data_3V3E
# 
_entry.id   3V3E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V3E         
RCSB  RCSB069544   
WWPDB D_1000069544 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3V3Q 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3V3E 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-13 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Q.' 1 
'Shi, C.'   2 
'Yang, K.'  3 
'Chen, Y.'  4 
'Zhan, Y.'  5 
'Wu, Q.'    6 
'Lin, T.'   7 
# 
_citation.id                        primary 
_citation.title                     'The orphan nuclear receptor Nur77 regulates LKB1 localization and activates AMPK' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            8 
_citation.page_first                897 
_citation.page_last                 904 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22983157 
_citation.pdbx_database_id_DOI      10.1038/nchembio.1069 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhan, Y.'   1  
primary 'Chen, Y.'   2  
primary 'Zhang, Q.'  3  
primary 'Zhuang, J.' 4  
primary 'Tian, M.'   5  
primary 'Chen, H.'   6  
primary 'Zhang, L.'  7  
primary 'Zhang, H.'  8  
primary 'He, J.'     9  
primary 'Wang, W.'   10 
primary 'Wu, R.'     11 
primary 'Wang, Y.'   12 
primary 'Shi, C.'    13 
primary 'Yang, K.'   14 
primary 'Li, A.'     15 
primary 'Xin, Y.'    16 
primary 'Li, T.Y.'   17 
primary 'Yang, J.Y.' 18 
primary 'Zheng, Z.'  19 
primary 'Yu, C.'     20 
primary 'Lin, S.'    21 
primary 'Chang, C.'  22 
primary 'Huang, P.'  23 
primary 'Lin, T.'    24 
primary 'Wu, Q.'     25 
# 
_cell.length_a           74.430 
_cell.length_b           76.773 
_cell.length_c           128.953 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3V3E 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3V3E 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 1' 28745.305 2   ? ? 'UNP residues 351-598' ? 
2 non-polymer syn GLYCEROL                                        92.094    3   ? ? ?                      ? 
3 water       nat water                                           18.015    480 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Orphan nuclear receptor NR4A1, Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_strand_id                 B,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   LYS n 
1 6   GLN n 
1 7   PRO n 
1 8   PRO n 
1 9   ASP n 
1 10  ALA n 
1 11  SER n 
1 12  PRO n 
1 13  ALA n 
1 14  ASN n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ARG n 
1 22  ALA n 
1 23  HIS n 
1 24  LEU n 
1 25  ASP n 
1 26  SER n 
1 27  GLY n 
1 28  PRO n 
1 29  SER n 
1 30  THR n 
1 31  ALA n 
1 32  LYS n 
1 33  LEU n 
1 34  ASP n 
1 35  TYR n 
1 36  SER n 
1 37  LYS n 
1 38  PHE n 
1 39  GLN n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  LEU n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  GLY n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  ALA n 
1 52  GLY n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  GLN n 
1 57  PHE n 
1 58  TYR n 
1 59  ASP n 
1 60  LEU n 
1 61  LEU n 
1 62  SER n 
1 63  GLY n 
1 64  SER n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  ILE n 
1 69  ARG n 
1 70  LYS n 
1 71  TRP n 
1 72  ALA n 
1 73  GLU n 
1 74  LYS n 
1 75  ILE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  ALA n 
1 80  GLU n 
1 81  LEU n 
1 82  SER n 
1 83  PRO n 
1 84  ALA n 
1 85  ASP n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LEU n 
1 90  LEU n 
1 91  GLU n 
1 92  SER n 
1 93  ALA n 
1 94  PHE n 
1 95  LEU n 
1 96  GLU n 
1 97  LEU n 
1 98  PHE n 
1 99  ILE n 
1 100 LEU n 
1 101 ARG n 
1 102 LEU n 
1 103 ALA n 
1 104 TYR n 
1 105 ARG n 
1 106 SER n 
1 107 LYS n 
1 108 PRO n 
1 109 GLY n 
1 110 GLU n 
1 111 GLY n 
1 112 LYS n 
1 113 LEU n 
1 114 ILE n 
1 115 PHE n 
1 116 CYS n 
1 117 SER n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 LEU n 
1 122 HIS n 
1 123 ARG n 
1 124 LEU n 
1 125 GLN n 
1 126 CYS n 
1 127 ALA n 
1 128 ARG n 
1 129 GLY n 
1 130 PHE n 
1 131 GLY n 
1 132 ASP n 
1 133 TRP n 
1 134 ILE n 
1 135 ASP n 
1 136 SER n 
1 137 ILE n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 ARG n 
1 143 SER n 
1 144 LEU n 
1 145 HIS n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 VAL n 
1 152 PRO n 
1 153 ALA n 
1 154 PHE n 
1 155 ALA n 
1 156 CYS n 
1 157 LEU n 
1 158 SER n 
1 159 ALA n 
1 160 LEU n 
1 161 VAL n 
1 162 LEU n 
1 163 ILE n 
1 164 THR n 
1 165 ASP n 
1 166 ARG n 
1 167 HIS n 
1 168 GLY n 
1 169 LEU n 
1 170 GLN n 
1 171 GLU n 
1 172 PRO n 
1 173 ARG n 
1 174 ARG n 
1 175 VAL n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 GLN n 
1 180 ASN n 
1 181 ARG n 
1 182 ILE n 
1 183 ALA n 
1 184 SER n 
1 185 CYS n 
1 186 LEU n 
1 187 LYS n 
1 188 GLU n 
1 189 HIS n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 GLN n 
1 199 PRO n 
1 200 ALA n 
1 201 SER n 
1 202 CYS n 
1 203 LEU n 
1 204 SER n 
1 205 ARG n 
1 206 LEU n 
1 207 LEU n 
1 208 GLY n 
1 209 LYS n 
1 210 LEU n 
1 211 PRO n 
1 212 GLU n 
1 213 LEU n 
1 214 ARG n 
1 215 THR n 
1 216 LEU n 
1 217 CYS n 
1 218 THR n 
1 219 GLN n 
1 220 GLY n 
1 221 LEU n 
1 222 GLN n 
1 223 ARG n 
1 224 ILE n 
1 225 PHE n 
1 226 TYR n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 GLU n 
1 231 ASP n 
1 232 LEU n 
1 233 VAL n 
1 234 PRO n 
1 235 PRO n 
1 236 PRO n 
1 237 PRO n 
1 238 ILE n 
1 239 ILE n 
1 240 ASP n 
1 241 LYS n 
1 242 ILE n 
1 243 PHE n 
1 244 MET n 
1 245 ASP n 
1 246 THR n 
1 247 LEU n 
1 248 PRO n 
1 249 PHE n 
1 250 LEU n 
1 251 GLU n 
1 252 HIS n 
1 253 HIS n 
1 254 HIS n 
1 255 HIS n 
1 256 HIS n 
1 257 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A1, GFRP1, HMR, NAK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A1_HUMAN 
_struct_ref.pdbx_db_accession          P22736 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAEL
SPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALV
LITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDK
IFMDTLPF
;
_struct_ref.pdbx_align_begin           351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V3E B 2 ? 249 ? P22736 351 ? 598 ? 20 267 
2 1 3V3E A 2 ? 249 ? P22736 351 ? 598 ? 20 267 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V3E MET B 1   ? UNP P22736 ? ? 'EXPRESSION TAG' 19  1  
1 3V3E LEU B 250 ? UNP P22736 ? ? 'EXPRESSION TAG' 268 2  
1 3V3E GLU B 251 ? UNP P22736 ? ? 'EXPRESSION TAG' 269 3  
1 3V3E HIS B 252 ? UNP P22736 ? ? 'EXPRESSION TAG' 270 4  
1 3V3E HIS B 253 ? UNP P22736 ? ? 'EXPRESSION TAG' 271 5  
1 3V3E HIS B 254 ? UNP P22736 ? ? 'EXPRESSION TAG' 272 6  
1 3V3E HIS B 255 ? UNP P22736 ? ? 'EXPRESSION TAG' 273 7  
1 3V3E HIS B 256 ? UNP P22736 ? ? 'EXPRESSION TAG' 274 8  
1 3V3E HIS B 257 ? UNP P22736 ? ? 'EXPRESSION TAG' 275 9  
2 3V3E MET A 1   ? UNP P22736 ? ? 'EXPRESSION TAG' 19  10 
2 3V3E LEU A 250 ? UNP P22736 ? ? 'EXPRESSION TAG' 268 11 
2 3V3E GLU A 251 ? UNP P22736 ? ? 'EXPRESSION TAG' 269 12 
2 3V3E HIS A 252 ? UNP P22736 ? ? 'EXPRESSION TAG' 270 13 
2 3V3E HIS A 253 ? UNP P22736 ? ? 'EXPRESSION TAG' 271 14 
2 3V3E HIS A 254 ? UNP P22736 ? ? 'EXPRESSION TAG' 272 15 
2 3V3E HIS A 255 ? UNP P22736 ? ? 'EXPRESSION TAG' 273 16 
2 3V3E HIS A 256 ? UNP P22736 ? ? 'EXPRESSION TAG' 274 17 
2 3V3E HIS A 257 ? UNP P22736 ? ? 'EXPRESSION TAG' 275 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3V3E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   61.61 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    '7% PEG 6000, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2011-08-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3V3E 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.06 
_reflns.d_resolution_low             49.37 
_reflns.number_all                   ? 
_reflns.number_obs                   42980 
_reflns.percent_possible_obs         92.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3V3E 
_refine.ls_d_res_high                            2.0600 
_refine.ls_d_res_low                             49.3700 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.5000 
_refine.ls_number_reflns_obs                     42963 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT  
U VALUES: REFINED INDIVIDUALLY
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1987 
_refine.ls_R_factor_R_work                       0.1952 
_refine.ls_wR_factor_R_work                      0.1861 
_refine.ls_R_factor_R_free                       0.2650 
_refine.ls_wR_factor_R_free                      0.2517 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  2162 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               32.6259 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            0.0000 
_refine.aniso_B[3][3]                            0.0100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9440 
_refine.correlation_coeff_Fo_to_Fc_free          0.8960 
_refine.overall_SU_R_Cruickshank_DPI             0.1758 
_refine.overall_SU_R_free                        0.1830 
_refine.pdbx_overall_ESU_R                       0.1760 
_refine.pdbx_overall_ESU_R_Free                  0.1830 
_refine.overall_SU_ML                            0.1240 
_refine.overall_SU_B                             4.4970 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2QW4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8247 
_refine.B_iso_max                                154.990 
_refine.B_iso_min                                5.630 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3667 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             480 
_refine_hist.number_atoms_total               4165 
_refine_hist.d_res_high                       2.0600 
_refine_hist.d_res_low                        49.3700 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3804 0.019  0.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5157 2.101  2.002  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 479  6.462  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 159  36.904 23.270 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 661  20.035 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 29   18.474 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         597  0.163  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2820 0.012  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0600 
_refine_ls_shell.d_res_low                        2.1130 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               93.1600 
_refine_ls_shell.number_reflns_R_work             2870 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2610 
_refine_ls_shell.R_factor_R_free                  0.3180 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             141 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3011 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3V3E 
_struct.title                     'Crystal Structure of the Human Nur77 Ligand-binding Domain' 
_struct.pdbx_descriptor           'Nuclear receptor subfamily 4 group A member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V3E 
_struct_keywords.text            'orphan nuclear receptor, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 13  ? SER A 26  ? ALA B 31  SER B 44  1 ? 14 
HELX_P HELX_P2  2  SER A 29  ? LEU A 33  ? SER B 47  LEU B 51  5 ? 5  
HELX_P HELX_P3  3  ASP A 50  ? SER A 64  ? ASP B 68  SER B 82  1 ? 15 
HELX_P HELX_P4  4  SER A 64  ? LYS A 74  ? SER B 82  LYS B 92  1 ? 11 
HELX_P HELX_P5  5  GLY A 77  ? LEU A 81  ? GLY B 95  LEU B 99  5 ? 5  
HELX_P HELX_P6  6  SER A 82  ? SER A 106 ? SER B 100 SER B 124 1 ? 25 
HELX_P HELX_P7  7  LYS A 107 ? GLU A 110 ? LYS B 125 GLU B 128 5 ? 4  
HELX_P HELX_P8  8  ARG A 123 ? GLY A 131 ? ARG B 141 GLY B 149 1 ? 9  
HELX_P HELX_P9  9  ASP A 132 ? LEU A 147 ? ASP B 150 LEU B 165 1 ? 16 
HELX_P HELX_P10 10 ASP A 150 ? ILE A 163 ? ASP B 168 ILE B 181 1 ? 14 
HELX_P HELX_P11 11 GLU A 171 ? GLY A 195 ? GLU B 189 GLY B 213 1 ? 25 
HELX_P HELX_P12 12 SER A 201 ? GLY A 208 ? SER B 219 GLY B 226 1 ? 8  
HELX_P HELX_P13 13 GLY A 208 ? ASP A 231 ? GLY B 226 ASP B 249 1 ? 24 
HELX_P HELX_P14 14 PRO A 236 ? LEU A 247 ? PRO B 254 LEU B 265 1 ? 12 
HELX_P HELX_P15 15 ALA B 13  ? SER B 26  ? ALA A 31  SER A 44  1 ? 14 
HELX_P HELX_P16 16 ASP B 50  ? LYS B 74  ? ASP A 68  LYS A 92  1 ? 25 
HELX_P HELX_P17 17 GLY B 77  ? LEU B 81  ? GLY A 95  LEU A 99  5 ? 5  
HELX_P HELX_P18 18 SER B 82  ? SER B 106 ? SER A 100 SER A 124 1 ? 25 
HELX_P HELX_P19 19 LYS B 107 ? GLU B 110 ? LYS A 125 GLU A 128 5 ? 4  
HELX_P HELX_P20 20 ARG B 123 ? GLY B 131 ? ARG A 141 GLY A 149 1 ? 9  
HELX_P HELX_P21 21 ASP B 132 ? SER B 146 ? ASP A 150 SER A 164 1 ? 15 
HELX_P HELX_P22 22 ASP B 150 ? ILE B 163 ? ASP A 168 ILE A 181 1 ? 14 
HELX_P HELX_P23 23 GLU B 171 ? GLY B 195 ? GLU A 189 GLY A 213 1 ? 25 
HELX_P HELX_P24 24 SER B 201 ? GLY B 208 ? SER A 219 GLY A 226 1 ? 8  
HELX_P HELX_P25 25 LYS B 209 ? ASP B 231 ? LYS A 227 ASP A 249 1 ? 23 
HELX_P HELX_P26 26 PRO B 236 ? LEU B 247 ? PRO A 254 LEU A 265 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 12  A . ? PRO 30  B ALA 13  A ? ALA 31  B 1 -25.70 
2 LEU 43  A . ? LEU 61  B PRO 44  A ? PRO 62  B 1 -24.74 
3 PHE 46  A . ? PHE 64  B GLY 47  A ? GLY 65  B 1 -1.66  
4 GLU 196 A . ? GLU 214 B PRO 197 A ? PRO 215 B 1 -6.35  
5 PRO 12  B . ? PRO 30  A ALA 13  B ? ALA 31  A 1 -11.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 112 ? ILE A 114 ? LYS B 130 ILE B 132 
A 2 VAL A 120 ? HIS A 122 ? VAL B 138 HIS B 140 
B 1 LYS B 112 ? ILE B 114 ? LYS A 130 ILE A 132 
B 2 VAL B 120 ? HIS B 122 ? VAL A 138 HIS A 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 113 ? N LEU B 131 O LEU A 121 ? O LEU B 139 
B 1 2 N LEU B 113 ? N LEU A 131 O LEU B 121 ? O LEU A 139 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 301' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 301' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  HIS A 23  ? HIS B 41  . ? 1_555 ? 
2  AC1 9  SER A 26  ? SER B 44  . ? 1_555 ? 
3  AC1 9  GLY A 27  ? GLY B 45  . ? 1_555 ? 
4  AC1 9  ARG A 101 ? ARG B 119 . ? 1_555 ? 
5  AC1 9  ARG A 105 ? ARG B 123 . ? 1_555 ? 
6  AC1 9  HOH F .   ? HOH B 422 . ? 1_555 ? 
7  AC1 9  HOH F .   ? HOH B 423 . ? 1_555 ? 
8  AC1 9  HOH F .   ? HOH B 425 . ? 1_555 ? 
9  AC1 9  HOH F .   ? HOH B 511 . ? 1_555 ? 
10 AC2 3  LEU B 160 ? LEU A 178 . ? 1_555 ? 
11 AC2 3  VAL B 161 ? VAL A 179 . ? 1_555 ? 
12 AC2 3  HOH G .   ? HOH A 612 . ? 1_555 ? 
13 AC3 10 HIS B 23  ? HIS A 41  . ? 1_555 ? 
14 AC3 10 SER B 26  ? SER A 44  . ? 1_555 ? 
15 AC3 10 GLY B 27  ? GLY A 45  . ? 1_555 ? 
16 AC3 10 PRO B 28  ? PRO A 46  . ? 1_555 ? 
17 AC3 10 ARG B 101 ? ARG A 119 . ? 1_555 ? 
18 AC3 10 ARG B 105 ? ARG A 123 . ? 1_555 ? 
19 AC3 10 HOH G .   ? HOH A 405 . ? 1_555 ? 
20 AC3 10 HOH G .   ? HOH A 463 . ? 1_555 ? 
21 AC3 10 HOH G .   ? HOH A 529 . ? 1_555 ? 
22 AC3 10 HOH G .   ? HOH A 539 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3V3E 
_atom_sites.fract_transf_matrix[1][1]   0.013435 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013025 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007755 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 12  ? -0.985  -29.975 3.532  1.00 65.40  ? 30  PRO B N   1 
ATOM   2    C CA  . PRO A 1 12  ? -0.028  -30.359 4.548  1.00 63.91  ? 30  PRO B CA  1 
ATOM   3    C C   . PRO A 1 12  ? 1.267   -29.527 4.949  1.00 63.86  ? 30  PRO B C   1 
ATOM   4    O O   . PRO A 1 12  ? 2.078   -30.098 5.697  1.00 62.59  ? 30  PRO B O   1 
ATOM   5    C CB  . PRO A 1 12  ? 0.253   -31.825 4.174  1.00 67.57  ? 30  PRO B CB  1 
ATOM   6    C CG  . PRO A 1 12  ? -1.078  -32.298 3.599  1.00 73.00  ? 30  PRO B CG  1 
ATOM   7    C CD  . PRO A 1 12  ? -1.926  -31.080 3.290  1.00 64.57  ? 30  PRO B CD  1 
ATOM   8    N N   . ALA A 1 13  ? 1.514   -28.255 4.536  1.00 59.01  ? 31  ALA B N   1 
ATOM   9    C CA  . ALA A 1 13  ? 1.036   -27.526 3.313  1.00 61.48  ? 31  ALA B CA  1 
ATOM   10   C C   . ALA A 1 13  ? -0.323  -26.786 3.288  1.00 58.71  ? 31  ALA B C   1 
ATOM   11   O O   . ALA A 1 13  ? -0.465  -25.618 3.736  1.00 43.95  ? 31  ALA B O   1 
ATOM   12   N N   . ASN A 1 14  ? -1.300  -27.478 2.698  1.00 55.41  ? 32  ASN B N   1 
ATOM   13   C CA  . ASN A 1 14  ? -2.710  -27.188 2.922  1.00 51.11  ? 32  ASN B CA  1 
ATOM   14   C C   . ASN A 1 14  ? -3.075  -27.380 4.406  1.00 43.35  ? 32  ASN B C   1 
ATOM   15   O O   . ASN A 1 14  ? -3.989  -26.734 4.911  1.00 40.14  ? 32  ASN B O   1 
ATOM   16   C CB  . ASN A 1 14  ? -3.579  -28.081 2.040  1.00 56.81  ? 32  ASN B CB  1 
ATOM   17   C CG  . ASN A 1 14  ? -5.019  -27.618 1.965  1.00 54.65  ? 32  ASN B CG  1 
ATOM   18   O OD1 . ASN A 1 14  ? -5.351  -26.496 2.332  1.00 64.37  ? 32  ASN B OD1 1 
ATOM   19   N ND2 . ASN A 1 14  ? -5.890  -28.490 1.475  1.00 64.91  ? 32  ASN B ND2 1 
ATOM   20   N N   . LEU A 1 15  ? -2.340  -28.221 5.121  1.00 36.14  ? 33  LEU B N   1 
ATOM   21   C CA  . LEU A 1 15  ? -2.567  -28.302 6.565  1.00 34.92  ? 33  LEU B CA  1 
ATOM   22   C C   . LEU A 1 15  ? -2.170  -26.945 7.206  1.00 34.10  ? 33  LEU B C   1 
ATOM   23   O O   . LEU A 1 15  ? -2.933  -26.337 7.966  1.00 30.54  ? 33  LEU B O   1 
ATOM   24   C CB  . LEU A 1 15  ? -1.789  -29.470 7.183  1.00 32.39  ? 33  LEU B CB  1 
ATOM   25   C CG  . LEU A 1 15  ? -1.867  -29.632 8.721  1.00 32.56  ? 33  LEU B CG  1 
ATOM   26   C CD1 . LEU A 1 15  ? -3.331  -29.678 9.039  1.00 26.66  ? 33  LEU B CD1 1 
ATOM   27   C CD2 . LEU A 1 15  ? -1.181  -30.925 9.184  1.00 30.79  ? 33  LEU B CD2 1 
ATOM   28   N N   . LEU A 1 16  ? -0.990  -26.470 6.819  1.00 33.39  ? 34  LEU B N   1 
ATOM   29   C CA  . LEU A 1 16  ? -0.406  -25.287 7.373  1.00 32.56  ? 34  LEU B CA  1 
ATOM   30   C C   . LEU A 1 16  ? -1.291  -24.075 7.112  1.00 37.62  ? 34  LEU B C   1 
ATOM   31   O O   . LEU A 1 16  ? -1.525  -23.287 8.018  1.00 35.11  ? 34  LEU B O   1 
ATOM   32   C CB  . LEU A 1 16  ? 1.007   -25.100 6.818  1.00 31.10  ? 34  LEU B CB  1 
ATOM   33   C CG  . LEU A 1 16  ? 1.837   -24.000 7.504  1.00 34.82  ? 34  LEU B CG  1 
ATOM   34   C CD1 . LEU A 1 16  ? 1.918   -24.273 9.011  1.00 36.03  ? 34  LEU B CD1 1 
ATOM   35   C CD2 . LEU A 1 16  ? 3.254   -23.838 6.909  1.00 36.38  ? 34  LEU B CD2 1 
ATOM   36   N N   . THR A 1 17  ? -1.845  -23.986 5.891  1.00 40.25  ? 35  THR B N   1 
ATOM   37   C CA  . THR A 1 17  ? -2.734  -22.899 5.472  1.00 39.92  ? 35  THR B CA  1 
ATOM   38   C C   . THR A 1 17  ? -4.044  -22.979 6.260  1.00 37.69  ? 35  THR B C   1 
ATOM   39   O O   . THR A 1 17  ? -4.588  -21.963 6.671  1.00 33.72  ? 35  THR B O   1 
ATOM   40   C CB  . THR A 1 17  ? -3.008  -22.978 3.925  1.00 40.65  ? 35  THR B CB  1 
ATOM   41   O OG1 . THR A 1 17  ? -1.784  -22.748 3.231  1.00 42.69  ? 35  THR B OG1 1 
ATOM   42   C CG2 . THR A 1 17  ? -3.968  -21.918 3.473  1.00 39.11  ? 35  THR B CG2 1 
ATOM   43   N N   . SER A 1 18  ? -4.562  -24.188 6.440  1.00 34.58  ? 36  SER B N   1 
ATOM   44   C CA  . SER A 1 18  ? -5.798  -24.377 7.179  1.00 34.28  ? 36  SER B CA  1 
ATOM   45   C C   . SER A 1 18  ? -5.609  -23.937 8.610  1.00 33.41  ? 36  SER B C   1 
ATOM   46   O O   . SER A 1 18  ? -6.421  -23.186 9.161  1.00 31.54  ? 36  SER B O   1 
ATOM   47   C CB  . SER A 1 18  ? -6.230  -25.835 7.142  1.00 34.79  ? 36  SER B CB  1 
ATOM   48   O OG  . SER A 1 18  ? -6.566  -26.186 5.809  1.00 39.54  ? 36  SER B OG  1 
ATOM   49   N N   . LEU A 1 19  ? -4.523  -24.415 9.193  1.00 34.42  ? 37  LEU B N   1 
ATOM   50   C CA  . LEU A 1 19  ? -4.177  -24.074 10.578 1.00 31.95  ? 37  LEU B CA  1 
ATOM   51   C C   . LEU A 1 19  ? -3.960  -22.580 10.743 1.00 30.96  ? 37  LEU B C   1 
ATOM   52   O O   . LEU A 1 19  ? -4.354  -22.018 11.779 1.00 30.81  ? 37  LEU B O   1 
ATOM   53   C CB  . LEU A 1 19  ? -2.883  -24.795 10.975 1.00 26.67  ? 37  LEU B CB  1 
ATOM   54   C CG  . LEU A 1 19  ? -2.991  -26.299 11.195 1.00 24.76  ? 37  LEU B CG  1 
ATOM   55   C CD1 . LEU A 1 19  ? -1.626  -26.919 11.407 1.00 23.25  ? 37  LEU B CD1 1 
ATOM   56   C CD2 . LEU A 1 19  ? -3.962  -26.577 12.339 1.00 26.35  ? 37  LEU B CD2 1 
ATOM   57   N N   . VAL A 1 20  ? -3.329  -21.949 9.740  1.00 30.44  ? 38  VAL B N   1 
ATOM   58   C CA  . VAL A 1 20  ? -3.056  -20.503 9.791  1.00 28.49  ? 38  VAL B CA  1 
ATOM   59   C C   . VAL A 1 20  ? -4.392  -19.756 9.686  1.00 29.61  ? 38  VAL B C   1 
ATOM   60   O O   . VAL A 1 20  ? -4.647  -18.789 10.425 1.00 26.21  ? 38  VAL B O   1 
ATOM   61   C CB  . VAL A 1 20  ? -2.118  -19.986 8.672  1.00 32.66  ? 38  VAL B CB  1 
ATOM   62   C CG1 . VAL A 1 20  ? -2.238  -18.436 8.562  1.00 27.57  ? 38  VAL B CG1 1 
ATOM   63   C CG2 . VAL A 1 20  ? -0.676  -20.420 8.898  1.00 28.06  ? 38  VAL B CG2 1 
ATOM   64   N N   . ARG A 1 21  ? -5.244  -20.163 8.733  1.00 29.03  ? 39  ARG B N   1 
ATOM   65   C CA  . ARG A 1 21  ? -6.544  -19.474 8.612  1.00 29.98  ? 39  ARG B CA  1 
ATOM   66   C C   . ARG A 1 21  ? -7.423  -19.686 9.870  1.00 30.51  ? 39  ARG B C   1 
ATOM   67   O O   . ARG A 1 21  ? -8.217  -18.787 10.230 1.00 29.36  ? 39  ARG B O   1 
ATOM   68   C CB  . ARG A 1 21  ? -7.285  -19.930 7.337  1.00 35.53  ? 39  ARG B CB  1 
ATOM   69   C CG  . ARG A 1 21  ? -8.810  -19.865 7.438  1.00 37.61  ? 39  ARG B CG  1 
ATOM   70   C CD  . ARG A 1 21  ? -9.399  -18.501 7.110  1.00 48.29  ? 39  ARG B CD  1 
ATOM   71   N NE  . ARG A 1 21  ? -8.529  -17.413 7.530  1.00 55.72  ? 39  ARG B NE  1 
ATOM   72   C CZ  . ARG A 1 21  ? -8.001  -16.524 6.699  1.00 59.46  ? 39  ARG B CZ  1 
ATOM   73   N NH1 . ARG A 1 21  ? -7.176  -15.588 7.160  1.00 53.09  ? 39  ARG B NH1 1 
ATOM   74   N NH2 . ARG A 1 21  ? -8.319  -16.565 5.402  1.00 68.39  ? 39  ARG B NH2 1 
ATOM   75   N N   . ALA A 1 22  ? -7.364  -20.880 10.497 1.00 25.73  ? 40  ALA B N   1 
ATOM   76   C CA  . ALA A 1 22  ? -8.251  -21.108 11.681 1.00 25.10  ? 40  ALA B CA  1 
ATOM   77   C C   . ALA A 1 22  ? -7.806  -20.156 12.805 1.00 22.42  ? 40  ALA B C   1 
ATOM   78   O O   . ALA A 1 22  ? -8.577  -19.456 13.383 1.00 26.16  ? 40  ALA B O   1 
ATOM   79   C CB  . ALA A 1 22  ? -8.185  -22.557 12.133 1.00 23.36  ? 40  ALA B CB  1 
ATOM   80   N N   . HIS A 1 23  ? -6.524  -20.124 13.077 1.00 25.04  ? 41  HIS B N   1 
ATOM   81   C CA  . HIS A 1 23  ? -5.948  -19.177 14.068 1.00 25.07  ? 41  HIS B CA  1 
ATOM   82   C C   . HIS A 1 23  ? -6.361  -17.703 13.800 1.00 24.58  ? 41  HIS B C   1 
ATOM   83   O O   . HIS A 1 23  ? -7.066  -17.065 14.601 1.00 23.44  ? 41  HIS B O   1 
ATOM   84   C CB  . HIS A 1 23  ? -4.415  -19.329 14.056 1.00 24.41  ? 41  HIS B CB  1 
ATOM   85   C CG  . HIS A 1 23  ? -3.742  -18.253 14.866 1.00 29.58  ? 41  HIS B CG  1 
ATOM   86   N ND1 . HIS A 1 23  ? -3.884  -18.169 16.214 1.00 29.79  ? 41  HIS B ND1 1 
ATOM   87   C CD2 . HIS A 1 23  ? -3.018  -17.140 14.476 1.00 28.97  ? 41  HIS B CD2 1 
ATOM   88   C CE1 . HIS A 1 23  ? -3.212  -17.092 16.665 1.00 31.44  ? 41  HIS B CE1 1 
ATOM   89   N NE2 . HIS A 1 23  ? -2.690  -16.454 15.604 1.00 30.62  ? 41  HIS B NE2 1 
ATOM   90   N N   . LEU A 1 24  ? -5.996  -17.161 12.641 1.00 23.97  ? 42  LEU B N   1 
ATOM   91   C CA  . LEU A 1 24  ? -6.357  -15.771 12.344 1.00 27.09  ? 42  LEU B CA  1 
ATOM   92   C C   . LEU A 1 24  ? -7.818  -15.463 12.426 1.00 27.27  ? 42  LEU B C   1 
ATOM   93   O O   . LEU A 1 24  ? -8.190  -14.393 12.862 1.00 27.64  ? 42  LEU B O   1 
ATOM   94   C CB  . LEU A 1 24  ? -5.822  -15.309 10.968 1.00 30.33  ? 42  LEU B CB  1 
ATOM   95   C CG  . LEU A 1 24  ? -4.286  -15.216 10.900 1.00 32.00  ? 42  LEU B CG  1 
ATOM   96   C CD1 . LEU A 1 24  ? -3.786  -14.930 9.474  1.00 42.45  ? 42  LEU B CD1 1 
ATOM   97   C CD2 . LEU A 1 24  ? -3.669  -14.239 11.868 1.00 32.23  ? 42  LEU B CD2 1 
ATOM   98   N N   . ASP A 1 25  ? -8.654  -16.393 11.988 1.00 28.54  ? 43  ASP B N   1 
ATOM   99   C CA  . ASP A 1 25  ? -10.071 -16.143 11.990 1.00 31.62  ? 43  ASP B CA  1 
ATOM   100  C C   . ASP A 1 25  ? -10.672 -16.167 13.409 1.00 31.81  ? 43  ASP B C   1 
ATOM   101  O O   . ASP A 1 25  ? -11.790 -15.713 13.594 1.00 26.38  ? 43  ASP B O   1 
ATOM   102  C CB  . ASP A 1 25  ? -10.784 -17.152 11.085 1.00 35.01  ? 43  ASP B CB  1 
ATOM   103  C CG  . ASP A 1 25  ? -10.729 -16.742 9.610  1.00 40.24  ? 43  ASP B CG  1 
ATOM   104  O OD1 . ASP A 1 25  ? -10.378 -15.573 9.308  1.00 43.97  ? 43  ASP B OD1 1 
ATOM   105  O OD2 . ASP A 1 25  ? -11.026 -17.603 8.751  1.00 38.87  ? 43  ASP B OD2 1 
ATOM   106  N N   . SER A 1 26  ? -9.909  -16.685 14.385 1.00 28.13  ? 44  SER B N   1 
ATOM   107  C CA  . SER A 1 26  ? -10.407 -16.873 15.754 1.00 30.08  ? 44  SER B CA  1 
ATOM   108  C C   . SER A 1 26  ? -10.064 -15.700 16.718 1.00 30.50  ? 44  SER B C   1 
ATOM   109  O O   . SER A 1 26  ? -10.167 -15.857 17.927 1.00 28.90  ? 44  SER B O   1 
ATOM   110  C CB  . SER A 1 26  ? -9.840  -18.184 16.347 1.00 27.87  ? 44  SER B CB  1 
ATOM   111  O OG  . SER A 1 26  ? -8.448  -18.056 16.607 1.00 27.84  ? 44  SER B OG  1 
ATOM   112  N N   . GLY A 1 27  ? -9.588  -14.579 16.191 1.00 27.93  ? 45  GLY B N   1 
ATOM   113  C CA  . GLY A 1 27  ? -9.199  -13.444 17.045 1.00 29.00  ? 45  GLY B CA  1 
ATOM   114  C C   . GLY A 1 27  ? -9.487  -12.118 16.361 1.00 28.55  ? 45  GLY B C   1 
ATOM   115  O O   . GLY A 1 27  ? -9.919  -12.121 15.207 1.00 29.09  ? 45  GLY B O   1 
ATOM   116  N N   . PRO A 1 28  ? -9.303  -10.989 17.083 1.00 26.47  ? 46  PRO B N   1 
ATOM   117  C CA  . PRO A 1 28  ? -9.632  -9.675  16.518 1.00 27.61  ? 46  PRO B CA  1 
ATOM   118  C C   . PRO A 1 28  ? -8.565  -9.185  15.550 1.00 27.51  ? 46  PRO B C   1 
ATOM   119  O O   . PRO A 1 28  ? -7.345  -9.469  15.696 1.00 26.51  ? 46  PRO B O   1 
ATOM   120  C CB  . PRO A 1 28  ? -9.715  -8.771  17.751 1.00 27.12  ? 46  PRO B CB  1 
ATOM   121  C CG  . PRO A 1 28  ? -8.859  -9.407  18.788 1.00 27.62  ? 46  PRO B CG  1 
ATOM   122  C CD  . PRO A 1 28  ? -8.771  -10.876 18.453 1.00 26.77  ? 46  PRO B CD  1 
ATOM   123  N N   . SER A 1 29  ? -9.055  -8.545  14.503 1.00 30.75  ? 47  SER B N   1 
ATOM   124  C CA  . SER A 1 29  ? -8.254  -7.649  13.666 1.00 36.57  ? 47  SER B CA  1 
ATOM   125  C C   . SER A 1 29  ? -7.681  -6.595  14.576 1.00 34.09  ? 47  SER B C   1 
ATOM   126  O O   . SER A 1 29  ? -8.378  -6.206  15.521 1.00 31.98  ? 47  SER B O   1 
ATOM   127  C CB  . SER A 1 29  ? -9.179  -6.880  12.722 1.00 37.34  ? 47  SER B CB  1 
ATOM   128  O OG  . SER A 1 29  ? -8.450  -6.611  11.555 1.00 53.88  ? 47  SER B OG  1 
ATOM   129  N N   . THR A 1 30  ? -6.473  -6.113  14.258 1.00 33.45  ? 48  THR B N   1 
ATOM   130  C CA  . THR A 1 30  ? -5.916  -4.869  14.816 1.00 35.58  ? 48  THR B CA  1 
ATOM   131  C C   . THR A 1 30  ? -6.922  -3.710  14.731 1.00 35.88  ? 48  THR B C   1 
ATOM   132  O O   . THR A 1 30  ? -7.074  -2.912  15.702 1.00 34.36  ? 48  THR B O   1 
ATOM   133  C CB  . THR A 1 30  ? -4.584  -4.474  14.105 1.00 38.02  ? 48  THR B CB  1 
ATOM   134  O OG1 . THR A 1 30  ? -3.437  -4.936  14.855 1.00 39.71  ? 48  THR B OG1 1 
ATOM   135  C CG2 . THR A 1 30  ? -4.493  -3.048  13.964 1.00 36.00  ? 48  THR B CG2 1 
ATOM   136  N N   . ALA A 1 31  ? -7.652  -3.612  13.618 1.00 44.08  ? 49  ALA B N   1 
ATOM   137  C CA  . ALA A 1 31  ? -8.616  -2.495  13.511 1.00 49.27  ? 49  ALA B CA  1 
ATOM   138  C C   . ALA A 1 31  ? -9.847  -2.712  14.412 1.00 47.42  ? 49  ALA B C   1 
ATOM   139  O O   . ALA A 1 31  ? -10.593 -1.769  14.665 1.00 49.21  ? 49  ALA B O   1 
ATOM   140  C CB  . ALA A 1 31  ? -9.009  -2.216  12.043 1.00 50.49  ? 49  ALA B CB  1 
ATOM   141  N N   . LYS A 1 32  ? -10.027 -3.942  14.910 1.00 38.05  ? 50  LYS B N   1 
ATOM   142  C CA  . LYS A 1 32  ? -11.181 -4.303  15.736 1.00 37.35  ? 50  LYS B CA  1 
ATOM   143  C C   . LYS A 1 32  ? -10.883 -4.271  17.268 1.00 35.42  ? 50  LYS B C   1 
ATOM   144  O O   . LYS A 1 32  ? -11.737 -4.550  18.105 1.00 35.52  ? 50  LYS B O   1 
ATOM   145  C CB  . LYS A 1 32  ? -11.703 -5.686  15.303 1.00 36.04  ? 50  LYS B CB  1 
ATOM   146  N N   . LEU A 1 33  ? -9.643  -3.963  17.634 1.00 38.01  ? 51  LEU B N   1 
ATOM   147  C CA  . LEU A 1 33  ? -9.294  -3.738  19.035 1.00 33.26  ? 51  LEU B CA  1 
ATOM   148  C C   . LEU A 1 33  ? -10.199 -2.669  19.720 1.00 33.92  ? 51  LEU B C   1 
ATOM   149  O O   . LEU A 1 33  ? -10.471 -1.602  19.148 1.00 31.42  ? 51  LEU B O   1 
ATOM   150  C CB  . LEU A 1 33  ? -7.862  -3.286  19.088 1.00 32.86  ? 51  LEU B CB  1 
ATOM   151  C CG  . LEU A 1 33  ? -6.765  -4.313  19.371 1.00 34.92  ? 51  LEU B CG  1 
ATOM   152  C CD1 . LEU A 1 33  ? -7.011  -5.791  18.997 1.00 32.74  ? 51  LEU B CD1 1 
ATOM   153  C CD2 . LEU A 1 33  ? -5.458  -3.770  18.861 1.00 30.47  ? 51  LEU B CD2 1 
ATOM   154  N N   . ASP A 1 34  ? -10.631 -2.948  20.952 1.00 27.16  ? 52  ASP B N   1 
ATOM   155  C CA  . ASP A 1 34  ? -11.549 -2.079  21.668 1.00 26.62  ? 52  ASP B CA  1 
ATOM   156  C C   . ASP A 1 34  ? -10.833 -1.487  22.866 1.00 26.35  ? 52  ASP B C   1 
ATOM   157  O O   . ASP A 1 34  ? -10.624 -2.172  23.876 1.00 22.63  ? 52  ASP B O   1 
ATOM   158  C CB  . ASP A 1 34  ? -12.733 -2.908  22.174 1.00 26.99  ? 52  ASP B CB  1 
ATOM   159  C CG  . ASP A 1 34  ? -13.813 -2.050  22.899 1.00 34.31  ? 52  ASP B CG  1 
ATOM   160  O OD1 . ASP A 1 34  ? -14.924 -2.620  23.098 1.00 36.43  ? 52  ASP B OD1 1 
ATOM   161  O OD2 . ASP A 1 34  ? -13.581 -0.833  23.238 1.00 32.29  ? 52  ASP B OD2 1 
ATOM   162  N N   . TYR A 1 35  ? -10.498 -0.213  22.804 1.00 24.89  ? 53  TYR B N   1 
ATOM   163  C CA  . TYR A 1 35  ? -9.775  0.396   23.911 1.00 24.73  ? 53  TYR B CA  1 
ATOM   164  C C   . TYR A 1 35  ? -10.699 1.206   24.823 1.00 26.36  ? 53  TYR B C   1 
ATOM   165  O O   . TYR A 1 35  ? -10.235 1.760   25.779 1.00 25.04  ? 53  TYR B O   1 
ATOM   166  C CB  . TYR A 1 35  ? -8.609  1.297   23.397 1.00 24.90  ? 53  TYR B CB  1 
ATOM   167  C CG  . TYR A 1 35  ? -7.340  0.548   22.979 1.00 24.85  ? 53  TYR B CG  1 
ATOM   168  C CD1 . TYR A 1 35  ? -7.231  -0.003  21.699 1.00 25.77  ? 53  TYR B CD1 1 
ATOM   169  C CD2 . TYR A 1 35  ? -6.259  0.417   23.844 1.00 24.67  ? 53  TYR B CD2 1 
ATOM   170  C CE1 . TYR A 1 35  ? -6.089  -0.662  21.300 1.00 27.32  ? 53  TYR B CE1 1 
ATOM   171  C CE2 . TYR A 1 35  ? -5.121  -0.282  23.473 1.00 24.61  ? 53  TYR B CE2 1 
ATOM   172  C CZ  . TYR A 1 35  ? -5.030  -0.809  22.218 1.00 26.51  ? 53  TYR B CZ  1 
ATOM   173  O OH  . TYR A 1 35  ? -3.890  -1.443  21.821 1.00 26.04  ? 53  TYR B OH  1 
ATOM   174  N N   . SER A 1 36  ? -12.007 1.235   24.572 1.00 28.28  ? 54  SER B N   1 
ATOM   175  C CA  . SER A 1 36  ? -12.910 2.090   25.334 1.00 31.01  ? 54  SER B CA  1 
ATOM   176  C C   . SER A 1 36  ? -13.001 1.733   26.853 1.00 31.60  ? 54  SER B C   1 
ATOM   177  O O   . SER A 1 36  ? -13.564 2.490   27.608 1.00 31.04  ? 54  SER B O   1 
ATOM   178  C CB  . SER A 1 36  ? -14.320 2.007   24.734 1.00 31.81  ? 54  SER B CB  1 
ATOM   179  O OG  . SER A 1 36  ? -14.839 0.696   24.884 1.00 30.37  ? 54  SER B OG  1 
ATOM   180  N N   . LYS A 1 37  ? -12.406 0.629   27.294 1.00 29.64  ? 55  LYS B N   1 
ATOM   181  C CA  . LYS A 1 37  ? -12.421 0.294   28.728 1.00 33.04  ? 55  LYS B CA  1 
ATOM   182  C C   . LYS A 1 37  ? -11.020 0.341   29.352 1.00 28.21  ? 55  LYS B C   1 
ATOM   183  O O   . LYS A 1 37  ? -10.864 0.252   30.549 1.00 30.14  ? 55  LYS B O   1 
ATOM   184  C CB  . LYS A 1 37  ? -13.100 -1.079  28.957 1.00 36.55  ? 55  LYS B CB  1 
ATOM   185  C CG  . LYS A 1 37  ? -13.681 -1.243  30.357 1.00 47.27  ? 55  LYS B CG  1 
ATOM   186  C CD  . LYS A 1 37  ? -14.099 -2.677  30.727 1.00 55.88  ? 55  LYS B CD  1 
ATOM   187  C CE  . LYS A 1 37  ? -14.180 -2.865  32.245 1.00 53.29  ? 55  LYS B CE  1 
ATOM   188  N NZ  . LYS A 1 37  ? -12.904 -2.534  32.951 1.00 48.41  ? 55  LYS B NZ  1 
ATOM   189  N N   . PHE A 1 38  ? -10.001 0.489   28.528 1.00 28.27  ? 56  PHE B N   1 
ATOM   190  C CA  . PHE A 1 38  ? -8.597  0.485   28.982 1.00 31.00  ? 56  PHE B CA  1 
ATOM   191  C C   . PHE A 1 38  ? -8.318  1.688   29.895 1.00 33.00  ? 56  PHE B C   1 
ATOM   192  O O   . PHE A 1 38  ? -8.681  2.805   29.536 1.00 29.16  ? 56  PHE B O   1 
ATOM   193  C CB  . PHE A 1 38  ? -7.696  0.514   27.765 1.00 28.25  ? 56  PHE B CB  1 
ATOM   194  C CG  . PHE A 1 38  ? -6.223  0.359   28.050 1.00 31.41  ? 56  PHE B CG  1 
ATOM   195  C CD1 . PHE A 1 38  ? -5.644  -0.900  28.188 1.00 27.76  ? 56  PHE B CD1 1 
ATOM   196  C CD2 . PHE A 1 38  ? -5.390  1.481   28.051 1.00 33.25  ? 56  PHE B CD2 1 
ATOM   197  C CE1 . PHE A 1 38  ? -4.265  -1.031  28.401 1.00 32.94  ? 56  PHE B CE1 1 
ATOM   198  C CE2 . PHE A 1 38  ? -4.008  1.353   28.237 1.00 36.32  ? 56  PHE B CE2 1 
ATOM   199  C CZ  . PHE A 1 38  ? -3.444  0.087   28.399 1.00 31.81  ? 56  PHE B CZ  1 
ATOM   200  N N   . GLN A 1 39  ? -7.769  1.411   31.089 1.00 29.86  ? 57  GLN B N   1 
ATOM   201  C CA  . GLN A 1 39  ? -7.206  2.424   31.986 1.00 34.54  ? 57  GLN B CA  1 
ATOM   202  C C   . GLN A 1 39  ? -5.951  1.832   32.582 1.00 38.42  ? 57  GLN B C   1 
ATOM   203  O O   . GLN A 1 39  ? -6.000  0.797   33.236 1.00 39.99  ? 57  GLN B O   1 
ATOM   204  C CB  . GLN A 1 39  ? -8.139  2.803   33.149 1.00 28.86  ? 57  GLN B CB  1 
ATOM   205  C CG  . GLN A 1 39  ? -9.554  3.108   32.733 1.00 30.50  ? 57  GLN B CG  1 
ATOM   206  N N   . GLU A 1 40  ? -4.831  2.497   32.378 1.00 43.18  ? 58  GLU B N   1 
ATOM   207  C CA  . GLU A 1 40  ? -3.631  2.072   33.054 1.00 43.10  ? 58  GLU B CA  1 
ATOM   208  C C   . GLU A 1 40  ? -3.621  2.461   34.564 1.00 47.80  ? 58  GLU B C   1 
ATOM   209  O O   . GLU A 1 40  ? -2.894  1.881   35.357 1.00 42.49  ? 58  GLU B O   1 
ATOM   210  C CB  . GLU A 1 40  ? -2.444  2.626   32.323 1.00 45.38  ? 58  GLU B CB  1 
ATOM   211  C CG  . GLU A 1 40  ? -2.304  4.108   32.478 1.00 53.57  ? 58  GLU B CG  1 
ATOM   212  C CD  . GLU A 1 40  ? -1.040  4.599   31.831 1.00 58.46  ? 58  GLU B CD  1 
ATOM   213  O OE1 . GLU A 1 40  ? -0.441  3.794   31.071 1.00 60.83  ? 58  GLU B OE1 1 
ATOM   214  O OE2 . GLU A 1 40  ? -0.664  5.776   32.087 1.00 53.72  ? 58  GLU B OE2 1 
ATOM   215  N N   . LEU A 1 41  ? -4.500  3.375   34.961 1.00 49.22  ? 59  LEU B N   1 
ATOM   216  C CA  . LEU A 1 41  ? -4.558  3.901   36.319 1.00 47.18  ? 59  LEU B CA  1 
ATOM   217  C C   . LEU A 1 41  ? -5.862  3.458   36.967 1.00 55.42  ? 59  LEU B C   1 
ATOM   218  O O   . LEU A 1 41  ? -6.950  3.745   36.448 1.00 61.61  ? 59  LEU B O   1 
ATOM   219  C CB  . LEU A 1 41  ? -4.516  5.423   36.213 1.00 51.96  ? 59  LEU B CB  1 
ATOM   220  C CG  . LEU A 1 41  ? -3.511  6.343   36.882 1.00 49.67  ? 59  LEU B CG  1 
ATOM   221  C CD1 . LEU A 1 41  ? -2.142  5.739   37.073 1.00 39.24  ? 59  LEU B CD1 1 
ATOM   222  C CD2 . LEU A 1 41  ? -3.445  7.620   36.070 1.00 51.30  ? 59  LEU B CD2 1 
ATOM   223  N N   . VAL A 1 42  ? -5.764  2.734   38.079 1.00 50.08  ? 60  VAL B N   1 
ATOM   224  C CA  . VAL A 1 42  ? -6.944  2.277   38.817 1.00 56.32  ? 60  VAL B CA  1 
ATOM   225  C C   . VAL A 1 42  ? -6.836  3.046   40.169 1.00 66.60  ? 60  VAL B C   1 
ATOM   226  O O   . VAL A 1 42  ? -5.786  3.644   40.440 1.00 61.71  ? 60  VAL B O   1 
ATOM   227  C CB  . VAL A 1 42  ? -6.978  0.704   38.886 1.00 55.58  ? 60  VAL B CB  1 
ATOM   228  C CG1 . VAL A 1 42  ? -8.218  0.164   39.613 1.00 54.18  ? 60  VAL B CG1 1 
ATOM   229  C CG2 . VAL A 1 42  ? -6.858  0.083   37.476 1.00 43.87  ? 60  VAL B CG2 1 
ATOM   230  N N   . LEU A 1 43  ? -7.874  3.024   41.015 1.00 73.55  ? 61  LEU B N   1 
ATOM   231  C CA  . LEU A 1 43  ? -8.132  4.152   41.947 1.00 80.36  ? 61  LEU B CA  1 
ATOM   232  C C   . LEU A 1 43  ? -8.550  3.915   43.440 1.00 86.42  ? 61  LEU B C   1 
ATOM   233  O O   . LEU A 1 43  ? -9.696  4.222   43.789 1.00 86.46  ? 61  LEU B O   1 
ATOM   234  C CB  . LEU A 1 43  ? -9.255  4.965   41.305 1.00 77.90  ? 61  LEU B CB  1 
ATOM   235  C CG  . LEU A 1 43  ? -9.470  6.458   41.328 1.00 78.71  ? 61  LEU B CG  1 
ATOM   236  C CD1 . LEU A 1 43  ? -9.346  6.899   39.882 1.00 80.55  ? 61  LEU B CD1 1 
ATOM   237  C CD2 . LEU A 1 43  ? -10.877 6.723   41.852 1.00 78.30  ? 61  LEU B CD2 1 
ATOM   238  N N   . PRO A 1 44  ? -7.671  3.372   44.326 1.00 89.58  ? 62  PRO B N   1 
ATOM   239  C CA  . PRO A 1 44  ? -6.482  2.503   44.276 1.00 94.49  ? 62  PRO B CA  1 
ATOM   240  C C   . PRO A 1 44  ? -6.829  1.055   44.698 1.00 101.06 ? 62  PRO B C   1 
ATOM   241  O O   . PRO A 1 44  ? -7.891  0.834   45.293 1.00 98.74  ? 62  PRO B O   1 
ATOM   242  C CB  . PRO A 1 44  ? -5.505  3.161   45.278 1.00 87.65  ? 62  PRO B CB  1 
ATOM   243  C CG  . PRO A 1 44  ? -6.235  4.341   45.860 1.00 88.90  ? 62  PRO B CG  1 
ATOM   244  C CD  . PRO A 1 44  ? -7.694  4.112   45.599 1.00 86.27  ? 62  PRO B CD  1 
ATOM   245  N N   . HIS A 1 45  ? -5.936  0.101   44.397 1.00 107.17 ? 63  HIS B N   1 
ATOM   246  C CA  . HIS A 1 45  ? -6.213  -1.368  44.459 1.00 113.33 ? 63  HIS B CA  1 
ATOM   247  C C   . HIS A 1 45  ? -6.933  -1.970  45.666 1.00 112.69 ? 63  HIS B C   1 
ATOM   248  O O   . HIS A 1 45  ? -8.073  -2.447  45.523 1.00 106.22 ? 63  HIS B O   1 
ATOM   249  C CB  . HIS A 1 45  ? -4.955  -2.199  44.123 1.00 111.17 ? 63  HIS B CB  1 
ATOM   250  C CG  . HIS A 1 45  ? -4.870  -2.652  42.665 1.00 105.95 ? 63  HIS B CG  1 
ATOM   251  N ND1 . HIS A 1 45  ? -5.961  -2.840  41.890 1.00 93.67  ? 63  HIS B ND1 1 
ATOM   252  C CD2 . HIS A 1 45  ? -3.764  -2.980  41.868 1.00 98.78  ? 63  HIS B CD2 1 
ATOM   253  C CE1 . HIS A 1 45  ? -5.575  -3.244  40.663 1.00 83.82  ? 63  HIS B CE1 1 
ATOM   254  N NE2 . HIS A 1 45  ? -4.235  -3.333  40.651 1.00 89.20  ? 63  HIS B NE2 1 
ATOM   255  N N   . PHE A 1 46  ? -6.278  -1.983  46.838 1.00 101.94 ? 64  PHE B N   1 
ATOM   256  C CA  . PHE A 1 46  ? -6.824  -2.621  48.061 1.00 94.51  ? 64  PHE B CA  1 
ATOM   257  C C   . PHE A 1 46  ? -8.289  -2.211  48.397 1.00 90.89  ? 64  PHE B C   1 
ATOM   258  O O   . PHE A 1 46  ? -8.742  -1.126  48.001 1.00 79.71  ? 64  PHE B O   1 
ATOM   259  C CB  . PHE A 1 46  ? -5.892  -2.385  49.259 1.00 84.72  ? 64  PHE B CB  1 
ATOM   260  N N   . GLY A 1 47  ? -9.045  -3.060  49.102 0.50 81.93  ? 65  GLY B N   1 
ATOM   261  C CA  . GLY A 1 47  ? -8.609  -4.373  49.558 0.50 75.72  ? 65  GLY B CA  1 
ATOM   262  C C   . GLY A 1 47  ? -8.661  -5.389  48.439 0.50 73.72  ? 65  GLY B C   1 
ATOM   263  O O   . GLY A 1 47  ? -8.513  -5.044  47.265 0.50 69.38  ? 65  GLY B O   1 
ATOM   264  N N   . LYS A 1 48  ? -8.885  -6.645  48.806 1.00 76.00  ? 66  LYS B N   1 
ATOM   265  C CA  . LYS A 1 48  ? -8.822  -7.753  47.848 1.00 74.01  ? 66  LYS B CA  1 
ATOM   266  C C   . LYS A 1 48  ? -10.109 -7.826  47.020 1.00 73.01  ? 66  LYS B C   1 
ATOM   267  O O   . LYS A 1 48  ? -11.056 -7.065  47.267 1.00 71.99  ? 66  LYS B O   1 
ATOM   268  C CB  . LYS A 1 48  ? -8.525  -9.083  48.564 1.00 74.58  ? 66  LYS B CB  1 
ATOM   269  N N   . GLU A 1 49  ? -10.136 -8.744  46.050 1.00 70.26  ? 67  GLU B N   1 
ATOM   270  C CA  . GLU A 1 49  ? -11.237 -8.857  45.066 1.00 64.11  ? 67  GLU B CA  1 
ATOM   271  C C   . GLU A 1 49  ? -12.630 -8.690  45.673 1.00 60.34  ? 67  GLU B C   1 
ATOM   272  O O   . GLU A 1 49  ? -12.959 -9.277  46.710 1.00 55.58  ? 67  GLU B O   1 
ATOM   273  C CB  . GLU A 1 49  ? -11.160 -10.163 44.235 1.00 54.89  ? 67  GLU B CB  1 
ATOM   274  C CG  . GLU A 1 49  ? -11.693 -11.415 44.936 1.00 51.74  ? 67  GLU B CG  1 
ATOM   275  C CD  . GLU A 1 49  ? -10.790 -11.864 46.071 1.00 53.67  ? 67  GLU B CD  1 
ATOM   276  O OE1 . GLU A 1 49  ? -11.266 -12.553 46.992 1.00 53.52  ? 67  GLU B OE1 1 
ATOM   277  O OE2 . GLU A 1 49  ? -9.587  -11.522 46.059 1.00 53.99  ? 67  GLU B OE2 1 
ATOM   278  N N   . ASP A 1 50  ? -13.419 -7.858  45.003 1.00 59.54  ? 68  ASP B N   1 
ATOM   279  C CA  . ASP A 1 50  ? -14.845 -7.744  45.240 1.00 52.31  ? 68  ASP B CA  1 
ATOM   280  C C   . ASP A 1 50  ? -15.564 -8.508  44.098 1.00 55.09  ? 68  ASP B C   1 
ATOM   281  O O   . ASP A 1 50  ? -14.906 -9.102  43.200 1.00 50.91  ? 68  ASP B O   1 
ATOM   282  C CB  . ASP A 1 50  ? -15.218 -6.258  45.277 1.00 52.40  ? 68  ASP B CB  1 
ATOM   283  C CG  . ASP A 1 50  ? -15.148 -5.583  43.895 1.00 55.27  ? 68  ASP B CG  1 
ATOM   284  O OD1 . ASP A 1 50  ? -15.835 -6.051  42.963 1.00 48.14  ? 68  ASP B OD1 1 
ATOM   285  O OD2 . ASP A 1 50  ? -14.434 -4.559  43.745 1.00 58.45  ? 68  ASP B OD2 1 
ATOM   286  N N   . ALA A 1 51  ? -16.895 -8.476  44.104 1.00 48.37  ? 69  ALA B N   1 
ATOM   287  C CA  . ALA A 1 51  ? -17.696 -9.305  43.179 1.00 50.85  ? 69  ALA B CA  1 
ATOM   288  C C   . ALA A 1 51  ? -17.533 -8.972  41.670 1.00 49.41  ? 69  ALA B C   1 
ATOM   289  O O   . ALA A 1 51  ? -17.562 -9.870  40.774 1.00 40.08  ? 69  ALA B O   1 
ATOM   290  C CB  . ALA A 1 51  ? -19.165 -9.270  43.592 1.00 49.05  ? 69  ALA B CB  1 
ATOM   291  N N   . GLY A 1 52  ? -17.378 -7.674  41.400 1.00 49.76  ? 70  GLY B N   1 
ATOM   292  C CA  . GLY A 1 52  ? -17.223 -7.168  40.041 1.00 42.62  ? 70  GLY B CA  1 
ATOM   293  C C   . GLY A 1 52  ? -15.942 -7.685  39.414 1.00 37.23  ? 70  GLY B C   1 
ATOM   294  O O   . GLY A 1 52  ? -15.912 -7.980  38.244 1.00 32.41  ? 70  GLY B O   1 
ATOM   295  N N   . ASP A 1 53  ? -14.881 -7.800  40.206 1.00 40.87  ? 71  ASP B N   1 
ATOM   296  C CA  . ASP A 1 53  ? -13.606 -8.368  39.719 1.00 36.02  ? 71  ASP B CA  1 
ATOM   297  C C   . ASP A 1 53  ? -13.793 -9.839  39.326 1.00 35.48  ? 71  ASP B C   1 
ATOM   298  O O   . ASP A 1 53  ? -13.244 -10.310 38.343 1.00 30.00  ? 71  ASP B O   1 
ATOM   299  C CB  . ASP A 1 53  ? -12.544 -8.285  40.802 1.00 37.41  ? 71  ASP B CB  1 
ATOM   300  C CG  . ASP A 1 53  ? -12.262 -6.864  41.198 1.00 38.93  ? 71  ASP B CG  1 
ATOM   301  O OD1 . ASP A 1 53  ? -11.988 -6.105  40.264 1.00 36.65  ? 71  ASP B OD1 1 
ATOM   302  O OD2 . ASP A 1 53  ? -12.365 -6.542  42.411 1.00 37.51  ? 71  ASP B OD2 1 
ATOM   303  N N   . VAL A 1 54  ? -14.596 -10.551 40.093 1.00 34.05  ? 72  VAL B N   1 
ATOM   304  C CA  . VAL A 1 54  ? -14.683 -11.984 39.926 1.00 31.33  ? 72  VAL B CA  1 
ATOM   305  C C   . VAL A 1 54  ? -15.538 -12.292 38.714 1.00 32.60  ? 72  VAL B C   1 
ATOM   306  O O   . VAL A 1 54  ? -15.251 -13.221 37.953 1.00 31.05  ? 72  VAL B O   1 
ATOM   307  C CB  . VAL A 1 54  ? -15.179 -12.564 41.231 1.00 31.97  ? 72  VAL B CB  1 
ATOM   308  C CG1 . VAL A 1 54  ? -15.628 -14.035 41.129 1.00 33.08  ? 72  VAL B CG1 1 
ATOM   309  C CG2 . VAL A 1 54  ? -14.064 -12.344 42.245 1.00 28.26  ? 72  VAL B CG2 1 
ATOM   310  N N   . GLN A 1 55  ? -16.574 -11.477 38.536 1.00 33.77  ? 73  GLN B N   1 
ATOM   311  C CA  . GLN A 1 55  ? -17.521 -11.652 37.499 1.00 31.98  ? 73  GLN B CA  1 
ATOM   312  C C   . GLN A 1 55  ? -16.810 -11.359 36.148 1.00 30.17  ? 73  GLN B C   1 
ATOM   313  O O   . GLN A 1 55  ? -16.982 -12.066 35.163 1.00 27.04  ? 73  GLN B O   1 
ATOM   314  C CB  . GLN A 1 55  ? -18.763 -10.786 37.778 1.00 32.86  ? 73  GLN B CB  1 
ATOM   315  C CG  . GLN A 1 55  ? -19.822 -10.900 36.681 1.00 35.40  ? 73  GLN B CG  1 
ATOM   316  C CD  . GLN A 1 55  ? -20.520 -12.256 36.613 1.00 37.92  ? 73  GLN B CD  1 
ATOM   317  O OE1 . GLN A 1 55  ? -21.029 -12.769 37.601 1.00 43.14  ? 73  GLN B OE1 1 
ATOM   318  N NE2 . GLN A 1 55  ? -20.547 -12.840 35.431 1.00 41.43  ? 73  GLN B NE2 1 
ATOM   319  N N   . GLN A 1 56  ? -15.934 -10.370 36.150 1.00 31.13  ? 74  GLN B N   1 
ATOM   320  C CA  . GLN A 1 56  ? -15.104 -10.083 34.995 1.00 33.03  ? 74  GLN B CA  1 
ATOM   321  C C   . GLN A 1 56  ? -14.143 -11.217 34.638 1.00 32.10  ? 74  GLN B C   1 
ATOM   322  O O   . GLN A 1 56  ? -14.000 -11.546 33.457 1.00 32.75  ? 74  GLN B O   1 
ATOM   323  C CB  . GLN A 1 56  ? -14.294 -8.888  35.333 1.00 35.79  ? 74  GLN B CB  1 
ATOM   324  C CG  . GLN A 1 56  ? -13.308 -8.505  34.300 1.00 42.68  ? 74  GLN B CG  1 
ATOM   325  C CD  . GLN A 1 56  ? -12.324 -7.581  34.921 1.00 46.94  ? 74  GLN B CD  1 
ATOM   326  O OE1 . GLN A 1 56  ? -11.735 -7.874  35.997 1.00 49.12  ? 74  GLN B OE1 1 
ATOM   327  N NE2 . GLN A 1 56  ? -12.171 -6.430  34.298 1.00 41.42  ? 74  GLN B NE2 1 
ATOM   328  N N   . PHE A 1 57  ? -13.469 -11.783 35.655 1.00 30.09  ? 75  PHE B N   1 
ATOM   329  C CA  . PHE A 1 57  ? -12.600 -12.927 35.472 1.00 30.56  ? 75  PHE B CA  1 
ATOM   330  C C   . PHE A 1 57  ? -13.388 -14.042 34.755 1.00 29.67  ? 75  PHE B C   1 
ATOM   331  O O   . PHE A 1 57  ? -12.937 -14.510 33.706 1.00 26.11  ? 75  PHE B O   1 
ATOM   332  C CB  . PHE A 1 57  ? -12.084 -13.406 36.822 1.00 30.24  ? 75  PHE B CB  1 
ATOM   333  C CG  . PHE A 1 57  ? -11.339 -14.726 36.789 1.00 27.43  ? 75  PHE B CG  1 
ATOM   334  C CD1 . PHE A 1 57  ? -10.004 -14.784 36.426 1.00 28.83  ? 75  PHE B CD1 1 
ATOM   335  C CD2 . PHE A 1 57  ? -11.954 -15.885 37.239 1.00 26.35  ? 75  PHE B CD2 1 
ATOM   336  C CE1 . PHE A 1 57  ? -9.310  -15.999 36.426 1.00 25.33  ? 75  PHE B CE1 1 
ATOM   337  C CE2 . PHE A 1 57  ? -11.290 -17.084 37.280 1.00 24.68  ? 75  PHE B CE2 1 
ATOM   338  C CZ  . PHE A 1 57  ? -9.975  -17.147 36.845 1.00 27.75  ? 75  PHE B CZ  1 
ATOM   339  N N   . TYR A 1 58  ? -14.562 -14.424 35.286 1.00 24.86  ? 76  TYR B N   1 
ATOM   340  C CA  . TYR A 1 58  ? -15.334 -15.480 34.659 1.00 26.34  ? 76  TYR B CA  1 
ATOM   341  C C   . TYR A 1 58  ? -15.822 -15.054 33.272 1.00 28.53  ? 76  TYR B C   1 
ATOM   342  O O   . TYR A 1 58  ? -15.838 -15.899 32.369 1.00 29.60  ? 76  TYR B O   1 
ATOM   343  C CB  . TYR A 1 58  ? -16.499 -15.959 35.549 1.00 28.17  ? 76  TYR B CB  1 
ATOM   344  C CG  . TYR A 1 58  ? -16.062 -16.783 36.761 1.00 28.41  ? 76  TYR B CG  1 
ATOM   345  C CD1 . TYR A 1 58  ? -15.189 -17.899 36.612 1.00 27.19  ? 76  TYR B CD1 1 
ATOM   346  C CD2 . TYR A 1 58  ? -16.501 -16.442 38.042 1.00 28.42  ? 76  TYR B CD2 1 
ATOM   347  C CE1 . TYR A 1 58  ? -14.803 -18.676 37.717 1.00 29.42  ? 76  TYR B CE1 1 
ATOM   348  C CE2 . TYR A 1 58  ? -16.117 -17.172 39.164 1.00 29.94  ? 76  TYR B CE2 1 
ATOM   349  C CZ  . TYR A 1 58  ? -15.276 -18.281 39.012 1.00 32.49  ? 76  TYR B CZ  1 
ATOM   350  O OH  . TYR A 1 58  ? -14.914 -18.963 40.147 1.00 31.40  ? 76  TYR B OH  1 
ATOM   351  N N   . ASP A 1 59  ? -16.165 -13.762 33.083 1.00 27.01  ? 77  ASP B N   1 
ATOM   352  C CA  . ASP A 1 59  ? -16.694 -13.311 31.776 1.00 31.96  ? 77  ASP B CA  1 
ATOM   353  C C   . ASP A 1 59  ? -15.571 -13.435 30.745 1.00 31.08  ? 77  ASP B C   1 
ATOM   354  O O   . ASP A 1 59  ? -15.807 -13.834 29.610 1.00 31.08  ? 77  ASP B O   1 
ATOM   355  C CB  . ASP A 1 59  ? -17.192 -11.847 31.806 1.00 31.21  ? 77  ASP B CB  1 
ATOM   356  C CG  . ASP A 1 59  ? -18.541 -11.694 32.537 1.00 34.58  ? 77  ASP B CG  1 
ATOM   357  O OD1 . ASP A 1 59  ? -19.224 -12.697 32.759 1.00 32.97  ? 77  ASP B OD1 1 
ATOM   358  O OD2 . ASP A 1 59  ? -18.920 -10.563 32.871 1.00 34.87  ? 77  ASP B OD2 1 
ATOM   359  N N   . LEU A 1 60  ? -14.355 -13.104 31.154 1.00 28.31  ? 78  LEU B N   1 
ATOM   360  C CA  . LEU A 1 60  ? -13.194 -13.203 30.223 1.00 29.78  ? 78  LEU B CA  1 
ATOM   361  C C   . LEU A 1 60  ? -12.913 -14.623 29.785 1.00 26.14  ? 78  LEU B C   1 
ATOM   362  O O   . LEU A 1 60  ? -12.686 -14.884 28.585 1.00 24.08  ? 78  LEU B O   1 
ATOM   363  C CB  . LEU A 1 60  ? -11.966 -12.568 30.855 1.00 29.85  ? 78  LEU B CB  1 
ATOM   364  C CG  . LEU A 1 60  ? -11.616 -11.075 30.751 1.00 31.77  ? 78  LEU B CG  1 
ATOM   365  C CD1 . LEU A 1 60  ? -12.579 -10.289 29.920 1.00 28.48  ? 78  LEU B CD1 1 
ATOM   366  C CD2 . LEU A 1 60  ? -11.288 -10.414 32.072 1.00 29.56  ? 78  LEU B CD2 1 
ATOM   367  N N   . LEU A 1 61  ? -12.936 -15.535 30.756 1.00 24.80  ? 79  LEU B N   1 
ATOM   368  C CA  . LEU A 1 61  ? -12.812 -16.982 30.527 1.00 26.49  ? 79  LEU B CA  1 
ATOM   369  C C   . LEU A 1 61  ? -13.911 -17.516 29.585 1.00 29.52  ? 79  LEU B C   1 
ATOM   370  O O   . LEU A 1 61  ? -13.622 -18.156 28.525 1.00 25.71  ? 79  LEU B O   1 
ATOM   371  C CB  . LEU A 1 61  ? -12.875 -17.741 31.871 1.00 26.27  ? 79  LEU B CB  1 
ATOM   372  C CG  . LEU A 1 61  ? -11.560 -18.221 32.508 1.00 31.21  ? 79  LEU B CG  1 
ATOM   373  C CD1 . LEU A 1 61  ? -10.397 -17.259 32.384 1.00 31.29  ? 79  LEU B CD1 1 
ATOM   374  C CD2 . LEU A 1 61  ? -11.770 -18.690 33.937 1.00 24.92  ? 79  LEU B CD2 1 
ATOM   375  N N   . SER A 1 62  ? -15.166 -17.277 29.984 1.00 28.56  ? 80  SER B N   1 
ATOM   376  C CA  . SER A 1 62  ? -16.305 -17.724 29.210 1.00 31.17  ? 80  SER B CA  1 
ATOM   377  C C   . SER A 1 62  ? -16.243 -17.200 27.792 1.00 29.06  ? 80  SER B C   1 
ATOM   378  O O   . SER A 1 62  ? -16.509 -17.931 26.840 1.00 28.16  ? 80  SER B O   1 
ATOM   379  C CB  . SER A 1 62  ? -17.609 -17.242 29.819 1.00 31.43  ? 80  SER B CB  1 
ATOM   380  O OG  . SER A 1 62  ? -17.759 -17.904 31.029 1.00 32.13  ? 80  SER B OG  1 
ATOM   381  N N   . GLY A 1 63  ? -15.855 -15.947 27.665 1.00 29.02  ? 81  GLY B N   1 
ATOM   382  C CA  . GLY A 1 63  ? -15.763 -15.329 26.331 1.00 32.31  ? 81  GLY B CA  1 
ATOM   383  C C   . GLY A 1 63  ? -14.923 -16.113 25.327 1.00 30.30  ? 81  GLY B C   1 
ATOM   384  O O   . GLY A 1 63  ? -15.143 -16.000 24.130 1.00 31.54  ? 81  GLY B O   1 
ATOM   385  N N   . SER A 1 64  ? -13.955 -16.895 25.801 1.00 28.84  ? 82  SER B N   1 
ATOM   386  C CA  . SER A 1 64  ? -13.084 -17.661 24.915 1.00 27.63  ? 82  SER B CA  1 
ATOM   387  C C   . SER A 1 64  ? -13.599 -19.043 24.556 1.00 28.39  ? 82  SER B C   1 
ATOM   388  O O   . SER A 1 64  ? -13.047 -19.652 23.649 1.00 28.02  ? 82  SER B O   1 
ATOM   389  C CB  . SER A 1 64  ? -11.724 -17.830 25.534 1.00 30.87  ? 82  SER B CB  1 
ATOM   390  O OG  . SER A 1 64  ? -10.955 -16.723 25.244 1.00 32.57  ? 82  SER B OG  1 
ATOM   391  N N   . LEU A 1 65  ? -14.690 -19.482 25.202 1.00 28.14  ? 83  LEU B N   1 
ATOM   392  C CA  . LEU A 1 65  ? -15.277 -20.807 25.035 1.00 32.35  ? 83  LEU B CA  1 
ATOM   393  C C   . LEU A 1 65  ? -15.700 -21.195 23.629 1.00 33.68  ? 83  LEU B C   1 
ATOM   394  O O   . LEU A 1 65  ? -15.229 -22.243 23.064 1.00 27.32  ? 83  LEU B O   1 
ATOM   395  C CB  . LEU A 1 65  ? -16.519 -20.909 25.893 1.00 39.37  ? 83  LEU B CB  1 
ATOM   396  C CG  . LEU A 1 65  ? -16.493 -21.776 27.147 1.00 45.02  ? 83  LEU B CG  1 
ATOM   397  C CD1 . LEU A 1 65  ? -15.157 -22.459 27.363 1.00 40.85  ? 83  LEU B CD1 1 
ATOM   398  C CD2 . LEU A 1 65  ? -16.995 -21.010 28.365 1.00 38.08  ? 83  LEU B CD2 1 
ATOM   399  N N   . GLU A 1 66  ? -16.616 -20.385 23.090 1.00 29.73  ? 84  GLU B N   1 
ATOM   400  C CA  . GLU A 1 66  ? -17.225 -20.647 21.804 1.00 34.81  ? 84  GLU B CA  1 
ATOM   401  C C   . GLU A 1 66  ? -16.185 -20.425 20.708 1.00 31.03  ? 84  GLU B C   1 
ATOM   402  O O   . GLU A 1 66  ? -16.192 -21.113 19.699 1.00 34.35  ? 84  GLU B O   1 
ATOM   403  C CB  . GLU A 1 66  ? -18.434 -19.706 21.622 1.00 40.86  ? 84  GLU B CB  1 
ATOM   404  C CG  . GLU A 1 66  ? -19.275 -19.932 20.364 1.00 56.08  ? 84  GLU B CG  1 
ATOM   405  C CD  . GLU A 1 66  ? -20.013 -18.673 19.869 1.00 66.14  ? 84  GLU B CD  1 
ATOM   406  O OE1 . GLU A 1 66  ? -20.089 -17.655 20.615 1.00 78.05  ? 84  GLU B OE1 1 
ATOM   407  O OE2 . GLU A 1 66  ? -20.523 -18.696 18.719 1.00 61.80  ? 84  GLU B OE2 1 
ATOM   408  N N   . VAL A 1 67  ? -15.302 -19.459 20.921 1.00 28.40  ? 85  VAL B N   1 
ATOM   409  C CA  . VAL A 1 67  ? -14.259 -19.106 19.956 1.00 26.45  ? 85  VAL B CA  1 
ATOM   410  C C   . VAL A 1 67  ? -13.270 -20.273 19.793 1.00 24.54  ? 85  VAL B C   1 
ATOM   411  O O   . VAL A 1 67  ? -12.960 -20.726 18.679 1.00 22.50  ? 85  VAL B O   1 
ATOM   412  C CB  . VAL A 1 67  ? -13.558 -17.822 20.422 1.00 25.04  ? 85  VAL B CB  1 
ATOM   413  C CG1 . VAL A 1 67  ? -12.252 -17.617 19.705 1.00 21.85  ? 85  VAL B CG1 1 
ATOM   414  C CG2 . VAL A 1 67  ? -14.495 -16.603 20.229 1.00 28.64  ? 85  VAL B CG2 1 
ATOM   415  N N   . ILE A 1 68  ? -12.836 -20.841 20.912 1.00 21.83  ? 86  ILE B N   1 
ATOM   416  C CA  . ILE A 1 68  ? -11.890 -21.887 20.818 1.00 19.63  ? 86  ILE B CA  1 
ATOM   417  C C   . ILE A 1 68  ? -12.613 -23.109 20.272 1.00 17.28  ? 86  ILE B C   1 
ATOM   418  O O   . ILE A 1 68  ? -11.992 -23.927 19.564 1.00 19.62  ? 86  ILE B O   1 
ATOM   419  C CB  . ILE A 1 68  ? -11.241 -22.264 22.187 1.00 20.39  ? 86  ILE B CB  1 
ATOM   420  C CG1 . ILE A 1 68  ? -10.225 -21.166 22.577 1.00 22.52  ? 86  ILE B CG1 1 
ATOM   421  C CG2 . ILE A 1 68  ? -10.533 -23.599 22.005 1.00 20.40  ? 86  ILE B CG2 1 
ATOM   422  C CD1 . ILE A 1 68  ? -9.780  -21.071 24.051 1.00 19.62  ? 86  ILE B CD1 1 
ATOM   423  N N   . ARG A 1 69  ? -13.873 -23.283 20.618 1.00 19.99  ? 87  ARG B N   1 
ATOM   424  C CA  . ARG A 1 69  ? -14.587 -24.464 20.061 1.00 24.24  ? 87  ARG B CA  1 
ATOM   425  C C   . ARG A 1 69  ? -14.746 -24.273 18.525 1.00 24.41  ? 87  ARG B C   1 
ATOM   426  O O   . ARG A 1 69  ? -14.549 -25.211 17.735 1.00 24.54  ? 87  ARG B O   1 
ATOM   427  C CB  . ARG A 1 69  ? -15.946 -24.711 20.770 1.00 25.11  ? 87  ARG B CB  1 
ATOM   428  C CG  . ARG A 1 69  ? -16.675 -25.951 20.206 1.00 31.85  ? 87  ARG B CG  1 
ATOM   429  C CD  . ARG A 1 69  ? -18.048 -26.145 20.838 1.00 37.49  ? 87  ARG B CD  1 
ATOM   430  N NE  . ARG A 1 69  ? -18.013 -25.570 22.201 1.00 50.88  ? 87  ARG B NE  1 
ATOM   431  C CZ  . ARG A 1 69  ? -17.533 -26.164 23.298 1.00 48.34  ? 87  ARG B CZ  1 
ATOM   432  N NH1 . ARG A 1 69  ? -17.086 -27.430 23.257 1.00 49.72  ? 87  ARG B NH1 1 
ATOM   433  N NH2 . ARG A 1 69  ? -17.543 -25.489 24.448 1.00 52.89  ? 87  ARG B NH2 1 
ATOM   434  N N   . LYS A 1 70  ? -15.066 -23.053 18.093 1.00 23.08  ? 88  LYS B N   1 
ATOM   435  C CA  . LYS A 1 70  ? -15.166 -22.841 16.616 1.00 25.01  ? 88  LYS B CA  1 
ATOM   436  C C   . LYS A 1 70  ? -13.845 -22.945 15.912 1.00 24.55  ? 88  LYS B C   1 
ATOM   437  O O   . LYS A 1 70  ? -13.785 -23.459 14.805 1.00 24.35  ? 88  LYS B O   1 
ATOM   438  C CB  . LYS A 1 70  ? -15.801 -21.529 16.259 1.00 23.96  ? 88  LYS B CB  1 
ATOM   439  C CG  . LYS A 1 70  ? -17.271 -21.470 16.510 1.00 30.41  ? 88  LYS B CG  1 
ATOM   440  C CD  . LYS A 1 70  ? -17.723 -20.057 16.116 1.00 36.10  ? 88  LYS B CD  1 
ATOM   441  C CE  . LYS A 1 70  ? -19.055 -19.729 16.735 1.00 41.96  ? 88  LYS B CE  1 
ATOM   442  N NZ  . LYS A 1 70  ? -19.527 -18.417 16.189 1.00 48.11  ? 88  LYS B NZ  1 
ATOM   443  N N   . TRP A 1 71  ? -12.762 -22.489 16.562 1.00 22.43  ? 89  TRP B N   1 
ATOM   444  C CA  . TRP A 1 71  ? -11.396 -22.679 15.993 1.00 22.17  ? 89  TRP B CA  1 
ATOM   445  C C   . TRP A 1 71  ? -11.017 -24.124 15.828 1.00 20.74  ? 89  TRP B C   1 
ATOM   446  O O   . TRP A 1 71  ? -10.547 -24.558 14.769 1.00 19.45  ? 89  TRP B O   1 
ATOM   447  C CB  . TRP A 1 71  ? -10.399 -22.018 16.915 1.00 21.58  ? 89  TRP B CB  1 
ATOM   448  C CG  . TRP A 1 71  ? -8.959  -22.396 16.773 1.00 21.57  ? 89  TRP B CG  1 
ATOM   449  C CD1 . TRP A 1 71  ? -8.027  -21.891 15.861 1.00 22.07  ? 89  TRP B CD1 1 
ATOM   450  C CD2 . TRP A 1 71  ? -8.213  -23.352 17.604 1.00 21.42  ? 89  TRP B CD2 1 
ATOM   451  N NE1 . TRP A 1 71  ? -6.802  -22.471 16.062 1.00 23.42  ? 89  TRP B NE1 1 
ATOM   452  C CE2 . TRP A 1 71  ? -6.828  -23.303 17.136 1.00 23.74  ? 89  TRP B CE2 1 
ATOM   453  C CE3 . TRP A 1 71  ? -8.531  -24.144 18.733 1.00 19.54  ? 89  TRP B CE3 1 
ATOM   454  C CZ2 . TRP A 1 71  ? -5.812  -24.085 17.735 1.00 24.39  ? 89  TRP B CZ2 1 
ATOM   455  C CZ3 . TRP A 1 71  ? -7.520  -24.870 19.349 1.00 21.14  ? 89  TRP B CZ3 1 
ATOM   456  C CH2 . TRP A 1 71  ? -6.196  -24.876 18.849 1.00 25.66  ? 89  TRP B CH2 1 
ATOM   457  N N   . ALA A 1 72  ? -11.308 -24.899 16.856 1.00 18.92  ? 90  ALA B N   1 
ATOM   458  C CA  . ALA A 1 72  ? -10.973 -26.333 16.857 1.00 19.69  ? 90  ALA B CA  1 
ATOM   459  C C   . ALA A 1 72  ? -11.691 -27.024 15.676 1.00 19.67  ? 90  ALA B C   1 
ATOM   460  O O   . ALA A 1 72  ? -11.073 -27.858 14.993 1.00 20.52  ? 90  ALA B O   1 
ATOM   461  C CB  . ALA A 1 72  ? -11.413 -26.973 18.166 1.00 19.17  ? 90  ALA B CB  1 
ATOM   462  N N   . GLU A 1 73  ? -12.945 -26.658 15.424 1.00 19.20  ? 91  GLU B N   1 
ATOM   463  C CA  A GLU A 1 73  ? -13.726 -27.271 14.328 0.50 23.34  ? 91  GLU B CA  1 
ATOM   464  C CA  B GLU A 1 73  ? -13.688 -27.357 14.369 0.50 23.06  ? 91  GLU B CA  1 
ATOM   465  C C   . GLU A 1 73  ? -13.074 -27.111 12.971 1.00 23.93  ? 91  GLU B C   1 
ATOM   466  O O   . GLU A 1 73  ? -13.254 -27.933 12.047 1.00 28.03  ? 91  GLU B O   1 
ATOM   467  C CB  A GLU A 1 73  ? -15.150 -26.717 14.293 0.50 26.93  ? 91  GLU B CB  1 
ATOM   468  C CB  B GLU A 1 73  ? -15.210 -27.097 14.461 0.50 25.88  ? 91  GLU B CB  1 
ATOM   469  C CG  A GLU A 1 73  ? -16.082 -27.519 15.172 0.50 31.68  ? 91  GLU B CG  1 
ATOM   470  C CG  B GLU A 1 73  ? -15.913 -27.588 15.767 0.50 29.98  ? 91  GLU B CG  1 
ATOM   471  C CD  A GLU A 1 73  ? -15.946 -28.983 14.838 0.50 33.91  ? 91  GLU B CD  1 
ATOM   472  C CD  B GLU A 1 73  ? -14.955 -27.849 16.938 0.50 31.64  ? 91  GLU B CD  1 
ATOM   473  O OE1 A GLU A 1 73  ? -16.263 -29.265 13.656 0.50 36.03  ? 91  GLU B OE1 1 
ATOM   474  O OE1 B GLU A 1 73  ? -13.748 -27.949 16.670 0.50 36.10  ? 91  GLU B OE1 1 
ATOM   475  O OE2 A GLU A 1 73  ? -15.519 -29.811 15.709 0.50 27.50  ? 91  GLU B OE2 1 
ATOM   476  O OE2 B GLU A 1 73  ? -15.358 -27.949 18.122 0.50 28.81  ? 91  GLU B OE2 1 
ATOM   477  N N   . LYS A 1 74  ? -12.285 -26.040 12.834 1.00 25.60  ? 92  LYS B N   1 
ATOM   478  C CA  . LYS A 1 74  ? -11.609 -25.766 11.580 1.00 25.79  ? 92  LYS B CA  1 
ATOM   479  C C   . LYS A 1 74  ? -10.280 -26.411 11.455 1.00 24.97  ? 92  LYS B C   1 
ATOM   480  O O   . LYS A 1 74  ? -9.672  -26.329 10.402 1.00 27.50  ? 92  LYS B O   1 
ATOM   481  C CB  . LYS A 1 74  ? -11.524 -24.261 11.376 1.00 29.03  ? 92  LYS B CB  1 
ATOM   482  C CG  . LYS A 1 74  ? -12.895 -23.661 11.006 1.00 31.59  ? 92  LYS B CG  1 
ATOM   483  C CD  . LYS A 1 74  ? -13.058 -22.190 11.421 1.00 38.85  ? 92  LYS B CD  1 
ATOM   484  C CE  . LYS A 1 74  ? -11.989 -21.243 10.843 1.00 41.37  ? 92  LYS B CE  1 
ATOM   485  N NZ  . LYS A 1 74  ? -12.508 -19.855 10.666 1.00 51.19  ? 92  LYS B NZ  1 
ATOM   486  N N   . ILE A 1 75  ? -9.768  -27.042 12.514 1.00 26.48  ? 93  ILE B N   1 
ATOM   487  C CA  . ILE A 1 75  ? -8.485  -27.836 12.374 1.00 24.68  ? 93  ILE B CA  1 
ATOM   488  C C   . ILE A 1 75  ? -8.748  -29.083 11.520 1.00 23.75  ? 93  ILE B C   1 
ATOM   489  O O   . ILE A 1 75  ? -9.592  -29.888 11.886 1.00 22.46  ? 93  ILE B O   1 
ATOM   490  C CB  . ILE A 1 75  ? -7.870  -28.220 13.763 1.00 21.49  ? 93  ILE B CB  1 
ATOM   491  C CG1 . ILE A 1 75  ? -7.440  -26.936 14.517 1.00 23.24  ? 93  ILE B CG1 1 
ATOM   492  C CG2 . ILE A 1 75  ? -6.751  -29.252 13.591 1.00 25.39  ? 93  ILE B CG2 1 
ATOM   493  C CD1 . ILE A 1 75  ? -7.314  -26.995 16.054 1.00 22.91  ? 93  ILE B CD1 1 
ATOM   494  N N   . PRO A 1 76  ? -8.012  -29.283 10.392 1.00 25.56  ? 94  PRO B N   1 
ATOM   495  C CA  . PRO A 1 76  ? -8.342  -30.513 9.605  1.00 24.39  ? 94  PRO B CA  1 
ATOM   496  C C   . PRO A 1 76  ? -8.182  -31.772 10.438 1.00 23.30  ? 94  PRO B C   1 
ATOM   497  O O   . PRO A 1 76  ? -7.147  -31.935 11.130 1.00 24.94  ? 94  PRO B O   1 
ATOM   498  C CB  . PRO A 1 76  ? -7.290  -30.509 8.507  1.00 27.17  ? 94  PRO B CB  1 
ATOM   499  C CG  . PRO A 1 76  ? -7.067  -29.053 8.273  1.00 30.33  ? 94  PRO B CG  1 
ATOM   500  C CD  . PRO A 1 76  ? -7.017  -28.466 9.687  1.00 26.25  ? 94  PRO B CD  1 
ATOM   501  N N   . GLY A 1 77  ? -9.193  -32.634 10.387 1.00 17.59  ? 95  GLY B N   1 
ATOM   502  C CA  . GLY A 1 77  ? -9.146  -33.863 11.136 1.00 19.86  ? 95  GLY B CA  1 
ATOM   503  C C   . GLY A 1 77  ? -9.773  -33.809 12.511 1.00 19.54  ? 95  GLY B C   1 
ATOM   504  O O   . GLY A 1 77  ? -10.155 -34.845 13.069 1.00 18.83  ? 95  GLY B O   1 
ATOM   505  N N   . PHE A 1 78  ? -9.948  -32.619 13.062 1.00 24.02  ? 96  PHE B N   1 
ATOM   506  C CA  . PHE A 1 78  ? -10.512 -32.550 14.437 1.00 21.84  ? 96  PHE B CA  1 
ATOM   507  C C   . PHE A 1 78  ? -11.929 -33.051 14.437 1.00 23.41  ? 96  PHE B C   1 
ATOM   508  O O   . PHE A 1 78  ? -12.301 -33.888 15.301 1.00 23.31  ? 96  PHE B O   1 
ATOM   509  C CB  . PHE A 1 78  ? -10.397 -31.165 15.071 1.00 22.94  ? 96  PHE B CB  1 
ATOM   510  C CG  . PHE A 1 78  ? -10.915 -31.110 16.519 1.00 22.69  ? 96  PHE B CG  1 
ATOM   511  C CD1 . PHE A 1 78  ? -10.139 -31.611 17.559 1.00 22.63  ? 96  PHE B CD1 1 
ATOM   512  C CD2 . PHE A 1 78  ? -12.166 -30.570 16.832 1.00 25.91  ? 96  PHE B CD2 1 
ATOM   513  C CE1 . PHE A 1 78  ? -10.566 -31.549 18.884 1.00 21.83  ? 96  PHE B CE1 1 
ATOM   514  C CE2 . PHE A 1 78  ? -12.631 -30.537 18.169 1.00 26.12  ? 96  PHE B CE2 1 
ATOM   515  C CZ  . PHE A 1 78  ? -11.793 -31.005 19.206 1.00 20.94  ? 96  PHE B CZ  1 
ATOM   516  N N   . ALA A 1 79  ? -12.726 -32.626 13.459 1.00 22.24  ? 97  ALA B N   1 
ATOM   517  C CA  . ALA A 1 79  ? -14.137 -33.098 13.435 1.00 25.39  ? 97  ALA B CA  1 
ATOM   518  C C   . ALA A 1 79  ? -14.244 -34.583 13.108 1.00 26.57  ? 97  ALA B C   1 
ATOM   519  O O   . ALA A 1 79  ? -15.306 -35.178 13.260 1.00 30.05  ? 97  ALA B O   1 
ATOM   520  C CB  . ALA A 1 79  ? -15.020 -32.260 12.461 1.00 25.59  ? 97  ALA B CB  1 
ATOM   521  N N   . GLU A 1 80  ? -13.141 -35.205 12.709 1.00 26.07  ? 98  GLU B N   1 
ATOM   522  C CA  . GLU A 1 80  ? -13.193 -36.661 12.494 1.00 24.42  ? 98  GLU B CA  1 
ATOM   523  C C   . GLU A 1 80  ? -12.796 -37.527 13.630 1.00 23.79  ? 98  GLU B C   1 
ATOM   524  O O   . GLU A 1 80  ? -12.691 -38.707 13.431 1.00 20.83  ? 98  GLU B O   1 
ATOM   525  C CB  . GLU A 1 80  ? -12.351 -37.090 11.306 1.00 24.20  ? 98  GLU B CB  1 
ATOM   526  C CG  . GLU A 1 80  ? -13.220 -37.098 10.132 1.00 31.20  ? 98  GLU B CG  1 
ATOM   527  C CD  . GLU A 1 80  ? -12.839 -36.091 9.168  1.00 37.34  ? 98  GLU B CD  1 
ATOM   528  O OE1 . GLU A 1 80  ? -11.961 -36.434 8.314  1.00 46.63  ? 98  GLU B OE1 1 
ATOM   529  O OE2 . GLU A 1 80  ? -13.478 -35.029 9.245  1.00 46.97  ? 98  GLU B OE2 1 
ATOM   530  N N   . LEU A 1 81  ? -12.474 -36.935 14.783 1.00 22.21  ? 99  LEU B N   1 
ATOM   531  C CA  . LEU A 1 81  ? -12.275 -37.678 16.006 1.00 24.70  ? 99  LEU B CA  1 
ATOM   532  C C   . LEU A 1 81  ? -13.689 -37.929 16.469 1.00 24.18  ? 99  LEU B C   1 
ATOM   533  O O   . LEU A 1 81  ? -14.648 -37.264 15.990 1.00 26.11  ? 99  LEU B O   1 
ATOM   534  C CB  . LEU A 1 81  ? -11.507 -36.801 17.014 1.00 24.12  ? 99  LEU B CB  1 
ATOM   535  C CG  . LEU A 1 81  ? -10.109 -36.286 16.530 1.00 27.18  ? 99  LEU B CG  1 
ATOM   536  C CD1 . LEU A 1 81  ? -9.488  -35.361 17.583 1.00 24.93  ? 99  LEU B CD1 1 
ATOM   537  C CD2 . LEU A 1 81  ? -9.105  -37.398 16.241 1.00 24.22  ? 99  LEU B CD2 1 
ATOM   538  N N   . SER A 1 82  ? -13.853 -38.890 17.373 1.00 25.01  ? 100 SER B N   1 
ATOM   539  C CA  . SER A 1 82  ? -15.128 -39.167 17.945 1.00 25.58  ? 100 SER B CA  1 
ATOM   540  C C   . SER A 1 82  ? -15.677 -37.914 18.677 1.00 25.99  ? 100 SER B C   1 
ATOM   541  O O   . SER A 1 82  ? -14.913 -37.044 19.105 1.00 27.09  ? 100 SER B O   1 
ATOM   542  C CB  . SER A 1 82  ? -15.091 -40.410 18.829 1.00 26.84  ? 100 SER B CB  1 
ATOM   543  O OG  . SER A 1 82  ? -14.584 -40.176 20.111 1.00 23.14  ? 100 SER B OG  1 
ATOM   544  N N   . PRO A 1 83  ? -16.992 -37.789 18.747 1.00 24.01  ? 101 PRO B N   1 
ATOM   545  C CA  . PRO A 1 83  ? -17.488 -36.618 19.439 1.00 24.33  ? 101 PRO B CA  1 
ATOM   546  C C   . PRO A 1 83  ? -17.076 -36.643 20.925 1.00 22.65  ? 101 PRO B C   1 
ATOM   547  O O   . PRO A 1 83  ? -16.852 -35.582 21.460 1.00 19.93  ? 101 PRO B O   1 
ATOM   548  C CB  . PRO A 1 83  ? -18.998 -36.769 19.324 1.00 23.31  ? 101 PRO B CB  1 
ATOM   549  C CG  . PRO A 1 83  ? -19.171 -37.383 17.958 1.00 29.64  ? 101 PRO B CG  1 
ATOM   550  C CD  . PRO A 1 83  ? -18.001 -38.357 17.832 1.00 26.99  ? 101 PRO B CD  1 
ATOM   551  N N   . ALA A 1 84  ? -17.032 -37.816 21.573 1.00 21.11  ? 102 ALA B N   1 
ATOM   552  C CA  . ALA A 1 84  ? -16.616 -37.878 22.991 1.00 21.98  ? 102 ALA B CA  1 
ATOM   553  C C   . ALA A 1 84  ? -15.147 -37.386 23.118 1.00 20.88  ? 102 ALA B C   1 
ATOM   554  O O   . ALA A 1 84  ? -14.790 -36.682 24.055 1.00 21.89  ? 102 ALA B O   1 
ATOM   555  C CB  . ALA A 1 84  ? -16.835 -39.267 23.588 1.00 21.33  ? 102 ALA B CB  1 
ATOM   556  N N   . ASP A 1 85  ? -14.340 -37.680 22.100 1.00 18.96  ? 103 ASP B N   1 
ATOM   557  C CA  . ASP A 1 85  ? -12.926 -37.366 22.132 1.00 21.34  ? 103 ASP B CA  1 
ATOM   558  C C   . ASP A 1 85  ? -12.677 -35.849 21.875 1.00 21.87  ? 103 ASP B C   1 
ATOM   559  O O   . ASP A 1 85  ? -11.789 -35.228 22.486 1.00 19.47  ? 103 ASP B O   1 
ATOM   560  C CB  . ASP A 1 85  ? -12.128 -38.231 21.126 1.00 20.05  ? 103 ASP B CB  1 
ATOM   561  C CG  . ASP A 1 85  ? -11.798 -39.615 21.689 1.00 22.23  ? 103 ASP B CG  1 
ATOM   562  O OD1 . ASP A 1 85  ? -12.154 -39.907 22.863 1.00 22.30  ? 103 ASP B OD1 1 
ATOM   563  O OD2 . ASP A 1 85  ? -11.103 -40.380 20.996 1.00 22.27  ? 103 ASP B OD2 1 
ATOM   564  N N   . GLN A 1 86  ? -13.450 -35.278 20.951 1.00 20.77  ? 104 GLN B N   1 
ATOM   565  C CA  . GLN A 1 86  ? -13.454 -33.824 20.728 1.00 22.10  ? 104 GLN B CA  1 
ATOM   566  C C   . GLN A 1 86  ? -13.838 -33.063 22.010 1.00 22.81  ? 104 GLN B C   1 
ATOM   567  O O   . GLN A 1 86  ? -13.159 -32.104 22.391 1.00 23.25  ? 104 GLN B O   1 
ATOM   568  C CB  . GLN A 1 86  ? -14.447 -33.420 19.626 1.00 20.96  ? 104 GLN B CB  1 
ATOM   569  C CG  . GLN A 1 86  ? -14.104 -33.991 18.255 1.00 19.38  ? 104 GLN B CG  1 
ATOM   570  C CD  . GLN A 1 86  ? -15.208 -33.627 17.265 1.00 21.55  ? 104 GLN B CD  1 
ATOM   571  O OE1 . GLN A 1 86  ? -15.670 -32.483 17.231 1.00 21.89  ? 104 GLN B OE1 1 
ATOM   572  N NE2 . GLN A 1 86  ? -15.671 -34.607 16.512 1.00 19.00  ? 104 GLN B NE2 1 
ATOM   573  N N   . ASP A 1 87  ? -14.898 -33.476 22.669 1.00 23.38  ? 105 ASP B N   1 
ATOM   574  C CA  . ASP A 1 87  ? -15.289 -32.820 23.931 1.00 24.13  ? 105 ASP B CA  1 
ATOM   575  C C   . ASP A 1 87  ? -14.252 -32.912 25.075 1.00 23.72  ? 105 ASP B C   1 
ATOM   576  O O   . ASP A 1 87  ? -14.033 -31.944 25.815 1.00 19.57  ? 105 ASP B O   1 
ATOM   577  C CB  . ASP A 1 87  ? -16.562 -33.453 24.443 1.00 30.66  ? 105 ASP B CB  1 
ATOM   578  C CG  . ASP A 1 87  ? -17.772 -33.000 23.682 1.00 34.60  ? 105 ASP B CG  1 
ATOM   579  O OD1 . ASP A 1 87  ? -17.695 -32.018 22.906 1.00 37.85  ? 105 ASP B OD1 1 
ATOM   580  O OD2 . ASP A 1 87  ? -18.788 -33.669 23.865 1.00 40.22  ? 105 ASP B OD2 1 
ATOM   581  N N   . LEU A 1 88  ? -13.672 -34.096 25.246 1.00 25.34  ? 106 LEU B N   1 
ATOM   582  C CA  . LEU A 1 88  ? -12.607 -34.270 26.226 1.00 23.18  ? 106 LEU B CA  1 
ATOM   583  C C   . LEU A 1 88  ? -11.387 -33.439 25.859 1.00 22.22  ? 106 LEU B C   1 
ATOM   584  O O   . LEU A 1 88  ? -10.798 -32.799 26.735 1.00 22.64  ? 106 LEU B O   1 
ATOM   585  C CB  . LEU A 1 88  ? -12.207 -35.726 26.307 1.00 22.52  ? 106 LEU B CB  1 
ATOM   586  C CG  . LEU A 1 88  ? -11.096 -36.139 27.290 1.00 23.65  ? 106 LEU B CG  1 
ATOM   587  C CD1 . LEU A 1 88  ? -11.495 -35.917 28.788 1.00 20.37  ? 106 LEU B CD1 1 
ATOM   588  C CD2 . LEU A 1 88  ? -10.689 -37.574 27.070 1.00 23.49  ? 106 LEU B CD2 1 
ATOM   589  N N   . LEU A 1 89  ? -10.948 -33.481 24.603 1.00 19.55  ? 107 LEU B N   1 
ATOM   590  C CA  . LEU A 1 89  ? -9.769  -32.634 24.197 1.00 20.09  ? 107 LEU B CA  1 
ATOM   591  C C   . LEU A 1 89  ? -9.946  -31.191 24.459 1.00 21.94  ? 107 LEU B C   1 
ATOM   592  O O   . LEU A 1 89  ? -9.059  -30.575 25.117 1.00 19.22  ? 107 LEU B O   1 
ATOM   593  C CB  . LEU A 1 89  ? -9.303  -32.859 22.733 1.00 20.51  ? 107 LEU B CB  1 
ATOM   594  C CG  . LEU A 1 89  ? -8.701  -34.247 22.395 1.00 20.80  ? 107 LEU B CG  1 
ATOM   595  C CD1 . LEU A 1 89  ? -8.436  -34.562 20.902 1.00 21.51  ? 107 LEU B CD1 1 
ATOM   596  C CD2 . LEU A 1 89  ? -7.427  -34.578 23.138 1.00 18.58  ? 107 LEU B CD2 1 
ATOM   597  N N   . LEU A 1 90  ? -11.125 -30.675 24.034 1.00 21.20  ? 108 LEU B N   1 
ATOM   598  C CA  . LEU A 1 90  ? -11.513 -29.272 24.215 1.00 22.32  ? 108 LEU B CA  1 
ATOM   599  C C   . LEU A 1 90  ? -11.558 -28.833 25.706 1.00 22.22  ? 108 LEU B C   1 
ATOM   600  O O   . LEU A 1 90  ? -10.875 -27.881 26.114 1.00 19.97  ? 108 LEU B O   1 
ATOM   601  C CB  . LEU A 1 90  ? -12.865 -29.028 23.577 1.00 23.97  ? 108 LEU B CB  1 
ATOM   602  C CG  . LEU A 1 90  ? -13.179 -28.171 22.344 1.00 28.36  ? 108 LEU B CG  1 
ATOM   603  C CD1 . LEU A 1 90  ? -12.003 -27.406 21.720 1.00 26.10  ? 108 LEU B CD1 1 
ATOM   604  C CD2 . LEU A 1 90  ? -14.135 -28.848 21.333 1.00 24.66  ? 108 LEU B CD2 1 
ATOM   605  N N   . GLU A 1 91  ? -12.297 -29.576 26.521 1.00 24.42  ? 109 GLU B N   1 
ATOM   606  C CA  . GLU A 1 91  ? -12.346 -29.316 27.977 1.00 27.54  ? 109 GLU B CA  1 
ATOM   607  C C   . GLU A 1 91  ? -10.963 -29.371 28.670 1.00 23.66  ? 109 GLU B C   1 
ATOM   608  O O   . GLU A 1 91  ? -10.613 -28.498 29.491 1.00 21.29  ? 109 GLU B O   1 
ATOM   609  C CB  . GLU A 1 91  ? -13.314 -30.333 28.613 1.00 31.18  ? 109 GLU B CB  1 
ATOM   610  C CG  . GLU A 1 91  ? -13.890 -29.963 29.962 1.00 41.72  ? 109 GLU B CG  1 
ATOM   611  C CD  . GLU A 1 91  ? -15.109 -30.851 30.300 1.00 45.56  ? 109 GLU B CD  1 
ATOM   612  O OE1 . GLU A 1 91  ? -16.232 -30.309 30.516 1.00 47.09  ? 109 GLU B OE1 1 
ATOM   613  O OE2 . GLU A 1 91  ? -14.937 -32.090 30.301 1.00 43.76  ? 109 GLU B OE2 1 
ATOM   614  N N   . SER A 1 92  ? -10.191 -30.413 28.336 1.00 23.00  ? 110 SER B N   1 
ATOM   615  C CA  . SER A 1 92  ? -8.868  -30.676 28.950 1.00 21.22  ? 110 SER B CA  1 
ATOM   616  C C   . SER A 1 92  ? -7.810  -29.602 28.561 1.00 20.94  ? 110 SER B C   1 
ATOM   617  O O   . SER A 1 92  ? -6.888  -29.319 29.329 1.00 19.39  ? 110 SER B O   1 
ATOM   618  C CB  . SER A 1 92  ? -8.355  -32.019 28.488 1.00 19.85  ? 110 SER B CB  1 
ATOM   619  O OG  . SER A 1 92  ? -9.057  -33.087 29.029 1.00 24.28  ? 110 SER B OG  1 
ATOM   620  N N   . ALA A 1 93  ? -7.983  -29.008 27.375 1.00 22.13  ? 111 ALA B N   1 
ATOM   621  C CA  . ALA A 1 93  ? -7.076  -28.001 26.795 1.00 20.56  ? 111 ALA B CA  1 
ATOM   622  C C   . ALA A 1 93  ? -7.566  -26.544 26.992 1.00 21.60  ? 111 ALA B C   1 
ATOM   623  O O   . ALA A 1 93  ? -6.822  -25.624 26.715 1.00 19.95  ? 111 ALA B O   1 
ATOM   624  C CB  . ALA A 1 93  ? -6.904  -28.246 25.275 1.00 18.47  ? 111 ALA B CB  1 
ATOM   625  N N   . PHE A 1 94  ? -8.798  -26.345 27.493 1.00 21.60  ? 112 PHE B N   1 
ATOM   626  C CA  . PHE A 1 94  ? -9.358  -25.042 27.563 1.00 20.86  ? 112 PHE B CA  1 
ATOM   627  C C   . PHE A 1 94  ? -8.488  -23.975 28.275 1.00 23.31  ? 112 PHE B C   1 
ATOM   628  O O   . PHE A 1 94  ? -8.157  -22.929 27.703 1.00 25.89  ? 112 PHE B O   1 
ATOM   629  C CB  . PHE A 1 94  ? -10.786 -25.055 28.149 1.00 21.54  ? 112 PHE B CB  1 
ATOM   630  C CG  . PHE A 1 94  ? -11.286 -23.691 28.350 1.00 24.16  ? 112 PHE B CG  1 
ATOM   631  C CD1 . PHE A 1 94  ? -11.554 -22.887 27.248 1.00 25.39  ? 112 PHE B CD1 1 
ATOM   632  C CD2 . PHE A 1 94  ? -11.355 -23.131 29.634 1.00 23.45  ? 112 PHE B CD2 1 
ATOM   633  C CE1 . PHE A 1 94  ? -11.882 -21.542 27.418 1.00 27.58  ? 112 PHE B CE1 1 
ATOM   634  C CE2 . PHE A 1 94  ? -11.719 -21.814 29.791 1.00 28.14  ? 112 PHE B CE2 1 
ATOM   635  C CZ  . PHE A 1 94  ? -11.964 -21.010 28.689 1.00 26.49  ? 112 PHE B CZ  1 
ATOM   636  N N   . LEU A 1 95  ? -8.081  -24.241 29.504 1.00 22.26  ? 113 LEU B N   1 
ATOM   637  C CA  . LEU A 1 95  ? -7.280  -23.262 30.229 1.00 23.06  ? 113 LEU B CA  1 
ATOM   638  C C   . LEU A 1 95  ? -5.961  -22.958 29.534 1.00 22.73  ? 113 LEU B C   1 
ATOM   639  O O   . LEU A 1 95  ? -5.639  -21.777 29.318 1.00 25.33  ? 113 LEU B O   1 
ATOM   640  C CB  . LEU A 1 95  ? -7.070  -23.753 31.665 1.00 24.92  ? 113 LEU B CB  1 
ATOM   641  C CG  . LEU A 1 95  ? -7.733  -23.109 32.857 1.00 27.43  ? 113 LEU B CG  1 
ATOM   642  C CD1 . LEU A 1 95  ? -8.944  -22.227 32.562 1.00 27.65  ? 113 LEU B CD1 1 
ATOM   643  C CD2 . LEU A 1 95  ? -7.860  -23.967 34.139 1.00 24.94  ? 113 LEU B CD2 1 
ATOM   644  N N   . GLU A 1 96  ? -5.228  -23.989 29.147 1.00 19.33  ? 114 GLU B N   1 
ATOM   645  C CA  . GLU A 1 96  ? -3.991  -23.864 28.365 1.00 20.96  ? 114 GLU B CA  1 
ATOM   646  C C   . GLU A 1 96  ? -4.175  -23.082 27.008 1.00 24.52  ? 114 GLU B C   1 
ATOM   647  O O   . GLU A 1 96  ? -3.365  -22.190 26.630 1.00 24.45  ? 114 GLU B O   1 
ATOM   648  C CB  . GLU A 1 96  ? -3.442  -25.247 28.030 1.00 22.47  ? 114 GLU B CB  1 
ATOM   649  C CG  . GLU A 1 96  ? -2.795  -26.119 29.141 1.00 22.88  ? 114 GLU B CG  1 
ATOM   650  C CD  . GLU A 1 96  ? -2.723  -27.580 28.677 1.00 24.21  ? 114 GLU B CD  1 
ATOM   651  O OE1 . GLU A 1 96  ? -3.735  -28.343 28.875 1.00 23.74  ? 114 GLU B OE1 1 
ATOM   652  O OE2 . GLU A 1 96  ? -1.698  -27.926 28.008 1.00 22.00  ? 114 GLU B OE2 1 
ATOM   653  N N   . LEU A 1 97  ? -5.256  -23.368 26.302 1.00 21.53  ? 115 LEU B N   1 
ATOM   654  C CA  . LEU A 1 97  ? -5.484  -22.595 25.051 1.00 23.37  ? 115 LEU B CA  1 
ATOM   655  C C   . LEU A 1 97  ? -5.749  -21.119 25.322 1.00 21.39  ? 115 LEU B C   1 
ATOM   656  O O   . LEU A 1 97  ? -5.195  -20.211 24.644 1.00 26.40  ? 115 LEU B O   1 
ATOM   657  C CB  . LEU A 1 97  ? -6.625  -23.230 24.238 1.00 21.01  ? 115 LEU B CB  1 
ATOM   658  C CG  . LEU A 1 97  ? -6.215  -24.613 23.710 1.00 20.37  ? 115 LEU B CG  1 
ATOM   659  C CD1 . LEU A 1 97  ? -7.488  -25.345 23.259 1.00 18.23  ? 115 LEU B CD1 1 
ATOM   660  C CD2 . LEU A 1 97  ? -5.234  -24.384 22.559 1.00 22.05  ? 115 LEU B CD2 1 
ATOM   661  N N   . PHE A 1 98  ? -6.651  -20.874 26.254 1.00 24.53  ? 116 PHE B N   1 
ATOM   662  C CA  . PHE A 1 98  ? -6.901  -19.541 26.806 1.00 25.46  ? 116 PHE B CA  1 
ATOM   663  C C   . PHE A 1 98  ? -5.614  -18.769 27.146 1.00 26.60  ? 116 PHE B C   1 
ATOM   664  O O   . PHE A 1 98  ? -5.431  -17.617 26.681 1.00 26.49  ? 116 PHE B O   1 
ATOM   665  C CB  . PHE A 1 98  ? -7.792  -19.595 28.057 1.00 25.60  ? 116 PHE B CB  1 
ATOM   666  C CG  . PHE A 1 98  ? -8.006  -18.252 28.661 1.00 23.91  ? 116 PHE B CG  1 
ATOM   667  C CD1 . PHE A 1 98  ? -8.846  -17.324 28.036 1.00 24.73  ? 116 PHE B CD1 1 
ATOM   668  C CD2 . PHE A 1 98  ? -7.292  -17.866 29.804 1.00 21.23  ? 116 PHE B CD2 1 
ATOM   669  C CE1 . PHE A 1 98  ? -9.036  -16.050 28.592 1.00 27.03  ? 116 PHE B CE1 1 
ATOM   670  C CE2 . PHE A 1 98  ? -7.446  -16.587 30.330 1.00 23.07  ? 116 PHE B CE2 1 
ATOM   671  C CZ  . PHE A 1 98  ? -8.318  -15.673 29.719 1.00 22.51  ? 116 PHE B CZ  1 
ATOM   672  N N   . ILE A 1 99  ? -4.700  -19.422 27.860 1.00 24.28  ? 117 ILE B N   1 
ATOM   673  C CA  . ILE A 1 99  ? -3.497  -18.783 28.339 1.00 22.85  ? 117 ILE B CA  1 
ATOM   674  C C   . ILE A 1 99  ? -2.507  -18.555 27.188 1.00 23.61  ? 117 ILE B C   1 
ATOM   675  O O   . ILE A 1 99  ? -1.923  -17.476 27.074 1.00 20.48  ? 117 ILE B O   1 
ATOM   676  C CB  . ILE A 1 99  ? -2.740  -19.629 29.396 1.00 22.90  ? 117 ILE B CB  1 
ATOM   677  C CG1 . ILE A 1 99  ? -3.545  -20.021 30.641 1.00 26.59  ? 117 ILE B CG1 1 
ATOM   678  C CG2 . ILE A 1 99  ? -1.386  -18.985 29.817 1.00 21.89  ? 117 ILE B CG2 1 
ATOM   679  C CD1 . ILE A 1 99  ? -3.104  -21.450 31.172 1.00 25.01  ? 117 ILE B CD1 1 
ATOM   680  N N   . LEU A 1 100 ? -2.257  -19.598 26.396 1.00 24.02  ? 118 LEU B N   1 
ATOM   681  C CA  . LEU A 1 100 ? -1.288  -19.492 25.298 1.00 21.03  ? 118 LEU B CA  1 
ATOM   682  C C   . LEU A 1 100 ? -1.758  -18.429 24.311 1.00 21.73  ? 118 LEU B C   1 
ATOM   683  O O   . LEU A 1 100 ? -0.971  -17.697 23.826 1.00 19.80  ? 118 LEU B O   1 
ATOM   684  C CB  . LEU A 1 100 ? -1.210  -20.799 24.536 1.00 20.87  ? 118 LEU B CB  1 
ATOM   685  C CG  . LEU A 1 100 ? -0.308  -20.801 23.323 1.00 21.25  ? 118 LEU B CG  1 
ATOM   686  C CD1 . LEU A 1 100 ? 1.173   -20.512 23.759 1.00 19.71  ? 118 LEU B CD1 1 
ATOM   687  C CD2 . LEU A 1 100 ? -0.371  -22.114 22.574 1.00 20.11  ? 118 LEU B CD2 1 
ATOM   688  N N   . ARG A 1 101 ? -3.036  -18.430 23.954 1.00 21.05  ? 119 ARG B N   1 
ATOM   689  C CA  . ARG A 1 101 ? -3.526  -17.497 22.955 1.00 21.54  ? 119 ARG B CA  1 
ATOM   690  C C   . ARG A 1 101 ? -3.560  -16.061 23.503 1.00 20.42  ? 119 ARG B C   1 
ATOM   691  O O   . ARG A 1 101 ? -3.216  -15.119 22.771 1.00 20.46  ? 119 ARG B O   1 
ATOM   692  C CB  . ARG A 1 101 ? -4.882  -17.901 22.375 1.00 17.17  ? 119 ARG B CB  1 
ATOM   693  C CG  . ARG A 1 101 ? -4.771  -19.044 21.342 1.00 18.25  ? 119 ARG B CG  1 
ATOM   694  C CD  . ARG A 1 101 ? -6.021  -19.932 21.342 1.00 20.68  ? 119 ARG B CD  1 
ATOM   695  N NE  . ARG A 1 101 ? -7.201  -19.070 21.192 1.00 20.06  ? 119 ARG B NE  1 
ATOM   696  C CZ  . ARG A 1 101 ? -7.781  -18.737 20.042 1.00 19.09  ? 119 ARG B CZ  1 
ATOM   697  N NH1 . ARG A 1 101 ? -7.258  -19.129 18.882 1.00 19.14  ? 119 ARG B NH1 1 
ATOM   698  N NH2 . ARG A 1 101 ? -8.840  -17.930 20.071 1.00 20.87  ? 119 ARG B NH2 1 
ATOM   699  N N   . LEU A 1 102 ? -3.927  -15.898 24.762 1.00 18.77  ? 120 LEU B N   1 
ATOM   700  C CA  . LEU A 1 102 ? -3.793  -14.585 25.435 1.00 18.57  ? 120 LEU B CA  1 
ATOM   701  C C   . LEU A 1 102 ? -2.356  -14.070 25.400 1.00 22.15  ? 120 LEU B C   1 
ATOM   702  O O   . LEU A 1 102 ? -2.038  -12.961 24.891 1.00 24.98  ? 120 LEU B O   1 
ATOM   703  C CB  . LEU A 1 102 ? -4.389  -14.609 26.905 1.00 17.53  ? 120 LEU B CB  1 
ATOM   704  C CG  . LEU A 1 102 ? -4.475  -13.303 27.736 1.00 18.81  ? 120 LEU B CG  1 
ATOM   705  C CD1 . LEU A 1 102 ? -5.425  -12.318 26.986 1.00 17.45  ? 120 LEU B CD1 1 
ATOM   706  C CD2 . LEU A 1 102 ? -5.017  -13.566 29.192 1.00 18.77  ? 120 LEU B CD2 1 
ATOM   707  N N   . ALA A 1 103 ? -1.453  -14.903 25.895 1.00 23.22  ? 121 ALA B N   1 
ATOM   708  C CA  . ALA A 1 103 ? -0.033  -14.589 25.967 1.00 23.82  ? 121 ALA B CA  1 
ATOM   709  C C   . ALA A 1 103 ? 0.524   -14.069 24.656 1.00 27.58  ? 121 ALA B C   1 
ATOM   710  O O   . ALA A 1 103 ? 1.228   -13.031 24.622 1.00 26.09  ? 121 ALA B O   1 
ATOM   711  C CB  . ALA A 1 103 ? 0.748   -15.840 26.410 1.00 23.64  ? 121 ALA B CB  1 
ATOM   712  N N   . TYR A 1 104 ? 0.214   -14.783 23.590 1.00 25.59  ? 122 TYR B N   1 
ATOM   713  C CA  . TYR A 1 104 ? 0.673   -14.428 22.228 1.00 26.21  ? 122 TYR B CA  1 
ATOM   714  C C   . TYR A 1 104 ? 0.055   -13.184 21.695 1.00 26.06  ? 122 TYR B C   1 
ATOM   715  O O   . TYR A 1 104 ? 0.715   -12.419 20.945 1.00 29.75  ? 122 TYR B O   1 
ATOM   716  C CB  . TYR A 1 104 ? 0.358   -15.561 21.279 1.00 24.89  ? 122 TYR B CB  1 
ATOM   717  C CG  . TYR A 1 104 ? 1.016   -15.532 19.878 1.00 28.82  ? 122 TYR B CG  1 
ATOM   718  C CD1 . TYR A 1 104 ? 2.405   -15.459 19.735 1.00 25.84  ? 122 TYR B CD1 1 
ATOM   719  C CD2 . TYR A 1 104 ? 0.244   -15.619 18.722 1.00 28.08  ? 122 TYR B CD2 1 
ATOM   720  C CE1 . TYR A 1 104 ? 2.999   -15.467 18.488 1.00 29.33  ? 122 TYR B CE1 1 
ATOM   721  C CE2 . TYR A 1 104 ? 0.835   -15.657 17.449 1.00 28.29  ? 122 TYR B CE2 1 
ATOM   722  C CZ  . TYR A 1 104 ? 2.225   -15.558 17.349 1.00 29.66  ? 122 TYR B CZ  1 
ATOM   723  O OH  . TYR A 1 104 ? 2.893   -15.586 16.128 1.00 30.74  ? 122 TYR B OH  1 
ATOM   724  N N   . ARG A 1 105 ? -1.204  -12.953 22.068 1.00 25.94  ? 123 ARG B N   1 
ATOM   725  C CA  . ARG A 1 105 ? -1.949  -11.771 21.641 1.00 25.33  ? 123 ARG B CA  1 
ATOM   726  C C   . ARG A 1 105 ? -1.566  -10.545 22.481 1.00 25.86  ? 123 ARG B C   1 
ATOM   727  O O   . ARG A 1 105 ? -1.619  -9.453  22.018 1.00 22.19  ? 123 ARG B O   1 
ATOM   728  C CB  . ARG A 1 105 ? -3.438  -12.001 21.879 1.00 23.27  ? 123 ARG B CB  1 
ATOM   729  C CG  . ARG A 1 105 ? -4.313  -11.296 20.881 1.00 22.94  ? 123 ARG B CG  1 
ATOM   730  C CD  . ARG A 1 105 ? -5.836  -11.568 21.116 1.00 23.44  ? 123 ARG B CD  1 
ATOM   731  N NE  . ARG A 1 105 ? -6.253  -12.995 20.950 1.00 21.25  ? 123 ARG B NE  1 
ATOM   732  C CZ  . ARG A 1 105 ? -6.610  -13.795 21.956 1.00 20.01  ? 123 ARG B CZ  1 
ATOM   733  N NH1 . ARG A 1 105 ? -6.623  -13.386 23.225 1.00 20.19  ? 123 ARG B NH1 1 
ATOM   734  N NH2 . ARG A 1 105 ? -6.944  -15.055 21.700 1.00 21.40  ? 123 ARG B NH2 1 
ATOM   735  N N   . SER A 1 106 ? -1.278  -10.709 23.770 1.00 27.19  ? 124 SER B N   1 
ATOM   736  C CA  . SER A 1 106 ? -1.054  -9.502  24.557 1.00 24.36  ? 124 SER B CA  1 
ATOM   737  C C   . SER A 1 106 ? 0.303   -8.764  24.278 1.00 26.37  ? 124 SER B C   1 
ATOM   738  O O   . SER A 1 106 ? 1.124   -9.162  23.399 1.00 25.34  ? 124 SER B O   1 
ATOM   739  C CB  . SER A 1 106 ? -1.162  -9.867  26.011 1.00 25.36  ? 124 SER B CB  1 
ATOM   740  O OG  . SER A 1 106 ? -2.419  -10.353 26.247 1.00 21.82  ? 124 SER B OG  1 
ATOM   741  N N   . LYS A 1 107 ? 0.549   -7.707  25.052 1.00 25.47  ? 125 LYS B N   1 
ATOM   742  C CA  . LYS A 1 107 ? 1.738   -6.900  24.854 1.00 27.31  ? 125 LYS B CA  1 
ATOM   743  C C   . LYS A 1 107 ? 2.307   -6.729  26.242 1.00 26.23  ? 125 LYS B C   1 
ATOM   744  O O   . LYS A 1 107 ? 2.006   -5.731  26.916 1.00 25.41  ? 125 LYS B O   1 
ATOM   745  C CB  . LYS A 1 107 ? 1.368   -5.504  24.290 1.00 29.09  ? 125 LYS B CB  1 
ATOM   746  C CG  . LYS A 1 107 ? 0.535   -5.506  23.015 1.00 35.15  ? 125 LYS B CG  1 
ATOM   747  C CD  . LYS A 1 107 ? 1.379   -5.959  21.835 1.00 38.13  ? 125 LYS B CD  1 
ATOM   748  C CE  . LYS A 1 107 ? 0.519   -6.039  20.577 1.00 42.72  ? 125 LYS B CE  1 
ATOM   749  N NZ  . LYS A 1 107 ? 1.159   -6.869  19.508 1.00 45.01  ? 125 LYS B NZ  1 
ATOM   750  N N   . PRO A 1 108 ? 3.120   -7.699  26.688 1.00 28.06  ? 126 PRO B N   1 
ATOM   751  C CA  . PRO A 1 108 ? 3.573   -7.619  28.044 1.00 29.23  ? 126 PRO B CA  1 
ATOM   752  C C   . PRO A 1 108 ? 4.560   -6.457  28.358 1.00 30.95  ? 126 PRO B C   1 
ATOM   753  O O   . PRO A 1 108 ? 4.595   -5.952  29.515 1.00 30.11  ? 126 PRO B O   1 
ATOM   754  C CB  . PRO A 1 108 ? 4.185   -9.020  28.287 1.00 30.10  ? 126 PRO B CB  1 
ATOM   755  C CG  . PRO A 1 108 ? 4.529   -9.553  26.959 1.00 27.81  ? 126 PRO B CG  1 
ATOM   756  C CD  . PRO A 1 108 ? 3.635   -8.899  25.965 1.00 27.92  ? 126 PRO B CD  1 
ATOM   757  N N   . GLY A 1 109 ? 5.317   -5.992  27.361 1.00 31.24  ? 127 GLY B N   1 
ATOM   758  C CA  . GLY A 1 109 ? 6.230   -4.839  27.584 1.00 34.68  ? 127 GLY B CA  1 
ATOM   759  C C   . GLY A 1 109 ? 5.456   -3.645  28.143 1.00 37.84  ? 127 GLY B C   1 
ATOM   760  O O   . GLY A 1 109 ? 5.989   -2.870  28.975 1.00 37.51  ? 127 GLY B O   1 
ATOM   761  N N   . GLU A 1 110 ? 4.185   -3.537  27.732 1.00 35.00  ? 128 GLU B N   1 
ATOM   762  C CA  . GLU A 1 110 ? 3.292   -2.437  28.146 1.00 38.51  ? 128 GLU B CA  1 
ATOM   763  C C   . GLU A 1 110 ? 2.187   -2.784  29.210 1.00 36.19  ? 128 GLU B C   1 
ATOM   764  O O   . GLU A 1 110 ? 1.270   -1.988  29.473 1.00 30.48  ? 128 GLU B O   1 
ATOM   765  C CB  . GLU A 1 110 ? 2.661   -1.762  26.886 1.00 40.70  ? 128 GLU B CB  1 
ATOM   766  C CG  . GLU A 1 110 ? 3.641   -1.193  25.841 1.00 41.55  ? 128 GLU B CG  1 
ATOM   767  C CD  . GLU A 1 110 ? 3.966   -2.171  24.708 1.00 55.33  ? 128 GLU B CD  1 
ATOM   768  O OE1 . GLU A 1 110 ? 3.160   -2.303  23.742 1.00 68.05  ? 128 GLU B OE1 1 
ATOM   769  O OE2 . GLU A 1 110 ? 5.041   -2.815  24.755 1.00 53.87  ? 128 GLU B OE2 1 
ATOM   770  N N   . GLY A 1 111 ? 2.218   -3.974  29.796 1.00 32.20  ? 129 GLY B N   1 
ATOM   771  C CA  . GLY A 1 111 ? 1.131   -4.331  30.751 1.00 30.17  ? 129 GLY B CA  1 
ATOM   772  C C   . GLY A 1 111 ? -0.246  -4.506  30.084 1.00 27.34  ? 129 GLY B C   1 
ATOM   773  O O   . GLY A 1 111 ? -1.253  -4.413  30.756 1.00 28.26  ? 129 GLY B O   1 
ATOM   774  N N   . LYS A 1 112 ? -0.305  -4.752  28.771 1.00 25.48  ? 130 LYS B N   1 
ATOM   775  C CA  . LYS A 1 112 ? -1.615  -4.768  28.059 1.00 30.71  ? 130 LYS B CA  1 
ATOM   776  C C   . LYS A 1 112 ? -2.117  -6.178  27.798 1.00 24.95  ? 130 LYS B C   1 
ATOM   777  O O   . LYS A 1 112 ? -1.439  -6.910  27.098 1.00 23.62  ? 130 LYS B O   1 
ATOM   778  C CB  . LYS A 1 112 ? -1.487  -4.177  26.651 1.00 35.55  ? 130 LYS B CB  1 
ATOM   779  C CG  . LYS A 1 112 ? -1.806  -2.714  26.459 1.00 45.87  ? 130 LYS B CG  1 
ATOM   780  C CD  . LYS A 1 112 ? -2.212  -2.529  25.003 1.00 45.28  ? 130 LYS B CD  1 
ATOM   781  C CE  . LYS A 1 112 ? -1.088  -2.006  24.116 1.00 52.52  ? 130 LYS B CE  1 
ATOM   782  N NZ  . LYS A 1 112 ? -1.126  -0.513  24.050 1.00 51.67  ? 130 LYS B NZ  1 
ATOM   783  N N   . LEU A 1 113 ? -3.340  -6.502  28.254 1.00 23.76  ? 131 LEU B N   1 
ATOM   784  C CA  . LEU A 1 113 ? -3.970  -7.787  27.938 1.00 22.42  ? 131 LEU B CA  1 
ATOM   785  C C   . LEU A 1 113 ? -4.967  -7.562  26.845 1.00 21.80  ? 131 LEU B C   1 
ATOM   786  O O   . LEU A 1 113 ? -5.771  -6.642  26.949 1.00 23.04  ? 131 LEU B O   1 
ATOM   787  C CB  . LEU A 1 113 ? -4.658  -8.369  29.156 1.00 19.63  ? 131 LEU B CB  1 
ATOM   788  C CG  . LEU A 1 113 ? -3.715  -9.036  30.191 1.00 21.86  ? 131 LEU B CG  1 
ATOM   789  C CD1 . LEU A 1 113 ? -2.613  -9.995  29.655 1.00 17.53  ? 131 LEU B CD1 1 
ATOM   790  C CD2 . LEU A 1 113 ? -3.094  -8.034  31.116 1.00 24.39  ? 131 LEU B CD2 1 
ATOM   791  N N   . ILE A 1 114 ? -4.840  -8.342  25.775 1.00 21.24  ? 132 ILE B N   1 
ATOM   792  C CA  . ILE A 1 114 ? -5.770  -8.275  24.651 1.00 22.66  ? 132 ILE B CA  1 
ATOM   793  C C   . ILE A 1 114 ? -6.535  -9.604  24.559 1.00 24.07  ? 132 ILE B C   1 
ATOM   794  O O   . ILE A 1 114 ? -5.943  -10.619 24.299 1.00 21.84  ? 132 ILE B O   1 
ATOM   795  C CB  . ILE A 1 114 ? -5.039  -8.022  23.313 1.00 23.03  ? 132 ILE B CB  1 
ATOM   796  C CG1 . ILE A 1 114 ? -4.206  -6.715  23.428 1.00 24.79  ? 132 ILE B CG1 1 
ATOM   797  C CG2 . ILE A 1 114 ? -6.070  -7.898  22.183 1.00 24.43  ? 132 ILE B CG2 1 
ATOM   798  C CD1 . ILE A 1 114 ? -3.499  -6.301  22.143 1.00 23.36  ? 132 ILE B CD1 1 
ATOM   799  N N   . PHE A 1 115 ? -7.843  -9.579  24.815 1.00 24.57  ? 133 PHE B N   1 
ATOM   800  C CA  . PHE A 1 115 ? -8.695  -10.755 24.755 1.00 23.15  ? 133 PHE B CA  1 
ATOM   801  C C   . PHE A 1 115 ? -9.218  -11.031 23.332 1.00 24.21  ? 133 PHE B C   1 
ATOM   802  O O   . PHE A 1 115 ? -9.093  -10.182 22.436 1.00 20.60  ? 133 PHE B O   1 
ATOM   803  C CB  . PHE A 1 115 ? -9.807  -10.584 25.804 1.00 22.92  ? 133 PHE B CB  1 
ATOM   804  C CG  . PHE A 1 115 ? -9.229  -10.453 27.191 1.00 26.20  ? 133 PHE B CG  1 
ATOM   805  C CD1 . PHE A 1 115 ? -8.900  -9.201  27.732 1.00 25.93  ? 133 PHE B CD1 1 
ATOM   806  C CD2 . PHE A 1 115 ? -8.875  -11.576 27.903 1.00 23.96  ? 133 PHE B CD2 1 
ATOM   807  C CE1 . PHE A 1 115 ? -8.298  -9.093  28.964 1.00 23.85  ? 133 PHE B CE1 1 
ATOM   808  C CE2 . PHE A 1 115 ? -8.255  -11.461 29.136 1.00 22.05  ? 133 PHE B CE2 1 
ATOM   809  C CZ  . PHE A 1 115 ? -7.963  -10.213 29.657 1.00 22.19  ? 133 PHE B CZ  1 
ATOM   810  N N   . CYS A 1 116 ? -9.792  -12.215 23.137 1.00 23.34  ? 134 CYS B N   1 
ATOM   811  C CA  . CYS A 1 116 ? -10.199 -12.634 21.816 1.00 24.73  ? 134 CYS B CA  1 
ATOM   812  C C   . CYS A 1 116 ? -11.404 -11.841 21.306 1.00 24.15  ? 134 CYS B C   1 
ATOM   813  O O   . CYS A 1 116 ? -11.534 -11.685 20.113 1.00 27.48  ? 134 CYS B O   1 
ATOM   814  C CB  . CYS A 1 116 ? -10.447 -14.139 21.765 1.00 27.00  ? 134 CYS B CB  1 
ATOM   815  S SG  . CYS A 1 116 ? -11.876 -14.691 22.690 1.00 27.49  ? 134 CYS B SG  1 
ATOM   816  N N   . SER A 1 117 ? -12.211 -11.259 22.192 1.00 27.46  ? 135 SER B N   1 
ATOM   817  C CA  . SER A 1 117 ? -13.284 -10.339 21.744 1.00 27.56  ? 135 SER B CA  1 
ATOM   818  C C   . SER A 1 117 ? -12.685 -9.097  21.067 1.00 30.95  ? 135 SER B C   1 
ATOM   819  O O   . SER A 1 117 ? -13.377 -8.423  20.318 1.00 29.14  ? 135 SER B O   1 
ATOM   820  C CB  . SER A 1 117 ? -14.167 -9.874  22.906 1.00 29.32  ? 135 SER B CB  1 
ATOM   821  O OG  . SER A 1 117 ? -13.415 -9.003  23.762 1.00 26.52  ? 135 SER B OG  1 
ATOM   822  N N   . GLY A 1 118 ? -11.412 -8.793  21.341 1.00 28.20  ? 136 GLY B N   1 
ATOM   823  C CA  . GLY A 1 118 ? -10.826 -7.496  20.955 1.00 26.55  ? 136 GLY B CA  1 
ATOM   824  C C   . GLY A 1 118 ? -10.642 -6.538  22.115 1.00 25.65  ? 136 GLY B C   1 
ATOM   825  O O   . GLY A 1 118 ? -9.916  -5.528  21.984 1.00 25.13  ? 136 GLY B O   1 
ATOM   826  N N   . LEU A 1 119 ? -11.281 -6.852  23.255 1.00 25.75  ? 137 LEU B N   1 
ATOM   827  C CA  . LEU A 1 119 ? -11.206 -6.049  24.469 1.00 25.67  ? 137 LEU B CA  1 
ATOM   828  C C   . LEU A 1 119 ? -9.760  -5.883  24.974 1.00 26.06  ? 137 LEU B C   1 
ATOM   829  O O   . LEU A 1 119 ? -9.027  -6.869  25.132 1.00 24.67  ? 137 LEU B O   1 
ATOM   830  C CB  . LEU A 1 119 ? -12.092 -6.640  25.604 1.00 30.38  ? 137 LEU B CB  1 
ATOM   831  C CG  . LEU A 1 119 ? -12.099 -5.779  26.888 1.00 27.57  ? 137 LEU B CG  1 
ATOM   832  C CD1 . LEU A 1 119 ? -12.632 -4.392  26.591 1.00 28.69  ? 137 LEU B CD1 1 
ATOM   833  C CD2 . LEU A 1 119 ? -12.881 -6.425  28.010 1.00 31.26  ? 137 LEU B CD2 1 
ATOM   834  N N   . VAL A 1 120 ? -9.317  -4.635  25.168 1.00 23.36  ? 138 VAL B N   1 
ATOM   835  C CA  . VAL A 1 120 ? -7.995  -4.411  25.777 1.00 21.81  ? 138 VAL B CA  1 
ATOM   836  C C   . VAL A 1 120 ? -8.088  -3.921  27.212 1.00 20.42  ? 138 VAL B C   1 
ATOM   837  O O   . VAL A 1 120 ? -8.809  -2.973  27.468 1.00 23.00  ? 138 VAL B O   1 
ATOM   838  C CB  . VAL A 1 120 ? -7.166  -3.438  24.918 1.00 20.50  ? 138 VAL B CB  1 
ATOM   839  C CG1 . VAL A 1 120 ? -5.755  -3.445  25.425 1.00 18.15  ? 138 VAL B CG1 1 
ATOM   840  C CG2 . VAL A 1 120 ? -7.161  -3.977  23.500 1.00 19.19  ? 138 VAL B CG2 1 
ATOM   841  N N   . LEU A 1 121 ? -7.371  -4.589  28.135 1.00 22.46  ? 139 LEU B N   1 
ATOM   842  C CA  . LEU A 1 121 ? -7.392  -4.222  29.575 1.00 24.28  ? 139 LEU B CA  1 
ATOM   843  C C   . LEU A 1 121 ? -5.970  -4.132  30.036 1.00 22.65  ? 139 LEU B C   1 
ATOM   844  O O   . LEU A 1 121 ? -5.145  -4.863  29.576 1.00 26.37  ? 139 LEU B O   1 
ATOM   845  C CB  . LEU A 1 121 ? -8.087  -5.274  30.448 1.00 23.71  ? 139 LEU B CB  1 
ATOM   846  C CG  . LEU A 1 121 ? -9.577  -5.188  30.809 1.00 28.16  ? 139 LEU B CG  1 
ATOM   847  C CD1 . LEU A 1 121 ? -10.394 -4.058  30.161 1.00 26.77  ? 139 LEU B CD1 1 
ATOM   848  C CD2 . LEU A 1 121 ? -10.311 -6.507  30.788 1.00 30.28  ? 139 LEU B CD2 1 
ATOM   849  N N   . HIS A 1 122 ? -5.681  -3.202  30.929 1.00 22.06  ? 140 HIS B N   1 
ATOM   850  C CA  . HIS A 1 122 ? -4.348  -3.130  31.494 1.00 22.80  ? 140 HIS B CA  1 
ATOM   851  C C   . HIS A 1 122 ? -4.254  -4.183  32.520 1.00 23.26  ? 140 HIS B C   1 
ATOM   852  O O   . HIS A 1 122 ? -5.249  -4.533  33.110 1.00 20.67  ? 140 HIS B O   1 
ATOM   853  C CB  . HIS A 1 122 ? -4.097  -1.790  32.195 1.00 26.02  ? 140 HIS B CB  1 
ATOM   854  C CG  . HIS A 1 122 ? -2.668  -1.608  32.574 1.00 28.06  ? 140 HIS B CG  1 
ATOM   855  N ND1 . HIS A 1 122 ? -1.759  -1.125  31.705 1.00 29.44  ? 140 HIS B ND1 1 
ATOM   856  C CD2 . HIS A 1 122 ? -1.963  -2.004  33.701 1.00 30.54  ? 140 HIS B CD2 1 
ATOM   857  C CE1 . HIS A 1 122 ? -0.537  -1.136  32.276 1.00 31.78  ? 140 HIS B CE1 1 
ATOM   858  N NE2 . HIS A 1 122 ? -0.658  -1.661  33.497 1.00 34.69  ? 140 HIS B NE2 1 
ATOM   859  N N   . ARG A 1 123 ? -3.051  -4.713  32.760 1.00 25.64  ? 141 ARG B N   1 
ATOM   860  C CA  . ARG A 1 123 ? -2.908  -5.748  33.806 1.00 27.24  ? 141 ARG B CA  1 
ATOM   861  C C   . ARG A 1 123 ? -3.439  -5.388  35.194 1.00 25.60  ? 141 ARG B C   1 
ATOM   862  O O   . ARG A 1 123 ? -4.021  -6.244  35.883 1.00 29.79  ? 141 ARG B O   1 
ATOM   863  C CB  . ARG A 1 123 ? -1.469  -6.298  33.859 1.00 28.80  ? 141 ARG B CB  1 
ATOM   864  C CG  . ARG A 1 123 ? -0.515  -5.484  34.660 1.00 37.82  ? 141 ARG B CG  1 
ATOM   865  C CD  . ARG A 1 123 ? 0.486   -6.347  35.442 1.00 43.10  ? 141 ARG B CD  1 
ATOM   866  N NE  . ARG A 1 123 ? -0.025  -6.768  36.751 1.00 45.99  ? 141 ARG B NE  1 
ATOM   867  C CZ  . ARG A 1 123 ? 0.254   -6.156  37.902 1.00 54.32  ? 141 ARG B CZ  1 
ATOM   868  N NH1 . ARG A 1 123 ? 1.029   -5.063  37.923 1.00 52.98  ? 141 ARG B NH1 1 
ATOM   869  N NH2 . ARG A 1 123 ? -0.242  -6.634  39.042 1.00 48.68  ? 141 ARG B NH2 1 
ATOM   870  N N   . LEU A 1 124 ? -3.261  -4.134  35.636 1.00 27.87  ? 142 LEU B N   1 
ATOM   871  C CA  . LEU A 1 124 ? -3.883  -3.664  36.919 1.00 25.99  ? 142 LEU B CA  1 
ATOM   872  C C   . LEU A 1 124 ? -5.408  -3.671  36.858 1.00 27.40  ? 142 LEU B C   1 
ATOM   873  O O   . LEU A 1 124 ? -6.072  -3.630  37.877 1.00 26.57  ? 142 LEU B O   1 
ATOM   874  C CB  . LEU A 1 124 ? -3.433  -2.239  37.298 1.00 26.66  ? 142 LEU B CB  1 
ATOM   875  C CG  . LEU A 1 124 ? -1.921  -2.153  37.345 1.00 25.39  ? 142 LEU B CG  1 
ATOM   876  C CD1 . LEU A 1 124 ? -1.428  -0.748  37.072 1.00 27.30  ? 142 LEU B CD1 1 
ATOM   877  C CD2 . LEU A 1 124 ? -1.378  -2.811  38.638 1.00 29.07  ? 142 LEU B CD2 1 
ATOM   878  N N   . GLN A 1 125 ? -6.007  -3.698  35.679 1.00 23.30  ? 143 GLN B N   1 
ATOM   879  C CA  . GLN A 1 125 ? -7.455  -3.793  35.691 1.00 25.54  ? 143 GLN B CA  1 
ATOM   880  C C   . GLN A 1 125 ? -7.899  -5.264  35.913 1.00 32.45  ? 143 GLN B C   1 
ATOM   881  O O   . GLN A 1 125 ? -9.072  -5.547  36.224 1.00 33.74  ? 143 GLN B O   1 
ATOM   882  C CB  . GLN A 1 125 ? -8.028  -3.196  34.412 1.00 26.97  ? 143 GLN B CB  1 
ATOM   883  C CG  . GLN A 1 125 ? -7.866  -1.667  34.268 1.00 23.45  ? 143 GLN B CG  1 
ATOM   884  C CD  . GLN A 1 125 ? -8.420  -1.247  32.900 1.00 28.07  ? 143 GLN B CD  1 
ATOM   885  O OE1 . GLN A 1 125 ? -7.759  -1.419  31.885 1.00 26.27  ? 143 GLN B OE1 1 
ATOM   886  N NE2 . GLN A 1 125 ? -9.682  -0.770  32.872 1.00 24.54  ? 143 GLN B NE2 1 
ATOM   887  N N   . CYS A 1 126 ? -6.933  -6.175  35.776 1.00 31.19  ? 144 CYS B N   1 
ATOM   888  C CA  . CYS A 1 126 ? -7.163  -7.622  35.730 1.00 32.01  ? 144 CYS B CA  1 
ATOM   889  C C   . CYS A 1 126 ? -6.776  -8.264  37.028 1.00 31.95  ? 144 CYS B C   1 
ATOM   890  O O   . CYS A 1 126 ? -7.383  -9.269  37.442 1.00 36.61  ? 144 CYS B O   1 
ATOM   891  C CB  . CYS A 1 126 ? -6.258  -8.233  34.671 1.00 31.45  ? 144 CYS B CB  1 
ATOM   892  S SG  . CYS A 1 126 ? -6.956  -8.131  33.066 1.00 35.25  ? 144 CYS B SG  1 
ATOM   893  N N   . ALA A 1 127 ? -5.780  -7.651  37.660 1.00 26.69  ? 145 ALA B N   1 
ATOM   894  C CA  . ALA A 1 127 ? -5.057  -8.225  38.801 1.00 30.48  ? 145 ALA B CA  1 
ATOM   895  C C   . ALA A 1 127 ? -5.995  -8.696  39.897 1.00 33.01  ? 145 ALA B C   1 
ATOM   896  O O   . ALA A 1 127 ? -5.821  -9.783  40.446 1.00 31.86  ? 145 ALA B O   1 
ATOM   897  C CB  . ALA A 1 127 ? -4.025  -7.218  39.348 1.00 27.03  ? 145 ALA B CB  1 
ATOM   898  N N   . ARG A 1 128 ? -6.979  -7.888  40.263 1.00 33.97  ? 146 ARG B N   1 
ATOM   899  C CA  . ARG A 1 128 ? -7.839  -8.328  41.383 1.00 35.35  ? 146 ARG B CA  1 
ATOM   900  C C   . ARG A 1 128 ? -8.646  -9.589  41.053 1.00 34.30  ? 146 ARG B C   1 
ATOM   901  O O   . ARG A 1 128 ? -8.873  -10.418 41.903 1.00 36.32  ? 146 ARG B O   1 
ATOM   902  C CB  . ARG A 1 128 ? -8.791  -7.223  41.813 1.00 37.51  ? 146 ARG B CB  1 
ATOM   903  C CG  . ARG A 1 128 ? -8.220  -6.280  42.853 1.00 49.39  ? 146 ARG B CG  1 
ATOM   904  C CD  . ARG A 1 128 ? -8.600  -4.843  42.554 1.00 56.73  ? 146 ARG B CD  1 
ATOM   905  N NE  . ARG A 1 128 ? -10.027 -4.562  42.705 1.00 59.11  ? 146 ARG B NE  1 
ATOM   906  C CZ  . ARG A 1 128 ? -10.547 -3.334  42.688 1.00 66.87  ? 146 ARG B CZ  1 
ATOM   907  N NH1 . ARG A 1 128 ? -9.769  -2.269  42.518 1.00 64.62  ? 146 ARG B NH1 1 
ATOM   908  N NH2 . ARG A 1 128 ? -11.850 -3.170  42.848 1.00 67.61  ? 146 ARG B NH2 1 
ATOM   909  N N   . GLY A 1 129 ? -9.092  -9.737  39.808 1.00 34.23  ? 147 GLY B N   1 
ATOM   910  C CA  . GLY A 1 129 ? -9.839  -10.900 39.451 1.00 27.74  ? 147 GLY B CA  1 
ATOM   911  C C   . GLY A 1 129 ? -8.952  -12.130 39.336 1.00 25.78  ? 147 GLY B C   1 
ATOM   912  O O   . GLY A 1 129 ? -9.281  -13.233 39.875 1.00 26.64  ? 147 GLY B O   1 
ATOM   913  N N   . PHE A 1 130 ? -7.856  -11.965 38.624 1.00 27.47  ? 148 PHE B N   1 
ATOM   914  C CA  . PHE A 1 130 ? -7.042  -13.115 38.251 1.00 29.34  ? 148 PHE B CA  1 
ATOM   915  C C   . PHE A 1 130 ? -6.130  -13.526 39.356 1.00 29.36  ? 148 PHE B C   1 
ATOM   916  O O   . PHE A 1 130 ? -5.604  -14.631 39.303 1.00 25.07  ? 148 PHE B O   1 
ATOM   917  C CB  . PHE A 1 130 ? -6.160  -12.817 37.036 1.00 27.48  ? 148 PHE B CB  1 
ATOM   918  C CG  . PHE A 1 130 ? -6.876  -12.957 35.712 1.00 27.96  ? 148 PHE B CG  1 
ATOM   919  C CD1 . PHE A 1 130 ? -7.861  -12.049 35.333 1.00 27.72  ? 148 PHE B CD1 1 
ATOM   920  C CD2 . PHE A 1 130 ? -6.499  -13.955 34.803 1.00 28.55  ? 148 PHE B CD2 1 
ATOM   921  C CE1 . PHE A 1 130 ? -8.511  -12.165 34.088 1.00 27.49  ? 148 PHE B CE1 1 
ATOM   922  C CE2 . PHE A 1 130 ? -7.118  -14.085 33.570 1.00 29.22  ? 148 PHE B CE2 1 
ATOM   923  C CZ  . PHE A 1 130 ? -8.145  -13.178 33.210 1.00 29.94  ? 148 PHE B CZ  1 
ATOM   924  N N   . GLY A 1 131 ? -5.909  -12.625 40.332 1.00 31.63  ? 149 GLY B N   1 
ATOM   925  C CA  . GLY A 1 131 ? -4.824  -12.831 41.335 1.00 32.31  ? 149 GLY B CA  1 
ATOM   926  C C   . GLY A 1 131 ? -3.435  -12.787 40.699 1.00 33.62  ? 149 GLY B C   1 
ATOM   927  O O   . GLY A 1 131 ? -3.280  -12.285 39.571 1.00 28.93  ? 149 GLY B O   1 
ATOM   928  N N   . ASP A 1 132 ? -2.446  -13.349 41.408 1.00 35.17  ? 150 ASP B N   1 
ATOM   929  C CA  . ASP A 1 132 ? -1.058  -13.562 40.929 1.00 39.29  ? 150 ASP B CA  1 
ATOM   930  C C   . ASP A 1 132 ? -0.973  -14.234 39.549 1.00 37.47  ? 150 ASP B C   1 
ATOM   931  O O   . ASP A 1 132 ? -0.073  -13.955 38.769 1.00 37.71  ? 150 ASP B O   1 
ATOM   932  C CB  . ASP A 1 132 ? -0.239  -14.418 41.937 1.00 43.25  ? 150 ASP B CB  1 
ATOM   933  C CG  . ASP A 1 132 ? -0.236  -13.834 43.351 1.00 52.88  ? 150 ASP B CG  1 
ATOM   934  O OD1 . ASP A 1 132 ? 0.031   -14.584 44.311 1.00 63.26  ? 150 ASP B OD1 1 
ATOM   935  O OD2 . ASP A 1 132 ? -0.518  -12.629 43.524 1.00 59.97  ? 150 ASP B OD2 1 
ATOM   936  N N   . TRP A 1 133 ? -1.956  -15.058 39.226 1.00 32.01  ? 151 TRP B N   1 
ATOM   937  C CA  . TRP A 1 133 ? -1.969  -15.747 37.961 1.00 29.57  ? 151 TRP B CA  1 
ATOM   938  C C   . TRP A 1 133 ? -1.658  -14.817 36.793 1.00 29.61  ? 151 TRP B C   1 
ATOM   939  O O   . TRP A 1 133 ? -0.860  -15.178 35.917 1.00 32.13  ? 151 TRP B O   1 
ATOM   940  C CB  . TRP A 1 133 ? -3.279  -16.481 37.825 1.00 24.18  ? 151 TRP B CB  1 
ATOM   941  C CG  . TRP A 1 133 ? -3.317  -17.493 36.705 1.00 22.91  ? 151 TRP B CG  1 
ATOM   942  C CD1 . TRP A 1 133 ? -2.260  -18.329 36.252 1.00 23.40  ? 151 TRP B CD1 1 
ATOM   943  C CD2 . TRP A 1 133 ? -4.442  -17.830 35.888 1.00 20.57  ? 151 TRP B CD2 1 
ATOM   944  N NE1 . TRP A 1 133 ? -2.681  -19.133 35.233 1.00 22.57  ? 151 TRP B NE1 1 
ATOM   945  C CE2 . TRP A 1 133 ? -3.991  -18.888 34.972 1.00 22.24  ? 151 TRP B CE2 1 
ATOM   946  C CE3 . TRP A 1 133 ? -5.763  -17.419 35.842 1.00 22.67  ? 151 TRP B CE3 1 
ATOM   947  C CZ2 . TRP A 1 133 ? -4.843  -19.457 34.035 1.00 25.69  ? 151 TRP B CZ2 1 
ATOM   948  C CZ3 . TRP A 1 133 ? -6.611  -17.999 34.909 1.00 27.63  ? 151 TRP B CZ3 1 
ATOM   949  C CH2 . TRP A 1 133 ? -6.158  -18.980 33.993 1.00 22.81  ? 151 TRP B CH2 1 
ATOM   950  N N   . ILE A 1 134 ? -2.178  -13.587 36.832 1.00 28.82  ? 152 ILE B N   1 
ATOM   951  C CA  . ILE A 1 134 ? -2.026  -12.600 35.748 1.00 29.88  ? 152 ILE B CA  1 
ATOM   952  C C   . ILE A 1 134 ? -0.560  -12.286 35.507 1.00 31.93  ? 152 ILE B C   1 
ATOM   953  O O   . ILE A 1 134 ? -0.145  -12.175 34.359 1.00 31.11  ? 152 ILE B O   1 
ATOM   954  C CB  . ILE A 1 134 ? -2.891  -11.289 35.888 1.00 32.84  ? 152 ILE B CB  1 
ATOM   955  C CG1 . ILE A 1 134 ? -3.158  -10.637 34.521 1.00 34.37  ? 152 ILE B CG1 1 
ATOM   956  C CG2 . ILE A 1 134 ? -2.195  -10.205 36.727 1.00 31.67  ? 152 ILE B CG2 1 
ATOM   957  C CD1 . ILE A 1 134 ? -4.109  -11.380 33.603 1.00 32.25  ? 152 ILE B CD1 1 
ATOM   958  N N   . ASP A 1 135 ? 0.220   -12.204 36.585 1.00 31.60  ? 153 ASP B N   1 
ATOM   959  C CA  . ASP A 1 135 ? 1.650   -11.983 36.483 1.00 32.08  ? 153 ASP B CA  1 
ATOM   960  C C   . ASP A 1 135 ? 2.466   -13.117 35.856 1.00 26.26  ? 153 ASP B C   1 
ATOM   961  O O   . ASP A 1 135 ? 3.415   -12.860 35.085 1.00 26.55  ? 153 ASP B O   1 
ATOM   962  C CB  . ASP A 1 135 ? 2.189   -11.743 37.878 1.00 33.93  ? 153 ASP B CB  1 
ATOM   963  C CG  . ASP A 1 135 ? 1.674   -10.467 38.457 1.00 36.86  ? 153 ASP B CG  1 
ATOM   964  O OD1 . ASP A 1 135 ? 1.502   -9.473  37.693 1.00 41.07  ? 153 ASP B OD1 1 
ATOM   965  O OD2 . ASP A 1 135 ? 1.436   -10.490 39.667 1.00 32.30  ? 153 ASP B OD2 1 
ATOM   966  N N   . SER A 1 136 ? 2.146   -14.354 36.226 1.00 27.56  ? 154 SER B N   1 
ATOM   967  C CA  . SER A 1 136 ? 2.731   -15.570 35.602 1.00 25.03  ? 154 SER B CA  1 
ATOM   968  C C   . SER A 1 136 ? 2.409   -15.646 34.158 1.00 23.48  ? 154 SER B C   1 
ATOM   969  O O   . SER A 1 136 ? 3.234   -16.038 33.344 1.00 28.05  ? 154 SER B O   1 
ATOM   970  C CB  . SER A 1 136 ? 2.221   -16.839 36.254 1.00 27.37  ? 154 SER B CB  1 
ATOM   971  O OG  . SER A 1 136 ? 2.503   -16.825 37.637 1.00 36.57  ? 154 SER B OG  1 
ATOM   972  N N   . ILE A 1 137 ? 1.220   -15.241 33.827 1.00 22.09  ? 155 ILE B N   1 
ATOM   973  C CA  . ILE A 1 137 ? 0.775   -15.323 32.453 1.00 20.95  ? 155 ILE B CA  1 
ATOM   974  C C   . ILE A 1 137 ? 1.582   -14.246 31.698 1.00 19.90  ? 155 ILE B C   1 
ATOM   975  O O   . ILE A 1 137 ? 2.055   -14.447 30.573 1.00 18.28  ? 155 ILE B O   1 
ATOM   976  C CB  . ILE A 1 137 ? -0.721  -15.008 32.379 1.00 20.04  ? 155 ILE B CB  1 
ATOM   977  C CG1 . ILE A 1 137 ? -1.569  -16.175 32.884 1.00 22.24  ? 155 ILE B CG1 1 
ATOM   978  C CG2 . ILE A 1 137 ? -1.167  -14.657 30.939 1.00 23.08  ? 155 ILE B CG2 1 
ATOM   979  C CD1 . ILE A 1 137 ? -3.041  -15.810 32.990 1.00 18.24  ? 155 ILE B CD1 1 
ATOM   980  N N   . LEU A 1 138 ? 1.697   -13.085 32.323 1.00 19.77  ? 156 LEU B N   1 
ATOM   981  C CA  . LEU A 1 138 ? 2.541   -12.061 31.772 1.00 22.99  ? 156 LEU B CA  1 
ATOM   982  C C   . LEU A 1 138 ? 4.012   -12.453 31.631 1.00 23.77  ? 156 LEU B C   1 
ATOM   983  O O   . LEU A 1 138 ? 4.619   -12.147 30.605 1.00 21.65  ? 156 LEU B O   1 
ATOM   984  C CB  . LEU A 1 138 ? 2.339   -10.748 32.533 1.00 23.49  ? 156 LEU B CB  1 
ATOM   985  C CG  . LEU A 1 138 ? 1.049   -10.163 32.051 1.00 23.12  ? 156 LEU B CG  1 
ATOM   986  C CD1 . LEU A 1 138 ? 0.503   -9.119  33.009 1.00 22.70  ? 156 LEU B CD1 1 
ATOM   987  C CD2 . LEU A 1 138 ? 1.254   -9.631  30.612 1.00 22.50  ? 156 LEU B CD2 1 
ATOM   988  N N   . ALA A 1 139 ? 4.600   -13.106 32.635 1.00 22.55  ? 157 ALA B N   1 
ATOM   989  C CA  . ALA A 1 139 ? 5.960   -13.636 32.444 1.00 24.57  ? 157 ALA B CA  1 
ATOM   990  C C   . ALA A 1 139 ? 6.039   -14.608 31.241 1.00 26.58  ? 157 ALA B C   1 
ATOM   991  O O   . ALA A 1 139 ? 6.997   -14.596 30.436 1.00 25.85  ? 157 ALA B O   1 
ATOM   992  C CB  . ALA A 1 139 ? 6.464   -14.371 33.709 1.00 27.19  ? 157 ALA B CB  1 
ATOM   993  N N   . PHE A 1 140 ? 5.091   -15.529 31.172 1.00 26.48  ? 158 PHE B N   1 
ATOM   994  C CA  . PHE A 1 140 ? 5.116   -16.501 30.069 1.00 22.23  ? 158 PHE B CA  1 
ATOM   995  C C   . PHE A 1 140 ? 4.991   -15.773 28.706 1.00 22.59  ? 158 PHE B C   1 
ATOM   996  O O   . PHE A 1 140 ? 5.633   -16.127 27.754 1.00 21.81  ? 158 PHE B O   1 
ATOM   997  C CB  . PHE A 1 140 ? 4.000   -17.453 30.321 1.00 21.56  ? 158 PHE B CB  1 
ATOM   998  C CG  . PHE A 1 140 ? 3.836   -18.465 29.261 1.00 24.20  ? 158 PHE B CG  1 
ATOM   999  C CD1 . PHE A 1 140 ? 4.592   -19.626 29.285 1.00 25.50  ? 158 PHE B CD1 1 
ATOM   1000 C CD2 . PHE A 1 140 ? 2.898   -18.264 28.242 1.00 24.03  ? 158 PHE B CD2 1 
ATOM   1001 C CE1 . PHE A 1 140 ? 4.428   -20.607 28.311 1.00 24.63  ? 158 PHE B CE1 1 
ATOM   1002 C CE2 . PHE A 1 140 ? 2.749   -19.225 27.250 1.00 25.80  ? 158 PHE B CE2 1 
ATOM   1003 C CZ  . PHE A 1 140 ? 3.507   -20.397 27.287 1.00 29.36  ? 158 PHE B CZ  1 
ATOM   1004 N N   . SER A 1 141 ? 4.197   -14.716 28.674 1.00 22.19  ? 159 SER B N   1 
ATOM   1005 C CA  . SER A 1 141 ? 3.981   -13.961 27.481 1.00 24.72  ? 159 SER B CA  1 
ATOM   1006 C C   . SER A 1 141 ? 5.239   -13.192 27.122 1.00 28.19  ? 159 SER B C   1 
ATOM   1007 O O   . SER A 1 141 ? 5.560   -13.108 25.917 1.00 26.98  ? 159 SER B O   1 
ATOM   1008 C CB  . SER A 1 141 ? 2.787   -13.004 27.617 1.00 24.56  ? 159 SER B CB  1 
ATOM   1009 O OG  . SER A 1 141 ? 2.716   -12.030 26.529 1.00 23.46  ? 159 SER B OG  1 
ATOM   1010 N N   . ARG A 1 142 ? 5.981   -12.621 28.082 1.00 24.57  ? 160 ARG B N   1 
ATOM   1011 C CA  A ARG A 1 142 ? 7.291   -12.071 27.735 0.50 27.61  ? 160 ARG B CA  1 
ATOM   1012 C CA  B ARG A 1 142 ? 7.268   -12.054 27.653 0.50 28.37  ? 160 ARG B CA  1 
ATOM   1013 C C   . ARG A 1 142 ? 8.176   -13.179 27.175 1.00 29.30  ? 160 ARG B C   1 
ATOM   1014 O O   . ARG A 1 142 ? 8.845   -13.055 26.157 1.00 31.40  ? 160 ARG B O   1 
ATOM   1015 C CB  A ARG A 1 142 ? 7.965   -11.421 28.958 0.50 27.79  ? 160 ARG B CB  1 
ATOM   1016 C CB  B ARG A 1 142 ? 7.951   -11.168 28.716 0.50 30.46  ? 160 ARG B CB  1 
ATOM   1017 C CG  A ARG A 1 142 ? 9.372   -10.945 28.625 0.50 28.52  ? 160 ARG B CG  1 
ATOM   1018 C CG  B ARG A 1 142 ? 9.025   -10.229 28.133 0.50 32.21  ? 160 ARG B CG  1 
ATOM   1019 C CD  A ARG A 1 142 ? 9.834   -9.818  29.505 0.50 28.76  ? 160 ARG B CD  1 
ATOM   1020 C CD  B ARG A 1 142 ? 8.440   -9.167  27.183 0.50 34.37  ? 160 ARG B CD  1 
ATOM   1021 N NE  A ARG A 1 142 ? 10.359  -10.272 30.772 0.50 27.98  ? 160 ARG B NE  1 
ATOM   1022 N NE  B ARG A 1 142 ? 8.787   -9.344  25.769 0.50 31.92  ? 160 ARG B NE  1 
ATOM   1023 C CZ  A ARG A 1 142 ? 11.076  -9.491  31.574 0.50 30.87  ? 160 ARG B CZ  1 
ATOM   1024 C CZ  B ARG A 1 142 ? 9.709   -10.190 25.299 0.50 31.08  ? 160 ARG B CZ  1 
ATOM   1025 N NH1 A ARG A 1 142 ? 11.334  -8.237  31.190 0.50 30.82  ? 160 ARG B NH1 1 
ATOM   1026 N NH1 B ARG A 1 142 ? 10.377  -10.974 26.122 0.50 31.70  ? 160 ARG B NH1 1 
ATOM   1027 N NH2 A ARG A 1 142 ? 11.518  -9.946  32.752 0.50 28.62  ? 160 ARG B NH2 1 
ATOM   1028 N NH2 B ARG A 1 142 ? 9.971   -10.259 23.991 0.50 31.13  ? 160 ARG B NH2 1 
ATOM   1029 N N   . SER A 1 143 ? 8.170   -14.312 27.849 1.00 28.30  ? 161 SER B N   1 
ATOM   1030 C CA  . SER A 1 143 ? 9.061   -15.345 27.399 1.00 29.69  ? 161 SER B CA  1 
ATOM   1031 C C   . SER A 1 143 ? 8.711   -15.850 25.970 1.00 29.93  ? 161 SER B C   1 
ATOM   1032 O O   . SER A 1 143 ? 9.582   -16.060 25.138 1.00 28.74  ? 161 SER B O   1 
ATOM   1033 C CB  . SER A 1 143 ? 9.085   -16.469 28.430 1.00 25.95  ? 161 SER B CB  1 
ATOM   1034 O OG  . SER A 1 143 ? 9.917   -17.499 27.963 1.00 29.84  ? 161 SER B OG  1 
ATOM   1035 N N   . LEU A 1 144 ? 7.422   -16.054 25.702 1.00 28.67  ? 162 LEU B N   1 
ATOM   1036 C CA  . LEU A 1 144 ? 6.963   -16.470 24.344 1.00 31.44  ? 162 LEU B CA  1 
ATOM   1037 C C   . LEU A 1 144 ? 7.341   -15.439 23.278 1.00 27.33  ? 162 LEU B C   1 
ATOM   1038 O O   . LEU A 1 144 ? 7.741   -15.790 22.191 1.00 32.44  ? 162 LEU B O   1 
ATOM   1039 C CB  . LEU A 1 144 ? 5.435   -16.534 24.334 1.00 26.53  ? 162 LEU B CB  1 
ATOM   1040 C CG  . LEU A 1 144 ? 4.624   -17.602 23.663 1.00 28.91  ? 162 LEU B CG  1 
ATOM   1041 C CD1 . LEU A 1 144 ? 3.203   -17.083 23.399 1.00 24.15  ? 162 LEU B CD1 1 
ATOM   1042 C CD2 . LEU A 1 144 ? 5.292   -18.212 22.461 1.00 27.69  ? 162 LEU B CD2 1 
ATOM   1043 N N   . HIS A 1 145 ? 7.161   -14.180 23.604 1.00 28.04  ? 163 HIS B N   1 
ATOM   1044 C CA  . HIS A 1 145 ? 7.450   -13.086 22.704 1.00 31.60  ? 163 HIS B CA  1 
ATOM   1045 C C   . HIS A 1 145 ? 8.919   -13.009 22.352 1.00 32.94  ? 163 HIS B C   1 
ATOM   1046 O O   . HIS A 1 145 ? 9.262   -12.603 21.251 1.00 28.40  ? 163 HIS B O   1 
ATOM   1047 C CB  . HIS A 1 145 ? 6.962   -11.759 23.290 1.00 31.45  ? 163 HIS B CB  1 
ATOM   1048 C CG  . HIS A 1 145 ? 5.515   -11.434 22.943 1.00 36.25  ? 163 HIS B CG  1 
ATOM   1049 N ND1 . HIS A 1 145 ? 4.525   -11.524 23.824 1.00 39.10  ? 163 HIS B ND1 1 
ATOM   1050 C CD2 . HIS A 1 145 ? 4.924   -11.077 21.741 1.00 38.75  ? 163 HIS B CD2 1 
ATOM   1051 C CE1 . HIS A 1 145 ? 3.369   -11.229 23.244 1.00 34.74  ? 163 HIS B CE1 1 
ATOM   1052 N NE2 . HIS A 1 145 ? 3.614   -10.944 21.967 1.00 45.52  ? 163 HIS B NE2 1 
ATOM   1053 N N   . SER A 1 146 ? 9.795   -13.384 23.274 1.00 30.82  ? 164 SER B N   1 
ATOM   1054 C CA  . SER A 1 146 ? 11.217  -13.383 22.976 1.00 33.86  ? 164 SER B CA  1 
ATOM   1055 C C   . SER A 1 146 ? 11.565  -14.444 21.914 1.00 35.58  ? 164 SER B C   1 
ATOM   1056 O O   . SER A 1 146 ? 12.543  -14.297 21.196 1.00 38.22  ? 164 SER B O   1 
ATOM   1057 C CB  . SER A 1 146 ? 12.046  -13.671 24.252 1.00 36.40  ? 164 SER B CB  1 
ATOM   1058 O OG  . SER A 1 146 ? 11.825  -12.686 25.240 1.00 48.03  ? 164 SER B OG  1 
ATOM   1059 N N   . LEU A 1 147 ? 10.787  -15.519 21.834 1.00 33.55  ? 165 LEU B N   1 
ATOM   1060 C CA  . LEU A 1 147 ? 11.159  -16.637 20.988 1.00 35.09  ? 165 LEU B CA  1 
ATOM   1061 C C   . LEU A 1 147 ? 10.822  -16.270 19.543 1.00 35.68  ? 165 LEU B C   1 
ATOM   1062 O O   . LEU A 1 147 ? 11.215  -16.980 18.624 1.00 43.36  ? 165 LEU B O   1 
ATOM   1063 C CB  . LEU A 1 147 ? 10.367  -17.861 21.435 1.00 37.89  ? 165 LEU B CB  1 
ATOM   1064 C CG  . LEU A 1 147 ? 11.069  -19.174 21.784 1.00 46.28  ? 165 LEU B CG  1 
ATOM   1065 C CD1 . LEU A 1 147 ? 12.407  -19.006 22.501 1.00 43.92  ? 165 LEU B CD1 1 
ATOM   1066 C CD2 . LEU A 1 147 ? 10.128  -20.008 22.624 1.00 39.99  ? 165 LEU B CD2 1 
ATOM   1067 N N   . LEU A 1 148 ? 10.096  -15.161 19.388 1.00 33.34  ? 166 LEU B N   1 
ATOM   1068 C CA  . LEU A 1 148 ? 9.616   -14.603 18.117 1.00 35.16  ? 166 LEU B CA  1 
ATOM   1069 C C   . LEU A 1 148 ? 8.974   -15.684 17.296 1.00 34.43  ? 166 LEU B C   1 
ATOM   1070 O O   . LEU A 1 148 ? 9.441   -15.997 16.231 1.00 32.69  ? 166 LEU B O   1 
ATOM   1071 C CB  . LEU A 1 148 ? 10.738  -13.907 17.327 1.00 39.63  ? 166 LEU B CB  1 
ATOM   1072 C CG  . LEU A 1 148 ? 11.315  -12.659 18.021 1.00 41.15  ? 166 LEU B CG  1 
ATOM   1073 C CD1 . LEU A 1 148 ? 12.764  -12.448 17.622 1.00 41.79  ? 166 LEU B CD1 1 
ATOM   1074 C CD2 . LEU A 1 148 ? 10.446  -11.419 17.744 1.00 38.54  ? 166 LEU B CD2 1 
ATOM   1075 N N   . VAL A 1 149 ? 7.882   -16.244 17.804 1.00 33.62  ? 167 VAL B N   1 
ATOM   1076 C CA  . VAL A 1 149 ? 7.146   -17.321 17.112 1.00 31.96  ? 167 VAL B CA  1 
ATOM   1077 C C   . VAL A 1 149 ? 6.299   -16.738 15.980 1.00 30.69  ? 167 VAL B C   1 
ATOM   1078 O O   . VAL A 1 149 ? 5.432   -15.903 16.204 1.00 29.39  ? 167 VAL B O   1 
ATOM   1079 C CB  . VAL A 1 149 ? 6.309   -18.123 18.141 1.00 27.84  ? 167 VAL B CB  1 
ATOM   1080 C CG1 . VAL A 1 149 ? 5.659   -19.355 17.512 1.00 31.71  ? 167 VAL B CG1 1 
ATOM   1081 C CG2 . VAL A 1 149 ? 7.218   -18.546 19.293 1.00 27.40  ? 167 VAL B CG2 1 
ATOM   1082 N N   . ASP A 1 150 ? 6.566   -17.180 14.750 1.00 32.13  ? 168 ASP B N   1 
ATOM   1083 C CA  . ASP A 1 150 ? 5.796   -16.697 13.622 1.00 28.63  ? 168 ASP B CA  1 
ATOM   1084 C C   . ASP A 1 150 ? 4.394   -17.289 13.646 1.00 30.43  ? 168 ASP B C   1 
ATOM   1085 O O   . ASP A 1 150 ? 4.109   -18.234 14.449 1.00 31.45  ? 168 ASP B O   1 
ATOM   1086 C CB  . ASP A 1 150 ? 6.530   -16.816 12.266 1.00 29.10  ? 168 ASP B CB  1 
ATOM   1087 C CG  . ASP A 1 150 ? 6.601   -18.231 11.738 1.00 37.98  ? 168 ASP B CG  1 
ATOM   1088 O OD1 . ASP A 1 150 ? 7.325   -18.434 10.736 1.00 37.74  ? 168 ASP B OD1 1 
ATOM   1089 O OD2 . ASP A 1 150 ? 5.973   -19.155 12.299 1.00 32.50  ? 168 ASP B OD2 1 
ATOM   1090 N N   . VAL A 1 151 ? 3.497   -16.699 12.856 1.00 25.83  ? 169 VAL B N   1 
ATOM   1091 C CA  . VAL A 1 151 ? 2.051   -17.097 12.909 1.00 32.87  ? 169 VAL B CA  1 
ATOM   1092 C C   . VAL A 1 151 ? 1.800   -18.550 12.483 1.00 30.94  ? 169 VAL B C   1 
ATOM   1093 O O   . VAL A 1 151 ? 0.993   -19.250 13.116 1.00 33.48  ? 169 VAL B O   1 
ATOM   1094 C CB  . VAL A 1 151 ? 1.135   -16.081 12.172 1.00 32.64  ? 169 VAL B CB  1 
ATOM   1095 C CG1 . VAL A 1 151 ? -0.291  -16.606 12.015 1.00 36.63  ? 169 VAL B CG1 1 
ATOM   1096 C CG2 . VAL A 1 151 ? 1.161   -14.753 12.930 1.00 32.87  ? 169 VAL B CG2 1 
ATOM   1097 N N   . PRO A 1 152 ? 2.506   -19.027 11.435 1.00 31.72  ? 170 PRO B N   1 
ATOM   1098 C CA  . PRO A 1 152 ? 2.272   -20.421 11.068 1.00 30.68  ? 170 PRO B CA  1 
ATOM   1099 C C   . PRO A 1 152 ? 2.823   -21.352 12.128 1.00 32.13  ? 170 PRO B C   1 
ATOM   1100 O O   . PRO A 1 152 ? 2.196   -22.379 12.406 1.00 31.06  ? 170 PRO B O   1 
ATOM   1101 C CB  . PRO A 1 152 ? 3.009   -20.584 9.726  1.00 35.00  ? 170 PRO B CB  1 
ATOM   1102 C CG  . PRO A 1 152 ? 3.168   -19.187 9.187  1.00 35.84  ? 170 PRO B CG  1 
ATOM   1103 C CD  . PRO A 1 152 ? 3.307   -18.309 10.409 1.00 35.13  ? 170 PRO B CD  1 
ATOM   1104 N N   . ALA A 1 153 ? 3.935   -20.975 12.775 1.00 27.68  ? 171 ALA B N   1 
ATOM   1105 C CA  . ALA A 1 153 ? 4.427   -21.820 13.853 1.00 26.70  ? 171 ALA B CA  1 
ATOM   1106 C C   . ALA A 1 153 ? 3.486   -21.817 15.017 1.00 26.90  ? 171 ALA B C   1 
ATOM   1107 O O   . ALA A 1 153 ? 3.275   -22.865 15.571 1.00 30.03  ? 171 ALA B O   1 
ATOM   1108 C CB  . ALA A 1 153 ? 5.844   -21.481 14.317 1.00 25.81  ? 171 ALA B CB  1 
ATOM   1109 N N   . PHE A 1 154 ? 2.974   -20.645 15.409 1.00 27.82  ? 172 PHE B N   1 
ATOM   1110 C CA  . PHE A 1 154 ? 2.028   -20.541 16.482 1.00 24.89  ? 172 PHE B CA  1 
ATOM   1111 C C   . PHE A 1 154 ? 0.752   -21.335 16.149 1.00 25.08  ? 172 PHE B C   1 
ATOM   1112 O O   . PHE A 1 154 ? 0.124   -21.957 17.020 1.00 28.49  ? 172 PHE B O   1 
ATOM   1113 C CB  . PHE A 1 154 ? 1.674   -19.070 16.787 1.00 24.99  ? 172 PHE B CB  1 
ATOM   1114 C CG  . PHE A 1 154 ? 0.797   -18.934 18.011 1.00 25.33  ? 172 PHE B CG  1 
ATOM   1115 C CD1 . PHE A 1 154 ? 1.389   -18.906 19.302 1.00 25.40  ? 172 PHE B CD1 1 
ATOM   1116 C CD2 . PHE A 1 154 ? -0.607  -18.998 17.917 1.00 23.22  ? 172 PHE B CD2 1 
ATOM   1117 C CE1 . PHE A 1 154 ? 0.559   -18.888 20.445 1.00 25.43  ? 172 PHE B CE1 1 
ATOM   1118 C CE2 . PHE A 1 154 ? -1.440  -18.942 19.050 1.00 25.84  ? 172 PHE B CE2 1 
ATOM   1119 C CZ  . PHE A 1 154 ? -0.855  -18.860 20.327 1.00 23.11  ? 172 PHE B CZ  1 
ATOM   1120 N N   . ALA A 1 155 ? 0.351   -21.290 14.885 1.00 27.58  ? 173 ALA B N   1 
ATOM   1121 C CA  . ALA A 1 155 ? -0.911  -21.944 14.391 1.00 24.86  ? 173 ALA B CA  1 
ATOM   1122 C C   . ALA A 1 155 ? -0.796  -23.425 14.638 1.00 22.07  ? 173 ALA B C   1 
ATOM   1123 O O   . ALA A 1 155 ? -1.766  -24.062 14.963 1.00 23.81  ? 173 ALA B O   1 
ATOM   1124 C CB  . ALA A 1 155 ? -1.085  -21.667 12.902 1.00 22.77  ? 173 ALA B CB  1 
ATOM   1125 N N   . CYS A 1 156 ? 0.421   -23.959 14.582 1.00 22.69  ? 174 CYS B N   1 
ATOM   1126 C CA  . CYS A 1 156 ? 0.609   -25.407 14.786 1.00 24.30  ? 174 CYS B CA  1 
ATOM   1127 C C   . CYS A 1 156 ? 0.740   -25.730 16.295 1.00 24.35  ? 174 CYS B C   1 
ATOM   1128 O O   . CYS A 1 156 ? 0.187   -26.714 16.789 1.00 24.31  ? 174 CYS B O   1 
ATOM   1129 C CB  . CYS A 1 156 ? 1.853   -25.945 14.042 1.00 27.19  ? 174 CYS B CB  1 
ATOM   1130 S SG  . CYS A 1 156 ? 1.989   -25.782 12.232 1.00 31.49  ? 174 CYS B SG  1 
ATOM   1131 N N   . LEU A 1 157 ? 1.556   -24.930 16.999 1.00 26.02  ? 175 LEU B N   1 
ATOM   1132 C CA  . LEU A 1 157 ? 1.732   -25.047 18.446 1.00 26.32  ? 175 LEU B CA  1 
ATOM   1133 C C   . LEU A 1 157 ? 0.399   -25.107 19.208 1.00 23.91  ? 175 LEU B C   1 
ATOM   1134 O O   . LEU A 1 157 ? 0.187   -25.960 20.079 1.00 22.80  ? 175 LEU B O   1 
ATOM   1135 C CB  . LEU A 1 157 ? 2.526   -23.834 18.924 1.00 24.40  ? 175 LEU B CB  1 
ATOM   1136 C CG  . LEU A 1 157 ? 3.543   -23.942 20.053 1.00 29.88  ? 175 LEU B CG  1 
ATOM   1137 C CD1 . LEU A 1 157 ? 3.106   -23.051 21.168 1.00 31.80  ? 175 LEU B CD1 1 
ATOM   1138 C CD2 . LEU A 1 157 ? 3.994   -25.322 20.513 1.00 27.84  ? 175 LEU B CD2 1 
ATOM   1139 N N   . SER A 1 158 ? -0.480  -24.156 18.935 1.00 22.96  ? 176 SER B N   1 
ATOM   1140 C CA  . SER A 1 158 ? -1.809  -24.116 19.623 1.00 20.32  ? 176 SER B CA  1 
ATOM   1141 C C   . SER A 1 158 ? -2.616  -25.339 19.303 1.00 22.93  ? 176 SER B C   1 
ATOM   1142 O O   . SER A 1 158 ? -3.317  -25.893 20.172 1.00 20.85  ? 176 SER B O   1 
ATOM   1143 C CB  . SER A 1 158 ? -2.597  -22.888 19.233 1.00 21.91  ? 176 SER B CB  1 
ATOM   1144 O OG  . SER A 1 158 ? -2.610  -22.737 17.823 1.00 20.27  ? 176 SER B OG  1 
ATOM   1145 N N   . ALA A 1 159 ? -2.507  -25.815 18.057 1.00 25.16  ? 177 ALA B N   1 
ATOM   1146 C CA  . ALA A 1 159 ? -3.257  -27.009 17.688 1.00 24.30  ? 177 ALA B CA  1 
ATOM   1147 C C   . ALA A 1 159 ? -2.646  -28.171 18.451 1.00 26.63  ? 177 ALA B C   1 
ATOM   1148 O O   . ALA A 1 159 ? -3.344  -29.079 18.834 1.00 25.88  ? 177 ALA B O   1 
ATOM   1149 C CB  . ALA A 1 159 ? -3.177  -27.275 16.213 1.00 23.32  ? 177 ALA B CB  1 
ATOM   1150 N N   . LEU A 1 160 ? -1.338  -28.124 18.670 1.00 27.69  ? 178 LEU B N   1 
ATOM   1151 C CA  . LEU A 1 160 ? -0.687  -29.241 19.351 1.00 27.93  ? 178 LEU B CA  1 
ATOM   1152 C C   . LEU A 1 160 ? -1.055  -29.280 20.841 1.00 24.71  ? 178 LEU B C   1 
ATOM   1153 O O   . LEU A 1 160 ? -0.999  -30.348 21.458 1.00 27.38  ? 178 LEU B O   1 
ATOM   1154 C CB  . LEU A 1 160 ? 0.826   -29.164 19.176 1.00 27.26  ? 178 LEU B CB  1 
ATOM   1155 C CG  . LEU A 1 160 ? 1.387   -29.647 17.857 1.00 29.87  ? 178 LEU B CG  1 
ATOM   1156 C CD1 . LEU A 1 160 ? 2.869   -29.272 17.840 1.00 24.79  ? 178 LEU B CD1 1 
ATOM   1157 C CD2 . LEU A 1 160 ? 1.143   -31.139 17.684 1.00 28.40  ? 178 LEU B CD2 1 
ATOM   1158 N N   . VAL A 1 161 ? -1.483  -28.139 21.383 1.00 24.81  ? 179 VAL B N   1 
ATOM   1159 C CA  . VAL A 1 161 ? -1.870  -28.020 22.805 1.00 22.07  ? 179 VAL B CA  1 
ATOM   1160 C C   . VAL A 1 161 ? -3.204  -28.809 22.945 1.00 23.60  ? 179 VAL B C   1 
ATOM   1161 O O   . VAL A 1 161 ? -3.430  -29.556 23.901 1.00 19.82  ? 179 VAL B O   1 
ATOM   1162 C CB  . VAL A 1 161 ? -2.028  -26.551 23.232 1.00 23.35  ? 179 VAL B CB  1 
ATOM   1163 C CG1 . VAL A 1 161 ? -2.750  -26.448 24.579 1.00 25.36  ? 179 VAL B CG1 1 
ATOM   1164 C CG2 . VAL A 1 161 ? -0.718  -25.837 23.332 1.00 22.01  ? 179 VAL B CG2 1 
ATOM   1165 N N   . LEU A 1 162 ? -4.050  -28.652 21.923 1.00 20.68  ? 180 LEU B N   1 
ATOM   1166 C CA  . LEU A 1 162 ? -5.383  -29.214 21.892 1.00 20.53  ? 180 LEU B CA  1 
ATOM   1167 C C   . LEU A 1 162 ? -5.340  -30.718 21.614 1.00 20.21  ? 180 LEU B C   1 
ATOM   1168 O O   . LEU A 1 162 ? -5.965  -31.486 22.289 1.00 21.58  ? 180 LEU B O   1 
ATOM   1169 C CB  . LEU A 1 162 ? -6.152  -28.548 20.733 1.00 18.18  ? 180 LEU B CB  1 
ATOM   1170 C CG  . LEU A 1 162 ? -7.533  -29.139 20.471 1.00 18.04  ? 180 LEU B CG  1 
ATOM   1171 C CD1 . LEU A 1 162 ? -8.476  -28.794 21.656 1.00 16.71  ? 180 LEU B CD1 1 
ATOM   1172 C CD2 . LEU A 1 162 ? -8.198  -28.700 19.177 1.00 16.81  ? 180 LEU B CD2 1 
ATOM   1173 N N   . ILE A 1 163 ? -4.604  -31.110 20.578 1.00 19.42  ? 181 ILE B N   1 
ATOM   1174 C CA  . ILE A 1 163 ? -4.661  -32.483 20.098 1.00 20.24  ? 181 ILE B CA  1 
ATOM   1175 C C   . ILE A 1 163 ? -3.447  -33.248 20.698 1.00 21.25  ? 181 ILE B C   1 
ATOM   1176 O O   . ILE A 1 163 ? -2.324  -33.227 20.154 1.00 20.15  ? 181 ILE B O   1 
ATOM   1177 C CB  . ILE A 1 163 ? -4.496  -32.554 18.574 1.00 20.94  ? 181 ILE B CB  1 
ATOM   1178 C CG1 . ILE A 1 163 ? -5.317  -31.512 17.858 1.00 22.68  ? 181 ILE B CG1 1 
ATOM   1179 C CG2 . ILE A 1 163 ? -4.833  -33.923 18.032 1.00 20.52  ? 181 ILE B CG2 1 
ATOM   1180 C CD1 . ILE A 1 163 ? -6.737  -31.729 17.993 1.00 22.59  ? 181 ILE B CD1 1 
ATOM   1181 N N   . THR A 1 164 ? -3.723  -33.990 21.768 1.00 20.68  ? 182 THR B N   1 
ATOM   1182 C CA  . THR A 1 164 ? -2.669  -34.496 22.567 1.00 22.64  ? 182 THR B CA  1 
ATOM   1183 C C   . THR A 1 164 ? -3.238  -35.613 23.434 1.00 24.86  ? 182 THR B C   1 
ATOM   1184 O O   . THR A 1 164 ? -4.450  -35.689 23.639 1.00 24.67  ? 182 THR B O   1 
ATOM   1185 C CB  . THR A 1 164 ? -2.071  -33.340 23.450 1.00 21.98  ? 182 THR B CB  1 
ATOM   1186 O OG1 . THR A 1 164 ? -0.829  -33.774 23.970 1.00 22.99  ? 182 THR B OG1 1 
ATOM   1187 C CG2 . THR A 1 164 ? -2.929  -32.978 24.602 1.00 18.86  ? 182 THR B CG2 1 
ATOM   1188 N N   . ASP A 1 165 ? -2.378  -36.461 23.975 1.00 24.76  ? 183 ASP B N   1 
ATOM   1189 C CA  . ASP A 1 165 ? -2.930  -37.565 24.724 1.00 25.70  ? 183 ASP B CA  1 
ATOM   1190 C C   . ASP A 1 165 ? -3.541  -37.013 25.996 1.00 26.73  ? 183 ASP B C   1 
ATOM   1191 O O   . ASP A 1 165 ? -2.950  -36.117 26.692 1.00 27.76  ? 183 ASP B O   1 
ATOM   1192 C CB  . ASP A 1 165 ? -1.899  -38.618 25.050 1.00 28.14  ? 183 ASP B CB  1 
ATOM   1193 C CG  . ASP A 1 165 ? -2.556  -39.938 25.533 1.00 33.16  ? 183 ASP B CG  1 
ATOM   1194 O OD1 . ASP A 1 165 ? -3.266  -40.677 24.752 1.00 34.22  ? 183 ASP B OD1 1 
ATOM   1195 O OD2 . ASP A 1 165 ? -2.413  -40.214 26.712 1.00 30.76  ? 183 ASP B OD2 1 
ATOM   1196 N N   . ARG A 1 166 ? -4.698  -37.581 26.288 1.00 23.32  ? 184 ARG B N   1 
ATOM   1197 C CA  . ARG A 1 166 ? -5.493  -37.313 27.477 1.00 25.35  ? 184 ARG B CA  1 
ATOM   1198 C C   . ARG A 1 166 ? -6.040  -38.643 27.981 1.00 28.22  ? 184 ARG B C   1 
ATOM   1199 O O   . ARG A 1 166 ? -6.469  -39.503 27.173 1.00 29.44  ? 184 ARG B O   1 
ATOM   1200 C CB  . ARG A 1 166 ? -6.710  -36.385 27.175 1.00 24.43  ? 184 ARG B CB  1 
ATOM   1201 C CG  . ARG A 1 166 ? -6.283  -34.982 26.732 1.00 22.78  ? 184 ARG B CG  1 
ATOM   1202 C CD  . ARG A 1 166 ? -5.509  -34.185 27.812 1.00 23.47  ? 184 ARG B CD  1 
ATOM   1203 N NE  . ARG A 1 166 ? -5.309  -32.828 27.290 1.00 22.98  ? 184 ARG B NE  1 
ATOM   1204 C CZ  . ARG A 1 166 ? -4.797  -31.814 27.957 1.00 23.94  ? 184 ARG B CZ  1 
ATOM   1205 N NH1 . ARG A 1 166 ? -4.294  -32.023 29.191 1.00 22.23  ? 184 ARG B NH1 1 
ATOM   1206 N NH2 . ARG A 1 166 ? -4.706  -30.606 27.358 1.00 19.82  ? 184 ARG B NH2 1 
ATOM   1207 N N   . HIS A 1 167 ? -6.100  -38.781 29.305 1.00 28.62  ? 185 HIS B N   1 
ATOM   1208 C CA  . HIS A 1 167 ? -6.776  -39.958 29.941 1.00 29.79  ? 185 HIS B CA  1 
ATOM   1209 C C   . HIS A 1 167 ? -8.207  -40.021 29.506 1.00 26.64  ? 185 HIS B C   1 
ATOM   1210 O O   . HIS A 1 167 ? -8.872  -38.996 29.524 1.00 30.83  ? 185 HIS B O   1 
ATOM   1211 C CB  . HIS A 1 167 ? -6.754  -39.832 31.470 1.00 30.88  ? 185 HIS B CB  1 
ATOM   1212 C CG  . HIS A 1 167 ? -7.191  -41.095 32.165 1.00 33.72  ? 185 HIS B CG  1 
ATOM   1213 N ND1 . HIS A 1 167 ? -6.325  -42.115 32.432 1.00 38.47  ? 185 HIS B ND1 1 
ATOM   1214 C CD2 . HIS A 1 167 ? -8.453  -41.516 32.610 1.00 33.64  ? 185 HIS B CD2 1 
ATOM   1215 C CE1 . HIS A 1 167 ? -6.998  -43.124 33.036 1.00 38.43  ? 185 HIS B CE1 1 
ATOM   1216 N NE2 . HIS A 1 167 ? -8.302  -42.760 33.138 1.00 36.53  ? 185 HIS B NE2 1 
ATOM   1217 N N   . GLY A 1 168 ? -8.704  -41.199 29.122 1.00 25.83  ? 186 GLY B N   1 
ATOM   1218 C CA  . GLY A 1 168 ? -10.110 -41.348 28.745 1.00 27.77  ? 186 GLY B CA  1 
ATOM   1219 C C   . GLY A 1 168 ? -10.458 -41.211 27.259 1.00 25.81  ? 186 GLY B C   1 
ATOM   1220 O O   . GLY A 1 168 ? -11.618 -41.326 26.877 1.00 25.41  ? 186 GLY B O   1 
ATOM   1221 N N   . LEU A 1 169 ? -9.465  -41.014 26.423 1.00 25.46  ? 187 LEU B N   1 
ATOM   1222 C CA  . LEU A 1 169 ? -9.629  -41.027 24.928 1.00 26.86  ? 187 LEU B CA  1 
ATOM   1223 C C   . LEU A 1 169 ? -10.104 -42.400 24.480 1.00 31.14  ? 187 LEU B C   1 
ATOM   1224 O O   . LEU A 1 169 ? -9.667  -43.392 25.054 1.00 26.93  ? 187 LEU B O   1 
ATOM   1225 C CB  . LEU A 1 169 ? -8.335  -40.647 24.201 1.00 22.40  ? 187 LEU B CB  1 
ATOM   1226 C CG  . LEU A 1 169 ? -7.982  -39.134 24.235 1.00 22.38  ? 187 LEU B CG  1 
ATOM   1227 C CD1 . LEU A 1 169 ? -6.542  -38.882 23.756 1.00 21.01  ? 187 LEU B CD1 1 
ATOM   1228 C CD2 . LEU A 1 169 ? -8.995  -38.219 23.457 1.00 21.83  ? 187 LEU B CD2 1 
ATOM   1229 N N   . GLN A 1 170 ? -11.032 -42.422 23.501 1.00 27.19  ? 188 GLN B N   1 
ATOM   1230 C CA  . GLN A 1 170 ? -11.612 -43.625 22.943 1.00 27.12  ? 188 GLN B CA  1 
ATOM   1231 C C   . GLN A 1 170 ? -10.706 -44.082 21.831 1.00 25.62  ? 188 GLN B C   1 
ATOM   1232 O O   . GLN A 1 170 ? -10.558 -45.244 21.573 1.00 26.76  ? 188 GLN B O   1 
ATOM   1233 C CB  . GLN A 1 170 ? -12.990 -43.324 22.310 1.00 24.51  ? 188 GLN B CB  1 
ATOM   1234 C CG  . GLN A 1 170 ? -13.985 -42.850 23.343 1.00 29.40  ? 188 GLN B CG  1 
ATOM   1235 C CD  . GLN A 1 170 ? -15.349 -42.449 22.766 1.00 30.81  ? 188 GLN B CD  1 
ATOM   1236 O OE1 . GLN A 1 170 ? -16.366 -42.594 23.440 1.00 39.25  ? 188 GLN B OE1 1 
ATOM   1237 N NE2 . GLN A 1 170 ? -15.383 -41.979 21.540 1.00 32.17  ? 188 GLN B NE2 1 
ATOM   1238 N N   . GLU A 1 171 ? -10.083 -43.144 21.155 1.00 23.54  ? 189 GLU B N   1 
ATOM   1239 C CA  . GLU A 1 171 ? -9.310  -43.516 20.030 1.00 23.27  ? 189 GLU B CA  1 
ATOM   1240 C C   . GLU A 1 171 ? -8.005  -42.805 20.186 1.00 25.47  ? 189 GLU B C   1 
ATOM   1241 O O   . GLU A 1 171 ? -7.620  -41.948 19.330 1.00 28.43  ? 189 GLU B O   1 
ATOM   1242 C CB  . GLU A 1 171 ? -10.033 -43.100 18.743 1.00 23.44  ? 189 GLU B CB  1 
ATOM   1243 C CG  . GLU A 1 171 ? -11.392 -43.746 18.508 1.00 23.53  ? 189 GLU B CG  1 
ATOM   1244 C CD  . GLU A 1 171 ? -11.884 -43.432 17.081 1.00 29.32  ? 189 GLU B CD  1 
ATOM   1245 O OE1 . GLU A 1 171 ? -11.980 -42.208 16.744 1.00 24.01  ? 189 GLU B OE1 1 
ATOM   1246 O OE2 . GLU A 1 171 ? -12.052 -44.398 16.271 1.00 26.77  ? 189 GLU B OE2 1 
ATOM   1247 N N   . PRO A 1 172 ? -7.289  -43.162 21.257 1.00 24.52  ? 190 PRO B N   1 
ATOM   1248 C CA  . PRO A 1 172 ? -6.000  -42.513 21.465 1.00 24.03  ? 190 PRO B CA  1 
ATOM   1249 C C   . PRO A 1 172 ? -4.990  -42.549 20.283 1.00 28.11  ? 190 PRO B C   1 
ATOM   1250 O O   . PRO A 1 172 ? -4.214  -41.569 20.114 1.00 27.89  ? 190 PRO B O   1 
ATOM   1251 C CB  . PRO A 1 172 ? -5.472  -43.169 22.756 1.00 25.47  ? 190 PRO B CB  1 
ATOM   1252 C CG  . PRO A 1 172 ? -6.210  -44.493 22.896 1.00 26.60  ? 190 PRO B CG  1 
ATOM   1253 C CD  . PRO A 1 172 ? -7.480  -44.382 22.092 1.00 24.13  ? 190 PRO B CD  1 
ATOM   1254 N N   . ARG A 1 173 ? -4.989  -43.609 19.462 1.00 24.09  ? 191 ARG B N   1 
ATOM   1255 C CA  . ARG A 1 173 ? -4.040  -43.679 18.328 1.00 25.11  ? 191 ARG B CA  1 
ATOM   1256 C C   . ARG A 1 173 ? -4.379  -42.721 17.190 1.00 21.46  ? 191 ARG B C   1 
ATOM   1257 O O   . ARG A 1 173 ? -3.477  -42.221 16.483 1.00 23.19  ? 191 ARG B O   1 
ATOM   1258 C CB  . ARG A 1 173 ? -4.023  -45.088 17.762 1.00 28.66  ? 191 ARG B CB  1 
ATOM   1259 C CG  . ARG A 1 173 ? -3.646  -46.133 18.795 1.00 34.58  ? 191 ARG B CG  1 
ATOM   1260 C CD  . ARG A 1 173 ? -2.190  -46.530 18.736 1.00 40.09  ? 191 ARG B CD  1 
ATOM   1261 N NE  . ARG A 1 173 ? -1.977  -47.922 19.217 1.00 54.69  ? 191 ARG B NE  1 
ATOM   1262 C CZ  . ARG A 1 173 ? -2.934  -48.794 19.603 1.00 57.07  ? 191 ARG B CZ  1 
ATOM   1263 N NH1 . ARG A 1 173 ? -2.588  -50.006 20.037 1.00 49.67  ? 191 ARG B NH1 1 
ATOM   1264 N NH2 . ARG A 1 173 ? -4.238  -48.484 19.564 1.00 58.76  ? 191 ARG B NH2 1 
ATOM   1265 N N   . ARG A 1 174 ? -5.675  -42.468 17.017 1.00 21.20  ? 192 ARG B N   1 
ATOM   1266 C CA  . ARG A 1 174 ? -6.162  -41.426 16.095 1.00 23.71  ? 192 ARG B CA  1 
ATOM   1267 C C   . ARG A 1 174 ? -5.824  -39.980 16.508 1.00 21.99  ? 192 ARG B C   1 
ATOM   1268 O O   . ARG A 1 174 ? -5.371  -39.208 15.649 1.00 20.81  ? 192 ARG B O   1 
ATOM   1269 C CB  . ARG A 1 174 ? -7.645  -41.636 15.790 1.00 19.05  ? 192 ARG B CB  1 
ATOM   1270 C CG  . ARG A 1 174 ? -7.862  -43.009 15.209 1.00 22.62  ? 192 ARG B CG  1 
ATOM   1271 C CD  . ARG A 1 174 ? -9.179  -43.122 14.482 1.00 25.13  ? 192 ARG B CD  1 
ATOM   1272 N NE  . ARG A 1 174 ? -9.248  -42.131 13.417 1.00 24.10  ? 192 ARG B NE  1 
ATOM   1273 C CZ  . ARG A 1 174 ? -10.134 -41.130 13.321 1.00 22.24  ? 192 ARG B CZ  1 
ATOM   1274 N NH1 . ARG A 1 174 ? -10.074 -40.319 12.259 1.00 22.78  ? 192 ARG B NH1 1 
ATOM   1275 N NH2 . ARG A 1 174 ? -11.059 -40.948 14.240 1.00 19.75  ? 192 ARG B NH2 1 
ATOM   1276 N N   . VAL A 1 175 ? -6.014  -39.622 17.790 1.00 22.78  ? 193 VAL B N   1 
ATOM   1277 C CA  . VAL A 1 175 ? -5.443  -38.357 18.363 1.00 21.68  ? 193 VAL B CA  1 
ATOM   1278 C C   . VAL A 1 175 ? -3.943  -38.310 18.047 1.00 23.52  ? 193 VAL B C   1 
ATOM   1279 O O   . VAL A 1 175 ? -3.420  -37.322 17.503 1.00 21.88  ? 193 VAL B O   1 
ATOM   1280 C CB  . VAL A 1 175 ? -5.689  -38.267 19.900 1.00 20.84  ? 193 VAL B CB  1 
ATOM   1281 C CG1 . VAL A 1 175 ? -5.112  -36.963 20.516 1.00 21.00  ? 193 VAL B CG1 1 
ATOM   1282 C CG2 . VAL A 1 175 ? -7.182  -38.277 20.127 1.00 20.74  ? 193 VAL B CG2 1 
ATOM   1283 N N   . GLU A 1 176 ? -3.260  -39.417 18.303 1.00 25.68  ? 194 GLU B N   1 
ATOM   1284 C CA  . GLU A 1 176 ? -1.803  -39.490 18.015 1.00 25.89  ? 194 GLU B CA  1 
ATOM   1285 C C   . GLU A 1 176 ? -1.478  -39.294 16.559 1.00 27.74  ? 194 GLU B C   1 
ATOM   1286 O O   . GLU A 1 176 ? -0.560  -38.517 16.235 1.00 24.83  ? 194 GLU B O   1 
ATOM   1287 C CB  . GLU A 1 176 ? -1.181  -40.783 18.523 1.00 28.05  ? 194 GLU B CB  1 
ATOM   1288 C CG  . GLU A 1 176 ? 0.359   -40.669 18.602 1.00 33.38  ? 194 GLU B CG  1 
ATOM   1289 C CD  . GLU A 1 176 ? 1.066   -42.017 18.865 1.00 42.88  ? 194 GLU B CD  1 
ATOM   1290 O OE1 . GLU A 1 176 ? 0.369   -43.070 19.028 1.00 45.02  ? 194 GLU B OE1 1 
ATOM   1291 O OE2 . GLU A 1 176 ? 2.323   -42.021 18.913 1.00 47.22  ? 194 GLU B OE2 1 
ATOM   1292 N N   . GLU A 1 177 ? -2.255  -39.915 15.653 1.00 28.69  ? 195 GLU B N   1 
ATOM   1293 C CA  . GLU A 1 177 ? -1.984  -39.671 14.217 1.00 30.56  ? 195 GLU B CA  1 
ATOM   1294 C C   . GLU A 1 177 ? -2.119  -38.225 13.837 1.00 26.25  ? 195 GLU B C   1 
ATOM   1295 O O   . GLU A 1 177 ? -1.304  -37.757 13.063 1.00 28.75  ? 195 GLU B O   1 
ATOM   1296 C CB  . GLU A 1 177 ? -2.855  -40.535 13.262 1.00 29.83  ? 195 GLU B CB  1 
ATOM   1297 C CG  . GLU A 1 177 ? -2.618  -42.035 13.468 1.00 35.20  ? 195 GLU B CG  1 
ATOM   1298 C CD  . GLU A 1 177 ? -3.800  -42.929 13.024 1.00 38.92  ? 195 GLU B CD  1 
ATOM   1299 O OE1 . GLU A 1 177 ? -4.818  -42.410 12.506 1.00 34.12  ? 195 GLU B OE1 1 
ATOM   1300 O OE2 . GLU A 1 177 ? -3.723  -44.162 13.243 1.00 41.79  ? 195 GLU B OE2 1 
ATOM   1301 N N   . LEU A 1 178 ? -3.199  -37.572 14.276 1.00 26.65  ? 196 LEU B N   1 
ATOM   1302 C CA  . LEU A 1 178 ? -3.484  -36.161 13.895 1.00 24.73  ? 196 LEU B CA  1 
ATOM   1303 C C   . LEU A 1 178 ? -2.424  -35.235 14.521 1.00 25.79  ? 196 LEU B C   1 
ATOM   1304 O O   . LEU A 1 178 ? -1.827  -34.389 13.844 1.00 26.95  ? 196 LEU B O   1 
ATOM   1305 C CB  . LEU A 1 178 ? -4.911  -35.745 14.304 1.00 24.31  ? 196 LEU B CB  1 
ATOM   1306 C CG  . LEU A 1 178 ? -5.304  -34.285 13.918 1.00 23.47  ? 196 LEU B CG  1 
ATOM   1307 C CD1 . LEU A 1 178 ? -5.381  -34.064 12.380 1.00 24.37  ? 196 LEU B CD1 1 
ATOM   1308 C CD2 . LEU A 1 178 ? -6.628  -33.932 14.553 1.00 26.26  ? 196 LEU B CD2 1 
ATOM   1309 N N   . GLN A 1 179 ? -2.129  -35.431 15.800 1.00 24.52  ? 197 GLN B N   1 
ATOM   1310 C CA  . GLN A 1 179 ? -0.963  -34.742 16.399 1.00 27.15  ? 197 GLN B CA  1 
ATOM   1311 C C   . GLN A 1 179 ? 0.393   -34.889 15.640 1.00 26.25  ? 197 GLN B C   1 
ATOM   1312 O O   . GLN A 1 179 ? 1.089   -33.917 15.445 1.00 30.46  ? 197 GLN B O   1 
ATOM   1313 C CB  . GLN A 1 179 ? -0.786  -35.240 17.821 1.00 30.36  ? 197 GLN B CB  1 
ATOM   1314 C CG  . GLN A 1 179 ? 0.523   -34.876 18.489 1.00 35.08  ? 197 GLN B CG  1 
ATOM   1315 C CD  . GLN A 1 179 ? 0.700   -35.671 19.796 1.00 39.52  ? 197 GLN B CD  1 
ATOM   1316 O OE1 . GLN A 1 179 ? 0.912   -36.887 19.785 1.00 42.05  ? 197 GLN B OE1 1 
ATOM   1317 N NE2 . GLN A 1 179 ? 0.604   -34.989 20.909 1.00 33.60  ? 197 GLN B NE2 1 
ATOM   1318 N N   . ASN A 1 180 ? 0.793   -36.104 15.272 1.00 30.97  ? 198 ASN B N   1 
ATOM   1319 C CA  . ASN A 1 180 ? 2.000   -36.311 14.438 1.00 30.02  ? 198 ASN B CA  1 
ATOM   1320 C C   . ASN A 1 180 ? 1.891   -35.609 13.139 1.00 26.51  ? 198 ASN B C   1 
ATOM   1321 O O   . ASN A 1 180 ? 2.823   -34.981 12.713 1.00 28.58  ? 198 ASN B O   1 
ATOM   1322 C CB  . ASN A 1 180 ? 2.331   -37.805 14.204 1.00 30.98  ? 198 ASN B CB  1 
ATOM   1323 C CG  . ASN A 1 180 ? 2.747   -38.512 15.488 1.00 39.25  ? 198 ASN B CG  1 
ATOM   1324 O OD1 . ASN A 1 180 ? 3.085   -37.848 16.491 1.00 44.01  ? 198 ASN B OD1 1 
ATOM   1325 N ND2 . ASN A 1 180 ? 2.673   -39.870 15.496 1.00 33.33  ? 198 ASN B ND2 1 
ATOM   1326 N N   . ARG A 1 181 ? 0.734   -35.676 12.496 1.00 29.95  ? 199 ARG B N   1 
ATOM   1327 C CA  . ARG A 1 181 ? 0.524   -34.817 11.331 1.00 27.41  ? 199 ARG B CA  1 
ATOM   1328 C C   . ARG A 1 181 ? 0.828   -33.350 11.637 1.00 27.17  ? 199 ARG B C   1 
ATOM   1329 O O   . ARG A 1 181 ? 1.525   -32.662 10.875 1.00 26.02  ? 199 ARG B O   1 
ATOM   1330 C CB  . ARG A 1 181 ? -0.916  -34.965 10.821 1.00 28.96  ? 199 ARG B CB  1 
ATOM   1331 C CG  . ARG A 1 181 ? -1.025  -35.893 9.636  1.00 36.48  ? 199 ARG B CG  1 
ATOM   1332 C CD  . ARG A 1 181 ? -2.475  -36.068 9.193  1.00 38.78  ? 199 ARG B CD  1 
ATOM   1333 N NE  . ARG A 1 181 ? -2.937  -37.296 9.809  1.00 48.20  ? 199 ARG B NE  1 
ATOM   1334 C CZ  . ARG A 1 181 ? -4.136  -37.470 10.337 1.00 55.02  ? 199 ARG B CZ  1 
ATOM   1335 N NH1 . ARG A 1 181 ? -4.429  -38.641 10.873 1.00 60.07  ? 199 ARG B NH1 1 
ATOM   1336 N NH2 . ARG A 1 181 ? -5.038  -36.491 10.323 1.00 49.21  ? 199 ARG B NH2 1 
ATOM   1337 N N   . ILE A 1 182 ? 0.320   -32.847 12.767 1.00 25.95  ? 200 ILE B N   1 
ATOM   1338 C CA  . ILE A 1 182 ? 0.535   -31.451 13.014 1.00 25.62  ? 200 ILE B CA  1 
ATOM   1339 C C   . ILE A 1 182 ? 1.979   -31.172 13.394 1.00 28.87  ? 200 ILE B C   1 
ATOM   1340 O O   . ILE A 1 182 ? 2.545   -30.178 12.962 1.00 26.47  ? 200 ILE B O   1 
ATOM   1341 C CB  . ILE A 1 182 ? -0.457  -30.877 14.033 1.00 23.83  ? 200 ILE B CB  1 
ATOM   1342 C CG1 . ILE A 1 182 ? -1.834  -30.702 13.361 1.00 23.58  ? 200 ILE B CG1 1 
ATOM   1343 C CG2 . ILE A 1 182 ? 0.039   -29.518 14.514 1.00 25.39  ? 200 ILE B CG2 1 
ATOM   1344 C CD1 . ILE A 1 182 ? -3.044  -31.010 14.245 1.00 23.33  ? 200 ILE B CD1 1 
ATOM   1345 N N   . ALA A 1 183 ? 2.574   -32.030 14.216 1.00 29.51  ? 201 ALA B N   1 
ATOM   1346 C CA  . ALA A 1 183 ? 3.971   -31.814 14.600 1.00 29.44  ? 201 ALA B CA  1 
ATOM   1347 C C   . ALA A 1 183 ? 4.920   -31.879 13.335 1.00 29.74  ? 201 ALA B C   1 
ATOM   1348 O O   . ALA A 1 183 ? 5.862   -31.095 13.198 1.00 30.55  ? 201 ALA B O   1 
ATOM   1349 C CB  . ALA A 1 183 ? 4.384   -32.818 15.679 1.00 29.77  ? 201 ALA B CB  1 
ATOM   1350 N N   . SER A 1 184 ? 4.638   -32.783 12.411 1.00 28.31  ? 202 SER B N   1 
ATOM   1351 C CA  . SER A 1 184 ? 5.408   -32.857 11.145 1.00 33.30  ? 202 SER B CA  1 
ATOM   1352 C C   . SER A 1 184 ? 5.323   -31.539 10.378 1.00 32.35  ? 202 SER B C   1 
ATOM   1353 O O   . SER A 1 184 ? 6.331   -31.021 9.903  1.00 32.72  ? 202 SER B O   1 
ATOM   1354 C CB  . SER A 1 184 ? 4.859   -33.959 10.253 1.00 33.41  ? 202 SER B CB  1 
ATOM   1355 O OG  . SER A 1 184 ? 5.230   -35.214 10.744 1.00 47.29  ? 202 SER B OG  1 
ATOM   1356 N N   . CYS A 1 185 ? 4.108   -30.992 10.315 1.00 34.20  ? 203 CYS B N   1 
ATOM   1357 C CA  . CYS A 1 185 ? 3.862   -29.738 9.636  1.00 36.57  ? 203 CYS B CA  1 
ATOM   1358 C C   . CYS A 1 185 ? 4.724   -28.669 10.265 1.00 38.42  ? 203 CYS B C   1 
ATOM   1359 O O   . CYS A 1 185 ? 5.449   -27.931 9.566  1.00 39.37  ? 203 CYS B O   1 
ATOM   1360 C CB  . CYS A 1 185 ? 2.409   -29.368 9.799  1.00 37.73  ? 203 CYS B CB  1 
ATOM   1361 S SG  . CYS A 1 185 ? 1.821   -28.023 8.744  1.00 44.21  ? 203 CYS B SG  1 
ATOM   1362 N N   . LEU A 1 186 ? 4.660   -28.594 11.595 1.00 34.75  ? 204 LEU B N   1 
ATOM   1363 C CA  . LEU A 1 186 ? 5.404   -27.584 12.334 1.00 31.54  ? 204 LEU B CA  1 
ATOM   1364 C C   . LEU A 1 186 ? 6.884   -27.789 12.025 1.00 30.48  ? 204 LEU B C   1 
ATOM   1365 O O   . LEU A 1 186 ? 7.514   -26.897 11.543 1.00 29.04  ? 204 LEU B O   1 
ATOM   1366 C CB  . LEU A 1 186 ? 5.126   -27.646 13.853 1.00 29.21  ? 204 LEU B CB  1 
ATOM   1367 C CG  . LEU A 1 186 ? 5.995   -26.754 14.773 1.00 34.36  ? 204 LEU B CG  1 
ATOM   1368 C CD1 . LEU A 1 186 ? 5.814   -25.258 14.506 1.00 31.42  ? 204 LEU B CD1 1 
ATOM   1369 C CD2 . LEU A 1 186 ? 5.881   -27.047 16.282 1.00 29.29  ? 204 LEU B CD2 1 
ATOM   1370 N N   . LYS A 1 187 ? 7.412   -28.986 12.297 1.00 31.03  ? 205 LYS B N   1 
ATOM   1371 C CA  . LYS A 1 187 ? 8.826   -29.268 12.139 1.00 34.72  ? 205 LYS B CA  1 
ATOM   1372 C C   . LYS A 1 187 ? 9.318   -28.852 10.743 1.00 36.29  ? 205 LYS B C   1 
ATOM   1373 O O   . LYS A 1 187 ? 10.315  -28.149 10.617 1.00 42.92  ? 205 LYS B O   1 
ATOM   1374 C CB  . LYS A 1 187 ? 9.055   -30.765 12.342 1.00 36.15  ? 205 LYS B CB  1 
ATOM   1375 C CG  . LYS A 1 187 ? 10.522  -31.173 12.357 1.00 45.46  ? 205 LYS B CG  1 
ATOM   1376 C CD  . LYS A 1 187 ? 10.828  -32.313 11.386 1.00 45.65  ? 205 LYS B CD  1 
ATOM   1377 C CE  . LYS A 1 187 ? 11.724  -33.324 12.061 1.00 47.71  ? 205 LYS B CE  1 
ATOM   1378 N NZ  . LYS A 1 187 ? 12.879  -33.541 11.167 1.00 44.78  ? 205 LYS B NZ  1 
ATOM   1379 N N   . GLU A 1 188 ? 8.605   -29.253 9.695  1.00 37.31  ? 206 GLU B N   1 
ATOM   1380 C CA  . GLU A 1 188 ? 8.986   -28.841 8.356  1.00 43.61  ? 206 GLU B CA  1 
ATOM   1381 C C   . GLU A 1 188 ? 8.937   -27.316 8.195  1.00 45.89  ? 206 GLU B C   1 
ATOM   1382 O O   . GLU A 1 188 ? 9.882   -26.741 7.660  1.00 49.37  ? 206 GLU B O   1 
ATOM   1383 C CB  . GLU A 1 188 ? 8.133   -29.534 7.302  1.00 46.66  ? 206 GLU B CB  1 
ATOM   1384 C CG  . GLU A 1 188 ? 8.213   -28.875 5.934  1.00 59.46  ? 206 GLU B CG  1 
ATOM   1385 C CD  . GLU A 1 188 ? 7.726   -29.779 4.810  1.00 70.22  ? 206 GLU B CD  1 
ATOM   1386 O OE1 . GLU A 1 188 ? 7.722   -29.328 3.638  1.00 80.21  ? 206 GLU B OE1 1 
ATOM   1387 O OE2 . GLU A 1 188 ? 7.340   -30.941 5.091  1.00 70.98  ? 206 GLU B OE2 1 
ATOM   1388 N N   . HIS A 1 189 ? 7.869   -26.651 8.652  1.00 43.42  ? 207 HIS B N   1 
ATOM   1389 C CA  . HIS A 1 189 ? 7.814   -25.171 8.567  1.00 41.00  ? 207 HIS B CA  1 
ATOM   1390 C C   . HIS A 1 189 ? 8.949   -24.442 9.281  1.00 45.28  ? 207 HIS B C   1 
ATOM   1391 O O   . HIS A 1 189 ? 9.473   -23.434 8.792  1.00 43.52  ? 207 HIS B O   1 
ATOM   1392 C CB  . HIS A 1 189 ? 6.480   -24.607 9.036  1.00 42.13  ? 207 HIS B CB  1 
ATOM   1393 C CG  . HIS A 1 189 ? 6.528   -23.129 9.248  1.00 40.67  ? 207 HIS B CG  1 
ATOM   1394 N ND1 . HIS A 1 189 ? 6.441   -22.251 8.229  1.00 45.25  ? 207 HIS B ND1 1 
ATOM   1395 C CD2 . HIS A 1 189 ? 6.730   -22.382 10.390 1.00 42.77  ? 207 HIS B CD2 1 
ATOM   1396 C CE1 . HIS A 1 189 ? 6.568   -20.999 8.705  1.00 42.71  ? 207 HIS B CE1 1 
ATOM   1397 N NE2 . HIS A 1 189 ? 6.737   -21.080 10.028 1.00 38.82  ? 207 HIS B NE2 1 
ATOM   1398 N N   . VAL A 1 190 ? 9.320   -24.925 10.455 1.00 43.29  ? 208 VAL B N   1 
ATOM   1399 C CA  . VAL A 1 190 ? 10.419  -24.346 11.181 1.00 47.76  ? 208 VAL B CA  1 
ATOM   1400 C C   . VAL A 1 190 ? 11.767  -24.647 10.521 1.00 56.92  ? 208 VAL B C   1 
ATOM   1401 O O   . VAL A 1 190 ? 12.700  -23.856 10.673 1.00 60.22  ? 208 VAL B O   1 
ATOM   1402 C CB  . VAL A 1 190 ? 10.384  -24.797 12.637 1.00 50.36  ? 208 VAL B CB  1 
ATOM   1403 C CG1 . VAL A 1 190 ? 11.747  -24.648 13.298 1.00 54.68  ? 208 VAL B CG1 1 
ATOM   1404 C CG2 . VAL A 1 190 ? 9.329   -23.989 13.375 1.00 46.29  ? 208 VAL B CG2 1 
ATOM   1405 N N   . ALA A 1 191 ? 11.871  -25.772 9.801  1.00 53.38  ? 209 ALA B N   1 
ATOM   1406 C CA  . ALA A 1 191 ? 13.037  -26.005 8.922  1.00 61.22  ? 209 ALA B CA  1 
ATOM   1407 C C   . ALA A 1 191 ? 12.976  -25.195 7.601  1.00 59.76  ? 209 ALA B C   1 
ATOM   1408 O O   . ALA A 1 191 ? 14.005  -24.686 7.137  1.00 54.06  ? 209 ALA B O   1 
ATOM   1409 C CB  . ALA A 1 191 ? 13.264  -27.497 8.647  1.00 56.92  ? 209 ALA B CB  1 
ATOM   1410 N N   . ALA A 1 192 ? 11.774  -25.055 7.034  1.00 58.13  ? 210 ALA B N   1 
ATOM   1411 C CA  . ALA A 1 192 ? 11.566  -24.349 5.765  1.00 57.28  ? 210 ALA B CA  1 
ATOM   1412 C C   . ALA A 1 192 ? 11.630  -22.830 5.866  1.00 65.15  ? 210 ALA B C   1 
ATOM   1413 O O   . ALA A 1 192 ? 11.588  -22.139 4.840  1.00 62.65  ? 210 ALA B O   1 
ATOM   1414 C CB  . ALA A 1 192 ? 10.264  -24.782 5.106  1.00 65.69  ? 210 ALA B CB  1 
ATOM   1415 N N   . VAL A 1 193 ? 11.717  -22.307 7.092  1.00 71.05  ? 211 VAL B N   1 
ATOM   1416 C CA  . VAL A 1 193 ? 12.012  -20.884 7.315  1.00 72.05  ? 211 VAL B CA  1 
ATOM   1417 C C   . VAL A 1 193 ? 13.418  -20.676 7.879  1.00 81.81  ? 211 VAL B C   1 
ATOM   1418 O O   . VAL A 1 193 ? 14.144  -19.829 7.380  1.00 87.59  ? 211 VAL B O   1 
ATOM   1419 C CB  . VAL A 1 193 ? 10.988  -20.175 8.232  1.00 70.33  ? 211 VAL B CB  1 
ATOM   1420 C CG1 . VAL A 1 193 ? 11.612  -18.950 8.895  1.00 62.52  ? 211 VAL B CG1 1 
ATOM   1421 C CG2 . VAL A 1 193 ? 9.748   -19.785 7.441  1.00 67.87  ? 211 VAL B CG2 1 
ATOM   1422 N N   . ALA A 1 194 ? 13.801  -21.456 8.895  1.00 86.11  ? 212 ALA B N   1 
ATOM   1423 C CA  . ALA A 1 194 ? 14.971  -21.122 9.721  1.00 91.38  ? 212 ALA B CA  1 
ATOM   1424 C C   . ALA A 1 194 ? 16.259  -21.934 9.461  1.00 94.99  ? 212 ALA B C   1 
ATOM   1425 O O   . ALA A 1 194 ? 17.123  -22.022 10.342 1.00 94.43  ? 212 ALA B O   1 
ATOM   1426 C CB  . ALA A 1 194 ? 14.597  -21.125 11.208 1.00 82.98  ? 212 ALA B CB  1 
ATOM   1427 N N   . GLY A 1 195 ? 16.396  -22.488 8.250  1.00 97.26  ? 213 GLY B N   1 
ATOM   1428 C CA  . GLY A 1 195 ? 17.610  -23.218 7.855  1.00 101.87 ? 213 GLY B CA  1 
ATOM   1429 C C   . GLY A 1 195 ? 17.434  -24.702 7.548  1.00 111.26 ? 213 GLY B C   1 
ATOM   1430 O O   . GLY A 1 195 ? 16.758  -25.436 8.286  1.00 95.91  ? 213 GLY B O   1 
ATOM   1431 N N   . GLU A 1 196 ? 18.061  -25.143 6.450  1.00 131.32 ? 214 GLU B N   1 
ATOM   1432 C CA  . GLU A 1 196 ? 17.998  -26.544 6.011  1.00 135.73 ? 214 GLU B CA  1 
ATOM   1433 C C   . GLU A 1 196 ? 19.305  -27.298 6.357  1.00 144.03 ? 214 GLU B C   1 
ATOM   1434 O O   . GLU A 1 196 ? 20.349  -26.667 6.560  1.00 154.99 ? 214 GLU B O   1 
ATOM   1435 C CB  . GLU A 1 196 ? 17.708  -26.605 4.502  1.00 124.70 ? 214 GLU B CB  1 
ATOM   1436 N N   . PRO A 1 197 ? 19.252  -28.648 6.448  1.00 143.22 ? 215 PRO B N   1 
ATOM   1437 C CA  . PRO A 1 197 ? 18.053  -29.486 6.380  1.00 137.46 ? 215 PRO B CA  1 
ATOM   1438 C C   . PRO A 1 197 ? 17.458  -29.827 7.757  1.00 126.94 ? 215 PRO B C   1 
ATOM   1439 O O   . PRO A 1 197 ? 16.520  -30.622 7.832  1.00 119.29 ? 215 PRO B O   1 
ATOM   1440 C CB  . PRO A 1 197 ? 18.555  -30.765 5.667  1.00 135.39 ? 215 PRO B CB  1 
ATOM   1441 C CG  . PRO A 1 197 ? 20.030  -30.578 5.434  1.00 128.90 ? 215 PRO B CG  1 
ATOM   1442 C CD  . PRO A 1 197 ? 20.468  -29.476 6.356  1.00 132.52 ? 215 PRO B CD  1 
ATOM   1443 N N   . GLN A 1 198 ? 17.991  -29.229 8.825  1.00 122.07 ? 216 GLN B N   1 
ATOM   1444 C CA  . GLN A 1 198 ? 17.526  -29.508 10.193 1.00 118.66 ? 216 GLN B CA  1 
ATOM   1445 C C   . GLN A 1 198 ? 16.804  -28.315 10.818 1.00 110.65 ? 216 GLN B C   1 
ATOM   1446 O O   . GLN A 1 198 ? 16.157  -28.445 11.858 1.00 112.14 ? 216 GLN B O   1 
ATOM   1447 C CB  . GLN A 1 198 ? 18.685  -29.967 11.093 1.00 112.89 ? 216 GLN B CB  1 
ATOM   1448 N N   . ALA A 1 200 ? 16.780  -27.114 14.476 1.00 84.03  ? 218 ALA B N   1 
ATOM   1449 C CA  . ALA A 1 200 ? 15.837  -27.800 15.356 1.00 81.38  ? 218 ALA B CA  1 
ATOM   1450 C C   . ALA A 1 200 ? 16.211  -27.636 16.832 1.00 74.65  ? 218 ALA B C   1 
ATOM   1451 O O   . ALA A 1 200 ? 15.907  -28.486 17.664 1.00 70.58  ? 218 ALA B O   1 
ATOM   1452 C CB  . ALA A 1 200 ? 15.713  -29.279 14.977 1.00 82.12  ? 218 ALA B CB  1 
ATOM   1453 N N   . SER A 1 201 ? 16.900  -26.547 17.145 1.00 74.39  ? 219 SER B N   1 
ATOM   1454 C CA  . SER A 1 201 ? 16.919  -26.055 18.510 1.00 68.13  ? 219 SER B CA  1 
ATOM   1455 C C   . SER A 1 201 ? 15.746  -25.081 18.600 1.00 64.48  ? 219 SER B C   1 
ATOM   1456 O O   . SER A 1 201 ? 15.119  -24.969 19.647 1.00 57.60  ? 219 SER B O   1 
ATOM   1457 C CB  . SER A 1 201 ? 18.242  -25.352 18.860 1.00 70.48  ? 219 SER B CB  1 
ATOM   1458 O OG  . SER A 1 201 ? 18.119  -23.930 18.882 1.00 60.72  ? 219 SER B OG  1 
ATOM   1459 N N   . CYS A 1 202 ? 15.455  -24.371 17.502 1.00 61.82  ? 220 CYS B N   1 
ATOM   1460 C CA  . CYS A 1 202 ? 14.336  -23.443 17.505 1.00 58.00  ? 220 CYS B CA  1 
ATOM   1461 C C   . CYS A 1 202 ? 13.116  -24.247 17.927 1.00 58.79  ? 220 CYS B C   1 
ATOM   1462 O O   . CYS A 1 202 ? 12.400  -23.841 18.845 1.00 52.63  ? 220 CYS B O   1 
ATOM   1463 C CB  . CYS A 1 202 ? 14.103  -22.810 16.133 1.00 62.70  ? 220 CYS B CB  1 
ATOM   1464 S SG  . CYS A 1 202 ? 12.362  -22.390 15.773 1.00 67.12  ? 220 CYS B SG  1 
ATOM   1465 N N   . LEU A 1 203 ? 12.942  -25.402 17.270 1.00 53.59  ? 221 LEU B N   1 
ATOM   1466 C CA  . LEU A 1 203 ? 11.806  -26.292 17.440 1.00 52.79  ? 221 LEU B CA  1 
ATOM   1467 C C   . LEU A 1 203 ? 11.671  -26.787 18.882 1.00 51.42  ? 221 LEU B C   1 
ATOM   1468 O O   . LEU A 1 203 ? 10.613  -26.637 19.493 1.00 46.91  ? 221 LEU B O   1 
ATOM   1469 C CB  . LEU A 1 203 ? 11.927  -27.472 16.489 1.00 52.65  ? 221 LEU B CB  1 
ATOM   1470 C CG  . LEU A 1 203 ? 10.969  -28.668 16.591 1.00 63.98  ? 221 LEU B CG  1 
ATOM   1471 C CD1 . LEU A 1 203 ? 9.607   -28.401 15.942 1.00 56.17  ? 221 LEU B CD1 1 
ATOM   1472 C CD2 . LEU A 1 203 ? 11.624  -29.916 15.987 1.00 62.18  ? 221 LEU B CD2 1 
ATOM   1473 N N   . SER A 1 204 ? 12.728  -27.345 19.455 1.00 44.27  ? 222 SER B N   1 
ATOM   1474 C CA  . SER A 1 204 ? 12.583  -27.786 20.850 1.00 50.80  ? 222 SER B CA  1 
ATOM   1475 C C   . SER A 1 204 ? 12.581  -26.673 21.904 1.00 47.03  ? 222 SER B C   1 
ATOM   1476 O O   . SER A 1 204 ? 12.285  -26.912 23.086 1.00 49.80  ? 222 SER B O   1 
ATOM   1477 C CB  . SER A 1 204 ? 13.557  -28.906 21.205 1.00 48.04  ? 222 SER B CB  1 
ATOM   1478 O OG  . SER A 1 204 ? 14.856  -28.392 21.222 1.00 46.80  ? 222 SER B OG  1 
ATOM   1479 N N   . ARG A 1 205 ? 12.878  -25.448 21.506 1.00 43.02  ? 223 ARG B N   1 
ATOM   1480 C CA  . ARG A 1 205 ? 12.595  -24.329 22.428 1.00 50.03  ? 223 ARG B CA  1 
ATOM   1481 C C   . ARG A 1 205 ? 11.109  -23.984 22.353 1.00 47.92  ? 223 ARG B C   1 
ATOM   1482 O O   . ARG A 1 205 ? 10.495  -23.746 23.366 1.00 45.05  ? 223 ARG B O   1 
ATOM   1483 C CB  . ARG A 1 205 ? 13.473  -23.097 22.193 1.00 51.35  ? 223 ARG B CB  1 
ATOM   1484 C CG  . ARG A 1 205 ? 14.605  -22.939 23.203 1.00 51.16  ? 223 ARG B CG  1 
ATOM   1485 C CD  . ARG A 1 205 ? 15.549  -21.841 22.756 1.00 61.08  ? 223 ARG B CD  1 
ATOM   1486 N NE  . ARG A 1 205 ? 15.574  -21.791 21.295 1.00 70.76  ? 223 ARG B NE  1 
ATOM   1487 C CZ  . ARG A 1 205 ? 16.060  -20.795 20.562 1.00 71.93  ? 223 ARG B CZ  1 
ATOM   1488 N NH1 . ARG A 1 205 ? 16.586  -19.723 21.149 1.00 72.39  ? 223 ARG B NH1 1 
ATOM   1489 N NH2 . ARG A 1 205 ? 16.009  -20.877 19.230 1.00 72.86  ? 223 ARG B NH2 1 
ATOM   1490 N N   . LEU A 1 206 ? 10.540  -24.028 21.147 1.00 46.60  ? 224 LEU B N   1 
ATOM   1491 C CA  . LEU A 1 206 ? 9.107   -23.909 20.957 1.00 45.35  ? 224 LEU B CA  1 
ATOM   1492 C C   . LEU A 1 206 ? 8.303   -24.937 21.778 1.00 45.61  ? 224 LEU B C   1 
ATOM   1493 O O   . LEU A 1 206 ? 7.393   -24.586 22.516 1.00 34.75  ? 224 LEU B O   1 
ATOM   1494 C CB  . LEU A 1 206 ? 8.783   -24.151 19.491 1.00 47.77  ? 224 LEU B CB  1 
ATOM   1495 C CG  . LEU A 1 206 ? 8.770   -23.030 18.478 1.00 46.86  ? 224 LEU B CG  1 
ATOM   1496 C CD1 . LEU A 1 206 ? 8.496   -23.680 17.136 1.00 47.48  ? 224 LEU B CD1 1 
ATOM   1497 C CD2 . LEU A 1 206 ? 7.642   -22.106 18.904 1.00 50.13  ? 224 LEU B CD2 1 
ATOM   1498 N N   . LEU A 1 207 ? 8.629   -26.215 21.581 1.00 41.47  ? 225 LEU B N   1 
ATOM   1499 C CA  . LEU A 1 207 ? 7.951   -27.305 22.235 1.00 34.76  ? 225 LEU B CA  1 
ATOM   1500 C C   . LEU A 1 207 ? 8.186   -27.315 23.737 1.00 33.09  ? 225 LEU B C   1 
ATOM   1501 O O   . LEU A 1 207 ? 7.321   -27.770 24.497 1.00 30.66  ? 225 LEU B O   1 
ATOM   1502 C CB  . LEU A 1 207 ? 8.401   -28.617 21.628 1.00 34.91  ? 225 LEU B CB  1 
ATOM   1503 C CG  . LEU A 1 207 ? 7.522   -29.246 20.558 1.00 40.99  ? 225 LEU B CG  1 
ATOM   1504 C CD1 . LEU A 1 207 ? 6.644   -28.247 19.821 1.00 41.96  ? 225 LEU B CD1 1 
ATOM   1505 C CD2 . LEU A 1 207 ? 8.394   -30.019 19.581 1.00 42.39  ? 225 LEU B CD2 1 
ATOM   1506 N N   . GLY A 1 208 ? 9.353   -26.829 24.146 1.00 28.38  ? 226 GLY B N   1 
ATOM   1507 C CA  . GLY A 1 208 ? 9.637   -26.490 25.525 1.00 31.55  ? 226 GLY B CA  1 
ATOM   1508 C C   . GLY A 1 208 ? 8.602   -25.589 26.203 1.00 37.98  ? 226 GLY B C   1 
ATOM   1509 O O   . GLY A 1 208 ? 8.501   -25.574 27.435 1.00 33.69  ? 226 GLY B O   1 
ATOM   1510 N N   . LYS A 1 209 ? 7.817   -24.835 25.417 1.00 38.02  ? 227 LYS B N   1 
ATOM   1511 C CA  . LYS A 1 209 ? 6.743   -24.022 26.017 1.00 40.54  ? 227 LYS B CA  1 
ATOM   1512 C C   . LYS A 1 209 ? 5.541   -24.862 26.488 1.00 38.26  ? 227 LYS B C   1 
ATOM   1513 O O   . LYS A 1 209 ? 4.709   -24.377 27.235 1.00 37.06  ? 227 LYS B O   1 
ATOM   1514 C CB  . LYS A 1 209 ? 6.245   -22.932 25.048 1.00 38.21  ? 227 LYS B CB  1 
ATOM   1515 C CG  . LYS A 1 209 ? 7.261   -21.848 24.804 1.00 38.24  ? 227 LYS B CG  1 
ATOM   1516 C CD  . LYS A 1 209 ? 7.133   -20.847 25.920 1.00 44.70  ? 227 LYS B CD  1 
ATOM   1517 C CE  . LYS A 1 209 ? 8.473   -20.283 26.321 1.00 46.01  ? 227 LYS B CE  1 
ATOM   1518 N NZ  . LYS A 1 209 ? 8.143   -19.399 27.461 1.00 55.58  ? 227 LYS B NZ  1 
ATOM   1519 N N   . LEU A 1 210 ? 5.419   -26.095 26.021 1.00 31.88  ? 228 LEU B N   1 
ATOM   1520 C CA  . LEU A 1 210 ? 4.232   -26.852 26.369 1.00 32.33  ? 228 LEU B CA  1 
ATOM   1521 C C   . LEU A 1 210 ? 4.157   -27.227 27.884 1.00 30.91  ? 228 LEU B C   1 
ATOM   1522 O O   . LEU A 1 210 ? 3.176   -26.882 28.520 1.00 34.51  ? 228 LEU B O   1 
ATOM   1523 C CB  . LEU A 1 210 ? 4.034   -28.016 25.396 1.00 30.05  ? 228 LEU B CB  1 
ATOM   1524 C CG  . LEU A 1 210 ? 3.961   -27.574 23.914 1.00 31.28  ? 228 LEU B CG  1 
ATOM   1525 C CD1 . LEU A 1 210 ? 3.773   -28.752 23.018 1.00 27.89  ? 228 LEU B CD1 1 
ATOM   1526 C CD2 . LEU A 1 210 ? 2.883   -26.521 23.706 1.00 36.13  ? 228 LEU B CD2 1 
ATOM   1527 N N   . PRO A 1 211 ? 5.206   -27.864 28.465 1.00 31.84  ? 229 PRO B N   1 
ATOM   1528 C CA  . PRO A 1 211 ? 5.207   -28.074 29.937 1.00 34.07  ? 229 PRO B CA  1 
ATOM   1529 C C   . PRO A 1 211 ? 5.053   -26.834 30.776 1.00 32.62  ? 229 PRO B C   1 
ATOM   1530 O O   . PRO A 1 211 ? 4.281   -26.846 31.718 1.00 35.57  ? 229 PRO B O   1 
ATOM   1531 C CB  . PRO A 1 211 ? 6.550   -28.764 30.223 1.00 31.48  ? 229 PRO B CB  1 
ATOM   1532 C CG  . PRO A 1 211 ? 7.326   -28.633 28.946 1.00 33.43  ? 229 PRO B CG  1 
ATOM   1533 C CD  . PRO A 1 211 ? 6.360   -28.537 27.824 1.00 31.78  ? 229 PRO B CD  1 
ATOM   1534 N N   . GLU A 1 212 ? 5.732   -25.739 30.448 1.00 33.93  ? 230 GLU B N   1 
ATOM   1535 C CA  . GLU A 1 212 ? 5.482   -24.499 31.219 1.00 32.35  ? 230 GLU B CA  1 
ATOM   1536 C C   . GLU A 1 212 ? 3.998   -24.067 31.141 1.00 27.14  ? 230 GLU B C   1 
ATOM   1537 O O   . GLU A 1 212 ? 3.471   -23.534 32.079 1.00 25.18  ? 230 GLU B O   1 
ATOM   1538 C CB  . GLU A 1 212 ? 6.356   -23.321 30.779 1.00 35.29  ? 230 GLU B CB  1 
ATOM   1539 C CG  . GLU A 1 212 ? 7.705   -23.726 30.227 1.00 45.06  ? 230 GLU B CG  1 
ATOM   1540 C CD  . GLU A 1 212 ? 8.497   -22.528 29.769 1.00 44.50  ? 230 GLU B CD  1 
ATOM   1541 O OE1 . GLU A 1 212 ? 9.733   -22.610 29.839 1.00 48.02  ? 230 GLU B OE1 1 
ATOM   1542 O OE2 . GLU A 1 212 ? 7.879   -21.521 29.337 1.00 42.90  ? 230 GLU B OE2 1 
ATOM   1543 N N   . LEU A 1 213 ? 3.341   -24.265 29.987 1.00 26.75  ? 231 LEU B N   1 
ATOM   1544 C CA  . LEU A 1 213 ? 1.919   -23.939 29.843 1.00 23.21  ? 231 LEU B CA  1 
ATOM   1545 C C   . LEU A 1 213 ? 1.056   -24.796 30.801 1.00 22.06  ? 231 LEU B C   1 
ATOM   1546 O O   . LEU A 1 213 ? 0.081   -24.301 31.383 1.00 24.86  ? 231 LEU B O   1 
ATOM   1547 C CB  . LEU A 1 213 ? 1.487   -24.190 28.388 1.00 23.51  ? 231 LEU B CB  1 
ATOM   1548 C CG  . LEU A 1 213 ? 0.145   -23.628 27.970 1.00 23.74  ? 231 LEU B CG  1 
ATOM   1549 C CD1 . LEU A 1 213 ? -0.044  -22.153 28.355 1.00 22.42  ? 231 LEU B CD1 1 
ATOM   1550 C CD2 . LEU A 1 213 ? -0.052  -23.869 26.434 1.00 23.30  ? 231 LEU B CD2 1 
ATOM   1551 N N   . ARG A 1 214 ? 1.355   -26.094 30.889 1.00 23.19  ? 232 ARG B N   1 
ATOM   1552 C CA  . ARG A 1 214 ? 0.637   -26.991 31.816 1.00 25.69  ? 232 ARG B CA  1 
ATOM   1553 C C   . ARG A 1 214 ? 0.714   -26.467 33.228 1.00 25.18  ? 232 ARG B C   1 
ATOM   1554 O O   . ARG A 1 214 ? -0.245  -26.474 33.956 1.00 24.50  ? 232 ARG B O   1 
ATOM   1555 C CB  . ARG A 1 214 ? 1.229   -28.421 31.781 1.00 24.53  ? 232 ARG B CB  1 
ATOM   1556 C CG  . ARG A 1 214 ? 0.863   -29.137 30.486 1.00 27.57  ? 232 ARG B CG  1 
ATOM   1557 C CD  . ARG A 1 214 ? -0.510  -29.782 30.589 1.00 28.82  ? 232 ARG B CD  1 
ATOM   1558 N NE  . ARG A 1 214 ? -0.871  -30.388 29.316 1.00 31.12  ? 232 ARG B NE  1 
ATOM   1559 C CZ  . ARG A 1 214 ? -0.884  -31.680 29.078 1.00 30.30  ? 232 ARG B CZ  1 
ATOM   1560 N NH1 . ARG A 1 214 ? -0.514  -32.517 30.029 1.00 31.66  ? 232 ARG B NH1 1 
ATOM   1561 N NH2 . ARG A 1 214 ? -1.257  -32.125 27.887 1.00 29.34  ? 232 ARG B NH2 1 
ATOM   1562 N N   . THR A 1 215 ? 1.928   -26.060 33.609 1.00 28.32  ? 233 THR B N   1 
ATOM   1563 C CA  . THR A 1 215 ? 2.198   -25.525 34.909 1.00 28.96  ? 233 THR B CA  1 
ATOM   1564 C C   . THR A 1 215 ? 1.376   -24.312 35.158 1.00 27.65  ? 233 THR B C   1 
ATOM   1565 O O   . THR A 1 215 ? 0.838   -24.195 36.217 1.00 28.36  ? 233 THR B O   1 
ATOM   1566 C CB  . THR A 1 215 ? 3.705   -25.206 35.043 1.00 34.26  ? 233 THR B CB  1 
ATOM   1567 O OG1 . THR A 1 215 ? 4.429   -26.447 35.044 1.00 30.95  ? 233 THR B OG1 1 
ATOM   1568 C CG2 . THR A 1 215 ? 4.019   -24.377 36.351 1.00 34.12  ? 233 THR B CG2 1 
ATOM   1569 N N   . LEU A 1 216 ? 1.282   -23.383 34.206 1.00 31.94  ? 234 LEU B N   1 
ATOM   1570 C CA  . LEU A 1 216 ? 0.321   -22.254 34.342 1.00 28.56  ? 234 LEU B CA  1 
ATOM   1571 C C   . LEU A 1 216 ? -1.146  -22.568 34.382 1.00 32.14  ? 234 LEU B C   1 
ATOM   1572 O O   . LEU A 1 216 ? -1.858  -21.854 35.058 1.00 35.45  ? 234 LEU B O   1 
ATOM   1573 C CB  . LEU A 1 216 ? 0.495   -21.305 33.169 1.00 32.23  ? 234 LEU B CB  1 
ATOM   1574 C CG  . LEU A 1 216 ? 1.638   -20.332 33.178 1.00 29.15  ? 234 LEU B CG  1 
ATOM   1575 C CD1 . LEU A 1 216 ? 1.850   -20.065 31.698 1.00 29.67  ? 234 LEU B CD1 1 
ATOM   1576 C CD2 . LEU A 1 216 ? 1.080   -19.091 33.907 1.00 27.35  ? 234 LEU B CD2 1 
ATOM   1577 N N   . CYS A 1 217 ? -1.618  -23.555 33.607 1.00 28.09  ? 235 CYS B N   1 
ATOM   1578 C CA  . CYS A 1 217 ? -2.987  -24.081 33.706 1.00 27.74  ? 235 CYS B CA  1 
ATOM   1579 C C   . CYS A 1 217 ? -3.242  -24.384 35.209 1.00 30.39  ? 235 CYS B C   1 
ATOM   1580 O O   . CYS A 1 217 ? -4.287  -24.022 35.747 1.00 28.24  ? 235 CYS B O   1 
ATOM   1581 C CB  . CYS A 1 217 ? -3.220  -25.424 32.905 1.00 31.07  ? 235 CYS B CB  1 
ATOM   1582 S SG  . CYS A 1 217 ? -4.809  -26.452 33.143 1.00 32.88  ? 235 CYS B SG  1 
ATOM   1583 N N   . THR A 1 218 ? -2.296  -25.069 35.856 1.00 30.61  ? 236 THR B N   1 
ATOM   1584 C CA  . THR A 1 218 ? -2.501  -25.560 37.223 1.00 30.45  ? 236 THR B CA  1 
ATOM   1585 C C   . THR A 1 218 ? -2.770  -24.329 38.109 1.00 28.64  ? 236 THR B C   1 
ATOM   1586 O O   . THR A 1 218 ? -3.645  -24.372 38.999 1.00 29.22  ? 236 THR B O   1 
ATOM   1587 C CB  . THR A 1 218 ? -1.234  -26.297 37.714 1.00 31.90  ? 236 THR B CB  1 
ATOM   1588 O OG1 . THR A 1 218 ? -1.007  -27.421 36.901 1.00 34.41  ? 236 THR B OG1 1 
ATOM   1589 C CG2 . THR A 1 218 ? -1.390  -26.757 39.099 1.00 32.45  ? 236 THR B CG2 1 
ATOM   1590 N N   . GLN A 1 219 ? -2.048  -23.238 37.821 1.00 25.79  ? 237 GLN B N   1 
ATOM   1591 C CA  . GLN A 1 219 ? -2.225  -21.959 38.555 1.00 28.29  ? 237 GLN B CA  1 
ATOM   1592 C C   . GLN A 1 219 ? -3.593  -21.330 38.345 1.00 30.54  ? 237 GLN B C   1 
ATOM   1593 O O   . GLN A 1 219 ? -4.159  -20.699 39.264 1.00 30.85  ? 237 GLN B O   1 
ATOM   1594 C CB  . GLN A 1 219 ? -1.192  -20.950 38.173 1.00 27.71  ? 237 GLN B CB  1 
ATOM   1595 C CG  . GLN A 1 219 ? 0.227   -21.303 38.549 1.00 35.14  ? 237 GLN B CG  1 
ATOM   1596 C CD  . GLN A 1 219 ? 1.164   -20.162 38.156 1.00 41.38  ? 237 GLN B CD  1 
ATOM   1597 O OE1 . GLN A 1 219 ? 0.887   -18.948 38.422 1.00 39.32  ? 237 GLN B OE1 1 
ATOM   1598 N NE2 . GLN A 1 219 ? 2.287   -20.532 37.521 1.00 39.17  ? 237 GLN B NE2 1 
ATOM   1599 N N   . GLY A 1 220 ? -4.155  -21.567 37.170 1.00 26.10  ? 238 GLY B N   1 
ATOM   1600 C CA  . GLY A 1 220 ? -5.540  -21.187 36.888 1.00 27.10  ? 238 GLY B CA  1 
ATOM   1601 C C   . GLY A 1 220 ? -6.522  -21.988 37.707 1.00 23.44  ? 238 GLY B C   1 
ATOM   1602 O O   . GLY A 1 220 ? -7.493  -21.422 38.243 1.00 21.77  ? 238 GLY B O   1 
ATOM   1603 N N   . LEU A 1 221 ? -6.293  -23.297 37.787 1.00 23.76  ? 239 LEU B N   1 
ATOM   1604 C CA  . LEU A 1 221 ? -7.225  -24.196 38.574 1.00 26.13  ? 239 LEU B CA  1 
ATOM   1605 C C   . LEU A 1 221 ? -7.156  -23.761 40.048 1.00 22.93  ? 239 LEU B C   1 
ATOM   1606 O O   . LEU A 1 221 ? -8.173  -23.680 40.740 1.00 23.33  ? 239 LEU B O   1 
ATOM   1607 C CB  . LEU A 1 221 ? -6.806  -25.694 38.478 1.00 23.43  ? 239 LEU B CB  1 
ATOM   1608 C CG  . LEU A 1 221 ? -7.042  -26.312 37.098 1.00 26.05  ? 239 LEU B CG  1 
ATOM   1609 C CD1 . LEU A 1 221 ? -6.455  -27.725 37.024 1.00 22.10  ? 239 LEU B CD1 1 
ATOM   1610 C CD2 . LEU A 1 221 ? -8.551  -26.355 36.807 1.00 24.97  ? 239 LEU B CD2 1 
ATOM   1611 N N   . GLN A 1 222 ? -5.949  -23.416 40.489 1.00 21.76  ? 240 GLN B N   1 
ATOM   1612 C CA  . GLN A 1 222 ? -5.798  -22.833 41.847 1.00 26.71  ? 240 GLN B CA  1 
ATOM   1613 C C   . GLN A 1 222 ? -6.587  -21.566 42.090 1.00 26.69  ? 240 GLN B C   1 
ATOM   1614 O O   . GLN A 1 222 ? -7.229  -21.413 43.150 1.00 28.45  ? 240 GLN B O   1 
ATOM   1615 C CB  . GLN A 1 222 ? -4.334  -22.635 42.198 1.00 25.30  ? 240 GLN B CB  1 
ATOM   1616 C CG  . GLN A 1 222 ? -3.584  -23.951 42.349 1.00 25.75  ? 240 GLN B CG  1 
ATOM   1617 C CD  . GLN A 1 222 ? -2.155  -23.643 42.636 1.00 31.02  ? 240 GLN B CD  1 
ATOM   1618 O OE1 . GLN A 1 222 ? -1.377  -23.300 41.744 1.00 31.42  ? 240 GLN B OE1 1 
ATOM   1619 N NE2 . GLN A 1 222 ? -1.805  -23.683 43.900 1.00 32.26  ? 240 GLN B NE2 1 
ATOM   1620 N N   . ARG A 1 223 ? -6.584  -20.664 41.117 1.00 26.49  ? 241 ARG B N   1 
ATOM   1621 C CA  . ARG A 1 223 ? -7.336  -19.452 41.290 1.00 25.09  ? 241 ARG B CA  1 
ATOM   1622 C C   . ARG A 1 223 ? -8.807  -19.795 41.331 1.00 26.05  ? 241 ARG B C   1 
ATOM   1623 O O   . ARG A 1 223 ? -9.532  -19.264 42.164 1.00 23.19  ? 241 ARG B O   1 
ATOM   1624 C CB  . ARG A 1 223 ? -7.047  -18.462 40.182 1.00 24.54  ? 241 ARG B CB  1 
ATOM   1625 C CG  . ARG A 1 223 ? -7.820  -17.177 40.281 1.00 26.53  ? 241 ARG B CG  1 
ATOM   1626 C CD  . ARG A 1 223 ? -7.389  -16.419 41.563 1.00 29.25  ? 241 ARG B CD  1 
ATOM   1627 N NE  . ARG A 1 223 ? -8.104  -15.175 41.788 1.00 30.87  ? 241 ARG B NE  1 
ATOM   1628 C CZ  . ARG A 1 223 ? -8.015  -14.453 42.930 1.00 34.71  ? 241 ARG B CZ  1 
ATOM   1629 N NH1 . ARG A 1 223 ? -7.226  -14.868 43.935 1.00 33.90  ? 241 ARG B NH1 1 
ATOM   1630 N NH2 . ARG A 1 223 ? -8.707  -13.313 43.064 1.00 30.32  ? 241 ARG B NH2 1 
ATOM   1631 N N   . ILE A 1 224 ? -9.252  -20.723 40.468 1.00 25.03  ? 242 ILE B N   1 
ATOM   1632 C CA  . ILE A 1 224 ? -10.631 -21.051 40.451 1.00 25.23  ? 242 ILE B CA  1 
ATOM   1633 C C   . ILE A 1 224 ? -11.037 -21.767 41.719 1.00 28.68  ? 242 ILE B C   1 
ATOM   1634 O O   . ILE A 1 224 ? -12.066 -21.444 42.287 1.00 27.73  ? 242 ILE B O   1 
ATOM   1635 C CB  . ILE A 1 224 ? -11.067 -21.923 39.250 1.00 25.79  ? 242 ILE B CB  1 
ATOM   1636 C CG1 . ILE A 1 224 ? -11.004 -21.112 37.955 1.00 24.78  ? 242 ILE B CG1 1 
ATOM   1637 C CG2 . ILE A 1 224 ? -12.479 -22.402 39.492 1.00 23.83  ? 242 ILE B CG2 1 
ATOM   1638 C CD1 . ILE A 1 224 ? -11.018 -21.997 36.704 1.00 24.53  ? 242 ILE B CD1 1 
ATOM   1639 N N   . PHE A 1 225 ? -10.211 -22.710 42.174 1.00 28.54  ? 243 PHE B N   1 
ATOM   1640 C CA  . PHE A 1 225 ? -10.465 -23.301 43.462 1.00 29.79  ? 243 PHE B CA  1 
ATOM   1641 C C   . PHE A 1 225 ? -10.693 -22.219 44.512 1.00 26.74  ? 243 PHE B C   1 
ATOM   1642 O O   . PHE A 1 225 ? -11.637 -22.310 45.290 1.00 24.84  ? 243 PHE B O   1 
ATOM   1643 C CB  . PHE A 1 225 ? -9.340  -24.206 43.907 1.00 28.20  ? 243 PHE B CB  1 
ATOM   1644 C CG  . PHE A 1 225 ? -9.526  -24.747 45.296 1.00 26.67  ? 243 PHE B CG  1 
ATOM   1645 C CD1 . PHE A 1 225 ? -10.492 -25.743 45.557 1.00 28.58  ? 243 PHE B CD1 1 
ATOM   1646 C CD2 . PHE A 1 225 ? -8.756  -24.284 46.355 1.00 26.32  ? 243 PHE B CD2 1 
ATOM   1647 C CE1 . PHE A 1 225 ? -10.692 -26.230 46.863 1.00 28.68  ? 243 PHE B CE1 1 
ATOM   1648 C CE2 . PHE A 1 225 ? -8.942  -24.802 47.649 1.00 26.89  ? 243 PHE B CE2 1 
ATOM   1649 C CZ  . PHE A 1 225 ? -9.906  -25.773 47.908 1.00 26.26  ? 243 PHE B CZ  1 
ATOM   1650 N N   . TYR A 1 226 ? -9.832  -21.221 44.512 1.00 25.30  ? 244 TYR B N   1 
ATOM   1651 C CA  . TYR A 1 226 ? -9.872  -20.188 45.550 1.00 25.46  ? 244 TYR B CA  1 
ATOM   1652 C C   . TYR A 1 226 ? -11.159 -19.341 45.458 1.00 30.25  ? 244 TYR B C   1 
ATOM   1653 O O   . TYR A 1 226 ? -11.721 -18.920 46.502 1.00 27.32  ? 244 TYR B O   1 
ATOM   1654 C CB  . TYR A 1 226 ? -8.621  -19.288 45.505 1.00 26.26  ? 244 TYR B CB  1 
ATOM   1655 C CG  . TYR A 1 226 ? -8.818  -18.042 46.361 1.00 34.04  ? 244 TYR B CG  1 
ATOM   1656 C CD1 . TYR A 1 226 ? -8.538  -18.041 47.746 1.00 34.89  ? 244 TYR B CD1 1 
ATOM   1657 C CD2 . TYR A 1 226 ? -9.405  -16.905 45.816 1.00 33.07  ? 244 TYR B CD2 1 
ATOM   1658 C CE1 . TYR A 1 226 ? -8.780  -16.910 48.523 1.00 37.65  ? 244 TYR B CE1 1 
ATOM   1659 C CE2 . TYR A 1 226 ? -9.631  -15.776 46.574 1.00 39.29  ? 244 TYR B CE2 1 
ATOM   1660 C CZ  . TYR A 1 226 ? -9.325  -15.769 47.913 1.00 40.87  ? 244 TYR B CZ  1 
ATOM   1661 O OH  . TYR A 1 226 ? -9.593  -14.616 48.605 1.00 44.42  ? 244 TYR B OH  1 
ATOM   1662 N N   . LEU A 1 227 ? -11.603 -19.048 44.222 1.00 26.80  ? 245 LEU B N   1 
ATOM   1663 C CA  . LEU A 1 227 ? -12.776 -18.257 44.069 1.00 27.40  ? 245 LEU B CA  1 
ATOM   1664 C C   . LEU A 1 227 ? -13.987 -19.040 44.410 1.00 27.76  ? 245 LEU B C   1 
ATOM   1665 O O   . LEU A 1 227 ? -14.946 -18.494 44.964 1.00 32.94  ? 245 LEU B O   1 
ATOM   1666 C CB  . LEU A 1 227 ? -12.870 -17.578 42.688 1.00 28.84  ? 245 LEU B CB  1 
ATOM   1667 C CG  . LEU A 1 227 ? -11.674 -16.728 42.220 1.00 30.38  ? 245 LEU B CG  1 
ATOM   1668 C CD1 . LEU A 1 227 ? -11.733 -16.404 40.728 1.00 30.41  ? 245 LEU B CD1 1 
ATOM   1669 C CD2 . LEU A 1 227 ? -11.547 -15.428 42.984 1.00 32.56  ? 245 LEU B CD2 1 
ATOM   1670 N N   . LYS A 1 228 ? -13.973 -20.328 44.147 1.00 26.42  ? 246 LYS B N   1 
ATOM   1671 C CA  . LYS A 1 228 ? -15.134 -21.100 44.495 1.00 27.86  ? 246 LYS B CA  1 
ATOM   1672 C C   . LYS A 1 228 ? -15.237 -21.208 46.005 1.00 33.41  ? 246 LYS B C   1 
ATOM   1673 O O   . LYS A 1 228 ? -16.346 -21.243 46.563 1.00 31.06  ? 246 LYS B O   1 
ATOM   1674 C CB  . LYS A 1 228 ? -15.053 -22.501 43.918 1.00 30.13  ? 246 LYS B CB  1 
ATOM   1675 C CG  . LYS A 1 228 ? -14.858 -22.576 42.399 1.00 29.26  ? 246 LYS B CG  1 
ATOM   1676 C CD  . LYS A 1 228 ? -14.702 -24.032 41.948 1.00 31.58  ? 246 LYS B CD  1 
ATOM   1677 C CE  . LYS A 1 228 ? -15.674 -25.006 42.640 1.00 33.33  ? 246 LYS B CE  1 
ATOM   1678 N NZ  . LYS A 1 228 ? -17.063 -25.010 42.052 1.00 35.47  ? 246 LYS B NZ  1 
ATOM   1679 N N   . LEU A 1 229 ? -14.085 -21.216 46.664 1.00 29.35  ? 247 LEU B N   1 
ATOM   1680 C CA  . LEU A 1 229 ? -14.034 -21.320 48.125 1.00 37.64  ? 247 LEU B CA  1 
ATOM   1681 C C   . LEU A 1 229 ? -14.664 -20.083 48.769 1.00 38.20  ? 247 LEU B C   1 
ATOM   1682 O O   . LEU A 1 229 ? -15.541 -20.166 49.622 1.00 37.64  ? 247 LEU B O   1 
ATOM   1683 C CB  . LEU A 1 229 ? -12.577 -21.453 48.564 1.00 34.71  ? 247 LEU B CB  1 
ATOM   1684 C CG  . LEU A 1 229 ? -12.118 -22.608 49.440 1.00 40.14  ? 247 LEU B CG  1 
ATOM   1685 C CD1 . LEU A 1 229 ? -11.017 -21.995 50.274 1.00 35.62  ? 247 LEU B CD1 1 
ATOM   1686 C CD2 . LEU A 1 229 ? -13.198 -23.227 50.360 1.00 39.46  ? 247 LEU B CD2 1 
ATOM   1687 N N   . GLU A 1 230 ? -14.197 -18.949 48.285 1.00 40.67  ? 248 GLU B N   1 
ATOM   1688 C CA  A GLU A 1 230 ? -14.616 -17.636 48.687 0.50 40.62  ? 248 GLU B CA  1 
ATOM   1689 C CA  B GLU A 1 230 ? -14.635 -17.652 48.743 0.50 40.38  ? 248 GLU B CA  1 
ATOM   1690 C C   . GLU A 1 230 ? -16.101 -17.499 48.389 1.00 45.62  ? 248 GLU B C   1 
ATOM   1691 O O   . GLU A 1 230 ? -16.904 -17.047 49.232 1.00 42.70  ? 248 GLU B O   1 
ATOM   1692 C CB  A GLU A 1 230 ? -13.804 -16.660 47.844 0.50 39.04  ? 248 GLU B CB  1 
ATOM   1693 C CB  B GLU A 1 230 ? -13.792 -16.553 48.093 0.50 39.31  ? 248 GLU B CB  1 
ATOM   1694 C CG  A GLU A 1 230 ? -14.371 -15.273 47.721 0.50 38.38  ? 248 GLU B CG  1 
ATOM   1695 C CG  B GLU A 1 230 ? -12.427 -16.362 48.744 0.50 36.54  ? 248 GLU B CG  1 
ATOM   1696 C CD  A GLU A 1 230 ? -13.387 -14.323 47.085 0.50 39.05  ? 248 GLU B CD  1 
ATOM   1697 C CD  B GLU A 1 230 ? -12.518 -16.177 50.245 0.50 36.22  ? 248 GLU B CD  1 
ATOM   1698 O OE1 A GLU A 1 230 ? -13.155 -14.436 45.878 0.50 39.19  ? 248 GLU B OE1 1 
ATOM   1699 O OE1 B GLU A 1 230 ? -11.905 -16.964 50.990 0.50 30.91  ? 248 GLU B OE1 1 
ATOM   1700 O OE2 A GLU A 1 230 ? -12.838 -13.459 47.788 0.50 36.68  ? 248 GLU B OE2 1 
ATOM   1701 O OE2 B GLU A 1 230 ? -13.212 -15.244 50.696 0.50 38.54  ? 248 GLU B OE2 1 
ATOM   1702 N N   . ASP A 1 231 ? -16.444 -17.902 47.159 1.00 45.07  ? 249 ASP B N   1 
ATOM   1703 C CA  . ASP A 1 231 ? -17.813 -17.932 46.681 1.00 47.60  ? 249 ASP B CA  1 
ATOM   1704 C C   . ASP A 1 231 ? -18.530 -16.592 46.663 1.00 43.88  ? 249 ASP B C   1 
ATOM   1705 O O   . ASP A 1 231 ? -19.637 -16.518 47.102 1.00 45.64  ? 249 ASP B O   1 
ATOM   1706 C CB  . ASP A 1 231 ? -18.618 -18.912 47.528 1.00 49.79  ? 249 ASP B CB  1 
ATOM   1707 C CG  . ASP A 1 231 ? -19.979 -19.205 46.936 1.00 56.32  ? 249 ASP B CG  1 
ATOM   1708 O OD1 . ASP A 1 231 ? -20.239 -18.780 45.770 1.00 47.32  ? 249 ASP B OD1 1 
ATOM   1709 O OD2 . ASP A 1 231 ? -20.761 -19.895 47.637 1.00 59.75  ? 249 ASP B OD2 1 
ATOM   1710 N N   . LEU A 1 232 ? -17.902 -15.539 46.165 1.00 51.26  ? 250 LEU B N   1 
ATOM   1711 C CA  . LEU A 1 232 ? -18.593 -14.243 46.004 1.00 47.52  ? 250 LEU B CA  1 
ATOM   1712 C C   . LEU A 1 232 ? -19.504 -14.344 44.788 1.00 48.32  ? 250 LEU B C   1 
ATOM   1713 O O   . LEU A 1 232 ? -20.693 -14.076 44.880 1.00 48.81  ? 250 LEU B O   1 
ATOM   1714 C CB  . LEU A 1 232 ? -17.597 -13.079 45.844 1.00 51.20  ? 250 LEU B CB  1 
ATOM   1715 C CG  . LEU A 1 232 ? -16.694 -12.854 47.059 1.00 53.48  ? 250 LEU B CG  1 
ATOM   1716 C CD1 . LEU A 1 232 ? -15.742 -11.688 46.812 1.00 58.34  ? 250 LEU B CD1 1 
ATOM   1717 C CD2 . LEU A 1 232 ? -17.535 -12.662 48.332 1.00 51.77  ? 250 LEU B CD2 1 
ATOM   1718 N N   . VAL A 1 233 ? -18.938 -14.732 43.647 1.00 42.50  ? 251 VAL B N   1 
ATOM   1719 C CA  . VAL A 1 233 ? -19.755 -15.084 42.495 1.00 39.62  ? 251 VAL B CA  1 
ATOM   1720 C C   . VAL A 1 233 ? -19.280 -16.446 41.971 1.00 37.00  ? 251 VAL B C   1 
ATOM   1721 O O   . VAL A 1 233 ? -18.081 -16.673 41.874 1.00 33.59  ? 251 VAL B O   1 
ATOM   1722 C CB  . VAL A 1 233 ? -19.917 -13.941 41.435 1.00 39.68  ? 251 VAL B CB  1 
ATOM   1723 C CG1 . VAL A 1 233 ? -19.444 -12.581 41.954 1.00 44.99  ? 251 VAL B CG1 1 
ATOM   1724 C CG2 . VAL A 1 233 ? -19.305 -14.267 40.098 1.00 38.17  ? 251 VAL B CG2 1 
ATOM   1725 N N   . PRO A 1 234 ? -20.239 -17.368 41.716 1.00 38.53  ? 252 PRO B N   1 
ATOM   1726 C CA  . PRO A 1 234 ? -20.025 -18.732 41.259 1.00 38.37  ? 252 PRO B CA  1 
ATOM   1727 C C   . PRO A 1 234 ? -19.529 -18.755 39.833 1.00 39.15  ? 252 PRO B C   1 
ATOM   1728 O O   . PRO A 1 234 ? -19.855 -17.861 39.067 1.00 36.64  ? 252 PRO B O   1 
ATOM   1729 C CB  . PRO A 1 234 ? -21.445 -19.342 41.289 1.00 39.42  ? 252 PRO B CB  1 
ATOM   1730 C CG  . PRO A 1 234 ? -22.342 -18.161 41.133 1.00 37.38  ? 252 PRO B CG  1 
ATOM   1731 C CD  . PRO A 1 234 ? -21.673 -17.119 41.968 1.00 36.73  ? 252 PRO B CD  1 
ATOM   1732 N N   . PRO A 1 235 ? -18.728 -19.768 39.480 1.00 39.79  ? 253 PRO B N   1 
ATOM   1733 C CA  . PRO A 1 235 ? -18.385 -19.905 38.076 1.00 42.55  ? 253 PRO B CA  1 
ATOM   1734 C C   . PRO A 1 235 ? -19.661 -20.193 37.293 1.00 39.86  ? 253 PRO B C   1 
ATOM   1735 O O   . PRO A 1 235 ? -20.551 -20.875 37.808 1.00 42.38  ? 253 PRO B O   1 
ATOM   1736 C CB  . PRO A 1 235 ? -17.456 -21.150 38.046 1.00 39.10  ? 253 PRO B CB  1 
ATOM   1737 C CG  . PRO A 1 235 ? -17.029 -21.355 39.439 1.00 40.03  ? 253 PRO B CG  1 
ATOM   1738 C CD  . PRO A 1 235 ? -18.164 -20.863 40.293 1.00 40.48  ? 253 PRO B CD  1 
ATOM   1739 N N   . PRO A 1 236 ? -19.739 -19.676 36.058 1.00 40.85  ? 254 PRO B N   1 
ATOM   1740 C CA  . PRO A 1 236 ? -20.775 -20.121 35.139 1.00 35.97  ? 254 PRO B CA  1 
ATOM   1741 C C   . PRO A 1 236 ? -20.658 -21.619 34.935 1.00 34.37  ? 254 PRO B C   1 
ATOM   1742 O O   . PRO A 1 236 ? -19.526 -22.201 35.050 1.00 34.75  ? 254 PRO B O   1 
ATOM   1743 C CB  . PRO A 1 236 ? -20.438 -19.363 33.842 1.00 36.30  ? 254 PRO B CB  1 
ATOM   1744 C CG  . PRO A 1 236 ? -18.986 -18.991 33.971 1.00 34.89  ? 254 PRO B CG  1 
ATOM   1745 C CD  . PRO A 1 236 ? -18.828 -18.699 35.430 1.00 35.92  ? 254 PRO B CD  1 
ATOM   1746 N N   . PRO A 1 237 ? -21.811 -22.272 34.673 1.00 34.17  ? 255 PRO B N   1 
ATOM   1747 C CA  . PRO A 1 237 ? -21.820 -23.736 34.624 1.00 37.68  ? 255 PRO B CA  1 
ATOM   1748 C C   . PRO A 1 237 ? -20.777 -24.403 33.708 1.00 31.51  ? 255 PRO B C   1 
ATOM   1749 O O   . PRO A 1 237 ? -20.223 -25.398 34.103 1.00 29.18  ? 255 PRO B O   1 
ATOM   1750 C CB  . PRO A 1 237 ? -23.278 -24.085 34.232 1.00 35.51  ? 255 PRO B CB  1 
ATOM   1751 C CG  . PRO A 1 237 ? -24.055 -22.879 34.593 1.00 36.35  ? 255 PRO B CG  1 
ATOM   1752 C CD  . PRO A 1 237 ? -23.147 -21.713 34.359 1.00 32.49  ? 255 PRO B CD  1 
ATOM   1753 N N   . ILE A 1 238 ? -20.480 -23.856 32.522 1.00 34.66  ? 256 ILE B N   1 
ATOM   1754 C CA  . ILE A 1 238 ? -19.459 -24.500 31.663 1.00 32.23  ? 256 ILE B CA  1 
ATOM   1755 C C   . ILE A 1 238 ? -18.030 -24.465 32.254 1.00 32.01  ? 256 ILE B C   1 
ATOM   1756 O O   . ILE A 1 238 ? -17.290 -25.461 32.170 1.00 33.15  ? 256 ILE B O   1 
ATOM   1757 C CB  . ILE A 1 238 ? -19.482 -23.974 30.210 1.00 33.96  ? 256 ILE B CB  1 
ATOM   1758 C CG1 . ILE A 1 238 ? -20.947 -24.017 29.676 1.00 38.22  ? 256 ILE B CG1 1 
ATOM   1759 C CG2 . ILE A 1 238 ? -18.620 -24.884 29.363 1.00 32.10  ? 256 ILE B CG2 1 
ATOM   1760 C CD1 . ILE A 1 238 ? -21.217 -23.306 28.356 1.00 36.93  ? 256 ILE B CD1 1 
ATOM   1761 N N   . ILE A 1 239 ? -17.647 -23.337 32.858 1.00 32.66  ? 257 ILE B N   1 
ATOM   1762 C CA  . ILE A 1 239 ? -16.313 -23.248 33.491 1.00 31.77  ? 257 ILE B CA  1 
ATOM   1763 C C   . ILE A 1 239 ? -16.277 -24.193 34.673 1.00 29.31  ? 257 ILE B C   1 
ATOM   1764 O O   . ILE A 1 239 ? -15.340 -24.968 34.856 1.00 32.33  ? 257 ILE B O   1 
ATOM   1765 C CB  . ILE A 1 239 ? -15.962 -21.795 33.955 1.00 31.31  ? 257 ILE B CB  1 
ATOM   1766 C CG1 . ILE A 1 239 ? -16.099 -20.777 32.804 1.00 32.22  ? 257 ILE B CG1 1 
ATOM   1767 C CG2 . ILE A 1 239 ? -14.527 -21.705 34.532 1.00 30.03  ? 257 ILE B CG2 1 
ATOM   1768 C CD1 . ILE A 1 239 ? -15.167 -20.989 31.654 1.00 28.47  ? 257 ILE B CD1 1 
ATOM   1769 N N   . ASP A 1 240 ? -17.320 -24.115 35.483 1.00 30.17  ? 258 ASP B N   1 
ATOM   1770 C CA  . ASP A 1 240 ? -17.442 -25.028 36.603 1.00 30.49  ? 258 ASP B CA  1 
ATOM   1771 C C   . ASP A 1 240 ? -17.281 -26.481 36.155 1.00 32.28  ? 258 ASP B C   1 
ATOM   1772 O O   . ASP A 1 240 ? -16.531 -27.245 36.784 1.00 30.75  ? 258 ASP B O   1 
ATOM   1773 C CB  . ASP A 1 240 ? -18.743 -24.801 37.382 1.00 29.69  ? 258 ASP B CB  1 
ATOM   1774 C CG  . ASP A 1 240 ? -18.644 -25.334 38.796 1.00 33.78  ? 258 ASP B CG  1 
ATOM   1775 O OD1 . ASP A 1 240 ? -17.621 -25.144 39.474 1.00 37.38  ? 258 ASP B OD1 1 
ATOM   1776 O OD2 . ASP A 1 240 ? -19.575 -25.973 39.254 1.00 38.08  ? 258 ASP B OD2 1 
ATOM   1777 N N   . LYS A 1 241 ? -17.978 -26.869 35.071 1.00 29.53  ? 259 LYS B N   1 
ATOM   1778 C CA  . LYS A 1 241 ? -17.849 -28.216 34.573 1.00 30.44  ? 259 LYS B CA  1 
ATOM   1779 C C   . LYS A 1 241 ? -16.390 -28.558 34.217 1.00 33.29  ? 259 LYS B C   1 
ATOM   1780 O O   . LYS A 1 241 ? -15.874 -29.646 34.622 1.00 30.11  ? 259 LYS B O   1 
ATOM   1781 C CB  . LYS A 1 241 ? -18.812 -28.446 33.383 1.00 39.37  ? 259 LYS B CB  1 
ATOM   1782 C CG  . LYS A 1 241 ? -18.769 -29.849 32.744 1.00 43.91  ? 259 LYS B CG  1 
ATOM   1783 C CD  . LYS A 1 241 ? -20.034 -30.124 31.933 1.00 46.49  ? 259 LYS B CD  1 
ATOM   1784 C CE  . LYS A 1 241 ? -19.792 -30.885 30.624 1.00 49.68  ? 259 LYS B CE  1 
ATOM   1785 N NZ  . LYS A 1 241 ? -18.996 -32.142 30.715 1.00 52.04  ? 259 LYS B NZ  1 
ATOM   1786 N N   . ILE A 1 242 ? -15.721 -27.635 33.485 1.00 30.88  ? 260 ILE B N   1 
ATOM   1787 C CA  . ILE A 1 242 ? -14.316 -27.878 33.102 1.00 30.14  ? 260 ILE B CA  1 
ATOM   1788 C C   . ILE A 1 242 ? -13.435 -28.050 34.363 1.00 28.14  ? 260 ILE B C   1 
ATOM   1789 O O   . ILE A 1 242 ? -12.589 -28.987 34.471 1.00 26.21  ? 260 ILE B O   1 
ATOM   1790 C CB  . ILE A 1 242 ? -13.767 -26.736 32.208 1.00 31.41  ? 260 ILE B CB  1 
ATOM   1791 C CG1 . ILE A 1 242 ? -14.570 -26.608 30.889 1.00 35.08  ? 260 ILE B CG1 1 
ATOM   1792 C CG2 . ILE A 1 242 ? -12.273 -26.954 31.970 1.00 27.21  ? 260 ILE B CG2 1 
ATOM   1793 C CD1 . ILE A 1 242 ? -14.481 -25.225 30.208 1.00 30.94  ? 260 ILE B CD1 1 
ATOM   1794 N N   . PHE A 1 243 ? -13.634 -27.154 35.326 1.00 25.41  ? 261 PHE B N   1 
ATOM   1795 C CA  . PHE A 1 243 ? -12.912 -27.287 36.625 1.00 27.18  ? 261 PHE B CA  1 
ATOM   1796 C C   . PHE A 1 243 ? -13.147 -28.681 37.237 1.00 28.48  ? 261 PHE B C   1 
ATOM   1797 O O   . PHE A 1 243 ? -12.201 -29.406 37.532 1.00 29.34  ? 261 PHE B O   1 
ATOM   1798 C CB  . PHE A 1 243 ? -13.343 -26.159 37.582 1.00 24.52  ? 261 PHE B CB  1 
ATOM   1799 C CG  . PHE A 1 243 ? -12.710 -26.221 38.961 1.00 25.30  ? 261 PHE B CG  1 
ATOM   1800 C CD1 . PHE A 1 243 ? -11.457 -25.647 39.205 1.00 26.33  ? 261 PHE B CD1 1 
ATOM   1801 C CD2 . PHE A 1 243 ? -13.384 -26.812 40.025 1.00 25.22  ? 261 PHE B CD2 1 
ATOM   1802 C CE1 . PHE A 1 243 ? -10.884 -25.673 40.477 1.00 25.33  ? 261 PHE B CE1 1 
ATOM   1803 C CE2 . PHE A 1 243 ? -12.781 -26.888 41.274 1.00 26.04  ? 261 PHE B CE2 1 
ATOM   1804 C CZ  . PHE A 1 243 ? -11.550 -26.287 41.498 1.00 25.34  ? 261 PHE B CZ  1 
ATOM   1805 N N   . MET A 1 244 ? -14.414 -29.057 37.429 1.00 30.34  ? 262 MET B N   1 
ATOM   1806 C CA  . MET A 1 244 ? -14.689 -30.334 38.080 1.00 31.61  ? 262 MET B CA  1 
ATOM   1807 C C   . MET A 1 244 ? -14.232 -31.525 37.228 1.00 32.58  ? 262 MET B C   1 
ATOM   1808 O O   . MET A 1 244 ? -13.640 -32.447 37.766 1.00 33.92  ? 262 MET B O   1 
ATOM   1809 C CB  . MET A 1 244 ? -16.149 -30.458 38.513 1.00 32.27  ? 262 MET B CB  1 
ATOM   1810 C CG  . MET A 1 244 ? -16.676 -29.332 39.380 1.00 30.46  ? 262 MET B CG  1 
ATOM   1811 S SD  . MET A 1 244 ? -16.063 -29.478 41.067 1.00 36.74  ? 262 MET B SD  1 
ATOM   1812 C CE  . MET A 1 244 ? -16.504 -27.895 41.624 1.00 36.93  ? 262 MET B CE  1 
ATOM   1813 N N   . ASP A 1 245 ? -14.415 -31.470 35.898 1.00 34.97  ? 263 ASP B N   1 
ATOM   1814 C CA  . ASP A 1 245 ? -13.964 -32.580 35.015 1.00 33.06  ? 263 ASP B CA  1 
ATOM   1815 C C   . ASP A 1 245 ? -12.490 -32.705 34.990 1.00 37.34  ? 263 ASP B C   1 
ATOM   1816 O O   . ASP A 1 245 ? -11.979 -33.797 34.812 1.00 38.98  ? 263 ASP B O   1 
ATOM   1817 C CB  . ASP A 1 245 ? -14.515 -32.468 33.580 1.00 36.12  ? 263 ASP B CB  1 
ATOM   1818 C CG  . ASP A 1 245 ? -16.018 -32.635 33.546 1.00 36.74  ? 263 ASP B CG  1 
ATOM   1819 O OD1 . ASP A 1 245 ? -16.523 -33.122 34.587 1.00 37.66  ? 263 ASP B OD1 1 
ATOM   1820 O OD2 . ASP A 1 245 ? -16.704 -32.264 32.557 1.00 31.44  ? 263 ASP B OD2 1 
ATOM   1821 N N   . THR A 1 246 ? -11.772 -31.604 35.236 1.00 38.17  ? 264 THR B N   1 
ATOM   1822 C CA  . THR A 1 246 ? -10.322 -31.681 35.106 1.00 36.06  ? 264 THR B CA  1 
ATOM   1823 C C   . THR A 1 246 ? -9.564  -31.846 36.432 1.00 41.10  ? 264 THR B C   1 
ATOM   1824 O O   . THR A 1 246 ? -8.341  -31.894 36.433 1.00 44.25  ? 264 THR B O   1 
ATOM   1825 C CB  . THR A 1 246 ? -9.746  -30.566 34.183 1.00 37.97  ? 264 THR B CB  1 
ATOM   1826 O OG1 . THR A 1 246 ? -10.148 -29.273 34.675 1.00 35.76  ? 264 THR B OG1 1 
ATOM   1827 C CG2 . THR A 1 246 ? -10.264 -30.759 32.722 1.00 32.35  ? 264 THR B CG2 1 
ATOM   1828 N N   . LEU A 1 247 ? -10.276 -31.948 37.544 1.00 38.29  ? 265 LEU B N   1 
ATOM   1829 C CA  . LEU A 1 247 ? -9.635  -32.264 38.796 1.00 42.35  ? 265 LEU B CA  1 
ATOM   1830 C C   . LEU A 1 247 ? -9.500  -33.759 38.869 1.00 49.53  ? 265 LEU B C   1 
ATOM   1831 O O   . LEU A 1 247 ? -10.512 -34.446 38.992 1.00 52.81  ? 265 LEU B O   1 
ATOM   1832 C CB  . LEU A 1 247 ? -10.499 -31.822 39.958 1.00 42.83  ? 265 LEU B CB  1 
ATOM   1833 C CG  . LEU A 1 247 ? -10.759 -30.335 40.094 1.00 43.18  ? 265 LEU B CG  1 
ATOM   1834 C CD1 . LEU A 1 247 ? -11.597 -30.103 41.363 1.00 45.79  ? 265 LEU B CD1 1 
ATOM   1835 C CD2 . LEU A 1 247 ? -9.471  -29.531 40.116 1.00 40.50  ? 265 LEU B CD2 1 
ATOM   1836 N N   . PRO A 1 248 ? -8.256  -34.276 38.804 1.00 57.76  ? 266 PRO B N   1 
ATOM   1837 C CA  . PRO A 1 248 ? -7.981  -35.715 38.806 1.00 60.01  ? 266 PRO B CA  1 
ATOM   1838 C C   . PRO A 1 248 ? -7.998  -36.420 40.188 1.00 63.12  ? 266 PRO B C   1 
ATOM   1839 O O   . PRO A 1 248 ? -7.144  -37.275 40.455 1.00 65.99  ? 266 PRO B O   1 
ATOM   1840 C CB  . PRO A 1 248 ? -6.583  -35.812 38.158 1.00 64.04  ? 266 PRO B CB  1 
ATOM   1841 C CG  . PRO A 1 248 ? -6.088  -34.405 37.996 1.00 66.49  ? 266 PRO B CG  1 
ATOM   1842 C CD  . PRO A 1 248 ? -7.009  -33.499 38.754 1.00 60.89  ? 266 PRO B CD  1 
ATOM   1843 N N   . PHE A 1 249 ? -8.963  -36.069 41.043 1.00 61.38  ? 267 PHE B N   1 
ATOM   1844 C CA  . PHE A 1 249 ? -9.223  -36.810 42.284 1.00 56.31  ? 267 PHE B CA  1 
ATOM   1845 C C   . PHE A 1 249 ? -10.725 -36.854 42.537 1.00 57.65  ? 267 PHE B C   1 
ATOM   1846 O O   . PHE A 1 249 ? -11.506 -36.462 41.668 1.00 64.21  ? 267 PHE B O   1 
ATOM   1847 C CB  . PHE A 1 249 ? -8.469  -36.224 43.500 1.00 55.47  ? 267 PHE B CB  1 
ATOM   1848 C CG  . PHE A 1 249 ? -8.685  -34.747 43.707 1.00 49.04  ? 267 PHE B CG  1 
ATOM   1849 C CD1 . PHE A 1 249 ? -9.837  -34.279 44.308 1.00 47.07  ? 267 PHE B CD1 1 
ATOM   1850 C CD2 . PHE A 1 249 ? -7.731  -33.827 43.269 1.00 48.10  ? 267 PHE B CD2 1 
ATOM   1851 C CE1 . PHE A 1 249 ? -10.039 -32.922 44.484 1.00 44.99  ? 267 PHE B CE1 1 
ATOM   1852 C CE2 . PHE A 1 249 ? -7.916  -32.467 43.443 1.00 44.19  ? 267 PHE B CE2 1 
ATOM   1853 C CZ  . PHE A 1 249 ? -9.074  -32.017 44.054 1.00 43.70  ? 267 PHE B CZ  1 
ATOM   1854 N N   . PRO B 1 12  ? -8.684  -25.418 90.874 1.00 85.75  ? 30  PRO A N   1 
ATOM   1855 C CA  . PRO B 1 12  ? -8.796  -23.956 91.045 1.00 87.06  ? 30  PRO A CA  1 
ATOM   1856 C C   . PRO B 1 12  ? -9.234  -23.138 89.780 1.00 81.25  ? 30  PRO A C   1 
ATOM   1857 O O   . PRO B 1 12  ? -8.389  -22.493 89.150 1.00 63.83  ? 30  PRO A O   1 
ATOM   1858 C CB  . PRO B 1 12  ? -7.369  -23.543 91.497 1.00 87.15  ? 30  PRO A CB  1 
ATOM   1859 C CG  . PRO B 1 12  ? -6.543  -24.811 91.525 1.00 85.47  ? 30  PRO A CG  1 
ATOM   1860 C CD  . PRO B 1 12  ? -7.502  -25.962 91.567 1.00 77.12  ? 30  PRO A CD  1 
ATOM   1861 N N   . ALA B 1 13  ? -10.518 -23.159 89.392 1.00 74.88  ? 31  ALA A N   1 
ATOM   1862 C CA  . ALA B 1 13  ? -11.555 -24.075 89.906 1.00 71.25  ? 31  ALA A CA  1 
ATOM   1863 C C   . ALA B 1 13  ? -11.547 -25.349 89.050 1.00 56.99  ? 31  ALA A C   1 
ATOM   1864 O O   . ALA B 1 13  ? -10.600 -25.584 88.280 1.00 45.74  ? 31  ALA A O   1 
ATOM   1865 C CB  . ALA B 1 13  ? -12.946 -23.409 89.907 1.00 70.28  ? 31  ALA A CB  1 
ATOM   1866 N N   . ASN B 1 14  ? -12.589 -26.172 89.126 1.00 46.44  ? 32  ASN A N   1 
ATOM   1867 C CA  . ASN B 1 14  ? -12.344 -27.456 88.495 1.00 45.16  ? 32  ASN A CA  1 
ATOM   1868 C C   . ASN B 1 14  ? -12.298 -27.582 86.943 1.00 37.75  ? 32  ASN A C   1 
ATOM   1869 O O   . ASN B 1 14  ? -11.441 -28.322 86.390 1.00 29.26  ? 32  ASN A O   1 
ATOM   1870 C CB  . ASN B 1 14  ? -13.116 -28.562 89.118 1.00 46.95  ? 32  ASN A CB  1 
ATOM   1871 C CG  . ASN B 1 14  ? -12.425 -29.871 88.901 1.00 49.63  ? 32  ASN A CG  1 
ATOM   1872 O OD1 . ASN B 1 14  ? -11.200 -29.987 89.093 1.00 50.13  ? 32  ASN A OD1 1 
ATOM   1873 N ND2 . ASN B 1 14  ? -13.173 -30.847 88.445 1.00 47.40  ? 32  ASN A ND2 1 
ATOM   1874 N N   . LEU B 1 15  ? -13.203 -26.896 86.251 1.00 31.75  ? 33  LEU A N   1 
ATOM   1875 C CA  . LEU B 1 15  ? -13.158 -26.967 84.783 1.00 32.34  ? 33  LEU A CA  1 
ATOM   1876 C C   . LEU B 1 15  ? -11.778 -26.435 84.317 1.00 30.32  ? 33  LEU A C   1 
ATOM   1877 O O   . LEU B 1 15  ? -11.121 -27.060 83.492 1.00 29.56  ? 33  LEU A O   1 
ATOM   1878 C CB  . LEU B 1 15  ? -14.325 -26.191 84.133 1.00 32.35  ? 33  LEU A CB  1 
ATOM   1879 C CG  . LEU B 1 15  ? -14.402 -26.239 82.600 1.00 27.99  ? 33  LEU A CG  1 
ATOM   1880 C CD1 . LEU B 1 15  ? -14.412 -27.689 82.119 1.00 26.25  ? 33  LEU A CD1 1 
ATOM   1881 C CD2 . LEU B 1 15  ? -15.634 -25.514 82.138 1.00 26.44  ? 33  LEU A CD2 1 
ATOM   1882 N N   . LEU B 1 16  ? -11.330 -25.325 84.892 1.00 29.46  ? 34  LEU A N   1 
ATOM   1883 C CA  . LEU B 1 16  ? -10.118 -24.708 84.401 1.00 31.66  ? 34  LEU A CA  1 
ATOM   1884 C C   . LEU B 1 16  ? -8.938  -25.635 84.564 1.00 33.92  ? 34  LEU A C   1 
ATOM   1885 O O   . LEU B 1 16  ? -8.125  -25.773 83.639 1.00 31.45  ? 34  LEU A O   1 
ATOM   1886 C CB  . LEU B 1 16  ? -9.829  -23.373 85.037 1.00 31.86  ? 34  LEU A CB  1 
ATOM   1887 C CG  . LEU B 1 16  ? -8.689  -22.610 84.326 1.00 31.92  ? 34  LEU A CG  1 
ATOM   1888 C CD1 . LEU B 1 16  ? -9.138  -22.120 82.923 1.00 29.79  ? 34  LEU A CD1 1 
ATOM   1889 C CD2 . LEU B 1 16  ? -8.167  -21.448 85.162 1.00 30.72  ? 34  LEU A CD2 1 
ATOM   1890 N N   . THR B 1 17  ? -8.861  -26.319 85.700 1.00 30.30  ? 35  THR A N   1 
ATOM   1891 C CA  . THR B 1 17  ? -7.734  -27.211 85.932 1.00 32.27  ? 35  THR A CA  1 
ATOM   1892 C C   . THR B 1 17  ? -7.743  -28.301 84.880 1.00 29.59  ? 35  THR A C   1 
ATOM   1893 O O   . THR B 1 17  ? -6.690  -28.687 84.368 1.00 31.00  ? 35  THR A O   1 
ATOM   1894 C CB  . THR B 1 17  ? -7.768  -27.815 87.376 1.00 34.46  ? 35  THR A CB  1 
ATOM   1895 O OG1 . THR B 1 17  ? -7.552  -26.758 88.312 1.00 38.27  ? 35  THR A OG1 1 
ATOM   1896 C CG2 . THR B 1 17  ? -6.656  -28.855 87.574 1.00 37.61  ? 35  THR A CG2 1 
ATOM   1897 N N   . SER B 1 18  ? -8.927  -28.810 84.555 1.00 28.34  ? 36  SER A N   1 
ATOM   1898 C CA  . SER B 1 18  ? -8.990  -29.881 83.565 1.00 29.63  ? 36  SER A CA  1 
ATOM   1899 C C   . SER B 1 18  ? -8.645  -29.413 82.149 1.00 27.35  ? 36  SER A C   1 
ATOM   1900 O O   . SER B 1 18  ? -8.052  -30.140 81.408 1.00 32.17  ? 36  SER A O   1 
ATOM   1901 C CB  . SER B 1 18  ? -10.348 -30.549 83.567 1.00 34.15  ? 36  SER A CB  1 
ATOM   1902 O OG  . SER B 1 18  ? -10.747 -30.802 84.874 1.00 35.39  ? 36  SER A OG  1 
ATOM   1903 N N   . LEU B 1 19  ? -9.021  -28.196 81.780 1.00 31.00  ? 37  LEU A N   1 
ATOM   1904 C CA  . LEU B 1 19  ? -8.654  -27.640 80.451 1.00 28.50  ? 37  LEU A CA  1 
ATOM   1905 C C   . LEU B 1 19  ? -7.141  -27.423 80.394 1.00 28.23  ? 37  LEU A C   1 
ATOM   1906 O O   . LEU B 1 19  ? -6.489  -27.801 79.392 1.00 29.78  ? 37  LEU A O   1 
ATOM   1907 C CB  . LEU B 1 19  ? -9.395  -26.311 80.188 1.00 26.73  ? 37  LEU A CB  1 
ATOM   1908 C CG  . LEU B 1 19  ? -10.931 -26.470 80.100 1.00 25.14  ? 37  LEU A CG  1 
ATOM   1909 C CD1 . LEU B 1 19  ? -11.670 -25.159 80.062 1.00 26.33  ? 37  LEU A CD1 1 
ATOM   1910 C CD2 . LEU B 1 19  ? -11.374 -27.315 78.926 1.00 28.70  ? 37  LEU A CD2 1 
ATOM   1911 N N   . VAL B 1 20  ? -6.584  -26.857 81.482 1.00 25.05  ? 38  VAL A N   1 
ATOM   1912 C CA  . VAL B 1 20  ? -5.148  -26.597 81.562 1.00 26.63  ? 38  VAL A CA  1 
ATOM   1913 C C   . VAL B 1 20  ? -4.380  -27.919 81.432 1.00 27.83  ? 38  VAL A C   1 
ATOM   1914 O O   . VAL B 1 20  ? -3.394  -27.999 80.734 1.00 27.44  ? 38  VAL A O   1 
ATOM   1915 C CB  . VAL B 1 20  ? -4.745  -25.781 82.817 1.00 26.28  ? 38  VAL A CB  1 
ATOM   1916 C CG1 . VAL B 1 20  ? -3.219  -25.797 83.017 1.00 24.59  ? 38  VAL A CG1 1 
ATOM   1917 C CG2 . VAL B 1 20  ? -5.262  -24.347 82.716 1.00 22.69  ? 38  VAL A CG2 1 
ATOM   1918 N N   . ARG B 1 21  ? -4.887  -28.974 82.056 1.00 28.79  ? 39  ARG A N   1 
ATOM   1919 C CA  . ARG B 1 21  ? -4.185  -30.229 82.077 1.00 31.90  ? 39  ARG A CA  1 
ATOM   1920 C C   . ARG B 1 21  ? -4.361  -30.901 80.700 1.00 28.82  ? 39  ARG A C   1 
ATOM   1921 O O   . ARG B 1 21  ? -3.430  -31.471 80.165 1.00 25.54  ? 39  ARG A O   1 
ATOM   1922 C CB  . ARG B 1 21  ? -4.689  -31.118 83.246 1.00 37.67  ? 39  ARG A CB  1 
ATOM   1923 C CG  . ARG B 1 21  ? -4.228  -32.573 83.198 1.00 44.78  ? 39  ARG A CG  1 
ATOM   1924 C CD  . ARG B 1 21  ? -2.944  -32.850 83.987 1.00 55.21  ? 39  ARG A CD  1 
ATOM   1925 N NE  . ARG B 1 21  ? -2.222  -31.632 84.395 1.00 64.35  ? 39  ARG A NE  1 
ATOM   1926 C CZ  . ARG B 1 21  ? -1.041  -31.216 83.924 1.00 58.13  ? 39  ARG A CZ  1 
ATOM   1927 N NH1 . ARG B 1 21  ? -0.514  -30.083 84.388 1.00 54.21  ? 39  ARG A NH1 1 
ATOM   1928 N NH2 . ARG B 1 21  ? -0.391  -31.901 82.996 1.00 54.03  ? 39  ARG A NH2 1 
ATOM   1929 N N   . ALA B 1 22  ? -5.547  -30.813 80.108 1.00 28.71  ? 40  ALA A N   1 
ATOM   1930 C CA  . ALA B 1 22  ? -5.709  -31.351 78.751 1.00 28.48  ? 40  ALA A CA  1 
ATOM   1931 C C   . ALA B 1 22  ? -4.702  -30.642 77.757 1.00 25.12  ? 40  ALA A C   1 
ATOM   1932 O O   . ALA B 1 22  ? -4.021  -31.310 76.969 1.00 23.39  ? 40  ALA A O   1 
ATOM   1933 C CB  . ALA B 1 22  ? -7.168  -31.178 78.278 1.00 24.81  ? 40  ALA A CB  1 
ATOM   1934 N N   . HIS B 1 23  ? -4.618  -29.302 77.842 1.00 22.25  ? 41  HIS A N   1 
ATOM   1935 C CA  . HIS B 1 23  ? -3.686  -28.516 76.988 1.00 23.52  ? 41  HIS A CA  1 
ATOM   1936 C C   . HIS B 1 23  ? -2.230  -28.923 77.162 1.00 23.99  ? 41  HIS A C   1 
ATOM   1937 O O   . HIS B 1 23  ? -1.556  -29.329 76.219 1.00 25.64  ? 41  HIS A O   1 
ATOM   1938 C CB  . HIS B 1 23  ? -3.824  -27.022 77.269 1.00 21.02  ? 41  HIS A CB  1 
ATOM   1939 C CG  . HIS B 1 23  ? -2.805  -26.193 76.531 1.00 27.74  ? 41  HIS A CG  1 
ATOM   1940 N ND1 . HIS B 1 23  ? -2.815  -26.061 75.182 1.00 24.67  ? 41  HIS A ND1 1 
ATOM   1941 C CD2 . HIS B 1 23  ? -1.681  -25.473 76.998 1.00 24.71  ? 41  HIS A CD2 1 
ATOM   1942 C CE1 . HIS B 1 23  ? -1.795  -25.260 74.806 1.00 27.55  ? 41  HIS A CE1 1 
ATOM   1943 N NE2 . HIS B 1 23  ? -1.092  -24.907 75.924 1.00 25.24  ? 41  HIS A NE2 1 
ATOM   1944 N N   . LEU B 1 24  ? -1.737  -28.834 78.377 1.00 22.33  ? 42  LEU A N   1 
ATOM   1945 C CA  . LEU B 1 24  ? -0.337  -29.148 78.607 1.00 26.54  ? 42  LEU A CA  1 
ATOM   1946 C C   . LEU B 1 24  ? 0.063   -30.602 78.210 1.00 27.04  ? 42  LEU A C   1 
ATOM   1947 O O   . LEU B 1 24  ? 1.150   -30.866 77.676 1.00 26.94  ? 42  LEU A O   1 
ATOM   1948 C CB  . LEU B 1 24  ? -0.050  -28.841 80.065 1.00 28.90  ? 42  LEU A CB  1 
ATOM   1949 C CG  . LEU B 1 24  ? -0.004  -27.367 80.474 1.00 28.58  ? 42  LEU A CG  1 
ATOM   1950 C CD1 . LEU B 1 24  ? 0.550   -27.436 81.890 1.00 29.27  ? 42  LEU A CD1 1 
ATOM   1951 C CD2 . LEU B 1 24  ? 0.911   -26.497 79.635 1.00 25.43  ? 42  LEU A CD2 1 
ATOM   1952 N N   . ASP B 1 25  ? -0.826  -31.549 78.450 1.00 27.45  ? 43  ASP A N   1 
ATOM   1953 C CA  . ASP B 1 25  ? -0.580  -32.941 78.007 1.00 29.48  ? 43  ASP A CA  1 
ATOM   1954 C C   . ASP B 1 25  ? -0.713  -33.136 76.499 1.00 30.65  ? 43  ASP A C   1 
ATOM   1955 O O   . ASP B 1 25  ? -0.307  -34.178 75.989 1.00 30.10  ? 43  ASP A O   1 
ATOM   1956 C CB  . ASP B 1 25  ? -1.499  -33.892 78.719 1.00 32.57  ? 43  ASP A CB  1 
ATOM   1957 C CG  . ASP B 1 25  ? -1.197  -33.975 80.200 1.00 37.30  ? 43  ASP A CG  1 
ATOM   1958 O OD1 . ASP B 1 25  ? -0.178  -33.392 80.695 1.00 37.42  ? 43  ASP A OD1 1 
ATOM   1959 O OD2 . ASP B 1 25  ? -1.965  -34.676 80.849 1.00 44.63  ? 43  ASP A OD2 1 
ATOM   1960 N N   . SER B 1 26  ? -1.195  -32.133 75.763 1.00 25.11  ? 44  SER A N   1 
ATOM   1961 C CA  . SER B 1 26  ? -1.339  -32.360 74.316 1.00 26.70  ? 44  SER A CA  1 
ATOM   1962 C C   . SER B 1 26  ? -0.177  -31.808 73.478 1.00 26.63  ? 44  SER A C   1 
ATOM   1963 O O   . SER B 1 26  ? -0.297  -31.633 72.260 1.00 30.84  ? 44  SER A O   1 
ATOM   1964 C CB  . SER B 1 26  ? -2.638  -31.688 73.849 1.00 25.49  ? 44  SER A CB  1 
ATOM   1965 O OG  . SER B 1 26  ? -2.516  -30.289 73.967 1.00 26.50  ? 44  SER A OG  1 
ATOM   1966 N N   . GLY B 1 27  ? 0.949   -31.558 74.121 1.00 27.46  ? 45  GLY A N   1 
ATOM   1967 C CA  . GLY B 1 27  ? 2.085   -30.909 73.464 1.00 33.90  ? 45  GLY A CA  1 
ATOM   1968 C C   . GLY B 1 27  ? 3.340   -31.173 74.274 1.00 35.85  ? 45  GLY A C   1 
ATOM   1969 O O   . GLY B 1 27  ? 3.274   -31.775 75.349 1.00 31.68  ? 45  GLY A O   1 
ATOM   1970 N N   . PRO B 1 28  ? 4.493   -30.761 73.750 1.00 35.61  ? 46  PRO A N   1 
ATOM   1971 C CA  . PRO B 1 28  ? 5.734   -31.118 74.409 1.00 39.45  ? 46  PRO A CA  1 
ATOM   1972 C C   . PRO B 1 28  ? 6.173   -30.128 75.478 1.00 40.87  ? 46  PRO A C   1 
ATOM   1973 O O   . PRO B 1 28  ? 5.902   -28.936 75.382 1.00 43.45  ? 46  PRO A O   1 
ATOM   1974 C CB  . PRO B 1 28  ? 6.753   -31.075 73.253 1.00 40.29  ? 46  PRO A CB  1 
ATOM   1975 C CG  . PRO B 1 28  ? 6.198   -29.992 72.378 1.00 36.96  ? 46  PRO A CG  1 
ATOM   1976 C CD  . PRO B 1 28  ? 4.726   -30.228 72.390 1.00 36.97  ? 46  PRO A CD  1 
ATOM   1977 N N   . SER B 1 29  ? 6.889   -30.633 76.482 1.00 47.50  ? 47  SER A N   1 
ATOM   1978 C CA  . SER B 1 29  ? 7.680   -29.769 77.379 1.00 53.00  ? 47  SER A CA  1 
ATOM   1979 C C   . SER B 1 29  ? 9.011   -29.428 76.705 1.00 51.13  ? 47  SER A C   1 
ATOM   1980 O O   . SER B 1 29  ? 9.413   -30.104 75.772 1.00 49.67  ? 47  SER A O   1 
ATOM   1981 C CB  . SER B 1 29  ? 7.951   -30.463 78.712 1.00 45.77  ? 47  SER A CB  1 
ATOM   1982 O OG  . SER B 1 29  ? 8.089   -31.851 78.489 1.00 47.71  ? 47  SER A OG  1 
ATOM   1983 N N   . THR B 1 30  ? 9.691   -28.397 77.190 1.00 57.57  ? 48  THR A N   1 
ATOM   1984 C CA  . THR B 1 30  ? 11.044  -28.096 76.734 1.00 62.96  ? 48  THR A CA  1 
ATOM   1985 C C   . THR B 1 30  ? 11.902  -29.347 76.793 1.00 61.86  ? 48  THR A C   1 
ATOM   1986 O O   . THR B 1 30  ? 12.536  -29.717 75.798 1.00 64.02  ? 48  THR A O   1 
ATOM   1987 C CB  . THR B 1 30  ? 11.671  -27.029 77.609 1.00 67.88  ? 48  THR A CB  1 
ATOM   1988 O OG1 . THR B 1 30  ? 10.636  -26.124 78.012 1.00 78.49  ? 48  THR A OG1 1 
ATOM   1989 C CG2 . THR B 1 30  ? 12.768  -26.280 76.842 1.00 69.76  ? 48  THR A CG2 1 
ATOM   1990 N N   . ALA B 1 31  ? 11.880  -30.012 77.947 1.00 55.75  ? 49  ALA A N   1 
ATOM   1991 C CA  . ALA B 1 31  ? 12.547  -31.306 78.134 1.00 58.49  ? 49  ALA A CA  1 
ATOM   1992 C C   . ALA B 1 31  ? 12.499  -32.203 76.894 1.00 54.73  ? 49  ALA A C   1 
ATOM   1993 O O   . ALA B 1 31  ? 13.541  -32.444 76.309 1.00 57.09  ? 49  ALA A O   1 
ATOM   1994 C CB  . ALA B 1 31  ? 12.029  -32.054 79.375 1.00 54.62  ? 49  ALA A CB  1 
ATOM   1995 N N   . LYS B 1 32  ? 11.318  -32.668 76.472 1.00 57.33  ? 50  LYS A N   1 
ATOM   1996 C CA  A LYS B 1 32  ? 11.203  -33.568 75.321 0.50 53.95  ? 50  LYS A CA  1 
ATOM   1997 C CA  B LYS B 1 32  ? 11.261  -33.570 75.315 0.50 53.77  ? 50  LYS A CA  1 
ATOM   1998 C C   . LYS B 1 32  ? 11.005  -32.886 73.938 1.00 54.12  ? 50  LYS A C   1 
ATOM   1999 O O   . LYS B 1 32  ? 10.258  -33.408 73.069 1.00 58.29  ? 50  LYS A O   1 
ATOM   2000 C CB  A LYS B 1 32  ? 10.115  -34.617 75.587 0.50 54.88  ? 50  LYS A CB  1 
ATOM   2001 C CB  B LYS B 1 32  ? 10.383  -34.809 75.602 0.50 54.33  ? 50  LYS A CB  1 
ATOM   2002 C CG  A LYS B 1 32  ? 8.765   -34.033 75.980 0.50 56.54  ? 50  LYS A CG  1 
ATOM   2003 C CG  B LYS B 1 32  ? 8.888   -34.709 75.321 0.50 55.99  ? 50  LYS A CG  1 
ATOM   2004 C CD  A LYS B 1 32  ? 7.823   -35.116 76.486 0.50 55.04  ? 50  LYS A CD  1 
ATOM   2005 C CD  B LYS B 1 32  ? 8.250   -33.428 75.829 0.50 53.76  ? 50  LYS A CD  1 
ATOM   2006 C CE  A LYS B 1 32  ? 8.564   -36.145 77.322 0.50 55.34  ? 50  LYS A CE  1 
ATOM   2007 C CE  B LYS B 1 32  ? 6.773   -33.652 76.139 0.50 55.13  ? 50  LYS A CE  1 
ATOM   2008 N NZ  A LYS B 1 32  ? 9.312   -37.107 76.463 0.50 53.40  ? 50  LYS A NZ  1 
ATOM   2009 N NZ  B LYS B 1 32  ? 6.498   -33.960 77.568 0.50 54.20  ? 50  LYS A NZ  1 
ATOM   2010 N N   . LEU B 1 33  ? 11.667  -31.735 73.714 1.00 50.38  ? 51  LEU A N   1 
ATOM   2011 C CA  . LEU B 1 33  ? 11.748  -31.090 72.352 1.00 44.49  ? 51  LEU A CA  1 
ATOM   2012 C C   . LEU B 1 33  ? 12.716  -31.826 71.457 1.00 40.62  ? 51  LEU A C   1 
ATOM   2013 O O   . LEU B 1 33  ? 13.834  -32.167 71.851 1.00 44.20  ? 51  LEU A O   1 
ATOM   2014 C CB  . LEU B 1 33  ? 12.151  -29.617 72.419 1.00 39.40  ? 51  LEU A CB  1 
ATOM   2015 C CG  . LEU B 1 33  ? 11.166  -28.499 72.060 1.00 38.19  ? 51  LEU A CG  1 
ATOM   2016 C CD1 . LEU B 1 33  ? 9.674   -28.782 72.288 1.00 30.24  ? 51  LEU A CD1 1 
ATOM   2017 C CD2 . LEU B 1 33  ? 11.632  -27.142 72.636 1.00 35.62  ? 51  LEU A CD2 1 
ATOM   2018 N N   . ASP B 1 34  ? 12.291  -32.095 70.240 1.00 39.41  ? 52  ASP A N   1 
ATOM   2019 C CA  . ASP B 1 34  ? 13.018  -33.056 69.433 1.00 34.63  ? 52  ASP A CA  1 
ATOM   2020 C C   . ASP B 1 34  ? 13.776  -32.385 68.282 1.00 32.54  ? 52  ASP A C   1 
ATOM   2021 O O   . ASP B 1 34  ? 13.190  -31.958 67.255 1.00 28.75  ? 52  ASP A O   1 
ATOM   2022 C CB  . ASP B 1 34  ? 12.054  -34.157 68.979 1.00 31.75  ? 52  ASP A CB  1 
ATOM   2023 C CG  . ASP B 1 34  ? 12.677  -35.091 68.002 1.00 33.93  ? 52  ASP A CG  1 
ATOM   2024 O OD1 . ASP B 1 34  ? 11.929  -35.780 67.290 1.00 34.80  ? 52  ASP A OD1 1 
ATOM   2025 O OD2 . ASP B 1 34  ? 13.916  -35.133 67.944 1.00 30.66  ? 52  ASP A OD2 1 
ATOM   2026 N N   . TYR B 1 35  ? 15.093  -32.350 68.460 1.00 28.29  ? 53  TYR A N   1 
ATOM   2027 C CA  . TYR B 1 35  ? 16.018  -31.621 67.581 1.00 31.89  ? 53  TYR A CA  1 
ATOM   2028 C C   . TYR B 1 35  ? 16.691  -32.502 66.540 1.00 32.16  ? 53  TYR A C   1 
ATOM   2029 O O   . TYR B 1 35  ? 17.546  -32.030 65.824 1.00 30.82  ? 53  TYR A O   1 
ATOM   2030 C CB  . TYR B 1 35  ? 17.067  -30.842 68.398 1.00 27.22  ? 53  TYR A CB  1 
ATOM   2031 C CG  . TYR B 1 35  ? 16.539  -29.490 68.828 1.00 31.78  ? 53  TYR A CG  1 
ATOM   2032 C CD1 . TYR B 1 35  ? 16.015  -29.246 70.121 1.00 33.54  ? 53  TYR A CD1 1 
ATOM   2033 C CD2 . TYR B 1 35  ? 16.529  -28.449 67.935 1.00 33.23  ? 53  TYR A CD2 1 
ATOM   2034 C CE1 . TYR B 1 35  ? 15.510  -27.980 70.469 1.00 31.28  ? 53  TYR A CE1 1 
ATOM   2035 C CE2 . TYR B 1 35  ? 16.051  -27.222 68.271 1.00 33.62  ? 53  TYR A CE2 1 
ATOM   2036 C CZ  . TYR B 1 35  ? 15.541  -26.977 69.506 1.00 35.54  ? 53  TYR A CZ  1 
ATOM   2037 O OH  . TYR B 1 35  ? 15.105  -25.673 69.677 1.00 35.36  ? 53  TYR A OH  1 
ATOM   2038 N N   . SER B 1 36  ? 16.266  -33.762 66.422 1.00 32.96  ? 54  SER A N   1 
ATOM   2039 C CA  . SER B 1 36  ? 17.058  -34.725 65.658 1.00 34.38  ? 54  SER A CA  1 
ATOM   2040 C C   . SER B 1 36  ? 16.823  -34.549 64.172 1.00 35.98  ? 54  SER A C   1 
ATOM   2041 O O   . SER B 1 36  ? 17.521  -35.163 63.364 1.00 34.38  ? 54  SER A O   1 
ATOM   2042 C CB  . SER B 1 36  ? 16.689  -36.174 66.066 1.00 36.71  ? 54  SER A CB  1 
ATOM   2043 O OG  . SER B 1 36  ? 15.319  -36.408 65.785 1.00 31.26  ? 54  SER A OG  1 
ATOM   2044 N N   . LYS B 1 37  ? 15.841  -33.730 63.788 1.00 30.90  ? 55  LYS A N   1 
ATOM   2045 C CA  . LYS B 1 37  ? 15.745  -33.426 62.376 1.00 29.52  ? 55  LYS A CA  1 
ATOM   2046 C C   . LYS B 1 37  ? 16.113  -31.952 62.126 1.00 24.06  ? 55  LYS A C   1 
ATOM   2047 O O   . LYS B 1 37  ? 16.253  -31.537 61.014 1.00 26.47  ? 55  LYS A O   1 
ATOM   2048 C CB  . LYS B 1 37  ? 14.326  -33.803 61.814 1.00 29.81  ? 55  LYS A CB  1 
ATOM   2049 C CG  . LYS B 1 37  ? 13.883  -35.257 62.063 1.00 33.08  ? 55  LYS A CG  1 
ATOM   2050 C CD  . LYS B 1 37  ? 12.754  -35.610 61.077 1.00 42.26  ? 55  LYS A CD  1 
ATOM   2051 C CE  . LYS B 1 37  ? 12.049  -36.960 61.252 1.00 43.17  ? 55  LYS A CE  1 
ATOM   2052 N NZ  . LYS B 1 37  ? 10.905  -36.895 62.223 1.00 50.57  ? 55  LYS A NZ  1 
ATOM   2053 N N   . PHE B 1 38  ? 16.249  -31.153 63.160 1.00 23.78  ? 56  PHE A N   1 
ATOM   2054 C CA  . PHE B 1 38  ? 16.424  -29.741 62.976 1.00 23.93  ? 56  PHE A CA  1 
ATOM   2055 C C   . PHE B 1 38  ? 17.751  -29.361 62.260 1.00 27.27  ? 56  PHE A C   1 
ATOM   2056 O O   . PHE B 1 38  ? 18.808  -29.848 62.614 1.00 23.60  ? 56  PHE A O   1 
ATOM   2057 C CB  . PHE B 1 38  ? 16.389  -29.074 64.339 1.00 24.48  ? 56  PHE A CB  1 
ATOM   2058 C CG  . PHE B 1 38  ? 16.556  -27.625 64.270 1.00 22.24  ? 56  PHE A CG  1 
ATOM   2059 C CD1 . PHE B 1 38  ? 15.530  -26.817 63.801 1.00 21.35  ? 56  PHE A CD1 1 
ATOM   2060 C CD2 . PHE B 1 38  ? 17.753  -27.046 64.677 1.00 21.75  ? 56  PHE A CD2 1 
ATOM   2061 C CE1 . PHE B 1 38  ? 15.700  -25.443 63.733 1.00 20.80  ? 56  PHE A CE1 1 
ATOM   2062 C CE2 . PHE B 1 38  ? 17.918  -25.686 64.580 1.00 21.65  ? 56  PHE A CE2 1 
ATOM   2063 C CZ  . PHE B 1 38  ? 16.897  -24.890 64.100 1.00 21.68  ? 56  PHE A CZ  1 
ATOM   2064 N N   . GLN B 1 39  ? 17.676  -28.491 61.266 1.00 28.12  ? 57  GLN A N   1 
ATOM   2065 C CA  . GLN B 1 39  ? 18.885  -27.894 60.710 1.00 30.02  ? 57  GLN A CA  1 
ATOM   2066 C C   . GLN B 1 39  ? 18.696  -26.402 60.559 1.00 27.81  ? 57  GLN A C   1 
ATOM   2067 O O   . GLN B 1 39  ? 17.728  -25.979 59.889 1.00 21.60  ? 57  GLN A O   1 
ATOM   2068 C CB  . GLN B 1 39  ? 19.200  -28.492 59.339 1.00 33.09  ? 57  GLN A CB  1 
ATOM   2069 C CG  . GLN B 1 39  ? 19.785  -29.876 59.410 1.00 42.81  ? 57  GLN A CG  1 
ATOM   2070 C CD  . GLN B 1 39  ? 19.817  -30.502 58.061 1.00 49.87  ? 57  GLN A CD  1 
ATOM   2071 O OE1 . GLN B 1 39  ? 20.544  -30.038 57.183 1.00 59.07  ? 57  GLN A OE1 1 
ATOM   2072 N NE2 . GLN B 1 39  ? 19.018  -31.558 57.869 1.00 54.44  ? 57  GLN A NE2 1 
ATOM   2073 N N   . GLU B 1 40  ? 19.659  -25.635 61.108 1.00 29.46  ? 58  GLU A N   1 
ATOM   2074 C CA  . GLU B 1 40  ? 19.583  -24.168 61.122 1.00 30.03  ? 58  GLU A CA  1 
ATOM   2075 C C   . GLU B 1 40  ? 19.657  -23.537 59.760 1.00 28.61  ? 58  GLU A C   1 
ATOM   2076 O O   . GLU B 1 40  ? 19.187  -22.429 59.599 1.00 32.28  ? 58  GLU A O   1 
ATOM   2077 C CB  . GLU B 1 40  ? 20.478  -23.425 62.141 1.00 31.51  ? 58  GLU A CB  1 
ATOM   2078 C CG  . GLU B 1 40  ? 21.739  -24.075 62.576 1.00 38.97  ? 58  GLU A CG  1 
ATOM   2079 C CD  . GLU B 1 40  ? 21.540  -25.381 63.310 1.00 38.58  ? 58  GLU A CD  1 
ATOM   2080 O OE1 . GLU B 1 40  ? 21.287  -25.376 64.541 1.00 44.99  ? 58  GLU A OE1 1 
ATOM   2081 O OE2 . GLU B 1 40  ? 21.680  -26.425 62.652 1.00 36.06  ? 58  GLU A OE2 1 
ATOM   2082 N N   . LEU B 1 41  ? 20.166  -24.256 58.780 1.00 27.68  ? 59  LEU A N   1 
ATOM   2083 C CA  . LEU B 1 41  ? 20.161  -23.770 57.403 1.00 29.68  ? 59  LEU A CA  1 
ATOM   2084 C C   . LEU B 1 41  ? 20.055  -24.937 56.418 1.00 29.27  ? 59  LEU A C   1 
ATOM   2085 O O   . LEU B 1 41  ? 20.869  -25.826 56.451 1.00 33.98  ? 59  LEU A O   1 
ATOM   2086 C CB  . LEU B 1 41  ? 21.510  -23.070 57.143 1.00 27.91  ? 59  LEU A CB  1 
ATOM   2087 C CG  . LEU B 1 41  ? 21.734  -21.937 56.168 1.00 28.76  ? 59  LEU A CG  1 
ATOM   2088 C CD1 . LEU B 1 41  ? 23.064  -22.102 55.464 1.00 26.39  ? 59  LEU A CD1 1 
ATOM   2089 C CD2 . LEU B 1 41  ? 20.698  -21.648 55.093 1.00 27.00  ? 59  LEU A CD2 1 
ATOM   2090 N N   . VAL B 1 42  ? 19.054  -24.929 55.546 1.00 33.21  ? 60  VAL A N   1 
ATOM   2091 C CA  . VAL B 1 42  ? 18.969  -25.863 54.420 1.00 32.28  ? 60  VAL A CA  1 
ATOM   2092 C C   . VAL B 1 42  ? 18.813  -24.942 53.178 1.00 38.09  ? 60  VAL A C   1 
ATOM   2093 O O   . VAL B 1 42  ? 18.436  -23.727 53.294 1.00 31.24  ? 60  VAL A O   1 
ATOM   2094 C CB  . VAL B 1 42  ? 17.798  -26.901 54.583 1.00 39.45  ? 60  VAL A CB  1 
ATOM   2095 C CG1 . VAL B 1 42  ? 16.503  -26.235 55.073 1.00 31.95  ? 60  VAL A CG1 1 
ATOM   2096 C CG2 . VAL B 1 42  ? 17.470  -27.601 53.262 1.00 38.03  ? 60  VAL A CG2 1 
ATOM   2097 N N   . LEU B 1 43  ? 19.163  -25.481 52.016 1.00 30.37  ? 61  LEU A N   1 
ATOM   2098 C CA  . LEU B 1 43  ? 19.114  -24.706 50.812 1.00 35.96  ? 61  LEU A CA  1 
ATOM   2099 C C   . LEU B 1 43  ? 18.033  -25.336 49.888 1.00 39.98  ? 61  LEU A C   1 
ATOM   2100 O O   . LEU B 1 43  ? 18.363  -26.209 49.079 1.00 35.83  ? 61  LEU A O   1 
ATOM   2101 C CB  . LEU B 1 43  ? 20.496  -24.727 50.137 1.00 33.70  ? 61  LEU A CB  1 
ATOM   2102 C CG  . LEU B 1 43  ? 21.704  -24.456 51.050 1.00 34.70  ? 61  LEU A CG  1 
ATOM   2103 C CD1 . LEU B 1 43  ? 23.005  -24.559 50.259 1.00 34.67  ? 61  LEU A CD1 1 
ATOM   2104 C CD2 . LEU B 1 43  ? 21.540  -23.105 51.759 1.00 28.56  ? 61  LEU A CD2 1 
ATOM   2105 N N   . PRO B 1 44  ? 16.745  -24.924 50.041 1.00 43.29  ? 62  PRO A N   1 
ATOM   2106 C CA  . PRO B 1 44  ? 15.755  -25.672 49.274 1.00 45.91  ? 62  PRO A CA  1 
ATOM   2107 C C   . PRO B 1 44  ? 15.619  -25.109 47.876 1.00 44.27  ? 62  PRO A C   1 
ATOM   2108 O O   . PRO B 1 44  ? 15.930  -23.951 47.639 1.00 39.87  ? 62  PRO A O   1 
ATOM   2109 C CB  . PRO B 1 44  ? 14.458  -25.486 50.079 1.00 41.81  ? 62  PRO A CB  1 
ATOM   2110 C CG  . PRO B 1 44  ? 14.646  -24.226 50.869 1.00 40.90  ? 62  PRO A CG  1 
ATOM   2111 C CD  . PRO B 1 44  ? 16.111  -23.840 50.835 1.00 46.16  ? 62  PRO A CD  1 
ATOM   2112 N N   . HIS B 1 45  ? 15.160  -25.947 46.961 1.00 51.27  ? 63  HIS A N   1 
ATOM   2113 C CA  . HIS B 1 45  ? 14.591  -25.474 45.707 1.00 44.04  ? 63  HIS A CA  1 
ATOM   2114 C C   . HIS B 1 45  ? 13.201  -24.963 46.027 1.00 40.27  ? 63  HIS A C   1 
ATOM   2115 O O   . HIS B 1 45  ? 12.251  -25.740 46.168 1.00 36.30  ? 63  HIS A O   1 
ATOM   2116 C CB  . HIS B 1 45  ? 14.529  -26.645 44.760 1.00 48.25  ? 63  HIS A CB  1 
ATOM   2117 C CG  . HIS B 1 45  ? 14.756  -26.294 43.327 1.00 54.87  ? 63  HIS A CG  1 
ATOM   2118 N ND1 . HIS B 1 45  ? 13.932  -25.477 42.639 1.00 57.14  ? 63  HIS A ND1 1 
ATOM   2119 C CD2 . HIS B 1 45  ? 15.730  -26.724 42.431 1.00 55.50  ? 63  HIS A CD2 1 
ATOM   2120 C CE1 . HIS B 1 45  ? 14.383  -25.360 41.377 1.00 57.47  ? 63  HIS A CE1 1 
ATOM   2121 N NE2 . HIS B 1 45  ? 15.488  -26.120 41.255 1.00 61.09  ? 63  HIS A NE2 1 
ATOM   2122 N N   . PHE B 1 46  ? 13.072  -23.645 46.167 1.00 37.57  ? 64  PHE A N   1 
ATOM   2123 C CA  . PHE B 1 46  ? 11.773  -22.997 46.500 1.00 37.19  ? 64  PHE A CA  1 
ATOM   2124 C C   . PHE B 1 46  ? 10.673  -23.237 45.422 1.00 37.72  ? 64  PHE A C   1 
ATOM   2125 O O   . PHE B 1 46  ? 11.009  -23.447 44.262 1.00 36.78  ? 64  PHE A O   1 
ATOM   2126 C CB  . PHE B 1 46  ? 11.960  -21.482 46.742 1.00 36.59  ? 64  PHE A CB  1 
ATOM   2127 C CG  . PHE B 1 46  ? 12.831  -21.163 47.947 1.00 43.61  ? 64  PHE A CG  1 
ATOM   2128 C CD1 . PHE B 1 46  ? 12.363  -21.384 49.243 1.00 40.86  ? 64  PHE A CD1 1 
ATOM   2129 C CD2 . PHE B 1 46  ? 14.141  -20.662 47.778 1.00 47.23  ? 64  PHE A CD2 1 
ATOM   2130 C CE1 . PHE B 1 46  ? 13.161  -21.094 50.343 1.00 49.58  ? 64  PHE A CE1 1 
ATOM   2131 C CE2 . PHE B 1 46  ? 14.961  -20.379 48.889 1.00 46.84  ? 64  PHE A CE2 1 
ATOM   2132 C CZ  . PHE B 1 46  ? 14.467  -20.597 50.166 1.00 49.80  ? 64  PHE A CZ  1 
ATOM   2133 N N   . GLY B 1 47  ? 9.397   -23.243 45.796 0.50 30.61  ? 65  GLY A N   1 
ATOM   2134 C CA  . GLY B 1 47  ? 8.328   -23.335 44.781 0.50 34.57  ? 65  GLY A CA  1 
ATOM   2135 C C   . GLY B 1 47  ? 8.122   -24.713 44.141 0.50 34.47  ? 65  GLY A C   1 
ATOM   2136 O O   . GLY B 1 47  ? 7.401   -24.860 43.161 0.50 33.90  ? 65  GLY A O   1 
ATOM   2137 N N   . LYS B 1 48  ? 8.780   -25.719 44.696 1.00 38.66  ? 66  LYS A N   1 
ATOM   2138 C CA  . LYS B 1 48  ? 8.438   -27.103 44.437 1.00 34.94  ? 66  LYS A CA  1 
ATOM   2139 C C   . LYS B 1 48  ? 8.841   -28.039 45.603 1.00 33.86  ? 66  LYS A C   1 
ATOM   2140 O O   . LYS B 1 48  ? 9.206   -27.574 46.709 1.00 33.58  ? 66  LYS A O   1 
ATOM   2141 C CB  . LYS B 1 48  ? 8.942   -27.574 43.073 1.00 38.69  ? 66  LYS A CB  1 
ATOM   2142 C CG  . LYS B 1 48  ? 10.398  -27.322 42.763 1.00 37.59  ? 66  LYS A CG  1 
ATOM   2143 C CD  . LYS B 1 48  ? 11.318  -28.250 43.525 1.00 34.54  ? 66  LYS A CD  1 
ATOM   2144 C CE  . LYS B 1 48  ? 12.553  -28.613 42.707 1.00 33.36  ? 66  LYS A CE  1 
ATOM   2145 N NZ  . LYS B 1 48  ? 13.210  -29.863 43.149 1.00 28.13  ? 66  LYS A NZ  1 
ATOM   2146 N N   . GLU B 1 49  ? 8.768   -29.353 45.353 1.00 29.02  ? 67  GLU A N   1 
ATOM   2147 C CA  . GLU B 1 49  ? 8.605   -30.304 46.434 1.00 30.84  ? 67  GLU A CA  1 
ATOM   2148 C C   . GLU B 1 49  ? 8.729   -31.735 45.948 1.00 28.47  ? 67  GLU A C   1 
ATOM   2149 O O   . GLU B 1 49  ? 8.258   -32.038 44.887 1.00 30.08  ? 67  GLU A O   1 
ATOM   2150 C CB  . GLU B 1 49  ? 7.266   -30.110 47.156 1.00 27.92  ? 67  GLU A CB  1 
ATOM   2151 C CG  . GLU B 1 49  ? 6.050   -30.291 46.299 1.00 27.54  ? 67  GLU A CG  1 
ATOM   2152 C CD  . GLU B 1 49  ? 5.629   -29.073 45.503 1.00 30.76  ? 67  GLU A CD  1 
ATOM   2153 O OE1 . GLU B 1 49  ? 5.198   -29.276 44.311 1.00 32.37  ? 67  GLU A OE1 1 
ATOM   2154 O OE2 . GLU B 1 49  ? 5.716   -27.919 46.031 1.00 28.85  ? 67  GLU A OE2 1 
ATOM   2155 N N   . ASP B 1 50  ? 9.353   -32.593 46.746 1.00 27.22  ? 68  ASP A N   1 
ATOM   2156 C CA  . ASP B 1 50  ? 9.384   -34.024 46.415 1.00 28.36  ? 68  ASP A CA  1 
ATOM   2157 C C   . ASP B 1 50  ? 8.476   -34.840 47.367 1.00 28.89  ? 68  ASP A C   1 
ATOM   2158 O O   . ASP B 1 50  ? 7.847   -34.278 48.273 1.00 25.42  ? 68  ASP A O   1 
ATOM   2159 C CB  . ASP B 1 50  ? 10.808  -34.523 46.424 1.00 26.43  ? 68  ASP A CB  1 
ATOM   2160 C CG  . ASP B 1 50  ? 11.460  -34.331 47.752 1.00 28.98  ? 68  ASP A CG  1 
ATOM   2161 O OD1 . ASP B 1 50  ? 10.918  -34.737 48.809 1.00 27.25  ? 68  ASP A OD1 1 
ATOM   2162 O OD2 . ASP B 1 50  ? 12.516  -33.717 47.732 1.00 30.72  ? 68  ASP A OD2 1 
ATOM   2163 N N   . ALA B 1 51  ? 8.430   -36.163 47.184 1.00 25.30  ? 69  ALA A N   1 
ATOM   2164 C CA  . ALA B 1 51  ? 7.446   -36.997 47.883 1.00 23.07  ? 69  ALA A CA  1 
ATOM   2165 C C   . ALA B 1 51  ? 7.723   -37.036 49.359 1.00 21.74  ? 69  ALA A C   1 
ATOM   2166 O O   . ALA B 1 51  ? 6.822   -37.170 50.170 1.00 21.40  ? 69  ALA A O   1 
ATOM   2167 C CB  . ALA B 1 51  ? 7.417   -38.421 47.319 1.00 20.55  ? 69  ALA A CB  1 
ATOM   2168 N N   . GLY B 1 52  ? 8.980   -36.988 49.709 1.00 20.07  ? 70  GLY A N   1 
ATOM   2169 C CA  . GLY B 1 52  ? 9.318   -36.939 51.136 1.00 22.86  ? 70  GLY A CA  1 
ATOM   2170 C C   . GLY B 1 52  ? 8.833   -35.643 51.779 1.00 20.17  ? 70  GLY A C   1 
ATOM   2171 O O   . GLY B 1 52  ? 8.335   -35.656 52.912 1.00 21.06  ? 70  GLY A O   1 
ATOM   2172 N N   . ASP B 1 53  ? 8.980   -34.517 51.091 1.00 21.10  ? 71  ASP A N   1 
ATOM   2173 C CA  . ASP B 1 53  ? 8.430   -33.277 51.645 1.00 20.00  ? 71  ASP A CA  1 
ATOM   2174 C C   . ASP B 1 53  ? 6.892   -33.390 51.854 1.00 20.71  ? 71  ASP A C   1 
ATOM   2175 O O   . ASP B 1 53  ? 6.348   -32.898 52.880 1.00 17.79  ? 71  ASP A O   1 
ATOM   2176 C CB  . ASP B 1 53  ? 8.634   -32.061 50.701 1.00 23.22  ? 71  ASP A CB  1 
ATOM   2177 C CG  . ASP B 1 53  ? 10.088  -31.818 50.334 1.00 27.43  ? 71  ASP A CG  1 
ATOM   2178 O OD1 . ASP B 1 53  ? 10.931  -32.037 51.198 1.00 27.83  ? 71  ASP A OD1 1 
ATOM   2179 O OD2 . ASP B 1 53  ? 10.383  -31.395 49.187 1.00 27.63  ? 71  ASP A OD2 1 
ATOM   2180 N N   . VAL B 1 54  ? 6.175   -33.919 50.847 1.00 19.25  ? 72  VAL A N   1 
ATOM   2181 C CA  . VAL B 1 54  ? 4.684   -33.975 50.869 1.00 20.48  ? 72  VAL A CA  1 
ATOM   2182 C C   . VAL B 1 54  ? 4.221   -35.007 51.931 1.00 24.73  ? 72  VAL A C   1 
ATOM   2183 O O   . VAL B 1 54  ? 3.227   -34.783 52.662 1.00 23.84  ? 72  VAL A O   1 
ATOM   2184 C CB  . VAL B 1 54  ? 4.137   -34.281 49.449 1.00 21.08  ? 72  VAL A CB  1 
ATOM   2185 C CG1 . VAL B 1 54  ? 2.635   -34.424 49.479 1.00 22.48  ? 72  VAL A CG1 1 
ATOM   2186 C CG2 . VAL B 1 54  ? 4.508   -33.146 48.459 1.00 20.09  ? 72  VAL A CG2 1 
ATOM   2187 N N   . GLN B 1 55  ? 4.962   -36.114 52.060 1.00 20.58  ? 73  GLN A N   1 
ATOM   2188 C CA  . GLN B 1 55  ? 4.582   -37.081 53.031 1.00 20.34  ? 73  GLN A CA  1 
ATOM   2189 C C   . GLN B 1 55  ? 4.782   -36.537 54.453 1.00 19.97  ? 73  GLN A C   1 
ATOM   2190 O O   . GLN B 1 55  ? 3.971   -36.776 55.332 1.00 18.97  ? 73  GLN A O   1 
ATOM   2191 C CB  . GLN B 1 55  ? 5.390   -38.364 52.855 1.00 20.84  ? 73  GLN A CB  1 
ATOM   2192 C CG  . GLN B 1 55  ? 4.873   -39.443 53.802 1.00 22.53  ? 73  GLN A CG  1 
ATOM   2193 C CD  . GLN B 1 55  ? 3.503   -39.878 53.399 1.00 26.18  ? 73  GLN A CD  1 
ATOM   2194 O OE1 . GLN B 1 55  ? 3.330   -40.368 52.292 1.00 27.47  ? 73  GLN A OE1 1 
ATOM   2195 N NE2 . GLN B 1 55  ? 2.491   -39.538 54.204 1.00 27.38  ? 73  GLN A NE2 1 
ATOM   2196 N N   . GLN B 1 56  ? 5.890   -35.825 54.694 1.00 21.47  ? 74  GLN A N   1 
ATOM   2197 C CA  . GLN B 1 56  ? 6.036   -35.198 55.991 1.00 21.72  ? 74  GLN A CA  1 
ATOM   2198 C C   . GLN B 1 56  ? 4.946   -34.180 56.265 1.00 21.41  ? 74  GLN A C   1 
ATOM   2199 O O   . GLN B 1 56  ? 4.454   -34.084 57.380 1.00 19.39  ? 74  GLN A O   1 
ATOM   2200 C CB  . GLN B 1 56  ? 7.396   -34.562 56.105 1.00 23.08  ? 74  GLN A CB  1 
ATOM   2201 C CG  . GLN B 1 56  ? 7.641   -33.890 57.454 1.00 24.36  ? 74  GLN A CG  1 
ATOM   2202 C CD  . GLN B 1 56  ? 8.969   -33.181 57.422 1.00 25.99  ? 74  GLN A CD  1 
ATOM   2203 O OE1 . GLN B 1 56  ? 9.198   -32.236 56.629 1.00 27.96  ? 74  GLN A OE1 1 
ATOM   2204 N NE2 . GLN B 1 56  ? 9.887   -33.706 58.165 1.00 24.30  ? 74  GLN A NE2 1 
ATOM   2205 N N   . PHE B 1 57  ? 4.574   -33.377 55.261 1.00 20.59  ? 75  PHE A N   1 
ATOM   2206 C CA  . PHE B 1 57  ? 3.549   -32.393 55.470 1.00 17.83  ? 75  PHE A CA  1 
ATOM   2207 C C   . PHE B 1 57  ? 2.283   -33.132 55.959 1.00 20.11  ? 75  PHE A C   1 
ATOM   2208 O O   . PHE B 1 57  ? 1.704   -32.724 56.959 1.00 18.88  ? 75  PHE A O   1 
ATOM   2209 C CB  . PHE B 1 57  ? 3.301   -31.642 54.171 1.00 16.76  ? 75  PHE A CB  1 
ATOM   2210 C CG  . PHE B 1 57  ? 2.047   -30.869 54.126 1.00 16.71  ? 75  PHE A CG  1 
ATOM   2211 C CD1 . PHE B 1 57  ? 2.044   -29.513 54.439 1.00 17.44  ? 75  PHE A CD1 1 
ATOM   2212 C CD2 . PHE B 1 57  ? 0.857   -31.450 53.636 1.00 19.32  ? 75  PHE A CD2 1 
ATOM   2213 C CE1 . PHE B 1 57  ? 0.894   -28.731 54.307 1.00 19.08  ? 75  PHE A CE1 1 
ATOM   2214 C CE2 . PHE B 1 57  ? -0.282  -30.676 53.514 1.00 16.57  ? 75  PHE A CE2 1 
ATOM   2215 C CZ  . PHE B 1 57  ? -0.289  -29.347 53.860 1.00 16.42  ? 75  PHE A CZ  1 
ATOM   2216 N N   . TYR B 1 58  ? 1.895   -34.238 55.278 1.00 17.44  ? 76  TYR A N   1 
ATOM   2217 C CA  . TYR B 1 58  ? 0.764   -34.997 55.600 1.00 18.88  ? 76  TYR A CA  1 
ATOM   2218 C C   . TYR B 1 58  ? 0.877   -35.685 56.949 1.00 20.02  ? 76  TYR A C   1 
ATOM   2219 O O   . TYR B 1 58  ? -0.089  -35.669 57.685 1.00 25.29  ? 76  TYR A O   1 
ATOM   2220 C CB  . TYR B 1 58  ? 0.398   -36.079 54.514 1.00 20.46  ? 76  TYR A CB  1 
ATOM   2221 C CG  . TYR B 1 58  ? -0.230  -35.526 53.278 1.00 20.47  ? 76  TYR A CG  1 
ATOM   2222 C CD1 . TYR B 1 58  ? -1.199  -34.555 53.376 1.00 20.95  ? 76  TYR A CD1 1 
ATOM   2223 C CD2 . TYR B 1 58  ? 0.118   -36.010 52.007 1.00 20.61  ? 76  TYR A CD2 1 
ATOM   2224 C CE1 . TYR B 1 58  ? -1.823  -34.020 52.275 1.00 20.49  ? 76  TYR A CE1 1 
ATOM   2225 C CE2 . TYR B 1 58  ? -0.493  -35.493 50.885 1.00 21.32  ? 76  TYR A CE2 1 
ATOM   2226 C CZ  . TYR B 1 58  ? -1.464  -34.480 51.047 1.00 25.11  ? 76  TYR A CZ  1 
ATOM   2227 O OH  . TYR B 1 58  ? -2.135  -33.927 50.016 1.00 21.81  ? 76  TYR A OH  1 
ATOM   2228 N N   . ASP B 1 59  ? 2.036   -36.232 57.283 1.00 17.16  ? 77  ASP A N   1 
ATOM   2229 C CA  . ASP B 1 59  ? 2.174   -36.931 58.534 1.00 19.74  ? 77  ASP A CA  1 
ATOM   2230 C C   . ASP B 1 59  ? 2.063   -35.923 59.697 1.00 21.23  ? 77  ASP A C   1 
ATOM   2231 O O   . ASP B 1 59  ? 1.579   -36.245 60.743 1.00 24.10  ? 77  ASP A O   1 
ATOM   2232 C CB  . ASP B 1 59  ? 3.535   -37.577 58.637 1.00 20.36  ? 77  ASP A CB  1 
ATOM   2233 C CG  . ASP B 1 59  ? 3.702   -38.770 57.705 1.00 21.90  ? 77  ASP A CG  1 
ATOM   2234 O OD1 . ASP B 1 59  ? 2.701   -39.303 57.131 1.00 20.76  ? 77  ASP A OD1 1 
ATOM   2235 O OD2 . ASP B 1 59  ? 4.868   -39.129 57.557 1.00 21.54  ? 77  ASP A OD2 1 
ATOM   2236 N N   . LEU B 1 60  ? 2.536   -34.713 59.500 1.00 20.43  ? 78  LEU A N   1 
ATOM   2237 C CA  . LEU B 1 60  ? 2.350   -33.644 60.510 1.00 21.52  ? 78  LEU A CA  1 
ATOM   2238 C C   . LEU B 1 60  ? 0.918   -33.252 60.743 1.00 19.82  ? 78  LEU A C   1 
ATOM   2239 O O   . LEU B 1 60  ? 0.524   -33.052 61.869 1.00 18.55  ? 78  LEU A O   1 
ATOM   2240 C CB  . LEU B 1 60  ? 3.097   -32.384 60.072 1.00 22.94  ? 78  LEU A CB  1 
ATOM   2241 C CG  . LEU B 1 60  ? 4.502   -32.126 60.621 1.00 29.77  ? 78  LEU A CG  1 
ATOM   2242 C CD1 . LEU B 1 60  ? 5.129   -33.014 61.738 1.00 20.30  ? 78  LEU A CD1 1 
ATOM   2243 C CD2 . LEU B 1 60  ? 5.457   -31.647 59.543 1.00 23.23  ? 78  LEU A CD2 1 
ATOM   2244 N N   . LEU B 1 61  ? 0.171   -33.069 59.669 1.00 18.76  ? 79  LEU A N   1 
ATOM   2245 C CA  . LEU B 1 61  ? -1.259  -32.903 59.808 1.00 19.52  ? 79  LEU A CA  1 
ATOM   2246 C C   . LEU B 1 61  ? -1.988  -34.072 60.541 1.00 19.75  ? 79  LEU A C   1 
ATOM   2247 O O   . LEU B 1 61  ? -2.798  -33.819 61.462 1.00 18.29  ? 79  LEU A O   1 
ATOM   2248 C CB  . LEU B 1 61  ? -1.883  -32.689 58.472 1.00 18.82  ? 79  LEU A CB  1 
ATOM   2249 C CG  . LEU B 1 61  ? -2.172  -31.300 57.935 1.00 23.66  ? 79  LEU A CG  1 
ATOM   2250 C CD1 . LEU B 1 61  ? -1.461  -30.147 58.576 1.00 22.55  ? 79  LEU A CD1 1 
ATOM   2251 C CD2 . LEU B 1 61  ? -2.360  -31.192 56.427 1.00 19.24  ? 79  LEU A CD2 1 
ATOM   2252 N N   . SER B 1 62  ? -1.732  -35.304 60.106 1.00 19.04  ? 80  SER A N   1 
ATOM   2253 C CA  . SER B 1 62  ? -2.377  -36.469 60.721 1.00 23.67  ? 80  SER A CA  1 
ATOM   2254 C C   . SER B 1 62  ? -2.010  -36.594 62.185 1.00 23.81  ? 80  SER A C   1 
ATOM   2255 O O   . SER B 1 62  ? -2.835  -36.975 62.971 1.00 22.62  ? 80  SER A O   1 
ATOM   2256 C CB  . SER B 1 62  ? -1.889  -37.778 60.039 1.00 25.80  ? 80  SER A CB  1 
ATOM   2257 O OG  . SER B 1 62  ? -2.286  -37.808 58.691 1.00 34.72  ? 80  SER A OG  1 
ATOM   2258 N N   . GLY B 1 63  ? -0.726  -36.446 62.497 1.00 21.05  ? 81  GLY A N   1 
ATOM   2259 C CA  . GLY B 1 63  ? -0.271  -36.642 63.848 1.00 24.74  ? 81  GLY A CA  1 
ATOM   2260 C C   . GLY B 1 63  ? -0.844  -35.539 64.707 1.00 25.65  ? 81  GLY A C   1 
ATOM   2261 O O   . GLY B 1 63  ? -1.189  -35.775 65.891 1.00 27.16  ? 81  GLY A O   1 
ATOM   2262 N N   . SER B 1 64  ? -0.954  -34.329 64.140 1.00 21.83  ? 82  SER A N   1 
ATOM   2263 C CA  . SER B 1 64  ? -1.668  -33.256 64.891 1.00 20.92  ? 82  SER A CA  1 
ATOM   2264 C C   . SER B 1 64  ? -3.134  -33.583 65.139 1.00 20.47  ? 82  SER A C   1 
ATOM   2265 O O   . SER B 1 64  ? -3.667  -33.365 66.234 1.00 20.77  ? 82  SER A O   1 
ATOM   2266 C CB  . SER B 1 64  ? -1.537  -31.864 64.226 1.00 21.36  ? 82  SER A CB  1 
ATOM   2267 O OG  . SER B 1 64  ? -2.697  -31.049 64.561 1.00 22.71  ? 82  SER A OG  1 
ATOM   2268 N N   . LEU B 1 65  ? -3.810  -34.148 64.153 1.00 21.74  ? 83  LEU A N   1 
ATOM   2269 C CA  . LEU B 1 65  ? -5.206  -34.496 64.428 1.00 21.73  ? 83  LEU A CA  1 
ATOM   2270 C C   . LEU B 1 65  ? -5.351  -35.625 65.516 1.00 22.14  ? 83  LEU A C   1 
ATOM   2271 O O   . LEU B 1 65  ? -6.279  -35.607 66.372 1.00 19.53  ? 83  LEU A O   1 
ATOM   2272 C CB  . LEU B 1 65  ? -5.860  -34.897 63.098 1.00 20.84  ? 83  LEU A CB  1 
ATOM   2273 C CG  . LEU B 1 65  ? -7.303  -35.415 63.199 1.00 23.33  ? 83  LEU A CG  1 
ATOM   2274 C CD1 . LEU B 1 65  ? -8.266  -34.285 63.587 1.00 21.66  ? 83  LEU A CD1 1 
ATOM   2275 C CD2 . LEU B 1 65  ? -7.607  -36.036 61.812 1.00 25.13  ? 83  LEU A CD2 1 
ATOM   2276 N N   . GLU B 1 66  ? -4.422  -36.572 65.550 1.00 20.69  ? 84  GLU A N   1 
ATOM   2277 C CA  A GLU B 1 66  ? -4.426  -37.666 66.569 0.50 23.05  ? 84  GLU A CA  1 
ATOM   2278 C CA  B GLU B 1 66  ? -4.552  -37.613 66.582 0.50 22.99  ? 84  GLU A CA  1 
ATOM   2279 C C   . GLU B 1 66  ? -4.288  -37.078 67.950 1.00 22.94  ? 84  GLU A C   1 
ATOM   2280 O O   . GLU B 1 66  ? -4.960  -37.492 68.895 1.00 27.14  ? 84  GLU A O   1 
ATOM   2281 C CB  A GLU B 1 66  ? -3.302  -38.689 66.305 0.50 24.93  ? 84  GLU A CB  1 
ATOM   2282 C CB  B GLU B 1 66  ? -3.716  -38.845 66.320 0.50 24.81  ? 84  GLU A CB  1 
ATOM   2283 C CG  A GLU B 1 66  ? -3.151  -39.703 67.443 0.50 28.95  ? 84  GLU A CG  1 
ATOM   2284 C CG  B GLU B 1 66  ? -4.173  -39.965 67.248 0.50 28.97  ? 84  GLU A CG  1 
ATOM   2285 C CD  A GLU B 1 66  ? -2.122  -40.807 67.217 0.50 32.44  ? 84  GLU A CD  1 
ATOM   2286 C CD  B GLU B 1 66  ? -5.686  -39.898 67.584 0.50 28.54  ? 84  GLU A CD  1 
ATOM   2287 O OE1 A GLU B 1 66  ? -2.124  -41.794 68.006 0.50 32.62  ? 84  GLU A OE1 1 
ATOM   2288 O OE1 B GLU B 1 66  ? -6.045  -39.761 68.787 0.50 25.95  ? 84  GLU A OE1 1 
ATOM   2289 O OE2 A GLU B 1 66  ? -1.299  -40.694 66.276 0.50 36.43  ? 84  GLU A OE2 1 
ATOM   2290 O OE2 B GLU B 1 66  ? -6.505  -39.963 66.647 0.50 28.40  ? 84  GLU A OE2 1 
ATOM   2291 N N   . VAL B 1 67  ? -3.418  -36.075 68.055 1.00 18.95  ? 85  VAL A N   1 
ATOM   2292 C CA  . VAL B 1 67  ? -3.203  -35.465 69.314 1.00 20.31  ? 85  VAL A CA  1 
ATOM   2293 C C   . VAL B 1 67  ? -4.386  -34.553 69.737 1.00 20.33  ? 85  VAL A C   1 
ATOM   2294 O O   . VAL B 1 67  ? -4.709  -34.460 70.926 1.00 20.63  ? 85  VAL A O   1 
ATOM   2295 C CB  . VAL B 1 67  ? -1.814  -34.683 69.324 1.00 20.68  ? 85  VAL A CB  1 
ATOM   2296 C CG1 . VAL B 1 67  ? -1.707  -33.749 70.488 1.00 20.11  ? 85  VAL A CG1 1 
ATOM   2297 C CG2 . VAL B 1 67  ? -0.619  -35.626 69.409 1.00 20.02  ? 85  VAL A CG2 1 
ATOM   2298 N N   . ILE B 1 68  ? -5.032  -33.893 68.781 1.00 20.82  ? 86  ILE A N   1 
ATOM   2299 C CA  . ILE B 1 68  ? -6.131  -32.983 69.114 1.00 20.10  ? 86  ILE A CA  1 
ATOM   2300 C C   . ILE B 1 68  ? -7.316  -33.824 69.527 1.00 21.72  ? 86  ILE A C   1 
ATOM   2301 O O   . ILE B 1 68  ? -8.067  -33.458 70.402 1.00 20.15  ? 86  ILE A O   1 
ATOM   2302 C CB  . ILE B 1 68  ? -6.411  -32.016 67.934 1.00 19.70  ? 86  ILE A CB  1 
ATOM   2303 C CG1 . ILE B 1 68  ? -5.290  -30.930 67.896 1.00 22.59  ? 86  ILE A CG1 1 
ATOM   2304 C CG2 . ILE B 1 68  ? -7.800  -31.379 67.963 1.00 21.30  ? 86  ILE A CG2 1 
ATOM   2305 C CD1 . ILE B 1 68  ? -5.215  -30.117 66.585 1.00 21.04  ? 86  ILE A CD1 1 
ATOM   2306 N N   . ARG B 1 69  ? -7.462  -34.991 68.928 1.00 22.84  ? 87  ARG A N   1 
ATOM   2307 C CA  . ARG B 1 69  ? -8.552  -35.898 69.304 1.00 24.12  ? 87  ARG A CA  1 
ATOM   2308 C C   . ARG B 1 69  ? -8.377  -36.359 70.766 1.00 23.37  ? 87  ARG A C   1 
ATOM   2309 O O   . ARG B 1 69  ? -9.311  -36.343 71.530 1.00 22.63  ? 87  ARG A O   1 
ATOM   2310 C CB  . ARG B 1 69  ? -8.534  -37.059 68.349 1.00 25.07  ? 87  ARG A CB  1 
ATOM   2311 C CG  . ARG B 1 69  ? -9.587  -38.079 68.556 1.00 32.15  ? 87  ARG A CG  1 
ATOM   2312 C CD  . ARG B 1 69  ? -9.389  -39.152 67.485 1.00 44.05  ? 87  ARG A CD  1 
ATOM   2313 N NE  . ARG B 1 69  ? -9.328  -38.684 66.069 1.00 40.94  ? 87  ARG A NE  1 
ATOM   2314 C CZ  . ARG B 1 69  ? -10.405 -38.385 65.335 1.00 44.73  ? 87  ARG A CZ  1 
ATOM   2315 N NH1 . ARG B 1 69  ? -11.625 -38.413 65.887 1.00 45.22  ? 87  ARG A NH1 1 
ATOM   2316 N NH2 . ARG B 1 69  ? -10.282 -38.061 64.053 1.00 37.79  ? 87  ARG A NH2 1 
ATOM   2317 N N   . LYS B 1 70  ? -7.151  -36.680 71.171 1.00 22.16  ? 88  LYS A N   1 
ATOM   2318 C CA  . LYS B 1 70  ? -6.887  -37.046 72.573 1.00 25.16  ? 88  LYS A CA  1 
ATOM   2319 C C   . LYS B 1 70  ? -7.032  -35.869 73.526 1.00 23.24  ? 88  LYS A C   1 
ATOM   2320 O O   . LYS B 1 70  ? -7.446  -35.991 74.664 1.00 23.32  ? 88  LYS A O   1 
ATOM   2321 C CB  . LYS B 1 70  ? -5.478  -37.639 72.686 1.00 26.20  ? 88  LYS A CB  1 
ATOM   2322 C CG  . LYS B 1 70  ? -5.457  -38.794 71.714 1.00 33.70  ? 88  LYS A CG  1 
ATOM   2323 C CD  . LYS B 1 70  ? -4.620  -39.936 72.230 1.00 39.03  ? 88  LYS A CD  1 
ATOM   2324 C CE  . LYS B 1 70  ? -3.228  -39.910 71.665 1.00 38.60  ? 88  LYS A CE  1 
ATOM   2325 N NZ  . LYS B 1 70  ? -3.019  -41.297 71.124 1.00 44.38  ? 88  LYS A NZ  1 
ATOM   2326 N N   . TRP B 1 71  ? -6.694  -34.694 73.060 1.00 22.38  ? 89  TRP A N   1 
ATOM   2327 C CA  . TRP B 1 71  ? -6.985  -33.519 73.873 1.00 24.76  ? 89  TRP A CA  1 
ATOM   2328 C C   . TRP B 1 71  ? -8.474  -33.291 74.093 1.00 21.43  ? 89  TRP A C   1 
ATOM   2329 O O   . TRP B 1 71  ? -8.947  -33.092 75.231 1.00 25.93  ? 89  TRP A O   1 
ATOM   2330 C CB  . TRP B 1 71  ? -6.350  -32.357 73.161 1.00 24.33  ? 89  TRP A CB  1 
ATOM   2331 C CG  . TRP B 1 71  ? -6.810  -31.003 73.569 1.00 22.54  ? 89  TRP A CG  1 
ATOM   2332 C CD1 . TRP B 1 71  ? -6.430  -30.310 74.670 1.00 22.28  ? 89  TRP A CD1 1 
ATOM   2333 C CD2 . TRP B 1 71  ? -7.659  -30.091 72.783 1.00 20.77  ? 89  TRP A CD2 1 
ATOM   2334 N NE1 . TRP B 1 71  ? -6.962  -29.049 74.677 1.00 23.29  ? 89  TRP A NE1 1 
ATOM   2335 C CE2 . TRP B 1 71  ? -7.719  -28.843 73.554 1.00 21.28  ? 89  TRP A CE2 1 
ATOM   2336 C CE3 . TRP B 1 71  ? -8.377  -30.196 71.588 1.00 19.17  ? 89  TRP A CE3 1 
ATOM   2337 C CZ2 . TRP B 1 71  ? -8.498  -27.766 73.152 1.00 19.94  ? 89  TRP A CZ2 1 
ATOM   2338 C CZ3 . TRP B 1 71  ? -9.112  -29.086 71.155 1.00 19.45  ? 89  TRP A CZ3 1 
ATOM   2339 C CH2 . TRP B 1 71  ? -9.180  -27.908 71.907 1.00 21.01  ? 89  TRP A CH2 1 
ATOM   2340 N N   . ALA B 1 72  ? -9.240  -33.299 73.012 1.00 22.64  ? 90  ALA A N   1 
ATOM   2341 C CA  . ALA B 1 72  ? -10.700 -33.119 73.075 1.00 24.10  ? 90  ALA A CA  1 
ATOM   2342 C C   . ALA B 1 72  ? -11.336 -34.137 74.041 1.00 25.44  ? 90  ALA A C   1 
ATOM   2343 O O   . ALA B 1 72  ? -12.217 -33.776 74.833 1.00 27.31  ? 90  ALA A O   1 
ATOM   2344 C CB  . ALA B 1 72  ? -11.307 -33.232 71.691 1.00 25.25  ? 90  ALA A CB  1 
ATOM   2345 N N   . GLU B 1 73  ? -10.905 -35.391 73.936 1.00 24.97  ? 91  GLU A N   1 
ATOM   2346 C CA  A GLU B 1 73  ? -11.356 -36.460 74.847 0.50 27.12  ? 91  GLU A CA  1 
ATOM   2347 C CA  B GLU B 1 73  ? -11.366 -36.455 74.845 0.50 27.81  ? 91  GLU A CA  1 
ATOM   2348 C C   . GLU B 1 73  ? -11.234 -36.084 76.337 1.00 27.03  ? 91  GLU A C   1 
ATOM   2349 O O   . GLU B 1 73  ? -12.009 -36.561 77.130 1.00 26.14  ? 91  GLU A O   1 
ATOM   2350 C CB  A GLU B 1 73  ? -10.687 -37.824 74.496 0.50 26.98  ? 91  GLU A CB  1 
ATOM   2351 C CB  B GLU B 1 73  ? -10.653 -37.793 74.552 0.50 29.05  ? 91  GLU A CB  1 
ATOM   2352 C CG  A GLU B 1 73  ? -9.988  -38.572 75.630 0.50 30.59  ? 91  GLU A CG  1 
ATOM   2353 C CG  B GLU B 1 73  ? -11.258 -38.663 73.458 0.50 33.60  ? 91  GLU A CG  1 
ATOM   2354 C CD  A GLU B 1 73  ? -8.643  -39.182 75.188 0.50 30.46  ? 91  GLU A CD  1 
ATOM   2355 C CD  B GLU B 1 73  ? -12.232 -37.930 72.525 0.50 35.01  ? 91  GLU A CD  1 
ATOM   2356 O OE1 A GLU B 1 73  ? -8.727  -40.118 74.339 0.50 31.84  ? 91  GLU A OE1 1 
ATOM   2357 O OE1 B GLU B 1 73  ? -13.404 -37.716 72.956 0.50 32.87  ? 91  GLU A OE1 1 
ATOM   2358 O OE2 A GLU B 1 73  ? -7.541  -38.742 75.672 0.50 20.39  ? 91  GLU A OE2 1 
ATOM   2359 O OE2 B GLU B 1 73  ? -11.842 -37.618 71.352 0.50 34.91  ? 91  GLU A OE2 1 
ATOM   2360 N N   . LYS B 1 74  ? -10.287 -35.173 76.701 1.00 26.87  ? 92  LYS A N   1 
ATOM   2361 C CA  . LYS B 1 74  ? -10.132 -34.707 78.073 1.00 26.38  ? 92  LYS A CA  1 
ATOM   2362 C C   . LYS B 1 74  ? -10.887 -33.429 78.430 1.00 27.22  ? 92  LYS A C   1 
ATOM   2363 O O   . LYS B 1 74  ? -10.793 -32.980 79.553 1.00 29.62  ? 92  LYS A O   1 
ATOM   2364 C CB  . LYS B 1 74  ? -8.651  -34.564 78.454 1.00 30.14  ? 92  LYS A CB  1 
ATOM   2365 C CG  . LYS B 1 74  ? -7.838  -35.888 78.330 1.00 30.10  ? 92  LYS A CG  1 
ATOM   2366 C CD  . LYS B 1 74  ? -6.444  -35.528 77.863 1.00 36.46  ? 92  LYS A CD  1 
ATOM   2367 C CE  . LYS B 1 74  ? -5.453  -36.702 77.895 1.00 37.36  ? 92  LYS A CE  1 
ATOM   2368 N NZ  . LYS B 1 74  ? -4.030  -36.201 77.918 1.00 34.72  ? 92  LYS A NZ  1 
ATOM   2369 N N   . ILE B 1 75  ? -11.624 -32.827 77.502 1.00 24.04  ? 93  ILE A N   1 
ATOM   2370 C CA  . ILE B 1 75  ? -12.429 -31.673 77.852 1.00 23.72  ? 93  ILE A CA  1 
ATOM   2371 C C   . ILE B 1 75  ? -13.699 -32.256 78.482 1.00 24.31  ? 93  ILE A C   1 
ATOM   2372 O O   . ILE B 1 75  ? -14.357 -33.053 77.839 1.00 25.82  ? 93  ILE A O   1 
ATOM   2373 C CB  . ILE B 1 75  ? -12.768 -30.789 76.649 1.00 25.00  ? 93  ILE A CB  1 
ATOM   2374 C CG1 . ILE B 1 75  ? -11.464 -30.243 76.061 1.00 24.75  ? 93  ILE A CG1 1 
ATOM   2375 C CG2 . ILE B 1 75  ? -13.761 -29.664 77.069 1.00 21.69  ? 93  ILE A CG2 1 
ATOM   2376 C CD1 . ILE B 1 75  ? -11.634 -29.664 74.684 1.00 30.05  ? 93  ILE A CD1 1 
ATOM   2377 N N   . PRO B 1 76  ? -14.029 -31.864 79.753 1.00 25.16  ? 94  PRO A N   1 
ATOM   2378 C CA  . PRO B 1 76  ? -15.173 -32.358 80.519 1.00 23.27  ? 94  PRO A CA  1 
ATOM   2379 C C   . PRO B 1 76  ? -16.425 -32.176 79.748 1.00 22.57  ? 94  PRO A C   1 
ATOM   2380 O O   . PRO B 1 76  ? -16.681 -31.083 79.285 1.00 24.47  ? 94  PRO A O   1 
ATOM   2381 C CB  . PRO B 1 76  ? -15.169 -31.404 81.719 1.00 26.58  ? 94  PRO A CB  1 
ATOM   2382 C CG  . PRO B 1 76  ? -13.718 -31.346 81.998 1.00 25.53  ? 94  PRO A CG  1 
ATOM   2383 C CD  . PRO B 1 76  ? -13.258 -30.948 80.590 1.00 22.80  ? 94  PRO A CD  1 
ATOM   2384 N N   . GLY B 1 77  ? -17.164 -33.255 79.554 1.00 24.05  ? 95  GLY A N   1 
ATOM   2385 C CA  . GLY B 1 77  ? -18.381 -33.232 78.740 1.00 24.59  ? 95  GLY A CA  1 
ATOM   2386 C C   . GLY B 1 77  ? -18.198 -33.659 77.292 1.00 23.63  ? 95  GLY A C   1 
ATOM   2387 O O   . GLY B 1 77  ? -19.138 -34.039 76.643 1.00 25.34  ? 95  GLY A O   1 
ATOM   2388 N N   . PHE B 1 78  ? -17.015 -33.491 76.727 1.00 23.55  ? 96  PHE A N   1 
ATOM   2389 C CA  . PHE B 1 78  ? -16.910 -33.740 75.277 1.00 21.61  ? 96  PHE A CA  1 
ATOM   2390 C C   . PHE B 1 78  ? -17.137 -35.208 74.803 1.00 21.57  ? 96  PHE A C   1 
ATOM   2391 O O   . PHE B 1 78  ? -17.873 -35.462 73.783 1.00 18.02  ? 96  PHE A O   1 
ATOM   2392 C CB  . PHE B 1 78  ? -15.547 -33.233 74.738 1.00 20.99  ? 96  PHE A CB  1 
ATOM   2393 C CG  . PHE B 1 78  ? -15.400 -33.419 73.253 1.00 20.57  ? 96  PHE A CG  1 
ATOM   2394 C CD1 . PHE B 1 78  ? -15.873 -32.429 72.344 1.00 20.55  ? 96  PHE A CD1 1 
ATOM   2395 C CD2 . PHE B 1 78  ? -14.815 -34.576 72.741 1.00 19.12  ? 96  PHE A CD2 1 
ATOM   2396 C CE1 . PHE B 1 78  ? -15.659 -32.601 70.946 1.00 19.24  ? 96  PHE A CE1 1 
ATOM   2397 C CE2 . PHE B 1 78  ? -14.639 -34.756 71.364 1.00 21.67  ? 96  PHE A CE2 1 
ATOM   2398 C CZ  . PHE B 1 78  ? -15.046 -33.746 70.471 1.00 18.72  ? 96  PHE A CZ  1 
ATOM   2399 N N   . ALA B 1 79  ? -16.529 -36.166 75.514 1.00 20.27  ? 97  ALA A N   1 
ATOM   2400 C CA  . ALA B 1 79  ? -16.596 -37.582 75.102 1.00 22.83  ? 97  ALA A CA  1 
ATOM   2401 C C   . ALA B 1 79  ? -18.030 -38.168 75.264 1.00 22.85  ? 97  ALA A C   1 
ATOM   2402 O O   . ALA B 1 79  ? -18.338 -39.192 74.712 1.00 24.76  ? 97  ALA A O   1 
ATOM   2403 C CB  . ALA B 1 79  ? -15.551 -38.430 75.867 1.00 23.47  ? 97  ALA A CB  1 
ATOM   2404 N N   . GLU B 1 80  ? -18.915 -37.448 75.948 1.00 21.73  ? 98  GLU A N   1 
ATOM   2405 C CA  . GLU B 1 80  ? -20.327 -37.856 76.055 1.00 20.08  ? 98  GLU A CA  1 
ATOM   2406 C C   . GLU B 1 80  ? -21.234 -37.268 75.003 1.00 22.15  ? 98  GLU A C   1 
ATOM   2407 O O   . GLU B 1 80  ? -22.408 -37.668 74.861 1.00 19.64  ? 98  GLU A O   1 
ATOM   2408 C CB  . GLU B 1 80  ? -20.842 -37.531 77.467 1.00 21.39  ? 98  GLU A CB  1 
ATOM   2409 C CG  . GLU B 1 80  ? -20.182 -38.493 78.461 1.00 24.04  ? 98  GLU A CG  1 
ATOM   2410 C CD  . GLU B 1 80  ? -18.739 -38.135 78.790 1.00 23.53  ? 98  GLU A CD  1 
ATOM   2411 O OE1 . GLU B 1 80  ? -18.476 -36.994 79.145 1.00 28.01  ? 98  GLU A OE1 1 
ATOM   2412 O OE2 . GLU B 1 80  ? -17.852 -39.020 78.785 1.00 28.95  ? 98  GLU A OE2 1 
ATOM   2413 N N   . LEU B 1 81  ? -20.728 -36.301 74.256 1.00 21.23  ? 99  LEU A N   1 
ATOM   2414 C CA  . LEU B 1 81  ? -21.444 -35.953 73.030 1.00 22.52  ? 99  LEU A CA  1 
ATOM   2415 C C   . LEU B 1 81  ? -21.581 -37.212 72.139 1.00 24.00  ? 99  LEU A C   1 
ATOM   2416 O O   . LEU B 1 81  ? -20.804 -38.188 72.273 1.00 20.56  ? 99  LEU A O   1 
ATOM   2417 C CB  . LEU B 1 81  ? -20.685 -34.797 72.327 1.00 20.74  ? 99  LEU A CB  1 
ATOM   2418 C CG  . LEU B 1 81  ? -20.604 -33.599 73.295 1.00 19.23  ? 99  LEU A CG  1 
ATOM   2419 C CD1 . LEU B 1 81  ? -19.565 -32.608 72.799 1.00 20.89  ? 99  LEU A CD1 1 
ATOM   2420 C CD2 . LEU B 1 81  ? -21.933 -32.868 73.626 1.00 17.07  ? 99  LEU A CD2 1 
ATOM   2421 N N   . SER B 1 82  ? -22.511 -37.164 71.192 1.00 24.96  ? 100 SER A N   1 
ATOM   2422 C CA  . SER B 1 82  ? -22.715 -38.231 70.252 1.00 25.62  ? 100 SER A CA  1 
ATOM   2423 C C   . SER B 1 82  ? -21.459 -38.413 69.374 1.00 29.88  ? 100 SER A C   1 
ATOM   2424 O O   . SER B 1 82  ? -20.659 -37.456 69.176 1.00 26.16  ? 100 SER A O   1 
ATOM   2425 C CB  . SER B 1 82  ? -23.939 -37.904 69.372 1.00 29.16  ? 100 SER A CB  1 
ATOM   2426 O OG  . SER B 1 82  ? -23.585 -37.192 68.194 1.00 22.10  ? 100 SER A OG  1 
ATOM   2427 N N   . PRO B 1 83  ? -21.245 -39.658 68.883 1.00 27.48  ? 101 PRO A N   1 
ATOM   2428 C CA  . PRO B 1 83  ? -19.972 -39.806 68.228 1.00 27.43  ? 101 PRO A CA  1 
ATOM   2429 C C   . PRO B 1 83  ? -19.953 -39.016 66.926 1.00 23.60  ? 101 PRO A C   1 
ATOM   2430 O O   . PRO B 1 83  ? -18.940 -38.518 66.549 1.00 21.54  ? 101 PRO A O   1 
ATOM   2431 C CB  . PRO B 1 83  ? -19.855 -41.345 67.994 1.00 28.50  ? 101 PRO A CB  1 
ATOM   2432 C CG  . PRO B 1 83  ? -20.736 -41.945 69.063 1.00 30.44  ? 101 PRO A CG  1 
ATOM   2433 C CD  . PRO B 1 83  ? -21.859 -40.957 69.253 1.00 26.91  ? 101 PRO A CD  1 
ATOM   2434 N N   . ALA B 1 84  ? -21.084 -38.900 66.267 1.00 22.93  ? 102 ALA A N   1 
ATOM   2435 C CA  . ALA B 1 84  ? -21.139 -38.089 65.085 1.00 20.96  ? 102 ALA A CA  1 
ATOM   2436 C C   . ALA B 1 84  ? -20.783 -36.647 65.431 1.00 19.11  ? 102 ALA A C   1 
ATOM   2437 O O   . ALA B 1 84  ? -20.051 -36.003 64.674 1.00 18.80  ? 102 ALA A O   1 
ATOM   2438 C CB  . ALA B 1 84  ? -22.473 -38.217 64.329 1.00 20.29  ? 102 ALA A CB  1 
ATOM   2439 N N   . ASP B 1 85  ? -21.296 -36.147 66.549 1.00 16.48  ? 103 ASP A N   1 
ATOM   2440 C CA  . ASP B 1 85  ? -21.019 -34.790 66.989 1.00 17.72  ? 103 ASP A CA  1 
ATOM   2441 C C   . ASP B 1 85  ? -19.537 -34.493 67.360 1.00 19.72  ? 103 ASP A C   1 
ATOM   2442 O O   . ASP B 1 85  ? -19.005 -33.413 67.000 1.00 16.74  ? 103 ASP A O   1 
ATOM   2443 C CB  . ASP B 1 85  ? -21.962 -34.316 68.092 1.00 17.37  ? 103 ASP A CB  1 
ATOM   2444 C CG  . ASP B 1 85  ? -23.394 -33.962 67.568 1.00 21.23  ? 103 ASP A CG  1 
ATOM   2445 O OD1 . ASP B 1 85  ? -23.671 -34.140 66.343 1.00 20.11  ? 103 ASP A OD1 1 
ATOM   2446 O OD2 . ASP B 1 85  ? -24.201 -33.455 68.400 1.00 21.74  ? 103 ASP A OD2 1 
ATOM   2447 N N   . GLN B 1 86  ? -18.901 -35.423 68.083 1.00 19.26  ? 104 GLN A N   1 
ATOM   2448 C CA  . GLN B 1 86  ? -17.476 -35.302 68.430 1.00 20.84  ? 104 GLN A CA  1 
ATOM   2449 C C   . GLN B 1 86  ? -16.661 -35.230 67.095 1.00 19.57  ? 104 GLN A C   1 
ATOM   2450 O O   . GLN B 1 86  ? -15.811 -34.346 66.924 1.00 20.04  ? 104 GLN A O   1 
ATOM   2451 C CB  . GLN B 1 86  ? -17.002 -36.509 69.256 1.00 20.34  ? 104 GLN A CB  1 
ATOM   2452 C CG  . GLN B 1 86  ? -17.741 -36.708 70.600 1.00 21.29  ? 104 GLN A CG  1 
ATOM   2453 C CD  . GLN B 1 86  ? -17.221 -37.917 71.343 1.00 22.56  ? 104 GLN A CD  1 
ATOM   2454 O OE1 . GLN B 1 86  ? -16.002 -38.175 71.368 1.00 23.63  ? 104 GLN A OE1 1 
ATOM   2455 N NE2 . GLN B 1 86  ? -18.130 -38.699 71.921 1.00 24.48  ? 104 GLN A NE2 1 
ATOM   2456 N N   . ASP B 1 87  ? -16.974 -36.146 66.183 1.00 19.21  ? 105 ASP A N   1 
ATOM   2457 C CA  . ASP B 1 87  ? -16.344 -36.183 64.861 1.00 21.05  ? 105 ASP A CA  1 
ATOM   2458 C C   . ASP B 1 87  ? -16.466 -34.867 64.068 1.00 17.98  ? 105 ASP A C   1 
ATOM   2459 O O   . ASP B 1 87  ? -15.517 -34.386 63.487 1.00 19.14  ? 105 ASP A O   1 
ATOM   2460 C CB  . ASP B 1 87  ? -16.857 -37.370 64.017 1.00 22.80  ? 105 ASP A CB  1 
ATOM   2461 C CG  . ASP B 1 87  ? -16.166 -38.697 64.399 1.00 24.73  ? 105 ASP A CG  1 
ATOM   2462 O OD1 . ASP B 1 87  ? -15.193 -38.710 65.158 1.00 25.36  ? 105 ASP A OD1 1 
ATOM   2463 O OD2 . ASP B 1 87  ? -16.588 -39.725 63.921 1.00 28.38  ? 105 ASP A OD2 1 
ATOM   2464 N N   . LEU B 1 88  ? -17.654 -34.327 64.043 1.00 20.02  ? 106 LEU A N   1 
ATOM   2465 C CA  . LEU B 1 88  ? -17.922 -33.144 63.265 1.00 19.01  ? 106 LEU A CA  1 
ATOM   2466 C C   . LEU B 1 88  ? -17.242 -31.959 63.922 1.00 19.82  ? 106 LEU A C   1 
ATOM   2467 O O   . LEU B 1 88  ? -16.673 -31.107 63.190 1.00 19.67  ? 106 LEU A O   1 
ATOM   2468 C CB  . LEU B 1 88  ? -19.429 -32.895 63.170 1.00 20.60  ? 106 LEU A CB  1 
ATOM   2469 C CG  . LEU B 1 88  ? -19.874 -31.572 62.516 1.00 19.92  ? 106 LEU A CG  1 
ATOM   2470 C CD1 . LEU B 1 88  ? -19.468 -31.537 61.046 1.00 18.42  ? 106 LEU A CD1 1 
ATOM   2471 C CD2 . LEU B 1 88  ? -21.361 -31.389 62.735 1.00 19.24  ? 106 LEU A CD2 1 
ATOM   2472 N N   . LEU B 1 89  ? -17.215 -31.912 65.268 1.00 16.70  ? 107 LEU A N   1 
ATOM   2473 C CA  . LEU B 1 89  ? -16.591 -30.752 65.922 1.00 15.74  ? 107 LEU A CA  1 
ATOM   2474 C C   . LEU B 1 89  ? -15.082 -30.714 65.560 1.00 17.32  ? 107 LEU A C   1 
ATOM   2475 O O   . LEU B 1 89  ? -14.552 -29.652 65.246 1.00 17.09  ? 107 LEU A O   1 
ATOM   2476 C CB  . LEU B 1 89  ? -16.806 -30.743 67.468 1.00 15.49  ? 107 LEU A CB  1 
ATOM   2477 C CG  . LEU B 1 89  ? -18.262 -30.308 67.981 1.00 15.96  ? 107 LEU A CG  1 
ATOM   2478 C CD1 . LEU B 1 89  ? -18.450 -30.413 69.484 1.00 17.73  ? 107 LEU A CD1 1 
ATOM   2479 C CD2 . LEU B 1 89  ? -18.671 -28.875 67.601 1.00 15.45  ? 107 LEU A CD2 1 
ATOM   2480 N N   . LEU B 1 90  ? -14.422 -31.873 65.691 1.00 19.30  ? 108 LEU A N   1 
ATOM   2481 C CA  . LEU B 1 90  ? -12.975 -32.057 65.539 1.00 19.41  ? 108 LEU A CA  1 
ATOM   2482 C C   . LEU B 1 90  ? -12.616 -31.791 64.104 1.00 19.70  ? 108 LEU A C   1 
ATOM   2483 O O   . LEU B 1 90  ? -11.716 -30.957 63.834 1.00 23.14  ? 108 LEU A O   1 
ATOM   2484 C CB  . LEU B 1 90  ? -12.709 -33.527 65.801 1.00 21.91  ? 108 LEU A CB  1 
ATOM   2485 C CG  . LEU B 1 90  ? -12.160 -34.178 67.076 1.00 22.60  ? 108 LEU A CG  1 
ATOM   2486 C CD1 . LEU B 1 90  ? -11.487 -33.218 68.074 1.00 17.93  ? 108 LEU A CD1 1 
ATOM   2487 C CD2 . LEU B 1 90  ? -13.028 -35.350 67.650 1.00 20.97  ? 108 LEU A CD2 1 
ATOM   2488 N N   . GLU B 1 91  ? -13.347 -32.454 63.176 1.00 17.30  ? 109 GLU A N   1 
ATOM   2489 C CA  . GLU B 1 91  ? -13.107 -32.231 61.734 1.00 18.47  ? 109 GLU A CA  1 
ATOM   2490 C C   . GLU B 1 91  ? -13.291 -30.794 61.274 1.00 18.14  ? 109 GLU A C   1 
ATOM   2491 O O   . GLU B 1 91  ? -12.492 -30.338 60.475 1.00 18.49  ? 109 GLU A O   1 
ATOM   2492 C CB  . GLU B 1 91  ? -13.972 -33.179 60.836 1.00 20.68  ? 109 GLU A CB  1 
ATOM   2493 C CG  . GLU B 1 91  ? -13.485 -34.630 61.010 1.00 23.84  ? 109 GLU A CG  1 
ATOM   2494 C CD  . GLU B 1 91  ? -14.488 -35.651 60.546 1.00 27.73  ? 109 GLU A CD  1 
ATOM   2495 O OE1 . GLU B 1 91  ? -14.391 -36.801 60.997 1.00 31.33  ? 109 GLU A OE1 1 
ATOM   2496 O OE2 . GLU B 1 91  ? -15.394 -35.296 59.749 1.00 28.01  ? 109 GLU A OE2 1 
ATOM   2497 N N   . SER B 1 92  ? -14.345 -30.095 61.758 1.00 17.89  ? 110 SER A N   1 
ATOM   2498 C CA  . SER B 1 92  ? -14.618 -28.747 61.320 1.00 18.92  ? 110 SER A CA  1 
ATOM   2499 C C   . SER B 1 92  ? -13.637 -27.827 61.944 1.00 18.14  ? 110 SER A C   1 
ATOM   2500 O O   . SER B 1 92  ? -13.421 -26.799 61.392 1.00 13.79  ? 110 SER A O   1 
ATOM   2501 C CB  . SER B 1 92  ? -15.998 -28.260 61.827 1.00 18.48  ? 110 SER A CB  1 
ATOM   2502 O OG  . SER B 1 92  ? -16.951 -29.171 61.429 1.00 22.94  ? 110 SER A OG  1 
ATOM   2503 N N   . ALA B 1 93  ? -13.160 -28.130 63.174 1.00 17.02  ? 111 ALA A N   1 
ATOM   2504 C CA  . ALA B 1 93  ? -12.139 -27.222 63.830 1.00 18.46  ? 111 ALA A CA  1 
ATOM   2505 C C   . ALA B 1 93  ? -10.649 -27.572 63.558 1.00 21.00  ? 111 ALA A C   1 
ATOM   2506 O O   . ALA B 1 93  ? -9.736  -26.802 63.925 1.00 20.45  ? 111 ALA A O   1 
ATOM   2507 C CB  . ALA B 1 93  ? -12.320 -27.198 65.347 1.00 12.94  ? 111 ALA A CB  1 
ATOM   2508 N N   . PHE B 1 94  ? -10.372 -28.767 63.051 1.00 20.79  ? 112 PHE A N   1 
ATOM   2509 C CA  . PHE B 1 94  ? -8.964  -29.212 62.984 1.00 18.95  ? 112 PHE A CA  1 
ATOM   2510 C C   . PHE B 1 94  ? -7.976  -28.182 62.361 1.00 18.74  ? 112 PHE A C   1 
ATOM   2511 O O   . PHE B 1 94  ? -6.997  -27.779 62.982 1.00 21.15  ? 112 PHE A O   1 
ATOM   2512 C CB  . PHE B 1 94  ? -8.852  -30.514 62.202 1.00 19.67  ? 112 PHE A CB  1 
ATOM   2513 C CG  . PHE B 1 94  ? -7.427  -30.815 61.820 1.00 22.40  ? 112 PHE A CG  1 
ATOM   2514 C CD1 . PHE B 1 94  ? -6.500  -31.169 62.803 1.00 19.50  ? 112 PHE A CD1 1 
ATOM   2515 C CD2 . PHE B 1 94  ? -6.999  -30.688 60.502 1.00 22.27  ? 112 PHE A CD2 1 
ATOM   2516 C CE1 . PHE B 1 94  ? -5.190  -31.340 62.508 1.00 17.85  ? 112 PHE A CE1 1 
ATOM   2517 C CE2 . PHE B 1 94  ? -5.655  -30.889 60.207 1.00 21.26  ? 112 PHE A CE2 1 
ATOM   2518 C CZ  . PHE B 1 94  ? -4.761  -31.241 61.198 1.00 18.30  ? 112 PHE A CZ  1 
ATOM   2519 N N   . LEU B 1 95  ? -8.244  -27.690 61.168 1.00 17.18  ? 113 LEU A N   1 
ATOM   2520 C CA  . LEU B 1 95  ? -7.218  -26.807 60.559 1.00 20.01  ? 113 LEU A CA  1 
ATOM   2521 C C   . LEU B 1 95  ? -7.015  -25.593 61.456 1.00 18.92  ? 113 LEU A C   1 
ATOM   2522 O O   . LEU B 1 95  ? -5.898  -25.180 61.741 1.00 16.71  ? 113 LEU A O   1 
ATOM   2523 C CB  . LEU B 1 95  ? -7.694  -26.317 59.177 1.00 26.99  ? 113 LEU A CB  1 
ATOM   2524 C CG  . LEU B 1 95  ? -6.853  -26.433 57.925 1.00 33.68  ? 113 LEU A CG  1 
ATOM   2525 C CD1 . LEU B 1 95  ? -5.708  -27.453 57.971 1.00 29.92  ? 113 LEU A CD1 1 
ATOM   2526 C CD2 . LEU B 1 95  ? -7.779  -26.648 56.731 1.00 33.16  ? 113 LEU A CD2 1 
ATOM   2527 N N   . GLU B 1 96  ? -8.092  -25.022 61.960 1.00 18.77  ? 114 GLU A N   1 
ATOM   2528 C CA  . GLU B 1 96  ? -7.926  -23.839 62.825 1.00 17.91  ? 114 GLU A CA  1 
ATOM   2529 C C   . GLU B 1 96  ? -7.080  -24.126 64.084 1.00 19.65  ? 114 GLU A C   1 
ATOM   2530 O O   . GLU B 1 96  ? -6.241  -23.297 64.522 1.00 18.13  ? 114 GLU A O   1 
ATOM   2531 C CB  . GLU B 1 96  ? -9.282  -23.423 63.261 1.00 20.72  ? 114 GLU A CB  1 
ATOM   2532 C CG  . GLU B 1 96  ? -9.263  -22.140 64.008 1.00 22.59  ? 114 GLU A CG  1 
ATOM   2533 C CD  . GLU B 1 96  ? -10.569 -21.405 63.975 1.00 24.74  ? 114 GLU A CD  1 
ATOM   2534 O OE1 . GLU B 1 96  ? -11.642 -21.914 63.536 1.00 24.21  ? 114 GLU A OE1 1 
ATOM   2535 O OE2 . GLU B 1 96  ? -10.532 -20.320 64.558 1.00 30.19  ? 114 GLU A OE2 1 
ATOM   2536 N N   . LEU B 1 97  ? -7.332  -25.291 64.683 1.00 18.33  ? 115 LEU A N   1 
ATOM   2537 C CA  . LEU B 1 97  ? -6.640  -25.646 65.919 1.00 19.20  ? 115 LEU A CA  1 
ATOM   2538 C C   . LEU B 1 97  ? -5.202  -25.982 65.605 1.00 20.20  ? 115 LEU A C   1 
ATOM   2539 O O   . LEU B 1 97  ? -4.331  -25.664 66.418 1.00 19.70  ? 115 LEU A O   1 
ATOM   2540 C CB  . LEU B 1 97  ? -7.309  -26.841 66.592 1.00 15.73  ? 115 LEU A CB  1 
ATOM   2541 C CG  . LEU B 1 97  ? -8.735  -26.539 67.145 1.00 14.77  ? 115 LEU A CG  1 
ATOM   2542 C CD1 . LEU B 1 97  ? -9.432  -27.853 67.395 1.00 15.17  ? 115 LEU A CD1 1 
ATOM   2543 C CD2 . LEU B 1 97  ? -8.685  -25.743 68.454 1.00 15.67  ? 115 LEU A CD2 1 
ATOM   2544 N N   . PHE B 1 98  ? -4.962  -26.711 64.499 1.00 18.40  ? 116 PHE A N   1 
ATOM   2545 C CA  . PHE B 1 98  ? -3.577  -27.004 64.109 1.00 17.40  ? 116 PHE A CA  1 
ATOM   2546 C C   . PHE B 1 98  ? -2.762  -25.690 64.034 1.00 17.09  ? 116 PHE A C   1 
ATOM   2547 O O   . PHE B 1 98  ? -1.590  -25.605 64.521 1.00 15.35  ? 116 PHE A O   1 
ATOM   2548 C CB  . PHE B 1 98  ? -3.554  -27.721 62.729 1.00 17.52  ? 116 PHE A CB  1 
ATOM   2549 C CG  . PHE B 1 98  ? -2.178  -27.827 62.114 1.00 16.70  ? 116 PHE A CG  1 
ATOM   2550 C CD1 . PHE B 1 98  ? -1.286  -28.820 62.548 1.00 16.24  ? 116 PHE A CD1 1 
ATOM   2551 C CD2 . PHE B 1 98  ? -1.763  -26.921 61.141 1.00 16.89  ? 116 PHE A CD2 1 
ATOM   2552 C CE1 . PHE B 1 98  ? -0.033  -28.920 62.024 1.00 17.07  ? 116 PHE A CE1 1 
ATOM   2553 C CE2 . PHE B 1 98  ? -0.504  -27.078 60.536 1.00 15.64  ? 116 PHE A CE2 1 
ATOM   2554 C CZ  . PHE B 1 98  ? 0.372   -27.994 61.043 1.00 16.69  ? 116 PHE A CZ  1 
ATOM   2555 N N   . ILE B 1 99  ? -3.328  -24.696 63.353 1.00 16.67  ? 117 ILE A N   1 
ATOM   2556 C CA  . ILE B 1 99  ? -2.622  -23.446 63.009 1.00 15.83  ? 117 ILE A CA  1 
ATOM   2557 C C   . ILE B 1 99  ? -2.487  -22.704 64.351 1.00 18.12  ? 117 ILE A C   1 
ATOM   2558 O O   . ILE B 1 99  ? -1.391  -22.205 64.711 1.00 16.58  ? 117 ILE A O   1 
ATOM   2559 C CB  . ILE B 1 99  ? -3.478  -22.582 62.074 1.00 14.98  ? 117 ILE A CB  1 
ATOM   2560 C CG1 . ILE B 1 99  ? -3.529  -23.194 60.677 1.00 14.67  ? 117 ILE A CG1 1 
ATOM   2561 C CG2 . ILE B 1 99  ? -2.860  -21.158 61.948 1.00 15.61  ? 117 ILE A CG2 1 
ATOM   2562 C CD1 . ILE B 1 99  ? -4.765  -22.741 59.855 1.00 16.72  ? 117 ILE A CD1 1 
ATOM   2563 N N   . LEU B 1 100 ? -3.571  -22.680 65.147 1.00 15.84  ? 118 LEU A N   1 
ATOM   2564 C CA  . LEU B 1 100 ? -3.504  -21.926 66.413 1.00 17.03  ? 118 LEU A CA  1 
ATOM   2565 C C   . LEU B 1 100 ? -2.526  -22.458 67.428 1.00 16.13  ? 118 LEU A C   1 
ATOM   2566 O O   . LEU B 1 100 ? -1.824  -21.710 68.063 1.00 17.48  ? 118 LEU A O   1 
ATOM   2567 C CB  . LEU B 1 100 ? -4.883  -21.827 67.059 1.00 17.25  ? 118 LEU A CB  1 
ATOM   2568 C CG  . LEU B 1 100 ? -5.127  -20.869 68.251 1.00 20.02  ? 118 LEU A CG  1 
ATOM   2569 C CD1 . LEU B 1 100 ? -4.804  -19.446 67.900 1.00 15.23  ? 118 LEU A CD1 1 
ATOM   2570 C CD2 . LEU B 1 100 ? -6.595  -20.979 68.724 1.00 20.64  ? 118 LEU A CD2 1 
ATOM   2571 N N   . ARG B 1 101 ? -2.542  -23.764 67.641 1.00 17.64  ? 119 ARG A N   1 
ATOM   2572 C CA  . ARG B 1 101 ? -1.608  -24.411 68.546 1.00 16.88  ? 119 ARG A CA  1 
ATOM   2573 C C   . ARG B 1 101 ? -0.206  -24.328 68.021 1.00 18.76  ? 119 ARG A C   1 
ATOM   2574 O O   . ARG B 1 101 ? 0.672   -24.153 68.794 1.00 17.36  ? 119 ARG A O   1 
ATOM   2575 C CB  . ARG B 1 101 ? -2.023  -25.879 68.777 1.00 15.69  ? 119 ARG A CB  1 
ATOM   2576 C CG  . ARG B 1 101 ? -3.318  -25.907 69.660 1.00 15.09  ? 119 ARG A CG  1 
ATOM   2577 C CD  . ARG B 1 101 ? -4.161  -27.177 69.479 1.00 17.13  ? 119 ARG A CD  1 
ATOM   2578 N NE  . ARG B 1 101 ? -3.355  -28.391 69.585 1.00 17.39  ? 119 ARG A NE  1 
ATOM   2579 C CZ  . ARG B 1 101 ? -3.004  -28.964 70.744 1.00 18.87  ? 119 ARG A CZ  1 
ATOM   2580 N NH1 . ARG B 1 101 ? -3.417  -28.475 71.904 1.00 17.59  ? 119 ARG A NH1 1 
ATOM   2581 N NH2 . ARG B 1 101 ? -2.251  -30.037 70.724 1.00 18.52  ? 119 ARG A NH2 1 
ATOM   2582 N N   . LEU B 1 102 ? 0.005   -24.513 66.708 1.00 15.81  ? 120 LEU A N   1 
ATOM   2583 C CA  . LEU B 1 102 ? 1.333   -24.412 66.146 1.00 16.98  ? 120 LEU A CA  1 
ATOM   2584 C C   . LEU B 1 102 ? 1.901   -22.989 66.399 1.00 19.42  ? 120 LEU A C   1 
ATOM   2585 O O   . LEU B 1 102 ? 3.072   -22.830 66.789 1.00 20.57  ? 120 LEU A O   1 
ATOM   2586 C CB  . LEU B 1 102 ? 1.274   -24.620 64.614 1.00 16.94  ? 120 LEU A CB  1 
ATOM   2587 C CG  . LEU B 1 102 ? 2.599   -24.664 63.861 1.00 16.54  ? 120 LEU A CG  1 
ATOM   2588 C CD1 . LEU B 1 102 ? 3.572   -25.654 64.556 1.00 16.86  ? 120 LEU A CD1 1 
ATOM   2589 C CD2 . LEU B 1 102 ? 2.340   -25.086 62.367 1.00 14.67  ? 120 LEU A CD2 1 
ATOM   2590 N N   . ALA B 1 103 ? 1.092   -21.953 66.139 1.00 18.70  ? 121 ALA A N   1 
ATOM   2591 C CA  . ALA B 1 103 ? 1.550   -20.554 66.224 1.00 19.07  ? 121 ALA A CA  1 
ATOM   2592 C C   . ALA B 1 103 ? 1.865   -20.267 67.717 1.00 19.91  ? 121 ALA A C   1 
ATOM   2593 O O   . ALA B 1 103 ? 2.870   -19.542 68.089 1.00 16.97  ? 121 ALA A O   1 
ATOM   2594 C CB  . ALA B 1 103 ? 0.448   -19.591 65.725 1.00 17.09  ? 121 ALA A CB  1 
ATOM   2595 N N   . TYR B 1 104 ? 1.023   -20.834 68.581 1.00 20.62  ? 122 TYR A N   1 
ATOM   2596 C CA  . TYR B 1 104 ? 1.198   -20.542 70.015 1.00 19.76  ? 122 TYR A CA  1 
ATOM   2597 C C   . TYR B 1 104 ? 2.476   -21.185 70.470 1.00 21.45  ? 122 TYR A C   1 
ATOM   2598 O O   . TYR B 1 104 ? 3.187   -20.598 71.270 1.00 24.45  ? 122 TYR A O   1 
ATOM   2599 C CB  . TYR B 1 104 ? 0.007   -21.028 70.872 1.00 20.41  ? 122 TYR A CB  1 
ATOM   2600 C CG  . TYR B 1 104 ? -0.029  -20.528 72.367 1.00 20.01  ? 122 TYR A CG  1 
ATOM   2601 C CD1 . TYR B 1 104 ? -0.138  -19.141 72.666 1.00 23.01  ? 122 TYR A CD1 1 
ATOM   2602 C CD2 . TYR B 1 104 ? -0.036  -21.413 73.444 1.00 20.10  ? 122 TYR A CD2 1 
ATOM   2603 C CE1 . TYR B 1 104 ? -0.212  -18.684 73.993 1.00 21.33  ? 122 TYR A CE1 1 
ATOM   2604 C CE2 . TYR B 1 104 ? -0.121  -20.945 74.781 1.00 18.25  ? 122 TYR A CE2 1 
ATOM   2605 C CZ  . TYR B 1 104 ? -0.232  -19.610 75.026 1.00 19.31  ? 122 TYR A CZ  1 
ATOM   2606 O OH  . TYR B 1 104 ? -0.349  -19.094 76.309 1.00 23.83  ? 122 TYR A OH  1 
ATOM   2607 N N   . ARG B 1 105 ? 2.774   -22.418 70.043 1.00 22.91  ? 123 ARG A N   1 
ATOM   2608 C CA  . ARG B 1 105 ? 3.998   -23.005 70.585 1.00 23.15  ? 123 ARG A CA  1 
ATOM   2609 C C   . ARG B 1 105 ? 5.351   -22.713 69.887 1.00 22.32  ? 123 ARG A C   1 
ATOM   2610 O O   . ARG B 1 105 ? 6.418   -22.963 70.468 1.00 20.60  ? 123 ARG A O   1 
ATOM   2611 C CB  . ARG B 1 105 ? 3.836   -24.477 70.910 1.00 24.04  ? 123 ARG A CB  1 
ATOM   2612 C CG  . ARG B 1 105 ? 4.180   -25.415 69.837 1.00 23.37  ? 123 ARG A CG  1 
ATOM   2613 C CD  . ARG B 1 105 ? 4.021   -26.879 70.281 1.00 21.67  ? 123 ARG A CD  1 
ATOM   2614 N NE  . ARG B 1 105 ? 2.646   -27.389 70.276 1.00 20.04  ? 123 ARG A NE  1 
ATOM   2615 C CZ  . ARG B 1 105 ? 1.905   -27.599 69.197 1.00 21.72  ? 123 ARG A CZ  1 
ATOM   2616 N NH1 . ARG B 1 105 ? 2.372   -27.337 67.980 1.00 18.02  ? 123 ARG A NH1 1 
ATOM   2617 N NH2 . ARG B 1 105 ? 0.648   -28.078 69.327 1.00 21.19  ? 123 ARG A NH2 1 
ATOM   2618 N N   . SER B 1 106 ? 5.313   -22.194 68.662 1.00 21.00  ? 124 SER A N   1 
ATOM   2619 C CA  . SER B 1 106 ? 6.526   -21.925 67.911 1.00 21.18  ? 124 SER A CA  1 
ATOM   2620 C C   . SER B 1 106 ? 7.334   -20.696 68.422 1.00 20.03  ? 124 SER A C   1 
ATOM   2621 O O   . SER B 1 106 ? 6.909   -19.893 69.301 1.00 20.50  ? 124 SER A O   1 
ATOM   2622 C CB  . SER B 1 106 ? 6.166   -21.751 66.417 1.00 22.88  ? 124 SER A CB  1 
ATOM   2623 O OG  . SER B 1 106 ? 5.595   -22.982 65.933 1.00 22.58  ? 124 SER A OG  1 
ATOM   2624 N N   . LYS B 1 107 ? 8.478   -20.519 67.799 1.00 19.44  ? 125 LYS A N   1 
ATOM   2625 C CA  . LYS B 1 107 ? 9.438   -19.479 68.162 1.00 20.25  ? 125 LYS A CA  1 
ATOM   2626 C C   . LYS B 1 107 ? 9.781   -18.702 66.901 1.00 18.02  ? 125 LYS A C   1 
ATOM   2627 O O   . LYS B 1 107 ? 10.789  -19.002 66.273 1.00 18.18  ? 125 LYS A O   1 
ATOM   2628 C CB  . LYS B 1 107 ? 10.715  -20.167 68.762 1.00 23.13  ? 125 LYS A CB  1 
ATOM   2629 C CG  . LYS B 1 107 ? 10.503  -20.841 70.132 1.00 26.72  ? 125 LYS A CG  1 
ATOM   2630 C CD  . LYS B 1 107 ? 9.648   -19.945 71.014 1.00 33.51  ? 125 LYS A CD  1 
ATOM   2631 C CE  . LYS B 1 107 ? 8.853   -20.755 72.041 1.00 46.09  ? 125 LYS A CE  1 
ATOM   2632 N NZ  . LYS B 1 107 ? 7.383   -20.391 72.048 1.00 45.66  ? 125 LYS A NZ  1 
ATOM   2633 N N   . PRO B 1 108 ? 8.941   -17.722 66.518 1.00 17.18  ? 126 PRO A N   1 
ATOM   2634 C CA  . PRO B 1 108 ? 9.154   -17.090 65.239 1.00 18.84  ? 126 PRO A CA  1 
ATOM   2635 C C   . PRO B 1 108 ? 10.379  -16.197 65.239 1.00 20.62  ? 126 PRO A C   1 
ATOM   2636 O O   . PRO B 1 108 ? 10.811  -15.805 64.157 1.00 19.71  ? 126 PRO A O   1 
ATOM   2637 C CB  . PRO B 1 108 ? 7.906   -16.184 65.088 1.00 17.55  ? 126 PRO A CB  1 
ATOM   2638 C CG  . PRO B 1 108 ? 7.385   -15.975 66.501 1.00 17.04  ? 126 PRO A CG  1 
ATOM   2639 C CD  . PRO B 1 108 ? 7.643   -17.323 67.095 1.00 17.33  ? 126 PRO A CD  1 
ATOM   2640 N N   . GLY B 1 109 ? 10.864  -15.800 66.431 1.00 19.74  ? 127 GLY A N   1 
ATOM   2641 C CA  . GLY B 1 109 ? 12.084  -15.022 66.489 1.00 19.96  ? 127 GLY A CA  1 
ATOM   2642 C C   . GLY B 1 109 ? 13.291  -15.851 66.148 1.00 19.49  ? 127 GLY A C   1 
ATOM   2643 O O   . GLY B 1 109 ? 14.370  -15.315 65.940 1.00 22.12  ? 127 GLY A O   1 
ATOM   2644 N N   . GLU B 1 110 ? 13.166  -17.172 66.124 1.00 20.35  ? 128 GLU A N   1 
ATOM   2645 C CA  . GLU B 1 110 ? 14.283  -17.975 65.684 1.00 21.42  ? 128 GLU A CA  1 
ATOM   2646 C C   . GLU B 1 110 ? 13.942  -18.793 64.395 1.00 20.32  ? 128 GLU A C   1 
ATOM   2647 O O   . GLU B 1 110 ? 14.691  -19.702 64.058 1.00 19.44  ? 128 GLU A O   1 
ATOM   2648 C CB  . GLU B 1 110 ? 14.681  -19.006 66.751 1.00 22.83  ? 128 GLU A CB  1 
ATOM   2649 C CG  . GLU B 1 110 ? 15.429  -18.494 67.980 1.00 24.16  ? 128 GLU A CG  1 
ATOM   2650 C CD  . GLU B 1 110 ? 15.484  -19.607 69.018 1.00 26.88  ? 128 GLU A CD  1 
ATOM   2651 O OE1 . GLU B 1 110 ? 16.333  -20.488 68.894 1.00 29.83  ? 128 GLU A OE1 1 
ATOM   2652 O OE2 . GLU B 1 110 ? 14.638  -19.648 69.928 1.00 29.67  ? 128 GLU A OE2 1 
ATOM   2653 N N   . GLY B 1 111 ? 12.792  -18.562 63.763 1.00 20.17  ? 129 GLY A N   1 
ATOM   2654 C CA  . GLY B 1 111 ? 12.398  -19.333 62.534 1.00 16.54  ? 129 GLY A CA  1 
ATOM   2655 C C   . GLY B 1 111 ? 12.043  -20.770 62.783 1.00 19.65  ? 129 GLY A C   1 
ATOM   2656 O O   . GLY B 1 111 ? 12.013  -21.558 61.847 1.00 19.36  ? 129 GLY A O   1 
ATOM   2657 N N   . LYS B 1 112 ? 11.705  -21.075 64.039 1.00 18.37  ? 130 LYS A N   1 
ATOM   2658 C CA  . LYS B 1 112 ? 11.432  -22.441 64.511 1.00 18.09  ? 130 LYS A CA  1 
ATOM   2659 C C   . LYS B 1 112 ? 9.929   -22.776 64.646 1.00 20.02  ? 130 LYS A C   1 
ATOM   2660 O O   . LYS B 1 112 ? 9.194   -22.108 65.427 1.00 19.91  ? 130 LYS A O   1 
ATOM   2661 C CB  . LYS B 1 112 ? 12.092  -22.659 65.897 1.00 18.55  ? 130 LYS A CB  1 
ATOM   2662 C CG  . LYS B 1 112 ? 13.610  -22.765 65.871 1.00 19.41  ? 130 LYS A CG  1 
ATOM   2663 C CD  . LYS B 1 112 ? 14.105  -23.162 67.298 1.00 16.53  ? 130 LYS A CD  1 
ATOM   2664 C CE  . LYS B 1 112 ? 15.627  -23.092 67.328 1.00 21.14  ? 130 LYS A CE  1 
ATOM   2665 N NZ  . LYS B 1 112 ? 16.209  -23.236 68.715 1.00 22.44  ? 130 LYS A NZ  1 
ATOM   2666 N N   . LEU B 1 113 ? 9.480   -23.798 63.900 1.00 18.52  ? 131 LEU A N   1 
ATOM   2667 C CA  . LEU B 1 113 ? 8.125   -24.334 63.960 1.00 20.44  ? 131 LEU A CA  1 
ATOM   2668 C C   . LEU B 1 113 ? 8.319   -25.468 64.900 1.00 21.87  ? 131 LEU A C   1 
ATOM   2669 O O   . LEU B 1 113 ? 9.231   -26.314 64.714 1.00 23.22  ? 131 LEU A O   1 
ATOM   2670 C CB  . LEU B 1 113 ? 7.656   -24.903 62.580 1.00 18.01  ? 131 LEU A CB  1 
ATOM   2671 C CG  . LEU B 1 113 ? 7.215   -23.753 61.646 1.00 20.33  ? 131 LEU A CG  1 
ATOM   2672 C CD1 . LEU B 1 113 ? 6.119   -22.980 62.354 1.00 22.41  ? 131 LEU A CD1 1 
ATOM   2673 C CD2 . LEU B 1 113 ? 8.402   -22.853 61.187 1.00 19.01  ? 131 LEU A CD2 1 
ATOM   2674 N N   . ILE B 1 114 ? 7.444   -25.568 65.885 1.00 20.12  ? 132 ILE A N   1 
ATOM   2675 C CA  . ILE B 1 114 ? 7.579   -26.614 66.885 1.00 19.41  ? 132 ILE A CA  1 
ATOM   2676 C C   . ILE B 1 114 ? 6.232   -27.311 66.920 1.00 21.11  ? 132 ILE A C   1 
ATOM   2677 O O   . ILE B 1 114 ? 5.212   -26.697 67.263 1.00 21.92  ? 132 ILE A O   1 
ATOM   2678 C CB  . ILE B 1 114 ? 7.851   -26.005 68.282 1.00 19.09  ? 132 ILE A CB  1 
ATOM   2679 C CG1 . ILE B 1 114 ? 9.213   -25.301 68.316 1.00 18.75  ? 132 ILE A CG1 1 
ATOM   2680 C CG2 . ILE B 1 114 ? 7.646   -27.089 69.373 1.00 17.79  ? 132 ILE A CG2 1 
ATOM   2681 C CD1 . ILE B 1 114 ? 9.548   -24.665 69.672 1.00 19.90  ? 132 ILE A CD1 1 
ATOM   2682 N N   . PHE B 1 115 ? 6.218   -28.571 66.566 1.00 21.40  ? 133 PHE A N   1 
ATOM   2683 C CA  . PHE B 1 115 ? 5.000   -29.305 66.354 1.00 25.02  ? 133 PHE A CA  1 
ATOM   2684 C C   . PHE B 1 115 ? 4.595   -30.103 67.624 1.00 27.89  ? 133 PHE A C   1 
ATOM   2685 O O   . PHE B 1 115 ? 5.370   -30.181 68.585 1.00 22.19  ? 133 PHE A O   1 
ATOM   2686 C CB  . PHE B 1 115 ? 5.240   -30.234 65.158 1.00 21.52  ? 133 PHE A CB  1 
ATOM   2687 C CG  . PHE B 1 115 ? 5.436   -29.479 63.866 1.00 21.83  ? 133 PHE A CG  1 
ATOM   2688 C CD1 . PHE B 1 115 ? 6.725   -29.227 63.372 1.00 20.61  ? 133 PHE A CD1 1 
ATOM   2689 C CD2 . PHE B 1 115 ? 4.355   -29.052 63.138 1.00 19.53  ? 133 PHE A CD2 1 
ATOM   2690 C CE1 . PHE B 1 115 ? 6.906   -28.520 62.168 1.00 19.68  ? 133 PHE A CE1 1 
ATOM   2691 C CE2 . PHE B 1 115 ? 4.525   -28.327 61.935 1.00 19.59  ? 133 PHE A CE2 1 
ATOM   2692 C CZ  . PHE B 1 115 ? 5.816   -28.054 61.459 1.00 19.05  ? 133 PHE A CZ  1 
ATOM   2693 N N   . CYS B 1 116 ? 3.389   -30.685 67.623 1.00 27.75  ? 134 CYS A N   1 
ATOM   2694 C CA  . CYS B 1 116 ? 2.844   -31.250 68.892 1.00 28.65  ? 134 CYS A CA  1 
ATOM   2695 C C   . CYS B 1 116 ? 3.631   -32.454 69.401 1.00 28.24  ? 134 CYS A C   1 
ATOM   2696 O O   . CYS B 1 116 ? 3.720   -32.654 70.597 1.00 33.78  ? 134 CYS A O   1 
ATOM   2697 C CB  . CYS B 1 116 ? 1.345   -31.610 68.772 1.00 26.16  ? 134 CYS A CB  1 
ATOM   2698 S SG  . CYS B 1 116 ? 1.033   -32.821 67.482 1.00 27.93  ? 134 CYS A SG  1 
ATOM   2699 N N   . SER B 1 117 ? 4.244   -33.214 68.502 1.00 29.75  ? 135 SER A N   1 
ATOM   2700 C CA  . SER B 1 117 ? 5.185   -34.311 68.885 1.00 30.48  ? 135 SER A CA  1 
ATOM   2701 C C   . SER B 1 117 ? 6.516   -33.818 69.500 1.00 33.61  ? 135 SER A C   1 
ATOM   2702 O O   . SER B 1 117 ? 7.301   -34.613 69.983 1.00 37.15  ? 135 SER A O   1 
ATOM   2703 C CB  . SER B 1 117 ? 5.516   -35.127 67.628 1.00 31.10  ? 135 SER A CB  1 
ATOM   2704 O OG  . SER B 1 117 ? 6.354   -34.328 66.764 1.00 27.77  ? 135 SER A OG  1 
ATOM   2705 N N   . GLY B 1 118 ? 6.808   -32.521 69.471 1.00 31.61  ? 136 GLY A N   1 
ATOM   2706 C CA  . GLY B 1 118 ? 8.116   -32.020 69.969 1.00 28.42  ? 136 GLY A CA  1 
ATOM   2707 C C   . GLY B 1 118 ? 9.155   -31.728 68.878 1.00 27.68  ? 136 GLY A C   1 
ATOM   2708 O O   . GLY B 1 118 ? 10.125  -30.978 69.087 1.00 29.76  ? 136 GLY A O   1 
ATOM   2709 N N   . LEU B 1 119 ? 8.959   -32.335 67.709 1.00 30.54  ? 137 LEU A N   1 
ATOM   2710 C CA  . LEU B 1 119 ? 9.760   -32.052 66.525 1.00 26.24  ? 137 LEU A CA  1 
ATOM   2711 C C   . LEU B 1 119 ? 9.835   -30.539 66.245 1.00 27.56  ? 137 LEU A C   1 
ATOM   2712 O O   . LEU B 1 119 ? 8.815   -29.805 66.202 1.00 25.52  ? 137 LEU A O   1 
ATOM   2713 C CB  . LEU B 1 119 ? 9.181   -32.792 65.329 1.00 27.46  ? 137 LEU A CB  1 
ATOM   2714 C CG  . LEU B 1 119 ? 9.993   -32.751 64.031 1.00 27.44  ? 137 LEU A CG  1 
ATOM   2715 C CD1 . LEU B 1 119 ? 11.152  -33.757 64.062 1.00 28.58  ? 137 LEU A CD1 1 
ATOM   2716 C CD2 . LEU B 1 119 ? 9.096   -33.084 62.823 1.00 27.44  ? 137 LEU A CD2 1 
ATOM   2717 N N   . VAL B 1 120 ? 11.074  -30.087 66.114 1.00 24.27  ? 138 VAL A N   1 
ATOM   2718 C CA  . VAL B 1 120 ? 11.401  -28.747 65.714 1.00 23.20  ? 138 VAL A CA  1 
ATOM   2719 C C   . VAL B 1 120 ? 11.954  -28.795 64.275 1.00 22.50  ? 138 VAL A C   1 
ATOM   2720 O O   . VAL B 1 120 ? 12.784  -29.611 63.926 1.00 18.92  ? 138 VAL A O   1 
ATOM   2721 C CB  . VAL B 1 120 ? 12.424  -28.144 66.719 1.00 23.06  ? 138 VAL A CB  1 
ATOM   2722 C CG1 . VAL B 1 120 ? 12.798  -26.700 66.397 1.00 21.45  ? 138 VAL A CG1 1 
ATOM   2723 C CG2 . VAL B 1 120 ? 11.870  -28.261 68.149 1.00 27.31  ? 138 VAL A CG2 1 
ATOM   2724 N N   . LEU B 1 121 ? 11.488  -27.855 63.451 1.00 23.25  ? 139 LEU A N   1 
ATOM   2725 C CA  . LEU B 1 121 ? 11.935  -27.720 62.083 1.00 20.37  ? 139 LEU A CA  1 
ATOM   2726 C C   . LEU B 1 121 ? 12.083  -26.226 61.819 1.00 20.89  ? 139 LEU A C   1 
ATOM   2727 O O   . LEU B 1 121 ? 11.303  -25.382 62.359 1.00 21.96  ? 139 LEU A O   1 
ATOM   2728 C CB  . LEU B 1 121 ? 10.840  -28.297 61.200 1.00 20.23  ? 139 LEU A CB  1 
ATOM   2729 C CG  . LEU B 1 121 ? 11.013  -29.657 60.520 1.00 26.99  ? 139 LEU A CG  1 
ATOM   2730 C CD1 . LEU B 1 121 ? 11.990  -30.637 61.158 1.00 23.44  ? 139 LEU A CD1 1 
ATOM   2731 C CD2 . LEU B 1 121 ? 9.631   -30.262 60.228 1.00 21.33  ? 139 LEU A CD2 1 
ATOM   2732 N N   . HIS B 1 122 ? 13.117  -25.867 61.073 1.00 20.00  ? 140 HIS A N   1 
ATOM   2733 C CA  . HIS B 1 122 ? 13.327  -24.452 60.682 1.00 19.02  ? 140 HIS A CA  1 
ATOM   2734 C C   . HIS B 1 122 ? 12.347  -24.117 59.583 1.00 19.57  ? 140 HIS A C   1 
ATOM   2735 O O   . HIS B 1 122 ? 11.979  -24.999 58.781 1.00 18.18  ? 140 HIS A O   1 
ATOM   2736 C CB  . HIS B 1 122 ? 14.776  -24.228 60.228 1.00 17.85  ? 140 HIS A CB  1 
ATOM   2737 C CG  . HIS B 1 122 ? 15.117  -22.784 59.953 1.00 17.80  ? 140 HIS A CG  1 
ATOM   2738 N ND1 . HIS B 1 122 ? 15.563  -21.929 60.921 1.00 20.93  ? 140 HIS A ND1 1 
ATOM   2739 C CD2 . HIS B 1 122 ? 14.998  -22.036 58.811 1.00 15.51  ? 140 HIS A CD2 1 
ATOM   2740 C CE1 . HIS B 1 122 ? 15.756  -20.713 60.405 1.00 16.97  ? 140 HIS A CE1 1 
ATOM   2741 N NE2 . HIS B 1 122 ? 15.453  -20.779 59.103 1.00 19.15  ? 140 HIS A NE2 1 
ATOM   2742 N N   . ARG B 1 123 ? 11.823  -22.895 59.596 1.00 18.35  ? 141 ARG A N   1 
ATOM   2743 C CA  . ARG B 1 123 ? 11.063  -22.328 58.436 1.00 19.36  ? 141 ARG A CA  1 
ATOM   2744 C C   . ARG B 1 123 ? 11.532  -22.855 57.038 1.00 19.34  ? 141 ARG A C   1 
ATOM   2745 O O   . ARG B 1 123 ? 10.690  -23.281 56.191 1.00 17.07  ? 141 ARG A O   1 
ATOM   2746 C CB  . ARG B 1 123 ? 11.168  -20.759 58.486 1.00 19.42  ? 141 ARG A CB  1 
ATOM   2747 C CG  . ARG B 1 123 ? 10.323  -19.935 57.462 1.00 22.09  ? 141 ARG A CG  1 
ATOM   2748 C CD  . ARG B 1 123 ? 11.070  -18.541 57.137 1.00 22.47  ? 141 ARG A CD  1 
ATOM   2749 N NE  . ARG B 1 123 ? 11.555  -18.421 55.730 1.00 29.66  ? 141 ARG A NE  1 
ATOM   2750 C CZ  . ARG B 1 123 ? 12.738  -17.895 55.347 1.00 30.64  ? 141 ARG A CZ  1 
ATOM   2751 N NH1 . ARG B 1 123 ? 13.104  -17.849 54.089 1.00 38.72  ? 141 ARG A NH1 1 
ATOM   2752 N NH2 . ARG B 1 123 ? 13.574  -17.388 56.193 1.00 38.70  ? 141 ARG A NH2 1 
ATOM   2753 N N   . LEU B 1 124 ? 12.857  -22.860 56.828 1.00 16.59  ? 142 LEU A N   1 
ATOM   2754 C CA  . LEU B 1 124 ? 13.478  -23.281 55.564 1.00 17.59  ? 142 LEU A CA  1 
ATOM   2755 C C   . LEU B 1 124 ? 13.248  -24.762 55.283 1.00 18.03  ? 142 LEU A C   1 
ATOM   2756 O O   . LEU B 1 124 ? 13.166  -25.156 54.165 1.00 19.67  ? 142 LEU A O   1 
ATOM   2757 C CB  . LEU B 1 124 ? 15.029  -22.938 55.534 1.00 16.76  ? 142 LEU A CB  1 
ATOM   2758 C CG  . LEU B 1 124 ? 15.277  -21.451 55.429 1.00 17.83  ? 142 LEU A CG  1 
ATOM   2759 C CD1 . LEU B 1 124 ? 16.743  -21.148 55.720 1.00 19.10  ? 142 LEU A CD1 1 
ATOM   2760 C CD2 . LEU B 1 124 ? 14.845  -20.923 54.044 1.00 17.86  ? 142 LEU A CD2 1 
ATOM   2761 N N   . GLN B 1 125 ? 13.167  -25.566 56.325 1.00 20.11  ? 143 GLN A N   1 
ATOM   2762 C CA  . GLN B 1 125 ? 12.901  -27.008 56.223 1.00 20.32  ? 143 GLN A CA  1 
ATOM   2763 C C   . GLN B 1 125 ? 11.368  -27.265 55.978 1.00 23.58  ? 143 GLN A C   1 
ATOM   2764 O O   . GLN B 1 125 ? 10.961  -28.356 55.493 1.00 24.33  ? 143 GLN A O   1 
ATOM   2765 C CB  . GLN B 1 125 ? 13.336  -27.676 57.519 1.00 19.10  ? 143 GLN A CB  1 
ATOM   2766 C CG  . GLN B 1 125 ? 14.824  -27.576 57.868 1.00 20.94  ? 143 GLN A CG  1 
ATOM   2767 C CD  . GLN B 1 125 ? 15.149  -28.410 59.099 1.00 23.55  ? 143 GLN A CD  1 
ATOM   2768 O OE1 . GLN B 1 125 ? 14.885  -28.030 60.194 1.00 21.94  ? 143 GLN A OE1 1 
ATOM   2769 N NE2 . GLN B 1 125 ? 15.662  -29.574 58.897 1.00 26.55  ? 143 GLN A NE2 1 
ATOM   2770 N N   . CYS B 1 126 ? 10.542  -26.273 56.258 1.00 22.79  ? 144 CYS A N   1 
ATOM   2771 C CA  . CYS B 1 126 ? 9.061   -26.402 56.023 1.00 23.36  ? 144 CYS A CA  1 
ATOM   2772 C C   . CYS B 1 126 ? 8.650   -25.855 54.650 1.00 23.87  ? 144 CYS A C   1 
ATOM   2773 O O   . CYS B 1 126 ? 7.616   -26.217 54.119 1.00 22.91  ? 144 CYS A O   1 
ATOM   2774 C CB  . CYS B 1 126 ? 8.316   -25.658 57.097 1.00 21.86  ? 144 CYS A CB  1 
ATOM   2775 S SG  . CYS B 1 126 ? 8.592   -26.411 58.712 1.00 21.99  ? 144 CYS A SG  1 
ATOM   2776 N N   . ALA B 1 127 ? 9.487   -25.001 54.080 1.00 22.52  ? 145 ALA A N   1 
ATOM   2777 C CA  . ALA B 1 127 ? 9.182   -24.355 52.858 1.00 25.01  ? 145 ALA A CA  1 
ATOM   2778 C C   . ALA B 1 127 ? 8.729   -25.280 51.683 1.00 24.35  ? 145 ALA A C   1 
ATOM   2779 O O   . ALA B 1 127 ? 7.776   -24.959 51.012 1.00 22.63  ? 145 ALA A O   1 
ATOM   2780 C CB  . ALA B 1 127 ? 10.318  -23.438 52.448 1.00 22.68  ? 145 ALA A CB  1 
ATOM   2781 N N   . ARG B 1 128 ? 9.389   -26.399 51.461 1.00 23.98  ? 146 ARG A N   1 
ATOM   2782 C CA  . ARG B 1 128 ? 9.038   -27.271 50.329 1.00 27.82  ? 146 ARG A CA  1 
ATOM   2783 C C   . ARG B 1 128 ? 7.676   -28.000 50.533 1.00 29.32  ? 146 ARG A C   1 
ATOM   2784 O O   . ARG B 1 128 ? 6.843   -27.932 49.637 1.00 28.90  ? 146 ARG A O   1 
ATOM   2785 C CB  . ARG B 1 128 ? 10.184  -28.248 49.999 1.00 33.37  ? 146 ARG A CB  1 
ATOM   2786 C CG  . ARG B 1 128 ? 11.298  -27.584 49.163 1.00 29.92  ? 146 ARG A CG  1 
ATOM   2787 C CD  . ARG B 1 128 ? 12.529  -28.477 48.968 1.00 27.85  ? 146 ARG A CD  1 
ATOM   2788 N NE  . ARG B 1 128 ? 12.286  -29.744 48.272 1.00 30.63  ? 146 ARG A NE  1 
ATOM   2789 C CZ  . ARG B 1 128 ? 12.094  -29.884 46.966 1.00 37.07  ? 146 ARG A CZ  1 
ATOM   2790 N NH1 . ARG B 1 128 ? 12.097  -28.829 46.152 1.00 41.66  ? 146 ARG A NH1 1 
ATOM   2791 N NH2 . ARG B 1 128 ? 11.867  -31.082 46.472 1.00 42.19  ? 146 ARG A NH2 1 
ATOM   2792 N N   . GLY B 1 129 ? 7.402   -28.568 51.724 1.00 21.89  ? 147 GLY A N   1 
ATOM   2793 C CA  . GLY B 1 129 ? 6.088   -29.161 51.967 1.00 23.11  ? 147 GLY A CA  1 
ATOM   2794 C C   . GLY B 1 129 ? 4.915   -28.186 52.059 1.00 22.44  ? 147 GLY A C   1 
ATOM   2795 O O   . GLY B 1 129 ? 3.904   -28.340 51.384 1.00 20.84  ? 147 GLY A O   1 
ATOM   2796 N N   . PHE B 1 130 ? 5.067   -27.136 52.879 1.00 20.16  ? 148 PHE A N   1 
ATOM   2797 C CA  . PHE B 1 130 ? 3.976   -26.237 53.279 1.00 18.97  ? 148 PHE A CA  1 
ATOM   2798 C C   . PHE B 1 130 ? 3.784   -25.104 52.290 1.00 23.33  ? 148 PHE A C   1 
ATOM   2799 O O   . PHE B 1 130 ? 2.716   -24.471 52.271 1.00 22.62  ? 148 PHE A O   1 
ATOM   2800 C CB  . PHE B 1 130 ? 4.328   -25.667 54.679 1.00 20.18  ? 148 PHE A CB  1 
ATOM   2801 C CG  . PHE B 1 130 ? 4.104   -26.656 55.816 1.00 18.76  ? 148 PHE A CG  1 
ATOM   2802 C CD1 . PHE B 1 130 ? 5.075   -27.607 56.147 1.00 21.47  ? 148 PHE A CD1 1 
ATOM   2803 C CD2 . PHE B 1 130 ? 2.889   -26.688 56.489 1.00 21.97  ? 148 PHE A CD2 1 
ATOM   2804 C CE1 . PHE B 1 130 ? 4.835   -28.564 57.131 1.00 25.87  ? 148 PHE A CE1 1 
ATOM   2805 C CE2 . PHE B 1 130 ? 2.646   -27.643 57.477 1.00 22.59  ? 148 PHE A CE2 1 
ATOM   2806 C CZ  . PHE B 1 130 ? 3.608   -28.596 57.798 1.00 23.53  ? 148 PHE A CZ  1 
ATOM   2807 N N   . GLY B 1 131 ? 4.821   -24.806 51.478 1.00 23.52  ? 149 GLY A N   1 
ATOM   2808 C CA  . GLY B 1 131 ? 4.859   -23.554 50.683 1.00 26.77  ? 149 GLY A CA  1 
ATOM   2809 C C   . GLY B 1 131 ? 4.913   -22.343 51.629 1.00 28.03  ? 149 GLY A C   1 
ATOM   2810 O O   . GLY B 1 131 ? 5.377   -22.434 52.774 1.00 29.95  ? 149 GLY A O   1 
ATOM   2811 N N   . ASP B 1 132 ? 4.308   -21.252 51.155 1.00 29.07  ? 150 ASP A N   1 
ATOM   2812 C CA  . ASP B 1 132 ? 4.152   -19.955 51.817 1.00 27.05  ? 150 ASP A CA  1 
ATOM   2813 C C   . ASP B 1 132 ? 3.393   -19.955 53.110 1.00 22.71  ? 150 ASP A C   1 
ATOM   2814 O O   . ASP B 1 132 ? 3.559   -19.069 53.908 1.00 22.02  ? 150 ASP A O   1 
ATOM   2815 C CB  . ASP B 1 132 ? 3.298   -19.051 50.893 1.00 34.29  ? 150 ASP A CB  1 
ATOM   2816 C CG  . ASP B 1 132 ? 4.058   -18.611 49.703 1.00 46.12  ? 150 ASP A CG  1 
ATOM   2817 O OD1 . ASP B 1 132 ? 3.459   -17.957 48.818 1.00 54.78  ? 150 ASP A OD1 1 
ATOM   2818 O OD2 . ASP B 1 132 ? 5.284   -18.929 49.666 1.00 46.87  ? 150 ASP A OD2 1 
ATOM   2819 N N   . TRP B 1 133 ? 2.478   -20.875 53.224 1.00 20.16  ? 151 TRP A N   1 
ATOM   2820 C CA  . TRP B 1 133 ? 1.613   -21.020 54.383 1.00 22.16  ? 151 TRP A CA  1 
ATOM   2821 C C   . TRP B 1 133 ? 2.387   -21.022 55.706 1.00 22.83  ? 151 TRP A C   1 
ATOM   2822 O O   . TRP B 1 133 ? 1.912   -20.491 56.686 1.00 19.20  ? 151 TRP A O   1 
ATOM   2823 C CB  . TRP B 1 133 ? 0.850   -22.327 54.248 1.00 20.74  ? 151 TRP A CB  1 
ATOM   2824 C CG  . TRP B 1 133 ? -0.242  -22.565 55.284 1.00 17.60  ? 151 TRP A CG  1 
ATOM   2825 C CD1 . TRP B 1 133 ? -1.039  -21.639 55.889 1.00 18.07  ? 151 TRP A CD1 1 
ATOM   2826 C CD2 . TRP B 1 133 ? -0.725  -23.843 55.732 1.00 17.54  ? 151 TRP A CD2 1 
ATOM   2827 N NE1 . TRP B 1 133 ? -1.936  -22.229 56.755 1.00 19.17  ? 151 TRP A NE1 1 
ATOM   2828 C CE2 . TRP B 1 133 ? -1.790  -23.573 56.701 1.00 18.15  ? 151 TRP A CE2 1 
ATOM   2829 C CE3 . TRP B 1 133 ? -0.362  -25.160 55.476 1.00 16.40  ? 151 TRP A CE3 1 
ATOM   2830 C CZ2 . TRP B 1 133 ? -2.478  -24.602 57.363 1.00 15.29  ? 151 TRP A CZ2 1 
ATOM   2831 C CZ3 . TRP B 1 133 ? -0.994  -26.176 56.209 1.00 17.62  ? 151 TRP A CZ3 1 
ATOM   2832 C CH2 . TRP B 1 133 ? -2.072  -25.905 57.110 1.00 15.95  ? 151 TRP A CH2 1 
ATOM   2833 N N   . ILE B 1 134 ? 3.535   -21.700 55.736 1.00 22.14  ? 152 ILE A N   1 
ATOM   2834 C CA  . ILE B 1 134 ? 4.323   -21.792 56.961 1.00 20.40  ? 152 ILE A CA  1 
ATOM   2835 C C   . ILE B 1 134 ? 4.869   -20.394 57.347 1.00 21.84  ? 152 ILE A C   1 
ATOM   2836 O O   . ILE B 1 134 ? 4.839   -19.987 58.531 1.00 19.42  ? 152 ILE A O   1 
ATOM   2837 C CB  . ILE B 1 134 ? 5.443   -22.894 56.894 1.00 22.43  ? 152 ILE A CB  1 
ATOM   2838 C CG1 . ILE B 1 134 ? 5.805   -23.334 58.318 1.00 19.22  ? 152 ILE A CG1 1 
ATOM   2839 C CG2 . ILE B 1 134 ? 6.650   -22.441 56.093 1.00 25.72  ? 152 ILE A CG2 1 
ATOM   2840 C CD1 . ILE B 1 134 ? 4.574   -24.063 58.890 1.00 19.33  ? 152 ILE A CD1 1 
ATOM   2841 N N   . ASP B 1 135 ? 5.302   -19.646 56.335 1.00 19.49  ? 153 ASP A N   1 
ATOM   2842 C CA  . ASP B 1 135 ? 5.733   -18.288 56.572 1.00 23.68  ? 153 ASP A CA  1 
ATOM   2843 C C   . ASP B 1 135 ? 4.591   -17.500 57.195 1.00 21.29  ? 153 ASP A C   1 
ATOM   2844 O O   . ASP B 1 135 ? 4.822   -16.740 58.132 1.00 22.08  ? 153 ASP A O   1 
ATOM   2845 C CB  . ASP B 1 135 ? 6.252   -17.559 55.298 1.00 20.77  ? 153 ASP A CB  1 
ATOM   2846 C CG  . ASP B 1 135 ? 7.340   -18.326 54.596 1.00 25.06  ? 153 ASP A CG  1 
ATOM   2847 O OD1 . ASP B 1 135 ? 8.075   -19.055 55.248 1.00 23.52  ? 153 ASP A OD1 1 
ATOM   2848 O OD2 . ASP B 1 135 ? 7.519   -18.199 53.374 1.00 27.10  ? 153 ASP A OD2 1 
ATOM   2849 N N   . SER B 1 136 ? 3.391   -17.605 56.628 1.00 19.55  ? 154 SER A N   1 
ATOM   2850 C CA  . SER B 1 136 ? 2.229   -16.874 57.134 1.00 17.99  ? 154 SER A CA  1 
ATOM   2851 C C   . SER B 1 136 ? 1.888   -17.340 58.554 1.00 17.92  ? 154 SER A C   1 
ATOM   2852 O O   . SER B 1 136 ? 1.458   -16.520 59.424 1.00 18.95  ? 154 SER A O   1 
ATOM   2853 C CB  . SER B 1 136 ? 1.009   -17.029 56.178 1.00 18.77  ? 154 SER A CB  1 
ATOM   2854 O OG  . SER B 1 136 ? 1.368   -16.492 54.930 1.00 22.31  ? 154 SER A OG  1 
ATOM   2855 N N   . ILE B 1 137 ? 2.088   -18.622 58.816 1.00 17.39  ? 155 ILE A N   1 
ATOM   2856 C CA  . ILE B 1 137 ? 1.783   -19.145 60.162 1.00 19.32  ? 155 ILE A CA  1 
ATOM   2857 C C   . ILE B 1 137 ? 2.762   -18.542 61.204 1.00 17.85  ? 155 ILE A C   1 
ATOM   2858 O O   . ILE B 1 137 ? 2.341   -18.144 62.284 1.00 18.22  ? 155 ILE A O   1 
ATOM   2859 C CB  . ILE B 1 137 ? 1.749   -20.680 60.177 1.00 20.13  ? 155 ILE A CB  1 
ATOM   2860 C CG1 . ILE B 1 137 ? 0.504   -21.223 59.435 1.00 19.55  ? 155 ILE A CG1 1 
ATOM   2861 C CG2 . ILE B 1 137 ? 1.851   -21.203 61.591 1.00 17.83  ? 155 ILE A CG2 1 
ATOM   2862 C CD1 . ILE B 1 137 ? 0.591   -22.736 59.232 1.00 18.87  ? 155 ILE A CD1 1 
ATOM   2863 N N   . LEU B 1 138 ? 4.031   -18.397 60.852 1.00 17.79  ? 156 LEU A N   1 
ATOM   2864 C CA  . LEU B 1 138 ? 4.981   -17.724 61.759 1.00 20.21  ? 156 LEU A CA  1 
ATOM   2865 C C   . LEU B 1 138 ? 4.688   -16.283 62.023 1.00 18.34  ? 156 LEU A C   1 
ATOM   2866 O O   . LEU B 1 138 ? 4.918   -15.820 63.123 1.00 21.90  ? 156 LEU A O   1 
ATOM   2867 C CB  . LEU B 1 138 ? 6.461   -17.834 61.285 1.00 18.28  ? 156 LEU A CB  1 
ATOM   2868 C CG  . LEU B 1 138 ? 7.182   -19.131 61.507 1.00 20.49  ? 156 LEU A CG  1 
ATOM   2869 C CD1 . LEU B 1 138 ? 8.549   -19.066 60.759 1.00 26.01  ? 156 LEU A CD1 1 
ATOM   2870 C CD2 . LEU B 1 138 ? 7.386   -19.448 62.983 1.00 17.88  ? 156 LEU A CD2 1 
ATOM   2871 N N   . ALA B 1 139 ? 4.226   -15.566 61.020 1.00 17.33  ? 157 ALA A N   1 
ATOM   2872 C CA  . ALA B 1 139 ? 3.734   -14.193 61.188 1.00 19.40  ? 157 ALA A CA  1 
ATOM   2873 C C   . ALA B 1 139 ? 2.573   -14.113 62.186 1.00 20.06  ? 157 ALA A C   1 
ATOM   2874 O O   . ALA B 1 139 ? 2.484   -13.206 63.053 1.00 19.33  ? 157 ALA A O   1 
ATOM   2875 C CB  . ALA B 1 139 ? 3.300   -13.588 59.849 1.00 18.02  ? 157 ALA A CB  1 
ATOM   2876 N N   . PHE B 1 140 ? 1.691   -15.090 62.094 1.00 20.50  ? 158 PHE A N   1 
ATOM   2877 C CA  . PHE B 1 140 ? 0.558   -15.122 63.040 1.00 18.93  ? 158 PHE A CA  1 
ATOM   2878 C C   . PHE B 1 140 ? 1.064   -15.562 64.459 1.00 20.49  ? 158 PHE A C   1 
ATOM   2879 O O   . PHE B 1 140 ? 0.592   -15.043 65.509 1.00 19.95  ? 158 PHE A O   1 
ATOM   2880 C CB  . PHE B 1 140 ? -0.520  -16.016 62.441 1.00 20.09  ? 158 PHE A CB  1 
ATOM   2881 C CG  . PHE B 1 140 ? -1.689  -16.212 63.332 1.00 20.96  ? 158 PHE A CG  1 
ATOM   2882 C CD1 . PHE B 1 140 ? -2.499  -15.149 63.617 1.00 21.67  ? 158 PHE A CD1 1 
ATOM   2883 C CD2 . PHE B 1 140 ? -1.887  -17.415 63.972 1.00 20.64  ? 158 PHE A CD2 1 
ATOM   2884 C CE1 . PHE B 1 140 ? -3.578  -15.291 64.506 1.00 28.41  ? 158 PHE A CE1 1 
ATOM   2885 C CE2 . PHE B 1 140 ? -2.917  -17.556 64.910 1.00 23.56  ? 158 PHE A CE2 1 
ATOM   2886 C CZ  . PHE B 1 140 ? -3.795  -16.490 65.155 1.00 24.35  ? 158 PHE A CZ  1 
ATOM   2887 N N   . SER B 1 141 ? 2.068   -16.460 64.510 1.00 21.91  ? 159 SER A N   1 
ATOM   2888 C CA  . SER B 1 141 ? 2.800   -16.703 65.768 1.00 20.52  ? 159 SER A CA  1 
ATOM   2889 C C   . SER B 1 141 ? 3.180   -15.359 66.419 1.00 21.47  ? 159 SER A C   1 
ATOM   2890 O O   . SER B 1 141 ? 2.840   -15.138 67.583 1.00 21.16  ? 159 SER A O   1 
ATOM   2891 C CB  . SER B 1 141 ? 4.032   -17.612 65.562 1.00 17.97  ? 159 SER A CB  1 
ATOM   2892 O OG  . SER B 1 141 ? 4.604   -17.986 66.836 1.00 19.42  ? 159 SER A OG  1 
ATOM   2893 N N   . ARG B 1 142 ? 3.893   -14.464 65.695 1.00 20.53  ? 160 ARG A N   1 
ATOM   2894 C CA  . ARG B 1 142 ? 4.333   -13.197 66.261 1.00 19.10  ? 160 ARG A CA  1 
ATOM   2895 C C   . ARG B 1 142 ? 3.097   -12.379 66.711 1.00 23.98  ? 160 ARG A C   1 
ATOM   2896 O O   . ARG B 1 142 ? 3.028   -11.825 67.844 1.00 21.54  ? 160 ARG A O   1 
ATOM   2897 C CB  . ARG B 1 142 ? 5.109   -12.369 65.218 1.00 20.75  ? 160 ARG A CB  1 
ATOM   2898 C CG  . ARG B 1 142 ? 6.304   -13.064 64.608 1.00 21.52  ? 160 ARG A CG  1 
ATOM   2899 C CD  . ARG B 1 142 ? 7.209   -12.220 63.686 1.00 20.88  ? 160 ARG A CD  1 
ATOM   2900 N NE  . ARG B 1 142 ? 8.280   -13.120 63.236 1.00 21.73  ? 160 ARG A NE  1 
ATOM   2901 C CZ  . ARG B 1 142 ? 8.278   -13.767 62.051 1.00 21.52  ? 160 ARG A CZ  1 
ATOM   2902 N NH1 . ARG B 1 142 ? 7.318   -13.533 61.137 1.00 21.28  ? 160 ARG A NH1 1 
ATOM   2903 N NH2 . ARG B 1 142 ? 9.234   -14.661 61.793 1.00 19.79  ? 160 ARG A NH2 1 
ATOM   2904 N N   . SER B 1 143 ? 2.123   -12.319 65.808 1.00 23.43  ? 161 SER A N   1 
ATOM   2905 C CA  . SER B 1 143 ? 0.867   -11.617 66.025 1.00 25.01  ? 161 SER A CA  1 
ATOM   2906 C C   . SER B 1 143 ? 0.221   -12.136 67.325 1.00 23.83  ? 161 SER A C   1 
ATOM   2907 O O   . SER B 1 143 ? -0.091  -11.355 68.240 1.00 27.00  ? 161 SER A O   1 
ATOM   2908 C CB  . SER B 1 143 ? -0.001  -11.777 64.774 1.00 27.49  ? 161 SER A CB  1 
ATOM   2909 O OG  . SER B 1 143 ? -1.229  -11.135 64.921 1.00 36.99  ? 161 SER A OG  1 
ATOM   2910 N N   . LEU B 1 144 ? 0.110   -13.440 67.470 1.00 20.38  ? 162 LEU A N   1 
ATOM   2911 C CA  . LEU B 1 144 ? -0.486  -14.014 68.664 1.00 22.92  ? 162 LEU A CA  1 
ATOM   2912 C C   . LEU B 1 144 ? 0.363   -13.755 69.906 1.00 24.39  ? 162 LEU A C   1 
ATOM   2913 O O   . LEU B 1 144 ? -0.195  -13.473 70.956 1.00 22.73  ? 162 LEU A O   1 
ATOM   2914 C CB  . LEU B 1 144 ? -0.594  -15.531 68.554 1.00 22.79  ? 162 LEU A CB  1 
ATOM   2915 C CG  . LEU B 1 144 ? -1.793  -16.359 68.991 1.00 29.37  ? 162 LEU A CG  1 
ATOM   2916 C CD1 . LEU B 1 144 ? -1.424  -17.854 69.086 1.00 23.06  ? 162 LEU A CD1 1 
ATOM   2917 C CD2 . LEU B 1 144 ? -2.548  -15.905 70.238 1.00 24.98  ? 162 LEU A CD2 1 
ATOM   2918 N N   . HIS B 1 145 ? 1.692   -13.892 69.787 1.00 21.14  ? 163 HIS A N   1 
ATOM   2919 C CA  . HIS B 1 145 ? 2.560   -13.782 70.967 1.00 25.03  ? 163 HIS A CA  1 
ATOM   2920 C C   . HIS B 1 145 ? 2.533   -12.368 71.522 1.00 23.97  ? 163 HIS A C   1 
ATOM   2921 O O   . HIS B 1 145 ? 2.746   -12.190 72.703 1.00 27.14  ? 163 HIS A O   1 
ATOM   2922 C CB  . HIS B 1 145 ? 4.044   -14.184 70.701 1.00 25.15  ? 163 HIS A CB  1 
ATOM   2923 C CG  . HIS B 1 145 ? 4.271   -15.681 70.494 1.00 27.14  ? 163 HIS A CG  1 
ATOM   2924 N ND1 . HIS B 1 145 ? 3.376   -16.620 70.850 1.00 30.54  ? 163 HIS A ND1 1 
ATOM   2925 C CD2 . HIS B 1 145 ? 5.344   -16.358 69.935 1.00 24.94  ? 163 HIS A CD2 1 
ATOM   2926 C CE1 . HIS B 1 145 ? 3.885   -17.842 70.557 1.00 26.85  ? 163 HIS A CE1 1 
ATOM   2927 N NE2 . HIS B 1 145 ? 5.073   -17.661 69.971 1.00 26.57  ? 163 HIS A NE2 1 
ATOM   2928 N N   . SER B 1 146 ? 2.301   -11.397 70.659 1.00 22.87  ? 164 SER A N   1 
ATOM   2929 C CA  . SER B 1 146 ? 2.267   -9.949  71.024 1.00 30.32  ? 164 SER A CA  1 
ATOM   2930 C C   . SER B 1 146 ? 1.122   -9.587  72.025 1.00 28.92  ? 164 SER A C   1 
ATOM   2931 O O   . SER B 1 146 ? 1.151   -8.578  72.724 1.00 29.96  ? 164 SER A O   1 
ATOM   2932 C CB  . SER B 1 146 ? 2.176   -9.106  69.723 1.00 28.47  ? 164 SER A CB  1 
ATOM   2933 O OG  . SER B 1 146 ? 0.809   -8.856  69.342 1.00 30.64  ? 164 SER A OG  1 
ATOM   2934 N N   . LEU B 1 147 ? 0.135   -10.450 72.089 1.00 26.86  ? 165 LEU A N   1 
ATOM   2935 C CA  . LEU B 1 147 ? -0.942  -10.333 73.039 1.00 30.84  ? 165 LEU A CA  1 
ATOM   2936 C C   . LEU B 1 147 ? -0.641  -10.932 74.380 1.00 30.03  ? 165 LEU A C   1 
ATOM   2937 O O   . LEU B 1 147 ? -1.360  -10.659 75.298 1.00 32.40  ? 165 LEU A O   1 
ATOM   2938 C CB  . LEU B 1 147 ? -2.187  -10.978 72.480 1.00 29.52  ? 165 LEU A CB  1 
ATOM   2939 C CG  . LEU B 1 147 ? -3.222  -10.011 71.846 1.00 33.12  ? 165 LEU A CG  1 
ATOM   2940 C CD1 . LEU B 1 147 ? -2.767  -8.568  71.549 1.00 30.50  ? 165 LEU A CD1 1 
ATOM   2941 C CD2 . LEU B 1 147 ? -3.818  -10.663 70.616 1.00 34.84  ? 165 LEU A CD2 1 
ATOM   2942 N N   . LEU B 1 148 ? 0.377   -11.775 74.480 1.00 29.00  ? 166 LEU A N   1 
ATOM   2943 C CA  . LEU B 1 148 ? 0.726   -12.392 75.749 1.00 31.65  ? 166 LEU A CA  1 
ATOM   2944 C C   . LEU B 1 148 ? -0.440  -13.166 76.417 1.00 32.00  ? 166 LEU A C   1 
ATOM   2945 O O   . LEU B 1 148 ? -0.739  -13.023 77.593 1.00 28.04  ? 166 LEU A O   1 
ATOM   2946 C CB  . LEU B 1 148 ? 1.346   -11.324 76.701 1.00 32.63  ? 166 LEU A CB  1 
ATOM   2947 C CG  . LEU B 1 148 ? 2.542   -10.621 76.064 1.00 31.98  ? 166 LEU A CG  1 
ATOM   2948 C CD1 . LEU B 1 148 ? 2.739   -9.247  76.678 1.00 39.19  ? 166 LEU A CD1 1 
ATOM   2949 C CD2 . LEU B 1 148 ? 3.781   -11.512 76.166 1.00 34.73  ? 166 LEU A CD2 1 
ATOM   2950 N N   . VAL B 1 149 ? -1.106  -13.990 75.629 1.00 34.37  ? 167 VAL A N   1 
ATOM   2951 C CA  . VAL B 1 149 ? -2.163  -14.879 76.114 1.00 28.84  ? 167 VAL A CA  1 
ATOM   2952 C C   . VAL B 1 149 ? -1.599  -15.936 77.056 1.00 25.59  ? 167 VAL A C   1 
ATOM   2953 O O   . VAL B 1 149 ? -0.877  -16.814 76.641 1.00 27.55  ? 167 VAL A O   1 
ATOM   2954 C CB  . VAL B 1 149 ? -2.870  -15.516 74.889 1.00 29.09  ? 167 VAL A CB  1 
ATOM   2955 C CG1 . VAL B 1 149 ? -3.900  -16.560 75.299 1.00 24.74  ? 167 VAL A CG1 1 
ATOM   2956 C CG2 . VAL B 1 149 ? -3.543  -14.399 74.070 1.00 31.93  ? 167 VAL A CG2 1 
ATOM   2957 N N   . ASP B 1 150 ? -1.935  -15.869 78.341 1.00 28.46  ? 168 ASP A N   1 
ATOM   2958 C CA  . ASP B 1 150 ? -1.443  -16.876 79.309 1.00 27.75  ? 168 ASP A CA  1 
ATOM   2959 C C   . ASP B 1 150 ? -1.987  -18.312 79.065 1.00 25.80  ? 168 ASP A C   1 
ATOM   2960 O O   . ASP B 1 150 ? -2.915  -18.512 78.289 1.00 23.27  ? 168 ASP A O   1 
ATOM   2961 C CB  . ASP B 1 150 ? -1.584  -16.369 80.783 1.00 27.66  ? 168 ASP A CB  1 
ATOM   2962 C CG  . ASP B 1 150 ? -3.030  -16.317 81.269 1.00 30.08  ? 168 ASP A CG  1 
ATOM   2963 O OD1 . ASP B 1 150 ? -3.362  -15.406 82.079 1.00 33.04  ? 168 ASP A OD1 1 
ATOM   2964 O OD2 . ASP B 1 150 ? -3.835  -17.202 80.886 1.00 29.64  ? 168 ASP A OD2 1 
ATOM   2965 N N   . VAL B 1 151 ? -1.421  -19.315 79.714 1.00 25.55  ? 169 VAL A N   1 
ATOM   2966 C CA  . VAL B 1 151 ? -1.817  -20.694 79.369 1.00 27.68  ? 169 VAL A CA  1 
ATOM   2967 C C   . VAL B 1 151 ? -3.283  -21.016 79.706 1.00 25.54  ? 169 VAL A C   1 
ATOM   2968 O O   . VAL B 1 151 ? -3.946  -21.689 78.930 1.00 23.56  ? 169 VAL A O   1 
ATOM   2969 C CB  . VAL B 1 151 ? -0.835  -21.757 79.955 1.00 28.32  ? 169 VAL A CB  1 
ATOM   2970 C CG1 . VAL B 1 151 ? -1.437  -23.180 79.956 1.00 25.68  ? 169 VAL A CG1 1 
ATOM   2971 C CG2 . VAL B 1 151 ? 0.494   -21.718 79.178 1.00 27.01  ? 169 VAL A CG2 1 
ATOM   2972 N N   . PRO B 1 152 ? -3.781  -20.575 80.898 1.00 25.54  ? 170 PRO A N   1 
ATOM   2973 C CA  . PRO B 1 152 ? -5.135  -21.018 81.206 1.00 22.49  ? 170 PRO A CA  1 
ATOM   2974 C C   . PRO B 1 152 ? -6.135  -20.335 80.258 1.00 21.66  ? 170 PRO A C   1 
ATOM   2975 O O   . PRO B 1 152 ? -7.129  -20.987 79.836 1.00 22.81  ? 170 PRO A O   1 
ATOM   2976 C CB  . PRO B 1 152 ? -5.310  -20.606 82.684 1.00 23.25  ? 170 PRO A CB  1 
ATOM   2977 C CG  . PRO B 1 152 ? -3.865  -20.731 83.249 1.00 23.68  ? 170 PRO A CG  1 
ATOM   2978 C CD  . PRO B 1 152 ? -3.105  -20.035 82.107 1.00 25.37  ? 170 PRO A CD  1 
ATOM   2979 N N   . ALA B 1 153 ? -5.810  -19.112 79.835 1.00 19.90  ? 171 ALA A N   1 
ATOM   2980 C CA  . ALA B 1 153 ? -6.652  -18.417 78.868 1.00 22.51  ? 171 ALA A CA  1 
ATOM   2981 C C   . ALA B 1 153 ? -6.676  -19.190 77.532 1.00 22.98  ? 171 ALA A C   1 
ATOM   2982 O O   . ALA B 1 153 ? -7.755  -19.346 76.915 1.00 24.77  ? 171 ALA A O   1 
ATOM   2983 C CB  . ALA B 1 153 ? -6.156  -17.005 78.645 1.00 18.79  ? 171 ALA A CB  1 
ATOM   2984 N N   . PHE B 1 154 ? -5.485  -19.678 77.128 1.00 23.88  ? 172 PHE A N   1 
ATOM   2985 C CA  . PHE B 1 154 ? -5.288  -20.342 75.844 1.00 23.79  ? 172 PHE A CA  1 
ATOM   2986 C C   . PHE B 1 154 ? -5.975  -21.672 75.872 1.00 22.01  ? 172 PHE A C   1 
ATOM   2987 O O   . PHE B 1 154 ? -6.669  -22.100 74.909 1.00 23.49  ? 172 PHE A O   1 
ATOM   2988 C CB  . PHE B 1 154 ? -3.779  -20.554 75.524 1.00 21.90  ? 172 PHE A CB  1 
ATOM   2989 C CG  . PHE B 1 154 ? -3.578  -21.148 74.125 1.00 19.20  ? 172 PHE A CG  1 
ATOM   2990 C CD1 . PHE B 1 154 ? -3.532  -20.299 73.017 1.00 19.00  ? 172 PHE A CD1 1 
ATOM   2991 C CD2 . PHE B 1 154 ? -3.583  -22.531 73.910 1.00 18.66  ? 172 PHE A CD2 1 
ATOM   2992 C CE1 . PHE B 1 154 ? -3.445  -20.803 71.714 1.00 16.34  ? 172 PHE A CE1 1 
ATOM   2993 C CE2 . PHE B 1 154 ? -3.484  -23.045 72.603 1.00 20.07  ? 172 PHE A CE2 1 
ATOM   2994 C CZ  . PHE B 1 154 ? -3.384  -22.169 71.501 1.00 16.04  ? 172 PHE A CZ  1 
ATOM   2995 N N   . ALA B 1 155 ? -5.826  -22.337 76.996 1.00 20.45  ? 173 ALA A N   1 
ATOM   2996 C CA  . ALA B 1 155 ? -6.531  -23.608 77.244 1.00 19.56  ? 173 ALA A CA  1 
ATOM   2997 C C   . ALA B 1 155 ? -8.041  -23.515 77.052 1.00 18.38  ? 173 ALA A C   1 
ATOM   2998 O O   . ALA B 1 155 ? -8.622  -24.405 76.399 1.00 17.90  ? 173 ALA A O   1 
ATOM   2999 C CB  . ALA B 1 155 ? -6.207  -24.149 78.619 1.00 18.45  ? 173 ALA A CB  1 
ATOM   3000 N N   . CYS B 1 156 ? -8.655  -22.431 77.572 1.00 19.83  ? 174 CYS A N   1 
ATOM   3001 C CA  . CYS B 1 156 ? -10.092 -22.141 77.348 1.00 20.57  ? 174 CYS A CA  1 
ATOM   3002 C C   . CYS B 1 156 ? -10.436 -21.750 75.894 1.00 19.98  ? 174 CYS A C   1 
ATOM   3003 O O   . CYS B 1 156 ? -11.424 -22.233 75.361 1.00 17.55  ? 174 CYS A O   1 
ATOM   3004 C CB  . CYS B 1 156 ? -10.555 -20.981 78.211 1.00 23.91  ? 174 CYS A CB  1 
ATOM   3005 S SG  . CYS B 1 156 ? -10.607 -21.383 80.004 1.00 27.92  ? 174 CYS A SG  1 
ATOM   3006 N N   . LEU B 1 157 ? -9.620  -20.847 75.301 1.00 19.26  ? 175 LEU A N   1 
ATOM   3007 C CA  . LEU B 1 157 ? -9.893  -20.309 73.979 1.00 21.31  ? 175 LEU A CA  1 
ATOM   3008 C C   . LEU B 1 157 ? -9.834  -21.399 72.903 1.00 19.54  ? 175 LEU A C   1 
ATOM   3009 O O   . LEU B 1 157 ? -10.669 -21.428 72.013 1.00 21.57  ? 175 LEU A O   1 
ATOM   3010 C CB  . LEU B 1 157 ? -8.922  -19.169 73.625 1.00 21.04  ? 175 LEU A CB  1 
ATOM   3011 C CG  . LEU B 1 157 ? -9.138  -17.849 74.377 1.00 26.83  ? 175 LEU A CG  1 
ATOM   3012 C CD1 . LEU B 1 157 ? -7.863  -16.981 74.375 1.00 29.06  ? 175 LEU A CD1 1 
ATOM   3013 C CD2 . LEU B 1 157 ? -10.366 -17.080 73.861 1.00 25.44  ? 175 LEU A CD2 1 
ATOM   3014 N N   . SER B 1 158 ? -8.847  -22.279 72.987 1.00 19.21  ? 176 SER A N   1 
ATOM   3015 C CA  . SER B 1 158 ? -8.659  -23.353 72.011 1.00 19.30  ? 176 SER A CA  1 
ATOM   3016 C C   . SER B 1 158 ? -9.836  -24.291 72.105 1.00 20.17  ? 176 SER A C   1 
ATOM   3017 O O   . SER B 1 158 ? -10.335 -24.803 71.070 1.00 19.56  ? 176 SER A O   1 
ATOM   3018 C CB  . SER B 1 158 ? -7.338  -24.110 72.203 1.00 18.41  ? 176 SER A CB  1 
ATOM   3019 O OG  . SER B 1 158 ? -7.113  -24.520 73.556 1.00 19.55  ? 176 SER A OG  1 
ATOM   3020 N N   . ALA B 1 159 ? -10.318 -24.507 73.342 1.00 21.28  ? 177 ALA A N   1 
ATOM   3021 C CA  . ALA B 1 159 ? -11.433 -25.403 73.540 1.00 18.12  ? 177 ALA A CA  1 
ATOM   3022 C C   . ALA B 1 159 ? -12.652 -24.779 72.965 1.00 18.87  ? 177 ALA A C   1 
ATOM   3023 O O   . ALA B 1 159 ? -13.472 -25.488 72.403 1.00 20.29  ? 177 ALA A O   1 
ATOM   3024 C CB  . ALA B 1 159 ? -11.648 -25.749 75.005 1.00 19.64  ? 177 ALA A CB  1 
ATOM   3025 N N   . LEU B 1 160 ? -12.798 -23.469 73.113 1.00 17.66  ? 178 LEU A N   1 
ATOM   3026 C CA  . LEU B 1 160 ? -13.933 -22.802 72.485 1.00 17.45  ? 178 LEU A CA  1 
ATOM   3027 C C   . LEU B 1 160 ? -13.880 -22.766 70.950 1.00 15.33  ? 178 LEU A C   1 
ATOM   3028 O O   . LEU B 1 160 ? -14.928 -22.617 70.278 1.00 14.00  ? 178 LEU A O   1 
ATOM   3029 C CB  . LEU B 1 160 ? -14.045 -21.351 72.997 1.00 17.89  ? 178 LEU A CB  1 
ATOM   3030 C CG  . LEU B 1 160 ? -14.646 -21.242 74.416 1.00 19.93  ? 178 LEU A CG  1 
ATOM   3031 C CD1 . LEU B 1 160 ? -14.127 -19.926 75.028 1.00 19.33  ? 178 LEU A CD1 1 
ATOM   3032 C CD2 . LEU B 1 160 ? -16.181 -21.365 74.441 1.00 23.35  ? 178 LEU A CD2 1 
ATOM   3033 N N   . VAL B 1 161 ? -12.690 -22.868 70.413 1.00 16.09  ? 179 VAL A N   1 
ATOM   3034 C CA  . VAL B 1 161 ? -12.537 -23.035 68.925 1.00 18.09  ? 179 VAL A CA  1 
ATOM   3035 C C   . VAL B 1 161 ? -13.223 -24.329 68.467 1.00 18.00  ? 179 VAL A C   1 
ATOM   3036 O O   . VAL B 1 161 ? -13.946 -24.345 67.506 1.00 21.35  ? 179 VAL A O   1 
ATOM   3037 C CB  . VAL B 1 161 ? -11.094 -22.953 68.446 1.00 18.63  ? 179 VAL A CB  1 
ATOM   3038 C CG1 . VAL B 1 161 ? -11.006 -23.305 66.948 1.00 23.17  ? 179 VAL A CG1 1 
ATOM   3039 C CG2 . VAL B 1 161 ? -10.564 -21.567 68.644 1.00 18.35  ? 179 VAL A CG2 1 
ATOM   3040 N N   . LEU B 1 162 ? -13.034 -25.370 69.232 1.00 16.97  ? 180 LEU A N   1 
ATOM   3041 C CA  . LEU B 1 162 ? -13.616 -26.698 68.999 1.00 17.52  ? 180 LEU A CA  1 
ATOM   3042 C C   . LEU B 1 162 ? -15.089 -26.744 69.392 1.00 16.22  ? 180 LEU A C   1 
ATOM   3043 O O   . LEU B 1 162 ? -15.924 -27.216 68.652 1.00 15.89  ? 180 LEU A O   1 
ATOM   3044 C CB  . LEU B 1 162 ? -12.875 -27.698 69.921 1.00 15.08  ? 180 LEU A CB  1 
ATOM   3045 C CG  . LEU B 1 162 ? -13.369 -29.108 69.933 1.00 16.19  ? 180 LEU A CG  1 
ATOM   3046 C CD1 . LEU B 1 162 ? -13.103 -29.839 68.631 1.00 16.67  ? 180 LEU A CD1 1 
ATOM   3047 C CD2 . LEU B 1 162 ? -12.849 -29.884 71.137 1.00 15.95  ? 180 LEU A CD2 1 
ATOM   3048 N N   . ILE B 1 163 ? -15.414 -26.235 70.565 1.00 16.75  ? 181 ILE A N   1 
ATOM   3049 C CA  . ILE B 1 163 ? -16.816 -26.388 71.030 1.00 17.88  ? 181 ILE A CA  1 
ATOM   3050 C C   . ILE B 1 163 ? -17.596 -25.155 70.621 1.00 16.44  ? 181 ILE A C   1 
ATOM   3051 O O   . ILE B 1 163 ? -17.594 -24.196 71.305 1.00 17.25  ? 181 ILE A O   1 
ATOM   3052 C CB  . ILE B 1 163 ? -16.856 -26.384 72.567 1.00 20.18  ? 181 ILE A CB  1 
ATOM   3053 C CG1 . ILE B 1 163 ? -15.727 -27.263 73.153 1.00 20.48  ? 181 ILE A CG1 1 
ATOM   3054 C CG2 . ILE B 1 163 ? -18.229 -26.767 73.071 1.00 16.75  ? 181 ILE A CG2 1 
ATOM   3055 C CD1 . ILE B 1 163 ? -15.915 -28.720 72.856 1.00 18.41  ? 181 ILE A CD1 1 
ATOM   3056 N N   . THR B 1 164 ? -18.303 -25.251 69.515 1.00 17.91  ? 182 THR A N   1 
ATOM   3057 C CA  . THR B 1 164 ? -18.940 -24.164 68.862 1.00 18.41  ? 182 THR A CA  1 
ATOM   3058 C C   . THR B 1 164 ? -20.122 -24.699 67.967 1.00 19.02  ? 182 THR A C   1 
ATOM   3059 O O   . THR B 1 164 ? -20.164 -25.860 67.615 1.00 18.75  ? 182 THR A O   1 
ATOM   3060 C CB  . THR B 1 164 ? -17.898 -23.389 68.021 1.00 18.04  ? 182 THR A CB  1 
ATOM   3061 O OG1 . THR B 1 164 ? -18.453 -22.138 67.681 1.00 15.22  ? 182 THR A OG1 1 
ATOM   3062 C CG2 . THR B 1 164 ? -17.529 -24.148 66.719 1.00 19.16  ? 182 THR A CG2 1 
ATOM   3063 N N   . ASP B 1 165 ? -21.069 -23.845 67.614 1.00 17.77  ? 183 ASP A N   1 
ATOM   3064 C CA  . ASP B 1 165 ? -22.061 -24.229 66.591 1.00 20.07  ? 183 ASP A CA  1 
ATOM   3065 C C   . ASP B 1 165 ? -21.392 -24.717 65.287 1.00 17.78  ? 183 ASP A C   1 
ATOM   3066 O O   . ASP B 1 165 ? -20.430 -24.092 64.858 1.00 17.27  ? 183 ASP A O   1 
ATOM   3067 C CB  . ASP B 1 165 ? -22.955 -23.016 66.285 1.00 18.43  ? 183 ASP A CB  1 
ATOM   3068 C CG  . ASP B 1 165 ? -23.852 -22.712 67.453 1.00 19.94  ? 183 ASP A CG  1 
ATOM   3069 O OD1 . ASP B 1 165 ? -23.816 -21.579 67.977 1.00 23.82  ? 183 ASP A OD1 1 
ATOM   3070 O OD2 . ASP B 1 165 ? -24.629 -23.622 67.869 1.00 21.47  ? 183 ASP A OD2 1 
ATOM   3071 N N   . ARG B 1 166 ? -21.880 -25.845 64.742 1.00 17.47  ? 184 ARG A N   1 
ATOM   3072 C CA  . ARG B 1 166 ? -21.564 -26.274 63.373 1.00 19.06  ? 184 ARG A CA  1 
ATOM   3073 C C   . ARG B 1 166 ? -22.858 -26.795 62.699 1.00 21.49  ? 184 ARG A C   1 
ATOM   3074 O O   . ARG B 1 166 ? -23.697 -27.494 63.327 1.00 19.40  ? 184 ARG A O   1 
ATOM   3075 C CB  . ARG B 1 166 ? -20.629 -27.467 63.350 1.00 18.05  ? 184 ARG A CB  1 
ATOM   3076 C CG  . ARG B 1 166 ? -19.258 -27.199 63.964 1.00 19.62  ? 184 ARG A CG  1 
ATOM   3077 C CD  . ARG B 1 166 ? -18.512 -26.109 63.169 1.00 17.23  ? 184 ARG A CD  1 
ATOM   3078 N NE  . ARG B 1 166 ? -17.223 -25.863 63.846 1.00 19.10  ? 184 ARG A NE  1 
ATOM   3079 C CZ  . ARG B 1 166 ? -16.329 -24.980 63.424 1.00 23.22  ? 184 ARG A CZ  1 
ATOM   3080 N NH1 . ARG B 1 166 ? -16.581 -24.263 62.279 1.00 20.78  ? 184 ARG A NH1 1 
ATOM   3081 N NH2 . ARG B 1 166 ? -15.173 -24.814 64.102 1.00 20.29  ? 184 ARG A NH2 1 
ATOM   3082 N N   . HIS B 1 167 ? -23.010 -26.466 61.430 1.00 17.90  ? 185 HIS A N   1 
ATOM   3083 C CA  . HIS B 1 167 ? -24.108 -27.049 60.671 1.00 21.00  ? 185 HIS A CA  1 
ATOM   3084 C C   . HIS B 1 167 ? -23.974 -28.547 60.681 1.00 20.73  ? 185 HIS A C   1 
ATOM   3085 O O   . HIS B 1 167 ? -22.869 -29.063 60.449 1.00 19.66  ? 185 HIS A O   1 
ATOM   3086 C CB  . HIS B 1 167 ? -24.092 -26.466 59.269 1.00 22.18  ? 185 HIS A CB  1 
ATOM   3087 C CG  . HIS B 1 167 ? -25.139 -27.061 58.411 1.00 29.40  ? 185 HIS A CG  1 
ATOM   3088 N ND1 . HIS B 1 167 ? -26.411 -26.594 58.387 1.00 30.38  ? 185 HIS A ND1 1 
ATOM   3089 C CD2 . HIS B 1 167 ? -25.092 -28.163 57.567 1.00 28.37  ? 185 HIS A CD2 1 
ATOM   3090 C CE1 . HIS B 1 167 ? -27.121 -27.347 57.546 1.00 33.28  ? 185 HIS A CE1 1 
ATOM   3091 N NE2 . HIS B 1 167 ? -26.298 -28.312 57.043 1.00 30.85  ? 185 HIS A NE2 1 
ATOM   3092 N N   . GLY B 1 168 ? -25.054 -29.258 61.054 1.00 21.94  ? 186 GLY A N   1 
ATOM   3093 C CA  . GLY B 1 168 ? -25.077 -30.753 61.124 1.00 20.25  ? 186 GLY A CA  1 
ATOM   3094 C C   . GLY B 1 168 ? -24.967 -31.419 62.493 1.00 20.57  ? 186 GLY A C   1 
ATOM   3095 O O   . GLY B 1 168 ? -25.036 -32.642 62.625 1.00 22.55  ? 186 GLY A O   1 
ATOM   3096 N N   . LEU B 1 169 ? -24.751 -30.643 63.536 1.00 19.74  ? 187 LEU A N   1 
ATOM   3097 C CA  . LEU B 1 169 ? -24.683 -31.222 64.860 1.00 21.39  ? 187 LEU A CA  1 
ATOM   3098 C C   . LEU B 1 169 ? -26.034 -31.922 65.151 1.00 23.94  ? 187 LEU A C   1 
ATOM   3099 O O   . LEU B 1 169 ? -27.097 -31.378 64.781 1.00 23.52  ? 187 LEU A O   1 
ATOM   3100 C CB  . LEU B 1 169 ? -24.422 -30.095 65.869 1.00 18.45  ? 187 LEU A CB  1 
ATOM   3101 C CG  . LEU B 1 169 ? -22.962 -29.652 66.019 1.00 15.05  ? 187 LEU A CG  1 
ATOM   3102 C CD1 . LEU B 1 169 ? -22.938 -28.444 66.929 1.00 14.71  ? 187 LEU A CD1 1 
ATOM   3103 C CD2 . LEU B 1 169 ? -22.076 -30.868 66.441 1.00 14.27  ? 187 LEU A CD2 1 
ATOM   3104 N N   . GLN B 1 170 ? -26.000 -33.102 65.774 1.00 24.81  ? 188 GLN A N   1 
ATOM   3105 C CA  . GLN B 1 170 ? -27.279 -33.756 66.240 1.00 22.61  ? 188 GLN A CA  1 
ATOM   3106 C C   . GLN B 1 170 ? -27.817 -33.030 67.495 1.00 23.69  ? 188 GLN A C   1 
ATOM   3107 O O   . GLN B 1 170 ? -29.049 -32.862 67.671 1.00 22.80  ? 188 GLN A O   1 
ATOM   3108 C CB  . GLN B 1 170 ? -27.028 -35.217 66.545 1.00 24.64  ? 188 GLN A CB  1 
ATOM   3109 C CG  . GLN B 1 170 ? -26.389 -35.893 65.338 1.00 25.35  ? 188 GLN A CG  1 
ATOM   3110 C CD  . GLN B 1 170 ? -26.148 -37.377 65.470 1.00 28.22  ? 188 GLN A CD  1 
ATOM   3111 O OE1 . GLN B 1 170 ? -26.510 -38.142 64.573 1.00 32.13  ? 188 GLN A OE1 1 
ATOM   3112 N NE2 . GLN B 1 170 ? -25.476 -37.782 66.509 1.00 22.90  ? 188 GLN A NE2 1 
ATOM   3113 N N   . GLU B 1 171 ? -26.909 -32.584 68.347 1.00 19.05  ? 189 GLU A N   1 
ATOM   3114 C CA  . GLU B 1 171 ? -27.304 -31.958 69.632 1.00 21.60  ? 189 GLU A CA  1 
ATOM   3115 C C   . GLU B 1 171 ? -26.662 -30.595 69.835 1.00 18.84  ? 189 GLU A C   1 
ATOM   3116 O O   . GLU B 1 171 ? -25.873 -30.391 70.764 1.00 18.64  ? 189 GLU A O   1 
ATOM   3117 C CB  . GLU B 1 171 ? -26.995 -32.900 70.814 1.00 20.31  ? 189 GLU A CB  1 
ATOM   3118 C CG  . GLU B 1 171 ? -27.480 -34.299 70.529 1.00 24.08  ? 189 GLU A CG  1 
ATOM   3119 C CD  . GLU B 1 171 ? -27.491 -35.197 71.761 1.00 28.41  ? 189 GLU A CD  1 
ATOM   3120 O OE1 . GLU B 1 171 ? -26.420 -35.783 72.124 1.00 25.55  ? 189 GLU A OE1 1 
ATOM   3121 O OE2 . GLU B 1 171 ? -28.589 -35.314 72.366 1.00 29.37  ? 189 GLU A OE2 1 
ATOM   3122 N N   . PRO B 1 172 ? -27.003 -29.658 68.955 1.00 20.48  ? 190 PRO A N   1 
ATOM   3123 C CA  . PRO B 1 172 ? -26.424 -28.336 69.092 1.00 20.72  ? 190 PRO A CA  1 
ATOM   3124 C C   . PRO B 1 172 ? -26.617 -27.710 70.476 1.00 23.84  ? 190 PRO A C   1 
ATOM   3125 O O   . PRO B 1 172 ? -25.747 -26.950 70.900 1.00 24.32  ? 190 PRO A O   1 
ATOM   3126 C CB  . PRO B 1 172 ? -27.186 -27.516 68.003 1.00 21.40  ? 190 PRO A CB  1 
ATOM   3127 C CG  . PRO B 1 172 ? -28.461 -28.292 67.707 1.00 16.89  ? 190 PRO A CG  1 
ATOM   3128 C CD  . PRO B 1 172 ? -28.061 -29.719 67.898 1.00 17.60  ? 190 PRO A CD  1 
ATOM   3129 N N   . ARG B 1 173 ? -27.714 -27.970 71.200 1.00 24.00  ? 191 ARG A N   1 
ATOM   3130 C CA  . ARG B 1 173 ? -27.879 -27.266 72.482 1.00 24.22  ? 191 ARG A CA  1 
ATOM   3131 C C   . ARG B 1 173 ? -26.952 -27.763 73.584 1.00 24.76  ? 191 ARG A C   1 
ATOM   3132 O O   . ARG B 1 173 ? -26.582 -26.984 74.491 1.00 23.82  ? 191 ARG A O   1 
ATOM   3133 C CB  . ARG B 1 173 ? -29.320 -27.306 73.006 1.00 25.96  ? 191 ARG A CB  1 
ATOM   3134 C CG  . ARG B 1 173 ? -30.417 -27.033 71.993 1.00 30.82  ? 191 ARG A CG  1 
ATOM   3135 C CD  . ARG B 1 173 ? -30.878 -25.600 71.941 1.00 29.12  ? 191 ARG A CD  1 
ATOM   3136 N NE  . ARG B 1 173 ? -31.236 -24.898 73.185 1.00 28.31  ? 191 ARG A NE  1 
ATOM   3137 C CZ  . ARG B 1 173 ? -32.464 -24.550 73.576 1.00 30.37  ? 191 ARG A CZ  1 
ATOM   3138 N NH1 . ARG B 1 173 ? -32.613 -23.834 74.672 1.00 31.17  ? 191 ARG A NH1 1 
ATOM   3139 N NH2 . ARG B 1 173 ? -33.554 -24.900 72.895 1.00 34.52  ? 191 ARG A NH2 1 
ATOM   3140 N N   . ARG B 1 174 ? -26.646 -29.083 73.543 1.00 20.04  ? 192 ARG A N   1 
ATOM   3141 C CA  . ARG B 1 174 ? -25.647 -29.675 74.399 1.00 20.00  ? 192 ARG A CA  1 
ATOM   3142 C C   . ARG B 1 174 ? -24.333 -29.045 74.074 1.00 18.75  ? 192 ARG A C   1 
ATOM   3143 O O   . ARG B 1 174 ? -23.573 -28.812 74.936 1.00 17.26  ? 192 ARG A O   1 
ATOM   3144 C CB  . ARG B 1 174 ? -25.535 -31.192 74.143 1.00 18.62  ? 192 ARG A CB  1 
ATOM   3145 C CG  . ARG B 1 174 ? -26.790 -31.964 74.589 1.00 18.73  ? 192 ARG A CG  1 
ATOM   3146 C CD  . ARG B 1 174 ? -26.428 -33.438 74.537 1.00 22.95  ? 192 ARG A CD  1 
ATOM   3147 N NE  . ARG B 1 174 ? -25.473 -33.913 75.545 1.00 23.61  ? 192 ARG A NE  1 
ATOM   3148 C CZ  . ARG B 1 174 ? -24.741 -35.046 75.430 1.00 21.15  ? 192 ARG A CZ  1 
ATOM   3149 N NH1 . ARG B 1 174 ? -23.922 -35.448 76.418 1.00 16.33  ? 192 ARG A NH1 1 
ATOM   3150 N NH2 . ARG B 1 174 ? -24.817 -35.770 74.339 1.00 18.95  ? 192 ARG A NH2 1 
ATOM   3151 N N   . VAL B 1 175 ? -24.058 -28.792 72.802 1.00 19.16  ? 193 VAL A N   1 
ATOM   3152 C CA  . VAL B 1 175 ? -22.748 -28.167 72.445 1.00 18.57  ? 193 VAL A CA  1 
ATOM   3153 C C   . VAL B 1 175 ? -22.704 -26.735 72.950 1.00 20.07  ? 193 VAL A C   1 
ATOM   3154 O O   . VAL B 1 175 ? -21.700 -26.371 73.498 1.00 21.96  ? 193 VAL A O   1 
ATOM   3155 C CB  . VAL B 1 175 ? -22.431 -28.211 70.964 1.00 17.71  ? 193 VAL A CB  1 
ATOM   3156 C CG1 . VAL B 1 175 ? -21.074 -27.490 70.670 1.00 19.40  ? 193 VAL A CG1 1 
ATOM   3157 C CG2 . VAL B 1 175 ? -22.389 -29.668 70.516 1.00 16.98  ? 193 VAL A CG2 1 
ATOM   3158 N N   . GLU B 1 176 ? -23.785 -25.949 72.745 1.00 18.62  ? 194 GLU A N   1 
ATOM   3159 C CA  . GLU B 1 176 ? -23.906 -24.599 73.272 1.00 21.51  ? 194 GLU A CA  1 
ATOM   3160 C C   . GLU B 1 176 ? -23.783 -24.498 74.807 1.00 23.77  ? 194 GLU A C   1 
ATOM   3161 O O   . GLU B 1 176 ? -23.133 -23.604 75.335 1.00 23.34  ? 194 GLU A O   1 
ATOM   3162 C CB  . GLU B 1 176 ? -25.162 -23.906 72.758 1.00 19.84  ? 194 GLU A CB  1 
ATOM   3163 C CG  . GLU B 1 176 ? -25.111 -23.702 71.213 1.00 21.06  ? 194 GLU A CG  1 
ATOM   3164 C CD  . GLU B 1 176 ? -26.426 -23.262 70.610 1.00 21.67  ? 194 GLU A CD  1 
ATOM   3165 O OE1 . GLU B 1 176 ? -26.502 -22.936 69.342 1.00 20.12  ? 194 GLU A OE1 1 
ATOM   3166 O OE2 . GLU B 1 176 ? -27.389 -23.175 71.439 1.00 20.14  ? 194 GLU A OE2 1 
ATOM   3167 N N   . GLU B 1 177 ? -24.384 -25.456 75.498 1.00 27.47  ? 195 GLU A N   1 
ATOM   3168 C CA  . GLU B 1 177 ? -24.280 -25.542 76.953 1.00 26.34  ? 195 GLU A CA  1 
ATOM   3169 C C   . GLU B 1 177 ? -22.825 -25.670 77.362 1.00 28.90  ? 195 GLU A C   1 
ATOM   3170 O O   . GLU B 1 177 ? -22.388 -24.992 78.278 1.00 27.90  ? 195 GLU A O   1 
ATOM   3171 C CB  . GLU B 1 177 ? -25.070 -26.773 77.455 1.00 24.95  ? 195 GLU A CB  1 
ATOM   3172 C CG  . GLU B 1 177 ? -24.744 -27.169 78.903 1.00 28.58  ? 195 GLU A CG  1 
ATOM   3173 C CD  . GLU B 1 177 ? -25.010 -26.041 79.891 1.00 32.36  ? 195 GLU A CD  1 
ATOM   3174 O OE1 . GLU B 1 177 ? -24.337 -26.043 80.940 1.00 36.65  ? 195 GLU A OE1 1 
ATOM   3175 O OE2 . GLU B 1 177 ? -25.849 -25.114 79.637 1.00 31.78  ? 195 GLU A OE2 1 
ATOM   3176 N N   . LEU B 1 178 ? -22.088 -26.588 76.715 1.00 24.37  ? 196 LEU A N   1 
ATOM   3177 C CA  . LEU B 1 178 ? -20.671 -26.751 76.997 1.00 23.82  ? 196 LEU A CA  1 
ATOM   3178 C C   . LEU B 1 178 ? -19.875 -25.452 76.599 1.00 21.90  ? 196 LEU A C   1 
ATOM   3179 O O   . LEU B 1 178 ? -18.947 -24.995 77.265 1.00 19.09  ? 196 LEU A O   1 
ATOM   3180 C CB  . LEU B 1 178 ? -20.144 -28.062 76.293 1.00 21.40  ? 196 LEU A CB  1 
ATOM   3181 C CG  . LEU B 1 178 ? -18.705 -28.486 76.626 1.00 25.38  ? 196 LEU A CG  1 
ATOM   3182 C CD1 . LEU B 1 178 ? -18.606 -28.758 78.133 1.00 24.16  ? 196 LEU A CD1 1 
ATOM   3183 C CD2 . LEU B 1 178 ? -18.213 -29.725 75.867 1.00 24.14  ? 196 LEU A CD2 1 
ATOM   3184 N N   . GLN B 1 179 ? -20.292 -24.784 75.541 1.00 24.33  ? 197 GLN A N   1 
ATOM   3185 C CA  . GLN B 1 179 ? -19.657 -23.475 75.153 1.00 23.01  ? 197 GLN A CA  1 
ATOM   3186 C C   . GLN B 1 179 ? -19.901 -22.419 76.257 1.00 23.83  ? 197 GLN A C   1 
ATOM   3187 O O   . GLN B 1 179 ? -19.013 -21.554 76.552 1.00 23.84  ? 197 GLN A O   1 
ATOM   3188 C CB  . GLN B 1 179 ? -20.332 -22.958 73.832 1.00 22.99  ? 197 GLN A CB  1 
ATOM   3189 C CG  . GLN B 1 179 ? -19.737 -21.714 73.160 1.00 20.35  ? 197 GLN A CG  1 
ATOM   3190 C CD  . GLN B 1 179 ? -20.564 -21.324 71.941 1.00 24.14  ? 197 GLN A CD  1 
ATOM   3191 O OE1 . GLN B 1 179 ? -21.799 -21.132 72.052 1.00 23.48  ? 197 GLN A OE1 1 
ATOM   3192 N NE2 . GLN B 1 179 ? -19.931 -21.209 70.780 1.00 21.98  ? 197 GLN A NE2 1 
ATOM   3193 N N   . ASN B 1 180 ? -21.117 -22.437 76.815 1.00 18.71  ? 198 ASN A N   1 
ATOM   3194 C CA  . ASN B 1 180 ? -21.406 -21.508 77.925 1.00 21.58  ? 198 ASN A CA  1 
ATOM   3195 C C   . ASN B 1 180 ? -20.467 -21.789 79.080 1.00 20.68  ? 198 ASN A C   1 
ATOM   3196 O O   . ASN B 1 180 ? -19.928 -20.875 79.659 1.00 21.76  ? 198 ASN A O   1 
ATOM   3197 C CB  . ASN B 1 180 ? -22.870 -21.669 78.446 1.00 22.45  ? 198 ASN A CB  1 
ATOM   3198 C CG  . ASN B 1 180 ? -23.928 -21.044 77.538 1.00 23.90  ? 198 ASN A CG  1 
ATOM   3199 O OD1 . ASN B 1 180 ? -23.632 -20.280 76.622 1.00 22.20  ? 198 ASN A OD1 1 
ATOM   3200 N ND2 . ASN B 1 180 ? -25.193 -21.342 77.829 1.00 21.40  ? 198 ASN A ND2 1 
ATOM   3201 N N   . ARG B 1 181 ? -20.334 -23.066 79.473 1.00 24.35  ? 199 ARG A N   1 
ATOM   3202 C CA  . ARG B 1 181 ? -19.493 -23.437 80.675 1.00 25.98  ? 199 ARG A CA  1 
ATOM   3203 C C   . ARG B 1 181 ? -18.047 -23.008 80.472 1.00 25.52  ? 199 ARG A C   1 
ATOM   3204 O O   . ARG B 1 181 ? -17.382 -22.457 81.359 1.00 26.56  ? 199 ARG A O   1 
ATOM   3205 C CB  . ARG B 1 181 ? -19.521 -24.964 80.893 1.00 24.42  ? 199 ARG A CB  1 
ATOM   3206 C CG  . ARG B 1 181 ? -20.866 -25.568 81.324 1.00 27.17  ? 199 ARG A CG  1 
ATOM   3207 C CD  . ARG B 1 181 ? -20.767 -27.095 81.314 1.00 29.06  ? 199 ARG A CD  1 
ATOM   3208 N NE  . ARG B 1 181 ? -22.070 -27.741 81.252 1.00 36.26  ? 199 ARG A NE  1 
ATOM   3209 C CZ  . ARG B 1 181 ? -22.277 -29.067 81.334 1.00 43.66  ? 199 ARG A CZ  1 
ATOM   3210 N NH1 . ARG B 1 181 ? -23.527 -29.568 81.284 1.00 36.28  ? 199 ARG A NH1 1 
ATOM   3211 N NH2 . ARG B 1 181 ? -21.233 -29.901 81.505 1.00 38.47  ? 199 ARG A NH2 1 
ATOM   3212 N N   . ILE B 1 182 ? -17.530 -23.277 79.277 1.00 23.06  ? 200 ILE A N   1 
ATOM   3213 C CA  . ILE B 1 182 ? -16.135 -22.885 78.959 1.00 22.47  ? 200 ILE A CA  1 
ATOM   3214 C C   . ILE B 1 182 ? -15.960 -21.327 78.924 1.00 21.02  ? 200 ILE A C   1 
ATOM   3215 O O   . ILE B 1 182 ? -15.027 -20.819 79.491 1.00 20.63  ? 200 ILE A O   1 
ATOM   3216 C CB  . ILE B 1 182 ? -15.525 -23.611 77.679 1.00 21.13  ? 200 ILE A CB  1 
ATOM   3217 C CG1 . ILE B 1 182 ? -15.486 -25.157 77.915 1.00 22.41  ? 200 ILE A CG1 1 
ATOM   3218 C CG2 . ILE B 1 182 ? -14.053 -23.150 77.492 1.00 21.10  ? 200 ILE A CG2 1 
ATOM   3219 C CD1 . ILE B 1 182 ? -15.442 -26.049 76.666 1.00 25.56  ? 200 ILE A CD1 1 
ATOM   3220 N N   . ALA B 1 183 ? -16.840 -20.581 78.250 1.00 22.98  ? 201 ALA A N   1 
ATOM   3221 C CA  . ALA B 1 183 ? -16.830 -19.114 78.335 1.00 24.02  ? 201 ALA A CA  1 
ATOM   3222 C C   . ALA B 1 183 ? -16.881 -18.526 79.821 1.00 25.47  ? 201 ALA A C   1 
ATOM   3223 O O   . ALA B 1 183 ? -16.175 -17.544 80.182 1.00 24.17  ? 201 ALA A O   1 
ATOM   3224 C CB  . ALA B 1 183 ? -18.008 -18.554 77.542 1.00 26.34  ? 201 ALA A CB  1 
ATOM   3225 N N   . SER B 1 184 ? -17.779 -19.071 80.630 1.00 25.33  ? 202 SER A N   1 
ATOM   3226 C CA  . SER B 1 184 ? -17.833 -18.664 82.058 1.00 27.99  ? 202 SER A CA  1 
ATOM   3227 C C   . SER B 1 184 ? -16.535 -18.939 82.760 1.00 26.97  ? 202 SER A C   1 
ATOM   3228 O O   . SER B 1 184 ? -16.141 -18.164 83.595 1.00 30.73  ? 202 SER A O   1 
ATOM   3229 C CB  . SER B 1 184 ? -18.921 -19.416 82.831 1.00 26.49  ? 202 SER A CB  1 
ATOM   3230 O OG  . SER B 1 184 ? -20.207 -19.044 82.338 1.00 29.67  ? 202 SER A OG  1 
ATOM   3231 N N   . CYS B 1 185 ? -15.934 -20.085 82.463 1.00 27.32  ? 203 CYS A N   1 
ATOM   3232 C CA  . CYS B 1 185 ? -14.674 -20.507 83.058 1.00 30.98  ? 203 CYS A CA  1 
ATOM   3233 C C   . CYS B 1 185 ? -13.602 -19.515 82.617 1.00 33.18  ? 203 CYS A C   1 
ATOM   3234 O O   . CYS B 1 185 ? -12.739 -19.096 83.409 1.00 31.62  ? 203 CYS A O   1 
ATOM   3235 C CB  . CYS B 1 185 ? -14.314 -21.924 82.559 1.00 30.53  ? 203 CYS A CB  1 
ATOM   3236 S SG  . CYS B 1 185 ? -12.772 -22.621 83.211 1.00 36.20  ? 203 CYS A SG  1 
ATOM   3237 N N   . LEU B 1 186 ? -13.665 -19.102 81.358 1.00 29.31  ? 204 LEU A N   1 
ATOM   3238 C CA  . LEU B 1 186 ? -12.677 -18.136 80.897 1.00 29.69  ? 204 LEU A CA  1 
ATOM   3239 C C   . LEU B 1 186 ? -12.858 -16.780 81.577 1.00 30.38  ? 204 LEU A C   1 
ATOM   3240 O O   . LEU B 1 186 ? -11.894 -16.172 82.037 1.00 30.19  ? 204 LEU A O   1 
ATOM   3241 C CB  . LEU B 1 186 ? -12.659 -18.001 79.363 1.00 23.16  ? 204 LEU A CB  1 
ATOM   3242 C CG  . LEU B 1 186 ? -11.720 -16.918 78.765 1.00 26.80  ? 204 LEU A CG  1 
ATOM   3243 C CD1 . LEU B 1 186 ? -10.201 -17.154 79.008 1.00 23.55  ? 204 LEU A CD1 1 
ATOM   3244 C CD2 . LEU B 1 186 ? -11.965 -16.767 77.264 1.00 24.60  ? 204 LEU A CD2 1 
ATOM   3245 N N   . LYS B 1 187 ? -14.079 -16.286 81.612 1.00 34.73  ? 205 LYS A N   1 
ATOM   3246 C CA  . LYS B 1 187 ? -14.366 -14.984 82.258 1.00 35.85  ? 205 LYS A CA  1 
ATOM   3247 C C   . LYS B 1 187 ? -13.841 -14.938 83.731 1.00 36.76  ? 205 LYS A C   1 
ATOM   3248 O O   . LYS B 1 187 ? -13.154 -13.994 84.154 1.00 38.63  ? 205 LYS A O   1 
ATOM   3249 C CB  . LYS B 1 187 ? -15.869 -14.728 82.175 1.00 33.36  ? 205 LYS A CB  1 
ATOM   3250 C CG  . LYS B 1 187 ? -16.306 -13.294 82.461 1.00 42.87  ? 205 LYS A CG  1 
ATOM   3251 C CD  . LYS B 1 187 ? -17.802 -13.221 82.809 1.00 42.12  ? 205 LYS A CD  1 
ATOM   3252 C CE  . LYS B 1 187 ? -18.275 -11.810 83.201 1.00 47.30  ? 205 LYS A CE  1 
ATOM   3253 N NZ  . LYS B 1 187 ? -18.518 -10.832 82.097 1.00 43.13  ? 205 LYS A NZ  1 
ATOM   3254 N N   . GLU B 1 188 ? -14.145 -15.976 84.487 1.00 32.86  ? 206 GLU A N   1 
ATOM   3255 C CA  . GLU B 1 188 ? -13.588 -16.161 85.829 1.00 38.49  ? 206 GLU A CA  1 
ATOM   3256 C C   . GLU B 1 188 ? -12.078 -16.022 85.884 1.00 36.74  ? 206 GLU A C   1 
ATOM   3257 O O   . GLU B 1 188 ? -11.545 -15.293 86.715 1.00 34.87  ? 206 GLU A O   1 
ATOM   3258 C CB  . GLU B 1 188 ? -13.967 -17.531 86.346 1.00 37.90  ? 206 GLU A CB  1 
ATOM   3259 C CG  . GLU B 1 188 ? -14.164 -17.565 87.845 1.00 52.15  ? 206 GLU A CG  1 
ATOM   3260 C CD  . GLU B 1 188 ? -15.023 -18.746 88.274 1.00 59.64  ? 206 GLU A CD  1 
ATOM   3261 O OE1 . GLU B 1 188 ? -14.912 -19.125 89.462 1.00 60.33  ? 206 GLU A OE1 1 
ATOM   3262 O OE2 . GLU B 1 188 ? -15.799 -19.302 87.427 1.00 63.17  ? 206 GLU A OE2 1 
ATOM   3263 N N   . HIS B 1 189 ? -11.378 -16.721 84.989 1.00 34.20  ? 207 HIS A N   1 
ATOM   3264 C CA  . HIS B 1 189 ? -9.925  -16.635 84.961 1.00 32.71  ? 207 HIS A CA  1 
ATOM   3265 C C   . HIS B 1 189 ? -9.426  -15.255 84.628 1.00 34.23  ? 207 HIS A C   1 
ATOM   3266 O O   . HIS B 1 189 ? -8.485  -14.760 85.253 1.00 34.85  ? 207 HIS A O   1 
ATOM   3267 C CB  . HIS B 1 189 ? -9.325  -17.653 84.010 1.00 33.07  ? 207 HIS A CB  1 
ATOM   3268 C CG  . HIS B 1 189 ? -7.838  -17.498 83.810 1.00 31.49  ? 207 HIS A CG  1 
ATOM   3269 N ND1 . HIS B 1 189 ? -6.954  -17.721 84.797 1.00 32.86  ? 207 HIS A ND1 1 
ATOM   3270 C CD2 . HIS B 1 189 ? -7.091  -17.141 82.677 1.00 35.63  ? 207 HIS A CD2 1 
ATOM   3271 C CE1 . HIS B 1 189 ? -5.695  -17.528 84.329 1.00 37.11  ? 207 HIS A CE1 1 
ATOM   3272 N NE2 . HIS B 1 189 ? -5.782  -17.154 83.035 1.00 39.16  ? 207 HIS A NE2 1 
ATOM   3273 N N   . VAL B 1 190 ? -10.035 -14.604 83.649 1.00 36.67  ? 208 VAL A N   1 
ATOM   3274 C CA  . VAL B 1 190 ? -9.578  -13.279 83.260 1.00 41.32  ? 208 VAL A CA  1 
ATOM   3275 C C   . VAL B 1 190 ? -9.861  -12.268 84.396 1.00 46.71  ? 208 VAL A C   1 
ATOM   3276 O O   . VAL B 1 190 ? -9.083  -11.325 84.585 1.00 51.45  ? 208 VAL A O   1 
ATOM   3277 C CB  . VAL B 1 190 ? -10.097 -12.815 81.880 1.00 39.75  ? 208 VAL A CB  1 
ATOM   3278 C CG1 . VAL B 1 190 ? -9.674  -13.776 80.773 1.00 40.03  ? 208 VAL A CG1 1 
ATOM   3279 C CG2 . VAL B 1 190 ? -11.590 -12.693 81.883 1.00 47.30  ? 208 VAL A CG2 1 
ATOM   3280 N N   . ALA B 1 191 ? -10.910 -12.511 85.183 1.00 41.48  ? 209 ALA A N   1 
ATOM   3281 C CA  . ALA B 1 191 ? -11.143 -11.768 86.448 1.00 48.14  ? 209 ALA A CA  1 
ATOM   3282 C C   . ALA B 1 191 ? -10.094 -12.043 87.533 1.00 44.08  ? 209 ALA A C   1 
ATOM   3283 O O   . ALA B 1 191 ? -9.515  -11.099 88.056 1.00 49.15  ? 209 ALA A O   1 
ATOM   3284 C CB  . ALA B 1 191 ? -12.539 -12.033 87.013 1.00 43.06  ? 209 ALA A CB  1 
ATOM   3285 N N   . ALA B 1 192 ? -9.891  -13.309 87.912 1.00 45.77  ? 210 ALA A N   1 
ATOM   3286 C CA  . ALA B 1 192 ? -8.895  -13.636 88.944 1.00 45.84  ? 210 ALA A CA  1 
ATOM   3287 C C   . ALA B 1 192 ? -7.519  -13.016 88.608 1.00 51.10  ? 210 ALA A C   1 
ATOM   3288 O O   . ALA B 1 192 ? -6.858  -12.393 89.457 1.00 44.81  ? 210 ALA A O   1 
ATOM   3289 C CB  . ALA B 1 192 ? -8.785  -15.139 89.155 1.00 42.44  ? 210 ALA A CB  1 
ATOM   3290 N N   . VAL B 1 193 ? -7.120  -13.158 87.348 1.00 50.48  ? 211 VAL A N   1 
ATOM   3291 C CA  . VAL B 1 193 ? -5.849  -12.633 86.881 1.00 52.17  ? 211 VAL A CA  1 
ATOM   3292 C C   . VAL B 1 193 ? -5.818  -11.103 86.840 1.00 55.10  ? 211 VAL A C   1 
ATOM   3293 O O   . VAL B 1 193 ? -4.858  -10.502 87.321 1.00 61.45  ? 211 VAL A O   1 
ATOM   3294 C CB  . VAL B 1 193 ? -5.384  -13.330 85.562 1.00 52.70  ? 211 VAL A CB  1 
ATOM   3295 C CG1 . VAL B 1 193 ? -4.514  -12.422 84.714 1.00 52.93  ? 211 VAL A CG1 1 
ATOM   3296 C CG2 . VAL B 1 193 ? -4.628  -14.613 85.896 1.00 49.62  ? 211 VAL A CG2 1 
ATOM   3297 N N   . ALA B 1 194 ? -6.865  -10.468 86.328 1.00 59.07  ? 212 ALA A N   1 
ATOM   3298 C CA  . ALA B 1 194 ? -6.849  -8.999  86.175 1.00 70.08  ? 212 ALA A CA  1 
ATOM   3299 C C   . ALA B 1 194 ? -6.652  -8.327  87.524 1.00 72.47  ? 212 ALA A C   1 
ATOM   3300 O O   . ALA B 1 194 ? -5.786  -7.459  87.649 1.00 68.80  ? 212 ALA A O   1 
ATOM   3301 C CB  . ALA B 1 194 ? -8.110  -8.466  85.485 1.00 59.68  ? 212 ALA A CB  1 
ATOM   3302 N N   . GLY B 1 195 ? -7.456  -8.754  88.508 1.00 75.42  ? 213 GLY A N   1 
ATOM   3303 C CA  . GLY B 1 195 ? -7.363  -8.316  89.901 1.00 78.10  ? 213 GLY A CA  1 
ATOM   3304 C C   . GLY B 1 195 ? -7.314  -6.813  90.113 1.00 81.72  ? 213 GLY A C   1 
ATOM   3305 O O   . GLY B 1 195 ? -6.478  -6.315  90.875 1.00 82.09  ? 213 GLY A O   1 
ATOM   3306 N N   . ALA B 1 200 ? -12.953 -8.560  77.700 1.00 70.84  ? 218 ALA A N   1 
ATOM   3307 C CA  . ALA B 1 200 ? -13.155 -7.140  77.417 1.00 74.25  ? 218 ALA A CA  1 
ATOM   3308 C C   . ALA B 1 200 ? -12.121 -6.615  76.418 1.00 72.22  ? 218 ALA A C   1 
ATOM   3309 O O   . ALA B 1 200 ? -12.475 -6.303  75.274 1.00 67.68  ? 218 ALA A O   1 
ATOM   3310 C CB  . ALA B 1 200 ? -13.145 -6.310  78.705 1.00 72.88  ? 218 ALA A CB  1 
ATOM   3311 N N   . SER B 1 201 ? -10.855 -6.530  76.837 1.00 63.54  ? 219 SER A N   1 
ATOM   3312 C CA  . SER B 1 201 ? -9.865  -5.850  76.007 1.00 62.48  ? 219 SER A CA  1 
ATOM   3313 C C   . SER B 1 201 ? -8.785  -6.744  75.361 1.00 62.38  ? 219 SER A C   1 
ATOM   3314 O O   . SER B 1 201 ? -8.632  -6.696  74.129 1.00 60.19  ? 219 SER A O   1 
ATOM   3315 C CB  . SER B 1 201 ? -9.280  -4.611  76.698 1.00 60.50  ? 219 SER A CB  1 
ATOM   3316 O OG  . SER B 1 201 ? -8.889  -3.636  75.741 1.00 52.02  ? 219 SER A OG  1 
ATOM   3317 N N   . CYS B 1 202 ? -8.043  -7.547  76.137 1.00 56.01  ? 220 CYS A N   1 
ATOM   3318 C CA  . CYS B 1 202 ? -7.217  -8.570  75.472 1.00 55.85  ? 220 CYS A CA  1 
ATOM   3319 C C   . CYS B 1 202 ? -8.106  -9.353  74.492 1.00 56.46  ? 220 CYS A C   1 
ATOM   3320 O O   . CYS B 1 202 ? -7.694  -9.580  73.355 1.00 53.04  ? 220 CYS A O   1 
ATOM   3321 C CB  . CYS B 1 202 ? -6.492  -9.542  76.427 1.00 57.98  ? 220 CYS A CB  1 
ATOM   3322 S SG  . CYS B 1 202 ? -5.499  -10.793 75.540 1.00 55.94  ? 220 CYS A SG  1 
ATOM   3323 N N   . LEU B 1 203 ? -9.323  -9.719  74.919 1.00 50.97  ? 221 LEU A N   1 
ATOM   3324 C CA  . LEU B 1 203 ? -10.173 -10.556 74.075 1.00 46.00  ? 221 LEU A CA  1 
ATOM   3325 C C   . LEU B 1 203 ? -10.713 -9.820  72.865 1.00 43.49  ? 221 LEU A C   1 
ATOM   3326 O O   . LEU B 1 203 ? -10.731 -10.369 71.752 1.00 41.84  ? 221 LEU A O   1 
ATOM   3327 C CB  . LEU B 1 203 ? -11.270 -11.306 74.858 1.00 47.16  ? 221 LEU A CB  1 
ATOM   3328 C CG  . LEU B 1 203 ? -12.243 -12.093 73.956 1.00 47.34  ? 221 LEU A CG  1 
ATOM   3329 C CD1 . LEU B 1 203 ? -12.348 -13.591 74.232 1.00 42.79  ? 221 LEU A CD1 1 
ATOM   3330 C CD2 . LEU B 1 203 ? -13.600 -11.393 74.011 1.00 51.40  ? 221 LEU A CD2 1 
ATOM   3331 N N   . SER B 1 204 ? -11.142 -8.582  73.044 1.00 42.19  ? 222 SER A N   1 
ATOM   3332 C CA  . SER B 1 204 ? -11.476 -7.783  71.876 1.00 37.29  ? 222 SER A CA  1 
ATOM   3333 C C   . SER B 1 204 ? -10.205 -7.646  70.970 1.00 31.14  ? 222 SER A C   1 
ATOM   3334 O O   . SER B 1 204 ? -10.262 -7.735  69.706 1.00 30.35  ? 222 SER A O   1 
ATOM   3335 C CB  . SER B 1 204 ? -11.990 -6.420  72.320 1.00 40.36  ? 222 SER A CB  1 
ATOM   3336 O OG  . SER B 1 204 ? -10.989 -5.460  72.087 1.00 36.70  ? 222 SER A OG  1 
ATOM   3337 N N   . ARG B 1 205 ? -9.046  -7.524  71.600 1.00 29.12  ? 223 ARG A N   1 
ATOM   3338 C CA  . ARG B 1 205 ? -7.778  -7.449  70.808 1.00 33.70  ? 223 ARG A CA  1 
ATOM   3339 C C   . ARG B 1 205 ? -7.552  -8.735  70.040 1.00 30.58  ? 223 ARG A C   1 
ATOM   3340 O O   . ARG B 1 205 ? -7.266  -8.729  68.838 1.00 32.28  ? 223 ARG A O   1 
ATOM   3341 C CB  . ARG B 1 205 ? -6.540  -7.089  71.641 1.00 32.88  ? 223 ARG A CB  1 
ATOM   3342 C CG  . ARG B 1 205 ? -6.180  -5.630  71.522 1.00 41.09  ? 223 ARG A CG  1 
ATOM   3343 C CD  . ARG B 1 205 ? -4.857  -5.323  72.203 1.00 43.77  ? 223 ARG A CD  1 
ATOM   3344 N NE  . ARG B 1 205 ? -4.921  -5.528  73.661 1.00 46.77  ? 223 ARG A NE  1 
ATOM   3345 C CZ  . ARG B 1 205 ? -5.592  -4.736  74.507 1.00 56.43  ? 223 ARG A CZ  1 
ATOM   3346 N NH1 . ARG B 1 205 ? -6.289  -3.708  74.041 1.00 57.72  ? 223 ARG A NH1 1 
ATOM   3347 N NH2 . ARG B 1 205 ? -5.596  -4.969  75.824 1.00 53.51  ? 223 ARG A NH2 1 
ATOM   3348 N N   . LEU B 1 206 ? -7.794  -9.823  70.739 1.00 28.08  ? 224 LEU A N   1 
ATOM   3349 C CA  . LEU B 1 206 ? -7.634  -11.168 70.242 1.00 28.88  ? 224 LEU A CA  1 
ATOM   3350 C C   . LEU B 1 206 ? -8.609  -11.481 69.072 1.00 31.27  ? 224 LEU A C   1 
ATOM   3351 O O   . LEU B 1 206 ? -8.188  -11.948 67.983 1.00 28.32  ? 224 LEU A O   1 
ATOM   3352 C CB  . LEU B 1 206 ? -7.842  -12.052 71.460 1.00 31.55  ? 224 LEU A CB  1 
ATOM   3353 C CG  . LEU B 1 206 ? -7.539  -13.537 71.626 1.00 35.78  ? 224 LEU A CG  1 
ATOM   3354 C CD1 . LEU B 1 206 ? -7.035  -13.711 73.030 1.00 36.22  ? 224 LEU A CD1 1 
ATOM   3355 C CD2 . LEU B 1 206 ? -8.794  -14.353 71.480 1.00 41.84  ? 224 LEU A CD2 1 
ATOM   3356 N N   . LEU B 1 207 ? -9.897  -11.218 69.291 1.00 29.42  ? 225 LEU A N   1 
ATOM   3357 C CA  . LEU B 1 207 ? -10.944 -11.317 68.249 1.00 33.82  ? 225 LEU A CA  1 
ATOM   3358 C C   . LEU B 1 207 ? -10.601 -10.571 66.961 1.00 31.38  ? 225 LEU A C   1 
ATOM   3359 O O   . LEU B 1 207 ? -10.856 -11.087 65.836 1.00 32.84  ? 225 LEU A O   1 
ATOM   3360 C CB  . LEU B 1 207 ? -12.300 -10.886 68.823 1.00 35.90  ? 225 LEU A CB  1 
ATOM   3361 C CG  . LEU B 1 207 ? -13.249 -11.989 69.345 1.00 37.52  ? 225 LEU A CG  1 
ATOM   3362 C CD1 . LEU B 1 207 ? -12.575 -13.202 69.959 1.00 36.28  ? 225 LEU A CD1 1 
ATOM   3363 C CD2 . LEU B 1 207 ? -14.268 -11.393 70.301 1.00 29.78  ? 225 LEU A CD2 1 
ATOM   3364 N N   . GLY B 1 208 ? -9.937  -9.426  67.110 1.00 28.45  ? 226 GLY A N   1 
ATOM   3365 C CA  . GLY B 1 208 ? -9.338  -8.713  65.962 1.00 32.07  ? 226 GLY A CA  1 
ATOM   3366 C C   . GLY B 1 208 ? -8.237  -9.494  65.174 1.00 32.98  ? 226 GLY A C   1 
ATOM   3367 O O   . GLY B 1 208 ? -7.840  -9.058  64.107 1.00 31.91  ? 226 GLY A O   1 
ATOM   3368 N N   . LYS B 1 209 ? -7.698  -10.607 65.686 1.00 29.74  ? 227 LYS A N   1 
ATOM   3369 C CA  . LYS B 1 209 ? -6.765  -11.402 64.869 1.00 27.94  ? 227 LYS A CA  1 
ATOM   3370 C C   . LYS B 1 209 ? -7.467  -12.575 64.225 1.00 32.57  ? 227 LYS A C   1 
ATOM   3371 O O   . LYS B 1 209 ? -6.864  -13.327 63.476 1.00 29.24  ? 227 LYS A O   1 
ATOM   3372 C CB  . LYS B 1 209 ? -5.620  -11.915 65.707 1.00 35.10  ? 227 LYS A CB  1 
ATOM   3373 C CG  . LYS B 1 209 ? -5.343  -11.033 66.899 1.00 39.12  ? 227 LYS A CG  1 
ATOM   3374 C CD  . LYS B 1 209 ? -3.898  -10.723 67.053 1.00 37.72  ? 227 LYS A CD  1 
ATOM   3375 C CE  . LYS B 1 209 ? -3.658  -9.363  66.450 1.00 40.88  ? 227 LYS A CE  1 
ATOM   3376 N NZ  . LYS B 1 209 ? -2.330  -8.848  66.825 1.00 32.20  ? 227 LYS A NZ  1 
ATOM   3377 N N   . LEU B 1 210 ? -8.744  -12.773 64.532 1.00 30.66  ? 228 LEU A N   1 
ATOM   3378 C CA  . LEU B 1 210 ? -9.481  -13.849 63.868 1.00 30.28  ? 228 LEU A CA  1 
ATOM   3379 C C   . LEU B 1 210 ? -9.490  -13.808 62.334 1.00 32.62  ? 228 LEU A C   1 
ATOM   3380 O O   . LEU B 1 210 ? -9.487  -14.851 61.716 1.00 35.53  ? 228 LEU A O   1 
ATOM   3381 C CB  . LEU B 1 210 ? -10.883 -13.868 64.391 1.00 28.76  ? 228 LEU A CB  1 
ATOM   3382 C CG  . LEU B 1 210 ? -11.552 -15.195 64.673 1.00 37.14  ? 228 LEU A CG  1 
ATOM   3383 C CD1 . LEU B 1 210 ? -10.555 -16.282 65.121 1.00 28.86  ? 228 LEU A CD1 1 
ATOM   3384 C CD2 . LEU B 1 210 ? -12.655 -14.896 65.691 1.00 33.23  ? 228 LEU A CD2 1 
ATOM   3385 N N   . PRO B 1 211 ? -9.510  -12.608 61.708 1.00 33.42  ? 229 PRO A N   1 
ATOM   3386 C CA  . PRO B 1 211 ? -9.398  -12.604 60.207 1.00 32.88  ? 229 PRO A CA  1 
ATOM   3387 C C   . PRO B 1 211 ? -8.075  -13.149 59.663 1.00 30.54  ? 229 PRO A C   1 
ATOM   3388 O O   . PRO B 1 211 ? -8.069  -13.925 58.721 1.00 28.57  ? 229 PRO A O   1 
ATOM   3389 C CB  . PRO B 1 211 ? -9.605  -11.111 59.803 1.00 32.57  ? 229 PRO A CB  1 
ATOM   3390 C CG  . PRO B 1 211 ? -10.328 -10.488 60.965 1.00 35.66  ? 229 PRO A CG  1 
ATOM   3391 C CD  . PRO B 1 211 ? -9.995  -11.304 62.233 1.00 33.70  ? 229 PRO A CD  1 
ATOM   3392 N N   . GLU B 1 212 ? -6.971  -12.770 60.265 1.00 27.68  ? 230 GLU A N   1 
ATOM   3393 C CA  . GLU B 1 212 ? -5.690  -13.456 60.033 1.00 30.93  ? 230 GLU A CA  1 
ATOM   3394 C C   . GLU B 1 212 ? -5.781  -14.993 60.201 1.00 26.81  ? 230 GLU A C   1 
ATOM   3395 O O   . GLU B 1 212 ? -5.258  -15.725 59.390 1.00 23.93  ? 230 GLU A O   1 
ATOM   3396 C CB  . GLU B 1 212 ? -4.681  -12.983 61.057 1.00 30.39  ? 230 GLU A CB  1 
ATOM   3397 C CG  . GLU B 1 212 ? -4.132  -11.605 60.826 1.00 37.66  ? 230 GLU A CG  1 
ATOM   3398 C CD  . GLU B 1 212 ? -3.477  -11.110 62.091 1.00 43.66  ? 230 GLU A CD  1 
ATOM   3399 O OE1 . GLU B 1 212 ? -2.404  -11.693 62.439 1.00 39.54  ? 230 GLU A OE1 1 
ATOM   3400 O OE2 . GLU B 1 212 ? -4.082  -10.198 62.727 1.00 37.25  ? 230 GLU A OE2 1 
ATOM   3401 N N   . LEU B 1 213 ? -6.441  -15.469 61.261 1.00 24.48  ? 231 LEU A N   1 
ATOM   3402 C CA  . LEU B 1 213 ? -6.589  -16.942 61.443 1.00 25.80  ? 231 LEU A CA  1 
ATOM   3403 C C   . LEU B 1 213 ? -7.420  -17.586 60.336 1.00 27.30  ? 231 LEU A C   1 
ATOM   3404 O O   . LEU B 1 213 ? -7.055  -18.629 59.806 1.00 25.48  ? 231 LEU A O   1 
ATOM   3405 C CB  . LEU B 1 213 ? -7.200  -17.298 62.787 1.00 23.88  ? 231 LEU A CB  1 
ATOM   3406 C CG  . LEU B 1 213 ? -7.283  -18.817 63.107 1.00 25.81  ? 231 LEU A CG  1 
ATOM   3407 C CD1 . LEU B 1 213 ? -5.924  -19.518 63.034 1.00 25.62  ? 231 LEU A CD1 1 
ATOM   3408 C CD2 . LEU B 1 213 ? -7.884  -19.009 64.496 1.00 26.15  ? 231 LEU A CD2 1 
ATOM   3409 N N   . ARG B 1 214 ? -8.560  -16.972 60.030 1.00 29.58  ? 232 ARG A N   1 
ATOM   3410 C CA  . ARG B 1 214 ? -9.417  -17.431 58.938 1.00 30.80  ? 232 ARG A CA  1 
ATOM   3411 C C   . ARG B 1 214 ? -8.641  -17.466 57.617 1.00 27.09  ? 232 ARG A C   1 
ATOM   3412 O O   . ARG B 1 214 ? -8.761  -18.386 56.857 1.00 24.22  ? 232 ARG A O   1 
ATOM   3413 C CB  . ARG B 1 214 ? -10.606 -16.506 58.817 1.00 32.68  ? 232 ARG A CB  1 
ATOM   3414 C CG  . ARG B 1 214 ? -11.894 -16.941 59.562 1.00 48.24  ? 232 ARG A CG  1 
ATOM   3415 C CD  . ARG B 1 214 ? -11.731 -17.476 60.982 1.00 55.21  ? 232 ARG A CD  1 
ATOM   3416 N NE  . ARG B 1 214 ? -12.890 -17.192 61.848 1.00 68.79  ? 232 ARG A NE  1 
ATOM   3417 C CZ  . ARG B 1 214 ? -13.269 -17.950 62.884 1.00 72.03  ? 232 ARG A CZ  1 
ATOM   3418 N NH1 . ARG B 1 214 ? -12.610 -19.074 63.172 1.00 69.74  ? 232 ARG A NH1 1 
ATOM   3419 N NH2 . ARG B 1 214 ? -14.320 -17.601 63.625 1.00 69.51  ? 232 ARG A NH2 1 
ATOM   3420 N N   . THR B 1 215 ? -7.859  -16.434 57.331 1.00 24.87  ? 233 THR A N   1 
ATOM   3421 C CA  . THR B 1 215 ? -7.033  -16.478 56.106 1.00 25.71  ? 233 THR A CA  1 
ATOM   3422 C C   . THR B 1 215 ? -6.051  -17.668 56.139 1.00 23.30  ? 233 THR A C   1 
ATOM   3423 O O   . THR B 1 215 ? -5.784  -18.266 55.122 1.00 22.81  ? 233 THR A O   1 
ATOM   3424 C CB  . THR B 1 215 ? -6.330  -15.137 55.889 1.00 27.66  ? 233 THR A CB  1 
ATOM   3425 O OG1 . THR B 1 215 ? -7.334  -14.165 55.561 1.00 31.91  ? 233 THR A OG1 1 
ATOM   3426 C CG2 . THR B 1 215 ? -5.305  -15.194 54.772 1.00 29.86  ? 233 THR A CG2 1 
ATOM   3427 N N   . LEU B 1 216 ? -5.543  -18.035 57.323 1.00 24.42  ? 234 LEU A N   1 
ATOM   3428 C CA  . LEU B 1 216 ? -4.549  -19.094 57.398 1.00 19.71  ? 234 LEU A CA  1 
ATOM   3429 C C   . LEU B 1 216 ? -5.258  -20.388 57.117 1.00 19.45  ? 234 LEU A C   1 
ATOM   3430 O O   . LEU B 1 216 ? -4.659  -21.300 56.495 1.00 21.32  ? 234 LEU A O   1 
ATOM   3431 C CB  . LEU B 1 216 ? -3.781  -19.052 58.779 1.00 18.44  ? 234 LEU A CB  1 
ATOM   3432 C CG  . LEU B 1 216 ? -2.814  -17.862 58.829 1.00 19.23  ? 234 LEU A CG  1 
ATOM   3433 C CD1 . LEU B 1 216 ? -2.133  -17.793 60.156 1.00 19.47  ? 234 LEU A CD1 1 
ATOM   3434 C CD2 . LEU B 1 216 ? -1.690  -18.034 57.832 1.00 18.53  ? 234 LEU A CD2 1 
ATOM   3435 N N   . CYS B 1 217 ? -6.517  -20.512 57.564 1.00 17.78  ? 235 CYS A N   1 
ATOM   3436 C CA  . CYS B 1 217 ? -7.273  -21.745 57.293 1.00 19.79  ? 235 CYS A CA  1 
ATOM   3437 C C   . CYS B 1 217 ? -7.482  -21.942 55.787 1.00 22.10  ? 235 CYS A C   1 
ATOM   3438 O O   . CYS B 1 217 ? -7.240  -23.030 55.270 1.00 22.23  ? 235 CYS A O   1 
ATOM   3439 C CB  . CYS B 1 217 ? -8.641  -21.770 58.008 1.00 23.37  ? 235 CYS A CB  1 
ATOM   3440 S SG  . CYS B 1 217 ? -8.535  -21.850 59.836 1.00 26.03  ? 235 CYS A SG  1 
ATOM   3441 N N   . THR B 1 218 ? -7.937  -20.881 55.107 1.00 20.91  ? 236 THR A N   1 
ATOM   3442 C CA  . THR B 1 218 ? -8.055  -20.898 53.675 1.00 22.64  ? 236 THR A CA  1 
ATOM   3443 C C   . THR B 1 218 ? -6.700  -21.217 52.986 1.00 23.06  ? 236 THR A C   1 
ATOM   3444 O O   . THR B 1 218 ? -6.651  -22.000 52.021 1.00 23.82  ? 236 THR A O   1 
ATOM   3445 C CB  . THR B 1 218 ? -8.522  -19.520 53.167 1.00 21.32  ? 236 THR A CB  1 
ATOM   3446 O OG1 . THR B 1 218 ? -9.716  -19.188 53.810 1.00 24.16  ? 236 THR A OG1 1 
ATOM   3447 C CG2 . THR B 1 218 ? -8.826  -19.540 51.682 1.00 22.13  ? 236 THR A CG2 1 
ATOM   3448 N N   . GLN B 1 219 ? -5.630  -20.576 53.432 1.00 20.11  ? 237 GLN A N   1 
ATOM   3449 C CA  . GLN B 1 219 ? -4.327  -20.868 52.864 1.00 23.08  ? 237 GLN A CA  1 
ATOM   3450 C C   . GLN B 1 219 ? -3.970  -22.327 53.028 1.00 20.54  ? 237 GLN A C   1 
ATOM   3451 O O   . GLN B 1 219 ? -3.333  -22.880 52.144 1.00 20.39  ? 237 GLN A O   1 
ATOM   3452 C CB  . GLN B 1 219 ? -3.162  -20.083 53.481 1.00 25.33  ? 237 GLN A CB  1 
ATOM   3453 C CG  . GLN B 1 219 ? -3.318  -18.594 53.484 1.00 31.24  ? 237 GLN A CG  1 
ATOM   3454 C CD  . GLN B 1 219 ? -2.119  -17.920 54.137 1.00 35.14  ? 237 GLN A CD  1 
ATOM   3455 O OE1 . GLN B 1 219 ? -1.020  -18.474 54.121 1.00 37.99  ? 237 GLN A OE1 1 
ATOM   3456 N NE2 . GLN B 1 219 ? -2.303  -16.683 54.639 1.00 40.38  ? 237 GLN A NE2 1 
ATOM   3457 N N   . GLY B 1 220 ? -4.389  -22.962 54.116 1.00 19.03  ? 238 GLY A N   1 
ATOM   3458 C CA  . GLY B 1 220 ? -4.115  -24.394 54.251 1.00 16.66  ? 238 GLY A CA  1 
ATOM   3459 C C   . GLY B 1 220 ? -4.894  -25.264 53.271 1.00 17.11  ? 238 GLY A C   1 
ATOM   3460 O O   . GLY B 1 220 ? -4.355  -26.253 52.784 1.00 19.06  ? 238 GLY A O   1 
ATOM   3461 N N   . LEU B 1 221 ? -6.187  -24.975 53.095 1.00 18.75  ? 239 LEU A N   1 
ATOM   3462 C CA  . LEU B 1 221 ? -7.064  -25.691 52.133 1.00 20.27  ? 239 LEU A CA  1 
ATOM   3463 C C   . LEU B 1 221 ? -6.430  -25.465 50.771 1.00 19.67  ? 239 LEU A C   1 
ATOM   3464 O O   . LEU B 1 221 ? -6.343  -26.392 49.956 1.00 20.98  ? 239 LEU A O   1 
ATOM   3465 C CB  . LEU B 1 221 ? -8.484  -25.106 52.147 1.00 16.21  ? 239 LEU A CB  1 
ATOM   3466 C CG  . LEU B 1 221 ? -9.259  -25.339 53.454 1.00 19.92  ? 239 LEU A CG  1 
ATOM   3467 C CD1 . LEU B 1 221 ? -10.608 -24.638 53.433 1.00 22.16  ? 239 LEU A CD1 1 
ATOM   3468 C CD2 . LEU B 1 221 ? -9.496  -26.848 53.628 1.00 21.12  ? 239 LEU A CD2 1 
ATOM   3469 N N   . GLN B 1 222 ? -5.977  -24.241 50.496 1.00 18.62  ? 240 GLN A N   1 
ATOM   3470 C CA  . GLN B 1 222 ? -5.358  -24.052 49.202 1.00 20.44  ? 240 GLN A CA  1 
ATOM   3471 C C   . GLN B 1 222 ? -4.091  -24.878 48.988 1.00 22.82  ? 240 GLN A C   1 
ATOM   3472 O O   . GLN B 1 222 ? -3.868  -25.414 47.887 1.00 21.64  ? 240 GLN A O   1 
ATOM   3473 C CB  . GLN B 1 222 ? -5.062  -22.610 48.959 1.00 25.64  ? 240 GLN A CB  1 
ATOM   3474 C CG  . GLN B 1 222 ? -6.219  -21.661 48.943 1.00 23.51  ? 240 GLN A CG  1 
ATOM   3475 C CD  . GLN B 1 222 ? -5.649  -20.252 48.819 1.00 28.08  ? 240 GLN A CD  1 
ATOM   3476 O OE1 . GLN B 1 222 ? -5.391  -19.547 49.817 1.00 28.29  ? 240 GLN A OE1 1 
ATOM   3477 N NE2 . GLN B 1 222 ? -5.395  -19.848 47.587 1.00 29.82  ? 240 GLN A NE2 1 
ATOM   3478 N N   . ARG B 1 223 ? -3.243  -24.967 50.020 1.00 20.99  ? 241 ARG A N   1 
ATOM   3479 C CA  . ARG B 1 223 ? -2.049  -25.811 49.924 1.00 22.31  ? 241 ARG A CA  1 
ATOM   3480 C C   . ARG B 1 223 ? -2.416  -27.283 49.723 1.00 20.85  ? 241 ARG A C   1 
ATOM   3481 O O   . ARG B 1 223 ? -1.772  -27.979 48.905 1.00 20.09  ? 241 ARG A O   1 
ATOM   3482 C CB  . ARG B 1 223 ? -1.119  -25.626 51.137 1.00 20.81  ? 241 ARG A CB  1 
ATOM   3483 C CG  . ARG B 1 223 ? 0.130   -26.495 51.052 1.00 23.06  ? 241 ARG A CG  1 
ATOM   3484 C CD  . ARG B 1 223 ? 1.074   -25.960 49.925 1.00 21.69  ? 241 ARG A CD  1 
ATOM   3485 N NE  . ARG B 1 223 ? 2.315   -26.716 49.807 1.00 22.46  ? 241 ARG A NE  1 
ATOM   3486 C CZ  . ARG B 1 223 ? 3.179   -26.602 48.773 1.00 21.69  ? 241 ARG A CZ  1 
ATOM   3487 N NH1 . ARG B 1 223 ? 2.903   -25.781 47.763 1.00 23.45  ? 241 ARG A NH1 1 
ATOM   3488 N NH2 . ARG B 1 223 ? 4.266   -27.354 48.709 1.00 20.97  ? 241 ARG A NH2 1 
ATOM   3489 N N   . ILE B 1 224 ? -3.472  -27.748 50.406 1.00 17.69  ? 242 ILE A N   1 
ATOM   3490 C CA  . ILE B 1 224 ? -3.900  -29.151 50.249 1.00 18.19  ? 242 ILE A CA  1 
ATOM   3491 C C   . ILE B 1 224 ? -4.461  -29.412 48.816 1.00 18.90  ? 242 ILE A C   1 
ATOM   3492 O O   . ILE B 1 224 ? -4.167  -30.443 48.180 1.00 15.24  ? 242 ILE A O   1 
ATOM   3493 C CB  . ILE B 1 224 ? -4.883  -29.575 51.350 1.00 20.72  ? 242 ILE A CB  1 
ATOM   3494 C CG1 . ILE B 1 224 ? -4.225  -29.545 52.730 1.00 18.04  ? 242 ILE A CG1 1 
ATOM   3495 C CG2 . ILE B 1 224 ? -5.514  -30.963 51.074 1.00 20.32  ? 242 ILE A CG2 1 
ATOM   3496 C CD1 . ILE B 1 224 ? -5.232  -29.669 53.863 1.00 18.67  ? 242 ILE A CD1 1 
ATOM   3497 N N   . PHE B 1 225 ? -5.242  -28.455 48.308 1.00 21.60  ? 243 PHE A N   1 
ATOM   3498 C CA  . PHE B 1 225 ? -5.710  -28.580 46.919 1.00 21.89  ? 243 PHE A CA  1 
ATOM   3499 C C   . PHE B 1 225 ? -4.504  -28.720 45.979 1.00 23.92  ? 243 PHE A C   1 
ATOM   3500 O O   . PHE B 1 225 ? -4.452  -29.570 45.098 1.00 22.23  ? 243 PHE A O   1 
ATOM   3501 C CB  . PHE B 1 225 ? -6.539  -27.367 46.540 1.00 19.24  ? 243 PHE A CB  1 
ATOM   3502 C CG  . PHE B 1 225 ? -6.938  -27.347 45.094 1.00 20.59  ? 243 PHE A CG  1 
ATOM   3503 C CD1 . PHE B 1 225 ? -7.960  -28.157 44.643 1.00 21.27  ? 243 PHE A CD1 1 
ATOM   3504 C CD2 . PHE B 1 225 ? -6.285  -26.537 44.191 1.00 21.07  ? 243 PHE A CD2 1 
ATOM   3505 C CE1 . PHE B 1 225 ? -8.367  -28.131 43.287 1.00 25.18  ? 243 PHE A CE1 1 
ATOM   3506 C CE2 . PHE B 1 225 ? -6.658  -26.529 42.816 1.00 23.61  ? 243 PHE A CE2 1 
ATOM   3507 C CZ  . PHE B 1 225 ? -7.700  -27.316 42.385 1.00 22.50  ? 243 PHE A CZ  1 
ATOM   3508 N N   . TYR B 1 226 ? -3.514  -27.888 46.172 1.00 21.88  ? 244 TYR A N   1 
ATOM   3509 C CA  . TYR B 1 226 ? -2.408  -27.906 45.229 1.00 24.16  ? 244 TYR A CA  1 
ATOM   3510 C C   . TYR B 1 226 ? -1.640  -29.248 45.267 1.00 26.08  ? 244 TYR A C   1 
ATOM   3511 O O   . TYR B 1 226 ? -1.330  -29.834 44.220 1.00 22.73  ? 244 TYR A O   1 
ATOM   3512 C CB  . TYR B 1 226 ? -1.498  -26.690 45.459 1.00 26.38  ? 244 TYR A CB  1 
ATOM   3513 C CG  . TYR B 1 226 ? -0.155  -26.873 44.770 1.00 31.61  ? 244 TYR A CG  1 
ATOM   3514 C CD1 . TYR B 1 226 ? 0.036   -26.519 43.421 1.00 31.84  ? 244 TYR A CD1 1 
ATOM   3515 C CD2 . TYR B 1 226 ? 0.885   -27.499 45.432 1.00 32.73  ? 244 TYR A CD2 1 
ATOM   3516 C CE1 . TYR B 1 226 ? 1.248   -26.746 42.795 1.00 31.98  ? 244 TYR A CE1 1 
ATOM   3517 C CE2 . TYR B 1 226 ? 2.077   -27.720 44.820 1.00 33.59  ? 244 TYR A CE2 1 
ATOM   3518 C CZ  . TYR B 1 226 ? 2.257   -27.349 43.514 1.00 35.03  ? 244 TYR A CZ  1 
ATOM   3519 O OH  . TYR B 1 226 ? 3.499   -27.597 42.986 1.00 42.98  ? 244 TYR A OH  1 
ATOM   3520 N N   . LEU B 1 227 ? -1.368  -29.753 46.485 1.00 20.60  ? 245 LEU A N   1 
ATOM   3521 C CA  . LEU B 1 227 ? -0.711  -30.982 46.656 1.00 20.00  ? 245 LEU A CA  1 
ATOM   3522 C C   . LEU B 1 227 ? -1.538  -32.118 46.103 1.00 22.08  ? 245 LEU A C   1 
ATOM   3523 O O   . LEU B 1 227 ? -0.987  -33.111 45.598 1.00 23.76  ? 245 LEU A O   1 
ATOM   3524 C CB  . LEU B 1 227 ? -0.409  -31.218 48.176 1.00 18.76  ? 245 LEU A CB  1 
ATOM   3525 C CG  . LEU B 1 227 ? 0.580   -30.174 48.781 1.00 18.03  ? 245 LEU A CG  1 
ATOM   3526 C CD1 . LEU B 1 227 ? 0.827   -30.346 50.313 1.00 17.94  ? 245 LEU A CD1 1 
ATOM   3527 C CD2 . LEU B 1 227 ? 1.882   -30.223 48.032 1.00 14.98  ? 245 LEU A CD2 1 
ATOM   3528 N N   . LYS B 1 228 ? -2.844  -32.006 46.228 1.00 22.29  ? 246 LYS A N   1 
ATOM   3529 C CA  . LYS B 1 228 ? -3.731  -33.103 45.761 1.00 27.09  ? 246 LYS A CA  1 
ATOM   3530 C C   . LYS B 1 228 ? -3.722  -33.149 44.227 1.00 27.43  ? 246 LYS A C   1 
ATOM   3531 O O   . LYS B 1 228 ? -3.695  -34.217 43.603 1.00 26.04  ? 246 LYS A O   1 
ATOM   3532 C CB  . LYS B 1 228 ? -5.152  -32.885 46.290 1.00 25.18  ? 246 LYS A CB  1 
ATOM   3533 C CG  . LYS B 1 228 ? -5.401  -33.405 47.713 1.00 23.19  ? 246 LYS A CG  1 
ATOM   3534 C CD  . LYS B 1 228 ? -6.812  -33.061 48.175 1.00 24.62  ? 246 LYS A CD  1 
ATOM   3535 C CE  . LYS B 1 228 ? -7.978  -33.698 47.326 1.00 28.59  ? 246 LYS A CE  1 
ATOM   3536 N NZ  . LYS B 1 228 ? -8.144  -35.184 47.553 1.00 24.42  ? 246 LYS A NZ  1 
ATOM   3537 N N   . LEU B 1 229 ? -3.746  -31.967 43.627 1.00 27.00  ? 247 LEU A N   1 
ATOM   3538 C CA  . LEU B 1 229 ? -3.520  -31.828 42.199 1.00 26.56  ? 247 LEU A CA  1 
ATOM   3539 C C   . LEU B 1 229 ? -2.191  -32.431 41.767 1.00 30.46  ? 247 LEU A C   1 
ATOM   3540 O O   . LEU B 1 229 ? -2.088  -33.141 40.742 1.00 28.55  ? 247 LEU A O   1 
ATOM   3541 C CB  . LEU B 1 229 ? -3.478  -30.330 41.879 1.00 31.76  ? 247 LEU A CB  1 
ATOM   3542 C CG  . LEU B 1 229 ? -4.737  -29.775 41.308 1.00 32.18  ? 247 LEU A CG  1 
ATOM   3543 C CD1 . LEU B 1 229 ? -4.337  -28.451 40.724 1.00 35.90  ? 247 LEU A CD1 1 
ATOM   3544 C CD2 . LEU B 1 229 ? -5.087  -30.730 40.171 1.00 33.65  ? 247 LEU A CD2 1 
ATOM   3545 N N   . GLU B 1 230 ? -1.171  -32.153 42.563 1.00 27.43  ? 248 GLU A N   1 
ATOM   3546 C CA  . GLU B 1 230 ? 0.152   -32.612 42.244 1.00 31.65  ? 248 GLU A CA  1 
ATOM   3547 C C   . GLU B 1 230 ? 0.184   -34.126 42.374 1.00 31.81  ? 248 GLU A C   1 
ATOM   3548 O O   . GLU B 1 230 ? 0.719   -34.806 41.527 1.00 29.48  ? 248 GLU A O   1 
ATOM   3549 C CB  . GLU B 1 230 ? 1.186   -31.970 43.175 1.00 31.55  ? 248 GLU A CB  1 
ATOM   3550 C CG  . GLU B 1 230 ? 2.592   -32.250 42.737 1.00 30.64  ? 248 GLU A CG  1 
ATOM   3551 C CD  . GLU B 1 230 ? 3.640   -31.485 43.535 1.00 36.53  ? 248 GLU A CD  1 
ATOM   3552 O OE1 . GLU B 1 230 ? 3.456   -31.272 44.758 1.00 32.09  ? 248 GLU A OE1 1 
ATOM   3553 O OE2 . GLU B 1 230 ? 4.678   -31.126 42.937 1.00 36.82  ? 248 GLU A OE2 1 
ATOM   3554 N N   . ASP B 1 231 ? -0.401  -34.617 43.450 1.00 29.09  ? 249 ASP A N   1 
ATOM   3555 C CA  . ASP B 1 231 ? -0.583  -36.017 43.717 1.00 29.37  ? 249 ASP A CA  1 
ATOM   3556 C C   . ASP B 1 231 ? 0.770   -36.798 43.790 1.00 30.83  ? 249 ASP A C   1 
ATOM   3557 O O   . ASP B 1 231 ? 0.857   -37.906 43.300 1.00 30.81  ? 249 ASP A O   1 
ATOM   3558 C CB  . ASP B 1 231 ? -1.564  -36.588 42.672 1.00 35.47  ? 249 ASP A CB  1 
ATOM   3559 C CG  . ASP B 1 231 ? -1.932  -38.049 42.935 1.00 42.59  ? 249 ASP A CG  1 
ATOM   3560 O OD1 . ASP B 1 231 ? -2.499  -38.318 44.007 1.00 37.58  ? 249 ASP A OD1 1 
ATOM   3561 O OD2 . ASP B 1 231 ? -1.672  -38.923 42.062 1.00 49.76  ? 249 ASP A OD2 1 
ATOM   3562 N N   . LEU B 1 232 ? 1.807   -36.258 44.431 1.00 25.25  ? 250 LEU A N   1 
ATOM   3563 C CA  . LEU B 1 232 ? 3.045   -37.047 44.655 1.00 25.68  ? 250 LEU A CA  1 
ATOM   3564 C C   . LEU B 1 232 ? 2.830   -38.285 45.514 1.00 26.47  ? 250 LEU A C   1 
ATOM   3565 O O   . LEU B 1 232 ? 3.397   -39.355 45.265 1.00 24.24  ? 250 LEU A O   1 
ATOM   3566 C CB  . LEU B 1 232 ? 4.200   -36.212 45.211 1.00 24.32  ? 250 LEU A CB  1 
ATOM   3567 C CG  . LEU B 1 232 ? 4.640   -34.964 44.390 1.00 25.00  ? 250 LEU A CG  1 
ATOM   3568 C CD1 . LEU B 1 232 ? 6.009   -34.483 44.873 1.00 20.83  ? 250 LEU A CD1 1 
ATOM   3569 C CD2 . LEU B 1 232 ? 4.697   -35.263 42.883 1.00 25.69  ? 250 LEU A CD2 1 
ATOM   3570 N N   . VAL B 1 233 ? 2.020   -38.140 46.545 1.00 28.56  ? 251 VAL A N   1 
ATOM   3571 C CA  . VAL B 1 233 ? 1.687   -39.249 47.436 1.00 25.64  ? 251 VAL A CA  1 
ATOM   3572 C C   . VAL B 1 233 ? 0.214   -39.013 47.843 1.00 26.74  ? 251 VAL A C   1 
ATOM   3573 O O   . VAL B 1 233 ? -0.262  -37.887 47.817 1.00 26.09  ? 251 VAL A O   1 
ATOM   3574 C CB  . VAL B 1 233 ? 2.555   -39.239 48.675 1.00 27.75  ? 251 VAL A CB  1 
ATOM   3575 C CG1 . VAL B 1 233 ? 4.057   -39.141 48.327 1.00 27.52  ? 251 VAL A CG1 1 
ATOM   3576 C CG2 . VAL B 1 233 ? 2.160   -38.065 49.561 1.00 28.86  ? 251 VAL A CG2 1 
ATOM   3577 N N   . PRO B 1 234 ? -0.530  -40.077 48.140 1.00 26.19  ? 252 PRO A N   1 
ATOM   3578 C CA  . PRO B 1 234 ? -1.933  -39.698 48.376 1.00 28.30  ? 252 PRO A CA  1 
ATOM   3579 C C   . PRO B 1 234 ? -2.097  -39.140 49.814 1.00 30.97  ? 252 PRO A C   1 
ATOM   3580 O O   . PRO B 1 234 ? -1.301  -39.471 50.696 1.00 28.57  ? 252 PRO A O   1 
ATOM   3581 C CB  . PRO B 1 234 ? -2.697  -41.006 48.130 1.00 28.37  ? 252 PRO A CB  1 
ATOM   3582 C CG  . PRO B 1 234 ? -1.718  -42.102 48.393 1.00 32.92  ? 252 PRO A CG  1 
ATOM   3583 C CD  . PRO B 1 234 ? -0.322  -41.534 48.066 1.00 28.04  ? 252 PRO A CD  1 
ATOM   3584 N N   . PRO B 1 235 ? -3.101  -38.288 50.039 1.00 29.82  ? 253 PRO A N   1 
ATOM   3585 C CA  . PRO B 1 235 ? -3.302  -37.733 51.366 1.00 26.36  ? 253 PRO A CA  1 
ATOM   3586 C C   . PRO B 1 235 ? -3.870  -38.799 52.326 1.00 28.16  ? 253 PRO A C   1 
ATOM   3587 O O   . PRO B 1 235 ? -4.527  -39.702 51.861 1.00 25.81  ? 253 PRO A O   1 
ATOM   3588 C CB  . PRO B 1 235 ? -4.326  -36.615 51.085 1.00 25.61  ? 253 PRO A CB  1 
ATOM   3589 C CG  . PRO B 1 235 ? -5.040  -37.075 49.896 1.00 28.63  ? 253 PRO A CG  1 
ATOM   3590 C CD  . PRO B 1 235 ? -4.023  -37.702 49.049 1.00 28.54  ? 253 PRO A CD  1 
ATOM   3591 N N   . PRO B 1 236 ? -3.642  -38.683 53.655 1.00 28.21  ? 254 PRO A N   1 
ATOM   3592 C CA  . PRO B 1 236 ? -4.328  -39.512 54.660 1.00 30.27  ? 254 PRO A CA  1 
ATOM   3593 C C   . PRO B 1 236 ? -5.872  -39.383 54.530 1.00 29.73  ? 254 PRO A C   1 
ATOM   3594 O O   . PRO B 1 236 ? -6.366  -38.288 54.283 1.00 25.23  ? 254 PRO A O   1 
ATOM   3595 C CB  . PRO B 1 236 ? -3.938  -38.851 55.976 1.00 28.46  ? 254 PRO A CB  1 
ATOM   3596 C CG  . PRO B 1 236 ? -2.769  -37.979 55.671 1.00 26.83  ? 254 PRO A CG  1 
ATOM   3597 C CD  . PRO B 1 236 ? -3.041  -37.500 54.282 1.00 29.11  ? 254 PRO A CD  1 
ATOM   3598 N N   . PRO B 1 237 ? -6.616  -40.501 54.657 1.00 31.58  ? 255 PRO A N   1 
ATOM   3599 C CA  . PRO B 1 237 ? -8.082  -40.541 54.608 1.00 28.47  ? 255 PRO A CA  1 
ATOM   3600 C C   . PRO B 1 237 ? -8.785  -39.478 55.384 1.00 26.82  ? 255 PRO A C   1 
ATOM   3601 O O   . PRO B 1 237 ? -9.648  -38.784 54.833 1.00 27.07  ? 255 PRO A O   1 
ATOM   3602 C CB  . PRO B 1 237 ? -8.420  -41.918 55.255 1.00 30.29  ? 255 PRO A CB  1 
ATOM   3603 C CG  . PRO B 1 237 ? -7.208  -42.765 54.994 1.00 34.42  ? 255 PRO A CG  1 
ATOM   3604 C CD  . PRO B 1 237 ? -6.047  -41.860 54.551 1.00 34.21  ? 255 PRO A CD  1 
ATOM   3605 N N   . ILE B 1 238 ? -8.460  -39.336 56.682 1.00 26.76  ? 256 ILE A N   1 
ATOM   3606 C CA  . ILE B 1 238 ? -9.182  -38.352 57.473 1.00 27.43  ? 256 ILE A CA  1 
ATOM   3607 C C   . ILE B 1 238 ? -8.845  -36.938 57.049 1.00 24.41  ? 256 ILE A C   1 
ATOM   3608 O O   . ILE B 1 238 ? -9.707  -36.090 56.980 1.00 23.75  ? 256 ILE A O   1 
ATOM   3609 C CB  . ILE B 1 238 ? -9.055  -38.585 59.001 1.00 31.92  ? 256 ILE A CB  1 
ATOM   3610 C CG1 . ILE B 1 238 ? -9.363  -40.060 59.323 1.00 37.86  ? 256 ILE A CG1 1 
ATOM   3611 C CG2 . ILE B 1 238 ? -10.132 -37.801 59.741 1.00 28.89  ? 256 ILE A CG2 1 
ATOM   3612 C CD1 . ILE B 1 238 ? -8.313  -40.779 60.188 1.00 41.52  ? 256 ILE A CD1 1 
ATOM   3613 N N   . ILE B 1 239 ? -7.593  -36.654 56.725 1.00 25.57  ? 257 ILE A N   1 
ATOM   3614 C CA  . ILE B 1 239 ? -7.280  -35.250 56.252 1.00 22.97  ? 257 ILE A CA  1 
ATOM   3615 C C   . ILE B 1 239 ? -8.054  -34.992 54.943 1.00 23.05  ? 257 ILE A C   1 
ATOM   3616 O O   . ILE B 1 239 ? -8.619  -33.962 54.704 1.00 23.89  ? 257 ILE A O   1 
ATOM   3617 C CB  . ILE B 1 239 ? -5.739  -35.062 56.081 1.00 21.08  ? 257 ILE A CB  1 
ATOM   3618 C CG1 . ILE B 1 239 ? -5.046  -35.207 57.449 1.00 21.91  ? 257 ILE A CG1 1 
ATOM   3619 C CG2 . ILE B 1 239 ? -5.366  -33.737 55.396 1.00 18.94  ? 257 ILE A CG2 1 
ATOM   3620 C CD1 . ILE B 1 239 ? -5.640  -34.321 58.523 1.00 20.56  ? 257 ILE A CD1 1 
ATOM   3621 N N   . ASP B 1 240 ? -8.130  -36.006 54.120 1.00 23.33  ? 258 ASP A N   1 
ATOM   3622 C CA  . ASP B 1 240 ? -8.762  -35.832 52.819 1.00 25.57  ? 258 ASP A CA  1 
ATOM   3623 C C   . ASP B 1 240 ? -10.242 -35.620 53.011 1.00 24.50  ? 258 ASP A C   1 
ATOM   3624 O O   . ASP B 1 240 ? -10.805 -34.777 52.327 1.00 22.94  ? 258 ASP A O   1 
ATOM   3625 C CB  . ASP B 1 240 ? -8.449  -37.048 51.902 1.00 26.47  ? 258 ASP A CB  1 
ATOM   3626 C CG  . ASP B 1 240 ? -8.715  -36.745 50.406 1.00 30.23  ? 258 ASP A CG  1 
ATOM   3627 O OD1 . ASP B 1 240 ? -8.479  -35.628 49.977 1.00 32.61  ? 258 ASP A OD1 1 
ATOM   3628 O OD2 . ASP B 1 240 ? -9.127  -37.630 49.626 1.00 34.15  ? 258 ASP A OD2 1 
ATOM   3629 N N   . LYS B 1 241 ? -10.885 -36.358 53.951 1.00 28.05  ? 259 LYS A N   1 
ATOM   3630 C CA  . LYS B 1 241 ? -12.315 -36.104 54.289 1.00 26.18  ? 259 LYS A CA  1 
ATOM   3631 C C   . LYS B 1 241 ? -12.560 -34.681 54.788 1.00 26.23  ? 259 LYS A C   1 
ATOM   3632 O O   . LYS B 1 241 ? -13.470 -33.963 54.326 1.00 23.09  ? 259 LYS A O   1 
ATOM   3633 C CB  . LYS B 1 241 ? -12.799 -37.102 55.384 1.00 29.19  ? 259 LYS A CB  1 
ATOM   3634 C CG  . LYS B 1 241 ? -14.254 -36.937 55.816 1.00 27.05  ? 259 LYS A CG  1 
ATOM   3635 C CD  . LYS B 1 241 ? -14.558 -37.924 56.942 1.00 32.40  ? 259 LYS A CD  1 
ATOM   3636 C CE  . LYS B 1 241 ? -15.993 -37.910 57.402 1.00 29.76  ? 259 LYS A CE  1 
ATOM   3637 N NZ  . LYS B 1 241 ? -16.667 -36.614 57.165 1.00 40.48  ? 259 LYS A NZ  1 
ATOM   3638 N N   . ILE B 1 242 ? -11.727 -34.270 55.755 1.00 26.95  ? 260 ILE A N   1 
ATOM   3639 C CA  . ILE B 1 242 ? -11.795 -32.926 56.305 1.00 22.71  ? 260 ILE A CA  1 
ATOM   3640 C C   . ILE B 1 242 ? -11.760 -31.911 55.129 1.00 23.24  ? 260 ILE A C   1 
ATOM   3641 O O   . ILE B 1 242 ? -12.649 -31.016 54.988 1.00 27.10  ? 260 ILE A O   1 
ATOM   3642 C CB  . ILE B 1 242 ? -10.627 -32.699 57.291 1.00 24.07  ? 260 ILE A CB  1 
ATOM   3643 C CG1 . ILE B 1 242 ? -10.936 -33.358 58.634 1.00 22.46  ? 260 ILE A CG1 1 
ATOM   3644 C CG2 . ILE B 1 242 ? -10.394 -31.208 57.485 1.00 23.77  ? 260 ILE A CG2 1 
ATOM   3645 C CD1 . ILE B 1 242 ? -9.805  -33.477 59.653 1.00 23.56  ? 260 ILE A CD1 1 
ATOM   3646 N N   . PHE B 1 243 ? -10.778 -32.046 54.252 1.00 20.61  ? 261 PHE A N   1 
ATOM   3647 C CA  . PHE B 1 243 ? -10.679 -31.094 53.111 1.00 21.86  ? 261 PHE A CA  1 
ATOM   3648 C C   . PHE B 1 243 ? -11.967 -31.134 52.260 1.00 25.69  ? 261 PHE A C   1 
ATOM   3649 O O   . PHE B 1 243 ? -12.577 -30.089 51.976 1.00 32.36  ? 261 PHE A O   1 
ATOM   3650 C CB  . PHE B 1 243 ? -9.405  -31.454 52.253 1.00 24.03  ? 261 PHE A CB  1 
ATOM   3651 C CG  . PHE B 1 243 ? -9.347  -30.771 50.906 1.00 23.23  ? 261 PHE A CG  1 
ATOM   3652 C CD1 . PHE B 1 243 ? -8.747  -29.518 50.788 1.00 19.62  ? 261 PHE A CD1 1 
ATOM   3653 C CD2 . PHE B 1 243 ? -9.922  -31.387 49.761 1.00 23.62  ? 261 PHE A CD2 1 
ATOM   3654 C CE1 . PHE B 1 243 ? -8.683  -28.881 49.587 1.00 21.08  ? 261 PHE A CE1 1 
ATOM   3655 C CE2 . PHE B 1 243 ? -9.864  -30.741 48.520 1.00 21.50  ? 261 PHE A CE2 1 
ATOM   3656 C CZ  . PHE B 1 243 ? -9.238  -29.482 48.453 1.00 24.55  ? 261 PHE A CZ  1 
ATOM   3657 N N   . MET B 1 244 ? -12.395 -32.329 51.838 1.00 27.44  ? 262 MET A N   1 
ATOM   3658 C CA  . MET B 1 244 ? -13.612 -32.472 50.991 1.00 29.25  ? 262 MET A CA  1 
ATOM   3659 C C   . MET B 1 244 ? -14.884 -31.921 51.678 1.00 31.24  ? 262 MET A C   1 
ATOM   3660 O O   . MET B 1 244 ? -15.647 -31.154 51.101 1.00 34.20  ? 262 MET A O   1 
ATOM   3661 C CB  . MET B 1 244 ? -13.778 -33.952 50.561 1.00 31.10  ? 262 MET A CB  1 
ATOM   3662 C CG  . MET B 1 244 ? -12.626 -34.493 49.737 1.00 31.81  ? 262 MET A CG  1 
ATOM   3663 S SD  . MET B 1 244 ? -12.531 -33.510 48.231 1.00 37.48  ? 262 MET A SD  1 
ATOM   3664 C CE  . MET B 1 244 ? -11.146 -34.309 47.522 1.00 27.74  ? 262 MET A CE  1 
ATOM   3665 N N   . ASP B 1 245 ? -15.072 -32.273 52.949 1.00 33.46  ? 263 ASP A N   1 
ATOM   3666 C CA  . ASP B 1 245 ? -16.171 -31.743 53.777 1.00 34.21  ? 263 ASP A CA  1 
ATOM   3667 C C   . ASP B 1 245 ? -16.246 -30.230 53.962 1.00 43.14  ? 263 ASP A C   1 
ATOM   3668 O O   . ASP B 1 245 ? -17.342 -29.683 54.141 1.00 37.15  ? 263 ASP A O   1 
ATOM   3669 C CB  . ASP B 1 245 ? -16.126 -32.399 55.156 1.00 33.52  ? 263 ASP A CB  1 
ATOM   3670 C CG  . ASP B 1 245 ? -16.568 -33.856 55.125 1.00 38.39  ? 263 ASP A CG  1 
ATOM   3671 O OD1 . ASP B 1 245 ? -16.831 -34.364 53.991 1.00 45.43  ? 263 ASP A OD1 1 
ATOM   3672 O OD2 . ASP B 1 245 ? -16.632 -34.503 56.196 1.00 31.44  ? 263 ASP A OD2 1 
ATOM   3673 N N   . THR B 1 246 ? -15.097 -29.552 53.963 1.00 41.41  ? 264 THR A N   1 
ATOM   3674 C CA  . THR B 1 246 ? -15.049 -28.090 54.148 1.00 37.96  ? 264 THR A CA  1 
ATOM   3675 C C   . THR B 1 246 ? -15.429 -27.327 52.867 1.00 43.98  ? 264 THR A C   1 
ATOM   3676 O O   . THR B 1 246 ? -15.649 -26.110 52.883 1.00 39.01  ? 264 THR A O   1 
ATOM   3677 C CB  . THR B 1 246 ? -13.609 -27.660 54.525 1.00 46.46  ? 264 THR A CB  1 
ATOM   3678 O OG1 . THR B 1 246 ? -13.033 -28.579 55.474 1.00 39.89  ? 264 THR A OG1 1 
ATOM   3679 C CG2 . THR B 1 246 ? -13.589 -26.210 55.073 1.00 48.34  ? 264 THR A CG2 1 
ATOM   3680 N N   . LEU B 1 247 ? -15.481 -28.043 51.746 1.00 43.85  ? 265 LEU A N   1 
ATOM   3681 C CA  . LEU B 1 247 ? -15.751 -27.417 50.458 1.00 46.26  ? 265 LEU A CA  1 
ATOM   3682 C C   . LEU B 1 247 ? -17.249 -27.182 50.186 1.00 49.02  ? 265 LEU A C   1 
ATOM   3683 O O   . LEU B 1 247 ? -17.991 -28.158 50.036 1.00 49.59  ? 265 LEU A O   1 
ATOM   3684 C CB  . LEU B 1 247 ? -15.141 -28.276 49.364 1.00 42.85  ? 265 LEU A CB  1 
ATOM   3685 C CG  . LEU B 1 247 ? -13.656 -28.106 49.001 1.00 46.73  ? 265 LEU A CG  1 
ATOM   3686 C CD1 . LEU B 1 247 ? -12.719 -27.685 50.122 1.00 40.51  ? 265 LEU A CD1 1 
ATOM   3687 C CD2 . LEU B 1 247 ? -13.142 -29.374 48.309 1.00 47.42  ? 265 LEU A CD2 1 
ATOM   3688 N N   . PRO B 1 248 ? -17.688 -25.897 50.048 1.00 53.30  ? 266 PRO A N   1 
ATOM   3689 C CA  . PRO B 1 248 ? -19.129 -25.608 49.871 1.00 58.16  ? 266 PRO A CA  1 
ATOM   3690 C C   . PRO B 1 248 ? -19.791 -26.144 48.570 1.00 63.33  ? 266 PRO A C   1 
ATOM   3691 O O   . PRO B 1 248 ? -20.977 -25.901 48.371 1.00 63.88  ? 266 PRO A O   1 
ATOM   3692 C CB  . PRO B 1 248 ? -19.185 -24.076 49.903 1.00 55.80  ? 266 PRO A CB  1 
ATOM   3693 C CG  . PRO B 1 248 ? -17.871 -23.644 49.337 1.00 54.89  ? 266 PRO A CG  1 
ATOM   3694 C CD  . PRO B 1 248 ? -16.861 -24.713 49.718 1.00 54.35  ? 266 PRO A CD  1 
ATOM   3695 N N   . PHE B 1 249 ? -19.048 -26.877 47.725 1.00 61.94  ? 267 PHE A N   1 
ATOM   3696 C CA  . PHE B 1 249 ? -19.501 -27.292 46.373 1.00 57.79  ? 267 PHE A CA  1 
ATOM   3697 C C   . PHE B 1 249 ? -19.441 -28.806 46.136 1.00 63.34  ? 267 PHE A C   1 
ATOM   3698 O O   . PHE B 1 249 ? -19.515 -29.601 47.079 1.00 65.45  ? 267 PHE A O   1 
ATOM   3699 C CB  . PHE B 1 249 ? -18.708 -26.542 45.268 1.00 52.47  ? 267 PHE A CB  1 
ATOM   3700 C CG  . PHE B 1 249 ? -17.190 -26.485 45.492 1.00 48.62  ? 267 PHE A CG  1 
ATOM   3701 C CD1 . PHE B 1 249 ? -16.357 -27.510 45.044 1.00 44.15  ? 267 PHE A CD1 1 
ATOM   3702 C CD2 . PHE B 1 249 ? -16.597 -25.382 46.128 1.00 44.57  ? 267 PHE A CD2 1 
ATOM   3703 C CE1 . PHE B 1 249 ? -14.975 -27.449 45.242 1.00 47.25  ? 267 PHE A CE1 1 
ATOM   3704 C CE2 . PHE B 1 249 ? -15.215 -25.310 46.306 1.00 45.22  ? 267 PHE A CE2 1 
ATOM   3705 C CZ  . PHE B 1 249 ? -14.405 -26.345 45.872 1.00 44.69  ? 267 PHE A CZ  1 
HETATM 3706 C C1  . GOL C 2 .   ? -5.621  -14.263 15.930 1.00 24.80  ? 301 GOL B C1  1 
HETATM 3707 O O1  . GOL C 2 .   ? -5.038  -12.989 15.563 1.00 26.18  ? 301 GOL B O1  1 
HETATM 3708 C C2  . GOL C 2 .   ? -5.352  -14.432 17.435 1.00 25.43  ? 301 GOL B C2  1 
HETATM 3709 O O2  . GOL C 2 .   ? -5.935  -13.277 18.083 1.00 26.19  ? 301 GOL B O2  1 
HETATM 3710 C C3  . GOL C 2 .   ? -5.966  -15.750 17.981 1.00 27.50  ? 301 GOL B C3  1 
HETATM 3711 O O3  . GOL C 2 .   ? -5.900  -15.877 19.440 1.00 24.83  ? 301 GOL B O3  1 
HETATM 3712 C C1  . GOL D 2 .   ? -14.737 -19.478 69.056 1.00 45.23  ? 301 GOL A C1  1 
HETATM 3713 O O1  . GOL D 2 .   ? -16.172 -19.349 69.060 1.00 47.94  ? 301 GOL A O1  1 
HETATM 3714 C C2  . GOL D 2 .   ? -13.942 -18.258 69.524 1.00 46.03  ? 301 GOL A C2  1 
HETATM 3715 O O2  . GOL D 2 .   ? -14.093 -17.179 68.602 1.00 51.71  ? 301 GOL A O2  1 
HETATM 3716 C C3  . GOL D 2 .   ? -12.429 -18.590 69.697 1.00 51.27  ? 301 GOL A C3  1 
HETATM 3717 O O3  . GOL D 2 .   ? -11.428 -17.504 69.750 1.00 45.24  ? 301 GOL A O3  1 
HETATM 3718 C C1  . GOL E 2 .   ? -0.197  -27.838 73.063 1.00 24.26  ? 302 GOL A C1  1 
HETATM 3719 O O1  . GOL E 2 .   ? -0.351  -27.182 71.771 1.00 24.56  ? 302 GOL A O1  1 
HETATM 3720 C C2  . GOL E 2 .   ? 1.011   -27.345 73.815 1.00 26.50  ? 302 GOL A C2  1 
HETATM 3721 O O2  . GOL E 2 .   ? 2.215   -27.773 73.152 1.00 27.20  ? 302 GOL A O2  1 
HETATM 3722 C C3  . GOL E 2 .   ? 1.025   -27.979 75.207 1.00 27.00  ? 302 GOL A C3  1 
HETATM 3723 O O3  . GOL E 2 .   ? 2.139   -27.334 75.830 1.00 29.71  ? 302 GOL A O3  1 
HETATM 3724 O O   . HOH F 3 .   ? -9.061  -17.276 23.072 1.00 8.39   ? 401 HOH B O   1 
HETATM 3725 O O   . HOH F 3 .   ? -0.857  -34.673 26.590 1.00 23.88  ? 402 HOH B O   1 
HETATM 3726 O O   . HOH F 3 .   ? -6.914  -38.746 13.370 1.00 32.05  ? 403 HOH B O   1 
HETATM 3727 O O   . HOH F 3 .   ? -12.003 -30.382 11.698 1.00 20.12  ? 404 HOH B O   1 
HETATM 3728 O O   . HOH F 3 .   ? -10.782 -1.461  26.524 1.00 27.65  ? 405 HOH B O   1 
HETATM 3729 O O   . HOH F 3 .   ? -8.595  -34.625 30.907 1.00 34.08  ? 406 HOH B O   1 
HETATM 3730 O O   . HOH F 3 .   ? -7.988  -28.033 33.235 1.00 24.63  ? 407 HOH B O   1 
HETATM 3731 O O   . HOH F 3 .   ? -7.077  -15.869 25.129 1.00 21.04  ? 408 HOH B O   1 
HETATM 3732 O O   . HOH F 3 .   ? -6.447  -31.734 25.105 1.00 23.06  ? 409 HOH B O   1 
HETATM 3733 O O   . HOH F 3 .   ? -6.105  -25.966 -1.136 1.00 47.36  ? 410 HOH B O   1 
HETATM 3734 O O   . HOH F 3 .   ? 4.085   -14.189 11.168 1.00 34.57  ? 411 HOH B O   1 
HETATM 3735 O O   . HOH F 3 .   ? -8.474  -45.402 30.670 1.00 59.77  ? 412 HOH B O   1 
HETATM 3736 O O   . HOH F 3 .   ? -9.165  -13.941 25.410 1.00 22.85  ? 413 HOH B O   1 
HETATM 3737 O O   . HOH F 3 .   ? 12.355  -16.918 25.218 1.00 50.39  ? 414 HOH B O   1 
HETATM 3738 O O   . HOH F 3 .   ? -22.008 -12.052 32.543 1.00 52.58  ? 415 HOH B O   1 
HETATM 3739 O O   . HOH F 3 .   ? -10.103 -47.091 13.699 1.00 34.19  ? 416 HOH B O   1 
HETATM 3740 O O   . HOH F 3 .   ? -11.372 -40.012 18.251 1.00 30.32  ? 417 HOH B O   1 
HETATM 3741 O O   . HOH F 3 .   ? -5.823  -45.771 14.323 1.00 34.40  ? 418 HOH B O   1 
HETATM 3742 O O   . HOH F 3 .   ? -2.045  -8.873  19.605 1.00 31.10  ? 419 HOH B O   1 
HETATM 3743 O O   . HOH F 3 .   ? -8.673  -26.646 30.863 1.00 21.89  ? 420 HOH B O   1 
HETATM 3744 O O   . HOH F 3 .   ? -18.060 -33.767 14.534 1.00 35.73  ? 421 HOH B O   1 
HETATM 3745 O O   . HOH F 3 .   ? -5.359  -10.809 17.282 1.00 33.93  ? 422 HOH B O   1 
HETATM 3746 O O   . HOH F 3 .   ? -6.795  -12.140 13.702 1.00 43.68  ? 423 HOH B O   1 
HETATM 3747 O O   . HOH F 3 .   ? -19.132 -15.230 32.855 1.00 36.46  ? 424 HOH B O   1 
HETATM 3748 O O   . HOH F 3 .   ? -3.327  -15.317 19.965 1.00 28.88  ? 425 HOH B O   1 
HETATM 3749 O O   . HOH F 3 .   ? -3.040  -40.031 22.182 1.00 26.39  ? 426 HOH B O   1 
HETATM 3750 O O   . HOH F 3 .   ? -10.356 -7.509  38.252 1.00 34.10  ? 427 HOH B O   1 
HETATM 3751 O O   . HOH F 3 .   ? -11.855 -32.077 9.489  1.00 30.66  ? 428 HOH B O   1 
HETATM 3752 O O   . HOH F 3 .   ? -15.556 -23.558 13.026 1.00 30.57  ? 429 HOH B O   1 
HETATM 3753 O O   . HOH F 3 .   ? 11.335  -13.400 28.760 1.00 54.30  ? 430 HOH B O   1 
HETATM 3754 O O   . HOH F 3 .   ? 5.201   -8.525  32.303 1.00 39.46  ? 431 HOH B O   1 
HETATM 3755 O O   . HOH F 3 .   ? 0.658   -27.456 26.981 1.00 24.82  ? 432 HOH B O   1 
HETATM 3756 O O   . HOH F 3 .   ? -18.602 -5.653  43.513 1.00 56.07  ? 433 HOH B O   1 
HETATM 3757 O O   . HOH F 3 .   ? 8.773   -19.213 14.275 1.00 38.41  ? 434 HOH B O   1 
HETATM 3758 O O   . HOH F 3 .   ? -14.221 -24.614 24.005 1.00 43.02  ? 435 HOH B O   1 
HETATM 3759 O O   . HOH F 3 .   ? -18.131 -13.526 28.347 1.00 32.01  ? 436 HOH B O   1 
HETATM 3760 O O   . HOH F 3 .   ? -4.008  -34.400 30.786 1.00 29.94  ? 437 HOH B O   1 
HETATM 3761 O O   . HOH F 3 .   ? -6.510  -30.027 31.648 1.00 32.27  ? 438 HOH B O   1 
HETATM 3762 O O   . HOH F 3 .   ? -0.080  -11.300 18.258 1.00 54.39  ? 439 HOH B O   1 
HETATM 3763 O O   . HOH F 3 .   ? -7.740  -5.097  39.302 1.00 31.18  ? 440 HOH B O   1 
HETATM 3764 O O   . HOH F 3 .   ? -18.379 -20.449 44.450 1.00 44.18  ? 441 HOH B O   1 
HETATM 3765 O O   . HOH F 3 .   ? -20.258 -7.631  39.407 1.00 47.98  ? 442 HOH B O   1 
HETATM 3766 O O   . HOH F 3 .   ? -19.089 -35.153 12.569 1.00 41.48  ? 443 HOH B O   1 
HETATM 3767 O O   . HOH F 3 .   ? -16.267 -18.594 42.103 1.00 26.29  ? 444 HOH B O   1 
HETATM 3768 O O   . HOH F 3 .   ? -5.904  5.543   33.491 1.00 35.23  ? 445 HOH B O   1 
HETATM 3769 O O   . HOH F 3 .   ? -11.999 4.190   29.818 1.00 41.80  ? 446 HOH B O   1 
HETATM 3770 O O   . HOH F 3 .   ? -21.586 -9.380  32.595 1.00 56.23  ? 447 HOH B O   1 
HETATM 3771 O O   . HOH F 3 .   ? -13.306 -39.702 25.260 1.00 31.00  ? 448 HOH B O   1 
HETATM 3772 O O   . HOH F 3 .   ? -5.705  -26.845 29.868 1.00 29.17  ? 449 HOH B O   1 
HETATM 3773 O O   . HOH F 3 .   ? -4.696  -20.097 18.036 1.00 27.59  ? 450 HOH B O   1 
HETATM 3774 O O   . HOH F 3 .   ? -11.646 -14.099 26.330 1.00 33.43  ? 451 HOH B O   1 
HETATM 3775 O O   . HOH F 3 .   ? 5.165   -10.906 35.208 1.00 32.70  ? 452 HOH B O   1 
HETATM 3776 O O   . HOH F 3 .   ? 6.510   -23.028 5.909  1.00 48.46  ? 453 HOH B O   1 
HETATM 3777 O O   . HOH F 3 .   ? 1.622   -28.419 37.953 1.00 43.96  ? 454 HOH B O   1 
HETATM 3778 O O   . HOH F 3 .   ? 2.209   -4.168  36.152 1.00 36.85  ? 455 HOH B O   1 
HETATM 3779 O O   . HOH F 3 .   ? 11.682  -20.728 18.116 1.00 45.53  ? 456 HOH B O   1 
HETATM 3780 O O   . HOH F 3 .   ? 12.519  -16.510 29.185 1.00 48.58  ? 457 HOH B O   1 
HETATM 3781 O O   . HOH F 3 .   ? -6.087  -21.858 45.623 1.00 21.95  ? 458 HOH B O   1 
HETATM 3782 O O   . HOH F 3 .   ? -12.822 -18.923 16.461 1.00 25.23  ? 459 HOH B O   1 
HETATM 3783 O O   . HOH F 3 .   ? -16.072 -36.510 26.253 1.00 28.38  ? 460 HOH B O   1 
HETATM 3784 O O   . HOH F 3 .   ? 5.589   -12.710 19.383 1.00 36.97  ? 461 HOH B O   1 
HETATM 3785 O O   . HOH F 3 .   ? -17.053 -34.809 10.973 1.00 29.66  ? 462 HOH B O   1 
HETATM 3786 O O   . HOH F 3 .   ? 3.378   -33.481 23.193 1.00 54.43  ? 463 HOH B O   1 
HETATM 3787 O O   . HOH F 3 .   ? -10.594 -11.915 12.682 1.00 39.09  ? 464 HOH B O   1 
HETATM 3788 O O   . HOH F 3 .   ? 8.874   -11.137 32.547 1.00 52.56  ? 465 HOH B O   1 
HETATM 3789 O O   . HOH F 3 .   ? 0.582   -36.854 23.249 1.00 34.26  ? 466 HOH B O   1 
HETATM 3790 O O   . HOH F 3 .   ? 11.165  -31.841 8.204  1.00 48.46  ? 467 HOH B O   1 
HETATM 3791 O O   . HOH F 3 .   ? 1.346   -41.337 12.718 1.00 46.01  ? 468 HOH B O   1 
HETATM 3792 O O   . HOH F 3 .   ? -1.818  -29.846 26.107 1.00 24.91  ? 469 HOH B O   1 
HETATM 3793 O O   . HOH F 3 .   ? -7.777  -45.967 12.640 1.00 32.22  ? 470 HOH B O   1 
HETATM 3794 O O   . HOH F 3 .   ? 5.003   -17.878 34.328 1.00 32.18  ? 471 HOH B O   1 
HETATM 3795 O O   . HOH F 3 .   ? 2.716   -1.056  32.887 1.00 38.78  ? 472 HOH B O   1 
HETATM 3796 O O   . HOH F 3 .   ? -23.131 -10.363 30.836 1.00 66.23  ? 473 HOH B O   1 
HETATM 3797 O O   . HOH F 3 .   ? 2.361   -29.826 40.334 1.00 54.79  ? 474 HOH B O   1 
HETATM 3798 O O   . HOH F 3 .   ? -20.157 -6.881  36.957 1.00 54.60  ? 475 HOH B O   1 
HETATM 3799 O O   . HOH F 3 .   ? -20.847 -37.338 29.730 1.00 56.69  ? 476 HOH B O   1 
HETATM 3800 O O   . HOH F 3 .   ? -7.483  -46.252 10.098 1.00 52.85  ? 477 HOH B O   1 
HETATM 3801 O O   . HOH F 3 .   ? -20.633 -11.480 28.529 1.00 48.07  ? 478 HOH B O   1 
HETATM 3802 O O   . HOH F 3 .   ? -1.021  -12.050 12.844 1.00 39.55  ? 479 HOH B O   1 
HETATM 3803 O O   . HOH F 3 .   ? -18.032 -36.752 31.259 1.00 67.64  ? 480 HOH B O   1 
HETATM 3804 O O   . HOH F 3 .   ? -0.514  -12.678 10.019 1.00 42.27  ? 481 HOH B O   1 
HETATM 3805 O O   . HOH F 3 .   ? -2.294  -29.248 33.406 1.00 38.71  ? 482 HOH B O   1 
HETATM 3806 O O   . HOH F 3 .   ? -11.316 -19.710 13.627 1.00 28.66  ? 483 HOH B O   1 
HETATM 3807 O O   . HOH F 3 .   ? -1.447  -19.102 39.701 1.00 43.72  ? 484 HOH B O   1 
HETATM 3808 O O   . HOH F 3 .   ? -13.786 -37.877 41.425 1.00 69.20  ? 485 HOH B O   1 
HETATM 3809 O O   . HOH F 3 .   ? -14.729 -38.933 27.300 1.00 35.98  ? 486 HOH B O   1 
HETATM 3810 O O   . HOH F 3 .   ? -15.332 -15.285 45.006 1.00 38.26  ? 487 HOH B O   1 
HETATM 3811 O O   . HOH F 3 .   ? -3.841  7.308   32.696 1.00 35.38  ? 488 HOH B O   1 
HETATM 3812 O O   . HOH F 3 .   ? -14.688 -41.815 15.753 1.00 27.72  ? 489 HOH B O   1 
HETATM 3813 O O   . HOH F 3 .   ? -17.564 -7.429  36.092 1.00 34.55  ? 490 HOH B O   1 
HETATM 3814 O O   . HOH F 3 .   ? -6.876  -49.352 15.985 1.00 38.63  ? 491 HOH B O   1 
HETATM 3815 O O   . HOH F 3 .   ? -3.744  -30.084 31.360 1.00 26.83  ? 492 HOH B O   1 
HETATM 3816 O O   . HOH F 3 .   ? 13.717  -19.152 19.727 1.00 62.24  ? 493 HOH B O   1 
HETATM 3817 O O   . HOH F 3 .   ? -17.535 -31.226 14.797 1.00 42.13  ? 494 HOH B O   1 
HETATM 3818 O O   . HOH F 3 .   ? -10.955 -21.776 7.720  1.00 41.82  ? 495 HOH B O   1 
HETATM 3819 O O   . HOH F 3 .   ? 1.588   -9.363  20.173 1.00 41.16  ? 496 HOH B O   1 
HETATM 3820 O O   . HOH F 3 .   ? -6.420  -4.583  11.011 1.00 38.35  ? 497 HOH B O   1 
HETATM 3821 O O   . HOH F 3 .   ? 0.385   -32.724 21.258 1.00 36.08  ? 498 HOH B O   1 
HETATM 3822 O O   . HOH F 3 .   ? -21.720 -21.526 31.457 1.00 48.89  ? 499 HOH B O   1 
HETATM 3823 O O   . HOH F 3 .   ? 2.763   -32.164 3.279  1.00 59.83  ? 500 HOH B O   1 
HETATM 3824 O O   . HOH F 3 .   ? -21.592 -16.827 37.747 1.00 34.29  ? 501 HOH B O   1 
HETATM 3825 O O   . HOH F 3 .   ? 0.300   -47.852 16.956 1.00 57.75  ? 502 HOH B O   1 
HETATM 3826 O O   . HOH F 3 .   ? -1.346  -44.094 20.957 1.00 45.98  ? 503 HOH B O   1 
HETATM 3827 O O   . HOH F 3 .   ? 6.798   -8.115  23.643 1.00 48.49  ? 504 HOH B O   1 
HETATM 3828 O O   . HOH F 3 .   ? -7.429  -43.250 11.487 1.00 36.35  ? 505 HOH B O   1 
HETATM 3829 O O   . HOH F 3 .   ? -5.427  -16.757 44.264 1.00 33.23  ? 506 HOH B O   1 
HETATM 3830 O O   . HOH F 3 .   ? -9.830  -35.754 36.036 1.00 55.05  ? 507 HOH B O   1 
HETATM 3831 O O   . HOH F 3 .   ? -3.944  -16.350 41.043 1.00 32.27  ? 508 HOH B O   1 
HETATM 3832 O O   . HOH F 3 .   ? -20.866 -15.969 14.836 1.00 43.77  ? 509 HOH B O   1 
HETATM 3833 O O   . HOH F 3 .   ? -14.899 -13.719 49.904 1.00 60.71  ? 510 HOH B O   1 
HETATM 3834 O O   . HOH F 3 .   ? -2.318  -13.651 15.482 1.00 26.46  ? 511 HOH B O   1 
HETATM 3835 O O   . HOH F 3 .   ? -4.425  -22.716 14.427 1.00 24.98  ? 512 HOH B O   1 
HETATM 3836 O O   . HOH F 3 .   ? -19.461 -23.752 18.792 1.00 54.42  ? 513 HOH B O   1 
HETATM 3837 O O   . HOH F 3 .   ? -7.959  6.284   35.621 1.00 40.59  ? 514 HOH B O   1 
HETATM 3838 O O   . HOH F 3 .   ? -19.009 -27.053 41.815 1.00 39.24  ? 515 HOH B O   1 
HETATM 3839 O O   . HOH F 3 .   ? 5.179   -6.213  24.300 1.00 28.42  ? 516 HOH B O   1 
HETATM 3840 O O   . HOH F 3 .   ? -3.198  -41.602 10.148 1.00 50.78  ? 517 HOH B O   1 
HETATM 3841 O O   . HOH F 3 .   ? -10.237 -46.807 23.828 1.00 63.42  ? 518 HOH B O   1 
HETATM 3842 O O   . HOH F 3 .   ? -2.281  -13.460 18.415 1.00 23.61  ? 519 HOH B O   1 
HETATM 3843 O O   . HOH F 3 .   ? -1.610  -44.803 16.138 1.00 58.77  ? 520 HOH B O   1 
HETATM 3844 O O   . HOH F 3 .   ? -5.654  -37.936 7.528  1.00 38.52  ? 521 HOH B O   1 
HETATM 3845 O O   . HOH F 3 .   ? 1.731   -23.932 3.277  1.00 57.55  ? 522 HOH B O   1 
HETATM 3846 O O   . HOH F 3 .   ? 0.774   -31.463 23.883 1.00 32.79  ? 523 HOH B O   1 
HETATM 3847 O O   . HOH F 3 .   ? 14.632  -15.789 20.245 1.00 50.46  ? 524 HOH B O   1 
HETATM 3848 O O   . HOH F 3 .   ? 3.797   -8.802  36.121 1.00 39.68  ? 525 HOH B O   1 
HETATM 3849 O O   . HOH F 3 .   ? -5.840  -34.294 9.321  1.00 40.08  ? 526 HOH B O   1 
HETATM 3850 O O   . HOH F 3 .   ? 7.614   -7.548  29.996 1.00 37.29  ? 527 HOH B O   1 
HETATM 3851 O O   . HOH F 3 .   ? -3.476  -28.758 35.357 1.00 45.78  ? 528 HOH B O   1 
HETATM 3852 O O   . HOH F 3 .   ? 5.308   -21.984 33.463 1.00 47.02  ? 529 HOH B O   1 
HETATM 3853 O O   . HOH F 3 .   ? -18.149 -33.157 28.179 1.00 42.61  ? 530 HOH B O   1 
HETATM 3854 O O   . HOH F 3 .   ? 11.604  -29.519 24.114 1.00 38.51  ? 531 HOH B O   1 
HETATM 3855 O O   . HOH F 3 .   ? -16.241 -29.609 25.690 1.00 49.66  ? 532 HOH B O   1 
HETATM 3856 O O   . HOH F 3 .   ? -0.002  -17.369 40.341 1.00 41.55  ? 533 HOH B O   1 
HETATM 3857 O O   . HOH F 3 .   ? -16.165 -35.899 36.772 1.00 65.34  ? 534 HOH B O   1 
HETATM 3858 O O   . HOH F 3 .   ? -3.445  -18.958 40.887 1.00 31.01  ? 535 HOH B O   1 
HETATM 3859 O O   . HOH F 3 .   ? -1.435  -39.793 9.414  1.00 58.08  ? 536 HOH B O   1 
HETATM 3860 O O   . HOH F 3 .   ? -16.756 -36.151 8.875  1.00 34.52  ? 537 HOH B O   1 
HETATM 3861 O O   . HOH F 3 .   ? -15.733 -9.839  19.495 1.00 46.38  ? 538 HOH B O   1 
HETATM 3862 O O   . HOH F 3 .   ? -12.839 -12.200 25.009 1.00 31.41  ? 539 HOH B O   1 
HETATM 3863 O O   . HOH F 3 .   ? -13.907 -27.881 9.446  1.00 40.82  ? 540 HOH B O   1 
HETATM 3864 O O   . HOH F 3 .   ? -17.626 -30.291 11.754 1.00 38.00  ? 541 HOH B O   1 
HETATM 3865 O O   . HOH F 3 .   ? 14.955  -16.082 22.659 1.00 62.10  ? 542 HOH B O   1 
HETATM 3866 O O   . HOH F 3 .   ? 10.249  -9.834  21.204 1.00 61.68  ? 543 HOH B O   1 
HETATM 3867 O O   . HOH F 3 .   ? -18.732 -36.679 25.874 1.00 46.09  ? 544 HOH B O   1 
HETATM 3868 O O   . HOH F 3 .   ? 5.897   -7.617  38.209 1.00 52.35  ? 545 HOH B O   1 
HETATM 3869 O O   . HOH F 3 .   ? -19.355 -30.638 20.995 1.00 46.88  ? 546 HOH B O   1 
HETATM 3870 O O   . HOH F 3 .   ? -15.149 -27.297 26.272 1.00 52.54  ? 547 HOH B O   1 
HETATM 3871 O O   . HOH F 3 .   ? -18.806 -32.903 19.179 1.00 45.05  ? 548 HOH B O   1 
HETATM 3872 O O   . HOH F 3 .   ? 14.032  -30.398 25.445 1.00 48.86  ? 549 HOH B O   1 
HETATM 3873 O O   . HOH F 3 .   ? -23.452 -19.075 37.664 1.00 49.18  ? 550 HOH B O   1 
HETATM 3874 O O   . HOH F 3 .   ? 8.670   -33.088 8.698  1.00 46.16  ? 551 HOH B O   1 
HETATM 3875 O O   . HOH F 3 .   ? -15.376 -5.473  21.135 1.00 45.74  ? 552 HOH B O   1 
HETATM 3876 O O   . HOH F 3 .   ? -7.012  -45.767 19.129 1.00 21.88  ? 553 HOH B O   1 
HETATM 3877 O O   . HOH F 3 .   ? -7.508  -46.110 16.514 1.00 36.28  ? 554 HOH B O   1 
HETATM 3878 O O   . HOH F 3 .   ? -10.077 -46.483 15.888 1.00 29.87  ? 555 HOH B O   1 
HETATM 3879 O O   . HOH F 3 .   ? -7.257  -43.472 28.776 1.00 28.91  ? 556 HOH B O   1 
HETATM 3880 O O   . HOH F 3 .   ? -9.009  -37.401 9.907  1.00 34.92  ? 557 HOH B O   1 
HETATM 3881 O O   . HOH F 3 .   ? 7.321   -17.886 31.898 1.00 52.33  ? 558 HOH B O   1 
HETATM 3882 O O   . HOH F 3 .   ? -20.839 -24.083 41.928 1.00 42.24  ? 559 HOH B O   1 
HETATM 3883 O O   . HOH F 3 .   ? 9.706   -14.050 31.402 1.00 36.30  ? 560 HOH B O   1 
HETATM 3884 O O   . HOH F 3 .   ? -4.926  4.650   30.103 1.00 47.82  ? 561 HOH B O   1 
HETATM 3885 O O   . HOH F 3 .   ? -17.451 -29.000 20.335 1.00 47.57  ? 562 HOH B O   1 
HETATM 3886 O O   . HOH F 3 .   ? -6.871  -13.109 46.502 1.00 39.73  ? 563 HOH B O   1 
HETATM 3887 O O   . HOH F 3 .   ? 17.738  -19.302 9.344  1.00 65.57  ? 564 HOH B O   1 
HETATM 3888 O O   . HOH F 3 .   ? -10.538 -16.496 53.164 1.00 36.35  ? 565 HOH B O   1 
HETATM 3889 O O   . HOH F 3 .   ? -17.070 -0.049  26.819 1.00 37.88  ? 566 HOH B O   1 
HETATM 3890 O O   . HOH F 3 .   ? 5.365   -27.474 6.549  1.00 53.03  ? 567 HOH B O   1 
HETATM 3891 O O   . HOH F 3 .   ? -14.714 -5.224  23.468 1.00 40.13  ? 568 HOH B O   1 
HETATM 3892 O O   . HOH F 3 .   ? -12.829 -34.416 41.321 1.00 45.93  ? 569 HOH B O   1 
HETATM 3893 O O   . HOH F 3 .   ? -12.266 -10.439 48.949 1.00 58.94  ? 570 HOH B O   1 
HETATM 3894 O O   . HOH F 3 .   ? -0.023  7.305   30.181 1.00 30.15  ? 571 HOH B O   1 
HETATM 3895 O O   . HOH F 3 .   ? -10.042 3.497   38.855 1.00 47.48  ? 572 HOH B O   1 
HETATM 3896 O O   . HOH F 3 .   ? -18.500 -22.992 43.435 1.00 44.15  ? 573 HOH B O   1 
HETATM 3897 O O   . HOH F 3 .   ? 6.517   -15.003 19.893 1.00 27.81  ? 574 HOH B O   1 
HETATM 3898 O O   . HOH F 3 .   ? -5.444  -31.215 36.002 1.00 42.80  ? 575 HOH B O   1 
HETATM 3899 O O   . HOH F 3 .   ? 3.449   -6.507  32.056 1.00 48.92  ? 576 HOH B O   1 
HETATM 3900 O O   . HOH F 3 .   ? -5.181  -41.469 25.918 1.00 34.11  ? 577 HOH B O   1 
HETATM 3901 O O   . HOH F 3 .   ? -5.465  -36.734 30.960 1.00 29.11  ? 578 HOH B O   1 
HETATM 3902 O O   . HOH F 3 .   ? 4.443   -19.975 35.784 1.00 42.33  ? 579 HOH B O   1 
HETATM 3903 O O   . HOH F 3 .   ? 0.246   -39.087 11.281 1.00 38.22  ? 580 HOH B O   1 
HETATM 3904 O O   . HOH F 3 .   ? -17.729 -8.470  33.537 1.00 42.76  ? 581 HOH B O   1 
HETATM 3905 O O   . HOH F 3 .   ? 6.923   -30.700 25.162 1.00 46.16  ? 582 HOH B O   1 
HETATM 3906 O O   . HOH F 3 .   ? 4.785   -31.010 6.414  1.00 64.05  ? 583 HOH B O   1 
HETATM 3907 O O   . HOH F 3 .   ? 2.723   -7.296  40.249 1.00 43.74  ? 584 HOH B O   1 
HETATM 3908 O O   . HOH F 3 .   ? -14.016 -1.346  17.655 1.00 57.78  ? 585 HOH B O   1 
HETATM 3909 O O   . HOH F 3 .   ? -22.973 -14.758 38.208 1.00 44.99  ? 586 HOH B O   1 
HETATM 3910 O O   . HOH F 3 .   ? 1.932   -33.261 8.212  1.00 35.04  ? 587 HOH B O   1 
HETATM 3911 O O   . HOH F 3 .   ? -21.064 -21.475 49.401 1.00 59.64  ? 588 HOH B O   1 
HETATM 3912 O O   . HOH F 3 .   ? 19.879  -25.481 15.131 1.00 57.56  ? 589 HOH B O   1 
HETATM 3913 O O   . HOH F 3 .   ? 6.253   -13.224 16.826 1.00 30.29  ? 590 HOH B O   1 
HETATM 3914 O O   . HOH F 3 .   ? 0.440   1.033   25.778 1.00 66.90  ? 591 HOH B O   1 
HETATM 3915 O O   . HOH F 3 .   ? 3.584   0.961   27.914 1.00 54.92  ? 592 HOH B O   1 
HETATM 3916 O O   . HOH F 3 .   ? -15.612 -7.738  31.492 1.00 42.29  ? 593 HOH B O   1 
HETATM 3917 O O   . HOH F 3 .   ? -6.458  -19.769 3.354  1.00 50.14  ? 594 HOH B O   1 
HETATM 3918 O O   . HOH F 3 .   ? -9.032  -37.319 12.489 1.00 30.64  ? 595 HOH B O   1 
HETATM 3919 O O   . HOH F 3 .   ? -13.903 -6.000  32.125 1.00 52.17  ? 596 HOH B O   1 
HETATM 3920 O O   . HOH F 3 .   ? -17.632 -16.607 19.018 1.00 42.61  ? 597 HOH B O   1 
HETATM 3921 O O   . HOH F 3 .   ? -4.241  -18.741 43.317 1.00 41.50  ? 598 HOH B O   1 
HETATM 3922 O O   . HOH F 3 .   ? -16.835 -30.782 19.188 1.00 44.58  ? 599 HOH B O   1 
HETATM 3923 O O   . HOH F 3 .   ? -11.246 1.112   45.757 1.00 52.97  ? 600 HOH B O   1 
HETATM 3924 O O   . HOH F 3 .   ? -4.087  0.028   41.893 1.00 64.51  ? 601 HOH B O   1 
HETATM 3925 O O   . HOH F 3 .   ? -17.984 -40.496 20.964 1.00 27.96  ? 602 HOH B O   1 
HETATM 3926 O O   . HOH F 3 .   ? -10.359 -12.417 50.788 1.00 53.42  ? 603 HOH B O   1 
HETATM 3927 O O   . HOH F 3 .   ? -4.849  -7.196  11.976 1.00 45.50  ? 604 HOH B O   1 
HETATM 3928 O O   . HOH F 3 .   ? -6.103  1.999   42.241 1.00 49.45  ? 605 HOH B O   1 
HETATM 3929 O O   . HOH F 3 .   ? -11.285 3.295   41.785 1.00 58.27  ? 606 HOH B O   1 
HETATM 3930 O O   . HOH F 3 .   ? -19.929 -37.162 23.404 1.00 49.14  ? 607 HOH B O   1 
HETATM 3931 O O   . HOH F 3 .   ? -5.794  -40.244 11.499 1.00 38.76  ? 608 HOH B O   1 
HETATM 3932 O O   . HOH F 3 .   ? -21.535 -27.174 35.679 1.00 39.14  ? 609 HOH B O   1 
HETATM 3933 O O   . HOH F 3 .   ? -22.771 -28.158 33.474 1.00 48.83  ? 610 HOH B O   1 
HETATM 3934 O O   . HOH F 3 .   ? 5.408   -20.294 5.954  1.00 56.10  ? 611 HOH B O   1 
HETATM 3935 O O   . HOH F 3 .   ? -1.694  -38.587 28.868 1.00 40.65  ? 612 HOH B O   1 
HETATM 3936 O O   . HOH F 3 .   ? 14.272  -17.042 18.333 1.00 52.30  ? 613 HOH B O   1 
HETATM 3937 O O   . HOH G 3 .   ? 5.642   -11.169 60.459 1.00 16.18  ? 401 HOH A O   1 
HETATM 3938 O O   . HOH G 3 .   ? 10.495  -16.300 69.207 1.00 22.69  ? 402 HOH A O   1 
HETATM 3939 O O   . HOH G 3 .   ? -4.799  -26.290 73.040 1.00 22.81  ? 403 HOH A O   1 
HETATM 3940 O O   . HOH G 3 .   ? 14.024  -31.948 64.750 1.00 31.48  ? 404 HOH A O   1 
HETATM 3941 O O   . HOH G 3 .   ? 4.730   -26.966 73.850 1.00 27.68  ? 405 HOH A O   1 
HETATM 3942 O O   . HOH G 3 .   ? -24.381 -32.591 78.207 1.00 33.65  ? 406 HOH A O   1 
HETATM 3943 O O   . HOH G 3 .   ? -23.677 -20.423 70.110 1.00 25.01  ? 407 HOH A O   1 
HETATM 3944 O O   . HOH G 3 .   ? -3.546  -34.717 73.414 1.00 24.20  ? 408 HOH A O   1 
HETATM 3945 O O   . HOH G 3 .   ? 1.905   -15.828 76.717 1.00 29.33  ? 409 HOH A O   1 
HETATM 3946 O O   . HOH G 3 .   ? -15.860 -27.394 65.831 1.00 16.66  ? 410 HOH A O   1 
HETATM 3947 O O   . HOH G 3 .   ? -10.762 -25.320 61.045 1.00 16.34  ? 411 HOH A O   1 
HETATM 3948 O O   . HOH G 3 .   ? -21.158 -20.528 67.819 1.00 23.88  ? 412 HOH A O   1 
HETATM 3949 O O   . HOH G 3 .   ? -23.444 -34.577 63.690 1.00 22.65  ? 413 HOH A O   1 
HETATM 3950 O O   . HOH G 3 .   ? 2.979   -10.495 62.416 1.00 19.28  ? 414 HOH A O   1 
HETATM 3951 O O   . HOH G 3 .   ? -1.557  -29.766 67.388 1.00 5.63   ? 415 HOH A O   1 
HETATM 3952 O O   . HOH G 3 .   ? 7.816   -38.945 68.275 1.00 56.51  ? 416 HOH A O   1 
HETATM 3953 O O   . HOH G 3 .   ? 2.594   -21.939 48.482 1.00 42.93  ? 417 HOH A O   1 
HETATM 3954 O O   . HOH G 3 .   ? -4.727  -39.736 76.549 1.00 46.36  ? 418 HOH A O   1 
HETATM 3955 O O   . HOH G 3 .   ? 1.663   -29.706 65.381 1.00 25.62  ? 419 HOH A O   1 
HETATM 3956 O O   . HOH G 3 .   ? -27.275 -38.620 68.532 1.00 48.70  ? 420 HOH A O   1 
HETATM 3957 O O   . HOH G 3 .   ? 2.197   -23.743 73.389 1.00 25.03  ? 421 HOH A O   1 
HETATM 3958 O O   . HOH G 3 .   ? 17.106  -22.304 46.086 1.00 53.66  ? 422 HOH A O   1 
HETATM 3959 O O   . HOH G 3 .   ? -23.726 -30.227 77.391 1.00 24.74  ? 423 HOH A O   1 
HETATM 3960 O O   . HOH G 3 .   ? -5.072  -16.644 47.207 1.00 37.64  ? 424 HOH A O   1 
HETATM 3961 O O   . HOH G 3 .   ? 9.180   -25.399 75.937 1.00 52.73  ? 425 HOH A O   1 
HETATM 3962 O O   . HOH G 3 .   ? -27.811 -28.804 63.733 1.00 26.63  ? 426 HOH A O   1 
HETATM 3963 O O   . HOH G 3 .   ? -19.744 -36.470 62.137 1.00 25.81  ? 427 HOH A O   1 
HETATM 3964 O O   . HOH G 3 .   ? 6.414   -35.772 63.896 1.00 42.51  ? 428 HOH A O   1 
HETATM 3965 O O   . HOH G 3 .   ? 0.097   -38.305 66.805 1.00 39.71  ? 429 HOH A O   1 
HETATM 3966 O O   . HOH G 3 .   ? -4.207  -24.051 45.474 1.00 20.01  ? 430 HOH A O   1 
HETATM 3967 O O   . HOH G 3 .   ? 14.835  -21.910 71.512 1.00 37.11  ? 431 HOH A O   1 
HETATM 3968 O O   . HOH G 3 .   ? 13.301  -32.542 50.041 1.00 38.34  ? 432 HOH A O   1 
HETATM 3969 O O   . HOH G 3 .   ? -10.716 -28.095 59.672 1.00 22.74  ? 433 HOH A O   1 
HETATM 3970 O O   . HOH G 3 .   ? -30.501 -29.642 64.540 1.00 44.11  ? 434 HOH A O   1 
HETATM 3971 O O   . HOH G 3 .   ? -12.066 -40.717 56.410 1.00 43.15  ? 435 HOH A O   1 
HETATM 3972 O O   . HOH G 3 .   ? -7.212  -36.836 81.644 1.00 65.07  ? 436 HOH A O   1 
HETATM 3973 O O   . HOH G 3 .   ? -34.332 -22.082 76.265 1.00 52.91  ? 437 HOH A O   1 
HETATM 3974 O O   . HOH G 3 .   ? 9.236   -33.599 42.517 1.00 47.52  ? 438 HOH A O   1 
HETATM 3975 O O   . HOH G 3 .   ? -0.909  -39.139 69.302 1.00 45.30  ? 439 HOH A O   1 
HETATM 3976 O O   . HOH G 3 .   ? -24.212 -34.849 70.896 1.00 20.98  ? 440 HOH A O   1 
HETATM 3977 O O   . HOH G 3 .   ? -6.113  -36.482 46.077 1.00 34.42  ? 441 HOH A O   1 
HETATM 3978 O O   . HOH G 3 .   ? -30.180 -33.604 73.375 1.00 31.69  ? 442 HOH A O   1 
HETATM 3979 O O   . HOH G 3 .   ? -29.003 -30.259 56.335 1.00 39.10  ? 443 HOH A O   1 
HETATM 3980 O O   . HOH G 3 .   ? 1.578   -33.841 46.057 1.00 31.23  ? 444 HOH A O   1 
HETATM 3981 O O   . HOH G 3 .   ? -19.346 -8.575  83.068 1.00 56.48  ? 445 HOH A O   1 
HETATM 3982 O O   . HOH G 3 .   ? 4.862   -34.070 72.798 1.00 45.38  ? 446 HOH A O   1 
HETATM 3983 O O   . HOH G 3 .   ? 0.772   -23.716 47.431 1.00 36.00  ? 447 HOH A O   1 
HETATM 3984 O O   . HOH G 3 .   ? 18.501  -20.803 61.925 1.00 22.60  ? 448 HOH A O   1 
HETATM 3985 O O   . HOH G 3 .   ? -26.790 -38.326 71.220 1.00 37.84  ? 449 HOH A O   1 
HETATM 3986 O O   . HOH G 3 .   ? -12.180 -20.857 89.325 1.00 57.92  ? 450 HOH A O   1 
HETATM 3987 O O   . HOH G 3 .   ? 9.256   -29.221 53.586 1.00 23.87  ? 451 HOH A O   1 
HETATM 3988 O O   . HOH G 3 .   ? 0.087   -15.074 73.088 1.00 24.89  ? 452 HOH A O   1 
HETATM 3989 O O   . HOH G 3 .   ? -14.230 -30.329 57.286 1.00 53.75  ? 453 HOH A O   1 
HETATM 3990 O O   . HOH G 3 .   ? 16.983  -24.493 57.903 1.00 29.15  ? 454 HOH A O   1 
HETATM 3991 O O   . HOH G 3 .   ? 6.908   -25.673 47.810 1.00 27.60  ? 455 HOH A O   1 
HETATM 3992 O O   . HOH G 3 .   ? 8.357   -16.445 71.607 1.00 41.75  ? 456 HOH A O   1 
HETATM 3993 O O   . HOH G 3 .   ? -0.230  -39.218 57.488 1.00 32.93  ? 457 HOH A O   1 
HETATM 3994 O O   . HOH G 3 .   ? -18.537 -26.420 55.104 1.00 63.53  ? 458 HOH A O   1 
HETATM 3995 O O   . HOH G 3 .   ? 14.610  -15.454 70.581 1.00 36.69  ? 459 HOH A O   1 
HETATM 3996 O O   . HOH G 3 .   ? -4.054  -14.017 79.021 1.00 30.34  ? 460 HOH A O   1 
HETATM 3997 O O   . HOH G 3 .   ? 21.249  -32.965 63.118 1.00 63.70  ? 461 HOH A O   1 
HETATM 3998 O O   . HOH G 3 .   ? 4.670   -6.620  75.308 1.00 52.35  ? 462 HOH A O   1 
HETATM 3999 O O   . HOH G 3 .   ? 0.261   -24.633 71.561 1.00 18.64  ? 463 HOH A O   1 
HETATM 4000 O O   . HOH G 3 .   ? -4.349  -31.566 86.772 1.00 48.75  ? 464 HOH A O   1 
HETATM 4001 O O   . HOH G 3 .   ? 0.217   -7.714  64.625 1.00 43.30  ? 465 HOH A O   1 
HETATM 4002 O O   . HOH G 3 .   ? -4.076  -34.142 76.028 1.00 29.10  ? 466 HOH A O   1 
HETATM 4003 O O   . HOH G 3 .   ? -2.230  -38.325 76.548 1.00 50.55  ? 467 HOH A O   1 
HETATM 4004 O O   . HOH G 3 .   ? -8.133  -12.019 77.964 1.00 42.25  ? 468 HOH A O   1 
HETATM 4005 O O   . HOH G 3 .   ? -3.546  -12.161 56.967 1.00 34.72  ? 469 HOH A O   1 
HETATM 4006 O O   . HOH G 3 .   ? 7.512   -36.754 61.560 1.00 50.49  ? 470 HOH A O   1 
HETATM 4007 O O   . HOH G 3 .   ? -25.364 -41.297 70.143 1.00 46.87  ? 471 HOH A O   1 
HETATM 4008 O O   . HOH G 3 .   ? 6.340   -33.701 39.128 1.00 51.55  ? 472 HOH A O   1 
HETATM 4009 O O   . HOH G 3 .   ? -0.486  -22.478 83.318 1.00 39.91  ? 473 HOH A O   1 
HETATM 4010 O O   . HOH G 3 .   ? -16.272 -36.001 79.856 1.00 22.57  ? 474 HOH A O   1 
HETATM 4011 O O   . HOH G 3 .   ? -4.138  -39.246 81.275 1.00 56.24  ? 475 HOH A O   1 
HETATM 4012 O O   . HOH G 3 .   ? -13.771 -11.442 83.011 1.00 48.96  ? 476 HOH A O   1 
HETATM 4013 O O   . HOH G 3 .   ? -20.148 -21.393 65.524 1.00 23.74  ? 477 HOH A O   1 
HETATM 4014 O O   . HOH G 3 .   ? -20.229 -25.365 53.611 1.00 54.23  ? 478 HOH A O   1 
HETATM 4015 O O   . HOH G 3 .   ? -21.549 -10.017 81.602 1.00 33.10  ? 479 HOH A O   1 
HETATM 4016 O O   . HOH G 3 .   ? -20.483 -22.291 84.464 1.00 39.48  ? 480 HOH A O   1 
HETATM 4017 O O   . HOH G 3 .   ? 17.203  -16.490 72.322 1.00 61.76  ? 481 HOH A O   1 
HETATM 4018 O O   . HOH G 3 .   ? 11.985  -27.109 52.605 1.00 22.16  ? 482 HOH A O   1 
HETATM 4019 O O   . HOH G 3 .   ? -4.884  -38.422 62.102 1.00 33.69  ? 483 HOH A O   1 
HETATM 4020 O O   . HOH G 3 .   ? -14.524 -35.486 77.626 1.00 19.62  ? 484 HOH A O   1 
HETATM 4021 O O   . HOH G 3 .   ? -12.638 -23.822 62.737 1.00 22.13  ? 485 HOH A O   1 
HETATM 4022 O O   . HOH G 3 .   ? 7.272   -15.408 58.843 1.00 21.24  ? 486 HOH A O   1 
HETATM 4023 O O   . HOH G 3 .   ? 4.473   -25.571 45.510 1.00 34.29  ? 487 HOH A O   1 
HETATM 4024 O O   . HOH G 3 .   ? 7.469   -31.077 54.805 1.00 24.55  ? 488 HOH A O   1 
HETATM 4025 O O   . HOH G 3 .   ? 11.869  -30.991 55.772 1.00 37.46  ? 489 HOH A O   1 
HETATM 4026 O O   . HOH G 3 .   ? -17.059 -21.222 65.232 1.00 37.24  ? 490 HOH A O   1 
HETATM 4027 O O   . HOH G 3 .   ? 16.887  -21.215 64.125 1.00 24.72  ? 491 HOH A O   1 
HETATM 4028 O O   . HOH G 3 .   ? -0.101  -27.557 65.965 1.00 26.43  ? 492 HOH A O   1 
HETATM 4029 O O   . HOH G 3 .   ? 0.577   -41.309 50.817 1.00 29.18  ? 493 HOH A O   1 
HETATM 4030 O O   . HOH G 3 .   ? 10.425  -12.405 65.091 1.00 29.24  ? 494 HOH A O   1 
HETATM 4031 O O   . HOH G 3 .   ? 20.535  -27.852 51.826 1.00 33.97  ? 495 HOH A O   1 
HETATM 4032 O O   . HOH G 3 .   ? -14.419 -22.056 65.999 1.00 25.18  ? 496 HOH A O   1 
HETATM 4033 O O   . HOH G 3 .   ? -5.748  -38.524 59.085 1.00 41.43  ? 497 HOH A O   1 
HETATM 4034 O O   . HOH G 3 .   ? -7.589  -10.390 83.064 1.00 35.88  ? 498 HOH A O   1 
HETATM 4035 O O   . HOH G 3 .   ? -11.284 -39.697 52.895 1.00 38.79  ? 499 HOH A O   1 
HETATM 4036 O O   . HOH G 3 .   ? -26.801 -24.190 59.651 1.00 35.38  ? 500 HOH A O   1 
HETATM 4037 O O   . HOH G 3 .   ? 3.448   -24.185 43.526 1.00 44.08  ? 501 HOH A O   1 
HETATM 4038 O O   . HOH G 3 .   ? -6.372  -40.842 50.591 1.00 33.09  ? 502 HOH A O   1 
HETATM 4039 O O   . HOH G 3 .   ? -4.787  -34.887 40.780 1.00 62.83  ? 503 HOH A O   1 
HETATM 4040 O O   . HOH G 3 .   ? -13.206 -40.530 73.962 1.00 43.34  ? 504 HOH A O   1 
HETATM 4041 O O   . HOH G 3 .   ? -13.837 -14.686 61.509 1.00 38.27  ? 505 HOH A O   1 
HETATM 4042 O O   . HOH G 3 .   ? -29.211 -24.265 57.162 1.00 39.77  ? 506 HOH A O   1 
HETATM 4043 O O   . HOH G 3 .   ? -24.970 -25.944 65.892 1.00 18.17  ? 507 HOH A O   1 
HETATM 4044 O O   . HOH G 3 .   ? 18.002  -22.431 48.903 1.00 47.12  ? 508 HOH A O   1 
HETATM 4045 O O   . HOH G 3 .   ? -15.358 -33.096 58.062 1.00 39.38  ? 509 HOH A O   1 
HETATM 4046 O O   . HOH G 3 .   ? -1.940  -35.482 47.807 1.00 28.29  ? 510 HOH A O   1 
HETATM 4047 O O   . HOH G 3 .   ? -0.326  -39.193 71.618 1.00 48.92  ? 511 HOH A O   1 
HETATM 4048 O O   . HOH G 3 .   ? -16.103 -25.566 89.143 1.00 42.87  ? 512 HOH A O   1 
HETATM 4049 O O   . HOH G 3 .   ? -12.726 -24.132 86.689 1.00 39.25  ? 513 HOH A O   1 
HETATM 4050 O O   . HOH G 3 .   ? -10.322 -3.829  79.404 1.00 57.73  ? 514 HOH A O   1 
HETATM 4051 O O   . HOH G 3 .   ? -12.736 -37.858 62.631 1.00 32.66  ? 515 HOH A O   1 
HETATM 4052 O O   . HOH G 3 .   ? -28.765 -36.755 74.664 1.00 24.65  ? 516 HOH A O   1 
HETATM 4053 O O   . HOH G 3 .   ? -3.059  -15.687 52.035 1.00 60.80  ? 517 HOH A O   1 
HETATM 4054 O O   . HOH G 3 .   ? -11.702 -27.108 57.587 1.00 33.08  ? 518 HOH A O   1 
HETATM 4055 O O   . HOH G 3 .   ? -14.609 -22.875 60.312 1.00 43.80  ? 519 HOH A O   1 
HETATM 4056 O O   . HOH G 3 .   ? -18.512 -29.767 80.939 1.00 30.17  ? 520 HOH A O   1 
HETATM 4057 O O   . HOH G 3 .   ? 8.642   -37.892 54.819 1.00 34.75  ? 521 HOH A O   1 
HETATM 4058 O O   . HOH G 3 .   ? -15.549 -28.234 57.788 1.00 34.77  ? 522 HOH A O   1 
HETATM 4059 O O   . HOH G 3 .   ? -5.890  -13.838 69.904 1.00 41.09  ? 523 HOH A O   1 
HETATM 4060 O O   . HOH G 3 .   ? -25.654 -22.854 80.458 1.00 33.06  ? 524 HOH A O   1 
HETATM 4061 O O   . HOH G 3 .   ? -6.727  -10.208 61.682 1.00 37.42  ? 525 HOH A O   1 
HETATM 4062 O O   . HOH G 3 .   ? -11.196 -19.778 57.005 1.00 44.01  ? 526 HOH A O   1 
HETATM 4063 O O   . HOH G 3 .   ? -12.374 -13.360 58.667 1.00 40.25  ? 527 HOH A O   1 
HETATM 4064 O O   . HOH G 3 .   ? 9.837   -37.250 45.043 1.00 27.95  ? 528 HOH A O   1 
HETATM 4065 O O   . HOH G 3 .   ? 3.235   -29.028 77.629 1.00 41.76  ? 529 HOH A O   1 
HETATM 4066 O O   . HOH G 3 .   ? -20.114 -35.383 80.534 1.00 30.61  ? 530 HOH A O   1 
HETATM 4067 O O   . HOH G 3 .   ? 14.092  -36.724 70.612 1.00 49.74  ? 531 HOH A O   1 
HETATM 4068 O O   . HOH G 3 .   ? 4.829   -8.271  70.256 1.00 57.01  ? 532 HOH A O   1 
HETATM 4069 O O   . HOH G 3 .   ? -6.025  -11.452 57.069 1.00 51.99  ? 533 HOH A O   1 
HETATM 4070 O O   . HOH G 3 .   ? -3.500  -36.371 45.382 1.00 42.46  ? 534 HOH A O   1 
HETATM 4071 O O   . HOH G 3 .   ? -13.896 -25.856 58.986 1.00 34.05  ? 535 HOH A O   1 
HETATM 4072 O O   . HOH G 3 .   ? -0.456  -14.502 58.997 1.00 23.37  ? 536 HOH A O   1 
HETATM 4073 O O   . HOH G 3 .   ? -9.162  -33.517 84.427 1.00 43.40  ? 537 HOH A O   1 
HETATM 4074 O O   . HOH G 3 .   ? -15.773 -27.940 87.123 1.00 43.25  ? 538 HOH A O   1 
HETATM 4075 O O   . HOH G 3 .   ? 1.515   -24.452 76.479 1.00 30.83  ? 539 HOH A O   1 
HETATM 4076 O O   . HOH G 3 .   ? -8.133  -16.750 68.222 1.00 44.67  ? 540 HOH A O   1 
HETATM 4077 O O   . HOH G 3 .   ? 5.194   -10.785 68.912 1.00 42.92  ? 541 HOH A O   1 
HETATM 4078 O O   . HOH G 3 .   ? 1.957   -32.141 63.894 1.00 26.75  ? 542 HOH A O   1 
HETATM 4079 O O   . HOH G 3 .   ? -20.413 -29.854 52.519 1.00 42.09  ? 543 HOH A O   1 
HETATM 4080 O O   . HOH G 3 .   ? 1.555   -23.058 44.804 1.00 51.91  ? 544 HOH A O   1 
HETATM 4081 O O   . HOH G 3 .   ? 1.370   -22.630 50.974 1.00 35.69  ? 545 HOH A O   1 
HETATM 4082 O O   . HOH G 3 .   ? 6.226   -12.552 73.564 1.00 42.13  ? 546 HOH A O   1 
HETATM 4083 O O   . HOH G 3 .   ? -6.239  -2.051  71.667 1.00 55.06  ? 547 HOH A O   1 
HETATM 4084 O O   . HOH G 3 .   ? 7.506   -16.284 48.769 1.00 47.08  ? 548 HOH A O   1 
HETATM 4085 O O   . HOH G 3 .   ? -17.862 -35.142 60.444 1.00 34.04  ? 549 HOH A O   1 
HETATM 4086 O O   . HOH G 3 .   ? 17.646  -28.368 42.130 1.00 55.58  ? 550 HOH A O   1 
HETATM 4087 O O   . HOH G 3 .   ? -6.689  -7.078  66.884 1.00 53.40  ? 551 HOH A O   1 
HETATM 4088 O O   . HOH G 3 .   ? -7.528  -6.578  79.370 1.00 43.77  ? 552 HOH A O   1 
HETATM 4089 O O   . HOH G 3 .   ? -31.858 -31.172 67.885 1.00 44.11  ? 553 HOH A O   1 
HETATM 4090 O O   . HOH G 3 .   ? 6.983   -23.821 72.735 1.00 39.71  ? 554 HOH A O   1 
HETATM 4091 O O   . HOH G 3 .   ? 15.484  -30.873 55.888 1.00 29.58  ? 555 HOH A O   1 
HETATM 4092 O O   . HOH G 3 .   ? -22.400 -31.068 58.047 1.00 40.41  ? 556 HOH A O   1 
HETATM 4093 O O   . HOH G 3 .   ? -6.345  -41.008 57.715 1.00 53.26  ? 557 HOH A O   1 
HETATM 4094 O O   . HOH G 3 .   ? 12.817  -35.664 50.501 1.00 44.92  ? 558 HOH A O   1 
HETATM 4095 O O   . HOH G 3 .   ? 4.437   -14.434 74.240 1.00 51.35  ? 559 HOH A O   1 
HETATM 4096 O O   . HOH G 3 .   ? -17.676 -41.542 74.715 1.00 45.33  ? 560 HOH A O   1 
HETATM 4097 O O   . HOH G 3 .   ? -4.725  -7.003  64.846 1.00 40.86  ? 561 HOH A O   1 
HETATM 4098 O O   . HOH G 3 .   ? -15.093 -29.957 85.194 1.00 37.14  ? 562 HOH A O   1 
HETATM 4099 O O   . HOH G 3 .   ? -27.619 -25.363 61.534 1.00 26.32  ? 563 HOH A O   1 
HETATM 4100 O O   . HOH G 3 .   ? -29.779 -24.203 59.467 1.00 40.76  ? 564 HOH A O   1 
HETATM 4101 O O   . HOH G 3 .   ? -28.702 -23.757 73.870 1.00 22.67  ? 565 HOH A O   1 
HETATM 4102 O O   . HOH G 3 .   ? -29.575 -23.846 76.072 1.00 34.91  ? 566 HOH A O   1 
HETATM 4103 O O   . HOH G 3 .   ? -27.749 -24.103 77.688 1.00 30.91  ? 567 HOH A O   1 
HETATM 4104 O O   . HOH G 3 .   ? -29.518 -30.599 71.539 1.00 27.35  ? 568 HOH A O   1 
HETATM 4105 O O   . HOH G 3 .   ? -7.035  -39.254 63.636 1.00 30.11  ? 569 HOH A O   1 
HETATM 4106 O O   . HOH G 3 .   ? 3.682   -18.804 74.290 1.00 44.72  ? 570 HOH A O   1 
HETATM 4107 O O   . HOH G 3 .   ? -15.304 -40.676 73.273 1.00 48.89  ? 571 HOH A O   1 
HETATM 4108 O O   . HOH G 3 .   ? -23.563 -40.629 66.457 1.00 33.81  ? 572 HOH A O   1 
HETATM 4109 O O   . HOH G 3 .   ? -21.876 -32.858 77.694 1.00 35.14  ? 573 HOH A O   1 
HETATM 4110 O O   . HOH G 3 .   ? -11.906 -20.228 85.971 1.00 35.52  ? 574 HOH A O   1 
HETATM 4111 O O   . HOH G 3 .   ? 2.986   -42.034 56.850 1.00 42.30  ? 575 HOH A O   1 
HETATM 4112 O O   . HOH G 3 .   ? -0.854  -39.954 62.078 1.00 43.56  ? 576 HOH A O   1 
HETATM 4113 O O   . HOH G 3 .   ? -8.279  -40.797 70.445 1.00 31.45  ? 577 HOH A O   1 
HETATM 4114 O O   . HOH G 3 .   ? -1.411  -7.672  77.027 1.00 58.28  ? 578 HOH A O   1 
HETATM 4115 O O   . HOH G 3 .   ? 1.977   -34.985 72.149 1.00 50.43  ? 579 HOH A O   1 
HETATM 4116 O O   . HOH G 3 .   ? 20.297  -28.265 49.100 1.00 52.52  ? 580 HOH A O   1 
HETATM 4117 O O   . HOH G 3 .   ? 1.315   -42.981 55.509 1.00 47.47  ? 581 HOH A O   1 
HETATM 4118 O O   . HOH G 3 .   ? -6.892  -33.137 50.451 1.00 49.98  ? 582 HOH A O   1 
HETATM 4119 O O   . HOH G 3 .   ? -8.845  -28.133 90.398 1.00 45.90  ? 583 HOH A O   1 
HETATM 4120 O O   . HOH G 3 .   ? -20.466 -23.123 62.074 1.00 50.52  ? 584 HOH A O   1 
HETATM 4121 O O   . HOH G 3 .   ? -15.421 -39.648 79.926 1.00 33.45  ? 585 HOH A O   1 
HETATM 4122 O O   . HOH G 3 .   ? -26.921 -34.192 61.209 1.00 43.16  ? 586 HOH A O   1 
HETATM 4123 O O   . HOH G 3 .   ? 9.745   -18.692 51.751 1.00 33.05  ? 587 HOH A O   1 
HETATM 4124 O O   . HOH G 3 .   ? -2.777  -11.259 78.754 1.00 59.68  ? 588 HOH A O   1 
HETATM 4125 O O   . HOH G 3 .   ? 7.009   -27.413 78.885 1.00 57.22  ? 589 HOH A O   1 
HETATM 4126 O O   . HOH G 3 .   ? -0.811  -41.349 55.439 1.00 41.80  ? 590 HOH A O   1 
HETATM 4127 O O   . HOH G 3 .   ? -11.211 -14.878 55.056 1.00 36.17  ? 591 HOH A O   1 
HETATM 4128 O O   . HOH G 3 .   ? 7.398   -29.719 42.626 1.00 43.49  ? 592 HOH A O   1 
HETATM 4129 O O   . HOH G 3 .   ? -14.158 -41.202 63.270 1.00 47.45  ? 593 HOH A O   1 
HETATM 4130 O O   . HOH G 3 .   ? 9.330   -36.681 68.780 1.00 45.27  ? 594 HOH A O   1 
HETATM 4131 O O   . HOH G 3 .   ? -2.619  -8.195  87.856 1.00 61.08  ? 595 HOH A O   1 
HETATM 4132 O O   . HOH G 3 .   ? 18.934  -23.935 68.064 1.00 47.12  ? 596 HOH A O   1 
HETATM 4133 O O   . HOH G 3 .   ? -13.886 -40.499 67.478 1.00 41.26  ? 597 HOH A O   1 
HETATM 4134 O O   . HOH G 3 .   ? 1.679   -19.659 48.033 1.00 49.39  ? 598 HOH A O   1 
HETATM 4135 O O   . HOH G 3 .   ? -18.557 -20.921 63.317 1.00 43.30  ? 599 HOH A O   1 
HETATM 4136 O O   . HOH G 3 .   ? -5.040  -42.172 67.337 1.00 52.32  ? 600 HOH A O   1 
HETATM 4137 O O   . HOH G 3 .   ? 19.415  -33.969 61.069 1.00 48.17  ? 601 HOH A O   1 
HETATM 4138 O O   . HOH G 3 .   ? 11.708  -35.583 72.294 1.00 55.51  ? 602 HOH A O   1 
HETATM 4139 O O   . HOH G 3 .   ? 9.416   -19.673 49.415 1.00 50.17  ? 603 HOH A O   1 
HETATM 4140 O O   . HOH G 3 .   ? 19.318  -25.962 69.382 1.00 44.50  ? 604 HOH A O   1 
HETATM 4141 O O   . HOH G 3 .   ? -10.031 -18.949 87.860 1.00 41.39  ? 605 HOH A O   1 
HETATM 4142 O O   . HOH G 3 .   ? -1.595  -22.591 47.858 1.00 35.39  ? 606 HOH A O   1 
HETATM 4143 O O   . HOH G 3 .   ? -7.987  -15.507 51.884 1.00 34.36  ? 607 HOH A O   1 
HETATM 4144 O O   . HOH G 3 .   ? 1.786   -38.591 61.790 1.00 36.07  ? 608 HOH A O   1 
HETATM 4145 O O   . HOH G 3 .   ? -26.939 -37.070 61.712 1.00 49.01  ? 609 HOH A O   1 
HETATM 4146 O O   . HOH G 3 .   ? -13.239 -38.628 68.941 1.00 40.05  ? 610 HOH A O   1 
HETATM 4147 O O   . HOH G 3 .   ? -12.306 -37.640 80.268 1.00 47.74  ? 611 HOH A O   1 
HETATM 4148 O O   . HOH G 3 .   ? -17.100 -20.928 70.786 1.00 24.93  ? 612 HOH A O   1 
HETATM 4149 O O   . HOH G 3 .   ? -7.077  -14.937 66.771 1.00 64.57  ? 613 HOH A O   1 
HETATM 4150 O O   . HOH G 3 .   ? -10.660 -14.743 67.451 1.00 60.29  ? 614 HOH A O   1 
HETATM 4151 O O   . HOH G 3 .   ? -21.993 -32.421 82.346 1.00 37.12  ? 615 HOH A O   1 
HETATM 4152 O O   . HOH G 3 .   ? -16.877 -30.727 46.962 1.00 49.24  ? 616 HOH A O   1 
HETATM 4153 O O   . HOH G 3 .   ? 2.738   -9.226  64.905 1.00 40.70  ? 617 HOH A O   1 
HETATM 4154 O O   . HOH G 3 .   ? 3.275   -7.005  72.878 1.00 51.06  ? 618 HOH A O   1 
HETATM 4155 O O   . HOH G 3 .   ? 20.211  -29.831 65.586 1.00 48.20  ? 619 HOH A O   1 
HETATM 4156 O O   . HOH G 3 .   ? -0.848  -12.879 61.008 1.00 37.35  ? 620 HOH A O   1 
HETATM 4157 O O   . HOH G 3 .   ? -18.230 -25.327 60.090 1.00 46.32  ? 621 HOH A O   1 
HETATM 4158 O O   . HOH G 3 .   ? 1.162   -36.034 78.140 1.00 41.24  ? 622 HOH A O   1 
HETATM 4159 O O   . HOH G 3 .   ? 12.891  -17.709 70.560 1.00 35.78  ? 623 HOH A O   1 
HETATM 4160 O O   . HOH G 3 .   ? -1.375  -22.074 50.370 1.00 29.52  ? 624 HOH A O   1 
HETATM 4161 O O   . HOH G 3 .   ? -0.849  -7.036  68.069 1.00 42.76  ? 625 HOH A O   1 
HETATM 4162 O O   . HOH G 3 .   ? 19.790  -36.719 64.692 1.00 45.35  ? 626 HOH A O   1 
HETATM 4163 O O   . HOH G 3 .   ? -12.540 -15.028 89.312 1.00 54.89  ? 627 HOH A O   1 
HETATM 4164 O O   . HOH G 3 .   ? 3.452   -34.102 64.855 1.00 43.11  ? 628 HOH A O   1 
HETATM 4165 O O   . HOH G 3 .   ? 17.334  -38.020 62.964 1.00 57.59  ? 629 HOH A O   1 
HETATM 4166 O O   . HOH G 3 .   ? -10.352 -13.263 56.811 1.00 37.60  ? 630 HOH A O   1 
HETATM 4167 O O   . HOH G 3 .   ? -15.804 -22.690 85.642 1.00 34.22  ? 631 HOH A O   1 
HETATM 4168 O O   . HOH G 3 .   ? -17.608 -34.339 51.682 1.00 45.29  ? 632 HOH A O   1 
HETATM 4169 O O   . HOH G 3 .   ? -16.515 -24.372 55.457 1.00 60.93  ? 633 HOH A O   1 
HETATM 4170 O O   . HOH G 3 .   ? 3.561   -33.244 77.702 1.00 45.99  ? 634 HOH A O   1 
HETATM 4171 O O   . HOH G 3 .   ? 5.775   -41.366 56.638 1.00 46.82  ? 635 HOH A O   1 
HETATM 4172 O O   . HOH G 3 .   ? -27.611 -28.344 61.137 1.00 28.28  ? 636 HOH A O   1 
HETATM 4173 O O   . HOH G 3 .   ? -5.946  -14.290 81.043 1.00 34.37  ? 637 HOH A O   1 
HETATM 4174 O O   . HOH G 3 .   ? -20.753 -28.277 59.031 1.00 40.24  ? 638 HOH A O   1 
HETATM 4175 O O   . HOH G 3 .   ? -7.563  -27.039 76.738 1.00 24.71  ? 639 HOH A O   1 
HETATM 4176 O O   . HOH G 3 .   ? -10.421 -9.821  77.670 1.00 47.47  ? 640 HOH A O   1 
HETATM 4177 O O   . HOH G 3 .   ? -3.352  -7.922  75.412 1.00 54.26  ? 641 HOH A O   1 
HETATM 4178 O O   . HOH G 3 .   ? -24.667 -41.006 64.231 1.00 46.46  ? 642 HOH A O   1 
HETATM 4179 O O   . HOH G 3 .   ? -19.408 -37.604 58.296 1.00 40.39  ? 643 HOH A O   1 
HETATM 4180 O O   . HOH G 3 .   ? -13.585 -7.477  68.710 1.00 59.23  ? 644 HOH A O   1 
HETATM 4181 O O   . HOH G 3 .   ? 2.545   -15.795 73.902 1.00 30.44  ? 645 HOH A O   1 
HETATM 4182 O O   . HOH G 3 .   ? -4.713  -6.650  68.441 1.00 62.59  ? 646 HOH A O   1 
HETATM 4183 O O   . HOH G 3 .   ? 0.687   -18.566 81.436 1.00 41.64  ? 647 HOH A O   1 
HETATM 4184 O O   . HOH G 3 .   ? -12.829 -19.552 65.962 1.00 36.15  ? 648 HOH A O   1 
HETATM 4185 O O   . HOH G 3 .   ? -16.602 -30.547 58.953 1.00 48.48  ? 649 HOH A O   1 
HETATM 4186 O O   . HOH G 3 .   ? 3.875   -34.578 39.273 1.00 55.02  ? 650 HOH A O   1 
HETATM 4187 O O   . HOH G 3 .   ? 16.734  -33.728 70.440 1.00 35.39  ? 651 HOH A O   1 
HETATM 4188 O O   . HOH G 3 .   ? -12.334 -35.070 81.798 1.00 45.32  ? 652 HOH A O   1 
HETATM 4189 O O   . HOH G 3 .   ? 7.396   -37.891 56.991 1.00 47.00  ? 653 HOH A O   1 
HETATM 4190 O O   . HOH G 3 .   ? 2.678   -20.724 81.849 1.00 51.80  ? 654 HOH A O   1 
HETATM 4191 O O   . HOH G 3 .   ? 1.206   -36.028 80.545 1.00 58.02  ? 655 HOH A O   1 
HETATM 4192 O O   . HOH G 3 .   ? 13.983  -35.401 73.512 1.00 54.33  ? 656 HOH A O   1 
HETATM 4193 O O   . HOH G 3 .   ? -7.579  -18.622 87.354 1.00 48.68  ? 657 HOH A O   1 
HETATM 4194 O O   . HOH G 3 .   ? 15.945  -13.694 68.789 1.00 35.69  ? 658 HOH A O   1 
HETATM 4195 O O   . HOH G 3 .   ? -18.079 -23.181 83.900 1.00 29.46  ? 659 HOH A O   1 
HETATM 4196 O O   . HOH G 3 .   ? -5.740  -17.265 51.020 1.00 45.40  ? 660 HOH A O   1 
HETATM 4197 O O   . HOH G 3 .   ? -17.671 -26.824 57.710 1.00 47.76  ? 661 HOH A O   1 
HETATM 4198 O O   . HOH G 3 .   ? 6.321   -11.360 71.499 1.00 43.91  ? 662 HOH A O   1 
HETATM 4199 O O   . HOH G 3 .   ? -33.943 -27.631 71.228 1.00 47.48  ? 663 HOH A O   1 
HETATM 4200 O O   . HOH G 3 .   ? 14.661  -33.372 45.991 1.00 43.29  ? 664 HOH A O   1 
HETATM 4201 O O   . HOH G 3 .   ? 0.376   -13.592 80.073 1.00 51.09  ? 665 HOH A O   1 
HETATM 4202 O O   . HOH G 3 .   ? 8.743   -23.525 48.503 1.00 39.36  ? 666 HOH A O   1 
HETATM 4203 O O   . HOH G 3 .   ? -21.741 -20.906 82.618 1.00 35.90  ? 667 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   19  ?   ?   ?   B . n 
A 1 2   SER 2   20  ?   ?   ?   B . n 
A 1 3   LYS 3   21  ?   ?   ?   B . n 
A 1 4   PRO 4   22  ?   ?   ?   B . n 
A 1 5   LYS 5   23  ?   ?   ?   B . n 
A 1 6   GLN 6   24  ?   ?   ?   B . n 
A 1 7   PRO 7   25  ?   ?   ?   B . n 
A 1 8   PRO 8   26  ?   ?   ?   B . n 
A 1 9   ASP 9   27  ?   ?   ?   B . n 
A 1 10  ALA 10  28  ?   ?   ?   B . n 
A 1 11  SER 11  29  ?   ?   ?   B . n 
A 1 12  PRO 12  30  30  PRO PRO B . n 
A 1 13  ALA 13  31  31  ALA ALA B . n 
A 1 14  ASN 14  32  32  ASN ASN B . n 
A 1 15  LEU 15  33  33  LEU LEU B . n 
A 1 16  LEU 16  34  34  LEU LEU B . n 
A 1 17  THR 17  35  35  THR THR B . n 
A 1 18  SER 18  36  36  SER SER B . n 
A 1 19  LEU 19  37  37  LEU LEU B . n 
A 1 20  VAL 20  38  38  VAL VAL B . n 
A 1 21  ARG 21  39  39  ARG ARG B . n 
A 1 22  ALA 22  40  40  ALA ALA B . n 
A 1 23  HIS 23  41  41  HIS HIS B . n 
A 1 24  LEU 24  42  42  LEU LEU B . n 
A 1 25  ASP 25  43  43  ASP ASP B . n 
A 1 26  SER 26  44  44  SER SER B . n 
A 1 27  GLY 27  45  45  GLY GLY B . n 
A 1 28  PRO 28  46  46  PRO PRO B . n 
A 1 29  SER 29  47  47  SER SER B . n 
A 1 30  THR 30  48  48  THR THR B . n 
A 1 31  ALA 31  49  49  ALA ALA B . n 
A 1 32  LYS 32  50  50  LYS LYS B . n 
A 1 33  LEU 33  51  51  LEU LEU B . n 
A 1 34  ASP 34  52  52  ASP ASP B . n 
A 1 35  TYR 35  53  53  TYR TYR B . n 
A 1 36  SER 36  54  54  SER SER B . n 
A 1 37  LYS 37  55  55  LYS LYS B . n 
A 1 38  PHE 38  56  56  PHE PHE B . n 
A 1 39  GLN 39  57  57  GLN GLN B . n 
A 1 40  GLU 40  58  58  GLU GLU B . n 
A 1 41  LEU 41  59  59  LEU LEU B . n 
A 1 42  VAL 42  60  60  VAL VAL B . n 
A 1 43  LEU 43  61  61  LEU LEU B . n 
A 1 44  PRO 44  62  62  PRO PRO B . n 
A 1 45  HIS 45  63  63  HIS HIS B . n 
A 1 46  PHE 46  64  64  PHE PHE B . n 
A 1 47  GLY 47  65  65  GLY GLY B . n 
A 1 48  LYS 48  66  66  LYS LYS B . n 
A 1 49  GLU 49  67  67  GLU GLU B . n 
A 1 50  ASP 50  68  68  ASP ASP B . n 
A 1 51  ALA 51  69  69  ALA ALA B . n 
A 1 52  GLY 52  70  70  GLY GLY B . n 
A 1 53  ASP 53  71  71  ASP ASP B . n 
A 1 54  VAL 54  72  72  VAL VAL B . n 
A 1 55  GLN 55  73  73  GLN GLN B . n 
A 1 56  GLN 56  74  74  GLN GLN B . n 
A 1 57  PHE 57  75  75  PHE PHE B . n 
A 1 58  TYR 58  76  76  TYR TYR B . n 
A 1 59  ASP 59  77  77  ASP ASP B . n 
A 1 60  LEU 60  78  78  LEU LEU B . n 
A 1 61  LEU 61  79  79  LEU LEU B . n 
A 1 62  SER 62  80  80  SER SER B . n 
A 1 63  GLY 63  81  81  GLY GLY B . n 
A 1 64  SER 64  82  82  SER SER B . n 
A 1 65  LEU 65  83  83  LEU LEU B . n 
A 1 66  GLU 66  84  84  GLU GLU B . n 
A 1 67  VAL 67  85  85  VAL VAL B . n 
A 1 68  ILE 68  86  86  ILE ILE B . n 
A 1 69  ARG 69  87  87  ARG ARG B . n 
A 1 70  LYS 70  88  88  LYS LYS B . n 
A 1 71  TRP 71  89  89  TRP TRP B . n 
A 1 72  ALA 72  90  90  ALA ALA B . n 
A 1 73  GLU 73  91  91  GLU GLU B . n 
A 1 74  LYS 74  92  92  LYS LYS B . n 
A 1 75  ILE 75  93  93  ILE ILE B . n 
A 1 76  PRO 76  94  94  PRO PRO B . n 
A 1 77  GLY 77  95  95  GLY GLY B . n 
A 1 78  PHE 78  96  96  PHE PHE B . n 
A 1 79  ALA 79  97  97  ALA ALA B . n 
A 1 80  GLU 80  98  98  GLU GLU B . n 
A 1 81  LEU 81  99  99  LEU LEU B . n 
A 1 82  SER 82  100 100 SER SER B . n 
A 1 83  PRO 83  101 101 PRO PRO B . n 
A 1 84  ALA 84  102 102 ALA ALA B . n 
A 1 85  ASP 85  103 103 ASP ASP B . n 
A 1 86  GLN 86  104 104 GLN GLN B . n 
A 1 87  ASP 87  105 105 ASP ASP B . n 
A 1 88  LEU 88  106 106 LEU LEU B . n 
A 1 89  LEU 89  107 107 LEU LEU B . n 
A 1 90  LEU 90  108 108 LEU LEU B . n 
A 1 91  GLU 91  109 109 GLU GLU B . n 
A 1 92  SER 92  110 110 SER SER B . n 
A 1 93  ALA 93  111 111 ALA ALA B . n 
A 1 94  PHE 94  112 112 PHE PHE B . n 
A 1 95  LEU 95  113 113 LEU LEU B . n 
A 1 96  GLU 96  114 114 GLU GLU B . n 
A 1 97  LEU 97  115 115 LEU LEU B . n 
A 1 98  PHE 98  116 116 PHE PHE B . n 
A 1 99  ILE 99  117 117 ILE ILE B . n 
A 1 100 LEU 100 118 118 LEU LEU B . n 
A 1 101 ARG 101 119 119 ARG ARG B . n 
A 1 102 LEU 102 120 120 LEU LEU B . n 
A 1 103 ALA 103 121 121 ALA ALA B . n 
A 1 104 TYR 104 122 122 TYR TYR B . n 
A 1 105 ARG 105 123 123 ARG ARG B . n 
A 1 106 SER 106 124 124 SER SER B . n 
A 1 107 LYS 107 125 125 LYS LYS B . n 
A 1 108 PRO 108 126 126 PRO PRO B . n 
A 1 109 GLY 109 127 127 GLY GLY B . n 
A 1 110 GLU 110 128 128 GLU GLU B . n 
A 1 111 GLY 111 129 129 GLY GLY B . n 
A 1 112 LYS 112 130 130 LYS LYS B . n 
A 1 113 LEU 113 131 131 LEU LEU B . n 
A 1 114 ILE 114 132 132 ILE ILE B . n 
A 1 115 PHE 115 133 133 PHE PHE B . n 
A 1 116 CYS 116 134 134 CYS CYS B . n 
A 1 117 SER 117 135 135 SER SER B . n 
A 1 118 GLY 118 136 136 GLY GLY B . n 
A 1 119 LEU 119 137 137 LEU LEU B . n 
A 1 120 VAL 120 138 138 VAL VAL B . n 
A 1 121 LEU 121 139 139 LEU LEU B . n 
A 1 122 HIS 122 140 140 HIS HIS B . n 
A 1 123 ARG 123 141 141 ARG ARG B . n 
A 1 124 LEU 124 142 142 LEU LEU B . n 
A 1 125 GLN 125 143 143 GLN GLN B . n 
A 1 126 CYS 126 144 144 CYS CYS B . n 
A 1 127 ALA 127 145 145 ALA ALA B . n 
A 1 128 ARG 128 146 146 ARG ARG B . n 
A 1 129 GLY 129 147 147 GLY GLY B . n 
A 1 130 PHE 130 148 148 PHE PHE B . n 
A 1 131 GLY 131 149 149 GLY GLY B . n 
A 1 132 ASP 132 150 150 ASP ASP B . n 
A 1 133 TRP 133 151 151 TRP TRP B . n 
A 1 134 ILE 134 152 152 ILE ILE B . n 
A 1 135 ASP 135 153 153 ASP ASP B . n 
A 1 136 SER 136 154 154 SER SER B . n 
A 1 137 ILE 137 155 155 ILE ILE B . n 
A 1 138 LEU 138 156 156 LEU LEU B . n 
A 1 139 ALA 139 157 157 ALA ALA B . n 
A 1 140 PHE 140 158 158 PHE PHE B . n 
A 1 141 SER 141 159 159 SER SER B . n 
A 1 142 ARG 142 160 160 ARG ARG B . n 
A 1 143 SER 143 161 161 SER SER B . n 
A 1 144 LEU 144 162 162 LEU LEU B . n 
A 1 145 HIS 145 163 163 HIS HIS B . n 
A 1 146 SER 146 164 164 SER SER B . n 
A 1 147 LEU 147 165 165 LEU LEU B . n 
A 1 148 LEU 148 166 166 LEU LEU B . n 
A 1 149 VAL 149 167 167 VAL VAL B . n 
A 1 150 ASP 150 168 168 ASP ASP B . n 
A 1 151 VAL 151 169 169 VAL VAL B . n 
A 1 152 PRO 152 170 170 PRO PRO B . n 
A 1 153 ALA 153 171 171 ALA ALA B . n 
A 1 154 PHE 154 172 172 PHE PHE B . n 
A 1 155 ALA 155 173 173 ALA ALA B . n 
A 1 156 CYS 156 174 174 CYS CYS B . n 
A 1 157 LEU 157 175 175 LEU LEU B . n 
A 1 158 SER 158 176 176 SER SER B . n 
A 1 159 ALA 159 177 177 ALA ALA B . n 
A 1 160 LEU 160 178 178 LEU LEU B . n 
A 1 161 VAL 161 179 179 VAL VAL B . n 
A 1 162 LEU 162 180 180 LEU LEU B . n 
A 1 163 ILE 163 181 181 ILE ILE B . n 
A 1 164 THR 164 182 182 THR THR B . n 
A 1 165 ASP 165 183 183 ASP ASP B . n 
A 1 166 ARG 166 184 184 ARG ARG B . n 
A 1 167 HIS 167 185 185 HIS HIS B . n 
A 1 168 GLY 168 186 186 GLY GLY B . n 
A 1 169 LEU 169 187 187 LEU LEU B . n 
A 1 170 GLN 170 188 188 GLN GLN B . n 
A 1 171 GLU 171 189 189 GLU GLU B . n 
A 1 172 PRO 172 190 190 PRO PRO B . n 
A 1 173 ARG 173 191 191 ARG ARG B . n 
A 1 174 ARG 174 192 192 ARG ARG B . n 
A 1 175 VAL 175 193 193 VAL VAL B . n 
A 1 176 GLU 176 194 194 GLU GLU B . n 
A 1 177 GLU 177 195 195 GLU GLU B . n 
A 1 178 LEU 178 196 196 LEU LEU B . n 
A 1 179 GLN 179 197 197 GLN GLN B . n 
A 1 180 ASN 180 198 198 ASN ASN B . n 
A 1 181 ARG 181 199 199 ARG ARG B . n 
A 1 182 ILE 182 200 200 ILE ILE B . n 
A 1 183 ALA 183 201 201 ALA ALA B . n 
A 1 184 SER 184 202 202 SER SER B . n 
A 1 185 CYS 185 203 203 CYS CYS B . n 
A 1 186 LEU 186 204 204 LEU LEU B . n 
A 1 187 LYS 187 205 205 LYS LYS B . n 
A 1 188 GLU 188 206 206 GLU GLU B . n 
A 1 189 HIS 189 207 207 HIS HIS B . n 
A 1 190 VAL 190 208 208 VAL VAL B . n 
A 1 191 ALA 191 209 209 ALA ALA B . n 
A 1 192 ALA 192 210 210 ALA ALA B . n 
A 1 193 VAL 193 211 211 VAL VAL B . n 
A 1 194 ALA 194 212 212 ALA ALA B . n 
A 1 195 GLY 195 213 213 GLY GLY B . n 
A 1 196 GLU 196 214 214 GLU GLU B . n 
A 1 197 PRO 197 215 215 PRO PRO B . n 
A 1 198 GLN 198 216 216 GLN GLN B . n 
A 1 199 PRO 199 217 ?   ?   ?   B . n 
A 1 200 ALA 200 218 218 ALA ALA B . n 
A 1 201 SER 201 219 219 SER SER B . n 
A 1 202 CYS 202 220 220 CYS CYS B . n 
A 1 203 LEU 203 221 221 LEU LEU B . n 
A 1 204 SER 204 222 222 SER SER B . n 
A 1 205 ARG 205 223 223 ARG ARG B . n 
A 1 206 LEU 206 224 224 LEU LEU B . n 
A 1 207 LEU 207 225 225 LEU LEU B . n 
A 1 208 GLY 208 226 226 GLY GLY B . n 
A 1 209 LYS 209 227 227 LYS LYS B . n 
A 1 210 LEU 210 228 228 LEU LEU B . n 
A 1 211 PRO 211 229 229 PRO PRO B . n 
A 1 212 GLU 212 230 230 GLU GLU B . n 
A 1 213 LEU 213 231 231 LEU LEU B . n 
A 1 214 ARG 214 232 232 ARG ARG B . n 
A 1 215 THR 215 233 233 THR THR B . n 
A 1 216 LEU 216 234 234 LEU LEU B . n 
A 1 217 CYS 217 235 235 CYS CYS B . n 
A 1 218 THR 218 236 236 THR THR B . n 
A 1 219 GLN 219 237 237 GLN GLN B . n 
A 1 220 GLY 220 238 238 GLY GLY B . n 
A 1 221 LEU 221 239 239 LEU LEU B . n 
A 1 222 GLN 222 240 240 GLN GLN B . n 
A 1 223 ARG 223 241 241 ARG ARG B . n 
A 1 224 ILE 224 242 242 ILE ILE B . n 
A 1 225 PHE 225 243 243 PHE PHE B . n 
A 1 226 TYR 226 244 244 TYR TYR B . n 
A 1 227 LEU 227 245 245 LEU LEU B . n 
A 1 228 LYS 228 246 246 LYS LYS B . n 
A 1 229 LEU 229 247 247 LEU LEU B . n 
A 1 230 GLU 230 248 248 GLU GLU B . n 
A 1 231 ASP 231 249 249 ASP ASP B . n 
A 1 232 LEU 232 250 250 LEU LEU B . n 
A 1 233 VAL 233 251 251 VAL VAL B . n 
A 1 234 PRO 234 252 252 PRO PRO B . n 
A 1 235 PRO 235 253 253 PRO PRO B . n 
A 1 236 PRO 236 254 254 PRO PRO B . n 
A 1 237 PRO 237 255 255 PRO PRO B . n 
A 1 238 ILE 238 256 256 ILE ILE B . n 
A 1 239 ILE 239 257 257 ILE ILE B . n 
A 1 240 ASP 240 258 258 ASP ASP B . n 
A 1 241 LYS 241 259 259 LYS LYS B . n 
A 1 242 ILE 242 260 260 ILE ILE B . n 
A 1 243 PHE 243 261 261 PHE PHE B . n 
A 1 244 MET 244 262 262 MET MET B . n 
A 1 245 ASP 245 263 263 ASP ASP B . n 
A 1 246 THR 246 264 264 THR THR B . n 
A 1 247 LEU 247 265 265 LEU LEU B . n 
A 1 248 PRO 248 266 266 PRO PRO B . n 
A 1 249 PHE 249 267 267 PHE PHE B . n 
A 1 250 LEU 250 268 ?   ?   ?   B . n 
A 1 251 GLU 251 269 ?   ?   ?   B . n 
A 1 252 HIS 252 270 ?   ?   ?   B . n 
A 1 253 HIS 253 271 ?   ?   ?   B . n 
A 1 254 HIS 254 272 ?   ?   ?   B . n 
A 1 255 HIS 255 273 ?   ?   ?   B . n 
A 1 256 HIS 256 274 ?   ?   ?   B . n 
A 1 257 HIS 257 275 ?   ?   ?   B . n 
B 1 1   MET 1   19  ?   ?   ?   A . n 
B 1 2   SER 2   20  ?   ?   ?   A . n 
B 1 3   LYS 3   21  ?   ?   ?   A . n 
B 1 4   PRO 4   22  ?   ?   ?   A . n 
B 1 5   LYS 5   23  ?   ?   ?   A . n 
B 1 6   GLN 6   24  ?   ?   ?   A . n 
B 1 7   PRO 7   25  ?   ?   ?   A . n 
B 1 8   PRO 8   26  ?   ?   ?   A . n 
B 1 9   ASP 9   27  ?   ?   ?   A . n 
B 1 10  ALA 10  28  ?   ?   ?   A . n 
B 1 11  SER 11  29  ?   ?   ?   A . n 
B 1 12  PRO 12  30  30  PRO PRO A . n 
B 1 13  ALA 13  31  31  ALA ALA A . n 
B 1 14  ASN 14  32  32  ASN ASN A . n 
B 1 15  LEU 15  33  33  LEU LEU A . n 
B 1 16  LEU 16  34  34  LEU LEU A . n 
B 1 17  THR 17  35  35  THR THR A . n 
B 1 18  SER 18  36  36  SER SER A . n 
B 1 19  LEU 19  37  37  LEU LEU A . n 
B 1 20  VAL 20  38  38  VAL VAL A . n 
B 1 21  ARG 21  39  39  ARG ARG A . n 
B 1 22  ALA 22  40  40  ALA ALA A . n 
B 1 23  HIS 23  41  41  HIS HIS A . n 
B 1 24  LEU 24  42  42  LEU LEU A . n 
B 1 25  ASP 25  43  43  ASP ASP A . n 
B 1 26  SER 26  44  44  SER SER A . n 
B 1 27  GLY 27  45  45  GLY GLY A . n 
B 1 28  PRO 28  46  46  PRO PRO A . n 
B 1 29  SER 29  47  47  SER SER A . n 
B 1 30  THR 30  48  48  THR THR A . n 
B 1 31  ALA 31  49  49  ALA ALA A . n 
B 1 32  LYS 32  50  50  LYS LYS A . n 
B 1 33  LEU 33  51  51  LEU LEU A . n 
B 1 34  ASP 34  52  52  ASP ASP A . n 
B 1 35  TYR 35  53  53  TYR TYR A . n 
B 1 36  SER 36  54  54  SER SER A . n 
B 1 37  LYS 37  55  55  LYS LYS A . n 
B 1 38  PHE 38  56  56  PHE PHE A . n 
B 1 39  GLN 39  57  57  GLN GLN A . n 
B 1 40  GLU 40  58  58  GLU GLU A . n 
B 1 41  LEU 41  59  59  LEU LEU A . n 
B 1 42  VAL 42  60  60  VAL VAL A . n 
B 1 43  LEU 43  61  61  LEU LEU A . n 
B 1 44  PRO 44  62  62  PRO PRO A . n 
B 1 45  HIS 45  63  63  HIS HIS A . n 
B 1 46  PHE 46  64  64  PHE PHE A . n 
B 1 47  GLY 47  65  65  GLY GLY A . n 
B 1 48  LYS 48  66  66  LYS LYS A . n 
B 1 49  GLU 49  67  67  GLU GLU A . n 
B 1 50  ASP 50  68  68  ASP ASP A . n 
B 1 51  ALA 51  69  69  ALA ALA A . n 
B 1 52  GLY 52  70  70  GLY GLY A . n 
B 1 53  ASP 53  71  71  ASP ASP A . n 
B 1 54  VAL 54  72  72  VAL VAL A . n 
B 1 55  GLN 55  73  73  GLN GLN A . n 
B 1 56  GLN 56  74  74  GLN GLN A . n 
B 1 57  PHE 57  75  75  PHE PHE A . n 
B 1 58  TYR 58  76  76  TYR TYR A . n 
B 1 59  ASP 59  77  77  ASP ASP A . n 
B 1 60  LEU 60  78  78  LEU LEU A . n 
B 1 61  LEU 61  79  79  LEU LEU A . n 
B 1 62  SER 62  80  80  SER SER A . n 
B 1 63  GLY 63  81  81  GLY GLY A . n 
B 1 64  SER 64  82  82  SER SER A . n 
B 1 65  LEU 65  83  83  LEU LEU A . n 
B 1 66  GLU 66  84  84  GLU GLU A . n 
B 1 67  VAL 67  85  85  VAL VAL A . n 
B 1 68  ILE 68  86  86  ILE ILE A . n 
B 1 69  ARG 69  87  87  ARG ARG A . n 
B 1 70  LYS 70  88  88  LYS LYS A . n 
B 1 71  TRP 71  89  89  TRP TRP A . n 
B 1 72  ALA 72  90  90  ALA ALA A . n 
B 1 73  GLU 73  91  91  GLU GLU A . n 
B 1 74  LYS 74  92  92  LYS LYS A . n 
B 1 75  ILE 75  93  93  ILE ILE A . n 
B 1 76  PRO 76  94  94  PRO PRO A . n 
B 1 77  GLY 77  95  95  GLY GLY A . n 
B 1 78  PHE 78  96  96  PHE PHE A . n 
B 1 79  ALA 79  97  97  ALA ALA A . n 
B 1 80  GLU 80  98  98  GLU GLU A . n 
B 1 81  LEU 81  99  99  LEU LEU A . n 
B 1 82  SER 82  100 100 SER SER A . n 
B 1 83  PRO 83  101 101 PRO PRO A . n 
B 1 84  ALA 84  102 102 ALA ALA A . n 
B 1 85  ASP 85  103 103 ASP ASP A . n 
B 1 86  GLN 86  104 104 GLN GLN A . n 
B 1 87  ASP 87  105 105 ASP ASP A . n 
B 1 88  LEU 88  106 106 LEU LEU A . n 
B 1 89  LEU 89  107 107 LEU LEU A . n 
B 1 90  LEU 90  108 108 LEU LEU A . n 
B 1 91  GLU 91  109 109 GLU GLU A . n 
B 1 92  SER 92  110 110 SER SER A . n 
B 1 93  ALA 93  111 111 ALA ALA A . n 
B 1 94  PHE 94  112 112 PHE PHE A . n 
B 1 95  LEU 95  113 113 LEU LEU A . n 
B 1 96  GLU 96  114 114 GLU GLU A . n 
B 1 97  LEU 97  115 115 LEU LEU A . n 
B 1 98  PHE 98  116 116 PHE PHE A . n 
B 1 99  ILE 99  117 117 ILE ILE A . n 
B 1 100 LEU 100 118 118 LEU LEU A . n 
B 1 101 ARG 101 119 119 ARG ARG A . n 
B 1 102 LEU 102 120 120 LEU LEU A . n 
B 1 103 ALA 103 121 121 ALA ALA A . n 
B 1 104 TYR 104 122 122 TYR TYR A . n 
B 1 105 ARG 105 123 123 ARG ARG A . n 
B 1 106 SER 106 124 124 SER SER A . n 
B 1 107 LYS 107 125 125 LYS LYS A . n 
B 1 108 PRO 108 126 126 PRO PRO A . n 
B 1 109 GLY 109 127 127 GLY GLY A . n 
B 1 110 GLU 110 128 128 GLU GLU A . n 
B 1 111 GLY 111 129 129 GLY GLY A . n 
B 1 112 LYS 112 130 130 LYS LYS A . n 
B 1 113 LEU 113 131 131 LEU LEU A . n 
B 1 114 ILE 114 132 132 ILE ILE A . n 
B 1 115 PHE 115 133 133 PHE PHE A . n 
B 1 116 CYS 116 134 134 CYS CYS A . n 
B 1 117 SER 117 135 135 SER SER A . n 
B 1 118 GLY 118 136 136 GLY GLY A . n 
B 1 119 LEU 119 137 137 LEU LEU A . n 
B 1 120 VAL 120 138 138 VAL VAL A . n 
B 1 121 LEU 121 139 139 LEU LEU A . n 
B 1 122 HIS 122 140 140 HIS HIS A . n 
B 1 123 ARG 123 141 141 ARG ARG A . n 
B 1 124 LEU 124 142 142 LEU LEU A . n 
B 1 125 GLN 125 143 143 GLN GLN A . n 
B 1 126 CYS 126 144 144 CYS CYS A . n 
B 1 127 ALA 127 145 145 ALA ALA A . n 
B 1 128 ARG 128 146 146 ARG ARG A . n 
B 1 129 GLY 129 147 147 GLY GLY A . n 
B 1 130 PHE 130 148 148 PHE PHE A . n 
B 1 131 GLY 131 149 149 GLY GLY A . n 
B 1 132 ASP 132 150 150 ASP ASP A . n 
B 1 133 TRP 133 151 151 TRP TRP A . n 
B 1 134 ILE 134 152 152 ILE ILE A . n 
B 1 135 ASP 135 153 153 ASP ASP A . n 
B 1 136 SER 136 154 154 SER SER A . n 
B 1 137 ILE 137 155 155 ILE ILE A . n 
B 1 138 LEU 138 156 156 LEU LEU A . n 
B 1 139 ALA 139 157 157 ALA ALA A . n 
B 1 140 PHE 140 158 158 PHE PHE A . n 
B 1 141 SER 141 159 159 SER SER A . n 
B 1 142 ARG 142 160 160 ARG ARG A . n 
B 1 143 SER 143 161 161 SER SER A . n 
B 1 144 LEU 144 162 162 LEU LEU A . n 
B 1 145 HIS 145 163 163 HIS HIS A . n 
B 1 146 SER 146 164 164 SER SER A . n 
B 1 147 LEU 147 165 165 LEU LEU A . n 
B 1 148 LEU 148 166 166 LEU LEU A . n 
B 1 149 VAL 149 167 167 VAL VAL A . n 
B 1 150 ASP 150 168 168 ASP ASP A . n 
B 1 151 VAL 151 169 169 VAL VAL A . n 
B 1 152 PRO 152 170 170 PRO PRO A . n 
B 1 153 ALA 153 171 171 ALA ALA A . n 
B 1 154 PHE 154 172 172 PHE PHE A . n 
B 1 155 ALA 155 173 173 ALA ALA A . n 
B 1 156 CYS 156 174 174 CYS CYS A . n 
B 1 157 LEU 157 175 175 LEU LEU A . n 
B 1 158 SER 158 176 176 SER SER A . n 
B 1 159 ALA 159 177 177 ALA ALA A . n 
B 1 160 LEU 160 178 178 LEU LEU A . n 
B 1 161 VAL 161 179 179 VAL VAL A . n 
B 1 162 LEU 162 180 180 LEU LEU A . n 
B 1 163 ILE 163 181 181 ILE ILE A . n 
B 1 164 THR 164 182 182 THR THR A . n 
B 1 165 ASP 165 183 183 ASP ASP A . n 
B 1 166 ARG 166 184 184 ARG ARG A . n 
B 1 167 HIS 167 185 185 HIS HIS A . n 
B 1 168 GLY 168 186 186 GLY GLY A . n 
B 1 169 LEU 169 187 187 LEU LEU A . n 
B 1 170 GLN 170 188 188 GLN GLN A . n 
B 1 171 GLU 171 189 189 GLU GLU A . n 
B 1 172 PRO 172 190 190 PRO PRO A . n 
B 1 173 ARG 173 191 191 ARG ARG A . n 
B 1 174 ARG 174 192 192 ARG ARG A . n 
B 1 175 VAL 175 193 193 VAL VAL A . n 
B 1 176 GLU 176 194 194 GLU GLU A . n 
B 1 177 GLU 177 195 195 GLU GLU A . n 
B 1 178 LEU 178 196 196 LEU LEU A . n 
B 1 179 GLN 179 197 197 GLN GLN A . n 
B 1 180 ASN 180 198 198 ASN ASN A . n 
B 1 181 ARG 181 199 199 ARG ARG A . n 
B 1 182 ILE 182 200 200 ILE ILE A . n 
B 1 183 ALA 183 201 201 ALA ALA A . n 
B 1 184 SER 184 202 202 SER SER A . n 
B 1 185 CYS 185 203 203 CYS CYS A . n 
B 1 186 LEU 186 204 204 LEU LEU A . n 
B 1 187 LYS 187 205 205 LYS LYS A . n 
B 1 188 GLU 188 206 206 GLU GLU A . n 
B 1 189 HIS 189 207 207 HIS HIS A . n 
B 1 190 VAL 190 208 208 VAL VAL A . n 
B 1 191 ALA 191 209 209 ALA ALA A . n 
B 1 192 ALA 192 210 210 ALA ALA A . n 
B 1 193 VAL 193 211 211 VAL VAL A . n 
B 1 194 ALA 194 212 212 ALA ALA A . n 
B 1 195 GLY 195 213 213 GLY GLY A . n 
B 1 196 GLU 196 214 ?   ?   ?   A . n 
B 1 197 PRO 197 215 ?   ?   ?   A . n 
B 1 198 GLN 198 216 ?   ?   ?   A . n 
B 1 199 PRO 199 217 ?   ?   ?   A . n 
B 1 200 ALA 200 218 218 ALA ALA A . n 
B 1 201 SER 201 219 219 SER SER A . n 
B 1 202 CYS 202 220 220 CYS CYS A . n 
B 1 203 LEU 203 221 221 LEU LEU A . n 
B 1 204 SER 204 222 222 SER SER A . n 
B 1 205 ARG 205 223 223 ARG ARG A . n 
B 1 206 LEU 206 224 224 LEU LEU A . n 
B 1 207 LEU 207 225 225 LEU LEU A . n 
B 1 208 GLY 208 226 226 GLY GLY A . n 
B 1 209 LYS 209 227 227 LYS LYS A . n 
B 1 210 LEU 210 228 228 LEU LEU A . n 
B 1 211 PRO 211 229 229 PRO PRO A . n 
B 1 212 GLU 212 230 230 GLU GLU A . n 
B 1 213 LEU 213 231 231 LEU LEU A . n 
B 1 214 ARG 214 232 232 ARG ARG A . n 
B 1 215 THR 215 233 233 THR THR A . n 
B 1 216 LEU 216 234 234 LEU LEU A . n 
B 1 217 CYS 217 235 235 CYS CYS A . n 
B 1 218 THR 218 236 236 THR THR A . n 
B 1 219 GLN 219 237 237 GLN GLN A . n 
B 1 220 GLY 220 238 238 GLY GLY A . n 
B 1 221 LEU 221 239 239 LEU LEU A . n 
B 1 222 GLN 222 240 240 GLN GLN A . n 
B 1 223 ARG 223 241 241 ARG ARG A . n 
B 1 224 ILE 224 242 242 ILE ILE A . n 
B 1 225 PHE 225 243 243 PHE PHE A . n 
B 1 226 TYR 226 244 244 TYR TYR A . n 
B 1 227 LEU 227 245 245 LEU LEU A . n 
B 1 228 LYS 228 246 246 LYS LYS A . n 
B 1 229 LEU 229 247 247 LEU LEU A . n 
B 1 230 GLU 230 248 248 GLU GLU A . n 
B 1 231 ASP 231 249 249 ASP ASP A . n 
B 1 232 LEU 232 250 250 LEU LEU A . n 
B 1 233 VAL 233 251 251 VAL VAL A . n 
B 1 234 PRO 234 252 252 PRO PRO A . n 
B 1 235 PRO 235 253 253 PRO PRO A . n 
B 1 236 PRO 236 254 254 PRO PRO A . n 
B 1 237 PRO 237 255 255 PRO PRO A . n 
B 1 238 ILE 238 256 256 ILE ILE A . n 
B 1 239 ILE 239 257 257 ILE ILE A . n 
B 1 240 ASP 240 258 258 ASP ASP A . n 
B 1 241 LYS 241 259 259 LYS LYS A . n 
B 1 242 ILE 242 260 260 ILE ILE A . n 
B 1 243 PHE 243 261 261 PHE PHE A . n 
B 1 244 MET 244 262 262 MET MET A . n 
B 1 245 ASP 245 263 263 ASP ASP A . n 
B 1 246 THR 246 264 264 THR THR A . n 
B 1 247 LEU 247 265 265 LEU LEU A . n 
B 1 248 PRO 248 266 266 PRO PRO A . n 
B 1 249 PHE 249 267 267 PHE PHE A . n 
B 1 250 LEU 250 268 ?   ?   ?   A . n 
B 1 251 GLU 251 269 ?   ?   ?   A . n 
B 1 252 HIS 252 270 ?   ?   ?   A . n 
B 1 253 HIS 253 271 ?   ?   ?   A . n 
B 1 254 HIS 254 272 ?   ?   ?   A . n 
B 1 255 HIS 255 273 ?   ?   ?   A . n 
B 1 256 HIS 256 274 ?   ?   ?   A . n 
B 1 257 HIS 257 275 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2020  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  22160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-09-26 
2 'Structure model' 1 1 2013-07-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_phasing_MR.entry_id                     3V3E 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     47.620 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           49.370 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        49.370 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHASER      2.1.4 'Mon Jan 29 16:49:23 2007' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
2 REFMAC      .     ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.10  'June 10, 2010'            package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 AUTOMAR     .     ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLU 67 ? ? OE2 B GLU 248 ? A 1.98 
2 1 CA  B PRO 62 ? ? O   B HOH 605 ? ? 2.13 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH1 A ARG 141 ? ? 1_555 OD1 A ASN 198 ? ? 4_546 1.84 
2 1 NH2 A ARG 141 ? ? 1_555 OE1 A GLN 197 ? ? 4_546 1.98 
3 1 O   A HOH 402 ? ? 1_555 O   A HOH 500 ? ? 4_546 2.11 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             41 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             41 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.414 
_pdbx_validate_rmsd_bond.bond_target_value         1.354 
_pdbx_validate_rmsd_bond.bond_deviation            0.060 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.009 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA B CYS 235 ? ? CB B CYS 235 ? ? SG  B CYS 235 ? ? 121.16 114.20 6.96  1.10 N 
2 1 CB A LEU 78  ? ? CG A LEU 78  ? ? CD1 A LEU 78  ? ? 122.03 111.00 11.03 1.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA B 31  ? ? 86.04   -99.62 
2 1 PHE B 64  ? ? -49.53  153.89 
3 1 PRO B 266 ? ? -80.48  41.39  
4 1 LYS A 50  ? ? -90.57  37.23  
5 1 LYS A 50  ? ? -94.12  41.67  
6 1 GLU A 67  ? ? -172.51 141.92 
7 1 PRO A 266 ? ? -64.57  2.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ALA 31  ? CB  ? A ALA 13  CB  
2  1 Y 1 B LYS 50  ? CG  ? A LYS 32  CG  
3  1 Y 1 B LYS 50  ? CD  ? A LYS 32  CD  
4  1 Y 1 B LYS 50  ? CE  ? A LYS 32  CE  
5  1 Y 1 B LYS 50  ? NZ  ? A LYS 32  NZ  
6  1 Y 1 B GLN 57  ? CD  ? A GLN 39  CD  
7  1 Y 1 B GLN 57  ? OE1 ? A GLN 39  OE1 
8  1 Y 1 B GLN 57  ? NE2 ? A GLN 39  NE2 
9  1 Y 1 B PHE 64  ? CG  ? A PHE 46  CG  
10 1 Y 1 B PHE 64  ? CD1 ? A PHE 46  CD1 
11 1 Y 1 B PHE 64  ? CD2 ? A PHE 46  CD2 
12 1 Y 1 B PHE 64  ? CE1 ? A PHE 46  CE1 
13 1 Y 1 B PHE 64  ? CE2 ? A PHE 46  CE2 
14 1 Y 1 B PHE 64  ? CZ  ? A PHE 46  CZ  
15 1 Y 1 B LYS 66  ? CG  ? A LYS 48  CG  
16 1 Y 1 B LYS 66  ? CD  ? A LYS 48  CD  
17 1 Y 1 B LYS 66  ? CE  ? A LYS 48  CE  
18 1 Y 1 B LYS 66  ? NZ  ? A LYS 48  NZ  
19 1 Y 1 B GLU 214 ? CG  ? A GLU 196 CG  
20 1 Y 1 B GLU 214 ? CD  ? A GLU 196 CD  
21 1 Y 1 B GLU 214 ? OE1 ? A GLU 196 OE1 
22 1 Y 1 B GLU 214 ? OE2 ? A GLU 196 OE2 
23 1 Y 1 B GLN 216 ? CG  ? A GLN 198 CG  
24 1 Y 1 B GLN 216 ? CD  ? A GLN 198 CD  
25 1 Y 1 B GLN 216 ? OE1 ? A GLN 198 OE1 
26 1 Y 1 B GLN 216 ? NE2 ? A GLN 198 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 19  ? A MET 1   
2  1 Y 1 B SER 20  ? A SER 2   
3  1 Y 1 B LYS 21  ? A LYS 3   
4  1 Y 1 B PRO 22  ? A PRO 4   
5  1 Y 1 B LYS 23  ? A LYS 5   
6  1 Y 1 B GLN 24  ? A GLN 6   
7  1 Y 1 B PRO 25  ? A PRO 7   
8  1 Y 1 B PRO 26  ? A PRO 8   
9  1 Y 1 B ASP 27  ? A ASP 9   
10 1 Y 1 B ALA 28  ? A ALA 10  
11 1 Y 1 B SER 29  ? A SER 11  
12 1 Y 1 B PRO 217 ? A PRO 199 
13 1 Y 1 B LEU 268 ? A LEU 250 
14 1 Y 1 B GLU 269 ? A GLU 251 
15 1 Y 1 B HIS 270 ? A HIS 252 
16 1 Y 1 B HIS 271 ? A HIS 253 
17 1 Y 1 B HIS 272 ? A HIS 254 
18 1 Y 1 B HIS 273 ? A HIS 255 
19 1 Y 1 B HIS 274 ? A HIS 256 
20 1 Y 1 B HIS 275 ? A HIS 257 
21 1 Y 1 A MET 19  ? B MET 1   
22 1 Y 1 A SER 20  ? B SER 2   
23 1 Y 1 A LYS 21  ? B LYS 3   
24 1 Y 1 A PRO 22  ? B PRO 4   
25 1 Y 1 A LYS 23  ? B LYS 5   
26 1 Y 1 A GLN 24  ? B GLN 6   
27 1 Y 1 A PRO 25  ? B PRO 7   
28 1 Y 1 A PRO 26  ? B PRO 8   
29 1 Y 1 A ASP 27  ? B ASP 9   
30 1 Y 1 A ALA 28  ? B ALA 10  
31 1 Y 1 A SER 29  ? B SER 11  
32 1 Y 1 A GLU 214 ? B GLU 196 
33 1 Y 1 A PRO 215 ? B PRO 197 
34 1 Y 1 A GLN 216 ? B GLN 198 
35 1 Y 1 A PRO 217 ? B PRO 199 
36 1 Y 1 A LEU 268 ? B LEU 250 
37 1 Y 1 A GLU 269 ? B GLU 251 
38 1 Y 1 A HIS 270 ? B HIS 252 
39 1 Y 1 A HIS 271 ? B HIS 253 
40 1 Y 1 A HIS 272 ? B HIS 254 
41 1 Y 1 A HIS 273 ? B HIS 255 
42 1 Y 1 A HIS 274 ? B HIS 256 
43 1 Y 1 A HIS 275 ? B HIS 257 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1   301 1   GOL GOL B . 
D 2 GOL 1   301 1   GOL GOL A . 
E 2 GOL 1   302 1   GOL GOL A . 
F 3 HOH 1   401 2   HOH HOH B . 
F 3 HOH 2   402 13  HOH HOH B . 
F 3 HOH 3   403 17  HOH HOH B . 
F 3 HOH 4   404 19  HOH HOH B . 
F 3 HOH 5   405 20  HOH HOH B . 
F 3 HOH 6   406 277 HOH HOH B . 
F 3 HOH 7   407 23  HOH HOH B . 
F 3 HOH 8   408 29  HOH HOH B . 
F 3 HOH 9   409 33  HOH HOH B . 
F 3 HOH 10  410 281 HOH HOH B . 
F 3 HOH 11  411 36  HOH HOH B . 
F 3 HOH 12  412 283 HOH HOH B . 
F 3 HOH 13  413 37  HOH HOH B . 
F 3 HOH 14  414 285 HOH HOH B . 
F 3 HOH 15  415 38  HOH HOH B . 
F 3 HOH 16  416 40  HOH HOH B . 
F 3 HOH 17  417 288 HOH HOH B . 
F 3 HOH 18  418 289 HOH HOH B . 
F 3 HOH 19  419 43  HOH HOH B . 
F 3 HOH 20  420 44  HOH HOH B . 
F 3 HOH 21  421 292 HOH HOH B . 
F 3 HOH 22  422 49  HOH HOH B . 
F 3 HOH 23  423 294 HOH HOH B . 
F 3 HOH 24  424 295 HOH HOH B . 
F 3 HOH 25  425 50  HOH HOH B . 
F 3 HOH 26  426 51  HOH HOH B . 
F 3 HOH 27  427 53  HOH HOH B . 
F 3 HOH 28  428 60  HOH HOH B . 
F 3 HOH 29  429 61  HOH HOH B . 
F 3 HOH 30  430 65  HOH HOH B . 
F 3 HOH 31  431 302 HOH HOH B . 
F 3 HOH 32  432 68  HOH HOH B . 
F 3 HOH 33  433 304 HOH HOH B . 
F 3 HOH 34  434 70  HOH HOH B . 
F 3 HOH 35  435 306 HOH HOH B . 
F 3 HOH 36  436 71  HOH HOH B . 
F 3 HOH 37  437 73  HOH HOH B . 
F 3 HOH 38  438 309 HOH HOH B . 
F 3 HOH 39  439 310 HOH HOH B . 
F 3 HOH 40  440 76  HOH HOH B . 
F 3 HOH 41  441 77  HOH HOH B . 
F 3 HOH 42  442 313 HOH HOH B . 
F 3 HOH 43  443 314 HOH HOH B . 
F 3 HOH 44  444 78  HOH HOH B . 
F 3 HOH 45  445 80  HOH HOH B . 
F 3 HOH 46  446 317 HOH HOH B . 
F 3 HOH 47  447 318 HOH HOH B . 
F 3 HOH 48  448 82  HOH HOH B . 
F 3 HOH 49  449 83  HOH HOH B . 
F 3 HOH 50  450 84  HOH HOH B . 
F 3 HOH 51  451 86  HOH HOH B . 
F 3 HOH 52  452 88  HOH HOH B . 
F 3 HOH 53  453 91  HOH HOH B . 
F 3 HOH 54  454 325 HOH HOH B . 
F 3 HOH 55  455 93  HOH HOH B . 
F 3 HOH 56  456 94  HOH HOH B . 
F 3 HOH 57  457 328 HOH HOH B . 
F 3 HOH 58  458 97  HOH HOH B . 
F 3 HOH 59  459 100 HOH HOH B . 
F 3 HOH 60  460 101 HOH HOH B . 
F 3 HOH 61  461 102 HOH HOH B . 
F 3 HOH 62  462 107 HOH HOH B . 
F 3 HOH 63  463 109 HOH HOH B . 
F 3 HOH 64  464 110 HOH HOH B . 
F 3 HOH 65  465 336 HOH HOH B . 
F 3 HOH 66  466 112 HOH HOH B . 
F 3 HOH 67  467 338 HOH HOH B . 
F 3 HOH 68  468 339 HOH HOH B . 
F 3 HOH 69  469 113 HOH HOH B . 
F 3 HOH 70  470 341 HOH HOH B . 
F 3 HOH 71  471 115 HOH HOH B . 
F 3 HOH 72  472 121 HOH HOH B . 
F 3 HOH 73  473 344 HOH HOH B . 
F 3 HOH 74  474 345 HOH HOH B . 
F 3 HOH 75  475 346 HOH HOH B . 
F 3 HOH 76  476 347 HOH HOH B . 
F 3 HOH 77  477 348 HOH HOH B . 
F 3 HOH 78  478 349 HOH HOH B . 
F 3 HOH 79  479 350 HOH HOH B . 
F 3 HOH 80  480 351 HOH HOH B . 
F 3 HOH 81  481 352 HOH HOH B . 
F 3 HOH 82  482 353 HOH HOH B . 
F 3 HOH 83  483 354 HOH HOH B . 
F 3 HOH 84  484 355 HOH HOH B . 
F 3 HOH 85  485 122 HOH HOH B . 
F 3 HOH 86  486 123 HOH HOH B . 
F 3 HOH 87  487 358 HOH HOH B . 
F 3 HOH 88  488 359 HOH HOH B . 
F 3 HOH 89  489 124 HOH HOH B . 
F 3 HOH 90  490 361 HOH HOH B . 
F 3 HOH 91  491 126 HOH HOH B . 
F 3 HOH 92  492 128 HOH HOH B . 
F 3 HOH 93  493 364 HOH HOH B . 
F 3 HOH 94  494 365 HOH HOH B . 
F 3 HOH 95  495 131 HOH HOH B . 
F 3 HOH 96  496 133 HOH HOH B . 
F 3 HOH 97  497 134 HOH HOH B . 
F 3 HOH 98  498 369 HOH HOH B . 
F 3 HOH 99  499 370 HOH HOH B . 
F 3 HOH 100 500 371 HOH HOH B . 
F 3 HOH 101 501 372 HOH HOH B . 
F 3 HOH 102 502 373 HOH HOH B . 
F 3 HOH 103 503 138 HOH HOH B . 
F 3 HOH 104 504 375 HOH HOH B . 
F 3 HOH 105 505 140 HOH HOH B . 
F 3 HOH 106 506 141 HOH HOH B . 
F 3 HOH 107 507 378 HOH HOH B . 
F 3 HOH 108 508 147 HOH HOH B . 
F 3 HOH 109 509 380 HOH HOH B . 
F 3 HOH 110 510 381 HOH HOH B . 
F 3 HOH 111 511 148 HOH HOH B . 
F 3 HOH 112 512 150 HOH HOH B . 
F 3 HOH 113 513 153 HOH HOH B . 
F 3 HOH 114 514 385 HOH HOH B . 
F 3 HOH 115 515 386 HOH HOH B . 
F 3 HOH 116 516 154 HOH HOH B . 
F 3 HOH 117 517 388 HOH HOH B . 
F 3 HOH 118 518 156 HOH HOH B . 
F 3 HOH 119 519 159 HOH HOH B . 
F 3 HOH 120 520 391 HOH HOH B . 
F 3 HOH 121 521 392 HOH HOH B . 
F 3 HOH 122 522 165 HOH HOH B . 
F 3 HOH 123 523 167 HOH HOH B . 
F 3 HOH 124 524 170 HOH HOH B . 
F 3 HOH 125 525 177 HOH HOH B . 
F 3 HOH 126 526 397 HOH HOH B . 
F 3 HOH 127 527 398 HOH HOH B . 
F 3 HOH 128 528 178 HOH HOH B . 
F 3 HOH 129 529 400 HOH HOH B . 
F 3 HOH 130 530 401 HOH HOH B . 
F 3 HOH 131 531 402 HOH HOH B . 
F 3 HOH 132 532 403 HOH HOH B . 
F 3 HOH 133 533 404 HOH HOH B . 
F 3 HOH 134 534 184 HOH HOH B . 
F 3 HOH 135 535 185 HOH HOH B . 
F 3 HOH 136 536 407 HOH HOH B . 
F 3 HOH 137 537 187 HOH HOH B . 
F 3 HOH 138 538 188 HOH HOH B . 
F 3 HOH 139 539 189 HOH HOH B . 
F 3 HOH 140 540 411 HOH HOH B . 
F 3 HOH 141 541 412 HOH HOH B . 
F 3 HOH 142 542 413 HOH HOH B . 
F 3 HOH 143 543 190 HOH HOH B . 
F 3 HOH 144 544 415 HOH HOH B . 
F 3 HOH 145 545 200 HOH HOH B . 
F 3 HOH 146 546 417 HOH HOH B . 
F 3 HOH 147 547 418 HOH HOH B . 
F 3 HOH 148 548 419 HOH HOH B . 
F 3 HOH 149 549 420 HOH HOH B . 
F 3 HOH 150 550 210 HOH HOH B . 
F 3 HOH 151 551 213 HOH HOH B . 
F 3 HOH 152 552 214 HOH HOH B . 
F 3 HOH 153 553 424 HOH HOH B . 
F 3 HOH 154 554 425 HOH HOH B . 
F 3 HOH 155 555 426 HOH HOH B . 
F 3 HOH 156 556 215 HOH HOH B . 
F 3 HOH 157 557 216 HOH HOH B . 
F 3 HOH 158 558 218 HOH HOH B . 
F 3 HOH 159 559 220 HOH HOH B . 
F 3 HOH 160 560 222 HOH HOH B . 
F 3 HOH 161 561 432 HOH HOH B . 
F 3 HOH 162 562 433 HOH HOH B . 
F 3 HOH 163 563 223 HOH HOH B . 
F 3 HOH 164 564 435 HOH HOH B . 
F 3 HOH 165 565 436 HOH HOH B . 
F 3 HOH 166 566 437 HOH HOH B . 
F 3 HOH 167 567 226 HOH HOH B . 
F 3 HOH 168 568 229 HOH HOH B . 
F 3 HOH 169 569 232 HOH HOH B . 
F 3 HOH 170 570 441 HOH HOH B . 
F 3 HOH 171 571 235 HOH HOH B . 
F 3 HOH 172 572 236 HOH HOH B . 
F 3 HOH 173 573 238 HOH HOH B . 
F 3 HOH 174 574 241 HOH HOH B . 
F 3 HOH 175 575 245 HOH HOH B . 
F 3 HOH 176 576 246 HOH HOH B . 
F 3 HOH 177 577 448 HOH HOH B . 
F 3 HOH 178 578 247 HOH HOH B . 
F 3 HOH 179 579 248 HOH HOH B . 
F 3 HOH 180 580 249 HOH HOH B . 
F 3 HOH 181 581 452 HOH HOH B . 
F 3 HOH 182 582 253 HOH HOH B . 
F 3 HOH 183 583 257 HOH HOH B . 
F 3 HOH 184 584 455 HOH HOH B . 
F 3 HOH 185 585 456 HOH HOH B . 
F 3 HOH 186 586 457 HOH HOH B . 
F 3 HOH 187 587 258 HOH HOH B . 
F 3 HOH 188 588 262 HOH HOH B . 
F 3 HOH 189 589 265 HOH HOH B . 
F 3 HOH 190 590 267 HOH HOH B . 
F 3 HOH 191 591 268 HOH HOH B . 
F 3 HOH 192 592 463 HOH HOH B . 
F 3 HOH 193 593 464 HOH HOH B . 
F 3 HOH 194 594 269 HOH HOH B . 
F 3 HOH 195 595 272 HOH HOH B . 
F 3 HOH 196 596 467 HOH HOH B . 
F 3 HOH 197 597 468 HOH HOH B . 
F 3 HOH 198 598 275 HOH HOH B . 
F 3 HOH 199 599 470 HOH HOH B . 
F 3 HOH 200 600 471 HOH HOH B . 
F 3 HOH 201 601 472 HOH HOH B . 
F 3 HOH 202 602 477 HOH HOH B . 
F 3 HOH 203 603 480 HOH HOH B . 
F 3 HOH 204 604 481 HOH HOH B . 
F 3 HOH 205 605 483 HOH HOH B . 
F 3 HOH 206 606 484 HOH HOH B . 
F 3 HOH 207 607 486 HOH HOH B . 
F 3 HOH 208 608 487 HOH HOH B . 
F 3 HOH 209 609 489 HOH HOH B . 
F 3 HOH 210 610 490 HOH HOH B . 
F 3 HOH 211 611 492 HOH HOH B . 
F 3 HOH 212 612 493 HOH HOH B . 
F 3 HOH 213 613 496 HOH HOH B . 
G 3 HOH 1   401 3   HOH HOH A . 
G 3 HOH 2   402 4   HOH HOH A . 
G 3 HOH 3   403 5   HOH HOH A . 
G 3 HOH 4   404 6   HOH HOH A . 
G 3 HOH 5   405 7   HOH HOH A . 
G 3 HOH 6   406 8   HOH HOH A . 
G 3 HOH 7   407 9   HOH HOH A . 
G 3 HOH 8   408 10  HOH HOH A . 
G 3 HOH 9   409 11  HOH HOH A . 
G 3 HOH 10  410 12  HOH HOH A . 
G 3 HOH 11  411 14  HOH HOH A . 
G 3 HOH 12  412 15  HOH HOH A . 
G 3 HOH 13  413 16  HOH HOH A . 
G 3 HOH 14  414 18  HOH HOH A . 
G 3 HOH 15  415 1   HOH HOH A . 
G 3 HOH 16  416 278 HOH HOH A . 
G 3 HOH 17  417 279 HOH HOH A . 
G 3 HOH 18  418 280 HOH HOH A . 
G 3 HOH 19  419 21  HOH HOH A . 
G 3 HOH 20  420 282 HOH HOH A . 
G 3 HOH 21  421 22  HOH HOH A . 
G 3 HOH 22  422 284 HOH HOH A . 
G 3 HOH 23  423 24  HOH HOH A . 
G 3 HOH 24  424 286 HOH HOH A . 
G 3 HOH 25  425 287 HOH HOH A . 
G 3 HOH 26  426 25  HOH HOH A . 
G 3 HOH 27  427 26  HOH HOH A . 
G 3 HOH 28  428 290 HOH HOH A . 
G 3 HOH 29  429 291 HOH HOH A . 
G 3 HOH 30  430 27  HOH HOH A . 
G 3 HOH 31  431 293 HOH HOH A . 
G 3 HOH 32  432 28  HOH HOH A . 
G 3 HOH 33  433 30  HOH HOH A . 
G 3 HOH 34  434 296 HOH HOH A . 
G 3 HOH 35  435 297 HOH HOH A . 
G 3 HOH 36  436 298 HOH HOH A . 
G 3 HOH 37  437 299 HOH HOH A . 
G 3 HOH 38  438 300 HOH HOH A . 
G 3 HOH 39  439 301 HOH HOH A . 
G 3 HOH 40  440 31  HOH HOH A . 
G 3 HOH 41  441 303 HOH HOH A . 
G 3 HOH 42  442 32  HOH HOH A . 
G 3 HOH 43  443 305 HOH HOH A . 
G 3 HOH 44  444 34  HOH HOH A . 
G 3 HOH 45  445 307 HOH HOH A . 
G 3 HOH 46  446 308 HOH HOH A . 
G 3 HOH 47  447 35  HOH HOH A . 
G 3 HOH 48  448 39  HOH HOH A . 
G 3 HOH 49  449 311 HOH HOH A . 
G 3 HOH 50  450 312 HOH HOH A . 
G 3 HOH 51  451 41  HOH HOH A . 
G 3 HOH 52  452 42  HOH HOH A . 
G 3 HOH 53  453 315 HOH HOH A . 
G 3 HOH 54  454 45  HOH HOH A . 
G 3 HOH 55  455 46  HOH HOH A . 
G 3 HOH 56  456 47  HOH HOH A . 
G 3 HOH 57  457 48  HOH HOH A . 
G 3 HOH 58  458 320 HOH HOH A . 
G 3 HOH 59  459 321 HOH HOH A . 
G 3 HOH 60  460 52  HOH HOH A . 
G 3 HOH 61  461 323 HOH HOH A . 
G 3 HOH 62  462 324 HOH HOH A . 
G 3 HOH 63  463 54  HOH HOH A . 
G 3 HOH 64  464 326 HOH HOH A . 
G 3 HOH 65  465 327 HOH HOH A . 
G 3 HOH 66  466 55  HOH HOH A . 
G 3 HOH 67  467 329 HOH HOH A . 
G 3 HOH 68  468 330 HOH HOH A . 
G 3 HOH 69  469 331 HOH HOH A . 
G 3 HOH 70  470 332 HOH HOH A . 
G 3 HOH 71  471 333 HOH HOH A . 
G 3 HOH 72  472 334 HOH HOH A . 
G 3 HOH 73  473 335 HOH HOH A . 
G 3 HOH 74  474 56  HOH HOH A . 
G 3 HOH 75  475 337 HOH HOH A . 
G 3 HOH 76  476 57  HOH HOH A . 
G 3 HOH 77  477 58  HOH HOH A . 
G 3 HOH 78  478 340 HOH HOH A . 
G 3 HOH 79  479 59  HOH HOH A . 
G 3 HOH 80  480 342 HOH HOH A . 
G 3 HOH 81  481 343 HOH HOH A . 
G 3 HOH 82  482 62  HOH HOH A . 
G 3 HOH 83  483 63  HOH HOH A . 
G 3 HOH 84  484 64  HOH HOH A . 
G 3 HOH 85  485 66  HOH HOH A . 
G 3 HOH 86  486 67  HOH HOH A . 
G 3 HOH 87  487 69  HOH HOH A . 
G 3 HOH 88  488 72  HOH HOH A . 
G 3 HOH 89  489 74  HOH HOH A . 
G 3 HOH 90  490 75  HOH HOH A . 
G 3 HOH 91  491 79  HOH HOH A . 
G 3 HOH 92  492 81  HOH HOH A . 
G 3 HOH 93  493 85  HOH HOH A . 
G 3 HOH 94  494 356 HOH HOH A . 
G 3 HOH 95  495 357 HOH HOH A . 
G 3 HOH 96  496 87  HOH HOH A . 
G 3 HOH 97  497 89  HOH HOH A . 
G 3 HOH 98  498 360 HOH HOH A . 
G 3 HOH 99  499 90  HOH HOH A . 
G 3 HOH 100 500 362 HOH HOH A . 
G 3 HOH 101 501 363 HOH HOH A . 
G 3 HOH 102 502 92  HOH HOH A . 
G 3 HOH 103 503 95  HOH HOH A . 
G 3 HOH 104 504 366 HOH HOH A . 
G 3 HOH 105 505 367 HOH HOH A . 
G 3 HOH 106 506 368 HOH HOH A . 
G 3 HOH 107 507 96  HOH HOH A . 
G 3 HOH 108 508 98  HOH HOH A . 
G 3 HOH 109 509 99  HOH HOH A . 
G 3 HOH 110 510 103 HOH HOH A . 
G 3 HOH 111 511 104 HOH HOH A . 
G 3 HOH 112 512 374 HOH HOH A . 
G 3 HOH 113 513 105 HOH HOH A . 
G 3 HOH 114 514 376 HOH HOH A . 
G 3 HOH 115 515 106 HOH HOH A . 
G 3 HOH 116 516 108 HOH HOH A . 
G 3 HOH 117 517 379 HOH HOH A . 
G 3 HOH 118 518 111 HOH HOH A . 
G 3 HOH 119 519 114 HOH HOH A . 
G 3 HOH 120 520 382 HOH HOH A . 
G 3 HOH 121 521 383 HOH HOH A . 
G 3 HOH 122 522 384 HOH HOH A . 
G 3 HOH 123 523 116 HOH HOH A . 
G 3 HOH 124 524 117 HOH HOH A . 
G 3 HOH 125 525 387 HOH HOH A . 
G 3 HOH 126 526 118 HOH HOH A . 
G 3 HOH 127 527 389 HOH HOH A . 
G 3 HOH 128 528 390 HOH HOH A . 
G 3 HOH 129 529 119 HOH HOH A . 
G 3 HOH 130 530 120 HOH HOH A . 
G 3 HOH 131 531 393 HOH HOH A . 
G 3 HOH 132 532 394 HOH HOH A . 
G 3 HOH 133 533 395 HOH HOH A . 
G 3 HOH 134 534 125 HOH HOH A . 
G 3 HOH 135 535 127 HOH HOH A . 
G 3 HOH 136 536 129 HOH HOH A . 
G 3 HOH 137 537 399 HOH HOH A . 
G 3 HOH 138 538 130 HOH HOH A . 
G 3 HOH 139 539 132 HOH HOH A . 
G 3 HOH 140 540 135 HOH HOH A . 
G 3 HOH 141 541 136 HOH HOH A . 
G 3 HOH 142 542 137 HOH HOH A . 
G 3 HOH 143 543 405 HOH HOH A . 
G 3 HOH 144 544 406 HOH HOH A . 
G 3 HOH 145 545 139 HOH HOH A . 
G 3 HOH 146 546 408 HOH HOH A . 
G 3 HOH 147 547 409 HOH HOH A . 
G 3 HOH 148 548 410 HOH HOH A . 
G 3 HOH 149 549 142 HOH HOH A . 
G 3 HOH 150 550 143 HOH HOH A . 
G 3 HOH 151 551 144 HOH HOH A . 
G 3 HOH 152 552 414 HOH HOH A . 
G 3 HOH 153 553 145 HOH HOH A . 
G 3 HOH 154 554 416 HOH HOH A . 
G 3 HOH 155 555 149 HOH HOH A . 
G 3 HOH 156 556 151 HOH HOH A . 
G 3 HOH 157 557 152 HOH HOH A . 
G 3 HOH 158 558 155 HOH HOH A . 
G 3 HOH 159 559 157 HOH HOH A . 
G 3 HOH 160 560 158 HOH HOH A . 
G 3 HOH 161 561 160 HOH HOH A . 
G 3 HOH 162 562 162 HOH HOH A . 
G 3 HOH 163 563 163 HOH HOH A . 
G 3 HOH 164 564 164 HOH HOH A . 
G 3 HOH 165 565 427 HOH HOH A . 
G 3 HOH 166 566 428 HOH HOH A . 
G 3 HOH 167 567 429 HOH HOH A . 
G 3 HOH 168 568 430 HOH HOH A . 
G 3 HOH 169 569 431 HOH HOH A . 
G 3 HOH 170 570 166 HOH HOH A . 
G 3 HOH 171 571 168 HOH HOH A . 
G 3 HOH 172 572 434 HOH HOH A . 
G 3 HOH 173 573 169 HOH HOH A . 
G 3 HOH 174 574 171 HOH HOH A . 
G 3 HOH 175 575 172 HOH HOH A . 
G 3 HOH 176 576 438 HOH HOH A . 
G 3 HOH 177 577 439 HOH HOH A . 
G 3 HOH 178 578 440 HOH HOH A . 
G 3 HOH 179 579 173 HOH HOH A . 
G 3 HOH 180 580 174 HOH HOH A . 
G 3 HOH 181 581 176 HOH HOH A . 
G 3 HOH 182 582 444 HOH HOH A . 
G 3 HOH 183 583 445 HOH HOH A . 
G 3 HOH 184 584 446 HOH HOH A . 
G 3 HOH 185 585 447 HOH HOH A . 
G 3 HOH 186 586 179 HOH HOH A . 
G 3 HOH 187 587 449 HOH HOH A . 
G 3 HOH 188 588 180 HOH HOH A . 
G 3 HOH 189 589 451 HOH HOH A . 
G 3 HOH 190 590 181 HOH HOH A . 
G 3 HOH 191 591 453 HOH HOH A . 
G 3 HOH 192 592 454 HOH HOH A . 
G 3 HOH 193 593 182 HOH HOH A . 
G 3 HOH 194 594 183 HOH HOH A . 
G 3 HOH 195 595 186 HOH HOH A . 
G 3 HOH 196 596 458 HOH HOH A . 
G 3 HOH 197 597 191 HOH HOH A . 
G 3 HOH 198 598 460 HOH HOH A . 
G 3 HOH 199 599 461 HOH HOH A . 
G 3 HOH 200 600 462 HOH HOH A . 
G 3 HOH 201 601 192 HOH HOH A . 
G 3 HOH 202 602 193 HOH HOH A . 
G 3 HOH 203 603 465 HOH HOH A . 
G 3 HOH 204 604 466 HOH HOH A . 
G 3 HOH 205 605 194 HOH HOH A . 
G 3 HOH 206 606 195 HOH HOH A . 
G 3 HOH 207 607 469 HOH HOH A . 
G 3 HOH 208 608 196 HOH HOH A . 
G 3 HOH 209 609 197 HOH HOH A . 
G 3 HOH 210 610 198 HOH HOH A . 
G 3 HOH 211 611 473 HOH HOH A . 
G 3 HOH 212 612 474 HOH HOH A . 
G 3 HOH 213 613 475 HOH HOH A . 
G 3 HOH 214 614 476 HOH HOH A . 
G 3 HOH 215 615 199 HOH HOH A . 
G 3 HOH 216 616 478 HOH HOH A . 
G 3 HOH 217 617 479 HOH HOH A . 
G 3 HOH 218 618 201 HOH HOH A . 
G 3 HOH 219 619 202 HOH HOH A . 
G 3 HOH 220 620 482 HOH HOH A . 
G 3 HOH 221 621 203 HOH HOH A . 
G 3 HOH 222 622 204 HOH HOH A . 
G 3 HOH 223 623 485 HOH HOH A . 
G 3 HOH 224 624 205 HOH HOH A . 
G 3 HOH 225 625 206 HOH HOH A . 
G 3 HOH 226 626 488 HOH HOH A . 
G 3 HOH 227 627 207 HOH HOH A . 
G 3 HOH 228 628 208 HOH HOH A . 
G 3 HOH 229 629 491 HOH HOH A . 
G 3 HOH 230 630 209 HOH HOH A . 
G 3 HOH 231 631 211 HOH HOH A . 
G 3 HOH 232 632 494 HOH HOH A . 
G 3 HOH 233 633 495 HOH HOH A . 
G 3 HOH 234 634 212 HOH HOH A . 
G 3 HOH 235 635 217 HOH HOH A . 
G 3 HOH 236 636 219 HOH HOH A . 
G 3 HOH 237 637 221 HOH HOH A . 
G 3 HOH 238 638 224 HOH HOH A . 
G 3 HOH 239 639 225 HOH HOH A . 
G 3 HOH 240 640 227 HOH HOH A . 
G 3 HOH 241 641 228 HOH HOH A . 
G 3 HOH 242 642 230 HOH HOH A . 
G 3 HOH 243 643 231 HOH HOH A . 
G 3 HOH 244 644 233 HOH HOH A . 
G 3 HOH 245 645 234 HOH HOH A . 
G 3 HOH 246 646 237 HOH HOH A . 
G 3 HOH 247 647 239 HOH HOH A . 
G 3 HOH 248 648 240 HOH HOH A . 
G 3 HOH 249 649 242 HOH HOH A . 
G 3 HOH 250 650 243 HOH HOH A . 
G 3 HOH 251 651 244 HOH HOH A . 
G 3 HOH 252 652 250 HOH HOH A . 
G 3 HOH 253 653 251 HOH HOH A . 
G 3 HOH 254 654 252 HOH HOH A . 
G 3 HOH 255 655 254 HOH HOH A . 
G 3 HOH 256 656 255 HOH HOH A . 
G 3 HOH 257 657 256 HOH HOH A . 
G 3 HOH 258 658 259 HOH HOH A . 
G 3 HOH 259 659 260 HOH HOH A . 
G 3 HOH 260 660 261 HOH HOH A . 
G 3 HOH 261 661 263 HOH HOH A . 
G 3 HOH 262 662 264 HOH HOH A . 
G 3 HOH 263 663 266 HOH HOH A . 
G 3 HOH 264 664 270 HOH HOH A . 
G 3 HOH 265 665 271 HOH HOH A . 
G 3 HOH 266 666 274 HOH HOH A . 
G 3 HOH 267 667 276 HOH HOH A . 
#