data_3UXA
# 
_entry.id   3UXA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UXA         
RCSB  RCSB069324   
WWPDB D_1000069324 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3UXD 'Designed protein KE59 R1 7/10H with dichlorobenzotriazole (DBT)' unspecified 
PDB 3UY7 'Designed protein KE59 R1 7/10H with G130S mutation'              unspecified 
PDB 3UY8 'Designed protein KE59 R5_11/5F'                                  unspecified 
PDB 3UYC 'Designed protein KE59 R8_2/7A'                                   unspecified 
PDB 3UZ5 'Designed protein KE59 R13 3/11H'                                 unspecified 
PDB 3UZJ 'Designed protein KE59 R13 3/11H with benzotriazole'              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UXA 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Khersonsky, O.'                             1 
'Kiss, G.'                                   2 
'Roethlisberger, D.'                         3 
'Dym, O.'                                    4 
'Albeck, S.'                                 5 
'Houk, K.N.'                                 6 
'Baker, D.'                                  7 
'Tawfik, D.S.'                               8 
'Israel Structural Proteomics Center (ISPC)' 9 
# 
_citation.id                        primary 
_citation.title                     
;Bridging the gaps in design methodologies by evolutionary optimization of the stability and proficiency of designed Kemp eliminase KE59.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            109 
_citation.page_first                10358 
_citation.page_last                 10363 
_citation.year                      2012 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22685214 
_citation.pdbx_database_id_DOI      10.1073/pnas.1121063109 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Khersonsky, O.'    1 
primary 'Kiss, G.'          2 
primary 'Rothlisberger, D.' 3 
primary 'Dym, O.'           4 
primary 'Albeck, S.'        5 
primary 'Houk, K.N.'        6 
primary 'Baker, D.'         7 
primary 'Tawfik, D.S.'      8 
# 
_cell.entry_id           3UXA 
_cell.length_a           61.860 
_cell.length_b           61.860 
_cell.length_c           119.435 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UXA 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kemp eliminase KE59 R1 7/10H' 28749.346 2 4.-.-.- ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                94.971    2 ?       ? ? ? 
3 water       nat water                          18.015    8 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPRYLKGALKDVVQLSLRRPSLRASRQRPIISLRERILEFNKRNITAIIAVYKRKSPSGLDVERDPIEYAKFMERYAVGL
VILTEEKYFNGSYEDLRKIASSVSIPILMWDFIVKESQIDDAYNLGADTVGLIVKILTERELESLLEYARSYGMEPAIVI
NDEEDLDIALRIGARIIIISSRDLETLEINKENQRKLISMIPSNVVKVAASGISERNEIEELRKLGVNAFEIGSSLMRNP
EKIKELILGSLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPRYLKGALKDVVQLSLRRPSLRASRQRPIISLRERILEFNKRNITAIIAVYKRKSPSGLDVERDPIEYAKFMERYAVGL
VILTEEKYFNGSYEDLRKIASSVSIPILMWDFIVKESQIDDAYNLGADTVGLIVKILTERELESLLEYARSYGMEPAIVI
NDEEDLDIALRIGARIIIISSRDLETLEINKENQRKLISMIPSNVVKVAASGISERNEIEELRKLGVNAFEIGSSLMRNP
EKIKELILGSLE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ARG n 
1 4   TYR n 
1 5   LEU n 
1 6   LYS n 
1 7   GLY n 
1 8   ALA n 
1 9   LEU n 
1 10  LYS n 
1 11  ASP n 
1 12  VAL n 
1 13  VAL n 
1 14  GLN n 
1 15  LEU n 
1 16  SER n 
1 17  LEU n 
1 18  ARG n 
1 19  ARG n 
1 20  PRO n 
1 21  SER n 
1 22  LEU n 
1 23  ARG n 
1 24  ALA n 
1 25  SER n 
1 26  ARG n 
1 27  GLN n 
1 28  ARG n 
1 29  PRO n 
1 30  ILE n 
1 31  ILE n 
1 32  SER n 
1 33  LEU n 
1 34  ARG n 
1 35  GLU n 
1 36  ARG n 
1 37  ILE n 
1 38  LEU n 
1 39  GLU n 
1 40  PHE n 
1 41  ASN n 
1 42  LYS n 
1 43  ARG n 
1 44  ASN n 
1 45  ILE n 
1 46  THR n 
1 47  ALA n 
1 48  ILE n 
1 49  ILE n 
1 50  ALA n 
1 51  VAL n 
1 52  TYR n 
1 53  LYS n 
1 54  ARG n 
1 55  LYS n 
1 56  SER n 
1 57  PRO n 
1 58  SER n 
1 59  GLY n 
1 60  LEU n 
1 61  ASP n 
1 62  VAL n 
1 63  GLU n 
1 64  ARG n 
1 65  ASP n 
1 66  PRO n 
1 67  ILE n 
1 68  GLU n 
1 69  TYR n 
1 70  ALA n 
1 71  LYS n 
1 72  PHE n 
1 73  MET n 
1 74  GLU n 
1 75  ARG n 
1 76  TYR n 
1 77  ALA n 
1 78  VAL n 
1 79  GLY n 
1 80  LEU n 
1 81  VAL n 
1 82  ILE n 
1 83  LEU n 
1 84  THR n 
1 85  GLU n 
1 86  GLU n 
1 87  LYS n 
1 88  TYR n 
1 89  PHE n 
1 90  ASN n 
1 91  GLY n 
1 92  SER n 
1 93  TYR n 
1 94  GLU n 
1 95  ASP n 
1 96  LEU n 
1 97  ARG n 
1 98  LYS n 
1 99  ILE n 
1 100 ALA n 
1 101 SER n 
1 102 SER n 
1 103 VAL n 
1 104 SER n 
1 105 ILE n 
1 106 PRO n 
1 107 ILE n 
1 108 LEU n 
1 109 MET n 
1 110 TRP n 
1 111 ASP n 
1 112 PHE n 
1 113 ILE n 
1 114 VAL n 
1 115 LYS n 
1 116 GLU n 
1 117 SER n 
1 118 GLN n 
1 119 ILE n 
1 120 ASP n 
1 121 ASP n 
1 122 ALA n 
1 123 TYR n 
1 124 ASN n 
1 125 LEU n 
1 126 GLY n 
1 127 ALA n 
1 128 ASP n 
1 129 THR n 
1 130 VAL n 
1 131 GLY n 
1 132 LEU n 
1 133 ILE n 
1 134 VAL n 
1 135 LYS n 
1 136 ILE n 
1 137 LEU n 
1 138 THR n 
1 139 GLU n 
1 140 ARG n 
1 141 GLU n 
1 142 LEU n 
1 143 GLU n 
1 144 SER n 
1 145 LEU n 
1 146 LEU n 
1 147 GLU n 
1 148 TYR n 
1 149 ALA n 
1 150 ARG n 
1 151 SER n 
1 152 TYR n 
1 153 GLY n 
1 154 MET n 
1 155 GLU n 
1 156 PRO n 
1 157 ALA n 
1 158 ILE n 
1 159 VAL n 
1 160 ILE n 
1 161 ASN n 
1 162 ASP n 
1 163 GLU n 
1 164 GLU n 
1 165 ASP n 
1 166 LEU n 
1 167 ASP n 
1 168 ILE n 
1 169 ALA n 
1 170 LEU n 
1 171 ARG n 
1 172 ILE n 
1 173 GLY n 
1 174 ALA n 
1 175 ARG n 
1 176 ILE n 
1 177 ILE n 
1 178 ILE n 
1 179 ILE n 
1 180 SER n 
1 181 SER n 
1 182 ARG n 
1 183 ASP n 
1 184 LEU n 
1 185 GLU n 
1 186 THR n 
1 187 LEU n 
1 188 GLU n 
1 189 ILE n 
1 190 ASN n 
1 191 LYS n 
1 192 GLU n 
1 193 ASN n 
1 194 GLN n 
1 195 ARG n 
1 196 LYS n 
1 197 LEU n 
1 198 ILE n 
1 199 SER n 
1 200 MET n 
1 201 ILE n 
1 202 PRO n 
1 203 SER n 
1 204 ASN n 
1 205 VAL n 
1 206 VAL n 
1 207 LYS n 
1 208 VAL n 
1 209 ALA n 
1 210 ALA n 
1 211 SER n 
1 212 GLY n 
1 213 ILE n 
1 214 SER n 
1 215 GLU n 
1 216 ARG n 
1 217 ASN n 
1 218 GLU n 
1 219 ILE n 
1 220 GLU n 
1 221 GLU n 
1 222 LEU n 
1 223 ARG n 
1 224 LYS n 
1 225 LEU n 
1 226 GLY n 
1 227 VAL n 
1 228 ASN n 
1 229 ALA n 
1 230 PHE n 
1 231 GLU n 
1 232 ILE n 
1 233 GLY n 
1 234 SER n 
1 235 SER n 
1 236 LEU n 
1 237 MET n 
1 238 ARG n 
1 239 ASN n 
1 240 PRO n 
1 241 GLU n 
1 242 LYS n 
1 243 ILE n 
1 244 LYS n 
1 245 GLU n 
1 246 LEU n 
1 247 ILE n 
1 248 LEU n 
1 249 GLY n 
1 250 SER n 
1 251 LEU n 
1 252 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    3UXA 
_struct_ref.pdbx_db_accession          3UXA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   
;MPRYLKGALKDVVQLSLRRPSLRASRQRPIISLRERILEFNKRNITAIIAVYKRKSPSGLDVERDPIEYAKFMERYAVGL
VILTEEKYFNGSYEDLRKIASSVSIPILMWDFIVKESQIDDAYNLGADTVGLIVKILTERELESLLEYARSYGMEPAIVI
NDEEDLDIALRIGARIIIISSRDLETLEINKENQRKLISMIPSNVVKVAASGISERNEIEELRKLGVNAFEIGSSLMRNP
EKIKELILGSLE
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UXA A 1 ? 252 ? 3UXA 1 ? 252 ? 1 252 
2 1 3UXA B 1 ? 252 ? 3UXA 1 ? 252 ? 1 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3UXA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.29 
_exptl_crystal.density_percent_sol   46.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
;0.2 M ammonium chloride, 0.1 M sodium acetate, pH 5.0, 20% PEG6000, 3-(1-Methylpiperidinum)-1-propane-sulfonate, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2009-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3UXA 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             27.465 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   17470 
_reflns.number_all                   17772 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.159 
_reflns.pdbx_Rsym_value              0.111 
_reflns.pdbx_netI_over_sigmaI        9.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.700 
_reflns_shell.pdbx_Rsym_value        0.601 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3UXA 
_refine.ls_number_reflns_obs                     16555 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.465 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    98.20 
_refine.ls_R_factor_obs                          0.21587 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21224 
_refine.ls_R_factor_R_free                       0.28358 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  888 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.927 
_refine.correlation_coeff_Fo_to_Fc_free          0.864 
_refine.B_iso_mean                               31.196 
_refine.aniso_B[1][1]                            1.79 
_refine.aniso_B[2][2]                            1.79 
_refine.aniso_B[3][3]                            -2.68 
_refine.aniso_B[1][2]                            0.89 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS  
U VALUES      : REFINED INDIVIDUALLY
;
_refine.pdbx_starting_model                      'PDB ENTRY 3UYC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.007 
_refine.pdbx_overall_ESU_R_Free                  0.350 
_refine.overall_SU_ML                            0.268 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.869 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3841 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               3859 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        27.465 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.016  0.022  ? 3896 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.648  2.000  ? 5262 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       6.201  5.000  ? 492  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       40.103 23.734 ? 158  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       19.219 15.000 ? 740  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       22.456 15.000 ? 35   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.105  0.200  ? 628  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.007  0.021  ? 2809 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.608  1.500  ? 2464 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.156  2.000  ? 3983 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.100  3.000  ? 1432 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 3.454  4.500  ? 1279 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.560 
_refine_ls_shell.number_reflns_R_work             1221 
_refine_ls_shell.R_factor_R_work                  0.250 
_refine_ls_shell.percent_reflns_obs               98.39 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3UXA 
_struct.title                     'Designed protein KE59 R1 7/10H' 
_struct.pdbx_descriptor           'Kemp eliminase KE59 R1 7/10H (E.C.4.-.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UXA 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'Structural Genomics, Israel Structural Proteomics Center, ISPC, Beta Barrel, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? ARG A 18  ? LYS A 6   ARG A 18  1 ? 13 
HELX_P HELX_P2  2  SER A 32  ? ARG A 43  ? SER A 32  ARG A 43  1 ? 12 
HELX_P HELX_P3  3  ASP A 65  ? ARG A 75  ? ASP A 65  ARG A 75  1 ? 11 
HELX_P HELX_P4  4  SER A 92  ? SER A 101 ? SER A 92  SER A 101 1 ? 10 
HELX_P HELX_P5  5  LYS A 115 ? GLY A 126 ? LYS A 115 GLY A 126 1 ? 12 
HELX_P HELX_P6  6  LYS A 135 ? LEU A 137 ? LYS A 135 LEU A 137 5 ? 3  
HELX_P HELX_P7  7  THR A 138 ? TYR A 152 ? THR A 138 TYR A 152 1 ? 15 
HELX_P HELX_P8  8  ASP A 162 ? ILE A 172 ? ASP A 162 ILE A 172 1 ? 11 
HELX_P HELX_P9  9  ASN A 190 ? MET A 200 ? ASN A 190 MET A 200 1 ? 11 
HELX_P HELX_P10 10 GLU A 215 ? LEU A 225 ? GLU A 215 LEU A 225 1 ? 11 
HELX_P HELX_P11 11 GLY A 233 ? ASN A 239 ? GLY A 233 ASN A 239 1 ? 7  
HELX_P HELX_P12 12 GLU A 241 ? ILE A 247 ? GLU A 241 ILE A 247 1 ? 7  
HELX_P HELX_P13 13 LYS B 6   ? ARG B 18  ? LYS B 6   ARG B 18  1 ? 13 
HELX_P HELX_P14 14 SER B 32  ? ARG B 43  ? SER B 32  ARG B 43  1 ? 12 
HELX_P HELX_P15 15 ASP B 65  ? GLU B 74  ? ASP B 65  GLU B 74  1 ? 10 
HELX_P HELX_P16 16 SER B 92  ? VAL B 103 ? SER B 92  VAL B 103 1 ? 12 
HELX_P HELX_P17 17 LYS B 115 ? GLY B 126 ? LYS B 115 GLY B 126 1 ? 12 
HELX_P HELX_P18 18 THR B 138 ? SER B 151 ? THR B 138 SER B 151 1 ? 14 
HELX_P HELX_P19 19 ASP B 162 ? ILE B 172 ? ASP B 162 ILE B 172 1 ? 11 
HELX_P HELX_P20 20 ASN B 190 ? MET B 200 ? ASN B 190 MET B 200 1 ? 11 
HELX_P HELX_P21 21 GLU B 215 ? LEU B 225 ? GLU B 215 LEU B 225 1 ? 11 
HELX_P HELX_P22 22 GLY B 233 ? ASN B 239 ? GLY B 233 ASN B 239 1 ? 7  
HELX_P HELX_P23 23 GLU B 241 ? ILE B 247 ? GLU B 241 ILE B 247 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
A 8 9 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
B 8 9 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 47  ? TYR A 52  ? ALA A 47  TYR A 52  
A 2 GLY A 79  ? LEU A 83  ? GLY A 79  LEU A 83  
A 3 ILE A 107 ? TRP A 110 ? ILE A 107 TRP A 110 
A 4 THR A 129 ? ILE A 133 ? THR A 129 ILE A 133 
A 5 ALA A 157 ? ILE A 160 ? ALA A 157 ILE A 160 
A 6 ILE A 176 ? SER A 180 ? ILE A 176 SER A 180 
A 7 VAL A 206 ? ALA A 210 ? VAL A 206 ALA A 210 
A 8 ALA A 229 ? ILE A 232 ? ALA A 229 ILE A 232 
A 9 ALA A 47  ? TYR A 52  ? ALA A 47  TYR A 52  
B 1 ILE B 48  ? TYR B 52  ? ILE B 48  TYR B 52  
B 2 GLY B 79  ? LEU B 83  ? GLY B 79  LEU B 83  
B 3 ILE B 107 ? TRP B 110 ? ILE B 107 TRP B 110 
B 4 THR B 129 ? ILE B 133 ? THR B 129 ILE B 133 
B 5 ALA B 157 ? ILE B 160 ? ALA B 157 ILE B 160 
B 6 ILE B 176 ? SER B 180 ? ILE B 176 SER B 180 
B 7 VAL B 206 ? ALA B 210 ? VAL B 206 ALA B 210 
B 8 ALA B 229 ? ILE B 232 ? ALA B 229 ILE B 232 
B 9 ILE B 48  ? TYR B 52  ? ILE B 48  TYR B 52  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 52  ? N TYR A 52  O VAL A 81  ? O VAL A 81  
A 2 3 N LEU A 80  ? N LEU A 80  O LEU A 108 ? O LEU A 108 
A 3 4 N MET A 109 ? N MET A 109 O THR A 129 ? O THR A 129 
A 4 5 N LEU A 132 ? N LEU A 132 O ALA A 157 ? O ALA A 157 
A 5 6 N ILE A 160 ? N ILE A 160 O ILE A 178 ? O ILE A 178 
A 6 7 N ILE A 179 ? N ILE A 179 O ALA A 210 ? O ALA A 210 
A 7 8 N ALA A 209 ? N ALA A 209 O GLU A 231 ? O GLU A 231 
A 8 9 O PHE A 230 ? O PHE A 230 N ILE A 49  ? N ILE A 49  
B 1 2 N TYR B 52  ? N TYR B 52  O VAL B 81  ? O VAL B 81  
B 2 3 N LEU B 80  ? N LEU B 80  O LEU B 108 ? O LEU B 108 
B 3 4 N MET B 109 ? N MET B 109 O THR B 129 ? O THR B 129 
B 4 5 N LEU B 132 ? N LEU B 132 O VAL B 159 ? O VAL B 159 
B 5 6 N ILE B 158 ? N ILE B 158 O ILE B 178 ? O ILE B 178 
B 6 7 N ILE B 177 ? N ILE B 177 O VAL B 206 ? O VAL B 206 
B 7 8 N ALA B 209 ? N ALA B 209 O GLU B 231 ? O GLU B 231 
B 8 9 O PHE B 230 ? O PHE B 230 N ILE B 49  ? N ILE B 49  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PO4 A 253' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 B 253' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 LYS A 53  ? LYS A 53  . ? 1_555 ? 
2  AC1 7 ARG A 182 ? ARG A 182 . ? 1_555 ? 
3  AC1 7 SER A 211 ? SER A 211 . ? 1_555 ? 
4  AC1 7 GLY A 212 ? GLY A 212 . ? 1_555 ? 
5  AC1 7 ILE A 232 ? ILE A 232 . ? 1_555 ? 
6  AC1 7 GLY A 233 ? GLY A 233 . ? 1_555 ? 
7  AC1 7 SER A 234 ? SER A 234 . ? 1_555 ? 
8  AC2 6 LYS B 53  ? LYS B 53  . ? 1_555 ? 
9  AC2 6 ARG B 182 ? ARG B 182 . ? 1_555 ? 
10 AC2 6 GLY B 212 ? GLY B 212 . ? 1_555 ? 
11 AC2 6 ILE B 232 ? ILE B 232 . ? 1_555 ? 
12 AC2 6 GLY B 233 ? GLY B 233 . ? 1_555 ? 
13 AC2 6 SER B 234 ? SER B 234 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3UXA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UXA 
_atom_sites.fract_transf_matrix[1][1]   0.016166 
_atom_sites.fract_transf_matrix[1][2]   0.009333 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018666 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008373 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 2   ? 39.855  -18.300 2.149   1.00 39.14 ? 2   PRO A N   1 
ATOM   2    C CA  . PRO A 1 2   ? 38.437  -18.118 1.781   1.00 38.72 ? 2   PRO A CA  1 
ATOM   3    C C   . PRO A 1 2   ? 38.281  -18.013 0.261   1.00 38.77 ? 2   PRO A C   1 
ATOM   4    O O   . PRO A 1 2   ? 39.282  -17.977 -0.456  1.00 38.56 ? 2   PRO A O   1 
ATOM   5    C CB  . PRO A 1 2   ? 38.053  -16.809 2.479   1.00 38.42 ? 2   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 2   ? 39.155  -16.582 3.516   1.00 38.16 ? 2   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 2   ? 40.387  -17.168 2.930   1.00 38.83 ? 2   PRO A CD  1 
ATOM   8    N N   . ARG A 1 3   ? 37.040  -17.994 -0.224  1.00 38.87 ? 3   ARG A N   1 
ATOM   9    C CA  . ARG A 1 3   ? 36.754  -17.848 -1.665  1.00 38.74 ? 3   ARG A CA  1 
ATOM   10   C C   . ARG A 1 3   ? 37.189  -16.482 -2.243  1.00 38.70 ? 3   ARG A C   1 
ATOM   11   O O   . ARG A 1 3   ? 37.650  -15.589 -1.511  1.00 38.54 ? 3   ARG A O   1 
ATOM   12   C CB  . ARG A 1 3   ? 35.260  -18.066 -1.948  1.00 38.63 ? 3   ARG A CB  1 
ATOM   13   C CG  . ARG A 1 3   ? 34.830  -19.503 -1.991  1.00 38.95 ? 3   ARG A CG  1 
ATOM   14   C CD  . ARG A 1 3   ? 33.378  -19.642 -2.391  1.00 40.78 ? 3   ARG A CD  1 
ATOM   15   N NE  . ARG A 1 3   ? 32.996  -21.054 -2.397  1.00 44.09 ? 3   ARG A NE  1 
ATOM   16   N N   . TYR A 1 4   ? 37.052  -16.330 -3.561  1.00 38.20 ? 4   TYR A N   1 
ATOM   17   C CA  . TYR A 1 4   ? 37.252  -15.026 -4.154  1.00 37.97 ? 4   TYR A CA  1 
ATOM   18   C C   . TYR A 1 4   ? 35.976  -14.209 -4.025  1.00 36.87 ? 4   TYR A C   1 
ATOM   19   O O   . TYR A 1 4   ? 34.887  -14.660 -4.391  1.00 36.83 ? 4   TYR A O   1 
ATOM   20   C CB  . TYR A 1 4   ? 37.762  -15.161 -5.581  1.00 38.29 ? 4   TYR A CB  1 
ATOM   21   C CG  . TYR A 1 4   ? 39.219  -15.516 -5.574  1.00 40.87 ? 4   TYR A CG  1 
ATOM   22   C CD1 . TYR A 1 4   ? 40.185  -14.551 -5.231  1.00 43.08 ? 4   TYR A CD1 1 
ATOM   23   C CD2 . TYR A 1 4   ? 39.646  -16.822 -5.860  1.00 42.91 ? 4   TYR A CD2 1 
ATOM   24   C CE1 . TYR A 1 4   ? 41.561  -14.862 -5.204  1.00 44.10 ? 4   TYR A CE1 1 
ATOM   25   C CE2 . TYR A 1 4   ? 41.024  -17.154 -5.837  1.00 45.23 ? 4   TYR A CE2 1 
ATOM   26   C CZ  . TYR A 1 4   ? 41.975  -16.159 -5.503  1.00 46.07 ? 4   TYR A CZ  1 
ATOM   27   O OH  . TYR A 1 4   ? 43.332  -16.453 -5.475  1.00 47.37 ? 4   TYR A OH  1 
ATOM   28   N N   . LEU A 1 5   ? 36.121  -13.016 -3.469  1.00 35.86 ? 5   LEU A N   1 
ATOM   29   C CA  . LEU A 1 5   ? 34.975  -12.209 -3.065  1.00 34.89 ? 5   LEU A CA  1 
ATOM   30   C C   . LEU A 1 5   ? 35.126  -10.744 -3.420  1.00 34.77 ? 5   LEU A C   1 
ATOM   31   O O   . LEU A 1 5   ? 36.194  -10.284 -3.852  1.00 34.62 ? 5   LEU A O   1 
ATOM   32   C CB  . LEU A 1 5   ? 34.751  -12.348 -1.548  1.00 34.58 ? 5   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 5   ? 34.529  -13.764 -1.024  1.00 31.80 ? 5   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 5   ? 34.787  -13.773 0.430   1.00 29.39 ? 5   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 5   ? 33.124  -14.293 -1.360  1.00 26.59 ? 5   LEU A CD2 1 
ATOM   36   N N   . LYS A 1 6   ? 34.030  -10.020 -3.243  1.00 34.75 ? 6   LYS A N   1 
ATOM   37   C CA  . LYS A 1 6   ? 33.985  -8.605  -3.604  1.00 34.80 ? 6   LYS A CA  1 
ATOM   38   C C   . LYS A 1 6   ? 33.013  -7.857  -2.679  1.00 34.52 ? 6   LYS A C   1 
ATOM   39   O O   . LYS A 1 6   ? 32.096  -8.477  -2.090  1.00 33.99 ? 6   LYS A O   1 
ATOM   40   C CB  . LYS A 1 6   ? 33.629  -8.426  -5.105  1.00 34.19 ? 6   LYS A CB  1 
ATOM   41   C CG  . LYS A 1 6   ? 32.253  -8.925  -5.519  1.00 34.11 ? 6   LYS A CG  1 
ATOM   42   C CD  . LYS A 1 6   ? 32.145  -9.055  -7.054  1.00 34.53 ? 6   LYS A CD  1 
ATOM   43   C CE  . LYS A 1 6   ? 31.087  -10.061 -7.502  1.00 32.18 ? 6   LYS A CE  1 
ATOM   44   N N   . GLY A 1 7   ? 33.247  -6.549  -2.525  1.00 33.95 ? 7   GLY A N   1 
ATOM   45   C CA  . GLY A 1 7   ? 32.293  -5.653  -1.863  1.00 33.62 ? 7   GLY A CA  1 
ATOM   46   C C   . GLY A 1 7   ? 32.194  -5.818  -0.355  1.00 33.69 ? 7   GLY A C   1 
ATOM   47   O O   . GLY A 1 7   ? 33.221  -5.931  0.332   1.00 33.93 ? 7   GLY A O   1 
ATOM   48   N N   . ALA A 1 8   ? 30.960  -5.830  0.158   1.00 32.94 ? 8   ALA A N   1 
ATOM   49   C CA  . ALA A 1 8   ? 30.739  -5.939  1.595   1.00 32.55 ? 8   ALA A CA  1 
ATOM   50   C C   . ALA A 1 8   ? 31.215  -7.295  2.122   1.00 32.26 ? 8   ALA A C   1 
ATOM   51   O O   . ALA A 1 8   ? 31.821  -7.358  3.180   1.00 32.09 ? 8   ALA A O   1 
ATOM   52   C CB  . ALA A 1 8   ? 29.275  -5.690  1.959   1.00 31.57 ? 8   ALA A CB  1 
ATOM   53   N N   . LEU A 1 9   ? 30.959  -8.363  1.370   1.00 31.93 ? 9   LEU A N   1 
ATOM   54   C CA  . LEU A 1 9   ? 31.385  -9.702  1.759   1.00 31.63 ? 9   LEU A CA  1 
ATOM   55   C C   . LEU A 1 9   ? 32.875  -9.792  1.977   1.00 32.09 ? 9   LEU A C   1 
ATOM   56   O O   . LEU A 1 9   ? 33.303  -10.229 3.039   1.00 32.24 ? 9   LEU A O   1 
ATOM   57   C CB  . LEU A 1 9   ? 31.011  -10.732 0.708   1.00 30.94 ? 9   LEU A CB  1 
ATOM   58   C CG  . LEU A 1 9   ? 29.934  -11.730 1.061   1.00 30.82 ? 9   LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 9   ? 30.142  -12.860 0.128   1.00 29.58 ? 9   LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 9   ? 29.958  -12.220 2.537   1.00 28.34 ? 9   LEU A CD2 1 
ATOM   61   N N   . LYS A 1 10  ? 33.652  -9.385  0.963   1.00 31.94 ? 10  LYS A N   1 
ATOM   62   C CA  . LYS A 1 10  ? 35.105  -9.423  1.028   1.00 31.71 ? 10  LYS A CA  1 
ATOM   63   C C   . LYS A 1 10  ? 35.611  -8.690  2.267   1.00 31.50 ? 10  LYS A C   1 
ATOM   64   O O   . LYS A 1 10  ? 36.568  -9.133  2.922   1.00 30.62 ? 10  LYS A O   1 
ATOM   65   C CB  . LYS A 1 10  ? 35.718  -8.785  -0.217  1.00 32.23 ? 10  LYS A CB  1 
ATOM   66   C CG  . LYS A 1 10  ? 37.210  -9.037  -0.365  1.00 31.46 ? 10  LYS A CG  1 
ATOM   67   C CD  . LYS A 1 10  ? 37.726  -8.484  -1.670  1.00 32.08 ? 10  LYS A CD  1 
ATOM   68   C CE  . LYS A 1 10  ? 39.072  -9.092  -1.994  1.00 33.48 ? 10  LYS A CE  1 
ATOM   69   N NZ  . LYS A 1 10  ? 40.169  -8.418  -1.249  1.00 34.43 ? 10  LYS A NZ  1 
ATOM   70   N N   . ASP A 1 11  ? 34.955  -7.575  2.576   1.00 31.11 ? 11  ASP A N   1 
ATOM   71   C CA  . ASP A 1 11  ? 35.355  -6.746  3.704   1.00 31.06 ? 11  ASP A CA  1 
ATOM   72   C C   . ASP A 1 11  ? 35.076  -7.446  5.048   1.00 30.77 ? 11  ASP A C   1 
ATOM   73   O O   . ASP A 1 11  ? 35.895  -7.380  5.951   1.00 30.87 ? 11  ASP A O   1 
ATOM   74   C CB  . ASP A 1 11  ? 34.656  -5.386  3.636   1.00 30.76 ? 11  ASP A CB  1 
ATOM   75   C CG  . ASP A 1 11  ? 35.190  -4.413  4.661   1.00 31.28 ? 11  ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 11  ? 34.404  -3.941  5.520   1.00 29.04 ? 11  ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 11  ? 36.409  -4.134  4.599   1.00 32.42 ? 11  ASP A OD2 1 
ATOM   78   N N   . VAL A 1 12  ? 33.941  -8.129  5.170   1.00 30.08 ? 12  VAL A N   1 
ATOM   79   C CA  . VAL A 1 12  ? 33.697  -8.912  6.374   1.00 30.69 ? 12  VAL A CA  1 
ATOM   80   C C   . VAL A 1 12  ? 34.752  -9.994  6.556   1.00 30.55 ? 12  VAL A C   1 
ATOM   81   O O   . VAL A 1 12  ? 35.235  -10.217 7.670   1.00 31.10 ? 12  VAL A O   1 
ATOM   82   C CB  . VAL A 1 12  ? 32.331  -9.621  6.449   1.00 30.30 ? 12  VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 12  ? 31.770  -9.405  7.821   1.00 32.47 ? 12  VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 12  ? 31.355  -9.143  5.428   1.00 30.92 ? 12  VAL A CG2 1 
ATOM   85   N N   . VAL A 1 13  ? 35.102  -10.661 5.467   1.00 29.75 ? 13  VAL A N   1 
ATOM   86   C CA  . VAL A 1 13  ? 36.040  -11.754 5.528   1.00 29.74 ? 13  VAL A CA  1 
ATOM   87   C C   . VAL A 1 13  ? 37.468  -11.249 5.841   1.00 30.52 ? 13  VAL A C   1 
ATOM   88   O O   . VAL A 1 13  ? 38.250  -11.953 6.488   1.00 29.55 ? 13  VAL A O   1 
ATOM   89   C CB  . VAL A 1 13  ? 35.962  -12.602 4.230   1.00 30.03 ? 13  VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 13  ? 37.126  -13.626 4.149   1.00 29.04 ? 13  VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 13  ? 34.616  -13.319 4.162   1.00 28.50 ? 13  VAL A CG2 1 
ATOM   92   N N   . GLN A 1 14  ? 37.814  -10.025 5.413   1.00 31.41 ? 14  GLN A N   1 
ATOM   93   C CA  . GLN A 1 14  ? 39.144  -9.483  5.775   1.00 31.77 ? 14  GLN A CA  1 
ATOM   94   C C   . GLN A 1 14  ? 39.182  -9.221  7.265   1.00 31.19 ? 14  GLN A C   1 
ATOM   95   O O   . GLN A 1 14  ? 40.170  -9.566  7.908   1.00 31.33 ? 14  GLN A O   1 
ATOM   96   C CB  . GLN A 1 14  ? 39.529  -8.184  5.061   1.00 32.19 ? 14  GLN A CB  1 
ATOM   97   C CG  . GLN A 1 14  ? 39.002  -8.011  3.671   1.00 35.80 ? 14  GLN A CG  1 
ATOM   98   C CD  . GLN A 1 14  ? 39.879  -8.625  2.641   1.00 37.76 ? 14  GLN A CD  1 
ATOM   99   O OE1 . GLN A 1 14  ? 40.656  -7.915  2.000   1.00 39.91 ? 14  GLN A OE1 1 
ATOM   100  N NE2 . GLN A 1 14  ? 39.766  -9.952  2.451   1.00 38.90 ? 14  GLN A NE2 1 
ATOM   101  N N   . LEU A 1 15  ? 38.123  -8.620  7.806   1.00 30.16 ? 15  LEU A N   1 
ATOM   102  C CA  . LEU A 1 15  ? 38.093  -8.319  9.223   1.00 30.26 ? 15  LEU A CA  1 
ATOM   103  C C   . LEU A 1 15  ? 38.112  -9.588  10.057  1.00 30.24 ? 15  LEU A C   1 
ATOM   104  O O   . LEU A 1 15  ? 38.993  -9.737  10.897  1.00 30.83 ? 15  LEU A O   1 
ATOM   105  C CB  . LEU A 1 15  ? 36.894  -7.455  9.597   1.00 30.56 ? 15  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 15  ? 36.852  -6.054  8.987   1.00 31.88 ? 15  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 15  ? 35.421  -5.512  9.013   1.00 32.32 ? 15  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 15  ? 37.796  -5.111  9.680   1.00 32.51 ? 15  LEU A CD2 1 
ATOM   109  N N   . SER A 1 16  ? 37.161  -10.494 9.827   1.00 29.58 ? 16  SER A N   1 
ATOM   110  C CA  . SER A 1 16  ? 37.210  -11.844 10.404  1.00 29.66 ? 16  SER A CA  1 
ATOM   111  C C   . SER A 1 16  ? 38.555  -12.556 10.419  1.00 29.69 ? 16  SER A C   1 
ATOM   112  O O   . SER A 1 16  ? 38.905  -13.115 11.424  1.00 29.85 ? 16  SER A O   1 
ATOM   113  C CB  . SER A 1 16  ? 36.192  -12.733 9.750   1.00 28.92 ? 16  SER A CB  1 
ATOM   114  O OG  . SER A 1 16  ? 34.945  -12.192 10.062  1.00 30.54 ? 16  SER A OG  1 
ATOM   115  N N   . LEU A 1 17  ? 39.292  -12.558 9.317   1.00 30.51 ? 17  LEU A N   1 
ATOM   116  C CA  . LEU A 1 17  ? 40.668  -13.071 9.319   1.00 31.76 ? 17  LEU A CA  1 
ATOM   117  C C   . LEU A 1 17  ? 41.606  -12.328 10.261  1.00 32.69 ? 17  LEU A C   1 
ATOM   118  O O   . LEU A 1 17  ? 42.599  -12.901 10.737  1.00 32.71 ? 17  LEU A O   1 
ATOM   119  C CB  . LEU A 1 17  ? 41.290  -12.987 7.925   1.00 31.50 ? 17  LEU A CB  1 
ATOM   120  C CG  . LEU A 1 17  ? 40.885  -14.025 6.888   1.00 31.68 ? 17  LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 17  ? 41.156  -13.486 5.470   1.00 28.92 ? 17  LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 17  ? 41.598  -15.372 7.162   1.00 32.48 ? 17  LEU A CD2 1 
ATOM   123  N N   . ARG A 1 18  ? 41.324  -11.047 10.484  1.00 33.52 ? 18  ARG A N   1 
ATOM   124  C CA  . ARG A 1 18  ? 42.173  -10.213 11.319  1.00 35.07 ? 18  ARG A CA  1 
ATOM   125  C C   . ARG A 1 18  ? 41.675  -10.255 12.763  1.00 35.33 ? 18  ARG A C   1 
ATOM   126  O O   . ARG A 1 18  ? 42.224  -9.558  13.613  1.00 35.65 ? 18  ARG A O   1 
ATOM   127  C CB  . ARG A 1 18  ? 42.215  -8.752  10.802  1.00 35.35 ? 18  ARG A CB  1 
ATOM   128  C CG  . ARG A 1 18  ? 42.878  -8.563  9.397   1.00 39.11 ? 18  ARG A CG  1 
ATOM   129  C CD  . ARG A 1 18  ? 43.304  -7.112  9.082   1.00 44.99 ? 18  ARG A CD  1 
ATOM   130  N NE  . ARG A 1 18  ? 42.233  -6.118  9.274   1.00 48.96 ? 18  ARG A NE  1 
ATOM   131  C CZ  . ARG A 1 18  ? 41.488  -5.590  8.290   1.00 51.42 ? 18  ARG A CZ  1 
ATOM   132  N NH1 . ARG A 1 18  ? 41.678  -5.948  7.015   1.00 52.11 ? 18  ARG A NH1 1 
ATOM   133  N NH2 . ARG A 1 18  ? 40.538  -4.698  8.575   1.00 50.66 ? 18  ARG A NH2 1 
ATOM   134  N N   . ARG A 1 19  ? 40.650  -11.062 13.048  1.00 35.27 ? 19  ARG A N   1 
ATOM   135  C CA  . ARG A 1 19  ? 39.961  -10.959 14.338  1.00 35.62 ? 19  ARG A CA  1 
ATOM   136  C C   . ARG A 1 19  ? 40.631  -11.670 15.507  1.00 35.87 ? 19  ARG A C   1 
ATOM   137  O O   . ARG A 1 19  ? 40.829  -12.895 15.468  1.00 35.44 ? 19  ARG A O   1 
ATOM   138  C CB  . ARG A 1 19  ? 38.500  -11.396 14.258  1.00 36.12 ? 19  ARG A CB  1 
ATOM   139  C CG  . ARG A 1 19  ? 37.630  -10.686 15.295  1.00 35.51 ? 19  ARG A CG  1 
ATOM   140  C CD  . ARG A 1 19  ? 36.293  -11.307 15.446  1.00 35.50 ? 19  ARG A CD  1 
ATOM   141  N NE  . ARG A 1 19  ? 35.537  -10.580 16.468  1.00 36.04 ? 19  ARG A NE  1 
ATOM   142  C CZ  . ARG A 1 19  ? 34.222  -10.651 16.638  1.00 32.99 ? 19  ARG A CZ  1 
ATOM   143  N NH1 . ARG A 1 19  ? 33.477  -11.414 15.868  1.00 32.26 ? 19  ARG A NH1 1 
ATOM   144  N NH2 . ARG A 1 19  ? 33.644  -9.939  17.581  1.00 36.71 ? 19  ARG A NH2 1 
ATOM   145  N N   . PRO A 1 20  ? 40.937  -10.901 16.573  1.00 36.01 ? 20  PRO A N   1 
ATOM   146  C CA  . PRO A 1 20  ? 41.713  -11.403 17.721  1.00 35.67 ? 20  PRO A CA  1 
ATOM   147  C C   . PRO A 1 20  ? 40.987  -12.513 18.442  1.00 35.39 ? 20  PRO A C   1 
ATOM   148  O O   . PRO A 1 20  ? 39.797  -12.434 18.707  1.00 34.13 ? 20  PRO A O   1 
ATOM   149  C CB  . PRO A 1 20  ? 41.861  -10.181 18.629  1.00 35.35 ? 20  PRO A CB  1 
ATOM   150  C CG  . PRO A 1 20  ? 41.446  -8.984  17.767  1.00 36.12 ? 20  PRO A CG  1 
ATOM   151  C CD  . PRO A 1 20  ? 40.434  -9.536  16.812  1.00 35.64 ? 20  PRO A CD  1 
ATOM   152  N N   . SER A 1 21  ? 41.732  -13.573 18.706  1.00 36.50 ? 21  SER A N   1 
ATOM   153  C CA  . SER A 1 21  ? 41.245  -14.727 19.448  1.00 37.12 ? 21  SER A CA  1 
ATOM   154  C C   . SER A 1 21  ? 40.914  -14.323 20.912  1.00 37.99 ? 21  SER A C   1 
ATOM   155  O O   . SER A 1 21  ? 41.152  -13.168 21.332  1.00 38.72 ? 21  SER A O   1 
ATOM   156  C CB  . SER A 1 21  ? 42.347  -15.773 19.419  1.00 35.99 ? 21  SER A CB  1 
ATOM   157  O OG  . SER A 1 21  ? 41.796  -17.046 19.594  1.00 37.26 ? 21  SER A OG  1 
ATOM   158  N N   . LEU A 1 22  ? 40.411  -15.276 21.695  1.00 38.30 ? 22  LEU A N   1 
ATOM   159  C CA  . LEU A 1 22  ? 39.984  -15.027 23.067  1.00 38.04 ? 22  LEU A CA  1 
ATOM   160  C C   . LEU A 1 22  ? 40.430  -16.129 24.014  1.00 38.16 ? 22  LEU A C   1 
ATOM   161  O O   . LEU A 1 22  ? 40.332  -17.324 23.683  1.00 38.04 ? 22  LEU A O   1 
ATOM   162  C CB  . LEU A 1 22  ? 38.469  -14.976 23.093  1.00 38.17 ? 22  LEU A CB  1 
ATOM   163  C CG  . LEU A 1 22  ? 37.804  -13.897 23.928  1.00 38.48 ? 22  LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 22  ? 38.189  -12.514 23.437  1.00 39.36 ? 22  LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 22  ? 36.330  -14.083 23.809  1.00 38.35 ? 22  LEU A CD2 1 
ATOM   166  N N   . ARG A 1 23  ? 40.874  -15.743 25.210  1.00 38.08 ? 23  ARG A N   1 
ATOM   167  C CA  . ARG A 1 23  ? 41.221  -16.735 26.226  1.00 38.22 ? 23  ARG A CA  1 
ATOM   168  C C   . ARG A 1 23  ? 40.100  -16.855 27.243  1.00 37.62 ? 23  ARG A C   1 
ATOM   169  O O   . ARG A 1 23  ? 39.673  -15.860 27.797  1.00 38.30 ? 23  ARG A O   1 
ATOM   170  C CB  . ARG A 1 23  ? 42.548  -16.418 26.906  1.00 37.96 ? 23  ARG A CB  1 
ATOM   171  C CG  . ARG A 1 23  ? 43.692  -16.036 25.959  1.00 39.46 ? 23  ARG A CG  1 
ATOM   172  C CD  . ARG A 1 23  ? 44.180  -17.169 25.039  1.00 41.88 ? 23  ARG A CD  1 
ATOM   173  N NE  . ARG A 1 23  ? 43.679  -16.891 23.700  1.00 45.47 ? 23  ARG A NE  1 
ATOM   174  C CZ  . ARG A 1 23  ? 44.371  -16.314 22.720  1.00 46.08 ? 23  ARG A CZ  1 
ATOM   175  N NH1 . ARG A 1 23  ? 45.643  -15.967 22.884  1.00 46.07 ? 23  ARG A NH1 1 
ATOM   176  N NH2 . ARG A 1 23  ? 43.774  -16.089 21.560  1.00 46.89 ? 23  ARG A NH2 1 
ATOM   177  N N   . ALA A 1 24  ? 39.613  -18.075 27.464  1.00 36.96 ? 24  ALA A N   1 
ATOM   178  C CA  . ALA A 1 24  ? 38.564  -18.317 28.458  1.00 36.05 ? 24  ALA A CA  1 
ATOM   179  C C   . ALA A 1 24  ? 38.252  -19.802 28.566  1.00 35.55 ? 24  ALA A C   1 
ATOM   180  O O   . ALA A 1 24  ? 38.567  -20.567 27.663  1.00 34.83 ? 24  ALA A O   1 
ATOM   181  C CB  . ALA A 1 24  ? 37.287  -17.502 28.148  1.00 34.79 ? 24  ALA A CB  1 
ATOM   182  N N   . SER A 1 25  ? 37.632  -20.182 29.680  1.00 35.22 ? 25  SER A N   1 
ATOM   183  C CA  . SER A 1 25  ? 37.250  -21.560 29.944  1.00 34.58 ? 25  SER A CA  1 
ATOM   184  C C   . SER A 1 25  ? 35.745  -21.678 29.775  1.00 34.11 ? 25  SER A C   1 
ATOM   185  O O   . SER A 1 25  ? 35.005  -20.847 30.268  1.00 33.22 ? 25  SER A O   1 
ATOM   186  C CB  . SER A 1 25  ? 37.667  -21.981 31.375  1.00 34.92 ? 25  SER A CB  1 
ATOM   187  O OG  . SER A 1 25  ? 39.076  -21.918 31.571  1.00 33.58 ? 25  SER A OG  1 
ATOM   188  N N   . ARG A 1 26  ? 35.300  -22.703 29.047  1.00 34.59 ? 26  ARG A N   1 
ATOM   189  C CA  . ARG A 1 26  ? 33.871  -22.959 28.859  1.00 34.63 ? 26  ARG A CA  1 
ATOM   190  C C   . ARG A 1 26  ? 33.265  -23.466 30.159  1.00 35.56 ? 26  ARG A C   1 
ATOM   191  O O   . ARG A 1 26  ? 33.806  -24.382 30.777  1.00 36.10 ? 26  ARG A O   1 
ATOM   192  C CB  . ARG A 1 26  ? 33.634  -23.993 27.768  1.00 33.83 ? 26  ARG A CB  1 
ATOM   193  C CG  . ARG A 1 26  ? 32.173  -24.408 27.627  1.00 30.47 ? 26  ARG A CG  1 
ATOM   194  C CD  . ARG A 1 26  ? 32.041  -25.423 26.532  1.00 27.26 ? 26  ARG A CD  1 
ATOM   195  N NE  . ARG A 1 26  ? 30.642  -25.708 26.212  1.00 24.84 ? 26  ARG A NE  1 
ATOM   196  C CZ  . ARG A 1 26  ? 29.981  -25.166 25.192  1.00 25.05 ? 26  ARG A CZ  1 
ATOM   197  N NH1 . ARG A 1 26  ? 30.583  -24.294 24.379  1.00 21.33 ? 26  ARG A NH1 1 
ATOM   198  N NH2 . ARG A 1 26  ? 28.703  -25.483 25.000  1.00 24.90 ? 26  ARG A NH2 1 
ATOM   199  N N   . GLN A 1 27  ? 32.140  -22.884 30.555  1.00 36.40 ? 27  GLN A N   1 
ATOM   200  C CA  . GLN A 1 27  ? 31.512  -23.215 31.840  1.00 36.93 ? 27  GLN A CA  1 
ATOM   201  C C   . GLN A 1 27  ? 30.084  -23.704 31.659  1.00 37.32 ? 27  GLN A C   1 
ATOM   202  O O   . GLN A 1 27  ? 29.214  -23.511 32.520  1.00 37.63 ? 27  GLN A O   1 
ATOM   203  C CB  . GLN A 1 27  ? 31.589  -22.016 32.778  1.00 36.58 ? 27  GLN A CB  1 
ATOM   204  C CG  . GLN A 1 27  ? 33.056  -21.720 33.128  1.00 36.46 ? 27  GLN A CG  1 
ATOM   205  C CD  . GLN A 1 27  ? 33.284  -20.395 33.836  1.00 37.76 ? 27  GLN A CD  1 
ATOM   206  O OE1 . GLN A 1 27  ? 32.359  -19.603 34.028  1.00 38.16 ? 27  GLN A OE1 1 
ATOM   207  N NE2 . GLN A 1 27  ? 34.535  -20.149 34.230  1.00 38.55 ? 27  GLN A NE2 1 
ATOM   208  N N   . ARG A 1 28  ? 29.855  -24.336 30.511  1.00 37.07 ? 28  ARG A N   1 
ATOM   209  C CA  . ARG A 1 28  ? 28.624  -25.047 30.281  1.00 36.43 ? 28  ARG A CA  1 
ATOM   210  C C   . ARG A 1 28  ? 28.877  -26.311 29.471  1.00 36.21 ? 28  ARG A C   1 
ATOM   211  O O   . ARG A 1 28  ? 29.924  -26.444 28.845  1.00 35.55 ? 28  ARG A O   1 
ATOM   212  C CB  . ARG A 1 28  ? 27.524  -24.153 29.679  1.00 36.47 ? 28  ARG A CB  1 
ATOM   213  C CG  . ARG A 1 28  ? 27.806  -23.486 28.361  1.00 35.21 ? 28  ARG A CG  1 
ATOM   214  C CD  . ARG A 1 28  ? 26.646  -22.495 28.015  1.00 34.74 ? 28  ARG A CD  1 
ATOM   215  N NE  . ARG A 1 28  ? 25.734  -23.000 26.985  1.00 35.31 ? 28  ARG A NE  1 
ATOM   216  C CZ  . ARG A 1 28  ? 24.427  -22.759 26.948  1.00 34.49 ? 28  ARG A CZ  1 
ATOM   217  N NH1 . ARG A 1 28  ? 23.849  -22.022 27.876  1.00 35.53 ? 28  ARG A NH1 1 
ATOM   218  N NH2 . ARG A 1 28  ? 23.689  -23.263 25.988  1.00 33.27 ? 28  ARG A NH2 1 
ATOM   219  N N   . PRO A 1 29  ? 27.935  -27.266 29.547  1.00 36.17 ? 29  PRO A N   1 
ATOM   220  C CA  . PRO A 1 29  ? 27.930  -28.436 28.688  1.00 36.76 ? 29  PRO A CA  1 
ATOM   221  C C   . PRO A 1 29  ? 27.636  -28.070 27.220  1.00 36.99 ? 29  PRO A C   1 
ATOM   222  O O   . PRO A 1 29  ? 27.125  -26.973 26.952  1.00 36.43 ? 29  PRO A O   1 
ATOM   223  C CB  . PRO A 1 29  ? 26.773  -29.270 29.261  1.00 37.37 ? 29  PRO A CB  1 
ATOM   224  C CG  . PRO A 1 29  ? 25.864  -28.239 29.975  1.00 35.93 ? 29  PRO A CG  1 
ATOM   225  C CD  . PRO A 1 29  ? 26.881  -27.338 30.580  1.00 36.23 ? 29  PRO A CD  1 
ATOM   226  N N   . ILE A 1 30  ? 27.965  -28.981 26.295  1.00 36.83 ? 30  ILE A N   1 
ATOM   227  C CA  . ILE A 1 30  ? 27.568  -28.841 24.898  1.00 36.75 ? 30  ILE A CA  1 
ATOM   228  C C   . ILE A 1 30  ? 26.134  -29.360 24.701  1.00 37.30 ? 30  ILE A C   1 
ATOM   229  O O   . ILE A 1 30  ? 25.868  -30.558 24.819  1.00 37.22 ? 30  ILE A O   1 
ATOM   230  C CB  . ILE A 1 30  ? 28.560  -29.518 23.962  1.00 36.63 ? 30  ILE A CB  1 
ATOM   231  C CG1 . ILE A 1 30  ? 29.816  -28.672 23.883  1.00 37.14 ? 30  ILE A CG1 1 
ATOM   232  C CG2 . ILE A 1 30  ? 27.980  -29.715 22.540  1.00 36.15 ? 30  ILE A CG2 1 
ATOM   233  C CD1 . ILE A 1 30  ? 30.431  -28.650 22.520  1.00 37.93 ? 30  ILE A CD1 1 
ATOM   234  N N   . ILE A 1 31  ? 25.209  -28.445 24.432  1.00 37.27 ? 31  ILE A N   1 
ATOM   235  C CA  . ILE A 1 31  ? 23.814  -28.815 24.227  1.00 37.83 ? 31  ILE A CA  1 
ATOM   236  C C   . ILE A 1 31  ? 23.512  -28.854 22.698  1.00 37.95 ? 31  ILE A C   1 
ATOM   237  O O   . ILE A 1 31  ? 23.450  -27.799 22.070  1.00 38.21 ? 31  ILE A O   1 
ATOM   238  C CB  . ILE A 1 31  ? 22.861  -27.798 24.961  1.00 37.68 ? 31  ILE A CB  1 
ATOM   239  C CG1 . ILE A 1 31  ? 23.230  -27.650 26.455  1.00 39.17 ? 31  ILE A CG1 1 
ATOM   240  C CG2 . ILE A 1 31  ? 21.409  -28.246 24.867  1.00 36.77 ? 31  ILE A CG2 1 
ATOM   241  C CD1 . ILE A 1 31  ? 24.214  -26.466 26.849  1.00 35.80 ? 31  ILE A CD1 1 
ATOM   242  N N   . SER A 1 32  ? 23.328  -30.038 22.103  1.00 37.18 ? 32  SER A N   1 
ATOM   243  C CA  . SER A 1 32  ? 23.082  -30.117 20.650  1.00 36.72 ? 32  SER A CA  1 
ATOM   244  C C   . SER A 1 32  ? 21.803  -29.401 20.170  1.00 36.07 ? 32  SER A C   1 
ATOM   245  O O   . SER A 1 32  ? 20.701  -29.712 20.628  1.00 35.78 ? 32  SER A O   1 
ATOM   246  C CB  . SER A 1 32  ? 23.065  -31.566 20.147  1.00 36.98 ? 32  SER A CB  1 
ATOM   247  O OG  . SER A 1 32  ? 22.663  -31.612 18.772  1.00 36.82 ? 32  SER A OG  1 
ATOM   248  N N   . LEU A 1 33  ? 21.964  -28.459 19.235  1.00 35.17 ? 33  LEU A N   1 
ATOM   249  C CA  . LEU A 1 33  ? 20.803  -27.819 18.571  1.00 34.52 ? 33  LEU A CA  1 
ATOM   250  C C   . LEU A 1 33  ? 19.988  -28.795 17.692  1.00 34.47 ? 33  LEU A C   1 
ATOM   251  O O   . LEU A 1 33  ? 18.764  -28.761 17.693  1.00 33.89 ? 33  LEU A O   1 
ATOM   252  C CB  . LEU A 1 33  ? 21.255  -26.617 17.751  1.00 33.71 ? 33  LEU A CB  1 
ATOM   253  C CG  . LEU A 1 33  ? 20.259  -25.882 16.862  1.00 32.53 ? 33  LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 33  ? 19.009  -25.350 17.607  1.00 28.86 ? 33  LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 33  ? 20.980  -24.743 16.144  1.00 31.21 ? 33  LEU A CD2 1 
ATOM   256  N N   . ARG A 1 34  ? 20.687  -29.662 16.960  1.00 34.95 ? 34  ARG A N   1 
ATOM   257  C CA  . ARG A 1 34  ? 20.066  -30.646 16.066  1.00 35.39 ? 34  ARG A CA  1 
ATOM   258  C C   . ARG A 1 34  ? 19.110  -31.522 16.881  1.00 35.40 ? 34  ARG A C   1 
ATOM   259  O O   . ARG A 1 34  ? 17.901  -31.562 16.617  1.00 34.98 ? 34  ARG A O   1 
ATOM   260  C CB  . ARG A 1 34  ? 21.155  -31.503 15.356  1.00 35.65 ? 34  ARG A CB  1 
ATOM   261  C CG  . ARG A 1 34  ? 20.694  -32.320 14.122  1.00 36.33 ? 34  ARG A CG  1 
ATOM   262  C CD  . ARG A 1 34  ? 21.759  -33.367 13.614  1.00 38.44 ? 34  ARG A CD  1 
ATOM   263  N NE  . ARG A 1 34  ? 21.199  -34.388 12.711  1.00 35.86 ? 34  ARG A NE  1 
ATOM   264  N N   . GLU A 1 35  ? 19.664  -32.184 17.901  1.00 35.37 ? 35  GLU A N   1 
ATOM   265  C CA  . GLU A 1 35  ? 18.897  -33.081 18.766  1.00 34.98 ? 35  GLU A CA  1 
ATOM   266  C C   . GLU A 1 35  ? 17.639  -32.443 19.360  1.00 34.42 ? 35  GLU A C   1 
ATOM   267  O O   . GLU A 1 35  ? 16.613  -33.097 19.413  1.00 34.36 ? 35  GLU A O   1 
ATOM   268  C CB  . GLU A 1 35  ? 19.789  -33.701 19.861  1.00 35.24 ? 35  GLU A CB  1 
ATOM   269  N N   . ARG A 1 36  ? 17.716  -31.178 19.790  1.00 33.92 ? 36  ARG A N   1 
ATOM   270  C CA  . ARG A 1 36  ? 16.551  -30.512 20.368  1.00 33.58 ? 36  ARG A CA  1 
ATOM   271  C C   . ARG A 1 36  ? 15.507  -30.087 19.338  1.00 33.21 ? 36  ARG A C   1 
ATOM   272  O O   . ARG A 1 36  ? 14.315  -30.074 19.633  1.00 33.64 ? 36  ARG A O   1 
ATOM   273  C CB  . ARG A 1 36  ? 16.933  -29.322 21.260  1.00 33.58 ? 36  ARG A CB  1 
ATOM   274  C CG  . ARG A 1 36  ? 15.704  -28.788 22.057  1.00 34.61 ? 36  ARG A CG  1 
ATOM   275  C CD  . ARG A 1 36  ? 16.084  -28.321 23.462  1.00 39.90 ? 36  ARG A CD  1 
ATOM   276  N NE  . ARG A 1 36  ? 14.942  -27.924 24.286  1.00 41.17 ? 36  ARG A NE  1 
ATOM   277  C CZ  . ARG A 1 36  ? 14.597  -26.667 24.562  1.00 42.06 ? 36  ARG A CZ  1 
ATOM   278  N NH1 . ARG A 1 36  ? 15.303  -25.653 24.066  1.00 43.81 ? 36  ARG A NH1 1 
ATOM   279  N NH2 . ARG A 1 36  ? 13.534  -26.418 25.324  1.00 37.57 ? 36  ARG A NH2 1 
ATOM   280  N N   . ILE A 1 37  ? 15.944  -29.716 18.143  1.00 32.90 ? 37  ILE A N   1 
ATOM   281  C CA  . ILE A 1 37  ? 15.001  -29.490 17.051  1.00 32.85 ? 37  ILE A CA  1 
ATOM   282  C C   . ILE A 1 37  ? 14.163  -30.756 16.825  1.00 33.55 ? 37  ILE A C   1 
ATOM   283  O O   . ILE A 1 37  ? 12.913  -30.699 16.789  1.00 33.79 ? 37  ILE A O   1 
ATOM   284  C CB  . ILE A 1 37  ? 15.712  -28.989 15.762  1.00 32.39 ? 37  ILE A CB  1 
ATOM   285  C CG1 . ILE A 1 37  ? 16.182  -27.549 15.955  1.00 31.14 ? 37  ILE A CG1 1 
ATOM   286  C CG2 . ILE A 1 37  ? 14.788  -29.001 14.604  1.00 30.66 ? 37  ILE A CG2 1 
ATOM   287  C CD1 . ILE A 1 37  ? 17.219  -27.089 14.928  1.00 32.05 ? 37  ILE A CD1 1 
ATOM   288  N N   . LEU A 1 38  ? 14.856  -31.896 16.748  1.00 34.17 ? 38  LEU A N   1 
ATOM   289  C CA  . LEU A 1 38  ? 14.215  -33.219 16.583  1.00 35.06 ? 38  LEU A CA  1 
ATOM   290  C C   . LEU A 1 38  ? 13.249  -33.626 17.689  1.00 35.46 ? 38  LEU A C   1 
ATOM   291  O O   . LEU A 1 38  ? 12.174  -34.142 17.388  1.00 35.78 ? 38  LEU A O   1 
ATOM   292  C CB  . LEU A 1 38  ? 15.245  -34.324 16.325  1.00 35.00 ? 38  LEU A CB  1 
ATOM   293  C CG  . LEU A 1 38  ? 15.918  -34.277 14.940  1.00 35.83 ? 38  LEU A CG  1 
ATOM   294  C CD1 . LEU A 1 38  ? 17.129  -35.203 14.871  1.00 35.94 ? 38  LEU A CD1 1 
ATOM   295  C CD2 . LEU A 1 38  ? 14.919  -34.541 13.773  1.00 35.46 ? 38  LEU A CD2 1 
ATOM   296  N N   . GLU A 1 39  ? 13.621  -33.371 18.949  1.00 36.17 ? 39  GLU A N   1 
ATOM   297  C CA  . GLU A 1 39  ? 12.713  -33.540 20.100  1.00 36.48 ? 39  GLU A CA  1 
ATOM   298  C C   . GLU A 1 39  ? 11.435  -32.730 19.910  1.00 36.64 ? 39  GLU A C   1 
ATOM   299  O O   . GLU A 1 39  ? 10.329  -33.278 20.000  1.00 36.40 ? 39  GLU A O   1 
ATOM   300  C CB  . GLU A 1 39  ? 13.412  -33.151 21.410  1.00 36.71 ? 39  GLU A CB  1 
ATOM   301  C CG  . GLU A 1 39  ? 12.502  -33.102 22.651  1.00 37.97 ? 39  GLU A CG  1 
ATOM   302  C CD  . GLU A 1 39  ? 13.151  -32.364 23.813  1.00 42.01 ? 39  GLU A CD  1 
ATOM   303  O OE1 . GLU A 1 39  ? 14.389  -32.515 23.984  1.00 43.94 ? 39  GLU A OE1 1 
ATOM   304  O OE2 . GLU A 1 39  ? 12.442  -31.629 24.539  1.00 41.12 ? 39  GLU A OE2 1 
ATOM   305  N N   . PHE A 1 40  ? 11.592  -31.436 19.615  1.00 36.99 ? 40  PHE A N   1 
ATOM   306  C CA  . PHE A 1 40  ? 10.455  -30.582 19.292  1.00 37.56 ? 40  PHE A CA  1 
ATOM   307  C C   . PHE A 1 40  ? 9.600   -31.170 18.180  1.00 38.48 ? 40  PHE A C   1 
ATOM   308  O O   . PHE A 1 40  ? 8.380   -31.182 18.307  1.00 38.75 ? 40  PHE A O   1 
ATOM   309  C CB  . PHE A 1 40  ? 10.904  -29.165 18.914  1.00 37.90 ? 40  PHE A CB  1 
ATOM   310  C CG  . PHE A 1 40  ? 11.151  -28.267 20.081  1.00 35.61 ? 40  PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 40  ? 11.856  -28.710 21.192  1.00 35.81 ? 40  PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 40  ? 10.704  -26.965 20.055  1.00 36.16 ? 40  PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 40  ? 12.085  -27.849 22.294  1.00 37.50 ? 40  PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 40  ? 10.931  -26.083 21.147  1.00 38.57 ? 40  PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 40  ? 11.628  -26.528 22.263  1.00 36.69 ? 40  PHE A CZ  1 
ATOM   316  N N   . ASN A 1 41  ? 10.210  -31.663 17.098  1.00 39.17 ? 41  ASN A N   1 
ATOM   317  C CA  . ASN A 1 41  ? 9.389   -32.271 16.041  1.00 40.34 ? 41  ASN A CA  1 
ATOM   318  C C   . ASN A 1 41  ? 8.535   -33.441 16.568  1.00 41.50 ? 41  ASN A C   1 
ATOM   319  O O   . ASN A 1 41  ? 7.303   -33.476 16.351  1.00 41.32 ? 41  ASN A O   1 
ATOM   320  C CB  . ASN A 1 41  ? 10.232  -32.733 14.838  1.00 39.86 ? 41  ASN A CB  1 
ATOM   321  C CG  . ASN A 1 41  ? 10.975  -31.582 14.136  1.00 38.29 ? 41  ASN A CG  1 
ATOM   322  O OD1 . ASN A 1 41  ? 10.632  -30.404 14.252  1.00 33.05 ? 41  ASN A OD1 1 
ATOM   323  N ND2 . ASN A 1 41  ? 12.009  -31.945 13.408  1.00 35.97 ? 41  ASN A ND2 1 
ATOM   324  N N   . LYS A 1 42  ? 9.203   -34.386 17.252  1.00 42.66 ? 42  LYS A N   1 
ATOM   325  C CA  . LYS A 1 42  ? 8.559   -35.587 17.849  1.00 43.46 ? 42  LYS A CA  1 
ATOM   326  C C   . LYS A 1 42  ? 7.486   -35.137 18.829  1.00 44.08 ? 42  LYS A C   1 
ATOM   327  O O   . LYS A 1 42  ? 6.390   -35.714 18.870  1.00 44.69 ? 42  LYS A O   1 
ATOM   328  C CB  . LYS A 1 42  ? 9.551   -36.466 18.634  1.00 43.42 ? 42  LYS A CB  1 
ATOM   329  C CG  . LYS A 1 42  ? 10.959  -36.652 18.069  1.00 44.38 ? 42  LYS A CG  1 
ATOM   330  C CD  . LYS A 1 42  ? 10.954  -37.453 16.787  1.00 47.56 ? 42  LYS A CD  1 
ATOM   331  C CE  . LYS A 1 42  ? 12.113  -38.459 16.732  1.00 49.50 ? 42  LYS A CE  1 
ATOM   332  N NZ  . LYS A 1 42  ? 11.624  -39.703 16.018  1.00 51.03 ? 42  LYS A NZ  1 
ATOM   333  N N   . ARG A 1 43  ? 7.812   -34.099 19.607  1.00 43.88 ? 43  ARG A N   1 
ATOM   334  C CA  . ARG A 1 43  ? 6.904   -33.533 20.607  1.00 43.69 ? 43  ARG A CA  1 
ATOM   335  C C   . ARG A 1 43  ? 5.833   -32.641 20.001  1.00 43.53 ? 43  ARG A C   1 
ATOM   336  O O   . ARG A 1 43  ? 5.071   -32.014 20.745  1.00 44.19 ? 43  ARG A O   1 
ATOM   337  C CB  . ARG A 1 43  ? 7.688   -32.730 21.657  1.00 43.90 ? 43  ARG A CB  1 
ATOM   338  C CG  . ARG A 1 43  ? 8.561   -33.571 22.573  1.00 43.18 ? 43  ARG A CG  1 
ATOM   339  C CD  . ARG A 1 43  ? 9.355   -32.721 23.527  1.00 43.90 ? 43  ARG A CD  1 
ATOM   340  N NE  . ARG A 1 43  ? 8.496   -31.989 24.442  1.00 46.03 ? 43  ARG A NE  1 
ATOM   341  C CZ  . ARG A 1 43  ? 8.878   -30.943 25.178  1.00 49.07 ? 43  ARG A CZ  1 
ATOM   342  N NH1 . ARG A 1 43  ? 10.122  -30.471 25.132  1.00 48.84 ? 43  ARG A NH1 1 
ATOM   343  N NH2 . ARG A 1 43  ? 7.996   -30.360 25.979  1.00 50.56 ? 43  ARG A NH2 1 
ATOM   344  N N   . ASN A 1 44  ? 5.775   -32.600 18.665  1.00 42.96 ? 44  ASN A N   1 
ATOM   345  C CA  . ASN A 1 44  ? 4.920   -31.682 17.885  1.00 42.07 ? 44  ASN A CA  1 
ATOM   346  C C   . ASN A 1 44  ? 4.891   -30.248 18.373  1.00 41.46 ? 44  ASN A C   1 
ATOM   347  O O   . ASN A 1 44  ? 3.821   -29.630 18.397  1.00 41.50 ? 44  ASN A O   1 
ATOM   348  C CB  . ASN A 1 44  ? 3.486   -32.190 17.770  1.00 42.51 ? 44  ASN A CB  1 
ATOM   349  C CG  . ASN A 1 44  ? 2.820   -31.756 16.455  1.00 44.69 ? 44  ASN A CG  1 
ATOM   350  O OD1 . ASN A 1 44  ? 3.479   -31.680 15.408  1.00 46.16 ? 44  ASN A OD1 1 
ATOM   351  N ND2 . ASN A 1 44  ? 1.516   -31.482 16.501  1.00 43.47 ? 44  ASN A ND2 1 
ATOM   352  N N   . ILE A 1 45  ? 6.055   -29.734 18.785  1.00 40.29 ? 45  ILE A N   1 
ATOM   353  C CA  . ILE A 1 45  ? 6.225   -28.305 19.113  1.00 39.56 ? 45  ILE A CA  1 
ATOM   354  C C   . ILE A 1 45  ? 7.000   -27.578 17.993  1.00 38.00 ? 45  ILE A C   1 
ATOM   355  O O   . ILE A 1 45  ? 7.988   -28.121 17.472  1.00 38.01 ? 45  ILE A O   1 
ATOM   356  C CB  . ILE A 1 45  ? 6.928   -28.082 20.499  1.00 39.80 ? 45  ILE A CB  1 
ATOM   357  C CG1 . ILE A 1 45  ? 6.456   -29.113 21.555  1.00 41.79 ? 45  ILE A CG1 1 
ATOM   358  C CG2 . ILE A 1 45  ? 6.737   -26.643 20.999  1.00 39.61 ? 45  ILE A CG2 1 
ATOM   359  C CD1 . ILE A 1 45  ? 4.967   -29.031 21.953  1.00 44.31 ? 45  ILE A CD1 1 
ATOM   360  N N   . THR A 1 46  ? 6.515   -26.384 17.615  1.00 36.54 ? 46  THR A N   1 
ATOM   361  C CA  . THR A 1 46  ? 7.132   -25.487 16.609  1.00 34.89 ? 46  THR A CA  1 
ATOM   362  C C   . THR A 1 46  ? 8.526   -25.072 17.061  1.00 34.27 ? 46  THR A C   1 
ATOM   363  O O   . THR A 1 46  ? 8.709   -24.587 18.169  1.00 34.36 ? 46  THR A O   1 
ATOM   364  C CB  . THR A 1 46  ? 6.301   -24.169 16.355  1.00 34.65 ? 46  THR A CB  1 
ATOM   365  O OG1 . THR A 1 46  ? 4.981   -24.473 15.900  1.00 33.83 ? 46  THR A OG1 1 
ATOM   366  C CG2 . THR A 1 46  ? 6.953   -23.287 15.302  1.00 34.02 ? 46  THR A CG2 1 
ATOM   367  N N   . ALA A 1 47  ? 9.504   -25.284 16.197  1.00 33.33 ? 47  ALA A N   1 
ATOM   368  C CA  . ALA A 1 47  ? 10.870  -24.983 16.520  1.00 32.57 ? 47  ALA A CA  1 
ATOM   369  C C   . ALA A 1 47  ? 11.269  -23.645 15.915  1.00 32.01 ? 47  ALA A C   1 
ATOM   370  O O   . ALA A 1 47  ? 11.514  -23.520 14.710  1.00 32.03 ? 47  ALA A O   1 
ATOM   371  C CB  . ALA A 1 47  ? 11.779  -26.098 16.041  1.00 32.97 ? 47  ALA A CB  1 
ATOM   372  N N   . ILE A 1 48  ? 11.318  -22.640 16.777  1.00 30.98 ? 48  ILE A N   1 
ATOM   373  C CA  . ILE A 1 48  ? 11.752  -21.333 16.385  1.00 30.11 ? 48  ILE A CA  1 
ATOM   374  C C   . ILE A 1 48  ? 13.130  -21.037 16.940  1.00 30.29 ? 48  ILE A C   1 
ATOM   375  O O   . ILE A 1 48  ? 13.405  -21.260 18.129  1.00 30.41 ? 48  ILE A O   1 
ATOM   376  C CB  . ILE A 1 48  ? 10.733  -20.303 16.772  1.00 29.85 ? 48  ILE A CB  1 
ATOM   377  C CG1 . ILE A 1 48  ? 9.454   -20.575 15.932  1.00 30.59 ? 48  ILE A CG1 1 
ATOM   378  C CG2 . ILE A 1 48  ? 11.300  -18.951 16.568  1.00 27.51 ? 48  ILE A CG2 1 
ATOM   379  C CD1 . ILE A 1 48  ? 8.269   -19.587 16.104  1.00 30.18 ? 48  ILE A CD1 1 
ATOM   380  N N   . ILE A 1 49  ? 14.016  -20.590 16.052  1.00 30.00 ? 49  ILE A N   1 
ATOM   381  C CA  . ILE A 1 49  ? 15.338  -20.194 16.463  1.00 29.47 ? 49  ILE A CA  1 
ATOM   382  C C   . ILE A 1 49  ? 15.412  -18.675 16.457  1.00 29.19 ? 49  ILE A C   1 
ATOM   383  O O   . ILE A 1 49  ? 15.445  -18.069 15.384  1.00 29.46 ? 49  ILE A O   1 
ATOM   384  C CB  . ILE A 1 49  ? 16.437  -20.780 15.559  1.00 29.68 ? 49  ILE A CB  1 
ATOM   385  C CG1 . ILE A 1 49  ? 16.140  -22.232 15.141  1.00 29.22 ? 49  ILE A CG1 1 
ATOM   386  C CG2 . ILE A 1 49  ? 17.748  -20.773 16.309  1.00 31.26 ? 49  ILE A CG2 1 
ATOM   387  C CD1 . ILE A 1 49  ? 17.383  -22.994 14.624  1.00 25.66 ? 49  ILE A CD1 1 
ATOM   388  N N   . ALA A 1 50  ? 15.435  -18.075 17.658  1.00 28.39 ? 50  ALA A N   1 
ATOM   389  C CA  . ALA A 1 50  ? 15.455  -16.612 17.841  1.00 27.64 ? 50  ALA A CA  1 
ATOM   390  C C   . ALA A 1 50  ? 16.842  -16.004 17.704  1.00 27.31 ? 50  ALA A C   1 
ATOM   391  O O   . ALA A 1 50  ? 17.784  -16.425 18.372  1.00 27.56 ? 50  ALA A O   1 
ATOM   392  C CB  . ALA A 1 50  ? 14.856  -16.240 19.170  1.00 27.04 ? 50  ALA A CB  1 
ATOM   393  N N   . VAL A 1 51  ? 16.962  -15.018 16.832  1.00 27.26 ? 51  VAL A N   1 
ATOM   394  C CA  . VAL A 1 51  ? 18.252  -14.386 16.557  1.00 28.11 ? 51  VAL A CA  1 
ATOM   395  C C   . VAL A 1 51  ? 18.415  -13.156 17.444  1.00 28.44 ? 51  VAL A C   1 
ATOM   396  O O   . VAL A 1 51  ? 17.431  -12.397 17.649  1.00 28.60 ? 51  VAL A O   1 
ATOM   397  C CB  . VAL A 1 51  ? 18.375  -13.917 15.063  1.00 28.06 ? 51  VAL A CB  1 
ATOM   398  C CG1 . VAL A 1 51  ? 19.680  -13.212 14.807  1.00 27.47 ? 51  VAL A CG1 1 
ATOM   399  C CG2 . VAL A 1 51  ? 18.241  -15.074 14.110  1.00 29.97 ? 51  VAL A CG2 1 
ATOM   400  N N   . TYR A 1 52  ? 19.640  -12.948 17.941  1.00 27.46 ? 52  TYR A N   1 
ATOM   401  C CA  . TYR A 1 52  ? 19.987  -11.684 18.561  1.00 27.90 ? 52  TYR A CA  1 
ATOM   402  C C   . TYR A 1 52  ? 20.966  -10.909 17.715  1.00 28.71 ? 52  TYR A C   1 
ATOM   403  O O   . TYR A 1 52  ? 22.099  -11.362 17.467  1.00 28.74 ? 52  TYR A O   1 
ATOM   404  C CB  . TYR A 1 52  ? 20.577  -11.835 19.969  1.00 27.41 ? 52  TYR A CB  1 
ATOM   405  C CG  . TYR A 1 52  ? 20.873  -10.501 20.636  1.00 24.48 ? 52  TYR A CG  1 
ATOM   406  C CD1 . TYR A 1 52  ? 19.863  -9.804  21.338  1.00 22.18 ? 52  TYR A CD1 1 
ATOM   407  C CD2 . TYR A 1 52  ? 22.145  -9.928  20.559  1.00 22.37 ? 52  TYR A CD2 1 
ATOM   408  C CE1 . TYR A 1 52  ? 20.099  -8.586  21.938  1.00 17.15 ? 52  TYR A CE1 1 
ATOM   409  C CE2 . TYR A 1 52  ? 22.418  -8.711  21.157  1.00 20.87 ? 52  TYR A CE2 1 
ATOM   410  C CZ  . TYR A 1 52  ? 21.381  -8.043  21.868  1.00 22.97 ? 52  TYR A CZ  1 
ATOM   411  O OH  . TYR A 1 52  ? 21.650  -6.819  22.479  1.00 21.34 ? 52  TYR A OH  1 
ATOM   412  N N   . LYS A 1 53  ? 20.529  -9.719  17.318  1.00 29.51 ? 53  LYS A N   1 
ATOM   413  C CA  . LYS A 1 53  ? 21.367  -8.786  16.570  1.00 31.12 ? 53  LYS A CA  1 
ATOM   414  C C   . LYS A 1 53  ? 20.955  -7.308  16.802  1.00 31.27 ? 53  LYS A C   1 
ATOM   415  O O   . LYS A 1 53  ? 19.786  -6.939  16.694  1.00 31.82 ? 53  LYS A O   1 
ATOM   416  C CB  . LYS A 1 53  ? 21.381  -9.147  15.062  1.00 30.89 ? 53  LYS A CB  1 
ATOM   417  C CG  . LYS A 1 53  ? 20.002  -9.304  14.441  1.00 32.54 ? 53  LYS A CG  1 
ATOM   418  C CD  . LYS A 1 53  ? 20.059  -9.458  12.924  1.00 34.55 ? 53  LYS A CD  1 
ATOM   419  C CE  . LYS A 1 53  ? 18.858  -10.257 12.420  1.00 34.81 ? 53  LYS A CE  1 
ATOM   420  N NZ  . LYS A 1 53  ? 18.375  -9.849  11.065  1.00 34.62 ? 53  LYS A NZ  1 
ATOM   421  N N   . ARG A 1 54  ? 21.928  -6.477  17.127  1.00 31.98 ? 54  ARG A N   1 
ATOM   422  C CA  . ARG A 1 54  ? 21.675  -5.053  17.373  1.00 32.79 ? 54  ARG A CA  1 
ATOM   423  C C   . ARG A 1 54  ? 21.500  -4.256  16.083  1.00 32.52 ? 54  ARG A C   1 
ATOM   424  O O   . ARG A 1 54  ? 20.870  -3.200  16.067  1.00 31.57 ? 54  ARG A O   1 
ATOM   425  C CB  . ARG A 1 54  ? 22.838  -4.458  18.155  1.00 32.85 ? 54  ARG A CB  1 
ATOM   426  C CG  . ARG A 1 54  ? 22.653  -4.571  19.633  1.00 35.23 ? 54  ARG A CG  1 
ATOM   427  C CD  . ARG A 1 54  ? 23.693  -3.738  20.404  1.00 38.37 ? 54  ARG A CD  1 
ATOM   428  N NE  . ARG A 1 54  ? 23.733  -4.244  21.769  1.00 39.20 ? 54  ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 54  ? 24.415  -5.326  22.121  1.00 40.39 ? 54  ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 54  ? 24.379  -5.746  23.378  1.00 38.25 ? 54  ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 54  ? 25.131  -5.984  21.201  1.00 41.90 ? 54  ARG A NH2 1 
ATOM   432  N N   . LYS A 1 55  ? 22.074  -4.790  15.014  1.00 32.23 ? 55  LYS A N   1 
ATOM   433  C CA  . LYS A 1 55  ? 22.127  -4.123  13.745  1.00 32.71 ? 55  LYS A CA  1 
ATOM   434  C C   . LYS A 1 55  ? 22.239  -5.213  12.685  1.00 32.52 ? 55  LYS A C   1 
ATOM   435  O O   . LYS A 1 55  ? 22.771  -6.294  12.956  1.00 32.69 ? 55  LYS A O   1 
ATOM   436  C CB  . LYS A 1 55  ? 23.363  -3.212  13.718  1.00 32.93 ? 55  LYS A CB  1 
ATOM   437  C CG  . LYS A 1 55  ? 23.668  -2.595  12.369  1.00 33.79 ? 55  LYS A CG  1 
ATOM   438  C CD  . LYS A 1 55  ? 25.028  -1.892  12.323  1.00 33.34 ? 55  LYS A CD  1 
ATOM   439  C CE  . LYS A 1 55  ? 25.074  -1.006  11.071  1.00 34.40 ? 55  LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 55  ? 26.475  -0.857  10.667  1.00 37.62 ? 55  LYS A NZ  1 
ATOM   441  N N   . SER A 1 56  ? 21.724  -4.942  11.494  1.00 31.87 ? 56  SER A N   1 
ATOM   442  C CA  . SER A 1 56  ? 21.986  -5.804  10.351  1.00 31.38 ? 56  SER A CA  1 
ATOM   443  C C   . SER A 1 56  ? 21.852  -4.990  9.103   1.00 31.44 ? 56  SER A C   1 
ATOM   444  O O   . SER A 1 56  ? 21.198  -3.939  9.118   1.00 31.27 ? 56  SER A O   1 
ATOM   445  C CB  . SER A 1 56  ? 21.034  -6.998  10.278  1.00 31.02 ? 56  SER A CB  1 
ATOM   446  O OG  . SER A 1 56  ? 19.703  -6.573  10.155  1.00 29.54 ? 56  SER A OG  1 
ATOM   447  N N   . PRO A 1 57  ? 22.452  -5.472  8.004   1.00 31.10 ? 57  PRO A N   1 
ATOM   448  C CA  . PRO A 1 57  ? 22.248  -4.720  6.782   1.00 30.65 ? 57  PRO A CA  1 
ATOM   449  C C   . PRO A 1 57  ? 20.785  -4.736  6.324   1.00 30.31 ? 57  PRO A C   1 
ATOM   450  O O   . PRO A 1 57  ? 20.399  -3.883  5.522   1.00 30.80 ? 57  PRO A O   1 
ATOM   451  C CB  . PRO A 1 57  ? 23.165  -5.412  5.772   1.00 30.58 ? 57  PRO A CB  1 
ATOM   452  C CG  . PRO A 1 57  ? 23.518  -6.745  6.382   1.00 30.87 ? 57  PRO A CG  1 
ATOM   453  C CD  . PRO A 1 57  ? 23.396  -6.593  7.846   1.00 31.07 ? 57  PRO A CD  1 
ATOM   454  N N   . SER A 1 58  ? 19.981  -5.672  6.825   1.00 29.44 ? 58  SER A N   1 
ATOM   455  C CA  . SER A 1 58  ? 18.588  -5.762  6.411   1.00 29.19 ? 58  SER A CA  1 
ATOM   456  C C   . SER A 1 58  ? 17.577  -5.315  7.465   1.00 29.28 ? 58  SER A C   1 
ATOM   457  O O   . SER A 1 58  ? 16.398  -5.656  7.382   1.00 30.24 ? 58  SER A O   1 
ATOM   458  C CB  . SER A 1 58  ? 18.248  -7.167  5.927   1.00 29.16 ? 58  SER A CB  1 
ATOM   459  O OG  . SER A 1 58  ? 18.168  -8.054  7.024   1.00 29.83 ? 58  SER A OG  1 
ATOM   460  N N   . GLY A 1 59  ? 18.011  -4.541  8.449   1.00 29.01 ? 59  GLY A N   1 
ATOM   461  C CA  . GLY A 1 59  ? 17.067  -3.890  9.349   1.00 28.61 ? 59  GLY A CA  1 
ATOM   462  C C   . GLY A 1 59  ? 17.539  -2.574  9.937   1.00 28.68 ? 59  GLY A C   1 
ATOM   463  O O   . GLY A 1 59  ? 18.646  -2.116  9.679   1.00 28.55 ? 59  GLY A O   1 
ATOM   464  N N   . LEU A 1 60  ? 16.675  -1.963  10.731  1.00 29.49 ? 60  LEU A N   1 
ATOM   465  C CA  . LEU A 1 60  ? 17.045  -0.822  11.576  1.00 31.10 ? 60  LEU A CA  1 
ATOM   466  C C   . LEU A 1 60  ? 17.703  -1.338  12.877  1.00 31.68 ? 60  LEU A C   1 
ATOM   467  O O   . LEU A 1 60  ? 17.355  -2.412  13.337  1.00 31.22 ? 60  LEU A O   1 
ATOM   468  C CB  . LEU A 1 60  ? 15.800  0.026   11.871  1.00 29.89 ? 60  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 60  ? 15.722  1.419   11.258  1.00 31.03 ? 60  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 60  ? 16.699  1.637   10.051  1.00 30.79 ? 60  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 60  ? 14.278  1.770   10.890  1.00 28.69 ? 60  LEU A CD2 1 
ATOM   472  N N   . ASP A 1 61  ? 18.659  -0.583  13.432  1.00 33.14 ? 61  ASP A N   1 
ATOM   473  C CA  . ASP A 1 61  ? 19.307  -0.921  14.714  1.00 34.08 ? 61  ASP A CA  1 
ATOM   474  C C   . ASP A 1 61  ? 18.292  -1.019  15.832  1.00 34.37 ? 61  ASP A C   1 
ATOM   475  O O   . ASP A 1 61  ? 17.400  -0.175  15.939  1.00 34.19 ? 61  ASP A O   1 
ATOM   476  C CB  . ASP A 1 61  ? 20.279  0.167   15.209  1.00 34.42 ? 61  ASP A CB  1 
ATOM   477  C CG  . ASP A 1 61  ? 21.401  0.475   14.241  1.00 36.15 ? 61  ASP A CG  1 
ATOM   478  O OD1 . ASP A 1 61  ? 22.122  1.459   14.558  1.00 35.15 ? 61  ASP A OD1 1 
ATOM   479  O OD2 . ASP A 1 61  ? 21.578  -0.231  13.211  1.00 38.11 ? 61  ASP A OD2 1 
ATOM   480  N N   . VAL A 1 62  ? 18.465  -2.026  16.684  1.00 34.45 ? 62  VAL A N   1 
ATOM   481  C CA  . VAL A 1 62  ? 17.741  -2.115  17.937  1.00 34.37 ? 62  VAL A CA  1 
ATOM   482  C C   . VAL A 1 62  ? 18.743  -2.166  19.112  1.00 35.41 ? 62  VAL A C   1 
ATOM   483  O O   . VAL A 1 62  ? 19.719  -2.927  19.086  1.00 35.58 ? 62  VAL A O   1 
ATOM   484  C CB  . VAL A 1 62  ? 16.789  -3.308  17.914  1.00 34.20 ? 62  VAL A CB  1 
ATOM   485  C CG1 . VAL A 1 62  ? 15.988  -3.430  19.225  1.00 33.46 ? 62  VAL A CG1 1 
ATOM   486  C CG2 . VAL A 1 62  ? 15.865  -3.160  16.752  1.00 30.94 ? 62  VAL A CG2 1 
ATOM   487  N N   . GLU A 1 63  ? 18.537  -1.288  20.096  1.00 36.03 ? 63  GLU A N   1 
ATOM   488  C CA  . GLU A 1 63  ? 19.301  -1.324  21.320  1.00 36.37 ? 63  GLU A CA  1 
ATOM   489  C C   . GLU A 1 63  ? 18.458  -2.076  22.346  1.00 35.62 ? 63  GLU A C   1 
ATOM   490  O O   . GLU A 1 63  ? 17.322  -1.722  22.614  1.00 35.65 ? 63  GLU A O   1 
ATOM   491  C CB  . GLU A 1 63  ? 19.697  0.086   21.754  1.00 37.21 ? 63  GLU A CB  1 
ATOM   492  C CG  . GLU A 1 63  ? 20.697  0.763   20.778  1.00 41.36 ? 63  GLU A CG  1 
ATOM   493  C CD  . GLU A 1 63  ? 21.847  -0.192  20.346  1.00 47.69 ? 63  GLU A CD  1 
ATOM   494  O OE1 . GLU A 1 63  ? 22.712  -0.549  21.198  1.00 47.90 ? 63  GLU A OE1 1 
ATOM   495  O OE2 . GLU A 1 63  ? 21.863  -0.614  19.158  1.00 49.81 ? 63  GLU A OE2 1 
ATOM   496  N N   . ARG A 1 64  ? 18.994  -3.181  22.844  1.00 34.71 ? 64  ARG A N   1 
ATOM   497  C CA  . ARG A 1 64  ? 18.230  -4.069  23.713  1.00 33.82 ? 64  ARG A CA  1 
ATOM   498  C C   . ARG A 1 64  ? 19.157  -4.936  24.514  1.00 33.38 ? 64  ARG A C   1 
ATOM   499  O O   . ARG A 1 64  ? 20.210  -5.338  24.039  1.00 33.14 ? 64  ARG A O   1 
ATOM   500  C CB  . ARG A 1 64  ? 17.306  -5.002  22.937  1.00 33.37 ? 64  ARG A CB  1 
ATOM   501  C CG  . ARG A 1 64  ? 16.508  -5.874  23.888  1.00 33.72 ? 64  ARG A CG  1 
ATOM   502  C CD  . ARG A 1 64  ? 15.767  -6.969  23.230  1.00 32.95 ? 64  ARG A CD  1 
ATOM   503  N NE  . ARG A 1 64  ? 14.671  -6.467  22.435  1.00 34.01 ? 64  ARG A NE  1 
ATOM   504  C CZ  . ARG A 1 64  ? 13.588  -5.853  22.912  1.00 36.18 ? 64  ARG A CZ  1 
ATOM   505  N NH1 . ARG A 1 64  ? 13.421  -5.632  24.219  1.00 34.49 ? 64  ARG A NH1 1 
ATOM   506  N NH2 . ARG A 1 64  ? 12.656  -5.440  22.052  1.00 35.06 ? 64  ARG A NH2 1 
ATOM   507  N N   . ASP A 1 65  ? 18.750  -5.254  25.729  1.00 33.00 ? 65  ASP A N   1 
ATOM   508  C CA  . ASP A 1 65  ? 19.597  -6.083  26.558  1.00 32.53 ? 65  ASP A CA  1 
ATOM   509  C C   . ASP A 1 65  ? 19.628  -7.561  26.106  1.00 31.29 ? 65  ASP A C   1 
ATOM   510  O O   . ASP A 1 65  ? 18.581  -8.241  26.071  1.00 30.83 ? 65  ASP A O   1 
ATOM   511  C CB  . ASP A 1 65  ? 19.233  -5.942  28.038  1.00 32.80 ? 65  ASP A CB  1 
ATOM   512  C CG  . ASP A 1 65  ? 20.095  -6.790  28.892  1.00 35.65 ? 65  ASP A CG  1 
ATOM   513  O OD1 . ASP A 1 65  ? 21.252  -6.391  29.165  1.00 38.86 ? 65  ASP A OD1 1 
ATOM   514  O OD2 . ASP A 1 65  ? 19.638  -7.905  29.231  1.00 40.61 ? 65  ASP A OD2 1 
ATOM   515  N N   . PRO A 1 66  ? 20.842  -8.055  25.792  1.00 29.88 ? 66  PRO A N   1 
ATOM   516  C CA  . PRO A 1 66  ? 21.120  -9.422  25.374  1.00 30.07 ? 66  PRO A CA  1 
ATOM   517  C C   . PRO A 1 66  ? 20.497  -10.433 26.318  1.00 30.82 ? 66  PRO A C   1 
ATOM   518  O O   . PRO A 1 66  ? 19.703  -11.265 25.888  1.00 31.01 ? 66  PRO A O   1 
ATOM   519  C CB  . PRO A 1 66  ? 22.633  -9.533  25.503  1.00 29.68 ? 66  PRO A CB  1 
ATOM   520  C CG  . PRO A 1 66  ? 23.133  -8.144  25.620  1.00 29.40 ? 66  PRO A CG  1 
ATOM   521  C CD  . PRO A 1 66  ? 22.058  -7.312  26.131  1.00 29.12 ? 66  PRO A CD  1 
ATOM   522  N N   . ILE A 1 67  ? 20.871  -10.340 27.601  1.00 31.39 ? 67  ILE A N   1 
ATOM   523  C CA  . ILE A 1 67  ? 20.397  -11.227 28.667  1.00 31.51 ? 67  ILE A CA  1 
ATOM   524  C C   . ILE A 1 67  ? 18.863  -11.247 28.847  1.00 32.12 ? 67  ILE A C   1 
ATOM   525  O O   . ILE A 1 67  ? 18.256  -12.330 28.897  1.00 31.62 ? 67  ILE A O   1 
ATOM   526  C CB  . ILE A 1 67  ? 21.062  -10.859 29.997  1.00 31.06 ? 67  ILE A CB  1 
ATOM   527  C CG1 . ILE A 1 67  ? 22.528  -11.279 29.973  1.00 31.48 ? 67  ILE A CG1 1 
ATOM   528  C CG2 . ILE A 1 67  ? 20.319  -11.508 31.153  1.00 30.45 ? 67  ILE A CG2 1 
ATOM   529  C CD1 . ILE A 1 67  ? 23.293  -10.956 31.239  1.00 30.48 ? 67  ILE A CD1 1 
ATOM   530  N N   . GLU A 1 68  ? 18.261  -10.050 28.955  1.00 32.28 ? 68  GLU A N   1 
ATOM   531  C CA  . GLU A 1 68  ? 16.802  -9.898  29.039  1.00 32.44 ? 68  GLU A CA  1 
ATOM   532  C C   . GLU A 1 68  ? 16.113  -10.597 27.875  1.00 31.89 ? 68  GLU A C   1 
ATOM   533  O O   . GLU A 1 68  ? 15.102  -11.236 28.065  1.00 32.84 ? 68  GLU A O   1 
ATOM   534  C CB  . GLU A 1 68  ? 16.383  -8.411  29.092  1.00 32.57 ? 68  GLU A CB  1 
ATOM   535  N N   . TYR A 1 69  ? 16.683  -10.476 26.679  1.00 31.58 ? 69  TYR A N   1 
ATOM   536  C CA  . TYR A 1 69  ? 16.168  -11.102 25.476  1.00 30.96 ? 69  TYR A CA  1 
ATOM   537  C C   . TYR A 1 69  ? 16.306  -12.632 25.571  1.00 31.24 ? 69  TYR A C   1 
ATOM   538  O O   . TYR A 1 69  ? 15.307  -13.366 25.463  1.00 30.59 ? 69  TYR A O   1 
ATOM   539  C CB  . TYR A 1 69  ? 16.935  -10.537 24.269  1.00 31.23 ? 69  TYR A CB  1 
ATOM   540  C CG  . TYR A 1 69  ? 16.549  -11.081 22.900  1.00 31.74 ? 69  TYR A CG  1 
ATOM   541  C CD1 . TYR A 1 69  ? 15.318  -10.738 22.303  1.00 31.52 ? 69  TYR A CD1 1 
ATOM   542  C CD2 . TYR A 1 69  ? 17.414  -11.911 22.193  1.00 31.68 ? 69  TYR A CD2 1 
ATOM   543  C CE1 . TYR A 1 69  ? 14.956  -11.210 21.057  1.00 29.96 ? 69  TYR A CE1 1 
ATOM   544  C CE2 . TYR A 1 69  ? 17.061  -12.394 20.937  1.00 33.88 ? 69  TYR A CE2 1 
ATOM   545  C CZ  . TYR A 1 69  ? 15.827  -12.035 20.374  1.00 32.32 ? 69  TYR A CZ  1 
ATOM   546  O OH  . TYR A 1 69  ? 15.478  -12.510 19.125  1.00 31.26 ? 69  TYR A OH  1 
ATOM   547  N N   . ALA A 1 70  ? 17.536  -13.104 25.789  1.00 30.52 ? 70  ALA A N   1 
ATOM   548  C CA  . ALA A 1 70  ? 17.798  -14.521 25.973  1.00 30.66 ? 70  ALA A CA  1 
ATOM   549  C C   . ALA A 1 70  ? 16.918  -15.181 27.041  1.00 31.18 ? 70  ALA A C   1 
ATOM   550  O O   . ALA A 1 70  ? 16.216  -16.150 26.758  1.00 31.34 ? 70  ALA A O   1 
ATOM   551  C CB  . ALA A 1 70  ? 19.243  -14.742 26.279  1.00 30.33 ? 70  ALA A CB  1 
ATOM   552  N N   . LYS A 1 71  ? 16.952  -14.655 28.260  1.00 31.74 ? 71  LYS A N   1 
ATOM   553  C CA  . LYS A 1 71  ? 16.092  -15.134 29.340  1.00 32.10 ? 71  LYS A CA  1 
ATOM   554  C C   . LYS A 1 71  ? 14.643  -15.165 28.895  1.00 32.60 ? 71  LYS A C   1 
ATOM   555  O O   . LYS A 1 71  ? 13.919  -16.093 29.216  1.00 33.95 ? 71  LYS A O   1 
ATOM   556  C CB  . LYS A 1 71  ? 16.236  -14.257 30.591  1.00 32.11 ? 71  LYS A CB  1 
ATOM   557  C CG  . LYS A 1 71  ? 17.123  -14.837 31.676  1.00 34.41 ? 71  LYS A CG  1 
ATOM   558  C CD  . LYS A 1 71  ? 17.315  -13.861 32.866  1.00 39.24 ? 71  LYS A CD  1 
ATOM   559  C CE  . LYS A 1 71  ? 17.911  -14.549 34.105  1.00 40.91 ? 71  LYS A CE  1 
ATOM   560  N NZ  . LYS A 1 71  ? 19.068  -13.790 34.690  1.00 42.25 ? 71  LYS A NZ  1 
ATOM   561  N N   . PHE A 1 72  ? 14.190  -14.152 28.164  1.00 32.66 ? 72  PHE A N   1 
ATOM   562  C CA  . PHE A 1 72  ? 12.811  -14.188 27.678  1.00 32.22 ? 72  PHE A CA  1 
ATOM   563  C C   . PHE A 1 72  ? 12.558  -15.303 26.662  1.00 32.56 ? 72  PHE A C   1 
ATOM   564  O O   . PHE A 1 72  ? 11.550  -16.019 26.745  1.00 33.52 ? 72  PHE A O   1 
ATOM   565  C CB  . PHE A 1 72  ? 12.390  -12.861 27.059  1.00 32.23 ? 72  PHE A CB  1 
ATOM   566  C CG  . PHE A 1 72  ? 11.072  -12.950 26.328  1.00 32.60 ? 72  PHE A CG  1 
ATOM   567  C CD1 . PHE A 1 72  ? 9.873   -12.715 26.996  1.00 29.53 ? 72  PHE A CD1 1 
ATOM   568  C CD2 . PHE A 1 72  ? 11.032  -13.329 24.968  1.00 31.88 ? 72  PHE A CD2 1 
ATOM   569  C CE1 . PHE A 1 72  ? 8.650   -12.823 26.324  1.00 31.50 ? 72  PHE A CE1 1 
ATOM   570  C CE2 . PHE A 1 72  ? 9.816   -13.459 24.292  1.00 30.66 ? 72  PHE A CE2 1 
ATOM   571  C CZ  . PHE A 1 72  ? 8.616   -13.196 24.969  1.00 31.12 ? 72  PHE A CZ  1 
ATOM   572  N N   . MET A 1 73  ? 13.446  -15.427 25.683  1.00 32.56 ? 73  MET A N   1 
ATOM   573  C CA  . MET A 1 73  ? 13.294  -16.442 24.651  1.00 32.93 ? 73  MET A CA  1 
ATOM   574  C C   . MET A 1 73  ? 13.408  -17.847 25.220  1.00 33.16 ? 73  MET A C   1 
ATOM   575  O O   . MET A 1 73  ? 12.876  -18.793 24.643  1.00 32.99 ? 73  MET A O   1 
ATOM   576  C CB  . MET A 1 73  ? 14.315  -16.245 23.535  1.00 32.93 ? 73  MET A CB  1 
ATOM   577  C CG  . MET A 1 73  ? 14.052  -15.015 22.667  1.00 33.44 ? 73  MET A CG  1 
ATOM   578  S SD  . MET A 1 73  ? 12.423  -15.124 21.930  1.00 36.48 ? 73  MET A SD  1 
ATOM   579  C CE  . MET A 1 73  ? 12.259  -13.457 21.197  1.00 31.52 ? 73  MET A CE  1 
ATOM   580  N N   . GLU A 1 74  ? 14.071  -17.978 26.369  1.00 34.07 ? 74  GLU A N   1 
ATOM   581  C CA  . GLU A 1 74  ? 14.315  -19.303 26.966  1.00 34.99 ? 74  GLU A CA  1 
ATOM   582  C C   . GLU A 1 74  ? 13.005  -20.080 27.184  1.00 35.26 ? 74  GLU A C   1 
ATOM   583  O O   . GLU A 1 74  ? 12.948  -21.285 26.992  1.00 35.26 ? 74  GLU A O   1 
ATOM   584  C CB  . GLU A 1 74  ? 15.109  -19.192 28.262  1.00 34.37 ? 74  GLU A CB  1 
ATOM   585  C CG  . GLU A 1 74  ? 15.446  -20.540 28.846  1.00 35.95 ? 74  GLU A CG  1 
ATOM   586  C CD  . GLU A 1 74  ? 16.078  -20.433 30.209  1.00 38.23 ? 74  GLU A CD  1 
ATOM   587  O OE1 . GLU A 1 74  ? 15.403  -19.837 31.117  1.00 39.49 ? 74  GLU A OE1 1 
ATOM   588  O OE2 . GLU A 1 74  ? 17.224  -20.952 30.355  1.00 34.33 ? 74  GLU A OE2 1 
ATOM   589  N N   . ARG A 1 75  ? 11.950  -19.362 27.529  1.00 35.83 ? 75  ARG A N   1 
ATOM   590  C CA  . ARG A 1 75  ? 10.647  -19.971 27.740  1.00 36.88 ? 75  ARG A CA  1 
ATOM   591  C C   . ARG A 1 75  ? 10.026  -20.586 26.471  1.00 37.36 ? 75  ARG A C   1 
ATOM   592  O O   . ARG A 1 75  ? 9.130   -21.449 26.582  1.00 37.33 ? 75  ARG A O   1 
ATOM   593  C CB  . ARG A 1 75  ? 9.691   -18.936 28.356  1.00 37.28 ? 75  ARG A CB  1 
ATOM   594  N N   . TYR A 1 76  ? 10.530  -20.177 25.292  1.00 37.33 ? 76  TYR A N   1 
ATOM   595  C CA  . TYR A 1 76  ? 9.811   -20.349 24.006  1.00 37.73 ? 76  TYR A CA  1 
ATOM   596  C C   . TYR A 1 76  ? 10.574  -20.994 22.847  1.00 36.89 ? 76  TYR A C   1 
ATOM   597  O O   . TYR A 1 76  ? 10.032  -21.864 22.163  1.00 36.77 ? 76  TYR A O   1 
ATOM   598  C CB  . TYR A 1 76  ? 9.239   -19.005 23.534  1.00 38.07 ? 76  TYR A CB  1 
ATOM   599  C CG  . TYR A 1 76  ? 8.319   -18.439 24.559  1.00 41.13 ? 76  TYR A CG  1 
ATOM   600  C CD1 . TYR A 1 76  ? 7.076   -19.048 24.812  1.00 43.53 ? 76  TYR A CD1 1 
ATOM   601  C CD2 . TYR A 1 76  ? 8.703   -17.343 25.342  1.00 43.62 ? 76  TYR A CD2 1 
ATOM   602  C CE1 . TYR A 1 76  ? 6.220   -18.558 25.810  1.00 45.09 ? 76  TYR A CE1 1 
ATOM   603  C CE2 . TYR A 1 76  ? 7.854   -16.838 26.342  1.00 45.76 ? 76  TYR A CE2 1 
ATOM   604  C CZ  . TYR A 1 76  ? 6.613   -17.456 26.567  1.00 46.21 ? 76  TYR A CZ  1 
ATOM   605  O OH  . TYR A 1 76  ? 5.765   -16.971 27.537  1.00 48.47 ? 76  TYR A OH  1 
ATOM   606  N N   . ALA A 1 77  ? 11.811  -20.546 22.632  1.00 35.43 ? 77  ALA A N   1 
ATOM   607  C CA  . ALA A 1 77  ? 12.559  -20.856 21.424  1.00 34.37 ? 77  ALA A CA  1 
ATOM   608  C C   . ALA A 1 77  ? 13.294  -22.177 21.551  1.00 33.72 ? 77  ALA A C   1 
ATOM   609  O O   . ALA A 1 77  ? 13.705  -22.567 22.650  1.00 34.10 ? 77  ALA A O   1 
ATOM   610  C CB  . ALA A 1 77  ? 13.547  -19.724 21.108  1.00 34.37 ? 77  ALA A CB  1 
ATOM   611  N N   . VAL A 1 78  ? 13.472  -22.857 20.425  1.00 32.37 ? 78  VAL A N   1 
ATOM   612  C CA  . VAL A 1 78  ? 14.164  -24.129 20.436  1.00 31.27 ? 78  VAL A CA  1 
ATOM   613  C C   . VAL A 1 78  ? 15.651  -23.865 20.629  1.00 30.79 ? 78  VAL A C   1 
ATOM   614  O O   . VAL A 1 78  ? 16.368  -24.716 21.177  1.00 31.13 ? 78  VAL A O   1 
ATOM   615  C CB  . VAL A 1 78  ? 13.866  -24.963 19.158  1.00 31.69 ? 78  VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 78  ? 14.607  -24.387 17.920  1.00 32.20 ? 78  VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 78  ? 14.190  -26.442 19.375  1.00 29.77 ? 78  VAL A CG2 1 
ATOM   618  N N   . GLY A 1 79  ? 16.086  -22.677 20.196  1.00 29.38 ? 79  GLY A N   1 
ATOM   619  C CA  . GLY A 1 79  ? 17.446  -22.170 20.399  1.00 28.81 ? 79  GLY A CA  1 
ATOM   620  C C   . GLY A 1 79  ? 17.692  -20.687 20.041  1.00 28.28 ? 79  GLY A C   1 
ATOM   621  O O   . GLY A 1 79  ? 16.811  -19.984 19.533  1.00 27.64 ? 79  GLY A O   1 
ATOM   622  N N   . LEU A 1 80  ? 18.902  -20.206 20.298  1.00 27.52 ? 80  LEU A N   1 
ATOM   623  C CA  . LEU A 1 80  ? 19.216  -18.815 20.000  1.00 27.52 ? 80  LEU A CA  1 
ATOM   624  C C   . LEU A 1 80  ? 20.394  -18.674 19.036  1.00 26.70 ? 80  LEU A C   1 
ATOM   625  O O   . LEU A 1 80  ? 21.390  -19.391 19.160  1.00 26.32 ? 80  LEU A O   1 
ATOM   626  C CB  . LEU A 1 80  ? 19.469  -18.018 21.300  1.00 28.09 ? 80  LEU A CB  1 
ATOM   627  C CG  . LEU A 1 80  ? 18.272  -17.770 22.263  1.00 29.91 ? 80  LEU A CG  1 
ATOM   628  C CD1 . LEU A 1 80  ? 18.702  -17.194 23.627  1.00 29.27 ? 80  LEU A CD1 1 
ATOM   629  C CD2 . LEU A 1 80  ? 17.221  -16.860 21.650  1.00 31.86 ? 80  LEU A CD2 1 
ATOM   630  N N   . VAL A 1 81  ? 20.262  -17.758 18.073  1.00 25.69 ? 81  VAL A N   1 
ATOM   631  C CA  . VAL A 1 81  ? 21.414  -17.321 17.270  1.00 24.93 ? 81  VAL A CA  1 
ATOM   632  C C   . VAL A 1 81  ? 21.905  -16.010 17.865  1.00 25.07 ? 81  VAL A C   1 
ATOM   633  O O   . VAL A 1 81  ? 21.105  -15.121 18.119  1.00 25.44 ? 81  VAL A O   1 
ATOM   634  C CB  . VAL A 1 81  ? 21.081  -17.178 15.733  1.00 24.18 ? 81  VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 81  ? 22.260  -16.637 14.970  1.00 23.08 ? 81  VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 81  ? 20.629  -18.558 15.119  1.00 23.14 ? 81  VAL A CG2 1 
ATOM   637  N N   . ILE A 1 82  ? 23.207  -15.911 18.116  1.00 25.18 ? 82  ILE A N   1 
ATOM   638  C CA  . ILE A 1 82  ? 23.823  -14.684 18.625  1.00 25.20 ? 82  ILE A CA  1 
ATOM   639  C C   . ILE A 1 82  ? 24.859  -14.237 17.632  1.00 25.48 ? 82  ILE A C   1 
ATOM   640  O O   . ILE A 1 82  ? 25.832  -14.975 17.341  1.00 25.08 ? 82  ILE A O   1 
ATOM   641  C CB  . ILE A 1 82  ? 24.560  -14.855 20.006  1.00 25.08 ? 82  ILE A CB  1 
ATOM   642  C CG1 . ILE A 1 82  ? 23.753  -15.701 21.016  1.00 27.06 ? 82  ILE A CG1 1 
ATOM   643  C CG2 . ILE A 1 82  ? 24.925  -13.493 20.598  1.00 24.97 ? 82  ILE A CG2 1 
ATOM   644  C CD1 . ILE A 1 82  ? 22.281  -15.297 21.199  1.00 29.27 ? 82  ILE A CD1 1 
ATOM   645  N N   . LEU A 1 83  ? 24.664  -13.023 17.131  1.00 25.46 ? 83  LEU A N   1 
ATOM   646  C CA  . LEU A 1 83  ? 25.602  -12.441 16.204  1.00 26.06 ? 83  LEU A CA  1 
ATOM   647  C C   . LEU A 1 83  ? 26.792  -11.976 16.980  1.00 26.21 ? 83  LEU A C   1 
ATOM   648  O O   . LEU A 1 83  ? 26.653  -11.458 18.071  1.00 27.53 ? 83  LEU A O   1 
ATOM   649  C CB  . LEU A 1 83  ? 24.958  -11.256 15.469  1.00 26.39 ? 83  LEU A CB  1 
ATOM   650  C CG  . LEU A 1 83  ? 24.429  -11.489 14.034  1.00 26.78 ? 83  LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 83  ? 25.599  -11.699 13.033  1.00 22.69 ? 83  LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 83  ? 23.326  -12.599 13.933  1.00 22.57 ? 83  LEU A CD2 1 
ATOM   653  N N   . THR A 1 84  ? 27.975  -12.150 16.424  1.00 26.43 ? 84  THR A N   1 
ATOM   654  C CA  . THR A 1 84  ? 29.177  -11.741 17.117  1.00 26.08 ? 84  THR A CA  1 
ATOM   655  C C   . THR A 1 84  ? 30.087  -11.052 16.155  1.00 26.23 ? 84  THR A C   1 
ATOM   656  O O   . THR A 1 84  ? 31.223  -10.720 16.511  1.00 26.32 ? 84  THR A O   1 
ATOM   657  C CB  . THR A 1 84  ? 29.929  -12.945 17.728  1.00 26.10 ? 84  THR A CB  1 
ATOM   658  O OG1 . THR A 1 84  ? 30.458  -13.757 16.672  1.00 26.14 ? 84  THR A OG1 1 
ATOM   659  C CG2 . THR A 1 84  ? 28.999  -13.774 18.640  1.00 25.45 ? 84  THR A CG2 1 
ATOM   660  N N   . GLU A 1 85  ? 29.602  -10.870 14.930  1.00 26.25 ? 85  GLU A N   1 
ATOM   661  C CA  . GLU A 1 85  ? 30.296  -10.062 13.908  1.00 27.18 ? 85  GLU A CA  1 
ATOM   662  C C   . GLU A 1 85  ? 30.198  -8.599  14.316  1.00 28.09 ? 85  GLU A C   1 
ATOM   663  O O   . GLU A 1 85  ? 29.109  -8.146  14.717  1.00 28.37 ? 85  GLU A O   1 
ATOM   664  C CB  . GLU A 1 85  ? 29.650  -10.258 12.537  1.00 26.18 ? 85  GLU A CB  1 
ATOM   665  C CG  . GLU A 1 85  ? 30.448  -9.754  11.399  1.00 25.99 ? 85  GLU A CG  1 
ATOM   666  C CD  . GLU A 1 85  ? 30.483  -8.225  11.290  1.00 27.20 ? 85  GLU A CD  1 
ATOM   667  O OE1 . GLU A 1 85  ? 29.427  -7.575  11.436  1.00 27.94 ? 85  GLU A OE1 1 
ATOM   668  O OE2 . GLU A 1 85  ? 31.581  -7.675  11.043  1.00 27.67 ? 85  GLU A OE2 1 
ATOM   669  N N   . GLU A 1 86  ? 31.313  -7.869  14.230  1.00 29.20 ? 86  GLU A N   1 
ATOM   670  C CA  . GLU A 1 86  ? 31.385  -6.516  14.826  1.00 30.86 ? 86  GLU A CA  1 
ATOM   671  C C   . GLU A 1 86  ? 30.904  -5.381  13.965  1.00 30.75 ? 86  GLU A C   1 
ATOM   672  O O   . GLU A 1 86  ? 30.067  -4.588  14.417  1.00 31.60 ? 86  GLU A O   1 
ATOM   673  C CB  . GLU A 1 86  ? 32.786  -6.194  15.345  1.00 31.34 ? 86  GLU A CB  1 
ATOM   674  C CG  . GLU A 1 86  ? 33.004  -6.730  16.770  1.00 36.38 ? 86  GLU A CG  1 
ATOM   675  C CD  . GLU A 1 86  ? 34.450  -6.692  17.234  1.00 40.60 ? 86  GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 86  ? 34.698  -7.132  18.383  1.00 44.80 ? 86  GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 86  ? 35.321  -6.227  16.469  1.00 40.05 ? 86  GLU A OE2 1 
ATOM   678  N N   . LYS A 1 87  ? 31.407  -5.321  12.726  1.00 30.66 ? 87  LYS A N   1 
ATOM   679  C CA  . LYS A 1 87  ? 31.179  -4.187  11.824  1.00 29.98 ? 87  LYS A CA  1 
ATOM   680  C C   . LYS A 1 87  ? 29.736  -3.966  11.355  1.00 29.75 ? 87  LYS A C   1 
ATOM   681  O O   . LYS A 1 87  ? 29.239  -2.828  11.404  1.00 29.90 ? 87  LYS A O   1 
ATOM   682  C CB  . LYS A 1 87  ? 32.113  -4.250  10.613  1.00 30.05 ? 87  LYS A CB  1 
ATOM   683  C CG  . LYS A 1 87  ? 32.551  -2.863  10.132  1.00 29.93 ? 87  LYS A CG  1 
ATOM   684  C CD  . LYS A 1 87  ? 33.277  -2.894  8.788   1.00 31.09 ? 87  LYS A CD  1 
ATOM   685  C CE  . LYS A 1 87  ? 33.330  -1.502  8.124   1.00 33.88 ? 87  LYS A CE  1 
ATOM   686  N NZ  . LYS A 1 87  ? 33.863  -1.595  6.732   1.00 36.94 ? 87  LYS A NZ  1 
ATOM   687  N N   . TYR A 1 88  ? 29.078  -5.040  10.922  1.00 29.05 ? 88  TYR A N   1 
ATOM   688  C CA  . TYR A 1 88  ? 27.834  -4.941  10.155  1.00 29.41 ? 88  TYR A CA  1 
ATOM   689  C C   . TYR A 1 88  ? 26.667  -5.243  11.060  1.00 29.73 ? 88  TYR A C   1 
ATOM   690  O O   . TYR A 1 88  ? 25.517  -4.899  10.768  1.00 29.07 ? 88  TYR A O   1 
ATOM   691  C CB  . TYR A 1 88  ? 27.863  -5.904  8.937   1.00 29.07 ? 88  TYR A CB  1 
ATOM   692  C CG  . TYR A 1 88  ? 28.844  -5.435  7.895   1.00 29.50 ? 88  TYR A CG  1 
ATOM   693  C CD1 . TYR A 1 88  ? 28.420  -4.715  6.776   1.00 27.96 ? 88  TYR A CD1 1 
ATOM   694  C CD2 . TYR A 1 88  ? 30.216  -5.659  8.062   1.00 30.34 ? 88  TYR A CD2 1 
ATOM   695  C CE1 . TYR A 1 88  ? 29.333  -4.250  5.840   1.00 29.61 ? 88  TYR A CE1 1 
ATOM   696  C CE2 . TYR A 1 88  ? 31.133  -5.206  7.142   1.00 31.62 ? 88  TYR A CE2 1 
ATOM   697  C CZ  . TYR A 1 88  ? 30.696  -4.488  6.027   1.00 31.40 ? 88  TYR A CZ  1 
ATOM   698  O OH  . TYR A 1 88  ? 31.641  -4.025  5.128   1.00 29.43 ? 88  TYR A OH  1 
ATOM   699  N N   . PHE A 1 89  ? 26.980  -5.894  12.174  1.00 30.42 ? 89  PHE A N   1 
ATOM   700  C CA  . PHE A 1 89  ? 25.924  -6.364  13.060  1.00 31.19 ? 89  PHE A CA  1 
ATOM   701  C C   . PHE A 1 89  ? 26.071  -5.817  14.471  1.00 31.53 ? 89  PHE A C   1 
ATOM   702  O O   . PHE A 1 89  ? 25.219  -6.075  15.324  1.00 31.35 ? 89  PHE A O   1 
ATOM   703  C CB  . PHE A 1 89  ? 25.864  -7.889  13.060  1.00 30.66 ? 89  PHE A CB  1 
ATOM   704  C CG  . PHE A 1 89  ? 25.462  -8.493  11.738  1.00 31.32 ? 89  PHE A CG  1 
ATOM   705  C CD1 . PHE A 1 89  ? 26.427  -8.819  10.779  1.00 31.23 ? 89  PHE A CD1 1 
ATOM   706  C CD2 . PHE A 1 89  ? 24.113  -8.771  11.460  1.00 31.74 ? 89  PHE A CD2 1 
ATOM   707  C CE1 . PHE A 1 89  ? 26.058  -9.412  9.548   1.00 31.34 ? 89  PHE A CE1 1 
ATOM   708  C CE2 . PHE A 1 89  ? 23.721  -9.364  10.236  1.00 32.10 ? 89  PHE A CE2 1 
ATOM   709  C CZ  . PHE A 1 89  ? 24.700  -9.685  9.278   1.00 32.59 ? 89  PHE A CZ  1 
ATOM   710  N N   . ASN A 1 90  ? 27.142  -5.048  14.704  1.00 32.13 ? 90  ASN A N   1 
ATOM   711  C CA  . ASN A 1 90  ? 27.411  -4.475  16.038  1.00 33.00 ? 90  ASN A CA  1 
ATOM   712  C C   . ASN A 1 90  ? 27.345  -5.507  17.193  1.00 32.22 ? 90  ASN A C   1 
ATOM   713  O O   . ASN A 1 90  ? 26.905  -5.215  18.288  1.00 32.09 ? 90  ASN A O   1 
ATOM   714  C CB  . ASN A 1 90  ? 26.508  -3.253  16.332  1.00 33.26 ? 90  ASN A CB  1 
ATOM   715  C CG  . ASN A 1 90  ? 26.969  -2.475  17.572  1.00 35.09 ? 90  ASN A CG  1 
ATOM   716  O OD1 . ASN A 1 90  ? 28.164  -2.214  17.755  1.00 36.76 ? 90  ASN A OD1 1 
ATOM   717  N ND2 . ASN A 1 90  ? 26.024  -2.143  18.444  1.00 37.47 ? 90  ASN A ND2 1 
ATOM   718  N N   . GLY A 1 91  ? 27.769  -6.731  16.914  1.00 31.59 ? 91  GLY A N   1 
ATOM   719  C CA  . GLY A 1 91  ? 27.771  -7.758  17.921  1.00 30.79 ? 91  GLY A CA  1 
ATOM   720  C C   . GLY A 1 91  ? 29.130  -7.929  18.561  1.00 30.00 ? 91  GLY A C   1 
ATOM   721  O O   . GLY A 1 91  ? 30.141  -7.441  18.056  1.00 29.20 ? 91  GLY A O   1 
ATOM   722  N N   . SER A 1 92  ? 29.134  -8.648  19.675  1.00 29.68 ? 92  SER A N   1 
ATOM   723  C CA  . SER A 1 92  ? 30.332  -8.879  20.450  1.00 29.33 ? 92  SER A CA  1 
ATOM   724  C C   . SER A 1 92  ? 30.340  -10.304 21.024  1.00 29.16 ? 92  SER A C   1 
ATOM   725  O O   . SER A 1 92  ? 29.306  -10.911 21.246  1.00 27.73 ? 92  SER A O   1 
ATOM   726  C CB  . SER A 1 92  ? 30.416  -7.838  21.575  1.00 29.72 ? 92  SER A CB  1 
ATOM   727  O OG  . SER A 1 92  ? 29.203  -7.830  22.318  1.00 28.33 ? 92  SER A OG  1 
ATOM   728  N N   . TYR A 1 93  ? 31.538  -10.819 21.262  1.00 29.56 ? 93  TYR A N   1 
ATOM   729  C CA  . TYR A 1 93  ? 31.695  -12.044 21.992  1.00 29.74 ? 93  TYR A CA  1 
ATOM   730  C C   . TYR A 1 93  ? 31.036  -11.991 23.354  1.00 30.57 ? 93  TYR A C   1 
ATOM   731  O O   . TYR A 1 93  ? 30.617  -13.025 23.905  1.00 31.01 ? 93  TYR A O   1 
ATOM   732  C CB  . TYR A 1 93  ? 33.161  -12.285 22.176  1.00 29.64 ? 93  TYR A CB  1 
ATOM   733  C CG  . TYR A 1 93  ? 33.809  -12.860 20.946  1.00 31.15 ? 93  TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 93  ? 33.047  -13.552 19.973  1.00 31.32 ? 93  TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 93  ? 35.186  -12.724 20.740  1.00 30.50 ? 93  TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 93  ? 33.651  -14.084 18.835  1.00 30.25 ? 93  TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 93  ? 35.795  -13.259 19.611  1.00 30.55 ? 93  TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 93  ? 35.022  -13.930 18.674  1.00 30.07 ? 93  TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 93  ? 35.651  -14.460 17.597  1.00 31.17 ? 93  TYR A OH  1 
ATOM   740  N N   . GLU A 1 94  ? 30.957  -10.791 23.907  1.00 31.11 ? 94  GLU A N   1 
ATOM   741  C CA  . GLU A 1 94  ? 30.345  -10.600 25.203  1.00 32.16 ? 94  GLU A CA  1 
ATOM   742  C C   . GLU A 1 94  ? 28.869  -10.921 25.172  1.00 31.16 ? 94  GLU A C   1 
ATOM   743  O O   . GLU A 1 94  ? 28.354  -11.587 26.072  1.00 31.65 ? 94  GLU A O   1 
ATOM   744  C CB  . GLU A 1 94  ? 30.598  -9.188  25.756  1.00 33.29 ? 94  GLU A CB  1 
ATOM   745  C CG  . GLU A 1 94  ? 32.080  -8.897  26.045  1.00 39.47 ? 94  GLU A CG  1 
ATOM   746  C CD  . GLU A 1 94  ? 32.720  -9.948  26.985  1.00 46.17 ? 94  GLU A CD  1 
ATOM   747  O OE1 . GLU A 1 94  ? 32.053  -10.395 27.951  1.00 45.61 ? 94  GLU A OE1 1 
ATOM   748  O OE2 . GLU A 1 94  ? 33.897  -10.322 26.747  1.00 50.86 ? 94  GLU A OE2 1 
ATOM   749  N N   . ASP A 1 95  ? 28.171  -10.485 24.141  1.00 30.56 ? 95  ASP A N   1 
ATOM   750  C CA  . ASP A 1 95  ? 26.781  -10.885 24.053  1.00 30.24 ? 95  ASP A CA  1 
ATOM   751  C C   . ASP A 1 95  ? 26.724  -12.408 24.211  1.00 29.96 ? 95  ASP A C   1 
ATOM   752  O O   . ASP A 1 95  ? 25.813  -12.936 24.858  1.00 29.32 ? 95  ASP A O   1 
ATOM   753  C CB  . ASP A 1 95  ? 26.132  -10.441 22.742  1.00 30.02 ? 95  ASP A CB  1 
ATOM   754  C CG  . ASP A 1 95  ? 26.219  -8.932  22.511  1.00 30.91 ? 95  ASP A CG  1 
ATOM   755  O OD1 . ASP A 1 95  ? 25.926  -8.150  23.434  1.00 32.52 ? 95  ASP A OD1 1 
ATOM   756  O OD2 . ASP A 1 95  ? 26.562  -8.520  21.384  1.00 31.01 ? 95  ASP A OD2 1 
ATOM   757  N N   . LEU A 1 96  ? 27.706  -13.106 23.628  1.00 29.75 ? 96  LEU A N   1 
ATOM   758  C CA  . LEU A 1 96  ? 27.674  -14.558 23.635  1.00 30.02 ? 96  LEU A CA  1 
ATOM   759  C C   . LEU A 1 96  ? 27.881  -15.042 25.058  1.00 30.35 ? 96  LEU A C   1 
ATOM   760  O O   . LEU A 1 96  ? 27.001  -15.749 25.605  1.00 29.68 ? 96  LEU A O   1 
ATOM   761  C CB  . LEU A 1 96  ? 28.718  -15.176 22.717  1.00 29.63 ? 96  LEU A CB  1 
ATOM   762  C CG  . LEU A 1 96  ? 28.335  -16.509 22.057  1.00 28.72 ? 96  LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 96  ? 29.591  -17.193 21.647  1.00 29.00 ? 96  LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 96  ? 27.509  -17.453 22.889  1.00 25.27 ? 96  LEU A CD2 1 
ATOM   765  N N   . ARG A 1 97  ? 29.022  -14.640 25.632  1.00 30.14 ? 97  ARG A N   1 
ATOM   766  C CA  . ARG A 1 97  ? 29.362  -14.968 27.012  1.00 31.41 ? 97  ARG A CA  1 
ATOM   767  C C   . ARG A 1 97  ? 28.232  -14.710 27.985  1.00 31.38 ? 97  ARG A C   1 
ATOM   768  O O   . ARG A 1 97  ? 27.915  -15.599 28.783  1.00 31.16 ? 97  ARG A O   1 
ATOM   769  C CB  . ARG A 1 97  ? 30.596  -14.224 27.505  1.00 31.39 ? 97  ARG A CB  1 
ATOM   770  C CG  . ARG A 1 97  ? 31.177  -14.866 28.760  1.00 33.41 ? 97  ARG A CG  1 
ATOM   771  C CD  . ARG A 1 97  ? 32.215  -13.941 29.431  1.00 40.42 ? 97  ARG A CD  1 
ATOM   772  N NE  . ARG A 1 97  ? 33.573  -14.057 28.866  1.00 43.36 ? 97  ARG A NE  1 
ATOM   773  C CZ  . ARG A 1 97  ? 34.457  -13.055 28.806  1.00 48.35 ? 97  ARG A CZ  1 
ATOM   774  N NH1 . ARG A 1 97  ? 34.137  -11.837 29.265  1.00 49.43 ? 97  ARG A NH1 1 
ATOM   775  N NH2 . ARG A 1 97  ? 35.665  -13.256 28.275  1.00 48.28 ? 97  ARG A NH2 1 
ATOM   776  N N   . LYS A 1 98  ? 27.636  -13.516 27.906  1.00 31.47 ? 98  LYS A N   1 
ATOM   777  C CA  . LYS A 1 98  ? 26.583  -13.117 28.832  1.00 32.37 ? 98  LYS A CA  1 
ATOM   778  C C   . LYS A 1 98  ? 25.388  -14.047 28.743  1.00 32.21 ? 98  LYS A C   1 
ATOM   779  O O   . LYS A 1 98  ? 24.970  -14.648 29.733  1.00 33.33 ? 98  LYS A O   1 
ATOM   780  C CB  . LYS A 1 98  ? 26.116  -11.671 28.593  1.00 32.71 ? 98  LYS A CB  1 
ATOM   781  C CG  . LYS A 1 98  ? 27.110  -10.611 29.006  1.00 34.03 ? 98  LYS A CG  1 
ATOM   782  C CD  . LYS A 1 98  ? 26.584  -9.172  28.769  1.00 36.84 ? 98  LYS A CD  1 
ATOM   783  C CE  . LYS A 1 98  ? 27.668  -8.148  29.108  1.00 37.41 ? 98  LYS A CE  1 
ATOM   784  N NZ  . LYS A 1 98  ? 29.064  -8.679  28.747  1.00 41.63 ? 98  LYS A NZ  1 
ATOM   785  N N   . ILE A 1 99  ? 24.841  -14.151 27.554  1.00 31.74 ? 99  ILE A N   1 
ATOM   786  C CA  . ILE A 1 99  ? 23.688  -14.984 27.284  1.00 31.97 ? 99  ILE A CA  1 
ATOM   787  C C   . ILE A 1 99  ? 23.970  -16.468 27.595  1.00 31.76 ? 99  ILE A C   1 
ATOM   788  O O   . ILE A 1 99  ? 23.102  -17.189 28.099  1.00 31.57 ? 99  ILE A O   1 
ATOM   789  C CB  . ILE A 1 99  ? 23.263  -14.807 25.790  1.00 31.80 ? 99  ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 99  ? 22.661  -13.420 25.568  1.00 32.16 ? 99  ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 99  ? 22.316  -15.900 25.351  1.00 31.62 ? 99  ILE A CG2 1 
ATOM   792  C CD1 . ILE A 1 99  ? 22.503  -13.045 24.100  1.00 33.18 ? 99  ILE A CD1 1 
ATOM   793  N N   . ALA A 1 100 ? 25.178  -16.919 27.280  1.00 32.00 ? 100 ALA A N   1 
ATOM   794  C CA  . ALA A 1 100 ? 25.554  -18.308 27.536  1.00 32.47 ? 100 ALA A CA  1 
ATOM   795  C C   . ALA A 1 100 ? 25.558  -18.632 29.036  1.00 33.08 ? 100 ALA A C   1 
ATOM   796  O O   . ALA A 1 100 ? 25.145  -19.723 29.438  1.00 33.40 ? 100 ALA A O   1 
ATOM   797  C CB  . ALA A 1 100 ? 26.896  -18.647 26.884  1.00 32.51 ? 100 ALA A CB  1 
ATOM   798  N N   . SER A 1 101 ? 25.969  -17.677 29.869  1.00 33.20 ? 101 SER A N   1 
ATOM   799  C CA  . SER A 1 101 ? 25.874  -17.879 31.321  1.00 33.54 ? 101 SER A CA  1 
ATOM   800  C C   . SER A 1 101 ? 24.483  -17.710 31.954  1.00 33.15 ? 101 SER A C   1 
ATOM   801  O O   . SER A 1 101 ? 24.341  -17.889 33.153  1.00 33.43 ? 101 SER A O   1 
ATOM   802  C CB  . SER A 1 101 ? 26.940  -17.081 32.081  1.00 33.92 ? 101 SER A CB  1 
ATOM   803  O OG  . SER A 1 101 ? 27.229  -15.845 31.458  1.00 35.75 ? 101 SER A OG  1 
ATOM   804  N N   . SER A 1 102 ? 23.453  -17.452 31.150  1.00 32.54 ? 102 SER A N   1 
ATOM   805  C CA  . SER A 1 102 ? 22.139  -17.083 31.676  1.00 31.65 ? 102 SER A CA  1 
ATOM   806  C C   . SER A 1 102 ? 21.010  -18.015 31.274  1.00 31.66 ? 102 SER A C   1 
ATOM   807  O O   . SER A 1 102 ? 19.952  -18.036 31.933  1.00 31.72 ? 102 SER A O   1 
ATOM   808  C CB  . SER A 1 102 ? 21.784  -15.663 31.239  1.00 31.89 ? 102 SER A CB  1 
ATOM   809  O OG  . SER A 1 102 ? 22.672  -14.706 31.807  1.00 33.29 ? 102 SER A OG  1 
ATOM   810  N N   . VAL A 1 103 ? 21.214  -18.764 30.184  1.00 31.04 ? 103 VAL A N   1 
ATOM   811  C CA  . VAL A 1 103 ? 20.216  -19.700 29.690  1.00 30.37 ? 103 VAL A CA  1 
ATOM   812  C C   . VAL A 1 103 ? 20.844  -21.036 29.347  1.00 30.38 ? 103 VAL A C   1 
ATOM   813  O O   . VAL A 1 103 ? 22.038  -21.148 29.162  1.00 30.18 ? 103 VAL A O   1 
ATOM   814  C CB  . VAL A 1 103 ? 19.440  -19.172 28.435  1.00 30.97 ? 103 VAL A CB  1 
ATOM   815  C CG1 . VAL A 1 103 ? 18.591  -17.917 28.784  1.00 30.72 ? 103 VAL A CG1 1 
ATOM   816  C CG2 . VAL A 1 103 ? 20.396  -18.933 27.257  1.00 29.01 ? 103 VAL A CG2 1 
ATOM   817  N N   . SER A 1 104 ? 20.026  -22.062 29.251  1.00 30.50 ? 104 SER A N   1 
ATOM   818  C CA  . SER A 1 104 ? 20.577  -23.356 28.989  1.00 30.97 ? 104 SER A CA  1 
ATOM   819  C C   . SER A 1 104 ? 19.771  -24.003 27.871  1.00 30.29 ? 104 SER A C   1 
ATOM   820  O O   . SER A 1 104 ? 19.504  -25.221 27.872  1.00 30.51 ? 104 SER A O   1 
ATOM   821  C CB  . SER A 1 104 ? 20.592  -24.192 30.286  1.00 31.44 ? 104 SER A CB  1 
ATOM   822  O OG  . SER A 1 104 ? 19.282  -24.616 30.574  1.00 31.84 ? 104 SER A OG  1 
ATOM   823  N N   . ILE A 1 105 ? 19.366  -23.165 26.926  1.00 28.81 ? 105 ILE A N   1 
ATOM   824  C CA  . ILE A 1 105 ? 18.867  -23.665 25.654  1.00 28.04 ? 105 ILE A CA  1 
ATOM   825  C C   . ILE A 1 105 ? 20.055  -23.637 24.645  1.00 27.32 ? 105 ILE A C   1 
ATOM   826  O O   . ILE A 1 105 ? 21.095  -23.026 24.940  1.00 27.23 ? 105 ILE A O   1 
ATOM   827  C CB  . ILE A 1 105 ? 17.578  -22.943 25.238  1.00 28.01 ? 105 ILE A CB  1 
ATOM   828  C CG1 . ILE A 1 105 ? 17.825  -21.454 24.993  1.00 28.71 ? 105 ILE A CG1 1 
ATOM   829  C CG2 . ILE A 1 105 ? 16.551  -23.100 26.345  1.00 28.29 ? 105 ILE A CG2 1 
ATOM   830  C CD1 . ILE A 1 105 ? 16.604  -20.681 24.461  1.00 29.42 ? 105 ILE A CD1 1 
ATOM   831  N N   . PRO A 1 106 ? 19.954  -24.337 23.498  1.00 26.36 ? 106 PRO A N   1 
ATOM   832  C CA  . PRO A 1 106 ? 21.189  -24.306 22.683  1.00 26.01 ? 106 PRO A CA  1 
ATOM   833  C C   . PRO A 1 106 ? 21.460  -22.958 21.959  1.00 26.45 ? 106 PRO A C   1 
ATOM   834  O O   . PRO A 1 106 ? 20.518  -22.270 21.532  1.00 25.29 ? 106 PRO A O   1 
ATOM   835  C CB  . PRO A 1 106 ? 21.000  -25.459 21.713  1.00 26.03 ? 106 PRO A CB  1 
ATOM   836  C CG  . PRO A 1 106 ? 19.759  -26.263 22.292  1.00 26.34 ? 106 PRO A CG  1 
ATOM   837  C CD  . PRO A 1 106 ? 18.944  -25.257 22.952  1.00 25.58 ? 106 PRO A CD  1 
ATOM   838  N N   . ILE A 1 107 ? 22.753  -22.598 21.877  1.00 27.09 ? 107 ILE A N   1 
ATOM   839  C CA  . ILE A 1 107 ? 23.241  -21.324 21.341  1.00 27.03 ? 107 ILE A CA  1 
ATOM   840  C C   . ILE A 1 107 ? 24.150  -21.554 20.152  1.00 26.60 ? 107 ILE A C   1 
ATOM   841  O O   . ILE A 1 107 ? 25.222  -22.149 20.289  1.00 25.76 ? 107 ILE A O   1 
ATOM   842  C CB  . ILE A 1 107 ? 24.161  -20.559 22.349  1.00 27.45 ? 107 ILE A CB  1 
ATOM   843  C CG1 . ILE A 1 107 ? 23.586  -20.493 23.775  1.00 28.81 ? 107 ILE A CG1 1 
ATOM   844  C CG2 . ILE A 1 107 ? 24.561  -19.154 21.801  1.00 27.01 ? 107 ILE A CG2 1 
ATOM   845  C CD1 . ILE A 1 107 ? 22.171  -20.002 23.890  1.00 30.14 ? 107 ILE A CD1 1 
ATOM   846  N N   . LEU A 1 108 ? 23.739  -21.018 19.011  1.00 26.33 ? 108 LEU A N   1 
ATOM   847  C CA  . LEU A 1 108 ? 24.587  -20.900 17.833  1.00 26.16 ? 108 LEU A CA  1 
ATOM   848  C C   . LEU A 1 108 ? 25.128  -19.486 17.710  1.00 25.59 ? 108 LEU A C   1 
ATOM   849  O O   . LEU A 1 108 ? 24.365  -18.526 17.692  1.00 25.66 ? 108 LEU A O   1 
ATOM   850  C CB  . LEU A 1 108 ? 23.800  -21.262 16.561  1.00 26.78 ? 108 LEU A CB  1 
ATOM   851  C CG  . LEU A 1 108 ? 24.512  -21.213 15.185  1.00 29.08 ? 108 LEU A CG  1 
ATOM   852  C CD1 . LEU A 1 108 ? 23.788  -22.105 14.170  1.00 27.54 ? 108 LEU A CD1 1 
ATOM   853  C CD2 . LEU A 1 108 ? 24.645  -19.763 14.633  1.00 29.44 ? 108 LEU A CD2 1 
ATOM   854  N N   . MET A 1 109 ? 26.446  -19.391 17.620  1.00 25.12 ? 109 MET A N   1 
ATOM   855  C CA  . MET A 1 109 ? 27.166  -18.190 17.285  1.00 25.28 ? 109 MET A CA  1 
ATOM   856  C C   . MET A 1 109 ? 27.198  -17.981 15.768  1.00 26.44 ? 109 MET A C   1 
ATOM   857  O O   . MET A 1 109 ? 27.679  -18.839 14.998  1.00 26.57 ? 109 MET A O   1 
ATOM   858  C CB  . MET A 1 109 ? 28.596  -18.336 17.744  1.00 25.18 ? 109 MET A CB  1 
ATOM   859  C CG  . MET A 1 109 ? 29.369  -17.063 17.689  1.00 24.54 ? 109 MET A CG  1 
ATOM   860  S SD  . MET A 1 109 ? 31.043  -17.296 18.276  1.00 26.88 ? 109 MET A SD  1 
ATOM   861  C CE  . MET A 1 109 ? 31.910  -17.080 16.691  1.00 27.22 ? 109 MET A CE  1 
ATOM   862  N N   . TRP A 1 110 ? 26.699  -16.830 15.340  1.00 26.42 ? 110 TRP A N   1 
ATOM   863  C CA  . TRP A 1 110 ? 26.669  -16.507 13.947  1.00 26.48 ? 110 TRP A CA  1 
ATOM   864  C C   . TRP A 1 110 ? 27.713  -15.412 13.681  1.00 26.75 ? 110 TRP A C   1 
ATOM   865  O O   . TRP A 1 110 ? 27.639  -14.289 14.219  1.00 27.54 ? 110 TRP A O   1 
ATOM   866  C CB  . TRP A 1 110 ? 25.254  -16.058 13.603  1.00 27.11 ? 110 TRP A CB  1 
ATOM   867  C CG  . TRP A 1 110 ? 24.838  -16.330 12.189  1.00 28.49 ? 110 TRP A CG  1 
ATOM   868  C CD1 . TRP A 1 110 ? 24.009  -17.338 11.724  1.00 30.75 ? 110 TRP A CD1 1 
ATOM   869  C CD2 . TRP A 1 110 ? 25.218  -15.576 11.058  1.00 28.38 ? 110 TRP A CD2 1 
ATOM   870  N NE1 . TRP A 1 110 ? 23.863  -17.240 10.347  1.00 30.36 ? 110 TRP A NE1 1 
ATOM   871  C CE2 . TRP A 1 110 ? 24.609  -16.170 9.921   1.00 29.43 ? 110 TRP A CE2 1 
ATOM   872  C CE3 . TRP A 1 110 ? 26.024  -14.460 10.885  1.00 26.37 ? 110 TRP A CE3 1 
ATOM   873  C CZ2 . TRP A 1 110 ? 24.789  -15.670 8.645   1.00 29.26 ? 110 TRP A CZ2 1 
ATOM   874  C CZ3 . TRP A 1 110 ? 26.192  -13.972 9.606   1.00 29.62 ? 110 TRP A CZ3 1 
ATOM   875  C CH2 . TRP A 1 110 ? 25.584  -14.575 8.508   1.00 28.20 ? 110 TRP A CH2 1 
ATOM   876  N N   . ASP A 1 111 ? 28.729  -15.754 12.900  1.00 26.07 ? 111 ASP A N   1 
ATOM   877  C CA  . ASP A 1 111 ? 29.750  -14.790 12.497  1.00 25.58 ? 111 ASP A CA  1 
ATOM   878  C C   . ASP A 1 111 ? 30.159  -15.277 11.127  1.00 25.12 ? 111 ASP A C   1 
ATOM   879  O O   . ASP A 1 111 ? 29.563  -16.221 10.620  1.00 25.70 ? 111 ASP A O   1 
ATOM   880  C CB  . ASP A 1 111 ? 30.944  -14.820 13.448  1.00 24.95 ? 111 ASP A CB  1 
ATOM   881  C CG  . ASP A 1 111 ? 31.658  -13.458 13.583  1.00 26.33 ? 111 ASP A CG  1 
ATOM   882  O OD1 . ASP A 1 111 ? 32.194  -12.878 12.576  1.00 24.00 ? 111 ASP A OD1 1 
ATOM   883  O OD2 . ASP A 1 111 ? 31.731  -12.999 14.751  1.00 25.45 ? 111 ASP A OD2 1 
ATOM   884  N N   . PHE A 1 112 ? 31.142  -14.627 10.518  1.00 24.34 ? 112 PHE A N   1 
ATOM   885  C CA  . PHE A 1 112 ? 31.690  -15.097 9.264   1.00 23.85 ? 112 PHE A CA  1 
ATOM   886  C C   . PHE A 1 112 ? 32.915  -15.865 9.633   1.00 22.51 ? 112 PHE A C   1 
ATOM   887  O O   . PHE A 1 112 ? 33.988  -15.290 9.790   1.00 22.05 ? 112 PHE A O   1 
ATOM   888  C CB  . PHE A 1 112 ? 31.991  -13.903 8.341   1.00 24.48 ? 112 PHE A CB  1 
ATOM   889  C CG  . PHE A 1 112 ? 30.745  -13.160 7.940   1.00 25.60 ? 112 PHE A CG  1 
ATOM   890  C CD1 . PHE A 1 112 ? 30.170  -13.365 6.682   1.00 25.51 ? 112 PHE A CD1 1 
ATOM   891  C CD2 . PHE A 1 112 ? 30.102  -12.325 8.846   1.00 25.22 ? 112 PHE A CD2 1 
ATOM   892  C CE1 . PHE A 1 112 ? 28.994  -12.720 6.317   1.00 25.10 ? 112 PHE A CE1 1 
ATOM   893  C CE2 . PHE A 1 112 ? 28.927  -11.680 8.492   1.00 26.64 ? 112 PHE A CE2 1 
ATOM   894  C CZ  . PHE A 1 112 ? 28.370  -11.878 7.207   1.00 26.62 ? 112 PHE A CZ  1 
ATOM   895  N N   . ILE A 1 113 ? 32.738  -17.161 9.856   1.00 21.51 ? 113 ILE A N   1 
ATOM   896  C CA  . ILE A 1 113 ? 33.820  -17.966 10.433  1.00 21.42 ? 113 ILE A CA  1 
ATOM   897  C C   . ILE A 1 113 ? 34.762  -18.374 9.322   1.00 21.69 ? 113 ILE A C   1 
ATOM   898  O O   . ILE A 1 113 ? 34.310  -18.941 8.310   1.00 20.56 ? 113 ILE A O   1 
ATOM   899  C CB  . ILE A 1 113 ? 33.268  -19.212 11.101  1.00 21.10 ? 113 ILE A CB  1 
ATOM   900  C CG1 . ILE A 1 113 ? 32.150  -18.821 12.056  1.00 22.33 ? 113 ILE A CG1 1 
ATOM   901  C CG2 . ILE A 1 113 ? 34.381  -20.028 11.739  1.00 22.60 ? 113 ILE A CG2 1 
ATOM   902  C CD1 . ILE A 1 113 ? 32.393  -19.104 13.476  1.00 24.42 ? 113 ILE A CD1 1 
ATOM   903  N N   . VAL A 1 114 ? 36.060  -18.102 9.518   1.00 22.40 ? 114 VAL A N   1 
ATOM   904  C CA  . VAL A 1 114 ? 37.095  -18.319 8.485   1.00 22.95 ? 114 VAL A CA  1 
ATOM   905  C C   . VAL A 1 114 ? 38.397  -18.951 8.993   1.00 24.57 ? 114 VAL A C   1 
ATOM   906  O O   . VAL A 1 114 ? 39.286  -19.261 8.190   1.00 24.95 ? 114 VAL A O   1 
ATOM   907  C CB  . VAL A 1 114 ? 37.462  -16.998 7.757   1.00 23.65 ? 114 VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 114 ? 36.266  -16.450 6.964   1.00 21.74 ? 114 VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 114 ? 37.997  -15.910 8.747   1.00 23.58 ? 114 VAL A CG2 1 
ATOM   910  N N   . LYS A 1 115 ? 38.535  -19.124 10.317  1.00 24.89 ? 115 LYS A N   1 
ATOM   911  C CA  . LYS A 1 115 ? 39.716  -19.788 10.868  1.00 25.04 ? 115 LYS A CA  1 
ATOM   912  C C   . LYS A 1 115 ? 39.419  -20.557 12.161  1.00 25.68 ? 115 LYS A C   1 
ATOM   913  O O   . LYS A 1 115 ? 38.538  -20.194 12.933  1.00 25.42 ? 115 LYS A O   1 
ATOM   914  C CB  . LYS A 1 115 ? 40.835  -18.779 11.081  1.00 25.00 ? 115 LYS A CB  1 
ATOM   915  C CG  . LYS A 1 115 ? 40.381  -17.595 11.870  1.00 24.91 ? 115 LYS A CG  1 
ATOM   916  C CD  . LYS A 1 115 ? 41.458  -16.579 12.039  1.00 24.84 ? 115 LYS A CD  1 
ATOM   917  C CE  . LYS A 1 115 ? 40.899  -15.473 12.919  1.00 24.81 ? 115 LYS A CE  1 
ATOM   918  N NZ  . LYS A 1 115 ? 41.934  -14.479 13.151  1.00 25.11 ? 115 LYS A NZ  1 
ATOM   919  N N   . GLU A 1 116 ? 40.157  -21.625 12.400  1.00 27.01 ? 116 GLU A N   1 
ATOM   920  C CA  . GLU A 1 116 ? 40.033  -22.343 13.684  1.00 28.72 ? 116 GLU A CA  1 
ATOM   921  C C   . GLU A 1 116 ? 39.815  -21.479 14.956  1.00 28.27 ? 116 GLU A C   1 
ATOM   922  O O   . GLU A 1 116 ? 38.902  -21.734 15.726  1.00 29.04 ? 116 GLU A O   1 
ATOM   923  C CB  . GLU A 1 116 ? 41.233  -23.272 13.855  1.00 29.28 ? 116 GLU A CB  1 
ATOM   924  C CG  . GLU A 1 116 ? 41.101  -24.555 13.016  1.00 32.42 ? 116 GLU A CG  1 
ATOM   925  C CD  . GLU A 1 116 ? 42.437  -25.146 12.650  1.00 36.20 ? 116 GLU A CD  1 
ATOM   926  O OE1 . GLU A 1 116 ? 43.456  -24.664 13.169  1.00 38.20 ? 116 GLU A OE1 1 
ATOM   927  O OE2 . GLU A 1 116 ? 42.487  -26.084 11.827  1.00 38.37 ? 116 GLU A OE2 1 
ATOM   928  N N   . SER A 1 117 ? 40.608  -20.437 15.166  1.00 27.95 ? 117 SER A N   1 
ATOM   929  C CA  . SER A 1 117 ? 40.555  -19.694 16.444  1.00 27.61 ? 117 SER A CA  1 
ATOM   930  C C   . SER A 1 117 ? 39.167  -19.104 16.793  1.00 27.17 ? 117 SER A C   1 
ATOM   931  O O   . SER A 1 117 ? 38.822  -18.935 17.987  1.00 26.59 ? 117 SER A O   1 
ATOM   932  C CB  . SER A 1 117 ? 41.598  -18.579 16.451  1.00 27.10 ? 117 SER A CB  1 
ATOM   933  O OG  . SER A 1 117 ? 41.133  -17.526 15.605  1.00 29.75 ? 117 SER A OG  1 
ATOM   934  N N   . GLN A 1 118 ? 38.399  -18.767 15.755  1.00 26.41 ? 118 GLN A N   1 
ATOM   935  C CA  . GLN A 1 118 ? 37.039  -18.270 15.905  1.00 25.90 ? 118 GLN A CA  1 
ATOM   936  C C   . GLN A 1 118 ? 36.134  -19.400 16.351  1.00 26.35 ? 118 GLN A C   1 
ATOM   937  O O   . GLN A 1 118 ? 35.065  -19.157 16.926  1.00 26.65 ? 118 GLN A O   1 
ATOM   938  C CB  . GLN A 1 118 ? 36.508  -17.778 14.573  1.00 25.60 ? 118 GLN A CB  1 
ATOM   939  C CG  . GLN A 1 118 ? 36.857  -16.381 14.190  1.00 26.32 ? 118 GLN A CG  1 
ATOM   940  C CD  . GLN A 1 118 ? 36.498  -16.128 12.754  1.00 27.53 ? 118 GLN A CD  1 
ATOM   941  O OE1 . GLN A 1 118 ? 35.593  -15.326 12.436  1.00 26.18 ? 118 GLN A OE1 1 
ATOM   942  N NE2 . GLN A 1 118 ? 37.163  -16.847 11.865  1.00 27.64 ? 118 GLN A NE2 1 
ATOM   943  N N   . ILE A 1 119 ? 36.518  -20.635 16.029  1.00 26.04 ? 119 ILE A N   1 
ATOM   944  C CA  . ILE A 1 119 ? 35.819  -21.805 16.564  1.00 25.93 ? 119 ILE A CA  1 
ATOM   945  C C   . ILE A 1 119 ? 36.213  -22.032 18.069  1.00 25.55 ? 119 ILE A C   1 
ATOM   946  O O   . ILE A 1 119 ? 35.318  -22.273 18.931  1.00 24.40 ? 119 ILE A O   1 
ATOM   947  C CB  . ILE A 1 119 ? 35.972  -23.063 15.629  1.00 26.37 ? 119 ILE A CB  1 
ATOM   948  C CG1 . ILE A 1 119 ? 35.158  -22.836 14.334  1.00 27.82 ? 119 ILE A CG1 1 
ATOM   949  C CG2 . ILE A 1 119 ? 35.510  -24.368 16.320  1.00 25.48 ? 119 ILE A CG2 1 
ATOM   950  C CD1 . ILE A 1 119 ? 35.248  -23.946 13.282  1.00 27.23 ? 119 ILE A CD1 1 
ATOM   951  N N   . ASP A 1 120 ? 37.513  -21.912 18.373  1.00 24.13 ? 120 ASP A N   1 
ATOM   952  C CA  . ASP A 1 120 ? 37.978  -21.876 19.779  1.00 23.92 ? 120 ASP A CA  1 
ATOM   953  C C   . ASP A 1 120 ? 37.195  -20.864 20.601  1.00 23.89 ? 120 ASP A C   1 
ATOM   954  O O   . ASP A 1 120 ? 36.769  -21.180 21.729  1.00 23.37 ? 120 ASP A O   1 
ATOM   955  C CB  . ASP A 1 120 ? 39.448  -21.487 19.905  1.00 23.54 ? 120 ASP A CB  1 
ATOM   956  C CG  . ASP A 1 120 ? 40.374  -22.408 19.191  1.00 25.07 ? 120 ASP A CG  1 
ATOM   957  O OD1 . ASP A 1 120 ? 40.097  -23.641 19.063  1.00 26.25 ? 120 ASP A OD1 1 
ATOM   958  O OD2 . ASP A 1 120 ? 41.422  -21.884 18.779  1.00 26.83 ? 120 ASP A OD2 1 
ATOM   959  N N   . ASP A 1 121 ? 36.993  -19.659 20.045  1.00 23.69 ? 121 ASP A N   1 
ATOM   960  C CA  . ASP A 1 121 ? 36.224  -18.638 20.780  1.00 24.34 ? 121 ASP A CA  1 
ATOM   961  C C   . ASP A 1 121 ? 34.790  -19.096 21.049  1.00 24.37 ? 121 ASP A C   1 
ATOM   962  O O   . ASP A 1 121 ? 34.305  -18.980 22.173  1.00 24.76 ? 121 ASP A O   1 
ATOM   963  C CB  . ASP A 1 121 ? 36.178  -17.286 20.067  1.00 24.65 ? 121 ASP A CB  1 
ATOM   964  C CG  . ASP A 1 121 ? 37.563  -16.727 19.701  1.00 26.22 ? 121 ASP A CG  1 
ATOM   965  O OD1 . ASP A 1 121 ? 38.605  -17.092 20.328  1.00 28.82 ? 121 ASP A OD1 1 
ATOM   966  O OD2 . ASP A 1 121 ? 37.580  -15.914 18.741  1.00 26.40 ? 121 ASP A OD2 1 
ATOM   967  N N   . ALA A 1 122 ? 34.110  -19.629 20.035  1.00 24.01 ? 122 ALA A N   1 
ATOM   968  C CA  . ALA A 1 122 ? 32.747  -20.135 20.247  1.00 23.96 ? 122 ALA A CA  1 
ATOM   969  C C   . ALA A 1 122 ? 32.715  -21.091 21.416  1.00 24.39 ? 122 ALA A C   1 
ATOM   970  O O   . ALA A 1 122 ? 31.802  -21.047 22.260  1.00 23.67 ? 122 ALA A O   1 
ATOM   971  C CB  . ALA A 1 122 ? 32.219  -20.841 19.023  1.00 23.62 ? 122 ALA A CB  1 
ATOM   972  N N   . TYR A 1 123 ? 33.721  -21.957 21.445  1.00 24.86 ? 123 TYR A N   1 
ATOM   973  C CA  . TYR A 1 123 ? 33.711  -23.055 22.363  1.00 25.99 ? 123 TYR A CA  1 
ATOM   974  C C   . TYR A 1 123 ? 33.949  -22.474 23.741  1.00 25.99 ? 123 TYR A C   1 
ATOM   975  O O   . TYR A 1 123 ? 33.204  -22.734 24.682  1.00 25.29 ? 123 TYR A O   1 
ATOM   976  C CB  . TYR A 1 123 ? 34.807  -24.062 22.036  1.00 26.22 ? 123 TYR A CB  1 
ATOM   977  C CG  . TYR A 1 123 ? 34.809  -25.193 23.016  1.00 28.14 ? 123 TYR A CG  1 
ATOM   978  C CD1 . TYR A 1 123 ? 33.814  -26.173 22.951  1.00 28.57 ? 123 TYR A CD1 1 
ATOM   979  C CD2 . TYR A 1 123 ? 35.765  -25.271 24.047  1.00 27.64 ? 123 TYR A CD2 1 
ATOM   980  C CE1 . TYR A 1 123 ? 33.770  -27.214 23.860  1.00 26.08 ? 123 TYR A CE1 1 
ATOM   981  C CE2 . TYR A 1 123 ? 35.737  -26.342 24.971  1.00 27.60 ? 123 TYR A CE2 1 
ATOM   982  C CZ  . TYR A 1 123 ? 34.729  -27.305 24.866  1.00 26.60 ? 123 TYR A CZ  1 
ATOM   983  O OH  . TYR A 1 123 ? 34.650  -28.385 25.734  1.00 23.45 ? 123 TYR A OH  1 
ATOM   984  N N   . ASN A 1 124 ? 34.979  -21.650 23.807  1.00 26.27 ? 124 ASN A N   1 
ATOM   985  C CA  . ASN A 1 124 ? 35.442  -21.100 25.041  1.00 26.47 ? 124 ASN A CA  1 
ATOM   986  C C   . ASN A 1 124 ? 34.400  -20.181 25.689  1.00 26.82 ? 124 ASN A C   1 
ATOM   987  O O   . ASN A 1 124 ? 34.362  -20.028 26.929  1.00 26.71 ? 124 ASN A O   1 
ATOM   988  C CB  . ASN A 1 124 ? 36.803  -20.452 24.819  1.00 26.39 ? 124 ASN A CB  1 
ATOM   989  C CG  . ASN A 1 124 ? 37.896  -21.496 24.615  1.00 26.61 ? 124 ASN A CG  1 
ATOM   990  O OD1 . ASN A 1 124 ? 39.033  -21.171 24.277  1.00 28.89 ? 124 ASN A OD1 1 
ATOM   991  N ND2 . ASN A 1 124 ? 37.554  -22.755 24.839  1.00 25.89 ? 124 ASN A ND2 1 
ATOM   992  N N   . LEU A 1 125 ? 33.504  -19.658 24.851  1.00 26.29 ? 125 LEU A N   1 
ATOM   993  C CA  . LEU A 1 125 ? 32.515  -18.676 25.290  1.00 25.71 ? 125 LEU A CA  1 
ATOM   994  C C   . LEU A 1 125 ? 31.177  -19.276 25.672  1.00 24.67 ? 125 LEU A C   1 
ATOM   995  O O   . LEU A 1 125 ? 30.365  -18.622 26.313  1.00 24.08 ? 125 LEU A O   1 
ATOM   996  C CB  . LEU A 1 125 ? 32.310  -17.631 24.208  1.00 26.06 ? 125 LEU A CB  1 
ATOM   997  C CG  . LEU A 1 125 ? 33.427  -16.600 24.095  1.00 26.27 ? 125 LEU A CG  1 
ATOM   998  C CD1 . LEU A 1 125 ? 33.359  -15.925 22.707  1.00 24.83 ? 125 LEU A CD1 1 
ATOM   999  C CD2 . LEU A 1 125 ? 33.256  -15.602 25.223  1.00 23.39 ? 125 LEU A CD2 1 
ATOM   1000 N N   . GLY A 1 126 ? 30.945  -20.511 25.256  1.00 24.58 ? 126 GLY A N   1 
ATOM   1001 C CA  . GLY A 1 126 ? 29.734  -21.238 25.648  1.00 24.88 ? 126 GLY A CA  1 
ATOM   1002 C C   . GLY A 1 126 ? 28.815  -21.620 24.505  1.00 25.28 ? 126 GLY A C   1 
ATOM   1003 O O   . GLY A 1 126 ? 27.857  -22.349 24.719  1.00 26.01 ? 126 GLY A O   1 
ATOM   1004 N N   . ALA A 1 127 ? 29.089  -21.129 23.295  1.00 25.34 ? 127 ALA A N   1 
ATOM   1005 C CA  . ALA A 1 127 ? 28.261  -21.472 22.121  1.00 25.39 ? 127 ALA A CA  1 
ATOM   1006 C C   . ALA A 1 127 ? 28.122  -22.979 21.974  1.00 25.53 ? 127 ALA A C   1 
ATOM   1007 O O   . ALA A 1 127 ? 29.130  -23.704 22.068  1.00 26.05 ? 127 ALA A O   1 
ATOM   1008 C CB  . ALA A 1 127 ? 28.852  -20.884 20.851  1.00 23.85 ? 127 ALA A CB  1 
ATOM   1009 N N   . ASP A 1 128 ? 26.904  -23.465 21.747  1.00 25.13 ? 128 ASP A N   1 
ATOM   1010 C CA  . ASP A 1 128 ? 26.740  -24.909 21.502  1.00 25.80 ? 128 ASP A CA  1 
ATOM   1011 C C   . ASP A 1 128 ? 27.170  -25.329 20.100  1.00 26.99 ? 128 ASP A C   1 
ATOM   1012 O O   . ASP A 1 128 ? 27.612  -26.475 19.898  1.00 27.57 ? 128 ASP A O   1 
ATOM   1013 C CB  . ASP A 1 128 ? 25.332  -25.389 21.803  1.00 24.85 ? 128 ASP A CB  1 
ATOM   1014 C CG  . ASP A 1 128 ? 24.900  -25.016 23.197  1.00 24.60 ? 128 ASP A CG  1 
ATOM   1015 O OD1 . ASP A 1 128 ? 25.460  -25.545 24.170  1.00 24.98 ? 128 ASP A OD1 1 
ATOM   1016 O OD2 . ASP A 1 128 ? 24.009  -24.167 23.318  1.00 23.03 ? 128 ASP A OD2 1 
ATOM   1017 N N   . THR A 1 129 ? 27.074  -24.391 19.146  1.00 27.02 ? 129 THR A N   1 
ATOM   1018 C CA  . THR A 1 129 ? 27.514  -24.636 17.771  1.00 25.92 ? 129 THR A CA  1 
ATOM   1019 C C   . THR A 1 129 ? 27.764  -23.335 16.981  1.00 25.40 ? 129 THR A C   1 
ATOM   1020 O O   . THR A 1 129 ? 27.622  -22.248 17.520  1.00 24.25 ? 129 THR A O   1 
ATOM   1021 C CB  . THR A 1 129 ? 26.500  -25.537 17.022  1.00 25.82 ? 129 THR A CB  1 
ATOM   1022 O OG1 . THR A 1 129 ? 27.044  -25.834 15.742  1.00 26.85 ? 129 THR A OG1 1 
ATOM   1023 C CG2 . THR A 1 129 ? 25.158  -24.850 16.809  1.00 24.24 ? 129 THR A CG2 1 
ATOM   1024 N N   . VAL A 1 130 ? 28.125  -23.465 15.703  1.00 25.50 ? 130 VAL A N   1 
ATOM   1025 C CA  . VAL A 1 130 ? 28.409  -22.315 14.833  1.00 25.75 ? 130 VAL A CA  1 
ATOM   1026 C C   . VAL A 1 130 ? 27.774  -22.446 13.445  1.00 26.33 ? 130 VAL A C   1 
ATOM   1027 O O   . VAL A 1 130 ? 27.354  -23.532 13.044  1.00 26.30 ? 130 VAL A O   1 
ATOM   1028 C CB  . VAL A 1 130 ? 29.938  -22.033 14.688  1.00 25.67 ? 130 VAL A CB  1 
ATOM   1029 C CG1 . VAL A 1 130 ? 30.554  -21.608 16.033  1.00 25.47 ? 130 VAL A CG1 1 
ATOM   1030 C CG2 . VAL A 1 130 ? 30.688  -23.241 14.108  1.00 24.20 ? 130 VAL A CG2 1 
ATOM   1031 N N   . GLY A 1 131 ? 27.691  -21.314 12.742  1.00 27.07 ? 131 GLY A N   1 
ATOM   1032 C CA  . GLY A 1 131 ? 27.267  -21.237 11.354  1.00 26.87 ? 131 GLY A CA  1 
ATOM   1033 C C   . GLY A 1 131 ? 28.497  -21.262 10.459  1.00 27.47 ? 131 GLY A C   1 
ATOM   1034 O O   . GLY A 1 131 ? 29.418  -20.420 10.588  1.00 28.64 ? 131 GLY A O   1 
ATOM   1035 N N   . LEU A 1 132 ? 28.538  -22.241 9.564   1.00 26.72 ? 132 LEU A N   1 
ATOM   1036 C CA  . LEU A 1 132 ? 29.541  -22.254 8.507   1.00 26.40 ? 132 LEU A CA  1 
ATOM   1037 C C   . LEU A 1 132 ? 28.916  -21.846 7.183   1.00 26.17 ? 132 LEU A C   1 
ATOM   1038 O O   . LEU A 1 132 ? 27.920  -22.470 6.719   1.00 26.09 ? 132 LEU A O   1 
ATOM   1039 C CB  . LEU A 1 132 ? 30.213  -23.619 8.401   1.00 26.05 ? 132 LEU A CB  1 
ATOM   1040 C CG  . LEU A 1 132 ? 31.085  -24.013 9.589   1.00 25.51 ? 132 LEU A CG  1 
ATOM   1041 C CD1 . LEU A 1 132 ? 31.835  -25.309 9.251   1.00 25.80 ? 132 LEU A CD1 1 
ATOM   1042 C CD2 . LEU A 1 132 ? 32.052  -22.918 9.947   1.00 22.90 ? 132 LEU A CD2 1 
ATOM   1043 N N   . ILE A 1 133 ? 29.488  -20.797 6.592   1.00 25.53 ? 133 ILE A N   1 
ATOM   1044 C CA  . ILE A 1 133 ? 28.927  -20.171 5.384   1.00 25.51 ? 133 ILE A CA  1 
ATOM   1045 C C   . ILE A 1 133 ? 29.623  -20.626 4.108   1.00 26.23 ? 133 ILE A C   1 
ATOM   1046 O O   . ILE A 1 133 ? 30.794  -20.317 3.887   1.00 27.24 ? 133 ILE A O   1 
ATOM   1047 C CB  . ILE A 1 133 ? 28.965  -18.616 5.510   1.00 25.92 ? 133 ILE A CB  1 
ATOM   1048 C CG1 . ILE A 1 133 ? 28.115  -18.151 6.705   1.00 22.51 ? 133 ILE A CG1 1 
ATOM   1049 C CG2 . ILE A 1 133 ? 28.529  -17.909 4.189   1.00 25.55 ? 133 ILE A CG2 1 
ATOM   1050 C CD1 . ILE A 1 133 ? 28.462  -16.767 7.129   1.00 18.23 ? 133 ILE A CD1 1 
ATOM   1051 N N   . VAL A 1 134 ? 28.906  -21.360 3.263   1.00 27.46 ? 134 VAL A N   1 
ATOM   1052 C CA  . VAL A 1 134 ? 29.482  -21.907 2.031   1.00 27.75 ? 134 VAL A CA  1 
ATOM   1053 C C   . VAL A 1 134 ? 30.007  -20.812 1.118   1.00 28.88 ? 134 VAL A C   1 
ATOM   1054 O O   . VAL A 1 134 ? 31.134  -20.917 0.651   1.00 30.76 ? 134 VAL A O   1 
ATOM   1055 C CB  . VAL A 1 134 ? 28.479  -22.784 1.249   1.00 27.82 ? 134 VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 134 ? 29.120  -23.350 -0.033  1.00 26.41 ? 134 VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 134 ? 27.956  -23.889 2.116   1.00 26.55 ? 134 VAL A CG2 1 
ATOM   1058 N N   . LYS A 1 135 ? 29.213  -19.769 0.881   1.00 29.32 ? 135 LYS A N   1 
ATOM   1059 C CA  . LYS A 1 135 ? 29.552  -18.680 -0.057  1.00 30.48 ? 135 LYS A CA  1 
ATOM   1060 C C   . LYS A 1 135 ? 30.905  -18.036 0.219   1.00 30.13 ? 135 LYS A C   1 
ATOM   1061 O O   . LYS A 1 135 ? 31.385  -17.231 -0.573  1.00 30.67 ? 135 LYS A O   1 
ATOM   1062 C CB  . LYS A 1 135 ? 28.487  -17.575 -0.032  1.00 30.90 ? 135 LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 135 ? 27.263  -17.821 -0.940  1.00 34.10 ? 135 LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 135 ? 27.168  -16.815 -2.089  1.00 36.20 ? 135 LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 135 ? 25.781  -16.877 -2.782  1.00 38.39 ? 135 LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 135 ? 25.414  -18.253 -3.264  1.00 38.87 ? 135 LYS A NZ  1 
ATOM   1067 N N   . ILE A 1 136 ? 31.522  -18.434 1.317   1.00 29.15 ? 136 ILE A N   1 
ATOM   1068 C CA  . ILE A 1 136 ? 32.620  -17.705 1.911   1.00 28.94 ? 136 ILE A CA  1 
ATOM   1069 C C   . ILE A 1 136 ? 33.855  -18.597 1.940   1.00 29.36 ? 136 ILE A C   1 
ATOM   1070 O O   . ILE A 1 136 ? 34.976  -18.117 1.868   1.00 28.25 ? 136 ILE A O   1 
ATOM   1071 C CB  . ILE A 1 136 ? 32.136  -17.120 3.338   1.00 29.46 ? 136 ILE A CB  1 
ATOM   1072 C CG1 . ILE A 1 136 ? 31.629  -15.709 3.160   1.00 27.93 ? 136 ILE A CG1 1 
ATOM   1073 C CG2 . ILE A 1 136 ? 33.172  -17.130 4.457   1.00 25.88 ? 136 ILE A CG2 1 
ATOM   1074 C CD1 . ILE A 1 136 ? 30.898  -15.539 1.935   1.00 29.78 ? 136 ILE A CD1 1 
ATOM   1075 N N   . LEU A 1 137 ? 33.632  -19.909 1.972   1.00 30.09 ? 137 LEU A N   1 
ATOM   1076 C CA  . LEU A 1 137 ? 34.727  -20.848 2.148   1.00 31.07 ? 137 LEU A CA  1 
ATOM   1077 C C   . LEU A 1 137 ? 34.952  -21.710 0.933   1.00 31.98 ? 137 LEU A C   1 
ATOM   1078 O O   . LEU A 1 137 ? 33.983  -22.092 0.246   1.00 33.01 ? 137 LEU A O   1 
ATOM   1079 C CB  . LEU A 1 137 ? 34.455  -21.765 3.352   1.00 30.69 ? 137 LEU A CB  1 
ATOM   1080 C CG  . LEU A 1 137 ? 34.256  -21.108 4.731   1.00 31.33 ? 137 LEU A CG  1 
ATOM   1081 C CD1 . LEU A 1 137 ? 33.784  -22.155 5.711   1.00 31.18 ? 137 LEU A CD1 1 
ATOM   1082 C CD2 . LEU A 1 137 ? 35.535  -20.415 5.258   1.00 30.42 ? 137 LEU A CD2 1 
ATOM   1083 N N   . THR A 1 138 ? 36.222  -22.052 0.694   1.00 32.25 ? 138 THR A N   1 
ATOM   1084 C CA  . THR A 1 138 ? 36.564  -23.146 -0.221  1.00 32.50 ? 138 THR A CA  1 
ATOM   1085 C C   . THR A 1 138 ? 35.939  -24.404 0.341   1.00 33.16 ? 138 THR A C   1 
ATOM   1086 O O   . THR A 1 138 ? 35.649  -24.484 1.533   1.00 33.62 ? 138 THR A O   1 
ATOM   1087 C CB  . THR A 1 138 ? 38.113  -23.324 -0.434  1.00 32.27 ? 138 THR A CB  1 
ATOM   1088 O OG1 . THR A 1 138 ? 38.770  -23.738 0.777   1.00 32.90 ? 138 THR A OG1 1 
ATOM   1089 C CG2 . THR A 1 138 ? 38.767  -22.011 -0.922  1.00 31.86 ? 138 THR A CG2 1 
ATOM   1090 N N   . GLU A 1 139 ? 35.687  -25.371 -0.524  1.00 34.10 ? 139 GLU A N   1 
ATOM   1091 C CA  . GLU A 1 139 ? 35.347  -26.725 -0.115  1.00 34.45 ? 139 GLU A CA  1 
ATOM   1092 C C   . GLU A 1 139 ? 36.311  -27.205 0.971   1.00 34.34 ? 139 GLU A C   1 
ATOM   1093 O O   . GLU A 1 139 ? 35.901  -27.845 1.943   1.00 34.48 ? 139 GLU A O   1 
ATOM   1094 C CB  . GLU A 1 139 ? 35.507  -27.624 -1.323  1.00 35.30 ? 139 GLU A CB  1 
ATOM   1095 C CG  . GLU A 1 139 ? 34.547  -28.806 -1.428  1.00 38.70 ? 139 GLU A CG  1 
ATOM   1096 C CD  . GLU A 1 139 ? 34.348  -29.258 -2.882  1.00 42.27 ? 139 GLU A CD  1 
ATOM   1097 O OE1 . GLU A 1 139 ? 34.643  -28.459 -3.824  1.00 42.43 ? 139 GLU A OE1 1 
ATOM   1098 O OE2 . GLU A 1 139 ? 33.885  -30.408 -3.075  1.00 43.25 ? 139 GLU A OE2 1 
ATOM   1099 N N   . ARG A 1 140 ? 37.596  -26.884 0.813   1.00 33.62 ? 140 ARG A N   1 
ATOM   1100 C CA  . ARG A 1 140 ? 38.606  -27.431 1.701   1.00 33.17 ? 140 ARG A CA  1 
ATOM   1101 C C   . ARG A 1 140 ? 38.446  -26.867 3.114   1.00 32.94 ? 140 ARG A C   1 
ATOM   1102 O O   . ARG A 1 140 ? 38.362  -27.624 4.099   1.00 32.13 ? 140 ARG A O   1 
ATOM   1103 C CB  . ARG A 1 140 ? 40.012  -27.155 1.177   1.00 33.03 ? 140 ARG A CB  1 
ATOM   1104 C CG  . ARG A 1 140 ? 41.077  -27.939 1.923   1.00 33.36 ? 140 ARG A CG  1 
ATOM   1105 C CD  . ARG A 1 140 ? 42.445  -27.593 1.414   1.00 36.61 ? 140 ARG A CD  1 
ATOM   1106 N NE  . ARG A 1 140 ? 43.458  -28.203 2.259   1.00 40.86 ? 140 ARG A NE  1 
ATOM   1107 C CZ  . ARG A 1 140 ? 44.738  -28.358 1.928   1.00 42.41 ? 140 ARG A CZ  1 
ATOM   1108 N NH1 . ARG A 1 140 ? 45.188  -27.954 0.739   1.00 40.53 ? 140 ARG A NH1 1 
ATOM   1109 N NH2 . ARG A 1 140 ? 45.565  -28.939 2.797   1.00 43.16 ? 140 ARG A NH2 1 
ATOM   1110 N N   . GLU A 1 141 ? 38.405  -25.539 3.175   1.00 32.00 ? 141 GLU A N   1 
ATOM   1111 C CA  . GLU A 1 141 ? 38.262  -24.799 4.413   1.00 31.89 ? 141 GLU A CA  1 
ATOM   1112 C C   . GLU A 1 141 ? 37.003  -25.177 5.156   1.00 31.34 ? 141 GLU A C   1 
ATOM   1113 O O   . GLU A 1 141 ? 37.019  -25.388 6.371   1.00 32.14 ? 141 GLU A O   1 
ATOM   1114 C CB  . GLU A 1 141 ? 38.247  -23.303 4.116   1.00 32.19 ? 141 GLU A CB  1 
ATOM   1115 C CG  . GLU A 1 141 ? 39.504  -22.783 3.467   1.00 30.52 ? 141 GLU A CG  1 
ATOM   1116 C CD  . GLU A 1 141 ? 39.272  -21.394 2.957   1.00 32.33 ? 141 GLU A CD  1 
ATOM   1117 O OE1 . GLU A 1 141 ? 38.157  -21.179 2.447   1.00 31.68 ? 141 GLU A OE1 1 
ATOM   1118 O OE2 . GLU A 1 141 ? 40.170  -20.522 3.073   1.00 30.67 ? 141 GLU A OE2 1 
ATOM   1119 N N   . LEU A 1 142 ? 35.923  -25.280 4.400   1.00 30.62 ? 142 LEU A N   1 
ATOM   1120 C CA  . LEU A 1 142 ? 34.610  -25.681 4.892   1.00 30.08 ? 142 LEU A CA  1 
ATOM   1121 C C   . LEU A 1 142 ? 34.606  -27.080 5.500   1.00 29.68 ? 142 LEU A C   1 
ATOM   1122 O O   . LEU A 1 142 ? 33.924  -27.343 6.472   1.00 29.37 ? 142 LEU A O   1 
ATOM   1123 C CB  . LEU A 1 142 ? 33.619  -25.649 3.719   1.00 30.09 ? 142 LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 142 ? 32.169  -25.244 3.922   1.00 29.93 ? 142 LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 142 ? 31.349  -25.991 2.924   1.00 30.57 ? 142 LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 142 ? 31.673  -25.594 5.303   1.00 32.21 ? 142 LEU A CD2 1 
ATOM   1127 N N   . GLU A 1 143 ? 35.348  -27.986 4.885   1.00 29.29 ? 143 GLU A N   1 
ATOM   1128 C CA  . GLU A 1 143 ? 35.464  -29.336 5.378   1.00 28.71 ? 143 GLU A CA  1 
ATOM   1129 C C   . GLU A 1 143 ? 36.366  -29.316 6.608   1.00 27.79 ? 143 GLU A C   1 
ATOM   1130 O O   . GLU A 1 143 ? 36.160  -30.043 7.575   1.00 27.46 ? 143 GLU A O   1 
ATOM   1131 C CB  . GLU A 1 143 ? 36.051  -30.215 4.268   1.00 28.56 ? 143 GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 143 ? 35.787  -31.669 4.453   1.00 30.82 ? 143 GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 143 ? 36.562  -32.229 5.623   1.00 35.35 ? 143 GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 143 ? 37.774  -31.897 5.757   1.00 35.86 ? 143 GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 143 ? 35.935  -32.953 6.443   1.00 37.89 ? 143 GLU A OE2 1 
ATOM   1136 N N   . SER A 1 144 ? 37.367  -28.459 6.558   1.00 27.70 ? 144 SER A N   1 
ATOM   1137 C CA  . SER A 1 144 ? 38.417  -28.414 7.560   1.00 27.92 ? 144 SER A CA  1 
ATOM   1138 C C   . SER A 1 144 ? 37.882  -27.890 8.902   1.00 28.12 ? 144 SER A C   1 
ATOM   1139 O O   . SER A 1 144 ? 38.256  -28.371 9.966   1.00 27.91 ? 144 SER A O   1 
ATOM   1140 C CB  . SER A 1 144 ? 39.531  -27.515 7.045   1.00 27.85 ? 144 SER A CB  1 
ATOM   1141 O OG  . SER A 1 144 ? 40.779  -27.877 7.574   1.00 28.25 ? 144 SER A OG  1 
ATOM   1142 N N   . LEU A 1 145 ? 36.986  -26.909 8.820   1.00 27.99 ? 145 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 145 ? 36.473  -26.226 9.983   1.00 27.63 ? 145 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 145 ? 35.291  -26.985 10.509  1.00 27.58 ? 145 LEU A C   1 
ATOM   1145 O O   . LEU A 1 145 ? 34.941  -26.868 11.669  1.00 28.09 ? 145 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 145 ? 36.040  -24.821 9.593   1.00 27.35 ? 145 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 145 ? 37.177  -23.837 9.311   1.00 27.54 ? 145 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 145 ? 36.614  -22.588 8.637   1.00 27.41 ? 145 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 145 ? 37.977  -23.478 10.553  1.00 24.23 ? 145 LEU A CD2 1 
ATOM   1150 N N   . LEU A 1 146 ? 34.658  -27.759 9.646   1.00 27.51 ? 146 LEU A N   1 
ATOM   1151 C CA  . LEU A 1 146 ? 33.566  -28.596 10.086  1.00 27.96 ? 146 LEU A CA  1 
ATOM   1152 C C   . LEU A 1 146 ? 34.100  -29.754 10.948  1.00 28.18 ? 146 LEU A C   1 
ATOM   1153 O O   . LEU A 1 146 ? 33.507  -30.098 11.962  1.00 28.39 ? 146 LEU A O   1 
ATOM   1154 C CB  . LEU A 1 146 ? 32.757  -29.097 8.903   1.00 26.81 ? 146 LEU A CB  1 
ATOM   1155 C CG  . LEU A 1 146 ? 31.788  -30.189 9.325   1.00 29.13 ? 146 LEU A CG  1 
ATOM   1156 C CD1 . LEU A 1 146 ? 30.505  -29.604 9.933   1.00 28.84 ? 146 LEU A CD1 1 
ATOM   1157 C CD2 . LEU A 1 146 ? 31.489  -31.129 8.163   1.00 31.23 ? 146 LEU A CD2 1 
ATOM   1158 N N   . GLU A 1 147 ? 35.219  -30.338 10.529  1.00 28.27 ? 147 GLU A N   1 
ATOM   1159 C CA  . GLU A 1 147 ? 35.889  -31.387 11.276  1.00 28.73 ? 147 GLU A CA  1 
ATOM   1160 C C   . GLU A 1 147 ? 36.312  -30.790 12.624  1.00 28.91 ? 147 GLU A C   1 
ATOM   1161 O O   . GLU A 1 147 ? 36.145  -31.415 13.671  1.00 29.35 ? 147 GLU A O   1 
ATOM   1162 C CB  . GLU A 1 147 ? 37.130  -31.856 10.484  1.00 28.93 ? 147 GLU A CB  1 
ATOM   1163 C CG  . GLU A 1 147 ? 37.364  -33.348 10.353  1.00 28.66 ? 147 GLU A CG  1 
ATOM   1164 C CD  . GLU A 1 147 ? 38.536  -33.681 9.383   1.00 32.63 ? 147 GLU A CD  1 
ATOM   1165 O OE1 . GLU A 1 147 ? 39.637  -34.080 9.869   1.00 31.40 ? 147 GLU A OE1 1 
ATOM   1166 O OE2 . GLU A 1 147 ? 38.354  -33.533 8.128   1.00 30.96 ? 147 GLU A OE2 1 
ATOM   1167 N N   . TYR A 1 148 ? 36.854  -29.575 12.580  1.00 28.48 ? 148 TYR A N   1 
ATOM   1168 C CA  . TYR A 1 148 ? 37.415  -28.932 13.753  1.00 28.53 ? 148 TYR A CA  1 
ATOM   1169 C C   . TYR A 1 148 ? 36.343  -28.624 14.776  1.00 27.78 ? 148 TYR A C   1 
ATOM   1170 O O   . TYR A 1 148 ? 36.561  -28.824 15.981  1.00 27.87 ? 148 TYR A O   1 
ATOM   1171 C CB  . TYR A 1 148 ? 38.155  -27.647 13.377  1.00 28.96 ? 148 TYR A CB  1 
ATOM   1172 C CG  . TYR A 1 148 ? 39.001  -27.071 14.491  1.00 30.74 ? 148 TYR A CG  1 
ATOM   1173 C CD1 . TYR A 1 148 ? 40.278  -27.579 14.758  1.00 34.07 ? 148 TYR A CD1 1 
ATOM   1174 C CD2 . TYR A 1 148 ? 38.546  -26.007 15.266  1.00 32.30 ? 148 TYR A CD2 1 
ATOM   1175 C CE1 . TYR A 1 148 ? 41.092  -27.048 15.774  1.00 33.68 ? 148 TYR A CE1 1 
ATOM   1176 C CE2 . TYR A 1 148 ? 39.354  -25.456 16.285  1.00 33.89 ? 148 TYR A CE2 1 
ATOM   1177 C CZ  . TYR A 1 148 ? 40.628  -25.987 16.528  1.00 34.55 ? 148 TYR A CZ  1 
ATOM   1178 O OH  . TYR A 1 148 ? 41.431  -25.458 17.527  1.00 34.69 ? 148 TYR A OH  1 
ATOM   1179 N N   . ALA A 1 149 ? 35.198  -28.139 14.300  1.00 26.53 ? 149 ALA A N   1 
ATOM   1180 C CA  . ALA A 1 149 ? 34.070  -27.894 15.181  1.00 26.48 ? 149 ALA A CA  1 
ATOM   1181 C C   . ALA A 1 149 ? 33.621  -29.200 15.839  1.00 27.12 ? 149 ALA A C   1 
ATOM   1182 O O   . ALA A 1 149 ? 33.197  -29.218 17.015  1.00 26.63 ? 149 ALA A O   1 
ATOM   1183 C CB  . ALA A 1 149 ? 32.939  -27.279 14.430  1.00 26.31 ? 149 ALA A CB  1 
ATOM   1184 N N   . ARG A 1 150 ? 33.747  -30.300 15.087  1.00 27.26 ? 150 ARG A N   1 
ATOM   1185 C CA  . ARG A 1 150 ? 33.332  -31.613 15.601  1.00 27.48 ? 150 ARG A CA  1 
ATOM   1186 C C   . ARG A 1 150 ? 34.299  -32.162 16.644  1.00 27.61 ? 150 ARG A C   1 
ATOM   1187 O O   . ARG A 1 150 ? 33.905  -32.958 17.459  1.00 26.79 ? 150 ARG A O   1 
ATOM   1188 C CB  . ARG A 1 150 ? 33.050  -32.619 14.475  1.00 27.09 ? 150 ARG A CB  1 
ATOM   1189 C CG  . ARG A 1 150 ? 31.783  -32.289 13.648  1.00 24.78 ? 150 ARG A CG  1 
ATOM   1190 C CD  . ARG A 1 150 ? 31.464  -33.448 12.708  1.00 24.82 ? 150 ARG A CD  1 
ATOM   1191 N NE  . ARG A 1 150 ? 30.266  -33.177 11.911  1.00 25.55 ? 150 ARG A NE  1 
ATOM   1192 C CZ  . ARG A 1 150 ? 30.124  -33.494 10.614  1.00 23.17 ? 150 ARG A CZ  1 
ATOM   1193 N NH1 . ARG A 1 150 ? 31.105  -34.100 9.968   1.00 20.77 ? 150 ARG A NH1 1 
ATOM   1194 N NH2 . ARG A 1 150 ? 29.002  -33.202 9.970   1.00 17.68 ? 150 ARG A NH2 1 
ATOM   1195 N N   . SER A 1 151 ? 35.548  -31.685 16.640  1.00 28.63 ? 151 SER A N   1 
ATOM   1196 C CA  . SER A 1 151 ? 36.557  -32.192 17.555  1.00 28.67 ? 151 SER A CA  1 
ATOM   1197 C C   . SER A 1 151 ? 36.219  -31.730 18.982  1.00 29.16 ? 151 SER A C   1 
ATOM   1198 O O   . SER A 1 151 ? 36.397  -32.469 19.950  1.00 30.01 ? 151 SER A O   1 
ATOM   1199 C CB  . SER A 1 151 ? 37.949  -31.773 17.098  1.00 28.64 ? 151 SER A CB  1 
ATOM   1200 O OG  . SER A 1 151 ? 38.209  -30.417 17.395  1.00 30.43 ? 151 SER A OG  1 
ATOM   1201 N N   . TYR A 1 152 ? 35.681  -30.520 19.088  1.00 29.66 ? 152 TYR A N   1 
ATOM   1202 C CA  . TYR A 1 152 ? 35.086  -29.986 20.317  1.00 29.28 ? 152 TYR A CA  1 
ATOM   1203 C C   . TYR A 1 152 ? 33.710  -30.599 20.692  1.00 29.77 ? 152 TYR A C   1 
ATOM   1204 O O   . TYR A 1 152 ? 33.210  -30.338 21.773  1.00 31.24 ? 152 TYR A O   1 
ATOM   1205 C CB  . TYR A 1 152 ? 34.888  -28.477 20.155  1.00 28.68 ? 152 TYR A CB  1 
ATOM   1206 C CG  . TYR A 1 152 ? 36.123  -27.635 20.375  1.00 28.76 ? 152 TYR A CG  1 
ATOM   1207 C CD1 . TYR A 1 152 ? 36.713  -27.567 21.645  1.00 26.63 ? 152 TYR A CD1 1 
ATOM   1208 C CD2 . TYR A 1 152 ? 36.683  -26.856 19.342  1.00 26.70 ? 152 TYR A CD2 1 
ATOM   1209 C CE1 . TYR A 1 152 ? 37.832  -26.794 21.885  1.00 24.71 ? 152 TYR A CE1 1 
ATOM   1210 C CE2 . TYR A 1 152 ? 37.821  -26.049 19.591  1.00 26.19 ? 152 TYR A CE2 1 
ATOM   1211 C CZ  . TYR A 1 152 ? 38.383  -26.032 20.884  1.00 25.29 ? 152 TYR A CZ  1 
ATOM   1212 O OH  . TYR A 1 152 ? 39.496  -25.272 21.226  1.00 23.60 ? 152 TYR A OH  1 
ATOM   1213 N N   . GLY A 1 153 ? 33.078  -31.379 19.824  1.00 29.55 ? 153 GLY A N   1 
ATOM   1214 C CA  . GLY A 1 153 ? 31.738  -31.896 20.110  1.00 29.43 ? 153 GLY A CA  1 
ATOM   1215 C C   . GLY A 1 153 ? 30.597  -31.129 19.435  1.00 29.98 ? 153 GLY A C   1 
ATOM   1216 O O   . GLY A 1 153 ? 29.410  -31.457 19.631  1.00 29.96 ? 153 GLY A O   1 
ATOM   1217 N N   . MET A 1 154 ? 30.946  -30.118 18.634  1.00 30.37 ? 154 MET A N   1 
ATOM   1218 C CA  . MET A 1 154 ? 29.963  -29.230 17.987  1.00 30.85 ? 154 MET A CA  1 
ATOM   1219 C C   . MET A 1 154 ? 29.483  -29.808 16.658  1.00 30.71 ? 154 MET A C   1 
ATOM   1220 O O   . MET A 1 154 ? 30.264  -30.426 15.933  1.00 31.53 ? 154 MET A O   1 
ATOM   1221 C CB  . MET A 1 154 ? 30.543  -27.830 17.730  1.00 30.77 ? 154 MET A CB  1 
ATOM   1222 C CG  . MET A 1 154 ? 31.165  -27.166 18.925  1.00 33.74 ? 154 MET A CG  1 
ATOM   1223 S SD  . MET A 1 154 ? 31.144  -25.374 18.817  1.00 40.39 ? 154 MET A SD  1 
ATOM   1224 C CE  . MET A 1 154 ? 32.852  -24.973 19.161  1.00 40.25 ? 154 MET A CE  1 
ATOM   1225 N N   . GLU A 1 155 ? 28.205  -29.601 16.361  1.00 29.58 ? 155 GLU A N   1 
ATOM   1226 C CA  . GLU A 1 155 ? 27.604  -29.951 15.083  1.00 29.02 ? 155 GLU A CA  1 
ATOM   1227 C C   . GLU A 1 155 ? 27.097  -28.646 14.425  1.00 28.35 ? 155 GLU A C   1 
ATOM   1228 O O   . GLU A 1 155 ? 26.016  -28.115 14.805  1.00 27.77 ? 155 GLU A O   1 
ATOM   1229 C CB  . GLU A 1 155 ? 26.464  -30.980 15.247  1.00 28.64 ? 155 GLU A CB  1 
ATOM   1230 C CG  . GLU A 1 155 ? 26.011  -31.617 13.915  1.00 30.21 ? 155 GLU A CG  1 
ATOM   1231 C CD  . GLU A 1 155 ? 27.180  -32.086 12.999  1.00 32.37 ? 155 GLU A CD  1 
ATOM   1232 O OE1 . GLU A 1 155 ? 28.215  -32.588 13.494  1.00 32.36 ? 155 GLU A OE1 1 
ATOM   1233 O OE2 . GLU A 1 155 ? 27.052  -31.969 11.761  1.00 34.43 ? 155 GLU A OE2 1 
ATOM   1234 N N   . PRO A 1 156 ? 27.892  -28.110 13.472  1.00 27.17 ? 156 PRO A N   1 
ATOM   1235 C CA  . PRO A 1 156 ? 27.648  -26.782 12.919  1.00 26.87 ? 156 PRO A CA  1 
ATOM   1236 C C   . PRO A 1 156 ? 26.493  -26.758 11.957  1.00 26.97 ? 156 PRO A C   1 
ATOM   1237 O O   . PRO A 1 156 ? 26.145  -27.779 11.356  1.00 27.60 ? 156 PRO A O   1 
ATOM   1238 C CB  . PRO A 1 156 ? 28.956  -26.456 12.202  1.00 25.99 ? 156 PRO A CB  1 
ATOM   1239 C CG  . PRO A 1 156 ? 29.942  -27.335 12.830  1.00 26.51 ? 156 PRO A CG  1 
ATOM   1240 C CD  . PRO A 1 156 ? 29.225  -28.591 13.110  1.00 26.50 ? 156 PRO A CD  1 
ATOM   1241 N N   . ALA A 1 157 ? 25.868  -25.606 11.828  1.00 26.68 ? 157 ALA A N   1 
ATOM   1242 C CA  . ALA A 1 157 ? 24.857  -25.463 10.803  1.00 26.50 ? 157 ALA A CA  1 
ATOM   1243 C C   . ALA A 1 157 ? 25.594  -24.961 9.580   1.00 26.32 ? 157 ALA A C   1 
ATOM   1244 O O   . ALA A 1 157 ? 26.557  -24.204 9.723   1.00 25.97 ? 157 ALA A O   1 
ATOM   1245 C CB  . ALA A 1 157 ? 23.805  -24.472 11.236  1.00 26.56 ? 157 ALA A CB  1 
ATOM   1246 N N   . ILE A 1 158 ? 25.164  -25.423 8.397   1.00 26.41 ? 158 ILE A N   1 
ATOM   1247 C CA  . ILE A 1 158 ? 25.721  -25.008 7.101   1.00 25.47 ? 158 ILE A CA  1 
ATOM   1248 C C   . ILE A 1 158 ? 24.726  -24.096 6.440   1.00 25.78 ? 158 ILE A C   1 
ATOM   1249 O O   . ILE A 1 158 ? 23.598  -24.487 6.190   1.00 26.28 ? 158 ILE A O   1 
ATOM   1250 C CB  . ILE A 1 158 ? 25.987  -26.228 6.198   1.00 25.79 ? 158 ILE A CB  1 
ATOM   1251 C CG1 . ILE A 1 158 ? 26.616  -27.368 7.022   1.00 24.18 ? 158 ILE A CG1 1 
ATOM   1252 C CG2 . ILE A 1 158 ? 26.863  -25.848 4.934   1.00 24.02 ? 158 ILE A CG2 1 
ATOM   1253 C CD1 . ILE A 1 158 ? 27.955  -26.990 7.639   1.00 23.06 ? 158 ILE A CD1 1 
ATOM   1254 N N   . VAL A 1 159 ? 25.123  -22.860 6.186   1.00 26.58 ? 159 VAL A N   1 
ATOM   1255 C CA  . VAL A 1 159 ? 24.178  -21.870 5.645   1.00 27.14 ? 159 VAL A CA  1 
ATOM   1256 C C   . VAL A 1 159 ? 24.219  -21.831 4.120   1.00 27.49 ? 159 VAL A C   1 
ATOM   1257 O O   . VAL A 1 159 ? 25.289  -21.698 3.543   1.00 28.09 ? 159 VAL A O   1 
ATOM   1258 C CB  . VAL A 1 159 ? 24.419  -20.463 6.278   1.00 26.80 ? 159 VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 159 ? 23.558  -19.383 5.608   1.00 24.37 ? 159 VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 159 ? 24.108  -20.530 7.778   1.00 27.15 ? 159 VAL A CG2 1 
ATOM   1261 N N   . ILE A 1 160 ? 23.057  -21.933 3.477   1.00 28.48 ? 160 ILE A N   1 
ATOM   1262 C CA  . ILE A 1 160 ? 22.965  -21.966 1.991   1.00 28.92 ? 160 ILE A CA  1 
ATOM   1263 C C   . ILE A 1 160 ? 21.904  -21.039 1.333   1.00 29.80 ? 160 ILE A C   1 
ATOM   1264 O O   . ILE A 1 160 ? 20.902  -20.655 1.955   1.00 29.62 ? 160 ILE A O   1 
ATOM   1265 C CB  . ILE A 1 160 ? 22.760  -23.408 1.460   1.00 28.76 ? 160 ILE A CB  1 
ATOM   1266 C CG1 . ILE A 1 160 ? 21.394  -23.961 1.833   1.00 27.46 ? 160 ILE A CG1 1 
ATOM   1267 C CG2 . ILE A 1 160 ? 23.853  -24.343 1.956   1.00 29.05 ? 160 ILE A CG2 1 
ATOM   1268 C CD1 . ILE A 1 160 ? 21.127  -25.259 1.180   1.00 29.31 ? 160 ILE A CD1 1 
ATOM   1269 N N   . ASN A 1 161 ? 22.140  -20.740 0.056   1.00 30.62 ? 161 ASN A N   1 
ATOM   1270 C CA  . ASN A 1 161 ? 21.383  -19.787 -0.756  1.00 31.39 ? 161 ASN A CA  1 
ATOM   1271 C C   . ASN A 1 161 ? 20.893  -20.343 -2.078  1.00 30.93 ? 161 ASN A C   1 
ATOM   1272 O O   . ASN A 1 161 ? 19.889  -19.865 -2.642  1.00 30.67 ? 161 ASN A O   1 
ATOM   1273 C CB  . ASN A 1 161 ? 22.324  -18.649 -1.166  1.00 32.22 ? 161 ASN A CB  1 
ATOM   1274 C CG  . ASN A 1 161 ? 22.121  -17.420 -0.360  1.00 36.43 ? 161 ASN A CG  1 
ATOM   1275 O OD1 . ASN A 1 161 ? 21.253  -17.389 0.528   1.00 42.06 ? 161 ASN A OD1 1 
ATOM   1276 N ND2 . ASN A 1 161 ? 22.907  -16.367 -0.658  1.00 39.95 ? 161 ASN A ND2 1 
ATOM   1277 N N   . ASP A 1 162 ? 21.675  -21.271 -2.635  1.00 30.43 ? 162 ASP A N   1 
ATOM   1278 C CA  . ASP A 1 162 ? 21.436  -21.761 -3.998  1.00 30.06 ? 162 ASP A CA  1 
ATOM   1279 C C   . ASP A 1 162 ? 21.795  -23.248 -4.158  1.00 29.91 ? 162 ASP A C   1 
ATOM   1280 O O   . ASP A 1 162 ? 22.223  -23.903 -3.190  1.00 29.51 ? 162 ASP A O   1 
ATOM   1281 C CB  . ASP A 1 162 ? 22.176  -20.882 -5.009  1.00 29.15 ? 162 ASP A CB  1 
ATOM   1282 C CG  . ASP A 1 162 ? 23.683  -20.868 -4.784  1.00 29.75 ? 162 ASP A CG  1 
ATOM   1283 O OD1 . ASP A 1 162 ? 24.259  -21.923 -4.387  1.00 28.02 ? 162 ASP A OD1 1 
ATOM   1284 O OD2 . ASP A 1 162 ? 24.299  -19.806 -5.039  1.00 27.89 ? 162 ASP A OD2 1 
ATOM   1285 N N   . GLU A 1 163 ? 21.618  -23.770 -5.376  1.00 29.41 ? 163 GLU A N   1 
ATOM   1286 C CA  . GLU A 1 163 ? 21.957  -25.156 -5.677  1.00 29.02 ? 163 GLU A CA  1 
ATOM   1287 C C   . GLU A 1 163 ? 23.431  -25.495 -5.532  1.00 28.61 ? 163 GLU A C   1 
ATOM   1288 O O   . GLU A 1 163 ? 23.775  -26.614 -5.163  1.00 28.90 ? 163 GLU A O   1 
ATOM   1289 C CB  . GLU A 1 163 ? 21.465  -25.528 -7.059  1.00 29.64 ? 163 GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 163 ? 20.028  -26.003 -7.023  1.00 31.62 ? 163 GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 163 ? 19.397  -26.148 -8.403  1.00 35.46 ? 163 GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 163 ? 19.958  -26.892 -9.257  1.00 33.26 ? 163 GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 163 ? 18.324  -25.505 -8.608  1.00 36.64 ? 163 GLU A OE2 1 
ATOM   1294 N N   . GLU A 1 164 ? 24.311  -24.541 -5.796  1.00 27.69 ? 164 GLU A N   1 
ATOM   1295 C CA  . GLU A 1 164 ? 25.724  -24.833 -5.642  1.00 27.43 ? 164 GLU A CA  1 
ATOM   1296 C C   . GLU A 1 164 ? 26.095  -25.002 -4.161  1.00 26.73 ? 164 GLU A C   1 
ATOM   1297 O O   . GLU A 1 164 ? 26.610  -26.046 -3.769  1.00 26.59 ? 164 GLU A O   1 
ATOM   1298 C CB  . GLU A 1 164 ? 26.584  -23.794 -6.333  1.00 27.21 ? 164 GLU A CB  1 
ATOM   1299 C CG  . GLU A 1 164 ? 27.975  -24.260 -6.491  1.00 30.31 ? 164 GLU A CG  1 
ATOM   1300 C CD  . GLU A 1 164 ? 28.816  -23.278 -7.235  1.00 35.99 ? 164 GLU A CD  1 
ATOM   1301 O OE1 . GLU A 1 164 ? 29.915  -22.957 -6.717  1.00 35.17 ? 164 GLU A OE1 1 
ATOM   1302 O OE2 . GLU A 1 164 ? 28.366  -22.814 -8.326  1.00 39.26 ? 164 GLU A OE2 1 
ATOM   1303 N N   . ASP A 1 165 ? 25.820  -23.977 -3.354  1.00 26.32 ? 165 ASP A N   1 
ATOM   1304 C CA  . ASP A 1 165 ? 25.807  -24.099 -1.883  1.00 25.84 ? 165 ASP A CA  1 
ATOM   1305 C C   . ASP A 1 165 ? 25.333  -25.485 -1.387  1.00 25.12 ? 165 ASP A C   1 
ATOM   1306 O O   . ASP A 1 165 ? 26.101  -26.216 -0.742  1.00 25.00 ? 165 ASP A O   1 
ATOM   1307 C CB  . ASP A 1 165 ? 24.875  -23.045 -1.265  1.00 26.55 ? 165 ASP A CB  1 
ATOM   1308 C CG  . ASP A 1 165 ? 25.471  -21.634 -1.211  1.00 26.96 ? 165 ASP A CG  1 
ATOM   1309 O OD1 . ASP A 1 165 ? 26.614  -21.396 -1.634  1.00 25.67 ? 165 ASP A OD1 1 
ATOM   1310 O OD2 . ASP A 1 165 ? 24.742  -20.744 -0.717  1.00 30.29 ? 165 ASP A OD2 1 
ATOM   1311 N N   . LEU A 1 166 ? 24.074  -25.827 -1.675  1.00 24.39 ? 166 LEU A N   1 
ATOM   1312 C CA  . LEU A 1 166 ? 23.480  -27.089 -1.239  1.00 24.33 ? 166 LEU A CA  1 
ATOM   1313 C C   . LEU A 1 166 ? 24.259  -28.320 -1.661  1.00 25.17 ? 166 LEU A C   1 
ATOM   1314 O O   . LEU A 1 166 ? 24.337  -29.276 -0.904  1.00 25.91 ? 166 LEU A O   1 
ATOM   1315 C CB  . LEU A 1 166 ? 22.049  -27.240 -1.741  1.00 24.10 ? 166 LEU A CB  1 
ATOM   1316 C CG  . LEU A 1 166 ? 21.373  -28.626 -1.650  1.00 23.25 ? 166 LEU A CG  1 
ATOM   1317 C CD1 . LEU A 1 166 ? 21.387  -29.163 -0.217  1.00 24.15 ? 166 LEU A CD1 1 
ATOM   1318 C CD2 . LEU A 1 166 ? 19.922  -28.633 -2.212  1.00 20.40 ? 166 LEU A CD2 1 
ATOM   1319 N N   . ASP A 1 167 ? 24.808  -28.312 -2.876  1.00 26.00 ? 167 ASP A N   1 
ATOM   1320 C CA  . ASP A 1 167 ? 25.528  -29.458 -3.399  1.00 25.78 ? 167 ASP A CA  1 
ATOM   1321 C C   . ASP A 1 167 ? 26.803  -29.648 -2.620  1.00 26.09 ? 167 ASP A C   1 
ATOM   1322 O O   . ASP A 1 167 ? 27.181  -30.777 -2.319  1.00 26.43 ? 167 ASP A O   1 
ATOM   1323 C CB  . ASP A 1 167 ? 25.848  -29.274 -4.884  1.00 26.07 ? 167 ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 167 ? 26.863  -30.288 -5.394  1.00 26.04 ? 167 ASP A CG  1 
ATOM   1325 O OD1 . ASP A 1 167 ? 27.948  -29.864 -5.855  1.00 27.66 ? 167 ASP A OD1 1 
ATOM   1326 O OD2 . ASP A 1 167 ? 26.575  -31.505 -5.323  1.00 25.11 ? 167 ASP A OD2 1 
ATOM   1327 N N   . ILE A 1 168 ? 27.462  -28.541 -2.301  1.00 26.66 ? 168 ILE A N   1 
ATOM   1328 C CA  . ILE A 1 168 ? 28.657  -28.552 -1.424  1.00 27.66 ? 168 ILE A CA  1 
ATOM   1329 C C   . ILE A 1 168 ? 28.335  -28.913 0.063   1.00 28.05 ? 168 ILE A C   1 
ATOM   1330 O O   . ILE A 1 168 ? 29.181  -29.486 0.794   1.00 28.59 ? 168 ILE A O   1 
ATOM   1331 C CB  . ILE A 1 168 ? 29.444  -27.211 -1.571  1.00 27.62 ? 168 ILE A CB  1 
ATOM   1332 C CG1 . ILE A 1 168 ? 30.269  -27.248 -2.872  1.00 28.19 ? 168 ILE A CG1 1 
ATOM   1333 C CG2 . ILE A 1 168 ? 30.331  -26.931 -0.352  1.00 26.03 ? 168 ILE A CG2 1 
ATOM   1334 C CD1 . ILE A 1 168 ? 30.717  -25.845 -3.382  1.00 32.08 ? 168 ILE A CD1 1 
ATOM   1335 N N   . ALA A 1 169 ? 27.122  -28.604 0.509   1.00 28.08 ? 169 ALA A N   1 
ATOM   1336 C CA  . ALA A 1 169 ? 26.744  -29.017 1.850   1.00 29.14 ? 169 ALA A CA  1 
ATOM   1337 C C   . ALA A 1 169 ? 26.558  -30.510 1.823   1.00 29.91 ? 169 ALA A C   1 
ATOM   1338 O O   . ALA A 1 169 ? 26.965  -31.205 2.752   1.00 30.62 ? 169 ALA A O   1 
ATOM   1339 C CB  . ALA A 1 169 ? 25.479  -28.324 2.342   1.00 28.91 ? 169 ALA A CB  1 
ATOM   1340 N N   . LEU A 1 170 ? 25.961  -31.027 0.758   1.00 30.46 ? 170 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 170 ? 25.797  -32.465 0.702   1.00 31.21 ? 170 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 170 ? 27.148  -33.169 0.571   1.00 31.31 ? 170 LEU A C   1 
ATOM   1343 O O   . LEU A 1 170 ? 27.354  -34.241 1.152   1.00 31.80 ? 170 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 170 ? 24.815  -32.881 -0.390  1.00 31.59 ? 170 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 170 ? 23.373  -32.446 -0.117  1.00 31.63 ? 170 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 170 ? 22.497  -32.817 -1.285  1.00 32.99 ? 170 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 170 ? 22.799  -33.089 1.137   1.00 32.92 ? 170 LEU A CD2 1 
ATOM   1348 N N   . ARG A 1 171 ? 28.073  -32.556 -0.155  1.00 31.41 ? 171 ARG A N   1 
ATOM   1349 C CA  . ARG A 1 171 ? 29.415  -33.117 -0.300  1.00 31.93 ? 171 ARG A CA  1 
ATOM   1350 C C   . ARG A 1 171 ? 30.056  -33.434 1.051   1.00 31.79 ? 171 ARG A C   1 
ATOM   1351 O O   . ARG A 1 171 ? 30.472  -34.563 1.296   1.00 32.17 ? 171 ARG A O   1 
ATOM   1352 C CB  . ARG A 1 171 ? 30.321  -32.183 -1.098  1.00 32.01 ? 171 ARG A CB  1 
ATOM   1353 C CG  . ARG A 1 171 ? 31.717  -32.751 -1.370  1.00 33.47 ? 171 ARG A CG  1 
ATOM   1354 C CD  . ARG A 1 171 ? 31.976  -32.860 -2.865  1.00 35.62 ? 171 ARG A CD  1 
ATOM   1355 N NE  . ARG A 1 171 ? 30.718  -33.012 -3.585  1.00 37.35 ? 171 ARG A NE  1 
ATOM   1356 C CZ  . ARG A 1 171 ? 30.293  -32.215 -4.559  1.00 37.16 ? 171 ARG A CZ  1 
ATOM   1357 N NH1 . ARG A 1 171 ? 31.034  -31.200 -4.996  1.00 37.67 ? 171 ARG A NH1 1 
ATOM   1358 N NH2 . ARG A 1 171 ? 29.121  -32.469 -5.109  1.00 37.17 ? 171 ARG A NH2 1 
ATOM   1359 N N   . ILE A 1 172 ? 30.102  -32.433 1.920   1.00 31.54 ? 172 ILE A N   1 
ATOM   1360 C CA  . ILE A 1 172 ? 30.659  -32.557 3.278   1.00 30.74 ? 172 ILE A CA  1 
ATOM   1361 C C   . ILE A 1 172 ? 29.758  -33.361 4.234   1.00 30.35 ? 172 ILE A C   1 
ATOM   1362 O O   . ILE A 1 172 ? 30.136  -33.614 5.373   1.00 31.26 ? 172 ILE A O   1 
ATOM   1363 C CB  . ILE A 1 172 ? 30.979  -31.146 3.866   1.00 30.55 ? 172 ILE A CB  1 
ATOM   1364 C CG1 . ILE A 1 172 ? 29.676  -30.323 4.063   1.00 30.75 ? 172 ILE A CG1 1 
ATOM   1365 C CG2 . ILE A 1 172 ? 31.929  -30.365 2.923   1.00 30.62 ? 172 ILE A CG2 1 
ATOM   1366 C CD1 . ILE A 1 172 ? 29.852  -28.985 4.760   1.00 26.30 ? 172 ILE A CD1 1 
ATOM   1367 N N   . GLY A 1 173 ? 28.568  -33.752 3.785   1.00 29.98 ? 173 GLY A N   1 
ATOM   1368 C CA  . GLY A 1 173 ? 27.630  -34.533 4.612   1.00 29.34 ? 173 GLY A CA  1 
ATOM   1369 C C   . GLY A 1 173 ? 27.038  -33.697 5.731   1.00 29.30 ? 173 GLY A C   1 
ATOM   1370 O O   . GLY A 1 173 ? 27.170  -34.006 6.931   1.00 29.94 ? 173 GLY A O   1 
ATOM   1371 N N   . ALA A 1 174 ? 26.395  -32.602 5.362   1.00 28.39 ? 174 ALA A N   1 
ATOM   1372 C CA  . ALA A 1 174 ? 25.839  -31.726 6.377   1.00 26.43 ? 174 ALA A CA  1 
ATOM   1373 C C   . ALA A 1 174 ? 24.798  -32.496 7.161   1.00 25.84 ? 174 ALA A C   1 
ATOM   1374 O O   . ALA A 1 174 ? 24.021  -33.278 6.615   1.00 25.85 ? 174 ALA A O   1 
ATOM   1375 C CB  . ALA A 1 174 ? 25.241  -30.520 5.725   1.00 26.05 ? 174 ALA A CB  1 
ATOM   1376 N N   . ARG A 1 175 ? 24.776  -32.299 8.457   1.00 26.14 ? 175 ARG A N   1 
ATOM   1377 C CA  . ARG A 1 175 ? 23.724  -32.929 9.234   1.00 26.73 ? 175 ARG A CA  1 
ATOM   1378 C C   . ARG A 1 175 ? 22.629  -31.912 9.515   1.00 25.78 ? 175 ARG A C   1 
ATOM   1379 O O   . ARG A 1 175 ? 21.451  -32.261 9.610   1.00 25.37 ? 175 ARG A O   1 
ATOM   1380 C CB  . ARG A 1 175 ? 24.292  -33.623 10.494  1.00 27.72 ? 175 ARG A CB  1 
ATOM   1381 C CG  . ARG A 1 175 ? 24.974  -35.019 10.233  1.00 30.74 ? 175 ARG A CG  1 
ATOM   1382 C CD  . ARG A 1 175 ? 25.764  -35.547 11.496  1.00 38.93 ? 175 ARG A CD  1 
ATOM   1383 N NE  . ARG A 1 175 ? 26.975  -36.332 11.148  1.00 44.02 ? 175 ARG A NE  1 
ATOM   1384 C CZ  . ARG A 1 175 ? 28.075  -36.465 11.911  1.00 44.98 ? 175 ARG A CZ  1 
ATOM   1385 N NH1 . ARG A 1 175 ? 28.145  -35.888 13.112  1.00 43.49 ? 175 ARG A NH1 1 
ATOM   1386 N NH2 . ARG A 1 175 ? 29.115  -37.189 11.475  1.00 44.07 ? 175 ARG A NH2 1 
ATOM   1387 N N   . ILE A 1 176 ? 23.033  -30.640 9.594   1.00 25.27 ? 176 ILE A N   1 
ATOM   1388 C CA  . ILE A 1 176 ? 22.111  -29.513 9.767   1.00 25.29 ? 176 ILE A CA  1 
ATOM   1389 C C   . ILE A 1 176 ? 22.398  -28.463 8.707   1.00 24.67 ? 176 ILE A C   1 
ATOM   1390 O O   . ILE A 1 176 ? 23.537  -28.031 8.520   1.00 23.81 ? 176 ILE A O   1 
ATOM   1391 C CB  . ILE A 1 176 ? 22.271  -28.816 11.149  1.00 25.56 ? 176 ILE A CB  1 
ATOM   1392 C CG1 . ILE A 1 176 ? 22.753  -29.808 12.185  1.00 27.21 ? 176 ILE A CG1 1 
ATOM   1393 C CG2 . ILE A 1 176 ? 20.974  -28.110 11.601  1.00 22.93 ? 176 ILE A CG2 1 
ATOM   1394 C CD1 . ILE A 1 176 ? 23.486  -29.158 13.350  1.00 32.14 ? 176 ILE A CD1 1 
ATOM   1395 N N   . ILE A 1 177 ? 21.347  -28.032 8.026   1.00 24.94 ? 177 ILE A N   1 
ATOM   1396 C CA  . ILE A 1 177 ? 21.487  -27.030 6.947   1.00 25.01 ? 177 ILE A CA  1 
ATOM   1397 C C   . ILE A 1 177 ? 20.553  -25.868 7.214   1.00 24.50 ? 177 ILE A C   1 
ATOM   1398 O O   . ILE A 1 177 ? 19.372  -26.100 7.501   1.00 23.84 ? 177 ILE A O   1 
ATOM   1399 C CB  . ILE A 1 177 ? 21.198  -27.659 5.542   1.00 24.66 ? 177 ILE A CB  1 
ATOM   1400 C CG1 . ILE A 1 177 ? 22.375  -28.514 5.081   1.00 25.01 ? 177 ILE A CG1 1 
ATOM   1401 C CG2 . ILE A 1 177 ? 20.924  -26.592 4.500   1.00 25.37 ? 177 ILE A CG2 1 
ATOM   1402 C CD1 . ILE A 1 177 ? 22.030  -29.528 3.936   1.00 26.83 ? 177 ILE A CD1 1 
ATOM   1403 N N   . ILE A 1 178 ? 21.080  -24.639 7.150   1.00 24.26 ? 178 ILE A N   1 
ATOM   1404 C CA  . ILE A 1 178 ? 20.217  -23.430 7.138   1.00 23.65 ? 178 ILE A CA  1 
ATOM   1405 C C   . ILE A 1 178 ? 20.038  -22.915 5.717   1.00 23.10 ? 178 ILE A C   1 
ATOM   1406 O O   . ILE A 1 178 ? 21.000  -22.490 5.056   1.00 22.75 ? 178 ILE A O   1 
ATOM   1407 C CB  . ILE A 1 178 ? 20.718  -22.260 8.087   1.00 23.93 ? 178 ILE A CB  1 
ATOM   1408 C CG1 . ILE A 1 178 ? 20.719  -22.702 9.545   1.00 23.92 ? 178 ILE A CG1 1 
ATOM   1409 C CG2 . ILE A 1 178 ? 19.830  -20.967 7.935   1.00 23.16 ? 178 ILE A CG2 1 
ATOM   1410 C CD1 . ILE A 1 178 ? 21.447  -21.752 10.495  1.00 26.79 ? 178 ILE A CD1 1 
ATOM   1411 N N   . ILE A 1 179 ? 18.788  -22.941 5.279   1.00 22.87 ? 179 ILE A N   1 
ATOM   1412 C CA  . ILE A 1 179 ? 18.368  -22.431 3.982   1.00 22.69 ? 179 ILE A CA  1 
ATOM   1413 C C   . ILE A 1 179 ? 17.886  -20.991 4.122   1.00 23.32 ? 179 ILE A C   1 
ATOM   1414 O O   . ILE A 1 179 ? 16.740  -20.706 4.548   1.00 23.20 ? 179 ILE A O   1 
ATOM   1415 C CB  . ILE A 1 179 ? 17.244  -23.304 3.341   1.00 22.26 ? 179 ILE A CB  1 
ATOM   1416 C CG1 . ILE A 1 179 ? 17.626  -24.791 3.329   1.00 23.03 ? 179 ILE A CG1 1 
ATOM   1417 C CG2 . ILE A 1 179 ? 16.992  -22.884 1.895   1.00 22.33 ? 179 ILE A CG2 1 
ATOM   1418 C CD1 . ILE A 1 179 ? 17.068  -25.649 4.500   1.00 21.11 ? 179 ILE A CD1 1 
ATOM   1419 N N   . SER A 1 180 ? 18.754  -20.069 3.753   1.00 24.28 ? 180 SER A N   1 
ATOM   1420 C CA  . SER A 1 180 ? 18.365  -18.674 3.778   1.00 26.10 ? 180 SER A CA  1 
ATOM   1421 C C   . SER A 1 180 ? 17.843  -18.252 2.411   1.00 26.87 ? 180 SER A C   1 
ATOM   1422 O O   . SER A 1 180 ? 18.398  -18.633 1.362   1.00 27.53 ? 180 SER A O   1 
ATOM   1423 C CB  . SER A 1 180 ? 19.527  -17.787 4.247   1.00 26.05 ? 180 SER A CB  1 
ATOM   1424 O OG  . SER A 1 180 ? 19.280  -16.426 3.916   1.00 29.41 ? 180 SER A OG  1 
ATOM   1425 N N   . SER A 1 181 ? 16.758  -17.481 2.447   1.00 27.94 ? 181 SER A N   1 
ATOM   1426 C CA  . SER A 1 181 ? 16.119  -16.893 1.269   1.00 28.38 ? 181 SER A CA  1 
ATOM   1427 C C   . SER A 1 181 ? 16.726  -15.550 0.871   1.00 29.67 ? 181 SER A C   1 
ATOM   1428 O O   . SER A 1 181 ? 16.473  -15.073 -0.223  1.00 28.95 ? 181 SER A O   1 
ATOM   1429 C CB  . SER A 1 181 ? 14.612  -16.716 1.529   1.00 28.81 ? 181 SER A CB  1 
ATOM   1430 O OG  . SER A 1 181 ? 14.332  -16.096 2.786   1.00 26.92 ? 181 SER A OG  1 
ATOM   1431 N N   . ARG A 1 182 ? 17.510  -14.953 1.776   1.00 32.00 ? 182 ARG A N   1 
ATOM   1432 C CA  . ARG A 1 182 ? 18.094  -13.610 1.601   1.00 34.30 ? 182 ARG A CA  1 
ATOM   1433 C C   . ARG A 1 182 ? 19.520  -13.689 1.124   1.00 35.86 ? 182 ARG A C   1 
ATOM   1434 O O   . ARG A 1 182 ? 20.381  -14.222 1.833   1.00 36.95 ? 182 ARG A O   1 
ATOM   1435 C CB  . ARG A 1 182 ? 18.066  -12.824 2.910   1.00 33.92 ? 182 ARG A CB  1 
ATOM   1436 C CG  . ARG A 1 182 ? 18.999  -11.605 2.941   1.00 35.11 ? 182 ARG A CG  1 
ATOM   1437 C CD  . ARG A 1 182 ? 18.960  -10.860 4.295   1.00 34.26 ? 182 ARG A CD  1 
ATOM   1438 N NE  . ARG A 1 182 ? 17.613  -10.381 4.608   1.00 32.98 ? 182 ARG A NE  1 
ATOM   1439 C CZ  . ARG A 1 182 ? 16.889  -10.789 5.638   1.00 30.48 ? 182 ARG A CZ  1 
ATOM   1440 N NH1 . ARG A 1 182 ? 17.371  -11.688 6.497   1.00 30.24 ? 182 ARG A NH1 1 
ATOM   1441 N NH2 . ARG A 1 182 ? 15.684  -10.279 5.817   1.00 27.19 ? 182 ARG A NH2 1 
ATOM   1442 N N   . ASP A 1 183 ? 19.765  -13.152 -0.064  1.00 37.07 ? 183 ASP A N   1 
ATOM   1443 C CA  . ASP A 1 183 ? 21.083  -13.161 -0.671  1.00 38.72 ? 183 ASP A CA  1 
ATOM   1444 C C   . ASP A 1 183 ? 22.036  -12.242 0.099   1.00 39.79 ? 183 ASP A C   1 
ATOM   1445 O O   . ASP A 1 183 ? 21.684  -11.105 0.482   1.00 40.20 ? 183 ASP A O   1 
ATOM   1446 C CB  . ASP A 1 183 ? 20.977  -12.725 -2.138  1.00 39.09 ? 183 ASP A CB  1 
ATOM   1447 C CG  . ASP A 1 183 ? 22.281  -12.885 -2.895  1.00 41.93 ? 183 ASP A CG  1 
ATOM   1448 O OD1 . ASP A 1 183 ? 22.426  -13.901 -3.629  1.00 43.65 ? 183 ASP A OD1 1 
ATOM   1449 O OD2 . ASP A 1 183 ? 23.171  -12.010 -2.742  1.00 44.31 ? 183 ASP A OD2 1 
ATOM   1450 N N   . LEU A 1 184 ? 23.253  -12.729 0.306   1.00 40.25 ? 184 LEU A N   1 
ATOM   1451 C CA  . LEU A 1 184 ? 24.222  -12.047 1.134   1.00 41.00 ? 184 LEU A CA  1 
ATOM   1452 C C   . LEU A 1 184 ? 24.634  -10.683 0.584   1.00 41.37 ? 184 LEU A C   1 
ATOM   1453 O O   . LEU A 1 184 ? 24.991  -9.775  1.351   1.00 40.92 ? 184 LEU A O   1 
ATOM   1454 C CB  . LEU A 1 184 ? 25.457  -12.923 1.255   1.00 41.42 ? 184 LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 184 ? 25.364  -14.126 2.182   1.00 42.80 ? 184 LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 184 ? 26.439  -15.113 1.789   1.00 45.57 ? 184 LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 184 ? 25.542  -13.691 3.627   1.00 44.03 ? 184 LEU A CD2 1 
ATOM   1458 N N   . GLU A 1 185 ? 24.597  -10.570 -0.746  1.00 41.47 ? 185 GLU A N   1 
ATOM   1459 C CA  . GLU A 1 185 ? 25.106  -9.409  -1.476  1.00 41.71 ? 185 GLU A CA  1 
ATOM   1460 C C   . GLU A 1 185 ? 23.988  -8.411  -1.832  1.00 41.00 ? 185 GLU A C   1 
ATOM   1461 O O   . GLU A 1 185 ? 24.040  -7.237  -1.440  1.00 41.26 ? 185 GLU A O   1 
ATOM   1462 C CB  . GLU A 1 185 ? 25.854  -9.848  -2.753  1.00 42.18 ? 185 GLU A CB  1 
ATOM   1463 C CG  . GLU A 1 185 ? 27.147  -10.680 -2.539  1.00 44.52 ? 185 GLU A CG  1 
ATOM   1464 C CD  . GLU A 1 185 ? 28.295  -10.303 -3.515  1.00 48.25 ? 185 GLU A CD  1 
ATOM   1465 O OE1 . GLU A 1 185 ? 28.074  -10.214 -4.762  1.00 48.81 ? 185 GLU A OE1 1 
ATOM   1466 O OE2 . GLU A 1 185 ? 29.427  -10.099 -3.024  1.00 47.43 ? 185 GLU A OE2 1 
ATOM   1467 N N   . THR A 1 186 ? 22.987  -8.879  -2.568  1.00 39.24 ? 186 THR A N   1 
ATOM   1468 C CA  . THR A 1 186 ? 21.896  -8.022  -3.005  1.00 38.06 ? 186 THR A CA  1 
ATOM   1469 C C   . THR A 1 186 ? 20.831  -7.803  -1.922  1.00 36.86 ? 186 THR A C   1 
ATOM   1470 O O   . THR A 1 186 ? 20.128  -6.809  -1.966  1.00 36.17 ? 186 THR A O   1 
ATOM   1471 C CB  . THR A 1 186 ? 21.216  -8.574  -4.304  1.00 38.32 ? 186 THR A CB  1 
ATOM   1472 N N   . LEU A 1 187 ? 20.722  -8.741  -0.971  1.00 35.74 ? 187 LEU A N   1 
ATOM   1473 C CA  . LEU A 1 187 ? 19.694  -8.758  0.093   1.00 34.16 ? 187 LEU A CA  1 
ATOM   1474 C C   . LEU A 1 187 ? 18.312  -9.096  -0.438  1.00 33.87 ? 187 LEU A C   1 
ATOM   1475 O O   . LEU A 1 187 ? 17.334  -9.133  0.306   1.00 33.85 ? 187 LEU A O   1 
ATOM   1476 C CB  . LEU A 1 187 ? 19.693  -7.460  0.912   1.00 34.06 ? 187 LEU A CB  1 
ATOM   1477 C CG  . LEU A 1 187 ? 21.085  -7.161  1.484   1.00 34.75 ? 187 LEU A CG  1 
ATOM   1478 C CD1 . LEU A 1 187 ? 21.229  -5.716  1.966   1.00 32.94 ? 187 LEU A CD1 1 
ATOM   1479 C CD2 . LEU A 1 187 ? 21.544  -8.220  2.560   1.00 34.38 ? 187 LEU A CD2 1 
ATOM   1480 N N   . GLU A 1 188 ? 18.247  -9.354  -1.743  1.00 33.77 ? 188 GLU A N   1 
ATOM   1481 C CA  . GLU A 1 188 ? 17.072  -9.922  -2.388  1.00 33.08 ? 188 GLU A CA  1 
ATOM   1482 C C   . GLU A 1 188 ? 16.625  -11.161 -1.615  1.00 32.44 ? 188 GLU A C   1 
ATOM   1483 O O   . GLU A 1 188 ? 17.425  -11.996 -1.203  1.00 31.73 ? 188 GLU A O   1 
ATOM   1484 C CB  . GLU A 1 188 ? 17.388  -10.305 -3.844  1.00 33.15 ? 188 GLU A CB  1 
ATOM   1485 N N   . ILE A 1 189 ? 15.329  -11.260 -1.431  1.00 32.12 ? 189 ILE A N   1 
ATOM   1486 C CA  . ILE A 1 189 ? 14.747  -12.413 -0.817  1.00 31.67 ? 189 ILE A CA  1 
ATOM   1487 C C   . ILE A 1 189 ? 14.023  -13.169 -1.929  1.00 31.45 ? 189 ILE A C   1 
ATOM   1488 O O   . ILE A 1 189 ? 13.219  -12.588 -2.636  1.00 30.95 ? 189 ILE A O   1 
ATOM   1489 C CB  . ILE A 1 189 ? 13.768  -11.992 0.299   1.00 31.87 ? 189 ILE A CB  1 
ATOM   1490 C CG1 . ILE A 1 189 ? 14.514  -11.171 1.366   1.00 32.53 ? 189 ILE A CG1 1 
ATOM   1491 C CG2 . ILE A 1 189 ? 13.049  -13.192 0.861   1.00 30.56 ? 189 ILE A CG2 1 
ATOM   1492 C CD1 . ILE A 1 189 ? 14.047  -11.419 2.774   1.00 32.89 ? 189 ILE A CD1 1 
ATOM   1493 N N   . ASN A 1 190 ? 14.311  -14.460 -2.097  1.00 30.94 ? 190 ASN A N   1 
ATOM   1494 C CA  . ASN A 1 190 ? 13.518  -15.269 -3.022  1.00 30.08 ? 190 ASN A CA  1 
ATOM   1495 C C   . ASN A 1 190 ? 12.947  -16.466 -2.311  1.00 29.27 ? 190 ASN A C   1 
ATOM   1496 O O   . ASN A 1 190 ? 13.676  -17.351 -1.983  1.00 29.61 ? 190 ASN A O   1 
ATOM   1497 C CB  . ASN A 1 190 ? 14.385  -15.692 -4.213  1.00 30.17 ? 190 ASN A CB  1 
ATOM   1498 C CG  . ASN A 1 190 ? 13.580  -16.067 -5.423  1.00 29.80 ? 190 ASN A CG  1 
ATOM   1499 O OD1 . ASN A 1 190 ? 12.911  -17.107 -5.450  1.00 31.66 ? 190 ASN A OD1 1 
ATOM   1500 N ND2 . ASN A 1 190 ? 13.655  -15.234 -6.449  1.00 29.12 ? 190 ASN A ND2 1 
ATOM   1501 N N   . LYS A 1 191 ? 11.647  -16.496 -2.058  1.00 29.63 ? 191 LYS A N   1 
ATOM   1502 C CA  . LYS A 1 191 ? 11.064  -17.599 -1.287  1.00 29.88 ? 191 LYS A CA  1 
ATOM   1503 C C   . LYS A 1 191 ? 10.801  -18.802 -2.140  1.00 31.21 ? 191 LYS A C   1 
ATOM   1504 O O   . LYS A 1 191 ? 10.793  -19.941 -1.637  1.00 31.61 ? 191 LYS A O   1 
ATOM   1505 C CB  . LYS A 1 191 ? 9.795   -17.191 -0.552  1.00 29.32 ? 191 LYS A CB  1 
ATOM   1506 C CG  . LYS A 1 191 ? 10.085  -16.281 0.590   1.00 26.97 ? 191 LYS A CG  1 
ATOM   1507 C CD  . LYS A 1 191 ? 8.911   -16.069 1.443   1.00 23.92 ? 191 LYS A CD  1 
ATOM   1508 C CE  . LYS A 1 191 ? 9.201   -14.883 2.302   1.00 26.23 ? 191 LYS A CE  1 
ATOM   1509 N NZ  . LYS A 1 191 ? 8.756   -15.031 3.706   1.00 29.67 ? 191 LYS A NZ  1 
ATOM   1510 N N   . GLU A 1 192 ? 10.578  -18.544 -3.422  1.00 32.23 ? 192 GLU A N   1 
ATOM   1511 C CA  . GLU A 1 192 ? 10.462  -19.572 -4.412  1.00 33.61 ? 192 GLU A CA  1 
ATOM   1512 C C   . GLU A 1 192 ? 11.762  -20.357 -4.492  1.00 33.23 ? 192 GLU A C   1 
ATOM   1513 O O   . GLU A 1 192 ? 11.737  -21.598 -4.517  1.00 33.20 ? 192 GLU A O   1 
ATOM   1514 C CB  . GLU A 1 192 ? 10.153  -18.926 -5.752  1.00 35.27 ? 192 GLU A CB  1 
ATOM   1515 C CG  . GLU A 1 192 ? 9.753   -19.871 -6.861  1.00 39.53 ? 192 GLU A CG  1 
ATOM   1516 C CD  . GLU A 1 192 ? 8.922   -19.135 -7.892  1.00 46.48 ? 192 GLU A CD  1 
ATOM   1517 O OE1 . GLU A 1 192 ? 9.339   -18.010 -8.289  1.00 47.83 ? 192 GLU A OE1 1 
ATOM   1518 O OE2 . GLU A 1 192 ? 7.841   -19.666 -8.281  1.00 49.90 ? 192 GLU A OE2 1 
ATOM   1519 N N   . ASN A 1 193 ? 12.906  -19.670 -4.527  1.00 32.20 ? 193 ASN A N   1 
ATOM   1520 C CA  . ASN A 1 193 ? 14.157  -20.427 -4.585  1.00 31.27 ? 193 ASN A CA  1 
ATOM   1521 C C   . ASN A 1 193 ? 14.394  -21.235 -3.290  1.00 31.14 ? 193 ASN A C   1 
ATOM   1522 O O   . ASN A 1 193 ? 14.839  -22.395 -3.332  1.00 29.98 ? 193 ASN A O   1 
ATOM   1523 C CB  . ASN A 1 193 ? 15.332  -19.538 -4.959  1.00 31.71 ? 193 ASN A CB  1 
ATOM   1524 C CG  . ASN A 1 193 ? 15.237  -19.010 -6.412  1.00 31.66 ? 193 ASN A CG  1 
ATOM   1525 N N   . GLN A 1 194 ? 14.044  -20.628 -2.152  1.00 30.45 ? 194 GLN A N   1 
ATOM   1526 C CA  . GLN A 1 194 ? 14.157  -21.281 -0.857  1.00 30.78 ? 194 GLN A CA  1 
ATOM   1527 C C   . GLN A 1 194 ? 13.348  -22.610 -0.804  1.00 30.75 ? 194 GLN A C   1 
ATOM   1528 O O   . GLN A 1 194 ? 13.868  -23.654 -0.370  1.00 29.59 ? 194 GLN A O   1 
ATOM   1529 C CB  . GLN A 1 194 ? 13.760  -20.304 0.270   1.00 31.05 ? 194 GLN A CB  1 
ATOM   1530 C CG  . GLN A 1 194 ? 13.590  -20.906 1.656   1.00 30.44 ? 194 GLN A CG  1 
ATOM   1531 C CD  . GLN A 1 194 ? 13.413  -19.836 2.725   1.00 32.75 ? 194 GLN A CD  1 
ATOM   1532 O OE1 . GLN A 1 194 ? 14.366  -19.481 3.420   1.00 35.01 ? 194 GLN A OE1 1 
ATOM   1533 N NE2 . GLN A 1 194 ? 12.203  -19.298 2.848   1.00 32.22 ? 194 GLN A NE2 1 
ATOM   1534 N N   . ARG A 1 195 ? 12.101  -22.557 -1.275  1.00 30.43 ? 195 ARG A N   1 
ATOM   1535 C CA  . ARG A 1 195 ? 11.209  -23.723 -1.310  1.00 30.02 ? 195 ARG A CA  1 
ATOM   1536 C C   . ARG A 1 195 ? 11.774  -24.854 -2.152  1.00 30.01 ? 195 ARG A C   1 
ATOM   1537 O O   . ARG A 1 195 ? 11.705  -26.018 -1.755  1.00 28.73 ? 195 ARG A O   1 
ATOM   1538 C CB  . ARG A 1 195 ? 9.790   -23.328 -1.779  1.00 29.95 ? 195 ARG A CB  1 
ATOM   1539 C CG  . ARG A 1 195 ? 8.845   -22.907 -0.620  1.00 30.31 ? 195 ARG A CG  1 
ATOM   1540 C CD  . ARG A 1 195 ? 7.410   -22.512 -1.089  1.00 32.60 ? 195 ARG A CD  1 
ATOM   1541 N NE  . ARG A 1 195 ? 7.305   -21.072 -1.319  1.00 34.66 ? 195 ARG A NE  1 
ATOM   1542 C CZ  . ARG A 1 195 ? 7.137   -20.504 -2.501  1.00 34.00 ? 195 ARG A CZ  1 
ATOM   1543 N NH1 . ARG A 1 195 ? 7.035   -21.251 -3.591  1.00 37.19 ? 195 ARG A NH1 1 
ATOM   1544 N NH2 . ARG A 1 195 ? 7.096   -19.194 -2.600  1.00 32.83 ? 195 ARG A NH2 1 
ATOM   1545 N N   . LYS A 1 196 ? 12.324  -24.513 -3.321  1.00 30.79 ? 196 LYS A N   1 
ATOM   1546 C CA  . LYS A 1 196 ? 12.952  -25.523 -4.190  1.00 31.10 ? 196 LYS A CA  1 
ATOM   1547 C C   . LYS A 1 196 ? 14.188  -26.188 -3.547  1.00 30.94 ? 196 LYS A C   1 
ATOM   1548 O O   . LYS A 1 196 ? 14.308  -27.426 -3.528  1.00 31.45 ? 196 LYS A O   1 
ATOM   1549 C CB  . LYS A 1 196 ? 13.271  -24.945 -5.571  1.00 31.24 ? 196 LYS A CB  1 
ATOM   1550 C CG  . LYS A 1 196 ? 12.123  -25.134 -6.587  1.00 32.51 ? 196 LYS A CG  1 
ATOM   1551 N N   . LEU A 1 197 ? 15.089  -25.366 -3.019  1.00 29.95 ? 197 LEU A N   1 
ATOM   1552 C CA  . LEU A 1 197 ? 16.236  -25.852 -2.254  1.00 29.35 ? 197 LEU A CA  1 
ATOM   1553 C C   . LEU A 1 197 ? 15.847  -26.863 -1.188  1.00 28.92 ? 197 LEU A C   1 
ATOM   1554 O O   . LEU A 1 197 ? 16.448  -27.926 -1.052  1.00 29.15 ? 197 LEU A O   1 
ATOM   1555 C CB  . LEU A 1 197 ? 16.950  -24.678 -1.612  1.00 29.04 ? 197 LEU A CB  1 
ATOM   1556 C CG  . LEU A 1 197 ? 17.989  -24.099 -2.528  1.00 30.07 ? 197 LEU A CG  1 
ATOM   1557 C CD1 . LEU A 1 197 ? 18.902  -23.249 -1.699  1.00 30.59 ? 197 LEU A CD1 1 
ATOM   1558 C CD2 . LEU A 1 197 ? 18.761  -25.279 -3.099  1.00 30.40 ? 197 LEU A CD2 1 
ATOM   1559 N N   . ILE A 1 198 ? 14.809  -26.516 -0.451  1.00 28.84 ? 198 ILE A N   1 
ATOM   1560 C CA  . ILE A 1 198 ? 14.248  -27.353 0.590   1.00 28.23 ? 198 ILE A CA  1 
ATOM   1561 C C   . ILE A 1 198 ? 13.744  -28.672 0.022   1.00 28.85 ? 198 ILE A C   1 
ATOM   1562 O O   . ILE A 1 198 ? 14.016  -29.718 0.605   1.00 29.09 ? 198 ILE A O   1 
ATOM   1563 C CB  . ILE A 1 198 ? 13.177  -26.560 1.363   1.00 27.78 ? 198 ILE A CB  1 
ATOM   1564 C CG1 . ILE A 1 198 ? 13.882  -25.676 2.400   1.00 26.54 ? 198 ILE A CG1 1 
ATOM   1565 C CG2 . ILE A 1 198 ? 12.066  -27.456 1.958   1.00 27.28 ? 198 ILE A CG2 1 
ATOM   1566 C CD1 . ILE A 1 198 ? 13.093  -24.455 2.786   1.00 23.80 ? 198 ILE A CD1 1 
ATOM   1567 N N   . SER A 1 199 ? 13.088  -28.641 -1.140  1.00 28.97 ? 199 SER A N   1 
ATOM   1568 C CA  . SER A 1 199 ? 12.549  -29.879 -1.747  1.00 29.50 ? 199 SER A CA  1 
ATOM   1569 C C   . SER A 1 199 ? 13.658  -30.826 -2.155  1.00 30.18 ? 199 SER A C   1 
ATOM   1570 O O   . SER A 1 199 ? 13.445  -32.034 -2.217  1.00 30.48 ? 199 SER A O   1 
ATOM   1571 C CB  . SER A 1 199 ? 11.661  -29.587 -2.960  1.00 29.29 ? 199 SER A CB  1 
ATOM   1572 O OG  . SER A 1 199 ? 12.460  -29.101 -4.041  1.00 29.45 ? 199 SER A OG  1 
ATOM   1573 N N   . MET A 1 200 ? 14.842  -30.266 -2.402  1.00 30.76 ? 200 MET A N   1 
ATOM   1574 C CA  . MET A 1 200 ? 15.975  -31.014 -2.907  1.00 31.09 ? 200 MET A CA  1 
ATOM   1575 C C   . MET A 1 200 ? 16.853  -31.612 -1.815  1.00 31.48 ? 200 MET A C   1 
ATOM   1576 O O   . MET A 1 200 ? 17.835  -32.258 -2.124  1.00 31.51 ? 200 MET A O   1 
ATOM   1577 C CB  . MET A 1 200 ? 16.817  -30.103 -3.807  1.00 31.04 ? 200 MET A CB  1 
ATOM   1578 C CG  . MET A 1 200 ? 16.239  -29.850 -5.198  1.00 31.28 ? 200 MET A CG  1 
ATOM   1579 S SD  . MET A 1 200 ? 17.207  -28.582 -6.030  1.00 33.83 ? 200 MET A SD  1 
ATOM   1580 C CE  . MET A 1 200 ? 18.382  -29.614 -6.888  1.00 35.20 ? 200 MET A CE  1 
ATOM   1581 N N   . ILE A 1 201 ? 16.519  -31.383 -0.545  1.00 32.27 ? 201 ILE A N   1 
ATOM   1582 C CA  . ILE A 1 201 ? 17.346  -31.841 0.590   1.00 32.37 ? 201 ILE A CA  1 
ATOM   1583 C C   . ILE A 1 201 ? 16.825  -33.143 1.203   1.00 32.55 ? 201 ILE A C   1 
ATOM   1584 O O   . ILE A 1 201 ? 15.633  -33.254 1.483   1.00 31.67 ? 201 ILE A O   1 
ATOM   1585 C CB  . ILE A 1 201 ? 17.419  -30.773 1.707   1.00 32.25 ? 201 ILE A CB  1 
ATOM   1586 C CG1 . ILE A 1 201 ? 18.167  -29.540 1.226   1.00 32.35 ? 201 ILE A CG1 1 
ATOM   1587 C CG2 . ILE A 1 201 ? 18.145  -31.307 2.945   1.00 33.52 ? 201 ILE A CG2 1 
ATOM   1588 C CD1 . ILE A 1 201 ? 18.106  -28.358 2.214   1.00 29.35 ? 201 ILE A CD1 1 
ATOM   1589 N N   . PRO A 1 202 ? 17.728  -34.121 1.439   1.00 33.42 ? 202 PRO A N   1 
ATOM   1590 C CA  . PRO A 1 202 ? 17.316  -35.440 1.925   1.00 34.37 ? 202 PRO A CA  1 
ATOM   1591 C C   . PRO A 1 202 ? 16.571  -35.354 3.257   1.00 35.98 ? 202 PRO A C   1 
ATOM   1592 O O   . PRO A 1 202 ? 16.813  -34.430 4.065   1.00 36.53 ? 202 PRO A O   1 
ATOM   1593 C CB  . PRO A 1 202 ? 18.645  -36.178 2.104   1.00 33.89 ? 202 PRO A CB  1 
ATOM   1594 C CG  . PRO A 1 202 ? 19.568  -35.512 1.214   1.00 33.12 ? 202 PRO A CG  1 
ATOM   1595 C CD  . PRO A 1 202 ? 19.181  -34.068 1.221   1.00 33.03 ? 202 PRO A CD  1 
ATOM   1596 N N   . SER A 1 203 ? 15.661  -36.298 3.477   1.00 36.96 ? 203 SER A N   1 
ATOM   1597 C CA  . SER A 1 203 ? 14.902  -36.365 4.724   1.00 38.03 ? 203 SER A CA  1 
ATOM   1598 C C   . SER A 1 203 ? 15.784  -36.485 5.968   1.00 38.01 ? 203 SER A C   1 
ATOM   1599 O O   . SER A 1 203 ? 15.428  -35.991 7.038   1.00 37.77 ? 203 SER A O   1 
ATOM   1600 C CB  . SER A 1 203 ? 13.927  -37.542 4.677   1.00 37.98 ? 203 SER A CB  1 
ATOM   1601 O OG  . SER A 1 203 ? 13.026  -37.331 3.607   1.00 41.30 ? 203 SER A OG  1 
ATOM   1602 N N   . ASN A 1 204 ? 16.923  -37.155 5.849   1.00 37.86 ? 204 ASN A N   1 
ATOM   1603 C CA  . ASN A 1 204 ? 17.678  -37.408 7.054   1.00 37.81 ? 204 ASN A CA  1 
ATOM   1604 C C   . ASN A 1 204 ? 18.401  -36.166 7.590   1.00 37.14 ? 204 ASN A C   1 
ATOM   1605 O O   . ASN A 1 204 ? 19.010  -36.213 8.662   1.00 36.80 ? 204 ASN A O   1 
ATOM   1606 C CB  . ASN A 1 204 ? 18.591  -38.655 6.919   1.00 38.88 ? 204 ASN A CB  1 
ATOM   1607 C CG  . ASN A 1 204 ? 19.701  -38.497 5.891   1.00 40.52 ? 204 ASN A CG  1 
ATOM   1608 O OD1 . ASN A 1 204 ? 19.643  -37.648 5.000   1.00 44.15 ? 204 ASN A OD1 1 
ATOM   1609 N ND2 . ASN A 1 204 ? 20.724  -39.345 6.002   1.00 42.56 ? 204 ASN A ND2 1 
ATOM   1610 N N   . VAL A 1 205 ? 18.309  -35.053 6.851   1.00 35.75 ? 205 VAL A N   1 
ATOM   1611 C CA  . VAL A 1 205 ? 18.998  -33.818 7.223   1.00 34.15 ? 205 VAL A CA  1 
ATOM   1612 C C   . VAL A 1 205 ? 18.057  -32.803 7.870   1.00 33.84 ? 205 VAL A C   1 
ATOM   1613 O O   . VAL A 1 205 ? 16.975  -32.511 7.352   1.00 33.56 ? 205 VAL A O   1 
ATOM   1614 C CB  . VAL A 1 205 ? 19.703  -33.159 6.024   1.00 34.56 ? 205 VAL A CB  1 
ATOM   1615 C CG1 . VAL A 1 205 ? 20.209  -31.773 6.411   1.00 33.19 ? 205 VAL A CG1 1 
ATOM   1616 C CG2 . VAL A 1 205 ? 20.862  -34.047 5.476   1.00 32.79 ? 205 VAL A CG2 1 
ATOM   1617 N N   . VAL A 1 206 ? 18.472  -32.267 9.015   1.00 33.27 ? 206 VAL A N   1 
ATOM   1618 C CA  . VAL A 1 206 ? 17.691  -31.227 9.698   1.00 32.43 ? 206 VAL A CA  1 
ATOM   1619 C C   . VAL A 1 206 ? 17.710  -29.945 8.871   1.00 31.89 ? 206 VAL A C   1 
ATOM   1620 O O   . VAL A 1 206 ? 18.779  -29.400 8.600   1.00 31.25 ? 206 VAL A O   1 
ATOM   1621 C CB  . VAL A 1 206 ? 18.196  -30.990 11.147  1.00 32.69 ? 206 VAL A CB  1 
ATOM   1622 C CG1 . VAL A 1 206 ? 17.505  -29.812 11.821  1.00 30.48 ? 206 VAL A CG1 1 
ATOM   1623 C CG2 . VAL A 1 206 ? 18.014  -32.264 11.969  1.00 33.59 ? 206 VAL A CG2 1 
ATOM   1624 N N   . LYS A 1 207 ? 16.517  -29.498 8.479   1.00 31.46 ? 207 LYS A N   1 
ATOM   1625 C CA  . LYS A 1 207 ? 16.340  -28.306 7.647   1.00 31.56 ? 207 LYS A CA  1 
ATOM   1626 C C   . LYS A 1 207 ? 15.804  -27.106 8.434   1.00 31.22 ? 207 LYS A C   1 
ATOM   1627 O O   . LYS A 1 207 ? 14.694  -27.150 8.960   1.00 31.69 ? 207 LYS A O   1 
ATOM   1628 C CB  . LYS A 1 207 ? 15.368  -28.596 6.477   1.00 31.52 ? 207 LYS A CB  1 
ATOM   1629 C CG  . LYS A 1 207 ? 15.721  -29.767 5.529   1.00 30.97 ? 207 LYS A CG  1 
ATOM   1630 C CD  . LYS A 1 207 ? 14.431  -30.384 4.985   1.00 31.65 ? 207 LYS A CD  1 
ATOM   1631 C CE  . LYS A 1 207 ? 14.538  -31.877 4.650   1.00 34.00 ? 207 LYS A CE  1 
ATOM   1632 N NZ  . LYS A 1 207 ? 14.717  -32.750 5.853   1.00 33.74 ? 207 LYS A NZ  1 
ATOM   1633 N N   . VAL A 1 208 ? 16.565  -26.021 8.468   1.00 30.70 ? 208 VAL A N   1 
ATOM   1634 C CA  . VAL A 1 208 ? 16.107  -24.780 9.075   1.00 30.44 ? 208 VAL A CA  1 
ATOM   1635 C C   . VAL A 1 208 ? 15.979  -23.674 8.042   1.00 30.34 ? 208 VAL A C   1 
ATOM   1636 O O   . VAL A 1 208 ? 16.971  -23.344 7.372   1.00 30.10 ? 208 VAL A O   1 
ATOM   1637 C CB  . VAL A 1 208 ? 17.083  -24.309 10.179  1.00 30.82 ? 208 VAL A CB  1 
ATOM   1638 C CG1 . VAL A 1 208 ? 16.684  -22.934 10.739  1.00 29.77 ? 208 VAL A CG1 1 
ATOM   1639 C CG2 . VAL A 1 208 ? 17.149  -25.355 11.280  1.00 31.60 ? 208 VAL A CG2 1 
ATOM   1640 N N   . ALA A 1 209 ? 14.774  -23.099 7.945   1.00 29.63 ? 209 ALA A N   1 
ATOM   1641 C CA  . ALA A 1 209 ? 14.467  -21.994 7.030   1.00 29.44 ? 209 ALA A CA  1 
ATOM   1642 C C   . ALA A 1 209 ? 14.792  -20.674 7.681   1.00 29.79 ? 209 ALA A C   1 
ATOM   1643 O O   . ALA A 1 209 ? 14.404  -20.436 8.838   1.00 30.14 ? 209 ALA A O   1 
ATOM   1644 C CB  . ALA A 1 209 ? 13.009  -22.014 6.655   1.00 29.08 ? 209 ALA A CB  1 
ATOM   1645 N N   . ALA A 1 210 ? 15.482  -19.798 6.961   1.00 29.31 ? 210 ALA A N   1 
ATOM   1646 C CA  . ALA A 1 210 ? 15.816  -18.505 7.554   1.00 28.99 ? 210 ALA A CA  1 
ATOM   1647 C C   . ALA A 1 210 ? 15.493  -17.276 6.671   1.00 29.42 ? 210 ALA A C   1 
ATOM   1648 O O   . ALA A 1 210 ? 15.263  -17.388 5.456   1.00 28.12 ? 210 ALA A O   1 
ATOM   1649 C CB  . ALA A 1 210 ? 17.249  -18.490 8.006   1.00 28.37 ? 210 ALA A CB  1 
ATOM   1650 N N   . SER A 1 211 ? 15.493  -16.102 7.310   1.00 30.47 ? 211 SER A N   1 
ATOM   1651 C CA  . SER A 1 211 ? 15.257  -14.816 6.634   1.00 31.16 ? 211 SER A CA  1 
ATOM   1652 C C   . SER A 1 211 ? 13.811  -14.748 6.120   1.00 31.64 ? 211 SER A C   1 
ATOM   1653 O O   . SER A 1 211 ? 13.273  -15.708 5.602   1.00 32.15 ? 211 SER A O   1 
ATOM   1654 C CB  . SER A 1 211 ? 16.267  -14.604 5.491   1.00 31.41 ? 211 SER A CB  1 
ATOM   1655 O OG  . SER A 1 211 ? 17.584  -15.098 5.800   1.00 30.79 ? 211 SER A OG  1 
ATOM   1656 N N   . GLY A 1 212 ? 13.147  -13.633 6.336   1.00 31.96 ? 212 GLY A N   1 
ATOM   1657 C CA  . GLY A 1 212 ? 11.871  -13.432 5.702   1.00 31.76 ? 212 GLY A CA  1 
ATOM   1658 C C   . GLY A 1 212 ? 10.635  -13.993 6.350   1.00 32.34 ? 212 GLY A C   1 
ATOM   1659 O O   . GLY A 1 212 ? 9.543   -13.620 5.937   1.00 32.75 ? 212 GLY A O   1 
ATOM   1660 N N   . ILE A 1 213 ? 10.759  -14.874 7.348   1.00 32.58 ? 213 ILE A N   1 
ATOM   1661 C CA  . ILE A 1 213 ? 9.558   -15.493 7.952   1.00 32.68 ? 213 ILE A CA  1 
ATOM   1662 C C   . ILE A 1 213 ? 8.873   -14.535 8.946   1.00 32.98 ? 213 ILE A C   1 
ATOM   1663 O O   . ILE A 1 213 ? 9.545   -13.888 9.739   1.00 32.05 ? 213 ILE A O   1 
ATOM   1664 C CB  . ILE A 1 213 ? 9.856   -16.848 8.647   1.00 33.07 ? 213 ILE A CB  1 
ATOM   1665 C CG1 . ILE A 1 213 ? 10.841  -17.682 7.837   1.00 32.74 ? 213 ILE A CG1 1 
ATOM   1666 C CG2 . ILE A 1 213 ? 8.575   -17.641 8.874   1.00 32.65 ? 213 ILE A CG2 1 
ATOM   1667 C CD1 . ILE A 1 213 ? 11.670  -18.531 8.716   1.00 33.12 ? 213 ILE A CD1 1 
ATOM   1668 N N   . SER A 1 214 ? 7.540   -14.448 8.902   1.00 33.65 ? 214 SER A N   1 
ATOM   1669 C CA  . SER A 1 214 ? 6.832   -13.440 9.688   1.00 34.06 ? 214 SER A CA  1 
ATOM   1670 C C   . SER A 1 214 ? 5.425   -13.797 10.153  1.00 34.32 ? 214 SER A C   1 
ATOM   1671 O O   . SER A 1 214 ? 4.740   -12.936 10.700  1.00 34.31 ? 214 SER A O   1 
ATOM   1672 C CB  . SER A 1 214 ? 6.788   -12.107 8.933   1.00 34.11 ? 214 SER A CB  1 
ATOM   1673 O OG  . SER A 1 214 ? 5.714   -12.086 7.996   1.00 36.46 ? 214 SER A OG  1 
ATOM   1674 N N   . GLU A 1 215 ? 4.975   -15.036 9.958   1.00 34.71 ? 215 GLU A N   1 
ATOM   1675 C CA  . GLU A 1 215 ? 3.624   -15.387 10.419  1.00 35.51 ? 215 GLU A CA  1 
ATOM   1676 C C   . GLU A 1 215 ? 3.350   -16.877 10.437  1.00 36.07 ? 215 GLU A C   1 
ATOM   1677 O O   . GLU A 1 215 ? 3.880   -17.612 9.621   1.00 36.45 ? 215 GLU A O   1 
ATOM   1678 C CB  . GLU A 1 215 ? 2.548   -14.629 9.620   1.00 35.50 ? 215 GLU A CB  1 
ATOM   1679 C CG  . GLU A 1 215 ? 2.644   -14.840 8.137   1.00 36.13 ? 215 GLU A CG  1 
ATOM   1680 C CD  . GLU A 1 215 ? 1.625   -14.067 7.345   1.00 38.32 ? 215 GLU A CD  1 
ATOM   1681 O OE1 . GLU A 1 215 ? 0.840   -14.749 6.654   1.00 41.80 ? 215 GLU A OE1 1 
ATOM   1682 O OE2 . GLU A 1 215 ? 1.613   -12.808 7.378   1.00 37.73 ? 215 GLU A OE2 1 
ATOM   1683 N N   . ARG A 1 216 ? 2.520   -17.326 11.383  1.00 36.73 ? 216 ARG A N   1 
ATOM   1684 C CA  . ARG A 1 216 ? 2.290   -18.764 11.584  1.00 37.07 ? 216 ARG A CA  1 
ATOM   1685 C C   . ARG A 1 216 ? 1.896   -19.520 10.314  1.00 37.18 ? 216 ARG A C   1 
ATOM   1686 O O   . ARG A 1 216 ? 2.159   -20.716 10.206  1.00 37.84 ? 216 ARG A O   1 
ATOM   1687 C CB  . ARG A 1 216 ? 1.266   -19.035 12.705  1.00 36.72 ? 216 ARG A CB  1 
ATOM   1688 N N   . ASN A 1 217 ? 1.238   -18.854 9.374   1.00 37.80 ? 217 ASN A N   1 
ATOM   1689 C CA  . ASN A 1 217 ? 0.793   -19.554 8.164   1.00 38.40 ? 217 ASN A CA  1 
ATOM   1690 C C   . ASN A 1 217 ? 1.982   -19.967 7.321   1.00 38.08 ? 217 ASN A C   1 
ATOM   1691 O O   . ASN A 1 217 ? 2.026   -21.099 6.847   1.00 38.14 ? 217 ASN A O   1 
ATOM   1692 C CB  . ASN A 1 217 ? -0.236  -18.774 7.342   1.00 38.72 ? 217 ASN A CB  1 
ATOM   1693 C CG  . ASN A 1 217 ? -1.651  -18.948 7.868   1.00 42.42 ? 217 ASN A CG  1 
ATOM   1694 O OD1 . ASN A 1 217 ? -2.003  -19.998 8.425   1.00 47.11 ? 217 ASN A OD1 1 
ATOM   1695 N ND2 . ASN A 1 217 ? -2.473  -17.907 7.717   1.00 44.73 ? 217 ASN A ND2 1 
ATOM   1696 N N   . GLU A 1 218 ? 2.943   -19.054 7.157   1.00 37.27 ? 218 GLU A N   1 
ATOM   1697 C CA  . GLU A 1 218 ? 4.212   -19.377 6.521   1.00 36.83 ? 218 GLU A CA  1 
ATOM   1698 C C   . GLU A 1 218 ? 4.885   -20.568 7.190   1.00 36.00 ? 218 GLU A C   1 
ATOM   1699 O O   . GLU A 1 218 ? 5.252   -21.530 6.513   1.00 35.17 ? 218 GLU A O   1 
ATOM   1700 C CB  . GLU A 1 218 ? 5.169   -18.233 6.654   1.00 36.94 ? 218 GLU A CB  1 
ATOM   1701 C CG  . GLU A 1 218 ? 5.099   -17.225 5.624   1.00 39.64 ? 218 GLU A CG  1 
ATOM   1702 C CD  . GLU A 1 218 ? 6.392   -16.447 5.603   1.00 43.01 ? 218 GLU A CD  1 
ATOM   1703 O OE1 . GLU A 1 218 ? 7.142   -16.614 4.605   1.00 44.11 ? 218 GLU A OE1 1 
ATOM   1704 O OE2 . GLU A 1 218 ? 6.664   -15.720 6.599   1.00 41.03 ? 218 GLU A OE2 1 
ATOM   1705 N N   . ILE A 1 219 ? 5.075   -20.468 8.510   1.00 35.10 ? 219 ILE A N   1 
ATOM   1706 C CA  . ILE A 1 219 ? 5.672   -21.536 9.287   1.00 34.95 ? 219 ILE A CA  1 
ATOM   1707 C C   . ILE A 1 219 ? 4.923   -22.836 9.020   1.00 35.46 ? 219 ILE A C   1 
ATOM   1708 O O   . ILE A 1 219 ? 5.569   -23.854 8.790   1.00 35.03 ? 219 ILE A O   1 
ATOM   1709 C CB  . ILE A 1 219 ? 5.735   -21.213 10.826  1.00 35.09 ? 219 ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 219 ? 6.930   -20.298 11.149  1.00 34.38 ? 219 ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 219 ? 5.805   -22.497 11.660  1.00 34.05 ? 219 ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 219 ? 6.863   -19.590 12.505  1.00 31.66 ? 219 ILE A CD1 1 
ATOM   1713 N N   . GLU A 1 220 ? 3.585   -22.793 9.018   1.00 36.04 ? 220 GLU A N   1 
ATOM   1714 C CA  . GLU A 1 220 ? 2.788   -23.990 8.762   1.00 37.84 ? 220 GLU A CA  1 
ATOM   1715 C C   . GLU A 1 220 ? 2.978   -24.543 7.349   1.00 38.49 ? 220 GLU A C   1 
ATOM   1716 O O   . GLU A 1 220 ? 3.132   -25.752 7.170   1.00 39.64 ? 220 GLU A O   1 
ATOM   1717 C CB  . GLU A 1 220 ? 1.297   -23.810 9.115   1.00 38.29 ? 220 GLU A CB  1 
ATOM   1718 C CG  . GLU A 1 220 ? 0.923   -24.310 10.529  1.00 39.11 ? 220 GLU A CG  1 
ATOM   1719 N N   . GLU A 1 221 ? 3.012   -23.669 6.357   1.00 38.85 ? 221 GLU A N   1 
ATOM   1720 C CA  . GLU A 1 221 ? 3.246   -24.094 4.986   1.00 39.65 ? 221 GLU A CA  1 
ATOM   1721 C C   . GLU A 1 221 ? 4.621   -24.761 4.866   1.00 39.38 ? 221 GLU A C   1 
ATOM   1722 O O   . GLU A 1 221 ? 4.744   -25.822 4.252   1.00 39.93 ? 221 GLU A O   1 
ATOM   1723 C CB  . GLU A 1 221 ? 3.064   -22.926 4.003   1.00 40.08 ? 221 GLU A CB  1 
ATOM   1724 C CG  . GLU A 1 221 ? 1.802   -22.043 4.338   1.00 43.35 ? 221 GLU A CG  1 
ATOM   1725 C CD  . GLU A 1 221 ? 1.074   -21.427 3.134   1.00 47.26 ? 221 GLU A CD  1 
ATOM   1726 O OE1 . GLU A 1 221 ? 1.336   -21.832 1.989   1.00 47.94 ? 221 GLU A OE1 1 
ATOM   1727 O OE2 . GLU A 1 221 ? 0.212   -20.536 3.347   1.00 50.60 ? 221 GLU A OE2 1 
ATOM   1728 N N   . LEU A 1 222 ? 5.636   -24.178 5.500   1.00 38.33 ? 222 LEU A N   1 
ATOM   1729 C CA  . LEU A 1 222 ? 6.981   -24.676 5.359   1.00 37.59 ? 222 LEU A CA  1 
ATOM   1730 C C   . LEU A 1 222 ? 7.180   -25.998 6.106   1.00 37.61 ? 222 LEU A C   1 
ATOM   1731 O O   . LEU A 1 222 ? 7.992   -26.840 5.694   1.00 37.44 ? 222 LEU A O   1 
ATOM   1732 C CB  . LEU A 1 222 ? 8.007   -23.617 5.768   1.00 37.35 ? 222 LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 222 ? 8.279   -22.529 4.705   1.00 37.51 ? 222 LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 222 ? 8.545   -21.139 5.362   1.00 36.21 ? 222 LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 222 ? 9.405   -22.896 3.689   1.00 33.65 ? 222 LEU A CD2 1 
ATOM   1736 N N   . ARG A 1 223 ? 6.420   -26.187 7.184   1.00 37.33 ? 223 ARG A N   1 
ATOM   1737 C CA  . ARG A 1 223 ? 6.477   -27.425 7.970   1.00 36.75 ? 223 ARG A CA  1 
ATOM   1738 C C   . ARG A 1 223 ? 5.918   -28.552 7.110   1.00 35.82 ? 223 ARG A C   1 
ATOM   1739 O O   . ARG A 1 223 ? 6.500   -29.622 7.076   1.00 35.84 ? 223 ARG A O   1 
ATOM   1740 C CB  . ARG A 1 223 ? 5.762   -27.278 9.349   1.00 37.15 ? 223 ARG A CB  1 
ATOM   1741 C CG  . ARG A 1 223 ? 5.842   -28.517 10.316  1.00 38.94 ? 223 ARG A CG  1 
ATOM   1742 C CD  . ARG A 1 223 ? 7.076   -28.573 11.277  1.00 41.12 ? 223 ARG A CD  1 
ATOM   1743 N NE  . ARG A 1 223 ? 7.137   -29.858 12.002  1.00 41.42 ? 223 ARG A NE  1 
ATOM   1744 C CZ  . ARG A 1 223 ? 7.892   -30.912 11.664  1.00 40.89 ? 223 ARG A CZ  1 
ATOM   1745 N NH1 . ARG A 1 223 ? 8.697   -30.880 10.610  1.00 40.47 ? 223 ARG A NH1 1 
ATOM   1746 N NH2 . ARG A 1 223 ? 7.845   -32.023 12.386  1.00 40.94 ? 223 ARG A NH2 1 
ATOM   1747 N N   . LYS A 1 224 ? 4.827   -28.299 6.379   1.00 35.34 ? 224 LYS A N   1 
ATOM   1748 C CA  . LYS A 1 224 ? 4.226   -29.318 5.491   1.00 34.83 ? 224 LYS A CA  1 
ATOM   1749 C C   . LYS A 1 224 ? 5.222   -29.761 4.395   1.00 34.31 ? 224 LYS A C   1 
ATOM   1750 O O   . LYS A 1 224 ? 5.231   -30.921 3.964   1.00 33.49 ? 224 LYS A O   1 
ATOM   1751 C CB  . LYS A 1 224 ? 2.920   -28.818 4.854   1.00 34.96 ? 224 LYS A CB  1 
ATOM   1752 C CG  . LYS A 1 224 ? 1.762   -28.547 5.836   1.00 35.31 ? 224 LYS A CG  1 
ATOM   1753 N N   . LEU A 1 225 ? 6.049   -28.812 3.961   1.00 33.68 ? 225 LEU A N   1 
ATOM   1754 C CA  . LEU A 1 225 ? 7.106   -29.070 2.994   1.00 33.67 ? 225 LEU A CA  1 
ATOM   1755 C C   . LEU A 1 225 ? 8.313   -29.788 3.579   1.00 32.91 ? 225 LEU A C   1 
ATOM   1756 O O   . LEU A 1 225 ? 9.249   -30.077 2.864   1.00 33.18 ? 225 LEU A O   1 
ATOM   1757 C CB  . LEU A 1 225 ? 7.523   -27.771 2.274   1.00 33.82 ? 225 LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 225 ? 6.431   -27.212 1.325   1.00 34.90 ? 225 LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 225 ? 6.881   -25.895 0.691   1.00 35.88 ? 225 LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 225 ? 5.969   -28.190 0.226   1.00 33.70 ? 225 LEU A CD2 1 
ATOM   1761 N N   . GLY A 1 226 ? 8.289   -30.078 4.875   1.00 32.33 ? 226 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 226 ? 9.350   -30.832 5.485   1.00 31.41 ? 226 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 226 ? 10.300  -30.020 6.335   1.00 31.79 ? 226 GLY A C   1 
ATOM   1764 O O   . GLY A 1 226 ? 11.218  -30.588 6.936   1.00 31.71 ? 226 GLY A O   1 
ATOM   1765 N N   . VAL A 1 227 ? 10.101  -28.701 6.422   1.00 31.38 ? 227 VAL A N   1 
ATOM   1766 C CA  . VAL A 1 227 ? 11.010  -27.889 7.248   1.00 30.89 ? 227 VAL A CA  1 
ATOM   1767 C C   . VAL A 1 227 ? 10.885  -28.270 8.739   1.00 30.35 ? 227 VAL A C   1 
ATOM   1768 O O   . VAL A 1 227 ? 9.784   -28.420 9.258   1.00 29.78 ? 227 VAL A O   1 
ATOM   1769 C CB  . VAL A 1 227 ? 10.826  -26.344 7.041   1.00 31.34 ? 227 VAL A CB  1 
ATOM   1770 C CG1 . VAL A 1 227 ? 11.797  -25.541 7.915   1.00 31.33 ? 227 VAL A CG1 1 
ATOM   1771 C CG2 . VAL A 1 227 ? 11.015  -25.939 5.587   1.00 30.64 ? 227 VAL A CG2 1 
ATOM   1772 N N   . ASN A 1 228 ? 12.032  -28.422 9.397   1.00 30.19 ? 228 ASN A N   1 
ATOM   1773 C CA  . ASN A 1 228 ? 12.135  -28.749 10.829  1.00 30.46 ? 228 ASN A CA  1 
ATOM   1774 C C   . ASN A 1 228 ? 12.031  -27.578 11.812  1.00 29.97 ? 228 ASN A C   1 
ATOM   1775 O O   . ASN A 1 228 ? 11.200  -27.604 12.712  1.00 30.38 ? 228 ASN A O   1 
ATOM   1776 C CB  . ASN A 1 228 ? 13.435  -29.493 11.097  1.00 30.67 ? 228 ASN A CB  1 
ATOM   1777 C CG  . ASN A 1 228 ? 13.488  -30.848 10.396  1.00 32.74 ? 228 ASN A CG  1 
ATOM   1778 O OD1 . ASN A 1 228 ? 14.427  -31.127 9.645   1.00 35.01 ? 228 ASN A OD1 1 
ATOM   1779 N ND2 . ASN A 1 228 ? 12.480  -31.686 10.631  1.00 30.34 ? 228 ASN A ND2 1 
ATOM   1780 N N   . ALA A 1 229 ? 12.886  -26.568 11.658  1.00 29.83 ? 229 ALA A N   1 
ATOM   1781 C CA  . ALA A 1 229 ? 12.849  -25.348 12.511  1.00 29.05 ? 229 ALA A CA  1 
ATOM   1782 C C   . ALA A 1 229 ? 12.966  -24.044 11.712  1.00 28.59 ? 229 ALA A C   1 
ATOM   1783 O O   . ALA A 1 229 ? 13.143  -24.059 10.503  1.00 27.86 ? 229 ALA A O   1 
ATOM   1784 C CB  . ALA A 1 229 ? 13.906  -25.410 13.612  1.00 28.01 ? 229 ALA A CB  1 
ATOM   1785 N N   . PHE A 1 230 ? 12.869  -22.913 12.402  1.00 29.00 ? 230 PHE A N   1 
ATOM   1786 C CA  . PHE A 1 230 ? 12.742  -21.620 11.733  1.00 28.95 ? 230 PHE A CA  1 
ATOM   1787 C C   . PHE A 1 230 ? 13.605  -20.556 12.409  1.00 28.66 ? 230 PHE A C   1 
ATOM   1788 O O   . PHE A 1 230 ? 13.350  -20.221 13.583  1.00 29.09 ? 230 PHE A O   1 
ATOM   1789 C CB  . PHE A 1 230 ? 11.265  -21.224 11.747  1.00 29.10 ? 230 PHE A CB  1 
ATOM   1790 C CG  . PHE A 1 230 ? 10.387  -22.249 11.132  1.00 30.96 ? 230 PHE A CG  1 
ATOM   1791 C CD1 . PHE A 1 230 ? 10.056  -23.416 11.828  1.00 33.98 ? 230 PHE A CD1 1 
ATOM   1792 C CD2 . PHE A 1 230 ? 9.943   -22.106 9.834   1.00 31.52 ? 230 PHE A CD2 1 
ATOM   1793 C CE1 . PHE A 1 230 ? 9.272   -24.412 11.240  1.00 32.98 ? 230 PHE A CE1 1 
ATOM   1794 C CE2 . PHE A 1 230 ? 9.133   -23.082 9.245   1.00 32.66 ? 230 PHE A CE2 1 
ATOM   1795 C CZ  . PHE A 1 230 ? 8.808   -24.237 9.941   1.00 32.68 ? 230 PHE A CZ  1 
ATOM   1796 N N   . GLU A 1 231 ? 14.637  -20.069 11.701  1.00 27.46 ? 231 GLU A N   1 
ATOM   1797 C CA  . GLU A 1 231 ? 15.454  -18.935 12.163  1.00 26.88 ? 231 GLU A CA  1 
ATOM   1798 C C   . GLU A 1 231 ? 14.660  -17.661 11.928  1.00 26.17 ? 231 GLU A C   1 
ATOM   1799 O O   . GLU A 1 231 ? 14.352  -17.303 10.804  1.00 25.69 ? 231 GLU A O   1 
ATOM   1800 C CB  . GLU A 1 231 ? 16.852  -18.871 11.484  1.00 27.00 ? 231 GLU A CB  1 
ATOM   1801 C CG  . GLU A 1 231 ? 17.667  -17.602 11.821  1.00 29.19 ? 231 GLU A CG  1 
ATOM   1802 C CD  . GLU A 1 231 ? 18.987  -17.426 11.021  1.00 33.58 ? 231 GLU A CD  1 
ATOM   1803 O OE1 . GLU A 1 231 ? 19.898  -18.275 11.135  1.00 33.51 ? 231 GLU A OE1 1 
ATOM   1804 O OE2 . GLU A 1 231 ? 19.141  -16.394 10.312  1.00 35.08 ? 231 GLU A OE2 1 
ATOM   1805 N N   . ILE A 1 232 ? 14.308  -16.992 13.012  1.00 26.52 ? 232 ILE A N   1 
ATOM   1806 C CA  . ILE A 1 232 ? 13.552  -15.746 12.933  1.00 26.80 ? 232 ILE A CA  1 
ATOM   1807 C C   . ILE A 1 232 ? 14.321  -14.624 13.640  1.00 27.01 ? 232 ILE A C   1 
ATOM   1808 O O   . ILE A 1 232 ? 14.738  -14.759 14.808  1.00 27.53 ? 232 ILE A O   1 
ATOM   1809 C CB  . ILE A 1 232 ? 12.113  -15.917 13.483  1.00 26.57 ? 232 ILE A CB  1 
ATOM   1810 C CG1 . ILE A 1 232 ? 11.441  -17.144 12.831  1.00 26.85 ? 232 ILE A CG1 1 
ATOM   1811 C CG2 . ILE A 1 232 ? 11.305  -14.630 13.256  1.00 26.56 ? 232 ILE A CG2 1 
ATOM   1812 C CD1 . ILE A 1 232 ? 9.925   -17.077 12.730  1.00 25.89 ? 232 ILE A CD1 1 
ATOM   1813 N N   . GLY A 1 233 ? 14.540  -13.530 12.924  1.00 26.73 ? 233 GLY A N   1 
ATOM   1814 C CA  . GLY A 1 233 ? 15.477  -12.522 13.411  1.00 26.97 ? 233 GLY A CA  1 
ATOM   1815 C C   . GLY A 1 233 ? 14.908  -11.196 13.854  1.00 27.35 ? 233 GLY A C   1 
ATOM   1816 O O   . GLY A 1 233 ? 14.189  -11.107 14.840  1.00 27.32 ? 233 GLY A O   1 
ATOM   1817 N N   . SER A 1 234 ? 15.259  -10.159 13.109  1.00 27.83 ? 234 SER A N   1 
ATOM   1818 C CA  . SER A 1 234 ? 14.826  -8.790  13.366  1.00 28.66 ? 234 SER A CA  1 
ATOM   1819 C C   . SER A 1 234 ? 13.370  -8.515  13.922  1.00 29.13 ? 234 SER A C   1 
ATOM   1820 O O   . SER A 1 234 ? 13.168  -7.563  14.687  1.00 29.08 ? 234 SER A O   1 
ATOM   1821 C CB  . SER A 1 234 ? 15.122  -7.958  12.115  1.00 28.05 ? 234 SER A CB  1 
ATOM   1822 O OG  . SER A 1 234 ? 16.489  -7.561  12.092  1.00 28.41 ? 234 SER A OG  1 
ATOM   1823 N N   . SER A 1 235 ? 12.360  -9.294  13.540  1.00 29.12 ? 235 SER A N   1 
ATOM   1824 C CA  . SER A 1 235 ? 11.009  -8.974  14.013  1.00 29.68 ? 235 SER A CA  1 
ATOM   1825 C C   . SER A 1 235 ? 10.857  -9.325  15.528  1.00 30.49 ? 235 SER A C   1 
ATOM   1826 O O   . SER A 1 235 ? 10.204  -8.576  16.297  1.00 30.65 ? 235 SER A O   1 
ATOM   1827 C CB  . SER A 1 235 ? 9.964   -9.681  13.178  1.00 28.87 ? 235 SER A CB  1 
ATOM   1828 O OG  . SER A 1 235 ? 10.167  -11.066 13.293  1.00 31.91 ? 235 SER A OG  1 
ATOM   1829 N N   . LEU A 1 236 ? 11.470  -10.453 15.932  1.00 29.72 ? 236 LEU A N   1 
ATOM   1830 C CA  . LEU A 1 236 ? 11.634  -10.801 17.323  1.00 28.52 ? 236 LEU A CA  1 
ATOM   1831 C C   . LEU A 1 236 ? 12.504  -9.795  18.079  1.00 28.91 ? 236 LEU A C   1 
ATOM   1832 O O   . LEU A 1 236 ? 12.203  -9.471  19.209  1.00 28.86 ? 236 LEU A O   1 
ATOM   1833 C CB  . LEU A 1 236 ? 12.162  -12.209 17.456  1.00 27.23 ? 236 LEU A CB  1 
ATOM   1834 C CG  . LEU A 1 236 ? 11.223  -13.301 16.931  1.00 27.16 ? 236 LEU A CG  1 
ATOM   1835 C CD1 . LEU A 1 236 ? 11.800  -14.687 17.141  1.00 25.79 ? 236 LEU A CD1 1 
ATOM   1836 C CD2 . LEU A 1 236 ? 9.807   -13.245 17.505  1.00 29.38 ? 236 LEU A CD2 1 
ATOM   1837 N N   . MET A 1 237 ? 13.562  -9.274  17.471  1.00 30.01 ? 237 MET A N   1 
ATOM   1838 C CA  . MET A 1 237 ? 14.315  -8.183  18.109  1.00 30.78 ? 237 MET A CA  1 
ATOM   1839 C C   . MET A 1 237 ? 13.408  -6.995  18.388  1.00 31.57 ? 237 MET A C   1 
ATOM   1840 O O   . MET A 1 237 ? 13.507  -6.403  19.460  1.00 31.87 ? 237 MET A O   1 
ATOM   1841 C CB  . MET A 1 237 ? 15.485  -7.683  17.266  1.00 30.42 ? 237 MET A CB  1 
ATOM   1842 C CG  . MET A 1 237 ? 16.703  -8.588  17.151  1.00 31.37 ? 237 MET A CG  1 
ATOM   1843 S SD  . MET A 1 237 ? 17.706  -8.826  18.625  1.00 31.05 ? 237 MET A SD  1 
ATOM   1844 C CE  . MET A 1 237 ? 18.014  -7.138  19.195  1.00 28.32 ? 237 MET A CE  1 
ATOM   1845 N N   . ARG A 1 238 ? 12.560  -6.632  17.420  1.00 32.61 ? 238 ARG A N   1 
ATOM   1846 C CA  . ARG A 1 238 ? 11.611  -5.513  17.569  1.00 33.88 ? 238 ARG A CA  1 
ATOM   1847 C C   . ARG A 1 238 ? 10.576  -5.844  18.620  1.00 34.69 ? 238 ARG A C   1 
ATOM   1848 O O   . ARG A 1 238 ? 10.345  -5.061  19.539  1.00 35.93 ? 238 ARG A O   1 
ATOM   1849 C CB  . ARG A 1 238 ? 10.809  -5.167  16.276  1.00 34.09 ? 238 ARG A CB  1 
ATOM   1850 C CG  . ARG A 1 238 ? 11.518  -4.909  14.931  1.00 34.09 ? 238 ARG A CG  1 
ATOM   1851 C CD  . ARG A 1 238 ? 12.742  -4.053  15.032  1.00 34.39 ? 238 ARG A CD  1 
ATOM   1852 N NE  . ARG A 1 238 ? 12.656  -2.628  14.665  1.00 35.84 ? 238 ARG A NE  1 
ATOM   1853 C CZ  . ARG A 1 238 ? 11.577  -1.917  14.352  1.00 34.54 ? 238 ARG A CZ  1 
ATOM   1854 N NH1 . ARG A 1 238 ? 10.352  -2.439  14.304  1.00 34.83 ? 238 ARG A NH1 1 
ATOM   1855 N NH2 . ARG A 1 238 ? 11.753  -0.639  14.094  1.00 32.43 ? 238 ARG A NH2 1 
ATOM   1856 N N   . ASN A 1 239 ? 9.932   -6.992  18.464  1.00 34.86 ? 239 ASN A N   1 
ATOM   1857 C CA  . ASN A 1 239 ? 8.764   -7.305  19.227  1.00 36.19 ? 239 ASN A CA  1 
ATOM   1858 C C   . ASN A 1 239 ? 8.940   -8.712  19.766  1.00 36.38 ? 239 ASN A C   1 
ATOM   1859 O O   . ASN A 1 239 ? 8.441   -9.674  19.171  1.00 36.86 ? 239 ASN A O   1 
ATOM   1860 C CB  . ASN A 1 239 ? 7.522   -7.202  18.330  1.00 36.76 ? 239 ASN A CB  1 
ATOM   1861 C CG  . ASN A 1 239 ? 6.240   -7.724  19.007  1.00 40.79 ? 239 ASN A CG  1 
ATOM   1862 O OD1 . ASN A 1 239 ? 6.246   -8.132  20.181  1.00 45.60 ? 239 ASN A OD1 1 
ATOM   1863 N ND2 . ASN A 1 239 ? 5.125   -7.701  18.264  1.00 44.48 ? 239 ASN A ND2 1 
ATOM   1864 N N   . PRO A 1 240 ? 9.667   -8.852  20.890  1.00 36.38 ? 240 PRO A N   1 
ATOM   1865 C CA  . PRO A 1 240 ? 10.004  -10.237 21.266  1.00 36.18 ? 240 PRO A CA  1 
ATOM   1866 C C   . PRO A 1 240 ? 8.804   -11.143 21.514  1.00 36.05 ? 240 PRO A C   1 
ATOM   1867 O O   . PRO A 1 240 ? 8.892   -12.350 21.301  1.00 35.69 ? 240 PRO A O   1 
ATOM   1868 C CB  . PRO A 1 240 ? 10.891  -10.055 22.500  1.00 35.66 ? 240 PRO A CB  1 
ATOM   1869 C CG  . PRO A 1 240 ? 11.559  -8.734  22.224  1.00 35.23 ? 240 PRO A CG  1 
ATOM   1870 C CD  . PRO A 1 240 ? 10.526  -7.871  21.580  1.00 35.30 ? 240 PRO A CD  1 
ATOM   1871 N N   . GLU A 1 241 ? 7.674   -10.566 21.889  1.00 36.71 ? 241 GLU A N   1 
ATOM   1872 C CA  . GLU A 1 241 ? 6.520   -11.397 22.232  1.00 37.35 ? 241 GLU A CA  1 
ATOM   1873 C C   . GLU A 1 241 ? 5.684   -11.874 21.028  1.00 37.12 ? 241 GLU A C   1 
ATOM   1874 O O   . GLU A 1 241 ? 4.664   -12.537 21.198  1.00 36.53 ? 241 GLU A O   1 
ATOM   1875 C CB  . GLU A 1 241 ? 5.683   -10.808 23.392  1.00 37.67 ? 241 GLU A CB  1 
ATOM   1876 C CG  . GLU A 1 241 ? 5.234   -9.347  23.283  1.00 40.99 ? 241 GLU A CG  1 
ATOM   1877 C CD  . GLU A 1 241 ? 4.595   -8.806  24.600  1.00 44.86 ? 241 GLU A CD  1 
ATOM   1878 O OE1 . GLU A 1 241 ? 3.413   -8.390  24.558  1.00 45.07 ? 241 GLU A OE1 1 
ATOM   1879 O OE2 . GLU A 1 241 ? 5.280   -8.785  25.668  1.00 46.77 ? 241 GLU A OE2 1 
ATOM   1880 N N   . LYS A 1 242 ? 6.157   -11.588 19.817  1.00 37.00 ? 242 LYS A N   1 
ATOM   1881 C CA  . LYS A 1 242 ? 5.578   -12.214 18.613  1.00 37.25 ? 242 LYS A CA  1 
ATOM   1882 C C   . LYS A 1 242 ? 5.764   -13.750 18.610  1.00 37.08 ? 242 LYS A C   1 
ATOM   1883 O O   . LYS A 1 242 ? 5.050   -14.474 17.916  1.00 36.88 ? 242 LYS A O   1 
ATOM   1884 C CB  . LYS A 1 242 ? 6.125   -11.574 17.313  1.00 36.94 ? 242 LYS A CB  1 
ATOM   1885 N N   . ILE A 1 243 ? 6.697   -14.252 19.408  1.00 37.36 ? 243 ILE A N   1 
ATOM   1886 C CA  . ILE A 1 243 ? 7.067   -15.673 19.309  1.00 37.08 ? 243 ILE A CA  1 
ATOM   1887 C C   . ILE A 1 243 ? 5.994   -16.592 19.916  1.00 37.32 ? 243 ILE A C   1 
ATOM   1888 O O   . ILE A 1 243 ? 5.852   -17.759 19.508  1.00 37.41 ? 243 ILE A O   1 
ATOM   1889 C CB  . ILE A 1 243 ? 8.515   -15.950 19.854  1.00 36.62 ? 243 ILE A CB  1 
ATOM   1890 C CG1 . ILE A 1 243 ? 8.964   -17.361 19.490  1.00 35.98 ? 243 ILE A CG1 1 
ATOM   1891 C CG2 . ILE A 1 243 ? 8.633   -15.665 21.359  1.00 35.73 ? 243 ILE A CG2 1 
ATOM   1892 C CD1 . ILE A 1 243 ? 10.379  -17.729 19.953  1.00 35.98 ? 243 ILE A CD1 1 
ATOM   1893 N N   . LYS A 1 244 ? 5.246   -16.053 20.884  1.00 37.72 ? 244 LYS A N   1 
ATOM   1894 C CA  . LYS A 1 244 ? 4.100   -16.752 21.489  1.00 37.71 ? 244 LYS A CA  1 
ATOM   1895 C C   . LYS A 1 244 ? 3.041   -16.959 20.433  1.00 37.57 ? 244 LYS A C   1 
ATOM   1896 O O   . LYS A 1 244 ? 2.531   -18.054 20.311  1.00 37.32 ? 244 LYS A O   1 
ATOM   1897 C CB  . LYS A 1 244 ? 3.528   -16.005 22.701  1.00 37.51 ? 244 LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 244 ? 4.293   -16.240 23.978  1.00 37.64 ? 244 LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 244 ? 3.908   -15.237 25.075  1.00 39.33 ? 244 LYS A CD  1 
ATOM   1900 N N   . GLU A 1 245 ? 2.749   -15.918 19.650  1.00 38.26 ? 245 GLU A N   1 
ATOM   1901 C CA  . GLU A 1 245 ? 1.897   -16.053 18.455  1.00 39.55 ? 245 GLU A CA  1 
ATOM   1902 C C   . GLU A 1 245 ? 2.442   -17.144 17.497  1.00 40.25 ? 245 GLU A C   1 
ATOM   1903 O O   . GLU A 1 245 ? 1.748   -18.128 17.167  1.00 40.54 ? 245 GLU A O   1 
ATOM   1904 C CB  . GLU A 1 245 ? 1.745   -14.704 17.728  1.00 39.14 ? 245 GLU A CB  1 
ATOM   1905 N N   . LEU A 1 246 ? 3.709   -16.984 17.113  1.00 40.37 ? 246 LEU A N   1 
ATOM   1906 C CA  . LEU A 1 246 ? 4.356   -17.855 16.154  1.00 40.69 ? 246 LEU A CA  1 
ATOM   1907 C C   . LEU A 1 246 ? 4.426   -19.338 16.538  1.00 41.92 ? 246 LEU A C   1 
ATOM   1908 O O   . LEU A 1 246 ? 4.359   -20.179 15.650  1.00 41.68 ? 246 LEU A O   1 
ATOM   1909 C CB  . LEU A 1 246 ? 5.746   -17.315 15.817  1.00 40.19 ? 246 LEU A CB  1 
ATOM   1910 C CG  . LEU A 1 246 ? 5.817   -16.046 14.968  1.00 38.34 ? 246 LEU A CG  1 
ATOM   1911 C CD1 . LEU A 1 246 ? 7.234   -15.518 14.943  1.00 37.84 ? 246 LEU A CD1 1 
ATOM   1912 C CD2 . LEU A 1 246 ? 5.307   -16.269 13.558  1.00 35.42 ? 246 LEU A CD2 1 
ATOM   1913 N N   . ILE A 1 247 ? 4.553   -19.669 17.830  1.00 43.61 ? 247 ILE A N   1 
ATOM   1914 C CA  . ILE A 1 247 ? 4.598   -21.098 18.246  1.00 45.02 ? 247 ILE A CA  1 
ATOM   1915 C C   . ILE A 1 247 ? 3.266   -21.870 18.420  1.00 46.08 ? 247 ILE A C   1 
ATOM   1916 O O   . ILE A 1 247 ? 3.305   -23.022 18.858  1.00 46.15 ? 247 ILE A O   1 
ATOM   1917 C CB  . ILE A 1 247 ? 5.449   -21.366 19.517  1.00 45.19 ? 247 ILE A CB  1 
ATOM   1918 C CG1 . ILE A 1 247 ? 4.859   -20.667 20.747  1.00 45.57 ? 247 ILE A CG1 1 
ATOM   1919 C CG2 . ILE A 1 247 ? 6.937   -21.079 19.287  1.00 44.96 ? 247 ILE A CG2 1 
ATOM   1920 C CD1 . ILE A 1 247 ? 5.162   -21.436 22.023  1.00 48.25 ? 247 ILE A CD1 1 
ATOM   1921 N N   . LEU A 1 248 ? 2.117   -21.269 18.081  1.00 47.45 ? 248 LEU A N   1 
ATOM   1922 C CA  . LEU A 1 248 ? 0.804   -21.967 18.198  1.00 48.42 ? 248 LEU A CA  1 
ATOM   1923 C C   . LEU A 1 248 ? 0.660   -23.198 17.286  1.00 48.81 ? 248 LEU A C   1 
ATOM   1924 O O   . LEU A 1 248 ? -0.315  -23.319 16.528  1.00 49.14 ? 248 LEU A O   1 
ATOM   1925 C CB  . LEU A 1 248 ? -0.361  -21.016 17.905  1.00 48.68 ? 248 LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 248 ? -0.549  -19.733 18.724  1.00 49.65 ? 248 LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 248 ? -1.851  -19.028 18.264  1.00 49.69 ? 248 LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 248 ? -0.492  -19.965 20.259  1.00 48.47 ? 248 LEU A CD2 1 
ATOM   1929 N N   . PRO B 1 2   ? -4.141  -7.962  3.282   1.00 35.36 ? 2   PRO B N   1 
ATOM   1930 C CA  . PRO B 1 2   ? -3.626  -6.652  3.739   1.00 34.75 ? 2   PRO B CA  1 
ATOM   1931 C C   . PRO B 1 2   ? -3.587  -6.523  5.273   1.00 34.48 ? 2   PRO B C   1 
ATOM   1932 O O   . PRO B 1 2   ? -4.135  -7.362  5.966   1.00 33.87 ? 2   PRO B O   1 
ATOM   1933 C CB  . PRO B 1 2   ? -4.622  -5.661  3.129   1.00 34.39 ? 2   PRO B CB  1 
ATOM   1934 C CG  . PRO B 1 2   ? -5.107  -6.367  1.892   1.00 34.19 ? 2   PRO B CG  1 
ATOM   1935 C CD  . PRO B 1 2   ? -5.231  -7.812  2.291   1.00 34.61 ? 2   PRO B CD  1 
ATOM   1936 N N   . ARG B 1 3   ? -2.903  -5.500  5.787   1.00 34.71 ? 3   ARG B N   1 
ATOM   1937 C CA  . ARG B 1 3   ? -2.974  -5.138  7.211   1.00 34.63 ? 3   ARG B CA  1 
ATOM   1938 C C   . ARG B 1 3   ? -4.433  -4.892  7.706   1.00 34.94 ? 3   ARG B C   1 
ATOM   1939 O O   . ARG B 1 3   ? -5.374  -4.755  6.898   1.00 35.20 ? 3   ARG B O   1 
ATOM   1940 C CB  . ARG B 1 3   ? -2.140  -3.889  7.468   1.00 34.23 ? 3   ARG B CB  1 
ATOM   1941 C CG  . ARG B 1 3   ? -0.652  -4.093  7.366   1.00 34.78 ? 3   ARG B CG  1 
ATOM   1942 C CD  . ARG B 1 3   ? 0.110   -2.836  7.717   1.00 34.62 ? 3   ARG B CD  1 
ATOM   1943 N NE  . ARG B 1 3   ? 1.473   -3.150  8.128   1.00 35.29 ? 3   ARG B NE  1 
ATOM   1944 N N   . TYR B 1 4   ? -4.635  -4.855  9.026   1.00 34.45 ? 4   TYR B N   1 
ATOM   1945 C CA  . TYR B 1 4   ? -5.919  -4.365  9.525   1.00 33.68 ? 4   TYR B CA  1 
ATOM   1946 C C   . TYR B 1 4   ? -5.810  -2.839  9.355   1.00 32.80 ? 4   TYR B C   1 
ATOM   1947 O O   . TYR B 1 4   ? -4.753  -2.272  9.579   1.00 33.06 ? 4   TYR B O   1 
ATOM   1948 C CB  . TYR B 1 4   ? -6.150  -4.820  10.971  1.00 33.55 ? 4   TYR B CB  1 
ATOM   1949 N N   . LEU B 1 5   ? -6.871  -2.185  8.907   1.00 32.43 ? 5   LEU B N   1 
ATOM   1950 C CA  . LEU B 1 5   ? -6.834  -0.755  8.548   1.00 31.51 ? 5   LEU B CA  1 
ATOM   1951 C C   . LEU B 1 5   ? -8.139  -0.039  8.939   1.00 31.50 ? 5   LEU B C   1 
ATOM   1952 O O   . LEU B 1 5   ? -9.097  -0.678  9.454   1.00 31.25 ? 5   LEU B O   1 
ATOM   1953 C CB  . LEU B 1 5   ? -6.582  -0.606  7.030   1.00 31.33 ? 5   LEU B CB  1 
ATOM   1954 C CG  . LEU B 1 5   ? -5.199  -1.007  6.460   1.00 31.19 ? 5   LEU B CG  1 
ATOM   1955 C CD1 . LEU B 1 5   ? -5.259  -1.350  4.979   1.00 29.05 ? 5   LEU B CD1 1 
ATOM   1956 C CD2 . LEU B 1 5   ? -4.148  0.077   6.697   1.00 26.58 ? 5   LEU B CD2 1 
ATOM   1957 N N   . LYS B 1 6   ? -8.187  1.273   8.680   1.00 31.36 ? 6   LYS B N   1 
ATOM   1958 C CA  . LYS B 1 6   ? -9.391  2.082   8.965   1.00 31.95 ? 6   LYS B CA  1 
ATOM   1959 C C   . LYS B 1 6   ? -9.649  3.247   7.978   1.00 32.01 ? 6   LYS B C   1 
ATOM   1960 O O   . LYS B 1 6   ? -8.724  3.751   7.332   1.00 32.41 ? 6   LYS B O   1 
ATOM   1961 C CB  . LYS B 1 6   ? -9.441  2.542   10.451  1.00 30.93 ? 6   LYS B CB  1 
ATOM   1962 C CG  . LYS B 1 6   ? -8.337  3.468   10.880  1.00 32.10 ? 6   LYS B CG  1 
ATOM   1963 C CD  . LYS B 1 6   ? -8.182  3.493   12.422  1.00 34.06 ? 6   LYS B CD  1 
ATOM   1964 C CE  . LYS B 1 6   ? -6.781  3.983   12.859  1.00 32.75 ? 6   LYS B CE  1 
ATOM   1965 N N   . GLY B 1 7   ? -10.919 3.642   7.848   1.00 32.18 ? 7   GLY B N   1 
ATOM   1966 C CA  . GLY B 1 7   ? -11.290 4.897   7.171   1.00 31.88 ? 7   GLY B CA  1 
ATOM   1967 C C   . GLY B 1 7   ? -11.084 4.846   5.673   1.00 32.01 ? 7   GLY B C   1 
ATOM   1968 O O   . GLY B 1 7   ? -11.254 3.789   5.053   1.00 31.98 ? 7   GLY B O   1 
ATOM   1969 N N   . ALA B 1 8   ? -10.690 5.988   5.113   1.00 31.99 ? 8   ALA B N   1 
ATOM   1970 C CA  . ALA B 1 8   ? -10.345 6.134   3.696   1.00 32.34 ? 8   ALA B CA  1 
ATOM   1971 C C   . ALA B 1 8   ? -9.378  5.046   3.216   1.00 32.48 ? 8   ALA B C   1 
ATOM   1972 O O   . ALA B 1 8   ? -9.538  4.504   2.130   1.00 32.66 ? 8   ALA B O   1 
ATOM   1973 C CB  . ALA B 1 8   ? -9.757  7.541   3.422   1.00 31.55 ? 8   ALA B CB  1 
ATOM   1974 N N   . LEU B 1 9   ? -8.387  4.725   4.036   1.00 32.33 ? 9   LEU B N   1 
ATOM   1975 C CA  . LEU B 1 9   ? -7.410  3.742   3.657   1.00 32.53 ? 9   LEU B CA  1 
ATOM   1976 C C   . LEU B 1 9   ? -8.003  2.346   3.555   1.00 33.56 ? 9   LEU B C   1 
ATOM   1977 O O   . LEU B 1 9   ? -7.642  1.613   2.641   1.00 34.62 ? 9   LEU B O   1 
ATOM   1978 C CB  . LEU B 1 9   ? -6.257  3.701   4.650   1.00 31.84 ? 9   LEU B CB  1 
ATOM   1979 C CG  . LEU B 1 9   ? -4.880  3.886   4.035   1.00 31.50 ? 9   LEU B CG  1 
ATOM   1980 C CD1 . LEU B 1 9   ? -3.834  3.522   5.054   1.00 31.24 ? 9   LEU B CD1 1 
ATOM   1981 C CD2 . LEU B 1 9   ? -4.677  3.139   2.705   1.00 27.25 ? 9   LEU B CD2 1 
ATOM   1982 N N   . LYS B 1 10  ? -8.867  1.943   4.497   1.00 33.50 ? 10  LYS B N   1 
ATOM   1983 C CA  . LYS B 1 10  ? -9.537  0.631   4.383   1.00 33.33 ? 10  LYS B CA  1 
ATOM   1984 C C   . LYS B 1 10  ? -10.331 0.597   3.068   1.00 32.65 ? 10  LYS B C   1 
ATOM   1985 O O   . LYS B 1 10  ? -10.344 -0.416  2.362   1.00 32.45 ? 10  LYS B O   1 
ATOM   1986 C CB  . LYS B 1 10  ? -10.465 0.375   5.579   1.00 33.50 ? 10  LYS B CB  1 
ATOM   1987 C CG  . LYS B 1 10  ? -10.596 -1.071  6.020   1.00 33.96 ? 10  LYS B CG  1 
ATOM   1988 C CD  . LYS B 1 10  ? -12.004 -1.322  6.571   1.00 36.88 ? 10  LYS B CD  1 
ATOM   1989 C CE  . LYS B 1 10  ? -12.021 -2.462  7.581   1.00 39.28 ? 10  LYS B CE  1 
ATOM   1990 N NZ  . LYS B 1 10  ? -11.511 -3.784  7.054   1.00 38.51 ? 10  LYS B NZ  1 
ATOM   1991 N N   . ASP B 1 11  ? -10.949 1.736   2.749   1.00 31.92 ? 11  ASP B N   1 
ATOM   1992 C CA  . ASP B 1 11  ? -11.814 1.878   1.591   1.00 31.74 ? 11  ASP B CA  1 
ATOM   1993 C C   . ASP B 1 11  ? -11.018 1.708   0.266   1.00 31.76 ? 11  ASP B C   1 
ATOM   1994 O O   . ASP B 1 11  ? -11.458 0.964   -0.618  1.00 31.79 ? 11  ASP B O   1 
ATOM   1995 C CB  . ASP B 1 11  ? -12.582 3.203   1.696   1.00 31.25 ? 11  ASP B CB  1 
ATOM   1996 C CG  . ASP B 1 11  ? -13.628 3.385   0.600   1.00 32.33 ? 11  ASP B CG  1 
ATOM   1997 O OD1 . ASP B 1 11  ? -13.547 4.394   -0.142  1.00 33.07 ? 11  ASP B OD1 1 
ATOM   1998 O OD2 . ASP B 1 11  ? -14.548 2.558   0.490   1.00 32.91 ? 11  ASP B OD2 1 
ATOM   1999 N N   . VAL B 1 12  ? -9.842  2.341   0.137   1.00 31.10 ? 12  VAL B N   1 
ATOM   2000 C CA  . VAL B 1 12  ? -9.014  2.089   -1.046  1.00 31.23 ? 12  VAL B CA  1 
ATOM   2001 C C   . VAL B 1 12  ? -8.622  0.635   -1.188  1.00 31.35 ? 12  VAL B C   1 
ATOM   2002 O O   . VAL B 1 12  ? -8.683  0.067   -2.272  1.00 32.67 ? 12  VAL B O   1 
ATOM   2003 C CB  . VAL B 1 12  ? -7.726  2.914   -1.155  1.00 30.91 ? 12  VAL B CB  1 
ATOM   2004 C CG1 . VAL B 1 12  ? -7.820  3.836   -2.364  1.00 31.27 ? 12  VAL B CG1 1 
ATOM   2005 C CG2 . VAL B 1 12  ? -7.454  3.704   0.058   1.00 31.17 ? 12  VAL B CG2 1 
ATOM   2006 N N   . VAL B 1 13  ? -8.229  0.028   -0.091  1.00 30.93 ? 13  VAL B N   1 
ATOM   2007 C CA  . VAL B 1 13  ? -7.771  -1.336  -0.118  1.00 30.61 ? 13  VAL B CA  1 
ATOM   2008 C C   . VAL B 1 13  ? -8.900  -2.296  -0.463  1.00 31.68 ? 13  VAL B C   1 
ATOM   2009 O O   . VAL B 1 13  ? -8.656  -3.294  -1.139  1.00 31.70 ? 13  VAL B O   1 
ATOM   2010 C CB  . VAL B 1 13  ? -7.047  -1.671  1.202   1.00 30.33 ? 13  VAL B CB  1 
ATOM   2011 C CG1 . VAL B 1 13  ? -6.945  -3.152  1.444   1.00 28.12 ? 13  VAL B CG1 1 
ATOM   2012 C CG2 . VAL B 1 13  ? -5.677  -1.046  1.169   1.00 28.53 ? 13  VAL B CG2 1 
ATOM   2013 N N   . GLN B 1 14  ? -10.136 -1.992  -0.031  1.00 32.48 ? 14  GLN B N   1 
ATOM   2014 C CA  . GLN B 1 14  ? -11.288 -2.849  -0.389  1.00 32.70 ? 14  GLN B CA  1 
ATOM   2015 C C   . GLN B 1 14  ? -11.628 -2.694  -1.869  1.00 32.71 ? 14  GLN B C   1 
ATOM   2016 O O   . GLN B 1 14  ? -11.907 -3.687  -2.532  1.00 32.53 ? 14  GLN B O   1 
ATOM   2017 C CB  . GLN B 1 14  ? -12.537 -2.596  0.476   1.00 32.38 ? 14  GLN B CB  1 
ATOM   2018 C CG  . GLN B 1 14  ? -12.367 -2.960  1.945   1.00 33.68 ? 14  GLN B CG  1 
ATOM   2019 C CD  . GLN B 1 14  ? -13.560 -2.507  2.802   1.00 34.04 ? 14  GLN B CD  1 
ATOM   2020 N N   . LEU B 1 15  ? -11.611 -1.459  -2.380  1.00 32.52 ? 15  LEU B N   1 
ATOM   2021 C CA  . LEU B 1 15  ? -11.834 -1.242  -3.802  1.00 32.81 ? 15  LEU B CA  1 
ATOM   2022 C C   . LEU B 1 15  ? -10.782 -2.010  -4.604  1.00 32.59 ? 15  LEU B C   1 
ATOM   2023 O O   . LEU B 1 15  ? -11.123 -2.921  -5.359  1.00 32.88 ? 15  LEU B O   1 
ATOM   2024 C CB  . LEU B 1 15  ? -11.856 0.256   -4.136  1.00 33.41 ? 15  LEU B CB  1 
ATOM   2025 C CG  . LEU B 1 15  ? -13.213 0.863   -3.734  1.00 34.95 ? 15  LEU B CG  1 
ATOM   2026 C CD1 . LEU B 1 15  ? -13.148 2.345   -3.408  1.00 33.33 ? 15  LEU B CD1 1 
ATOM   2027 C CD2 . LEU B 1 15  ? -14.285 0.573   -4.782  1.00 34.91 ? 15  LEU B CD2 1 
ATOM   2028 N N   . SER B 1 16  ? -9.510  -1.707  -4.375  1.00 31.84 ? 16  SER B N   1 
ATOM   2029 C CA  . SER B 1 16  ? -8.416  -2.421  -5.031  1.00 31.95 ? 16  SER B CA  1 
ATOM   2030 C C   . SER B 1 16  ? -8.447  -3.942  -5.000  1.00 32.53 ? 16  SER B C   1 
ATOM   2031 O O   . SER B 1 16  ? -8.072  -4.567  -5.974  1.00 32.82 ? 16  SER B O   1 
ATOM   2032 C CB  . SER B 1 16  ? -7.095  -1.959  -4.478  1.00 31.29 ? 16  SER B CB  1 
ATOM   2033 O OG  . SER B 1 16  ? -7.024  -0.583  -4.644  1.00 29.09 ? 16  SER B OG  1 
ATOM   2034 N N   . LEU B 1 17  ? -8.853  -4.537  -3.890  1.00 33.78 ? 17  LEU B N   1 
ATOM   2035 C CA  . LEU B 1 17  ? -9.061  -5.998  -3.838  1.00 35.42 ? 17  LEU B CA  1 
ATOM   2036 C C   . LEU B 1 17  ? -10.136 -6.484  -4.798  1.00 35.65 ? 17  LEU B C   1 
ATOM   2037 O O   . LEU B 1 17  ? -10.039 -7.602  -5.294  1.00 35.66 ? 17  LEU B O   1 
ATOM   2038 C CB  . LEU B 1 17  ? -9.460  -6.470  -2.434  1.00 35.45 ? 17  LEU B CB  1 
ATOM   2039 C CG  . LEU B 1 17  ? -8.355  -6.625  -1.399  1.00 37.27 ? 17  LEU B CG  1 
ATOM   2040 C CD1 . LEU B 1 17  ? -8.956  -6.695  0.007   1.00 36.76 ? 17  LEU B CD1 1 
ATOM   2041 C CD2 . LEU B 1 17  ? -7.473  -7.859  -1.716  1.00 39.79 ? 17  LEU B CD2 1 
ATOM   2042 N N   . ARG B 1 18  ? -11.161 -5.656  -5.020  1.00 36.30 ? 18  ARG B N   1 
ATOM   2043 C CA  . ARG B 1 18  ? -12.327 -6.036  -5.819  1.00 37.52 ? 18  ARG B CA  1 
ATOM   2044 C C   . ARG B 1 18  ? -12.144 -5.622  -7.282  1.00 38.03 ? 18  ARG B C   1 
ATOM   2045 O O   . ARG B 1 18  ? -13.072 -5.791  -8.082  1.00 38.41 ? 18  ARG B O   1 
ATOM   2046 C CB  . ARG B 1 18  ? -13.619 -5.378  -5.277  1.00 37.72 ? 18  ARG B CB  1 
ATOM   2047 C CG  . ARG B 1 18  ? -14.040 -5.732  -3.813  1.00 41.11 ? 18  ARG B CG  1 
ATOM   2048 C CD  . ARG B 1 18  ? -15.508 -5.364  -3.462  1.00 44.09 ? 18  ARG B CD  1 
ATOM   2049 N NE  . ARG B 1 18  ? -15.973 -4.123  -4.115  1.00 46.26 ? 18  ARG B NE  1 
ATOM   2050 C CZ  . ARG B 1 18  ? -16.246 -2.968  -3.489  1.00 48.35 ? 18  ARG B CZ  1 
ATOM   2051 N NH1 . ARG B 1 18  ? -16.117 -2.851  -2.163  1.00 47.79 ? 18  ARG B NH1 1 
ATOM   2052 N NH2 . ARG B 1 18  ? -16.660 -1.911  -4.192  1.00 48.47 ? 18  ARG B NH2 1 
ATOM   2053 N N   . ARG B 1 19  ? -10.970 -5.080  -7.621  1.00 37.89 ? 19  ARG B N   1 
ATOM   2054 C CA  . ARG B 1 19  ? -10.746 -4.426  -8.907  1.00 38.40 ? 19  ARG B CA  1 
ATOM   2055 C C   . ARG B 1 19  ? -10.324 -5.333  -10.068 1.00 38.73 ? 19  ARG B C   1 
ATOM   2056 O O   . ARG B 1 19  ? -9.349  -6.098  -9.964  1.00 38.98 ? 19  ARG B O   1 
ATOM   2057 C CB  . ARG B 1 19  ? -9.712  -3.305  -8.781  1.00 39.39 ? 19  ARG B CB  1 
ATOM   2058 C CG  . ARG B 1 19  ? -9.839  -2.231  -9.891  1.00 38.61 ? 19  ARG B CG  1 
ATOM   2059 C CD  . ARG B 1 19  ? -8.596  -1.435  -10.015 1.00 35.92 ? 19  ARG B CD  1 
ATOM   2060 N NE  . ARG B 1 19  ? -8.701  -0.441  -11.070 1.00 34.97 ? 19  ARG B NE  1 
ATOM   2061 C CZ  . ARG B 1 19  ? -7.892  0.607   -11.176 1.00 32.76 ? 19  ARG B CZ  1 
ATOM   2062 N NH1 . ARG B 1 19  ? -6.940  0.795   -10.284 1.00 32.08 ? 19  ARG B NH1 1 
ATOM   2063 N NH2 . ARG B 1 19  ? -8.039  1.471   -12.164 1.00 33.47 ? 19  ARG B NH2 1 
ATOM   2064 N N   . PRO B 1 20  ? -11.025 -5.205  -11.210 1.00 38.69 ? 20  PRO B N   1 
ATOM   2065 C CA  . PRO B 1 20  ? -10.809 -6.170  -12.290 1.00 38.00 ? 20  PRO B CA  1 
ATOM   2066 C C   . PRO B 1 20  ? -9.498  -6.010  -13.054 1.00 37.32 ? 20  PRO B C   1 
ATOM   2067 O O   . PRO B 1 20  ? -9.055  -4.911  -13.402 1.00 35.51 ? 20  PRO B O   1 
ATOM   2068 C CB  . PRO B 1 20  ? -12.024 -5.975  -13.215 1.00 37.85 ? 20  PRO B CB  1 
ATOM   2069 C CG  . PRO B 1 20  ? -12.959 -5.022  -12.458 1.00 39.27 ? 20  PRO B CG  1 
ATOM   2070 C CD  . PRO B 1 20  ? -12.055 -4.212  -11.568 1.00 38.67 ? 20  PRO B CD  1 
ATOM   2071 N N   . SER B 1 21  ? -8.901  -7.174  -13.265 1.00 37.78 ? 21  SER B N   1 
ATOM   2072 C CA  . SER B 1 21  ? -7.753  -7.406  -14.115 1.00 37.96 ? 21  SER B CA  1 
ATOM   2073 C C   . SER B 1 21  ? -8.093  -7.007  -15.546 1.00 38.24 ? 21  SER B C   1 
ATOM   2074 O O   . SER B 1 21  ? -9.285  -6.878  -15.893 1.00 37.72 ? 21  SER B O   1 
ATOM   2075 C CB  . SER B 1 21  ? -7.512  -8.905  -14.086 1.00 37.61 ? 21  SER B CB  1 
ATOM   2076 O OG  . SER B 1 21  ? -6.165  -9.184  -13.872 1.00 39.48 ? 21  SER B OG  1 
ATOM   2077 N N   . LEU B 1 22  ? -7.046  -6.873  -16.370 1.00 38.54 ? 22  LEU B N   1 
ATOM   2078 C CA  . LEU B 1 22  ? -7.101  -6.352  -17.743 1.00 38.60 ? 22  LEU B CA  1 
ATOM   2079 C C   . LEU B 1 22  ? -6.347  -7.267  -18.718 1.00 38.37 ? 22  LEU B C   1 
ATOM   2080 O O   . LEU B 1 22  ? -5.305  -7.838  -18.350 1.00 38.88 ? 22  LEU B O   1 
ATOM   2081 C CB  . LEU B 1 22  ? -6.431  -4.980  -17.752 1.00 38.88 ? 22  LEU B CB  1 
ATOM   2082 C CG  . LEU B 1 22  ? -7.037  -3.795  -18.509 1.00 40.73 ? 22  LEU B CG  1 
ATOM   2083 C CD1 . LEU B 1 22  ? -8.362  -3.342  -17.904 1.00 43.49 ? 22  LEU B CD1 1 
ATOM   2084 C CD2 . LEU B 1 22  ? -6.065  -2.639  -18.501 1.00 41.83 ? 22  LEU B CD2 1 
ATOM   2085 N N   . ARG B 1 23  ? -6.846  -7.417  -19.946 1.00 37.47 ? 23  ARG B N   1 
ATOM   2086 C CA  . ARG B 1 23  ? -6.110  -8.197  -20.950 1.00 37.41 ? 23  ARG B CA  1 
ATOM   2087 C C   . ARG B 1 23  ? -5.480  -7.298  -22.006 1.00 36.32 ? 23  ARG B C   1 
ATOM   2088 O O   . ARG B 1 23  ? -6.180  -6.563  -22.701 1.00 36.95 ? 23  ARG B O   1 
ATOM   2089 C CB  . ARG B 1 23  ? -6.967  -9.275  -21.630 1.00 37.53 ? 23  ARG B CB  1 
ATOM   2090 C CG  . ARG B 1 23  ? -7.736  -10.223 -20.698 1.00 39.75 ? 23  ARG B CG  1 
ATOM   2091 C CD  . ARG B 1 23  ? -6.876  -11.094 -19.778 1.00 42.03 ? 23  ARG B CD  1 
ATOM   2092 N NE  . ARG B 1 23  ? -7.040  -10.619 -18.403 1.00 47.35 ? 23  ARG B NE  1 
ATOM   2093 C CZ  . ARG B 1 23  ? -7.968  -11.038 -17.538 1.00 47.83 ? 23  ARG B CZ  1 
ATOM   2094 N NH1 . ARG B 1 23  ? -8.842  -11.975 -17.878 1.00 50.16 ? 23  ARG B NH1 1 
ATOM   2095 N NH2 . ARG B 1 23  ? -8.026  -10.514 -16.322 1.00 47.05 ? 23  ARG B NH2 1 
ATOM   2096 N N   . ALA B 1 24  ? -4.160  -7.368  -22.126 1.00 34.87 ? 24  ALA B N   1 
ATOM   2097 C CA  . ALA B 1 24  ? -3.427  -6.544  -23.091 1.00 33.83 ? 24  ALA B CA  1 
ATOM   2098 C C   . ALA B 1 24  ? -2.024  -7.071  -23.261 1.00 33.05 ? 24  ALA B C   1 
ATOM   2099 O O   . ALA B 1 24  ? -1.552  -7.840  -22.436 1.00 32.54 ? 24  ALA B O   1 
ATOM   2100 C CB  . ALA B 1 24  ? -3.399  -5.071  -22.680 1.00 33.09 ? 24  ALA B CB  1 
ATOM   2101 N N   . SER B 1 25  ? -1.376  -6.642  -24.341 1.00 32.58 ? 25  SER B N   1 
ATOM   2102 C CA  . SER B 1 25  ? -0.034  -7.081  -24.679 1.00 31.81 ? 25  SER B CA  1 
ATOM   2103 C C   . SER B 1 25  ? 0.922   -5.922  -24.503 1.00 31.87 ? 25  SER B C   1 
ATOM   2104 O O   . SER B 1 25  ? 0.688   -4.841  -25.016 1.00 31.89 ? 25  SER B O   1 
ATOM   2105 C CB  . SER B 1 25  ? 0.024   -7.639  -26.114 1.00 31.53 ? 25  SER B CB  1 
ATOM   2106 O OG  . SER B 1 25  ? -0.476  -8.955  -26.158 1.00 29.26 ? 25  SER B OG  1 
ATOM   2107 N N   . ARG B 1 26  ? 1.981   -6.142  -23.736 1.00 32.35 ? 26  ARG B N   1 
ATOM   2108 C CA  . ARG B 1 26  ? 2.998   -5.113  -23.549 1.00 32.73 ? 26  ARG B CA  1 
ATOM   2109 C C   . ARG B 1 26  ? 3.676   -4.871  -24.884 1.00 33.74 ? 26  ARG B C   1 
ATOM   2110 O O   . ARG B 1 26  ? 4.154   -5.810  -25.552 1.00 34.70 ? 26  ARG B O   1 
ATOM   2111 C CB  . ARG B 1 26  ? 4.033   -5.502  -22.488 1.00 31.74 ? 26  ARG B CB  1 
ATOM   2112 C CG  . ARG B 1 26  ? 5.120   -4.459  -22.296 1.00 30.77 ? 26  ARG B CG  1 
ATOM   2113 C CD  . ARG B 1 26  ? 6.145   -4.881  -21.265 1.00 29.53 ? 26  ARG B CD  1 
ATOM   2114 N NE  . ARG B 1 26  ? 6.911   -3.725  -20.800 1.00 29.37 ? 26  ARG B NE  1 
ATOM   2115 C CZ  . ARG B 1 26  ? 6.535   -2.929  -19.800 1.00 28.08 ? 26  ARG B CZ  1 
ATOM   2116 N NH1 . ARG B 1 26  ? 5.406   -3.161  -19.149 1.00 26.32 ? 26  ARG B NH1 1 
ATOM   2117 N NH2 . ARG B 1 26  ? 7.282   -1.885  -19.463 1.00 28.64 ? 26  ARG B NH2 1 
ATOM   2118 N N   . GLN B 1 27  ? 3.705   -3.612  -25.272 1.00 34.29 ? 27  GLN B N   1 
ATOM   2119 C CA  . GLN B 1 27  ? 4.298   -3.232  -26.529 1.00 34.94 ? 27  GLN B CA  1 
ATOM   2120 C C   . GLN B 1 27  ? 5.390   -2.232  -26.251 1.00 34.94 ? 27  GLN B C   1 
ATOM   2121 O O   . GLN B 1 27  ? 5.529   -1.201  -26.940 1.00 34.72 ? 27  GLN B O   1 
ATOM   2122 C CB  . GLN B 1 27  ? 3.211   -2.657  -27.431 1.00 35.42 ? 27  GLN B CB  1 
ATOM   2123 C CG  . GLN B 1 27  ? 2.382   -3.785  -28.021 1.00 37.68 ? 27  GLN B CG  1 
ATOM   2124 C CD  . GLN B 1 27  ? 1.038   -3.351  -28.560 1.00 40.49 ? 27  GLN B CD  1 
ATOM   2125 O OE1 . GLN B 1 27  ? 0.630   -2.204  -28.400 1.00 41.21 ? 27  GLN B OE1 1 
ATOM   2126 N NE2 . GLN B 1 27  ? 0.339   -4.282  -29.209 1.00 41.50 ? 27  GLN B NE2 1 
ATOM   2127 N N   . ARG B 1 28  ? 6.137   -2.527  -25.192 1.00 34.38 ? 28  ARG B N   1 
ATOM   2128 C CA  . ARG B 1 28  ? 7.351   -1.805  -24.920 1.00 33.96 ? 28  ARG B CA  1 
ATOM   2129 C C   . ARG B 1 28  ? 8.337   -2.565  -24.029 1.00 33.54 ? 28  ARG B C   1 
ATOM   2130 O O   . ARG B 1 28  ? 7.953   -3.496  -23.333 1.00 33.42 ? 28  ARG B O   1 
ATOM   2131 C CB  . ARG B 1 28  ? 7.078   -0.349  -24.492 1.00 34.03 ? 28  ARG B CB  1 
ATOM   2132 C CG  . ARG B 1 28  ? 6.690   -0.078  -23.084 1.00 33.15 ? 28  ARG B CG  1 
ATOM   2133 C CD  . ARG B 1 28  ? 6.398   1.433   -22.914 1.00 33.48 ? 28  ARG B CD  1 
ATOM   2134 N NE  . ARG B 1 28  ? 6.913   1.898   -21.630 1.00 35.57 ? 28  ARG B NE  1 
ATOM   2135 C CZ  . ARG B 1 28  ? 7.440   3.089   -21.389 1.00 34.35 ? 28  ARG B CZ  1 
ATOM   2136 N NH1 . ARG B 1 28  ? 7.518   4.030   -22.314 1.00 35.61 ? 28  ARG B NH1 1 
ATOM   2137 N NH2 . ARG B 1 28  ? 7.901   3.332   -20.193 1.00 36.03 ? 28  ARG B NH2 1 
ATOM   2138 N N   . PRO B 1 29  ? 9.627   -2.217  -24.129 1.00 33.49 ? 29  PRO B N   1 
ATOM   2139 C CA  . PRO B 1 29  ? 10.637  -2.830  -23.268 1.00 34.21 ? 29  PRO B CA  1 
ATOM   2140 C C   . PRO B 1 29  ? 10.475  -2.352  -21.815 1.00 34.73 ? 29  PRO B C   1 
ATOM   2141 O O   . PRO B 1 29  ? 9.665   -1.469  -21.551 1.00 34.63 ? 29  PRO B O   1 
ATOM   2142 C CB  . PRO B 1 29  ? 11.958  -2.308  -23.857 1.00 34.40 ? 29  PRO B CB  1 
ATOM   2143 C CG  . PRO B 1 29  ? 11.562  -1.004  -24.612 1.00 33.77 ? 29  PRO B CG  1 
ATOM   2144 C CD  . PRO B 1 29  ? 10.216  -1.326  -25.154 1.00 33.08 ? 29  PRO B CD  1 
ATOM   2145 N N   . ILE B 1 30  ? 11.233  -2.945  -20.893 1.00 35.08 ? 30  ILE B N   1 
ATOM   2146 C CA  . ILE B 1 30  ? 11.254  -2.473  -19.520 1.00 35.28 ? 30  ILE B CA  1 
ATOM   2147 C C   . ILE B 1 30  ? 12.457  -1.557  -19.334 1.00 35.39 ? 30  ILE B C   1 
ATOM   2148 O O   . ILE B 1 30  ? 13.598  -1.994  -19.361 1.00 35.42 ? 30  ILE B O   1 
ATOM   2149 C CB  . ILE B 1 30  ? 11.284  -3.611  -18.507 1.00 35.16 ? 30  ILE B CB  1 
ATOM   2150 C CG1 . ILE B 1 30  ? 9.968   -4.373  -18.520 1.00 36.29 ? 30  ILE B CG1 1 
ATOM   2151 C CG2 . ILE B 1 30  ? 11.438  -3.068  -17.092 1.00 35.97 ? 30  ILE B CG2 1 
ATOM   2152 C CD1 . ILE B 1 30  ? 10.056  -5.657  -17.736 1.00 36.67 ? 30  ILE B CD1 1 
ATOM   2153 N N   . ILE B 1 31  ? 12.168  -0.272  -19.184 1.00 35.44 ? 31  ILE B N   1 
ATOM   2154 C CA  . ILE B 1 31  ? 13.173  0.773   -18.967 1.00 35.64 ? 31  ILE B CA  1 
ATOM   2155 C C   . ILE B 1 31  ? 13.311  0.848   -17.434 1.00 35.82 ? 31  ILE B C   1 
ATOM   2156 O O   . ILE B 1 31  ? 12.293  0.838   -16.726 1.00 35.49 ? 31  ILE B O   1 
ATOM   2157 C CB  . ILE B 1 31  ? 12.681  2.145   -19.577 1.00 35.12 ? 31  ILE B CB  1 
ATOM   2158 C CG1 . ILE B 1 31  ? 12.350  2.019   -21.077 1.00 36.13 ? 31  ILE B CG1 1 
ATOM   2159 C CG2 . ILE B 1 31  ? 13.724  3.234   -19.405 1.00 35.18 ? 31  ILE B CG2 1 
ATOM   2160 C CD1 . ILE B 1 31  ? 10.856  1.575   -21.475 1.00 35.78 ? 31  ILE B CD1 1 
ATOM   2161 N N   . SER B 1 32  ? 14.528  0.871   -16.898 1.00 35.38 ? 32  SER B N   1 
ATOM   2162 C CA  . SER B 1 32  ? 14.634  0.872   -15.436 1.00 35.08 ? 32  SER B CA  1 
ATOM   2163 C C   . SER B 1 32  ? 14.657  2.274   -14.856 1.00 34.54 ? 32  SER B C   1 
ATOM   2164 O O   . SER B 1 32  ? 15.507  3.078   -15.202 1.00 34.71 ? 32  SER B O   1 
ATOM   2165 C CB  . SER B 1 32  ? 15.803  0.031   -14.919 1.00 35.03 ? 32  SER B CB  1 
ATOM   2166 O OG  . SER B 1 32  ? 15.963  0.208   -13.508 1.00 34.92 ? 32  SER B OG  1 
ATOM   2167 N N   . LEU B 1 33  ? 13.702  2.562   -13.976 1.00 34.25 ? 33  LEU B N   1 
ATOM   2168 C CA  . LEU B 1 33  ? 13.661  3.850   -13.288 1.00 33.63 ? 33  LEU B CA  1 
ATOM   2169 C C   . LEU B 1 33  ? 14.875  4.031   -12.358 1.00 33.81 ? 33  LEU B C   1 
ATOM   2170 O O   . LEU B 1 33  ? 15.456  5.099   -12.310 1.00 33.23 ? 33  LEU B O   1 
ATOM   2171 C CB  . LEU B 1 33  ? 12.345  4.003   -12.523 1.00 32.76 ? 33  LEU B CB  1 
ATOM   2172 C CG  . LEU B 1 33  ? 12.235  5.196   -11.550 1.00 31.55 ? 33  LEU B CG  1 
ATOM   2173 C CD1 . LEU B 1 33  ? 12.338  6.575   -12.227 1.00 25.93 ? 33  LEU B CD1 1 
ATOM   2174 C CD2 . LEU B 1 33  ? 10.988  5.099   -10.651 1.00 28.12 ? 33  LEU B CD2 1 
ATOM   2175 N N   . ARG B 1 34  ? 15.247  2.975   -11.636 1.00 34.54 ? 34  ARG B N   1 
ATOM   2176 C CA  . ARG B 1 34  ? 16.392  3.014   -10.720 1.00 35.54 ? 34  ARG B CA  1 
ATOM   2177 C C   . ARG B 1 34  ? 17.650  3.466   -11.447 1.00 35.43 ? 34  ARG B C   1 
ATOM   2178 O O   . ARG B 1 34  ? 18.291  4.449   -11.063 1.00 35.25 ? 34  ARG B O   1 
ATOM   2179 C CB  . ARG B 1 34  ? 16.625  1.637   -10.052 1.00 35.77 ? 34  ARG B CB  1 
ATOM   2180 C CG  . ARG B 1 34  ? 17.418  1.676   -8.715  1.00 37.81 ? 34  ARG B CG  1 
ATOM   2181 C CD  . ARG B 1 34  ? 17.650  0.273   -8.081  1.00 40.08 ? 34  ARG B CD  1 
ATOM   2182 N NE  . ARG B 1 34  ? 18.802  0.246   -7.168  1.00 40.38 ? 34  ARG B NE  1 
ATOM   2183 N N   . GLU B 1 35  ? 17.981  2.743   -12.513 1.00 35.49 ? 35  GLU B N   1 
ATOM   2184 C CA  . GLU B 1 35  ? 19.202  2.999   -13.263 1.00 35.14 ? 35  GLU B CA  1 
ATOM   2185 C C   . GLU B 1 35  ? 19.230  4.390   -13.914 1.00 34.67 ? 35  GLU B C   1 
ATOM   2186 O O   . GLU B 1 35  ? 20.272  5.052   -13.878 1.00 35.11 ? 35  GLU B O   1 
ATOM   2187 C CB  . GLU B 1 35  ? 19.470  1.876   -14.279 1.00 35.19 ? 35  GLU B CB  1 
ATOM   2188 N N   . ARG B 1 36  ? 18.115  4.843   -14.491 1.00 33.57 ? 36  ARG B N   1 
ATOM   2189 C CA  . ARG B 1 36  ? 18.107  6.174   -15.102 1.00 33.51 ? 36  ARG B CA  1 
ATOM   2190 C C   . ARG B 1 36  ? 18.329  7.282   -14.060 1.00 32.55 ? 36  ARG B C   1 
ATOM   2191 O O   . ARG B 1 36  ? 18.899  8.306   -14.376 1.00 32.81 ? 36  ARG B O   1 
ATOM   2192 C CB  . ARG B 1 36  ? 16.827  6.455   -15.920 1.00 33.72 ? 36  ARG B CB  1 
ATOM   2193 C CG  . ARG B 1 36  ? 16.890  7.815   -16.704 1.00 34.98 ? 36  ARG B CG  1 
ATOM   2194 C CD  . ARG B 1 36  ? 16.733  7.610   -18.201 1.00 41.14 ? 36  ARG B CD  1 
ATOM   2195 N NE  . ARG B 1 36  ? 16.721  8.823   -19.029 1.00 43.17 ? 36  ARG B NE  1 
ATOM   2196 C CZ  . ARG B 1 36  ? 15.725  9.715   -19.094 1.00 43.75 ? 36  ARG B CZ  1 
ATOM   2197 N NH1 . ARG B 1 36  ? 14.650  9.597   -18.316 1.00 45.80 ? 36  ARG B NH1 1 
ATOM   2198 N NH2 . ARG B 1 36  ? 15.819  10.757  -19.909 1.00 38.40 ? 36  ARG B NH2 1 
ATOM   2199 N N   . ILE B 1 37  ? 17.848  7.086   -12.836 1.00 31.92 ? 37  ILE B N   1 
ATOM   2200 C CA  . ILE B 1 37  ? 18.132  8.021   -11.722 1.00 31.20 ? 37  ILE B CA  1 
ATOM   2201 C C   . ILE B 1 37  ? 19.666  8.093   -11.472 1.00 31.18 ? 37  ILE B C   1 
ATOM   2202 O O   . ILE B 1 37  ? 20.265  9.191   -11.429 1.00 30.48 ? 37  ILE B O   1 
ATOM   2203 C CB  . ILE B 1 37  ? 17.358  7.628   -10.409 1.00 30.44 ? 37  ILE B CB  1 
ATOM   2204 C CG1 . ILE B 1 37  ? 15.847  7.736   -10.599 1.00 29.63 ? 37  ILE B CG1 1 
ATOM   2205 C CG2 . ILE B 1 37  ? 17.732  8.519   -9.280  1.00 28.81 ? 37  ILE B CG2 1 
ATOM   2206 C CD1 . ILE B 1 37  ? 15.034  6.954   -9.567  1.00 26.89 ? 37  ILE B CD1 1 
ATOM   2207 N N   . LEU B 1 38  ? 20.278  6.908   -11.356 1.00 31.10 ? 38  LEU B N   1 
ATOM   2208 C CA  . LEU B 1 38  ? 21.740  6.755   -11.168 1.00 31.61 ? 38  LEU B CA  1 
ATOM   2209 C C   . LEU B 1 38  ? 22.581  7.394   -12.289 1.00 32.07 ? 38  LEU B C   1 
ATOM   2210 O O   . LEU B 1 38  ? 23.569  8.051   -12.003 1.00 31.99 ? 38  LEU B O   1 
ATOM   2211 C CB  . LEU B 1 38  ? 22.131  5.277   -10.909 1.00 30.78 ? 38  LEU B CB  1 
ATOM   2212 C CG  . LEU B 1 38  ? 21.764  4.678   -9.532  1.00 30.83 ? 38  LEU B CG  1 
ATOM   2213 C CD1 . LEU B 1 38  ? 21.913  3.140   -9.418  1.00 29.18 ? 38  LEU B CD1 1 
ATOM   2214 C CD2 . LEU B 1 38  ? 22.499  5.388   -8.373  1.00 31.00 ? 38  LEU B CD2 1 
ATOM   2215 N N   . GLU B 1 39  ? 22.156  7.195   -13.546 1.00 33.22 ? 39  GLU B N   1 
ATOM   2216 C CA  . GLU B 1 39  ? 22.653  7.931   -14.710 1.00 33.28 ? 39  GLU B CA  1 
ATOM   2217 C C   . GLU B 1 39  ? 22.531  9.434   -14.498 1.00 33.60 ? 39  GLU B C   1 
ATOM   2218 O O   . GLU B 1 39  ? 23.539  10.156  -14.576 1.00 33.44 ? 39  GLU B O   1 
ATOM   2219 C CB  . GLU B 1 39  ? 21.906  7.511   -15.983 1.00 33.31 ? 39  GLU B CB  1 
ATOM   2220 N N   . PHE B 1 40  ? 21.323  9.912   -14.201 1.00 33.49 ? 40  PHE B N   1 
ATOM   2221 C CA  . PHE B 1 40  ? 21.175  11.340  -13.921 1.00 34.35 ? 40  PHE B CA  1 
ATOM   2222 C C   . PHE B 1 40  ? 22.146  11.794  -12.840 1.00 35.36 ? 40  PHE B C   1 
ATOM   2223 O O   . PHE B 1 40  ? 22.766  12.847  -12.999 1.00 35.89 ? 40  PHE B O   1 
ATOM   2224 C CB  . PHE B 1 40  ? 19.740  11.743  -13.562 1.00 34.06 ? 40  PHE B CB  1 
ATOM   2225 C CG  . PHE B 1 40  ? 18.851  11.995  -14.750 1.00 32.35 ? 40  PHE B CG  1 
ATOM   2226 C CD1 . PHE B 1 40  ? 18.810  11.108  -15.822 1.00 31.46 ? 40  PHE B CD1 1 
ATOM   2227 C CD2 . PHE B 1 40  ? 18.033  13.118  -14.788 1.00 31.45 ? 40  PHE B CD2 1 
ATOM   2228 C CE1 . PHE B 1 40  ? 17.949  11.360  -16.940 1.00 31.77 ? 40  PHE B CE1 1 
ATOM   2229 C CE2 . PHE B 1 40  ? 17.172  13.370  -15.883 1.00 30.74 ? 40  PHE B CE2 1 
ATOM   2230 C CZ  . PHE B 1 40  ? 17.127  12.491  -16.951 1.00 29.18 ? 40  PHE B CZ  1 
ATOM   2231 N N   . ASN B 1 41  ? 22.283  11.015  -11.760 1.00 35.93 ? 41  ASN B N   1 
ATOM   2232 C CA  . ASN B 1 41  ? 23.184  11.394  -10.661 1.00 37.35 ? 41  ASN B CA  1 
ATOM   2233 C C   . ASN B 1 41  ? 24.636  11.524  -11.132 1.00 38.74 ? 41  ASN B C   1 
ATOM   2234 O O   . ASN B 1 41  ? 25.331  12.514  -10.821 1.00 38.96 ? 41  ASN B O   1 
ATOM   2235 C CB  . ASN B 1 41  ? 23.109  10.401  -9.484  1.00 36.71 ? 41  ASN B CB  1 
ATOM   2236 C CG  . ASN B 1 41  ? 21.762  10.431  -8.763  1.00 35.64 ? 41  ASN B CG  1 
ATOM   2237 O OD1 . ASN B 1 41  ? 20.939  11.338  -8.956  1.00 32.93 ? 41  ASN B OD1 1 
ATOM   2238 N ND2 . ASN B 1 41  ? 21.533  9.430   -7.935  1.00 32.09 ? 41  ASN B ND2 1 
ATOM   2239 N N   . LYS B 1 42  ? 25.078  10.502  -11.870 1.00 39.90 ? 42  LYS B N   1 
ATOM   2240 C CA  . LYS B 1 42  ? 26.427  10.436  -12.423 1.00 40.84 ? 42  LYS B CA  1 
ATOM   2241 C C   . LYS B 1 42  ? 26.673  11.609  -13.395 1.00 41.58 ? 42  LYS B C   1 
ATOM   2242 O O   . LYS B 1 42  ? 27.820  12.009  -13.579 1.00 41.98 ? 42  LYS B O   1 
ATOM   2243 C CB  . LYS B 1 42  ? 26.684  9.073   -13.119 1.00 40.80 ? 42  LYS B CB  1 
ATOM   2244 C CG  . LYS B 1 42  ? 26.591  7.774   -12.247 1.00 40.68 ? 42  LYS B CG  1 
ATOM   2245 C CD  . LYS B 1 42  ? 27.776  7.569   -11.261 1.00 41.79 ? 42  LYS B CD  1 
ATOM   2246 N N   . ARG B 1 43  ? 25.606  12.174  -13.979 1.00 41.95 ? 43  ARG B N   1 
ATOM   2247 C CA  . ARG B 1 43  ? 25.716  13.281  -14.963 1.00 42.30 ? 43  ARG B CA  1 
ATOM   2248 C C   . ARG B 1 43  ? 25.415  14.669  -14.406 1.00 42.40 ? 43  ARG B C   1 
ATOM   2249 O O   . ARG B 1 43  ? 25.262  15.628  -15.189 1.00 42.69 ? 43  ARG B O   1 
ATOM   2250 C CB  . ARG B 1 43  ? 24.789  13.055  -16.162 1.00 42.48 ? 43  ARG B CB  1 
ATOM   2251 C CG  . ARG B 1 43  ? 25.285  12.025  -17.169 1.00 43.89 ? 43  ARG B CG  1 
ATOM   2252 C CD  . ARG B 1 43  ? 24.138  11.113  -17.657 1.00 44.65 ? 43  ARG B CD  1 
ATOM   2253 N NE  . ARG B 1 43  ? 23.220  11.749  -18.600 1.00 46.77 ? 43  ARG B NE  1 
ATOM   2254 C CZ  . ARG B 1 43  ? 22.097  11.170  -19.054 1.00 50.48 ? 43  ARG B CZ  1 
ATOM   2255 N NH1 . ARG B 1 43  ? 21.753  9.924   -18.651 1.00 49.83 ? 43  ARG B NH1 1 
ATOM   2256 N NH2 . ARG B 1 43  ? 21.309  11.834  -19.912 1.00 48.31 ? 43  ARG B NH2 1 
ATOM   2257 N N   . ASN B 1 44  ? 25.328  14.776  -13.075 1.00 41.70 ? 44  ASN B N   1 
ATOM   2258 C CA  . ASN B 1 44  ? 24.898  15.998  -12.396 1.00 40.69 ? 44  ASN B CA  1 
ATOM   2259 C C   . ASN B 1 44  ? 23.612  16.592  -12.988 1.00 39.79 ? 44  ASN B C   1 
ATOM   2260 O O   . ASN B 1 44  ? 23.490  17.799  -13.159 1.00 40.03 ? 44  ASN B O   1 
ATOM   2261 C CB  . ASN B 1 44  ? 26.012  17.043  -12.423 1.00 41.06 ? 44  ASN B CB  1 
ATOM   2262 C CG  . ASN B 1 44  ? 26.237  17.694  -11.062 1.00 43.15 ? 44  ASN B CG  1 
ATOM   2263 O OD1 . ASN B 1 44  ? 27.219  17.395  -10.378 1.00 44.89 ? 44  ASN B OD1 1 
ATOM   2264 N ND2 . ASN B 1 44  ? 25.325  18.579  -10.659 1.00 43.54 ? 44  ASN B ND2 1 
ATOM   2265 N N   . ILE B 1 45  ? 22.657  15.752  -13.338 1.00 38.28 ? 45  ILE B N   1 
ATOM   2266 C CA  . ILE B 1 45  ? 21.367  16.281  -13.775 1.00 37.30 ? 45  ILE B CA  1 
ATOM   2267 C C   . ILE B 1 45  ? 20.381  16.076  -12.620 1.00 36.48 ? 45  ILE B C   1 
ATOM   2268 O O   . ILE B 1 45  ? 20.330  14.971  -12.031 1.00 36.85 ? 45  ILE B O   1 
ATOM   2269 C CB  . ILE B 1 45  ? 20.876  15.650  -15.131 1.00 36.72 ? 45  ILE B CB  1 
ATOM   2270 C CG1 . ILE B 1 45  ? 22.056  15.578  -16.140 1.00 37.35 ? 45  ILE B CG1 1 
ATOM   2271 C CG2 . ILE B 1 45  ? 19.718  16.470  -15.679 1.00 37.39 ? 45  ILE B CG2 1 
ATOM   2272 C CD1 . ILE B 1 45  ? 21.795  15.046  -17.606 1.00 33.74 ? 45  ILE B CD1 1 
ATOM   2273 N N   . THR B 1 46  ? 19.656  17.137  -12.249 1.00 34.90 ? 46  THR B N   1 
ATOM   2274 C CA  . THR B 1 46  ? 18.613  17.018  -11.231 1.00 33.32 ? 46  THR B CA  1 
ATOM   2275 C C   . THR B 1 46  ? 17.610  15.989  -11.760 1.00 32.80 ? 46  THR B C   1 
ATOM   2276 O O   . THR B 1 46  ? 17.222  16.032  -12.926 1.00 32.91 ? 46  THR B O   1 
ATOM   2277 C CB  . THR B 1 46  ? 17.932  18.381  -10.901 1.00 33.43 ? 46  THR B CB  1 
ATOM   2278 O OG1 . THR B 1 46  ? 18.882  19.284  -10.324 1.00 33.47 ? 46  THR B OG1 1 
ATOM   2279 C CG2 . THR B 1 46  ? 16.785  18.221  -9.896  1.00 31.97 ? 46  THR B CG2 1 
ATOM   2280 N N   . ALA B 1 47  ? 17.239  15.036  -10.922 1.00 31.48 ? 47  ALA B N   1 
ATOM   2281 C CA  . ALA B 1 47  ? 16.332  14.000  -11.343 1.00 30.99 ? 47  ALA B CA  1 
ATOM   2282 C C   . ALA B 1 47  ? 14.986  14.210  -10.698 1.00 30.77 ? 47  ALA B C   1 
ATOM   2283 O O   . ALA B 1 47  ? 14.805  13.951  -9.512  1.00 31.64 ? 47  ALA B O   1 
ATOM   2284 C CB  . ALA B 1 47  ? 16.883  12.652  -10.982 1.00 31.25 ? 47  ALA B CB  1 
ATOM   2285 N N   . ILE B 1 48  ? 14.037  14.690  -11.484 1.00 30.02 ? 48  ILE B N   1 
ATOM   2286 C CA  . ILE B 1 48  ? 12.678  14.886  -11.014 1.00 29.01 ? 48  ILE B CA  1 
ATOM   2287 C C   . ILE B 1 48  ? 11.697  13.858  -11.560 1.00 28.94 ? 48  ILE B C   1 
ATOM   2288 O O   . ILE B 1 48  ? 11.719  13.546  -12.760 1.00 28.84 ? 48  ILE B O   1 
ATOM   2289 C CB  . ILE B 1 48  ? 12.189  16.263  -11.403 1.00 28.95 ? 48  ILE B CB  1 
ATOM   2290 C CG1 . ILE B 1 48  ? 13.177  17.317  -10.851 1.00 29.05 ? 48  ILE B CG1 1 
ATOM   2291 C CG2 . ILE B 1 48  ? 10.760  16.445  -10.936 1.00 25.91 ? 48  ILE B CG2 1 
ATOM   2292 C CD1 . ILE B 1 48  ? 12.687  18.791  -10.926 1.00 28.19 ? 48  ILE B CD1 1 
ATOM   2293 N N   . ILE B 1 49  ? 10.837  13.338  -10.678 1.00 28.51 ? 49  ILE B N   1 
ATOM   2294 C CA  . ILE B 1 49  ? 9.805   12.406  -11.082 1.00 28.09 ? 49  ILE B CA  1 
ATOM   2295 C C   . ILE B 1 49  ? 8.411   13.047  -11.011 1.00 28.44 ? 49  ILE B C   1 
ATOM   2296 O O   . ILE B 1 49  ? 7.850   13.255  -9.912  1.00 29.32 ? 49  ILE B O   1 
ATOM   2297 C CB  . ILE B 1 49  ? 9.842   11.115  -10.270 1.00 28.16 ? 49  ILE B CB  1 
ATOM   2298 C CG1 . ILE B 1 49  ? 11.281  10.622  -10.032 1.00 27.98 ? 49  ILE B CG1 1 
ATOM   2299 C CG2 . ILE B 1 49  ? 9.103   10.041  -11.019 1.00 29.18 ? 49  ILE B CG2 1 
ATOM   2300 C CD1 . ILE B 1 49  ? 11.371  9.255   -9.301  1.00 25.21 ? 49  ILE B CD1 1 
ATOM   2301 N N   . ALA B 1 50  ? 7.864   13.352  -12.190 1.00 27.61 ? 50  ALA B N   1 
ATOM   2302 C CA  . ALA B 1 50  ? 6.574   14.011  -12.350 1.00 27.00 ? 50  ALA B CA  1 
ATOM   2303 C C   . ALA B 1 50  ? 5.351   13.112  -12.215 1.00 26.74 ? 50  ALA B C   1 
ATOM   2304 O O   . ALA B 1 50  ? 5.228   12.052  -12.846 1.00 27.10 ? 50  ALA B O   1 
ATOM   2305 C CB  . ALA B 1 50  ? 6.534   14.732  -13.665 1.00 27.15 ? 50  ALA B CB  1 
ATOM   2306 N N   . VAL B 1 51  ? 4.420   13.547  -11.397 1.00 26.57 ? 51  VAL B N   1 
ATOM   2307 C CA  . VAL B 1 51  ? 3.233   12.747  -11.163 1.00 26.41 ? 51  VAL B CA  1 
ATOM   2308 C C   . VAL B 1 51  ? 2.140   13.248  -12.082 1.00 26.68 ? 51  VAL B C   1 
ATOM   2309 O O   . VAL B 1 51  ? 2.002   14.473  -12.277 1.00 26.43 ? 51  VAL B O   1 
ATOM   2310 C CB  . VAL B 1 51  ? 2.739   12.889  -9.698  1.00 26.34 ? 51  VAL B CB  1 
ATOM   2311 C CG1 . VAL B 1 51  ? 1.474   12.098  -9.475  1.00 25.64 ? 51  VAL B CG1 1 
ATOM   2312 C CG2 . VAL B 1 51  ? 3.808   12.447  -8.722  1.00 27.51 ? 51  VAL B CG2 1 
ATOM   2313 N N   . TYR B 1 52  ? 1.375   12.315  -12.646 1.00 26.65 ? 52  TYR B N   1 
ATOM   2314 C CA  . TYR B 1 52  ? 0.139   12.664  -13.286 1.00 27.35 ? 52  TYR B CA  1 
ATOM   2315 C C   . TYR B 1 52  ? -1.038  12.235  -12.436 1.00 28.16 ? 52  TYR B C   1 
ATOM   2316 O O   . TYR B 1 52  ? -1.277  11.032  -12.231 1.00 28.04 ? 52  TYR B O   1 
ATOM   2317 C CB  . TYR B 1 52  ? -0.001  12.054  -14.681 1.00 27.64 ? 52  TYR B CB  1 
ATOM   2318 C CG  . TYR B 1 52  ? -1.343  12.397  -15.312 1.00 27.77 ? 52  TYR B CG  1 
ATOM   2319 C CD1 . TYR B 1 52  ? -1.492  13.547  -16.107 1.00 25.02 ? 52  TYR B CD1 1 
ATOM   2320 C CD2 . TYR B 1 52  ? -2.470  11.595  -15.081 1.00 27.44 ? 52  TYR B CD2 1 
ATOM   2321 C CE1 . TYR B 1 52  ? -2.693  13.873  -16.672 1.00 23.32 ? 52  TYR B CE1 1 
ATOM   2322 C CE2 . TYR B 1 52  ? -3.713  11.930  -15.628 1.00 27.17 ? 52  TYR B CE2 1 
ATOM   2323 C CZ  . TYR B 1 52  ? -3.805  13.070  -16.441 1.00 28.55 ? 52  TYR B CZ  1 
ATOM   2324 O OH  . TYR B 1 52  ? -5.035  13.409  -17.005 1.00 31.70 ? 52  TYR B OH  1 
ATOM   2325 N N   . LYS B 1 53  ? -1.799  13.229  -11.985 1.00 28.69 ? 53  LYS B N   1 
ATOM   2326 C CA  . LYS B 1 53  ? -2.996  12.997  -11.192 1.00 29.32 ? 53  LYS B CA  1 
ATOM   2327 C C   . LYS B 1 53  ? -4.055  14.122  -11.324 1.00 29.30 ? 53  LYS B C   1 
ATOM   2328 O O   . LYS B 1 53  ? -3.766  15.295  -11.109 1.00 29.34 ? 53  LYS B O   1 
ATOM   2329 C CB  . LYS B 1 53  ? -2.621  12.730  -9.716  1.00 29.45 ? 53  LYS B CB  1 
ATOM   2330 C CG  . LYS B 1 53  ? -1.855  13.856  -9.003  1.00 32.12 ? 53  LYS B CG  1 
ATOM   2331 C CD  . LYS B 1 53  ? -1.341  13.408  -7.604  1.00 35.15 ? 53  LYS B CD  1 
ATOM   2332 C CE  . LYS B 1 53  ? -0.935  14.596  -6.736  1.00 38.88 ? 53  LYS B CE  1 
ATOM   2333 N NZ  . LYS B 1 53  ? -0.069  14.183  -5.574  1.00 40.60 ? 53  LYS B NZ  1 
ATOM   2334 N N   . ARG B 1 54  ? -5.280  13.737  -11.668 1.00 29.60 ? 54  ARG B N   1 
ATOM   2335 C CA  . ARG B 1 54  ? -6.400  14.668  -11.824 1.00 30.04 ? 54  ARG B CA  1 
ATOM   2336 C C   . ARG B 1 54  ? -7.066  15.062  -10.501 1.00 30.08 ? 54  ARG B C   1 
ATOM   2337 O O   . ARG B 1 54  ? -7.534  16.171  -10.344 1.00 29.58 ? 54  ARG B O   1 
ATOM   2338 C CB  . ARG B 1 54  ? -7.463  14.028  -12.703 1.00 30.45 ? 54  ARG B CB  1 
ATOM   2339 C CG  . ARG B 1 54  ? -7.116  13.926  -14.185 1.00 31.92 ? 54  ARG B CG  1 
ATOM   2340 C CD  . ARG B 1 54  ? -8.337  13.317  -14.903 1.00 33.17 ? 54  ARG B CD  1 
ATOM   2341 N NE  . ARG B 1 54  ? -8.034  12.957  -16.274 1.00 30.75 ? 54  ARG B NE  1 
ATOM   2342 C CZ  . ARG B 1 54  ? -7.569  11.770  -16.617 1.00 31.27 ? 54  ARG B CZ  1 
ATOM   2343 N NH1 . ARG B 1 54  ? -7.325  11.503  -17.901 1.00 29.42 ? 54  ARG B NH1 1 
ATOM   2344 N NH2 . ARG B 1 54  ? -7.347  10.861  -15.656 1.00 30.84 ? 54  ARG B NH2 1 
ATOM   2345 N N   . LYS B 1 55  ? -7.121  14.127  -9.562  1.00 30.32 ? 55  LYS B N   1 
ATOM   2346 C CA  . LYS B 1 55  ? -7.727  14.358  -8.278  1.00 30.84 ? 55  LYS B CA  1 
ATOM   2347 C C   . LYS B 1 55  ? -6.737  13.803  -7.257  1.00 31.18 ? 55  LYS B C   1 
ATOM   2348 O O   . LYS B 1 55  ? -5.917  12.923  -7.571  1.00 31.83 ? 55  LYS B O   1 
ATOM   2349 C CB  . LYS B 1 55  ? -9.074  13.606  -8.211  1.00 30.97 ? 55  LYS B CB  1 
ATOM   2350 C CG  . LYS B 1 55  ? -9.842  13.765  -6.911  1.00 33.15 ? 55  LYS B CG  1 
ATOM   2351 C CD  . LYS B 1 55  ? -11.091 12.867  -6.806  1.00 35.78 ? 55  LYS B CD  1 
ATOM   2352 C CE  . LYS B 1 55  ? -11.903 13.270  -5.551  1.00 37.73 ? 55  LYS B CE  1 
ATOM   2353 N NZ  . LYS B 1 55  ? -12.401 12.063  -4.816  1.00 39.90 ? 55  LYS B NZ  1 
ATOM   2354 N N   . SER B 1 56  ? -6.791  14.307  -6.038  1.00 30.44 ? 56  SER B N   1 
ATOM   2355 C CA  . SER B 1 56  ? -6.063  13.665  -4.978  1.00 30.27 ? 56  SER B CA  1 
ATOM   2356 C C   . SER B 1 56  ? -6.635  14.215  -3.708  1.00 29.93 ? 56  SER B C   1 
ATOM   2357 O O   . SER B 1 56  ? -7.145  15.322  -3.706  1.00 29.66 ? 56  SER B O   1 
ATOM   2358 C CB  . SER B 1 56  ? -4.562  13.959  -5.075  1.00 30.06 ? 56  SER B CB  1 
ATOM   2359 O OG  . SER B 1 56  ? -4.291  15.252  -4.604  1.00 31.51 ? 56  SER B OG  1 
ATOM   2360 N N   . PRO B 1 57  ? -6.532  13.462  -2.607  1.00 29.61 ? 57  PRO B N   1 
ATOM   2361 C CA  . PRO B 1 57  ? -7.039  14.044  -1.369  1.00 29.62 ? 57  PRO B CA  1 
ATOM   2362 C C   . PRO B 1 57  ? -6.276  15.304  -0.883  1.00 29.93 ? 57  PRO B C   1 
ATOM   2363 O O   . PRO B 1 57  ? -6.760  15.973  0.047   1.00 30.92 ? 57  PRO B O   1 
ATOM   2364 C CB  . PRO B 1 57  ? -6.920  12.903  -0.347  1.00 29.12 ? 57  PRO B CB  1 
ATOM   2365 C CG  . PRO B 1 57  ? -6.426  11.713  -1.092  1.00 29.59 ? 57  PRO B CG  1 
ATOM   2366 C CD  . PRO B 1 57  ? -5.909  12.149  -2.416  1.00 29.14 ? 57  PRO B CD  1 
ATOM   2367 N N   . SER B 1 58  ? -5.138  15.637  -1.492  1.00 29.10 ? 58  SER B N   1 
ATOM   2368 C CA  . SER B 1 58  ? -4.364  16.786  -1.045  1.00 29.70 ? 58  SER B CA  1 
ATOM   2369 C C   . SER B 1 58  ? -4.140  17.858  -2.112  1.00 29.87 ? 58  SER B C   1 
ATOM   2370 O O   . SER B 1 58  ? -3.060  18.420  -2.221  1.00 30.77 ? 58  SER B O   1 
ATOM   2371 C CB  . SER B 1 58  ? -3.028  16.339  -0.440  1.00 29.96 ? 58  SER B CB  1 
ATOM   2372 O OG  . SER B 1 58  ? -2.178  15.713  -1.407  1.00 30.25 ? 58  SER B OG  1 
ATOM   2373 N N   . GLY B 1 59  ? -5.174  18.147  -2.890  1.00 30.25 ? 59  GLY B N   1 
ATOM   2374 C CA  . GLY B 1 59  ? -5.144  19.174  -3.943  1.00 29.12 ? 59  GLY B CA  1 
ATOM   2375 C C   . GLY B 1 59  ? -6.504  19.349  -4.597  1.00 28.81 ? 59  GLY B C   1 
ATOM   2376 O O   . GLY B 1 59  ? -7.362  18.488  -4.507  1.00 28.15 ? 59  GLY B O   1 
ATOM   2377 N N   . LEU B 1 60  ? -6.707  20.489  -5.245  1.00 29.72 ? 60  LEU B N   1 
ATOM   2378 C CA  . LEU B 1 60  ? -7.905  20.732  -6.076  1.00 29.82 ? 60  LEU B CA  1 
ATOM   2379 C C   . LEU B 1 60  ? -7.839  19.869  -7.359  1.00 30.62 ? 60  LEU B C   1 
ATOM   2380 O O   . LEU B 1 60  ? -6.744  19.478  -7.758  1.00 30.55 ? 60  LEU B O   1 
ATOM   2381 C CB  . LEU B 1 60  ? -8.003  22.222  -6.393  1.00 28.62 ? 60  LEU B CB  1 
ATOM   2382 C CG  . LEU B 1 60  ? -9.235  23.004  -5.895  1.00 27.92 ? 60  LEU B CG  1 
ATOM   2383 C CD1 . LEU B 1 60  ? -9.917  22.342  -4.684  1.00 28.36 ? 60  LEU B CD1 1 
ATOM   2384 C CD2 . LEU B 1 60  ? -8.932  24.482  -5.608  1.00 24.24 ? 60  LEU B CD2 1 
ATOM   2385 N N   . ASP B 1 61  ? -8.980  19.538  -7.975  1.00 31.45 ? 61  ASP B N   1 
ATOM   2386 C CA  . ASP B 1 61  ? -8.984  18.725  -9.213  1.00 32.03 ? 61  ASP B CA  1 
ATOM   2387 C C   . ASP B 1 61  ? -8.374  19.492  -10.386 1.00 33.00 ? 61  ASP B C   1 
ATOM   2388 O O   . ASP B 1 61  ? -8.398  20.734  -10.419 1.00 33.17 ? 61  ASP B O   1 
ATOM   2389 C CB  . ASP B 1 61  ? -10.400 18.351  -9.639  1.00 32.23 ? 61  ASP B CB  1 
ATOM   2390 C CG  . ASP B 1 61  ? -11.063 17.361  -8.720  1.00 33.26 ? 61  ASP B CG  1 
ATOM   2391 O OD1 . ASP B 1 61  ? -12.185 16.938  -9.082  1.00 31.96 ? 61  ASP B OD1 1 
ATOM   2392 O OD2 . ASP B 1 61  ? -10.494 17.012  -7.654  1.00 35.40 ? 61  ASP B OD2 1 
ATOM   2393 N N   . VAL B 1 62  ? -7.851  18.750  -11.359 1.00 33.21 ? 62  VAL B N   1 
ATOM   2394 C CA  . VAL B 1 62  ? -7.272  19.330  -12.575 1.00 33.95 ? 62  VAL B CA  1 
ATOM   2395 C C   . VAL B 1 62  ? -7.575  18.428  -13.787 1.00 34.86 ? 62  VAL B C   1 
ATOM   2396 O O   . VAL B 1 62  ? -7.326  17.219  -13.738 1.00 35.47 ? 62  VAL B O   1 
ATOM   2397 C CB  . VAL B 1 62  ? -5.749  19.542  -12.457 1.00 33.22 ? 62  VAL B CB  1 
ATOM   2398 C CG1 . VAL B 1 62  ? -5.188  20.170  -13.718 1.00 33.11 ? 62  VAL B CG1 1 
ATOM   2399 C CG2 . VAL B 1 62  ? -5.445  20.415  -11.322 1.00 32.77 ? 62  VAL B CG2 1 
ATOM   2400 N N   . GLU B 1 63  ? -8.122  19.011  -14.855 1.00 34.90 ? 63  GLU B N   1 
ATOM   2401 C CA  . GLU B 1 63  ? -8.379  18.251  -16.054 1.00 35.02 ? 63  GLU B CA  1 
ATOM   2402 C C   . GLU B 1 63  ? -7.287  18.635  -17.045 1.00 34.35 ? 63  GLU B C   1 
ATOM   2403 O O   . GLU B 1 63  ? -7.180  19.772  -17.470 1.00 34.18 ? 63  GLU B O   1 
ATOM   2404 C CB  . GLU B 1 63  ? -9.798  18.501  -16.587 1.00 35.67 ? 63  GLU B CB  1 
ATOM   2405 C CG  . GLU B 1 63  ? -10.905 18.446  -15.501 1.00 39.00 ? 63  GLU B CG  1 
ATOM   2406 C CD  . GLU B 1 63  ? -11.060 17.047  -14.847 1.00 43.99 ? 63  GLU B CD  1 
ATOM   2407 O OE1 . GLU B 1 63  ? -11.504 16.089  -15.544 1.00 45.03 ? 63  GLU B OE1 1 
ATOM   2408 O OE2 . GLU B 1 63  ? -10.741 16.907  -13.638 0.50 43.14 ? 63  GLU B OE2 1 
ATOM   2409 N N   . ARG B 1 64  ? -6.443  17.668  -17.369 1.00 33.75 ? 64  ARG B N   1 
ATOM   2410 C CA  . ARG B 1 64  ? -5.346  17.886  -18.297 1.00 33.03 ? 64  ARG B CA  1 
ATOM   2411 C C   . ARG B 1 64  ? -5.160  16.630  -19.094 1.00 32.82 ? 64  ARG B C   1 
ATOM   2412 O O   . ARG B 1 64  ? -5.198  15.541  -18.549 1.00 32.32 ? 64  ARG B O   1 
ATOM   2413 C CB  . ARG B 1 64  ? -4.045  18.197  -17.562 1.00 32.37 ? 64  ARG B CB  1 
ATOM   2414 C CG  . ARG B 1 64  ? -2.925  18.496  -18.490 1.00 32.06 ? 64  ARG B CG  1 
ATOM   2415 C CD  . ARG B 1 64  ? -1.625  18.809  -17.787 1.00 31.18 ? 64  ARG B CD  1 
ATOM   2416 N NE  . ARG B 1 64  ? -1.703  20.001  -16.960 1.00 32.58 ? 64  ARG B NE  1 
ATOM   2417 C CZ  . ARG B 1 64  ? -1.808  21.249  -17.428 1.00 34.67 ? 64  ARG B CZ  1 
ATOM   2418 N NH1 . ARG B 1 64  ? -1.860  21.481  -18.749 1.00 32.17 ? 64  ARG B NH1 1 
ATOM   2419 N NH2 . ARG B 1 64  ? -1.873  22.273  -16.561 1.00 30.49 ? 64  ARG B NH2 1 
ATOM   2420 N N   . ASP B 1 65  ? -4.948  16.783  -20.393 1.00 32.99 ? 65  ASP B N   1 
ATOM   2421 C CA  . ASP B 1 65  ? -4.681  15.626  -21.222 1.00 32.45 ? 65  ASP B CA  1 
ATOM   2422 C C   . ASP B 1 65  ? -3.377  14.943  -20.795 1.00 31.44 ? 65  ASP B C   1 
ATOM   2423 O O   . ASP B 1 65  ? -2.301  15.567  -20.758 1.00 31.65 ? 65  ASP B O   1 
ATOM   2424 C CB  . ASP B 1 65  ? -4.688  15.967  -22.716 1.00 32.38 ? 65  ASP B CB  1 
ATOM   2425 C CG  . ASP B 1 65  ? -4.342  14.776  -23.575 1.00 35.14 ? 65  ASP B CG  1 
ATOM   2426 O OD1 . ASP B 1 65  ? -5.179  13.844  -23.799 1.00 37.57 ? 65  ASP B OD1 1 
ATOM   2427 O OD2 . ASP B 1 65  ? -3.183  14.761  -24.004 1.00 40.08 ? 65  ASP B OD2 1 
ATOM   2428 N N   . PRO B 1 66  ? -3.490  13.656  -20.471 1.00 30.16 ? 66  PRO B N   1 
ATOM   2429 C CA  . PRO B 1 66  ? -2.428  12.761  -20.063 1.00 30.44 ? 66  PRO B CA  1 
ATOM   2430 C C   . PRO B 1 66  ? -1.262  12.766  -21.026 1.00 31.17 ? 66  PRO B C   1 
ATOM   2431 O O   . PRO B 1 66  ? -0.137  13.018  -20.600 1.00 31.85 ? 66  PRO B O   1 
ATOM   2432 C CB  . PRO B 1 66  ? -3.107  11.390  -20.076 1.00 30.14 ? 66  PRO B CB  1 
ATOM   2433 C CG  . PRO B 1 66  ? -4.355  11.583  -20.861 1.00 29.79 ? 66  PRO B CG  1 
ATOM   2434 C CD  . PRO B 1 66  ? -4.767  12.956  -20.642 1.00 29.54 ? 66  PRO B CD  1 
ATOM   2435 N N   . ILE B 1 67  ? -1.539  12.502  -22.312 1.00 31.63 ? 67  ILE B N   1 
ATOM   2436 C CA  . ILE B 1 67  ? -0.543  12.509  -23.378 1.00 31.69 ? 67  ILE B CA  1 
ATOM   2437 C C   . ILE B 1 67  ? 0.195   13.848  -23.509 1.00 32.80 ? 67  ILE B C   1 
ATOM   2438 O O   . ILE B 1 67  ? 1.428   13.866  -23.618 1.00 32.17 ? 67  ILE B O   1 
ATOM   2439 C CB  . ILE B 1 67  ? -1.168  12.124  -24.737 1.00 31.66 ? 67  ILE B CB  1 
ATOM   2440 C CG1 . ILE B 1 67  ? -1.588  10.642  -24.732 1.00 32.00 ? 67  ILE B CG1 1 
ATOM   2441 C CG2 . ILE B 1 67  ? -0.225  12.486  -25.904 1.00 28.56 ? 67  ILE B CG2 1 
ATOM   2442 C CD1 . ILE B 1 67  ? -2.165  10.147  -26.080 1.00 31.38 ? 67  ILE B CD1 1 
ATOM   2443 N N   . GLU B 1 68  ? -0.535  14.966  -23.491 1.00 33.63 ? 68  GLU B N   1 
ATOM   2444 C CA  . GLU B 1 68  ? 0.167   16.248  -23.646 1.00 35.44 ? 68  GLU B CA  1 
ATOM   2445 C C   . GLU B 1 68  ? 1.068   16.469  -22.451 1.00 34.79 ? 68  GLU B C   1 
ATOM   2446 O O   . GLU B 1 68  ? 2.134   17.056  -22.586 1.00 36.25 ? 68  GLU B O   1 
ATOM   2447 C CB  . GLU B 1 68  ? -0.744  17.472  -23.941 1.00 35.69 ? 68  GLU B CB  1 
ATOM   2448 C CG  . GLU B 1 68  ? -1.602  17.954  -22.758 1.00 39.95 ? 68  GLU B CG  1 
ATOM   2449 C CD  . GLU B 1 68  ? -1.902  19.477  -22.749 1.00 43.86 ? 68  GLU B CD  1 
ATOM   2450 O OE1 . GLU B 1 68  ? -2.258  20.060  -23.829 1.00 42.30 ? 68  GLU B OE1 1 
ATOM   2451 O OE2 . GLU B 1 68  ? -1.800  20.066  -21.631 1.00 42.66 ? 68  GLU B OE2 1 
ATOM   2452 N N   . TYR B 1 69  ? 0.666   15.964  -21.292 1.00 34.00 ? 69  TYR B N   1 
ATOM   2453 C CA  . TYR B 1 69  ? 1.490   16.081  -20.097 1.00 33.22 ? 69  TYR B CA  1 
ATOM   2454 C C   . TYR B 1 69  ? 2.768   15.227  -20.235 1.00 33.04 ? 69  TYR B C   1 
ATOM   2455 O O   . TYR B 1 69  ? 3.883   15.722  -20.096 1.00 33.10 ? 69  TYR B O   1 
ATOM   2456 C CB  . TYR B 1 69  ? 0.661   15.648  -18.891 1.00 33.39 ? 69  TYR B CB  1 
ATOM   2457 C CG  . TYR B 1 69  ? 1.335   15.824  -17.540 1.00 33.40 ? 69  TYR B CG  1 
ATOM   2458 C CD1 . TYR B 1 69  ? 1.567   17.109  -17.011 1.00 30.50 ? 69  TYR B CD1 1 
ATOM   2459 C CD2 . TYR B 1 69  ? 1.706   14.712  -16.778 1.00 32.34 ? 69  TYR B CD2 1 
ATOM   2460 C CE1 . TYR B 1 69  ? 2.154   17.283  -15.788 1.00 30.18 ? 69  TYR B CE1 1 
ATOM   2461 C CE2 . TYR B 1 69  ? 2.296   14.877  -15.532 1.00 33.01 ? 69  TYR B CE2 1 
ATOM   2462 C CZ  . TYR B 1 69  ? 2.516   16.170  -15.039 1.00 32.29 ? 69  TYR B CZ  1 
ATOM   2463 O OH  . TYR B 1 69  ? 3.109   16.348  -13.804 1.00 30.38 ? 69  TYR B OH  1 
ATOM   2464 N N   . ALA B 1 70  ? 2.594   13.952  -20.559 1.00 32.41 ? 70  ALA B N   1 
ATOM   2465 C CA  . ALA B 1 70  ? 3.708   13.039  -20.690 1.00 32.22 ? 70  ALA B CA  1 
ATOM   2466 C C   . ALA B 1 70  ? 4.695   13.435  -21.781 1.00 32.14 ? 70  ALA B C   1 
ATOM   2467 O O   . ALA B 1 70  ? 5.915   13.313  -21.589 1.00 31.96 ? 70  ALA B O   1 
ATOM   2468 C CB  . ALA B 1 70  ? 3.191   11.638  -20.924 1.00 32.18 ? 70  ALA B CB  1 
ATOM   2469 N N   . LYS B 1 71  ? 4.168   13.897  -22.919 1.00 31.95 ? 71  LYS B N   1 
ATOM   2470 C CA  . LYS B 1 71  ? 5.006   14.263  -24.065 1.00 31.69 ? 71  LYS B CA  1 
ATOM   2471 C C   . LYS B 1 71  ? 5.871   15.444  -23.670 1.00 31.75 ? 71  LYS B C   1 
ATOM   2472 O O   . LYS B 1 71  ? 7.010   15.554  -24.096 1.00 32.74 ? 71  LYS B O   1 
ATOM   2473 C CB  . LYS B 1 71  ? 4.176   14.574  -25.325 1.00 31.25 ? 71  LYS B CB  1 
ATOM   2474 C CG  . LYS B 1 71  ? 3.985   13.377  -26.269 1.00 32.48 ? 71  LYS B CG  1 
ATOM   2475 C CD  . LYS B 1 71  ? 3.628   13.786  -27.739 1.00 34.80 ? 71  LYS B CD  1 
ATOM   2476 N N   . PHE B 1 72  ? 5.332   16.311  -22.829 1.00 31.25 ? 72  PHE B N   1 
ATOM   2477 C CA  . PHE B 1 72  ? 6.060   17.475  -22.386 1.00 31.11 ? 72  PHE B CA  1 
ATOM   2478 C C   . PHE B 1 72  ? 7.070   17.137  -21.285 1.00 31.35 ? 72  PHE B C   1 
ATOM   2479 O O   . PHE B 1 72  ? 8.183   17.705  -21.238 1.00 30.60 ? 72  PHE B O   1 
ATOM   2480 C CB  . PHE B 1 72  ? 5.096   18.528  -21.847 1.00 31.43 ? 72  PHE B CB  1 
ATOM   2481 C CG  . PHE B 1 72  ? 5.783   19.605  -21.043 1.00 31.61 ? 72  PHE B CG  1 
ATOM   2482 C CD1 . PHE B 1 72  ? 6.248   20.761  -21.662 1.00 31.55 ? 72  PHE B CD1 1 
ATOM   2483 C CD2 . PHE B 1 72  ? 5.995   19.442  -19.659 1.00 30.95 ? 72  PHE B CD2 1 
ATOM   2484 C CE1 . PHE B 1 72  ? 6.906   21.769  -20.907 1.00 33.59 ? 72  PHE B CE1 1 
ATOM   2485 C CE2 . PHE B 1 72  ? 6.657   20.408  -18.904 1.00 29.10 ? 72  PHE B CE2 1 
ATOM   2486 C CZ  . PHE B 1 72  ? 7.115   21.587  -19.521 1.00 31.00 ? 72  PHE B CZ  1 
ATOM   2487 N N   . MET B 1 73  ? 6.662   16.265  -20.358 1.00 31.23 ? 73  MET B N   1 
ATOM   2488 C CA  . MET B 1 73  ? 7.574   15.861  -19.287 1.00 31.59 ? 73  MET B CA  1 
ATOM   2489 C C   . MET B 1 73  ? 8.746   15.057  -19.852 1.00 32.40 ? 73  MET B C   1 
ATOM   2490 O O   . MET B 1 73  ? 9.854   15.085  -19.293 1.00 32.75 ? 73  MET B O   1 
ATOM   2491 C CB  . MET B 1 73  ? 6.852   15.120  -18.158 1.00 30.85 ? 73  MET B CB  1 
ATOM   2492 C CG  . MET B 1 73  ? 6.049   16.044  -17.212 1.00 30.65 ? 73  MET B CG  1 
ATOM   2493 S SD  . MET B 1 73  ? 7.002   17.487  -16.634 1.00 32.91 ? 73  MET B SD  1 
ATOM   2494 C CE  . MET B 1 73  ? 5.649   18.448  -15.918 1.00 32.05 ? 73  MET B CE  1 
ATOM   2495 N N   . GLU B 1 74  ? 8.518   14.384  -20.982 1.00 33.23 ? 74  GLU B N   1 
ATOM   2496 C CA  . GLU B 1 74  ? 9.588   13.629  -21.643 1.00 34.59 ? 74  GLU B CA  1 
ATOM   2497 C C   . GLU B 1 74  ? 10.933  14.388  -21.803 1.00 34.29 ? 74  GLU B C   1 
ATOM   2498 O O   . GLU B 1 74  ? 11.975  13.780  -21.708 1.00 34.67 ? 74  GLU B O   1 
ATOM   2499 C CB  . GLU B 1 74  ? 9.126   13.025  -22.979 1.00 34.83 ? 74  GLU B CB  1 
ATOM   2500 C CG  . GLU B 1 74  ? 10.110  12.028  -23.551 1.00 36.69 ? 74  GLU B CG  1 
ATOM   2501 C CD  . GLU B 1 74  ? 9.573   11.262  -24.733 1.00 40.89 ? 74  GLU B CD  1 
ATOM   2502 O OE1 . GLU B 1 74  ? 9.097   11.898  -25.694 1.00 43.38 ? 74  GLU B OE1 1 
ATOM   2503 O OE2 . GLU B 1 74  ? 9.645   10.016  -24.711 1.00 43.72 ? 74  GLU B OE2 1 
ATOM   2504 N N   . ARG B 1 75  ? 10.915  15.697  -22.003 1.00 34.31 ? 75  ARG B N   1 
ATOM   2505 C CA  . ARG B 1 75  ? 12.168  16.425  -22.248 1.00 34.71 ? 75  ARG B CA  1 
ATOM   2506 C C   . ARG B 1 75  ? 12.989  16.696  -20.984 1.00 34.89 ? 75  ARG B C   1 
ATOM   2507 O O   . ARG B 1 75  ? 14.157  17.089  -21.072 1.00 33.91 ? 75  ARG B O   1 
ATOM   2508 C CB  . ARG B 1 75  ? 11.909  17.729  -23.033 1.00 34.80 ? 75  ARG B CB  1 
ATOM   2509 N N   . TYR B 1 76  ? 12.380  16.458  -19.819 1.00 35.48 ? 76  TYR B N   1 
ATOM   2510 C CA  . TYR B 1 76  ? 12.898  16.978  -18.537 1.00 36.05 ? 76  TYR B CA  1 
ATOM   2511 C C   . TYR B 1 76  ? 12.924  15.982  -17.380 1.00 35.45 ? 76  TYR B C   1 
ATOM   2512 O O   . TYR B 1 76  ? 13.865  15.999  -16.584 1.00 36.19 ? 76  TYR B O   1 
ATOM   2513 C CB  . TYR B 1 76  ? 12.082  18.189  -18.099 1.00 36.43 ? 76  TYR B CB  1 
ATOM   2514 C CG  . TYR B 1 76  ? 12.009  19.261  -19.147 1.00 40.33 ? 76  TYR B CG  1 
ATOM   2515 C CD1 . TYR B 1 76  ? 13.057  20.179  -19.299 1.00 43.54 ? 76  TYR B CD1 1 
ATOM   2516 C CD2 . TYR B 1 76  ? 10.900  19.362  -20.008 1.00 43.68 ? 76  TYR B CD2 1 
ATOM   2517 C CE1 . TYR B 1 76  ? 13.014  21.180  -20.287 1.00 46.36 ? 76  TYR B CE1 1 
ATOM   2518 C CE2 . TYR B 1 76  ? 10.834  20.375  -20.998 1.00 46.46 ? 76  TYR B CE2 1 
ATOM   2519 C CZ  . TYR B 1 76  ? 11.907  21.275  -21.126 1.00 47.41 ? 76  TYR B CZ  1 
ATOM   2520 O OH  . TYR B 1 76  ? 11.891  22.267  -22.078 1.00 48.43 ? 76  TYR B OH  1 
ATOM   2521 N N   . ALA B 1 77  ? 11.895  15.136  -17.283 1.00 33.76 ? 77  ALA B N   1 
ATOM   2522 C CA  . ALA B 1 77  ? 11.696  14.295  -16.114 1.00 32.43 ? 77  ALA B CA  1 
ATOM   2523 C C   . ALA B 1 77  ? 12.559  13.057  -16.185 1.00 32.03 ? 77  ALA B C   1 
ATOM   2524 O O   . ALA B 1 77  ? 12.840  12.563  -17.282 1.00 32.36 ? 77  ALA B O   1 
ATOM   2525 C CB  . ALA B 1 77  ? 10.226  13.908  -15.984 1.00 32.29 ? 77  ALA B CB  1 
ATOM   2526 N N   . VAL B 1 78  ? 12.982  12.538  -15.031 1.00 30.69 ? 78  VAL B N   1 
ATOM   2527 C CA  . VAL B 1 78  ? 13.754  11.308  -15.057 1.00 29.78 ? 78  VAL B CA  1 
ATOM   2528 C C   . VAL B 1 78  ? 12.777  10.148  -15.194 1.00 29.55 ? 78  VAL B C   1 
ATOM   2529 O O   . VAL B 1 78  ? 13.165  9.059   -15.641 1.00 29.74 ? 78  VAL B O   1 
ATOM   2530 C CB  . VAL B 1 78  ? 14.754  11.152  -13.863 1.00 29.66 ? 78  VAL B CB  1 
ATOM   2531 C CG1 . VAL B 1 78  ? 14.037  10.951  -12.551 1.00 30.46 ? 78  VAL B CG1 1 
ATOM   2532 C CG2 . VAL B 1 78  ? 15.702  9.984   -14.097 1.00 29.28 ? 78  VAL B CG2 1 
ATOM   2533 N N   . GLY B 1 79  ? 11.510  10.411  -14.845 1.00 28.55 ? 79  GLY B N   1 
ATOM   2534 C CA  . GLY B 1 79  ? 10.423  9.439   -14.938 1.00 27.80 ? 79  GLY B CA  1 
ATOM   2535 C C   . GLY B 1 79  ? 9.016   9.995   -14.664 1.00 27.58 ? 79  GLY B C   1 
ATOM   2536 O O   . GLY B 1 79  ? 8.846   11.143  -14.293 1.00 27.38 ? 79  GLY B O   1 
ATOM   2537 N N   . LEU B 1 80  ? 8.005   9.159   -14.841 1.00 27.30 ? 80  LEU B N   1 
ATOM   2538 C CA  . LEU B 1 80  ? 6.631   9.546   -14.617 1.00 27.11 ? 80  LEU B CA  1 
ATOM   2539 C C   . LEU B 1 80  ? 5.968   8.594   -13.640 1.00 27.18 ? 80  LEU B C   1 
ATOM   2540 O O   . LEU B 1 80  ? 6.162   7.380   -13.707 1.00 27.17 ? 80  LEU B O   1 
ATOM   2541 C CB  . LEU B 1 80  ? 5.853   9.576   -15.948 1.00 27.57 ? 80  LEU B CB  1 
ATOM   2542 C CG  . LEU B 1 80  ? 6.265   10.672  -16.984 1.00 28.25 ? 80  LEU B CG  1 
ATOM   2543 C CD1 . LEU B 1 80  ? 5.516   10.566  -18.308 1.00 25.18 ? 80  LEU B CD1 1 
ATOM   2544 C CD2 . LEU B 1 80  ? 6.084   12.060  -16.408 1.00 27.56 ? 80  LEU B CD2 1 
ATOM   2545 N N   . VAL B 1 81  ? 5.221   9.168   -12.702 1.00 27.23 ? 81  VAL B N   1 
ATOM   2546 C CA  . VAL B 1 81  ? 4.287   8.423   -11.868 1.00 27.00 ? 81  VAL B CA  1 
ATOM   2547 C C   . VAL B 1 81  ? 2.881   8.697   -12.407 1.00 26.73 ? 81  VAL B C   1 
ATOM   2548 O O   . VAL B 1 81  ? 2.503   9.841   -12.640 1.00 26.63 ? 81  VAL B O   1 
ATOM   2549 C CB  . VAL B 1 81  ? 4.462   8.826   -10.364 1.00 27.05 ? 81  VAL B CB  1 
ATOM   2550 C CG1 . VAL B 1 81  ? 3.355   8.286   -9.504  1.00 25.70 ? 81  VAL B CG1 1 
ATOM   2551 C CG2 . VAL B 1 81  ? 5.841   8.342   -9.850  1.00 26.67 ? 81  VAL B CG2 1 
ATOM   2552 N N   . ILE B 1 82  ? 2.126   7.637   -12.657 1.00 26.93 ? 82  ILE B N   1 
ATOM   2553 C CA  . ILE B 1 82  ? 0.779   7.768   -13.238 1.00 25.91 ? 82  ILE B CA  1 
ATOM   2554 C C   . ILE B 1 82  ? -0.167  7.095   -12.291 1.00 25.84 ? 82  ILE B C   1 
ATOM   2555 O O   . ILE B 1 82  ? -0.030  5.902   -12.006 1.00 25.22 ? 82  ILE B O   1 
ATOM   2556 C CB  . ILE B 1 82  ? 0.630   7.081   -14.622 1.00 25.74 ? 82  ILE B CB  1 
ATOM   2557 C CG1 . ILE B 1 82  ? 1.780   7.442   -15.577 1.00 26.16 ? 82  ILE B CG1 1 
ATOM   2558 C CG2 . ILE B 1 82  ? -0.709  7.442   -15.254 1.00 26.17 ? 82  ILE B CG2 1 
ATOM   2559 C CD1 . ILE B 1 82  ? 2.009   8.970   -15.765 1.00 30.35 ? 82  ILE B CD1 1 
ATOM   2560 N N   . LEU B 1 83  ? -1.111  7.882   -11.791 1.00 25.65 ? 83  LEU B N   1 
ATOM   2561 C CA  . LEU B 1 83  ? -2.121  7.396   -10.893 1.00 26.08 ? 83  LEU B CA  1 
ATOM   2562 C C   . LEU B 1 83  ? -3.073  6.531   -11.645 1.00 26.49 ? 83  LEU B C   1 
ATOM   2563 O O   . LEU B 1 83  ? -3.635  6.962   -12.643 1.00 27.70 ? 83  LEU B O   1 
ATOM   2564 C CB  . LEU B 1 83  ? -2.886  8.564   -10.234 1.00 25.76 ? 83  LEU B CB  1 
ATOM   2565 C CG  . LEU B 1 83  ? -2.451  8.960   -8.804  1.00 25.39 ? 83  LEU B CG  1 
ATOM   2566 C CD1 . LEU B 1 83  ? -2.812  7.839   -7.870  1.00 21.09 ? 83  LEU B CD1 1 
ATOM   2567 C CD2 . LEU B 1 83  ? -0.928  9.356   -8.656  1.00 18.42 ? 83  LEU B CD2 1 
ATOM   2568 N N   . THR B 1 84  ? -3.274  5.313   -11.158 1.00 26.90 ? 84  THR B N   1 
ATOM   2569 C CA  . THR B 1 84  ? -4.314  4.469   -11.725 1.00 27.05 ? 84  THR B CA  1 
ATOM   2570 C C   . THR B 1 84  ? -5.427  4.150   -10.751 1.00 26.55 ? 84  THR B C   1 
ATOM   2571 O O   . THR B 1 84  ? -6.331  3.403   -11.085 1.00 26.56 ? 84  THR B O   1 
ATOM   2572 C CB  . THR B 1 84  ? -3.742  3.168   -12.269 1.00 27.16 ? 84  THR B CB  1 
ATOM   2573 O OG1 . THR B 1 84  ? -2.990  2.541   -11.223 1.00 26.71 ? 84  THR B OG1 1 
ATOM   2574 C CG2 . THR B 1 84  ? -2.837  3.463   -13.482 1.00 26.22 ? 84  THR B CG2 1 
ATOM   2575 N N   . GLU B 1 85  ? -5.367  4.702   -9.553  1.00 26.39 ? 85  GLU B N   1 
ATOM   2576 C CA  . GLU B 1 85  ? -6.449  4.503   -8.586  1.00 26.95 ? 85  GLU B CA  1 
ATOM   2577 C C   . GLU B 1 85  ? -7.642  5.376   -8.986  1.00 27.62 ? 85  GLU B C   1 
ATOM   2578 O O   . GLU B 1 85  ? -7.449  6.518   -9.370  1.00 27.56 ? 85  GLU B O   1 
ATOM   2579 C CB  . GLU B 1 85  ? -5.952  4.865   -7.191  1.00 26.44 ? 85  GLU B CB  1 
ATOM   2580 C CG  . GLU B 1 85  ? -6.777  4.311   -6.083  1.00 25.49 ? 85  GLU B CG  1 
ATOM   2581 C CD  . GLU B 1 85  ? -8.045  5.076   -5.878  1.00 25.54 ? 85  GLU B CD  1 
ATOM   2582 O OE1 . GLU B 1 85  ? -7.981  6.316   -5.927  1.00 24.24 ? 85  GLU B OE1 1 
ATOM   2583 O OE2 . GLU B 1 85  ? -9.100  4.424   -5.668  1.00 27.06 ? 85  GLU B OE2 1 
ATOM   2584 N N   . GLU B 1 86  ? -8.859  4.855   -8.884  1.00 29.10 ? 86  GLU B N   1 
ATOM   2585 C CA  . GLU B 1 86  ? -10.032 5.498   -9.525  1.00 30.83 ? 86  GLU B CA  1 
ATOM   2586 C C   . GLU B 1 86  ? -10.876 6.413   -8.635  1.00 31.35 ? 86  GLU B C   1 
ATOM   2587 O O   . GLU B 1 86  ? -11.214 7.543   -9.032  1.00 31.78 ? 86  GLU B O   1 
ATOM   2588 C CB  . GLU B 1 86  ? -10.962 4.446   -10.152 1.00 30.91 ? 86  GLU B CB  1 
ATOM   2589 C CG  . GLU B 1 86  ? -10.357 3.729   -11.368 1.00 34.59 ? 86  GLU B CG  1 
ATOM   2590 C CD  . GLU B 1 86  ? -11.233 2.600   -11.914 1.00 39.66 ? 86  GLU B CD  1 
ATOM   2591 O OE1 . GLU B 1 86  ? -11.247 2.407   -13.161 1.00 42.08 ? 86  GLU B OE1 1 
ATOM   2592 O OE2 . GLU B 1 86  ? -11.910 1.915   -11.102 1.00 41.65 ? 86  GLU B OE2 1 
ATOM   2593 N N   . LYS B 1 87  ? -11.227 5.918   -7.446  1.00 31.36 ? 87  LYS B N   1 
ATOM   2594 C CA  . LYS B 1 87  ? -12.093 6.648   -6.515  1.00 31.08 ? 87  LYS B CA  1 
ATOM   2595 C C   . LYS B 1 87  ? -11.499 7.966   -5.989  1.00 30.90 ? 87  LYS B C   1 
ATOM   2596 O O   . LYS B 1 87  ? -12.184 8.995   -5.986  1.00 31.22 ? 87  LYS B O   1 
ATOM   2597 C CB  . LYS B 1 87  ? -12.497 5.753   -5.340  1.00 30.97 ? 87  LYS B CB  1 
ATOM   2598 C CG  . LYS B 1 87  ? -13.846 6.100   -4.784  1.00 31.83 ? 87  LYS B CG  1 
ATOM   2599 C CD  . LYS B 1 87  ? -14.033 5.627   -3.356  1.00 33.96 ? 87  LYS B CD  1 
ATOM   2600 C CE  . LYS B 1 87  ? -15.254 6.281   -2.692  1.00 34.83 ? 87  LYS B CE  1 
ATOM   2601 N NZ  . LYS B 1 87  ? -15.787 5.411   -1.602  1.00 36.45 ? 87  LYS B NZ  1 
ATOM   2602 N N   . TYR B 1 88  ? -10.236 7.933   -5.560  1.00 30.09 ? 88  TYR B N   1 
ATOM   2603 C CA  . TYR B 1 88  ? -9.636  9.030   -4.801  1.00 29.36 ? 88  TYR B CA  1 
ATOM   2604 C C   . TYR B 1 88  ? -8.801  9.865   -5.706  1.00 28.74 ? 88  TYR B C   1 
ATOM   2605 O O   . TYR B 1 88  ? -8.583  11.053  -5.476  1.00 27.47 ? 88  TYR B O   1 
ATOM   2606 C CB  . TYR B 1 88  ? -8.795  8.475   -3.617  1.00 29.42 ? 88  TYR B CB  1 
ATOM   2607 C CG  . TYR B 1 88  ? -9.695  7.961   -2.545  1.00 30.56 ? 88  TYR B CG  1 
ATOM   2608 C CD1 . TYR B 1 88  ? -10.225 8.832   -1.589  1.00 30.57 ? 88  TYR B CD1 1 
ATOM   2609 C CD2 . TYR B 1 88  ? -10.104 6.625   -2.527  1.00 29.83 ? 88  TYR B CD2 1 
ATOM   2610 C CE1 . TYR B 1 88  ? -11.105 8.392   -0.611  1.00 29.96 ? 88  TYR B CE1 1 
ATOM   2611 C CE2 . TYR B 1 88  ? -10.979 6.170   -1.539  1.00 31.04 ? 88  TYR B CE2 1 
ATOM   2612 C CZ  . TYR B 1 88  ? -11.484 7.073   -0.587  1.00 30.63 ? 88  TYR B CZ  1 
ATOM   2613 O OH  . TYR B 1 88  ? -12.366 6.656   0.374   1.00 28.19 ? 88  TYR B OH  1 
ATOM   2614 N N   . PHE B 1 89  ? -8.323  9.228   -6.757  1.00 29.47 ? 89  PHE B N   1 
ATOM   2615 C CA  . PHE B 1 89  ? -7.439  9.939   -7.663  1.00 30.46 ? 89  PHE B CA  1 
ATOM   2616 C C   . PHE B 1 89  ? -7.979  10.122  -9.070  1.00 31.17 ? 89  PHE B C   1 
ATOM   2617 O O   . PHE B 1 89  ? -7.351  10.823  -9.866  1.00 32.03 ? 89  PHE B O   1 
ATOM   2618 C CB  . PHE B 1 89  ? -6.083  9.287   -7.672  1.00 29.77 ? 89  PHE B CB  1 
ATOM   2619 C CG  . PHE B 1 89  ? -5.391  9.329   -6.344  1.00 29.81 ? 89  PHE B CG  1 
ATOM   2620 C CD1 . PHE B 1 89  ? -5.570  8.303   -5.421  1.00 30.95 ? 89  PHE B CD1 1 
ATOM   2621 C CD2 . PHE B 1 89  ? -4.550  10.377  -6.021  1.00 27.70 ? 89  PHE B CD2 1 
ATOM   2622 C CE1 . PHE B 1 89  ? -4.916  8.324   -4.171  1.00 30.50 ? 89  PHE B CE1 1 
ATOM   2623 C CE2 . PHE B 1 89  ? -3.878  10.416  -4.795  1.00 29.72 ? 89  PHE B CE2 1 
ATOM   2624 C CZ  . PHE B 1 89  ? -4.067  9.391   -3.859  1.00 30.92 ? 89  PHE B CZ  1 
ATOM   2625 N N   . ASN B 1 90  ? -9.133  9.514   -9.374  1.00 31.46 ? 90  ASN B N   1 
ATOM   2626 C CA  . ASN B 1 90  ? -9.741  9.653   -10.708 1.00 32.49 ? 90  ASN B CA  1 
ATOM   2627 C C   . ASN B 1 90  ? -8.789  9.260   -11.853 1.00 31.73 ? 90  ASN B C   1 
ATOM   2628 O O   . ASN B 1 90  ? -8.778  9.863   -12.916 1.00 31.90 ? 90  ASN B O   1 
ATOM   2629 C CB  . ASN B 1 90  ? -10.267 11.081  -10.909 1.00 33.05 ? 90  ASN B CB  1 
ATOM   2630 C CG  . ASN B 1 90  ? -11.258 11.181  -12.071 1.00 36.20 ? 90  ASN B CG  1 
ATOM   2631 O OD1 . ASN B 1 90  ? -12.394 10.679  -11.999 1.00 37.71 ? 90  ASN B OD1 1 
ATOM   2632 N ND2 . ASN B 1 90  ? -10.826 11.839  -13.157 1.00 38.43 ? 90  ASN B ND2 1 
ATOM   2633 N N   . GLY B 1 91  ? -7.957  8.264   -11.600 1.00 30.94 ? 91  GLY B N   1 
ATOM   2634 C CA  . GLY B 1 91  ? -7.014  7.806   -12.579 1.00 30.74 ? 91  GLY B CA  1 
ATOM   2635 C C   . GLY B 1 91  ? -7.626  6.614   -13.271 1.00 30.40 ? 91  GLY B C   1 
ATOM   2636 O O   . GLY B 1 91  ? -8.644  6.085   -12.811 1.00 30.10 ? 91  GLY B O   1 
ATOM   2637 N N   . SER B 1 92  ? -7.022  6.197   -14.385 1.00 30.07 ? 92  SER B N   1 
ATOM   2638 C CA  . SER B 1 92  ? -7.423  4.949   -15.027 1.00 29.73 ? 92  SER B CA  1 
ATOM   2639 C C   . SER B 1 92  ? -6.245  4.218   -15.652 1.00 29.13 ? 92  SER B C   1 
ATOM   2640 O O   . SER B 1 92  ? -5.198  4.786   -15.932 1.00 28.25 ? 92  SER B O   1 
ATOM   2641 C CB  . SER B 1 92  ? -8.492  5.220   -16.091 1.00 30.29 ? 92  SER B CB  1 
ATOM   2642 O OG  . SER B 1 92  ? -7.952  6.077   -17.081 1.00 31.21 ? 92  SER B OG  1 
ATOM   2643 N N   . TYR B 1 93  ? -6.449  2.940   -15.877 1.00 29.09 ? 93  TYR B N   1 
ATOM   2644 C CA  . TYR B 1 93  ? -5.544  2.155   -16.665 1.00 29.39 ? 93  TYR B CA  1 
ATOM   2645 C C   . TYR B 1 93  ? -5.312  2.760   -18.054 1.00 29.85 ? 93  TYR B C   1 
ATOM   2646 O O   . TYR B 1 93  ? -4.188  2.761   -18.589 1.00 30.54 ? 93  TYR B O   1 
ATOM   2647 C CB  . TYR B 1 93  ? -6.109  0.755   -16.750 1.00 29.24 ? 93  TYR B CB  1 
ATOM   2648 C CG  . TYR B 1 93  ? -5.845  -0.047  -15.496 1.00 29.96 ? 93  TYR B CG  1 
ATOM   2649 C CD1 . TYR B 1 93  ? -4.760  0.256   -14.654 1.00 29.90 ? 93  TYR B CD1 1 
ATOM   2650 C CD2 . TYR B 1 93  ? -6.658  -1.126  -15.151 1.00 31.26 ? 93  TYR B CD2 1 
ATOM   2651 C CE1 . TYR B 1 93  ? -4.502  -0.496  -13.498 1.00 29.20 ? 93  TYR B CE1 1 
ATOM   2652 C CE2 . TYR B 1 93  ? -6.398  -1.880  -14.003 1.00 30.43 ? 93  TYR B CE2 1 
ATOM   2653 C CZ  . TYR B 1 93  ? -5.332  -1.551  -13.196 1.00 30.47 ? 93  TYR B CZ  1 
ATOM   2654 O OH  . TYR B 1 93  ? -5.104  -2.311  -12.097 1.00 34.66 ? 93  TYR B OH  1 
ATOM   2655 N N   . GLU B 1 94  ? -6.366  3.317   -18.624 1.00 30.11 ? 94  GLU B N   1 
ATOM   2656 C CA  . GLU B 1 94  ? -6.240  4.066   -19.855 1.00 30.48 ? 94  GLU B CA  1 
ATOM   2657 C C   . GLU B 1 94  ? -5.145  5.180   -19.828 1.00 29.70 ? 94  GLU B C   1 
ATOM   2658 O O   . GLU B 1 94  ? -4.407  5.353   -20.827 1.00 29.51 ? 94  GLU B O   1 
ATOM   2659 C CB  . GLU B 1 94  ? -7.627  4.576   -20.316 1.00 31.69 ? 94  GLU B CB  1 
ATOM   2660 C CG  . GLU B 1 94  ? -7.707  5.094   -21.784 1.00 34.08 ? 94  GLU B CG  1 
ATOM   2661 C CD  . GLU B 1 94  ? -7.287  4.042   -22.832 1.00 38.31 ? 94  GLU B CD  1 
ATOM   2662 O OE1 . GLU B 1 94  ? -7.508  2.810   -22.604 1.00 38.49 ? 94  GLU B OE1 1 
ATOM   2663 O OE2 . GLU B 1 94  ? -6.729  4.466   -23.879 1.00 38.81 ? 94  GLU B OE2 1 
ATOM   2664 N N   . ASP B 1 95  ? -5.014  5.914   -18.724 1.00 28.72 ? 95  ASP B N   1 
ATOM   2665 C CA  . ASP B 1 95  ? -4.030  7.014   -18.694 1.00 28.78 ? 95  ASP B CA  1 
ATOM   2666 C C   . ASP B 1 95  ? -2.634  6.455   -18.893 1.00 28.58 ? 95  ASP B C   1 
ATOM   2667 O O   . ASP B 1 95  ? -1.768  7.080   -19.531 1.00 28.21 ? 95  ASP B O   1 
ATOM   2668 C CB  . ASP B 1 95  ? -4.057  7.793   -17.374 1.00 28.85 ? 95  ASP B CB  1 
ATOM   2669 C CG  . ASP B 1 95  ? -5.376  8.524   -17.121 1.00 31.48 ? 95  ASP B CG  1 
ATOM   2670 O OD1 . ASP B 1 95  ? -6.038  8.957   -18.082 1.00 35.20 ? 95  ASP B OD1 1 
ATOM   2671 O OD2 . ASP B 1 95  ? -5.751  8.698   -15.938 1.00 36.19 ? 95  ASP B OD2 1 
ATOM   2672 N N   . LEU B 1 96  ? -2.420  5.272   -18.320 1.00 28.62 ? 96  LEU B N   1 
ATOM   2673 C CA  . LEU B 1 96  ? -1.106  4.658   -18.291 1.00 28.89 ? 96  LEU B CA  1 
ATOM   2674 C C   . LEU B 1 96  ? -0.782  4.171   -19.692 1.00 29.67 ? 96  LEU B C   1 
ATOM   2675 O O   . LEU B 1 96  ? 0.297   4.488   -20.217 1.00 29.28 ? 96  LEU B O   1 
ATOM   2676 C CB  . LEU B 1 96  ? -1.062  3.481   -17.314 1.00 28.02 ? 96  LEU B CB  1 
ATOM   2677 C CG  . LEU B 1 96  ? 0.304   2.964   -16.868 1.00 26.78 ? 96  LEU B CG  1 
ATOM   2678 C CD1 . LEU B 1 96  ? 0.041   1.784   -16.016 1.00 25.54 ? 96  LEU B CD1 1 
ATOM   2679 C CD2 . LEU B 1 96  ? 1.245   2.537   -17.988 1.00 26.77 ? 96  LEU B CD2 1 
ATOM   2680 N N   . ARG B 1 97  ? -1.717  3.404   -20.270 1.00 30.16 ? 97  ARG B N   1 
ATOM   2681 C CA  . ARG B 1 97  ? -1.552  2.877   -21.622 1.00 31.44 ? 97  ARG B CA  1 
ATOM   2682 C C   . ARG B 1 97  ? -1.211  3.976   -22.622 1.00 31.73 ? 97  ARG B C   1 
ATOM   2683 O O   . ARG B 1 97  ? -0.286  3.803   -23.421 1.00 31.07 ? 97  ARG B O   1 
ATOM   2684 C CB  . ARG B 1 97  ? -2.790  2.105   -22.096 1.00 31.70 ? 97  ARG B CB  1 
ATOM   2685 C CG  . ARG B 1 97  ? -2.539  1.247   -23.347 1.00 32.99 ? 97  ARG B CG  1 
ATOM   2686 C CD  . ARG B 1 97  ? -3.848  0.566   -23.835 1.00 36.91 ? 97  ARG B CD  1 
ATOM   2687 N N   . LYS B 1 98  ? -1.934  5.099   -22.568 1.00 32.24 ? 98  LYS B N   1 
ATOM   2688 C CA  . LYS B 1 98  ? -1.718  6.158   -23.546 1.00 32.99 ? 98  LYS B CA  1 
ATOM   2689 C C   . LYS B 1 98  ? -0.324  6.757   -23.401 1.00 33.21 ? 98  LYS B C   1 
ATOM   2690 O O   . LYS B 1 98  ? 0.416   6.888   -24.377 1.00 34.19 ? 98  LYS B O   1 
ATOM   2691 C CB  . LYS B 1 98  ? -2.767  7.259   -23.421 1.00 33.44 ? 98  LYS B CB  1 
ATOM   2692 C CG  . LYS B 1 98  ? -4.121  6.906   -23.971 1.00 34.38 ? 98  LYS B CG  1 
ATOM   2693 C CD  . LYS B 1 98  ? -5.175  7.960   -23.595 1.00 36.67 ? 98  LYS B CD  1 
ATOM   2694 C CE  . LYS B 1 98  ? -6.531  7.488   -24.039 1.00 37.10 ? 98  LYS B CE  1 
ATOM   2695 N NZ  . LYS B 1 98  ? -7.505  8.603   -24.118 1.00 41.02 ? 98  LYS B NZ  1 
ATOM   2696 N N   . ILE B 1 99  ? 0.036   7.119   -22.181 1.00 33.19 ? 99  ILE B N   1 
ATOM   2697 C CA  . ILE B 1 99  ? 1.340   7.720   -21.901 1.00 33.31 ? 99  ILE B CA  1 
ATOM   2698 C C   . ILE B 1 99  ? 2.466   6.712   -22.213 1.00 33.55 ? 99  ILE B C   1 
ATOM   2699 O O   . ILE B 1 99  ? 3.515   7.085   -22.759 1.00 33.32 ? 99  ILE B O   1 
ATOM   2700 C CB  . ILE B 1 99  ? 1.420   8.228   -20.412 1.00 33.15 ? 99  ILE B CB  1 
ATOM   2701 C CG1 . ILE B 1 99  ? 0.395   9.335   -20.176 1.00 32.28 ? 99  ILE B CG1 1 
ATOM   2702 C CG2 . ILE B 1 99  ? 2.835   8.694   -20.055 1.00 31.87 ? 99  ILE B CG2 1 
ATOM   2703 C CD1 . ILE B 1 99  ? 0.174   9.645   -18.740 1.00 30.88 ? 99  ILE B CD1 1 
ATOM   2704 N N   . ALA B 1 100 ? 2.232   5.448   -21.863 1.00 33.65 ? 100 ALA B N   1 
ATOM   2705 C CA  . ALA B 1 100 ? 3.170   4.364   -22.175 1.00 34.58 ? 100 ALA B CA  1 
ATOM   2706 C C   . ALA B 1 100 ? 3.298   4.132   -23.684 1.00 35.13 ? 100 ALA B C   1 
ATOM   2707 O O   . ALA B 1 100 ? 4.270   3.557   -24.136 1.00 35.83 ? 100 ALA B O   1 
ATOM   2708 C CB  . ALA B 1 100 ? 2.782   3.056   -21.448 1.00 33.87 ? 100 ALA B CB  1 
ATOM   2709 N N   . SER B 1 101 ? 2.321   4.591   -24.458 1.00 35.74 ? 101 SER B N   1 
ATOM   2710 C CA  . SER B 1 101 ? 2.406   4.529   -25.912 1.00 36.48 ? 101 SER B CA  1 
ATOM   2711 C C   . SER B 1 101 ? 3.147   5.727   -26.531 1.00 36.49 ? 101 SER B C   1 
ATOM   2712 O O   . SER B 1 101 ? 3.705   5.607   -27.644 1.00 35.99 ? 101 SER B O   1 
ATOM   2713 C CB  . SER B 1 101 ? 1.008   4.401   -26.502 1.00 36.56 ? 101 SER B CB  1 
ATOM   2714 O OG  . SER B 1 101 ? 0.390   3.245   -25.941 1.00 38.18 ? 101 SER B OG  1 
ATOM   2715 N N   . SER B 1 102 ? 3.163   6.843   -25.785 1.00 35.79 ? 102 SER B N   1 
ATOM   2716 C CA  . SER B 1 102 ? 3.615   8.144   -26.269 1.00 35.40 ? 102 SER B CA  1 
ATOM   2717 C C   . SER B 1 102 ? 5.020   8.535   -25.852 1.00 35.35 ? 102 SER B C   1 
ATOM   2718 O O   . SER B 1 102 ? 5.653   9.341   -26.550 1.00 36.09 ? 102 SER B O   1 
ATOM   2719 C CB  . SER B 1 102 ? 2.654   9.250   -25.819 1.00 35.55 ? 102 SER B CB  1 
ATOM   2720 O OG  . SER B 1 102 ? 1.338   9.018   -26.281 1.00 36.53 ? 102 SER B OG  1 
ATOM   2721 N N   . VAL B 1 103 ? 5.498   8.018   -24.714 1.00 34.93 ? 103 VAL B N   1 
ATOM   2722 C CA  . VAL B 1 103 ? 6.872   8.290   -24.260 1.00 34.41 ? 103 VAL B CA  1 
ATOM   2723 C C   . VAL B 1 103 ? 7.671   7.014   -23.995 1.00 34.45 ? 103 VAL B C   1 
ATOM   2724 O O   . VAL B 1 103 ? 7.112   5.941   -23.831 1.00 34.75 ? 103 VAL B O   1 
ATOM   2725 C CB  . VAL B 1 103 ? 6.919   9.232   -23.006 1.00 34.84 ? 103 VAL B CB  1 
ATOM   2726 C CG1 . VAL B 1 103 ? 6.156   10.535  -23.276 1.00 34.56 ? 103 VAL B CG1 1 
ATOM   2727 C CG2 . VAL B 1 103 ? 6.394   8.523   -21.753 1.00 32.42 ? 103 VAL B CG2 1 
ATOM   2728 N N   . SER B 1 104 ? 8.989   7.136   -23.961 1.00 34.40 ? 104 SER B N   1 
ATOM   2729 C CA  . SER B 1 104 ? 9.856   5.983   -23.726 1.00 34.13 ? 104 SER B CA  1 
ATOM   2730 C C   . SER B 1 104 ? 10.852  6.389   -22.625 1.00 33.50 ? 104 SER B C   1 
ATOM   2731 O O   . SER B 1 104 ? 12.029  6.019   -22.601 1.00 33.10 ? 104 SER B O   1 
ATOM   2732 C CB  . SER B 1 104 ? 10.542  5.557   -25.033 1.00 34.60 ? 104 SER B CB  1 
ATOM   2733 O OG  . SER B 1 104 ? 11.278  6.635   -25.564 1.00 34.93 ? 104 SER B OG  1 
ATOM   2734 N N   . ILE B 1 105 ? 10.324  7.205   -21.728 1.00 32.00 ? 105 ILE B N   1 
ATOM   2735 C CA  . ILE B 1 105 ? 10.936  7.533   -20.485 1.00 30.59 ? 105 ILE B CA  1 
ATOM   2736 C C   . ILE B 1 105 ? 10.298  6.557   -19.424 1.00 29.82 ? 105 ILE B C   1 
ATOM   2737 O O   . ILE B 1 105 ? 9.177   6.061   -19.635 1.00 30.03 ? 105 ILE B O   1 
ATOM   2738 C CB  . ILE B 1 105 ? 10.706  9.039   -20.298 1.00 30.82 ? 105 ILE B CB  1 
ATOM   2739 C CG1 . ILE B 1 105 ? 12.030  9.754   -20.132 1.00 31.90 ? 105 ILE B CG1 1 
ATOM   2740 C CG2 . ILE B 1 105 ? 9.597   9.414   -19.279 1.00 30.49 ? 105 ILE B CG2 1 
ATOM   2741 C CD1 . ILE B 1 105 ? 12.620  10.211  -21.460 1.00 33.39 ? 105 ILE B CD1 1 
ATOM   2742 N N   . PRO B 1 106 ? 11.016  6.213   -18.328 1.00 28.17 ? 106 PRO B N   1 
ATOM   2743 C CA  . PRO B 1 106 ? 10.471  5.226   -17.366 1.00 27.26 ? 106 PRO B CA  1 
ATOM   2744 C C   . PRO B 1 106 ? 9.185   5.661   -16.632 1.00 26.48 ? 106 PRO B C   1 
ATOM   2745 O O   . PRO B 1 106 ? 9.079   6.804   -16.200 1.00 25.66 ? 106 PRO B O   1 
ATOM   2746 C CB  . PRO B 1 106 ? 11.614  5.045   -16.365 1.00 27.37 ? 106 PRO B CB  1 
ATOM   2747 C CG  . PRO B 1 106 ? 12.826  5.564   -17.091 1.00 27.88 ? 106 PRO B CG  1 
ATOM   2748 C CD  . PRO B 1 106 ? 12.357  6.667   -17.938 1.00 27.96 ? 106 PRO B CD  1 
ATOM   2749 N N   . ILE B 1 107 ? 8.230   4.741   -16.506 1.00 26.09 ? 107 ILE B N   1 
ATOM   2750 C CA  . ILE B 1 107 ? 6.903   5.014   -15.941 1.00 25.85 ? 107 ILE B CA  1 
ATOM   2751 C C   . ILE B 1 107 ? 6.664   4.152   -14.714 1.00 26.01 ? 107 ILE B C   1 
ATOM   2752 O O   . ILE B 1 107 ? 6.657   2.906   -14.807 1.00 25.81 ? 107 ILE B O   1 
ATOM   2753 C CB  . ILE B 1 107 ? 5.763   4.641   -16.941 1.00 25.82 ? 107 ILE B CB  1 
ATOM   2754 C CG1 . ILE B 1 107 ? 5.965   5.277   -18.317 1.00 25.28 ? 107 ILE B CG1 1 
ATOM   2755 C CG2 . ILE B 1 107 ? 4.380   4.923   -16.347 1.00 25.03 ? 107 ILE B CG2 1 
ATOM   2756 C CD1 . ILE B 1 107 ? 6.028   6.779   -18.301 1.00 27.96 ? 107 ILE B CD1 1 
ATOM   2757 N N   . LEU B 1 108 ? 6.456   4.802   -13.572 1.00 26.02 ? 108 LEU B N   1 
ATOM   2758 C CA  . LEU B 1 108 ? 5.955   4.100   -12.380 1.00 26.13 ? 108 LEU B CA  1 
ATOM   2759 C C   . LEU B 1 108 ? 4.430   4.121   -12.306 1.00 25.59 ? 108 LEU B C   1 
ATOM   2760 O O   . LEU B 1 108 ? 3.816   5.171   -12.365 1.00 25.81 ? 108 LEU B O   1 
ATOM   2761 C CB  . LEU B 1 108 ? 6.569   4.687   -11.097 1.00 26.34 ? 108 LEU B CB  1 
ATOM   2762 C CG  . LEU B 1 108 ? 6.324   3.847   -9.820  1.00 27.43 ? 108 LEU B CG  1 
ATOM   2763 C CD1 . LEU B 1 108 ? 7.479   4.007   -8.837  1.00 25.51 ? 108 LEU B CD1 1 
ATOM   2764 C CD2 . LEU B 1 108 ? 4.968   4.164   -9.142  1.00 26.74 ? 108 LEU B CD2 1 
ATOM   2765 N N   . MET B 1 109 ? 3.817   2.960   -12.190 1.00 25.95 ? 109 MET B N   1 
ATOM   2766 C CA  . MET B 1 109 ? 2.389   2.924   -11.948 1.00 26.49 ? 109 MET B CA  1 
ATOM   2767 C C   . MET B 1 109 ? 2.151   3.024   -10.451 1.00 27.14 ? 109 MET B C   1 
ATOM   2768 O O   . MET B 1 109 ? 2.685   2.200   -9.663  1.00 27.37 ? 109 MET B O   1 
ATOM   2769 C CB  . MET B 1 109 ? 1.762   1.625   -12.436 1.00 26.49 ? 109 MET B CB  1 
ATOM   2770 C CG  . MET B 1 109 ? 0.257   1.656   -12.210 1.00 27.21 ? 109 MET B CG  1 
ATOM   2771 S SD  . MET B 1 109 ? -0.660  0.325   -12.956 1.00 27.51 ? 109 MET B SD  1 
ATOM   2772 C CE  . MET B 1 109 ? -1.072  -0.647  -11.479 1.00 28.52 ? 109 MET B CE  1 
ATOM   2773 N N   . TRP B 1 110 ? 1.348   4.006   -10.052 1.00 26.92 ? 110 TRP B N   1 
ATOM   2774 C CA  . TRP B 1 110 ? 1.069   4.224   -8.637  1.00 27.11 ? 110 TRP B CA  1 
ATOM   2775 C C   . TRP B 1 110 ? -0.391  3.898   -8.357  1.00 26.87 ? 110 TRP B C   1 
ATOM   2776 O O   . TRP B 1 110 ? -1.298  4.391   -9.026  1.00 27.43 ? 110 TRP B O   1 
ATOM   2777 C CB  . TRP B 1 110 ? 1.393   5.674   -8.287  1.00 27.81 ? 110 TRP B CB  1 
ATOM   2778 C CG  . TRP B 1 110 ? 1.782   5.960   -6.838  1.00 29.52 ? 110 TRP B CG  1 
ATOM   2779 C CD1 . TRP B 1 110 ? 3.052   6.237   -6.343  1.00 32.02 ? 110 TRP B CD1 1 
ATOM   2780 C CD2 . TRP B 1 110 ? 0.898   6.052   -5.724  1.00 30.06 ? 110 TRP B CD2 1 
ATOM   2781 N NE1 . TRP B 1 110 ? 2.995   6.469   -4.980  1.00 32.48 ? 110 TRP B NE1 1 
ATOM   2782 C CE2 . TRP B 1 110 ? 1.684   6.359   -4.579  1.00 31.99 ? 110 TRP B CE2 1 
ATOM   2783 C CE3 . TRP B 1 110 ? -0.477  5.885   -5.570  1.00 29.25 ? 110 TRP B CE3 1 
ATOM   2784 C CZ2 . TRP B 1 110 ? 1.120   6.514   -3.309  1.00 30.78 ? 110 TRP B CZ2 1 
ATOM   2785 C CZ3 . TRP B 1 110 ? -1.022  6.032   -4.300  1.00 30.94 ? 110 TRP B CZ3 1 
ATOM   2786 C CH2 . TRP B 1 110 ? -0.223  6.336   -3.191  1.00 29.38 ? 110 TRP B CH2 1 
ATOM   2787 N N   . ASP B 1 111 ? -0.625  3.053   -7.372  1.00 26.42 ? 111 ASP B N   1 
ATOM   2788 C CA  . ASP B 1 111 ? -1.981  2.608   -7.026  1.00 25.96 ? 111 ASP B CA  1 
ATOM   2789 C C   . ASP B 1 111 ? -1.817  1.901   -5.666  1.00 25.35 ? 111 ASP B C   1 
ATOM   2790 O O   . ASP B 1 111 ? -0.697  1.823   -5.131  1.00 25.74 ? 111 ASP B O   1 
ATOM   2791 C CB  . ASP B 1 111 ? -2.514  1.640   -8.097  1.00 25.44 ? 111 ASP B CB  1 
ATOM   2792 C CG  . ASP B 1 111 ? -4.076  1.584   -8.196  1.00 26.39 ? 111 ASP B CG  1 
ATOM   2793 O OD1 . ASP B 1 111 ? -4.822  1.581   -7.158  1.00 24.34 ? 111 ASP B OD1 1 
ATOM   2794 O OD2 . ASP B 1 111 ? -4.543  1.468   -9.370  1.00 23.25 ? 111 ASP B OD2 1 
ATOM   2795 N N   . PHE B 1 112 ? -2.911  1.399   -5.110  1.00 24.01 ? 112 PHE B N   1 
ATOM   2796 C CA  . PHE B 1 112 ? -2.825  0.624   -3.888  1.00 23.26 ? 112 PHE B CA  1 
ATOM   2797 C C   . PHE B 1 112 ? -2.822  -0.809  -4.270  1.00 22.42 ? 112 PHE B C   1 
ATOM   2798 O O   . PHE B 1 112 ? -3.859  -1.420  -4.482  1.00 21.55 ? 112 PHE B O   1 
ATOM   2799 C CB  . PHE B 1 112 ? -3.974  0.998   -2.967  1.00 23.69 ? 112 PHE B CB  1 
ATOM   2800 C CG  . PHE B 1 112 ? -3.905  2.433   -2.518  1.00 23.47 ? 112 PHE B CG  1 
ATOM   2801 C CD1 . PHE B 1 112 ? -3.384  2.758   -1.271  1.00 21.47 ? 112 PHE B CD1 1 
ATOM   2802 C CD2 . PHE B 1 112 ? -4.295  3.449   -3.368  1.00 22.37 ? 112 PHE B CD2 1 
ATOM   2803 C CE1 . PHE B 1 112 ? -3.294  4.076   -0.860  1.00 22.75 ? 112 PHE B CE1 1 
ATOM   2804 C CE2 . PHE B 1 112 ? -4.198  4.774   -2.966  1.00 24.28 ? 112 PHE B CE2 1 
ATOM   2805 C CZ  . PHE B 1 112 ? -3.702  5.084   -1.702  1.00 24.34 ? 112 PHE B CZ  1 
ATOM   2806 N N   . ILE B 1 113 ? -1.615  -1.319  -4.444  1.00 22.63 ? 113 ILE B N   1 
ATOM   2807 C CA  . ILE B 1 113 ? -1.414  -2.634  -5.034  1.00 22.82 ? 113 ILE B CA  1 
ATOM   2808 C C   . ILE B 1 113 ? -1.516  -3.626  -3.901  1.00 23.84 ? 113 ILE B C   1 
ATOM   2809 O O   . ILE B 1 113 ? -0.867  -3.448  -2.884  1.00 24.08 ? 113 ILE B O   1 
ATOM   2810 C CB  . ILE B 1 113 ? -0.086  -2.673  -5.755  1.00 21.85 ? 113 ILE B CB  1 
ATOM   2811 C CG1 . ILE B 1 113 ? -0.146  -1.657  -6.900  1.00 22.80 ? 113 ILE B CG1 1 
ATOM   2812 C CG2 . ILE B 1 113 ? 0.232   -4.090  -6.266  1.00 22.38 ? 113 ILE B CG2 1 
ATOM   2813 C CD1 . ILE B 1 113 ? 1.153   -1.437  -7.639  1.00 21.69 ? 113 ILE B CD1 1 
ATOM   2814 N N   . VAL B 1 114 ? -2.380  -4.624  -4.060  1.00 25.20 ? 114 VAL B N   1 
ATOM   2815 C CA  . VAL B 1 114 ? -2.671  -5.623  -3.006  1.00 26.62 ? 114 VAL B CA  1 
ATOM   2816 C C   . VAL B 1 114 ? -2.763  -7.056  -3.561  1.00 27.52 ? 114 VAL B C   1 
ATOM   2817 O O   . VAL B 1 114 ? -3.025  -8.003  -2.809  1.00 26.33 ? 114 VAL B O   1 
ATOM   2818 C CB  . VAL B 1 114 ? -4.028  -5.349  -2.335  1.00 26.82 ? 114 VAL B CB  1 
ATOM   2819 C CG1 . VAL B 1 114 ? -3.985  -4.075  -1.537  1.00 26.59 ? 114 VAL B CG1 1 
ATOM   2820 C CG2 . VAL B 1 114 ? -5.141  -5.306  -3.385  1.00 26.67 ? 114 VAL B CG2 1 
ATOM   2821 N N   . LYS B 1 115 ? -2.597  -7.181  -4.887  1.00 28.39 ? 115 LYS B N   1 
ATOM   2822 C CA  . LYS B 1 115 ? -2.669  -8.477  -5.552  1.00 29.46 ? 115 LYS B CA  1 
ATOM   2823 C C   . LYS B 1 115 ? -1.870  -8.544  -6.859  1.00 29.96 ? 115 LYS B C   1 
ATOM   2824 O O   . LYS B 1 115 ? -1.684  -7.528  -7.562  1.00 30.19 ? 115 LYS B O   1 
ATOM   2825 C CB  . LYS B 1 115 ? -4.129  -8.912  -5.761  1.00 29.44 ? 115 LYS B CB  1 
ATOM   2826 C CG  . LYS B 1 115 ? -4.940  -7.994  -6.651  1.00 29.25 ? 115 LYS B CG  1 
ATOM   2827 C CD  . LYS B 1 115 ? -6.395  -8.407  -6.686  1.00 28.64 ? 115 LYS B CD  1 
ATOM   2828 C CE  . LYS B 1 115 ? -7.177  -7.328  -7.411  1.00 28.33 ? 115 LYS B CE  1 
ATOM   2829 N NZ  . LYS B 1 115 ? -8.416  -7.834  -7.986  1.00 27.59 ? 115 LYS B NZ  1 
ATOM   2830 N N   . GLU B 1 116 ? -1.371  -9.741  -7.140  1.00 30.39 ? 116 GLU B N   1 
ATOM   2831 C CA  . GLU B 1 116 ? -0.701  -10.066 -8.401  1.00 30.96 ? 116 GLU B CA  1 
ATOM   2832 C C   . GLU B 1 116 ? -1.392  -9.487  -9.652  1.00 30.58 ? 116 GLU B C   1 
ATOM   2833 O O   . GLU B 1 116 ? -0.737  -8.861  -10.501 1.00 31.09 ? 116 GLU B O   1 
ATOM   2834 C CB  . GLU B 1 116 ? -0.549  -11.595 -8.504  1.00 31.21 ? 116 GLU B CB  1 
ATOM   2835 C CG  . GLU B 1 116 ? 0.618   -12.137 -7.646  1.00 33.12 ? 116 GLU B CG  1 
ATOM   2836 C CD  . GLU B 1 116 ? 0.475   -13.625 -7.250  1.00 36.66 ? 116 GLU B CD  1 
ATOM   2837 O OE1 . GLU B 1 116 ? -0.505  -14.311 -7.668  1.00 36.23 ? 116 GLU B OE1 1 
ATOM   2838 O OE2 . GLU B 1 116 ? 1.357   -14.106 -6.496  1.00 35.68 ? 116 GLU B OE2 1 
ATOM   2839 N N   . SER B 1 117 ? -2.705  -9.661  -9.771  1.00 29.97 ? 117 SER B N   1 
ATOM   2840 C CA  . SER B 1 117 ? -3.421  -9.145  -10.945 1.00 29.70 ? 117 SER B CA  1 
ATOM   2841 C C   . SER B 1 117 ? -3.065  -7.673  -11.286 1.00 29.02 ? 117 SER B C   1 
ATOM   2842 O O   . SER B 1 117 ? -2.994  -7.293  -12.469 1.00 28.64 ? 117 SER B O   1 
ATOM   2843 C CB  . SER B 1 117 ? -4.933  -9.274  -10.741 1.00 30.00 ? 117 SER B CB  1 
ATOM   2844 O OG  . SER B 1 117 ? -5.418  -8.161  -9.976  1.00 31.66 ? 117 SER B OG  1 
ATOM   2845 N N   . GLN B 1 118 ? -2.861  -6.842  -10.263 1.00 28.10 ? 118 GLN B N   1 
ATOM   2846 C CA  . GLN B 1 118 ? -2.589  -5.429  -10.517 1.00 28.35 ? 118 GLN B CA  1 
ATOM   2847 C C   . GLN B 1 118 ? -1.183  -5.252  -11.012 1.00 28.52 ? 118 GLN B C   1 
ATOM   2848 O O   . GLN B 1 118 ? -0.870  -4.241  -11.599 1.00 28.96 ? 118 GLN B O   1 
ATOM   2849 C CB  . GLN B 1 118 ? -2.782  -4.566  -9.274  1.00 28.34 ? 118 GLN B CB  1 
ATOM   2850 C CG  . GLN B 1 118 ? -4.201  -4.466  -8.750  1.00 27.92 ? 118 GLN B CG  1 
ATOM   2851 C CD  . GLN B 1 118 ? -4.211  -3.998  -7.312  1.00 26.78 ? 118 GLN B CD  1 
ATOM   2852 O OE1 . GLN B 1 118 ? -4.615  -2.861  -7.019  1.00 28.27 ? 118 GLN B OE1 1 
ATOM   2853 N NE2 . GLN B 1 118 ? -3.736  -4.843  -6.412  1.00 23.22 ? 118 GLN B NE2 1 
ATOM   2854 N N   . ILE B 1 119 ? -0.328  -6.228  -10.731 1.00 28.74 ? 119 ILE B N   1 
ATOM   2855 C CA  . ILE B 1 119 ? 1.030   -6.241  -11.234 1.00 28.92 ? 119 ILE B CA  1 
ATOM   2856 C C   . ILE B 1 119 ? 1.028   -6.685  -12.732 1.00 29.16 ? 119 ILE B C   1 
ATOM   2857 O O   . ILE B 1 119 ? 1.653   -6.026  -13.603 1.00 28.26 ? 119 ILE B O   1 
ATOM   2858 C CB  . ILE B 1 119 ? 1.997   -7.073  -10.292 1.00 28.99 ? 119 ILE B CB  1 
ATOM   2859 C CG1 . ILE B 1 119 ? 2.147   -6.354  -8.934  1.00 28.98 ? 119 ILE B CG1 1 
ATOM   2860 C CG2 . ILE B 1 119 ? 3.365   -7.254  -10.935 1.00 27.89 ? 119 ILE B CG2 1 
ATOM   2861 C CD1 . ILE B 1 119 ? 3.172   -6.942  -7.913  1.00 26.36 ? 119 ILE B CD1 1 
ATOM   2862 N N   . ASP B 1 120 ? 0.308   -7.774  -13.017 1.00 28.78 ? 120 ASP B N   1 
ATOM   2863 C CA  . ASP B 1 120 ? -0.012  -8.146  -14.403 1.00 28.68 ? 120 ASP B CA  1 
ATOM   2864 C C   . ASP B 1 120 ? -0.441  -6.909  -15.197 1.00 28.63 ? 120 ASP B C   1 
ATOM   2865 O O   . ASP B 1 120 ? 0.234   -6.530  -16.151 1.00 29.19 ? 120 ASP B O   1 
ATOM   2866 C CB  . ASP B 1 120 ? -1.117  -9.202  -14.444 1.00 28.71 ? 120 ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 120 ? -0.773  -10.472 -13.657 1.00 29.79 ? 120 ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 120 ? 0.418   -10.744 -13.392 1.00 29.87 ? 120 ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 120 ? -1.709  -11.230 -13.319 1.00 32.98 ? 120 ASP B OD2 1 
ATOM   2870 N N   . ASP B 1 121 ? -1.513  -6.241  -14.777 1.00 28.09 ? 121 ASP B N   1 
ATOM   2871 C CA  . ASP B 1 121 ? -1.976  -5.017  -15.462 1.00 27.65 ? 121 ASP B CA  1 
ATOM   2872 C C   . ASP B 1 121 ? -0.866  -4.001  -15.700 1.00 27.16 ? 121 ASP B C   1 
ATOM   2873 O O   . ASP B 1 121 ? -0.682  -3.525  -16.816 1.00 27.82 ? 121 ASP B O   1 
ATOM   2874 C CB  . ASP B 1 121 ? -3.104  -4.326  -14.700 1.00 27.84 ? 121 ASP B CB  1 
ATOM   2875 C CG  . ASP B 1 121 ? -4.265  -5.257  -14.363 1.00 30.56 ? 121 ASP B CG  1 
ATOM   2876 O OD1 . ASP B 1 121 ? -4.459  -6.280  -15.076 1.00 32.03 ? 121 ASP B OD1 1 
ATOM   2877 O OD2 . ASP B 1 121 ? -4.989  -4.947  -13.366 1.00 35.20 ? 121 ASP B OD2 1 
ATOM   2878 N N   . ALA B 1 122 ? -0.105  -3.657  -14.671 1.00 26.25 ? 122 ALA B N   1 
ATOM   2879 C CA  . ALA B 1 122 ? 0.944   -2.675  -14.869 1.00 25.52 ? 122 ALA B CA  1 
ATOM   2880 C C   . ALA B 1 122 ? 1.911   -3.088  -15.992 1.00 25.19 ? 122 ALA B C   1 
ATOM   2881 O O   . ALA B 1 122 ? 2.395   -2.240  -16.777 1.00 25.14 ? 122 ALA B O   1 
ATOM   2882 C CB  . ALA B 1 122 ? 1.697   -2.428  -13.574 1.00 25.54 ? 122 ALA B CB  1 
ATOM   2883 N N   . TYR B 1 123 ? 2.205   -4.382  -16.038 1.00 24.62 ? 123 TYR B N   1 
ATOM   2884 C CA  . TYR B 1 123 ? 3.175   -4.912  -16.975 1.00 25.17 ? 123 TYR B CA  1 
ATOM   2885 C C   . TYR B 1 123 ? 2.567   -4.952  -18.376 1.00 25.58 ? 123 TYR B C   1 
ATOM   2886 O O   . TYR B 1 123 ? 3.211   -4.597  -19.388 1.00 24.90 ? 123 TYR B O   1 
ATOM   2887 C CB  . TYR B 1 123 ? 3.623   -6.327  -16.576 1.00 25.28 ? 123 TYR B CB  1 
ATOM   2888 C CG  . TYR B 1 123 ? 4.539   -6.942  -17.606 1.00 24.93 ? 123 TYR B CG  1 
ATOM   2889 C CD1 . TYR B 1 123 ? 5.890   -6.618  -17.613 1.00 22.81 ? 123 TYR B CD1 1 
ATOM   2890 C CD2 . TYR B 1 123 ? 4.047   -7.833  -18.597 1.00 24.06 ? 123 TYR B CD2 1 
ATOM   2891 C CE1 . TYR B 1 123 ? 6.748   -7.153  -18.563 1.00 24.06 ? 123 TYR B CE1 1 
ATOM   2892 C CE2 . TYR B 1 123 ? 4.904   -8.406  -19.549 1.00 21.89 ? 123 TYR B CE2 1 
ATOM   2893 C CZ  . TYR B 1 123 ? 6.253   -8.040  -19.525 1.00 24.82 ? 123 TYR B CZ  1 
ATOM   2894 O OH  . TYR B 1 123 ? 7.155   -8.531  -20.415 1.00 22.68 ? 123 TYR B OH  1 
ATOM   2895 N N   . ASN B 1 124 ? 1.309   -5.371  -18.407 1.00 25.35 ? 124 ASN B N   1 
ATOM   2896 C CA  . ASN B 1 124 ? 0.599   -5.491  -19.642 1.00 25.29 ? 124 ASN B CA  1 
ATOM   2897 C C   . ASN B 1 124 ? 0.261   -4.153  -20.294 1.00 25.61 ? 124 ASN B C   1 
ATOM   2898 O O   . ASN B 1 124 ? 0.183   -4.078  -21.539 1.00 25.84 ? 124 ASN B O   1 
ATOM   2899 C CB  . ASN B 1 124 ? -0.556  -6.474  -19.481 1.00 25.21 ? 124 ASN B CB  1 
ATOM   2900 C CG  . ASN B 1 124 ? -0.041  -7.904  -19.418 1.00 24.79 ? 124 ASN B CG  1 
ATOM   2901 O OD1 . ASN B 1 124 ? -0.708  -8.814  -18.969 1.00 24.86 ? 124 ASN B OD1 1 
ATOM   2902 N ND2 . ASN B 1 124 ? 1.186   -8.087  -19.876 1.00 25.84 ? 124 ASN B ND2 1 
ATOM   2903 N N   . LEU B 1 125 ? 0.175   -3.098  -19.474 1.00 25.17 ? 125 LEU B N   1 
ATOM   2904 C CA  . LEU B 1 125 ? -0.090  -1.720  -19.960 1.00 24.96 ? 125 LEU B CA  1 
ATOM   2905 C C   . LEU B 1 125 ? 1.138   -0.902  -20.313 1.00 24.12 ? 125 LEU B C   1 
ATOM   2906 O O   . LEU B 1 125 ? 1.005   0.178   -20.875 1.00 23.29 ? 125 LEU B O   1 
ATOM   2907 C CB  . LEU B 1 125 ? -0.890  -0.919  -18.933 1.00 24.64 ? 125 LEU B CB  1 
ATOM   2908 C CG  . LEU B 1 125 ? -2.329  -1.369  -18.731 1.00 25.84 ? 125 LEU B CG  1 
ATOM   2909 C CD1 . LEU B 1 125 ? -2.760  -1.077  -17.274 1.00 24.03 ? 125 LEU B CD1 1 
ATOM   2910 C CD2 . LEU B 1 125 ? -3.309  -0.752  -19.799 1.00 22.90 ? 125 LEU B CD2 1 
ATOM   2911 N N   . GLY B 1 126 ? 2.321   -1.385  -19.933 1.00 24.93 ? 126 GLY B N   1 
ATOM   2912 C CA  . GLY B 1 126 ? 3.596   -0.711  -20.268 1.00 24.82 ? 126 GLY B CA  1 
ATOM   2913 C C   . GLY B 1 126 ? 4.299   0.019   -19.137 1.00 25.33 ? 126 GLY B C   1 
ATOM   2914 O O   . GLY B 1 126 ? 5.333   0.642   -19.354 1.00 25.78 ? 126 GLY B O   1 
ATOM   2915 N N   . ALA B 1 127 ? 3.757   -0.022  -17.924 1.00 25.57 ? 127 ALA B N   1 
ATOM   2916 C CA  . ALA B 1 127 ? 4.471   0.620   -16.801 1.00 25.56 ? 127 ALA B CA  1 
ATOM   2917 C C   . ALA B 1 127 ? 5.826   -0.066  -16.624 1.00 25.34 ? 127 ALA B C   1 
ATOM   2918 O O   . ALA B 1 127 ? 5.940   -1.281  -16.771 1.00 24.12 ? 127 ALA B O   1 
ATOM   2919 C CB  . ALA B 1 127 ? 3.634   0.558   -15.484 1.00 24.55 ? 127 ALA B CB  1 
ATOM   2920 N N   . ASP B 1 128 ? 6.869   0.692   -16.322 1.00 25.83 ? 128 ASP B N   1 
ATOM   2921 C CA  . ASP B 1 128 ? 8.170   0.016   -16.120 1.00 26.28 ? 128 ASP B CA  1 
ATOM   2922 C C   . ASP B 1 128 ? 8.338   -0.573  -14.738 1.00 26.67 ? 128 ASP B C   1 
ATOM   2923 O O   . ASP B 1 128 ? 9.156   -1.498  -14.554 1.00 27.24 ? 128 ASP B O   1 
ATOM   2924 C CB  . ASP B 1 128 ? 9.316   0.938   -16.416 1.00 25.81 ? 128 ASP B CB  1 
ATOM   2925 C CG  . ASP B 1 128 ? 9.262   1.454   -17.808 1.00 27.18 ? 128 ASP B CG  1 
ATOM   2926 O OD1 . ASP B 1 128 ? 9.552   0.683   -18.762 1.00 28.20 ? 128 ASP B OD1 1 
ATOM   2927 O OD2 . ASP B 1 128 ? 8.906   2.631   -17.933 1.00 25.71 ? 128 ASP B OD2 1 
ATOM   2928 N N   . THR B 1 129 ? 7.544   -0.057  -13.789 1.00 25.99 ? 129 THR B N   1 
ATOM   2929 C CA  . THR B 1 129 ? 7.624   -0.452  -12.400 1.00 25.37 ? 129 THR B CA  1 
ATOM   2930 C C   . THR B 1 129 ? 6.360   -0.043  -11.633 1.00 25.39 ? 129 THR B C   1 
ATOM   2931 O O   . THR B 1 129 ? 5.440   0.545   -12.186 1.00 24.84 ? 129 THR B O   1 
ATOM   2932 C CB  . THR B 1 129 ? 8.934   0.113   -11.727 1.00 25.10 ? 129 THR B CB  1 
ATOM   2933 O OG1 . THR B 1 129 ? 9.133   -0.543  -10.475 1.00 26.26 ? 129 THR B OG1 1 
ATOM   2934 C CG2 . THR B 1 129 ? 8.869   1.597   -11.468 1.00 23.36 ? 129 THR B CG2 1 
ATOM   2935 N N   . VAL B 1 130 ? 6.316   -0.364  -10.350 1.00 25.88 ? 130 VAL B N   1 
ATOM   2936 C CA  . VAL B 1 130 ? 5.165   -0.016  -9.538  1.00 26.62 ? 130 VAL B CA  1 
ATOM   2937 C C   . VAL B 1 130 ? 5.582   0.503   -8.165  1.00 27.36 ? 130 VAL B C   1 
ATOM   2938 O O   . VAL B 1 130 ? 6.730   0.338   -7.770  1.00 27.82 ? 130 VAL B O   1 
ATOM   2939 C CB  . VAL B 1 130 ? 4.248   -1.230  -9.379  1.00 26.24 ? 130 VAL B CB  1 
ATOM   2940 C CG1 . VAL B 1 130 ? 3.677   -1.639  -10.746 1.00 24.82 ? 130 VAL B CG1 1 
ATOM   2941 C CG2 . VAL B 1 130 ? 5.016   -2.373  -8.756  1.00 25.87 ? 130 VAL B CG2 1 
ATOM   2942 N N   . GLY B 1 131 ? 4.649   1.126   -7.444  1.00 28.27 ? 131 GLY B N   1 
ATOM   2943 C CA  . GLY B 1 131 ? 4.845   1.458   -6.026  1.00 28.11 ? 131 GLY B CA  1 
ATOM   2944 C C   . GLY B 1 131 ? 4.186   0.399   -5.138  1.00 28.32 ? 131 GLY B C   1 
ATOM   2945 O O   . GLY B 1 131 ? 2.983   0.126   -5.260  1.00 28.83 ? 131 GLY B O   1 
ATOM   2946 N N   . LEU B 1 132 ? 4.976   -0.216  -4.253  1.00 27.92 ? 132 LEU B N   1 
ATOM   2947 C CA  . LEU B 1 132 ? 4.428   -1.039  -3.169  1.00 27.04 ? 132 LEU B CA  1 
ATOM   2948 C C   . LEU B 1 132 ? 4.400   -0.283  -1.846  1.00 26.76 ? 132 LEU B C   1 
ATOM   2949 O O   . LEU B 1 132 ? 5.437   0.243   -1.404  1.00 26.99 ? 132 LEU B O   1 
ATOM   2950 C CB  . LEU B 1 132 ? 5.214   -2.328  -3.027  1.00 26.86 ? 132 LEU B CB  1 
ATOM   2951 C CG  . LEU B 1 132 ? 5.085   -3.256  -4.218  1.00 25.64 ? 132 LEU B CG  1 
ATOM   2952 C CD1 . LEU B 1 132 ? 6.020   -4.380  -4.010  1.00 27.42 ? 132 LEU B CD1 1 
ATOM   2953 C CD2 . LEU B 1 132 ? 3.679   -3.768  -4.322  1.00 21.86 ? 132 LEU B CD2 1 
ATOM   2954 N N   . ILE B 1 133 ? 3.210   -0.224  -1.237  1.00 26.60 ? 133 ILE B N   1 
ATOM   2955 C CA  . ILE B 1 133 ? 2.955   0.551   -0.015  1.00 26.16 ? 133 ILE B CA  1 
ATOM   2956 C C   . ILE B 1 133 ? 3.035   -0.267  1.281   1.00 26.61 ? 133 ILE B C   1 
ATOM   2957 O O   . ILE B 1 133 ? 2.174   -1.119  1.557   1.00 26.76 ? 133 ILE B O   1 
ATOM   2958 C CB  . ILE B 1 133 ? 1.615   1.311   -0.120  1.00 26.42 ? 133 ILE B CB  1 
ATOM   2959 C CG1 . ILE B 1 133 ? 1.670   2.294   -1.307  1.00 25.13 ? 133 ILE B CG1 1 
ATOM   2960 C CG2 . ILE B 1 133 ? 1.332   2.123   1.171   1.00 26.58 ? 133 ILE B CG2 1 
ATOM   2961 C CD1 . ILE B 1 133 ? 0.329   2.657   -1.819  1.00 21.45 ? 133 ILE B CD1 1 
ATOM   2962 N N   . VAL B 1 134 ? 4.069   -0.005  2.082   1.00 27.11 ? 134 VAL B N   1 
ATOM   2963 C CA  . VAL B 1 134 ? 4.317   -0.790  3.297   1.00 27.16 ? 134 VAL B CA  1 
ATOM   2964 C C   . VAL B 1 134 ? 3.126   -0.736  4.254   1.00 28.51 ? 134 VAL B C   1 
ATOM   2965 O O   . VAL B 1 134 ? 2.743   -1.767  4.823   1.00 29.82 ? 134 VAL B O   1 
ATOM   2966 C CB  . VAL B 1 134 ? 5.627   -0.381  4.039   1.00 26.70 ? 134 VAL B CB  1 
ATOM   2967 C CG1 . VAL B 1 134 ? 5.797   -1.182  5.313   1.00 25.10 ? 134 VAL B CG1 1 
ATOM   2968 C CG2 . VAL B 1 134 ? 6.848   -0.546  3.138   1.00 25.25 ? 134 VAL B CG2 1 
ATOM   2969 N N   . LYS B 1 135 ? 2.543   0.448   4.429   1.00 29.16 ? 135 LYS B N   1 
ATOM   2970 C CA  . LYS B 1 135 ? 1.489   0.656   5.426   1.00 29.76 ? 135 LYS B CA  1 
ATOM   2971 C C   . LYS B 1 135 ? 0.242   -0.195  5.146   1.00 29.67 ? 135 LYS B C   1 
ATOM   2972 O O   . LYS B 1 135 ? -0.699  -0.197  5.926   1.00 30.04 ? 135 LYS B O   1 
ATOM   2973 C CB  . LYS B 1 135 ? 1.106   2.146   5.530   1.00 29.97 ? 135 LYS B CB  1 
ATOM   2974 C CG  . LYS B 1 135 ? 1.825   2.929   6.641   1.00 32.23 ? 135 LYS B CG  1 
ATOM   2975 C CD  . LYS B 1 135 ? 1.020   4.162   7.062   1.00 35.28 ? 135 LYS B CD  1 
ATOM   2976 C CE  . LYS B 1 135 ? 1.902   5.292   7.635   1.00 38.00 ? 135 LYS B CE  1 
ATOM   2977 N NZ  . LYS B 1 135 ? 3.030   4.807   8.501   1.00 39.66 ? 135 LYS B NZ  1 
ATOM   2978 N N   . ILE B 1 136 ? 0.260   -0.953  4.059   1.00 29.27 ? 136 ILE B N   1 
ATOM   2979 C CA  . ILE B 1 136 ? -0.961  -1.566  3.513   1.00 28.52 ? 136 ILE B CA  1 
ATOM   2980 C C   . ILE B 1 136 ? -0.845  -3.093  3.425   1.00 28.27 ? 136 ILE B C   1 
ATOM   2981 O O   . ILE B 1 136 ? -1.807  -3.818  3.613   1.00 27.90 ? 136 ILE B O   1 
ATOM   2982 C CB  . ILE B 1 136 ? -1.341  -0.790  2.169   1.00 29.12 ? 136 ILE B CB  1 
ATOM   2983 C CG1 . ILE B 1 136 ? -2.419  0.234   2.467   1.00 27.53 ? 136 ILE B CG1 1 
ATOM   2984 C CG2 . ILE B 1 136 ? -1.611  -1.627  0.904   1.00 26.50 ? 136 ILE B CG2 1 
ATOM   2985 C CD1 . ILE B 1 136 ? -1.829  1.376   3.154   1.00 28.23 ? 136 ILE B CD1 1 
ATOM   2986 N N   . LEU B 1 137 ? 0.369   -3.560  3.204   1.00 28.26 ? 137 LEU B N   1 
ATOM   2987 C CA  . LEU B 1 137 ? 0.629   -4.974  3.033   1.00 28.39 ? 137 LEU B CA  1 
ATOM   2988 C C   . LEU B 1 137 ? 1.264   -5.542  4.281   1.00 28.68 ? 137 LEU B C   1 
ATOM   2989 O O   . LEU B 1 137 ? 2.105   -4.870  4.905   1.00 28.96 ? 137 LEU B O   1 
ATOM   2990 C CB  . LEU B 1 137 ? 1.567   -5.186  1.835   1.00 27.91 ? 137 LEU B CB  1 
ATOM   2991 C CG  . LEU B 1 137 ? 1.004   -4.790  0.451   1.00 27.78 ? 137 LEU B CG  1 
ATOM   2992 C CD1 . LEU B 1 137 ? 2.078   -4.848  -0.604  1.00 25.40 ? 137 LEU B CD1 1 
ATOM   2993 C CD2 . LEU B 1 137 ? -0.174  -5.681  0.052   1.00 25.05 ? 137 LEU B CD2 1 
ATOM   2994 N N   . THR B 1 138 ? 0.876   -6.770  4.641   1.00 28.48 ? 138 THR B N   1 
ATOM   2995 C CA  . THR B 1 138 ? 1.649   -7.548  5.614   1.00 28.39 ? 138 THR B CA  1 
ATOM   2996 C C   . THR B 1 138 ? 3.063   -7.616  5.100   1.00 28.50 ? 138 THR B C   1 
ATOM   2997 O O   . THR B 1 138 ? 3.307   -7.467  3.912   1.00 28.09 ? 138 THR B O   1 
ATOM   2998 C CB  . THR B 1 138 ? 1.153   -9.012  5.778   1.00 28.44 ? 138 THR B CB  1 
ATOM   2999 O OG1 . THR B 1 138 ? 1.524   -9.803  4.627   1.00 28.88 ? 138 THR B OG1 1 
ATOM   3000 C CG2 . THR B 1 138 ? -0.382  -9.089  6.042   1.00 27.14 ? 138 THR B CG2 1 
ATOM   3001 N N   . GLU B 1 139 ? 4.006   -7.840  5.999   1.00 29.73 ? 139 GLU B N   1 
ATOM   3002 C CA  . GLU B 1 139 ? 5.374   -8.250  5.606   1.00 30.54 ? 139 GLU B CA  1 
ATOM   3003 C C   . GLU B 1 139 ? 5.386   -9.325  4.494   1.00 30.16 ? 139 GLU B C   1 
ATOM   3004 O O   . GLU B 1 139 ? 6.194   -9.257  3.561   1.00 30.16 ? 139 GLU B O   1 
ATOM   3005 C CB  . GLU B 1 139 ? 6.061   -8.811  6.828   1.00 31.10 ? 139 GLU B CB  1 
ATOM   3006 C CG  . GLU B 1 139 ? 7.532   -8.714  6.852   1.00 34.07 ? 139 GLU B CG  1 
ATOM   3007 C CD  . GLU B 1 139 ? 8.055   -8.608  8.268   1.00 37.86 ? 139 GLU B CD  1 
ATOM   3008 O OE1 . GLU B 1 139 ? 7.237   -8.328  9.193   1.00 35.64 ? 139 GLU B OE1 1 
ATOM   3009 O OE2 . GLU B 1 139 ? 9.294   -8.799  8.449   1.00 41.78 ? 139 GLU B OE2 1 
ATOM   3010 N N   . ARG B 1 140 ? 4.490   -10.304 4.589   1.00 29.80 ? 140 ARG B N   1 
ATOM   3011 C CA  . ARG B 1 140 ? 4.520   -11.435 3.663   1.00 30.37 ? 140 ARG B CA  1 
ATOM   3012 C C   . ARG B 1 140 ? 4.045   -11.004 2.279   1.00 30.81 ? 140 ARG B C   1 
ATOM   3013 O O   . ARG B 1 140 ? 4.728   -11.234 1.264   1.00 30.89 ? 140 ARG B O   1 
ATOM   3014 C CB  . ARG B 1 140 ? 3.645   -12.563 4.170   1.00 30.13 ? 140 ARG B CB  1 
ATOM   3015 C CG  . ARG B 1 140 ? 3.882   -13.875 3.500   1.00 30.96 ? 140 ARG B CG  1 
ATOM   3016 C CD  . ARG B 1 140 ? 2.763   -14.817 3.867   1.00 34.96 ? 140 ARG B CD  1 
ATOM   3017 N NE  . ARG B 1 140 ? 2.899   -16.111 3.202   1.00 40.24 ? 140 ARG B NE  1 
ATOM   3018 C CZ  . ARG B 1 140 ? 2.209   -17.208 3.524   1.00 41.39 ? 140 ARG B CZ  1 
ATOM   3019 N NH1 . ARG B 1 140 ? 1.332   -17.195 4.530   1.00 40.39 ? 140 ARG B NH1 1 
ATOM   3020 N NH2 . ARG B 1 140 ? 2.417   -18.328 2.841   1.00 43.22 ? 140 ARG B NH2 1 
ATOM   3021 N N   . GLU B 1 141 ? 2.872   -10.381 2.265   1.00 30.39 ? 141 GLU B N   1 
ATOM   3022 C CA  . GLU B 1 141 ? 2.279   -9.851  1.065   1.00 30.44 ? 141 GLU B CA  1 
ATOM   3023 C C   . GLU B 1 141 ? 3.246   -8.965  0.327   1.00 30.65 ? 141 GLU B C   1 
ATOM   3024 O O   . GLU B 1 141 ? 3.472   -9.150  -0.868  1.00 31.89 ? 141 GLU B O   1 
ATOM   3025 C CB  . GLU B 1 141 ? 1.025   -9.072  1.419   1.00 30.64 ? 141 GLU B CB  1 
ATOM   3026 C CG  . GLU B 1 141 ? -0.092  -9.930  1.959   1.00 29.57 ? 141 GLU B CG  1 
ATOM   3027 C CD  . GLU B 1 141 ? -1.239  -9.075  2.403   1.00 31.03 ? 141 GLU B CD  1 
ATOM   3028 O OE1 . GLU B 1 141 ? -0.944  -8.024  3.004   1.00 32.55 ? 141 GLU B OE1 1 
ATOM   3029 O OE2 . GLU B 1 141 ? -2.416  -9.439  2.164   1.00 28.92 ? 141 GLU B OE2 1 
ATOM   3030 N N   . LEU B 1 142 ? 3.825   -8.016  1.051   1.00 30.94 ? 142 LEU B N   1 
ATOM   3031 C CA  . LEU B 1 142 ? 4.879   -7.114  0.559   1.00 30.69 ? 142 LEU B CA  1 
ATOM   3032 C C   . LEU B 1 142 ? 6.043   -7.817  -0.131  1.00 30.71 ? 142 LEU B C   1 
ATOM   3033 O O   . LEU B 1 142 ? 6.541   -7.365  -1.156  1.00 30.80 ? 142 LEU B O   1 
ATOM   3034 C CB  . LEU B 1 142 ? 5.455   -6.313  1.732   1.00 30.07 ? 142 LEU B CB  1 
ATOM   3035 C CG  . LEU B 1 142 ? 5.793   -4.835  1.550   1.00 30.11 ? 142 LEU B CG  1 
ATOM   3036 C CD1 . LEU B 1 142 ? 6.992   -4.543  2.396   1.00 31.07 ? 142 LEU B CD1 1 
ATOM   3037 C CD2 . LEU B 1 142 ? 6.114   -4.425  0.126   1.00 30.14 ? 142 LEU B CD2 1 
ATOM   3038 N N   . GLU B 1 143 ? 6.511   -8.898  0.478   1.00 31.06 ? 143 GLU B N   1 
ATOM   3039 C CA  . GLU B 1 143 ? 7.689   -9.597  0.002   1.00 30.89 ? 143 GLU B CA  1 
ATOM   3040 C C   . GLU B 1 143 ? 7.267   -10.430 -1.198  1.00 30.70 ? 143 GLU B C   1 
ATOM   3041 O O   . GLU B 1 143 ? 8.067   -10.694 -2.101  1.00 30.78 ? 143 GLU B O   1 
ATOM   3042 C CB  . GLU B 1 143 ? 8.239   -10.487 1.119   1.00 30.74 ? 143 GLU B CB  1 
ATOM   3043 C CG  . GLU B 1 143 ? 9.641   -10.944 0.905   1.00 32.50 ? 143 GLU B CG  1 
ATOM   3044 C CD  . GLU B 1 143 ? 9.748   -11.932 -0.230  1.00 37.20 ? 143 GLU B CD  1 
ATOM   3045 O OE1 . GLU B 1 143 ? 8.883   -12.848 -0.281  1.00 37.28 ? 143 GLU B OE1 1 
ATOM   3046 O OE2 . GLU B 1 143 ? 10.667  -11.764 -1.096  1.00 40.30 ? 143 GLU B OE2 1 
ATOM   3047 N N   . SER B 1 144 ? 6.006   -10.849 -1.190  1.00 30.06 ? 144 SER B N   1 
ATOM   3048 C CA  . SER B 1 144 ? 5.489   -11.726 -2.206  1.00 29.97 ? 144 SER B CA  1 
ATOM   3049 C C   . SER B 1 144 ? 5.269   -10.969 -3.516  1.00 30.09 ? 144 SER B C   1 
ATOM   3050 O O   . SER B 1 144 ? 5.542   -11.479 -4.606  1.00 29.78 ? 144 SER B O   1 
ATOM   3051 C CB  . SER B 1 144 ? 4.192   -12.347 -1.710  1.00 30.30 ? 144 SER B CB  1 
ATOM   3052 O OG  . SER B 1 144 ? 3.654   -13.223 -2.670  1.00 31.70 ? 144 SER B OG  1 
ATOM   3053 N N   . LEU B 1 145 ? 4.791   -9.732  -3.413  1.00 29.66 ? 145 LEU B N   1 
ATOM   3054 C CA  . LEU B 1 145 ? 4.445   -8.988  -4.613  1.00 28.87 ? 145 LEU B CA  1 
ATOM   3055 C C   . LEU B 1 145 ? 5.711   -8.400  -5.179  1.00 28.97 ? 145 LEU B C   1 
ATOM   3056 O O   . LEU B 1 145 ? 5.861   -8.225  -6.385  1.00 29.35 ? 145 LEU B O   1 
ATOM   3057 C CB  . LEU B 1 145 ? 3.410   -7.932  -4.293  1.00 28.15 ? 145 LEU B CB  1 
ATOM   3058 C CG  . LEU B 1 145 ? 2.013   -8.510  -3.993  1.00 28.05 ? 145 LEU B CG  1 
ATOM   3059 C CD1 . LEU B 1 145 ? 1.175   -7.508  -3.186  1.00 25.19 ? 145 LEU B CD1 1 
ATOM   3060 C CD2 . LEU B 1 145 ? 1.253   -8.995  -5.243  1.00 23.56 ? 145 LEU B CD2 1 
ATOM   3061 N N   . LEU B 1 146 ? 6.656   -8.140  -4.297  1.00 28.74 ? 146 LEU B N   1 
ATOM   3062 C CA  . LEU B 1 146 ? 7.956   -7.674  -4.729  1.00 28.75 ? 146 LEU B CA  1 
ATOM   3063 C C   . LEU B 1 146 ? 8.640   -8.778  -5.561  1.00 28.43 ? 146 LEU B C   1 
ATOM   3064 O O   . LEU B 1 146 ? 9.143   -8.518  -6.642  1.00 28.13 ? 146 LEU B O   1 
ATOM   3065 C CB  . LEU B 1 146 ? 8.782   -7.216  -3.524  1.00 27.74 ? 146 LEU B CB  1 
ATOM   3066 C CG  . LEU B 1 146 ? 10.256  -7.002  -3.772  1.00 29.31 ? 146 LEU B CG  1 
ATOM   3067 C CD1 . LEU B 1 146 ? 10.455  -5.828  -4.720  1.00 32.08 ? 146 LEU B CD1 1 
ATOM   3068 C CD2 . LEU B 1 146 ? 10.982  -6.784  -2.457  1.00 30.43 ? 146 LEU B CD2 1 
ATOM   3069 N N   . GLU B 1 147 ? 8.588   -10.018 -5.082  1.00 28.97 ? 147 GLU B N   1 
ATOM   3070 C CA  . GLU B 1 147 ? 9.174   -11.144 -5.808  1.00 29.67 ? 147 GLU B CA  1 
ATOM   3071 C C   . GLU B 1 147 ? 8.524   -11.260 -7.199  1.00 29.67 ? 147 GLU B C   1 
ATOM   3072 O O   . GLU B 1 147 ? 9.221   -11.476 -8.202  1.00 29.35 ? 147 GLU B O   1 
ATOM   3073 C CB  . GLU B 1 147 ? 9.011   -12.445 -5.001  1.00 29.66 ? 147 GLU B CB  1 
ATOM   3074 C CG  . GLU B 1 147 ? 10.235  -13.350 -4.933  1.00 31.45 ? 147 GLU B CG  1 
ATOM   3075 C CD  . GLU B 1 147 ? 9.998   -14.602 -4.052  1.00 36.06 ? 147 GLU B CD  1 
ATOM   3076 O OE1 . GLU B 1 147 ? 9.783   -15.722 -4.625  1.00 35.52 ? 147 GLU B OE1 1 
ATOM   3077 O OE2 . GLU B 1 147 ? 10.014  -14.449 -2.789  1.00 33.88 ? 147 GLU B OE2 1 
ATOM   3078 N N   . TYR B 1 148 ? 7.199   -11.064 -7.229  1.00 29.59 ? 148 TYR B N   1 
ATOM   3079 C CA  . TYR B 1 148 ? 6.369   -11.269 -8.402  1.00 29.99 ? 148 TYR B CA  1 
ATOM   3080 C C   . TYR B 1 148 ? 6.611   -10.192 -9.442  1.00 29.93 ? 148 TYR B C   1 
ATOM   3081 O O   . TYR B 1 148 ? 6.586   -10.461 -10.657 1.00 29.33 ? 148 TYR B O   1 
ATOM   3082 C CB  . TYR B 1 148 ? 4.879   -11.314 -8.010  1.00 30.67 ? 148 TYR B CB  1 
ATOM   3083 C CG  . TYR B 1 148 ? 3.926   -11.725 -9.132  1.00 33.03 ? 148 TYR B CG  1 
ATOM   3084 C CD1 . TYR B 1 148 ? 3.770   -13.067 -9.501  1.00 34.39 ? 148 TYR B CD1 1 
ATOM   3085 C CD2 . TYR B 1 148 ? 3.160   -10.767 -9.811  1.00 36.05 ? 148 TYR B CD2 1 
ATOM   3086 C CE1 . TYR B 1 148 ? 2.893   -13.456 -10.524 1.00 33.47 ? 148 TYR B CE1 1 
ATOM   3087 C CE2 . TYR B 1 148 ? 2.274   -11.142 -10.833 1.00 35.24 ? 148 TYR B CE2 1 
ATOM   3088 C CZ  . TYR B 1 148 ? 2.149   -12.492 -11.189 1.00 35.44 ? 148 TYR B CZ  1 
ATOM   3089 O OH  . TYR B 1 148 ? 1.275   -12.850 -12.210 1.00 33.72 ? 148 TYR B OH  1 
ATOM   3090 N N   . ALA B 1 149 ? 6.826   -8.964  -8.974  1.00 29.93 ? 149 ALA B N   1 
ATOM   3091 C CA  . ALA B 1 149 ? 7.098   -7.876  -9.896  1.00 30.04 ? 149 ALA B CA  1 
ATOM   3092 C C   . ALA B 1 149 ? 8.501   -8.071  -10.501 1.00 30.92 ? 149 ALA B C   1 
ATOM   3093 O O   . ALA B 1 149 ? 8.738   -7.771  -11.704 1.00 30.30 ? 149 ALA B O   1 
ATOM   3094 C CB  . ALA B 1 149 ? 6.982   -6.559  -9.204  1.00 29.36 ? 149 ALA B CB  1 
ATOM   3095 N N   . ARG B 1 150 ? 9.415   -8.603  -9.672  1.00 31.20 ? 150 ARG B N   1 
ATOM   3096 C CA  . ARG B 1 150 ? 10.787  -8.921  -10.128 1.00 31.77 ? 150 ARG B CA  1 
ATOM   3097 C C   . ARG B 1 150 ? 10.797  -9.977  -11.225 1.00 31.79 ? 150 ARG B C   1 
ATOM   3098 O O   . ARG B 1 150 ? 11.654  -9.943  -12.078 1.00 32.33 ? 150 ARG B O   1 
ATOM   3099 C CB  . ARG B 1 150 ? 11.742  -9.287  -8.969  1.00 31.31 ? 150 ARG B CB  1 
ATOM   3100 C CG  . ARG B 1 150 ? 12.215  -8.076  -8.184  1.00 31.38 ? 150 ARG B CG  1 
ATOM   3101 C CD  . ARG B 1 150 ? 13.392  -8.402  -7.273  1.00 35.32 ? 150 ARG B CD  1 
ATOM   3102 N NE  . ARG B 1 150 ? 13.802  -7.205  -6.514  1.00 34.30 ? 150 ARG B NE  1 
ATOM   3103 C CZ  . ARG B 1 150 ? 14.139  -7.197  -5.214  1.00 31.28 ? 150 ARG B CZ  1 
ATOM   3104 N NH1 . ARG B 1 150 ? 14.120  -8.332  -4.506  1.00 29.46 ? 150 ARG B NH1 1 
ATOM   3105 N NH2 . ARG B 1 150 ? 14.479  -6.047  -4.624  1.00 21.42 ? 150 ARG B NH2 1 
ATOM   3106 N N   . SER B 1 151 ? 9.827   -10.887 -11.215 1.00 32.10 ? 151 SER B N   1 
ATOM   3107 C CA  . SER B 1 151 ? 9.755   -11.957 -12.212 1.00 32.31 ? 151 SER B CA  1 
ATOM   3108 C C   . SER B 1 151 ? 9.438   -11.416 -13.614 1.00 32.20 ? 151 SER B C   1 
ATOM   3109 O O   . SER B 1 151 ? 9.644   -12.092 -14.624 1.00 33.09 ? 151 SER B O   1 
ATOM   3110 C CB  . SER B 1 151 ? 8.684   -12.936 -11.802 1.00 32.26 ? 151 SER B CB  1 
ATOM   3111 O OG  . SER B 1 151 ? 7.458   -12.251 -11.791 1.00 33.75 ? 151 SER B OG  1 
ATOM   3112 N N   . TYR B 1 152 ? 8.935   -10.190 -13.660 1.00 31.40 ? 152 TYR B N   1 
ATOM   3113 C CA  . TYR B 1 152 ? 8.652   -9.501  -14.910 1.00 30.03 ? 152 TYR B CA  1 
ATOM   3114 C C   . TYR B 1 152 ? 9.800   -8.567  -15.298 1.00 30.09 ? 152 TYR B C   1 
ATOM   3115 O O   . TYR B 1 152 ? 9.792   -8.024  -16.376 1.00 31.53 ? 152 TYR B O   1 
ATOM   3116 C CB  . TYR B 1 152 ? 7.409   -8.646  -14.753 1.00 29.17 ? 152 TYR B CB  1 
ATOM   3117 C CG  . TYR B 1 152 ? 6.066   -9.301  -14.968 1.00 28.64 ? 152 TYR B CG  1 
ATOM   3118 C CD1 . TYR B 1 152 ? 5.739   -9.899  -16.201 1.00 27.66 ? 152 TYR B CD1 1 
ATOM   3119 C CD2 . TYR B 1 152 ? 5.052   -9.231  -13.968 1.00 27.87 ? 152 TYR B CD2 1 
ATOM   3120 C CE1 . TYR B 1 152 ? 4.449   -10.462 -16.429 1.00 25.02 ? 152 TYR B CE1 1 
ATOM   3121 C CE2 . TYR B 1 152 ? 3.753   -9.792  -14.182 1.00 24.71 ? 152 TYR B CE2 1 
ATOM   3122 C CZ  . TYR B 1 152 ? 3.462   -10.397 -15.417 1.00 23.50 ? 152 TYR B CZ  1 
ATOM   3123 O OH  . TYR B 1 152 ? 2.229   -10.969 -15.649 1.00 18.06 ? 152 TYR B OH  1 
ATOM   3124 N N   . GLY B 1 153 ? 10.788  -8.365  -14.437 1.00 29.46 ? 153 GLY B N   1 
ATOM   3125 C CA  . GLY B 1 153 ? 11.872  -7.453  -14.737 1.00 28.69 ? 153 GLY B CA  1 
ATOM   3126 C C   . GLY B 1 153 ? 11.682  -6.109  -14.024 1.00 29.22 ? 153 GLY B C   1 
ATOM   3127 O O   . GLY B 1 153 ? 12.486  -5.170  -14.180 1.00 28.63 ? 153 GLY B O   1 
ATOM   3128 N N   . MET B 1 154 ? 10.619  -6.026  -13.232 1.00 28.88 ? 154 MET B N   1 
ATOM   3129 C CA  . MET B 1 154 ? 10.279  -4.811  -12.551 1.00 28.83 ? 154 MET B CA  1 
ATOM   3130 C C   . MET B 1 154 ? 11.053  -4.664  -11.243 1.00 28.49 ? 154 MET B C   1 
ATOM   3131 O O   . MET B 1 154 ? 11.240  -5.653  -10.496 1.00 28.56 ? 154 MET B O   1 
ATOM   3132 C CB  . MET B 1 154 ? 8.770   -4.733  -12.348 1.00 29.24 ? 154 MET B CB  1 
ATOM   3133 C CG  . MET B 1 154 ? 8.076   -4.445  -13.664 1.00 31.35 ? 154 MET B CG  1 
ATOM   3134 S SD  . MET B 1 154 ? 6.352   -3.979  -13.555 1.00 37.04 ? 154 MET B SD  1 
ATOM   3135 C CE  . MET B 1 154 ? 5.633   -5.523  -13.060 1.00 35.55 ? 154 MET B CE  1 
ATOM   3136 N N   . GLU B 1 155 ? 11.538  -3.442  -11.008 1.00 27.17 ? 155 GLU B N   1 
ATOM   3137 C CA  . GLU B 1 155 ? 12.206  -3.082  -9.755  1.00 27.19 ? 155 GLU B CA  1 
ATOM   3138 C C   . GLU B 1 155 ? 11.365  -2.003  -9.048  1.00 26.51 ? 155 GLU B C   1 
ATOM   3139 O O   . GLU B 1 155 ? 11.516  -0.791  -9.330  1.00 26.28 ? 155 GLU B O   1 
ATOM   3140 C CB  . GLU B 1 155 ? 13.649  -2.605  -9.948  1.00 26.37 ? 155 GLU B CB  1 
ATOM   3141 C CG  . GLU B 1 155 ? 14.377  -2.479  -8.621  1.00 28.79 ? 155 GLU B CG  1 
ATOM   3142 C CD  . GLU B 1 155 ? 14.304  -3.776  -7.782  1.00 29.16 ? 155 GLU B CD  1 
ATOM   3143 O OE1 . GLU B 1 155 ? 14.399  -4.865  -8.376  1.00 33.75 ? 155 GLU B OE1 1 
ATOM   3144 O OE2 . GLU B 1 155 ? 14.151  -3.720  -6.546  1.00 26.10 ? 155 GLU B OE2 1 
ATOM   3145 N N   . PRO B 1 156 ? 10.445  -2.459  -8.172  1.00 25.51 ? 156 PRO B N   1 
ATOM   3146 C CA  . PRO B 1 156 ? 9.428   -1.614  -7.566  1.00 24.86 ? 156 PRO B CA  1 
ATOM   3147 C C   . PRO B 1 156 ? 9.998   -0.626  -6.581  1.00 24.30 ? 156 PRO B C   1 
ATOM   3148 O O   . PRO B 1 156 ? 11.060  -0.840  -5.973  1.00 23.05 ? 156 PRO B O   1 
ATOM   3149 C CB  . PRO B 1 156 ? 8.503   -2.616  -6.871  1.00 24.69 ? 156 PRO B CB  1 
ATOM   3150 C CG  . PRO B 1 156 ? 8.750   -3.894  -7.602  1.00 25.67 ? 156 PRO B CG  1 
ATOM   3151 C CD  . PRO B 1 156 ? 10.197  -3.880  -7.892  1.00 24.51 ? 156 PRO B CD  1 
ATOM   3152 N N   . ALA B 1 157 ? 9.302   0.496   -6.479  1.00 24.09 ? 157 ALA B N   1 
ATOM   3153 C CA  . ALA B 1 157 ? 9.666   1.515   -5.525  1.00 23.54 ? 157 ALA B CA  1 
ATOM   3154 C C   . ALA B 1 157 ? 8.886   1.131   -4.280  1.00 23.53 ? 157 ALA B C   1 
ATOM   3155 O O   . ALA B 1 157 ? 7.699   0.760   -4.372  1.00 22.99 ? 157 ALA B O   1 
ATOM   3156 C CB  . ALA B 1 157 ? 9.279   2.852   -6.028  1.00 23.04 ? 157 ALA B CB  1 
ATOM   3157 N N   . ILE B 1 158 ? 9.591   1.126   -3.146  1.00 23.59 ? 158 ILE B N   1 
ATOM   3158 C CA  . ILE B 1 158 ? 8.980   0.879   -1.835  1.00 23.73 ? 158 ILE B CA  1 
ATOM   3159 C C   . ILE B 1 158 ? 8.600   2.170   -1.151  1.00 23.25 ? 158 ILE B C   1 
ATOM   3160 O O   . ILE B 1 158 ? 9.444   3.056   -0.986  1.00 23.11 ? 158 ILE B O   1 
ATOM   3161 C CB  . ILE B 1 158 ? 9.914   0.049   -0.969  1.00 24.11 ? 158 ILE B CB  1 
ATOM   3162 C CG1 . ILE B 1 158 ? 10.437  -1.085  -1.829  1.00 23.86 ? 158 ILE B CG1 1 
ATOM   3163 C CG2 . ILE B 1 158 ? 9.158   -0.517  0.282   1.00 20.99 ? 158 ILE B CG2 1 
ATOM   3164 C CD1 . ILE B 1 158 ? 9.257   -1.977  -2.344  1.00 24.05 ? 158 ILE B CD1 1 
ATOM   3165 N N   . VAL B 1 159 ? 7.323   2.297   -0.805  1.00 23.59 ? 159 VAL B N   1 
ATOM   3166 C CA  . VAL B 1 159 ? 6.797   3.588   -0.285  1.00 24.04 ? 159 VAL B CA  1 
ATOM   3167 C C   . VAL B 1 159 ? 6.685   3.639   1.251   1.00 24.62 ? 159 VAL B C   1 
ATOM   3168 O O   . VAL B 1 159 ? 5.953   2.865   1.852   1.00 24.51 ? 159 VAL B O   1 
ATOM   3169 C CB  . VAL B 1 159 ? 5.449   3.986   -0.949  1.00 23.73 ? 159 VAL B CB  1 
ATOM   3170 C CG1 . VAL B 1 159 ? 4.918   5.392   -0.431  1.00 20.74 ? 159 VAL B CG1 1 
ATOM   3171 C CG2 . VAL B 1 159 ? 5.635   4.030   -2.441  1.00 24.54 ? 159 VAL B CG2 1 
ATOM   3172 N N   . ILE B 1 160 ? 7.396   4.576   1.859   1.00 25.17 ? 160 ILE B N   1 
ATOM   3173 C CA  . ILE B 1 160 ? 7.448   4.682   3.302   1.00 26.46 ? 160 ILE B CA  1 
ATOM   3174 C C   . ILE B 1 160 ? 7.207   6.116   3.759   1.00 27.38 ? 160 ILE B C   1 
ATOM   3175 O O   . ILE B 1 160 ? 7.282   7.053   2.957   1.00 27.20 ? 160 ILE B O   1 
ATOM   3176 C CB  . ILE B 1 160 ? 8.837   4.180   3.884   1.00 26.95 ? 160 ILE B CB  1 
ATOM   3177 C CG1 . ILE B 1 160 ? 9.986   5.140   3.580   1.00 25.88 ? 160 ILE B CG1 1 
ATOM   3178 C CG2 . ILE B 1 160 ? 9.184   2.790   3.363   1.00 28.20 ? 160 ILE B CG2 1 
ATOM   3179 C CD1 . ILE B 1 160 ? 11.230  4.805   4.326   1.00 26.34 ? 160 ILE B CD1 1 
ATOM   3180 N N   . ASN B 1 161 ? 6.899   6.273   5.050   1.00 28.94 ? 161 ASN B N   1 
ATOM   3181 C CA  . ASN B 1 161 ? 6.892   7.590   5.691   1.00 29.72 ? 161 ASN B CA  1 
ATOM   3182 C C   . ASN B 1 161 ? 7.185   7.576   7.195   1.00 29.84 ? 161 ASN B C   1 
ATOM   3183 O O   . ASN B 1 161 ? 7.239   8.644   7.811   1.00 30.22 ? 161 ASN B O   1 
ATOM   3184 C CB  . ASN B 1 161 ? 5.577   8.314   5.430   1.00 31.18 ? 161 ASN B CB  1 
ATOM   3185 C CG  . ASN B 1 161 ? 4.474   7.866   6.351   1.00 32.80 ? 161 ASN B CG  1 
ATOM   3186 O OD1 . ASN B 1 161 ? 4.541   6.802   6.935   1.00 34.77 ? 161 ASN B OD1 1 
ATOM   3187 N ND2 . ASN B 1 161 ? 3.442   8.693   6.485   1.00 37.81 ? 161 ASN B ND2 1 
ATOM   3188 N N   . ASP B 1 162 ? 7.354   6.389   7.795   1.00 29.93 ? 162 ASP B N   1 
ATOM   3189 C CA  . ASP B 1 162 ? 7.871   6.318   9.176   1.00 29.76 ? 162 ASP B CA  1 
ATOM   3190 C C   . ASP B 1 162 ? 9.000   5.303   9.364   1.00 29.67 ? 162 ASP B C   1 
ATOM   3191 O O   . ASP B 1 162 ? 9.309   4.555   8.436   1.00 29.37 ? 162 ASP B O   1 
ATOM   3192 C CB  . ASP B 1 162 ? 6.741   6.123   10.182  1.00 29.17 ? 162 ASP B CB  1 
ATOM   3193 C CG  . ASP B 1 162 ? 6.089   4.784   10.068  1.00 30.21 ? 162 ASP B CG  1 
ATOM   3194 O OD1 . ASP B 1 162 ? 6.809   3.764   9.846   1.00 29.31 ? 162 ASP B OD1 1 
ATOM   3195 O OD2 . ASP B 1 162 ? 4.845   4.750   10.218  1.00 30.38 ? 162 ASP B OD2 1 
ATOM   3196 N N   . GLU B 1 163 ? 9.622   5.288   10.552  1.00 29.94 ? 163 GLU B N   1 
ATOM   3197 C CA  . GLU B 1 163 ? 10.714  4.319   10.874  1.00 29.68 ? 163 GLU B CA  1 
ATOM   3198 C C   . GLU B 1 163 ? 10.355  2.838   10.749  1.00 29.55 ? 163 GLU B C   1 
ATOM   3199 O O   . GLU B 1 163 ? 11.180  2.027   10.324  1.00 30.22 ? 163 GLU B O   1 
ATOM   3200 C CB  . GLU B 1 163 ? 11.293  4.586   12.249  1.00 29.10 ? 163 GLU B CB  1 
ATOM   3201 C CG  . GLU B 1 163 ? 12.147  5.828   12.257  1.00 32.58 ? 163 GLU B CG  1 
ATOM   3202 C CD  . GLU B 1 163 ? 12.837  6.114   13.596  1.00 36.37 ? 163 GLU B CD  1 
ATOM   3203 O OE1 . GLU B 1 163 ? 13.236  5.158   14.323  1.00 36.41 ? 163 GLU B OE1 1 
ATOM   3204 O OE2 . GLU B 1 163 ? 12.977  7.324   13.907  1.00 37.10 ? 163 GLU B OE2 1 
ATOM   3205 N N   . GLU B 1 164 ? 9.130   2.477   11.112  1.00 29.18 ? 164 GLU B N   1 
ATOM   3206 C CA  . GLU B 1 164 ? 8.694   1.098   10.971  1.00 29.58 ? 164 GLU B CA  1 
ATOM   3207 C C   . GLU B 1 164 ? 8.588   0.678   9.501   1.00 29.47 ? 164 GLU B C   1 
ATOM   3208 O O   . GLU B 1 164 ? 9.078   -0.386  9.116   1.00 29.27 ? 164 GLU B O   1 
ATOM   3209 C CB  . GLU B 1 164 ? 7.377   0.856   11.698  1.00 29.77 ? 164 GLU B CB  1 
ATOM   3210 C CG  . GLU B 1 164 ? 7.123   -0.592  11.969  1.00 32.26 ? 164 GLU B CG  1 
ATOM   3211 C CD  . GLU B 1 164 ? 5.819   -0.804  12.669  1.00 37.82 ? 164 GLU B CD  1 
ATOM   3212 O OE1 . GLU B 1 164 ? 5.012   -1.596  12.136  1.00 39.42 ? 164 GLU B OE1 1 
ATOM   3213 O OE2 . GLU B 1 164 ? 5.584   -0.169  13.732  1.00 40.23 ? 164 GLU B OE2 1 
ATOM   3214 N N   . ASP B 1 165 ? 7.933   1.514   8.693   1.00 29.39 ? 165 ASP B N   1 
ATOM   3215 C CA  . ASP B 1 165 ? 7.999   1.385   7.242   1.00 28.85 ? 165 ASP B CA  1 
ATOM   3216 C C   . ASP B 1 165 ? 9.431   1.154   6.751   1.00 28.12 ? 165 ASP B C   1 
ATOM   3217 O O   . ASP B 1 165 ? 9.675   0.207   5.999   1.00 27.93 ? 165 ASP B O   1 
ATOM   3218 C CB  . ASP B 1 165 ? 7.427   2.634   6.546   1.00 29.61 ? 165 ASP B CB  1 
ATOM   3219 C CG  . ASP B 1 165 ? 5.923   2.761   6.658   1.00 29.75 ? 165 ASP B CG  1 
ATOM   3220 O OD1 . ASP B 1 165 ? 5.247   1.840   7.156   1.00 29.20 ? 165 ASP B OD1 1 
ATOM   3221 O OD2 . ASP B 1 165 ? 5.420   3.832   6.246   1.00 35.21 ? 165 ASP B OD2 1 
ATOM   3222 N N   . LEU B 1 166 ? 10.376  2.001   7.162   1.00 27.92 ? 166 LEU B N   1 
ATOM   3223 C CA  . LEU B 1 166 ? 11.780  1.852   6.708   1.00 28.36 ? 166 LEU B CA  1 
ATOM   3224 C C   . LEU B 1 166 ? 12.448  0.565   7.206   1.00 29.07 ? 166 LEU B C   1 
ATOM   3225 O O   . LEU B 1 166 ? 13.263  -0.033  6.498   1.00 29.75 ? 166 LEU B O   1 
ATOM   3226 C CB  . LEU B 1 166 ? 12.632  3.061   7.081   1.00 28.20 ? 166 LEU B CB  1 
ATOM   3227 C CG  . LEU B 1 166 ? 14.176  3.004   7.046   1.00 28.96 ? 166 LEU B CG  1 
ATOM   3228 C CD1 . LEU B 1 166 ? 14.733  2.726   5.647   1.00 30.10 ? 166 LEU B CD1 1 
ATOM   3229 C CD2 . LEU B 1 166 ? 14.763  4.305   7.599   1.00 26.59 ? 166 LEU B CD2 1 
ATOM   3230 N N   . ASP B 1 167 ? 12.103  0.136   8.419   1.00 29.26 ? 167 ASP B N   1 
ATOM   3231 C CA  . ASP B 1 167 ? 12.616  -1.128  8.931   1.00 28.95 ? 167 ASP B CA  1 
ATOM   3232 C C   . ASP B 1 167 ? 12.096  -2.281  8.083   1.00 28.81 ? 167 ASP B C   1 
ATOM   3233 O O   . ASP B 1 167 ? 12.808  -3.253  7.835   1.00 29.52 ? 167 ASP B O   1 
ATOM   3234 C CB  . ASP B 1 167 ? 12.198  -1.334  10.386  1.00 28.96 ? 167 ASP B CB  1 
ATOM   3235 C CG  . ASP B 1 167 ? 12.537  -2.717  10.884  1.00 28.25 ? 167 ASP B CG  1 
ATOM   3236 O OD1 . ASP B 1 167 ? 11.607  -3.518  11.120  1.00 25.35 ? 167 ASP B OD1 1 
ATOM   3237 O OD2 . ASP B 1 167 ? 13.749  -2.996  11.022  1.00 28.44 ? 167 ASP B OD2 1 
ATOM   3238 N N   . ILE B 1 168 ? 10.864  -2.173  7.622   1.00 27.99 ? 168 ILE B N   1 
ATOM   3239 C CA  . ILE B 1 168 ? 10.314  -3.231  6.782   1.00 28.48 ? 168 ILE B CA  1 
ATOM   3240 C C   . ILE B 1 168 ? 10.865  -3.167  5.324   1.00 28.56 ? 168 ILE B C   1 
ATOM   3241 O O   . ILE B 1 168 ? 11.063  -4.203  4.657   1.00 28.48 ? 168 ILE B O   1 
ATOM   3242 C CB  . ILE B 1 168 ? 8.768   -3.221  6.823   1.00 28.28 ? 168 ILE B CB  1 
ATOM   3243 C CG1 . ILE B 1 168 ? 8.281   -3.797  8.164   1.00 28.70 ? 168 ILE B CG1 1 
ATOM   3244 C CG2 . ILE B 1 168 ? 8.200   -3.995  5.627   1.00 28.28 ? 168 ILE B CG2 1 
ATOM   3245 C CD1 . ILE B 1 168 ? 6.723   -3.957  8.316   1.00 31.07 ? 168 ILE B CD1 1 
ATOM   3246 N N   . ALA B 1 169 ? 11.127  -1.955  4.835   1.00 28.19 ? 169 ALA B N   1 
ATOM   3247 C CA  . ALA B 1 169 ? 11.660  -1.828  3.496   1.00 27.81 ? 169 ALA B CA  1 
ATOM   3248 C C   . ALA B 1 169 ? 13.053  -2.433  3.476   1.00 28.04 ? 169 ALA B C   1 
ATOM   3249 O O   . ALA B 1 169 ? 13.424  -3.116  2.504   1.00 28.26 ? 169 ALA B O   1 
ATOM   3250 C CB  . ALA B 1 169 ? 11.672  -0.386  3.027   1.00 27.41 ? 169 ALA B CB  1 
ATOM   3251 N N   . LEU B 1 170 ? 13.801  -2.235  4.555   1.00 27.78 ? 170 LEU B N   1 
ATOM   3252 C CA  . LEU B 1 170 ? 15.136  -2.810  4.616   1.00 28.64 ? 170 LEU B CA  1 
ATOM   3253 C C   . LEU B 1 170 ? 15.139  -4.332  4.746   1.00 28.47 ? 170 LEU B C   1 
ATOM   3254 O O   . LEU B 1 170 ? 16.026  -4.987  4.230   1.00 28.50 ? 170 LEU B O   1 
ATOM   3255 C CB  . LEU B 1 170 ? 15.962  -2.172  5.725   1.00 29.02 ? 170 LEU B CB  1 
ATOM   3256 C CG  . LEU B 1 170 ? 16.501  -0.791  5.394   1.00 29.74 ? 170 LEU B CG  1 
ATOM   3257 C CD1 . LEU B 1 170 ? 17.045  -0.159  6.696   1.00 29.63 ? 170 LEU B CD1 1 
ATOM   3258 C CD2 . LEU B 1 170 ? 17.600  -0.852  4.295   1.00 28.48 ? 170 LEU B CD2 1 
ATOM   3259 N N   . ARG B 1 171 ? 14.119  -4.872  5.399   1.00 28.87 ? 171 ARG B N   1 
ATOM   3260 C CA  . ARG B 1 171 ? 13.942  -6.321  5.568   1.00 29.70 ? 171 ARG B CA  1 
ATOM   3261 C C   . ARG B 1 171 ? 13.730  -7.097  4.256   1.00 29.86 ? 171 ARG B C   1 
ATOM   3262 O O   . ARG B 1 171 ? 14.069  -8.275  4.162   1.00 30.16 ? 171 ARG B O   1 
ATOM   3263 C CB  . ARG B 1 171 ? 12.741  -6.594  6.486   1.00 29.26 ? 171 ARG B CB  1 
ATOM   3264 C CG  . ARG B 1 171 ? 12.492  -8.078  6.822   1.00 30.78 ? 171 ARG B CG  1 
ATOM   3265 C CD  . ARG B 1 171 ? 12.281  -8.250  8.335   1.00 32.90 ? 171 ARG B CD  1 
ATOM   3266 N NE  . ARG B 1 171 ? 13.137  -7.278  9.001   1.00 34.83 ? 171 ARG B NE  1 
ATOM   3267 C CZ  . ARG B 1 171 ? 12.805  -6.562  10.063  1.00 34.29 ? 171 ARG B CZ  1 
ATOM   3268 N NH1 . ARG B 1 171 ? 11.614  -6.710  10.640  1.00 34.06 ? 171 ARG B NH1 1 
ATOM   3269 N NH2 . ARG B 1 171 ? 13.691  -5.710  10.545  1.00 34.38 ? 171 ARG B NH2 1 
ATOM   3270 N N   . ILE B 1 172 ? 13.115  -6.453  3.277   1.00 29.34 ? 172 ILE B N   1 
ATOM   3271 C CA  . ILE B 1 172 ? 12.848  -7.088  2.000   1.00 28.74 ? 172 ILE B CA  1 
ATOM   3272 C C   . ILE B 1 172 ? 13.994  -6.757  1.033   1.00 29.41 ? 172 ILE B C   1 
ATOM   3273 O O   . ILE B 1 172 ? 14.017  -7.241  -0.089  1.00 29.16 ? 172 ILE B O   1 
ATOM   3274 C CB  . ILE B 1 172 ? 11.454  -6.653  1.455   1.00 28.94 ? 172 ILE B CB  1 
ATOM   3275 C CG1 . ILE B 1 172 ? 11.478  -5.187  0.962   1.00 28.42 ? 172 ILE B CG1 1 
ATOM   3276 C CG2 . ILE B 1 172 ? 10.383  -6.840  2.548   1.00 27.40 ? 172 ILE B CG2 1 
ATOM   3277 C CD1 . ILE B 1 172 ? 10.125  -4.579  0.729   1.00 25.42 ? 172 ILE B CD1 1 
ATOM   3278 N N   . GLY B 1 173 ? 14.946  -5.930  1.488   1.00 29.97 ? 173 GLY B N   1 
ATOM   3279 C CA  . GLY B 1 173 ? 16.091  -5.524  0.684   1.00 30.61 ? 173 GLY B CA  1 
ATOM   3280 C C   . GLY B 1 173 ? 15.678  -4.571  -0.423  1.00 31.60 ? 173 GLY B C   1 
ATOM   3281 O O   . GLY B 1 173 ? 16.034  -4.757  -1.600  1.00 32.55 ? 173 GLY B O   1 
ATOM   3282 N N   . ALA B 1 174 ? 14.906  -3.548  -0.068  1.00 31.07 ? 174 ALA B N   1 
ATOM   3283 C CA  . ALA B 1 174 ? 14.486  -2.560  -1.052  1.00 29.85 ? 174 ALA B CA  1 
ATOM   3284 C C   . ALA B 1 174 ? 15.680  -1.987  -1.818  1.00 29.18 ? 174 ALA B C   1 
ATOM   3285 O O   . ALA B 1 174 ? 16.725  -1.698  -1.256  1.00 28.57 ? 174 ALA B O   1 
ATOM   3286 C CB  . ALA B 1 174 ? 13.725  -1.454  -0.367  1.00 29.70 ? 174 ALA B CB  1 
ATOM   3287 N N   . ARG B 1 175 ? 15.522  -1.808  -3.115  1.00 28.91 ? 175 ARG B N   1 
ATOM   3288 C CA  . ARG B 1 175 ? 16.578  -1.159  -3.866  1.00 27.80 ? 175 ARG B CA  1 
ATOM   3289 C C   . ARG B 1 175 ? 16.197  0.285   -4.189  1.00 27.06 ? 175 ARG B C   1 
ATOM   3290 O O   . ARG B 1 175 ? 17.072  1.144   -4.321  1.00 26.68 ? 175 ARG B O   1 
ATOM   3291 C CB  . ARG B 1 175 ? 16.906  -1.971  -5.101  1.00 28.36 ? 175 ARG B CB  1 
ATOM   3292 C CG  . ARG B 1 175 ? 17.300  -3.428  -4.795  1.00 31.47 ? 175 ARG B CG  1 
ATOM   3293 C CD  . ARG B 1 175 ? 18.670  -3.761  -5.386  1.00 40.78 ? 175 ARG B CD  1 
ATOM   3294 N NE  . ARG B 1 175 ? 19.736  -2.869  -4.894  1.00 44.14 ? 175 ARG B NE  1 
ATOM   3295 C CZ  . ARG B 1 175 ? 20.999  -2.887  -5.329  1.00 47.10 ? 175 ARG B CZ  1 
ATOM   3296 N NH1 . ARG B 1 175 ? 21.365  -3.744  -6.275  1.00 46.33 ? 175 ARG B NH1 1 
ATOM   3297 N NH2 . ARG B 1 175 ? 21.902  -2.036  -4.832  1.00 48.14 ? 175 ARG B NH2 1 
ATOM   3298 N N   . ILE B 1 176 ? 14.883  0.546   -4.269  1.00 26.08 ? 176 ILE B N   1 
ATOM   3299 C CA  . ILE B 1 176 ? 14.343  1.903   -4.417  1.00 25.12 ? 176 ILE B CA  1 
ATOM   3300 C C   . ILE B 1 176 ? 13.337  2.189   -3.330  1.00 24.55 ? 176 ILE B C   1 
ATOM   3301 O O   . ILE B 1 176 ? 12.392  1.446   -3.106  1.00 24.41 ? 176 ILE B O   1 
ATOM   3302 C CB  . ILE B 1 176 ? 13.613  2.173   -5.766  1.00 24.98 ? 176 ILE B CB  1 
ATOM   3303 C CG1 . ILE B 1 176 ? 13.962  1.118   -6.818  1.00 26.06 ? 176 ILE B CG1 1 
ATOM   3304 C CG2 . ILE B 1 176 ? 13.865  3.600   -6.238  1.00 22.11 ? 176 ILE B CG2 1 
ATOM   3305 C CD1 . ILE B 1 176 ? 13.587  1.502   -8.281  1.00 29.21 ? 176 ILE B CD1 1 
ATOM   3306 N N   . ILE B 1 177 ? 13.528  3.299   -2.658  1.00 24.69 ? 177 ILE B N   1 
ATOM   3307 C CA  . ILE B 1 177 ? 12.592  3.658   -1.629  1.00 25.05 ? 177 ILE B CA  1 
ATOM   3308 C C   . ILE B 1 177 ? 12.096  5.030   -1.930  1.00 25.03 ? 177 ILE B C   1 
ATOM   3309 O O   . ILE B 1 177 ? 12.921  5.920   -2.216  1.00 23.90 ? 177 ILE B O   1 
ATOM   3310 C CB  . ILE B 1 177 ? 13.209  3.573   -0.197  1.00 25.23 ? 177 ILE B CB  1 
ATOM   3311 C CG1 . ILE B 1 177 ? 13.664  2.132   0.102   1.00 24.20 ? 177 ILE B CG1 1 
ATOM   3312 C CG2 . ILE B 1 177 ? 12.185  3.991   0.826   1.00 26.69 ? 177 ILE B CG2 1 
ATOM   3313 C CD1 . ILE B 1 177 ? 14.560  1.964   1.337   1.00 25.36 ? 177 ILE B CD1 1 
ATOM   3314 N N   . ILE B 1 178 ? 10.756  5.175   -1.921  1.00 24.75 ? 178 ILE B N   1 
ATOM   3315 C CA  . ILE B 1 178 ? 10.134  6.500   -1.847  1.00 24.80 ? 178 ILE B CA  1 
ATOM   3316 C C   . ILE B 1 178 ? 9.752   6.858   -0.395  1.00 24.87 ? 178 ILE B C   1 
ATOM   3317 O O   . ILE B 1 178 ? 8.838   6.250   0.206   1.00 24.94 ? 178 ILE B O   1 
ATOM   3318 C CB  . ILE B 1 178 ? 8.902   6.678   -2.797  1.00 25.10 ? 178 ILE B CB  1 
ATOM   3319 C CG1 . ILE B 1 178 ? 9.277   6.400   -4.256  1.00 25.22 ? 178 ILE B CG1 1 
ATOM   3320 C CG2 . ILE B 1 178 ? 8.323   8.123   -2.686  1.00 24.66 ? 178 ILE B CG2 1 
ATOM   3321 C CD1 . ILE B 1 178 ? 8.076   6.108   -5.145  1.00 24.72 ? 178 ILE B CD1 1 
ATOM   3322 N N   . ILE B 1 179 ? 10.455  7.861   0.135   1.00 24.65 ? 179 ILE B N   1 
ATOM   3323 C CA  . ILE B 1 179 ? 10.193  8.473   1.456   1.00 24.21 ? 179 ILE B CA  1 
ATOM   3324 C C   . ILE B 1 179 ? 9.262   9.652   1.242   1.00 25.64 ? 179 ILE B C   1 
ATOM   3325 O O   . ILE B 1 179 ? 9.700   10.715  0.752   1.00 25.67 ? 179 ILE B O   1 
ATOM   3326 C CB  . ILE B 1 179 ? 11.490  9.090   2.100   1.00 23.39 ? 179 ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 179 ? 12.704  8.140   2.016   1.00 21.45 ? 179 ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 179 ? 11.237  9.561   3.524   1.00 23.03 ? 179 ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 179 ? 13.577  8.257   0.706   1.00 14.27 ? 179 ILE B CD1 1 
ATOM   3330 N N   . SER B 1 180 ? 7.988   9.473   1.596   1.00 26.79 ? 180 SER B N   1 
ATOM   3331 C CA  . SER B 1 180 ? 7.037   10.567  1.579   1.00 28.29 ? 180 SER B CA  1 
ATOM   3332 C C   . SER B 1 180 ? 6.953   11.269  2.930   1.00 29.42 ? 180 SER B C   1 
ATOM   3333 O O   . SER B 1 180 ? 7.014   10.623  3.985   1.00 29.26 ? 180 SER B O   1 
ATOM   3334 C CB  . SER B 1 180 ? 5.655   10.060  1.183   1.00 28.84 ? 180 SER B CB  1 
ATOM   3335 O OG  . SER B 1 180 ? 4.669   11.091  1.335   1.00 31.59 ? 180 SER B OG  1 
ATOM   3336 N N   . SER B 1 181 ? 6.818   12.595  2.883   1.00 30.89 ? 181 SER B N   1 
ATOM   3337 C CA  . SER B 1 181 ? 6.545   13.418  4.067   1.00 32.21 ? 181 SER B CA  1 
ATOM   3338 C C   . SER B 1 181 ? 5.071   13.477  4.444   1.00 32.91 ? 181 SER B C   1 
ATOM   3339 O O   . SER B 1 181 ? 4.743   13.930  5.521   1.00 32.70 ? 181 SER B O   1 
ATOM   3340 C CB  . SER B 1 181 ? 7.062   14.847  3.872   1.00 32.65 ? 181 SER B CB  1 
ATOM   3341 O OG  . SER B 1 181 ? 6.745   15.360  2.579   1.00 35.02 ? 181 SER B OG  1 
ATOM   3342 N N   . ARG B 1 182 ? 4.191   13.020  3.553   1.00 34.65 ? 182 ARG B N   1 
ATOM   3343 C CA  . ARG B 1 182 ? 2.738   13.164  3.722   1.00 35.91 ? 182 ARG B CA  1 
ATOM   3344 C C   . ARG B 1 182 ? 2.142   11.894  4.345   1.00 37.24 ? 182 ARG B C   1 
ATOM   3345 O O   . ARG B 1 182 ? 2.200   10.824  3.743   1.00 37.81 ? 182 ARG B O   1 
ATOM   3346 C CB  . ARG B 1 182 ? 2.096   13.489  2.368   1.00 35.49 ? 182 ARG B CB  1 
ATOM   3347 C CG  . ARG B 1 182 ? 0.572   13.488  2.315   1.00 35.51 ? 182 ARG B CG  1 
ATOM   3348 C CD  . ARG B 1 182 ? 0.044   13.927  0.929   1.00 34.55 ? 182 ARG B CD  1 
ATOM   3349 N NE  . ARG B 1 182 ? 0.350   15.337  0.663   1.00 33.69 ? 182 ARG B NE  1 
ATOM   3350 C CZ  . ARG B 1 182 ? 0.943   15.806  -0.439  1.00 34.29 ? 182 ARG B CZ  1 
ATOM   3351 N NH1 . ARG B 1 182 ? 1.292   15.007  -1.450  1.00 33.71 ? 182 ARG B NH1 1 
ATOM   3352 N NH2 . ARG B 1 182 ? 1.197   17.101  -0.536  1.00 33.45 ? 182 ARG B NH2 1 
ATOM   3353 N N   . ASP B 1 183 ? 1.590   11.997  5.550   1.00 38.14 ? 183 ASP B N   1 
ATOM   3354 C CA  . ASP B 1 183 ? 0.976   10.832  6.164   1.00 39.52 ? 183 ASP B CA  1 
ATOM   3355 C C   . ASP B 1 183 ? -0.278  10.468  5.380   1.00 40.08 ? 183 ASP B C   1 
ATOM   3356 O O   . ASP B 1 183 ? -1.076  11.352  5.003   1.00 40.09 ? 183 ASP B O   1 
ATOM   3357 C CB  . ASP B 1 183 ? 0.663   11.065  7.650   1.00 39.79 ? 183 ASP B CB  1 
ATOM   3358 C CG  . ASP B 1 183 ? -0.373  10.064  8.209   1.00 42.64 ? 183 ASP B CG  1 
ATOM   3359 O OD1 . ASP B 1 183 ? -0.171  9.552   9.341   1.00 44.62 ? 183 ASP B OD1 1 
ATOM   3360 O OD2 . ASP B 1 183 ? -1.406  9.804   7.531   1.00 43.60 ? 183 ASP B OD2 1 
ATOM   3361 N N   . LEU B 1 184 ? -0.443  9.166   5.150   1.00 40.31 ? 184 LEU B N   1 
ATOM   3362 C CA  . LEU B 1 184 ? -1.510  8.655   4.310   1.00 41.03 ? 184 LEU B CA  1 
ATOM   3363 C C   . LEU B 1 184 ? -2.925  9.053   4.702   1.00 41.17 ? 184 LEU B C   1 
ATOM   3364 O O   . LEU B 1 184 ? -3.743  9.326   3.824   1.00 41.40 ? 184 LEU B O   1 
ATOM   3365 C CB  . LEU B 1 184 ? -1.421  7.136   4.210   1.00 41.26 ? 184 LEU B CB  1 
ATOM   3366 C CG  . LEU B 1 184 ? -0.661  6.670   2.968   1.00 41.95 ? 184 LEU B CG  1 
ATOM   3367 C CD1 . LEU B 1 184 ? -0.409  5.167   3.038   1.00 41.96 ? 184 LEU B CD1 1 
ATOM   3368 C CD2 . LEU B 1 184 ? -1.386  7.074   1.672   1.00 40.71 ? 184 LEU B CD2 1 
ATOM   3369 N N   . GLU B 1 185 ? -3.213  9.055   6.004   1.00 40.88 ? 185 GLU B N   1 
ATOM   3370 C CA  . GLU B 1 185 ? -4.556  9.342   6.507   1.00 40.93 ? 185 GLU B CA  1 
ATOM   3371 C C   . GLU B 1 185 ? -4.768  10.809  6.899   1.00 40.17 ? 185 GLU B C   1 
ATOM   3372 O O   . GLU B 1 185 ? -5.651  11.464  6.356   1.00 40.76 ? 185 GLU B O   1 
ATOM   3373 C CB  . GLU B 1 185 ? -4.939  8.396   7.661   1.00 41.38 ? 185 GLU B CB  1 
ATOM   3374 C CG  . GLU B 1 185 ? -4.866  6.901   7.256   1.00 44.52 ? 185 GLU B CG  1 
ATOM   3375 C CD  . GLU B 1 185 ? -5.400  5.930   8.315   1.00 47.45 ? 185 GLU B CD  1 
ATOM   3376 O OE1 . GLU B 1 185 ? -4.571  5.253   8.954   1.00 46.98 ? 185 GLU B OE1 1 
ATOM   3377 O OE2 . GLU B 1 185 ? -6.643  5.837   8.497   1.00 49.08 ? 185 GLU B OE2 1 
ATOM   3378 N N   . THR B 1 186 ? -3.976  11.332  7.829   1.00 38.73 ? 186 THR B N   1 
ATOM   3379 C CA  . THR B 1 186 ? -4.165  12.712  8.267   1.00 37.17 ? 186 THR B CA  1 
ATOM   3380 C C   . THR B 1 186 ? -3.747  13.735  7.178   1.00 35.92 ? 186 THR B C   1 
ATOM   3381 O O   . THR B 1 186 ? -4.141  14.888  7.228   1.00 35.19 ? 186 THR B O   1 
ATOM   3382 C CB  . THR B 1 186 ? -3.410  12.982  9.609   1.00 37.79 ? 186 THR B CB  1 
ATOM   3383 N N   . LEU B 1 187 ? -2.959  13.286  6.197   1.00 34.72 ? 187 LEU B N   1 
ATOM   3384 C CA  . LEU B 1 187 ? -2.409  14.112  5.091   1.00 33.38 ? 187 LEU B CA  1 
ATOM   3385 C C   . LEU B 1 187 ? -1.381  15.109  5.548   1.00 32.59 ? 187 LEU B C   1 
ATOM   3386 O O   . LEU B 1 187 ? -0.913  15.917  4.739   1.00 32.41 ? 187 LEU B O   1 
ATOM   3387 C CB  . LEU B 1 187 ? -3.490  14.818  4.245   1.00 33.24 ? 187 LEU B CB  1 
ATOM   3388 C CG  . LEU B 1 187 ? -4.627  13.891  3.814   1.00 34.24 ? 187 LEU B CG  1 
ATOM   3389 C CD1 . LEU B 1 187 ? -5.795  14.646  3.183   1.00 30.86 ? 187 LEU B CD1 1 
ATOM   3390 C CD2 . LEU B 1 187 ? -4.081  12.694  2.951   1.00 33.91 ? 187 LEU B CD2 1 
ATOM   3391 N N   . GLU B 1 188 ? -1.049  15.043  6.842   1.00 31.98 ? 188 GLU B N   1 
ATOM   3392 C CA  . GLU B 1 188 ? -0.043  15.892  7.477   1.00 31.46 ? 188 GLU B CA  1 
ATOM   3393 C C   . GLU B 1 188 ? 1.338   15.736  6.818   1.00 31.03 ? 188 GLU B C   1 
ATOM   3394 O O   . GLU B 1 188 ? 1.722   14.649  6.386   1.00 30.58 ? 188 GLU B O   1 
ATOM   3395 C CB  . GLU B 1 188 ? 0.052   15.581  8.980   1.00 31.29 ? 188 GLU B CB  1 
ATOM   3396 N N   . ILE B 1 189 ? 2.086   16.828  6.766   1.00 30.44 ? 189 ILE B N   1 
ATOM   3397 C CA  . ILE B 1 189 ? 3.407   16.777  6.215   1.00 29.87 ? 189 ILE B CA  1 
ATOM   3398 C C   . ILE B 1 189 ? 4.412   17.020  7.322   1.00 29.95 ? 189 ILE B C   1 
ATOM   3399 O O   . ILE B 1 189 ? 4.365   18.049  7.974   1.00 29.29 ? 189 ILE B O   1 
ATOM   3400 C CB  . ILE B 1 189 ? 3.587   17.799  5.066   1.00 30.04 ? 189 ILE B CB  1 
ATOM   3401 C CG1 . ILE B 1 189 ? 2.683   17.408  3.886   1.00 30.82 ? 189 ILE B CG1 1 
ATOM   3402 C CG2 . ILE B 1 189 ? 5.042   17.896  4.642   1.00 28.15 ? 189 ILE B CG2 1 
ATOM   3403 C CD1 . ILE B 1 189 ? 3.073   18.041  2.617   1.00 31.63 ? 189 ILE B CD1 1 
ATOM   3404 N N   . ASN B 1 190 ? 5.334   16.077  7.525   1.00 29.33 ? 190 ASN B N   1 
ATOM   3405 C CA  . ASN B 1 190 ? 6.417   16.330  8.446   1.00 29.56 ? 190 ASN B CA  1 
ATOM   3406 C C   . ASN B 1 190 ? 7.778   16.265  7.762   1.00 29.48 ? 190 ASN B C   1 
ATOM   3407 O O   . ASN B 1 190 ? 8.259   15.200  7.395   1.00 29.46 ? 190 ASN B O   1 
ATOM   3408 C CB  . ASN B 1 190 ? 6.317   15.364  9.633   1.00 29.97 ? 190 ASN B CB  1 
ATOM   3409 C CG  . ASN B 1 190 ? 7.097   15.827  10.832  1.00 30.63 ? 190 ASN B CG  1 
ATOM   3410 O OD1 . ASN B 1 190 ? 8.317   16.021  10.778  1.00 30.56 ? 190 ASN B OD1 1 
ATOM   3411 N ND2 . ASN B 1 190 ? 6.396   15.999  11.936  1.00 33.02 ? 190 ASN B ND2 1 
ATOM   3412 N N   . LYS B 1 191 ? 8.415   17.409  7.595   1.00 30.09 ? 191 LYS B N   1 
ATOM   3413 C CA  . LYS B 1 191 ? 9.647   17.427  6.828   1.00 30.95 ? 191 LYS B CA  1 
ATOM   3414 C C   . LYS B 1 191 ? 10.851  17.105  7.669   1.00 32.35 ? 191 LYS B C   1 
ATOM   3415 O O   . LYS B 1 191 ? 11.859  16.633  7.136   1.00 32.72 ? 191 LYS B O   1 
ATOM   3416 C CB  . LYS B 1 191 ? 9.826   18.728  6.045   1.00 30.94 ? 191 LYS B CB  1 
ATOM   3417 C CG  . LYS B 1 191 ? 9.257   18.632  4.637   1.00 30.96 ? 191 LYS B CG  1 
ATOM   3418 C CD  . LYS B 1 191 ? 9.108   19.966  3.981   1.00 30.35 ? 191 LYS B CD  1 
ATOM   3419 C CE  . LYS B 1 191 ? 8.394   19.794  2.635   1.00 33.23 ? 191 LYS B CE  1 
ATOM   3420 N NZ  . LYS B 1 191 ? 7.887   21.112  2.075   1.00 35.19 ? 191 LYS B NZ  1 
ATOM   3421 N N   . GLU B 1 192 ? 10.744  17.353  8.978   1.00 33.73 ? 192 GLU B N   1 
ATOM   3422 C CA  . GLU B 1 192 ? 11.788  17.002  9.903   1.00 35.10 ? 192 GLU B CA  1 
ATOM   3423 C C   . GLU B 1 192 ? 11.900  15.506  9.878   1.00 35.13 ? 192 GLU B C   1 
ATOM   3424 O O   . GLU B 1 192 ? 13.014  14.958  9.789   1.00 35.41 ? 192 GLU B O   1 
ATOM   3425 C CB  . GLU B 1 192 ? 11.474  17.475  11.323  1.00 36.04 ? 192 GLU B CB  1 
ATOM   3426 C CG  . GLU B 1 192 ? 12.739  17.792  12.155  1.00 39.77 ? 192 GLU B CG  1 
ATOM   3427 C CD  . GLU B 1 192 ? 12.571  19.077  12.981  1.00 45.35 ? 192 GLU B CD  1 
ATOM   3428 O OE1 . GLU B 1 192 ? 11.679  19.074  13.871  1.00 47.27 ? 192 GLU B OE1 1 
ATOM   3429 O OE2 . GLU B 1 192 ? 13.304  20.085  12.732  1.00 44.26 ? 192 GLU B OE2 1 
ATOM   3430 N N   . ASN B 1 193 ? 10.754  14.835  9.919   1.00 34.98 ? 193 ASN B N   1 
ATOM   3431 C CA  . ASN B 1 193 ? 10.773  13.371  9.970   1.00 35.57 ? 193 ASN B CA  1 
ATOM   3432 C C   . ASN B 1 193 ? 11.236  12.672  8.681   1.00 34.84 ? 193 ASN B C   1 
ATOM   3433 O O   . ASN B 1 193 ? 11.864  11.636  8.740   1.00 35.20 ? 193 ASN B O   1 
ATOM   3434 C CB  . ASN B 1 193 ? 9.459   12.822  10.517  1.00 36.23 ? 193 ASN B CB  1 
ATOM   3435 C CG  . ASN B 1 193 ? 8.821   11.806  9.601   1.00 38.79 ? 193 ASN B CG  1 
ATOM   3436 O OD1 . ASN B 1 193 ? 8.936   10.587  9.824   1.00 41.12 ? 193 ASN B OD1 1 
ATOM   3437 N ND2 . ASN B 1 193 ? 8.106   12.302  8.561   1.00 42.06 ? 193 ASN B ND2 1 
ATOM   3438 N N   . GLN B 1 194 ? 10.961  13.247  7.521   1.00 34.22 ? 194 GLN B N   1 
ATOM   3439 C CA  . GLN B 1 194 ? 11.455  12.653  6.290   1.00 33.69 ? 194 GLN B CA  1 
ATOM   3440 C C   . GLN B 1 194 ? 13.001  12.752  6.189   1.00 33.45 ? 194 GLN B C   1 
ATOM   3441 O O   . GLN B 1 194 ? 13.661  11.785  5.801   1.00 32.63 ? 194 GLN B O   1 
ATOM   3442 C CB  . GLN B 1 194 ? 10.710  13.229  5.069   1.00 33.65 ? 194 GLN B CB  1 
ATOM   3443 C CG  . GLN B 1 194 ? 11.494  13.372  3.787   1.00 32.03 ? 194 GLN B CG  1 
ATOM   3444 C CD  . GLN B 1 194 ? 10.631  14.003  2.707   1.00 33.49 ? 194 GLN B CD  1 
ATOM   3445 O OE1 . GLN B 1 194 ? 9.879   13.313  2.004   1.00 32.65 ? 194 GLN B OE1 1 
ATOM   3446 N NE2 . GLN B 1 194 ? 10.715  15.333  2.583   1.00 34.25 ? 194 GLN B NE2 1 
ATOM   3447 N N   . ARG B 1 195 ? 13.563  13.904  6.569   1.00 32.95 ? 195 ARG B N   1 
ATOM   3448 C CA  . ARG B 1 195 ? 15.011  14.096  6.554   1.00 32.46 ? 195 ARG B CA  1 
ATOM   3449 C C   . ARG B 1 195 ? 15.717  13.027  7.390   1.00 32.17 ? 195 ARG B C   1 
ATOM   3450 O O   . ARG B 1 195 ? 16.747  12.499  6.966   1.00 32.26 ? 195 ARG B O   1 
ATOM   3451 C CB  . ARG B 1 195 ? 15.378  15.502  7.031   1.00 32.38 ? 195 ARG B CB  1 
ATOM   3452 C CG  . ARG B 1 195 ? 15.389  16.547  5.928   1.00 33.80 ? 195 ARG B CG  1 
ATOM   3453 C CD  . ARG B 1 195 ? 15.602  17.999  6.458   1.00 38.16 ? 195 ARG B CD  1 
ATOM   3454 N NE  . ARG B 1 195 ? 14.362  18.789  6.454   1.00 41.55 ? 195 ARG B NE  1 
ATOM   3455 C CZ  . ARG B 1 195 ? 13.802  19.363  7.519   1.00 42.62 ? 195 ARG B CZ  1 
ATOM   3456 N NH1 . ARG B 1 195 ? 14.356  19.270  8.713   1.00 42.98 ? 195 ARG B NH1 1 
ATOM   3457 N NH2 . ARG B 1 195 ? 12.675  20.047  7.387   1.00 45.50 ? 195 ARG B NH2 1 
ATOM   3458 N N   . LYS B 1 196 ? 15.157  12.690  8.555   1.00 31.68 ? 196 LYS B N   1 
ATOM   3459 C CA  . LYS B 1 196 ? 15.778  11.696  9.440   1.00 31.40 ? 196 LYS B CA  1 
ATOM   3460 C C   . LYS B 1 196 ? 15.689  10.275  8.899   1.00 31.06 ? 196 LYS B C   1 
ATOM   3461 O O   . LYS B 1 196 ? 16.616  9.481   9.048   1.00 31.15 ? 196 LYS B O   1 
ATOM   3462 C CB  . LYS B 1 196 ? 15.211  11.777  10.857  1.00 31.45 ? 196 LYS B CB  1 
ATOM   3463 C CG  . LYS B 1 196 ? 15.908  12.860  11.734  1.00 32.18 ? 196 LYS B CG  1 
ATOM   3464 N N   . LEU B 1 197 ? 14.560  9.956   8.285   1.00 30.36 ? 197 LEU B N   1 
ATOM   3465 C CA  . LEU B 1 197 ? 14.397  8.713   7.576   1.00 29.66 ? 197 LEU B CA  1 
ATOM   3466 C C   . LEU B 1 197 ? 15.474  8.566   6.525   1.00 29.68 ? 197 LEU B C   1 
ATOM   3467 O O   . LEU B 1 197 ? 16.087  7.515   6.394   1.00 30.33 ? 197 LEU B O   1 
ATOM   3468 C CB  . LEU B 1 197 ? 13.030  8.688   6.928   1.00 29.47 ? 197 LEU B CB  1 
ATOM   3469 C CG  . LEU B 1 197 ? 11.920  8.365   7.904   1.00 29.14 ? 197 LEU B CG  1 
ATOM   3470 C CD1 . LEU B 1 197 ? 10.638  8.284   7.149   1.00 30.78 ? 197 LEU B CD1 1 
ATOM   3471 C CD2 . LEU B 1 197 ? 12.205  7.019   8.543   1.00 28.98 ? 197 LEU B CD2 1 
ATOM   3472 N N   . ILE B 1 198 ? 15.730  9.642   5.806   1.00 29.90 ? 198 ILE B N   1 
ATOM   3473 C CA  . ILE B 1 198 ? 16.723  9.658   4.737   1.00 30.14 ? 198 ILE B CA  1 
ATOM   3474 C C   . ILE B 1 198 ? 18.104  9.349   5.295   1.00 30.75 ? 198 ILE B C   1 
ATOM   3475 O O   . ILE B 1 198 ? 18.739  8.397   4.862   1.00 31.36 ? 198 ILE B O   1 
ATOM   3476 C CB  . ILE B 1 198 ? 16.647  11.000  3.943   1.00 30.23 ? 198 ILE B CB  1 
ATOM   3477 C CG1 . ILE B 1 198 ? 15.417  10.953  3.030   1.00 28.99 ? 198 ILE B CG1 1 
ATOM   3478 C CG2 . ILE B 1 198 ? 17.943  11.310  3.171   1.00 28.40 ? 198 ILE B CG2 1 
ATOM   3479 C CD1 . ILE B 1 198 ? 14.964  12.305  2.571   1.00 29.97 ? 198 ILE B CD1 1 
ATOM   3480 N N   . SER B 1 199 ? 18.520  10.109  6.304   1.00 31.27 ? 199 SER B N   1 
ATOM   3481 C CA  . SER B 1 199 ? 19.777  9.881   7.034   1.00 31.56 ? 199 SER B CA  1 
ATOM   3482 C C   . SER B 1 199 ? 19.982  8.437   7.475   1.00 32.25 ? 199 SER B C   1 
ATOM   3483 O O   . SER B 1 199 ? 21.125  7.978   7.564   1.00 32.62 ? 199 SER B O   1 
ATOM   3484 C CB  . SER B 1 199 ? 19.860  10.788  8.270   1.00 31.46 ? 199 SER B CB  1 
ATOM   3485 O OG  . SER B 1 199 ? 19.032  10.276  9.318   1.00 30.54 ? 199 SER B OG  1 
ATOM   3486 N N   . MET B 1 200 ? 18.879  7.740   7.751   1.00 32.64 ? 200 MET B N   1 
ATOM   3487 C CA  . MET B 1 200 ? 18.903  6.344   8.189   1.00 33.08 ? 200 MET B CA  1 
ATOM   3488 C C   . MET B 1 200 ? 18.992  5.307   7.066   1.00 33.65 ? 200 MET B C   1 
ATOM   3489 O O   . MET B 1 200 ? 19.124  4.111   7.320   1.00 33.85 ? 200 MET B O   1 
ATOM   3490 C CB  . MET B 1 200 ? 17.678  6.067   9.045   1.00 32.79 ? 200 MET B CB  1 
ATOM   3491 C CG  . MET B 1 200 ? 17.730  6.772   10.396  1.00 33.79 ? 200 MET B CG  1 
ATOM   3492 S SD  . MET B 1 200 ? 16.320  6.363   11.392  1.00 35.44 ? 200 MET B SD  1 
ATOM   3493 C CE  . MET B 1 200 ? 17.091  4.937   12.173  1.00 38.50 ? 200 MET B CE  1 
ATOM   3494 N N   . ILE B 1 201 ? 18.921  5.749   5.817   1.00 34.20 ? 201 ILE B N   1 
ATOM   3495 C CA  . ILE B 1 201 ? 18.912  4.804   4.705   1.00 33.81 ? 201 ILE B CA  1 
ATOM   3496 C C   . ILE B 1 201 ? 20.329  4.560   4.199   1.00 34.10 ? 201 ILE B C   1 
ATOM   3497 O O   . ILE B 1 201 ? 21.088  5.505   4.013   1.00 33.73 ? 201 ILE B O   1 
ATOM   3498 C CB  . ILE B 1 201 ? 17.951  5.269   3.563   1.00 33.48 ? 201 ILE B CB  1 
ATOM   3499 C CG1 . ILE B 1 201 ? 16.532  5.419   4.102   1.00 31.51 ? 201 ILE B CG1 1 
ATOM   3500 C CG2 . ILE B 1 201 ? 17.946  4.255   2.398   1.00 33.17 ? 201 ILE B CG2 1 
ATOM   3501 C CD1 . ILE B 1 201 ? 15.618  6.181   3.194   1.00 28.96 ? 201 ILE B CD1 1 
ATOM   3502 N N   . PRO B 1 202 ? 20.688  3.287   3.970   1.00 34.85 ? 202 PRO B N   1 
ATOM   3503 C CA  . PRO B 1 202 ? 22.029  2.989   3.487   1.00 35.62 ? 202 PRO B CA  1 
ATOM   3504 C C   . PRO B 1 202 ? 22.310  3.680   2.146   1.00 36.55 ? 202 PRO B C   1 
ATOM   3505 O O   . PRO B 1 202 ? 21.390  3.982   1.364   1.00 36.89 ? 202 PRO B O   1 
ATOM   3506 C CB  . PRO B 1 202 ? 22.012  1.461   3.300   1.00 35.47 ? 202 PRO B CB  1 
ATOM   3507 C CG  . PRO B 1 202 ? 20.898  0.986   4.098   1.00 35.15 ? 202 PRO B CG  1 
ATOM   3508 C CD  . PRO B 1 202 ? 19.869  2.070   4.064   1.00 34.92 ? 202 PRO B CD  1 
ATOM   3509 N N   . SER B 1 203 ? 23.581  3.931   1.891   1.00 37.07 ? 203 SER B N   1 
ATOM   3510 C CA  . SER B 1 203 ? 23.975  4.619   0.687   1.00 37.78 ? 203 SER B CA  1 
ATOM   3511 C C   . SER B 1 203 ? 23.721  3.829   -0.620  1.00 37.53 ? 203 SER B C   1 
ATOM   3512 O O   . SER B 1 203 ? 23.408  4.423   -1.649  1.00 37.70 ? 203 SER B O   1 
ATOM   3513 C CB  . SER B 1 203 ? 25.425  5.081   0.837   1.00 38.19 ? 203 SER B CB  1 
ATOM   3514 O OG  . SER B 1 203 ? 25.500  5.926   1.987   1.00 39.22 ? 203 SER B OG  1 
ATOM   3515 N N   . ASN B 1 204 ? 23.836  2.504   -0.586  1.00 36.79 ? 204 ASN B N   1 
ATOM   3516 C CA  . ASN B 1 204 ? 23.537  1.712   -1.783  1.00 36.43 ? 204 ASN B CA  1 
ATOM   3517 C C   . ASN B 1 204 ? 22.030  1.740   -2.239  1.00 35.71 ? 204 ASN B C   1 
ATOM   3518 O O   . ASN B 1 204 ? 21.715  1.360   -3.360  1.00 35.22 ? 204 ASN B O   1 
ATOM   3519 C CB  . ASN B 1 204 ? 24.094  0.274   -1.654  1.00 36.63 ? 204 ASN B CB  1 
ATOM   3520 C CG  . ASN B 1 204 ? 23.451  -0.521  -0.516  1.00 38.22 ? 204 ASN B CG  1 
ATOM   3521 O OD1 . ASN B 1 204 ? 22.844  0.038   0.386   1.00 39.91 ? 204 ASN B OD1 1 
ATOM   3522 N ND2 . ASN B 1 204 ? 23.599  -1.843  -0.556  1.00 40.50 ? 204 ASN B ND2 1 
ATOM   3523 N N   . VAL B 1 205 ? 21.107  2.179   -1.373  1.00 34.66 ? 205 VAL B N   1 
ATOM   3524 C CA  . VAL B 1 205 ? 19.693  2.272   -1.766  1.00 32.97 ? 205 VAL B CA  1 
ATOM   3525 C C   . VAL B 1 205 ? 19.357  3.587   -2.489  1.00 32.65 ? 205 VAL B C   1 
ATOM   3526 O O   . VAL B 1 205 ? 19.706  4.684   -2.017  1.00 32.97 ? 205 VAL B O   1 
ATOM   3527 C CB  . VAL B 1 205 ? 18.702  2.038   -0.591  1.00 32.84 ? 205 VAL B CB  1 
ATOM   3528 C CG1 . VAL B 1 205 ? 17.265  2.272   -1.054  1.00 31.34 ? 205 VAL B CG1 1 
ATOM   3529 C CG2 . VAL B 1 205 ? 18.826  0.616   -0.021  1.00 31.21 ? 205 VAL B CG2 1 
ATOM   3530 N N   . VAL B 1 206 ? 18.678  3.473   -3.637  1.00 31.37 ? 206 VAL B N   1 
ATOM   3531 C CA  . VAL B 1 206 ? 18.173  4.663   -4.317  1.00 30.17 ? 206 VAL B CA  1 
ATOM   3532 C C   . VAL B 1 206 ? 16.977  5.231   -3.540  1.00 29.17 ? 206 VAL B C   1 
ATOM   3533 O O   . VAL B 1 206 ? 15.978  4.539   -3.308  1.00 28.84 ? 206 VAL B O   1 
ATOM   3534 C CB  . VAL B 1 206 ? 17.860  4.409   -5.810  1.00 30.48 ? 206 VAL B CB  1 
ATOM   3535 C CG1 . VAL B 1 206 ? 17.018  5.546   -6.414  1.00 28.77 ? 206 VAL B CG1 1 
ATOM   3536 C CG2 . VAL B 1 206 ? 19.173  4.279   -6.590  1.00 31.05 ? 206 VAL B CG2 1 
ATOM   3537 N N   . LYS B 1 207 ? 17.124  6.479   -3.116  1.00 27.57 ? 207 LYS B N   1 
ATOM   3538 C CA  . LYS B 1 207 ? 16.094  7.170   -2.368  1.00 26.53 ? 207 LYS B CA  1 
ATOM   3539 C C   . LYS B 1 207 ? 15.499  8.344   -3.128  1.00 25.86 ? 207 LYS B C   1 
ATOM   3540 O O   . LYS B 1 207 ? 16.210  9.169   -3.694  1.00 24.62 ? 207 LYS B O   1 
ATOM   3541 C CB  . LYS B 1 207 ? 16.596  7.598   -0.970  1.00 26.76 ? 207 LYS B CB  1 
ATOM   3542 C CG  . LYS B 1 207 ? 18.043  8.014   -0.878  1.00 26.16 ? 207 LYS B CG  1 
ATOM   3543 C CD  . LYS B 1 207 ? 18.591  7.824   0.533   1.00 24.84 ? 207 LYS B CD  1 
ATOM   3544 C CE  . LYS B 1 207 ? 20.052  7.287   0.589   1.00 26.28 ? 207 LYS B CE  1 
ATOM   3545 N NZ  . LYS B 1 207 ? 20.794  7.218   -0.710  1.00 22.73 ? 207 LYS B NZ  1 
ATOM   3546 N N   . VAL B 1 208 ? 14.169  8.370   -3.131  1.00 25.59 ? 208 VAL B N   1 
ATOM   3547 C CA  . VAL B 1 208 ? 13.378  9.416   -3.759  1.00 25.73 ? 208 VAL B CA  1 
ATOM   3548 C C   . VAL B 1 208 ? 12.521  10.130  -2.730  1.00 25.50 ? 208 VAL B C   1 
ATOM   3549 O O   . VAL B 1 208 ? 11.660  9.497   -2.110  1.00 26.01 ? 208 VAL B O   1 
ATOM   3550 C CB  . VAL B 1 208 ? 12.434  8.840   -4.828  1.00 25.82 ? 208 VAL B CB  1 
ATOM   3551 C CG1 . VAL B 1 208 ? 11.555  9.937   -5.407  1.00 25.69 ? 208 VAL B CG1 1 
ATOM   3552 C CG2 . VAL B 1 208 ? 13.228  8.127   -5.922  1.00 25.04 ? 208 VAL B CG2 1 
ATOM   3553 N N   . ALA B 1 209 ? 12.759  11.433  -2.553  1.00 24.63 ? 209 ALA B N   1 
ATOM   3554 C CA  . ALA B 1 209 ? 11.939  12.253  -1.694  1.00 24.24 ? 209 ALA B CA  1 
ATOM   3555 C C   . ALA B 1 209 ? 10.638  12.518  -2.414  1.00 24.76 ? 209 ALA B C   1 
ATOM   3556 O O   . ALA B 1 209 ? 10.661  12.897  -3.596  1.00 24.54 ? 209 ALA B O   1 
ATOM   3557 C CB  . ALA B 1 209 ? 12.625  13.548  -1.382  1.00 23.56 ? 209 ALA B CB  1 
ATOM   3558 N N   . ALA B 1 210 ? 9.517   12.323  -1.713  1.00 24.61 ? 210 ALA B N   1 
ATOM   3559 C CA  . ALA B 1 210 ? 8.220   12.675  -2.253  1.00 25.51 ? 210 ALA B CA  1 
ATOM   3560 C C   . ALA B 1 210 ? 7.364   13.574  -1.341  1.00 26.89 ? 210 ALA B C   1 
ATOM   3561 O O   . ALA B 1 210 ? 7.588   13.689  -0.130  1.00 26.24 ? 210 ALA B O   1 
ATOM   3562 C CB  . ALA B 1 210 ? 7.454   11.438  -2.616  1.00 25.10 ? 210 ALA B CB  1 
ATOM   3563 N N   . SER B 1 211 ? 6.353   14.184  -1.957  1.00 28.85 ? 211 SER B N   1 
ATOM   3564 C CA  . SER B 1 211 ? 5.338   14.985  -1.256  1.00 30.11 ? 211 SER B CA  1 
ATOM   3565 C C   . SER B 1 211 ? 5.859   16.355  -0.805  1.00 30.13 ? 211 SER B C   1 
ATOM   3566 O O   . SER B 1 211 ? 6.845   16.462  -0.090  1.00 30.64 ? 211 SER B O   1 
ATOM   3567 C CB  . SER B 1 211 ? 4.723   14.206  -0.067  1.00 30.48 ? 211 SER B CB  1 
ATOM   3568 O OG  . SER B 1 211 ? 4.294   12.883  -0.429  1.00 30.64 ? 211 SER B OG  1 
ATOM   3569 N N   . GLY B 1 212 ? 5.186   17.407  -1.246  1.00 30.59 ? 212 GLY B N   1 
ATOM   3570 C CA  . GLY B 1 212 ? 5.433   18.739  -0.700  1.00 30.05 ? 212 GLY B CA  1 
ATOM   3571 C C   . GLY B 1 212 ? 6.709   19.439  -1.107  1.00 30.12 ? 212 GLY B C   1 
ATOM   3572 O O   . GLY B 1 212 ? 7.062   20.447  -0.515  1.00 30.67 ? 212 GLY B O   1 
ATOM   3573 N N   . ILE B 1 213 ? 7.394   18.949  -2.139  1.00 30.64 ? 213 ILE B N   1 
ATOM   3574 C CA  . ILE B 1 213 ? 8.573   19.640  -2.661  1.00 30.74 ? 213 ILE B CA  1 
ATOM   3575 C C   . ILE B 1 213 ? 8.139   20.743  -3.669  1.00 30.69 ? 213 ILE B C   1 
ATOM   3576 O O   . ILE B 1 213 ? 7.390   20.474  -4.575  1.00 29.61 ? 213 ILE B O   1 
ATOM   3577 C CB  . ILE B 1 213 ? 9.536   18.627  -3.329  1.00 30.95 ? 213 ILE B CB  1 
ATOM   3578 C CG1 . ILE B 1 213 ? 9.744   17.410  -2.448  1.00 30.08 ? 213 ILE B CG1 1 
ATOM   3579 C CG2 . ILE B 1 213 ? 10.869  19.285  -3.720  1.00 31.13 ? 213 ILE B CG2 1 
ATOM   3580 C CD1 . ILE B 1 213 ? 10.091  16.177  -3.259  1.00 30.25 ? 213 ILE B CD1 1 
ATOM   3581 N N   . SER B 1 214 ? 8.610   21.979  -3.504  1.00 31.87 ? 214 SER B N   1 
ATOM   3582 C CA  . SER B 1 214 ? 8.179   23.081  -4.374  1.00 33.19 ? 214 SER B CA  1 
ATOM   3583 C C   . SER B 1 214 ? 9.241   24.108  -4.783  1.00 33.99 ? 214 SER B C   1 
ATOM   3584 O O   . SER B 1 214 ? 8.910   25.072  -5.452  1.00 34.44 ? 214 SER B O   1 
ATOM   3585 C CB  . SER B 1 214 ? 6.977   23.808  -3.776  1.00 33.03 ? 214 SER B CB  1 
ATOM   3586 O OG  . SER B 1 214 ? 7.402   24.586  -2.668  1.00 37.39 ? 214 SER B OG  1 
ATOM   3587 N N   . GLU B 1 215 ? 10.503  23.944  -4.397  1.00 34.95 ? 215 GLU B N   1 
ATOM   3588 C CA  . GLU B 1 215 ? 11.526  24.891  -4.881  1.00 35.93 ? 215 GLU B CA  1 
ATOM   3589 C C   . GLU B 1 215 ? 12.914  24.281  -5.066  1.00 36.50 ? 215 GLU B C   1 
ATOM   3590 O O   . GLU B 1 215 ? 13.212  23.224  -4.526  1.00 36.45 ? 215 GLU B O   1 
ATOM   3591 C CB  . GLU B 1 215 ? 11.575  26.211  -4.075  1.00 35.84 ? 215 GLU B CB  1 
ATOM   3592 C CG  . GLU B 1 215 ? 10.725  26.272  -2.825  1.00 36.19 ? 215 GLU B CG  1 
ATOM   3593 C CD  . GLU B 1 215 ? 10.972  27.532  -2.005  1.00 38.32 ? 215 GLU B CD  1 
ATOM   3594 O OE1 . GLU B 1 215 ? 12.145  27.761  -1.619  1.00 39.11 ? 215 GLU B OE1 1 
ATOM   3595 O OE2 . GLU B 1 215 ? 9.996   28.275  -1.723  1.00 35.17 ? 215 GLU B OE2 1 
ATOM   3596 N N   . ARG B 1 216 ? 13.731  24.943  -5.880  1.00 37.58 ? 216 ARG B N   1 
ATOM   3597 C CA  . ARG B 1 216 ? 15.056  24.457  -6.198  1.00 38.78 ? 216 ARG B CA  1 
ATOM   3598 C C   . ARG B 1 216 ? 15.889  24.334  -4.922  1.00 39.36 ? 216 ARG B C   1 
ATOM   3599 O O   . ARG B 1 216 ? 16.525  23.305  -4.692  1.00 39.42 ? 216 ARG B O   1 
ATOM   3600 C CB  . ARG B 1 216 ? 15.728  25.348  -7.256  1.00 38.74 ? 216 ARG B CB  1 
ATOM   3601 C CG  . ARG B 1 216 ? 17.177  24.964  -7.605  1.00 39.47 ? 216 ARG B CG  1 
ATOM   3602 C CD  . ARG B 1 216 ? 17.246  23.633  -8.361  1.00 39.23 ? 216 ARG B CD  1 
ATOM   3603 N N   . ASN B 1 217 ? 15.847  25.358  -4.072  1.00 40.41 ? 217 ASN B N   1 
ATOM   3604 C CA  . ASN B 1 217 ? 16.694  25.352  -2.868  1.00 41.05 ? 217 ASN B CA  1 
ATOM   3605 C C   . ASN B 1 217 ? 16.459  24.102  -2.031  1.00 40.49 ? 217 ASN B C   1 
ATOM   3606 O O   . ASN B 1 217 ? 17.414  23.516  -1.530  1.00 40.79 ? 217 ASN B O   1 
ATOM   3607 C CB  . ASN B 1 217 ? 16.583  26.635  -2.011  1.00 41.14 ? 217 ASN B CB  1 
ATOM   3608 C CG  . ASN B 1 217 ? 17.545  26.607  -0.799  1.00 44.40 ? 217 ASN B CG  1 
ATOM   3609 O OD1 . ASN B 1 217 ? 18.772  26.569  -0.971  1.00 47.42 ? 217 ASN B OD1 1 
ATOM   3610 N ND2 . ASN B 1 217 ? 16.990  26.598  0.428   1.00 45.05 ? 217 ASN B ND2 1 
ATOM   3611 N N   . GLU B 1 218 ? 15.195  23.695  -1.901  1.00 39.77 ? 218 GLU B N   1 
ATOM   3612 C CA  . GLU B 1 218 ? 14.841  22.492  -1.167  1.00 39.32 ? 218 GLU B CA  1 
ATOM   3613 C C   . GLU B 1 218 ? 15.511  21.274  -1.776  1.00 38.22 ? 218 GLU B C   1 
ATOM   3614 O O   . GLU B 1 218 ? 16.194  20.515  -1.090  1.00 38.26 ? 218 GLU B O   1 
ATOM   3615 C CB  . GLU B 1 218 ? 13.347  22.277  -1.207  1.00 39.74 ? 218 GLU B CB  1 
ATOM   3616 C CG  . GLU B 1 218 ? 12.648  22.261  0.111   1.00 42.84 ? 218 GLU B CG  1 
ATOM   3617 C CD  . GLU B 1 218 ? 11.195  21.776  -0.038  1.00 46.37 ? 218 GLU B CD  1 
ATOM   3618 O OE1 . GLU B 1 218 ? 10.728  20.968  0.822   1.00 47.10 ? 218 GLU B OE1 1 
ATOM   3619 O OE2 . GLU B 1 218 ? 10.541  22.195  -1.029  1.00 43.66 ? 218 GLU B OE2 1 
ATOM   3620 N N   . ILE B 1 219 ? 15.300  21.092  -3.069  1.00 36.89 ? 219 ILE B N   1 
ATOM   3621 C CA  . ILE B 1 219 ? 15.892  19.994  -3.816  1.00 35.64 ? 219 ILE B CA  1 
ATOM   3622 C C   . ILE B 1 219 ? 17.399  19.978  -3.597  1.00 35.36 ? 219 ILE B C   1 
ATOM   3623 O O   . ILE B 1 219 ? 17.976  18.906  -3.448  1.00 34.24 ? 219 ILE B O   1 
ATOM   3624 C CB  . ILE B 1 219 ? 15.587  20.133  -5.326  1.00 35.78 ? 219 ILE B CB  1 
ATOM   3625 C CG1 . ILE B 1 219 ? 14.080  19.991  -5.596  1.00 35.23 ? 219 ILE B CG1 1 
ATOM   3626 C CG2 . ILE B 1 219 ? 16.407  19.163  -6.148  1.00 35.00 ? 219 ILE B CG2 1 
ATOM   3627 C CD1 . ILE B 1 219 ? 13.704  20.033  -7.073  1.00 32.89 ? 219 ILE B CD1 1 
ATOM   3628 N N   . GLU B 1 220 ? 18.022  21.164  -3.572  1.00 35.38 ? 220 GLU B N   1 
ATOM   3629 C CA  . GLU B 1 220 ? 19.452  21.265  -3.330  1.00 36.10 ? 220 GLU B CA  1 
ATOM   3630 C C   . GLU B 1 220 ? 19.811  20.859  -1.905  1.00 36.39 ? 220 GLU B C   1 
ATOM   3631 O O   . GLU B 1 220 ? 20.677  20.014  -1.722  1.00 36.79 ? 220 GLU B O   1 
ATOM   3632 C CB  . GLU B 1 220 ? 20.024  22.631  -3.718  1.00 36.42 ? 220 GLU B CB  1 
ATOM   3633 C CG  . GLU B 1 220 ? 20.584  22.673  -5.163  1.00 37.57 ? 220 GLU B CG  1 
ATOM   3634 N N   . GLU B 1 221 ? 19.125  21.406  -0.904  1.00 36.56 ? 221 GLU B N   1 
ATOM   3635 C CA  . GLU B 1 221 ? 19.284  20.906  0.462   1.00 36.98 ? 221 GLU B CA  1 
ATOM   3636 C C   . GLU B 1 221 ? 19.187  19.362  0.484   1.00 36.64 ? 221 GLU B C   1 
ATOM   3637 O O   . GLU B 1 221 ? 20.097  18.698  0.976   1.00 37.52 ? 221 GLU B O   1 
ATOM   3638 C CB  . GLU B 1 221 ? 18.313  21.579  1.459   1.00 37.23 ? 221 GLU B CB  1 
ATOM   3639 C CG  . GLU B 1 221 ? 18.345  23.152  1.439   1.00 38.89 ? 221 GLU B CG  1 
ATOM   3640 C CD  . GLU B 1 221 ? 17.915  23.851  2.755   1.00 41.08 ? 221 GLU B CD  1 
ATOM   3641 O OE1 . GLU B 1 221 ? 16.993  23.369  3.464   1.00 41.08 ? 221 GLU B OE1 1 
ATOM   3642 O OE2 . GLU B 1 221 ? 18.505  24.916  3.073   1.00 41.06 ? 221 GLU B OE2 1 
ATOM   3643 N N   . LEU B 1 222 ? 18.136  18.797  -0.112  1.00 35.71 ? 222 LEU B N   1 
ATOM   3644 C CA  . LEU B 1 222 ? 17.887  17.358  -0.054  1.00 34.53 ? 222 LEU B CA  1 
ATOM   3645 C C   . LEU B 1 222 ? 18.923  16.535  -0.806  1.00 34.64 ? 222 LEU B C   1 
ATOM   3646 O O   . LEU B 1 222 ? 19.254  15.420  -0.401  1.00 34.15 ? 222 LEU B O   1 
ATOM   3647 C CB  . LEU B 1 222 ? 16.486  17.028  -0.559  1.00 34.39 ? 222 LEU B CB  1 
ATOM   3648 C CG  . LEU B 1 222 ? 15.277  17.379  0.342   1.00 34.79 ? 222 LEU B CG  1 
ATOM   3649 C CD1 . LEU B 1 222 ? 14.001  17.364  -0.512  1.00 32.12 ? 222 LEU B CD1 1 
ATOM   3650 C CD2 . LEU B 1 222 ? 15.133  16.460  1.627   1.00 30.03 ? 222 LEU B CD2 1 
ATOM   3651 N N   . ARG B 1 223 ? 19.436  17.089  -1.903  1.00 34.72 ? 223 ARG B N   1 
ATOM   3652 C CA  . ARG B 1 223 ? 20.465  16.426  -2.694  1.00 34.08 ? 223 ARG B CA  1 
ATOM   3653 C C   . ARG B 1 223 ? 21.690  16.266  -1.807  1.00 33.46 ? 223 ARG B C   1 
ATOM   3654 O O   . ARG B 1 223 ? 22.235  15.175  -1.732  1.00 33.35 ? 223 ARG B O   1 
ATOM   3655 C CB  . ARG B 1 223 ? 20.724  17.164  -4.035  1.00 34.21 ? 223 ARG B CB  1 
ATOM   3656 C CG  . ARG B 1 223 ? 21.760  16.519  -5.015  1.00 36.49 ? 223 ARG B CG  1 
ATOM   3657 C CD  . ARG B 1 223 ? 21.199  15.513  -6.062  1.00 37.10 ? 223 ARG B CD  1 
ATOM   3658 N NE  . ARG B 1 223 ? 22.298  14.732  -6.650  1.00 38.23 ? 223 ARG B NE  1 
ATOM   3659 C CZ  . ARG B 1 223 ? 22.775  13.583  -6.156  1.00 39.86 ? 223 ARG B CZ  1 
ATOM   3660 N NH1 . ARG B 1 223 ? 22.239  13.037  -5.067  1.00 40.68 ? 223 ARG B NH1 1 
ATOM   3661 N NH2 . ARG B 1 223 ? 23.794  12.963  -6.749  1.00 39.37 ? 223 ARG B NH2 1 
ATOM   3662 N N   . LYS B 1 224 ? 22.067  17.309  -1.065  1.00 33.19 ? 224 LYS B N   1 
ATOM   3663 C CA  . LYS B 1 224 ? 23.212  17.214  -0.122  1.00 33.24 ? 224 LYS B CA  1 
ATOM   3664 C C   . LYS B 1 224 ? 23.073  16.101  0.952   1.00 32.30 ? 224 LYS B C   1 
ATOM   3665 O O   . LYS B 1 224 ? 24.072  15.573  1.455   1.00 31.26 ? 224 LYS B O   1 
ATOM   3666 C CB  . LYS B 1 224 ? 23.540  18.576  0.534   1.00 33.54 ? 224 LYS B CB  1 
ATOM   3667 C CG  . LYS B 1 224 ? 24.144  19.625  -0.415  1.00 33.96 ? 224 LYS B CG  1 
ATOM   3668 N N   . LEU B 1 225 ? 21.834  15.747  1.284   1.00 31.68 ? 225 LEU B N   1 
ATOM   3669 C CA  . LEU B 1 225 ? 21.586  14.642  2.213   1.00 31.16 ? 225 LEU B CA  1 
ATOM   3670 C C   . LEU B 1 225 ? 21.618  13.276  1.531   1.00 30.80 ? 225 LEU B C   1 
ATOM   3671 O O   . LEU B 1 225 ? 21.340  12.249  2.164   1.00 30.72 ? 225 LEU B O   1 
ATOM   3672 C CB  . LEU B 1 225 ? 20.261  14.829  2.946   1.00 30.94 ? 225 LEU B CB  1 
ATOM   3673 C CG  . LEU B 1 225 ? 20.048  16.154  3.674   1.00 32.82 ? 225 LEU B CG  1 
ATOM   3674 C CD1 . LEU B 1 225 ? 18.575  16.237  4.079   1.00 34.94 ? 225 LEU B CD1 1 
ATOM   3675 C CD2 . LEU B 1 225 ? 20.997  16.425  4.888   1.00 32.19 ? 225 LEU B CD2 1 
ATOM   3676 N N   . GLY B 1 226 ? 21.951  13.270  0.244   1.00 29.89 ? 226 GLY B N   1 
ATOM   3677 C CA  . GLY B 1 226 ? 22.062  12.044  -0.506  1.00 29.47 ? 226 GLY B CA  1 
ATOM   3678 C C   . GLY B 1 226 ? 20.740  11.533  -1.037  1.00 30.15 ? 226 GLY B C   1 
ATOM   3679 O O   . GLY B 1 226 ? 20.604  10.332  -1.259  1.00 30.96 ? 226 GLY B O   1 
ATOM   3680 N N   . VAL B 1 227 ? 19.751  12.412  -1.209  1.00 29.59 ? 227 VAL B N   1 
ATOM   3681 C CA  . VAL B 1 227 ? 18.544  12.062  -1.963  1.00 29.35 ? 227 VAL B CA  1 
ATOM   3682 C C   . VAL B 1 227 ? 18.875  11.985  -3.468  1.00 29.03 ? 227 VAL B C   1 
ATOM   3683 O O   . VAL B 1 227 ? 19.485  12.897  -4.023  1.00 29.60 ? 227 VAL B O   1 
ATOM   3684 C CB  . VAL B 1 227 ? 17.342  13.069  -1.695  1.00 29.71 ? 227 VAL B CB  1 
ATOM   3685 C CG1 . VAL B 1 227 ? 16.107  12.679  -2.467  1.00 27.58 ? 227 VAL B CG1 1 
ATOM   3686 C CG2 . VAL B 1 227 ? 17.017  13.146  -0.218  1.00 28.90 ? 227 VAL B CG2 1 
ATOM   3687 N N   . ASN B 1 228 ? 18.460  10.904  -4.114  1.00 28.76 ? 228 ASN B N   1 
ATOM   3688 C CA  . ASN B 1 228 ? 18.779  10.658  -5.523  1.00 28.92 ? 228 ASN B CA  1 
ATOM   3689 C C   . ASN B 1 228 ? 17.893  11.342  -6.549  1.00 29.45 ? 228 ASN B C   1 
ATOM   3690 O O   . ASN B 1 228 ? 18.391  11.713  -7.604  1.00 30.32 ? 228 ASN B O   1 
ATOM   3691 C CB  . ASN B 1 228 ? 18.839  9.169   -5.815  1.00 28.44 ? 228 ASN B CB  1 
ATOM   3692 C CG  . ASN B 1 228 ? 19.832  8.436   -4.916  1.00 28.35 ? 228 ASN B CG  1 
ATOM   3693 O OD1 . ASN B 1 228 ? 19.424  7.730   -3.990  1.00 28.58 ? 228 ASN B OD1 1 
ATOM   3694 N ND2 . ASN B 1 228 ? 21.133  8.628   -5.162  1.00 22.56 ? 228 ASN B ND2 1 
ATOM   3695 N N   . ALA B 1 229 ? 16.602  11.511  -6.238  1.00 30.28 ? 229 ALA B N   1 
ATOM   3696 C CA  . ALA B 1 229 ? 15.588  12.059  -7.160  1.00 30.37 ? 229 ALA B CA  1 
ATOM   3697 C C   . ALA B 1 229 ? 14.329  12.502  -6.401  1.00 31.15 ? 229 ALA B C   1 
ATOM   3698 O O   . ALA B 1 229 ? 14.121  12.122  -5.240  1.00 31.33 ? 229 ALA B O   1 
ATOM   3699 C CB  . ALA B 1 229 ? 15.221  11.032  -8.217  1.00 29.95 ? 229 ALA B CB  1 
ATOM   3700 N N   . PHE B 1 230 ? 13.472  13.277  -7.063  1.00 31.18 ? 230 PHE B N   1 
ATOM   3701 C CA  . PHE B 1 230 ? 12.387  13.978  -6.365  1.00 31.59 ? 230 PHE B CA  1 
ATOM   3702 C C   . PHE B 1 230 ? 11.031  13.765  -7.054  1.00 31.74 ? 230 PHE B C   1 
ATOM   3703 O O   . PHE B 1 230 ? 10.904  14.048  -8.250  1.00 32.38 ? 230 PHE B O   1 
ATOM   3704 C CB  . PHE B 1 230 ? 12.773  15.457  -6.249  1.00 31.37 ? 230 PHE B CB  1 
ATOM   3705 C CG  . PHE B 1 230 ? 14.204  15.646  -5.803  1.00 31.91 ? 230 PHE B CG  1 
ATOM   3706 C CD1 . PHE B 1 230 ? 15.259  15.574  -6.723  1.00 32.93 ? 230 PHE B CD1 1 
ATOM   3707 C CD2 . PHE B 1 230 ? 14.511  15.819  -4.464  1.00 30.29 ? 230 PHE B CD2 1 
ATOM   3708 C CE1 . PHE B 1 230 ? 16.602  15.698  -6.304  1.00 32.73 ? 230 PHE B CE1 1 
ATOM   3709 C CE2 . PHE B 1 230 ? 15.841  15.960  -4.043  1.00 30.77 ? 230 PHE B CE2 1 
ATOM   3710 C CZ  . PHE B 1 230 ? 16.887  15.894  -4.950  1.00 30.92 ? 230 PHE B CZ  1 
ATOM   3711 N N   . GLU B 1 231 ? 10.058  13.198  -6.323  1.00 31.04 ? 231 GLU B N   1 
ATOM   3712 C CA  . GLU B 1 231 ? 8.702   12.963  -6.834  1.00 30.69 ? 231 GLU B CA  1 
ATOM   3713 C C   . GLU B 1 231 ? 7.906   14.236  -6.616  1.00 30.00 ? 231 GLU B C   1 
ATOM   3714 O O   . GLU B 1 231 ? 7.674   14.622  -5.493  1.00 29.43 ? 231 GLU B O   1 
ATOM   3715 C CB  . GLU B 1 231 ? 8.027   11.777  -6.127  1.00 30.95 ? 231 GLU B CB  1 
ATOM   3716 C CG  . GLU B 1 231 ? 6.656   11.363  -6.720  1.00 33.97 ? 231 GLU B CG  1 
ATOM   3717 C CD  . GLU B 1 231 ? 5.737   10.646  -5.716  1.00 39.17 ? 231 GLU B CD  1 
ATOM   3718 O OE1 . GLU B 1 231 ? 6.184   9.679   -5.055  1.00 41.69 ? 231 GLU B OE1 1 
ATOM   3719 O OE2 . GLU B 1 231 ? 4.552   11.045  -5.582  1.00 41.08 ? 231 GLU B OE2 1 
ATOM   3720 N N   . ILE B 1 232 ? 7.539   14.916  -7.696  1.00 29.93 ? 232 ILE B N   1 
ATOM   3721 C CA  . ILE B 1 232 ? 6.805   16.177  -7.582  1.00 29.80 ? 232 ILE B CA  1 
ATOM   3722 C C   . ILE B 1 232 ? 5.492   16.082  -8.348  1.00 30.11 ? 232 ILE B C   1 
ATOM   3723 O O   . ILE B 1 232 ? 5.466   15.689  -9.531  1.00 30.63 ? 232 ILE B O   1 
ATOM   3724 C CB  . ILE B 1 232 ? 7.660   17.406  -8.012  1.00 30.10 ? 232 ILE B CB  1 
ATOM   3725 C CG1 . ILE B 1 232 ? 9.064   17.312  -7.376  1.00 28.60 ? 232 ILE B CG1 1 
ATOM   3726 C CG2 . ILE B 1 232 ? 6.943   18.705  -7.662  1.00 28.43 ? 232 ILE B CG2 1 
ATOM   3727 C CD1 . ILE B 1 232 ? 9.838   18.596  -7.267  1.00 26.07 ? 232 ILE B CD1 1 
ATOM   3728 N N   . GLY B 1 233 ? 4.402   16.395  -7.656  1.00 29.40 ? 233 GLY B N   1 
ATOM   3729 C CA  . GLY B 1 233 ? 3.095   16.066  -8.157  1.00 29.37 ? 233 GLY B CA  1 
ATOM   3730 C C   . GLY B 1 233 ? 2.222   17.239  -8.514  1.00 29.63 ? 233 GLY B C   1 
ATOM   3731 O O   . GLY B 1 233 ? 2.351   17.840  -9.588  1.00 29.33 ? 233 GLY B O   1 
ATOM   3732 N N   . SER B 1 234 ? 1.304   17.553  -7.611  1.00 29.99 ? 234 SER B N   1 
ATOM   3733 C CA  . SER B 1 234 ? 0.324   18.607  -7.844  1.00 30.24 ? 234 SER B CA  1 
ATOM   3734 C C   . SER B 1 234 ? 0.838   19.906  -8.489  1.00 30.75 ? 234 SER B C   1 
ATOM   3735 O O   . SER B 1 234 ? 0.225   20.402  -9.421  1.00 31.36 ? 234 SER B O   1 
ATOM   3736 C CB  . SER B 1 234 ? -0.470  18.871  -6.572  1.00 29.49 ? 234 SER B CB  1 
ATOM   3737 O OG  . SER B 1 234 ? -1.577  17.991  -6.527  1.00 29.38 ? 234 SER B OG  1 
ATOM   3738 N N   . SER B 1 235 ? 1.963   20.442  -8.027  1.00 31.76 ? 235 SER B N   1 
ATOM   3739 C CA  . SER B 1 235 ? 2.419   21.713  -8.539  1.00 32.68 ? 235 SER B CA  1 
ATOM   3740 C C   . SER B 1 235 ? 2.904   21.617  -10.004 1.00 33.15 ? 235 SER B C   1 
ATOM   3741 O O   . SER B 1 235 ? 3.084   22.644  -10.673 1.00 34.08 ? 235 SER B O   1 
ATOM   3742 C CB  . SER B 1 235 ? 3.480   22.310  -7.641  1.00 32.69 ? 235 SER B CB  1 
ATOM   3743 O OG  . SER B 1 235 ? 4.705   21.637  -7.827  1.00 36.19 ? 235 SER B OG  1 
ATOM   3744 N N   . LEU B 1 236 ? 3.097   20.399  -10.508 1.00 32.40 ? 236 LEU B N   1 
ATOM   3745 C CA  . LEU B 1 236 ? 3.465   20.220  -11.895 1.00 31.04 ? 236 LEU B CA  1 
ATOM   3746 C C   . LEU B 1 236 ? 2.220   19.982  -12.682 1.00 31.59 ? 236 LEU B C   1 
ATOM   3747 O O   . LEU B 1 236 ? 2.117   20.442  -13.793 1.00 31.66 ? 236 LEU B O   1 
ATOM   3748 C CB  . LEU B 1 236 ? 4.447   19.089  -12.069 1.00 30.05 ? 236 LEU B CB  1 
ATOM   3749 C CG  . LEU B 1 236 ? 5.808   19.509  -11.563 1.00 29.42 ? 236 LEU B CG  1 
ATOM   3750 C CD1 . LEU B 1 236 ? 6.845   18.543  -12.080 1.00 30.64 ? 236 LEU B CD1 1 
ATOM   3751 C CD2 . LEU B 1 236 ? 6.147   20.924  -11.974 1.00 28.37 ? 236 LEU B CD2 1 
ATOM   3752 N N   . MET B 1 237 ? 1.263   19.263  -12.109 1.00 32.24 ? 237 MET B N   1 
ATOM   3753 C CA  . MET B 1 237 ? -0.068  19.248  -12.686 1.00 33.13 ? 237 MET B CA  1 
ATOM   3754 C C   . MET B 1 237 ? -0.558  20.684  -12.882 1.00 33.70 ? 237 MET B C   1 
ATOM   3755 O O   . MET B 1 237 ? -0.999  21.013  -13.975 1.00 34.45 ? 237 MET B O   1 
ATOM   3756 C CB  . MET B 1 237 ? -1.100  18.479  -11.847 1.00 32.70 ? 237 MET B CB  1 
ATOM   3757 C CG  . MET B 1 237 ? -0.965  16.959  -11.801 1.00 33.01 ? 237 MET B CG  1 
ATOM   3758 S SD  . MET B 1 237 ? -0.987  16.075  -13.362 1.00 32.17 ? 237 MET B SD  1 
ATOM   3759 C CE  . MET B 1 237 ? -2.685  16.311  -13.903 1.00 30.64 ? 237 MET B CE  1 
ATOM   3760 N N   . ARG B 1 238 ? -0.514  21.526  -11.848 1.00 34.54 ? 238 ARG B N   1 
ATOM   3761 C CA  . ARG B 1 238 ? -1.069  22.889  -11.990 1.00 35.38 ? 238 ARG B CA  1 
ATOM   3762 C C   . ARG B 1 238 ? -0.267  23.637  -13.039 1.00 35.05 ? 238 ARG B C   1 
ATOM   3763 O O   . ARG B 1 238 ? -0.842  24.297  -13.887 1.00 35.36 ? 238 ARG B O   1 
ATOM   3764 C CB  . ARG B 1 238 ? -1.108  23.749  -10.687 1.00 35.73 ? 238 ARG B CB  1 
ATOM   3765 C CG  . ARG B 1 238 ? -1.699  23.198  -9.362  1.00 36.08 ? 238 ARG B CG  1 
ATOM   3766 C CD  . ARG B 1 238 ? -3.135  22.642  -9.407  1.00 38.67 ? 238 ARG B CD  1 
ATOM   3767 N NE  . ARG B 1 238 ? -4.261  23.549  -9.158  1.00 37.64 ? 238 ARG B NE  1 
ATOM   3768 C CZ  . ARG B 1 238 ? -4.188  24.837  -8.852  1.00 38.00 ? 238 ARG B CZ  1 
ATOM   3769 N NH1 . ARG B 1 238 ? -3.020  25.464  -8.706  1.00 38.59 ? 238 ARG B NH1 1 
ATOM   3770 N NH2 . ARG B 1 238 ? -5.310  25.501  -8.704  1.00 36.38 ? 238 ARG B NH2 1 
ATOM   3771 N N   . ASN B 1 239 ? 1.057   23.511  -12.992 1.00 35.41 ? 239 ASN B N   1 
ATOM   3772 C CA  . ASN B 1 239 ? 1.944   24.303  -13.834 1.00 36.11 ? 239 ASN B CA  1 
ATOM   3773 C C   . ASN B 1 239 ? 3.100   23.445  -14.354 1.00 36.31 ? 239 ASN B C   1 
ATOM   3774 O O   . ASN B 1 239 ? 4.195   23.439  -13.772 1.00 36.47 ? 239 ASN B O   1 
ATOM   3775 C CB  . ASN B 1 239 ? 2.455   25.521  -13.045 1.00 36.61 ? 239 ASN B CB  1 
ATOM   3776 C CG  . ASN B 1 239 ? 3.555   26.309  -13.782 1.00 40.68 ? 239 ASN B CG  1 
ATOM   3777 O OD1 . ASN B 1 239 ? 3.549   26.427  -15.014 1.00 45.38 ? 239 ASN B OD1 1 
ATOM   3778 N ND2 . ASN B 1 239 ? 4.499   26.862  -13.018 1.00 42.63 ? 239 ASN B ND2 1 
ATOM   3779 N N   . PRO B 1 240 ? 2.876   22.722  -15.469 1.00 36.16 ? 240 PRO B N   1 
ATOM   3780 C CA  . PRO B 1 240 ? 3.921   21.803  -15.966 1.00 35.87 ? 240 PRO B CA  1 
ATOM   3781 C C   . PRO B 1 240 ? 5.302   22.442  -16.145 1.00 36.08 ? 240 PRO B C   1 
ATOM   3782 O O   . PRO B 1 240 ? 6.325   21.785  -15.922 1.00 35.59 ? 240 PRO B O   1 
ATOM   3783 C CB  . PRO B 1 240 ? 3.359   21.322  -17.291 1.00 35.56 ? 240 PRO B CB  1 
ATOM   3784 C CG  . PRO B 1 240 ? 1.843   21.410  -17.093 1.00 35.99 ? 240 PRO B CG  1 
ATOM   3785 C CD  . PRO B 1 240 ? 1.597   22.566  -16.183 1.00 35.35 ? 240 PRO B CD  1 
ATOM   3786 N N   . GLU B 1 241 ? 5.354   23.716  -16.490 1.00 36.55 ? 241 GLU B N   1 
ATOM   3787 C CA  . GLU B 1 241 ? 6.656   24.278  -16.788 1.00 38.04 ? 241 GLU B CA  1 
ATOM   3788 C C   . GLU B 1 241 ? 7.504   24.697  -15.578 1.00 37.96 ? 241 GLU B C   1 
ATOM   3789 O O   . GLU B 1 241 ? 8.660   25.080  -15.739 1.00 38.17 ? 241 GLU B O   1 
ATOM   3790 C CB  . GLU B 1 241 ? 6.613   25.354  -17.897 1.00 38.90 ? 241 GLU B CB  1 
ATOM   3791 C CG  . GLU B 1 241 ? 5.386   26.241  -17.987 1.00 42.54 ? 241 GLU B CG  1 
ATOM   3792 C CD  . GLU B 1 241 ? 5.211   26.830  -19.400 1.00 47.23 ? 241 GLU B CD  1 
ATOM   3793 O OE1 . GLU B 1 241 ? 5.491   28.049  -19.548 1.00 48.80 ? 241 GLU B OE1 1 
ATOM   3794 O OE2 . GLU B 1 241 ? 4.799   26.083  -20.345 1.00 47.12 ? 241 GLU B OE2 1 
ATOM   3795 N N   . LYS B 1 242 ? 6.946   24.601  -14.373 1.00 37.74 ? 242 LYS B N   1 
ATOM   3796 C CA  . LYS B 1 242 ? 7.750   24.795  -13.171 1.00 37.52 ? 242 LYS B CA  1 
ATOM   3797 C C   . LYS B 1 242 ? 8.948   23.833  -13.177 1.00 37.36 ? 242 LYS B C   1 
ATOM   3798 O O   . LYS B 1 242 ? 10.004  24.154  -12.637 1.00 37.26 ? 242 LYS B O   1 
ATOM   3799 C CB  . LYS B 1 242 ? 6.912   24.677  -11.877 1.00 37.01 ? 242 LYS B CB  1 
ATOM   3800 N N   . ILE B 1 243 ? 8.804   22.681  -13.827 1.00 37.79 ? 243 ILE B N   1 
ATOM   3801 C CA  . ILE B 1 243 ? 9.890   21.685  -13.866 1.00 38.11 ? 243 ILE B CA  1 
ATOM   3802 C C   . ILE B 1 243 ? 11.205  22.224  -14.477 1.00 38.89 ? 243 ILE B C   1 
ATOM   3803 O O   . ILE B 1 243 ? 12.286  21.858  -14.008 1.00 39.01 ? 243 ILE B O   1 
ATOM   3804 C CB  . ILE B 1 243 ? 9.458   20.335  -14.520 1.00 37.71 ? 243 ILE B CB  1 
ATOM   3805 C CG1 . ILE B 1 243 ? 10.461  19.232  -14.187 1.00 37.29 ? 243 ILE B CG1 1 
ATOM   3806 C CG2 . ILE B 1 243 ? 9.307   20.452  -16.038 1.00 37.18 ? 243 ILE B CG2 1 
ATOM   3807 C CD1 . ILE B 1 243 ? 9.944   17.793  -14.396 1.00 35.16 ? 243 ILE B CD1 1 
ATOM   3808 N N   . LYS B 1 244 ? 11.102  23.093  -15.495 1.00 39.60 ? 244 LYS B N   1 
ATOM   3809 C CA  . LYS B 1 244 ? 12.274  23.697  -16.145 1.00 40.39 ? 244 LYS B CA  1 
ATOM   3810 C C   . LYS B 1 244 ? 13.046  24.571  -15.161 1.00 40.92 ? 244 LYS B C   1 
ATOM   3811 O O   . LYS B 1 244 ? 14.264  24.585  -15.190 1.00 40.90 ? 244 LYS B O   1 
ATOM   3812 C CB  . LYS B 1 244 ? 11.897  24.480  -17.423 1.00 40.48 ? 244 LYS B CB  1 
ATOM   3813 N N   . GLU B 1 245 ? 12.337  25.271  -14.275 1.00 41.87 ? 245 GLU B N   1 
ATOM   3814 C CA  . GLU B 1 245 ? 12.989  25.976  -13.170 1.00 43.05 ? 245 GLU B CA  1 
ATOM   3815 C C   . GLU B 1 245 ? 13.687  25.002  -12.178 1.00 43.69 ? 245 GLU B C   1 
ATOM   3816 O O   . GLU B 1 245 ? 14.844  25.209  -11.766 1.00 44.15 ? 245 GLU B O   1 
ATOM   3817 C CB  . GLU B 1 245 ? 11.985  26.900  -12.453 1.00 42.98 ? 245 GLU B CB  1 
ATOM   3818 N N   . LEU B 1 246 ? 12.987  23.921  -11.845 1.00 44.01 ? 246 LEU B N   1 
ATOM   3819 C CA  . LEU B 1 246 ? 13.417  22.966  -10.832 1.00 44.51 ? 246 LEU B CA  1 
ATOM   3820 C C   . LEU B 1 246 ? 14.635  22.085  -11.187 1.00 45.10 ? 246 LEU B C   1 
ATOM   3821 O O   . LEU B 1 246 ? 15.230  21.483  -10.287 1.00 45.09 ? 246 LEU B O   1 
ATOM   3822 C CB  . LEU B 1 246 ? 12.236  22.073  -10.438 1.00 43.97 ? 246 LEU B CB  1 
ATOM   3823 C CG  . LEU B 1 246 ? 11.008  22.658  -9.732  1.00 43.83 ? 246 LEU B CG  1 
ATOM   3824 C CD1 . LEU B 1 246 ? 9.801   21.690  -9.823  1.00 41.97 ? 246 LEU B CD1 1 
ATOM   3825 C CD2 . LEU B 1 246 ? 11.294  23.048  -8.275  1.00 43.32 ? 246 LEU B CD2 1 
ATOM   3826 N N   . ILE B 1 247 ? 14.999  21.999  -12.471 1.00 45.90 ? 247 ILE B N   1 
ATOM   3827 C CA  . ILE B 1 247 ? 16.163  21.186  -12.905 1.00 46.85 ? 247 ILE B CA  1 
ATOM   3828 C C   . ILE B 1 247 ? 17.506  21.939  -13.006 1.00 47.62 ? 247 ILE B C   1 
ATOM   3829 O O   . ILE B 1 247 ? 18.475  21.384  -13.535 1.00 47.76 ? 247 ILE B O   1 
ATOM   3830 C CB  . ILE B 1 247 ? 15.929  20.474  -14.266 1.00 47.07 ? 247 ILE B CB  1 
ATOM   3831 C CG1 . ILE B 1 247 ? 15.434  21.483  -15.309 1.00 47.21 ? 247 ILE B CG1 1 
ATOM   3832 C CG2 . ILE B 1 247 ? 14.976  19.279  -14.115 1.00 46.51 ? 247 ILE B CG2 1 
ATOM   3833 C CD1 . ILE B 1 247 ? 16.306  21.561  -16.536 1.00 49.63 ? 247 ILE B CD1 1 
ATOM   3834 N N   . LEU B 1 248 ? 17.561  23.180  -12.502 1.00 48.40 ? 248 LEU B N   1 
ATOM   3835 C CA  . LEU B 1 248 ? 18.783  24.005  -12.551 1.00 49.05 ? 248 LEU B CA  1 
ATOM   3836 C C   . LEU B 1 248 ? 19.616  23.940  -11.265 1.00 48.95 ? 248 LEU B C   1 
ATOM   3837 O O   . LEU B 1 248 ? 20.618  24.651  -11.112 1.00 48.50 ? 248 LEU B O   1 
ATOM   3838 C CB  . LEU B 1 248 ? 18.426  25.465  -12.870 1.00 49.58 ? 248 LEU B CB  1 
ATOM   3839 C CG  . LEU B 1 248 ? 17.379  25.717  -13.979 1.00 50.48 ? 248 LEU B CG  1 
ATOM   3840 C CD1 . LEU B 1 248 ? 17.120  27.220  -14.165 1.00 50.55 ? 248 LEU B CD1 1 
ATOM   3841 C CD2 . LEU B 1 248 ? 17.745  25.060  -15.309 1.00 50.35 ? 248 LEU B CD2 1 
HETATM 3842 P P   . PO4 C 2 .   ? 15.402  -12.043 9.664   1.00 38.38 ? 253 PO4 A P   1 
HETATM 3843 O O1  . PO4 C 2 .   ? 14.905  -11.697 8.299   1.00 40.83 ? 253 PO4 A O1  1 
HETATM 3844 O O2  . PO4 C 2 .   ? 16.831  -12.533 9.568   1.00 40.86 ? 253 PO4 A O2  1 
HETATM 3845 O O3  . PO4 C 2 .   ? 14.555  -13.110 10.293  1.00 40.07 ? 253 PO4 A O3  1 
HETATM 3846 O O4  . PO4 C 2 .   ? 15.409  -10.801 10.487  1.00 40.99 ? 253 PO4 A O4  1 
HETATM 3847 P P   . PO4 D 2 .   ? 2.574   16.310  -4.205  1.00 28.02 ? 253 PO4 B P   1 
HETATM 3848 O O1  . PO4 D 2 .   ? 3.741   16.445  -5.138  1.00 27.57 ? 253 PO4 B O1  1 
HETATM 3849 O O2  . PO4 D 2 .   ? 1.269   16.512  -4.898  1.00 32.02 ? 253 PO4 B O2  1 
HETATM 3850 O O3  . PO4 D 2 .   ? 2.461   14.893  -3.705  1.00 33.88 ? 253 PO4 B O3  1 
HETATM 3851 O O4  . PO4 D 2 .   ? 2.740   17.198  -3.020  1.00 30.04 ? 253 PO4 B O4  1 
HETATM 3852 O O   . HOH E 3 .   ? 17.063  -5.594  14.107  1.00 14.18 ? 254 HOH A O   1 
HETATM 3853 O O   . HOH E 3 .   ? 21.318  -17.850 8.904   1.00 26.49 ? 255 HOH A O   1 
HETATM 3854 O O   . HOH E 3 .   ? 26.252  -19.890 1.200   1.00 12.25 ? 256 HOH A O   1 
HETATM 3855 O O   . HOH E 3 .   ? 20.361  -1.911  11.515  1.00 28.23 ? 257 HOH A O   1 
HETATM 3856 O O   . HOH F 3 .   ? 4.579   8.494   -3.341  1.00 25.72 ? 254 HOH B O   1 
HETATM 3857 O O   . HOH F 3 .   ? -3.527  17.887  -8.799  1.00 18.97 ? 255 HOH B O   1 
HETATM 3858 O O   . HOH F 3 .   ? -11.575 20.197  -7.160  1.00 24.06 ? 256 HOH B O   1 
HETATM 3859 O O   . HOH F 3 .   ? -4.109  -11.297 -8.220  1.00 25.07 ? 257 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 TRP 110 110 110 TRP TRP A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 ARG 150 150 150 ARG ARG A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 MET 154 154 154 MET MET A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 MET 237 237 237 MET MET A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ASN 239 239 239 ASN ASN A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 ?   ?   ?   A . n 
A 1 250 SER 250 250 ?   ?   ?   A . n 
A 1 251 LEU 251 251 ?   ?   ?   A . n 
A 1 252 GLU 252 252 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   ARG 3   3   3   ARG ARG B . n 
B 1 4   TYR 4   4   4   TYR TYR B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  VAL 13  13  13  VAL VAL B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  SER 21  21  21  SER SER B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  ARG 23  23  23  ARG ARG B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  GLN 27  27  27  GLN GLN B . n 
B 1 28  ARG 28  28  28  ARG ARG B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  ILE 30  30  30  ILE ILE B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  GLU 35  35  35  GLU GLU B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  ILE 37  37  37  ILE ILE B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PHE 40  40  40  PHE PHE B . n 
B 1 41  ASN 41  41  41  ASN ASN B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  ARG 43  43  43  ARG ARG B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  VAL 51  51  51  VAL VAL B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  SER 56  56  56  SER SER B . n 
B 1 57  PRO 57  57  57  PRO PRO B . n 
B 1 58  SER 58  58  58  SER SER B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  PRO 66  66  66  PRO PRO B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  TYR 69  69  69  TYR TYR B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  PHE 72  72  72  PHE PHE B . n 
B 1 73  MET 73  73  73  MET MET B . n 
B 1 74  GLU 74  74  74  GLU GLU B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  ALA 77  77  77  ALA ALA B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  ILE 82  82  82  ILE ILE B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  GLU 85  85  85  GLU GLU B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  TYR 88  88  88  TYR TYR B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  TYR 93  93  93  TYR TYR B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  ARG 97  97  97  ARG ARG B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 MET 109 109 109 MET MET B . n 
B 1 110 TRP 110 110 110 TRP TRP B . n 
B 1 111 ASP 111 111 111 ASP ASP B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 ASP 120 120 120 ASP ASP B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 TYR 123 123 123 TYR TYR B . n 
B 1 124 ASN 124 124 124 ASN ASN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 THR 129 129 129 THR THR B . n 
B 1 130 VAL 130 130 130 VAL VAL B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 LYS 135 135 135 LYS LYS B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 ARG 140 140 140 ARG ARG B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 GLU 143 143 143 GLU GLU B . n 
B 1 144 SER 144 144 144 SER SER B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 TYR 148 148 148 TYR TYR B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 ARG 150 150 150 ARG ARG B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 GLY 153 153 153 GLY GLY B . n 
B 1 154 MET 154 154 154 MET MET B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 PRO 156 156 156 PRO PRO B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 ILE 158 158 158 ILE ILE B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 ASN 161 161 161 ASN ASN B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 GLU 164 164 164 GLU GLU B . n 
B 1 165 ASP 165 165 165 ASP ASP B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ARG 171 171 171 ARG ARG B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 ALA 174 174 174 ALA ALA B . n 
B 1 175 ARG 175 175 175 ARG ARG B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 GLU 192 192 192 GLU GLU B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 ARG 195 195 195 ARG ARG B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 ILE 201 201 201 ILE ILE B . n 
B 1 202 PRO 202 202 202 PRO PRO B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 ALA 210 210 210 ALA ALA B . n 
B 1 211 SER 211 211 211 SER SER B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 ASN 217 217 217 ASN ASN B . n 
B 1 218 GLU 218 218 218 GLU GLU B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 GLU 220 220 220 GLU GLU B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 ARG 223 223 223 ARG ARG B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 ASN 228 228 228 ASN ASN B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 GLU 231 231 231 GLU GLU B . n 
B 1 232 ILE 232 232 232 ILE ILE B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 SER 234 234 234 SER SER B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 MET 237 237 237 MET MET B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 ASN 239 239 239 ASN ASN B . n 
B 1 240 PRO 240 240 240 PRO PRO B . n 
B 1 241 GLU 241 241 241 GLU GLU B . n 
B 1 242 LYS 242 242 242 LYS LYS B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 LYS 244 244 244 LYS LYS B . n 
B 1 245 GLU 245 245 245 GLU GLU B . n 
B 1 246 LEU 246 246 246 LEU LEU B . n 
B 1 247 ILE 247 247 247 ILE ILE B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 GLY 249 249 ?   ?   ?   B . n 
B 1 250 SER 250 250 ?   ?   ?   B . n 
B 1 251 LEU 251 251 ?   ?   ?   B . n 
B 1 252 GLU 252 252 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Israel Structural Proteomics Center' 
_pdbx_SG_project.initial_of_center     ISPC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-06 
2 'Structure model' 1 1 2012-06-27 
3 'Structure model' 1 2 2012-07-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.5.0102 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              238 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              238 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              238 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.20 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.10 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 135 ? ? -53.65  -6.51  
2 1 SER A 211 ? ? 66.83   134.85 
3 1 SER A 214 ? ? -150.09 7.42   
4 1 SER A 234 ? ? -35.95  -34.44 
5 1 TYR B 76  ? ? -134.88 -38.53 
6 1 ASN B 161 ? ? -152.12 -3.11  
7 1 SER B 211 ? ? 74.75   123.18 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 3   ? CZ  ? A ARG 3   CZ  
2   1 Y 1 A ARG 3   ? NH1 ? A ARG 3   NH1 
3   1 Y 1 A ARG 3   ? NH2 ? A ARG 3   NH2 
4   1 Y 1 A LYS 6   ? NZ  ? A LYS 6   NZ  
5   1 Y 1 A ARG 34  ? CZ  ? A ARG 34  CZ  
6   1 Y 1 A ARG 34  ? NH1 ? A ARG 34  NH1 
7   1 Y 1 A ARG 34  ? NH2 ? A ARG 34  NH2 
8   1 Y 1 A GLU 35  ? CG  ? A GLU 35  CG  
9   1 Y 1 A GLU 35  ? CD  ? A GLU 35  CD  
10  1 Y 1 A GLU 35  ? OE1 ? A GLU 35  OE1 
11  1 Y 1 A GLU 35  ? OE2 ? A GLU 35  OE2 
12  1 Y 1 A GLU 68  ? CG  ? A GLU 68  CG  
13  1 Y 1 A GLU 68  ? CD  ? A GLU 68  CD  
14  1 Y 1 A GLU 68  ? OE1 ? A GLU 68  OE1 
15  1 Y 1 A GLU 68  ? OE2 ? A GLU 68  OE2 
16  1 Y 1 A ARG 75  ? CG  ? A ARG 75  CG  
17  1 Y 1 A ARG 75  ? CD  ? A ARG 75  CD  
18  1 Y 1 A ARG 75  ? NE  ? A ARG 75  NE  
19  1 Y 1 A ARG 75  ? CZ  ? A ARG 75  CZ  
20  1 Y 1 A ARG 75  ? NH1 ? A ARG 75  NH1 
21  1 Y 1 A ARG 75  ? NH2 ? A ARG 75  NH2 
22  1 Y 1 A THR 186 ? OG1 ? A THR 186 OG1 
23  1 Y 1 A THR 186 ? CG2 ? A THR 186 CG2 
24  1 Y 1 A GLU 188 ? CG  ? A GLU 188 CG  
25  1 Y 1 A GLU 188 ? CD  ? A GLU 188 CD  
26  1 Y 1 A GLU 188 ? OE1 ? A GLU 188 OE1 
27  1 Y 1 A GLU 188 ? OE2 ? A GLU 188 OE2 
28  1 Y 1 A ASN 193 ? OD1 ? A ASN 193 OD1 
29  1 Y 1 A ASN 193 ? ND2 ? A ASN 193 ND2 
30  1 Y 1 A LYS 196 ? CD  ? A LYS 196 CD  
31  1 Y 1 A LYS 196 ? CE  ? A LYS 196 CE  
32  1 Y 1 A LYS 196 ? NZ  ? A LYS 196 NZ  
33  1 Y 1 A ARG 216 ? CG  ? A ARG 216 CG  
34  1 Y 1 A ARG 216 ? CD  ? A ARG 216 CD  
35  1 Y 1 A ARG 216 ? NE  ? A ARG 216 NE  
36  1 Y 1 A ARG 216 ? CZ  ? A ARG 216 CZ  
37  1 Y 1 A ARG 216 ? NH1 ? A ARG 216 NH1 
38  1 Y 1 A ARG 216 ? NH2 ? A ARG 216 NH2 
39  1 Y 1 A GLU 220 ? CD  ? A GLU 220 CD  
40  1 Y 1 A GLU 220 ? OE1 ? A GLU 220 OE1 
41  1 Y 1 A GLU 220 ? OE2 ? A GLU 220 OE2 
42  1 Y 1 A LYS 224 ? CD  ? A LYS 224 CD  
43  1 Y 1 A LYS 224 ? CE  ? A LYS 224 CE  
44  1 Y 1 A LYS 224 ? NZ  ? A LYS 224 NZ  
45  1 Y 1 A LYS 242 ? CG  ? A LYS 242 CG  
46  1 Y 1 A LYS 242 ? CD  ? A LYS 242 CD  
47  1 Y 1 A LYS 242 ? CE  ? A LYS 242 CE  
48  1 Y 1 A LYS 242 ? NZ  ? A LYS 242 NZ  
49  1 Y 1 A LYS 244 ? CE  ? A LYS 244 CE  
50  1 Y 1 A LYS 244 ? NZ  ? A LYS 244 NZ  
51  1 Y 1 A GLU 245 ? CG  ? A GLU 245 CG  
52  1 Y 1 A GLU 245 ? CD  ? A GLU 245 CD  
53  1 Y 1 A GLU 245 ? OE1 ? A GLU 245 OE1 
54  1 Y 1 A GLU 245 ? OE2 ? A GLU 245 OE2 
55  1 Y 1 B ARG 3   ? CZ  ? B ARG 3   CZ  
56  1 Y 1 B ARG 3   ? NH1 ? B ARG 3   NH1 
57  1 Y 1 B ARG 3   ? NH2 ? B ARG 3   NH2 
58  1 Y 1 B TYR 4   ? CG  ? B TYR 4   CG  
59  1 Y 1 B TYR 4   ? CD1 ? B TYR 4   CD1 
60  1 Y 1 B TYR 4   ? CD2 ? B TYR 4   CD2 
61  1 Y 1 B TYR 4   ? CE1 ? B TYR 4   CE1 
62  1 Y 1 B TYR 4   ? CE2 ? B TYR 4   CE2 
63  1 Y 1 B TYR 4   ? CZ  ? B TYR 4   CZ  
64  1 Y 1 B TYR 4   ? OH  ? B TYR 4   OH  
65  1 Y 1 B LYS 6   ? NZ  ? B LYS 6   NZ  
66  1 Y 1 B GLN 14  ? OE1 ? B GLN 14  OE1 
67  1 Y 1 B GLN 14  ? NE2 ? B GLN 14  NE2 
68  1 Y 1 B ARG 34  ? CZ  ? B ARG 34  CZ  
69  1 Y 1 B ARG 34  ? NH1 ? B ARG 34  NH1 
70  1 Y 1 B ARG 34  ? NH2 ? B ARG 34  NH2 
71  1 Y 1 B GLU 35  ? CG  ? B GLU 35  CG  
72  1 Y 1 B GLU 35  ? CD  ? B GLU 35  CD  
73  1 Y 1 B GLU 35  ? OE1 ? B GLU 35  OE1 
74  1 Y 1 B GLU 35  ? OE2 ? B GLU 35  OE2 
75  1 Y 1 B GLU 39  ? CG  ? B GLU 39  CG  
76  1 Y 1 B GLU 39  ? CD  ? B GLU 39  CD  
77  1 Y 1 B GLU 39  ? OE1 ? B GLU 39  OE1 
78  1 Y 1 B GLU 39  ? OE2 ? B GLU 39  OE2 
79  1 Y 1 B LYS 42  ? CE  ? B LYS 42  CE  
80  1 Y 1 B LYS 42  ? NZ  ? B LYS 42  NZ  
81  1 Y 1 B LYS 71  ? CE  ? B LYS 71  CE  
82  1 Y 1 B LYS 71  ? NZ  ? B LYS 71  NZ  
83  1 Y 1 B ARG 75  ? CG  ? B ARG 75  CG  
84  1 Y 1 B ARG 75  ? CD  ? B ARG 75  CD  
85  1 Y 1 B ARG 75  ? NE  ? B ARG 75  NE  
86  1 Y 1 B ARG 75  ? CZ  ? B ARG 75  CZ  
87  1 Y 1 B ARG 75  ? NH1 ? B ARG 75  NH1 
88  1 Y 1 B ARG 75  ? NH2 ? B ARG 75  NH2 
89  1 Y 1 B ARG 97  ? NE  ? B ARG 97  NE  
90  1 Y 1 B ARG 97  ? CZ  ? B ARG 97  CZ  
91  1 Y 1 B ARG 97  ? NH1 ? B ARG 97  NH1 
92  1 Y 1 B ARG 97  ? NH2 ? B ARG 97  NH2 
93  1 Y 1 B THR 186 ? OG1 ? B THR 186 OG1 
94  1 Y 1 B THR 186 ? CG2 ? B THR 186 CG2 
95  1 Y 1 B GLU 188 ? CG  ? B GLU 188 CG  
96  1 Y 1 B GLU 188 ? CD  ? B GLU 188 CD  
97  1 Y 1 B GLU 188 ? OE1 ? B GLU 188 OE1 
98  1 Y 1 B GLU 188 ? OE2 ? B GLU 188 OE2 
99  1 Y 1 B LYS 196 ? CD  ? B LYS 196 CD  
100 1 Y 1 B LYS 196 ? CE  ? B LYS 196 CE  
101 1 Y 1 B LYS 196 ? NZ  ? B LYS 196 NZ  
102 1 Y 1 B ARG 216 ? NE  ? B ARG 216 NE  
103 1 Y 1 B ARG 216 ? CZ  ? B ARG 216 CZ  
104 1 Y 1 B ARG 216 ? NH1 ? B ARG 216 NH1 
105 1 Y 1 B ARG 216 ? NH2 ? B ARG 216 NH2 
106 1 Y 1 B GLU 220 ? CD  ? B GLU 220 CD  
107 1 Y 1 B GLU 220 ? OE1 ? B GLU 220 OE1 
108 1 Y 1 B GLU 220 ? OE2 ? B GLU 220 OE2 
109 1 Y 1 B LYS 224 ? CD  ? B LYS 224 CD  
110 1 Y 1 B LYS 224 ? CE  ? B LYS 224 CE  
111 1 Y 1 B LYS 224 ? NZ  ? B LYS 224 NZ  
112 1 Y 1 B LYS 242 ? CG  ? B LYS 242 CG  
113 1 Y 1 B LYS 242 ? CD  ? B LYS 242 CD  
114 1 Y 1 B LYS 242 ? CE  ? B LYS 242 CE  
115 1 Y 1 B LYS 242 ? NZ  ? B LYS 242 NZ  
116 1 Y 1 B LYS 244 ? CG  ? B LYS 244 CG  
117 1 Y 1 B LYS 244 ? CD  ? B LYS 244 CD  
118 1 Y 1 B LYS 244 ? CE  ? B LYS 244 CE  
119 1 Y 1 B LYS 244 ? NZ  ? B LYS 244 NZ  
120 1 Y 1 B GLU 245 ? CG  ? B GLU 245 CG  
121 1 Y 1 B GLU 245 ? CD  ? B GLU 245 CD  
122 1 Y 1 B GLU 245 ? OE1 ? B GLU 245 OE1 
123 1 Y 1 B GLU 245 ? OE2 ? B GLU 245 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 249 ? A GLY 249 
3  1 Y 1 A SER 250 ? A SER 250 
4  1 Y 1 A LEU 251 ? A LEU 251 
5  1 Y 1 A GLU 252 ? A GLU 252 
6  1 Y 1 B MET 1   ? B MET 1   
7  1 Y 1 B GLY 249 ? B GLY 249 
8  1 Y 1 B SER 250 ? B SER 250 
9  1 Y 1 B LEU 251 ? B LEU 251 
10 1 Y 1 B GLU 252 ? B GLU 252 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PO4 1 253 1 PO4 PO4 A . 
D 2 PO4 1 253 2 PO4 PO4 B . 
E 3 HOH 1 254 1 HOH HOH A . 
E 3 HOH 2 255 2 HOH HOH A . 
E 3 HOH 3 256 4 HOH HOH A . 
E 3 HOH 4 257 6 HOH HOH A . 
F 3 HOH 1 254 3 HOH HOH B . 
F 3 HOH 2 255 5 HOH HOH B . 
F 3 HOH 3 256 7 HOH HOH B . 
F 3 HOH 4 257 8 HOH HOH B . 
#