data_3V2P
# 
_entry.id   3V2P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V2P         
RCSB  RCSB069519   
WWPDB D_1000069519 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MZ9 . unspecified 
PDB 3V2N . unspecified 
PDB 3V2Q . unspecified 
PDB 3V2R . unspecified 
PDB 3V2S . unspecified 
# 
_pdbx_database_status.entry_id                        3V2P 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-12 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Stetefeld, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'The pentameric channel of COMPcc in complex with different fatty acids.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            7 
_citation.page_first                e48130 
_citation.page_last                 e48130 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23133613 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0048130 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'MacFarlane, A.A.' 1 
primary 'Orriss, G.'       2 
primary 'Okun, N.'         3 
primary 'Meier, M.'        4 
primary 'Klonisch, T.'     5 
primary 'Khajehpour, M.'   6 
primary 'Stetefeld, J.'    7 
# 
_cell.length_a           37.900 
_cell.length_b           48.980 
_cell.length_c           53.997 
_cell.angle_alpha        90.000 
_cell.angle_beta         104.070 
_cell.angle_gamma        90.000 
_cell.entry_id           3V2P 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              10 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3V2P 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cartilage Oligomerization matrix protein (coiled-coil domain)' 5242.078 5   ? ? COMPcc         COMPcc 
2 non-polymer syn 'STEARIC ACID'                                                  284.477  1   ? ? 'stearic acid' ?      
3 water       nat water                                                           18.015   245 ? ? ?              ?      
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC 
_entity_poly.pdbx_seq_one_letter_code_can   MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC 
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  LEU n 
1 4  ALA n 
1 5  PRO n 
1 6  GLN n 
1 7  MET n 
1 8  LEU n 
1 9  ARG n 
1 10 GLU n 
1 11 LEU n 
1 12 GLN n 
1 13 GLU n 
1 14 THR n 
1 15 ASN n 
1 16 ALA n 
1 17 ALA n 
1 18 LEU n 
1 19 GLN n 
1 20 ASP n 
1 21 VAL n 
1 22 ARG n 
1 23 GLU n 
1 24 LEU n 
1 25 LEU n 
1 26 ARG n 
1 27 GLN n 
1 28 GLN n 
1 29 VAL n 
1 30 LYS n 
1 31 GLU n 
1 32 ILE n 
1 33 THR n 
1 34 PHE n 
1 35 LEU n 
1 36 LYS n 
1 37 ASN n 
1 38 THR n 
1 39 VAL n 
1 40 MET n 
1 41 GLU n 
1 42 CYS n 
1 43 ASP n 
1 44 ALA n 
1 45 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    3V2P 
_struct_ref.pdbx_db_accession          3V2P 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V2P A 1 ? 45 ? 3V2P 27 ? 71 ? 27 71 
2 1 3V2P B 1 ? 45 ? 3V2P 27 ? 71 ? 27 71 
3 1 3V2P C 1 ? 45 ? 3V2P 27 ? 71 ? 27 71 
4 1 3V2P D 1 ? 45 ? 3V2P 27 ? 71 ? 27 71 
5 1 3V2P E 1 ? 45 ? 3V2P 27 ? 71 ? 27 71 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
STE non-polymer         . 'STEARIC ACID'  ? 'C18 H36 O2'     284.477 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3V2P 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.85 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   33.68 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.25 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.25 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
# 
_reflns.entry_id                     3V2P 
_reflns.B_iso_Wilson_estimate        23.000 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.873 
_reflns.d_resolution_low             34.3 
_reflns.number_all                   15795 
_reflns.number_obs                   140183 
_reflns.percent_possible_obs         93 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3V2P 
_refine.ls_d_res_high                            1.873 
_refine.ls_d_res_low                             29.4000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               832812.0000 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.ls_percent_reflns_obs                    99.4000 
_refine.ls_number_reflns_obs                     15795 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2070 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2550 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 10.1000 
_refine.ls_number_reflns_R_free                  1588 
_refine.ls_R_factor_R_free_error                 0.0060 
_refine.B_iso_mean                               30.8333 
_refine.solvent_model_param_bsol                 58.0241 
_refine.solvent_model_param_ksol                 0.3800 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            -1.1400 
_refine.aniso_B[2][2]                            -4.8800 
_refine.aniso_B[3][3]                            6.0200 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            2.3500 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 1MZ9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                68.960 
_refine.B_iso_min                                14.080 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3V2P 
_refine_analyze.Luzzati_coordinate_error_obs    0.200 
_refine_analyze.Luzzati_sigma_a_obs             0.190 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.260 
_refine_analyze.Luzzati_sigma_a_free            0.260 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1810 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             245 
_refine_hist.number_atoms_total               2075 
_refine_hist.d_res_high                       1.873 
_refine_hist.d_res_low                        29.4000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d           ? 0.005  ? ? ? 'X-RAY DIFFRACTION' 
c_angle_deg        ? 0.900  ? ? ? 'X-RAY DIFFRACTION' 
c_dihedral_angle_d ? 15.200 ? ? ? 'X-RAY DIFFRACTION' 
c_improper_angle_d ? 0.660  ? ? ? 'X-RAY DIFFRACTION' 
c_mcbond_it        ? ?      ? ? ? 'X-RAY DIFFRACTION' 
c_mcangle_it       ? ?      ? ? ? 'X-RAY DIFFRACTION' 
c_scbond_it        ? ?      ? ? ? 'X-RAY DIFFRACTION' 
c_scangle_it       ? ?      ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.8700 
_refine_ls_shell.d_res_low                        1.9900 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.percent_reflns_obs               92.8000 
_refine_ls_shell.number_reflns_R_work             2197 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2850 
_refine_ls_shell.R_factor_R_free                  0.3570 
_refine_ls_shell.percent_reflns_R_free            9.9000 
_refine_ls_shell.number_reflns_R_free             242 
_refine_ls_shell.R_factor_R_free_error            0.0230 
_refine_ls_shell.number_reflns_all                2439 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param  dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param    water.top        'X-RAY DIFFRACTION' 
4 ion.param          ion.top          'X-RAY DIFFRACTION' 
5 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
6 ste.par            ste.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3V2P 
_struct.title                     'COMPcc in complex with fatty acids' 
_struct.pdbx_descriptor           COMPcc 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V2P 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'coiled coil stearic acid, storage, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 3 ? GLU A 41 ? LEU A 29 GLU A 67 1 ? 39 
HELX_P HELX_P2 2 LEU B 3 ? GLU B 41 ? LEU B 29 GLU B 67 1 ? 39 
HELX_P HELX_P3 3 LEU C 3 ? GLU C 41 ? LEU C 29 GLU C 67 1 ? 39 
HELX_P HELX_P4 4 LEU D 3 ? GLU D 41 ? LEU D 29 GLU D 67 1 ? 39 
HELX_P HELX_P5 5 LEU E 3 ? GLU E 41 ? LEU E 29 GLU E 67 1 ? 39 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 42 SG ? ? ? 1_555 E CYS 45 SG ? ? A CYS 68 E CYS 71 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 B CYS 42 SG ? ? A CYS 71 B CYS 68 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? B CYS 45 SG ? ? ? 1_555 C CYS 42 SG ? ? B CYS 71 C CYS 68 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? D CYS 45 SG ? ? ? 1_555 E CYS 42 SG ? ? D CYS 71 E CYS 68 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR RESIDUE STE A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LEU A 11 ? LEU A 37 . ? 1_555 ? 
2  AC1 15 THR A 14 ? THR A 40 . ? 1_555 ? 
3  AC1 15 LEU A 25 ? LEU A 51 . ? 1_555 ? 
4  AC1 15 GLN A 28 ? GLN A 54 . ? 1_555 ? 
5  AC1 15 LEU B 11 ? LEU B 37 . ? 1_555 ? 
6  AC1 15 THR B 14 ? THR B 40 . ? 1_555 ? 
7  AC1 15 GLN B 28 ? GLN B 54 . ? 1_555 ? 
8  AC1 15 LEU C 11 ? LEU C 37 . ? 1_555 ? 
9  AC1 15 GLN C 28 ? GLN C 54 . ? 1_555 ? 
10 AC1 15 LEU D 11 ? LEU D 37 . ? 1_555 ? 
11 AC1 15 LEU D 18 ? LEU D 44 . ? 1_555 ? 
12 AC1 15 GLN D 28 ? GLN D 54 . ? 1_555 ? 
13 AC1 15 LEU E 11 ? LEU E 37 . ? 1_555 ? 
14 AC1 15 LEU E 25 ? LEU E 51 . ? 1_555 ? 
15 AC1 15 GLN E 28 ? GLN E 54 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3V2P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    3V2P 
_atom_sites.fract_transf_matrix[1][1]   0.026385 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006612 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020417 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019092 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1  ? 22.714  15.089  -16.888 1.00 47.71 ? 27  MET A N   1 
ATOM   2    C CA  . MET A 1 1  ? 23.701  14.754  -15.823 1.00 47.10 ? 27  MET A CA  1 
ATOM   3    C C   . MET A 1 1  ? 23.450  13.353  -15.275 1.00 44.69 ? 27  MET A C   1 
ATOM   4    O O   . MET A 1 1  ? 22.471  12.707  -15.641 1.00 43.99 ? 27  MET A O   1 
ATOM   5    C CB  . MET A 1 1  ? 23.610  15.774  -14.686 1.00 50.12 ? 27  MET A CB  1 
ATOM   6    C CG  . MET A 1 1  ? 22.240  15.860  -14.040 1.00 53.30 ? 27  MET A CG  1 
ATOM   7    S SD  . MET A 1 1  ? 22.190  17.084  -12.716 1.00 59.10 ? 27  MET A SD  1 
ATOM   8    C CE  . MET A 1 1  ? 21.749  18.558  -13.635 1.00 56.30 ? 27  MET A CE  1 
ATOM   9    N N   . ASP A 1 2  ? 24.343  12.895  -14.400 1.00 41.85 ? 28  ASP A N   1 
ATOM   10   C CA  . ASP A 1 2  ? 24.238  11.572  -13.790 1.00 38.61 ? 28  ASP A CA  1 
ATOM   11   C C   . ASP A 1 2  ? 23.205  11.616  -12.667 1.00 36.16 ? 28  ASP A C   1 
ATOM   12   O O   . ASP A 1 2  ? 23.311  12.436  -11.756 1.00 35.54 ? 28  ASP A O   1 
ATOM   13   C CB  . ASP A 1 2  ? 25.598  11.153  -13.219 1.00 39.62 ? 28  ASP A CB  1 
ATOM   14   C CG  . ASP A 1 2  ? 25.636  9.696   -12.799 1.00 39.31 ? 28  ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 2  ? 24.626  9.196   -12.268 1.00 39.48 ? 28  ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 2  ? 26.686  9.050   -12.989 1.00 44.72 ? 28  ASP A OD2 1 
ATOM   17   N N   . LEU A 1 3  ? 22.215  10.728  -12.730 1.00 33.33 ? 29  LEU A N   1 
ATOM   18   C CA  . LEU A 1 3  ? 21.160  10.678  -11.718 1.00 29.66 ? 29  LEU A CA  1 
ATOM   19   C C   . LEU A 1 3  ? 21.398  9.628   -10.636 1.00 28.76 ? 29  LEU A C   1 
ATOM   20   O O   . LEU A 1 3  ? 20.588  9.486   -9.721  1.00 24.38 ? 29  LEU A O   1 
ATOM   21   C CB  . LEU A 1 3  ? 19.804  10.412  -12.383 1.00 31.59 ? 29  LEU A CB  1 
ATOM   22   C CG  . LEU A 1 3  ? 19.155  11.517  -13.223 1.00 31.37 ? 29  LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 3  ? 20.136  12.054  -14.238 1.00 33.63 ? 29  LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 3  ? 17.927  10.954  -13.923 1.00 30.09 ? 29  LEU A CD2 1 
ATOM   25   N N   . ALA A 1 4  ? 22.498  8.885   -10.747 1.00 26.82 ? 30  ALA A N   1 
ATOM   26   C CA  . ALA A 1 4  ? 22.824  7.859   -9.761  1.00 25.20 ? 30  ALA A CA  1 
ATOM   27   C C   . ALA A 1 4  ? 22.998  8.446   -8.360  1.00 23.97 ? 30  ALA A C   1 
ATOM   28   O O   . ALA A 1 4  ? 22.498  7.893   -7.385  1.00 22.60 ? 30  ALA A O   1 
ATOM   29   C CB  . ALA A 1 4  ? 24.090  7.115   -10.178 1.00 26.29 ? 30  ALA A CB  1 
ATOM   30   N N   . PRO A 1 5  ? 23.723  9.572   -8.234  1.00 22.69 ? 31  PRO A N   1 
ATOM   31   C CA  . PRO A 1 5  ? 23.886  10.136  -6.889  1.00 22.17 ? 31  PRO A CA  1 
ATOM   32   C C   . PRO A 1 5  ? 22.541  10.501  -6.259  1.00 20.53 ? 31  PRO A C   1 
ATOM   33   O O   . PRO A 1 5  ? 22.329  10.299  -5.063  1.00 20.45 ? 31  PRO A O   1 
ATOM   34   C CB  . PRO A 1 5  ? 24.769  11.357  -7.130  1.00 23.07 ? 31  PRO A CB  1 
ATOM   35   C CG  . PRO A 1 5  ? 25.603  10.929  -8.312  1.00 24.69 ? 31  PRO A CG  1 
ATOM   36   C CD  . PRO A 1 5  ? 24.566  10.288  -9.206  1.00 23.77 ? 31  PRO A CD  1 
ATOM   37   N N   . GLN A 1 6  ? 21.632  11.043  -7.061  1.00 19.78 ? 32  GLN A N   1 
ATOM   38   C CA  . GLN A 1 6  ? 20.323  11.404  -6.532  1.00 19.87 ? 32  GLN A CA  1 
ATOM   39   C C   . GLN A 1 6  ? 19.511  10.155  -6.212  1.00 18.90 ? 32  GLN A C   1 
ATOM   40   O O   . GLN A 1 6  ? 18.709  10.157  -5.284  1.00 14.08 ? 32  GLN A O   1 
ATOM   41   C CB  . GLN A 1 6  ? 19.548  12.284  -7.511  1.00 23.14 ? 32  GLN A CB  1 
ATOM   42   C CG  . GLN A 1 6  ? 18.212  12.722  -6.940  1.00 28.38 ? 32  GLN A CG  1 
ATOM   43   C CD  . GLN A 1 6  ? 17.586  13.869  -7.696  1.00 30.52 ? 32  GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 6  ? 16.431  14.213  -7.460  1.00 36.11 ? 32  GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 6  ? 18.346  14.476  -8.600  1.00 33.25 ? 32  GLN A NE2 1 
ATOM   46   N N   . MET A 1 7  ? 19.713  9.093   -6.986  1.00 17.90 ? 33  MET A N   1 
ATOM   47   C CA  . MET A 1 7  ? 19.003  7.849   -6.727  1.00 19.16 ? 33  MET A CA  1 
ATOM   48   C C   . MET A 1 7  ? 19.451  7.302   -5.377  1.00 18.86 ? 33  MET A C   1 
ATOM   49   O O   . MET A 1 7  ? 18.628  6.850   -4.583  1.00 19.24 ? 33  MET A O   1 
ATOM   50   C CB  . MET A 1 7  ? 19.281  6.817   -7.827  1.00 21.12 ? 33  MET A CB  1 
ATOM   51   C CG  . MET A 1 7  ? 18.530  7.098   -9.126  1.00 26.09 ? 33  MET A CG  1 
ATOM   52   S SD  . MET A 1 7  ? 18.821  5.856   -10.398 1.00 30.94 ? 33  MET A SD  1 
ATOM   53   C CE  . MET A 1 7  ? 18.001  4.444   -9.668  1.00 29.64 ? 33  MET A CE  1 
ATOM   54   N N   . LEU A 1 8  ? 20.758  7.333   -5.124  1.00 17.27 ? 34  LEU A N   1 
ATOM   55   C CA  . LEU A 1 8  ? 21.283  6.845   -3.855  1.00 18.88 ? 34  LEU A CA  1 
ATOM   56   C C   . LEU A 1 8  ? 20.683  7.680   -2.724  1.00 18.00 ? 34  LEU A C   1 
ATOM   57   O O   . LEU A 1 8  ? 20.284  7.148   -1.697  1.00 17.62 ? 34  LEU A O   1 
ATOM   58   C CB  . LEU A 1 8  ? 22.814  6.931   -3.833  1.00 17.94 ? 34  LEU A CB  1 
ATOM   59   C CG  . LEU A 1 8  ? 23.519  6.549   -2.528  1.00 17.16 ? 34  LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 8  ? 23.134  5.134   -2.091  1.00 16.57 ? 34  LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 8  ? 25.024  6.647   -2.730  1.00 18.19 ? 34  LEU A CD2 1 
ATOM   62   N N   . ARG A 1 9  ? 20.608  8.989   -2.922  1.00 18.74 ? 35  ARG A N   1 
ATOM   63   C CA  . ARG A 1 9  ? 20.031  9.861   -1.905  1.00 19.56 ? 35  ARG A CA  1 
ATOM   64   C C   . ARG A 1 9  ? 18.571  9.511   -1.612  1.00 18.88 ? 35  ARG A C   1 
ATOM   65   O O   . ARG A 1 9  ? 18.153  9.516   -0.453  1.00 19.93 ? 35  ARG A O   1 
ATOM   66   C CB  . ARG A 1 9  ? 20.140  11.331  -2.324  1.00 20.28 ? 35  ARG A CB  1 
ATOM   67   C CG  . ARG A 1 9  ? 21.516  11.960  -2.044  1.00 23.50 ? 35  ARG A CG  1 
ATOM   68   C CD  . ARG A 1 9  ? 21.815  12.037  -0.540  1.00 26.12 ? 35  ARG A CD  1 
ATOM   69   N NE  . ARG A 1 9  ? 20.910  12.944  0.169   1.00 25.58 ? 35  ARG A NE  1 
ATOM   70   C CZ  . ARG A 1 9  ? 20.205  12.612  1.245   1.00 27.45 ? 35  ARG A CZ  1 
ATOM   71   N NH1 . ARG A 1 9  ? 20.293  11.388  1.747   1.00 29.02 ? 35  ARG A NH1 1 
ATOM   72   N NH2 . ARG A 1 9  ? 19.400  13.499  1.814   1.00 29.94 ? 35  ARG A NH2 1 
ATOM   73   N N   . GLU A 1 10 ? 17.790  9.209   -2.648  1.00 18.62 ? 36  GLU A N   1 
ATOM   74   C CA  . GLU A 1 10 ? 16.390  8.859   -2.418  1.00 18.91 ? 36  GLU A CA  1 
ATOM   75   C C   . GLU A 1 10 ? 16.315  7.576   -1.589  1.00 17.70 ? 36  GLU A C   1 
ATOM   76   O O   . GLU A 1 10 ? 15.509  7.472   -0.672  1.00 17.69 ? 36  GLU A O   1 
ATOM   77   C CB  . GLU A 1 10 ? 15.637  8.661   -3.741  1.00 20.93 ? 36  GLU A CB  1 
ATOM   78   C CG  . GLU A 1 10 ? 15.375  9.936   -4.549  1.00 24.67 ? 36  GLU A CG  1 
ATOM   79   C CD  . GLU A 1 10 ? 14.565  10.983  -3.786  1.00 26.37 ? 36  GLU A CD  1 
ATOM   80   O OE1 . GLU A 1 10 ? 13.584  10.621  -3.099  1.00 26.67 ? 36  GLU A OE1 1 
ATOM   81   O OE2 . GLU A 1 10 ? 14.907  12.176  -3.886  1.00 29.12 ? 36  GLU A OE2 1 
ATOM   82   N N   . LEU A 1 11 ? 17.162  6.604   -1.913  1.00 18.34 ? 37  LEU A N   1 
ATOM   83   C CA  . LEU A 1 11 ? 17.186  5.340   -1.180  1.00 18.37 ? 37  LEU A CA  1 
ATOM   84   C C   . LEU A 1 11 ? 17.578  5.568   0.281   1.00 20.06 ? 37  LEU A C   1 
ATOM   85   O O   . LEU A 1 11 ? 17.036  4.934   1.185   1.00 19.99 ? 37  LEU A O   1 
ATOM   86   C CB  . LEU A 1 11 ? 18.180  4.372   -1.829  1.00 20.10 ? 37  LEU A CB  1 
ATOM   87   C CG  . LEU A 1 11 ? 17.826  3.841   -3.217  1.00 21.80 ? 37  LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 11 ? 18.977  2.984   -3.762  1.00 22.90 ? 37  LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 11 ? 16.548  3.034   -3.120  1.00 21.97 ? 37  LEU A CD2 1 
ATOM   90   N N   . GLN A 1 12 ? 18.530  6.466   0.512   1.00 18.63 ? 38  GLN A N   1 
ATOM   91   C CA  . GLN A 1 12 ? 18.957  6.754   1.878   1.00 19.48 ? 38  GLN A CA  1 
ATOM   92   C C   . GLN A 1 12 ? 17.825  7.405   2.656   1.00 18.38 ? 38  GLN A C   1 
ATOM   93   O O   . GLN A 1 12 ? 17.642  7.135   3.844   1.00 15.91 ? 38  GLN A O   1 
ATOM   94   C CB  . GLN A 1 12 ? 20.190  7.661   1.878   1.00 19.22 ? 38  GLN A CB  1 
ATOM   95   C CG  . GLN A 1 12 ? 21.427  6.979   1.292   1.00 22.35 ? 38  GLN A CG  1 
ATOM   96   C CD  . GLN A 1 12 ? 22.625  7.906   1.218   1.00 24.38 ? 38  GLN A CD  1 
ATOM   97   O OE1 . GLN A 1 12 ? 22.520  9.025   0.733   1.00 22.08 ? 38  GLN A OE1 1 
ATOM   98   N NE2 . GLN A 1 12 ? 23.773  7.436   1.695   1.00 26.93 ? 38  GLN A NE2 1 
ATOM   99   N N   . GLU A 1 13 ? 17.066  8.265   1.987   1.00 19.51 ? 39  GLU A N   1 
ATOM   100  C CA  . GLU A 1 13 ? 15.938  8.926   2.630   1.00 20.64 ? 39  GLU A CA  1 
ATOM   101  C C   . GLU A 1 13 ? 14.842  7.908   2.905   1.00 20.55 ? 39  GLU A C   1 
ATOM   102  O O   . GLU A 1 13 ? 14.152  7.993   3.919   1.00 21.63 ? 39  GLU A O   1 
ATOM   103  C CB  . GLU A 1 13 ? 15.404  10.052  1.744   1.00 23.60 ? 39  GLU A CB  1 
ATOM   104  C CG  . GLU A 1 13 ? 16.221  11.316  1.835   1.00 27.08 ? 39  GLU A CG  1 
ATOM   105  C CD  . GLU A 1 13 ? 16.305  11.832  3.258   1.00 27.89 ? 39  GLU A CD  1 
ATOM   106  O OE1 . GLU A 1 13 ? 15.249  11.925  3.916   1.00 28.48 ? 39  GLU A OE1 1 
ATOM   107  O OE2 . GLU A 1 13 ? 17.423  12.139  3.716   1.00 28.39 ? 39  GLU A OE2 1 
ATOM   108  N N   . THR A 1 14 ? 14.683  6.948   1.997   1.00 20.15 ? 40  THR A N   1 
ATOM   109  C CA  . THR A 1 14 ? 13.686  5.893   2.168   1.00 21.60 ? 40  THR A CA  1 
ATOM   110  C C   . THR A 1 14 ? 13.993  5.125   3.443   1.00 21.24 ? 40  THR A C   1 
ATOM   111  O O   . THR A 1 14 ? 13.115  4.915   4.277   1.00 21.21 ? 40  THR A O   1 
ATOM   112  C CB  . THR A 1 14 ? 13.701  4.876   0.996   1.00 22.46 ? 40  THR A CB  1 
ATOM   113  O OG1 . THR A 1 14 ? 13.163  5.489   -0.177  1.00 25.14 ? 40  THR A OG1 1 
ATOM   114  C CG2 . THR A 1 14 ? 12.862  3.643   1.342   1.00 22.87 ? 40  THR A CG2 1 
ATOM   115  N N   . ASN A 1 15 ? 15.245  4.699   3.586   1.00 19.52 ? 41  ASN A N   1 
ATOM   116  C CA  . ASN A 1 15 ? 15.642  3.957   4.775   1.00 19.50 ? 41  ASN A CA  1 
ATOM   117  C C   . ASN A 1 15 ? 15.491  4.783   6.048   1.00 19.46 ? 41  ASN A C   1 
ATOM   118  O O   . ASN A 1 15 ? 15.174  4.245   7.108   1.00 18.26 ? 41  ASN A O   1 
ATOM   119  C CB  . ASN A 1 15 ? 17.074  3.436   4.623   1.00 18.97 ? 41  ASN A CB  1 
ATOM   120  C CG  . ASN A 1 15 ? 17.140  2.213   3.728   1.00 21.61 ? 41  ASN A CG  1 
ATOM   121  O OD1 . ASN A 1 15 ? 16.284  1.333   3.818   1.00 26.46 ? 41  ASN A OD1 1 
ATOM   122  N ND2 . ASN A 1 15 ? 18.151  2.145   2.870   1.00 20.96 ? 41  ASN A ND2 1 
ATOM   123  N N   . ALA A 1 16 ? 15.707  6.091   5.950   1.00 18.49 ? 42  ALA A N   1 
ATOM   124  C CA  . ALA A 1 16 ? 15.555  6.949   7.120   1.00 19.27 ? 42  ALA A CA  1 
ATOM   125  C C   . ALA A 1 16 ? 14.095  6.902   7.584   1.00 18.66 ? 42  ALA A C   1 
ATOM   126  O O   . ALA A 1 16 ? 13.803  6.647   8.754   1.00 19.01 ? 42  ALA A O   1 
ATOM   127  C CB  . ALA A 1 16 ? 15.956  8.385   6.780   1.00 19.80 ? 42  ALA A CB  1 
ATOM   128  N N   . ALA A 1 17 ? 13.177  7.144   6.657   1.00 19.77 ? 43  ALA A N   1 
ATOM   129  C CA  . ALA A 1 17 ? 11.754  7.124   6.979   1.00 20.03 ? 43  ALA A CA  1 
ATOM   130  C C   . ALA A 1 17 ? 11.303  5.725   7.401   1.00 20.10 ? 43  ALA A C   1 
ATOM   131  O O   . ALA A 1 17 ? 10.482  5.573   8.307   1.00 21.01 ? 43  ALA A O   1 
ATOM   132  C CB  . ALA A 1 17 ? 10.939  7.604   5.778   1.00 17.96 ? 43  ALA A CB  1 
ATOM   133  N N   . LEU A 1 18 ? 11.844  4.702   6.755   1.00 19.23 ? 44  LEU A N   1 
ATOM   134  C CA  . LEU A 1 18 ? 11.473  3.333   7.098   1.00 20.36 ? 44  LEU A CA  1 
ATOM   135  C C   . LEU A 1 18 ? 11.919  2.993   8.523   1.00 18.92 ? 44  LEU A C   1 
ATOM   136  O O   . LEU A 1 18 ? 11.229  2.273   9.247   1.00 18.20 ? 44  LEU A O   1 
ATOM   137  C CB  . LEU A 1 18 ? 12.094  2.362   6.093   1.00 20.47 ? 44  LEU A CB  1 
ATOM   138  C CG  . LEU A 1 18 ? 11.757  0.876   6.219   1.00 22.72 ? 44  LEU A CG  1 
ATOM   139  C CD1 . LEU A 1 18 ? 10.248  0.677   6.351   1.00 22.68 ? 44  LEU A CD1 1 
ATOM   140  C CD2 . LEU A 1 18 ? 12.293  0.151   4.989   1.00 19.05 ? 44  LEU A CD2 1 
ATOM   141  N N   . GLN A 1 19 ? 13.076  3.509   8.920   1.00 19.80 ? 45  GLN A N   1 
ATOM   142  C CA  . GLN A 1 19 ? 13.580  3.270   10.265  1.00 21.54 ? 45  GLN A CA  1 
ATOM   143  C C   . GLN A 1 19 ? 12.659  3.952   11.279  1.00 19.90 ? 45  GLN A C   1 
ATOM   144  O O   . GLN A 1 19 ? 12.429  3.432   12.371  1.00 22.32 ? 45  GLN A O   1 
ATOM   145  C CB  . GLN A 1 19 ? 15.014  3.797   10.401  1.00 26.06 ? 45  GLN A CB  1 
ATOM   146  C CG  . GLN A 1 19 ? 15.598  3.648   11.798  1.00 32.28 ? 45  GLN A CG  1 
ATOM   147  C CD  . GLN A 1 19 ? 17.091  3.918   11.839  1.00 37.35 ? 45  GLN A CD  1 
ATOM   148  O OE1 . GLN A 1 19 ? 17.887  3.177   11.250  1.00 40.56 ? 45  GLN A OE1 1 
ATOM   149  N NE2 . GLN A 1 19 ? 17.480  4.984   12.531  1.00 38.96 ? 45  GLN A NE2 1 
ATOM   150  N N   . ASP A 1 20 ? 12.142  5.121   10.922  1.00 18.10 ? 46  ASP A N   1 
ATOM   151  C CA  . ASP A 1 20 ? 11.224  5.835   11.803  1.00 19.61 ? 46  ASP A CA  1 
ATOM   152  C C   . ASP A 1 20 ? 9.946   5.007   11.926  1.00 18.98 ? 46  ASP A C   1 
ATOM   153  O O   . ASP A 1 20 ? 9.374   4.885   13.009  1.00 16.58 ? 46  ASP A O   1 
ATOM   154  C CB  . ASP A 1 20 ? 10.863  7.211   11.241  1.00 21.79 ? 46  ASP A CB  1 
ATOM   155  C CG  . ASP A 1 20 ? 12.044  8.168   11.212  1.00 27.86 ? 46  ASP A CG  1 
ATOM   156  O OD1 . ASP A 1 20 ? 12.852  8.151   12.161  1.00 27.87 ? 46  ASP A OD1 1 
ATOM   157  O OD2 . ASP A 1 20 ? 12.151  8.952   10.243  1.00 30.48 ? 46  ASP A OD2 1 
ATOM   158  N N   . VAL A 1 21 ? 9.499   4.449   10.804  1.00 19.88 ? 47  VAL A N   1 
ATOM   159  C CA  . VAL A 1 21 ? 8.294   3.628   10.793  1.00 23.00 ? 47  VAL A CA  1 
ATOM   160  C C   . VAL A 1 21 ? 8.459   2.418   11.714  1.00 22.94 ? 47  VAL A C   1 
ATOM   161  O O   . VAL A 1 21 ? 7.544   2.080   12.461  1.00 22.40 ? 47  VAL A O   1 
ATOM   162  C CB  . VAL A 1 21 ? 7.948   3.143   9.352   1.00 21.41 ? 47  VAL A CB  1 
ATOM   163  C CG1 . VAL A 1 21 ? 6.839   2.102   9.399   1.00 24.15 ? 47  VAL A CG1 1 
ATOM   164  C CG2 . VAL A 1 21 ? 7.493   4.321   8.505   1.00 24.09 ? 47  VAL A CG2 1 
ATOM   165  N N   . ARG A 1 22 ? 9.628   1.777   11.668  1.00 23.41 ? 48  ARG A N   1 
ATOM   166  C CA  . ARG A 1 22 ? 9.897   0.609   12.515  1.00 25.67 ? 48  ARG A CA  1 
ATOM   167  C C   . ARG A 1 22 ? 9.797   0.953   13.995  1.00 24.04 ? 48  ARG A C   1 
ATOM   168  O O   . ARG A 1 22 ? 9.238   0.186   14.780  1.00 23.76 ? 48  ARG A O   1 
ATOM   169  C CB  . ARG A 1 22 ? 11.299  0.056   12.261  1.00 27.60 ? 48  ARG A CB  1 
ATOM   170  C CG  . ARG A 1 22 ? 11.540  -0.505  10.887  1.00 33.61 ? 48  ARG A CG  1 
ATOM   171  C CD  . ARG A 1 22 ? 13.012  -0.861  10.723  1.00 36.21 ? 48  ARG A CD  1 
ATOM   172  N NE  . ARG A 1 22 ? 13.465  -1.818  11.731  1.00 41.75 ? 48  ARG A NE  1 
ATOM   173  C CZ  . ARG A 1 22 ? 14.712  -2.271  11.824  1.00 43.16 ? 48  ARG A CZ  1 
ATOM   174  N NH1 . ARG A 1 22 ? 15.640  -1.852  10.973  1.00 43.99 ? 48  ARG A NH1 1 
ATOM   175  N NH2 . ARG A 1 22 ? 15.029  -3.158  12.757  1.00 44.93 ? 48  ARG A NH2 1 
ATOM   176  N N   . GLU A 1 23 ? 10.365  2.097   14.370  1.00 24.15 ? 49  GLU A N   1 
ATOM   177  C CA  . GLU A 1 23 ? 10.355  2.558   15.759  1.00 25.11 ? 49  GLU A CA  1 
ATOM   178  C C   . GLU A 1 23 ? 8.943   2.885   16.235  1.00 21.71 ? 49  GLU A C   1 
ATOM   179  O O   . GLU A 1 23 ? 8.577   2.595   17.372  1.00 21.88 ? 49  GLU A O   1 
ATOM   180  C CB  . GLU A 1 23 ? 11.230  3.804   15.920  1.00 27.46 ? 49  GLU A CB  1 
ATOM   181  C CG  . GLU A 1 23 ? 12.713  3.593   15.681  1.00 35.17 ? 49  GLU A CG  1 
ATOM   182  C CD  . GLU A 1 23 ? 13.501  4.895   15.784  1.00 38.70 ? 49  GLU A CD  1 
ATOM   183  O OE1 . GLU A 1 23 ? 14.743  4.855   15.659  1.00 43.65 ? 49  GLU A OE1 1 
ATOM   184  O OE2 . GLU A 1 23 ? 12.875  5.961   15.988  1.00 41.25 ? 49  GLU A OE2 1 
ATOM   185  N N   . LEU A 1 24 ? 8.162   3.520   15.370  1.00 21.43 ? 50  LEU A N   1 
ATOM   186  C CA  . LEU A 1 24 ? 6.788   3.867   15.705  1.00 20.46 ? 50  LEU A CA  1 
ATOM   187  C C   . LEU A 1 24 ? 5.976   2.595   15.908  1.00 20.78 ? 50  LEU A C   1 
ATOM   188  O O   . LEU A 1 24 ? 5.300   2.417   16.920  1.00 18.74 ? 50  LEU A O   1 
ATOM   189  C CB  . LEU A 1 24 ? 6.173   4.701   14.579  1.00 20.10 ? 50  LEU A CB  1 
ATOM   190  C CG  . LEU A 1 24 ? 6.713   6.128   14.526  1.00 19.67 ? 50  LEU A CG  1 
ATOM   191  C CD1 . LEU A 1 24 ? 6.329   6.794   13.217  1.00 20.34 ? 50  LEU A CD1 1 
ATOM   192  C CD2 . LEU A 1 24 ? 6.166   6.904   15.725  1.00 22.01 ? 50  LEU A CD2 1 
ATOM   193  N N   . LEU A 1 25 ? 6.064   1.702   14.933  1.00 18.63 ? 51  LEU A N   1 
ATOM   194  C CA  . LEU A 1 25 ? 5.337   0.449   14.985  1.00 20.39 ? 51  LEU A CA  1 
ATOM   195  C C   . LEU A 1 25 ? 5.704   -0.335  16.235  1.00 20.90 ? 51  LEU A C   1 
ATOM   196  O O   . LEU A 1 25 ? 4.848   -0.947  16.863  1.00 22.82 ? 51  LEU A O   1 
ATOM   197  C CB  . LEU A 1 25 ? 5.654   -0.372  13.740  1.00 21.05 ? 51  LEU A CB  1 
ATOM   198  C CG  . LEU A 1 25 ? 4.987   -1.733  13.572  1.00 21.85 ? 51  LEU A CG  1 
ATOM   199  C CD1 . LEU A 1 25 ? 3.463   -1.597  13.601  1.00 19.75 ? 51  LEU A CD1 1 
ATOM   200  C CD2 . LEU A 1 25 ? 5.444   -2.314  12.238  1.00 19.75 ? 51  LEU A CD2 1 
ATOM   201  N N   . ARG A 1 26 ? 6.983   -0.305  16.589  1.00 21.73 ? 52  ARG A N   1 
ATOM   202  C CA  . ARG A 1 26 ? 7.477   -1.007  17.762  1.00 23.91 ? 52  ARG A CA  1 
ATOM   203  C C   . ARG A 1 26 ? 6.788   -0.470  19.016  1.00 23.98 ? 52  ARG A C   1 
ATOM   204  O O   . ARG A 1 26 ? 6.362   -1.231  19.884  1.00 23.11 ? 52  ARG A O   1 
ATOM   205  C CB  . ARG A 1 26 ? 8.991   -0.813  17.877  1.00 28.19 ? 52  ARG A CB  1 
ATOM   206  C CG  . ARG A 1 26 ? 9.656   -1.715  18.884  1.00 30.09 ? 52  ARG A CG  1 
ATOM   207  C CD  . ARG A 1 26 ? 11.099  -1.298  19.109  1.00 34.56 ? 52  ARG A CD  1 
ATOM   208  N NE  . ARG A 1 26 ? 11.871  -1.261  17.871  1.00 35.73 ? 52  ARG A NE  1 
ATOM   209  C CZ  . ARG A 1 26 ? 12.101  -2.317  17.098  1.00 37.88 ? 52  ARG A CZ  1 
ATOM   210  N NH1 . ARG A 1 26 ? 11.613  -3.507  17.432  1.00 38.43 ? 52  ARG A NH1 1 
ATOM   211  N NH2 . ARG A 1 26 ? 12.825  -2.183  15.994  1.00 37.47 ? 52  ARG A NH2 1 
ATOM   212  N N   . GLN A 1 27 ? 6.681   0.850   19.106  1.00 25.28 ? 53  GLN A N   1 
ATOM   213  C CA  . GLN A 1 27 ? 6.040   1.476   20.253  1.00 24.26 ? 53  GLN A CA  1 
ATOM   214  C C   . GLN A 1 27 ? 4.554   1.146   20.275  1.00 23.67 ? 53  GLN A C   1 
ATOM   215  O O   . GLN A 1 27 ? 3.981   0.859   21.330  1.00 21.62 ? 53  GLN A O   1 
ATOM   216  C CB  . GLN A 1 27 ? 6.224   2.991   20.200  1.00 28.21 ? 53  GLN A CB  1 
ATOM   217  C CG  . GLN A 1 27 ? 5.624   3.712   21.390  1.00 31.73 ? 53  GLN A CG  1 
ATOM   218  C CD  . GLN A 1 27 ? 6.078   3.111   22.706  1.00 36.88 ? 53  GLN A CD  1 
ATOM   219  O OE1 . GLN A 1 27 ? 7.274   2.913   22.932  1.00 37.59 ? 53  GLN A OE1 1 
ATOM   220  N NE2 . GLN A 1 27 ? 5.125   2.819   23.586  1.00 37.95 ? 53  GLN A NE2 1 
ATOM   221  N N   . GLN A 1 28 ? 3.939   1.184   19.097  1.00 21.54 ? 54  GLN A N   1 
ATOM   222  C CA  . GLN A 1 28 ? 2.516   0.905   18.960  1.00 21.68 ? 54  GLN A CA  1 
ATOM   223  C C   . GLN A 1 28 ? 2.167   -0.498  19.447  1.00 22.94 ? 54  GLN A C   1 
ATOM   224  O O   . GLN A 1 28 ? 1.174   -0.682  20.150  1.00 21.24 ? 54  GLN A O   1 
ATOM   225  C CB  . GLN A 1 28 ? 2.093   1.085   17.499  1.00 21.11 ? 54  GLN A CB  1 
ATOM   226  C CG  . GLN A 1 28 ? 0.607   0.919   17.240  1.00 23.05 ? 54  GLN A CG  1 
ATOM   227  C CD  . GLN A 1 28 ? 0.219   1.326   15.830  1.00 23.43 ? 54  GLN A CD  1 
ATOM   228  O OE1 . GLN A 1 28 ? -0.012  2.505   15.551  1.00 23.93 ? 54  GLN A OE1 1 
ATOM   229  N NE2 . GLN A 1 28 ? 0.164   0.351   14.926  1.00 24.60 ? 54  GLN A NE2 1 
ATOM   230  N N   . VAL A 1 29 ? 2.971   -1.492  19.079  1.00 21.89 ? 55  VAL A N   1 
ATOM   231  C CA  . VAL A 1 29 ? 2.688   -2.852  19.531  1.00 23.42 ? 55  VAL A CA  1 
ATOM   232  C C   . VAL A 1 29 ? 2.682   -2.874  21.064  1.00 23.54 ? 55  VAL A C   1 
ATOM   233  O O   . VAL A 1 29 ? 1.879   -3.566  21.679  1.00 23.71 ? 55  VAL A O   1 
ATOM   234  C CB  . VAL A 1 29 ? 3.733   -3.871  19.015  1.00 24.16 ? 55  VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 29 ? 3.377   -5.261  19.514  1.00 25.75 ? 55  VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 29 ? 3.773   -3.863  17.492  1.00 24.58 ? 55  VAL A CG2 1 
ATOM   237  N N   . LYS A 1 30 ? 3.572   -2.105  21.681  1.00 24.64 ? 56  LYS A N   1 
ATOM   238  C CA  . LYS A 1 30 ? 3.633   -2.053  23.141  1.00 24.76 ? 56  LYS A CA  1 
ATOM   239  C C   . LYS A 1 30 ? 2.358   -1.450  23.725  1.00 24.85 ? 56  LYS A C   1 
ATOM   240  O O   . LYS A 1 30 ? 1.822   -1.950  24.719  1.00 22.60 ? 56  LYS A O   1 
ATOM   241  C CB  . LYS A 1 30 ? 4.853   -1.245  23.587  1.00 28.20 ? 56  LYS A CB  1 
ATOM   242  C CG  . LYS A 1 30 ? 6.168   -1.908  23.218  1.00 31.38 ? 56  LYS A CG  1 
ATOM   243  C CD  . LYS A 1 30 ? 7.370   -1.039  23.570  1.00 34.84 ? 56  LYS A CD  1 
ATOM   244  C CE  . LYS A 1 30 ? 8.674   -1.740  23.207  1.00 33.99 ? 56  LYS A CE  1 
ATOM   245  N NZ  . LYS A 1 30 ? 9.848   -0.829  23.340  1.00 36.59 ? 56  LYS A NZ  1 
ATOM   246  N N   . GLU A 1 31 ? 1.875   -0.378  23.099  1.00 23.53 ? 57  GLU A N   1 
ATOM   247  C CA  . GLU A 1 31 ? 0.655   0.286   23.540  1.00 23.46 ? 57  GLU A CA  1 
ATOM   248  C C   . GLU A 1 31 ? -0.539  -0.654  23.373  1.00 23.85 ? 57  GLU A C   1 
ATOM   249  O O   . GLU A 1 31 ? -1.421  -0.713  24.227  1.00 22.80 ? 57  GLU A O   1 
ATOM   250  C CB  . GLU A 1 31 ? 0.401   1.550   22.713  1.00 24.09 ? 57  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 31 ? 1.472   2.621   22.794  1.00 27.12 ? 57  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 31 ? 1.700   3.125   24.207  1.00 28.10 ? 57  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 31 ? 0.761   3.067   25.022  1.00 29.58 ? 57  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 31 ? 2.816   3.596   24.494  1.00 30.51 ? 57  GLU A OE2 1 
ATOM   255  N N   . ILE A 1 32 ? -0.563  -1.391  22.265  1.00 21.64 ? 58  ILE A N   1 
ATOM   256  C CA  . ILE A 1 32 ? -1.661  -2.311  22.000  1.00 22.88 ? 58  ILE A CA  1 
ATOM   257  C C   . ILE A 1 32 ? -1.661  -3.486  22.976  1.00 23.62 ? 58  ILE A C   1 
ATOM   258  O O   . ILE A 1 32 ? -2.718  -3.911  23.447  1.00 22.14 ? 58  ILE A O   1 
ATOM   259  C CB  . ILE A 1 32 ? -1.605  -2.834  20.543  1.00 22.94 ? 58  ILE A CB  1 
ATOM   260  C CG1 . ILE A 1 32 ? -1.951  -1.690  19.585  1.00 24.08 ? 58  ILE A CG1 1 
ATOM   261  C CG2 . ILE A 1 32 ? -2.562  -4.012  20.363  1.00 24.84 ? 58  ILE A CG2 1 
ATOM   262  C CD1 . ILE A 1 32 ? -1.887  -2.056  18.118  1.00 24.48 ? 58  ILE A CD1 1 
ATOM   263  N N   . THR A 1 33 ? -0.479  -4.011  23.281  1.00 25.19 ? 59  THR A N   1 
ATOM   264  C CA  . THR A 1 33 ? -0.388  -5.128  24.216  1.00 27.51 ? 59  THR A CA  1 
ATOM   265  C C   . THR A 1 33 ? -0.850  -4.654  25.591  1.00 28.73 ? 59  THR A C   1 
ATOM   266  O O   . THR A 1 33 ? -1.508  -5.390  26.334  1.00 27.19 ? 59  THR A O   1 
ATOM   267  C CB  . THR A 1 33 ? 1.053   -5.655  24.317  1.00 28.02 ? 59  THR A CB  1 
ATOM   268  O OG1 . THR A 1 33 ? 1.480   -6.114  23.028  1.00 31.18 ? 59  THR A OG1 1 
ATOM   269  C CG2 . THR A 1 33 ? 1.133   -6.805  25.308  1.00 29.11 ? 59  THR A CG2 1 
ATOM   270  N N   . PHE A 1 34 ? -0.511  -3.412  25.921  1.00 29.57 ? 60  PHE A N   1 
ATOM   271  C CA  . PHE A 1 34 ? -0.903  -2.845  27.200  1.00 31.26 ? 60  PHE A CA  1 
ATOM   272  C C   . PHE A 1 34 ? -2.421  -2.706  27.218  1.00 30.98 ? 60  PHE A C   1 
ATOM   273  O O   . PHE A 1 34 ? -3.069  -3.031  28.209  1.00 31.68 ? 60  PHE A O   1 
ATOM   274  C CB  . PHE A 1 34 ? -0.236  -1.480  27.404  1.00 33.14 ? 60  PHE A CB  1 
ATOM   275  C CG  . PHE A 1 34 ? -0.439  -0.912  28.780  1.00 37.18 ? 60  PHE A CG  1 
ATOM   276  C CD1 . PHE A 1 34 ? -1.672  -0.386  29.157  1.00 38.50 ? 60  PHE A CD1 1 
ATOM   277  C CD2 . PHE A 1 34 ? 0.589   -0.945  29.717  1.00 38.38 ? 60  PHE A CD2 1 
ATOM   278  C CE1 . PHE A 1 34 ? -1.879  0.096   30.451  1.00 39.27 ? 60  PHE A CE1 1 
ATOM   279  C CE2 . PHE A 1 34 ? 0.392   -0.466  31.011  1.00 39.74 ? 60  PHE A CE2 1 
ATOM   280  C CZ  . PHE A 1 34 ? -0.845  0.054   31.378  1.00 39.09 ? 60  PHE A CZ  1 
ATOM   281  N N   . LEU A 1 35 ? -2.979  -2.225  26.110  1.00 30.41 ? 61  LEU A N   1 
ATOM   282  C CA  . LEU A 1 35 ? -4.422  -2.057  25.982  1.00 30.26 ? 61  LEU A CA  1 
ATOM   283  C C   . LEU A 1 35 ? -5.103  -3.415  26.142  1.00 29.92 ? 61  LEU A C   1 
ATOM   284  O O   . LEU A 1 35 ? -6.125  -3.534  26.819  1.00 29.41 ? 61  LEU A O   1 
ATOM   285  C CB  . LEU A 1 35 ? -4.759  -1.454  24.612  1.00 31.08 ? 61  LEU A CB  1 
ATOM   286  C CG  . LEU A 1 35 ? -6.230  -1.287  24.219  1.00 35.00 ? 61  LEU A CG  1 
ATOM   287  C CD1 . LEU A 1 35 ? -6.962  -0.446  25.262  1.00 34.49 ? 61  LEU A CD1 1 
ATOM   288  C CD2 . LEU A 1 35 ? -6.316  -0.630  22.845  1.00 34.85 ? 61  LEU A CD2 1 
ATOM   289  N N   . LYS A 1 36 ? -4.527  -4.441  25.523  1.00 29.27 ? 62  LYS A N   1 
ATOM   290  C CA  . LYS A 1 36 ? -5.088  -5.781  25.610  1.00 29.55 ? 62  LYS A CA  1 
ATOM   291  C C   . LYS A 1 36 ? -5.190  -6.257  27.053  1.00 29.47 ? 62  LYS A C   1 
ATOM   292  O O   . LYS A 1 36 ? -6.272  -6.605  27.526  1.00 30.19 ? 62  LYS A O   1 
ATOM   293  C CB  . LYS A 1 36 ? -4.237  -6.786  24.827  1.00 28.90 ? 62  LYS A CB  1 
ATOM   294  C CG  . LYS A 1 36 ? -4.793  -8.208  24.906  1.00 29.19 ? 62  LYS A CG  1 
ATOM   295  C CD  . LYS A 1 36 ? -3.846  -9.240  24.320  1.00 30.20 ? 62  LYS A CD  1 
ATOM   296  C CE  . LYS A 1 36 ? -2.631  -9.447  25.204  1.00 26.89 ? 62  LYS A CE  1 
ATOM   297  N NZ  . LYS A 1 36 ? -1.774  -10.526 24.659  1.00 30.86 ? 62  LYS A NZ  1 
ATOM   298  N N   . ASN A 1 37 ? -4.054  -6.282  27.742  1.00 29.68 ? 63  ASN A N   1 
ATOM   299  C CA  . ASN A 1 37 ? -4.010  -6.733  29.126  1.00 31.23 ? 63  ASN A CA  1 
ATOM   300  C C   . ASN A 1 37 ? -4.955  -5.944  30.031  1.00 30.85 ? 63  ASN A C   1 
ATOM   301  O O   . ASN A 1 37 ? -5.609  -6.517  30.898  1.00 31.20 ? 63  ASN A O   1 
ATOM   302  C CB  . ASN A 1 37 ? -2.574  -6.657  29.654  1.00 32.73 ? 63  ASN A CB  1 
ATOM   303  C CG  . ASN A 1 37 ? -1.623  -7.562  28.881  1.00 33.39 ? 63  ASN A CG  1 
ATOM   304  O OD1 . ASN A 1 37 ? -1.977  -8.684  28.519  1.00 37.09 ? 63  ASN A OD1 1 
ATOM   305  N ND2 . ASN A 1 37 ? -0.411  -7.084  28.639  1.00 33.10 ? 63  ASN A ND2 1 
ATOM   306  N N   . THR A 1 38 ? -5.032  -4.632  29.828  1.00 31.82 ? 64  THR A N   1 
ATOM   307  C CA  . THR A 1 38 ? -5.921  -3.797  30.633  1.00 32.31 ? 64  THR A CA  1 
ATOM   308  C C   . THR A 1 38 ? -7.372  -4.245  30.435  1.00 32.92 ? 64  THR A C   1 
ATOM   309  O O   . THR A 1 38 ? -8.138  -4.358  31.393  1.00 31.05 ? 64  THR A O   1 
ATOM   310  C CB  . THR A 1 38 ? -5.793  -2.310  30.242  1.00 33.30 ? 64  THR A CB  1 
ATOM   311  O OG1 . THR A 1 38 ? -4.464  -1.854  30.525  1.00 33.65 ? 64  THR A OG1 1 
ATOM   312  C CG2 . THR A 1 38 ? -6.785  -1.465  31.016  1.00 33.28 ? 64  THR A CG2 1 
ATOM   313  N N   . VAL A 1 39 ? -7.739  -4.504  29.182  1.00 33.27 ? 65  VAL A N   1 
ATOM   314  C CA  . VAL A 1 39 ? -9.090  -4.949  28.844  1.00 34.39 ? 65  VAL A CA  1 
ATOM   315  C C   . VAL A 1 39 ? -9.365  -6.332  29.431  1.00 36.56 ? 65  VAL A C   1 
ATOM   316  O O   . VAL A 1 39 ? -10.480 -6.622  29.876  1.00 36.43 ? 65  VAL A O   1 
ATOM   317  C CB  . VAL A 1 39 ? -9.284  -4.994  27.310  1.00 33.21 ? 65  VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 39 ? -10.625 -5.627  26.955  1.00 31.90 ? 65  VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 39 ? -9.210  -3.590  26.750  1.00 31.27 ? 65  VAL A CG2 1 
ATOM   320  N N   . MET A 1 40 ? -8.345  -7.182  29.433  1.00 37.65 ? 66  MET A N   1 
ATOM   321  C CA  . MET A 1 40 ? -8.479  -8.528  29.975  1.00 39.95 ? 66  MET A CA  1 
ATOM   322  C C   . MET A 1 40 ? -8.799  -8.475  31.468  1.00 42.77 ? 66  MET A C   1 
ATOM   323  O O   . MET A 1 40 ? -9.475  -9.359  32.000  1.00 42.95 ? 66  MET A O   1 
ATOM   324  C CB  . MET A 1 40 ? -7.187  -9.317  29.747  1.00 38.84 ? 66  MET A CB  1 
ATOM   325  C CG  . MET A 1 40 ? -6.938  -9.698  28.297  1.00 38.44 ? 66  MET A CG  1 
ATOM   326  S SD  . MET A 1 40 ? -5.300  -10.419 28.034  1.00 38.64 ? 66  MET A SD  1 
ATOM   327  C CE  . MET A 1 40 ? -5.422  -11.906 29.037  1.00 36.35 ? 66  MET A CE  1 
ATOM   328  N N   . GLU A 1 41 ? -8.315  -7.432  32.137  1.00 45.36 ? 67  GLU A N   1 
ATOM   329  C CA  . GLU A 1 41 ? -8.545  -7.259  33.569  1.00 48.77 ? 67  GLU A CA  1 
ATOM   330  C C   . GLU A 1 41 ? -9.706  -6.320  33.881  1.00 49.58 ? 67  GLU A C   1 
ATOM   331  O O   . GLU A 1 41 ? -9.874  -5.888  35.021  1.00 49.49 ? 67  GLU A O   1 
ATOM   332  C CB  . GLU A 1 41 ? -7.276  -6.741  34.254  1.00 49.73 ? 67  GLU A CB  1 
ATOM   333  C CG  . GLU A 1 41 ? -6.382  -7.828  34.846  1.00 53.01 ? 67  GLU A CG  1 
ATOM   334  C CD  . GLU A 1 41 ? -5.850  -8.797  33.809  1.00 54.94 ? 67  GLU A CD  1 
ATOM   335  O OE1 . GLU A 1 41 ? -5.170  -8.346  32.861  1.00 56.76 ? 67  GLU A OE1 1 
ATOM   336  O OE2 . GLU A 1 41 ? -6.109  -10.011 33.945  1.00 56.08 ? 67  GLU A OE2 1 
ATOM   337  N N   . CYS A 1 42 ? -10.510 -6.002  32.872  1.00 51.05 ? 68  CYS A N   1 
ATOM   338  C CA  . CYS A 1 42 ? -11.647 -5.117  33.088  1.00 52.24 ? 68  CYS A CA  1 
ATOM   339  C C   . CYS A 1 42 ? -12.750 -5.874  33.819  1.00 53.58 ? 68  CYS A C   1 
ATOM   340  O O   . CYS A 1 42 ? -13.387 -6.761  33.252  1.00 54.18 ? 68  CYS A O   1 
ATOM   341  C CB  . CYS A 1 42 ? -12.178 -4.585  31.757  1.00 51.96 ? 68  CYS A CB  1 
ATOM   342  S SG  . CYS A 1 42 ? -13.451 -3.301  31.974  1.00 50.91 ? 68  CYS A SG  1 
ATOM   343  N N   . ASP A 1 43 ? -12.969 -5.516  35.081  1.00 55.11 ? 69  ASP A N   1 
ATOM   344  C CA  . ASP A 1 43 ? -13.983 -6.167  35.903  1.00 56.20 ? 69  ASP A CA  1 
ATOM   345  C C   . ASP A 1 43 ? -15.351 -6.252  35.237  1.00 56.46 ? 69  ASP A C   1 
ATOM   346  O O   . ASP A 1 43 ? -16.073 -7.234  35.418  1.00 57.00 ? 69  ASP A O   1 
ATOM   347  C CB  . ASP A 1 43 ? -14.110 -5.447  37.247  1.00 57.83 ? 69  ASP A CB  1 
ATOM   348  C CG  . ASP A 1 43 ? -12.851 -5.556  38.085  1.00 59.71 ? 69  ASP A CG  1 
ATOM   349  O OD1 . ASP A 1 43 ? -12.413 -6.696  38.354  1.00 61.04 ? 69  ASP A OD1 1 
ATOM   350  O OD2 . ASP A 1 43 ? -12.299 -4.506  38.477  1.00 60.89 ? 69  ASP A OD2 1 
ATOM   351  N N   . ALA A 1 44 ? -15.709 -5.227  34.471  1.00 56.19 ? 70  ALA A N   1 
ATOM   352  C CA  . ALA A 1 44 ? -16.996 -5.206  33.786  1.00 56.37 ? 70  ALA A CA  1 
ATOM   353  C C   . ALA A 1 44 ? -17.114 -6.380  32.819  1.00 56.45 ? 70  ALA A C   1 
ATOM   354  O O   . ALA A 1 44 ? -18.218 -6.831  32.511  1.00 56.23 ? 70  ALA A O   1 
ATOM   355  C CB  . ALA A 1 44 ? -17.167 -3.892  33.035  1.00 56.30 ? 70  ALA A CB  1 
ATOM   356  N N   . CYS A 1 45 ? -15.972 -6.871  32.346  1.00 56.68 ? 71  CYS A N   1 
ATOM   357  C CA  . CYS A 1 45 ? -15.940 -7.991  31.408  1.00 57.26 ? 71  CYS A CA  1 
ATOM   358  C C   . CYS A 1 45 ? -15.749 -9.341  32.098  1.00 57.49 ? 71  CYS A C   1 
ATOM   359  O O   . CYS A 1 45 ? -16.509 -10.279 31.769  1.00 57.13 ? 71  CYS A O   1 
ATOM   360  C CB  . CYS A 1 45 ? -14.829 -7.791  30.375  1.00 56.59 ? 71  CYS A CB  1 
ATOM   361  S SG  . CYS A 1 45 ? -15.101 -6.417  29.207  1.00 56.60 ? 71  CYS A SG  1 
ATOM   362  O OXT . CYS A 1 45 ? -14.834 -9.453  32.942  1.00 58.20 ? 71  CYS A OXT 1 
ATOM   363  N N   . MET B 1 1  ? 32.819  7.719   -9.556  1.00 47.89 ? 27  MET B N   1 
ATOM   364  C CA  . MET B 1 1  ? 32.654  6.715   -8.467  1.00 47.35 ? 27  MET B CA  1 
ATOM   365  C C   . MET B 1 1  ? 31.409  5.859   -8.663  1.00 44.34 ? 27  MET B C   1 
ATOM   366  O O   . MET B 1 1  ? 30.287  6.350   -8.553  1.00 45.00 ? 27  MET B O   1 
ATOM   367  C CB  . MET B 1 1  ? 32.579  7.417   -7.106  1.00 50.80 ? 27  MET B CB  1 
ATOM   368  C CG  . MET B 1 1  ? 33.929  7.668   -6.442  1.00 54.62 ? 27  MET B CG  1 
ATOM   369  S SD  . MET B 1 1  ? 35.133  8.521   -7.488  1.00 61.54 ? 27  MET B SD  1 
ATOM   370  C CE  . MET B 1 1  ? 36.131  7.126   -8.071  1.00 59.24 ? 27  MET B CE  1 
ATOM   371  N N   . ASP B 1 2  ? 31.621  4.578   -8.959  1.00 39.77 ? 28  ASP B N   1 
ATOM   372  C CA  . ASP B 1 2  ? 30.527  3.627   -9.155  1.00 35.90 ? 28  ASP B CA  1 
ATOM   373  C C   . ASP B 1 2  ? 29.723  3.540   -7.858  1.00 32.63 ? 28  ASP B C   1 
ATOM   374  O O   . ASP B 1 2  ? 30.254  3.164   -6.809  1.00 31.64 ? 28  ASP B O   1 
ATOM   375  C CB  . ASP B 1 2  ? 31.108  2.260   -9.539  1.00 34.31 ? 28  ASP B CB  1 
ATOM   376  C CG  . ASP B 1 2  ? 30.070  1.155   -9.552  1.00 35.23 ? 28  ASP B CG  1 
ATOM   377  O OD1 . ASP B 1 2  ? 28.888  1.423   -9.861  1.00 32.32 ? 28  ASP B OD1 1 
ATOM   378  O OD2 . ASP B 1 2  ? 30.453  0.002   -9.267  1.00 36.27 ? 28  ASP B OD2 1 
ATOM   379  N N   . LEU B 1 3  ? 28.442  3.891   -7.933  1.00 30.17 ? 29  LEU B N   1 
ATOM   380  C CA  . LEU B 1 3  ? 27.582  3.889   -6.752  1.00 25.38 ? 29  LEU B CA  1 
ATOM   381  C C   . LEU B 1 3  ? 26.790  2.614   -6.502  1.00 25.24 ? 29  LEU B C   1 
ATOM   382  O O   . LEU B 1 3  ? 26.092  2.507   -5.494  1.00 20.59 ? 29  LEU B O   1 
ATOM   383  C CB  . LEU B 1 3  ? 26.620  5.078   -6.819  1.00 25.78 ? 29  LEU B CB  1 
ATOM   384  C CG  . LEU B 1 3  ? 27.291  6.450   -6.937  1.00 25.81 ? 29  LEU B CG  1 
ATOM   385  C CD1 . LEU B 1 3  ? 26.225  7.545   -6.891  1.00 25.49 ? 29  LEU B CD1 1 
ATOM   386  C CD2 . LEU B 1 3  ? 28.293  6.630   -5.804  1.00 26.41 ? 29  LEU B CD2 1 
ATOM   387  N N   . ALA B 1 4  ? 26.894  1.651   -7.415  1.00 24.04 ? 30  ALA B N   1 
ATOM   388  C CA  . ALA B 1 4  ? 26.174  0.389   -7.272  1.00 24.77 ? 30  ALA B CA  1 
ATOM   389  C C   . ALA B 1 4  ? 26.395  -0.255  -5.900  1.00 24.55 ? 30  ALA B C   1 
ATOM   390  O O   . ALA B 1 4  ? 25.445  -0.691  -5.255  1.00 23.62 ? 30  ALA B O   1 
ATOM   391  C CB  . ALA B 1 4  ? 26.591  -0.582  -8.379  1.00 25.61 ? 30  ALA B CB  1 
ATOM   392  N N   . PRO B 1 5  ? 27.659  -0.332  -5.442  1.00 25.25 ? 31  PRO B N   1 
ATOM   393  C CA  . PRO B 1 5  ? 27.963  -0.933  -4.138  1.00 24.46 ? 31  PRO B CA  1 
ATOM   394  C C   . PRO B 1 5  ? 27.170  -0.298  -2.997  1.00 23.71 ? 31  PRO B C   1 
ATOM   395  O O   . PRO B 1 5  ? 26.656  -0.996  -2.118  1.00 21.36 ? 31  PRO B O   1 
ATOM   396  C CB  . PRO B 1 5  ? 29.464  -0.701  -3.996  1.00 26.73 ? 31  PRO B CB  1 
ATOM   397  C CG  . PRO B 1 5  ? 29.943  -0.771  -5.410  1.00 25.69 ? 31  PRO B CG  1 
ATOM   398  C CD  . PRO B 1 5  ? 28.900  0.038   -6.145  1.00 25.99 ? 31  PRO B CD  1 
ATOM   399  N N   . GLN B 1 6  ? 27.085  1.029   -3.005  1.00 22.57 ? 32  GLN B N   1 
ATOM   400  C CA  . GLN B 1 6  ? 26.339  1.740   -1.971  1.00 20.96 ? 32  GLN B CA  1 
ATOM   401  C C   . GLN B 1 6  ? 24.837  1.536   -2.142  1.00 18.71 ? 32  GLN B C   1 
ATOM   402  O O   . GLN B 1 6  ? 24.117  1.366   -1.159  1.00 19.07 ? 32  GLN B O   1 
ATOM   403  C CB  . GLN B 1 6  ? 26.672  3.237   -2.002  1.00 22.93 ? 32  GLN B CB  1 
ATOM   404  C CG  . GLN B 1 6  ? 28.083  3.563   -1.515  1.00 25.34 ? 32  GLN B CG  1 
ATOM   405  C CD  . GLN B 1 6  ? 28.437  5.040   -1.669  1.00 27.41 ? 32  GLN B CD  1 
ATOM   406  O OE1 . GLN B 1 6  ? 27.833  5.912   -1.035  1.00 26.35 ? 32  GLN B OE1 1 
ATOM   407  N NE2 . GLN B 1 6  ? 29.413  5.322   -2.517  1.00 26.13 ? 32  GLN B NE2 1 
ATOM   408  N N   . MET B 1 7  ? 24.355  1.550   -3.383  1.00 18.46 ? 33  MET B N   1 
ATOM   409  C CA  . MET B 1 7  ? 22.925  1.352   -3.612  1.00 19.28 ? 33  MET B CA  1 
ATOM   410  C C   . MET B 1 7  ? 22.495  -0.023  -3.114  1.00 20.05 ? 33  MET B C   1 
ATOM   411  O O   . MET B 1 7  ? 21.454  -0.163  -2.470  1.00 19.18 ? 33  MET B O   1 
ATOM   412  C CB  . MET B 1 7  ? 22.578  1.505   -5.094  1.00 23.50 ? 33  MET B CB  1 
ATOM   413  C CG  . MET B 1 7  ? 22.399  2.947   -5.536  1.00 28.46 ? 33  MET B CG  1 
ATOM   414  S SD  . MET B 1 7  ? 22.061  3.092   -7.304  1.00 33.99 ? 33  MET B SD  1 
ATOM   415  C CE  . MET B 1 7  ? 20.271  2.905   -7.337  1.00 34.91 ? 33  MET B CE  1 
ATOM   416  N N   . LEU B 1 8  ? 23.303  -1.035  -3.408  1.00 19.26 ? 34  LEU B N   1 
ATOM   417  C CA  . LEU B 1 8  ? 23.005  -2.392  -2.962  1.00 19.26 ? 34  LEU B CA  1 
ATOM   418  C C   . LEU B 1 8  ? 22.886  -2.443  -1.436  1.00 19.67 ? 34  LEU B C   1 
ATOM   419  O O   . LEU B 1 8  ? 21.984  -3.082  -0.897  1.00 19.04 ? 34  LEU B O   1 
ATOM   420  C CB  . LEU B 1 8  ? 24.096  -3.359  -3.434  1.00 18.16 ? 34  LEU B CB  1 
ATOM   421  C CG  . LEU B 1 8  ? 23.939  -4.801  -2.944  1.00 18.37 ? 34  LEU B CG  1 
ATOM   422  C CD1 . LEU B 1 8  ? 22.548  -5.319  -3.273  1.00 21.85 ? 34  LEU B CD1 1 
ATOM   423  C CD2 . LEU B 1 8  ? 25.008  -5.678  -3.586  1.00 20.34 ? 34  LEU B CD2 1 
ATOM   424  N N   . ARG B 1 9  ? 23.798  -1.781  -0.730  1.00 19.98 ? 35  ARG B N   1 
ATOM   425  C CA  . ARG B 1 9  ? 23.721  -1.785  0.725   1.00 19.12 ? 35  ARG B CA  1 
ATOM   426  C C   . ARG B 1 9  ? 22.410  -1.144  1.193   1.00 19.17 ? 35  ARG B C   1 
ATOM   427  O O   . ARG B 1 9  ? 21.793  -1.605  2.153   1.00 16.43 ? 35  ARG B O   1 
ATOM   428  C CB  . ARG B 1 9  ? 24.927  -1.057  1.348   1.00 21.61 ? 35  ARG B CB  1 
ATOM   429  C CG  . ARG B 1 9  ? 26.138  -1.966  1.589   1.00 24.75 ? 35  ARG B CG  1 
ATOM   430  C CD  . ARG B 1 9  ? 27.156  -1.338  2.550   1.00 26.70 ? 35  ARG B CD  1 
ATOM   431  N NE  . ARG B 1 9  ? 27.887  -0.220  1.955   1.00 26.88 ? 35  ARG B NE  1 
ATOM   432  C CZ  . ARG B 1 9  ? 28.863  -0.353  1.059   1.00 26.74 ? 35  ARG B CZ  1 
ATOM   433  N NH1 . ARG B 1 9  ? 29.464  0.722   0.572   1.00 23.89 ? 35  ARG B NH1 1 
ATOM   434  N NH2 . ARG B 1 9  ? 29.244  -1.560  0.658   1.00 26.47 ? 35  ARG B NH2 1 
ATOM   435  N N   . GLU B 1 10 ? 21.981  -0.083  0.517   1.00 16.47 ? 36  GLU B N   1 
ATOM   436  C CA  . GLU B 1 10 ? 20.731  0.570   0.890   1.00 17.38 ? 36  GLU B CA  1 
ATOM   437  C C   . GLU B 1 10 ? 19.564  -0.383  0.665   1.00 16.02 ? 36  GLU B C   1 
ATOM   438  O O   . GLU B 1 10 ? 18.682  -0.497  1.508   1.00 17.00 ? 36  GLU B O   1 
ATOM   439  C CB  . GLU B 1 10 ? 20.512  1.853   0.081   1.00 17.73 ? 36  GLU B CB  1 
ATOM   440  C CG  . GLU B 1 10 ? 21.512  2.958   0.387   1.00 21.03 ? 36  GLU B CG  1 
ATOM   441  C CD  . GLU B 1 10 ? 21.508  3.364   1.858   1.00 18.25 ? 36  GLU B CD  1 
ATOM   442  O OE1 . GLU B 1 10 ? 20.426  3.647   2.412   1.00 20.34 ? 36  GLU B OE1 1 
ATOM   443  O OE2 . GLU B 1 10 ? 22.591  3.405   2.456   1.00 20.13 ? 36  GLU B OE2 1 
ATOM   444  N N   . LEU B 1 11 ? 19.563  -1.081  -0.465  1.00 15.75 ? 37  LEU B N   1 
ATOM   445  C CA  . LEU B 1 11 ? 18.485  -2.025  -0.749  1.00 17.13 ? 37  LEU B CA  1 
ATOM   446  C C   . LEU B 1 11 ? 18.455  -3.132  0.296   1.00 16.50 ? 37  LEU B C   1 
ATOM   447  O O   . LEU B 1 11 ? 17.388  -3.559  0.730   1.00 18.05 ? 37  LEU B O   1 
ATOM   448  C CB  . LEU B 1 11 ? 18.660  -2.635  -2.137  1.00 18.32 ? 37  LEU B CB  1 
ATOM   449  C CG  . LEU B 1 11 ? 18.585  -1.619  -3.277  1.00 21.48 ? 37  LEU B CG  1 
ATOM   450  C CD1 . LEU B 1 11 ? 18.753  -2.329  -4.611  1.00 20.73 ? 37  LEU B CD1 1 
ATOM   451  C CD2 . LEU B 1 11 ? 17.253  -0.889  -3.220  1.00 23.06 ? 37  LEU B CD2 1 
ATOM   452  N N   . GLN B 1 12 ? 19.627  -3.596  0.706   1.00 17.21 ? 38  GLN B N   1 
ATOM   453  C CA  . GLN B 1 12 ? 19.684  -4.651  1.711   1.00 17.35 ? 38  GLN B CA  1 
ATOM   454  C C   . GLN B 1 12 ? 19.155  -4.166  3.050   1.00 17.16 ? 38  GLN B C   1 
ATOM   455  O O   . GLN B 1 12 ? 18.459  -4.901  3.752   1.00 17.60 ? 38  GLN B O   1 
ATOM   456  C CB  . GLN B 1 12 ? 21.113  -5.157  1.851   1.00 17.58 ? 38  GLN B CB  1 
ATOM   457  C CG  . GLN B 1 12 ? 21.570  -5.916  0.615   1.00 17.43 ? 38  GLN B CG  1 
ATOM   458  C CD  . GLN B 1 12 ? 23.018  -6.318  0.689   1.00 21.83 ? 38  GLN B CD  1 
ATOM   459  O OE1 . GLN B 1 12 ? 23.388  -7.422  0.284   1.00 25.59 ? 38  GLN B OE1 1 
ATOM   460  N NE2 . GLN B 1 12 ? 23.852  -5.423  1.197   1.00 16.34 ? 38  GLN B NE2 1 
ATOM   461  N N   . GLU B 1 13 ? 19.501  -2.930  3.400   1.00 16.61 ? 39  GLU B N   1 
ATOM   462  C CA  . GLU B 1 13 ? 19.042  -2.320  4.644   1.00 17.68 ? 39  GLU B CA  1 
ATOM   463  C C   . GLU B 1 13 ? 17.517  -2.212  4.606   1.00 17.26 ? 39  GLU B C   1 
ATOM   464  O O   . GLU B 1 13 ? 16.836  -2.497  5.592   1.00 17.23 ? 39  GLU B O   1 
ATOM   465  C CB  . GLU B 1 13 ? 19.662  -0.925  4.805   1.00 17.85 ? 39  GLU B CB  1 
ATOM   466  C CG  . GLU B 1 13 ? 19.236  -0.186  6.072   1.00 21.18 ? 39  GLU B CG  1 
ATOM   467  C CD  . GLU B 1 13 ? 20.002  1.118   6.275   1.00 24.45 ? 39  GLU B CD  1 
ATOM   468  O OE1 . GLU B 1 13 ? 21.249  1.095   6.245   1.00 25.13 ? 39  GLU B OE1 1 
ATOM   469  O OE2 . GLU B 1 13 ? 19.356  2.165   6.468   1.00 27.82 ? 39  GLU B OE2 1 
ATOM   470  N N   . THR B 1 14 ? 16.982  -1.797  3.463   1.00 18.28 ? 40  THR B N   1 
ATOM   471  C CA  . THR B 1 14 ? 15.539  -1.671  3.307   1.00 17.98 ? 40  THR B CA  1 
ATOM   472  C C   . THR B 1 14 ? 14.849  -3.005  3.606   1.00 19.06 ? 40  THR B C   1 
ATOM   473  O O   . THR B 1 14 ? 13.882  -3.055  4.365   1.00 17.95 ? 40  THR B O   1 
ATOM   474  C CB  . THR B 1 14 ? 15.161  -1.221  1.877   1.00 19.57 ? 40  THR B CB  1 
ATOM   475  O OG1 . THR B 1 14 ? 15.510  0.160   1.700   1.00 19.44 ? 40  THR B OG1 1 
ATOM   476  C CG2 . THR B 1 14 ? 13.667  -1.387  1.641   1.00 18.95 ? 40  THR B CG2 1 
ATOM   477  N N   . ASN B 1 15 ? 15.351  -4.089  3.022   1.00 19.10 ? 41  ASN B N   1 
ATOM   478  C CA  . ASN B 1 15 ? 14.742  -5.391  3.255   1.00 18.79 ? 41  ASN B CA  1 
ATOM   479  C C   . ASN B 1 15 ? 14.847  -5.865  4.696   1.00 19.02 ? 41  ASN B C   1 
ATOM   480  O O   . ASN B 1 15 ? 13.934  -6.519  5.201   1.00 18.66 ? 41  ASN B O   1 
ATOM   481  C CB  . ASN B 1 15 ? 15.324  -6.430  2.295   1.00 20.45 ? 41  ASN B CB  1 
ATOM   482  C CG  . ASN B 1 15 ? 14.754  -6.287  0.896   1.00 27.21 ? 41  ASN B CG  1 
ATOM   483  O OD1 . ASN B 1 15 ? 13.537  -6.203  0.727   1.00 28.38 ? 41  ASN B OD1 1 
ATOM   484  N ND2 . ASN B 1 15 ? 15.621  -6.256  -0.110  1.00 26.59 ? 41  ASN B ND2 1 
ATOM   485  N N   . ALA B 1 16 ? 15.951  -5.536  5.362   1.00 19.25 ? 42  ALA B N   1 
ATOM   486  C CA  . ALA B 1 16 ? 16.136  -5.930  6.756   1.00 19.61 ? 42  ALA B CA  1 
ATOM   487  C C   . ALA B 1 16 ? 15.111  -5.184  7.605   1.00 19.45 ? 42  ALA B C   1 
ATOM   488  O O   . ALA B 1 16 ? 14.512  -5.748  8.528   1.00 17.03 ? 42  ALA B O   1 
ATOM   489  C CB  . ALA B 1 16 ? 17.549  -5.587  7.218   1.00 20.82 ? 42  ALA B CB  1 
ATOM   490  N N   . ALA B 1 17 ? 14.912  -3.912  7.280   1.00 17.61 ? 43  ALA B N   1 
ATOM   491  C CA  . ALA B 1 17 ? 13.954  -3.079  7.994   1.00 18.31 ? 43  ALA B CA  1 
ATOM   492  C C   . ALA B 1 17 ? 12.556  -3.638  7.758   1.00 18.07 ? 43  ALA B C   1 
ATOM   493  O O   . ALA B 1 17 ? 11.768  -3.770  8.688   1.00 15.50 ? 43  ALA B O   1 
ATOM   494  C CB  . ALA B 1 17 ? 14.039  -1.630  7.503   1.00 17.60 ? 43  ALA B CB  1 
ATOM   495  N N   . LEU B 1 18 ? 12.256  -3.998  6.514   1.00 18.07 ? 44  LEU B N   1 
ATOM   496  C CA  . LEU B 1 18 ? 10.941  -4.546  6.215   1.00 19.54 ? 44  LEU B CA  1 
ATOM   497  C C   . LEU B 1 18 ? 10.697  -5.886  6.896   1.00 20.97 ? 44  LEU B C   1 
ATOM   498  O O   . LEU B 1 18 ? 9.568   -6.189  7.267   1.00 20.59 ? 44  LEU B O   1 
ATOM   499  C CB  . LEU B 1 18 ? 10.741  -4.689  4.710   1.00 23.15 ? 44  LEU B CB  1 
ATOM   500  C CG  . LEU B 1 18 ? 10.315  -3.395  4.022   1.00 24.17 ? 44  LEU B CG  1 
ATOM   501  C CD1 . LEU B 1 18 ? 10.203  -3.643  2.524   1.00 23.10 ? 44  LEU B CD1 1 
ATOM   502  C CD2 . LEU B 1 18 ? 8.973   -2.921  4.592   1.00 26.69 ? 44  LEU B CD2 1 
ATOM   503  N N   . GLN B 1 19 ? 11.744  -6.692  7.053   1.00 19.31 ? 45  GLN B N   1 
ATOM   504  C CA  . GLN B 1 19 ? 11.584  -7.978  7.726   1.00 21.22 ? 45  GLN B CA  1 
ATOM   505  C C   . GLN B 1 19 ? 11.087  -7.706  9.142   1.00 19.12 ? 45  GLN B C   1 
ATOM   506  O O   . GLN B 1 19 ? 10.166  -8.370  9.636   1.00 16.92 ? 45  GLN B O   1 
ATOM   507  C CB  . GLN B 1 19 ? 12.920  -8.730  7.784   1.00 21.77 ? 45  GLN B CB  1 
ATOM   508  C CG  . GLN B 1 19 ? 13.439  -9.162  6.421   1.00 23.71 ? 45  GLN B CG  1 
ATOM   509  C CD  . GLN B 1 19 ? 14.877  -9.658  6.460   1.00 27.13 ? 45  GLN B CD  1 
ATOM   510  O OE1 . GLN B 1 19 ? 15.378  -10.213 5.480   1.00 32.12 ? 45  GLN B OE1 1 
ATOM   511  N NE2 . GLN B 1 19 ? 15.547  -9.458  7.587   1.00 27.28 ? 45  GLN B NE2 1 
ATOM   512  N N   . ASP B 1 20 ? 11.694  -6.711  9.783   1.00 18.47 ? 46  ASP B N   1 
ATOM   513  C CA  . ASP B 1 20 ? 11.324  -6.337  11.146  1.00 20.54 ? 46  ASP B CA  1 
ATOM   514  C C   . ASP B 1 20 ? 9.904   -5.793  11.174  1.00 19.72 ? 46  ASP B C   1 
ATOM   515  O O   . ASP B 1 20 ? 9.110   -6.153  12.039  1.00 19.25 ? 46  ASP B O   1 
ATOM   516  C CB  . ASP B 1 20 ? 12.301  -5.290  11.689  1.00 23.25 ? 46  ASP B CB  1 
ATOM   517  C CG  . ASP B 1 20 ? 12.096  -5.009  13.162  1.00 28.37 ? 46  ASP B CG  1 
ATOM   518  O OD1 . ASP B 1 20 ? 11.757  -5.955  13.913  1.00 32.00 ? 46  ASP B OD1 1 
ATOM   519  O OD2 . ASP B 1 20 ? 12.294  -3.846  13.574  1.00 28.71 ? 46  ASP B OD2 1 
ATOM   520  N N   . VAL B 1 21 ? 9.592   -4.918  10.225  1.00 18.77 ? 47  VAL B N   1 
ATOM   521  C CA  . VAL B 1 21 ? 8.259   -4.336  10.123  1.00 17.23 ? 47  VAL B CA  1 
ATOM   522  C C   . VAL B 1 21 ? 7.201   -5.438  9.981   1.00 18.82 ? 47  VAL B C   1 
ATOM   523  O O   . VAL B 1 21 ? 6.157   -5.405  10.628  1.00 17.70 ? 47  VAL B O   1 
ATOM   524  C CB  . VAL B 1 21 ? 8.181   -3.382  8.900   1.00 17.29 ? 47  VAL B CB  1 
ATOM   525  C CG1 . VAL B 1 21 ? 6.730   -3.056  8.564   1.00 18.10 ? 47  VAL B CG1 1 
ATOM   526  C CG2 . VAL B 1 21 ? 8.962   -2.102  9.198   1.00 16.40 ? 47  VAL B CG2 1 
ATOM   527  N N   . ARG B 1 22 ? 7.484   -6.429  9.139   1.00 19.41 ? 48  ARG B N   1 
ATOM   528  C CA  . ARG B 1 22 ? 6.542   -7.516  8.921   1.00 18.31 ? 48  ARG B CA  1 
ATOM   529  C C   . ARG B 1 22 ? 6.329   -8.347  10.192  1.00 17.83 ? 48  ARG B C   1 
ATOM   530  O O   . ARG B 1 22 ? 5.197   -8.701  10.532  1.00 16.33 ? 48  ARG B O   1 
ATOM   531  C CB  . ARG B 1 22 ? 7.043   -8.405  7.773   1.00 19.23 ? 48  ARG B CB  1 
ATOM   532  C CG  . ARG B 1 22 ? 6.101   -9.529  7.381   1.00 25.85 ? 48  ARG B CG  1 
ATOM   533  C CD  . ARG B 1 22 ? 6.594   -10.239 6.109   1.00 29.96 ? 48  ARG B CD  1 
ATOM   534  N NE  . ARG B 1 22 ? 7.974   -10.699 6.239   1.00 32.12 ? 48  ARG B NE  1 
ATOM   535  C CZ  . ARG B 1 22 ? 8.703   -11.191 5.238   1.00 32.39 ? 48  ARG B CZ  1 
ATOM   536  N NH1 . ARG B 1 22 ? 8.187   -11.296 4.022   1.00 29.86 ? 48  ARG B NH1 1 
ATOM   537  N NH2 . ARG B 1 22 ? 9.958   -11.565 5.454   1.00 33.96 ? 48  ARG B NH2 1 
ATOM   538  N N   . GLU B 1 23 ? 7.418   -8.656  10.890  1.00 18.91 ? 49  GLU B N   1 
ATOM   539  C CA  . GLU B 1 23 ? 7.342   -9.438  12.122  1.00 21.07 ? 49  GLU B CA  1 
ATOM   540  C C   . GLU B 1 23 ? 6.542   -8.677  13.184  1.00 18.66 ? 49  GLU B C   1 
ATOM   541  O O   . GLU B 1 23 ? 5.741   -9.266  13.911  1.00 18.20 ? 49  GLU B O   1 
ATOM   542  C CB  . GLU B 1 23 ? 8.761   -9.742  12.634  1.00 24.37 ? 49  GLU B CB  1 
ATOM   543  C CG  . GLU B 1 23 ? 8.833   -10.372 14.031  1.00 27.65 ? 49  GLU B CG  1 
ATOM   544  C CD  . GLU B 1 23 ? 10.260  -10.723 14.442  1.00 31.85 ? 49  GLU B CD  1 
ATOM   545  O OE1 . GLU B 1 23 ? 11.177  -9.928  14.144  1.00 36.27 ? 49  GLU B OE1 1 
ATOM   546  O OE2 . GLU B 1 23 ? 10.466  -11.784 15.072  1.00 33.52 ? 49  GLU B OE2 1 
ATOM   547  N N   . LEU B 1 24 ? 6.762   -7.369  13.268  1.00 16.80 ? 50  LEU B N   1 
ATOM   548  C CA  . LEU B 1 24 ? 6.051   -6.533  14.234  1.00 18.07 ? 50  LEU B CA  1 
ATOM   549  C C   . LEU B 1 24 ? 4.561   -6.497  13.913  1.00 18.50 ? 50  LEU B C   1 
ATOM   550  O O   . LEU B 1 24 ? 3.713   -6.631  14.799  1.00 19.07 ? 50  LEU B O   1 
ATOM   551  C CB  . LEU B 1 24 ? 6.619   -5.104  14.225  1.00 17.52 ? 50  LEU B CB  1 
ATOM   552  C CG  . LEU B 1 24 ? 7.985   -4.915  14.892  1.00 18.60 ? 50  LEU B CG  1 
ATOM   553  C CD1 . LEU B 1 24 ? 8.569   -3.555  14.535  1.00 17.45 ? 50  LEU B CD1 1 
ATOM   554  C CD2 . LEU B 1 24 ? 7.815   -5.057  16.407  1.00 20.39 ? 50  LEU B CD2 1 
ATOM   555  N N   . LEU B 1 25 ? 4.246   -6.318  12.639  1.00 19.52 ? 51  LEU B N   1 
ATOM   556  C CA  . LEU B 1 25 ? 2.858   -6.266  12.207  1.00 20.41 ? 51  LEU B CA  1 
ATOM   557  C C   . LEU B 1 25 ? 2.199   -7.611  12.495  1.00 20.20 ? 51  LEU B C   1 
ATOM   558  O O   . LEU B 1 25 ? 1.049   -7.663  12.925  1.00 20.68 ? 51  LEU B O   1 
ATOM   559  C CB  . LEU B 1 25 ? 2.782   -5.930  10.710  1.00 22.55 ? 51  LEU B CB  1 
ATOM   560  C CG  . LEU B 1 25 ? 1.426   -5.664  10.053  1.00 24.88 ? 51  LEU B CG  1 
ATOM   561  C CD1 . LEU B 1 25 ? 0.642   -4.621  10.839  1.00 25.06 ? 51  LEU B CD1 1 
ATOM   562  C CD2 . LEU B 1 25 ? 1.659   -5.188  8.613   1.00 24.25 ? 51  LEU B CD2 1 
ATOM   563  N N   . ARG B 1 26 ? 2.931   -8.698  12.275  1.00 20.79 ? 52  ARG B N   1 
ATOM   564  C CA  . ARG B 1 26 ? 2.386   -10.023 12.537  1.00 22.34 ? 52  ARG B CA  1 
ATOM   565  C C   . ARG B 1 26 ? 2.026   -10.162 14.010  1.00 20.57 ? 52  ARG B C   1 
ATOM   566  O O   . ARG B 1 26 ? 0.960   -10.670 14.348  1.00 20.63 ? 52  ARG B O   1 
ATOM   567  C CB  . ARG B 1 26 ? 3.384   -11.121 12.153  1.00 24.58 ? 52  ARG B CB  1 
ATOM   568  C CG  . ARG B 1 26 ? 3.585   -11.303 10.655  1.00 33.55 ? 52  ARG B CG  1 
ATOM   569  C CD  . ARG B 1 26 ? 4.462   -12.519 10.351  1.00 37.55 ? 52  ARG B CD  1 
ATOM   570  N NE  . ARG B 1 26 ? 4.795   -12.622 8.929   1.00 41.67 ? 52  ARG B NE  1 
ATOM   571  C CZ  . ARG B 1 26 ? 3.914   -12.882 7.968   1.00 43.36 ? 52  ARG B CZ  1 
ATOM   572  N NH1 . ARG B 1 26 ? 2.639   -13.071 8.269   1.00 44.88 ? 52  ARG B NH1 1 
ATOM   573  N NH2 . ARG B 1 26 ? 4.307   -12.951 6.701   1.00 45.22 ? 52  ARG B NH2 1 
ATOM   574  N N   . GLN B 1 27 ? 2.910   -9.714  14.893  1.00 21.73 ? 53  GLN B N   1 
ATOM   575  C CA  . GLN B 1 27 ? 2.612   -9.827  16.313  1.00 21.66 ? 53  GLN B CA  1 
ATOM   576  C C   . GLN B 1 27 ? 1.487   -8.870  16.696  1.00 19.33 ? 53  GLN B C   1 
ATOM   577  O O   . GLN B 1 27 ? 0.651   -9.189  17.537  1.00 16.54 ? 53  GLN B O   1 
ATOM   578  C CB  . GLN B 1 27 ? 3.862   -9.561  17.166  1.00 24.16 ? 53  GLN B CB  1 
ATOM   579  C CG  . GLN B 1 27 ? 4.470   -8.178  17.034  1.00 35.96 ? 53  GLN B CG  1 
ATOM   580  C CD  . GLN B 1 27 ? 5.693   -7.986  17.925  1.00 39.17 ? 53  GLN B CD  1 
ATOM   581  O OE1 . GLN B 1 27 ? 5.583   -7.903  19.151  1.00 41.81 ? 53  GLN B OE1 1 
ATOM   582  N NE2 . GLN B 1 27 ? 6.867   -7.926  17.308  1.00 42.54 ? 53  GLN B NE2 1 
ATOM   583  N N   . GLN B 1 28 ? 1.443   -7.707  16.055  1.00 17.59 ? 54  GLN B N   1 
ATOM   584  C CA  . GLN B 1 28 ? 0.411   -6.736  16.378  1.00 16.44 ? 54  GLN B CA  1 
ATOM   585  C C   . GLN B 1 28 ? -0.978  -7.236  15.992  1.00 17.34 ? 54  GLN B C   1 
ATOM   586  O O   . GLN B 1 28 ? -1.946  -7.023  16.725  1.00 16.83 ? 54  GLN B O   1 
ATOM   587  C CB  . GLN B 1 28 ? 0.711   -5.396  15.702  1.00 17.45 ? 54  GLN B CB  1 
ATOM   588  C CG  . GLN B 1 28 ? -0.248  -4.285  16.112  1.00 17.58 ? 54  GLN B CG  1 
ATOM   589  C CD  . GLN B 1 28 ? 0.141   -2.948  15.525  1.00 19.03 ? 54  GLN B CD  1 
ATOM   590  O OE1 . GLN B 1 28 ? 0.819   -2.143  16.163  1.00 20.04 ? 54  GLN B OE1 1 
ATOM   591  N NE2 . GLN B 1 28 ? -0.268  -2.713  14.294  1.00 20.13 ? 54  GLN B NE2 1 
ATOM   592  N N   . VAL B 1 29 ? -1.081  -7.909  14.848  1.00 15.39 ? 55  VAL B N   1 
ATOM   593  C CA  . VAL B 1 29 ? -2.367  -8.442  14.415  1.00 18.22 ? 55  VAL B CA  1 
ATOM   594  C C   . VAL B 1 29 ? -2.845  -9.493  15.410  1.00 18.50 ? 55  VAL B C   1 
ATOM   595  O O   . VAL B 1 29 ? -4.041  -9.619  15.664  1.00 19.90 ? 55  VAL B O   1 
ATOM   596  C CB  . VAL B 1 29 ? -2.267  -9.106  13.020  1.00 19.98 ? 55  VAL B CB  1 
ATOM   597  C CG1 . VAL B 1 29 ? -3.592  -9.770  12.663  1.00 23.42 ? 55  VAL B CG1 1 
ATOM   598  C CG2 . VAL B 1 29 ? -1.895  -8.064  11.983  1.00 24.15 ? 55  VAL B CG2 1 
ATOM   599  N N   . LYS B 1 30 ? -1.907  -10.250 15.975  1.00 18.65 ? 56  LYS B N   1 
ATOM   600  C CA  . LYS B 1 30 ? -2.276  -11.285 16.939  1.00 20.59 ? 56  LYS B CA  1 
ATOM   601  C C   . LYS B 1 30 ? -2.837  -10.678 18.225  1.00 20.74 ? 56  LYS B C   1 
ATOM   602  O O   . LYS B 1 30 ? -3.769  -11.216 18.828  1.00 19.08 ? 56  LYS B O   1 
ATOM   603  C CB  . LYS B 1 30 ? -1.064  -12.160 17.266  1.00 22.19 ? 56  LYS B CB  1 
ATOM   604  C CG  . LYS B 1 30 ? -1.407  -13.347 18.147  1.00 26.78 ? 56  LYS B CG  1 
ATOM   605  C CD  . LYS B 1 30 ? -0.270  -14.346 18.237  1.00 30.26 ? 56  LYS B CD  1 
ATOM   606  C CE  . LYS B 1 30 ? -0.721  -15.591 18.996  1.00 32.73 ? 56  LYS B CE  1 
ATOM   607  N NZ  . LYS B 1 30 ? 0.337   -16.640 19.048  1.00 36.16 ? 56  LYS B NZ  1 
ATOM   608  N N   . GLU B 1 31 ? -2.257  -9.560  18.644  1.00 19.51 ? 57  GLU B N   1 
ATOM   609  C CA  . GLU B 1 31 ? -2.699  -8.864  19.847  1.00 20.47 ? 57  GLU B CA  1 
ATOM   610  C C   . GLU B 1 31 ? -4.088  -8.277  19.640  1.00 20.20 ? 57  GLU B C   1 
ATOM   611  O O   . GLU B 1 31 ? -4.947  -8.378  20.510  1.00 21.12 ? 57  GLU B O   1 
ATOM   612  C CB  . GLU B 1 31 ? -1.720  -7.743  20.196  1.00 21.90 ? 57  GLU B CB  1 
ATOM   613  C CG  . GLU B 1 31 ? -0.340  -8.239  20.574  1.00 26.00 ? 57  GLU B CG  1 
ATOM   614  C CD  . GLU B 1 31 ? -0.346  -9.005  21.882  1.00 29.48 ? 57  GLU B CD  1 
ATOM   615  O OE1 . GLU B 1 31 ? -0.446  -8.367  22.946  1.00 32.10 ? 57  GLU B OE1 1 
ATOM   616  O OE2 . GLU B 1 31 ? -0.263  -10.247 21.846  1.00 33.83 ? 57  GLU B OE2 1 
ATOM   617  N N   . ILE B 1 32 ? -4.298  -7.653  18.486  1.00 19.75 ? 58  ILE B N   1 
ATOM   618  C CA  . ILE B 1 32 ? -5.588  -7.054  18.165  1.00 20.05 ? 58  ILE B CA  1 
ATOM   619  C C   . ILE B 1 32 ? -6.664  -8.126  18.043  1.00 22.08 ? 58  ILE B C   1 
ATOM   620  O O   . ILE B 1 32 ? -7.811  -7.919  18.456  1.00 22.06 ? 58  ILE B O   1 
ATOM   621  C CB  . ILE B 1 32 ? -5.521  -6.258  16.843  1.00 20.76 ? 58  ILE B CB  1 
ATOM   622  C CG1 . ILE B 1 32 ? -4.581  -5.061  17.016  1.00 19.26 ? 58  ILE B CG1 1 
ATOM   623  C CG2 . ILE B 1 32 ? -6.931  -5.803  16.429  1.00 20.41 ? 58  ILE B CG2 1 
ATOM   624  C CD1 . ILE B 1 32 ? -4.324  -4.276  15.740  1.00 20.44 ? 58  ILE B CD1 1 
ATOM   625  N N   . THR B 1 33 ? -6.292  -9.266  17.466  1.00 19.73 ? 59  THR B N   1 
ATOM   626  C CA  . THR B 1 33 ? -7.228  -10.367 17.302  1.00 20.88 ? 59  THR B CA  1 
ATOM   627  C C   . THR B 1 33 ? -7.663  -10.876 18.671  1.00 21.70 ? 59  THR B C   1 
ATOM   628  O O   . THR B 1 33 ? -8.826  -11.207 18.874  1.00 23.68 ? 59  THR B O   1 
ATOM   629  C CB  . THR B 1 33 ? -6.596  -11.526 16.505  1.00 21.91 ? 59  THR B CB  1 
ATOM   630  O OG1 . THR B 1 33 ? -6.263  -11.064 15.184  1.00 21.67 ? 59  THR B OG1 1 
ATOM   631  C CG2 . THR B 1 33 ? -7.574  -12.702 16.411  1.00 22.92 ? 59  THR B CG2 1 
ATOM   632  N N   . PHE B 1 34 ? -6.724  -10.925 19.607  1.00 22.53 ? 60  PHE B N   1 
ATOM   633  C CA  . PHE B 1 34 ? -7.021  -11.377 20.962  1.00 25.85 ? 60  PHE B CA  1 
ATOM   634  C C   . PHE B 1 34 ? -7.903  -10.336 21.655  1.00 26.42 ? 60  PHE B C   1 
ATOM   635  O O   . PHE B 1 34 ? -8.849  -10.678 22.359  1.00 26.45 ? 60  PHE B O   1 
ATOM   636  C CB  . PHE B 1 34 ? -5.728  -11.565 21.757  1.00 25.33 ? 60  PHE B CB  1 
ATOM   637  C CG  . PHE B 1 34 ? -5.920  -12.309 23.044  1.00 30.10 ? 60  PHE B CG  1 
ATOM   638  C CD1 . PHE B 1 34 ? -5.840  -13.697 23.076  1.00 30.92 ? 60  PHE B CD1 1 
ATOM   639  C CD2 . PHE B 1 34 ? -6.222  -11.627 24.218  1.00 29.93 ? 60  PHE B CD2 1 
ATOM   640  C CE1 . PHE B 1 34 ? -6.059  -14.398 24.262  1.00 33.27 ? 60  PHE B CE1 1 
ATOM   641  C CE2 . PHE B 1 34 ? -6.443  -12.319 25.410  1.00 31.40 ? 60  PHE B CE2 1 
ATOM   642  C CZ  . PHE B 1 34 ? -6.361  -13.707 25.431  1.00 31.55 ? 60  PHE B CZ  1 
ATOM   643  N N   . LEU B 1 35 ? -7.583  -9.062  21.453  1.00 27.07 ? 61  LEU B N   1 
ATOM   644  C CA  . LEU B 1 35 ? -8.358  -7.973  22.042  1.00 28.56 ? 61  LEU B CA  1 
ATOM   645  C C   . LEU B 1 35 ? -9.793  -8.021  21.520  1.00 29.55 ? 61  LEU B C   1 
ATOM   646  O O   . LEU B 1 35 ? -10.741 -7.809  22.274  1.00 30.02 ? 61  LEU B O   1 
ATOM   647  C CB  . LEU B 1 35 ? -7.717  -6.623  21.692  1.00 28.86 ? 61  LEU B CB  1 
ATOM   648  C CG  . LEU B 1 35 ? -8.438  -5.346  22.137  1.00 31.57 ? 61  LEU B CG  1 
ATOM   649  C CD1 . LEU B 1 35 ? -8.736  -5.405  23.631  1.00 30.52 ? 61  LEU B CD1 1 
ATOM   650  C CD2 . LEU B 1 35 ? -7.565  -4.140  21.812  1.00 32.75 ? 61  LEU B CD2 1 
ATOM   651  N N   . LYS B 1 36 ? -9.943  -8.306  20.227  1.00 30.36 ? 62  LYS B N   1 
ATOM   652  C CA  . LYS B 1 36 ? -11.259 -8.401  19.594  1.00 31.65 ? 62  LYS B CA  1 
ATOM   653  C C   . LYS B 1 36 ? -12.096 -9.472  20.279  1.00 32.57 ? 62  LYS B C   1 
ATOM   654  O O   . LYS B 1 36 ? -13.199 -9.205  20.759  1.00 34.03 ? 62  LYS B O   1 
ATOM   655  C CB  . LYS B 1 36 ? -11.125 -8.768  18.107  1.00 28.80 ? 62  LYS B CB  1 
ATOM   656  C CG  . LYS B 1 36 ? -12.464 -8.972  17.391  1.00 28.87 ? 62  LYS B CG  1 
ATOM   657  C CD  . LYS B 1 36 ? -12.318 -9.744  16.073  1.00 25.02 ? 62  LYS B CD  1 
ATOM   658  C CE  . LYS B 1 36 ? -11.798 -11.166 16.299  1.00 26.10 ? 62  LYS B CE  1 
ATOM   659  N NZ  . LYS B 1 36 ? -11.655 -11.955 15.028  1.00 25.67 ? 62  LYS B NZ  1 
ATOM   660  N N   . ASN B 1 37 ? -11.564 -10.689 20.310  1.00 33.39 ? 63  ASN B N   1 
ATOM   661  C CA  . ASN B 1 37 ? -12.258 -11.814 20.919  1.00 34.20 ? 63  ASN B CA  1 
ATOM   662  C C   . ASN B 1 37 ? -12.592 -11.605 22.394  1.00 35.42 ? 63  ASN B C   1 
ATOM   663  O O   . ASN B 1 37 ? -13.618 -12.089 22.878  1.00 34.30 ? 63  ASN B O   1 
ATOM   664  C CB  . ASN B 1 37 ? -11.431 -13.091 20.743  1.00 34.08 ? 63  ASN B CB  1 
ATOM   665  C CG  . ASN B 1 37 ? -11.501 -13.631 19.329  1.00 34.79 ? 63  ASN B CG  1 
ATOM   666  O OD1 . ASN B 1 37 ? -12.578 -13.696 18.739  1.00 35.39 ? 63  ASN B OD1 1 
ATOM   667  N ND2 . ASN B 1 37 ? -10.359 -14.031 18.782  1.00 33.66 ? 63  ASN B ND2 1 
ATOM   668  N N   . THR B 1 38 ? -11.732 -10.880 23.103  1.00 34.97 ? 64  THR B N   1 
ATOM   669  C CA  . THR B 1 38 ? -11.956 -10.615 24.518  1.00 33.86 ? 64  THR B CA  1 
ATOM   670  C C   . THR B 1 38 ? -13.128 -9.659  24.707  1.00 35.25 ? 64  THR B C   1 
ATOM   671  O O   . THR B 1 38 ? -13.939 -9.828  25.620  1.00 35.58 ? 64  THR B O   1 
ATOM   672  C CB  . THR B 1 38 ? -10.701 -10.008 25.179  1.00 34.01 ? 64  THR B CB  1 
ATOM   673  O OG1 . THR B 1 38 ? -9.623  -10.954 25.118  1.00 28.47 ? 64  THR B OG1 1 
ATOM   674  C CG2 . THR B 1 38 ? -10.984 -9.650  26.635  1.00 31.64 ? 64  THR B CG2 1 
ATOM   675  N N   . VAL B 1 39 ? -13.218 -8.650  23.846  1.00 35.39 ? 65  VAL B N   1 
ATOM   676  C CA  . VAL B 1 39 ? -14.311 -7.688  23.936  1.00 35.67 ? 65  VAL B CA  1 
ATOM   677  C C   . VAL B 1 39 ? -15.606 -8.367  23.512  1.00 36.80 ? 65  VAL B C   1 
ATOM   678  O O   . VAL B 1 39 ? -16.670 -8.082  24.058  1.00 35.52 ? 65  VAL B O   1 
ATOM   679  C CB  . VAL B 1 39 ? -14.062 -6.460  23.033  1.00 35.66 ? 65  VAL B CB  1 
ATOM   680  C CG1 . VAL B 1 39 ? -15.304 -5.574  22.995  1.00 34.92 ? 65  VAL B CG1 1 
ATOM   681  C CG2 . VAL B 1 39 ? -12.872 -5.672  23.555  1.00 35.32 ? 65  VAL B CG2 1 
ATOM   682  N N   . MET B 1 40 ? -15.511 -9.268  22.537  1.00 38.41 ? 66  MET B N   1 
ATOM   683  C CA  . MET B 1 40 ? -16.687 -9.987  22.060  1.00 41.14 ? 66  MET B CA  1 
ATOM   684  C C   . MET B 1 40 ? -17.341 -10.792 23.184  1.00 43.37 ? 66  MET B C   1 
ATOM   685  O O   . MET B 1 40 ? -18.569 -10.837 23.281  1.00 43.80 ? 66  MET B O   1 
ATOM   686  C CB  . MET B 1 40 ? -16.327 -10.922 20.898  1.00 39.55 ? 66  MET B CB  1 
ATOM   687  C CG  . MET B 1 40 ? -15.920 -10.202 19.622  1.00 40.54 ? 66  MET B CG  1 
ATOM   688  S SD  . MET B 1 40 ? -15.814 -11.290 18.176  1.00 38.46 ? 66  MET B SD  1 
ATOM   689  C CE  . MET B 1 40 ? -17.218 -10.727 17.233  1.00 41.35 ? 66  MET B CE  1 
ATOM   690  N N   . GLU B 1 41 ? -16.530 -11.420 24.033  1.00 45.59 ? 67  GLU B N   1 
ATOM   691  C CA  . GLU B 1 41 ? -17.079 -12.205 25.136  1.00 49.65 ? 67  GLU B CA  1 
ATOM   692  C C   . GLU B 1 41 ? -17.079 -11.422 26.450  1.00 51.27 ? 67  GLU B C   1 
ATOM   693  O O   . GLU B 1 41 ? -16.923 -11.999 27.528  1.00 51.49 ? 67  GLU B O   1 
ATOM   694  C CB  . GLU B 1 41 ? -16.302 -13.517 25.324  1.00 50.59 ? 67  GLU B CB  1 
ATOM   695  C CG  . GLU B 1 41 ? -17.003 -14.488 26.288  1.00 52.84 ? 67  GLU B CG  1 
ATOM   696  C CD  . GLU B 1 41 ? -16.201 -15.743 26.591  1.00 53.59 ? 67  GLU B CD  1 
ATOM   697  O OE1 . GLU B 1 41 ? -15.941 -16.534 25.662  1.00 54.05 ? 67  GLU B OE1 1 
ATOM   698  O OE2 . GLU B 1 41 ? -15.837 -15.942 27.769  1.00 54.26 ? 67  GLU B OE2 1 
ATOM   699  N N   . CYS B 1 42 ? -17.256 -10.108 26.358  1.00 53.03 ? 68  CYS B N   1 
ATOM   700  C CA  . CYS B 1 42 ? -17.289 -9.263  27.547  1.00 55.16 ? 68  CYS B CA  1 
ATOM   701  C C   . CYS B 1 42 ? -18.685 -9.293  28.163  1.00 56.89 ? 68  CYS B C   1 
ATOM   702  O O   . CYS B 1 42 ? -19.678 -9.051  27.477  1.00 56.77 ? 68  CYS B O   1 
ATOM   703  C CB  . CYS B 1 42 ? -16.915 -7.820  27.193  1.00 55.11 ? 68  CYS B CB  1 
ATOM   704  S SG  . CYS B 1 42 ? -17.025 -6.672  28.606  1.00 55.21 ? 68  CYS B SG  1 
ATOM   705  N N   . ASP B 1 43 ? -18.753 -9.592  29.457  1.00 59.11 ? 69  ASP B N   1 
ATOM   706  C CA  . ASP B 1 43 ? -20.026 -9.662  30.170  1.00 61.42 ? 69  ASP B CA  1 
ATOM   707  C C   . ASP B 1 43 ? -20.858 -8.395  29.983  1.00 62.21 ? 69  ASP B C   1 
ATOM   708  O O   . ASP B 1 43 ? -21.997 -8.450  29.517  1.00 62.06 ? 69  ASP B O   1 
ATOM   709  C CB  . ASP B 1 43 ? -19.779 -9.891  31.664  1.00 62.18 ? 69  ASP B CB  1 
ATOM   710  C CG  . ASP B 1 43 ? -21.068 -10.012 32.456  1.00 62.90 ? 69  ASP B CG  1 
ATOM   711  O OD1 . ASP B 1 43 ? -21.817 -10.988 32.236  1.00 63.08 ? 69  ASP B OD1 1 
ATOM   712  O OD2 . ASP B 1 43 ? -21.333 -9.129  33.299  1.00 63.83 ? 69  ASP B OD2 1 
ATOM   713  N N   . ALA B 1 44 ? -20.283 -7.256  30.355  1.00 63.36 ? 70  ALA B N   1 
ATOM   714  C CA  . ALA B 1 44 ? -20.968 -5.977  30.230  1.00 64.35 ? 70  ALA B CA  1 
ATOM   715  C C   . ALA B 1 44 ? -21.017 -5.535  28.771  1.00 65.60 ? 70  ALA B C   1 
ATOM   716  O O   . ALA B 1 44 ? -20.330 -4.596  28.376  1.00 66.87 ? 70  ALA B O   1 
ATOM   717  C CB  . ALA B 1 44 ? -20.261 -4.924  31.072  1.00 63.93 ? 70  ALA B CB  1 
ATOM   718  N N   . CYS B 1 45 ? -21.826 -6.228  27.975  1.00 65.75 ? 71  CYS B N   1 
ATOM   719  C CA  . CYS B 1 45 ? -21.987 -5.918  26.557  1.00 65.76 ? 71  CYS B CA  1 
ATOM   720  C C   . CYS B 1 45 ? -23.220 -6.616  25.994  1.00 66.05 ? 71  CYS B C   1 
ATOM   721  O O   . CYS B 1 45 ? -24.078 -5.916  25.417  1.00 66.31 ? 71  CYS B O   1 
ATOM   722  C CB  . CYS B 1 45 ? -20.754 -6.351  25.753  1.00 65.01 ? 71  CYS B CB  1 
ATOM   723  S SG  . CYS B 1 45 ? -19.347 -5.187  25.733  1.00 63.79 ? 71  CYS B SG  1 
ATOM   724  O OXT . CYS B 1 45 ? -23.311 -7.855  26.131  1.00 66.32 ? 71  CYS B OXT 1 
ATOM   725  N N   . MET C 1 1  ? 32.922  -6.423  -9.906  1.00 38.97 ? 27  MET C N   1 
ATOM   726  C CA  . MET C 1 1  ? 31.850  -7.452  -9.808  1.00 38.31 ? 27  MET C CA  1 
ATOM   727  C C   . MET C 1 1  ? 30.497  -6.814  -10.110 1.00 37.61 ? 27  MET C C   1 
ATOM   728  O O   . MET C 1 1  ? 30.094  -5.856  -9.448  1.00 38.57 ? 27  MET C O   1 
ATOM   729  C CB  . MET C 1 1  ? 31.841  -8.066  -8.404  1.00 39.75 ? 27  MET C CB  1 
ATOM   730  C CG  . MET C 1 1  ? 30.855  -9.205  -8.221  1.00 40.75 ? 27  MET C CG  1 
ATOM   731  S SD  . MET C 1 1  ? 31.023  -10.026 -6.619  1.00 45.59 ? 27  MET C SD  1 
ATOM   732  C CE  . MET C 1 1  ? 29.695  -9.251  -5.684  1.00 44.56 ? 27  MET C CE  1 
ATOM   733  N N   . ASP C 1 2  ? 29.807  -7.343  -11.117 1.00 36.42 ? 28  ASP C N   1 
ATOM   734  C CA  . ASP C 1 2  ? 28.495  -6.831  -11.514 1.00 34.72 ? 28  ASP C CA  1 
ATOM   735  C C   . ASP C 1 2  ? 27.478  -7.088  -10.403 1.00 33.39 ? 28  ASP C C   1 
ATOM   736  O O   . ASP C 1 2  ? 27.218  -8.241  -10.039 1.00 31.90 ? 28  ASP C O   1 
ATOM   737  C CB  . ASP C 1 2  ? 28.058  -7.503  -12.819 1.00 36.69 ? 28  ASP C CB  1 
ATOM   738  C CG  . ASP C 1 2  ? 26.691  -7.045  -13.288 1.00 37.67 ? 28  ASP C CG  1 
ATOM   739  O OD1 . ASP C 1 2  ? 26.273  -5.921  -12.934 1.00 39.01 ? 28  ASP C OD1 1 
ATOM   740  O OD2 . ASP C 1 2  ? 26.041  -7.807  -14.030 1.00 38.14 ? 28  ASP C OD2 1 
ATOM   741  N N   . LEU C 1 3  ? 26.904  -6.012  -9.864  1.00 30.02 ? 29  LEU C N   1 
ATOM   742  C CA  . LEU C 1 3  ? 25.941  -6.134  -8.773  1.00 27.83 ? 29  LEU C CA  1 
ATOM   743  C C   . LEU C 1 3  ? 24.472  -6.031  -9.187  1.00 26.75 ? 29  LEU C C   1 
ATOM   744  O O   . LEU C 1 3  ? 23.584  -6.223  -8.357  1.00 27.16 ? 29  LEU C O   1 
ATOM   745  C CB  . LEU C 1 3  ? 26.233  -5.076  -7.699  1.00 26.97 ? 29  LEU C CB  1 
ATOM   746  C CG  . LEU C 1 3  ? 27.620  -5.060  -7.048  1.00 24.98 ? 29  LEU C CG  1 
ATOM   747  C CD1 . LEU C 1 3  ? 27.706  -3.903  -6.063  1.00 25.67 ? 29  LEU C CD1 1 
ATOM   748  C CD2 . LEU C 1 3  ? 27.884  -6.376  -6.341  1.00 27.29 ? 29  LEU C CD2 1 
ATOM   749  N N   . ALA C 1 4  ? 24.211  -5.734  -10.458 1.00 24.83 ? 30  ALA C N   1 
ATOM   750  C CA  . ALA C 1 4  ? 22.834  -5.602  -10.931 1.00 24.22 ? 30  ALA C CA  1 
ATOM   751  C C   . ALA C 1 4  ? 21.968  -6.822  -10.604 1.00 23.08 ? 30  ALA C C   1 
ATOM   752  O O   . ALA C 1 4  ? 20.872  -6.683  -10.057 1.00 21.97 ? 30  ALA C O   1 
ATOM   753  C CB  . ALA C 1 4  ? 22.816  -5.339  -12.432 1.00 24.68 ? 30  ALA C CB  1 
ATOM   754  N N   . PRO C 1 5  ? 22.444  -8.035  -10.941 1.00 23.05 ? 31  PRO C N   1 
ATOM   755  C CA  . PRO C 1 5  ? 21.653  -9.236  -10.651 1.00 22.23 ? 31  PRO C CA  1 
ATOM   756  C C   . PRO C 1 5  ? 21.200  -9.269  -9.194  1.00 20.43 ? 31  PRO C C   1 
ATOM   757  O O   . PRO C 1 5  ? 20.030  -9.519  -8.900  1.00 22.73 ? 31  PRO C O   1 
ATOM   758  C CB  . PRO C 1 5  ? 22.621  -10.376 -10.977 1.00 22.36 ? 31  PRO C CB  1 
ATOM   759  C CG  . PRO C 1 5  ? 23.474  -9.795  -12.055 1.00 23.98 ? 31  PRO C CG  1 
ATOM   760  C CD  . PRO C 1 5  ? 23.741  -8.398  -11.541 1.00 22.54 ? 31  PRO C CD  1 
ATOM   761  N N   . GLN C 1 6  ? 22.138  -9.007  -8.291  1.00 20.97 ? 32  GLN C N   1 
ATOM   762  C CA  . GLN C 1 6  ? 21.854  -9.014  -6.859  1.00 22.77 ? 32  GLN C CA  1 
ATOM   763  C C   . GLN C 1 6  ? 20.920  -7.868  -6.462  1.00 22.76 ? 32  GLN C C   1 
ATOM   764  O O   . GLN C 1 6  ? 20.110  -8.007  -5.544  1.00 20.72 ? 32  GLN C O   1 
ATOM   765  C CB  . GLN C 1 6  ? 23.168  -8.941  -6.065  1.00 24.34 ? 32  GLN C CB  1 
ATOM   766  C CG  . GLN C 1 6  ? 22.998  -8.920  -4.550  1.00 28.20 ? 32  GLN C CG  1 
ATOM   767  C CD  . GLN C 1 6  ? 24.289  -9.232  -3.804  1.00 30.56 ? 32  GLN C CD  1 
ATOM   768  O OE1 . GLN C 1 6  ? 25.391  -8.963  -4.292  1.00 31.14 ? 32  GLN C OE1 1 
ATOM   769  N NE2 . GLN C 1 6  ? 24.155  -9.790  -2.605  1.00 31.19 ? 32  GLN C NE2 1 
ATOM   770  N N   . MET C 1 7  ? 21.025  -6.740  -7.159  1.00 21.66 ? 33  MET C N   1 
ATOM   771  C CA  . MET C 1 7  ? 20.163  -5.607  -6.861  1.00 21.89 ? 33  MET C CA  1 
ATOM   772  C C   . MET C 1 7  ? 18.739  -5.943  -7.284  1.00 20.99 ? 33  MET C C   1 
ATOM   773  O O   . MET C 1 7  ? 17.781  -5.572  -6.606  1.00 20.21 ? 33  MET C O   1 
ATOM   774  C CB  . MET C 1 7  ? 20.672  -4.343  -7.567  1.00 22.24 ? 33  MET C CB  1 
ATOM   775  C CG  . MET C 1 7  ? 21.893  -3.742  -6.880  1.00 27.74 ? 33  MET C CG  1 
ATOM   776  S SD  . MET C 1 7  ? 22.682  -2.365  -7.753  1.00 30.63 ? 33  MET C SD  1 
ATOM   777  C CE  . MET C 1 7  ? 21.537  -1.027  -7.395  1.00 27.35 ? 33  MET C CE  1 
ATOM   778  N N   . LEU C 1 8  ? 18.603  -6.666  -8.392  1.00 21.51 ? 34  LEU C N   1 
ATOM   779  C CA  . LEU C 1 8  ? 17.288  -7.068  -8.879  1.00 21.10 ? 34  LEU C CA  1 
ATOM   780  C C   . LEU C 1 8  ? 16.655  -8.007  -7.858  1.00 18.98 ? 34  LEU C C   1 
ATOM   781  O O   . LEU C 1 8  ? 15.469  -7.901  -7.558  1.00 19.66 ? 34  LEU C O   1 
ATOM   782  C CB  . LEU C 1 8  ? 17.396  -7.790  -10.230 1.00 24.06 ? 34  LEU C CB  1 
ATOM   783  C CG  . LEU C 1 8  ? 16.255  -7.595  -11.239 1.00 28.51 ? 34  LEU C CG  1 
ATOM   784  C CD1 . LEU C 1 8  ? 16.218  -8.784  -12.195 1.00 23.14 ? 34  LEU C CD1 1 
ATOM   785  C CD2 . LEU C 1 8  ? 14.919  -7.463  -10.528 1.00 28.17 ? 34  LEU C CD2 1 
ATOM   786  N N   . ARG C 1 9  ? 17.444  -8.933  -7.323  1.00 18.36 ? 35  ARG C N   1 
ATOM   787  C CA  . ARG C 1 9  ? 16.918  -9.870  -6.331  1.00 18.90 ? 35  ARG C CA  1 
ATOM   788  C C   . ARG C 1 9  ? 16.433  -9.153  -5.064  1.00 18.69 ? 35  ARG C C   1 
ATOM   789  O O   . ARG C 1 9  ? 15.416  -9.540  -4.479  1.00 18.17 ? 35  ARG C O   1 
ATOM   790  C CB  . ARG C 1 9  ? 17.967  -10.930 -5.980  1.00 18.94 ? 35  ARG C CB  1 
ATOM   791  C CG  . ARG C 1 9  ? 18.140  -12.003 -7.060  1.00 22.86 ? 35  ARG C CG  1 
ATOM   792  C CD  . ARG C 1 9  ? 18.898  -13.213 -6.515  1.00 23.20 ? 35  ARG C CD  1 
ATOM   793  N NE  . ARG C 1 9  ? 20.318  -12.935 -6.311  1.00 25.52 ? 35  ARG C NE  1 
ATOM   794  C CZ  . ARG C 1 9  ? 21.220  -12.883 -7.287  1.00 24.48 ? 35  ARG C CZ  1 
ATOM   795  N NH1 . ARG C 1 9  ? 20.854  -13.091 -8.545  1.00 28.44 ? 35  ARG C NH1 1 
ATOM   796  N NH2 . ARG C 1 9  ? 22.490  -12.632 -7.004  1.00 25.73 ? 35  ARG C NH2 1 
ATOM   797  N N   . GLU C 1 10 ? 17.149  -8.112  -4.646  1.00 18.39 ? 36  GLU C N   1 
ATOM   798  C CA  . GLU C 1 10 ? 16.749  -7.349  -3.463  1.00 18.93 ? 36  GLU C CA  1 
ATOM   799  C C   . GLU C 1 10 ? 15.408  -6.650  -3.718  1.00 18.95 ? 36  GLU C C   1 
ATOM   800  O O   . GLU C 1 10 ? 14.530  -6.625  -2.852  1.00 17.40 ? 36  GLU C O   1 
ATOM   801  C CB  . GLU C 1 10 ? 17.794  -6.283  -3.111  1.00 22.27 ? 36  GLU C CB  1 
ATOM   802  C CG  . GLU C 1 10 ? 19.103  -6.790  -2.532  1.00 21.41 ? 36  GLU C CG  1 
ATOM   803  C CD  . GLU C 1 10 ? 18.923  -7.537  -1.224  1.00 23.71 ? 36  GLU C CD  1 
ATOM   804  O OE1 . GLU C 1 10 ? 18.119  -7.090  -0.379  1.00 18.85 ? 36  GLU C OE1 1 
ATOM   805  O OE2 . GLU C 1 10 ? 19.599  -8.566  -1.040  1.00 25.31 ? 36  GLU C OE2 1 
ATOM   806  N N   . LEU C 1 11 ? 15.261  -6.067  -4.904  1.00 18.24 ? 37  LEU C N   1 
ATOM   807  C CA  . LEU C 1 11 ? 14.024  -5.375  -5.252  1.00 16.74 ? 37  LEU C CA  1 
ATOM   808  C C   . LEU C 1 11 ? 12.850  -6.349  -5.303  1.00 18.13 ? 37  LEU C C   1 
ATOM   809  O O   . LEU C 1 11 ? 11.739  -6.018  -4.879  1.00 17.73 ? 37  LEU C O   1 
ATOM   810  C CB  . LEU C 1 11 ? 14.175  -4.652  -6.596  1.00 18.56 ? 37  LEU C CB  1 
ATOM   811  C CG  . LEU C 1 11 ? 15.137  -3.452  -6.597  1.00 18.32 ? 37  LEU C CG  1 
ATOM   812  C CD1 . LEU C 1 11 ? 15.284  -2.899  -8.017  1.00 18.43 ? 37  LEU C CD1 1 
ATOM   813  C CD2 . LEU C 1 11 ? 14.608  -2.383  -5.659  1.00 18.78 ? 37  LEU C CD2 1 
ATOM   814  N N   . GLN C 1 12 ? 13.091  -7.555  -5.815  1.00 16.89 ? 38  GLN C N   1 
ATOM   815  C CA  . GLN C 1 12 ? 12.028  -8.551  -5.885  1.00 16.22 ? 38  GLN C CA  1 
ATOM   816  C C   . GLN C 1 12 ? 11.649  -8.976  -4.465  1.00 17.74 ? 38  GLN C C   1 
ATOM   817  O O   . GLN C 1 12 ? 10.486  -9.258  -4.179  1.00 18.62 ? 38  GLN C O   1 
ATOM   818  C CB  . GLN C 1 12 ? 12.483  -9.760  -6.710  1.00 18.85 ? 38  GLN C CB  1 
ATOM   819  C CG  . GLN C 1 12 ? 12.843  -9.400  -8.146  1.00 21.81 ? 38  GLN C CG  1 
ATOM   820  C CD  . GLN C 1 12 ? 13.425  -10.572 -8.911  1.00 25.90 ? 38  GLN C CD  1 
ATOM   821  O OE1 . GLN C 1 12 ? 14.352  -11.230 -8.445  1.00 28.64 ? 38  GLN C OE1 1 
ATOM   822  N NE2 . GLN C 1 12 ? 12.890  -10.831 -10.097 1.00 29.17 ? 38  GLN C NE2 1 
ATOM   823  N N   . GLU C 1 13 ? 12.635  -9.018  -3.576  1.00 16.42 ? 39  GLU C N   1 
ATOM   824  C CA  . GLU C 1 13 ? 12.381  -9.385  -2.187  1.00 20.07 ? 39  GLU C CA  1 
ATOM   825  C C   . GLU C 1 13 ? 11.577  -8.277  -1.510  1.00 18.76 ? 39  GLU C C   1 
ATOM   826  O O   . GLU C 1 13 ? 10.712  -8.551  -0.687  1.00 19.87 ? 39  GLU C O   1 
ATOM   827  C CB  . GLU C 1 13 ? 13.695  -9.602  -1.428  1.00 22.47 ? 39  GLU C CB  1 
ATOM   828  C CG  . GLU C 1 13 ? 13.515  -9.764  0.084   1.00 26.28 ? 39  GLU C CG  1 
ATOM   829  C CD  . GLU C 1 13 ? 12.681  -10.984 0.465   1.00 29.77 ? 39  GLU C CD  1 
ATOM   830  O OE1 . GLU C 1 13 ? 12.084  -10.973 1.562   1.00 33.81 ? 39  GLU C OE1 1 
ATOM   831  O OE2 . GLU C 1 13 ? 12.626  -11.953 -0.319  1.00 30.60 ? 39  GLU C OE2 1 
ATOM   832  N N   . THR C 1 14 ? 11.865  -7.025  -1.857  1.00 17.71 ? 40  THR C N   1 
ATOM   833  C CA  . THR C 1 14 ? 11.132  -5.905  -1.273  1.00 17.48 ? 40  THR C CA  1 
ATOM   834  C C   . THR C 1 14 ? 9.655   -6.012  -1.647  1.00 18.61 ? 40  THR C C   1 
ATOM   835  O O   . THR C 1 14 ? 8.768   -5.746  -0.829  1.00 17.67 ? 40  THR C O   1 
ATOM   836  C CB  . THR C 1 14 ? 11.696  -4.563  -1.768  1.00 18.83 ? 40  THR C CB  1 
ATOM   837  O OG1 . THR C 1 14 ? 13.020  -4.397  -1.252  1.00 19.17 ? 40  THR C OG1 1 
ATOM   838  C CG2 . THR C 1 14 ? 10.817  -3.398  -1.310  1.00 20.41 ? 40  THR C CG2 1 
ATOM   839  N N   . ASN C 1 15 ? 9.385   -6.411  -2.884  1.00 18.70 ? 41  ASN C N   1 
ATOM   840  C CA  . ASN C 1 15 ? 8.009   -6.561  -3.324  1.00 20.64 ? 41  ASN C CA  1 
ATOM   841  C C   . ASN C 1 15 ? 7.325   -7.762  -2.677  1.00 20.46 ? 41  ASN C C   1 
ATOM   842  O O   . ASN C 1 15 ? 6.127   -7.730  -2.398  1.00 21.05 ? 41  ASN C O   1 
ATOM   843  C CB  . ASN C 1 15 ? 7.943   -6.672  -4.844  1.00 23.44 ? 41  ASN C CB  1 
ATOM   844  C CG  . ASN C 1 15 ? 8.018   -5.324  -5.512  1.00 25.63 ? 41  ASN C CG  1 
ATOM   845  O OD1 . ASN C 1 15 ? 7.343   -4.380  -5.090  1.00 27.68 ? 41  ASN C OD1 1 
ATOM   846  N ND2 . ASN C 1 15 ? 8.834   -5.216  -6.555  1.00 26.73 ? 41  ASN C ND2 1 
ATOM   847  N N   . ALA C 1 16 ? 8.079   -8.824  -2.438  1.00 19.43 ? 42  ALA C N   1 
ATOM   848  C CA  . ALA C 1 16 ? 7.492   -9.998  -1.809  1.00 19.75 ? 42  ALA C CA  1 
ATOM   849  C C   . ALA C 1 16 ? 7.127   -9.610  -0.381  1.00 18.72 ? 42  ALA C C   1 
ATOM   850  O O   . ALA C 1 16 ? 6.043   -9.927  0.098   1.00 21.09 ? 42  ALA C O   1 
ATOM   851  C CB  . ALA C 1 16 ? 8.482   -11.152 -1.810  1.00 16.72 ? 42  ALA C CB  1 
ATOM   852  N N   . ALA C 1 17 ? 8.037   -8.904  0.283   1.00 20.54 ? 43  ALA C N   1 
ATOM   853  C CA  . ALA C 1 17 ? 7.822   -8.471  1.658   1.00 21.50 ? 43  ALA C CA  1 
ATOM   854  C C   . ALA C 1 17 ? 6.668   -7.481  1.758   1.00 22.04 ? 43  ALA C C   1 
ATOM   855  O O   . ALA C 1 17 ? 5.886   -7.530  2.709   1.00 21.76 ? 43  ALA C O   1 
ATOM   856  C CB  . ALA C 1 17 ? 9.096   -7.844  2.212   1.00 21.44 ? 43  ALA C CB  1 
ATOM   857  N N   . LEU C 1 18 ? 6.568   -6.580  0.785   1.00 20.45 ? 44  LEU C N   1 
ATOM   858  C CA  . LEU C 1 18 ? 5.498   -5.584  0.784   1.00 22.35 ? 44  LEU C CA  1 
ATOM   859  C C   . LEU C 1 18 ? 4.143   -6.229  0.565   1.00 21.66 ? 44  LEU C C   1 
ATOM   860  O O   . LEU C 1 18 ? 3.134   -5.767  1.099   1.00 21.17 ? 44  LEU C O   1 
ATOM   861  C CB  . LEU C 1 18 ? 5.738   -4.527  -0.298  1.00 23.30 ? 44  LEU C CB  1 
ATOM   862  C CG  . LEU C 1 18 ? 6.258   -3.187  0.205   1.00 26.26 ? 44  LEU C CG  1 
ATOM   863  C CD1 . LEU C 1 18 ? 6.621   -2.299  -0.971  1.00 27.93 ? 44  LEU C CD1 1 
ATOM   864  C CD2 . LEU C 1 18 ? 5.186   -2.530  1.070   1.00 25.06 ? 44  LEU C CD2 1 
ATOM   865  N N   . GLN C 1 19 ? 4.110   -7.285  -0.238  1.00 22.47 ? 45  GLN C N   1 
ATOM   866  C CA  . GLN C 1 19 ? 2.856   -7.975  -0.473  1.00 22.14 ? 45  GLN C CA  1 
ATOM   867  C C   . GLN C 1 19 ? 2.408   -8.610  0.845   1.00 19.71 ? 45  GLN C C   1 
ATOM   868  O O   . GLN C 1 19 ? 1.218   -8.610  1.160   1.00 19.44 ? 45  GLN C O   1 
ATOM   869  C CB  . GLN C 1 19 ? 3.007   -9.049  -1.559  1.00 25.66 ? 45  GLN C CB  1 
ATOM   870  C CG  . GLN C 1 19 ? 3.223   -8.496  -2.968  1.00 34.67 ? 45  GLN C CG  1 
ATOM   871  C CD  . GLN C 1 19 ? 3.080   -9.563  -4.046  1.00 38.29 ? 45  GLN C CD  1 
ATOM   872  O OE1 . GLN C 1 19 ? 3.802   -10.559 -4.052  1.00 42.74 ? 45  GLN C OE1 1 
ATOM   873  N NE2 . GLN C 1 19 ? 2.139   -9.358  -4.961  1.00 41.35 ? 45  GLN C NE2 1 
ATOM   874  N N   . ASP C 1 20 ? 3.355   -9.146  1.616   1.00 19.62 ? 46  ASP C N   1 
ATOM   875  C CA  . ASP C 1 20 ? 3.011   -9.759  2.907   1.00 20.80 ? 46  ASP C CA  1 
ATOM   876  C C   . ASP C 1 20 ? 2.463   -8.679  3.844   1.00 20.14 ? 46  ASP C C   1 
ATOM   877  O O   . ASP C 1 20 ? 1.513   -8.909  4.583   1.00 19.81 ? 46  ASP C O   1 
ATOM   878  C CB  . ASP C 1 20 ? 4.227   -10.393 3.597   1.00 21.52 ? 46  ASP C CB  1 
ATOM   879  C CG  . ASP C 1 20 ? 4.739   -11.649 2.902   1.00 25.29 ? 46  ASP C CG  1 
ATOM   880  O OD1 . ASP C 1 20 ? 3.946   -12.389 2.284   1.00 26.13 ? 46  ASP C OD1 1 
ATOM   881  O OD2 . ASP C 1 20 ? 5.956   -11.909 3.007   1.00 26.91 ? 46  ASP C OD2 1 
ATOM   882  N N   . VAL C 1 21 ? 3.088   -7.505  3.822   1.00 20.28 ? 47  VAL C N   1 
ATOM   883  C CA  . VAL C 1 21 ? 2.665   -6.392  4.672   1.00 19.74 ? 47  VAL C CA  1 
ATOM   884  C C   . VAL C 1 21 ? 1.243   -5.948  4.331   1.00 20.09 ? 47  VAL C C   1 
ATOM   885  O O   . VAL C 1 21 ? 0.420   -5.702  5.215   1.00 19.57 ? 47  VAL C O   1 
ATOM   886  C CB  . VAL C 1 21 ? 3.626   -5.189  4.513   1.00 20.11 ? 47  VAL C CB  1 
ATOM   887  C CG1 . VAL C 1 21 ? 3.088   -3.980  5.259   1.00 18.79 ? 47  VAL C CG1 1 
ATOM   888  C CG2 . VAL C 1 21 ? 5.008   -5.564  5.042   1.00 18.82 ? 47  VAL C CG2 1 
ATOM   889  N N   . ARG C 1 22 ? 0.963   -5.853  3.040   1.00 19.22 ? 48  ARG C N   1 
ATOM   890  C CA  . ARG C 1 22 ? -0.352  -5.447  2.580   1.00 18.04 ? 48  ARG C CA  1 
ATOM   891  C C   . ARG C 1 22 ? -1.398  -6.469  3.023   1.00 16.63 ? 48  ARG C C   1 
ATOM   892  O O   . ARG C 1 22 ? -2.484  -6.107  3.455   1.00 16.48 ? 48  ARG C O   1 
ATOM   893  C CB  . ARG C 1 22 ? -0.344  -5.321  1.064   1.00 22.23 ? 48  ARG C CB  1 
ATOM   894  C CG  . ARG C 1 22 ? -1.654  -4.841  0.480   1.00 27.57 ? 48  ARG C CG  1 
ATOM   895  C CD  . ARG C 1 22 ? -1.489  -4.533  -0.991  1.00 30.34 ? 48  ARG C CD  1 
ATOM   896  N NE  . ARG C 1 22 ? -1.194  -5.729  -1.761  1.00 33.09 ? 48  ARG C NE  1 
ATOM   897  C CZ  . ARG C 1 22 ? -0.984  -5.730  -3.069  1.00 35.28 ? 48  ARG C CZ  1 
ATOM   898  N NH1 . ARG C 1 22 ? -1.036  -4.589  -3.746  1.00 31.95 ? 48  ARG C NH1 1 
ATOM   899  N NH2 . ARG C 1 22 ? -0.729  -6.870  -3.697  1.00 37.33 ? 48  ARG C NH2 1 
ATOM   900  N N   . GLU C 1 23 ? -1.051  -7.747  2.925   1.00 15.99 ? 49  GLU C N   1 
ATOM   901  C CA  . GLU C 1 23 ? -1.958  -8.818  3.317   1.00 16.44 ? 49  GLU C CA  1 
ATOM   902  C C   . GLU C 1 23 ? -2.273  -8.734  4.813   1.00 15.60 ? 49  GLU C C   1 
ATOM   903  O O   . GLU C 1 23 ? -3.424  -8.839  5.228   1.00 17.35 ? 49  GLU C O   1 
ATOM   904  C CB  . GLU C 1 23 ? -1.319  -10.168 2.971   1.00 17.49 ? 49  GLU C CB  1 
ATOM   905  C CG  . GLU C 1 23 ? -2.122  -11.378 3.388   1.00 23.40 ? 49  GLU C CG  1 
ATOM   906  C CD  . GLU C 1 23 ? -1.660  -12.631 2.673   1.00 27.23 ? 49  GLU C CD  1 
ATOM   907  O OE1 . GLU C 1 23 ? -1.940  -13.735 3.164   1.00 32.33 ? 49  GLU C OE1 1 
ATOM   908  O OE2 . GLU C 1 23 ? -1.023  -12.506 1.608   1.00 32.42 ? 49  GLU C OE2 1 
ATOM   909  N N   . LEU C 1 24 ? -1.244  -8.536  5.620   1.00 16.20 ? 50  LEU C N   1 
ATOM   910  C CA  . LEU C 1 24 ? -1.429  -8.425  7.062   1.00 17.00 ? 50  LEU C CA  1 
ATOM   911  C C   . LEU C 1 24 ? -2.228  -7.171  7.414   1.00 17.32 ? 50  LEU C C   1 
ATOM   912  O O   . LEU C 1 24 ? -3.076  -7.197  8.306   1.00 15.33 ? 50  LEU C O   1 
ATOM   913  C CB  . LEU C 1 24 ? -0.066  -8.383  7.765   1.00 17.54 ? 50  LEU C CB  1 
ATOM   914  C CG  . LEU C 1 24 ? 0.743   -9.685  7.722   1.00 19.81 ? 50  LEU C CG  1 
ATOM   915  C CD1 . LEU C 1 24 ? 2.174   -9.421  8.161   1.00 17.38 ? 50  LEU C CD1 1 
ATOM   916  C CD2 . LEU C 1 24 ? 0.082   -10.729 8.622   1.00 19.44 ? 50  LEU C CD2 1 
ATOM   917  N N   . LEU C 1 25 ? -1.970  -6.078  6.703   1.00 16.60 ? 51  LEU C N   1 
ATOM   918  C CA  . LEU C 1 25 ? -2.669  -4.829  6.982   1.00 18.41 ? 51  LEU C CA  1 
ATOM   919  C C   . LEU C 1 25 ? -4.155  -4.930  6.647   1.00 18.09 ? 51  LEU C C   1 
ATOM   920  O O   . LEU C 1 25 ? -5.000  -4.418  7.383   1.00 17.23 ? 51  LEU C O   1 
ATOM   921  C CB  . LEU C 1 25 ? -2.043  -3.674  6.192   1.00 18.33 ? 51  LEU C CB  1 
ATOM   922  C CG  . LEU C 1 25 ? -1.691  -2.378  6.937   1.00 25.49 ? 51  LEU C CG  1 
ATOM   923  C CD1 . LEU C 1 25 ? -1.413  -1.273  5.924   1.00 24.00 ? 51  LEU C CD1 1 
ATOM   924  C CD2 . LEU C 1 25 ? -2.826  -1.962  7.852   1.00 25.76 ? 51  LEU C CD2 1 
ATOM   925  N N   . ARG C 1 26 ? -4.489  -5.584  5.539   1.00 17.35 ? 52  ARG C N   1 
ATOM   926  C CA  . ARG C 1 26 ? -5.895  -5.700  5.201   1.00 18.17 ? 52  ARG C CA  1 
ATOM   927  C C   . ARG C 1 26 ? -6.623  -6.569  6.214   1.00 17.10 ? 52  ARG C C   1 
ATOM   928  O O   . ARG C 1 26 ? -7.783  -6.322  6.512   1.00 16.36 ? 52  ARG C O   1 
ATOM   929  C CB  . ARG C 1 26 ? -6.090  -6.233  3.780   1.00 23.09 ? 52  ARG C CB  1 
ATOM   930  C CG  . ARG C 1 26 ? -5.265  -7.420  3.420   1.00 30.48 ? 52  ARG C CG  1 
ATOM   931  C CD  . ARG C 1 26 ? -5.491  -7.793  1.964   1.00 33.47 ? 52  ARG C CD  1 
ATOM   932  N NE  . ARG C 1 26 ? -5.295  -6.658  1.067   1.00 34.44 ? 52  ARG C NE  1 
ATOM   933  C CZ  . ARG C 1 26 ? -4.775  -6.761  -0.151  1.00 33.88 ? 52  ARG C CZ  1 
ATOM   934  N NH1 . ARG C 1 26 ? -4.396  -7.945  -0.617  1.00 32.87 ? 52  ARG C NH1 1 
ATOM   935  N NH2 . ARG C 1 26 ? -4.628  -5.685  -0.904  1.00 34.46 ? 52  ARG C NH2 1 
ATOM   936  N N   . GLN C 1 27 ? -5.943  -7.574  6.757   1.00 15.83 ? 53  GLN C N   1 
ATOM   937  C CA  . GLN C 1 27 ? -6.581  -8.429  7.750   1.00 15.53 ? 53  GLN C CA  1 
ATOM   938  C C   . GLN C 1 27 ? -6.728  -7.631  9.037   1.00 15.28 ? 53  GLN C C   1 
ATOM   939  O O   . GLN C 1 27 ? -7.750  -7.703  9.709   1.00 14.34 ? 53  GLN C O   1 
ATOM   940  C CB  . GLN C 1 27 ? -5.735  -9.669  8.038   1.00 17.53 ? 53  GLN C CB  1 
ATOM   941  C CG  . GLN C 1 27 ? -6.433  -10.669 8.947   1.00 16.44 ? 53  GLN C CG  1 
ATOM   942  C CD  . GLN C 1 27 ? -7.788  -11.118 8.388   1.00 18.70 ? 53  GLN C CD  1 
ATOM   943  O OE1 . GLN C 1 27 ? -7.880  -11.594 7.256   1.00 17.50 ? 53  GLN C OE1 1 
ATOM   944  N NE2 . GLN C 1 27 ? -8.840  -10.961 9.185   1.00 16.85 ? 53  GLN C NE2 1 
ATOM   945  N N   . GLN C 1 28 ? -5.693  -6.868  9.372   1.00 15.18 ? 54  GLN C N   1 
ATOM   946  C CA  . GLN C 1 28 ? -5.712  -6.070  10.590  1.00 15.80 ? 54  GLN C CA  1 
ATOM   947  C C   . GLN C 1 28 ? -6.857  -5.063  10.560  1.00 16.03 ? 54  GLN C C   1 
ATOM   948  O O   . GLN C 1 28 ? -7.539  -4.863  11.563  1.00 17.15 ? 54  GLN C O   1 
ATOM   949  C CB  . GLN C 1 28 ? -4.367  -5.355  10.770  1.00 17.15 ? 54  GLN C CB  1 
ATOM   950  C CG  . GLN C 1 28 ? -4.261  -4.563  12.069  1.00 17.28 ? 54  GLN C CG  1 
ATOM   951  C CD  . GLN C 1 28 ? -2.863  -4.038  12.309  1.00 19.67 ? 54  GLN C CD  1 
ATOM   952  O OE1 . GLN C 1 28 ? -2.039  -4.696  12.947  1.00 17.60 ? 54  GLN C OE1 1 
ATOM   953  N NE2 . GLN C 1 28 ? -2.578  -2.857  11.771  1.00 18.71 ? 54  GLN C NE2 1 
ATOM   954  N N   . VAL C 1 29 ? -7.080  -4.432  9.411   1.00 15.83 ? 55  VAL C N   1 
ATOM   955  C CA  . VAL C 1 29 ? -8.164  -3.463  9.305   1.00 16.96 ? 55  VAL C CA  1 
ATOM   956  C C   . VAL C 1 29 ? -9.500  -4.154  9.599   1.00 17.56 ? 55  VAL C C   1 
ATOM   957  O O   . VAL C 1 29 ? -10.383 -3.578  10.247  1.00 17.65 ? 55  VAL C O   1 
ATOM   958  C CB  . VAL C 1 29 ? -8.202  -2.815  7.906   1.00 14.48 ? 55  VAL C CB  1 
ATOM   959  C CG1 . VAL C 1 29 ? -9.432  -1.955  7.770   1.00 18.63 ? 55  VAL C CG1 1 
ATOM   960  C CG2 . VAL C 1 29 ? -6.956  -1.959  7.696   1.00 19.40 ? 55  VAL C CG2 1 
ATOM   961  N N   . LYS C 1 30 ? -9.635  -5.400  9.146   1.00 17.53 ? 56  LYS C N   1 
ATOM   962  C CA  . LYS C 1 30 ? -10.857 -6.170  9.385   1.00 17.54 ? 56  LYS C CA  1 
ATOM   963  C C   . LYS C 1 30 ? -11.048 -6.427  10.878  1.00 17.57 ? 56  LYS C C   1 
ATOM   964  O O   . LYS C 1 30 ? -12.151 -6.272  11.410  1.00 17.92 ? 56  LYS C O   1 
ATOM   965  C CB  . LYS C 1 30 ? -10.810 -7.519  8.651   1.00 16.80 ? 56  LYS C CB  1 
ATOM   966  C CG  . LYS C 1 30 ? -10.841 -7.406  7.137   1.00 17.97 ? 56  LYS C CG  1 
ATOM   967  C CD  . LYS C 1 30 ? -10.787 -8.768  6.476   1.00 21.54 ? 56  LYS C CD  1 
ATOM   968  C CE  . LYS C 1 30 ? -11.094 -8.667  4.995   1.00 25.52 ? 56  LYS C CE  1 
ATOM   969  N NZ  . LYS C 1 30 ? -10.137 -7.803  4.276   1.00 27.39 ? 56  LYS C NZ  1 
ATOM   970  N N   . GLU C 1 31 ? -9.973  -6.819  11.550  1.00 17.85 ? 57  GLU C N   1 
ATOM   971  C CA  . GLU C 1 31 ? -10.032 -7.108  12.984  1.00 16.87 ? 57  GLU C CA  1 
ATOM   972  C C   . GLU C 1 31 ? -10.372 -5.842  13.761  1.00 17.22 ? 57  GLU C C   1 
ATOM   973  O O   . GLU C 1 31 ? -11.182 -5.867  14.680  1.00 17.11 ? 57  GLU C O   1 
ATOM   974  C CB  . GLU C 1 31 ? -8.694  -7.667  13.473  1.00 19.26 ? 57  GLU C CB  1 
ATOM   975  C CG  . GLU C 1 31 ? -8.239  -8.950  12.778  1.00 17.11 ? 57  GLU C CG  1 
ATOM   976  C CD  . GLU C 1 31 ? -9.262  -10.066 12.875  1.00 21.78 ? 57  GLU C CD  1 
ATOM   977  O OE1 . GLU C 1 31 ? -9.887  -10.207 13.947  1.00 22.16 ? 57  GLU C OE1 1 
ATOM   978  O OE2 . GLU C 1 31 ? -9.436  -10.809 11.883  1.00 21.58 ? 57  GLU C OE2 1 
ATOM   979  N N   . ILE C 1 32 ? -9.747  -4.733  13.387  1.00 18.20 ? 58  ILE C N   1 
ATOM   980  C CA  . ILE C 1 32 ? -10.013 -3.461  14.052  1.00 18.28 ? 58  ILE C CA  1 
ATOM   981  C C   . ILE C 1 32 ? -11.467 -3.058  13.836  1.00 19.53 ? 58  ILE C C   1 
ATOM   982  O O   . ILE C 1 32 ? -12.135 -2.572  14.755  1.00 19.60 ? 58  ILE C O   1 
ATOM   983  C CB  . ILE C 1 32 ? -9.097  -2.355  13.513  1.00 18.08 ? 58  ILE C CB  1 
ATOM   984  C CG1 . ILE C 1 32 ? -7.654  -2.645  13.936  1.00 18.18 ? 58  ILE C CG1 1 
ATOM   985  C CG2 . ILE C 1 32 ? -9.553  -0.979  14.034  1.00 18.49 ? 58  ILE C CG2 1 
ATOM   986  C CD1 . ILE C 1 32 ? -6.651  -1.648  13.416  1.00 18.66 ? 58  ILE C CD1 1 
ATOM   987  N N   . THR C 1 33 ? -11.960 -3.261  12.619  1.00 19.48 ? 59  THR C N   1 
ATOM   988  C CA  . THR C 1 33 ? -13.342 -2.906  12.308  1.00 20.47 ? 59  THR C CA  1 
ATOM   989  C C   . THR C 1 33 ? -14.316 -3.761  13.121  1.00 21.60 ? 59  THR C C   1 
ATOM   990  O O   . THR C 1 33 ? -15.330 -3.260  13.603  1.00 21.03 ? 59  THR C O   1 
ATOM   991  C CB  . THR C 1 33 ? -13.623 -3.056  10.803  1.00 20.84 ? 59  THR C CB  1 
ATOM   992  O OG1 . THR C 1 33 ? -12.788 -2.142  10.079  1.00 21.24 ? 59  THR C OG1 1 
ATOM   993  C CG2 . THR C 1 33 ? -15.085 -2.744  10.490  1.00 23.64 ? 59  THR C CG2 1 
ATOM   994  N N   . PHE C 1 34 ? -14.011 -5.047  13.274  1.00 21.67 ? 60  PHE C N   1 
ATOM   995  C CA  . PHE C 1 34 ? -14.869 -5.923  14.065  1.00 22.36 ? 60  PHE C CA  1 
ATOM   996  C C   . PHE C 1 34 ? -14.876 -5.412  15.499  1.00 23.54 ? 60  PHE C C   1 
ATOM   997  O O   . PHE C 1 34 ? -15.916 -5.388  16.155  1.00 23.34 ? 60  PHE C O   1 
ATOM   998  C CB  . PHE C 1 34 ? -14.358 -7.363  14.059  1.00 20.42 ? 60  PHE C CB  1 
ATOM   999  C CG  . PHE C 1 34 ? -14.673 -8.117  12.802  1.00 21.05 ? 60  PHE C CG  1 
ATOM   1000 C CD1 . PHE C 1 34 ? -15.972 -8.142  12.294  1.00 22.19 ? 60  PHE C CD1 1 
ATOM   1001 C CD2 . PHE C 1 34 ? -13.680 -8.828  12.139  1.00 20.47 ? 60  PHE C CD2 1 
ATOM   1002 C CE1 . PHE C 1 34 ? -16.275 -8.868  11.139  1.00 22.99 ? 60  PHE C CE1 1 
ATOM   1003 C CE2 . PHE C 1 34 ? -13.973 -9.556  10.988  1.00 19.78 ? 60  PHE C CE2 1 
ATOM   1004 C CZ  . PHE C 1 34 ? -15.272 -9.576  10.487  1.00 23.54 ? 60  PHE C CZ  1 
ATOM   1005 N N   . LEU C 1 35 ? -13.703 -5.015  15.982  1.00 23.07 ? 61  LEU C N   1 
ATOM   1006 C CA  . LEU C 1 35 ? -13.578 -4.497  17.341  1.00 24.20 ? 61  LEU C CA  1 
ATOM   1007 C C   . LEU C 1 35 ? -14.445 -3.254  17.508  1.00 23.23 ? 61  LEU C C   1 
ATOM   1008 O O   . LEU C 1 35 ? -15.159 -3.112  18.500  1.00 22.65 ? 61  LEU C O   1 
ATOM   1009 C CB  . LEU C 1 35 ? -12.116 -4.151  17.649  1.00 24.26 ? 61  LEU C CB  1 
ATOM   1010 C CG  . LEU C 1 35 ? -11.835 -3.518  19.018  1.00 26.92 ? 61  LEU C CG  1 
ATOM   1011 C CD1 . LEU C 1 35 ? -12.247 -4.479  20.135  1.00 27.35 ? 61  LEU C CD1 1 
ATOM   1012 C CD2 . LEU C 1 35 ? -10.354 -3.175  19.127  1.00 25.55 ? 61  LEU C CD2 1 
ATOM   1013 N N   . LYS C 1 36 ? -14.380 -2.354  16.533  1.00 24.12 ? 62  LYS C N   1 
ATOM   1014 C CA  . LYS C 1 36 ? -15.168 -1.125  16.578  1.00 25.14 ? 62  LYS C CA  1 
ATOM   1015 C C   . LYS C 1 36 ? -16.663 -1.412  16.689  1.00 27.53 ? 62  LYS C C   1 
ATOM   1016 O O   . LYS C 1 36 ? -17.346 -0.896  17.576  1.00 26.18 ? 62  LYS C O   1 
ATOM   1017 C CB  . LYS C 1 36 ? -14.926 -0.282  15.320  1.00 26.96 ? 62  LYS C CB  1 
ATOM   1018 C CG  . LYS C 1 36 ? -15.775 0.990   15.275  1.00 26.87 ? 62  LYS C CG  1 
ATOM   1019 C CD  . LYS C 1 36 ? -15.789 1.625   13.891  1.00 29.20 ? 62  LYS C CD  1 
ATOM   1020 C CE  . LYS C 1 36 ? -16.542 0.764   12.885  1.00 28.38 ? 62  LYS C CE  1 
ATOM   1021 N NZ  . LYS C 1 36 ? -16.734 1.467   11.584  1.00 32.68 ? 62  LYS C NZ  1 
ATOM   1022 N N   . ASN C 1 37 ? -17.172 -2.228  15.773  1.00 26.31 ? 63  ASN C N   1 
ATOM   1023 C CA  . ASN C 1 37 ? -18.589 -2.554  15.770  1.00 28.09 ? 63  ASN C CA  1 
ATOM   1024 C C   . ASN C 1 37 ? -19.033 -3.260  17.046  1.00 29.08 ? 63  ASN C C   1 
ATOM   1025 O O   . ASN C 1 37 ? -20.104 -2.966  17.574  1.00 29.23 ? 63  ASN C O   1 
ATOM   1026 C CB  . ASN C 1 37 ? -18.923 -3.388  14.529  1.00 29.52 ? 63  ASN C CB  1 
ATOM   1027 C CG  . ASN C 1 37 ? -18.906 -2.555  13.252  1.00 30.54 ? 63  ASN C CG  1 
ATOM   1028 O OD1 . ASN C 1 37 ? -18.556 -3.043  12.178  1.00 33.29 ? 63  ASN C OD1 1 
ATOM   1029 N ND2 . ASN C 1 37 ? -19.298 -1.291  13.368  1.00 29.88 ? 63  ASN C ND2 1 
ATOM   1030 N N   . THR C 1 38 ? -18.203 -4.163  17.556  1.00 27.86 ? 64  THR C N   1 
ATOM   1031 C CA  . THR C 1 38 ? -18.531 -4.898  18.777  1.00 29.93 ? 64  THR C CA  1 
ATOM   1032 C C   . THR C 1 38 ? -18.711 -3.956  19.964  1.00 31.87 ? 64  THR C C   1 
ATOM   1033 O O   . THR C 1 38 ? -19.593 -4.160  20.801  1.00 32.08 ? 64  THR C O   1 
ATOM   1034 C CB  . THR C 1 38 ? -17.434 -5.923  19.121  1.00 30.61 ? 64  THR C CB  1 
ATOM   1035 O OG1 . THR C 1 38 ? -17.309 -6.858  18.045  1.00 31.23 ? 64  THR C OG1 1 
ATOM   1036 C CG2 . THR C 1 38 ? -17.783 -6.674  20.400  1.00 31.97 ? 64  THR C CG2 1 
ATOM   1037 N N   . VAL C 1 39 ? -17.872 -2.928  20.036  1.00 32.94 ? 65  VAL C N   1 
ATOM   1038 C CA  . VAL C 1 39 ? -17.959 -1.956  21.119  1.00 34.96 ? 65  VAL C CA  1 
ATOM   1039 C C   . VAL C 1 39 ? -19.215 -1.103  20.948  1.00 37.86 ? 65  VAL C C   1 
ATOM   1040 O O   . VAL C 1 39 ? -19.861 -0.724  21.925  1.00 37.25 ? 65  VAL C O   1 
ATOM   1041 C CB  . VAL C 1 39 ? -16.725 -1.032  21.136  1.00 33.94 ? 65  VAL C CB  1 
ATOM   1042 C CG1 . VAL C 1 39 ? -16.888 0.042   22.208  1.00 33.98 ? 65  VAL C CG1 1 
ATOM   1043 C CG2 . VAL C 1 39 ? -15.470 -1.853  21.393  1.00 31.42 ? 65  VAL C CG2 1 
ATOM   1044 N N   . MET C 1 40 ? -19.554 -0.804  19.697  1.00 41.26 ? 66  MET C N   1 
ATOM   1045 C CA  . MET C 1 40 ? -20.732 0.001   19.395  1.00 43.83 ? 66  MET C CA  1 
ATOM   1046 C C   . MET C 1 40 ? -22.022 -0.675  19.840  1.00 46.17 ? 66  MET C C   1 
ATOM   1047 O O   . MET C 1 40 ? -22.974 -0.006  20.245  1.00 45.81 ? 66  MET C O   1 
ATOM   1048 C CB  . MET C 1 40 ? -20.807 0.285   17.897  1.00 44.73 ? 66  MET C CB  1 
ATOM   1049 C CG  . MET C 1 40 ? -19.705 1.184   17.384  1.00 45.65 ? 66  MET C CG  1 
ATOM   1050 S SD  . MET C 1 40 ? -19.904 1.518   15.638  1.00 49.13 ? 66  MET C SD  1 
ATOM   1051 C CE  . MET C 1 40 ? -21.228 2.720   15.682  1.00 49.15 ? 66  MET C CE  1 
ATOM   1052 N N   . GLU C 1 41 ? -22.057 -2.002  19.758  1.00 48.64 ? 67  GLU C N   1 
ATOM   1053 C CA  . GLU C 1 41 ? -23.243 -2.746  20.156  1.00 51.76 ? 67  GLU C CA  1 
ATOM   1054 C C   . GLU C 1 41 ? -23.145 -3.247  21.592  1.00 54.04 ? 67  GLU C C   1 
ATOM   1055 O O   . GLU C 1 41 ? -23.940 -4.081  22.023  1.00 53.95 ? 67  GLU C O   1 
ATOM   1056 C CB  . GLU C 1 41 ? -23.471 -3.928  19.210  1.00 52.77 ? 67  GLU C CB  1 
ATOM   1057 C CG  . GLU C 1 41 ? -22.389 -4.992  19.247  1.00 53.94 ? 67  GLU C CG  1 
ATOM   1058 C CD  . GLU C 1 41 ? -22.664 -6.129  18.280  1.00 54.06 ? 67  GLU C CD  1 
ATOM   1059 O OE1 . GLU C 1 41 ? -22.769 -5.866  17.064  1.00 53.83 ? 67  GLU C OE1 1 
ATOM   1060 O OE2 . GLU C 1 41 ? -22.777 -7.287  18.734  1.00 54.93 ? 67  GLU C OE2 1 
ATOM   1061 N N   . CYS C 1 42 ? -22.167 -2.735  22.332  1.00 56.26 ? 68  CYS C N   1 
ATOM   1062 C CA  . CYS C 1 42 ? -21.982 -3.134  23.721  1.00 58.81 ? 68  CYS C CA  1 
ATOM   1063 C C   . CYS C 1 42 ? -22.958 -2.373  24.618  1.00 59.85 ? 68  CYS C C   1 
ATOM   1064 O O   . CYS C 1 42 ? -22.812 -1.169  24.826  1.00 59.21 ? 68  CYS C O   1 
ATOM   1065 C CB  . CYS C 1 42 ? -20.541 -2.859  24.163  1.00 60.05 ? 68  CYS C CB  1 
ATOM   1066 S SG  . CYS C 1 42 ? -20.197 -3.347  25.883  1.00 62.61 ? 68  CYS C SG  1 
ATOM   1067 N N   . ASP C 1 43 ? -23.951 -3.086  25.143  1.00 61.58 ? 69  ASP C N   1 
ATOM   1068 C CA  . ASP C 1 43 ? -24.967 -2.492  26.011  1.00 63.60 ? 69  ASP C CA  1 
ATOM   1069 C C   . ASP C 1 43 ? -24.406 -1.623  27.135  1.00 64.30 ? 69  ASP C C   1 
ATOM   1070 O O   . ASP C 1 43 ? -24.906 -0.525  27.384  1.00 64.28 ? 69  ASP C O   1 
ATOM   1071 C CB  . ASP C 1 43 ? -25.842 -3.590  26.624  1.00 64.43 ? 69  ASP C CB  1 
ATOM   1072 C CG  . ASP C 1 43 ? -26.729 -4.269  25.601  1.00 65.05 ? 69  ASP C CG  1 
ATOM   1073 O OD1 . ASP C 1 43 ? -26.193 -4.854  24.636  1.00 66.04 ? 69  ASP C OD1 1 
ATOM   1074 O OD2 . ASP C 1 43 ? -27.966 -4.218  25.764  1.00 66.66 ? 69  ASP C OD2 1 
ATOM   1075 N N   . ALA C 1 44 ? -23.374 -2.121  27.810  1.00 65.10 ? 70  ALA C N   1 
ATOM   1076 C CA  . ALA C 1 44 ? -22.751 -1.411  28.924  1.00 66.20 ? 70  ALA C CA  1 
ATOM   1077 C C   . ALA C 1 44 ? -22.460 0.064   28.654  1.00 66.74 ? 70  ALA C C   1 
ATOM   1078 O O   . ALA C 1 44 ? -22.372 0.862   29.587  1.00 66.99 ? 70  ALA C O   1 
ATOM   1079 C CB  . ALA C 1 44 ? -21.469 -2.121  29.336  1.00 66.35 ? 70  ALA C CB  1 
ATOM   1080 N N   . CYS C 1 45 ? -22.310 0.426   27.385  1.00 67.39 ? 71  CYS C N   1 
ATOM   1081 C CA  . CYS C 1 45 ? -22.021 1.812   27.027  1.00 68.01 ? 71  CYS C CA  1 
ATOM   1082 C C   . CYS C 1 45 ? -23.288 2.657   26.932  1.00 68.05 ? 71  CYS C C   1 
ATOM   1083 O O   . CYS C 1 45 ? -24.391 2.083   27.051  1.00 68.30 ? 71  CYS C O   1 
ATOM   1084 C CB  . CYS C 1 45 ? -21.266 1.862   25.697  1.00 67.91 ? 71  CYS C CB  1 
ATOM   1085 S SG  . CYS C 1 45 ? -19.707 0.951   25.707  1.00 68.58 ? 71  CYS C SG  1 
ATOM   1086 O OXT . CYS C 1 45 ? -23.159 3.884   26.739  1.00 68.11 ? 71  CYS C OXT 1 
ATOM   1087 N N   . MET D 1 1  ? 17.874  -2.354  -21.165 1.00 53.99 ? 27  MET D N   1 
ATOM   1088 C CA  . MET D 1 1  ? 19.293  -2.090  -20.795 1.00 54.65 ? 27  MET D CA  1 
ATOM   1089 C C   . MET D 1 1  ? 19.723  -3.013  -19.659 1.00 52.98 ? 27  MET D C   1 
ATOM   1090 O O   . MET D 1 1  ? 19.693  -2.632  -18.487 1.00 52.39 ? 27  MET D O   1 
ATOM   1091 C CB  . MET D 1 1  ? 19.455  -0.626  -20.381 1.00 57.20 ? 27  MET D CB  1 
ATOM   1092 C CG  . MET D 1 1  ? 18.989  0.352   -21.449 1.00 60.73 ? 27  MET D CG  1 
ATOM   1093 S SD  . MET D 1 1  ? 19.232  2.083   -21.010 1.00 64.16 ? 27  MET D SD  1 
ATOM   1094 C CE  . MET D 1 1  ? 20.786  2.431   -21.849 1.00 63.59 ? 27  MET D CE  1 
ATOM   1095 N N   . ASP D 1 2  ? 20.127  -4.228  -20.022 1.00 50.95 ? 28  ASP D N   1 
ATOM   1096 C CA  . ASP D 1 2  ? 20.552  -5.233  -19.054 1.00 48.02 ? 28  ASP D CA  1 
ATOM   1097 C C   . ASP D 1 2  ? 19.369  -5.623  -18.177 1.00 43.88 ? 28  ASP D C   1 
ATOM   1098 O O   . ASP D 1 2  ? 18.387  -6.196  -18.655 1.00 43.44 ? 28  ASP D O   1 
ATOM   1099 C CB  . ASP D 1 2  ? 21.691  -4.698  -18.177 1.00 51.82 ? 28  ASP D CB  1 
ATOM   1100 C CG  . ASP D 1 2  ? 22.999  -4.555  -18.933 1.00 54.95 ? 28  ASP D CG  1 
ATOM   1101 O OD1 . ASP D 1 2  ? 23.549  -5.589  -19.372 1.00 57.46 ? 28  ASP D OD1 1 
ATOM   1102 O OD2 . ASP D 1 2  ? 23.479  -3.410  -19.087 1.00 55.81 ? 28  ASP D OD2 1 
ATOM   1103 N N   . LEU D 1 3  ? 19.467  -5.300  -16.893 1.00 38.86 ? 29  LEU D N   1 
ATOM   1104 C CA  . LEU D 1 3  ? 18.412  -5.610  -15.943 1.00 33.51 ? 29  LEU D CA  1 
ATOM   1105 C C   . LEU D 1 3  ? 17.647  -4.352  -15.545 1.00 32.59 ? 29  LEU D C   1 
ATOM   1106 O O   . LEU D 1 3  ? 16.718  -4.408  -14.734 1.00 30.40 ? 29  LEU D O   1 
ATOM   1107 C CB  . LEU D 1 3  ? 19.013  -6.273  -14.704 1.00 30.47 ? 29  LEU D CB  1 
ATOM   1108 C CG  . LEU D 1 3  ? 19.673  -7.630  -14.954 1.00 29.10 ? 29  LEU D CG  1 
ATOM   1109 C CD1 . LEU D 1 3  ? 20.245  -8.167  -13.652 1.00 28.80 ? 29  LEU D CD1 1 
ATOM   1110 C CD2 . LEU D 1 3  ? 18.645  -8.599  -15.536 1.00 27.41 ? 29  LEU D CD2 1 
ATOM   1111 N N   . ALA D 1 4  ? 18.041  -3.221  -16.119 1.00 29.78 ? 30  ALA D N   1 
ATOM   1112 C CA  . ALA D 1 4  ? 17.386  -1.951  -15.829 1.00 28.72 ? 30  ALA D CA  1 
ATOM   1113 C C   . ALA D 1 4  ? 15.875  -2.037  -16.046 1.00 27.94 ? 30  ALA D C   1 
ATOM   1114 O O   . ALA D 1 4  ? 15.100  -1.606  -15.188 1.00 26.58 ? 30  ALA D O   1 
ATOM   1115 C CB  . ALA D 1 4  ? 17.978  -0.847  -16.689 1.00 28.16 ? 30  ALA D CB  1 
ATOM   1116 N N   . PRO D 1 5  ? 15.432  -2.589  -17.195 1.00 26.32 ? 31  PRO D N   1 
ATOM   1117 C CA  . PRO D 1 5  ? 13.989  -2.696  -17.446 1.00 25.68 ? 31  PRO D CA  1 
ATOM   1118 C C   . PRO D 1 5  ? 13.280  -3.459  -16.329 1.00 24.78 ? 31  PRO D C   1 
ATOM   1119 O O   . PRO D 1 5  ? 12.221  -3.050  -15.858 1.00 22.93 ? 31  PRO D O   1 
ATOM   1120 C CB  . PRO D 1 5  ? 13.921  -3.447  -18.778 1.00 26.04 ? 31  PRO D CB  1 
ATOM   1121 C CG  . PRO D 1 5  ? 15.182  -3.024  -19.462 1.00 27.03 ? 31  PRO D CG  1 
ATOM   1122 C CD  . PRO D 1 5  ? 16.192  -3.121  -18.340 1.00 27.41 ? 31  PRO D CD  1 
ATOM   1123 N N   . GLN D 1 6  ? 13.871  -4.573  -15.911 1.00 23.45 ? 32  GLN D N   1 
ATOM   1124 C CA  . GLN D 1 6  ? 13.286  -5.385  -14.855 1.00 24.04 ? 32  GLN D CA  1 
ATOM   1125 C C   . GLN D 1 6  ? 13.297  -4.665  -13.511 1.00 23.07 ? 32  GLN D C   1 
ATOM   1126 O O   . GLN D 1 6  ? 12.351  -4.775  -12.735 1.00 23.37 ? 32  GLN D O   1 
ATOM   1127 C CB  . GLN D 1 6  ? 14.026  -6.723  -14.747 1.00 26.56 ? 32  GLN D CB  1 
ATOM   1128 C CG  . GLN D 1 6  ? 13.760  -7.642  -15.933 1.00 32.47 ? 32  GLN D CG  1 
ATOM   1129 C CD  . GLN D 1 6  ? 14.477  -8.972  -15.827 1.00 35.41 ? 32  GLN D CD  1 
ATOM   1130 O OE1 . GLN D 1 6  ? 14.191  -9.775  -14.940 1.00 38.21 ? 32  GLN D OE1 1 
ATOM   1131 N NE2 . GLN D 1 6  ? 15.418  -9.211  -16.735 1.00 37.74 ? 32  GLN D NE2 1 
ATOM   1132 N N   . MET D 1 7  ? 14.365  -3.935  -13.231 1.00 21.51 ? 33  MET D N   1 
ATOM   1133 C CA  . MET D 1 7  ? 14.444  -3.203  -11.970 1.00 24.00 ? 33  MET D CA  1 
ATOM   1134 C C   . MET D 1 7  ? 13.368  -2.123  -11.923 1.00 21.94 ? 33  MET D C   1 
ATOM   1135 O O   . MET D 1 7  ? 12.719  -1.937  -10.900 1.00 21.51 ? 33  MET D O   1 
ATOM   1136 C CB  . MET D 1 7  ? 15.822  -2.569  -11.801 1.00 23.78 ? 33  MET D CB  1 
ATOM   1137 C CG  . MET D 1 7  ? 16.953  -3.577  -11.717 1.00 30.36 ? 33  MET D CG  1 
ATOM   1138 S SD  . MET D 1 7  ? 18.535  -2.775  -11.402 1.00 35.18 ? 33  MET D SD  1 
ATOM   1139 C CE  . MET D 1 7  ? 18.415  -2.514  -9.666  1.00 33.98 ? 33  MET D CE  1 
ATOM   1140 N N   . LEU D 1 8  ? 13.175  -1.411  -13.032 1.00 21.34 ? 34  LEU D N   1 
ATOM   1141 C CA  . LEU D 1 8  ? 12.156  -0.364  -13.079 1.00 21.45 ? 34  LEU D CA  1 
ATOM   1142 C C   . LEU D 1 8  ? 10.770  -0.953  -12.819 1.00 21.57 ? 34  LEU D C   1 
ATOM   1143 O O   . LEU D 1 8  ? 9.947   -0.356  -12.119 1.00 20.33 ? 34  LEU D O   1 
ATOM   1144 C CB  . LEU D 1 8  ? 12.172  0.350   -14.440 1.00 20.86 ? 34  LEU D CB  1 
ATOM   1145 C CG  . LEU D 1 8  ? 11.041  1.356   -14.699 1.00 20.95 ? 34  LEU D CG  1 
ATOM   1146 C CD1 . LEU D 1 8  ? 11.061  2.466   -13.636 1.00 17.40 ? 34  LEU D CD1 1 
ATOM   1147 C CD2 . LEU D 1 8  ? 11.211  1.953   -16.092 1.00 22.15 ? 34  LEU D CD2 1 
ATOM   1148 N N   . ARG D 1 9  ? 10.509  -2.136  -13.366 1.00 23.06 ? 35  ARG D N   1 
ATOM   1149 C CA  . ARG D 1 9  ? 9.210   -2.760  -13.159 1.00 21.31 ? 35  ARG D CA  1 
ATOM   1150 C C   . ARG D 1 9  ? 8.998   -3.120  -11.688 1.00 20.06 ? 35  ARG D C   1 
ATOM   1151 O O   . ARG D 1 9  ? 7.899   -2.980  -11.168 1.00 17.95 ? 35  ARG D O   1 
ATOM   1152 C CB  . ARG D 1 9  ? 9.067   -4.005  -14.035 1.00 25.81 ? 35  ARG D CB  1 
ATOM   1153 C CG  . ARG D 1 9  ? 7.639   -4.511  -14.123 1.00 31.04 ? 35  ARG D CG  1 
ATOM   1154 C CD  . ARG D 1 9  ? 7.457   -5.541  -15.235 1.00 37.12 ? 35  ARG D CD  1 
ATOM   1155 N NE  . ARG D 1 9  ? 7.969   -5.078  -16.527 1.00 38.56 ? 35  ARG D NE  1 
ATOM   1156 C CZ  . ARG D 1 9  ? 9.219   -5.258  -16.945 1.00 39.27 ? 35  ARG D CZ  1 
ATOM   1157 N NH1 . ARG D 1 9  ? 10.089  -5.894  -16.174 1.00 42.66 ? 35  ARG D NH1 1 
ATOM   1158 N NH2 . ARG D 1 9  ? 9.603   -4.801  -18.130 1.00 40.94 ? 35  ARG D NH2 1 
ATOM   1159 N N   . GLU D 1 10 ? 10.045  -3.588  -11.017 1.00 18.04 ? 36  GLU D N   1 
ATOM   1160 C CA  . GLU D 1 10 ? 9.927   -3.925  -9.602  1.00 17.01 ? 36  GLU D CA  1 
ATOM   1161 C C   . GLU D 1 10 ? 9.605   -2.649  -8.820  1.00 16.69 ? 36  GLU D C   1 
ATOM   1162 O O   . GLU D 1 10 ? 8.793   -2.668  -7.903  1.00 18.23 ? 36  GLU D O   1 
ATOM   1163 C CB  . GLU D 1 10 ? 11.236  -4.509  -9.061  1.00 16.29 ? 36  GLU D CB  1 
ATOM   1164 C CG  . GLU D 1 10 ? 11.604  -5.884  -9.598  1.00 17.91 ? 36  GLU D CG  1 
ATOM   1165 C CD  . GLU D 1 10 ? 10.513  -6.910  -9.384  1.00 20.36 ? 36  GLU D CD  1 
ATOM   1166 O OE1 . GLU D 1 10 ? 9.979   -7.007  -8.256  1.00 18.64 ? 36  GLU D OE1 1 
ATOM   1167 O OE2 . GLU D 1 10 ? 10.190  -7.627  -10.351 1.00 23.10 ? 36  GLU D OE2 1 
ATOM   1168 N N   . LEU D 1 11 ? 10.261  -1.548  -9.178  1.00 15.69 ? 37  LEU D N   1 
ATOM   1169 C CA  . LEU D 1 11 ? 10.036  -0.275  -8.493  1.00 17.04 ? 37  LEU D CA  1 
ATOM   1170 C C   . LEU D 1 11 ? 8.609   0.226   -8.668  1.00 18.63 ? 37  LEU D C   1 
ATOM   1171 O O   . LEU D 1 11 ? 8.034   0.814   -7.751  1.00 20.05 ? 37  LEU D O   1 
ATOM   1172 C CB  . LEU D 1 11 ? 11.014  0.790   -8.994  1.00 15.90 ? 37  LEU D CB  1 
ATOM   1173 C CG  . LEU D 1 11 ? 12.487  0.582   -8.640  1.00 17.61 ? 37  LEU D CG  1 
ATOM   1174 C CD1 . LEU D 1 11 ? 13.330  1.686   -9.265  1.00 20.21 ? 37  LEU D CD1 1 
ATOM   1175 C CD2 . LEU D 1 11 ? 12.643  0.582   -7.130  1.00 16.78 ? 37  LEU D CD2 1 
ATOM   1176 N N   . GLN D 1 12 ? 8.048   0.021   -9.854  1.00 19.04 ? 38  GLN D N   1 
ATOM   1177 C CA  . GLN D 1 12 ? 6.679   0.441   -10.120 1.00 20.37 ? 38  GLN D CA  1 
ATOM   1178 C C   . GLN D 1 12 ? 5.729   -0.403  -9.271  1.00 20.61 ? 38  GLN D C   1 
ATOM   1179 O O   . GLN D 1 12 ? 4.771   0.117   -8.688  1.00 18.65 ? 38  GLN D O   1 
ATOM   1180 C CB  . GLN D 1 12 ? 6.363   0.289   -11.613 1.00 20.64 ? 38  GLN D CB  1 
ATOM   1181 C CG  . GLN D 1 12 ? 7.234   1.176   -12.491 1.00 23.42 ? 38  GLN D CG  1 
ATOM   1182 C CD  . GLN D 1 12 ? 6.976   0.993   -13.973 1.00 28.82 ? 38  GLN D CD  1 
ATOM   1183 O OE1 . GLN D 1 12 ? 6.882   -0.130  -14.461 1.00 26.75 ? 38  GLN D OE1 1 
ATOM   1184 N NE2 . GLN D 1 12 ? 6.879   2.105   -14.702 1.00 28.21 ? 38  GLN D NE2 1 
ATOM   1185 N N   . GLU D 1 13 ? 5.999   -1.706  -9.196  1.00 19.37 ? 39  GLU D N   1 
ATOM   1186 C CA  . GLU D 1 13 ? 5.170   -2.601  -8.395  1.00 21.57 ? 39  GLU D CA  1 
ATOM   1187 C C   . GLU D 1 13 ? 5.227   -2.185  -6.926  1.00 20.21 ? 39  GLU D C   1 
ATOM   1188 O O   . GLU D 1 13 ? 4.238   -2.251  -6.215  1.00 18.17 ? 39  GLU D O   1 
ATOM   1189 C CB  . GLU D 1 13 ? 5.659   -4.045  -8.522  1.00 24.80 ? 39  GLU D CB  1 
ATOM   1190 C CG  . GLU D 1 13 ? 5.432   -4.669  -9.887  1.00 32.19 ? 39  GLU D CG  1 
ATOM   1191 C CD  . GLU D 1 13 ? 5.867   -6.124  -9.931  1.00 34.45 ? 39  GLU D CD  1 
ATOM   1192 O OE1 . GLU D 1 13 ? 5.416   -6.898  -9.062  1.00 36.89 ? 39  GLU D OE1 1 
ATOM   1193 O OE2 . GLU D 1 13 ? 6.655   -6.491  -10.830 1.00 40.14 ? 39  GLU D OE2 1 
ATOM   1194 N N   . THR D 1 14 ? 6.404   -1.766  -6.480  1.00 20.99 ? 40  THR D N   1 
ATOM   1195 C CA  . THR D 1 14 ? 6.583   -1.335  -5.101  1.00 20.70 ? 40  THR D CA  1 
ATOM   1196 C C   . THR D 1 14 ? 5.758   -0.084  -4.816  1.00 19.60 ? 40  THR D C   1 
ATOM   1197 O O   . THR D 1 14 ? 5.157   0.035   -3.757  1.00 16.60 ? 40  THR D O   1 
ATOM   1198 C CB  . THR D 1 14 ? 8.072   -1.058  -4.812  1.00 21.53 ? 40  THR D CB  1 
ATOM   1199 O OG1 . THR D 1 14 ? 8.758   -2.309  -4.680  1.00 22.93 ? 40  THR D OG1 1 
ATOM   1200 C CG2 . THR D 1 14 ? 8.243   -0.228  -3.541  1.00 22.52 ? 40  THR D CG2 1 
ATOM   1201 N N   . ASN D 1 15 ? 5.726   0.841   -5.768  1.00 20.57 ? 41  ASN D N   1 
ATOM   1202 C CA  . ASN D 1 15 ? 4.957   2.066   -5.592  1.00 23.75 ? 41  ASN D CA  1 
ATOM   1203 C C   . ASN D 1 15 ? 3.461   1.753   -5.558  1.00 22.40 ? 41  ASN D C   1 
ATOM   1204 O O   . ASN D 1 15 ? 2.708   2.366   -4.808  1.00 23.19 ? 41  ASN D O   1 
ATOM   1205 C CB  . ASN D 1 15 ? 5.272   3.051   -6.726  1.00 28.45 ? 41  ASN D CB  1 
ATOM   1206 C CG  . ASN D 1 15 ? 4.642   4.413   -6.507  1.00 33.37 ? 41  ASN D CG  1 
ATOM   1207 O OD1 . ASN D 1 15 ? 4.558   4.894   -5.377  1.00 37.00 ? 41  ASN D OD1 1 
ATOM   1208 N ND2 . ASN D 1 15 ? 4.212   5.050   -7.590  1.00 36.34 ? 41  ASN D ND2 1 
ATOM   1209 N N   . ALA D 1 16 ? 3.035   0.786   -6.364  1.00 22.61 ? 42  ALA D N   1 
ATOM   1210 C CA  . ALA D 1 16 ? 1.629   0.402   -6.401  1.00 21.53 ? 42  ALA D CA  1 
ATOM   1211 C C   . ALA D 1 16 ? 1.220   -0.199  -5.058  1.00 20.61 ? 42  ALA D C   1 
ATOM   1212 O O   . ALA D 1 16 ? 0.164   0.133   -4.514  1.00 22.14 ? 42  ALA D O   1 
ATOM   1213 C CB  . ALA D 1 16 ? 1.385   -0.607  -7.525  1.00 22.46 ? 42  ALA D CB  1 
ATOM   1214 N N   . ALA D 1 17 ? 2.060   -1.085  -4.528  1.00 21.86 ? 43  ALA D N   1 
ATOM   1215 C CA  . ALA D 1 17 ? 1.786   -1.734  -3.249  1.00 20.24 ? 43  ALA D CA  1 
ATOM   1216 C C   . ALA D 1 17 ? 1.728   -0.711  -2.122  1.00 19.29 ? 43  ALA D C   1 
ATOM   1217 O O   . ALA D 1 17 ? 0.890   -0.810  -1.228  1.00 20.69 ? 43  ALA D O   1 
ATOM   1218 C CB  . ALA D 1 17 ? 2.859   -2.791  -2.949  1.00 20.93 ? 43  ALA D CB  1 
ATOM   1219 N N   . LEU D 1 18 ? 2.626   0.268   -2.169  1.00 20.05 ? 44  LEU D N   1 
ATOM   1220 C CA  . LEU D 1 18 ? 2.684   1.322   -1.158  1.00 19.57 ? 44  LEU D CA  1 
ATOM   1221 C C   . LEU D 1 18 ? 1.431   2.190   -1.177  1.00 19.15 ? 44  LEU D C   1 
ATOM   1222 O O   . LEU D 1 18 ? 0.968   2.654   -0.132  1.00 18.35 ? 44  LEU D O   1 
ATOM   1223 C CB  . LEU D 1 18 ? 3.897   2.222   -1.393  1.00 21.79 ? 44  LEU D CB  1 
ATOM   1224 C CG  . LEU D 1 18 ? 4.952   2.273   -0.290  1.00 26.21 ? 44  LEU D CG  1 
ATOM   1225 C CD1 . LEU D 1 18 ? 4.300   2.568   1.064   1.00 22.36 ? 44  LEU D CD1 1 
ATOM   1226 C CD2 . LEU D 1 18 ? 5.673   0.948   -0.254  1.00 25.03 ? 44  LEU D CD2 1 
ATOM   1227 N N   . GLN D 1 19 ? 0.904   2.439   -2.371  1.00 18.31 ? 45  GLN D N   1 
ATOM   1228 C CA  . GLN D 1 19 ? -0.303  3.248   -2.501  1.00 19.40 ? 45  GLN D CA  1 
ATOM   1229 C C   . GLN D 1 19 ? -1.422  2.524   -1.762  1.00 19.60 ? 45  GLN D C   1 
ATOM   1230 O O   . GLN D 1 19 ? -2.196  3.138   -1.027  1.00 18.55 ? 45  GLN D O   1 
ATOM   1231 C CB  . GLN D 1 19 ? -0.679  3.428   -3.975  1.00 22.15 ? 45  GLN D CB  1 
ATOM   1232 C CG  . GLN D 1 19 ? 0.273   4.337   -4.760  1.00 26.33 ? 45  GLN D CG  1 
ATOM   1233 C CD  . GLN D 1 19 ? 0.450   5.701   -4.101  1.00 31.05 ? 45  GLN D CD  1 
ATOM   1234 O OE1 . GLN D 1 19 ? -0.529  6.387   -3.776  1.00 32.10 ? 45  GLN D OE1 1 
ATOM   1235 N NE2 . GLN D 1 19 ? 1.700   6.098   -3.900  1.00 31.10 ? 45  GLN D NE2 1 
ATOM   1236 N N   . ASP D 1 20 ? -1.495  1.213   -1.958  1.00 18.07 ? 46  ASP D N   1 
ATOM   1237 C CA  . ASP D 1 20 ? -2.513  0.408   -1.296  1.00 18.57 ? 46  ASP D CA  1 
ATOM   1238 C C   . ASP D 1 20 ? -2.300  0.413   0.219   1.00 17.12 ? 46  ASP D C   1 
ATOM   1239 O O   . ASP D 1 20 ? -3.261  0.507   0.977   1.00 17.07 ? 46  ASP D O   1 
ATOM   1240 C CB  . ASP D 1 20 ? -2.484  -1.027  -1.824  1.00 24.80 ? 46  ASP D CB  1 
ATOM   1241 C CG  . ASP D 1 20 ? -3.687  -1.827  -1.380  1.00 30.57 ? 46  ASP D CG  1 
ATOM   1242 O OD1 . ASP D 1 20 ? -4.821  -1.340  -1.563  1.00 35.63 ? 46  ASP D OD1 1 
ATOM   1243 O OD2 . ASP D 1 20 ? -3.510  -2.943  -0.854  1.00 35.71 ? 46  ASP D OD2 1 
ATOM   1244 N N   . VAL D 1 21 ? -1.045  0.310   0.660   1.00 16.71 ? 47  VAL D N   1 
ATOM   1245 C CA  . VAL D 1 21 ? -0.746  0.328   2.094   1.00 16.61 ? 47  VAL D CA  1 
ATOM   1246 C C   . VAL D 1 21 ? -1.197  1.655   2.693   1.00 17.51 ? 47  VAL D C   1 
ATOM   1247 O O   . VAL D 1 21 ? -1.749  1.708   3.793   1.00 16.33 ? 47  VAL D O   1 
ATOM   1248 C CB  . VAL D 1 21 ? 0.771   0.136   2.357   1.00 18.22 ? 47  VAL D CB  1 
ATOM   1249 C CG1 . VAL D 1 21 ? 1.107   0.452   3.802   1.00 17.60 ? 47  VAL D CG1 1 
ATOM   1250 C CG2 . VAL D 1 21 ? 1.162   -1.300  2.049   1.00 19.36 ? 47  VAL D CG2 1 
ATOM   1251 N N   . ARG D 1 22 ? -0.968  2.730   1.951   1.00 16.60 ? 48  ARG D N   1 
ATOM   1252 C CA  . ARG D 1 22 ? -1.348  4.064   2.386   1.00 18.81 ? 48  ARG D CA  1 
ATOM   1253 C C   . ARG D 1 22 ? -2.867  4.177   2.530   1.00 17.66 ? 48  ARG D C   1 
ATOM   1254 O O   . ARG D 1 22 ? -3.368  4.678   3.538   1.00 17.02 ? 48  ARG D O   1 
ATOM   1255 C CB  . ARG D 1 22 ? -0.827  5.073   1.363   1.00 20.91 ? 48  ARG D CB  1 
ATOM   1256 C CG  . ARG D 1 22 ? -0.954  6.531   1.713   1.00 27.23 ? 48  ARG D CG  1 
ATOM   1257 C CD  . ARG D 1 22 ? -0.472  7.318   0.493   1.00 29.91 ? 48  ARG D CD  1 
ATOM   1258 N NE  . ARG D 1 22 ? 0.097   8.609   0.834   1.00 35.97 ? 48  ARG D NE  1 
ATOM   1259 C CZ  . ARG D 1 22 ? 0.674   9.422   -0.043  1.00 31.74 ? 48  ARG D CZ  1 
ATOM   1260 N NH1 . ARG D 1 22 ? 0.758   9.072   -1.319  1.00 35.13 ? 48  ARG D NH1 1 
ATOM   1261 N NH2 . ARG D 1 22 ? 1.168   10.580  0.361   1.00 37.19 ? 48  ARG D NH2 1 
ATOM   1262 N N   . GLU D 1 23 ? -3.600  3.711   1.523   1.00 17.39 ? 49  GLU D N   1 
ATOM   1263 C CA  . GLU D 1 23 ? -5.057  3.766   1.564   1.00 18.94 ? 49  GLU D CA  1 
ATOM   1264 C C   . GLU D 1 23 ? -5.583  2.921   2.724   1.00 18.11 ? 49  GLU D C   1 
ATOM   1265 O O   . GLU D 1 23 ? -6.498  3.333   3.435   1.00 17.84 ? 49  GLU D O   1 
ATOM   1266 C CB  . GLU D 1 23 ? -5.647  3.290   0.224   1.00 19.41 ? 49  GLU D CB  1 
ATOM   1267 C CG  . GLU D 1 23 ? -5.145  4.112   -0.965  1.00 22.73 ? 49  GLU D CG  1 
ATOM   1268 C CD  . GLU D 1 23 ? -5.612  3.597   -2.324  1.00 26.05 ? 49  GLU D CD  1 
ATOM   1269 O OE1 . GLU D 1 23 ? -6.028  2.422   -2.430  1.00 30.11 ? 49  GLU D OE1 1 
ATOM   1270 O OE2 . GLU D 1 23 ? -5.542  4.373   -3.302  1.00 27.81 ? 49  GLU D OE2 1 
ATOM   1271 N N   . LEU D 1 24 ? -4.988  1.752   2.935   1.00 17.55 ? 50  LEU D N   1 
ATOM   1272 C CA  . LEU D 1 24 ? -5.414  0.888   4.036   1.00 16.84 ? 50  LEU D CA  1 
ATOM   1273 C C   . LEU D 1 24 ? -5.166  1.561   5.382   1.00 17.77 ? 50  LEU D C   1 
ATOM   1274 O O   . LEU D 1 24 ? -6.017  1.528   6.275   1.00 18.34 ? 50  LEU D O   1 
ATOM   1275 C CB  . LEU D 1 24 ? -4.668  -0.454  3.976   1.00 18.16 ? 50  LEU D CB  1 
ATOM   1276 C CG  . LEU D 1 24 ? -5.108  -1.406  2.853   1.00 19.38 ? 50  LEU D CG  1 
ATOM   1277 C CD1 . LEU D 1 24 ? -4.095  -2.517  2.672   1.00 19.29 ? 50  LEU D CD1 1 
ATOM   1278 C CD2 . LEU D 1 24 ? -6.476  -1.985  3.188   1.00 20.32 ? 50  LEU D CD2 1 
ATOM   1279 N N   . LEU D 1 25 ? -3.997  2.176   5.528   1.00 18.07 ? 51  LEU D N   1 
ATOM   1280 C CA  . LEU D 1 25 ? -3.660  2.842   6.778   1.00 19.75 ? 51  LEU D CA  1 
ATOM   1281 C C   . LEU D 1 25 ? -4.592  4.025   7.010   1.00 19.86 ? 51  LEU D C   1 
ATOM   1282 O O   . LEU D 1 25 ? -4.997  4.293   8.141   1.00 18.47 ? 51  LEU D O   1 
ATOM   1283 C CB  . LEU D 1 25 ? -2.201  3.309   6.759   1.00 19.71 ? 51  LEU D CB  1 
ATOM   1284 C CG  . LEU D 1 25 ? -1.629  3.805   8.089   1.00 24.65 ? 51  LEU D CG  1 
ATOM   1285 C CD1 . LEU D 1 25 ? -1.859  2.751   9.184   1.00 24.11 ? 51  LEU D CD1 1 
ATOM   1286 C CD2 . LEU D 1 25 ? -0.138  4.098   7.924   1.00 24.18 ? 51  LEU D CD2 1 
ATOM   1287 N N   . ARG D 1 26 ? -4.938  4.737   5.941   1.00 20.29 ? 52  ARG D N   1 
ATOM   1288 C CA  . ARG D 1 26 ? -5.836  5.876   6.089   1.00 21.76 ? 52  ARG D CA  1 
ATOM   1289 C C   . ARG D 1 26 ? -7.201  5.432   6.594   1.00 21.56 ? 52  ARG D C   1 
ATOM   1290 O O   . ARG D 1 26 ? -7.843  6.127   7.379   1.00 21.07 ? 52  ARG D O   1 
ATOM   1291 C CB  . ARG D 1 26 ? -5.954  6.630   4.768   1.00 21.25 ? 52  ARG D CB  1 
ATOM   1292 C CG  . ARG D 1 26 ? -4.635  7.281   4.400   1.00 24.68 ? 52  ARG D CG  1 
ATOM   1293 C CD  . ARG D 1 26 ? -4.820  8.490   3.526   1.00 30.19 ? 52  ARG D CD  1 
ATOM   1294 N NE  . ARG D 1 26 ? -4.755  8.161   2.113   1.00 31.92 ? 52  ARG D NE  1 
ATOM   1295 C CZ  . ARG D 1 26 ? -3.838  8.641   1.283   1.00 33.50 ? 52  ARG D CZ  1 
ATOM   1296 N NH1 . ARG D 1 26 ? -2.903  9.472   1.726   1.00 35.87 ? 52  ARG D NH1 1 
ATOM   1297 N NH2 . ARG D 1 26 ? -3.864  8.298   0.006   1.00 33.50 ? 52  ARG D NH2 1 
ATOM   1298 N N   . GLN D 1 27 ? -7.636  4.257   6.161   1.00 21.85 ? 53  GLN D N   1 
ATOM   1299 C CA  . GLN D 1 27 ? -8.913  3.724   6.601   1.00 21.39 ? 53  GLN D CA  1 
ATOM   1300 C C   . GLN D 1 27 ? -8.798  3.260   8.050   1.00 21.06 ? 53  GLN D C   1 
ATOM   1301 O O   . GLN D 1 27 ? -9.691  3.505   8.862   1.00 21.55 ? 53  GLN D O   1 
ATOM   1302 C CB  . GLN D 1 27 ? -9.332  2.548   5.717   1.00 22.93 ? 53  GLN D CB  1 
ATOM   1303 C CG  . GLN D 1 27 ? -10.738 2.044   5.999   1.00 23.55 ? 53  GLN D CG  1 
ATOM   1304 C CD  . GLN D 1 27 ? -11.766 3.158   5.929   1.00 27.18 ? 53  GLN D CD  1 
ATOM   1305 O OE1 . GLN D 1 27 ? -11.751 3.969   5.001   1.00 27.34 ? 53  GLN D OE1 1 
ATOM   1306 N NE2 . GLN D 1 27 ? -12.666 3.203   6.908   1.00 24.69 ? 53  GLN D NE2 1 
ATOM   1307 N N   . GLN D 1 28 ? -7.687  2.600   8.371   1.00 20.21 ? 54  GLN D N   1 
ATOM   1308 C CA  . GLN D 1 28 ? -7.459  2.085   9.718   1.00 20.02 ? 54  GLN D CA  1 
ATOM   1309 C C   . GLN D 1 28 ? -7.443  3.177   10.790  1.00 21.61 ? 54  GLN D C   1 
ATOM   1310 O O   . GLN D 1 28 ? -7.951  2.979   11.899  1.00 19.21 ? 54  GLN D O   1 
ATOM   1311 C CB  . GLN D 1 28 ? -6.147  1.297   9.759   1.00 21.05 ? 54  GLN D CB  1 
ATOM   1312 C CG  . GLN D 1 28 ? -5.920  0.530   11.056  1.00 20.74 ? 54  GLN D CG  1 
ATOM   1313 C CD  . GLN D 1 28 ? -4.681  -0.344  11.002  1.00 22.36 ? 54  GLN D CD  1 
ATOM   1314 O OE1 . GLN D 1 28 ? -4.724  -1.497  10.552  1.00 20.44 ? 54  GLN D OE1 1 
ATOM   1315 N NE2 . GLN D 1 28 ? -3.563  0.206   11.444  1.00 22.35 ? 54  GLN D NE2 1 
ATOM   1316 N N   . VAL D 1 29 ? -6.842  4.318   10.468  1.00 20.92 ? 55  VAL D N   1 
ATOM   1317 C CA  . VAL D 1 29 ? -6.786  5.426   11.415  1.00 23.23 ? 55  VAL D CA  1 
ATOM   1318 C C   . VAL D 1 29 ? -8.198  5.933   11.703  1.00 23.02 ? 55  VAL D C   1 
ATOM   1319 O O   . VAL D 1 29 ? -8.517  6.301   12.834  1.00 23.47 ? 55  VAL D O   1 
ATOM   1320 C CB  . VAL D 1 29 ? -5.924  6.592   10.870  1.00 23.63 ? 55  VAL D CB  1 
ATOM   1321 C CG1 . VAL D 1 29 ? -5.982  7.774   11.827  1.00 25.89 ? 55  VAL D CG1 1 
ATOM   1322 C CG2 . VAL D 1 29 ? -4.489  6.132   10.696  1.00 27.96 ? 55  VAL D CG2 1 
ATOM   1323 N N   . LYS D 1 30 ? -9.050  5.947   10.684  1.00 22.69 ? 56  LYS D N   1 
ATOM   1324 C CA  . LYS D 1 30 ? -10.428 6.398   10.874  1.00 24.46 ? 56  LYS D CA  1 
ATOM   1325 C C   . LYS D 1 30 ? -11.189 5.459   11.812  1.00 24.04 ? 56  LYS D C   1 
ATOM   1326 O O   . LYS D 1 30 ? -12.023 5.898   12.604  1.00 22.68 ? 56  LYS D O   1 
ATOM   1327 C CB  . LYS D 1 30 ? -11.163 6.471   9.533   1.00 26.89 ? 56  LYS D CB  1 
ATOM   1328 C CG  . LYS D 1 30 ? -10.696 7.582   8.618   1.00 30.09 ? 56  LYS D CG  1 
ATOM   1329 C CD  . LYS D 1 30 ? -11.539 7.614   7.346   1.00 34.79 ? 56  LYS D CD  1 
ATOM   1330 C CE  . LYS D 1 30 ? -11.052 8.689   6.380   1.00 35.94 ? 56  LYS D CE  1 
ATOM   1331 N NZ  . LYS D 1 30 ? -11.805 8.640   5.088   1.00 38.94 ? 56  LYS D NZ  1 
ATOM   1332 N N   . GLU D 1 31 ? -10.908 4.163   11.719  1.00 22.02 ? 57  GLU D N   1 
ATOM   1333 C CA  . GLU D 1 31 ? -11.590 3.195   12.577  1.00 22.98 ? 57  GLU D CA  1 
ATOM   1334 C C   . GLU D 1 31 ? -11.086 3.323   14.012  1.00 23.64 ? 57  GLU D C   1 
ATOM   1335 O O   . GLU D 1 31 ? -11.855 3.178   14.968  1.00 24.31 ? 57  GLU D O   1 
ATOM   1336 C CB  . GLU D 1 31 ? -11.354 1.764   12.074  1.00 22.65 ? 57  GLU D CB  1 
ATOM   1337 C CG  . GLU D 1 31 ? -11.747 1.518   10.619  1.00 23.07 ? 57  GLU D CG  1 
ATOM   1338 C CD  . GLU D 1 31 ? -13.219 1.780   10.337  1.00 26.42 ? 57  GLU D CD  1 
ATOM   1339 O OE1 . GLU D 1 31 ? -13.962 2.102   11.284  1.00 29.39 ? 57  GLU D OE1 1 
ATOM   1340 O OE2 . GLU D 1 31 ? -13.635 1.659   9.162   1.00 23.45 ? 57  GLU D OE2 1 
ATOM   1341 N N   . ILE D 1 32 ? -9.792  3.586   14.162  1.00 22.58 ? 58  ILE D N   1 
ATOM   1342 C CA  . ILE D 1 32 ? -9.215  3.730   15.487  1.00 23.38 ? 58  ILE D CA  1 
ATOM   1343 C C   . ILE D 1 32 ? -9.712  5.012   16.146  1.00 25.06 ? 58  ILE D C   1 
ATOM   1344 O O   . ILE D 1 32 ? -9.980  5.038   17.354  1.00 23.79 ? 58  ILE D O   1 
ATOM   1345 C CB  . ILE D 1 32 ? -7.671  3.717   15.431  1.00 23.98 ? 58  ILE D CB  1 
ATOM   1346 C CG1 . ILE D 1 32 ? -7.198  2.333   14.970  1.00 23.40 ? 58  ILE D CG1 1 
ATOM   1347 C CG2 . ILE D 1 32 ? -7.089  4.055   16.807  1.00 23.56 ? 58  ILE D CG2 1 
ATOM   1348 C CD1 . ILE D 1 32 ? -5.703  2.161   14.937  1.00 24.58 ? 58  ILE D CD1 1 
ATOM   1349 N N   . THR D 1 33 ? -9.860  6.065   15.349  1.00 25.34 ? 59  THR D N   1 
ATOM   1350 C CA  . THR D 1 33 ? -10.350 7.339   15.868  1.00 28.23 ? 59  THR D CA  1 
ATOM   1351 C C   . THR D 1 33 ? -11.805 7.197   16.321  1.00 29.35 ? 59  THR D C   1 
ATOM   1352 O O   . THR D 1 33 ? -12.204 7.741   17.356  1.00 29.53 ? 59  THR D O   1 
ATOM   1353 C CB  . THR D 1 33 ? -10.254 8.452   14.801  1.00 28.09 ? 59  THR D CB  1 
ATOM   1354 O OG1 . THR D 1 33 ? -8.878  8.667   14.460  1.00 29.35 ? 59  THR D OG1 1 
ATOM   1355 C CG2 . THR D 1 33 ? -10.855 9.756   15.329  1.00 27.19 ? 59  THR D CG2 1 
ATOM   1356 N N   . PHE D 1 34 ? -12.599 6.466   15.544  1.00 30.39 ? 60  PHE D N   1 
ATOM   1357 C CA  . PHE D 1 34 ? -13.994 6.260   15.898  1.00 31.75 ? 60  PHE D CA  1 
ATOM   1358 C C   . PHE D 1 34 ? -14.057 5.449   17.188  1.00 31.83 ? 60  PHE D C   1 
ATOM   1359 O O   . PHE D 1 34 ? -14.856 5.733   18.081  1.00 30.38 ? 60  PHE D O   1 
ATOM   1360 C CB  . PHE D 1 34 ? -14.734 5.504   14.797  1.00 34.28 ? 60  PHE D CB  1 
ATOM   1361 C CG  . PHE D 1 34 ? -16.217 5.426   15.023  1.00 39.17 ? 60  PHE D CG  1 
ATOM   1362 C CD1 . PHE D 1 34 ? -17.035 6.512   14.727  1.00 40.28 ? 60  PHE D CD1 1 
ATOM   1363 C CD2 . PHE D 1 34 ? -16.792 4.286   15.571  1.00 40.16 ? 60  PHE D CD2 1 
ATOM   1364 C CE1 . PHE D 1 34 ? -18.407 6.466   14.975  1.00 42.26 ? 60  PHE D CE1 1 
ATOM   1365 C CE2 . PHE D 1 34 ? -18.163 4.228   15.824  1.00 41.69 ? 60  PHE D CE2 1 
ATOM   1366 C CZ  . PHE D 1 34 ? -18.971 5.320   15.525  1.00 41.16 ? 60  PHE D CZ  1 
ATOM   1367 N N   . LEU D 1 35 ? -13.206 4.433   17.272  1.00 30.74 ? 61  LEU D N   1 
ATOM   1368 C CA  . LEU D 1 35 ? -13.145 3.572   18.445  1.00 31.28 ? 61  LEU D CA  1 
ATOM   1369 C C   . LEU D 1 35 ? -12.728 4.404   19.659  1.00 32.80 ? 61  LEU D C   1 
ATOM   1370 O O   . LEU D 1 35 ? -13.253 4.232   20.759  1.00 32.26 ? 61  LEU D O   1 
ATOM   1371 C CB  . LEU D 1 35 ? -12.128 2.452   18.203  1.00 31.74 ? 61  LEU D CB  1 
ATOM   1372 C CG  . LEU D 1 35 ? -12.028 1.317   19.221  1.00 33.02 ? 61  LEU D CG  1 
ATOM   1373 C CD1 . LEU D 1 35 ? -13.358 0.582   19.306  1.00 32.04 ? 61  LEU D CD1 1 
ATOM   1374 C CD2 . LEU D 1 35 ? -10.907 0.362   18.800  1.00 33.31 ? 61  LEU D CD2 1 
ATOM   1375 N N   . LYS D 1 36 ? -11.780 5.310   19.442  1.00 34.24 ? 62  LYS D N   1 
ATOM   1376 C CA  . LYS D 1 36 ? -11.274 6.178   20.496  1.00 36.39 ? 62  LYS D CA  1 
ATOM   1377 C C   . LYS D 1 36 ? -12.385 7.068   21.049  1.00 37.96 ? 62  LYS D C   1 
ATOM   1378 O O   . LYS D 1 36 ? -12.550 7.184   22.266  1.00 38.58 ? 62  LYS D O   1 
ATOM   1379 C CB  . LYS D 1 36 ? -10.119 7.028   19.946  1.00 37.03 ? 62  LYS D CB  1 
ATOM   1380 C CG  . LYS D 1 36 ? -9.423  7.937   20.957  1.00 38.16 ? 62  LYS D CG  1 
ATOM   1381 C CD  . LYS D 1 36 ? -10.226 9.199   21.234  1.00 40.33 ? 62  LYS D CD  1 
ATOM   1382 C CE  . LYS D 1 36 ? -10.419 10.043  19.975  1.00 39.75 ? 62  LYS D CE  1 
ATOM   1383 N NZ  . LYS D 1 36 ? -9.166  10.694  19.501  1.00 39.80 ? 62  LYS D NZ  1 
ATOM   1384 N N   . ASN D 1 37 ? -13.147 7.691   20.155  1.00 38.46 ? 63  ASN D N   1 
ATOM   1385 C CA  . ASN D 1 37 ? -14.240 8.567   20.564  1.00 39.75 ? 63  ASN D CA  1 
ATOM   1386 C C   . ASN D 1 37 ? -15.358 7.775   21.240  1.00 39.37 ? 63  ASN D C   1 
ATOM   1387 O O   . ASN D 1 37 ? -15.983 8.250   22.189  1.00 38.31 ? 63  ASN D O   1 
ATOM   1388 C CB  . ASN D 1 37 ? -14.808 9.314   19.352  1.00 40.60 ? 63  ASN D CB  1 
ATOM   1389 C CG  . ASN D 1 37 ? -13.788 10.226  18.697  1.00 42.35 ? 63  ASN D CG  1 
ATOM   1390 O OD1 . ASN D 1 37 ? -13.115 11.005  19.369  1.00 44.31 ? 63  ASN D OD1 1 
ATOM   1391 N ND2 . ASN D 1 37 ? -13.680 10.143  17.376  1.00 43.41 ? 63  ASN D ND2 1 
ATOM   1392 N N   . THR D 1 38 ? -15.603 6.569   20.739  1.00 39.24 ? 64  THR D N   1 
ATOM   1393 C CA  . THR D 1 38 ? -16.640 5.695   21.278  1.00 40.41 ? 64  THR D CA  1 
ATOM   1394 C C   . THR D 1 38 ? -16.396 5.369   22.747  1.00 41.74 ? 64  THR D C   1 
ATOM   1395 O O   . THR D 1 38 ? -17.267 5.577   23.593  1.00 41.54 ? 64  THR D O   1 
ATOM   1396 C CB  . THR D 1 38 ? -16.717 4.371   20.484  1.00 40.93 ? 64  THR D CB  1 
ATOM   1397 O OG1 . THR D 1 38 ? -17.170 4.639   19.151  1.00 38.89 ? 64  THR D OG1 1 
ATOM   1398 C CG2 . THR D 1 38 ? -17.673 3.390   21.156  1.00 41.05 ? 64  THR D CG2 1 
ATOM   1399 N N   . VAL D 1 39 ? -15.213 4.847   23.046  1.00 43.31 ? 65  VAL D N   1 
ATOM   1400 C CA  . VAL D 1 39 ? -14.869 4.494   24.417  1.00 45.57 ? 65  VAL D CA  1 
ATOM   1401 C C   . VAL D 1 39 ? -14.769 5.747   25.279  1.00 47.25 ? 65  VAL D C   1 
ATOM   1402 O O   . VAL D 1 39 ? -15.095 5.729   26.466  1.00 46.31 ? 65  VAL D O   1 
ATOM   1403 C CB  . VAL D 1 39 ? -13.528 3.735   24.471  1.00 45.12 ? 65  VAL D CB  1 
ATOM   1404 C CG1 . VAL D 1 39 ? -13.163 3.416   25.910  1.00 46.19 ? 65  VAL D CG1 1 
ATOM   1405 C CG2 . VAL D 1 39 ? -13.629 2.459   23.658  1.00 46.75 ? 65  VAL D CG2 1 
ATOM   1406 N N   . MET D 1 40 ? -14.324 6.838   24.669  1.00 50.14 ? 66  MET D N   1 
ATOM   1407 C CA  . MET D 1 40 ? -14.171 8.100   25.375  1.00 52.66 ? 66  MET D CA  1 
ATOM   1408 C C   . MET D 1 40 ? -15.523 8.669   25.796  1.00 53.68 ? 66  MET D C   1 
ATOM   1409 O O   . MET D 1 40 ? -15.626 9.355   26.814  1.00 53.60 ? 66  MET D O   1 
ATOM   1410 C CB  . MET D 1 40 ? -13.436 9.103   24.483  1.00 54.93 ? 66  MET D CB  1 
ATOM   1411 C CG  . MET D 1 40 ? -12.997 10.371  25.189  1.00 56.48 ? 66  MET D CG  1 
ATOM   1412 S SD  . MET D 1 40 ? -11.914 11.368  24.145  1.00 60.24 ? 66  MET D SD  1 
ATOM   1413 C CE  . MET D 1 40 ? -10.340 10.554  24.410  1.00 56.56 ? 66  MET D CE  1 
ATOM   1414 N N   . GLU D 1 41 ? -16.556 8.376   25.010  1.00 54.53 ? 67  GLU D N   1 
ATOM   1415 C CA  . GLU D 1 41 ? -17.905 8.862   25.294  1.00 56.07 ? 67  GLU D CA  1 
ATOM   1416 C C   . GLU D 1 41 ? -18.796 7.780   25.895  1.00 56.12 ? 67  GLU D C   1 
ATOM   1417 O O   . GLU D 1 41 ? -20.022 7.899   25.876  1.00 56.67 ? 67  GLU D O   1 
ATOM   1418 C CB  . GLU D 1 41 ? -18.561 9.390   24.013  1.00 56.79 ? 67  GLU D CB  1 
ATOM   1419 C CG  . GLU D 1 41 ? -17.806 10.525  23.337  1.00 57.99 ? 67  GLU D CG  1 
ATOM   1420 C CD  . GLU D 1 41 ? -18.510 11.020  22.088  1.00 59.16 ? 67  GLU D CD  1 
ATOM   1421 O OE1 . GLU D 1 41 ? -19.632 11.558  22.211  1.00 59.99 ? 67  GLU D OE1 1 
ATOM   1422 O OE2 . GLU D 1 41 ? -17.943 10.869  20.983  1.00 58.15 ? 67  GLU D OE2 1 
ATOM   1423 N N   . CYS D 1 42 ? -18.180 6.729   26.426  1.00 55.70 ? 68  CYS D N   1 
ATOM   1424 C CA  . CYS D 1 42 ? -18.929 5.634   27.028  1.00 55.63 ? 68  CYS D CA  1 
ATOM   1425 C C   . CYS D 1 42 ? -19.499 6.060   28.377  1.00 56.07 ? 68  CYS D C   1 
ATOM   1426 O O   . CYS D 1 42 ? -18.879 6.837   29.107  1.00 55.73 ? 68  CYS D O   1 
ATOM   1427 C CB  . CYS D 1 42 ? -18.027 4.411   27.206  1.00 55.16 ? 68  CYS D CB  1 
ATOM   1428 S SG  . CYS D 1 42 ? -18.858 2.964   27.902  1.00 56.82 ? 68  CYS D SG  1 
ATOM   1429 N N   . ASP D 1 43 ? -20.682 5.545   28.700  1.00 56.38 ? 69  ASP D N   1 
ATOM   1430 C CA  . ASP D 1 43 ? -21.353 5.870   29.954  1.00 56.00 ? 69  ASP D CA  1 
ATOM   1431 C C   . ASP D 1 43 ? -20.820 5.077   31.141  1.00 55.41 ? 69  ASP D C   1 
ATOM   1432 O O   . ASP D 1 43 ? -20.566 5.640   32.208  1.00 54.68 ? 69  ASP D O   1 
ATOM   1433 C CB  . ASP D 1 43 ? -22.858 5.633   29.812  1.00 57.29 ? 69  ASP D CB  1 
ATOM   1434 C CG  . ASP D 1 43 ? -23.518 6.642   28.899  1.00 58.80 ? 69  ASP D CG  1 
ATOM   1435 O OD1 . ASP D 1 43 ? -23.065 6.782   27.741  1.00 59.93 ? 69  ASP D OD1 1 
ATOM   1436 O OD2 . ASP D 1 43 ? -24.490 7.295   29.339  1.00 58.65 ? 69  ASP D OD2 1 
ATOM   1437 N N   . ALA D 1 44 ? -20.650 3.772   30.949  1.00 54.46 ? 70  ALA D N   1 
ATOM   1438 C CA  . ALA D 1 44 ? -20.156 2.892   32.002  1.00 54.00 ? 70  ALA D CA  1 
ATOM   1439 C C   . ALA D 1 44 ? -18.806 3.337   32.563  1.00 53.39 ? 70  ALA D C   1 
ATOM   1440 O O   . ALA D 1 44 ? -18.484 3.061   33.717  1.00 53.23 ? 70  ALA D O   1 
ATOM   1441 C CB  . ALA D 1 44 ? -20.052 1.468   31.475  1.00 54.23 ? 70  ALA D CB  1 
ATOM   1442 N N   . CYS D 1 45 ? -18.021 4.031   31.745  1.00 52.49 ? 71  CYS D N   1 
ATOM   1443 C CA  . CYS D 1 45 ? -16.703 4.497   32.161  1.00 51.29 ? 71  CYS D CA  1 
ATOM   1444 C C   . CYS D 1 45 ? -16.710 5.666   33.151  1.00 51.95 ? 71  CYS D C   1 
ATOM   1445 O O   . CYS D 1 45 ? -15.823 5.676   34.030  1.00 51.82 ? 71  CYS D O   1 
ATOM   1446 C CB  . CYS D 1 45 ? -15.864 4.858   30.934  1.00 48.88 ? 71  CYS D CB  1 
ATOM   1447 S SG  . CYS D 1 45 ? -15.293 3.415   29.977  1.00 46.09 ? 71  CYS D SG  1 
ATOM   1448 O OXT . CYS D 1 45 ? -17.578 6.560   33.039  1.00 52.94 ? 71  CYS D OXT 1 
ATOM   1449 N N   . MET E 1 1  ? 22.132  8.512   -18.581 1.00 64.05 ? 27  MET E N   1 
ATOM   1450 C CA  . MET E 1 1  ? 21.869  7.305   -19.416 1.00 63.96 ? 27  MET E CA  1 
ATOM   1451 C C   . MET E 1 1  ? 20.966  6.320   -18.682 1.00 62.61 ? 27  MET E C   1 
ATOM   1452 O O   . MET E 1 1  ? 20.580  6.551   -17.535 1.00 63.30 ? 27  MET E O   1 
ATOM   1453 C CB  . MET E 1 1  ? 23.190  6.613   -19.773 1.00 65.40 ? 27  MET E CB  1 
ATOM   1454 C CG  . MET E 1 1  ? 24.145  7.464   -20.598 1.00 67.21 ? 27  MET E CG  1 
ATOM   1455 S SD  . MET E 1 1  ? 23.456  7.944   -22.196 1.00 68.90 ? 27  MET E SD  1 
ATOM   1456 C CE  . MET E 1 1  ? 22.791  9.566   -21.813 1.00 68.96 ? 27  MET E CE  1 
ATOM   1457 N N   . ASP E 1 2  ? 20.627  5.224   -19.356 1.00 59.85 ? 28  ASP E N   1 
ATOM   1458 C CA  . ASP E 1 2  ? 19.788  4.186   -18.769 1.00 56.31 ? 28  ASP E CA  1 
ATOM   1459 C C   . ASP E 1 2  ? 18.460  4.737   -18.250 1.00 52.72 ? 28  ASP E C   1 
ATOM   1460 O O   . ASP E 1 2  ? 18.231  5.948   -18.260 1.00 54.27 ? 28  ASP E O   1 
ATOM   1461 C CB  . ASP E 1 2  ? 20.559  3.492   -17.637 1.00 57.42 ? 28  ASP E CB  1 
ATOM   1462 C CG  . ASP E 1 2  ? 19.831  2.283   -17.078 1.00 57.89 ? 28  ASP E CG  1 
ATOM   1463 O OD1 . ASP E 1 2  ? 18.857  2.463   -16.315 1.00 57.66 ? 28  ASP E OD1 1 
ATOM   1464 O OD2 . ASP E 1 2  ? 20.234  1.147   -17.407 1.00 59.46 ? 28  ASP E OD2 1 
ATOM   1465 N N   . LEU E 1 3  ? 17.587  3.836   -17.809 1.00 46.28 ? 29  LEU E N   1 
ATOM   1466 C CA  . LEU E 1 3  ? 16.277  4.194   -17.274 1.00 39.82 ? 29  LEU E CA  1 
ATOM   1467 C C   . LEU E 1 3  ? 16.417  4.933   -15.945 1.00 35.94 ? 29  LEU E C   1 
ATOM   1468 O O   . LEU E 1 3  ? 15.520  4.886   -15.103 1.00 32.95 ? 29  LEU E O   1 
ATOM   1469 C CB  . LEU E 1 3  ? 15.441  2.930   -17.057 1.00 38.51 ? 29  LEU E CB  1 
ATOM   1470 C CG  . LEU E 1 3  ? 15.224  2.005   -18.258 1.00 37.34 ? 29  LEU E CG  1 
ATOM   1471 C CD1 . LEU E 1 3  ? 14.659  0.678   -17.780 1.00 37.09 ? 29  LEU E CD1 1 
ATOM   1472 C CD2 . LEU E 1 3  ? 14.288  2.667   -19.266 1.00 36.51 ? 29  LEU E CD2 1 
ATOM   1473 N N   . ALA E 1 4  ? 17.548  5.605   -15.760 1.00 31.88 ? 30  ALA E N   1 
ATOM   1474 C CA  . ALA E 1 4  ? 17.807  6.348   -14.534 1.00 29.83 ? 30  ALA E CA  1 
ATOM   1475 C C   . ALA E 1 4  ? 16.692  7.353   -14.235 1.00 26.95 ? 30  ALA E C   1 
ATOM   1476 O O   . ALA E 1 4  ? 16.225  7.441   -13.107 1.00 27.08 ? 30  ALA E O   1 
ATOM   1477 C CB  . ALA E 1 4  ? 19.156  7.066   -14.630 1.00 29.36 ? 30  ALA E CB  1 
ATOM   1478 N N   . PRO E 1 5  ? 16.254  8.125   -15.247 1.00 26.12 ? 31  PRO E N   1 
ATOM   1479 C CA  . PRO E 1 5  ? 15.186  9.106   -15.024 1.00 25.92 ? 31  PRO E CA  1 
ATOM   1480 C C   . PRO E 1 5  ? 13.903  8.458   -14.496 1.00 24.80 ? 31  PRO E C   1 
ATOM   1481 O O   . PRO E 1 5  ? 13.268  8.972   -13.569 1.00 24.14 ? 31  PRO E O   1 
ATOM   1482 C CB  . PRO E 1 5  ? 14.995  9.724   -16.409 1.00 26.68 ? 31  PRO E CB  1 
ATOM   1483 C CG  . PRO E 1 5  ? 16.369  9.641   -17.001 1.00 26.94 ? 31  PRO E CG  1 
ATOM   1484 C CD  . PRO E 1 5  ? 16.783  8.239   -16.618 1.00 26.69 ? 31  PRO E CD  1 
ATOM   1485 N N   . GLN E 1 6  ? 13.533  7.329   -15.092 1.00 22.08 ? 32  GLN E N   1 
ATOM   1486 C CA  . GLN E 1 6  ? 12.332  6.603   -14.694 1.00 22.18 ? 32  GLN E CA  1 
ATOM   1487 C C   . GLN E 1 6  ? 12.456  5.952   -13.312 1.00 21.21 ? 32  GLN E C   1 
ATOM   1488 O O   . GLN E 1 6  ? 11.519  5.979   -12.513 1.00 20.08 ? 32  GLN E O   1 
ATOM   1489 C CB  . GLN E 1 6  ? 11.997  5.531   -15.735 1.00 23.03 ? 32  GLN E CB  1 
ATOM   1490 C CG  . GLN E 1 6  ? 11.405  6.066   -17.028 1.00 25.61 ? 32  GLN E CG  1 
ATOM   1491 C CD  . GLN E 1 6  ? 12.449  6.561   -18.022 1.00 26.79 ? 32  GLN E CD  1 
ATOM   1492 O OE1 . GLN E 1 6  ? 12.100  7.046   -19.093 1.00 31.64 ? 32  GLN E OE1 1 
ATOM   1493 N NE2 . GLN E 1 6  ? 13.728  6.437   -17.675 1.00 26.84 ? 32  GLN E NE2 1 
ATOM   1494 N N   . MET E 1 7  ? 13.607  5.355   -13.031 1.00 21.00 ? 33  MET E N   1 
ATOM   1495 C CA  . MET E 1 7  ? 13.809  4.718   -11.737 1.00 20.98 ? 33  MET E CA  1 
ATOM   1496 C C   . MET E 1 7  ? 13.798  5.760   -10.626 1.00 19.37 ? 33  MET E C   1 
ATOM   1497 O O   . MET E 1 7  ? 13.215  5.542   -9.565  1.00 18.36 ? 33  MET E O   1 
ATOM   1498 C CB  . MET E 1 7  ? 15.127  3.942   -11.728 1.00 23.13 ? 33  MET E CB  1 
ATOM   1499 C CG  . MET E 1 7  ? 15.092  2.692   -12.594 1.00 27.57 ? 33  MET E CG  1 
ATOM   1500 S SD  . MET E 1 7  ? 16.596  1.721   -12.450 1.00 32.00 ? 33  MET E SD  1 
ATOM   1501 C CE  . MET E 1 7  ? 16.355  0.959   -10.865 1.00 33.28 ? 33  MET E CE  1 
ATOM   1502 N N   . LEU E 1 8  ? 14.437  6.899   -10.876 1.00 20.09 ? 34  LEU E N   1 
ATOM   1503 C CA  . LEU E 1 8  ? 14.484  7.972   -9.888  1.00 19.31 ? 34  LEU E CA  1 
ATOM   1504 C C   . LEU E 1 8  ? 13.063  8.424   -9.556  1.00 18.95 ? 34  LEU E C   1 
ATOM   1505 O O   . LEU E 1 8  ? 12.706  8.603   -8.390  1.00 20.30 ? 34  LEU E O   1 
ATOM   1506 C CB  . LEU E 1 8  ? 15.291  9.159   -10.426 1.00 19.09 ? 34  LEU E CB  1 
ATOM   1507 C CG  . LEU E 1 8  ? 15.282  10.406  -9.541  1.00 18.39 ? 34  LEU E CG  1 
ATOM   1508 C CD1 . LEU E 1 8  ? 15.819  10.065  -8.155  1.00 21.26 ? 34  LEU E CD1 1 
ATOM   1509 C CD2 . LEU E 1 8  ? 16.121  11.500  -10.195 1.00 22.75 ? 34  LEU E CD2 1 
ATOM   1510 N N   . ARG E 1 9  ? 12.250  8.601   -10.589 1.00 18.06 ? 35  ARG E N   1 
ATOM   1511 C CA  . ARG E 1 9  ? 10.867  9.019   -10.400 1.00 17.84 ? 35  ARG E CA  1 
ATOM   1512 C C   . ARG E 1 9  ? 10.100  8.041   -9.494  1.00 17.89 ? 35  ARG E C   1 
ATOM   1513 O O   . ARG E 1 9  ? 9.389   8.466   -8.588  1.00 15.86 ? 35  ARG E O   1 
ATOM   1514 C CB  . ARG E 1 9  ? 10.187  9.155   -11.765 1.00 16.42 ? 35  ARG E CB  1 
ATOM   1515 C CG  . ARG E 1 9  ? 8.697   9.372   -11.717 1.00 18.69 ? 35  ARG E CG  1 
ATOM   1516 C CD  . ARG E 1 9  ? 8.297   10.520  -10.808 1.00 20.17 ? 35  ARG E CD  1 
ATOM   1517 N NE  . ARG E 1 9  ? 6.850   10.675  -10.846 1.00 21.43 ? 35  ARG E NE  1 
ATOM   1518 C CZ  . ARG E 1 9  ? 6.189   11.373  -11.765 1.00 19.91 ? 35  ARG E CZ  1 
ATOM   1519 N NH1 . ARG E 1 9  ? 6.847   12.014  -12.727 1.00 21.14 ? 35  ARG E NH1 1 
ATOM   1520 N NH2 . ARG E 1 9  ? 4.862   11.385  -11.748 1.00 19.92 ? 35  ARG E NH2 1 
ATOM   1521 N N   . GLU E 1 10 ? 10.259  6.737   -9.722  1.00 18.19 ? 36  GLU E N   1 
ATOM   1522 C CA  . GLU E 1 10 ? 9.575   5.744   -8.889  1.00 16.88 ? 36  GLU E CA  1 
ATOM   1523 C C   . GLU E 1 10 ? 10.042  5.843   -7.444  1.00 18.26 ? 36  GLU E C   1 
ATOM   1524 O O   . GLU E 1 10 ? 9.247   5.701   -6.513  1.00 19.80 ? 36  GLU E O   1 
ATOM   1525 C CB  . GLU E 1 10 ? 9.834   4.324   -9.399  1.00 18.59 ? 36  GLU E CB  1 
ATOM   1526 C CG  . GLU E 1 10 ? 9.246   4.026   -10.765 1.00 19.73 ? 36  GLU E CG  1 
ATOM   1527 C CD  . GLU E 1 10 ? 7.771   4.360   -10.855 1.00 22.12 ? 36  GLU E CD  1 
ATOM   1528 O OE1 . GLU E 1 10 ? 6.987   3.877   -10.002 1.00 20.85 ? 36  GLU E OE1 1 
ATOM   1529 O OE2 . GLU E 1 10 ? 7.397   5.107   -11.784 1.00 21.47 ? 36  GLU E OE2 1 
ATOM   1530 N N   . LEU E 1 11 ? 11.336  6.081   -7.259  1.00 18.61 ? 37  LEU E N   1 
ATOM   1531 C CA  . LEU E 1 11 ? 11.891  6.202   -5.917  1.00 20.08 ? 37  LEU E CA  1 
ATOM   1532 C C   . LEU E 1 11 ? 11.342  7.441   -5.209  1.00 19.74 ? 37  LEU E C   1 
ATOM   1533 O O   . LEU E 1 11 ? 11.034  7.401   -4.018  1.00 19.85 ? 37  LEU E O   1 
ATOM   1534 C CB  . LEU E 1 11 ? 13.421  6.268   -5.984  1.00 21.00 ? 37  LEU E CB  1 
ATOM   1535 C CG  . LEU E 1 11 ? 14.116  5.026   -6.550  1.00 20.41 ? 37  LEU E CG  1 
ATOM   1536 C CD1 . LEU E 1 11 ? 15.621  5.212   -6.481  1.00 20.90 ? 37  LEU E CD1 1 
ATOM   1537 C CD2 . LEU E 1 11 ? 13.689  3.792   -5.766  1.00 23.01 ? 37  LEU E CD2 1 
ATOM   1538 N N   . GLN E 1 12 ? 11.219  8.545   -5.940  1.00 18.95 ? 38  GLN E N   1 
ATOM   1539 C CA  . GLN E 1 12 ? 10.700  9.770   -5.343  1.00 17.58 ? 38  GLN E CA  1 
ATOM   1540 C C   . GLN E 1 12 ? 9.239   9.609   -4.945  1.00 17.47 ? 38  GLN E C   1 
ATOM   1541 O O   . GLN E 1 12 ? 8.822   10.097  -3.901  1.00 17.16 ? 38  GLN E O   1 
ATOM   1542 C CB  . GLN E 1 12 ? 10.856  10.949  -6.308  1.00 17.09 ? 38  GLN E CB  1 
ATOM   1543 C CG  . GLN E 1 12 ? 12.298  11.227  -6.694  1.00 15.55 ? 38  GLN E CG  1 
ATOM   1544 C CD  . GLN E 1 12 ? 12.449  12.511  -7.484  1.00 17.87 ? 38  GLN E CD  1 
ATOM   1545 O OE1 . GLN E 1 12 ? 11.675  12.779  -8.396  1.00 18.13 ? 38  GLN E OE1 1 
ATOM   1546 N NE2 . GLN E 1 12 ? 13.457  13.305  -7.143  1.00 16.97 ? 38  GLN E NE2 1 
ATOM   1547 N N   . GLU E 1 13 ? 8.452   8.928   -5.772  1.00 17.00 ? 39  GLU E N   1 
ATOM   1548 C CA  . GLU E 1 13 ? 7.050   8.718   -5.432  1.00 19.56 ? 39  GLU E CA  1 
ATOM   1549 C C   . GLU E 1 13 ? 6.963   7.809   -4.210  1.00 19.91 ? 39  GLU E C   1 
ATOM   1550 O O   . GLU E 1 13 ? 6.116   8.010   -3.336  1.00 17.70 ? 39  GLU E O   1 
ATOM   1551 C CB  . GLU E 1 13 ? 6.289   8.105   -6.611  1.00 23.08 ? 39  GLU E CB  1 
ATOM   1552 C CG  . GLU E 1 13 ? 5.879   9.138   -7.668  1.00 25.94 ? 39  GLU E CG  1 
ATOM   1553 C CD  . GLU E 1 13 ? 5.066   8.536   -8.803  1.00 28.03 ? 39  GLU E CD  1 
ATOM   1554 O OE1 . GLU E 1 13 ? 4.155   7.731   -8.524  1.00 29.45 ? 39  GLU E OE1 1 
ATOM   1555 O OE2 . GLU E 1 13 ? 5.329   8.877   -9.974  1.00 28.97 ? 39  GLU E OE2 1 
ATOM   1556 N N   . THR E 1 14 ? 7.847   6.816   -4.146  1.00 19.49 ? 40  THR E N   1 
ATOM   1557 C CA  . THR E 1 14 ? 7.861   5.897   -3.006  1.00 21.11 ? 40  THR E CA  1 
ATOM   1558 C C   . THR E 1 14 ? 8.186   6.649   -1.717  1.00 22.41 ? 40  THR E C   1 
ATOM   1559 O O   . THR E 1 14 ? 7.553   6.433   -0.683  1.00 23.32 ? 40  THR E O   1 
ATOM   1560 C CB  . THR E 1 14 ? 8.901   4.783   -3.205  1.00 23.02 ? 40  THR E CB  1 
ATOM   1561 O OG1 . THR E 1 14 ? 8.487   3.956   -4.295  1.00 21.78 ? 40  THR E OG1 1 
ATOM   1562 C CG2 . THR E 1 14 ? 9.028   3.929   -1.946  1.00 23.58 ? 40  THR E CG2 1 
ATOM   1563 N N   . ASN E 1 15 ? 9.180   7.526   -1.780  1.00 23.06 ? 41  ASN E N   1 
ATOM   1564 C CA  . ASN E 1 15 ? 9.552   8.301   -0.610  1.00 24.51 ? 41  ASN E CA  1 
ATOM   1565 C C   . ASN E 1 15 ? 8.409   9.190   -0.160  1.00 24.42 ? 41  ASN E C   1 
ATOM   1566 O O   . ASN E 1 15 ? 8.150   9.310   1.039   1.00 26.51 ? 41  ASN E O   1 
ATOM   1567 C CB  . ASN E 1 15 ? 10.800  9.138   -0.889  1.00 26.77 ? 41  ASN E CB  1 
ATOM   1568 C CG  . ASN E 1 15 ? 12.075  8.357   -0.657  1.00 31.11 ? 41  ASN E CG  1 
ATOM   1569 O OD1 . ASN E 1 15 ? 12.180  7.614   0.317   1.00 33.13 ? 41  ASN E OD1 1 
ATOM   1570 N ND2 . ASN E 1 15 ? 13.051  8.522   -1.541  1.00 33.11 ? 41  ASN E ND2 1 
ATOM   1571 N N   . ALA E 1 16 ? 7.713   9.800   -1.116  1.00 23.10 ? 42  ALA E N   1 
ATOM   1572 C CA  . ALA E 1 16 ? 6.588   10.665  -0.786  1.00 22.28 ? 42  ALA E CA  1 
ATOM   1573 C C   . ALA E 1 16 ? 5.501   9.879   -0.058  1.00 21.03 ? 42  ALA E C   1 
ATOM   1574 O O   . ALA E 1 16 ? 4.883   10.381  0.882   1.00 18.98 ? 42  ALA E O   1 
ATOM   1575 C CB  . ALA E 1 16 ? 6.015   11.296  -2.050  1.00 22.43 ? 42  ALA E CB  1 
ATOM   1576 N N   . ALA E 1 17 ? 5.265   8.646   -0.493  1.00 19.82 ? 43  ALA E N   1 
ATOM   1577 C CA  . ALA E 1 17 ? 4.242   7.815   0.136   1.00 21.02 ? 43  ALA E CA  1 
ATOM   1578 C C   . ALA E 1 17 ? 4.683   7.352   1.518   1.00 19.99 ? 43  ALA E C   1 
ATOM   1579 O O   . ALA E 1 17 ? 3.877   7.296   2.450   1.00 22.48 ? 43  ALA E O   1 
ATOM   1580 C CB  . ALA E 1 17 ? 3.928   6.601   -0.744  1.00 22.67 ? 43  ALA E CB  1 
ATOM   1581 N N   . LEU E 1 18 ? 5.960   7.013   1.645   1.00 21.22 ? 44  LEU E N   1 
ATOM   1582 C CA  . LEU E 1 18 ? 6.495   6.538   2.917   1.00 22.29 ? 44  LEU E CA  1 
ATOM   1583 C C   . LEU E 1 18 ? 6.420   7.651   3.963   1.00 24.46 ? 44  LEU E C   1 
ATOM   1584 O O   . LEU E 1 18 ? 6.071   7.408   5.116   1.00 24.01 ? 44  LEU E O   1 
ATOM   1585 C CB  . LEU E 1 18 ? 7.939   6.067   2.738   1.00 21.72 ? 44  LEU E CB  1 
ATOM   1586 C CG  . LEU E 1 18 ? 8.568   5.331   3.923   1.00 23.58 ? 44  LEU E CG  1 
ATOM   1587 C CD1 . LEU E 1 18 ? 7.697   4.152   4.326   1.00 24.88 ? 44  LEU E CD1 1 
ATOM   1588 C CD2 . LEU E 1 18 ? 9.962   4.859   3.550   1.00 26.23 ? 44  LEU E CD2 1 
ATOM   1589 N N   . GLN E 1 19 ? 6.746   8.874   3.558   1.00 23.01 ? 45  GLN E N   1 
ATOM   1590 C CA  . GLN E 1 19 ? 6.673   9.998   4.479   1.00 24.12 ? 45  GLN E CA  1 
ATOM   1591 C C   . GLN E 1 19 ? 5.244   10.175  4.990   1.00 22.61 ? 45  GLN E C   1 
ATOM   1592 O O   . GLN E 1 19 ? 5.032   10.485  6.162   1.00 22.51 ? 45  GLN E O   1 
ATOM   1593 C CB  . GLN E 1 19 ? 7.172   11.264  3.788   1.00 26.14 ? 45  GLN E CB  1 
ATOM   1594 C CG  . GLN E 1 19 ? 8.683   11.284  3.658   1.00 30.17 ? 45  GLN E CG  1 
ATOM   1595 C CD  . GLN E 1 19 ? 9.175   12.348  2.707   1.00 32.45 ? 45  GLN E CD  1 
ATOM   1596 O OE1 . GLN E 1 19 ? 8.766   13.503  2.784   1.00 36.13 ? 45  GLN E OE1 1 
ATOM   1597 N NE2 . GLN E 1 19 ? 10.070  11.965  1.808   1.00 36.40 ? 45  GLN E NE2 1 
ATOM   1598 N N   . ASP E 1 20 ? 4.266   9.970   4.112   1.00 20.86 ? 46  ASP E N   1 
ATOM   1599 C CA  . ASP E 1 20 ? 2.859   10.073  4.495   1.00 22.69 ? 46  ASP E CA  1 
ATOM   1600 C C   . ASP E 1 20 ? 2.545   8.918   5.453   1.00 21.78 ? 46  ASP E C   1 
ATOM   1601 O O   . ASP E 1 20 ? 1.896   9.107   6.479   1.00 19.68 ? 46  ASP E O   1 
ATOM   1602 C CB  . ASP E 1 20 ? 1.962   9.977   3.261   1.00 26.00 ? 46  ASP E CB  1 
ATOM   1603 C CG  . ASP E 1 20 ? 0.510   10.293  3.566   1.00 33.23 ? 46  ASP E CG  1 
ATOM   1604 O OD1 . ASP E 1 20 ? -0.340  10.127  2.664   1.00 37.49 ? 46  ASP E OD1 1 
ATOM   1605 O OD2 . ASP E 1 20 ? 0.210   10.713  4.703   1.00 36.18 ? 46  ASP E OD2 1 
ATOM   1606 N N   . VAL E 1 21 ? 3.010   7.718   5.115   1.00 22.67 ? 47  VAL E N   1 
ATOM   1607 C CA  . VAL E 1 21 ? 2.785   6.563   5.980   1.00 21.79 ? 47  VAL E CA  1 
ATOM   1608 C C   . VAL E 1 21 ? 3.362   6.848   7.372   1.00 21.99 ? 47  VAL E C   1 
ATOM   1609 O O   . VAL E 1 21 ? 2.747   6.535   8.389   1.00 21.57 ? 47  VAL E O   1 
ATOM   1610 C CB  . VAL E 1 21 ? 3.453   5.293   5.407   1.00 23.14 ? 47  VAL E CB  1 
ATOM   1611 C CG1 . VAL E 1 21 ? 3.491   4.196   6.465   1.00 22.56 ? 47  VAL E CG1 1 
ATOM   1612 C CG2 . VAL E 1 21 ? 2.679   4.811   4.184   1.00 24.45 ? 47  VAL E CG2 1 
ATOM   1613 N N   . ARG E 1 22 ? 4.545   7.447   7.415   1.00 22.92 ? 48  ARG E N   1 
ATOM   1614 C CA  . ARG E 1 22 ? 5.170   7.761   8.693   1.00 24.45 ? 48  ARG E CA  1 
ATOM   1615 C C   . ARG E 1 22 ? 4.282   8.668   9.540   1.00 23.64 ? 48  ARG E C   1 
ATOM   1616 O O   . ARG E 1 22 ? 4.079   8.418   10.729  1.00 22.01 ? 48  ARG E O   1 
ATOM   1617 C CB  . ARG E 1 22 ? 6.515   8.452   8.481   1.00 27.08 ? 48  ARG E CB  1 
ATOM   1618 C CG  . ARG E 1 22 ? 7.125   8.987   9.774   1.00 31.95 ? 48  ARG E CG  1 
ATOM   1619 C CD  . ARG E 1 22 ? 7.981   10.205  9.494   1.00 35.57 ? 48  ARG E CD  1 
ATOM   1620 N NE  . ARG E 1 22 ? 9.275   9.847   8.938   1.00 37.53 ? 48  ARG E NE  1 
ATOM   1621 C CZ  . ARG E 1 22 ? 9.995   10.639  8.153   1.00 36.08 ? 48  ARG E CZ  1 
ATOM   1622 N NH1 . ARG E 1 22 ? 9.542   11.841  7.823   1.00 38.12 ? 48  ARG E NH1 1 
ATOM   1623 N NH2 . ARG E 1 22 ? 11.172  10.230  7.709   1.00 37.97 ? 48  ARG E NH2 1 
ATOM   1624 N N   . GLU E 1 23 ? 3.763   9.728   8.930   1.00 22.91 ? 49  GLU E N   1 
ATOM   1625 C CA  . GLU E 1 23 ? 2.917   10.663  9.653   1.00 23.61 ? 49  GLU E CA  1 
ATOM   1626 C C   . GLU E 1 23 ? 1.588   10.036  10.060  1.00 23.08 ? 49  GLU E C   1 
ATOM   1627 O O   . GLU E 1 23 ? 1.048   10.353  11.117  1.00 20.48 ? 49  GLU E O   1 
ATOM   1628 C CB  . GLU E 1 23 ? 2.695   11.925  8.821   1.00 28.35 ? 49  GLU E CB  1 
ATOM   1629 C CG  . GLU E 1 23 ? 3.985   12.679  8.540   1.00 31.95 ? 49  GLU E CG  1 
ATOM   1630 C CD  . GLU E 1 23 ? 4.836   12.854  9.790   1.00 35.46 ? 49  GLU E CD  1 
ATOM   1631 O OE1 . GLU E 1 23 ? 4.333   13.429  10.779  1.00 37.48 ? 49  GLU E OE1 1 
ATOM   1632 O OE2 . GLU E 1 23 ? 6.005   12.414  9.784   1.00 36.47 ? 49  GLU E OE2 1 
ATOM   1633 N N   . LEU E 1 24 ? 1.067   9.138   9.233   1.00 22.23 ? 50  LEU E N   1 
ATOM   1634 C CA  . LEU E 1 24 ? -0.185  8.469   9.569   1.00 22.45 ? 50  LEU E CA  1 
ATOM   1635 C C   . LEU E 1 24 ? 0.034   7.616   10.818  1.00 22.49 ? 50  LEU E C   1 
ATOM   1636 O O   . LEU E 1 24 ? -0.773  7.646   11.748  1.00 20.96 ? 50  LEU E O   1 
ATOM   1637 C CB  . LEU E 1 24 ? -0.648  7.576   8.416   1.00 21.82 ? 50  LEU E CB  1 
ATOM   1638 C CG  . LEU E 1 24 ? -1.178  8.296   7.172   1.00 22.29 ? 50  LEU E CG  1 
ATOM   1639 C CD1 . LEU E 1 24 ? -1.218  7.342   5.996   1.00 24.83 ? 50  LEU E CD1 1 
ATOM   1640 C CD2 . LEU E 1 24 ? -2.562  8.856   7.458   1.00 24.02 ? 50  LEU E CD2 1 
ATOM   1641 N N   . LEU E 1 25 ? 1.134   6.868   10.829  1.00 20.64 ? 51  LEU E N   1 
ATOM   1642 C CA  . LEU E 1 25 ? 1.466   5.998   11.956  1.00 23.68 ? 51  LEU E CA  1 
ATOM   1643 C C   . LEU E 1 25 ? 1.653   6.823   13.218  1.00 23.44 ? 51  LEU E C   1 
ATOM   1644 O O   . LEU E 1 25 ? 1.239   6.417   14.306  1.00 23.36 ? 51  LEU E O   1 
ATOM   1645 C CB  . LEU E 1 25 ? 2.752   5.225   11.664  1.00 24.56 ? 51  LEU E CB  1 
ATOM   1646 C CG  . LEU E 1 25 ? 2.692   3.698   11.717  1.00 29.46 ? 51  LEU E CG  1 
ATOM   1647 C CD1 . LEU E 1 25 ? 4.030   3.126   11.242  1.00 29.23 ? 51  LEU E CD1 1 
ATOM   1648 C CD2 . LEU E 1 25 ? 2.379   3.238   13.132  1.00 28.36 ? 51  LEU E CD2 1 
ATOM   1649 N N   . ARG E 1 26 ? 2.284   7.981   13.054  1.00 24.06 ? 52  ARG E N   1 
ATOM   1650 C CA  . ARG E 1 26 ? 2.546   8.902   14.156  1.00 28.05 ? 52  ARG E CA  1 
ATOM   1651 C C   . ARG E 1 26 ? 1.223   9.259   14.816  1.00 26.99 ? 52  ARG E C   1 
ATOM   1652 O O   . ARG E 1 26 ? 1.057   9.125   16.028  1.00 28.17 ? 52  ARG E O   1 
ATOM   1653 C CB  . ARG E 1 26 ? 3.211   10.171  13.621  1.00 30.07 ? 52  ARG E CB  1 
ATOM   1654 C CG  . ARG E 1 26 ? 3.619   11.166  14.682  1.00 34.54 ? 52  ARG E CG  1 
ATOM   1655 C CD  . ARG E 1 26 ? 5.109   11.106  14.885  1.00 39.53 ? 52  ARG E CD  1 
ATOM   1656 N NE  . ARG E 1 26 ? 5.815   11.319  13.624  1.00 40.95 ? 52  ARG E NE  1 
ATOM   1657 C CZ  . ARG E 1 26 ? 7.087   10.995  13.425  1.00 42.13 ? 52  ARG E CZ  1 
ATOM   1658 N NH1 . ARG E 1 26 ? 7.793   10.442  14.406  1.00 42.04 ? 52  ARG E NH1 1 
ATOM   1659 N NH2 . ARG E 1 26 ? 7.655   11.225  12.249  1.00 41.87 ? 52  ARG E NH2 1 
ATOM   1660 N N   . GLN E 1 27 ? 0.280   9.718   14.003  1.00 26.49 ? 53  GLN E N   1 
ATOM   1661 C CA  . GLN E 1 27 ? -1.038  10.080  14.498  1.00 27.47 ? 53  GLN E CA  1 
ATOM   1662 C C   . GLN E 1 27 ? -1.749  8.861   15.088  1.00 27.10 ? 53  GLN E C   1 
ATOM   1663 O O   . GLN E 1 27 ? -2.373  8.947   16.144  1.00 26.57 ? 53  GLN E O   1 
ATOM   1664 C CB  . GLN E 1 27 ? -1.879  10.664  13.361  1.00 28.70 ? 53  GLN E CB  1 
ATOM   1665 C CG  . GLN E 1 27 ? -3.359  10.811  13.695  1.00 34.77 ? 53  GLN E CG  1 
ATOM   1666 C CD  . GLN E 1 27 ? -4.198  11.161  12.482  1.00 38.80 ? 53  GLN E CD  1 
ATOM   1667 O OE1 . GLN E 1 27 ? -5.430  11.199  12.553  1.00 41.68 ? 53  GLN E OE1 1 
ATOM   1668 N NE2 . GLN E 1 27 ? -3.536  11.419  11.355  1.00 39.99 ? 53  GLN E NE2 1 
ATOM   1669 N N   . GLN E 1 28 ? -1.639  7.720   14.416  1.00 23.85 ? 54  GLN E N   1 
ATOM   1670 C CA  . GLN E 1 28 ? -2.306  6.517   14.890  1.00 24.07 ? 54  GLN E CA  1 
ATOM   1671 C C   . GLN E 1 28 ? -1.870  6.060   16.284  1.00 24.40 ? 54  GLN E C   1 
ATOM   1672 O O   . GLN E 1 28 ? -2.711  5.732   17.119  1.00 24.25 ? 54  GLN E O   1 
ATOM   1673 C CB  . GLN E 1 28 ? -2.118  5.386   13.879  1.00 24.18 ? 54  GLN E CB  1 
ATOM   1674 C CG  . GLN E 1 28 ? -2.872  4.118   14.223  1.00 26.37 ? 54  GLN E CG  1 
ATOM   1675 C CD  . GLN E 1 28 ? -2.795  3.081   13.119  1.00 24.97 ? 54  GLN E CD  1 
ATOM   1676 O OE1 . GLN E 1 28 ? -3.585  3.098   12.170  1.00 24.62 ? 54  GLN E OE1 1 
ATOM   1677 N NE2 . GLN E 1 28 ? -1.833  2.181   13.230  1.00 25.26 ? 54  GLN E NE2 1 
ATOM   1678 N N   . VAL E 1 29 ? -0.567  6.033   16.546  1.00 24.50 ? 55  VAL E N   1 
ATOM   1679 C CA  . VAL E 1 29 ? -0.091  5.605   17.857  1.00 27.11 ? 55  VAL E CA  1 
ATOM   1680 C C   . VAL E 1 29 ? -0.603  6.569   18.926  1.00 27.34 ? 55  VAL E C   1 
ATOM   1681 O O   . VAL E 1 29 ? -0.850  6.182   20.067  1.00 26.22 ? 55  VAL E O   1 
ATOM   1682 C CB  . VAL E 1 29 ? 1.448   5.558   17.918  1.00 27.95 ? 55  VAL E CB  1 
ATOM   1683 C CG1 . VAL E 1 29 ? 1.977   4.590   16.874  1.00 31.20 ? 55  VAL E CG1 1 
ATOM   1684 C CG2 . VAL E 1 29 ? 2.021   6.945   17.698  1.00 30.66 ? 55  VAL E CG2 1 
ATOM   1685 N N   . LYS E 1 30 ? -0.760  7.828   18.542  1.00 28.57 ? 56  LYS E N   1 
ATOM   1686 C CA  . LYS E 1 30 ? -1.261  8.847   19.454  1.00 30.68 ? 56  LYS E CA  1 
ATOM   1687 C C   . LYS E 1 30 ? -2.679  8.467   19.858  1.00 29.64 ? 56  LYS E C   1 
ATOM   1688 O O   . LYS E 1 30 ? -2.994  8.381   21.046  1.00 29.42 ? 56  LYS E O   1 
ATOM   1689 C CB  . LYS E 1 30 ? -1.271  10.210  18.761  1.00 34.37 ? 56  LYS E CB  1 
ATOM   1690 C CG  . LYS E 1 30 ? -1.666  11.370  19.663  1.00 38.52 ? 56  LYS E CG  1 
ATOM   1691 C CD  . LYS E 1 30 ? -1.970  12.628  18.854  1.00 44.38 ? 56  LYS E CD  1 
ATOM   1692 C CE  . LYS E 1 30 ? -0.776  13.077  18.019  1.00 46.81 ? 56  LYS E CE  1 
ATOM   1693 N NZ  . LYS E 1 30 ? -1.104  14.281  17.197  1.00 50.71 ? 56  LYS E NZ  1 
ATOM   1694 N N   . GLU E 1 31 ? -3.530  8.234   18.860  1.00 28.89 ? 57  GLU E N   1 
ATOM   1695 C CA  . GLU E 1 31 ? -4.923  7.855   19.097  1.00 27.06 ? 57  GLU E CA  1 
ATOM   1696 C C   . GLU E 1 31 ? -5.010  6.599   19.959  1.00 25.93 ? 57  GLU E C   1 
ATOM   1697 O O   . GLU E 1 31 ? -5.842  6.513   20.862  1.00 23.68 ? 57  GLU E O   1 
ATOM   1698 C CB  . GLU E 1 31 ? -5.644  7.602   17.766  1.00 29.91 ? 57  GLU E CB  1 
ATOM   1699 C CG  . GLU E 1 31 ? -5.600  8.769   16.791  1.00 33.14 ? 57  GLU E CG  1 
ATOM   1700 C CD  . GLU E 1 31 ? -6.608  9.853   17.113  1.00 35.26 ? 57  GLU E CD  1 
ATOM   1701 O OE1 . GLU E 1 31 ? -6.726  10.236  18.296  1.00 38.22 ? 57  GLU E OE1 1 
ATOM   1702 O OE2 . GLU E 1 31 ? -7.280  10.332  16.178  1.00 37.63 ? 57  GLU E OE2 1 
ATOM   1703 N N   . ILE E 1 32 ? -4.152  5.623   19.677  1.00 24.79 ? 58  ILE E N   1 
ATOM   1704 C CA  . ILE E 1 32 ? -4.151  4.379   20.440  1.00 24.29 ? 58  ILE E CA  1 
ATOM   1705 C C   . ILE E 1 32 ? -3.753  4.663   21.879  1.00 26.27 ? 58  ILE E C   1 
ATOM   1706 O O   . ILE E 1 32 ? -4.329  4.104   22.820  1.00 26.83 ? 58  ILE E O   1 
ATOM   1707 C CB  . ILE E 1 32 ? -3.181  3.348   19.822  1.00 23.58 ? 58  ILE E CB  1 
ATOM   1708 C CG1 . ILE E 1 32 ? -3.719  2.904   18.461  1.00 22.28 ? 58  ILE E CG1 1 
ATOM   1709 C CG2 . ILE E 1 32 ? -2.999  2.153   20.760  1.00 23.49 ? 58  ILE E CG2 1 
ATOM   1710 C CD1 . ILE E 1 32 ? -2.746  2.071   17.656  1.00 19.82 ? 58  ILE E CD1 1 
ATOM   1711 N N   . THR E 1 33 ? -2.764  5.535   22.046  1.00 27.23 ? 59  THR E N   1 
ATOM   1712 C CA  . THR E 1 33 ? -2.303  5.907   23.373  1.00 28.81 ? 59  THR E CA  1 
ATOM   1713 C C   . THR E 1 33 ? -3.436  6.592   24.138  1.00 28.46 ? 59  THR E C   1 
ATOM   1714 O O   . THR E 1 33 ? -3.572  6.403   25.348  1.00 30.50 ? 59  THR E O   1 
ATOM   1715 C CB  . THR E 1 33 ? -1.075  6.836   23.288  1.00 30.06 ? 59  THR E CB  1 
ATOM   1716 O OG1 . THR E 1 33 ? 0.030   6.106   22.732  1.00 30.66 ? 59  THR E OG1 1 
ATOM   1717 C CG2 . THR E 1 33 ? -0.689  7.342   24.670  1.00 31.69 ? 59  THR E CG2 1 
ATOM   1718 N N   . PHE E 1 34 ? -4.254  7.379   23.438  1.00 27.88 ? 60  PHE E N   1 
ATOM   1719 C CA  . PHE E 1 34 ? -5.384  8.045   24.086  1.00 29.09 ? 60  PHE E CA  1 
ATOM   1720 C C   . PHE E 1 34 ? -6.405  6.981   24.489  1.00 29.20 ? 60  PHE E C   1 
ATOM   1721 O O   . PHE E 1 34 ? -6.905  6.979   25.612  1.00 28.59 ? 60  PHE E O   1 
ATOM   1722 C CB  . PHE E 1 34 ? -6.058  9.054   23.148  1.00 30.22 ? 60  PHE E CB  1 
ATOM   1723 C CG  . PHE E 1 34 ? -5.203  10.245  22.804  1.00 31.80 ? 60  PHE E CG  1 
ATOM   1724 C CD1 . PHE E 1 34 ? -4.342  10.801  23.745  1.00 33.39 ? 60  PHE E CD1 1 
ATOM   1725 C CD2 . PHE E 1 34 ? -5.295  10.839  21.549  1.00 33.56 ? 60  PHE E CD2 1 
ATOM   1726 C CE1 . PHE E 1 34 ? -3.587  11.934  23.441  1.00 35.29 ? 60  PHE E CE1 1 
ATOM   1727 C CE2 . PHE E 1 34 ? -4.544  11.973  21.234  1.00 33.51 ? 60  PHE E CE2 1 
ATOM   1728 C CZ  . PHE E 1 34 ? -3.690  12.521  22.181  1.00 34.84 ? 60  PHE E CZ  1 
ATOM   1729 N N   . LEU E 1 35 ? -6.712  6.083   23.556  1.00 27.81 ? 61  LEU E N   1 
ATOM   1730 C CA  . LEU E 1 35 ? -7.660  5.003   23.802  1.00 28.62 ? 61  LEU E CA  1 
ATOM   1731 C C   . LEU E 1 35 ? -7.204  4.203   25.020  1.00 28.45 ? 61  LEU E C   1 
ATOM   1732 O O   . LEU E 1 35 ? -8.010  3.867   25.890  1.00 29.53 ? 61  LEU E O   1 
ATOM   1733 C CB  . LEU E 1 35 ? -7.748  4.093   22.569  1.00 28.75 ? 61  LEU E CB  1 
ATOM   1734 C CG  . LEU E 1 35 ? -8.646  2.852   22.604  1.00 29.60 ? 61  LEU E CG  1 
ATOM   1735 C CD1 . LEU E 1 35 ? -10.097 3.248   22.863  1.00 30.92 ? 61  LEU E CD1 1 
ATOM   1736 C CD2 . LEU E 1 35 ? -8.523  2.121   21.276  1.00 30.90 ? 61  LEU E CD2 1 
ATOM   1737 N N   . LYS E 1 36 ? -5.906  3.914   25.088  1.00 28.68 ? 62  LYS E N   1 
ATOM   1738 C CA  . LYS E 1 36 ? -5.351  3.158   26.203  1.00 28.73 ? 62  LYS E CA  1 
ATOM   1739 C C   . LYS E 1 36 ? -5.621  3.872   27.526  1.00 30.44 ? 62  LYS E C   1 
ATOM   1740 O O   . LYS E 1 36 ? -6.116  3.265   28.476  1.00 29.91 ? 62  LYS E O   1 
ATOM   1741 C CB  . LYS E 1 36 ? -3.841  2.972   26.028  1.00 28.32 ? 62  LYS E CB  1 
ATOM   1742 C CG  . LYS E 1 36 ? -3.167  2.262   27.201  1.00 30.60 ? 62  LYS E CG  1 
ATOM   1743 C CD  . LYS E 1 36 ? -1.662  2.463   27.197  1.00 28.61 ? 62  LYS E CD  1 
ATOM   1744 C CE  . LYS E 1 36 ? -1.306  3.945   27.267  1.00 28.44 ? 62  LYS E CE  1 
ATOM   1745 N NZ  . LYS E 1 36 ? 0.171   4.147   27.267  1.00 26.05 ? 62  LYS E NZ  1 
ATOM   1746 N N   . ASN E 1 37 ? -5.291  5.161   27.578  1.00 31.13 ? 63  ASN E N   1 
ATOM   1747 C CA  . ASN E 1 37 ? -5.487  5.965   28.785  1.00 31.51 ? 63  ASN E CA  1 
ATOM   1748 C C   . ASN E 1 37 ? -6.947  6.087   29.205  1.00 29.93 ? 63  ASN E C   1 
ATOM   1749 O O   . ASN E 1 37 ? -7.252  6.168   30.394  1.00 31.81 ? 63  ASN E O   1 
ATOM   1750 C CB  . ASN E 1 37 ? -4.911  7.374   28.597  1.00 31.08 ? 63  ASN E CB  1 
ATOM   1751 C CG  . ASN E 1 37 ? -3.404  7.376   28.461  1.00 33.72 ? 63  ASN E CG  1 
ATOM   1752 O OD1 . ASN E 1 37 ? -2.719  6.532   29.032  1.00 34.42 ? 63  ASN E OD1 1 
ATOM   1753 N ND2 . ASN E 1 37 ? -2.877  8.341   27.712  1.00 35.18 ? 63  ASN E ND2 1 
ATOM   1754 N N   . THR E 1 38 ? -7.841  6.118   28.227  1.00 28.42 ? 64  THR E N   1 
ATOM   1755 C CA  . THR E 1 38 ? -9.266  6.238   28.502  1.00 29.08 ? 64  THR E CA  1 
ATOM   1756 C C   . THR E 1 38 ? -9.800  4.955   29.118  1.00 29.05 ? 64  THR E C   1 
ATOM   1757 O O   . THR E 1 38 ? -10.719 4.983   29.941  1.00 29.05 ? 64  THR E O   1 
ATOM   1758 C CB  . THR E 1 38 ? -10.052 6.549   27.211  1.00 29.25 ? 64  THR E CB  1 
ATOM   1759 O OG1 . THR E 1 38 ? -9.634  7.818   26.697  1.00 29.83 ? 64  THR E OG1 1 
ATOM   1760 C CG2 . THR E 1 38 ? -11.553 6.592   27.485  1.00 30.80 ? 64  THR E CG2 1 
ATOM   1761 N N   . VAL E 1 39 ? -9.215  3.830   28.722  1.00 29.62 ? 65  VAL E N   1 
ATOM   1762 C CA  . VAL E 1 39 ? -9.631  2.533   29.234  1.00 30.19 ? 65  VAL E CA  1 
ATOM   1763 C C   . VAL E 1 39 ? -9.073  2.313   30.632  1.00 31.28 ? 65  VAL E C   1 
ATOM   1764 O O   . VAL E 1 39 ? -9.730  1.717   31.483  1.00 30.50 ? 65  VAL E O   1 
ATOM   1765 C CB  . VAL E 1 39 ? -9.167  1.400   28.290  1.00 30.26 ? 65  VAL E CB  1 
ATOM   1766 C CG1 . VAL E 1 39 ? -9.426  0.043   28.919  1.00 31.38 ? 65  VAL E CG1 1 
ATOM   1767 C CG2 . VAL E 1 39 ? -9.913  1.510   26.966  1.00 29.18 ? 65  VAL E CG2 1 
ATOM   1768 N N   . MET E 1 40 ? -7.859  2.804   30.866  1.00 34.11 ? 66  MET E N   1 
ATOM   1769 C CA  . MET E 1 40 ? -7.219  2.675   32.173  1.00 35.95 ? 66  MET E CA  1 
ATOM   1770 C C   . MET E 1 40 ? -7.988  3.447   33.240  1.00 36.18 ? 66  MET E C   1 
ATOM   1771 O O   . MET E 1 40 ? -7.925  3.114   34.422  1.00 37.25 ? 66  MET E O   1 
ATOM   1772 C CB  . MET E 1 40 ? -5.786  3.203   32.120  1.00 38.00 ? 66  MET E CB  1 
ATOM   1773 C CG  . MET E 1 40 ? -4.804  2.308   31.398  1.00 40.30 ? 66  MET E CG  1 
ATOM   1774 S SD  . MET E 1 40 ? -3.199  3.112   31.291  1.00 43.34 ? 66  MET E SD  1 
ATOM   1775 C CE  . MET E 1 40 ? -2.756  3.212   33.028  1.00 42.72 ? 66  MET E CE  1 
ATOM   1776 N N   . GLU E 1 41 ? -8.711  4.480   32.820  1.00 37.23 ? 67  GLU E N   1 
ATOM   1777 C CA  . GLU E 1 41 ? -9.481  5.301   33.749  1.00 38.51 ? 67  GLU E CA  1 
ATOM   1778 C C   . GLU E 1 41 ? -10.974 4.998   33.704  1.00 38.85 ? 67  GLU E C   1 
ATOM   1779 O O   . GLU E 1 41 ? -11.775 5.709   34.315  1.00 39.60 ? 67  GLU E O   1 
ATOM   1780 C CB  . GLU E 1 41 ? -9.256  6.783   33.447  1.00 39.98 ? 67  GLU E CB  1 
ATOM   1781 C CG  . GLU E 1 41 ? -7.796  7.201   33.463  1.00 42.55 ? 67  GLU E CG  1 
ATOM   1782 C CD  . GLU E 1 41 ? -7.087  6.793   34.741  1.00 44.59 ? 67  GLU E CD  1 
ATOM   1783 O OE1 . GLU E 1 41 ? -7.608  7.091   35.838  1.00 45.73 ? 67  GLU E OE1 1 
ATOM   1784 O OE2 . GLU E 1 41 ? -6.006  6.176   34.650  1.00 46.39 ? 67  GLU E OE2 1 
ATOM   1785 N N   . CYS E 1 42 ? -11.347 3.945   32.981  1.00 38.53 ? 68  CYS E N   1 
ATOM   1786 C CA  . CYS E 1 42 ? -12.747 3.557   32.862  1.00 40.50 ? 68  CYS E CA  1 
ATOM   1787 C C   . CYS E 1 42 ? -13.243 2.928   34.163  1.00 42.54 ? 68  CYS E C   1 
ATOM   1788 O O   . CYS E 1 42 ? -12.771 1.866   34.573  1.00 40.81 ? 68  CYS E O   1 
ATOM   1789 C CB  . CYS E 1 42 ? -12.929 2.567   31.704  1.00 41.84 ? 68  CYS E CB  1 
ATOM   1790 S SG  . CYS E 1 42 ? -14.666 2.101   31.401  1.00 41.86 ? 68  CYS E SG  1 
ATOM   1791 N N   . ASP E 1 43 ? -14.198 3.590   34.811  1.00 44.83 ? 69  ASP E N   1 
ATOM   1792 C CA  . ASP E 1 43 ? -14.748 3.094   36.068  1.00 47.30 ? 69  ASP E CA  1 
ATOM   1793 C C   . ASP E 1 43 ? -15.416 1.729   35.933  1.00 48.87 ? 69  ASP E C   1 
ATOM   1794 O O   . ASP E 1 43 ? -15.511 0.986   36.909  1.00 49.80 ? 69  ASP E O   1 
ATOM   1795 C CB  . ASP E 1 43 ? -15.737 4.108   36.650  1.00 47.57 ? 69  ASP E CB  1 
ATOM   1796 C CG  . ASP E 1 43 ? -15.040 5.264   37.354  1.00 49.54 ? 69  ASP E CG  1 
ATOM   1797 O OD1 . ASP E 1 43 ? -14.224 5.957   36.709  1.00 49.39 ? 69  ASP E OD1 1 
ATOM   1798 O OD2 . ASP E 1 43 ? -15.307 5.477   38.557  1.00 50.44 ? 69  ASP E OD2 1 
ATOM   1799 N N   . ALA E 1 44 ? -15.875 1.397   34.729  1.00 49.90 ? 70  ALA E N   1 
ATOM   1800 C CA  . ALA E 1 44 ? -16.522 0.108   34.495  1.00 51.40 ? 70  ALA E CA  1 
ATOM   1801 C C   . ALA E 1 44 ? -15.538 -1.016  34.804  1.00 52.56 ? 70  ALA E C   1 
ATOM   1802 O O   . ALA E 1 44 ? -15.929 -2.114  35.213  1.00 51.79 ? 70  ALA E O   1 
ATOM   1803 C CB  . ALA E 1 44 ? -16.992 0.009   33.049  1.00 52.28 ? 70  ALA E CB  1 
ATOM   1804 N N   . CYS E 1 45 ? -14.256 -0.732  34.598  1.00 53.51 ? 71  CYS E N   1 
ATOM   1805 C CA  . CYS E 1 45 ? -13.205 -1.703  34.862  1.00 54.27 ? 71  CYS E CA  1 
ATOM   1806 C C   . CYS E 1 45 ? -12.758 -1.571  36.316  1.00 56.02 ? 71  CYS E C   1 
ATOM   1807 O O   . CYS E 1 45 ? -11.579 -1.225  36.549  1.00 57.41 ? 71  CYS E O   1 
ATOM   1808 C CB  . CYS E 1 45 ? -12.013 -1.470  33.926  1.00 53.47 ? 71  CYS E CB  1 
ATOM   1809 S SG  . CYS E 1 45 ? -12.380 -1.582  32.141  1.00 52.04 ? 71  CYS E SG  1 
ATOM   1810 O OXT . CYS E 1 45 ? -13.601 -1.805  37.208  1.00 56.73 ? 71  CYS E OXT 1 
HETATM 1811 C C1  . STE F 2 .  ? 0.288   -0.190  11.394  1.00 34.33 ? 1   STE A C1  1 
HETATM 1812 O O1  . STE F 2 .  ? -0.498  -1.134  11.547  1.00 35.47 ? 1   STE A O1  1 
HETATM 1813 O O2  . STE F 2 .  ? 0.024   0.944   11.821  1.00 39.08 ? 1   STE A O2  1 
HETATM 1814 C C2  . STE F 2 .  ? 1.592   -0.453  10.665  1.00 37.42 ? 1   STE A C2  1 
HETATM 1815 C C3  . STE F 2 .  ? 1.452   -0.640  9.167   1.00 35.81 ? 1   STE A C3  1 
HETATM 1816 C C4  . STE F 2 .  ? 2.780   -0.901  8.481   1.00 36.00 ? 1   STE A C4  1 
HETATM 1817 C C5  . STE F 2 .  ? 3.478   0.380   8.048   1.00 36.28 ? 1   STE A C5  1 
HETATM 1818 C C6  . STE F 2 .  ? 3.760   0.454   6.557   1.00 35.78 ? 1   STE A C6  1 
HETATM 1819 C C7  . STE F 2 .  ? 5.132   -0.145  6.224   1.00 35.00 ? 1   STE A C7  1 
HETATM 1820 C C8  . STE F 2 .  ? 5.415   -0.066  4.720   1.00 35.78 ? 1   STE A C8  1 
HETATM 1821 C C9  . STE F 2 .  ? 6.868   0.239   4.427   1.00 35.94 ? 1   STE A C9  1 
HETATM 1822 C C10 . STE F 2 .  ? 7.193   0.332   2.954   1.00 37.60 ? 1   STE A C10 1 
HETATM 1823 C C11 . STE F 2 .  ? 8.678   0.371   2.664   1.00 38.61 ? 1   STE A C11 1 
HETATM 1824 C C12 . STE F 2 .  ? 8.913   1.128   1.365   1.00 40.81 ? 1   STE A C12 1 
HETATM 1825 C C13 . STE F 2 .  ? 9.638   0.238   0.374   1.00 41.23 ? 1   STE A C13 1 
HETATM 1826 C C14 . STE F 2 .  ? 11.058  0.715   0.148   1.00 41.68 ? 1   STE A C14 1 
HETATM 1827 C C15 . STE F 2 .  ? 11.580  0.295   -1.220  1.00 42.38 ? 1   STE A C15 1 
HETATM 1828 C C16 . STE F 2 .  ? 12.475  1.387   -1.802  1.00 44.04 ? 1   STE A C16 1 
HETATM 1829 C C17 . STE F 2 .  ? 12.761  1.298   -3.326  1.00 43.59 ? 1   STE A C17 1 
HETATM 1830 C C18 . STE F 2 .  ? 14.009  0.651   -3.902  1.00 44.47 ? 1   STE A C18 1 
HETATM 1831 O O   . HOH G 3 .  ? 24.684  10.332  -3.478  1.00 20.41 ? 9   HOH A O   1 
HETATM 1832 O O   . HOH G 3 .  ? 19.368  6.600   5.619   1.00 25.19 ? 12  HOH A O   1 
HETATM 1833 O O   . HOH G 3 .  ? 24.720  9.952   -0.802  1.00 21.49 ? 15  HOH A O   1 
HETATM 1834 O O   . HOH G 3 .  ? 22.269  12.792  -9.250  1.00 25.96 ? 23  HOH A O   1 
HETATM 1835 O O   . HOH G 3 .  ? 14.456  17.081  -5.044  1.00 24.88 ? 72  HOH A O   1 
HETATM 1836 O O   . HOH G 3 .  ? 14.483  16.015  -7.478  1.00 18.92 ? 73  HOH A O   1 
HETATM 1837 O O   . HOH G 3 .  ? 10.237  6.852   14.908  1.00 33.48 ? 74  HOH A O   1 
HETATM 1838 O O   . HOH G 3 .  ? 3.308   -3.403  26.357  1.00 37.28 ? 75  HOH A O   1 
HETATM 1839 O O   . HOH G 3 .  ? 9.341   1.235   21.548  1.00 32.51 ? 76  HOH A O   1 
HETATM 1840 O O   . HOH G 3 .  ? 15.463  7.637   10.775  1.00 33.27 ? 77  HOH A O   1 
HETATM 1841 O O   . HOH G 3 .  ? 10.100  2.443   19.542  1.00 33.55 ? 81  HOH A O   1 
HETATM 1842 O O   . HOH G 3 .  ? 25.600  14.007  -11.419 1.00 41.88 ? 96  HOH A O   1 
HETATM 1843 O O   . HOH G 3 .  ? 12.874  1.265   17.441  1.00 36.20 ? 98  HOH A O   1 
HETATM 1844 O O   . HOH G 3 .  ? 17.202  16.638  -7.595  1.00 38.55 ? 103 HOH A O   1 
HETATM 1845 O O   . HOH G 3 .  ? 10.427  -5.065  19.576  1.00 44.96 ? 114 HOH A O   1 
HETATM 1846 O O   . HOH G 3 .  ? 5.083   -5.089  25.596  1.00 36.62 ? 117 HOH A O   1 
HETATM 1847 O O   . HOH G 3 .  ? 0.750   -5.050  30.115  1.00 42.90 ? 118 HOH A O   1 
HETATM 1848 O O   . HOH G 3 .  ? 12.018  6.513   18.523  1.00 40.95 ? 122 HOH A O   1 
HETATM 1849 O O   . HOH G 3 .  ? 7.133   -3.651  20.788  1.00 31.44 ? 126 HOH A O   1 
HETATM 1850 O O   . HOH G 3 .  ? 15.483  -3.739  15.465  1.00 40.97 ? 134 HOH A O   1 
HETATM 1851 O O   . HOH G 3 .  ? 21.395  8.541   5.839   1.00 31.87 ? 136 HOH A O   1 
HETATM 1852 O O   . HOH G 3 .  ? 27.340  7.919   -10.250 1.00 41.02 ? 137 HOH A O   1 
HETATM 1853 O O   . HOH G 3 .  ? 9.271   6.908   17.711  1.00 40.54 ? 154 HOH A O   1 
HETATM 1854 O O   . HOH G 3 .  ? -11.866 -9.249  29.732  1.00 45.54 ? 157 HOH A O   1 
HETATM 1855 O O   . HOH G 3 .  ? 4.121   -6.407  23.056  1.00 43.17 ? 158 HOH A O   1 
HETATM 1856 O O   . HOH G 3 .  ? 12.186  12.819  -2.894  1.00 38.45 ? 159 HOH A O   1 
HETATM 1857 O O   . HOH G 3 .  ? 17.001  -4.381  10.625  1.00 38.12 ? 161 HOH A O   1 
HETATM 1858 O O   . HOH G 3 .  ? 22.108  8.810   -14.824 1.00 37.79 ? 163 HOH A O   1 
HETATM 1859 O O   . HOH G 3 .  ? 13.136  5.748   -2.750  1.00 40.41 ? 168 HOH A O   1 
HETATM 1860 O O   . HOH G 3 .  ? 3.182   -0.065  27.836  1.00 43.37 ? 171 HOH A O   1 
HETATM 1861 O O   . HOH G 3 .  ? 18.195  6.988   10.783  1.00 51.32 ? 174 HOH A O   1 
HETATM 1862 O O   . HOH G 3 .  ? 0.322   -6.746  32.164  1.00 41.59 ? 193 HOH A O   1 
HETATM 1863 O O   . HOH G 3 .  ? -4.281  -1.278  33.691  1.00 42.35 ? 194 HOH A O   1 
HETATM 1864 O O   . HOH G 3 .  ? -1.404  -3.557  30.929  1.00 43.83 ? 195 HOH A O   1 
HETATM 1865 O O   . HOH G 3 .  ? 24.177  12.969  -18.322 1.00 49.48 ? 198 HOH A O   1 
HETATM 1866 O O   . HOH G 3 .  ? 13.225  11.016  -0.426  1.00 62.46 ? 202 HOH A O   1 
HETATM 1867 O O   . HOH G 3 .  ? 1.273   -10.111 27.260  1.00 50.77 ? 205 HOH A O   1 
HETATM 1868 O O   . HOH G 3 .  ? 15.066  12.800  -0.932  1.00 49.28 ? 209 HOH A O   1 
HETATM 1869 O O   . HOH G 3 .  ? -18.464 -9.613  36.032  1.00 53.78 ? 213 HOH A O   1 
HETATM 1870 O O   . HOH G 3 .  ? 28.076  11.087  -10.828 1.00 57.32 ? 226 HOH A O   1 
HETATM 1871 O O   . HOH G 3 .  ? 29.832  7.337   -12.824 1.00 47.07 ? 227 HOH A O   1 
HETATM 1872 O O   . HOH G 3 .  ? 15.814  10.594  12.213  1.00 56.26 ? 235 HOH A O   1 
HETATM 1873 O O   . HOH G 3 .  ? 3.148   3.886   27.360  1.00 55.31 ? 241 HOH A O   1 
HETATM 1874 O O   . HOH G 3 .  ? 7.149   0.184   27.210  1.00 51.01 ? 243 HOH A O   1 
HETATM 1875 O O   . HOH G 3 .  ? 2.746   -8.529  22.126  1.00 48.72 ? 245 HOH A O   1 
HETATM 1876 O O   . HOH H 3 .  ? 27.277  -3.632  -1.695  1.00 21.52 ? 2   HOH B O   1 
HETATM 1877 O O   . HOH H 3 .  ? 29.472  2.781   -4.063  1.00 25.02 ? 5   HOH B O   1 
HETATM 1878 O O   . HOH H 3 .  ? 23.812  5.217   3.975   1.00 24.00 ? 6   HOH B O   1 
HETATM 1879 O O   . HOH H 3 .  ? -0.253  -12.676 13.416  1.00 21.75 ? 8   HOH B O   1 
HETATM 1880 O O   . HOH H 3 .  ? 18.821  -7.706  3.913   1.00 35.01 ? 10  HOH B O   1 
HETATM 1881 O O   . HOH H 3 .  ? 22.959  -2.793  4.273   1.00 22.81 ? 17  HOH B O   1 
HETATM 1882 O O   . HOH H 3 .  ? 10.533  -14.460 3.849   1.00 30.03 ? 18  HOH B O   1 
HETATM 1883 O O   . HOH H 3 .  ? 24.966  2.897   1.062   1.00 23.03 ? 24  HOH B O   1 
HETATM 1884 O O   . HOH H 3 .  ? 26.403  -5.403  0.097   1.00 22.91 ? 25  HOH B O   1 
HETATM 1885 O O   . HOH H 3 .  ? 27.039  2.449   2.537   1.00 33.63 ? 72  HOH B O   1 
HETATM 1886 O O   . HOH H 3 .  ? -10.766 -14.627 15.619  1.00 26.51 ? 73  HOH B O   1 
HETATM 1887 O O   . HOH H 3 .  ? -1.126  -13.116 10.862  1.00 28.28 ? 74  HOH B O   1 
HETATM 1888 O O   . HOH H 3 .  ? -0.479  -18.107 21.280  1.00 41.68 ? 75  HOH B O   1 
HETATM 1889 O O   . HOH H 3 .  ? -14.671 -14.685 20.299  1.00 47.68 ? 76  HOH B O   1 
HETATM 1890 O O   . HOH H 3 .  ? 24.878  -1.381  5.307   1.00 30.81 ? 77  HOH B O   1 
HETATM 1891 O O   . HOH H 3 .  ? 20.600  -6.799  5.406   1.00 37.75 ? 78  HOH B O   1 
HETATM 1892 O O   . HOH H 3 .  ? 18.549  5.936   8.133   1.00 30.52 ? 79  HOH B O   1 
HETATM 1893 O O   . HOH H 3 .  ? 20.704  4.236   5.074   1.00 22.35 ? 80  HOH B O   1 
HETATM 1894 O O   . HOH H 3 .  ? 29.327  -2.316  -8.757  1.00 25.94 ? 81  HOH B O   1 
HETATM 1895 O O   . HOH H 3 .  ? 27.268  8.604   -0.589  1.00 39.16 ? 82  HOH B O   1 
HETATM 1896 O O   . HOH H 3 .  ? 17.635  -2.528  8.583   1.00 27.94 ? 83  HOH B O   1 
HETATM 1897 O O   . HOH H 3 .  ? 26.229  5.335   1.065   1.00 34.05 ? 84  HOH B O   1 
HETATM 1898 O O   . HOH H 3 .  ? 1.208   -14.519 9.791   1.00 30.15 ? 85  HOH B O   1 
HETATM 1899 O O   . HOH H 3 .  ? -4.661  -13.687 18.503  1.00 25.58 ? 86  HOH B O   1 
HETATM 1900 O O   . HOH H 3 .  ? 23.164  1.301   4.190   1.00 34.73 ? 87  HOH B O   1 
HETATM 1901 O O   . HOH H 3 .  ? 5.913   -11.914 14.686  1.00 39.11 ? 88  HOH B O   1 
HETATM 1902 O O   . HOH H 3 .  ? -13.148 -15.189 24.606  1.00 42.78 ? 99  HOH B O   1 
HETATM 1903 O O   . HOH H 3 .  ? 16.864  1.979   0.022   1.00 30.51 ? 100 HOH B O   1 
HETATM 1904 O O   . HOH H 3 .  ? 21.596  -4.454  5.886   1.00 32.11 ? 101 HOH B O   1 
HETATM 1905 O O   . HOH H 3 .  ? 26.683  -8.127  -0.099  1.00 39.45 ? 102 HOH B O   1 
HETATM 1906 O O   . HOH H 3 .  ? 8.986   -14.337 6.070   1.00 39.57 ? 104 HOH B O   1 
HETATM 1907 O O   . HOH H 3 .  ? 9.918   -10.941 8.970   1.00 31.12 ? 123 HOH B O   1 
HETATM 1908 O O   . HOH H 3 .  ? 19.535  3.732   8.766   1.00 55.83 ? 135 HOH B O   1 
HETATM 1909 O O   . HOH H 3 .  ? 29.736  -4.747  -2.615  1.00 40.93 ? 139 HOH B O   1 
HETATM 1910 O O   . HOH H 3 .  ? 27.336  5.212   -10.399 1.00 43.56 ? 143 HOH B O   1 
HETATM 1911 O O   . HOH H 3 .  ? -13.998 -10.362 28.151  1.00 34.47 ? 145 HOH B O   1 
HETATM 1912 O O   . HOH H 3 .  ? 7.465   -12.735 12.372  1.00 40.43 ? 146 HOH B O   1 
HETATM 1913 O O   . HOH H 3 .  ? 3.598   -13.359 15.745  1.00 40.90 ? 150 HOH B O   1 
HETATM 1914 O O   . HOH H 3 .  ? 12.208  -7.886  3.328   1.00 36.02 ? 155 HOH B O   1 
HETATM 1915 O O   . HOH H 3 .  ? 28.639  7.824   -2.789  1.00 50.68 ? 156 HOH B O   1 
HETATM 1916 O O   . HOH H 3 .  ? 6.031   -13.986 4.891   1.00 49.49 ? 160 HOH B O   1 
HETATM 1917 O O   . HOH H 3 .  ? 7.540   -6.118  20.036  1.00 46.68 ? 162 HOH B O   1 
HETATM 1918 O O   . HOH H 3 .  ? 32.668  2.839   -5.503  1.00 41.97 ? 164 HOH B O   1 
HETATM 1919 O O   . HOH H 3 .  ? 26.405  1.684   -11.618 1.00 45.94 ? 165 HOH B O   1 
HETATM 1920 O O   . HOH H 3 .  ? 2.598   -11.065 19.543  1.00 47.96 ? 173 HOH B O   1 
HETATM 1921 O O   . HOH H 3 .  ? -24.694 -10.068 26.343  1.00 55.00 ? 184 HOH B O   1 
HETATM 1922 O O   . HOH H 3 .  ? -16.927 -1.111  29.454  1.00 47.95 ? 187 HOH B O   1 
HETATM 1923 O O   . HOH H 3 .  ? 7.646   -12.035 9.899   1.00 48.80 ? 191 HOH B O   1 
HETATM 1924 O O   . HOH H 3 .  ? 24.584  -5.321  3.795   1.00 35.20 ? 196 HOH B O   1 
HETATM 1925 O O   . HOH H 3 .  ? 9.892   -7.756  17.253  1.00 51.82 ? 197 HOH B O   1 
HETATM 1926 O O   . HOH H 3 .  ? 1.680   -17.385 23.254  1.00 54.12 ? 199 HOH B O   1 
HETATM 1927 O O   . HOH H 3 .  ? -19.495 -8.137  22.654  1.00 44.51 ? 200 HOH B O   1 
HETATM 1928 O O   . HOH H 3 .  ? -0.068  -13.234 6.782   1.00 56.54 ? 201 HOH B O   1 
HETATM 1929 O O   . HOH H 3 .  ? -7.907  -14.077 19.931  1.00 46.49 ? 207 HOH B O   1 
HETATM 1930 O O   . HOH H 3 .  ? -21.147 -9.991  21.865  1.00 50.14 ? 208 HOH B O   1 
HETATM 1931 O O   . HOH H 3 .  ? -17.608 -14.974 20.486  1.00 52.50 ? 218 HOH B O   1 
HETATM 1932 O O   . HOH H 3 .  ? -3.504  -15.033 20.965  1.00 54.00 ? 222 HOH B O   1 
HETATM 1933 O O   . HOH H 3 .  ? -24.536 -5.106  29.853  1.00 53.94 ? 224 HOH B O   1 
HETATM 1934 O O   . HOH H 3 .  ? -26.977 -9.578  23.179  1.00 51.01 ? 244 HOH B O   1 
HETATM 1935 O O   . HOH I 3 .  ? -14.217 -6.328  9.401   1.00 19.69 ? 3   HOH C O   1 
HETATM 1936 O O   . HOH I 3 .  ? -5.502  -10.266 3.939   1.00 16.47 ? 4   HOH C O   1 
HETATM 1937 O O   . HOH I 3 .  ? -0.995  -8.574  -0.807  1.00 20.67 ? 7   HOH C O   1 
HETATM 1938 O O   . HOH I 3 .  ? -5.404  -12.439 5.572   1.00 24.41 ? 16  HOH C O   1 
HETATM 1939 O O   . HOH I 3 .  ? 8.726   -10.484 -5.822  1.00 23.51 ? 19  HOH C O   1 
HETATM 1940 O O   . HOH I 3 .  ? 15.456  -3.216  -1.493  1.00 25.65 ? 22  HOH C O   1 
HETATM 1941 O O   . HOH I 3 .  ? 25.129  -9.461  -8.514  1.00 24.52 ? 26  HOH C O   1 
HETATM 1942 O O   . HOH I 3 .  ? 9.800   -12.470 1.802   1.00 31.20 ? 72  HOH C O   1 
HETATM 1943 O O   . HOH I 3 .  ? -11.898 -3.816  5.562   1.00 23.75 ? 73  HOH C O   1 
HETATM 1944 O O   . HOH I 3 .  ? 18.746  -11.032 -10.721 1.00 26.05 ? 74  HOH C O   1 
HETATM 1945 O O   . HOH I 3 .  ? -3.033  -12.146 7.227   1.00 26.73 ? 75  HOH C O   1 
HETATM 1946 O O   . HOH I 3 .  ? -9.367  -4.856  4.788   1.00 25.44 ? 76  HOH C O   1 
HETATM 1947 O O   . HOH I 3 .  ? -17.742 -0.315  9.895   1.00 34.84 ? 77  HOH C O   1 
HETATM 1948 O O   . HOH I 3 .  ? 12.857  -13.047 -2.518  1.00 36.07 ? 78  HOH C O   1 
HETATM 1949 O O   . HOH I 3 .  ? -7.886  -10.054 4.816   1.00 24.38 ? 79  HOH C O   1 
HETATM 1950 O O   . HOH I 3 .  ? 23.893  -7.511  -15.488 1.00 45.25 ? 80  HOH C O   1 
HETATM 1951 O O   . HOH I 3 .  ? 4.979   -12.369 -2.914  1.00 37.11 ? 81  HOH C O   1 
HETATM 1952 O O   . HOH I 3 .  ? 14.587  -12.206 -4.544  1.00 27.71 ? 82  HOH C O   1 
HETATM 1953 O O   . HOH I 3 .  ? 27.650  -3.362  -10.690 1.00 30.12 ? 83  HOH C O   1 
HETATM 1954 O O   . HOH I 3 .  ? 1.791   -12.368 1.058   1.00 34.72 ? 84  HOH C O   1 
HETATM 1955 O O   . HOH I 3 .  ? 5.066   -12.327 -0.452  1.00 29.21 ? 85  HOH C O   1 
HETATM 1956 O O   . HOH I 3 .  ? -3.324  -15.899 3.841   1.00 34.78 ? 86  HOH C O   1 
HETATM 1957 O O   . HOH I 3 .  ? 14.041  -13.362 -6.999  1.00 36.15 ? 87  HOH C O   1 
HETATM 1958 O O   . HOH I 3 .  ? -20.857 0.606   9.324   1.00 36.33 ? 88  HOH C O   1 
HETATM 1959 O O   . HOH I 3 .  ? 28.520  -10.574 -10.406 1.00 40.07 ? 89  HOH C O   1 
HETATM 1960 O O   . HOH I 3 .  ? 20.627  -9.280  1.915   1.00 35.85 ? 91  HOH C O   1 
HETATM 1961 O O   . HOH I 3 .  ? -9.084  -4.919  1.898   1.00 38.88 ? 105 HOH C O   1 
HETATM 1962 O O   . HOH I 3 .  ? 19.041  -11.826 -13.330 1.00 34.05 ? 106 HOH C O   1 
HETATM 1963 O O   . HOH I 3 .  ? 16.907  -9.015  1.096   1.00 37.41 ? 109 HOH C O   1 
HETATM 1964 O O   . HOH I 3 .  ? 31.127  -4.190  -7.417  1.00 33.97 ? 110 HOH C O   1 
HETATM 1965 O O   . HOH I 3 .  ? -13.784 -4.532  7.399   1.00 25.78 ? 112 HOH C O   1 
HETATM 1966 O O   . HOH I 3 .  ? 1.598   -11.749 5.200   1.00 36.13 ? 115 HOH C O   1 
HETATM 1967 O O   . HOH I 3 .  ? 16.102  -11.907 -10.502 1.00 28.70 ? 119 HOH C O   1 
HETATM 1968 O O   . HOH I 3 .  ? -16.936 -5.804  9.022   1.00 28.79 ? 121 HOH C O   1 
HETATM 1969 O O   . HOH I 3 .  ? -17.426 4.038   11.932  1.00 51.66 ? 127 HOH C O   1 
HETATM 1970 O O   . HOH I 3 .  ? 29.411  -3.689  -12.561 1.00 46.04 ? 129 HOH C O   1 
HETATM 1971 O O   . HOH I 3 .  ? 25.633  -3.269  -13.870 1.00 48.32 ? 130 HOH C O   1 
HETATM 1972 O O   . HOH I 3 .  ? 25.436  -1.948  -11.536 1.00 46.97 ? 133 HOH C O   1 
HETATM 1973 O O   . HOH I 3 .  ? 30.907  -9.970  -11.965 1.00 43.97 ? 138 HOH C O   1 
HETATM 1974 O O   . HOH I 3 .  ? -9.546  -7.993  1.744   1.00 39.54 ? 140 HOH C O   1 
HETATM 1975 O O   . HOH I 3 .  ? 24.944  -12.355 -8.656  1.00 47.75 ? 142 HOH C O   1 
HETATM 1976 O O   . HOH I 3 .  ? 7.821   -14.174 -4.243  1.00 42.43 ? 152 HOH C O   1 
HETATM 1977 O O   . HOH I 3 .  ? -21.701 -7.258  21.233  1.00 49.92 ? 153 HOH C O   1 
HETATM 1978 O O   . HOH I 3 .  ? 10.487  -11.912 -8.851  1.00 43.38 ? 166 HOH C O   1 
HETATM 1979 O O   . HOH I 3 .  ? 7.103   -13.773 1.526   1.00 42.75 ? 167 HOH C O   1 
HETATM 1980 O O   . HOH I 3 .  ? 35.028  -6.900  -12.485 1.00 47.02 ? 169 HOH C O   1 
HETATM 1981 O O   . HOH I 3 .  ? -3.285  -12.167 9.757   1.00 39.59 ? 170 HOH C O   1 
HETATM 1982 O O   . HOH I 3 .  ? 31.356  -4.076  -4.882  1.00 42.83 ? 176 HOH C O   1 
HETATM 1983 O O   . HOH I 3 .  ? 26.757  -9.596  -6.492  1.00 55.88 ? 179 HOH C O   1 
HETATM 1984 O O   . HOH I 3 .  ? 29.846  -10.424 -14.790 1.00 45.72 ? 185 HOH C O   1 
HETATM 1985 O O   . HOH I 3 .  ? -22.182 -0.011  14.086  1.00 46.58 ? 186 HOH C O   1 
HETATM 1986 O O   . HOH I 3 .  ? 21.991  -9.716  -1.014  1.00 50.44 ? 206 HOH C O   1 
HETATM 1987 O O   . HOH I 3 .  ? -22.585 1.224   7.278   1.00 36.00 ? 214 HOH C O   1 
HETATM 1988 O O   . HOH I 3 .  ? 33.076  -4.963  -13.337 1.00 51.50 ? 217 HOH C O   1 
HETATM 1989 O O   . HOH I 3 .  ? 21.513  -11.510 -15.160 1.00 43.45 ? 220 HOH C O   1 
HETATM 1990 O O   . HOH I 3 .  ? 19.939  -12.595 -17.138 1.00 46.70 ? 236 HOH C O   1 
HETATM 1991 O O   . HOH I 3 .  ? -25.255 -1.027  22.671  1.00 49.14 ? 237 HOH C O   1 
HETATM 1992 O O   . HOH I 3 .  ? -26.780 -3.422  22.077  1.00 53.85 ? 242 HOH C O   1 
HETATM 1993 O O   . HOH J 3 .  ? -7.428  8.740   7.802   1.00 29.25 ? 14  HOH D O   1 
HETATM 1994 O O   . HOH J 3 .  ? -8.337  4.837   2.373   1.00 26.28 ? 21  HOH D O   1 
HETATM 1995 O O   . HOH J 3 .  ? 7.983   -8.810  -8.108  1.00 32.65 ? 72  HOH D O   1 
HETATM 1996 O O   . HOH J 3 .  ? 3.099   1.877   -9.844  1.00 30.06 ? 73  HOH D O   1 
HETATM 1997 O O   . HOH J 3 .  ? -15.135 4.789   6.860   1.00 32.23 ? 74  HOH D O   1 
HETATM 1998 O O   . HOH J 3 .  ? 15.886  -6.490  -17.791 1.00 46.12 ? 75  HOH D O   1 
HETATM 1999 O O   . HOH J 3 .  ? -16.172 2.288   8.529   1.00 34.23 ? 76  HOH D O   1 
HETATM 2000 O O   . HOH J 3 .  ? -1.988  0.629   -6.200  1.00 26.77 ? 77  HOH D O   1 
HETATM 2001 O O   . HOH J 3 .  ? -6.395  0.373   -1.061  1.00 28.25 ? 78  HOH D O   1 
HETATM 2002 O O   . HOH J 3 .  ? 19.837  -8.425  -19.326 1.00 50.30 ? 79  HOH D O   1 
HETATM 2003 O O   . HOH J 3 .  ? -6.053  -3.236  -0.674  1.00 23.70 ? 80  HOH D O   1 
HETATM 2004 O O   . HOH J 3 .  ? -13.388 -0.660  7.923   1.00 22.19 ? 84  HOH D O   1 
HETATM 2005 O O   . HOH J 3 .  ? -2.380  5.948   -1.367  1.00 35.00 ? 86  HOH D O   1 
HETATM 2006 O O   . HOH J 3 .  ? -3.394  9.147   -2.374  1.00 32.33 ? 90  HOH D O   1 
HETATM 2007 O O   . HOH J 3 .  ? 11.112  -7.407  -12.878 1.00 36.41 ? 92  HOH D O   1 
HETATM 2008 O O   . HOH J 3 .  ? -1.634  2.769   -7.717  1.00 39.35 ? 93  HOH D O   1 
HETATM 2009 O O   . HOH J 3 .  ? -16.015 -1.223  7.695   1.00 38.11 ? 94  HOH D O   1 
HETATM 2010 O O   . HOH J 3 .  ? 11.177  -3.084  -5.644  1.00 31.25 ? 95  HOH D O   1 
HETATM 2011 O O   . HOH J 3 .  ? 9.732   -10.149 -10.615 1.00 38.32 ? 97  HOH D O   1 
HETATM 2012 O O   . HOH J 3 .  ? -16.243 8.864   32.486  1.00 46.54 ? 113 HOH D O   1 
HETATM 2013 O O   . HOH J 3 .  ? -5.456  10.553  8.022   1.00 33.83 ? 116 HOH D O   1 
HETATM 2014 O O   . HOH J 3 .  ? 8.181   4.676   -15.980 1.00 38.03 ? 125 HOH D O   1 
HETATM 2015 O O   . HOH J 3 .  ? 25.107  -7.957  -18.239 1.00 49.15 ? 131 HOH D O   1 
HETATM 2016 O O   . HOH J 3 .  ? -17.600 -3.348  7.977   1.00 41.11 ? 172 HOH D O   1 
HETATM 2017 O O   . HOH J 3 .  ? 5.376   -3.265  -12.543 1.00 43.75 ? 175 HOH D O   1 
HETATM 2018 O O   . HOH J 3 .  ? -3.644  6.423   -3.636  1.00 54.00 ? 177 HOH D O   1 
HETATM 2019 O O   . HOH J 3 .  ? -17.461 9.460   34.688  1.00 51.16 ? 180 HOH D O   1 
HETATM 2020 O O   . HOH J 3 .  ? 1.890   -0.113  -12.669 1.00 46.98 ? 181 HOH D O   1 
HETATM 2021 O O   . HOH J 3 .  ? -3.837  4.035   -8.072  1.00 56.89 ? 183 HOH D O   1 
HETATM 2022 O O   . HOH J 3 .  ? 14.098  -12.441 -12.958 1.00 42.48 ? 188 HOH D O   1 
HETATM 2023 O O   . HOH J 3 .  ? 3.282   -2.116  -11.377 1.00 42.48 ? 189 HOH D O   1 
HETATM 2024 O O   . HOH J 3 .  ? -10.800 6.027   3.532   1.00 49.32 ? 190 HOH D O   1 
HETATM 2025 O O   . HOH J 3 .  ? 22.229  -2.452  -14.889 1.00 44.02 ? 203 HOH D O   1 
HETATM 2026 O O   . HOH J 3 .  ? -14.361 7.861   4.520   1.00 54.19 ? 204 HOH D O   1 
HETATM 2027 O O   . HOH J 3 .  ? 4.812   -4.054  -15.927 1.00 53.95 ? 211 HOH D O   1 
HETATM 2028 O O   . HOH J 3 .  ? -14.967 5.037   11.731  1.00 44.77 ? 212 HOH D O   1 
HETATM 2029 O O   . HOH J 3 .  ? -10.039 9.627   11.509  1.00 52.19 ? 215 HOH D O   1 
HETATM 2030 O O   . HOH J 3 .  ? -13.946 9.571   29.545  1.00 50.60 ? 216 HOH D O   1 
HETATM 2031 O O   . HOH J 3 .  ? 1.845   -3.816  -9.818  1.00 42.94 ? 221 HOH D O   1 
HETATM 2032 O O   . HOH J 3 .  ? -20.739 9.953   30.123  1.00 53.51 ? 223 HOH D O   1 
HETATM 2033 O O   . HOH J 3 .  ? 10.693  -11.526 -12.794 1.00 58.63 ? 225 HOH D O   1 
HETATM 2034 O O   . HOH J 3 .  ? -13.518 8.154   12.400  1.00 41.68 ? 229 HOH D O   1 
HETATM 2035 O O   . HOH J 3 .  ? -22.802 2.174   35.484  1.00 54.15 ? 231 HOH D O   1 
HETATM 2036 O O   . HOH J 3 .  ? 7.043   0.360   -17.464 1.00 51.50 ? 240 HOH D O   1 
HETATM 2037 O O   . HOH K 3 .  ? 13.724  11.421  -12.883 1.00 21.39 ? 11  HOH E O   1 
HETATM 2038 O O   . HOH K 3 .  ? -7.102  8.717   38.041  1.00 25.59 ? 13  HOH E O   1 
HETATM 2039 O O   . HOH K 3 .  ? 9.414   12.459  -3.015  1.00 21.98 ? 20  HOH E O   1 
HETATM 2040 O O   . HOH K 3 .  ? 11.649  12.577  -11.097 1.00 19.48 ? 72  HOH E O   1 
HETATM 2041 O O   . HOH K 3 .  ? -2.501  10.678  4.273   1.00 31.76 ? 73  HOH E O   1 
HETATM 2042 O O   . HOH K 3 .  ? -4.931  13.853  11.395  1.00 41.30 ? 74  HOH E O   1 
HETATM 2043 O O   . HOH K 3 .  ? 5.302   7.469   -12.169 1.00 27.66 ? 75  HOH E O   1 
HETATM 2044 O O   . HOH K 3 .  ? 3.227   11.725  -14.190 1.00 31.67 ? 76  HOH E O   1 
HETATM 2045 O O   . HOH K 3 .  ? 8.911   6.167   -13.708 1.00 28.02 ? 77  HOH E O   1 
HETATM 2046 O O   . HOH K 3 .  ? 9.646   2.304   -6.020  1.00 34.49 ? 78  HOH E O   1 
HETATM 2047 O O   . HOH K 3 .  ? 8.366   8.358   -15.158 1.00 24.82 ? 79  HOH E O   1 
HETATM 2048 O O   . HOH K 3 .  ? 4.177   9.943   -15.984 1.00 31.43 ? 80  HOH E O   1 
HETATM 2049 O O   . HOH K 3 .  ? 1.376   12.859  12.173  1.00 35.18 ? 82  HOH E O   1 
HETATM 2050 O O   . HOH K 3 .  ? -10.031 2.870   36.218  1.00 46.61 ? 89  HOH E O   1 
HETATM 2051 O O   . HOH K 3 .  ? 4.501   12.921  1.113   1.00 36.41 ? 107 HOH E O   1 
HETATM 2052 O O   . HOH K 3 .  ? 4.323   3.825   -10.722 1.00 37.48 ? 108 HOH E O   1 
HETATM 2053 O O   . HOH K 3 .  ? 10.237  16.246  2.655   1.00 45.95 ? 111 HOH E O   1 
HETATM 2054 O O   . HOH K 3 .  ? -12.200 4.459   37.617  1.00 46.25 ? 120 HOH E O   1 
HETATM 2055 O O   . HOH K 3 .  ? 19.895  10.329  -17.806 1.00 43.36 ? 124 HOH E O   1 
HETATM 2056 O O   . HOH K 3 .  ? 16.009  6.495   -19.519 1.00 45.11 ? 128 HOH E O   1 
HETATM 2057 O O   . HOH K 3 .  ? 2.352   8.774   -11.110 1.00 40.03 ? 132 HOH E O   1 
HETATM 2058 O O   . HOH K 3 .  ? 1.129   2.649   29.768  1.00 54.51 ? 141 HOH E O   1 
HETATM 2059 O O   . HOH K 3 .  ? 0.737   6.688   27.837  1.00 41.00 ? 144 HOH E O   1 
HETATM 2060 O O   . HOH K 3 .  ? 2.625   6.299   -10.401 1.00 33.19 ? 147 HOH E O   1 
HETATM 2061 O O   . HOH K 3 .  ? -4.793  14.940  9.140   1.00 44.46 ? 148 HOH E O   1 
HETATM 2062 O O   . HOH K 3 .  ? -9.127  -0.229  33.653  1.00 38.14 ? 149 HOH E O   1 
HETATM 2063 O O   . HOH K 3 .  ? 8.998   13.109  -0.418  1.00 46.03 ? 151 HOH E O   1 
HETATM 2064 O O   . HOH K 3 .  ? 2.338   15.058  10.987  1.00 53.97 ? 178 HOH E O   1 
HETATM 2065 O O   . HOH K 3 .  ? 3.432   9.738   17.956  1.00 41.85 ? 182 HOH E O   1 
HETATM 2066 O O   . HOH K 3 .  ? -3.704  6.480   32.544  1.00 42.67 ? 192 HOH E O   1 
HETATM 2067 O O   . HOH K 3 .  ? -6.871  15.576  11.904  1.00 54.72 ? 210 HOH E O   1 
HETATM 2068 O O   . HOH K 3 .  ? -16.186 1.508   40.472  1.00 44.64 ? 219 HOH E O   1 
HETATM 2069 O O   . HOH K 3 .  ? 15.159  13.059  -14.564 1.00 40.24 ? 228 HOH E O   1 
HETATM 2070 O O   . HOH K 3 .  ? 3.393   2.112   -12.912 1.00 51.91 ? 230 HOH E O   1 
HETATM 2071 O O   . HOH K 3 .  ? -2.309  12.699  7.482   1.00 53.49 ? 232 HOH E O   1 
HETATM 2072 O O   . HOH K 3 .  ? 4.500   13.303  5.005   1.00 50.64 ? 233 HOH E O   1 
HETATM 2073 O O   . HOH K 3 .  ? -1.665  16.210  8.424   1.00 48.03 ? 234 HOH E O   1 
HETATM 2074 O O   . HOH K 3 .  ? -17.515 -3.230  37.049  1.00 58.88 ? 238 HOH E O   1 
HETATM 2075 O O   . HOH K 3 .  ? 2.583   8.931   20.397  1.00 47.17 ? 239 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  27 27 MET MET A . n 
A 1 2  ASP 2  28 28 ASP ASP A . n 
A 1 3  LEU 3  29 29 LEU LEU A . n 
A 1 4  ALA 4  30 30 ALA ALA A . n 
A 1 5  PRO 5  31 31 PRO PRO A . n 
A 1 6  GLN 6  32 32 GLN GLN A . n 
A 1 7  MET 7  33 33 MET MET A . n 
A 1 8  LEU 8  34 34 LEU LEU A . n 
A 1 9  ARG 9  35 35 ARG ARG A . n 
A 1 10 GLU 10 36 36 GLU GLU A . n 
A 1 11 LEU 11 37 37 LEU LEU A . n 
A 1 12 GLN 12 38 38 GLN GLN A . n 
A 1 13 GLU 13 39 39 GLU GLU A . n 
A 1 14 THR 14 40 40 THR THR A . n 
A 1 15 ASN 15 41 41 ASN ASN A . n 
A 1 16 ALA 16 42 42 ALA ALA A . n 
A 1 17 ALA 17 43 43 ALA ALA A . n 
A 1 18 LEU 18 44 44 LEU LEU A . n 
A 1 19 GLN 19 45 45 GLN GLN A . n 
A 1 20 ASP 20 46 46 ASP ASP A . n 
A 1 21 VAL 21 47 47 VAL VAL A . n 
A 1 22 ARG 22 48 48 ARG ARG A . n 
A 1 23 GLU 23 49 49 GLU GLU A . n 
A 1 24 LEU 24 50 50 LEU LEU A . n 
A 1 25 LEU 25 51 51 LEU LEU A . n 
A 1 26 ARG 26 52 52 ARG ARG A . n 
A 1 27 GLN 27 53 53 GLN GLN A . n 
A 1 28 GLN 28 54 54 GLN GLN A . n 
A 1 29 VAL 29 55 55 VAL VAL A . n 
A 1 30 LYS 30 56 56 LYS LYS A . n 
A 1 31 GLU 31 57 57 GLU GLU A . n 
A 1 32 ILE 32 58 58 ILE ILE A . n 
A 1 33 THR 33 59 59 THR THR A . n 
A 1 34 PHE 34 60 60 PHE PHE A . n 
A 1 35 LEU 35 61 61 LEU LEU A . n 
A 1 36 LYS 36 62 62 LYS LYS A . n 
A 1 37 ASN 37 63 63 ASN ASN A . n 
A 1 38 THR 38 64 64 THR THR A . n 
A 1 39 VAL 39 65 65 VAL VAL A . n 
A 1 40 MET 40 66 66 MET MET A . n 
A 1 41 GLU 41 67 67 GLU GLU A . n 
A 1 42 CYS 42 68 68 CYS CYS A . n 
A 1 43 ASP 43 69 69 ASP ASP A . n 
A 1 44 ALA 44 70 70 ALA ALA A . n 
A 1 45 CYS 45 71 71 CYS CYS A . n 
B 1 1  MET 1  27 27 MET MET B . n 
B 1 2  ASP 2  28 28 ASP ASP B . n 
B 1 3  LEU 3  29 29 LEU LEU B . n 
B 1 4  ALA 4  30 30 ALA ALA B . n 
B 1 5  PRO 5  31 31 PRO PRO B . n 
B 1 6  GLN 6  32 32 GLN GLN B . n 
B 1 7  MET 7  33 33 MET MET B . n 
B 1 8  LEU 8  34 34 LEU LEU B . n 
B 1 9  ARG 9  35 35 ARG ARG B . n 
B 1 10 GLU 10 36 36 GLU GLU B . n 
B 1 11 LEU 11 37 37 LEU LEU B . n 
B 1 12 GLN 12 38 38 GLN GLN B . n 
B 1 13 GLU 13 39 39 GLU GLU B . n 
B 1 14 THR 14 40 40 THR THR B . n 
B 1 15 ASN 15 41 41 ASN ASN B . n 
B 1 16 ALA 16 42 42 ALA ALA B . n 
B 1 17 ALA 17 43 43 ALA ALA B . n 
B 1 18 LEU 18 44 44 LEU LEU B . n 
B 1 19 GLN 19 45 45 GLN GLN B . n 
B 1 20 ASP 20 46 46 ASP ASP B . n 
B 1 21 VAL 21 47 47 VAL VAL B . n 
B 1 22 ARG 22 48 48 ARG ARG B . n 
B 1 23 GLU 23 49 49 GLU GLU B . n 
B 1 24 LEU 24 50 50 LEU LEU B . n 
B 1 25 LEU 25 51 51 LEU LEU B . n 
B 1 26 ARG 26 52 52 ARG ARG B . n 
B 1 27 GLN 27 53 53 GLN GLN B . n 
B 1 28 GLN 28 54 54 GLN GLN B . n 
B 1 29 VAL 29 55 55 VAL VAL B . n 
B 1 30 LYS 30 56 56 LYS LYS B . n 
B 1 31 GLU 31 57 57 GLU GLU B . n 
B 1 32 ILE 32 58 58 ILE ILE B . n 
B 1 33 THR 33 59 59 THR THR B . n 
B 1 34 PHE 34 60 60 PHE PHE B . n 
B 1 35 LEU 35 61 61 LEU LEU B . n 
B 1 36 LYS 36 62 62 LYS LYS B . n 
B 1 37 ASN 37 63 63 ASN ASN B . n 
B 1 38 THR 38 64 64 THR THR B . n 
B 1 39 VAL 39 65 65 VAL VAL B . n 
B 1 40 MET 40 66 66 MET MET B . n 
B 1 41 GLU 41 67 67 GLU GLU B . n 
B 1 42 CYS 42 68 68 CYS CYS B . n 
B 1 43 ASP 43 69 69 ASP ASP B . n 
B 1 44 ALA 44 70 70 ALA ALA B . n 
B 1 45 CYS 45 71 71 CYS CYS B . n 
C 1 1  MET 1  27 27 MET MET C . n 
C 1 2  ASP 2  28 28 ASP ASP C . n 
C 1 3  LEU 3  29 29 LEU LEU C . n 
C 1 4  ALA 4  30 30 ALA ALA C . n 
C 1 5  PRO 5  31 31 PRO PRO C . n 
C 1 6  GLN 6  32 32 GLN GLN C . n 
C 1 7  MET 7  33 33 MET MET C . n 
C 1 8  LEU 8  34 34 LEU LEU C . n 
C 1 9  ARG 9  35 35 ARG ARG C . n 
C 1 10 GLU 10 36 36 GLU GLU C . n 
C 1 11 LEU 11 37 37 LEU LEU C . n 
C 1 12 GLN 12 38 38 GLN GLN C . n 
C 1 13 GLU 13 39 39 GLU GLU C . n 
C 1 14 THR 14 40 40 THR THR C . n 
C 1 15 ASN 15 41 41 ASN ASN C . n 
C 1 16 ALA 16 42 42 ALA ALA C . n 
C 1 17 ALA 17 43 43 ALA ALA C . n 
C 1 18 LEU 18 44 44 LEU LEU C . n 
C 1 19 GLN 19 45 45 GLN GLN C . n 
C 1 20 ASP 20 46 46 ASP ASP C . n 
C 1 21 VAL 21 47 47 VAL VAL C . n 
C 1 22 ARG 22 48 48 ARG ARG C . n 
C 1 23 GLU 23 49 49 GLU GLU C . n 
C 1 24 LEU 24 50 50 LEU LEU C . n 
C 1 25 LEU 25 51 51 LEU LEU C . n 
C 1 26 ARG 26 52 52 ARG ARG C . n 
C 1 27 GLN 27 53 53 GLN GLN C . n 
C 1 28 GLN 28 54 54 GLN GLN C . n 
C 1 29 VAL 29 55 55 VAL VAL C . n 
C 1 30 LYS 30 56 56 LYS LYS C . n 
C 1 31 GLU 31 57 57 GLU GLU C . n 
C 1 32 ILE 32 58 58 ILE ILE C . n 
C 1 33 THR 33 59 59 THR THR C . n 
C 1 34 PHE 34 60 60 PHE PHE C . n 
C 1 35 LEU 35 61 61 LEU LEU C . n 
C 1 36 LYS 36 62 62 LYS LYS C . n 
C 1 37 ASN 37 63 63 ASN ASN C . n 
C 1 38 THR 38 64 64 THR THR C . n 
C 1 39 VAL 39 65 65 VAL VAL C . n 
C 1 40 MET 40 66 66 MET MET C . n 
C 1 41 GLU 41 67 67 GLU GLU C . n 
C 1 42 CYS 42 68 68 CYS CYS C . n 
C 1 43 ASP 43 69 69 ASP ASP C . n 
C 1 44 ALA 44 70 70 ALA ALA C . n 
C 1 45 CYS 45 71 71 CYS CYS C . n 
D 1 1  MET 1  27 27 MET MET D . n 
D 1 2  ASP 2  28 28 ASP ASP D . n 
D 1 3  LEU 3  29 29 LEU LEU D . n 
D 1 4  ALA 4  30 30 ALA ALA D . n 
D 1 5  PRO 5  31 31 PRO PRO D . n 
D 1 6  GLN 6  32 32 GLN GLN D . n 
D 1 7  MET 7  33 33 MET MET D . n 
D 1 8  LEU 8  34 34 LEU LEU D . n 
D 1 9  ARG 9  35 35 ARG ARG D . n 
D 1 10 GLU 10 36 36 GLU GLU D . n 
D 1 11 LEU 11 37 37 LEU LEU D . n 
D 1 12 GLN 12 38 38 GLN GLN D . n 
D 1 13 GLU 13 39 39 GLU GLU D . n 
D 1 14 THR 14 40 40 THR THR D . n 
D 1 15 ASN 15 41 41 ASN ASN D . n 
D 1 16 ALA 16 42 42 ALA ALA D . n 
D 1 17 ALA 17 43 43 ALA ALA D . n 
D 1 18 LEU 18 44 44 LEU LEU D . n 
D 1 19 GLN 19 45 45 GLN GLN D . n 
D 1 20 ASP 20 46 46 ASP ASP D . n 
D 1 21 VAL 21 47 47 VAL VAL D . n 
D 1 22 ARG 22 48 48 ARG ARG D . n 
D 1 23 GLU 23 49 49 GLU GLU D . n 
D 1 24 LEU 24 50 50 LEU LEU D . n 
D 1 25 LEU 25 51 51 LEU LEU D . n 
D 1 26 ARG 26 52 52 ARG ARG D . n 
D 1 27 GLN 27 53 53 GLN GLN D . n 
D 1 28 GLN 28 54 54 GLN GLN D . n 
D 1 29 VAL 29 55 55 VAL VAL D . n 
D 1 30 LYS 30 56 56 LYS LYS D . n 
D 1 31 GLU 31 57 57 GLU GLU D . n 
D 1 32 ILE 32 58 58 ILE ILE D . n 
D 1 33 THR 33 59 59 THR THR D . n 
D 1 34 PHE 34 60 60 PHE PHE D . n 
D 1 35 LEU 35 61 61 LEU LEU D . n 
D 1 36 LYS 36 62 62 LYS LYS D . n 
D 1 37 ASN 37 63 63 ASN ASN D . n 
D 1 38 THR 38 64 64 THR THR D . n 
D 1 39 VAL 39 65 65 VAL VAL D . n 
D 1 40 MET 40 66 66 MET MET D . n 
D 1 41 GLU 41 67 67 GLU GLU D . n 
D 1 42 CYS 42 68 68 CYS CYS D . n 
D 1 43 ASP 43 69 69 ASP ASP D . n 
D 1 44 ALA 44 70 70 ALA ALA D . n 
D 1 45 CYS 45 71 71 CYS CYS D . n 
E 1 1  MET 1  27 27 MET MET E . n 
E 1 2  ASP 2  28 28 ASP ASP E . n 
E 1 3  LEU 3  29 29 LEU LEU E . n 
E 1 4  ALA 4  30 30 ALA ALA E . n 
E 1 5  PRO 5  31 31 PRO PRO E . n 
E 1 6  GLN 6  32 32 GLN GLN E . n 
E 1 7  MET 7  33 33 MET MET E . n 
E 1 8  LEU 8  34 34 LEU LEU E . n 
E 1 9  ARG 9  35 35 ARG ARG E . n 
E 1 10 GLU 10 36 36 GLU GLU E . n 
E 1 11 LEU 11 37 37 LEU LEU E . n 
E 1 12 GLN 12 38 38 GLN GLN E . n 
E 1 13 GLU 13 39 39 GLU GLU E . n 
E 1 14 THR 14 40 40 THR THR E . n 
E 1 15 ASN 15 41 41 ASN ASN E . n 
E 1 16 ALA 16 42 42 ALA ALA E . n 
E 1 17 ALA 17 43 43 ALA ALA E . n 
E 1 18 LEU 18 44 44 LEU LEU E . n 
E 1 19 GLN 19 45 45 GLN GLN E . n 
E 1 20 ASP 20 46 46 ASP ASP E . n 
E 1 21 VAL 21 47 47 VAL VAL E . n 
E 1 22 ARG 22 48 48 ARG ARG E . n 
E 1 23 GLU 23 49 49 GLU GLU E . n 
E 1 24 LEU 24 50 50 LEU LEU E . n 
E 1 25 LEU 25 51 51 LEU LEU E . n 
E 1 26 ARG 26 52 52 ARG ARG E . n 
E 1 27 GLN 27 53 53 GLN GLN E . n 
E 1 28 GLN 28 54 54 GLN GLN E . n 
E 1 29 VAL 29 55 55 VAL VAL E . n 
E 1 30 LYS 30 56 56 LYS LYS E . n 
E 1 31 GLU 31 57 57 GLU GLU E . n 
E 1 32 ILE 32 58 58 ILE ILE E . n 
E 1 33 THR 33 59 59 THR THR E . n 
E 1 34 PHE 34 60 60 PHE PHE E . n 
E 1 35 LEU 35 61 61 LEU LEU E . n 
E 1 36 LYS 36 62 62 LYS LYS E . n 
E 1 37 ASN 37 63 63 ASN ASN E . n 
E 1 38 THR 38 64 64 THR THR E . n 
E 1 39 VAL 39 65 65 VAL VAL E . n 
E 1 40 MET 40 66 66 MET MET E . n 
E 1 41 GLU 41 67 67 GLU GLU E . n 
E 1 42 CYS 42 68 68 CYS CYS E . n 
E 1 43 ASP 43 69 69 ASP ASP E . n 
E 1 44 ALA 44 70 70 ALA ALA E . n 
E 1 45 CYS 45 71 71 CYS CYS E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 2 STE 1  1   1   STE STE A . 
G 3 HOH 1  9   9   HOH TIP A . 
G 3 HOH 2  12  12  HOH TIP A . 
G 3 HOH 3  15  15  HOH TIP A . 
G 3 HOH 4  23  23  HOH TIP A . 
G 3 HOH 5  72  72  HOH TIP A . 
G 3 HOH 6  73  1   HOH TIP A . 
G 3 HOH 7  74  40  HOH TIP A . 
G 3 HOH 8  75  46  HOH TIP A . 
G 3 HOH 9  76  48  HOH TIP A . 
G 3 HOH 10 77  67  HOH TIP A . 
G 3 HOH 11 81  81  HOH TIP A . 
G 3 HOH 12 96  96  HOH TIP A . 
G 3 HOH 13 98  98  HOH TIP A . 
G 3 HOH 14 103 103 HOH TIP A . 
G 3 HOH 15 114 114 HOH TIP A . 
G 3 HOH 16 117 117 HOH TIP A . 
G 3 HOH 17 118 118 HOH TIP A . 
G 3 HOH 18 122 122 HOH TIP A . 
G 3 HOH 19 126 126 HOH TIP A . 
G 3 HOH 20 134 134 HOH TIP A . 
G 3 HOH 21 136 136 HOH TIP A . 
G 3 HOH 22 137 137 HOH TIP A . 
G 3 HOH 23 154 154 HOH TIP A . 
G 3 HOH 24 157 157 HOH TIP A . 
G 3 HOH 25 158 158 HOH TIP A . 
G 3 HOH 26 159 159 HOH TIP A . 
G 3 HOH 27 161 161 HOH TIP A . 
G 3 HOH 28 163 163 HOH TIP A . 
G 3 HOH 29 168 168 HOH TIP A . 
G 3 HOH 30 171 171 HOH TIP A . 
G 3 HOH 31 174 174 HOH TIP A . 
G 3 HOH 32 193 193 HOH TIP A . 
G 3 HOH 33 194 194 HOH TIP A . 
G 3 HOH 34 195 195 HOH TIP A . 
G 3 HOH 35 198 198 HOH TIP A . 
G 3 HOH 36 202 202 HOH TIP A . 
G 3 HOH 37 205 205 HOH TIP A . 
G 3 HOH 38 209 209 HOH TIP A . 
G 3 HOH 39 213 213 HOH TIP A . 
G 3 HOH 40 226 226 HOH TIP A . 
G 3 HOH 41 227 227 HOH TIP A . 
G 3 HOH 42 235 235 HOH TIP A . 
G 3 HOH 43 241 241 HOH TIP A . 
G 3 HOH 44 243 243 HOH TIP A . 
G 3 HOH 45 245 245 HOH TIP A . 
H 3 HOH 1  2   2   HOH TIP B . 
H 3 HOH 2  5   5   HOH TIP B . 
H 3 HOH 3  6   6   HOH TIP B . 
H 3 HOH 4  8   8   HOH TIP B . 
H 3 HOH 5  10  10  HOH TIP B . 
H 3 HOH 6  17  17  HOH TIP B . 
H 3 HOH 7  18  18  HOH TIP B . 
H 3 HOH 8  24  24  HOH TIP B . 
H 3 HOH 9  25  25  HOH TIP B . 
H 3 HOH 10 72  36  HOH TIP B . 
H 3 HOH 11 73  37  HOH TIP B . 
H 3 HOH 12 74  74  HOH TIP B . 
H 3 HOH 13 75  39  HOH TIP B . 
H 3 HOH 14 76  76  HOH TIP B . 
H 3 HOH 15 77  77  HOH TIP B . 
H 3 HOH 16 78  78  HOH TIP B . 
H 3 HOH 17 79  79  HOH TIP B . 
H 3 HOH 18 80  41  HOH TIP B . 
H 3 HOH 19 81  44  HOH TIP B . 
H 3 HOH 20 82  47  HOH TIP B . 
H 3 HOH 21 83  83  HOH TIP B . 
H 3 HOH 22 84  53  HOH TIP B . 
H 3 HOH 23 85  54  HOH TIP B . 
H 3 HOH 24 86  57  HOH TIP B . 
H 3 HOH 25 87  60  HOH TIP B . 
H 3 HOH 26 88  69  HOH TIP B . 
H 3 HOH 27 99  99  HOH TIP B . 
H 3 HOH 28 100 100 HOH TIP B . 
H 3 HOH 29 101 101 HOH TIP B . 
H 3 HOH 30 102 102 HOH TIP B . 
H 3 HOH 31 104 104 HOH TIP B . 
H 3 HOH 32 123 123 HOH TIP B . 
H 3 HOH 33 135 135 HOH TIP B . 
H 3 HOH 34 139 139 HOH TIP B . 
H 3 HOH 35 143 143 HOH TIP B . 
H 3 HOH 36 145 145 HOH TIP B . 
H 3 HOH 37 146 146 HOH TIP B . 
H 3 HOH 38 150 150 HOH TIP B . 
H 3 HOH 39 155 155 HOH TIP B . 
H 3 HOH 40 156 156 HOH TIP B . 
H 3 HOH 41 160 160 HOH TIP B . 
H 3 HOH 42 162 162 HOH TIP B . 
H 3 HOH 43 164 164 HOH TIP B . 
H 3 HOH 44 165 165 HOH TIP B . 
H 3 HOH 45 173 173 HOH TIP B . 
H 3 HOH 46 184 184 HOH TIP B . 
H 3 HOH 47 187 187 HOH TIP B . 
H 3 HOH 48 191 191 HOH TIP B . 
H 3 HOH 49 196 196 HOH TIP B . 
H 3 HOH 50 197 197 HOH TIP B . 
H 3 HOH 51 199 199 HOH TIP B . 
H 3 HOH 52 200 200 HOH TIP B . 
H 3 HOH 53 201 201 HOH TIP B . 
H 3 HOH 54 207 207 HOH TIP B . 
H 3 HOH 55 208 208 HOH TIP B . 
H 3 HOH 56 218 218 HOH TIP B . 
H 3 HOH 57 222 222 HOH TIP B . 
H 3 HOH 58 224 224 HOH TIP B . 
H 3 HOH 59 244 244 HOH TIP B . 
I 3 HOH 1  3   3   HOH TIP C . 
I 3 HOH 2  4   4   HOH TIP C . 
I 3 HOH 3  7   7   HOH TIP C . 
I 3 HOH 4  16  16  HOH TIP C . 
I 3 HOH 5  19  19  HOH TIP C . 
I 3 HOH 6  22  22  HOH TIP C . 
I 3 HOH 7  26  26  HOH TIP C . 
I 3 HOH 8  72  27  HOH TIP C . 
I 3 HOH 9  73  73  HOH TIP C . 
I 3 HOH 10 74  28  HOH TIP C . 
I 3 HOH 11 75  75  HOH TIP C . 
I 3 HOH 12 76  29  HOH TIP C . 
I 3 HOH 13 77  34  HOH TIP C . 
I 3 HOH 14 78  42  HOH TIP C . 
I 3 HOH 15 79  50  HOH TIP C . 
I 3 HOH 16 80  51  HOH TIP C . 
I 3 HOH 17 81  52  HOH TIP C . 
I 3 HOH 18 82  58  HOH TIP C . 
I 3 HOH 19 83  61  HOH TIP C . 
I 3 HOH 20 84  62  HOH TIP C . 
I 3 HOH 21 85  85  HOH TIP C . 
I 3 HOH 22 86  63  HOH TIP C . 
I 3 HOH 23 87  87  HOH TIP C . 
I 3 HOH 24 88  88  HOH TIP C . 
I 3 HOH 25 89  65  HOH TIP C . 
I 3 HOH 26 91  91  HOH TIP C . 
I 3 HOH 27 105 105 HOH TIP C . 
I 3 HOH 28 106 106 HOH TIP C . 
I 3 HOH 29 109 109 HOH TIP C . 
I 3 HOH 30 110 110 HOH TIP C . 
I 3 HOH 31 112 112 HOH TIP C . 
I 3 HOH 32 115 115 HOH TIP C . 
I 3 HOH 33 119 119 HOH TIP C . 
I 3 HOH 34 121 121 HOH TIP C . 
I 3 HOH 35 127 127 HOH TIP C . 
I 3 HOH 36 129 129 HOH TIP C . 
I 3 HOH 37 130 130 HOH TIP C . 
I 3 HOH 38 133 133 HOH TIP C . 
I 3 HOH 39 138 138 HOH TIP C . 
I 3 HOH 40 140 140 HOH TIP C . 
I 3 HOH 41 142 142 HOH TIP C . 
I 3 HOH 42 152 152 HOH TIP C . 
I 3 HOH 43 153 153 HOH TIP C . 
I 3 HOH 44 166 166 HOH TIP C . 
I 3 HOH 45 167 167 HOH TIP C . 
I 3 HOH 46 169 169 HOH TIP C . 
I 3 HOH 47 170 170 HOH TIP C . 
I 3 HOH 48 176 176 HOH TIP C . 
I 3 HOH 49 179 179 HOH TIP C . 
I 3 HOH 50 185 185 HOH TIP C . 
I 3 HOH 51 186 186 HOH TIP C . 
I 3 HOH 52 206 206 HOH TIP C . 
I 3 HOH 53 214 214 HOH TIP C . 
I 3 HOH 54 217 217 HOH TIP C . 
I 3 HOH 55 220 220 HOH TIP C . 
I 3 HOH 56 236 236 HOH TIP C . 
I 3 HOH 57 237 237 HOH TIP C . 
I 3 HOH 58 242 242 HOH TIP C . 
J 3 HOH 1  14  14  HOH TIP D . 
J 3 HOH 2  21  21  HOH TIP D . 
J 3 HOH 3  72  30  HOH TIP D . 
J 3 HOH 4  73  31  HOH TIP D . 
J 3 HOH 5  74  33  HOH TIP D . 
J 3 HOH 6  75  35  HOH TIP D . 
J 3 HOH 7  76  43  HOH TIP D . 
J 3 HOH 8  77  49  HOH TIP D . 
J 3 HOH 9  78  55  HOH TIP D . 
J 3 HOH 10 79  68  HOH TIP D . 
J 3 HOH 11 80  70  HOH TIP D . 
J 3 HOH 12 84  84  HOH TIP D . 
J 3 HOH 13 86  86  HOH TIP D . 
J 3 HOH 14 90  90  HOH TIP D . 
J 3 HOH 15 92  92  HOH TIP D . 
J 3 HOH 16 93  93  HOH TIP D . 
J 3 HOH 17 94  94  HOH TIP D . 
J 3 HOH 18 95  95  HOH TIP D . 
J 3 HOH 19 97  97  HOH TIP D . 
J 3 HOH 20 113 113 HOH TIP D . 
J 3 HOH 21 116 116 HOH TIP D . 
J 3 HOH 22 125 125 HOH TIP D . 
J 3 HOH 23 131 131 HOH TIP D . 
J 3 HOH 24 172 172 HOH TIP D . 
J 3 HOH 25 175 175 HOH TIP D . 
J 3 HOH 26 177 177 HOH TIP D . 
J 3 HOH 27 180 180 HOH TIP D . 
J 3 HOH 28 181 181 HOH TIP D . 
J 3 HOH 29 183 183 HOH TIP D . 
J 3 HOH 30 188 188 HOH TIP D . 
J 3 HOH 31 189 189 HOH TIP D . 
J 3 HOH 32 190 190 HOH TIP D . 
J 3 HOH 33 203 203 HOH TIP D . 
J 3 HOH 34 204 204 HOH TIP D . 
J 3 HOH 35 211 211 HOH TIP D . 
J 3 HOH 36 212 212 HOH TIP D . 
J 3 HOH 37 215 215 HOH TIP D . 
J 3 HOH 38 216 216 HOH TIP D . 
J 3 HOH 39 221 221 HOH TIP D . 
J 3 HOH 40 223 223 HOH TIP D . 
J 3 HOH 41 225 225 HOH TIP D . 
J 3 HOH 42 229 229 HOH TIP D . 
J 3 HOH 43 231 231 HOH TIP D . 
J 3 HOH 44 240 240 HOH TIP D . 
K 3 HOH 1  11  11  HOH TIP E . 
K 3 HOH 2  13  13  HOH TIP E . 
K 3 HOH 3  20  20  HOH TIP E . 
K 3 HOH 4  72  32  HOH TIP E . 
K 3 HOH 5  73  38  HOH TIP E . 
K 3 HOH 6  74  45  HOH TIP E . 
K 3 HOH 7  75  56  HOH TIP E . 
K 3 HOH 8  76  59  HOH TIP E . 
K 3 HOH 9  77  64  HOH TIP E . 
K 3 HOH 10 78  66  HOH TIP E . 
K 3 HOH 11 79  71  HOH TIP E . 
K 3 HOH 12 80  80  HOH TIP E . 
K 3 HOH 13 82  82  HOH TIP E . 
K 3 HOH 14 89  89  HOH TIP E . 
K 3 HOH 15 107 107 HOH TIP E . 
K 3 HOH 16 108 108 HOH TIP E . 
K 3 HOH 17 111 111 HOH TIP E . 
K 3 HOH 18 120 120 HOH TIP E . 
K 3 HOH 19 124 124 HOH TIP E . 
K 3 HOH 20 128 128 HOH TIP E . 
K 3 HOH 21 132 132 HOH TIP E . 
K 3 HOH 22 141 141 HOH TIP E . 
K 3 HOH 23 144 144 HOH TIP E . 
K 3 HOH 24 147 147 HOH TIP E . 
K 3 HOH 25 148 148 HOH TIP E . 
K 3 HOH 26 149 149 HOH TIP E . 
K 3 HOH 27 151 151 HOH TIP E . 
K 3 HOH 28 178 178 HOH TIP E . 
K 3 HOH 29 182 182 HOH TIP E . 
K 3 HOH 30 192 192 HOH TIP E . 
K 3 HOH 31 210 210 HOH TIP E . 
K 3 HOH 32 219 219 HOH TIP E . 
K 3 HOH 33 228 228 HOH TIP E . 
K 3 HOH 34 230 230 HOH TIP E . 
K 3 HOH 35 232 232 HOH TIP E . 
K 3 HOH 36 233 233 HOH TIP E . 
K 3 HOH 37 234 234 HOH TIP E . 
K 3 HOH 38 238 238 HOH TIP E . 
K 3 HOH 39 239 239 HOH TIP E . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12230 ? 
1 MORE         -113  ? 
1 'SSA (A^2)'  11240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-01-16 
2 'Structure model' 1 1 2013-03-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 CNS         1.3  ?               package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        http://cns-online.org/ 
Fortran_77 ? 
2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB               deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU B 67 ? ? -98.43 32.46   
2 1 ASP D 28 ? ? 64.94  -114.40 
3 1 ASP E 28 ? ? 55.14  174.15  
4 1 LEU E 29 ? ? -68.05 26.92   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'STEARIC ACID' STE 
3 water          HOH 
#