data_3V3Q
# 
_entry.id   3V3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V3Q         
RCSB  RCSB069556   
WWPDB D_1000069556 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3V3E 
_pdbx_database_related.details        'Crystal Structure of the Human Nur77 Ligand-binding Domain' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3V3Q 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-14 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Q.' 1 
'Shi, C.'   2 
'Yang, K.'  3 
'Chen, Y.'  4 
'Zhan, Y.'  5 
'Wu, Q.'    6 
'Lin, T.'   7 
# 
_citation.id                        primary 
_citation.title                     'The orphan nuclear receptor Nur77 regulates LKB1 localization and activates AMPK' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            8 
_citation.page_first                897 
_citation.page_last                 904 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22983157 
_citation.pdbx_database_id_DOI      10.1038/nchembio.1069 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhan, Y.'   1  
primary 'Chen, Y.'   2  
primary 'Zhang, Q.'  3  
primary 'Zhuang, J.' 4  
primary 'Tian, M.'   5  
primary 'Chen, H.'   6  
primary 'Zhang, L.'  7  
primary 'Zhang, H.'  8  
primary 'He, J.'     9  
primary 'Wang, W.'   10 
primary 'Wu, R.'     11 
primary 'Wang, Y.'   12 
primary 'Shi, C.'    13 
primary 'Yang, K.'   14 
primary 'Li, A.'     15 
primary 'Xin, Y.'    16 
primary 'Li, T.Y.'   17 
primary 'Yang, J.Y.' 18 
primary 'Zheng, Z.'  19 
primary 'Yu, C.'     20 
primary 'Lin, S.'    21 
primary 'Chang, C.'  22 
primary 'Huang, P.'  23 
primary 'Lin, T.'    24 
primary 'Wu, Q.'     25 
# 
_cell.entry_id           3V3Q 
_cell.length_a           74.242 
_cell.length_b           76.773 
_cell.length_c           129.193 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V3Q 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 1'    28745.305 2   ? ? 
'ligand-bingding domain, UNP residues 351-598' ? 
2 non-polymer syn 'ethyl (2,3,4-trimethoxy-6-octanoylphenyl)acetate' 380.475   2   ? ? ? ? 
3 non-polymer syn GLYCEROL                                           92.094    4   ? ? ? ? 
4 non-polymer syn 'SODIUM ION'                                       22.990    1   ? ? ? ? 
5 water       nat water                                              18.015    397 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   LYS n 
1 6   GLN n 
1 7   PRO n 
1 8   PRO n 
1 9   ASP n 
1 10  ALA n 
1 11  SER n 
1 12  PRO n 
1 13  ALA n 
1 14  ASN n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ARG n 
1 22  ALA n 
1 23  HIS n 
1 24  LEU n 
1 25  ASP n 
1 26  SER n 
1 27  GLY n 
1 28  PRO n 
1 29  SER n 
1 30  THR n 
1 31  ALA n 
1 32  LYS n 
1 33  LEU n 
1 34  ASP n 
1 35  TYR n 
1 36  SER n 
1 37  LYS n 
1 38  PHE n 
1 39  GLN n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  LEU n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  GLY n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  ALA n 
1 52  GLY n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  GLN n 
1 57  PHE n 
1 58  TYR n 
1 59  ASP n 
1 60  LEU n 
1 61  LEU n 
1 62  SER n 
1 63  GLY n 
1 64  SER n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  ILE n 
1 69  ARG n 
1 70  LYS n 
1 71  TRP n 
1 72  ALA n 
1 73  GLU n 
1 74  LYS n 
1 75  ILE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  ALA n 
1 80  GLU n 
1 81  LEU n 
1 82  SER n 
1 83  PRO n 
1 84  ALA n 
1 85  ASP n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LEU n 
1 90  LEU n 
1 91  GLU n 
1 92  SER n 
1 93  ALA n 
1 94  PHE n 
1 95  LEU n 
1 96  GLU n 
1 97  LEU n 
1 98  PHE n 
1 99  ILE n 
1 100 LEU n 
1 101 ARG n 
1 102 LEU n 
1 103 ALA n 
1 104 TYR n 
1 105 ARG n 
1 106 SER n 
1 107 LYS n 
1 108 PRO n 
1 109 GLY n 
1 110 GLU n 
1 111 GLY n 
1 112 LYS n 
1 113 LEU n 
1 114 ILE n 
1 115 PHE n 
1 116 CYS n 
1 117 SER n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 LEU n 
1 122 HIS n 
1 123 ARG n 
1 124 LEU n 
1 125 GLN n 
1 126 CYS n 
1 127 ALA n 
1 128 ARG n 
1 129 GLY n 
1 130 PHE n 
1 131 GLY n 
1 132 ASP n 
1 133 TRP n 
1 134 ILE n 
1 135 ASP n 
1 136 SER n 
1 137 ILE n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 ARG n 
1 143 SER n 
1 144 LEU n 
1 145 HIS n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 VAL n 
1 152 PRO n 
1 153 ALA n 
1 154 PHE n 
1 155 ALA n 
1 156 CYS n 
1 157 LEU n 
1 158 SER n 
1 159 ALA n 
1 160 LEU n 
1 161 VAL n 
1 162 LEU n 
1 163 ILE n 
1 164 THR n 
1 165 ASP n 
1 166 ARG n 
1 167 HIS n 
1 168 GLY n 
1 169 LEU n 
1 170 GLN n 
1 171 GLU n 
1 172 PRO n 
1 173 ARG n 
1 174 ARG n 
1 175 VAL n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 GLN n 
1 180 ASN n 
1 181 ARG n 
1 182 ILE n 
1 183 ALA n 
1 184 SER n 
1 185 CYS n 
1 186 LEU n 
1 187 LYS n 
1 188 GLU n 
1 189 HIS n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 GLN n 
1 199 PRO n 
1 200 ALA n 
1 201 SER n 
1 202 CYS n 
1 203 LEU n 
1 204 SER n 
1 205 ARG n 
1 206 LEU n 
1 207 LEU n 
1 208 GLY n 
1 209 LYS n 
1 210 LEU n 
1 211 PRO n 
1 212 GLU n 
1 213 LEU n 
1 214 ARG n 
1 215 THR n 
1 216 LEU n 
1 217 CYS n 
1 218 THR n 
1 219 GLN n 
1 220 GLY n 
1 221 LEU n 
1 222 GLN n 
1 223 ARG n 
1 224 ILE n 
1 225 PHE n 
1 226 TYR n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 GLU n 
1 231 ASP n 
1 232 LEU n 
1 233 VAL n 
1 234 PRO n 
1 235 PRO n 
1 236 PRO n 
1 237 PRO n 
1 238 ILE n 
1 239 ILE n 
1 240 ASP n 
1 241 LYS n 
1 242 ILE n 
1 243 PHE n 
1 244 MET n 
1 245 ASP n 
1 246 THR n 
1 247 LEU n 
1 248 PRO n 
1 249 PHE n 
1 250 LEU n 
1 251 GLU n 
1 252 HIS n 
1 253 HIS n 
1 254 HIS n 
1 255 HIS n 
1 256 HIS n 
1 257 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A1, GFRP1, HMR, NAK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A1_HUMAN 
_struct_ref.pdbx_db_accession          P22736 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAEL
SPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALV
LITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDK
IFMDTLPF
;
_struct_ref.pdbx_align_begin           351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V3Q A 2 ? 249 ? P22736 351 ? 598 ? 20 267 
2 1 3V3Q B 2 ? 249 ? P22736 351 ? 598 ? 20 267 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V3Q MET A 1   ? UNP P22736 ? ? 'EXPRESSION TAG' 19  1  
1 3V3Q LEU A 250 ? UNP P22736 ? ? 'EXPRESSION TAG' 268 2  
1 3V3Q GLU A 251 ? UNP P22736 ? ? 'EXPRESSION TAG' 269 3  
1 3V3Q HIS A 252 ? UNP P22736 ? ? 'EXPRESSION TAG' 270 4  
1 3V3Q HIS A 253 ? UNP P22736 ? ? 'EXPRESSION TAG' 271 5  
1 3V3Q HIS A 254 ? UNP P22736 ? ? 'EXPRESSION TAG' 272 6  
1 3V3Q HIS A 255 ? UNP P22736 ? ? 'EXPRESSION TAG' 273 7  
1 3V3Q HIS A 256 ? UNP P22736 ? ? 'EXPRESSION TAG' 274 8  
1 3V3Q HIS A 257 ? UNP P22736 ? ? 'EXPRESSION TAG' 275 9  
2 3V3Q MET B 1   ? UNP P22736 ? ? 'EXPRESSION TAG' 19  10 
2 3V3Q LEU B 250 ? UNP P22736 ? ? 'EXPRESSION TAG' 268 11 
2 3V3Q GLU B 251 ? UNP P22736 ? ? 'EXPRESSION TAG' 269 12 
2 3V3Q HIS B 252 ? UNP P22736 ? ? 'EXPRESSION TAG' 270 13 
2 3V3Q HIS B 253 ? UNP P22736 ? ? 'EXPRESSION TAG' 271 14 
2 3V3Q HIS B 254 ? UNP P22736 ? ? 'EXPRESSION TAG' 272 15 
2 3V3Q HIS B 255 ? UNP P22736 ? ? 'EXPRESSION TAG' 273 16 
2 3V3Q HIS B 256 ? UNP P22736 ? ? 'EXPRESSION TAG' 274 17 
2 3V3Q HIS B 257 ? UNP P22736 ? ? 'EXPRESSION TAG' 275 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                               'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                               'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer         . GLYCEROL                                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking' y HISTIDINE                                          ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                              ?                               'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                               'C5 H11 N O2 S'  
149.211 
NA  non-polymer         . 'SODIUM ION'                                       ?                               'Na 1'           
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                             ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                          ?                               'C4 H9 N O3'     
119.119 
TMY non-polymer         . 'ethyl (2,3,4-trimethoxy-6-octanoylphenyl)acetate' ?                               'C21 H32 O6'     
380.475 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                             ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3V3Q 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   61.59 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    '7% PEG 6000, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2011-08-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3V3Q 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.22 
_reflns.d_resolution_low             48.73 
_reflns.number_all                   ? 
_reflns.number_obs                   34891 
_reflns.percent_possible_obs         93.6 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.22 
_reflns_shell.d_res_low                   ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        93.6 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3V3Q 
_refine.ls_d_res_high                            2.2200 
_refine.ls_d_res_low                             48.7300 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    93.6700 
_refine.ls_number_reflns_obs                     33113 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT  
U VALUES: REFINED INDIVIDUALLY
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2131 
_refine.ls_R_factor_R_work                       0.2092 
_refine.ls_wR_factor_R_work                      0.2035 
_refine.ls_R_factor_R_free                       0.2862 
_refine.ls_wR_factor_R_free                      0.2808 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1752 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               35.7602 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            0.0200 
_refine.aniso_B[3][3]                            -0.0100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9320 
_refine.correlation_coeff_Fo_to_Fc_free          0.8740 
_refine.overall_SU_R_Cruickshank_DPI             0.2486 
_refine.overall_SU_R_free                        0.2369 
_refine.pdbx_overall_ESU_R                       0.2490 
_refine.pdbx_overall_ESU_R_Free                  0.2370 
_refine.overall_SU_ML                            0.1720 
_refine.overall_SU_B                             6.8170 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3V3E' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7969 
_refine.B_iso_max                                125.950 
_refine.B_iso_min                                5.670 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3733 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         79 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               4209 
_refine_hist.d_res_high                       2.2200 
_refine_hist.d_res_low                        48.7300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3926 0.016  0.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5311 1.937  2.015  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 480  6.480  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 165  38.739 23.455 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 675  19.847 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 29   22.443 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         605  0.125  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2903 0.009  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.2200 
_refine_ls_shell.d_res_low                        2.2780 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.6700 
_refine_ls_shell.number_reflns_R_work             2350 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2590 
_refine_ls_shell.R_factor_R_free                  0.3350 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2469 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3V3Q 
_struct.title                     
'Crystal Structure of Human Nur77 Ligand-binding Domain in Complex with Ethyl 2-[2,3,4 trimethoxy-6(1-octanoyl)phenyl]acetate' 
_struct.pdbx_descriptor           'Nuclear receptor subfamily 4 group A member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V3Q 
_struct_keywords.text            
'orphan nuclear receptor, protein-antagonist complex, TRANSCRIPTION, TRANSCRIPTION-antagonist complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/antagonist 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 13  ? ASP A 25  ? ALA A 31  ASP A 43  1 ? 13 
HELX_P HELX_P2  2  SER A 29  ? LEU A 33  ? SER A 47  LEU A 51  5 ? 5  
HELX_P HELX_P3  3  ASP A 50  ? LYS A 74  ? ASP A 68  LYS A 92  1 ? 25 
HELX_P HELX_P4  4  GLY A 77  ? LEU A 81  ? GLY A 95  LEU A 99  5 ? 5  
HELX_P HELX_P5  5  SER A 82  ? SER A 106 ? SER A 100 SER A 124 1 ? 25 
HELX_P HELX_P6  6  LYS A 107 ? GLU A 110 ? LYS A 125 GLU A 128 5 ? 4  
HELX_P HELX_P7  7  ARG A 123 ? GLY A 131 ? ARG A 141 GLY A 149 1 ? 9  
HELX_P HELX_P8  8  GLY A 131 ? SER A 146 ? GLY A 149 SER A 164 1 ? 16 
HELX_P HELX_P9  9  ASP A 150 ? ILE A 163 ? ASP A 168 ILE A 181 1 ? 14 
HELX_P HELX_P10 10 GLU A 171 ? VAL A 193 ? GLU A 189 VAL A 211 1 ? 23 
HELX_P HELX_P11 11 SER A 201 ? GLY A 208 ? SER A 219 GLY A 226 1 ? 8  
HELX_P HELX_P12 12 LYS A 209 ? ASP A 231 ? LYS A 227 ASP A 249 1 ? 23 
HELX_P HELX_P13 13 PRO A 236 ? LEU A 247 ? PRO A 254 LEU A 265 1 ? 12 
HELX_P HELX_P14 14 ALA B 13  ? SER B 26  ? ALA B 31  SER B 44  1 ? 14 
HELX_P HELX_P15 15 SER B 29  ? LEU B 33  ? SER B 47  LEU B 51  5 ? 5  
HELX_P HELX_P16 16 ASP B 50  ? LYS B 74  ? ASP B 68  LYS B 92  1 ? 25 
HELX_P HELX_P17 17 GLY B 77  ? LEU B 81  ? GLY B 95  LEU B 99  5 ? 5  
HELX_P HELX_P18 18 SER B 82  ? SER B 106 ? SER B 100 SER B 124 1 ? 25 
HELX_P HELX_P19 19 LYS B 107 ? GLU B 110 ? LYS B 125 GLU B 128 5 ? 4  
HELX_P HELX_P20 20 ARG B 123 ? GLY B 131 ? ARG B 141 GLY B 149 1 ? 9  
HELX_P HELX_P21 21 ASP B 132 ? LEU B 148 ? ASP B 150 LEU B 166 1 ? 17 
HELX_P HELX_P22 22 ASP B 150 ? ILE B 163 ? ASP B 168 ILE B 181 1 ? 14 
HELX_P HELX_P23 23 GLU B 171 ? VAL B 193 ? GLU B 189 VAL B 211 1 ? 23 
HELX_P HELX_P24 24 ALA B 200 ? GLY B 208 ? ALA B 218 GLY B 226 1 ? 9  
HELX_P HELX_P25 25 GLY B 208 ? ASP B 231 ? GLY B 226 ASP B 249 1 ? 24 
HELX_P HELX_P26 26 PRO B 236 ? LEU B 247 ? PRO B 254 LEU B 265 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           SER 
_struct_conn.ptnr1_label_seq_id            64 
_struct_conn.ptnr1_label_atom_id           OG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           I 
_struct_conn.ptnr2_label_comp_id           NA 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           NA 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            SER 
_struct_conn.ptnr1_auth_seq_id             82 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            NA 
_struct_conn.ptnr2_auth_seq_id             302 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.771 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 9   A . ? ASP 27  A ALA 10  A ? ALA 28  A 1 2.55   
2 PRO 12  B . ? PRO 30  B ALA 13  B ? ALA 31  B 1 -16.54 
3 LEU 43  B . ? LEU 61  B PRO 44  B ? PRO 62  B 1 -3.79  
4 GLY 47  B . ? GLY 65  B LYS 48  B ? LYS 66  B 1 -2.15  
5 GLY 195 B . ? GLY 213 B GLU 196 B ? GLU 214 B 1 -9.95  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 112 ? ILE A 114 ? LYS A 130 ILE A 132 
A 2 VAL A 120 ? HIS A 122 ? VAL A 138 HIS A 140 
B 1 LYS B 112 ? ILE B 114 ? LYS B 130 ILE B 132 
B 2 VAL B 120 ? HIS B 122 ? VAL B 138 HIS B 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 113 ? N LEU A 131 O LEU A 121 ? O LEU A 139 
B 1 2 N LEU B 113 ? N LEU B 131 O LEU B 121 ? O LEU B 139 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE TMY A 301' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE TMY A 302' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 303' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 304' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 305' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL B 301' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA B 302'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 GLU A 91  ? GLU A 109 . ? 1_555 ? 
2  AC1 15 SER A 92  ? SER A 110 . ? 1_555 ? 
3  AC1 15 ALA A 93  ? ALA A 111 . ? 1_555 ? 
4  AC1 15 PHE A 94  ? PHE A 112 . ? 1_555 ? 
5  AC1 15 LEU A 95  ? LEU A 113 . ? 1_555 ? 
6  AC1 15 GLU A 96  ? GLU A 114 . ? 1_555 ? 
7  AC1 15 ARG A 214 ? ARG A 232 . ? 1_555 ? 
8  AC1 15 CYS A 217 ? CYS A 235 . ? 1_555 ? 
9  AC1 15 THR A 218 ? THR A 236 . ? 1_555 ? 
10 AC1 15 LEU A 221 ? LEU A 239 . ? 1_555 ? 
11 AC1 15 ILE A 242 ? ILE A 260 . ? 1_555 ? 
12 AC1 15 THR A 246 ? THR A 264 . ? 1_555 ? 
13 AC1 15 HOH J .   ? HOH A 544 . ? 1_555 ? 
14 AC1 15 HOH J .   ? HOH A 547 . ? 1_555 ? 
15 AC1 15 HOH J .   ? HOH A 603 . ? 1_555 ? 
16 AC2 17 HIS A 23  ? HIS A 41  . ? 1_555 ? 
17 AC2 17 LEU A 24  ? LEU A 42  . ? 1_555 ? 
18 AC2 17 PRO A 28  ? PRO A 46  . ? 1_555 ? 
19 AC2 17 TYR A 104 ? TYR A 122 . ? 1_555 ? 
20 AC2 17 ARG A 105 ? ARG A 123 . ? 1_555 ? 
21 AC2 17 LYS A 107 ? LYS A 125 . ? 1_555 ? 
22 AC2 17 LEU A 144 ? LEU A 162 . ? 1_555 ? 
23 AC2 17 HIS A 145 ? HIS A 163 . ? 1_555 ? 
24 AC2 17 LEU A 148 ? LEU A 166 . ? 1_555 ? 
25 AC2 17 VAL A 149 ? VAL A 167 . ? 1_555 ? 
26 AC2 17 VAL A 151 ? VAL A 169 . ? 1_555 ? 
27 AC2 17 GOL F .   ? GOL A 304 . ? 1_555 ? 
28 AC2 17 HOH J .   ? HOH A 438 . ? 1_555 ? 
29 AC2 17 HOH J .   ? HOH A 521 . ? 1_555 ? 
30 AC2 17 HOH J .   ? HOH A 575 . ? 1_555 ? 
31 AC2 17 HOH J .   ? HOH A 583 . ? 1_555 ? 
32 AC2 17 HOH J .   ? HOH A 599 . ? 1_555 ? 
33 AC3 3  LEU A 160 ? LEU A 178 . ? 1_555 ? 
34 AC3 3  HOH J .   ? HOH A 591 . ? 1_555 ? 
35 AC3 3  HOH J .   ? HOH A 595 . ? 1_555 ? 
36 AC4 8  HIS A 23  ? HIS A 41  . ? 1_555 ? 
37 AC4 8  SER A 26  ? SER A 44  . ? 1_555 ? 
38 AC4 8  GLY A 27  ? GLY A 45  . ? 1_555 ? 
39 AC4 8  PRO A 28  ? PRO A 46  . ? 1_555 ? 
40 AC4 8  ARG A 101 ? ARG A 119 . ? 1_555 ? 
41 AC4 8  ARG A 105 ? ARG A 123 . ? 1_555 ? 
42 AC4 8  TMY D .   ? TMY A 302 . ? 1_555 ? 
43 AC4 8  HOH J .   ? HOH A 583 . ? 1_555 ? 
44 AC5 6  GLY A 77  ? GLY A 95  . ? 1_555 ? 
45 AC5 6  GLU A 80  ? GLU A 98  . ? 1_555 ? 
46 AC5 6  ARG A 174 ? ARG A 192 . ? 1_555 ? 
47 AC5 6  GLU A 177 ? GLU A 195 . ? 1_555 ? 
48 AC5 6  GLU B 171 ? GLU B 189 . ? 2_464 ? 
49 AC5 6  HOH K .   ? HOH B 517 . ? 2_464 ? 
50 AC6 7  HIS B 23  ? HIS B 41  . ? 1_555 ? 
51 AC6 7  GLY B 27  ? GLY B 45  . ? 1_555 ? 
52 AC6 7  PRO B 28  ? PRO B 46  . ? 1_555 ? 
53 AC6 7  ARG B 105 ? ARG B 123 . ? 1_555 ? 
54 AC6 7  HOH K .   ? HOH B 574 . ? 1_555 ? 
55 AC6 7  HOH K .   ? HOH B 575 . ? 1_555 ? 
56 AC6 7  HOH K .   ? HOH B 578 . ? 1_555 ? 
57 AC7 4  SER B 64  ? SER B 82  . ? 1_555 ? 
58 AC7 4  ARG B 101 ? ARG B 119 . ? 1_555 ? 
59 AC7 4  ARG B 105 ? ARG B 123 . ? 1_555 ? 
60 AC7 4  CYS B 116 ? CYS B 134 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3V3Q 
_atom_sites.fract_transf_matrix[1][1]   0.013469 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013025 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007740 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 9   ? -11.511 34.836 -30.121 1.00 82.72  ? 27  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 9   ? -11.665 34.066 -28.850 1.00 81.81  ? 27  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 9   ? -13.148 33.792 -28.512 1.00 77.61  ? 27  ASP A C   1 
ATOM   4    O  O   . ASP A 1 9   ? -13.719 34.522 -27.710 1.00 74.22  ? 27  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 9   ? -10.923 34.761 -27.680 1.00 80.52  ? 27  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 9   ? -11.252 36.256 -27.551 1.00 84.96  ? 27  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 9   ? -11.019 37.014 -28.520 1.00 88.07  ? 27  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 9   ? -11.724 36.684 -26.470 1.00 80.68  ? 27  ASP A OD2 1 
ATOM   9    N  N   . ALA A 1 10  ? -13.789 32.760 -29.087 1.00 79.02  ? 28  ALA A N   1 
ATOM   10   C  CA  . ALA A 1 10  ? -13.227 31.751 -30.024 1.00 79.36  ? 28  ALA A CA  1 
ATOM   11   C  C   . ALA A 1 10  ? -11.823 31.234 -29.684 1.00 80.98  ? 28  ALA A C   1 
ATOM   12   O  O   . ALA A 1 10  ? -11.534 30.887 -28.531 1.00 83.04  ? 28  ALA A O   1 
ATOM   13   C  CB  . ALA A 1 10  ? -13.304 32.232 -31.477 1.00 77.17  ? 28  ALA A CB  1 
ATOM   14   N  N   . PRO A 1 12  ? -8.577  27.057 -29.076 1.00 85.04  ? 30  PRO A N   1 
ATOM   15   C  CA  . PRO A 1 12  ? -8.634  25.687 -28.535 1.00 85.60  ? 30  PRO A CA  1 
ATOM   16   C  C   . PRO A 1 12  ? -8.939  25.580 -27.008 1.00 78.91  ? 30  PRO A C   1 
ATOM   17   O  O   . PRO A 1 12  ? -8.425  26.378 -26.214 1.00 70.12  ? 30  PRO A O   1 
ATOM   18   C  CB  . PRO A 1 12  ? -7.242  25.119 -28.882 1.00 84.44  ? 30  PRO A CB  1 
ATOM   19   C  CG  . PRO A 1 12  ? -6.842  25.863 -30.117 1.00 81.75  ? 30  PRO A CG  1 
ATOM   20   C  CD  . PRO A 1 12  ? -7.439  27.247 -29.999 1.00 82.53  ? 30  PRO A CD  1 
ATOM   21   N  N   . ALA A 1 13  ? -9.799  24.606 -26.662 1.00 73.81  ? 31  ALA A N   1 
ATOM   22   C  CA  . ALA A 1 13  ? -10.216 24.196 -25.285 1.00 64.11  ? 31  ALA A CA  1 
ATOM   23   C  C   . ALA A 1 13  ? -10.728 25.271 -24.294 1.00 57.47  ? 31  ALA A C   1 
ATOM   24   O  O   . ALA A 1 13  ? -10.265 25.333 -23.163 1.00 52.60  ? 31  ALA A O   1 
ATOM   25   C  CB  . ALA A 1 13  ? -9.131  23.319 -24.638 1.00 64.06  ? 31  ALA A CB  1 
ATOM   26   N  N   . ASN A 1 14  ? -11.720 26.073 -24.681 1.00 53.16  ? 32  ASN A N   1 
ATOM   27   C  CA  . ASN A 1 14  ? -11.882 27.373 -24.014 1.00 49.19  ? 32  ASN A CA  1 
ATOM   28   C  C   . ASN A 1 14  ? -12.026 27.541 -22.472 1.00 41.17  ? 32  ASN A C   1 
ATOM   29   O  O   . ASN A 1 14  ? -11.291 28.344 -21.898 1.00 32.61  ? 32  ASN A O   1 
ATOM   30   C  CB  . ASN A 1 14  ? -12.890 28.265 -24.692 1.00 46.91  ? 32  ASN A CB  1 
ATOM   31   C  CG  . ASN A 1 14  ? -12.725 29.705 -24.253 1.00 51.33  ? 32  ASN A CG  1 
ATOM   32   O  OD1 . ASN A 1 14  ? -11.685 30.312 -24.497 1.00 57.42  ? 32  ASN A OD1 1 
ATOM   33   N  ND2 . ASN A 1 14  ? -13.721 30.240 -23.552 1.00 52.98  ? 32  ASN A ND2 1 
ATOM   34   N  N   . LEU A 1 15  ? -12.973 26.847 -21.823 1.00 35.65  ? 33  LEU A N   1 
ATOM   35   C  CA  . LEU A 1 15  ? -13.068 26.967 -20.350 1.00 33.41  ? 33  LEU A CA  1 
ATOM   36   C  C   . LEU A 1 15  ? -11.735 26.443 -19.791 1.00 31.12  ? 33  LEU A C   1 
ATOM   37   O  O   . LEU A 1 15  ? -11.071 27.101 -18.984 1.00 29.98  ? 33  LEU A O   1 
ATOM   38   C  CB  . LEU A 1 15  ? -14.285 26.218 -19.740 1.00 32.44  ? 33  LEU A CB  1 
ATOM   39   C  CG  . LEU A 1 15  ? -14.434 26.194 -18.182 1.00 30.64  ? 33  LEU A CG  1 
ATOM   40   C  CD1 . LEU A 1 15  ? -14.151 27.576 -17.609 1.00 28.22  ? 33  LEU A CD1 1 
ATOM   41   C  CD2 . LEU A 1 15  ? -15.772 25.636 -17.707 1.00 26.20  ? 33  LEU A CD2 1 
ATOM   42   N  N   . LEU A 1 16  ? -11.327 25.294 -20.290 1.00 31.71  ? 34  LEU A N   1 
ATOM   43   C  CA  . LEU A 1 16  ? -10.098 24.682 -19.860 1.00 35.77  ? 34  LEU A CA  1 
ATOM   44   C  C   . LEU A 1 16  ? -8.951  25.659 -20.018 1.00 38.89  ? 34  LEU A C   1 
ATOM   45   O  O   . LEU A 1 16  ? -8.142  25.820 -19.100 1.00 41.86  ? 34  LEU A O   1 
ATOM   46   C  CB  . LEU A 1 16  ? -9.842  23.373 -20.609 1.00 35.65  ? 34  LEU A CB  1 
ATOM   47   C  CG  . LEU A 1 16  ? -8.680  22.554 -20.027 1.00 36.32  ? 34  LEU A CG  1 
ATOM   48   C  CD1 . LEU A 1 16  ? -8.929  22.239 -18.536 1.00 34.14  ? 34  LEU A CD1 1 
ATOM   49   C  CD2 . LEU A 1 16  ? -8.381  21.281 -20.837 1.00 31.02  ? 34  LEU A CD2 1 
ATOM   50   N  N   . THR A 1 17  ? -8.890  26.366 -21.144 1.00 37.44  ? 35  THR A N   1 
ATOM   51   C  CA  . THR A 1 17  ? -7.766  27.276 -21.357 1.00 35.10  ? 35  THR A CA  1 
ATOM   52   C  C   . THR A 1 17  ? -7.735  28.380 -20.284 1.00 33.37  ? 35  THR A C   1 
ATOM   53   O  O   . THR A 1 17  ? -6.680  28.784 -19.807 1.00 32.53  ? 35  THR A O   1 
ATOM   54   C  CB  . THR A 1 17  ? -7.792  27.885 -22.781 1.00 34.21  ? 35  THR A CB  1 
ATOM   55   O  OG1 . THR A 1 17  ? -7.371  26.878 -23.688 1.00 34.07  ? 35  THR A OG1 1 
ATOM   56   C  CG2 . THR A 1 17  ? -6.819  29.085 -22.893 1.00 33.15  ? 35  THR A CG2 1 
ATOM   57   N  N   . SER A 1 18  ? -8.912  28.871 -19.934 1.00 32.75  ? 36  SER A N   1 
ATOM   58   C  CA  . SER A 1 18  ? -9.023  29.905 -18.939 1.00 34.27  ? 36  SER A CA  1 
ATOM   59   C  C   . SER A 1 18  ? -8.545  29.336 -17.576 1.00 34.20  ? 36  SER A C   1 
ATOM   60   O  O   . SER A 1 18  ? -7.733  29.966 -16.875 1.00 33.82  ? 36  SER A O   1 
ATOM   61   C  CB  . SER A 1 18  ? -10.465 30.390 -18.887 1.00 36.14  ? 36  SER A CB  1 
ATOM   62   O  OG  . SER A 1 18  ? -10.803 31.140 -20.035 1.00 36.48  ? 36  SER A OG  1 
ATOM   63   N  N   . LEU A 1 19  ? -9.011  28.128 -17.228 1.00 32.18  ? 37  LEU A N   1 
ATOM   64   C  CA  . LEU A 1 19  ? -8.621  27.526 -15.940 1.00 29.99  ? 37  LEU A CA  1 
ATOM   65   C  C   . LEU A 1 19  ? -7.095  27.401 -15.822 1.00 30.51  ? 37  LEU A C   1 
ATOM   66   O  O   . LEU A 1 19  ? -6.500  27.881 -14.823 1.00 30.82  ? 37  LEU A O   1 
ATOM   67   C  CB  . LEU A 1 19  ? -9.338  26.205 -15.687 1.00 27.28  ? 37  LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 19  ? -10.874 26.337 -15.677 1.00 27.32  ? 37  LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 19  ? -11.592 24.995 -15.624 1.00 27.32  ? 37  LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 19  ? -11.359 27.221 -14.548 1.00 30.33  ? 37  LEU A CD2 1 
ATOM   71   N  N   . VAL A 1 20  ? -6.465  26.821 -16.856 1.00 27.27  ? 38  VAL A N   1 
ATOM   72   C  CA  . VAL A 1 20  ? -5.024  26.676 -16.910 1.00 26.62  ? 38  VAL A CA  1 
ATOM   73   C  C   . VAL A 1 20  ? -4.378  28.044 -16.793 1.00 27.90  ? 38  VAL A C   1 
ATOM   74   O  O   . VAL A 1 20  ? -3.423  28.237 -16.010 1.00 28.28  ? 38  VAL A O   1 
ATOM   75   C  CB  . VAL A 1 20  ? -4.576  25.959 -18.208 1.00 27.28  ? 38  VAL A CB  1 
ATOM   76   C  CG1 . VAL A 1 20  ? -3.062  25.908 -18.303 1.00 26.20  ? 38  VAL A CG1 1 
ATOM   77   C  CG2 . VAL A 1 20  ? -5.094  24.532 -18.174 1.00 27.08  ? 38  VAL A CG2 1 
ATOM   78   N  N   . ARG A 1 21  ? -4.920  29.011 -17.525 1.00 26.90  ? 39  ARG A N   1 
ATOM   79   C  CA  . ARG A 1 21  ? -4.269  30.304 -17.538 1.00 30.15  ? 39  ARG A CA  1 
ATOM   80   C  C   . ARG A 1 21  ? -4.415  30.972 -16.187 1.00 27.45  ? 39  ARG A C   1 
ATOM   81   O  O   . ARG A 1 21  ? -3.461  31.535 -15.710 1.00 29.09  ? 39  ARG A O   1 
ATOM   82   C  CB  . ARG A 1 21  ? -4.774  31.201 -18.643 1.00 31.90  ? 39  ARG A CB  1 
ATOM   83   C  CG  . ARG A 1 21  ? -4.104  32.558 -18.599 1.00 38.51  ? 39  ARG A CG  1 
ATOM   84   C  CD  . ARG A 1 21  ? -4.142  33.167 -19.975 1.00 48.89  ? 39  ARG A CD  1 
ATOM   85   N  NE  . ARG A 1 21  ? -3.875  32.112 -20.959 1.00 55.92  ? 39  ARG A NE  1 
ATOM   86   C  CZ  . ARG A 1 21  ? -4.468  31.987 -22.144 1.00 51.26  ? 39  ARG A CZ  1 
ATOM   87   N  NH1 . ARG A 1 21  ? -4.110  30.976 -22.924 1.00 49.72  ? 39  ARG A NH1 1 
ATOM   88   N  NH2 . ARG A 1 21  ? -5.409  32.848 -22.544 1.00 49.01  ? 39  ARG A NH2 1 
ATOM   89   N  N   . ALA A 1 22  ? -5.600  30.889 -15.576 1.00 25.08  ? 40  ALA A N   1 
ATOM   90   C  CA  . ALA A 1 22  ? -5.768  31.335 -14.166 1.00 26.71  ? 40  ALA A CA  1 
ATOM   91   C  C   . ALA A 1 22  ? -4.777  30.594 -13.254 1.00 25.45  ? 40  ALA A C   1 
ATOM   92   O  O   . ALA A 1 22  ? -4.103  31.209 -12.451 1.00 25.17  ? 40  ALA A O   1 
ATOM   93   C  CB  . ALA A 1 22  ? -7.196  31.116 -13.662 1.00 25.03  ? 40  ALA A CB  1 
ATOM   94   N  N   . HIS A 1 23  ? -4.655  29.288 -13.417 1.00 25.46  ? 41  HIS A N   1 
ATOM   95   C  CA  . HIS A 1 23  ? -3.759  28.529 -12.537 1.00 28.48  ? 41  HIS A CA  1 
ATOM   96   C  C   . HIS A 1 23  ? -2.328  28.941 -12.647 1.00 28.39  ? 41  HIS A C   1 
ATOM   97   O  O   . HIS A 1 23  ? -1.720  29.346 -11.662 1.00 31.93  ? 41  HIS A O   1 
ATOM   98   C  CB  . HIS A 1 23  ? -3.876  27.034 -12.779 1.00 27.67  ? 41  HIS A CB  1 
ATOM   99   C  CG  . HIS A 1 23  ? -2.800  26.246 -12.093 1.00 34.04  ? 41  HIS A CG  1 
ATOM   100  N  ND1 . HIS A 1 23  ? -2.763  26.084 -10.755 1.00 33.54  ? 41  HIS A ND1 1 
ATOM   101  C  CD2 . HIS A 1 23  ? -1.682  25.588 -12.599 1.00 32.50  ? 41  HIS A CD2 1 
ATOM   102  C  CE1 . HIS A 1 23  ? -1.693  25.348 -10.426 1.00 32.55  ? 41  HIS A CE1 1 
ATOM   103  N  NE2 . HIS A 1 23  ? -1.029  25.053 -11.548 1.00 32.74  ? 41  HIS A NE2 1 
ATOM   104  N  N   . LEU A 1 24  ? -1.781  28.843 -13.851 1.00 27.47  ? 42  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 24  ? -0.421  29.258 -14.132 1.00 27.39  ? 42  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 24  ? -0.038  30.701 -13.729 1.00 27.04  ? 42  LEU A C   1 
ATOM   107  O  O   . LEU A 1 24  ? 1.052   30.936 -13.232 1.00 25.21  ? 42  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 24  ? -0.115  28.945 -15.594 1.00 30.32  ? 42  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 24  ? -0.073  27.464 -16.049 1.00 31.61  ? 42  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 24  ? 0.333   27.414 -17.534 1.00 35.03  ? 42  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 24  ? 0.863   26.565 -15.248 1.00 29.10  ? 42  LEU A CD2 1 
ATOM   112  N  N   . ASP A 1 25  ? -0.935  31.675 -13.890 1.00 30.13  ? 43  ASP A N   1 
ATOM   113  C  CA  . ASP A 1 25  ? -0.573  33.032 -13.485 1.00 28.73  ? 43  ASP A CA  1 
ATOM   114  C  C   . ASP A 1 25  ? -0.704  33.241 -11.968 1.00 31.45  ? 43  ASP A C   1 
ATOM   115  O  O   . ASP A 1 25  ? -0.391  34.321 -11.485 1.00 30.28  ? 43  ASP A O   1 
ATOM   116  C  CB  . ASP A 1 25  ? -1.402  34.052 -14.218 1.00 31.48  ? 43  ASP A CB  1 
ATOM   117  C  CG  . ASP A 1 25  ? -1.043  34.177 -15.705 1.00 35.93  ? 43  ASP A CG  1 
ATOM   118  O  OD1 . ASP A 1 25  ? -0.065  33.540 -16.204 1.00 39.05  ? 43  ASP A OD1 1 
ATOM   119  O  OD2 . ASP A 1 25  ? -1.776  34.940 -16.384 1.00 35.81  ? 43  ASP A OD2 1 
ATOM   120  N  N   . SER A 1 26  ? -1.123  32.211 -11.210 1.00 29.58  ? 44  SER A N   1 
ATOM   121  C  CA  . SER A 1 26  ? -1.340  32.388 -9.763  1.00 29.39  ? 44  SER A CA  1 
ATOM   122  C  C   . SER A 1 26  ? -0.175  31.900 -8.909  1.00 28.10  ? 44  SER A C   1 
ATOM   123  O  O   . SER A 1 26  ? -0.242  31.835 -7.672  1.00 30.23  ? 44  SER A O   1 
ATOM   124  C  CB  . SER A 1 26  ? -2.636  31.682 -9.356  1.00 26.68  ? 44  SER A CB  1 
ATOM   125  O  OG  . SER A 1 26  ? -2.485  30.269 -9.372  1.00 25.01  ? 44  SER A OG  1 
ATOM   126  N  N   . GLY A 1 27  ? 0.900   31.560 -9.584  1.00 32.98  ? 45  GLY A N   1 
ATOM   127  C  CA  . GLY A 1 27  ? 2.043   30.916 -8.949  1.00 36.30  ? 45  GLY A CA  1 
ATOM   128  C  C   . GLY A 1 27  ? 3.309   31.178 -9.737  1.00 39.72  ? 45  GLY A C   1 
ATOM   129  O  O   . GLY A 1 27  ? 3.253   31.735 -10.839 1.00 38.51  ? 45  GLY A O   1 
ATOM   130  N  N   . PRO A 1 28  ? 4.470   30.819 -9.159  1.00 41.08  ? 46  PRO A N   1 
ATOM   131  C  CA  . PRO A 1 28  ? 5.737   31.218 -9.756  1.00 39.98  ? 46  PRO A CA  1 
ATOM   132  C  C   . PRO A 1 28  ? 6.250   30.302 -10.876 1.00 43.61  ? 46  PRO A C   1 
ATOM   133  O  O   . PRO A 1 28  ? 6.066   29.085 -10.845 1.00 43.35  ? 46  PRO A O   1 
ATOM   134  C  CB  . PRO A 1 28  ? 6.702   31.186 -8.549  1.00 43.32  ? 46  PRO A CB  1 
ATOM   135  C  CG  . PRO A 1 28  ? 6.094   30.166 -7.610  1.00 39.80  ? 46  PRO A CG  1 
ATOM   136  C  CD  . PRO A 1 28  ? 4.624   30.356 -7.753  1.00 40.19  ? 46  PRO A CD  1 
ATOM   137  N  N   . SER A 1 29  ? 6.925   30.894 -11.855 1.00 48.87  ? 47  SER A N   1 
ATOM   138  C  CA  . SER A 1 29  ? 7.601   30.111 -12.889 1.00 51.26  ? 47  SER A CA  1 
ATOM   139  C  C   . SER A 1 29  ? 8.842   29.523 -12.234 1.00 55.79  ? 47  SER A C   1 
ATOM   140  O  O   . SER A 1 29  ? 9.384   30.104 -11.298 1.00 54.10  ? 47  SER A O   1 
ATOM   141  C  CB  . SER A 1 29  ? 8.041   31.004 -14.060 1.00 50.10  ? 47  SER A CB  1 
ATOM   142  O  OG  . SER A 1 29  ? 7.232   32.167 -14.175 1.00 53.40  ? 47  SER A OG  1 
ATOM   143  N  N   . THR A 1 30  ? 9.291   28.373 -12.713 1.00 60.03  ? 48  THR A N   1 
ATOM   144  C  CA  . THR A 1 30  ? 10.612  27.879 -12.378 1.00 68.06  ? 48  THR A CA  1 
ATOM   145  C  C   . THR A 1 30  ? 11.649  29.020 -12.382 1.00 73.68  ? 48  THR A C   1 
ATOM   146  O  O   . THR A 1 30  ? 12.518  29.084 -11.511 1.00 82.33  ? 48  THR A O   1 
ATOM   147  C  CB  . THR A 1 30  ? 10.997  26.749 -13.340 1.00 73.35  ? 48  THR A CB  1 
ATOM   148  O  OG1 . THR A 1 30  ? 10.156  25.620 -13.070 1.00 78.59  ? 48  THR A OG1 1 
ATOM   149  C  CG2 . THR A 1 30  ? 12.462  26.344 -13.186 1.00 73.47  ? 48  THR A CG2 1 
ATOM   150  N  N   . ALA A 1 31  ? 11.519  29.937 -13.336 1.00 76.83  ? 49  ALA A N   1 
ATOM   151  C  CA  . ALA A 1 31  ? 12.393  31.119 -13.439 1.00 75.81  ? 49  ALA A CA  1 
ATOM   152  C  C   . ALA A 1 31  ? 12.191  32.188 -12.344 1.00 66.81  ? 49  ALA A C   1 
ATOM   153  O  O   . ALA A 1 31  ? 13.122  32.906 -12.009 1.00 66.82  ? 49  ALA A O   1 
ATOM   154  C  CB  . ALA A 1 31  ? 12.276  31.751 -14.833 1.00 71.73  ? 49  ALA A CB  1 
ATOM   155  N  N   . LYS A 1 32  ? 10.984  32.299 -11.798 1.00 68.09  ? 50  LYS A N   1 
ATOM   156  C  CA  . LYS A 1 32  ? 10.703  33.314 -10.778 1.00 62.22  ? 50  LYS A CA  1 
ATOM   157  C  C   . LYS A 1 32  ? 10.801  32.832 -9.297  1.00 63.30  ? 50  LYS A C   1 
ATOM   158  O  O   . LYS A 1 32  ? 10.310  33.525 -8.370  1.00 63.14  ? 50  LYS A O   1 
ATOM   159  C  CB  . LYS A 1 32  ? 9.354   33.986 -11.056 1.00 65.60  ? 50  LYS A CB  1 
ATOM   160  C  CG  . LYS A 1 32  ? 9.446   35.500 -11.206 1.00 69.12  ? 50  LYS A CG  1 
ATOM   161  C  CD  . LYS A 1 32  ? 10.204  36.151 -10.052 1.00 72.01  ? 50  LYS A CD  1 
ATOM   162  C  CE  . LYS A 1 32  ? 10.258  37.663 -10.174 1.00 71.72  ? 50  LYS A CE  1 
ATOM   163  N  NZ  . LYS A 1 32  ? 11.282  38.070 -11.173 1.00 71.19  ? 50  LYS A NZ  1 
ATOM   164  N  N   . LEU A 1 33  ? 11.453  31.676 -9.076  1.00 53.96  ? 51  LEU A N   1 
ATOM   165  C  CA  . LEU A 1 33  ? 11.689  31.153 -7.710  1.00 47.23  ? 51  LEU A CA  1 
ATOM   166  C  C   . LEU A 1 33  ? 12.710  31.927 -6.910  1.00 44.82  ? 51  LEU A C   1 
ATOM   167  O  O   . LEU A 1 33  ? 13.795  32.251 -7.384  1.00 46.89  ? 51  LEU A O   1 
ATOM   168  C  CB  . LEU A 1 33  ? 12.103  29.703 -7.715  1.00 40.66  ? 51  LEU A CB  1 
ATOM   169  C  CG  . LEU A 1 33  ? 11.094  28.652 -8.110  1.00 38.29  ? 51  LEU A CG  1 
ATOM   170  C  CD1 . LEU A 1 33  ? 11.647  27.347 -7.541  1.00 41.99  ? 51  LEU A CD1 1 
ATOM   171  C  CD2 . LEU A 1 33  ? 9.706   28.926 -7.570  1.00 32.73  ? 51  LEU A CD2 1 
ATOM   172  N  N   . ASP A 1 34  ? 12.347  32.206 -5.674  1.00 41.50  ? 52  ASP A N   1 
ATOM   173  C  CA  . ASP A 1 34  ? 13.050  33.174 -4.867  1.00 38.91  ? 52  ASP A CA  1 
ATOM   174  C  C   . ASP A 1 34  ? 13.805  32.479 -3.750  1.00 35.18  ? 52  ASP A C   1 
ATOM   175  O  O   . ASP A 1 34  ? 13.244  32.159 -2.707  1.00 34.76  ? 52  ASP A O   1 
ATOM   176  C  CB  . ASP A 1 34  ? 12.037  34.240 -4.370  1.00 36.40  ? 52  ASP A CB  1 
ATOM   177  C  CG  . ASP A 1 34  ? 12.602  35.165 -3.328  1.00 37.31  ? 52  ASP A CG  1 
ATOM   178  O  OD1 . ASP A 1 34  ? 11.794  35.930 -2.742  1.00 37.51  ? 52  ASP A OD1 1 
ATOM   179  O  OD2 . ASP A 1 34  ? 13.831  35.135 -3.092  1.00 36.64  ? 52  ASP A OD2 1 
ATOM   180  N  N   . TYR A 1 35  ? 15.095  32.286 -3.984  1.00 33.87  ? 53  TYR A N   1 
ATOM   181  C  CA  . TYR A 1 35  ? 15.985  31.573 -3.071  1.00 33.45  ? 53  TYR A CA  1 
ATOM   182  C  C   . TYR A 1 35  ? 16.637  32.471 -2.017  1.00 36.31  ? 53  TYR A C   1 
ATOM   183  O  O   . TYR A 1 35  ? 17.590  32.074 -1.321  1.00 39.71  ? 53  TYR A O   1 
ATOM   184  C  CB  . TYR A 1 35  ? 17.011  30.812 -3.880  1.00 30.79  ? 53  TYR A CB  1 
ATOM   185  C  CG  . TYR A 1 35  ? 16.491  29.455 -4.363  1.00 37.45  ? 53  TYR A CG  1 
ATOM   186  C  CD1 . TYR A 1 35  ? 16.030  29.249 -5.693  1.00 37.12  ? 53  TYR A CD1 1 
ATOM   187  C  CD2 . TYR A 1 35  ? 16.484  28.371 -3.501  1.00 36.32  ? 53  TYR A CD2 1 
ATOM   188  C  CE1 . TYR A 1 35  ? 15.578  27.998 -6.111  1.00 38.32  ? 53  TYR A CE1 1 
ATOM   189  C  CE2 . TYR A 1 35  ? 16.042  27.144 -3.910  1.00 40.13  ? 53  TYR A CE2 1 
ATOM   190  C  CZ  . TYR A 1 35  ? 15.579  26.952 -5.196  1.00 39.19  ? 53  TYR A CZ  1 
ATOM   191  O  OH  . TYR A 1 35  ? 15.142  25.663 -5.500  1.00 41.93  ? 53  TYR A OH  1 
ATOM   192  N  N   . SER A 1 36  ? 16.090  33.675 -1.875  1.00 37.28  ? 54  SER A N   1 
ATOM   193  C  CA  . SER A 1 36  ? 16.747  34.717 -1.096  1.00 38.61  ? 54  SER A CA  1 
ATOM   194  C  C   . SER A 1 36  ? 16.711  34.477 0.401   1.00 37.98  ? 54  SER A C   1 
ATOM   195  O  O   . SER A 1 36  ? 17.549  35.018 1.126   1.00 36.66  ? 54  SER A O   1 
ATOM   196  C  CB  . SER A 1 36  ? 16.204  36.123 -1.455  1.00 38.88  ? 54  SER A CB  1 
ATOM   197  O  OG  . SER A 1 36  ? 14.880  36.325 -0.985  1.00 36.58  ? 54  SER A OG  1 
ATOM   198  N  N   . LYS A 1 37  ? 15.778  33.653 0.872   1.00 33.90  ? 55  LYS A N   1 
ATOM   199  C  CA  . LYS A 1 37  ? 15.709  33.408 2.299   1.00 31.28  ? 55  LYS A CA  1 
ATOM   200  C  C   . LYS A 1 37  ? 16.071  31.961 2.587   1.00 31.55  ? 55  LYS A C   1 
ATOM   201  O  O   . LYS A 1 37  ? 16.133  31.533 3.739   1.00 30.65  ? 55  LYS A O   1 
ATOM   202  C  CB  . LYS A 1 37  ? 14.301  33.698 2.802   1.00 31.84  ? 55  LYS A CB  1 
ATOM   203  C  CG  . LYS A 1 37  ? 14.020  35.146 3.176   1.00 37.90  ? 55  LYS A CG  1 
ATOM   204  C  CD  . LYS A 1 37  ? 13.058  35.846 2.233   1.00 38.98  ? 55  LYS A CD  1 
ATOM   205  C  CE  . LYS A 1 37  ? 11.922  36.534 3.000   1.00 39.08  ? 55  LYS A CE  1 
ATOM   206  N  NZ  . LYS A 1 37  ? 10.958  37.217 2.074   1.00 42.52  ? 55  LYS A NZ  1 
ATOM   207  N  N   . PHE A 1 38  ? 16.281  31.193 1.531   1.00 30.25  ? 56  PHE A N   1 
ATOM   208  C  CA  . PHE A 1 38  ? 16.481  29.748 1.655   1.00 28.84  ? 56  PHE A CA  1 
ATOM   209  C  C   . PHE A 1 38  ? 17.798  29.365 2.325   1.00 30.36  ? 56  PHE A C   1 
ATOM   210  O  O   . PHE A 1 38  ? 18.856  29.844 1.945   1.00 27.67  ? 56  PHE A O   1 
ATOM   211  C  CB  . PHE A 1 38  ? 16.369  29.061 0.275   1.00 24.78  ? 56  PHE A CB  1 
ATOM   212  C  CG  . PHE A 1 38  ? 16.491  27.582 0.341   1.00 23.29  ? 56  PHE A CG  1 
ATOM   213  C  CD1 . PHE A 1 38  ? 15.421  26.811 0.761   1.00 22.66  ? 56  PHE A CD1 1 
ATOM   214  C  CD2 . PHE A 1 38  ? 17.688  26.958 -0.005  1.00 23.62  ? 56  PHE A CD2 1 
ATOM   215  C  CE1 . PHE A 1 38  ? 15.529  25.421 0.829   1.00 22.99  ? 56  PHE A CE1 1 
ATOM   216  C  CE2 . PHE A 1 38  ? 17.806  25.596 0.065   1.00 23.01  ? 56  PHE A CE2 1 
ATOM   217  C  CZ  . PHE A 1 38  ? 16.723  24.832 0.485   1.00 23.92  ? 56  PHE A CZ  1 
ATOM   218  N  N   . GLN A 1 39  ? 17.710  28.457 3.299   1.00 32.03  ? 57  GLN A N   1 
ATOM   219  C  CA  . GLN A 1 39  ? 18.883  27.881 3.917   1.00 29.77  ? 57  GLN A CA  1 
ATOM   220  C  C   . GLN A 1 39  ? 18.642  26.402 4.042   1.00 30.32  ? 57  GLN A C   1 
ATOM   221  O  O   . GLN A 1 39  ? 17.638  25.977 4.691   1.00 25.42  ? 57  GLN A O   1 
ATOM   222  C  CB  . GLN A 1 39  ? 19.101  28.498 5.294   1.00 33.66  ? 57  GLN A CB  1 
ATOM   223  C  CG  . GLN A 1 39  ? 19.724  29.876 5.260   1.00 37.25  ? 57  GLN A CG  1 
ATOM   224  C  CD  . GLN A 1 39  ? 19.412  30.666 6.502   1.00 46.37  ? 57  GLN A CD  1 
ATOM   225  O  OE1 . GLN A 1 39  ? 19.886  30.335 7.602   1.00 51.14  ? 57  GLN A OE1 1 
ATOM   226  N  NE2 . GLN A 1 39  ? 18.613  31.733 6.347   1.00 51.25  ? 57  GLN A NE2 1 
ATOM   227  N  N   . GLU A 1 40  ? 19.575  25.625 3.464   1.00 29.69  ? 58  GLU A N   1 
ATOM   228  C  CA  . GLU A 1 40  ? 19.472  24.165 3.466   1.00 30.65  ? 58  GLU A CA  1 
ATOM   229  C  C   . GLU A 1 40  ? 19.593  23.581 4.850   1.00 30.85  ? 58  GLU A C   1 
ATOM   230  O  O   . GLU A 1 40  ? 19.108  22.511 5.091   1.00 32.11  ? 58  GLU A O   1 
ATOM   231  C  CB  . GLU A 1 40  ? 20.381  23.467 2.444   1.00 35.24  ? 58  GLU A CB  1 
ATOM   232  C  CG  . GLU A 1 40  ? 21.675  24.167 2.113   1.00 42.90  ? 58  GLU A CG  1 
ATOM   233  C  CD  . GLU A 1 40  ? 21.518  25.447 1.308   1.00 42.30  ? 58  GLU A CD  1 
ATOM   234  O  OE1 . GLU A 1 40  ? 20.980  25.393 0.192   1.00 49.42  ? 58  GLU A OE1 1 
ATOM   235  O  OE2 . GLU A 1 40  ? 21.983  26.505 1.767   1.00 44.51  ? 58  GLU A OE2 1 
ATOM   236  N  N   . LEU A 1 41  ? 20.172  24.321 5.778   1.00 30.58  ? 59  LEU A N   1 
ATOM   237  C  CA  . LEU A 1 41  ? 20.264  23.863 7.165   1.00 35.79  ? 59  LEU A CA  1 
ATOM   238  C  C   . LEU A 1 41  ? 20.098  25.067 8.118   1.00 34.88  ? 59  LEU A C   1 
ATOM   239  O  O   . LEU A 1 41  ? 20.893  26.012 8.108   1.00 36.85  ? 59  LEU A O   1 
ATOM   240  C  CB  . LEU A 1 41  ? 21.617  23.160 7.420   1.00 33.64  ? 59  LEU A CB  1 
ATOM   241  C  CG  . LEU A 1 41  ? 21.795  21.951 8.325   1.00 34.33  ? 59  LEU A CG  1 
ATOM   242  C  CD1 . LEU A 1 41  ? 23.063  22.221 9.060   1.00 31.76  ? 59  LEU A CD1 1 
ATOM   243  C  CD2 . LEU A 1 41  ? 20.738  21.574 9.381   1.00 33.54  ? 59  LEU A CD2 1 
ATOM   244  N  N   . VAL A 1 42  ? 19.015  25.035 8.867   1.00 34.56  ? 60  VAL A N   1 
ATOM   245  C  CA  . VAL A 1 42  ? 18.782  25.903 10.010  1.00 37.10  ? 60  VAL A CA  1 
ATOM   246  C  C   . VAL A 1 42  ? 18.677  24.942 11.225  1.00 38.78  ? 60  VAL A C   1 
ATOM   247  O  O   . VAL A 1 42  ? 18.255  23.765 11.092  1.00 29.12  ? 60  VAL A O   1 
ATOM   248  C  CB  . VAL A 1 42  ? 17.464  26.705 9.844   1.00 39.91  ? 60  VAL A CB  1 
ATOM   249  C  CG1 . VAL A 1 42  ? 16.956  27.209 11.196  1.00 46.25  ? 60  VAL A CG1 1 
ATOM   250  C  CG2 . VAL A 1 42  ? 17.636  27.890 8.885   1.00 35.62  ? 60  VAL A CG2 1 
ATOM   251  N  N   . LEU A 1 43  ? 19.077  25.445 12.392  1.00 35.51  ? 61  LEU A N   1 
ATOM   252  C  CA  . LEU A 1 43  ? 19.052  24.671 13.622  1.00 38.71  ? 61  LEU A CA  1 
ATOM   253  C  C   . LEU A 1 43  ? 17.992  25.310 14.530  1.00 43.84  ? 61  LEU A C   1 
ATOM   254  O  O   . LEU A 1 43  ? 18.309  26.197 15.329  1.00 42.26  ? 61  LEU A O   1 
ATOM   255  C  CB  . LEU A 1 43  ? 20.456  24.645 14.306  1.00 37.14  ? 61  LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 43  ? 21.696  24.327 13.412  1.00 32.24  ? 61  LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 43  ? 23.058  24.616 14.053  1.00 27.23  ? 61  LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 43  ? 21.640  22.936 12.741  1.00 28.76  ? 61  LEU A CD2 1 
ATOM   259  N  N   . PRO A 1 44  ? 16.721  24.878 14.392  1.00 47.05  ? 62  PRO A N   1 
ATOM   260  C  CA  . PRO A 1 44  ? 15.706  25.583 15.162  1.00 49.23  ? 62  PRO A CA  1 
ATOM   261  C  C   . PRO A 1 44  ? 15.543  25.023 16.586  1.00 48.35  ? 62  PRO A C   1 
ATOM   262  O  O   . PRO A 1 44  ? 15.855  23.859 16.851  1.00 43.09  ? 62  PRO A O   1 
ATOM   263  C  CB  . PRO A 1 44  ? 14.424  25.354 14.339  1.00 46.88  ? 62  PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 44  ? 14.670  24.070 13.574  1.00 43.26  ? 62  PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 44  ? 16.141  23.738 13.637  1.00 46.35  ? 62  PRO A CD  1 
ATOM   266  N  N   . HIS A 1 45  ? 15.067  25.871 17.487  1.00 50.99  ? 63  HIS A N   1 
ATOM   267  C  CA  . HIS A 1 45  ? 14.564  25.407 18.775  1.00 48.17  ? 63  HIS A CA  1 
ATOM   268  C  C   . HIS A 1 45  ? 13.166  24.888 18.530  1.00 45.17  ? 63  HIS A C   1 
ATOM   269  O  O   . HIS A 1 45  ? 12.215  25.680 18.413  1.00 46.83  ? 63  HIS A O   1 
ATOM   270  C  CB  . HIS A 1 45  ? 14.580  26.551 19.785  1.00 47.58  ? 63  HIS A CB  1 
ATOM   271  C  CG  . HIS A 1 45  ? 14.634  26.091 21.216  1.00 55.81  ? 63  HIS A CG  1 
ATOM   272  N  ND1 . HIS A 1 45  ? 13.778  25.154 21.724  1.00 57.42  ? 63  HIS A ND1 1 
ATOM   273  C  CD2 . HIS A 1 45  ? 15.475  26.468 22.263  1.00 56.15  ? 63  HIS A CD2 1 
ATOM   274  C  CE1 . HIS A 1 45  ? 14.071  24.940 23.021  1.00 56.80  ? 63  HIS A CE1 1 
ATOM   275  N  NE2 . HIS A 1 45  ? 15.111  25.744 23.353  1.00 62.17  ? 63  HIS A NE2 1 
ATOM   276  N  N   . PHE A 1 46  ? 13.023  23.566 18.396  1.00 42.54  ? 64  PHE A N   1 
ATOM   277  C  CA  . PHE A 1 46  ? 11.685  22.936 18.178  1.00 43.24  ? 64  PHE A CA  1 
ATOM   278  C  C   . PHE A 1 46  ? 10.722  23.086 19.400  1.00 40.81  ? 64  PHE A C   1 
ATOM   279  O  O   . PHE A 1 46  ? 11.165  22.998 20.556  1.00 43.88  ? 64  PHE A O   1 
ATOM   280  C  CB  . PHE A 1 46  ? 11.811  21.437 17.817  1.00 41.20  ? 64  PHE A CB  1 
ATOM   281  C  CG  . PHE A 1 46  ? 12.600  21.153 16.553  1.00 45.27  ? 64  PHE A CG  1 
ATOM   282  C  CD1 . PHE A 1 46  ? 12.010  21.294 15.286  1.00 43.87  ? 64  PHE A CD1 1 
ATOM   283  C  CD2 . PHE A 1 46  ? 13.929  20.708 16.625  1.00 46.09  ? 64  PHE A CD2 1 
ATOM   284  C  CE1 . PHE A 1 46  ? 12.732  21.033 14.129  1.00 47.54  ? 64  PHE A CE1 1 
ATOM   285  C  CE2 . PHE A 1 46  ? 14.670  20.444 15.462  1.00 47.55  ? 64  PHE A CE2 1 
ATOM   286  C  CZ  . PHE A 1 46  ? 14.066  20.599 14.214  1.00 49.94  ? 64  PHE A CZ  1 
ATOM   287  N  N   . GLY A 1 47  ? 9.428   23.282 19.130  0.50 36.39  ? 65  GLY A N   1 
ATOM   288  C  CA  . GLY A 1 47  ? 8.378   23.393 20.163  0.50 37.96  ? 65  GLY A CA  1 
ATOM   289  C  C   . GLY A 1 47  ? 7.986   24.797 20.623  0.50 36.11  ? 65  GLY A C   1 
ATOM   290  O  O   . GLY A 1 47  ? 7.150   24.958 21.502  0.50 35.85  ? 65  GLY A O   1 
ATOM   291  N  N   . LYS A 1 48  ? 8.581   25.807 20.000  1.00 39.68  ? 66  LYS A N   1 
ATOM   292  C  CA  . LYS A 1 48  ? 8.513   27.195 20.429  1.00 35.54  ? 66  LYS A CA  1 
ATOM   293  C  C   . LYS A 1 48  ? 8.692   28.091 19.200  1.00 38.50  ? 66  LYS A C   1 
ATOM   294  O  O   . LYS A 1 48  ? 8.976   27.620 18.074  1.00 39.15  ? 66  LYS A O   1 
ATOM   295  C  CB  . LYS A 1 48  ? 9.604   27.498 21.471  1.00 39.59  ? 66  LYS A CB  1 
ATOM   296  C  CG  . LYS A 1 48  ? 10.971  27.906 20.893  1.00 45.24  ? 66  LYS A CG  1 
ATOM   297  C  CD  . LYS A 1 48  ? 11.949  28.494 21.925  1.00 46.81  ? 66  LYS A CD  1 
ATOM   298  C  CE  . LYS A 1 48  ? 12.804  29.638 21.364  1.00 42.07  ? 66  LYS A CE  1 
ATOM   299  N  NZ  . LYS A 1 48  ? 12.042  30.920 21.125  1.00 46.48  ? 66  LYS A NZ  1 
ATOM   300  N  N   . GLU A 1 49  ? 8.543   29.391 19.402  1.00 34.04  ? 67  GLU A N   1 
ATOM   301  C  CA  . GLU A 1 49  ? 8.455   30.288 18.274  1.00 30.96  ? 67  GLU A CA  1 
ATOM   302  C  C   . GLU A 1 49  ? 8.524   31.699 18.741  1.00 29.74  ? 67  GLU A C   1 
ATOM   303  O  O   . GLU A 1 49  ? 7.985   32.022 19.798  1.00 32.05  ? 67  GLU A O   1 
ATOM   304  C  CB  . GLU A 1 49  ? 7.168   30.028 17.450  1.00 29.85  ? 67  GLU A CB  1 
ATOM   305  C  CG  . GLU A 1 49  ? 5.826   30.094 18.153  1.00 28.38  ? 67  GLU A CG  1 
ATOM   306  C  CD  . GLU A 1 49  ? 5.488   28.906 19.047  1.00 31.18  ? 67  GLU A CD  1 
ATOM   307  O  OE1 . GLU A 1 49  ? 4.987   29.144 20.182  1.00 29.45  ? 67  GLU A OE1 1 
ATOM   308  O  OE2 . GLU A 1 49  ? 5.708   27.732 18.651  1.00 29.56  ? 67  GLU A OE2 1 
ATOM   309  N  N   . ASP A 1 50  ? 9.159   32.549 17.937  1.00 32.25  ? 68  ASP A N   1 
ATOM   310  C  CA  . ASP A 1 50  ? 9.271   33.982 18.237  1.00 29.10  ? 68  ASP A CA  1 
ATOM   311  C  C   . ASP A 1 50  ? 8.407   34.805 17.241  1.00 28.49  ? 68  ASP A C   1 
ATOM   312  O  O   . ASP A 1 50  ? 7.750   34.223 16.366  1.00 26.84  ? 68  ASP A O   1 
ATOM   313  C  CB  . ASP A 1 50  ? 10.736  34.417 18.224  1.00 29.72  ? 68  ASP A CB  1 
ATOM   314  C  CG  . ASP A 1 50  ? 11.370  34.270 16.852  1.00 33.16  ? 68  ASP A CG  1 
ATOM   315  O  OD1 . ASP A 1 50  ? 10.746  34.689 15.860  1.00 28.71  ? 68  ASP A OD1 1 
ATOM   316  O  OD2 . ASP A 1 50  ? 12.497  33.711 16.771  1.00 38.46  ? 68  ASP A OD2 1 
ATOM   317  N  N   . ALA A 1 51  ? 8.387   36.136 17.389  1.00 22.87  ? 69  ALA A N   1 
ATOM   318  C  CA  . ALA A 1 51  ? 7.463   36.964 16.614  1.00 21.78  ? 69  ALA A CA  1 
ATOM   319  C  C   . ALA A 1 51  ? 7.784   37.004 15.131  1.00 19.72  ? 69  ALA A C   1 
ATOM   320  O  O   . ALA A 1 51  ? 6.888   37.180 14.339  1.00 20.40  ? 69  ALA A O   1 
ATOM   321  C  CB  . ALA A 1 51  ? 7.316   38.369 17.182  1.00 18.49  ? 69  ALA A CB  1 
ATOM   322  N  N   . GLY A 1 52  ? 9.034   36.851 14.743  1.00 19.44  ? 70  GLY A N   1 
ATOM   323  C  CA  . GLY A 1 52  ? 9.342   36.856 13.297  1.00 20.84  ? 70  GLY A CA  1 
ATOM   324  C  C   . GLY A 1 52  ? 8.786   35.577 12.687  1.00 21.19  ? 70  GLY A C   1 
ATOM   325  O  O   . GLY A 1 52  ? 8.181   35.619 11.613  1.00 20.43  ? 70  GLY A O   1 
ATOM   326  N  N   . ASP A 1 53  ? 8.967   34.442 13.379  1.00 20.15  ? 71  ASP A N   1 
ATOM   327  C  CA  . ASP A 1 53  ? 8.329   33.202 12.939  1.00 23.88  ? 71  ASP A CA  1 
ATOM   328  C  C   . ASP A 1 53  ? 6.831   33.357 12.704  1.00 25.23  ? 71  ASP A C   1 
ATOM   329  O  O   . ASP A 1 53  ? 6.300   32.866 11.664  1.00 23.60  ? 71  ASP A O   1 
ATOM   330  C  CB  . ASP A 1 53  ? 8.469   32.052 13.948  1.00 25.92  ? 71  ASP A CB  1 
ATOM   331  C  CG  . ASP A 1 53  ? 9.900   31.712 14.264  1.00 29.59  ? 71  ASP A CG  1 
ATOM   332  O  OD1 . ASP A 1 53  ? 10.744  31.907 13.375  1.00 31.62  ? 71  ASP A OD1 1 
ATOM   333  O  OD2 . ASP A 1 53  ? 10.177  31.306 15.418  1.00 29.50  ? 71  ASP A OD2 1 
ATOM   334  N  N   . VAL A 1 54  ? 6.130   33.974 13.677  1.00 22.22  ? 72  VAL A N   1 
ATOM   335  C  CA  . VAL A 1 54  ? 4.664   33.923 13.653  1.00 21.48  ? 72  VAL A CA  1 
ATOM   336  C  C   . VAL A 1 54  ? 4.163   34.899 12.578  1.00 25.12  ? 72  VAL A C   1 
ATOM   337  O  O   . VAL A 1 54  ? 3.193   34.593 11.798  1.00 22.78  ? 72  VAL A O   1 
ATOM   338  C  CB  . VAL A 1 54  ? 4.026   34.156 15.052  1.00 21.07  ? 72  VAL A CB  1 
ATOM   339  C  CG1 . VAL A 1 54  ? 2.522   34.260 14.942  1.00 20.46  ? 72  VAL A CG1 1 
ATOM   340  C  CG2 . VAL A 1 54  ? 4.390   33.039 16.029  1.00 19.31  ? 72  VAL A CG2 1 
ATOM   341  N  N   . GLN A 1 55  ? 4.885   36.024 12.465  1.00 23.79  ? 73  GLN A N   1 
ATOM   342  C  CA  . GLN A 1 55  ? 4.554   37.006 11.482  1.00 22.50  ? 73  GLN A CA  1 
ATOM   343  C  C   . GLN A 1 55  ? 4.786   36.463 10.074  1.00 24.55  ? 73  GLN A C   1 
ATOM   344  O  O   . GLN A 1 55  ? 3.992   36.695 9.200   1.00 22.72  ? 73  GLN A O   1 
ATOM   345  C  CB  . GLN A 1 55  ? 5.311   38.310 11.688  1.00 20.80  ? 73  GLN A CB  1 
ATOM   346  C  CG  . GLN A 1 55  ? 4.701   39.435 10.832  1.00 21.64  ? 73  GLN A CG  1 
ATOM   347  C  CD  . GLN A 1 55  ? 3.246   39.738 11.162  1.00 24.88  ? 73  GLN A CD  1 
ATOM   348  O  OE1 . GLN A 1 55  ? 2.958   40.316 12.211  1.00 28.14  ? 73  GLN A OE1 1 
ATOM   349  N  NE2 . GLN A 1 55  ? 2.318   39.408 10.245  1.00 23.98  ? 73  GLN A NE2 1 
ATOM   350  N  N   . GLN A 1 56  ? 5.898   35.776 9.835   1.00 24.75  ? 74  GLN A N   1 
ATOM   351  C  CA  . GLN A 1 56  ? 6.043   35.172 8.541   1.00 25.37  ? 74  GLN A CA  1 
ATOM   352  C  C   . GLN A 1 56  ? 4.877   34.154 8.265   1.00 25.21  ? 74  GLN A C   1 
ATOM   353  O  O   . GLN A 1 56  ? 4.389   34.068 7.154   1.00 23.85  ? 74  GLN A O   1 
ATOM   354  C  CB  . GLN A 1 56  ? 7.417   34.524 8.435   1.00 23.52  ? 74  GLN A CB  1 
ATOM   355  C  CG  . GLN A 1 56  ? 7.638   33.754 7.137   1.00 28.04  ? 74  GLN A CG  1 
ATOM   356  C  CD  . GLN A 1 56  ? 9.021   33.161 7.086   1.00 26.40  ? 74  GLN A CD  1 
ATOM   357  O  OE1 . GLN A 1 56  ? 9.327   32.228 7.822   1.00 28.03  ? 74  GLN A OE1 1 
ATOM   358  N  NE2 . GLN A 1 56  ? 9.885   33.771 6.304   1.00 23.94  ? 74  GLN A NE2 1 
ATOM   359  N  N   . PHE A 1 57  ? 4.438   33.401 9.277   1.00 22.79  ? 75  PHE A N   1 
ATOM   360  C  CA  . PHE A 1 57  ? 3.406   32.391 9.079   1.00 20.02  ? 75  PHE A CA  1 
ATOM   361  C  C   . PHE A 1 57  ? 2.158   33.093 8.607   1.00 22.71  ? 75  PHE A C   1 
ATOM   362  O  O   . PHE A 1 57  ? 1.645   32.738 7.539   1.00 21.82  ? 75  PHE A O   1 
ATOM   363  C  CB  . PHE A 1 57  ? 3.208   31.604 10.363  1.00 19.72  ? 75  PHE A CB  1 
ATOM   364  C  CG  . PHE A 1 57  ? 1.912   30.846 10.474  1.00 20.32  ? 75  PHE A CG  1 
ATOM   365  C  CD1 . PHE A 1 57  ? 1.856   29.478 10.191  1.00 21.24  ? 75  PHE A CD1 1 
ATOM   366  C  CD2 . PHE A 1 57  ? 0.773   31.462 11.004  1.00 20.42  ? 75  PHE A CD2 1 
ATOM   367  C  CE1 . PHE A 1 57  ? 0.674   28.746 10.377  1.00 21.49  ? 75  PHE A CE1 1 
ATOM   368  C  CE2 . PHE A 1 57  ? -0.416  30.759 11.140  1.00 20.27  ? 75  PHE A CE2 1 
ATOM   369  C  CZ  . PHE A 1 57  ? -0.461  29.400 10.831  1.00 22.32  ? 75  PHE A CZ  1 
ATOM   370  N  N   . TYR A 1 58  ? 1.714   34.125 9.360   1.00 21.33  ? 76  TYR A N   1 
ATOM   371  C  CA  . TYR A 1 58  ? 0.622   34.968 8.973   1.00 21.24  ? 76  TYR A CA  1 
ATOM   372  C  C   . TYR A 1 58  ? 0.786   35.630 7.585   1.00 23.14  ? 76  TYR A C   1 
ATOM   373  O  O   . TYR A 1 58  ? -0.139  35.580 6.784   1.00 25.10  ? 76  TYR A O   1 
ATOM   374  C  CB  . TYR A 1 58  ? 0.255   36.010 10.052  1.00 20.71  ? 76  TYR A CB  1 
ATOM   375  C  CG  . TYR A 1 58  ? -0.367  35.417 11.315  1.00 21.03  ? 76  TYR A CG  1 
ATOM   376  C  CD1 . TYR A 1 58  ? -1.314  34.369 11.253  1.00 22.75  ? 76  TYR A CD1 1 
ATOM   377  C  CD2 . TYR A 1 58  ? -0.067  35.945 12.568  1.00 20.83  ? 76  TYR A CD2 1 
ATOM   378  C  CE1 . TYR A 1 58  ? -1.888  33.819 12.397  1.00 21.77  ? 76  TYR A CE1 1 
ATOM   379  C  CE2 . TYR A 1 58  ? -0.681  35.438 13.723  1.00 20.85  ? 76  TYR A CE2 1 
ATOM   380  C  CZ  . TYR A 1 58  ? -1.572  34.370 13.623  1.00 23.40  ? 76  TYR A CZ  1 
ATOM   381  O  OH  . TYR A 1 58  ? -2.142  33.856 14.784  1.00 28.10  ? 76  TYR A OH  1 
ATOM   382  N  N   . ASP A 1 59  ? 1.927   36.231 7.293   1.00 21.13  ? 77  ASP A N   1 
ATOM   383  C  CA  . ASP A 1 59  ? 2.100   36.821 5.983   1.00 24.96  ? 77  ASP A CA  1 
ATOM   384  C  C   . ASP A 1 59  ? 1.926   35.796 4.858   1.00 24.04  ? 77  ASP A C   1 
ATOM   385  O  O   . ASP A 1 59  ? 1.343   36.061 3.825   1.00 25.95  ? 77  ASP A O   1 
ATOM   386  C  CB  . ASP A 1 59  ? 3.489   37.473 5.848   1.00 24.21  ? 77  ASP A CB  1 
ATOM   387  C  CG  . ASP A 1 59  ? 3.661   38.697 6.752   1.00 23.21  ? 77  ASP A CG  1 
ATOM   388  O  OD1 . ASP A 1 59  ? 2.718   39.189 7.391   1.00 20.62  ? 77  ASP A OD1 1 
ATOM   389  O  OD2 . ASP A 1 59  ? 4.799   39.131 6.857   1.00 24.88  ? 77  ASP A OD2 1 
ATOM   390  N  N   . LEU A 1 60  ? 2.470   34.620 5.073   1.00 26.89  ? 78  LEU A N   1 
ATOM   391  C  CA  . LEU A 1 60  ? 2.386   33.557 4.105   1.00 25.40  ? 78  LEU A CA  1 
ATOM   392  C  C   . LEU A 1 60  ? 0.941   33.174 3.817   1.00 24.82  ? 78  LEU A C   1 
ATOM   393  O  O   . LEU A 1 60  ? 0.552   33.005 2.662   1.00 23.59  ? 78  LEU A O   1 
ATOM   394  C  CB  . LEU A 1 60  ? 3.204   32.398 4.596   1.00 23.69  ? 78  LEU A CB  1 
ATOM   395  C  CG  . LEU A 1 60  ? 4.558   32.156 3.899   1.00 28.92  ? 78  LEU A CG  1 
ATOM   396  C  CD1 . LEU A 1 60  ? 5.092   33.191 2.868   1.00 22.43  ? 78  LEU A CD1 1 
ATOM   397  C  CD2 . LEU A 1 60  ? 5.606   31.656 4.880   1.00 22.56  ? 78  LEU A CD2 1 
ATOM   398  N  N   . LEU A 1 61  ? 0.145   33.104 4.871   1.00 22.01  ? 79  LEU A N   1 
ATOM   399  C  CA  . LEU A 1 61  ? -1.293  32.902 4.774   1.00 23.42  ? 79  LEU A CA  1 
ATOM   400  C  C   . LEU A 1 61  ? -2.041  34.036 4.049   1.00 23.40  ? 79  LEU A C   1 
ATOM   401  O  O   . LEU A 1 61  ? -2.859  33.800 3.096   1.00 23.36  ? 79  LEU A O   1 
ATOM   402  C  CB  . LEU A 1 61  ? -1.847  32.710 6.177   1.00 22.81  ? 79  LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 61  ? -2.233  31.306 6.674   1.00 25.38  ? 79  LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 61  ? -1.475  30.193 6.006   1.00 22.78  ? 79  LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 61  ? -2.253  31.142 8.204   1.00 25.10  ? 79  LEU A CD2 1 
ATOM   406  N  N   . SER A 1 62  ? -1.776  35.256 4.489   1.00 21.03  ? 80  SER A N   1 
ATOM   407  C  CA  . SER A 1 62  ? -2.359  36.417 3.843   1.00 23.96  ? 80  SER A CA  1 
ATOM   408  C  C   . SER A 1 62  ? -2.015  36.573 2.363   1.00 22.61  ? 80  SER A C   1 
ATOM   409  O  O   . SER A 1 62  ? -2.863  36.910 1.556   1.00 26.49  ? 80  SER A O   1 
ATOM   410  C  CB  . SER A 1 62  ? -1.898  37.697 4.539   1.00 25.90  ? 80  SER A CB  1 
ATOM   411  O  OG  . SER A 1 62  ? -2.665  37.858 5.676   1.00 30.93  ? 80  SER A OG  1 
ATOM   412  N  N   . GLY A 1 63  ? -0.751  36.489 2.026   1.00 23.33  ? 81  GLY A N   1 
ATOM   413  C  CA  . GLY A 1 63  ? -0.359  36.674 0.626   1.00 22.98  ? 81  GLY A CA  1 
ATOM   414  C  C   . GLY A 1 63  ? -1.008  35.577 -0.186  1.00 24.80  ? 81  GLY A C   1 
ATOM   415  O  O   . GLY A 1 63  ? -1.413  35.792 -1.334  1.00 27.01  ? 81  GLY A O   1 
ATOM   416  N  N   . SER A 1 64  ? -1.152  34.397 0.412   1.00 23.84  ? 82  SER A N   1 
ATOM   417  C  CA  . SER A 1 64  ? -1.762  33.301 -0.332  1.00 23.21  ? 82  SER A CA  1 
ATOM   418  C  C   . SER A 1 64  ? -3.199  33.577 -0.661  1.00 22.61  ? 82  SER A C   1 
ATOM   419  O  O   . SER A 1 64  ? -3.656  33.288 -1.758  1.00 21.66  ? 82  SER A O   1 
ATOM   420  C  CB  . SER A 1 64  ? -1.589  31.964 0.352   1.00 20.42  ? 82  SER A CB  1 
ATOM   421  O  OG  . SER A 1 64  ? -2.547  31.001 -0.100  1.00 20.29  ? 82  SER A OG  1 
ATOM   422  N  N   . LEU A 1 65  ? -3.899  34.174 0.283   1.00 23.83  ? 83  LEU A N   1 
ATOM   423  C  CA  . LEU A 1 65  ? -5.276  34.523 0.082   1.00 23.63  ? 83  LEU A CA  1 
ATOM   424  C  C   . LEU A 1 65  ? -5.443  35.672 -0.933  1.00 22.84  ? 83  LEU A C   1 
ATOM   425  O  O   . LEU A 1 65  ? -6.430  35.701 -1.663  1.00 21.92  ? 83  LEU A O   1 
ATOM   426  C  CB  . LEU A 1 65  ? -5.929  34.869 1.436   1.00 24.81  ? 83  LEU A CB  1 
ATOM   427  C  CG  . LEU A 1 65  ? -7.394  35.332 1.421   1.00 25.99  ? 83  LEU A CG  1 
ATOM   428  C  CD1 . LEU A 1 65  ? -8.334  34.309 0.817   1.00 20.75  ? 83  LEU A CD1 1 
ATOM   429  C  CD2 . LEU A 1 65  ? -7.777  35.688 2.869   1.00 27.13  ? 83  LEU A CD2 1 
ATOM   430  N  N   . GLU A 1 66  ? -4.480  36.586 -1.024  1.00 23.08  ? 84  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 66  ? -4.585  37.665 -2.047  1.00 24.10  ? 84  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 66  ? -4.376  37.095 -3.397  1.00 24.58  ? 84  GLU A C   1 
ATOM   433  O  O   . GLU A 1 66  ? -5.055  37.472 -4.339  1.00 27.39  ? 84  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 66  ? -3.593  38.771 -1.808  1.00 27.50  ? 84  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 66  ? -3.820  39.404 -0.452  1.00 34.41  ? 84  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 66  ? -5.175  40.132 -0.286  1.00 44.82  ? 84  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 66  ? -6.022  40.199 -1.237  1.00 49.64  ? 84  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 66  ? -5.391  40.684 0.828   1.00 47.72  ? 84  GLU A OE2 1 
ATOM   439  N  N   . VAL A 1 67  ? -3.489  36.110 -3.478  1.00 21.11  ? 85  VAL A N   1 
ATOM   440  C  CA  . VAL A 1 67  ? -3.248  35.440 -4.703  1.00 22.03  ? 85  VAL A CA  1 
ATOM   441  C  C   . VAL A 1 67  ? -4.427  34.502 -5.069  1.00 22.65  ? 85  VAL A C   1 
ATOM   442  O  O   . VAL A 1 67  ? -4.774  34.363 -6.246  1.00 23.82  ? 85  VAL A O   1 
ATOM   443  C  CB  . VAL A 1 67  ? -1.886  34.698 -4.609  1.00 21.75  ? 85  VAL A CB  1 
ATOM   444  C  CG1 . VAL A 1 67  ? -1.729  33.640 -5.670  1.00 21.42  ? 85  VAL A CG1 1 
ATOM   445  C  CG2 . VAL A 1 67  ? -0.760  35.706 -4.741  1.00 23.48  ? 85  VAL A CG2 1 
ATOM   446  N  N   . ILE A 1 68  ? -5.039  33.844 -4.093  1.00 20.08  ? 86  ILE A N   1 
ATOM   447  C  CA  . ILE A 1 68  ? -6.160  32.966 -4.440  1.00 22.16  ? 86  ILE A CA  1 
ATOM   448  C  C   . ILE A 1 68  ? -7.349  33.801 -4.944  1.00 23.60  ? 86  ILE A C   1 
ATOM   449  O  O   . ILE A 1 68  ? -7.980  33.436 -5.932  1.00 21.08  ? 86  ILE A O   1 
ATOM   450  C  CB  . ILE A 1 68  ? -6.519  31.996 -3.320  1.00 19.97  ? 86  ILE A CB  1 
ATOM   451  C  CG1 . ILE A 1 68  ? -5.429  30.909 -3.310  1.00 22.01  ? 86  ILE A CG1 1 
ATOM   452  C  CG2 . ILE A 1 68  ? -7.845  31.312 -3.563  1.00 18.81  ? 86  ILE A CG2 1 
ATOM   453  C  CD1 . ILE A 1 68  ? -5.244  30.194 -2.012  1.00 17.50  ? 86  ILE A CD1 1 
ATOM   454  N  N   . ARG A 1 69  ? -7.603  34.922 -4.288  1.00 23.34  ? 87  ARG A N   1 
ATOM   455  C  CA  . ARG A 1 69  ? -8.537  35.969 -4.787  1.00 27.02  ? 87  ARG A CA  1 
ATOM   456  C  C   . ARG A 1 69  ? -8.338  36.372 -6.281  1.00 26.98  ? 87  ARG A C   1 
ATOM   457  O  O   . ARG A 1 69  ? -9.282  36.365 -7.048  1.00 24.55  ? 87  ARG A O   1 
ATOM   458  C  CB  . ARG A 1 69  ? -8.333  37.222 -3.965  1.00 27.12  ? 87  ARG A CB  1 
ATOM   459  C  CG  . ARG A 1 69  ? -9.536  38.026 -3.587  1.00 33.67  ? 87  ARG A CG  1 
ATOM   460  C  CD  . ARG A 1 69  ? -9.089  39.006 -2.498  1.00 36.50  ? 87  ARG A CD  1 
ATOM   461  N  NE  . ARG A 1 69  ? -9.098  38.486 -1.129  1.00 31.60  ? 87  ARG A NE  1 
ATOM   462  C  CZ  . ARG A 1 69  ? -10.223 38.324 -0.429  1.00 40.88  ? 87  ARG A CZ  1 
ATOM   463  N  NH1 . ARG A 1 69  ? -11.406 38.562 -1.000  1.00 48.40  ? 87  ARG A NH1 1 
ATOM   464  N  NH2 . ARG A 1 69  ? -10.209 37.866 0.809   1.00 35.02  ? 87  ARG A NH2 1 
ATOM   465  N  N   . LYS A 1 70  ? -7.135  36.770 -6.683  1.00 27.65  ? 88  LYS A N   1 
ATOM   466  C  CA  . LYS A 1 70  ? -6.935  37.132 -8.091  1.00 30.06  ? 88  LYS A CA  1 
ATOM   467  C  C   . LYS A 1 70  ? -7.094  35.928 -9.031  1.00 29.44  ? 88  LYS A C   1 
ATOM   468  O  O   . LYS A 1 70  ? -7.563  36.056 -10.138 1.00 32.78  ? 88  LYS A O   1 
ATOM   469  C  CB  . LYS A 1 70  ? -5.575  37.811 -8.306  1.00 33.72  ? 88  LYS A CB  1 
ATOM   470  C  CG  . LYS A 1 70  ? -5.391  39.080 -7.442  1.00 37.25  ? 88  LYS A CG  1 
ATOM   471  C  CD  . LYS A 1 70  ? -3.922  39.506 -7.408  1.00 40.95  ? 88  LYS A CD  1 
ATOM   472  C  CE  . LYS A 1 70  ? -3.714  40.832 -6.690  1.00 45.05  ? 88  LYS A CE  1 
ATOM   473  N  NZ  . LYS A 1 70  ? -3.958  41.977 -7.608  1.00 53.74  ? 88  LYS A NZ  1 
ATOM   474  N  N   . TRP A 1 71  ? -6.694  34.743 -8.595  1.00 29.85  ? 89  TRP A N   1 
ATOM   475  C  CA  . TRP A 1 71  ? -6.933  33.551 -9.409  1.00 26.92  ? 89  TRP A CA  1 
ATOM   476  C  C   . TRP A 1 71  ? -8.418  33.285 -9.573  1.00 25.28  ? 89  TRP A C   1 
ATOM   477  O  O   . TRP A 1 71  ? -8.885  33.019 -10.660 1.00 29.12  ? 89  TRP A O   1 
ATOM   478  C  CB  . TRP A 1 71  ? -6.221  32.395 -8.752  1.00 24.68  ? 89  TRP A CB  1 
ATOM   479  C  CG  . TRP A 1 71  ? -6.751  31.020 -9.071  1.00 24.46  ? 89  TRP A CG  1 
ATOM   480  C  CD1 . TRP A 1 71  ? -6.434  30.257 -10.163 1.00 23.72  ? 89  TRP A CD1 1 
ATOM   481  C  CD2 . TRP A 1 71  ? -7.671  30.182 -8.261  1.00 23.20  ? 89  TRP A CD2 1 
ATOM   482  N  NE1 . TRP A 1 71  ? -7.040  29.033 -10.095 1.00 28.56  ? 89  TRP A NE1 1 
ATOM   483  C  CE2 . TRP A 1 71  ? -7.806  28.925 -8.982  1.00 24.97  ? 89  TRP A CE2 1 
ATOM   484  C  CE3 . TRP A 1 71  ? -8.382  30.357 -7.065  1.00 24.41  ? 89  TRP A CE3 1 
ATOM   485  C  CZ2 . TRP A 1 71  ? -8.621  27.889 -8.531  1.00 25.05  ? 89  TRP A CZ2 1 
ATOM   486  C  CZ3 . TRP A 1 71  ? -9.193  29.290 -6.604  1.00 24.27  ? 89  TRP A CZ3 1 
ATOM   487  C  CH2 . TRP A 1 71  ? -9.291  28.081 -7.316  1.00 24.60  ? 89  TRP A CH2 1 
ATOM   488  N  N   . ALA A 1 72  ? -9.175  33.362 -8.494  1.00 24.13  ? 90  ALA A N   1 
ATOM   489  C  CA  . ALA A 1 72  ? -10.630 33.201 -8.551  1.00 25.81  ? 90  ALA A CA  1 
ATOM   490  C  C   . ALA A 1 72  ? -11.323 34.222 -9.501  1.00 26.02  ? 90  ALA A C   1 
ATOM   491  O  O   . ALA A 1 72  ? -12.160 33.820 -10.318 1.00 27.22  ? 90  ALA A O   1 
ATOM   492  C  CB  . ALA A 1 72  ? -11.258 33.206 -7.142  1.00 23.34  ? 90  ALA A CB  1 
ATOM   493  N  N   . GLU A 1 73  ? -10.972 35.506 -9.413  1.00 26.39  ? 91  GLU A N   1 
ATOM   494  C  CA  . GLU A 1 73  ? -11.474 36.525 -10.372 1.00 31.33  ? 91  GLU A CA  1 
ATOM   495  C  C   . GLU A 1 73  ? -11.326 36.068 -11.848 1.00 31.61  ? 91  GLU A C   1 
ATOM   496  O  O   . GLU A 1 73  ? -12.084 36.505 -12.725 1.00 27.62  ? 91  GLU A O   1 
ATOM   497  C  CB  . GLU A 1 73  ? -10.817 37.927 -10.121 1.00 32.88  ? 91  GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 73  ? -11.138 39.030 -11.161 1.00 40.96  ? 91  GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 73  ? -12.155 40.138 -10.743 1.00 49.07  ? 91  GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 73  ? -12.477 40.335 -9.537  1.00 55.40  ? 91  GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 73  ? -12.642 40.869 -11.645 1.00 47.30  ? 91  GLU A OE2 1 
ATOM   502  N  N   . LYS A 1 74  ? -10.380 35.149 -12.108 1.00 32.94  ? 92  LYS A N   1 
ATOM   503  C  CA  . LYS A 1 74  ? -10.129 34.674 -13.457 1.00 31.01  ? 92  LYS A CA  1 
ATOM   504  C  C   . LYS A 1 74  ? -10.892 33.446 -13.881 1.00 29.98  ? 92  LYS A C   1 
ATOM   505  O  O   . LYS A 1 74  ? -10.864 33.079 -15.049 1.00 34.11  ? 92  LYS A O   1 
ATOM   506  C  CB  . LYS A 1 74  ? -8.625  34.515 -13.704 1.00 33.40  ? 92  LYS A CB  1 
ATOM   507  C  CG  . LYS A 1 74  ? -7.884  35.865 -13.802 1.00 32.65  ? 92  LYS A CG  1 
ATOM   508  C  CD  . LYS A 1 74  ? -6.385  35.625 -13.861 1.00 32.24  ? 92  LYS A CD  1 
ATOM   509  C  CE  . LYS A 1 74  ? -5.614  36.751 -13.197 1.00 34.32  ? 92  LYS A CE  1 
ATOM   510  N  NZ  . LYS A 1 74  ? -4.140  36.482 -13.304 1.00 37.59  ? 92  LYS A NZ  1 
ATOM   511  N  N   . ILE A 1 75  ? -11.574 32.786 -12.963 1.00 26.85  ? 93  ILE A N   1 
ATOM   512  C  CA  . ILE A 1 75  ? -12.404 31.667 -13.356 1.00 24.92  ? 93  ILE A CA  1 
ATOM   513  C  C   . ILE A 1 75  ? -13.662 32.235 -14.039 1.00 24.38  ? 93  ILE A C   1 
ATOM   514  O  O   . ILE A 1 75  ? -14.351 33.059 -13.423 1.00 25.24  ? 93  ILE A O   1 
ATOM   515  C  CB  . ILE A 1 75  ? -12.794 30.814 -12.152 1.00 25.27  ? 93  ILE A CB  1 
ATOM   516  C  CG1 . ILE A 1 75  ? -11.514 30.276 -11.468 1.00 28.11  ? 93  ILE A CG1 1 
ATOM   517  C  CG2 . ILE A 1 75  ? -13.777 29.724 -12.587 1.00 22.49  ? 93  ILE A CG2 1 
ATOM   518  C  CD1 . ILE A 1 75  ? -11.746 29.560 -10.148 1.00 27.40  ? 93  ILE A CD1 1 
ATOM   519  N  N   . PRO A 1 76  ? -13.949 31.826 -15.309 1.00 25.07  ? 94  PRO A N   1 
ATOM   520  C  CA  . PRO A 1 76  ? -15.077 32.431 -16.023 1.00 25.56  ? 94  PRO A CA  1 
ATOM   521  C  C   . PRO A 1 76  ? -16.337 32.250 -15.213 1.00 24.62  ? 94  PRO A C   1 
ATOM   522  O  O   . PRO A 1 76  ? -16.622 31.134 -14.772 1.00 21.91  ? 94  PRO A O   1 
ATOM   523  C  CB  . PRO A 1 76  ? -15.115 31.613 -17.325 1.00 23.48  ? 94  PRO A CB  1 
ATOM   524  C  CG  . PRO A 1 76  ? -13.688 31.478 -17.622 1.00 23.88  ? 94  PRO A CG  1 
ATOM   525  C  CD  . PRO A 1 76  ? -13.154 31.023 -16.259 1.00 25.69  ? 94  PRO A CD  1 
ATOM   526  N  N   . GLY A 1 77  ? -17.042 33.348 -14.958 1.00 24.74  ? 95  GLY A N   1 
ATOM   527  C  CA  . GLY A 1 77  ? -18.306 33.256 -14.171 1.00 24.11  ? 95  GLY A CA  1 
ATOM   528  C  C   . GLY A 1 77  ? -18.136 33.687 -12.729 1.00 25.07  ? 95  GLY A C   1 
ATOM   529  O  O   . GLY A 1 77  ? -19.009 34.245 -12.151 1.00 29.35  ? 95  GLY A O   1 
ATOM   530  N  N   . PHE A 1 78  ? -17.008 33.421 -12.113 1.00 24.32  ? 96  PHE A N   1 
ATOM   531  C  CA  . PHE A 1 78  ? -16.949 33.653 -10.677 1.00 22.84  ? 96  PHE A CA  1 
ATOM   532  C  C   . PHE A 1 78  ? -17.166 35.150 -10.325 1.00 24.19  ? 96  PHE A C   1 
ATOM   533  O  O   . PHE A 1 78  ? -17.964 35.502 -9.421  1.00 22.37  ? 96  PHE A O   1 
ATOM   534  C  CB  . PHE A 1 78  ? -15.619 33.088 -10.142 1.00 22.90  ? 96  PHE A CB  1 
ATOM   535  C  CG  . PHE A 1 78  ? -15.396 33.326 -8.689  1.00 26.00  ? 96  PHE A CG  1 
ATOM   536  C  CD1 . PHE A 1 78  ? -15.828 32.384 -7.731  1.00 25.69  ? 96  PHE A CD1 1 
ATOM   537  C  CD2 . PHE A 1 78  ? -14.786 34.523 -8.244  1.00 25.39  ? 96  PHE A CD2 1 
ATOM   538  C  CE1 . PHE A 1 78  ? -15.618 32.628 -6.358  1.00 25.38  ? 96  PHE A CE1 1 
ATOM   539  C  CE2 . PHE A 1 78  ? -14.572 34.752 -6.888  1.00 24.05  ? 96  PHE A CE2 1 
ATOM   540  C  CZ  . PHE A 1 78  ? -14.990 33.800 -5.954  1.00 24.30  ? 96  PHE A CZ  1 
ATOM   541  N  N   . ALA A 1 79  ? -16.485 36.036 -11.053 1.00 24.08  ? 97  ALA A N   1 
ATOM   542  C  CA  . ALA A 1 79  ? -16.501 37.459 -10.707 1.00 25.87  ? 97  ALA A CA  1 
ATOM   543  C  C   . ALA A 1 79  ? -17.893 38.058 -10.868 1.00 25.26  ? 97  ALA A C   1 
ATOM   544  O  O   . ALA A 1 79  ? -18.119 39.163 -10.452 1.00 23.66  ? 97  ALA A O   1 
ATOM   545  C  CB  . ALA A 1 79  ? -15.464 38.238 -11.536 1.00 25.84  ? 97  ALA A CB  1 
ATOM   546  N  N   . GLU A 1 80  ? -18.828 37.307 -11.456 1.00 25.86  ? 98  GLU A N   1 
ATOM   547  C  CA  . GLU A 1 80  ? -20.196 37.799 -11.611 1.00 26.57  ? 98  GLU A CA  1 
ATOM   548  C  C   . GLU A 1 80  ? -21.091 37.218 -10.526 1.00 25.67  ? 98  GLU A C   1 
ATOM   549  O  O   . GLU A 1 80  ? -22.239 37.604 -10.420 1.00 22.17  ? 98  GLU A O   1 
ATOM   550  C  CB  . GLU A 1 80  ? -20.787 37.544 -13.029 1.00 24.88  ? 98  GLU A CB  1 
ATOM   551  C  CG  . GLU A 1 80  ? -20.165 38.426 -14.088 1.00 23.25  ? 98  GLU A CG  1 
ATOM   552  C  CD  . GLU A 1 80  ? -18.704 38.116 -14.364 1.00 24.68  ? 98  GLU A CD  1 
ATOM   553  O  OE1 . GLU A 1 80  ? -18.351 36.952 -14.645 1.00 24.16  ? 98  GLU A OE1 1 
ATOM   554  O  OE2 . GLU A 1 80  ? -17.881 39.051 -14.296 1.00 25.68  ? 98  GLU A OE2 1 
ATOM   555  N  N   . LEU A 1 81  ? -20.552 36.341 -9.684  1.00 26.57  ? 99  LEU A N   1 
ATOM   556  C  CA  . LEU A 1 81  ? -21.303 35.966 -8.424  1.00 25.55  ? 99  LEU A CA  1 
ATOM   557  C  C   . LEU A 1 81  ? -21.477 37.193 -7.534  1.00 25.79  ? 99  LEU A C   1 
ATOM   558  O  O   . LEU A 1 81  ? -20.706 38.141 -7.658  1.00 25.37  ? 99  LEU A O   1 
ATOM   559  C  CB  . LEU A 1 81  ? -20.663 34.775 -7.703  1.00 23.54  ? 99  LEU A CB  1 
ATOM   560  C  CG  . LEU A 1 81  ? -20.599 33.529 -8.631  1.00 25.26  ? 99  LEU A CG  1 
ATOM   561  C  CD1 . LEU A 1 81  ? -19.601 32.525 -8.087  1.00 25.80  ? 99  LEU A CD1 1 
ATOM   562  C  CD2 . LEU A 1 81  ? -21.966 32.863 -8.918  1.00 22.19  ? 99  LEU A CD2 1 
ATOM   563  N  N   . SER A 1 82  ? -22.508 37.215 -6.679  1.00 27.73  ? 100 SER A N   1 
ATOM   564  C  CA  . SER A 1 82  ? -22.675 38.315 -5.726  1.00 26.97  ? 100 SER A CA  1 
ATOM   565  C  C   . SER A 1 82  ? -21.431 38.454 -4.874  1.00 28.03  ? 100 SER A C   1 
ATOM   566  O  O   . SER A 1 82  ? -20.761 37.459 -4.586  1.00 27.69  ? 100 SER A O   1 
ATOM   567  C  CB  . SER A 1 82  ? -23.846 38.096 -4.779  1.00 26.66  ? 100 SER A CB  1 
ATOM   568  O  OG  . SER A 1 82  ? -23.532 37.161 -3.749  1.00 26.09  ? 100 SER A OG  1 
ATOM   569  N  N   . PRO A 1 83  ? -21.132 39.699 -4.449  1.00 28.83  ? 101 PRO A N   1 
ATOM   570  C  CA  . PRO A 1 83  ? -19.938 39.955 -3.663  1.00 27.24  ? 101 PRO A CA  1 
ATOM   571  C  C   . PRO A 1 83  ? -19.867 39.060 -2.444  1.00 25.31  ? 101 PRO A C   1 
ATOM   572  O  O   . PRO A 1 83  ? -18.842 38.454 -2.188  1.00 24.23  ? 101 PRO A O   1 
ATOM   573  C  CB  . PRO A 1 83  ? -20.123 41.419 -3.242  1.00 27.77  ? 101 PRO A CB  1 
ATOM   574  C  CG  . PRO A 1 83  ? -20.859 41.996 -4.400  1.00 31.25  ? 101 PRO A CG  1 
ATOM   575  C  CD  . PRO A 1 83  ? -21.894 40.942 -4.686  1.00 24.91  ? 101 PRO A CD  1 
ATOM   576  N  N   . ALA A 1 84  ? -20.967 38.954 -1.725  1.00 24.55  ? 102 ALA A N   1 
ATOM   577  C  CA  . ALA A 1 84  ? -21.003 38.112 -0.564  1.00 23.64  ? 102 ALA A CA  1 
ATOM   578  C  C   . ALA A 1 84  ? -20.751 36.667 -0.951  1.00 22.61  ? 102 ALA A C   1 
ATOM   579  O  O   . ALA A 1 84  ? -20.073 35.963 -0.208  1.00 20.93  ? 102 ALA A O   1 
ATOM   580  C  CB  . ALA A 1 84  ? -22.307 38.297 0.237   1.00 19.53  ? 102 ALA A CB  1 
ATOM   581  N  N   . ASP A 1 85  ? -21.235 36.224 -2.120  1.00 22.37  ? 103 ASP A N   1 
ATOM   582  C  CA  . ASP A 1 85  ? -20.989 34.816 -2.521  1.00 22.16  ? 103 ASP A CA  1 
ATOM   583  C  C   . ASP A 1 85  ? -19.536 34.501 -2.871  1.00 22.64  ? 103 ASP A C   1 
ATOM   584  O  O   . ASP A 1 85  ? -19.019 33.433 -2.448  1.00 19.72  ? 103 ASP A O   1 
ATOM   585  C  CB  . ASP A 1 85  ? -21.936 34.305 -3.621  1.00 24.12  ? 103 ASP A CB  1 
ATOM   586  C  CG  . ASP A 1 85  ? -23.377 34.047 -3.103  1.00 23.32  ? 103 ASP A CG  1 
ATOM   587  O  OD1 . ASP A 1 85  ? -23.623 34.250 -1.876  1.00 20.16  ? 103 ASP A OD1 1 
ATOM   588  O  OD2 . ASP A 1 85  ? -24.237 33.627 -3.937  1.00 23.55  ? 103 ASP A OD2 1 
ATOM   589  N  N   . GLN A 1 86  ? -18.891 35.433 -3.599  1.00 21.65  ? 104 GLN A N   1 
ATOM   590  C  CA  . GLN A 1 86  ? -17.467 35.354 -3.899  1.00 23.65  ? 104 GLN A CA  1 
ATOM   591  C  C   . GLN A 1 86  ? -16.640 35.260 -2.562  1.00 23.68  ? 104 GLN A C   1 
ATOM   592  O  O   . GLN A 1 86  ? -15.815 34.363 -2.392  1.00 22.21  ? 104 GLN A O   1 
ATOM   593  C  CB  . GLN A 1 86  ? -17.020 36.592 -4.708  1.00 23.77  ? 104 GLN A CB  1 
ATOM   594  C  CG  . GLN A 1 86  ? -17.524 36.632 -6.168  1.00 25.35  ? 104 GLN A CG  1 
ATOM   595  C  CD  . GLN A 1 86  ? -17.113 37.893 -6.883  1.00 24.55  ? 104 GLN A CD  1 
ATOM   596  O  OE1 . GLN A 1 86  ? -15.948 38.237 -6.860  1.00 28.90  ? 104 GLN A OE1 1 
ATOM   597  N  NE2 . GLN A 1 86  ? -18.061 38.589 -7.537  1.00 25.12  ? 104 GLN A NE2 1 
ATOM   598  N  N   . ASP A 1 87  ? -16.894 36.182 -1.634  1.00 21.91  ? 105 ASP A N   1 
ATOM   599  C  CA  . ASP A 1 87  ? -16.264 36.145 -0.307  1.00 25.17  ? 105 ASP A CA  1 
ATOM   600  C  C   . ASP A 1 87  ? -16.393 34.815 0.433   1.00 24.27  ? 105 ASP A C   1 
ATOM   601  O  O   . ASP A 1 87  ? -15.416 34.241 0.938   1.00 24.14  ? 105 ASP A O   1 
ATOM   602  C  CB  . ASP A 1 87  ? -16.826 37.283 0.539   1.00 24.54  ? 105 ASP A CB  1 
ATOM   603  C  CG  . ASP A 1 87  ? -16.267 38.643 0.084   1.00 26.57  ? 105 ASP A CG  1 
ATOM   604  O  OD1 . ASP A 1 87  ? -15.286 38.701 -0.711  1.00 25.87  ? 105 ASP A OD1 1 
ATOM   605  O  OD2 . ASP A 1 87  ? -16.807 39.651 0.519   1.00 31.50  ? 105 ASP A OD2 1 
ATOM   606  N  N   . LEU A 1 88  ? -17.604 34.302 0.421   1.00 23.66  ? 106 LEU A N   1 
ATOM   607  C  CA  . LEU A 1 88  ? -17.919 33.151 1.212   1.00 23.11  ? 106 LEU A CA  1 
ATOM   608  C  C   . LEU A 1 88  ? -17.254 31.916 0.621   1.00 22.55  ? 106 LEU A C   1 
ATOM   609  O  O   . LEU A 1 88  ? -16.669 31.110 1.368   1.00 23.10  ? 106 LEU A O   1 
ATOM   610  C  CB  . LEU A 1 88  ? -19.441 33.001 1.358   1.00 22.89  ? 106 LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 88  ? -19.864 31.634 1.952   1.00 23.63  ? 106 LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 88  ? -19.605 31.487 3.462   1.00 19.45  ? 106 LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 88  ? -21.332 31.456 1.635   1.00 23.18  ? 106 LEU A CD2 1 
ATOM   614  N  N   . LEU A 1 89  ? -17.248 31.812 -0.709  1.00 21.35  ? 107 LEU A N   1 
ATOM   615  C  CA  . LEU A 1 89  ? -16.612 30.664 -1.365  1.00 21.88  ? 107 LEU A CA  1 
ATOM   616  C  C   . LEU A 1 89  ? -15.116 30.666 -1.061  1.00 21.67  ? 107 LEU A C   1 
ATOM   617  O  O   . LEU A 1 89  ? -14.572 29.660 -0.721  1.00 21.29  ? 107 LEU A O   1 
ATOM   618  C  CB  . LEU A 1 89  ? -16.828 30.671 -2.905  1.00 18.79  ? 107 LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 89  ? -18.240 30.308 -3.457  1.00 17.17  ? 107 LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 89  ? -18.274 30.437 -4.970  1.00 16.15  ? 107 LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 89  ? -18.702 28.899 -3.025  1.00 16.92  ? 107 LEU A CD2 1 
ATOM   622  N  N   . LEU A 1 90  ? -14.498 31.832 -1.237  1.00 24.67  ? 108 LEU A N   1 
ATOM   623  C  CA  . LEU A 1 90  ? -13.084 32.100 -1.060  1.00 24.22  ? 108 LEU A CA  1 
ATOM   624  C  C   . LEU A 1 90  ? -12.657 31.840 0.391   1.00 22.63  ? 108 LEU A C   1 
ATOM   625  O  O   . LEU A 1 90  ? -11.743 31.043 0.645   1.00 21.84  ? 108 LEU A O   1 
ATOM   626  C  CB  . LEU A 1 90  ? -12.881 33.563 -1.389  1.00 24.70  ? 108 LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 90  ? -12.050 34.187 -2.524  1.00 29.23  ? 108 LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 90  ? -11.550 33.266 -3.636  1.00 26.41  ? 108 LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 90  ? -12.721 35.476 -3.070  1.00 25.21  ? 108 LEU A CD2 1 
ATOM   630  N  N   . GLU A 1 91  ? -13.343 32.484 1.335   1.00 21.06  ? 109 GLU A N   1 
ATOM   631  C  CA  . GLU A 1 91  ? -13.070 32.258 2.758   1.00 23.30  ? 109 GLU A CA  1 
ATOM   632  C  C   . GLU A 1 91  ? -13.239 30.782 3.167   1.00 22.70  ? 109 GLU A C   1 
ATOM   633  O  O   . GLU A 1 91  ? -12.482 30.267 4.003   1.00 22.39  ? 109 GLU A O   1 
ATOM   634  C  CB  . GLU A 1 91  ? -13.937 33.198 3.657   1.00 22.08  ? 109 GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 91  ? -13.492 34.658 3.521   1.00 25.43  ? 109 GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 91  ? -14.530 35.702 3.936   1.00 30.75  ? 109 GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 91  ? -14.351 36.884 3.566   1.00 32.93  ? 109 GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 91  ? -15.509 35.387 4.652   1.00 32.22  ? 109 GLU A OE2 1 
ATOM   639  N  N   . SER A 1 92  ? -14.238 30.110 2.588   1.00 22.81  ? 110 SER A N   1 
ATOM   640  C  CA  . SER A 1 92  ? -14.553 28.746 2.992   1.00 21.55  ? 110 SER A CA  1 
ATOM   641  C  C   . SER A 1 92  ? -13.595 27.732 2.432   1.00 21.63  ? 110 SER A C   1 
ATOM   642  O  O   . SER A 1 92  ? -13.433 26.638 3.038   1.00 17.84  ? 110 SER A O   1 
ATOM   643  C  CB  . SER A 1 92  ? -15.968 28.345 2.632   1.00 21.10  ? 110 SER A CB  1 
ATOM   644  O  OG  . SER A 1 92  ? -16.893 29.307 3.083   1.00 24.14  ? 110 SER A OG  1 
ATOM   645  N  N   . ALA A 1 93  ? -12.994 28.057 1.279   1.00 21.07  ? 111 ALA A N   1 
ATOM   646  C  CA  . ALA A 1 93  ? -12.040 27.107 0.656   1.00 20.52  ? 111 ALA A CA  1 
ATOM   647  C  C   . ALA A 1 93  ? -10.612 27.490 0.890   1.00 22.22  ? 111 ALA A C   1 
ATOM   648  O  O   . ALA A 1 93  ? -9.731  26.701 0.499   1.00 24.87  ? 111 ALA A O   1 
ATOM   649  C  CB  . ALA A 1 93  ? -12.241 27.061 -0.825  1.00 17.16  ? 111 ALA A CB  1 
ATOM   650  N  N   . PHE A 1 94  ? -10.353 28.706 1.395   1.00 19.82  ? 112 PHE A N   1 
ATOM   651  C  CA  . PHE A 1 94  ? -8.975  29.183 1.486   1.00 21.96  ? 112 PHE A CA  1 
ATOM   652  C  C   . PHE A 1 94  ? -7.978  28.154 2.077   1.00 22.63  ? 112 PHE A C   1 
ATOM   653  O  O   . PHE A 1 94  ? -6.915  27.852 1.463   1.00 24.76  ? 112 PHE A O   1 
ATOM   654  C  CB  . PHE A 1 94  ? -8.860  30.474 2.310   1.00 22.55  ? 112 PHE A CB  1 
ATOM   655  C  CG  . PHE A 1 94  ? -7.427  30.789 2.670   1.00 23.70  ? 112 PHE A CG  1 
ATOM   656  C  CD1 . PHE A 1 94  ? -6.501  31.130 1.667   1.00 22.39  ? 112 PHE A CD1 1 
ATOM   657  C  CD2 . PHE A 1 94  ? -6.978  30.697 3.992   1.00 23.14  ? 112 PHE A CD2 1 
ATOM   658  C  CE1 . PHE A 1 94  ? -5.180  31.364 1.980   1.00 19.94  ? 112 PHE A CE1 1 
ATOM   659  C  CE2 . PHE A 1 94  ? -5.650  30.927 4.306   1.00 22.16  ? 112 PHE A CE2 1 
ATOM   660  C  CZ  . PHE A 1 94  ? -4.752  31.260 3.291   1.00 21.90  ? 112 PHE A CZ  1 
ATOM   661  N  N   . LEU A 1 95  ? -8.309  27.569 3.223   1.00 21.33  ? 113 LEU A N   1 
ATOM   662  C  CA  . LEU A 1 95  ? -7.308  26.641 3.872   1.00 25.22  ? 113 LEU A CA  1 
ATOM   663  C  C   . LEU A 1 95  ? -7.057  25.429 3.016   1.00 22.26  ? 113 LEU A C   1 
ATOM   664  O  O   . LEU A 1 95  ? -5.925  25.016 2.824   1.00 17.93  ? 113 LEU A O   1 
ATOM   665  C  CB  . LEU A 1 95  ? -7.727  26.215 5.286   1.00 27.94  ? 113 LEU A CB  1 
ATOM   666  C  CG  . LEU A 1 95  ? -6.817  26.440 6.495   1.00 35.82  ? 113 LEU A CG  1 
ATOM   667  C  CD1 . LEU A 1 95  ? -5.794  27.576 6.415   1.00 32.97  ? 113 LEU A CD1 1 
ATOM   668  C  CD2 . LEU A 1 95  ? -7.670  26.634 7.742   1.00 37.96  ? 113 LEU A CD2 1 
ATOM   669  N  N   . GLU A 1 96  ? -8.135  24.897 2.433   1.00 26.03  ? 114 GLU A N   1 
ATOM   670  C  CA  . GLU A 1 96  ? -8.037  23.773 1.520   1.00 25.35  ? 114 GLU A CA  1 
ATOM   671  C  C   . GLU A 1 96  ? -7.164  24.124 0.318   1.00 24.52  ? 114 GLU A C   1 
ATOM   672  O  O   . GLU A 1 96  ? -6.363  23.310 -0.146  1.00 26.23  ? 114 GLU A O   1 
ATOM   673  C  CB  . GLU A 1 96  ? -9.418  23.469 0.991   1.00 30.17  ? 114 GLU A CB  1 
ATOM   674  C  CG  . GLU A 1 96  ? -9.580  22.049 0.455   1.00 31.63  ? 114 GLU A CG  1 
ATOM   675  C  CD  . GLU A 1 96  ? -10.977 21.515 0.664   1.00 32.46  ? 114 GLU A CD  1 
ATOM   676  O  OE1 . GLU A 1 96  ? -11.876 22.260 1.130   1.00 30.92  ? 114 GLU A OE1 1 
ATOM   677  O  OE2 . GLU A 1 96  ? -11.156 20.332 0.342   1.00 41.17  ? 114 GLU A OE2 1 
ATOM   678  N  N   . LEU A 1 97  ? -7.337  25.337 -0.199  1.00 23.81  ? 115 LEU A N   1 
ATOM   679  C  CA  . LEU A 1 97  ? -6.703  25.716 -1.457  1.00 22.17  ? 115 LEU A CA  1 
ATOM   680  C  C   . LEU A 1 97  ? -5.248  26.013 -1.117  1.00 22.85  ? 115 LEU A C   1 
ATOM   681  O  O   . LEU A 1 97  ? -4.367  25.615 -1.860  1.00 22.32  ? 115 LEU A O   1 
ATOM   682  C  CB  . LEU A 1 97  ? -7.394  26.954 -2.073  1.00 20.65  ? 115 LEU A CB  1 
ATOM   683  C  CG  . LEU A 1 97  ? -8.784  26.765 -2.712  1.00 17.98  ? 115 LEU A CG  1 
ATOM   684  C  CD1 . LEU A 1 97  ? -9.475  28.094 -2.966  1.00 16.32  ? 115 LEU A CD1 1 
ATOM   685  C  CD2 . LEU A 1 97  ? -8.750  25.916 -3.965  1.00 19.14  ? 115 LEU A CD2 1 
ATOM   686  N  N   . PHE A 1 98  ? -5.005  26.716 -0.006  1.00 21.48  ? 116 PHE A N   1 
ATOM   687  C  CA  . PHE A 1 98  ? -3.647  27.015 0.396   1.00 20.16  ? 116 PHE A CA  1 
ATOM   688  C  C   . PHE A 1 98  ? -2.881  25.678 0.517   1.00 20.69  ? 116 PHE A C   1 
ATOM   689  O  O   . PHE A 1 98  ? -1.778  25.561 0.030   1.00 22.58  ? 116 PHE A O   1 
ATOM   690  C  CB  . PHE A 1 98  ? -3.642  27.775 1.726   1.00 20.30  ? 116 PHE A CB  1 
ATOM   691  C  CG  . PHE A 1 98  ? -2.318  27.807 2.426   1.00 20.16  ? 116 PHE A CG  1 
ATOM   692  C  CD1 . PHE A 1 98  ? -1.379  28.817 2.121   1.00 22.16  ? 116 PHE A CD1 1 
ATOM   693  C  CD2 . PHE A 1 98  ? -1.998  26.858 3.409   1.00 19.30  ? 116 PHE A CD2 1 
ATOM   694  C  CE1 . PHE A 1 98  ? -0.142  28.833 2.770   1.00 22.99  ? 116 PHE A CE1 1 
ATOM   695  C  CE2 . PHE A 1 98  ? -0.781  26.911 4.091   1.00 19.98  ? 116 PHE A CE2 1 
ATOM   696  C  CZ  . PHE A 1 98  ? 0.146   27.891 3.768   1.00 20.39  ? 116 PHE A CZ  1 
ATOM   697  N  N   . ILE A 1 99  ? -3.451  24.679 1.193   1.00 21.39  ? 117 ILE A N   1 
ATOM   698  C  CA  . ILE A 1 99  ? -2.763  23.396 1.410   1.00 18.30  ? 117 ILE A CA  1 
ATOM   699  C  C   . ILE A 1 99  ? -2.580  22.669 0.049   1.00 20.77  ? 117 ILE A C   1 
ATOM   700  O  O   . ILE A 1 99  ? -1.464  22.222 -0.282  1.00 21.09  ? 117 ILE A O   1 
ATOM   701  C  CB  . ILE A 1 99  ? -3.547  22.496 2.348   1.00 16.99  ? 117 ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 99  ? -3.625  23.125 3.745   1.00 17.35  ? 117 ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 99  ? -2.865  21.080 2.438   1.00 16.88  ? 117 ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 99  ? -4.889  22.752 4.525   1.00 17.18  ? 117 ILE A CD1 1 
ATOM   705  N  N   . LEU A 1 100 ? -3.665  22.567 -0.742  1.00 20.10  ? 118 LEU A N   1 
ATOM   706  C  CA  . LEU A 1 100 ? -3.609  21.812 -2.019  1.00 18.90  ? 118 LEU A CA  1 
ATOM   707  C  C   . LEU A 1 100 ? -2.611  22.417 -2.975  1.00 18.04  ? 118 LEU A C   1 
ATOM   708  O  O   . LEU A 1 100 ? -1.852  21.735 -3.547  1.00 18.32  ? 118 LEU A O   1 
ATOM   709  C  CB  . LEU A 1 100 ? -4.990  21.810 -2.705  1.00 21.05  ? 118 LEU A CB  1 
ATOM   710  C  CG  . LEU A 1 100 ? -5.317  20.881 -3.890  1.00 18.50  ? 118 LEU A CG  1 
ATOM   711  C  CD1 . LEU A 1 100 ? -5.004  19.456 -3.521  1.00 15.01  ? 118 LEU A CD1 1 
ATOM   712  C  CD2 . LEU A 1 100 ? -6.770  21.019 -4.332  1.00 18.61  ? 118 LEU A CD2 1 
ATOM   713  N  N   . ARG A 1 101 ? -2.631  23.724 -3.156  1.00 18.98  ? 119 ARG A N   1 
ATOM   714  C  CA  . ARG A 1 101 ? -1.680  24.412 -4.061  1.00 18.86  ? 119 ARG A CA  1 
ATOM   715  C  C   . ARG A 1 101 ? -0.266  24.360 -3.560  1.00 20.54  ? 119 ARG A C   1 
ATOM   716  O  O   . ARG A 1 101 ? 0.626   24.319 -4.375  1.00 19.92  ? 119 ARG A O   1 
ATOM   717  C  CB  . ARG A 1 101 ? -2.103  25.891 -4.302  1.00 15.97  ? 119 ARG A CB  1 
ATOM   718  C  CG  . ARG A 1 101 ? -3.422  25.946 -5.095  1.00 17.12  ? 119 ARG A CG  1 
ATOM   719  C  CD  . ARG A 1 101 ? -4.181  27.275 -4.977  1.00 15.55  ? 119 ARG A CD  1 
ATOM   720  N  NE  . ARG A 1 101 ? -3.284  28.403 -5.105  1.00 15.35  ? 119 ARG A NE  1 
ATOM   721  C  CZ  . ARG A 1 101 ? -2.958  29.027 -6.239  1.00 17.92  ? 119 ARG A CZ  1 
ATOM   722  N  NH1 . ARG A 1 101 ? -3.477  28.661 -7.426  1.00 19.22  ? 119 ARG A NH1 1 
ATOM   723  N  NH2 . ARG A 1 101 ? -2.140  30.066 -6.183  1.00 19.06  ? 119 ARG A NH2 1 
ATOM   724  N  N   . LEU A 1 102 ? -0.043  24.436 -2.231  1.00 19.25  ? 120 LEU A N   1 
ATOM   725  C  CA  . LEU A 1 102 ? 1.341   24.400 -1.729  1.00 20.13  ? 120 LEU A CA  1 
ATOM   726  C  C   . LEU A 1 102 ? 1.974   23.013 -1.913  1.00 21.36  ? 120 LEU A C   1 
ATOM   727  O  O   . LEU A 1 102 ? 3.172   22.878 -2.210  1.00 21.60  ? 120 LEU A O   1 
ATOM   728  C  CB  . LEU A 1 102 ? 1.374   24.738 -0.224  1.00 20.28  ? 120 LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 102 ? 2.673   24.829 0.553   1.00 19.72  ? 120 LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 102 ? 3.604   25.898 -0.037  1.00 18.77  ? 120 LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 102 ? 2.370   25.130 2.043   1.00 19.67  ? 120 LEU A CD2 1 
ATOM   732  N  N   . ALA A 1 103 ? 1.192   21.989 -1.614  1.00 20.95  ? 121 ALA A N   1 
ATOM   733  C  CA  . ALA A 1 103 ? 1.628   20.635 -1.724  1.00 20.48  ? 121 ALA A CA  1 
ATOM   734  C  C   . ALA A 1 103 ? 1.903   20.362 -3.248  1.00 24.82  ? 121 ALA A C   1 
ATOM   735  O  O   . ALA A 1 103 ? 2.845   19.609 -3.623  1.00 22.34  ? 121 ALA A O   1 
ATOM   736  C  CB  . ALA A 1 103 ? 0.524   19.712 -1.205  1.00 18.36  ? 121 ALA A CB  1 
ATOM   737  N  N   . TYR A 1 104 ? 1.080   20.951 -4.129  1.00 25.22  ? 122 TYR A N   1 
ATOM   738  C  CA  . TYR A 1 104 ? 1.192   20.597 -5.541  1.00 23.68  ? 122 TYR A CA  1 
ATOM   739  C  C   . TYR A 1 104 ? 2.465   21.184 -6.063  1.00 24.52  ? 122 TYR A C   1 
ATOM   740  O  O   . TYR A 1 104 ? 3.120   20.499 -6.750  1.00 26.69  ? 122 TYR A O   1 
ATOM   741  C  CB  . TYR A 1 104 ? -0.021  21.005 -6.386  1.00 25.74  ? 122 TYR A CB  1 
ATOM   742  C  CG  . TYR A 1 104 ? -0.046  20.502 -7.861  1.00 24.35  ? 122 TYR A CG  1 
ATOM   743  C  CD1 . TYR A 1 104 ? -0.045  19.110 -8.164  1.00 25.15  ? 122 TYR A CD1 1 
ATOM   744  C  CD2 . TYR A 1 104 ? -0.113  21.415 -8.941  1.00 23.32  ? 122 TYR A CD2 1 
ATOM   745  C  CE1 . TYR A 1 104 ? -0.104  18.660 -9.483  1.00 22.96  ? 122 TYR A CE1 1 
ATOM   746  C  CE2 . TYR A 1 104 ? -0.192  20.978 -10.267 1.00 21.89  ? 122 TYR A CE2 1 
ATOM   747  C  CZ  . TYR A 1 104 ? -0.181  19.597 -10.533 1.00 24.12  ? 122 TYR A CZ  1 
ATOM   748  O  OH  . TYR A 1 104 ? -0.215  19.110 -11.846 1.00 24.25  ? 122 TYR A OH  1 
ATOM   749  N  N   . ARG A 1 105 ? 2.865   22.407 -5.698  1.00 26.53  ? 123 ARG A N   1 
ATOM   750  C  CA  . ARG A 1 105 ? 4.145   22.953 -6.237  1.00 26.93  ? 123 ARG A CA  1 
ATOM   751  C  C   . ARG A 1 105 ? 5.447   22.679 -5.455  1.00 25.29  ? 123 ARG A C   1 
ATOM   752  O  O   . ARG A 1 105 ? 6.552   22.897 -5.966  1.00 25.22  ? 123 ARG A O   1 
ATOM   753  C  CB  . ARG A 1 105 ? 4.057   24.444 -6.549  1.00 26.85  ? 123 ARG A CB  1 
ATOM   754  C  CG  . ARG A 1 105 ? 3.757   25.291 -5.376  1.00 27.43  ? 123 ARG A CG  1 
ATOM   755  C  CD  . ARG A 1 105 ? 3.915   26.778 -5.761  1.00 25.95  ? 123 ARG A CD  1 
ATOM   756  N  NE  . ARG A 1 105 ? 2.601   27.405 -5.800  1.00 24.71  ? 123 ARG A NE  1 
ATOM   757  C  CZ  . ARG A 1 105 ? 1.848   27.617 -4.714  1.00 24.84  ? 123 ARG A CZ  1 
ATOM   758  N  NH1 . ARG A 1 105 ? 2.323   27.291 -3.500  1.00 19.17  ? 123 ARG A NH1 1 
ATOM   759  N  NH2 . ARG A 1 105 ? 0.630   28.189 -4.835  1.00 22.80  ? 123 ARG A NH2 1 
ATOM   760  N  N   . SER A 1 106 ? 5.322   22.176 -4.241  1.00 24.97  ? 124 SER A N   1 
ATOM   761  C  CA  . SER A 1 106 ? 6.474   21.862 -3.405  1.00 24.72  ? 124 SER A CA  1 
ATOM   762  C  C   . SER A 1 106 ? 7.317   20.680 -3.885  1.00 25.35  ? 124 SER A C   1 
ATOM   763  O  O   . SER A 1 106 ? 6.953   19.920 -4.811  1.00 26.94  ? 124 SER A O   1 
ATOM   764  C  CB  . SER A 1 106 ? 6.045   21.666 -1.936  1.00 27.07  ? 124 SER A CB  1 
ATOM   765  O  OG  . SER A 1 106 ? 5.622   22.931 -1.374  1.00 28.48  ? 124 SER A OG  1 
ATOM   766  N  N   . LYS A 1 107 ? 8.460   20.553 -3.243  1.00 22.05  ? 125 LYS A N   1 
ATOM   767  C  CA  . LYS A 1 107 ? 9.467   19.610 -3.627  1.00 23.97  ? 125 LYS A CA  1 
ATOM   768  C  C   . LYS A 1 107 ? 9.819   18.813 -2.367  1.00 22.18  ? 125 LYS A C   1 
ATOM   769  O  O   . LYS A 1 107 ? 10.781  19.133 -1.680  1.00 22.07  ? 125 LYS A O   1 
ATOM   770  C  CB  . LYS A 1 107 ? 10.684  20.359 -4.206  1.00 27.44  ? 125 LYS A CB  1 
ATOM   771  C  CG  . LYS A 1 107 ? 10.481  20.998 -5.600  1.00 29.31  ? 125 LYS A CG  1 
ATOM   772  C  CD  . LYS A 1 107 ? 9.592   20.118 -6.491  1.00 32.93  ? 125 LYS A CD  1 
ATOM   773  C  CE  . LYS A 1 107 ? 8.852   20.956 -7.536  1.00 41.85  ? 125 LYS A CE  1 
ATOM   774  N  NZ  . LYS A 1 107 ? 7.382   20.651 -7.589  1.00 43.23  ? 125 LYS A NZ  1 
ATOM   775  N  N   . PRO A 1 108 ? 8.997   17.793 -2.046  1.00 20.73  ? 126 PRO A N   1 
ATOM   776  C  CA  . PRO A 1 108 ? 9.217   17.134 -0.799  1.00 21.65  ? 126 PRO A CA  1 
ATOM   777  C  C   . PRO A 1 108 ? 10.464  16.269 -0.755  1.00 23.07  ? 126 PRO A C   1 
ATOM   778  O  O   . PRO A 1 108 ? 10.942  16.025 0.350   1.00 23.48  ? 126 PRO A O   1 
ATOM   779  C  CB  . PRO A 1 108 ? 7.959   16.268 -0.611  1.00 20.80  ? 126 PRO A CB  1 
ATOM   780  C  CG  . PRO A 1 108 ? 7.326   16.127 -1.941  1.00 19.46  ? 126 PRO A CG  1 
ATOM   781  C  CD  . PRO A 1 108 ? 7.740   17.360 -2.694  1.00 20.60  ? 126 PRO A CD  1 
ATOM   782  N  N   . GLY A 1 109 ? 10.949  15.807 -1.921  1.00 21.41  ? 127 GLY A N   1 
ATOM   783  C  CA  . GLY A 1 109 ? 12.194  15.053 -2.067  1.00 21.74  ? 127 GLY A CA  1 
ATOM   784  C  C   . GLY A 1 109 ? 13.395  15.924 -1.681  1.00 24.16  ? 127 GLY A C   1 
ATOM   785  O  O   . GLY A 1 109 ? 14.497  15.419 -1.453  1.00 25.11  ? 127 GLY A O   1 
ATOM   786  N  N   . GLU A 1 110 ? 13.199  17.236 -1.597  1.00 21.79  ? 128 GLU A N   1 
ATOM   787  C  CA  . GLU A 1 110 ? 14.243  18.090 -1.142  1.00 23.03  ? 128 GLU A CA  1 
ATOM   788  C  C   . GLU A 1 110 ? 13.912  18.913 0.130   1.00 23.21  ? 128 GLU A C   1 
ATOM   789  O  O   . GLU A 1 110 ? 14.665  19.841 0.471   1.00 22.61  ? 128 GLU A O   1 
ATOM   790  C  CB  . GLU A 1 110 ? 14.630  19.056 -2.242  1.00 24.68  ? 128 GLU A CB  1 
ATOM   791  C  CG  . GLU A 1 110 ? 15.175  18.418 -3.502  1.00 28.16  ? 128 GLU A CG  1 
ATOM   792  C  CD  . GLU A 1 110 ? 15.386  19.519 -4.519  1.00 32.34  ? 128 GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1 110 ? 16.380  20.280 -4.364  1.00 33.16  ? 128 GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1 110 ? 14.513  19.661 -5.404  1.00 34.50  ? 128 GLU A OE2 1 
ATOM   795  N  N   . GLY A 1 111 ? 12.818  18.593 0.798   1.00 22.98  ? 129 GLY A N   1 
ATOM   796  C  CA  . GLY A 1 111 ? 12.334  19.376 1.965   1.00 24.13  ? 129 GLY A CA  1 
ATOM   797  C  C   . GLY A 1 111 ? 11.999  20.817 1.693   1.00 24.11  ? 129 GLY A C   1 
ATOM   798  O  O   . GLY A 1 111 ? 12.109  21.685 2.579   1.00 26.83  ? 129 GLY A O   1 
ATOM   799  N  N   . LYS A 1 112 ? 11.589  21.073 0.469   1.00 23.61  ? 130 LYS A N   1 
ATOM   800  C  CA  . LYS A 1 112 ? 11.331  22.424 -0.012  1.00 24.69  ? 130 LYS A CA  1 
ATOM   801  C  C   . LYS A 1 112 ? 9.839   22.775 -0.152  1.00 23.13  ? 130 LYS A C   1 
ATOM   802  O  O   . LYS A 1 112 ? 9.089   22.125 -0.929  1.00 21.31  ? 130 LYS A O   1 
ATOM   803  C  CB  . LYS A 1 112 ? 11.965  22.578 -1.390  1.00 25.81  ? 130 LYS A CB  1 
ATOM   804  C  CG  . LYS A 1 112 ? 13.445  22.832 -1.405  1.00 26.67  ? 130 LYS A CG  1 
ATOM   805  C  CD  . LYS A 1 112 ? 13.860  23.121 -2.833  1.00 24.37  ? 130 LYS A CD  1 
ATOM   806  C  CE  . LYS A 1 112 ? 15.284  23.612 -2.811  1.00 28.94  ? 130 LYS A CE  1 
ATOM   807  N  NZ  . LYS A 1 112 ? 16.024  23.252 -4.063  1.00 32.69  ? 130 LYS A NZ  1 
ATOM   808  N  N   . LEU A 1 113 ? 9.442   23.829 0.561   1.00 22.38  ? 131 LEU A N   1 
ATOM   809  C  CA  . LEU A 1 113 ? 8.120   24.414 0.477   1.00 21.28  ? 131 LEU A CA  1 
ATOM   810  C  C   . LEU A 1 113 ? 8.278   25.579 -0.441  1.00 23.73  ? 131 LEU A C   1 
ATOM   811  O  O   . LEU A 1 113 ? 9.233   26.352 -0.320  1.00 22.96  ? 131 LEU A O   1 
ATOM   812  C  CB  . LEU A 1 113 ? 7.626   24.918 1.845   1.00 21.11  ? 131 LEU A CB  1 
ATOM   813  C  CG  . LEU A 1 113 ? 7.061   23.797 2.761   1.00 21.33  ? 131 LEU A CG  1 
ATOM   814  C  CD1 . LEU A 1 113 ? 5.883   22.998 2.123   1.00 19.93  ? 131 LEU A CD1 1 
ATOM   815  C  CD2 . LEU A 1 113 ? 8.175   22.873 3.233   1.00 17.76  ? 131 LEU A CD2 1 
ATOM   816  N  N   . ILE A 1 114 ? 7.324   25.734 -1.347  1.00 22.25  ? 132 ILE A N   1 
ATOM   817  C  CA  . ILE A 1 114 ? 7.420   26.787 -2.336  1.00 23.33  ? 132 ILE A CA  1 
ATOM   818  C  C   . ILE A 1 114 ? 6.089   27.486 -2.374  1.00 21.86  ? 132 ILE A C   1 
ATOM   819  O  O   . ILE A 1 114 ? 5.084   26.890 -2.707  1.00 22.73  ? 132 ILE A O   1 
ATOM   820  C  CB  . ILE A 1 114 ? 7.680   26.211 -3.736  1.00 22.56  ? 132 ILE A CB  1 
ATOM   821  C  CG1 . ILE A 1 114 ? 8.913   25.297 -3.670  1.00 20.99  ? 132 ILE A CG1 1 
ATOM   822  C  CG2 . ILE A 1 114 ? 7.749   27.363 -4.756  1.00 19.99  ? 132 ILE A CG2 1 
ATOM   823  C  CD1 . ILE A 1 114 ? 9.289   24.640 -5.006  1.00 21.05  ? 132 ILE A CD1 1 
ATOM   824  N  N   . PHE A 1 115 ? 6.093   28.719 -1.952  1.00 21.22  ? 133 PHE A N   1 
ATOM   825  C  CA  . PHE A 1 115 ? 4.902   29.440 -1.755  1.00 25.20  ? 133 PHE A CA  1 
ATOM   826  C  C   . PHE A 1 115 ? 4.503   30.170 -3.054  1.00 28.63  ? 133 PHE A C   1 
ATOM   827  O  O   . PHE A 1 115 ? 5.245   30.137 -4.035  1.00 24.32  ? 133 PHE A O   1 
ATOM   828  C  CB  . PHE A 1 115 ? 5.114   30.336 -0.542  1.00 24.56  ? 133 PHE A CB  1 
ATOM   829  C  CG  . PHE A 1 115 ? 5.335   29.544 0.731   1.00 25.89  ? 133 PHE A CG  1 
ATOM   830  C  CD1 . PHE A 1 115 ? 6.620   29.164 1.128   1.00 25.18  ? 133 PHE A CD1 1 
ATOM   831  C  CD2 . PHE A 1 115 ? 4.261   29.166 1.529   1.00 24.93  ? 133 PHE A CD2 1 
ATOM   832  C  CE1 . PHE A 1 115 ? 6.814   28.427 2.304   1.00 25.02  ? 133 PHE A CE1 1 
ATOM   833  C  CE2 . PHE A 1 115 ? 4.455   28.430 2.691   1.00 24.66  ? 133 PHE A CE2 1 
ATOM   834  C  CZ  . PHE A 1 115 ? 5.740   28.044 3.075   1.00 24.07  ? 133 PHE A CZ  1 
ATOM   835  N  N   . CYS A 1 116 ? 3.318   30.780 -3.074  1.00 31.09  ? 134 CYS A N   1 
ATOM   836  C  CA  . CYS A 1 116 ? 2.791   31.298 -4.348  1.00 29.98  ? 134 CYS A CA  1 
ATOM   837  C  C   . CYS A 1 116 ? 3.629   32.466 -4.853  1.00 30.79  ? 134 CYS A C   1 
ATOM   838  O  O   . CYS A 1 116 ? 3.790   32.636 -6.054  1.00 32.48  ? 134 CYS A O   1 
ATOM   839  C  CB  . CYS A 1 116 ? 1.334   31.715 -4.214  1.00 26.97  ? 134 CYS A CB  1 
ATOM   840  S  SG  . CYS A 1 116 ? 1.002   32.867 -2.866  1.00 29.54  ? 134 CYS A SG  1 
ATOM   841  N  N   . SER A 1 117 ? 4.191   33.238 -3.924  1.00 30.69  ? 135 SER A N   1 
ATOM   842  C  CA  . SER A 1 117 ? 4.995   34.420 -4.230  1.00 29.89  ? 135 SER A CA  1 
ATOM   843  C  C   . SER A 1 117 ? 6.296   34.098 -4.921  1.00 32.63  ? 135 SER A C   1 
ATOM   844  O  O   . SER A 1 117 ? 6.930   34.969 -5.513  1.00 36.37  ? 135 SER A O   1 
ATOM   845  C  CB  . SER A 1 117 ? 5.335   35.144 -2.931  1.00 28.59  ? 135 SER A CB  1 
ATOM   846  O  OG  . SER A 1 117 ? 6.223   34.352 -2.144  1.00 25.99  ? 135 SER A OG  1 
ATOM   847  N  N   . GLY A 1 118 ? 6.732   32.858 -4.772  1.00 34.35  ? 136 GLY A N   1 
ATOM   848  C  CA  . GLY A 1 118 ? 7.993   32.398 -5.328  1.00 31.61  ? 136 GLY A CA  1 
ATOM   849  C  C   . GLY A 1 118 ? 8.942   32.023 -4.207  1.00 29.28  ? 136 GLY A C   1 
ATOM   850  O  O   . GLY A 1 118 ? 9.894   31.305 -4.446  1.00 31.51  ? 136 GLY A O   1 
ATOM   851  N  N   . LEU A 1 119 ? 8.657   32.480 -2.981  1.00 29.94  ? 137 LEU A N   1 
ATOM   852  C  CA  . LEU A 1 119 ? 9.478   32.169 -1.785  1.00 28.28  ? 137 LEU A CA  1 
ATOM   853  C  C   . LEU A 1 119 ? 9.666   30.656 -1.564  1.00 28.82  ? 137 LEU A C   1 
ATOM   854  O  O   . LEU A 1 119 ? 8.682   29.913 -1.495  1.00 29.17  ? 137 LEU A O   1 
ATOM   855  C  CB  . LEU A 1 119 ? 8.853   32.795 -0.544  1.00 26.71  ? 137 LEU A CB  1 
ATOM   856  C  CG  . LEU A 1 119 ? 9.720   32.810 0.724   1.00 27.11  ? 137 LEU A CG  1 
ATOM   857  C  CD1 . LEU A 1 119 ? 10.933  33.743 0.558   1.00 29.37  ? 137 LEU A CD1 1 
ATOM   858  C  CD2 . LEU A 1 119 ? 8.897   33.209 1.943   1.00 26.86  ? 137 LEU A CD2 1 
ATOM   859  N  N   . VAL A 1 120 ? 10.933  30.226 -1.515  1.00 25.00  ? 138 VAL A N   1 
ATOM   860  C  CA  . VAL A 1 120 ? 11.319  28.892 -1.214  1.00 23.43  ? 138 VAL A CA  1 
ATOM   861  C  C   . VAL A 1 120 ? 11.880  28.903 0.198   1.00 23.27  ? 138 VAL A C   1 
ATOM   862  O  O   . VAL A 1 120 ? 12.743  29.712 0.554   1.00 19.62  ? 138 VAL A O   1 
ATOM   863  C  CB  . VAL A 1 120 ? 12.417  28.345 -2.175  1.00 26.39  ? 138 VAL A CB  1 
ATOM   864  C  CG1 . VAL A 1 120 ? 12.717  26.874 -1.891  1.00 24.81  ? 138 VAL A CG1 1 
ATOM   865  C  CG2 . VAL A 1 120 ? 12.030  28.509 -3.639  1.00 28.45  ? 138 VAL A CG2 1 
ATOM   866  N  N   . LEU A 1 121 ? 11.408  27.941 0.975   1.00 23.65  ? 139 LEU A N   1 
ATOM   867  C  CA  . LEU A 1 121 ? 11.781  27.789 2.391   1.00 24.77  ? 139 LEU A CA  1 
ATOM   868  C  C   . LEU A 1 121 ? 12.006  26.292 2.682   1.00 22.04  ? 139 LEU A C   1 
ATOM   869  O  O   . LEU A 1 121 ? 11.355  25.449 2.081   1.00 23.27  ? 139 LEU A O   1 
ATOM   870  C  CB  . LEU A 1 121 ? 10.632  28.341 3.238   1.00 25.91  ? 139 LEU A CB  1 
ATOM   871  C  CG  . LEU A 1 121 ? 10.821  29.607 4.077   1.00 26.28  ? 139 LEU A CG  1 
ATOM   872  C  CD1 . LEU A 1 121 ? 11.833  30.648 3.577   1.00 20.76  ? 139 LEU A CD1 1 
ATOM   873  C  CD2 . LEU A 1 121 ? 9.448   30.158 4.487   1.00 25.35  ? 139 LEU A CD2 1 
ATOM   874  N  N   . HIS A 1 122 ? 12.921  25.945 3.575   1.00 20.41  ? 140 HIS A N   1 
ATOM   875  C  CA  . HIS A 1 122 ? 13.150  24.528 3.881   1.00 21.11  ? 140 HIS A CA  1 
ATOM   876  C  C   . HIS A 1 122 ? 12.228  24.186 4.989   1.00 21.40  ? 140 HIS A C   1 
ATOM   877  O  O   . HIS A 1 122 ? 11.888  25.037 5.763   1.00 20.83  ? 140 HIS A O   1 
ATOM   878  C  CB  . HIS A 1 122 ? 14.595  24.255 4.313   1.00 18.91  ? 140 HIS A CB  1 
ATOM   879  C  CG  . HIS A 1 122 ? 14.921  22.786 4.506   1.00 19.17  ? 140 HIS A CG  1 
ATOM   880  N  ND1 . HIS A 1 122 ? 15.440  21.991 3.495   1.00 21.08  ? 140 HIS A ND1 1 
ATOM   881  C  CD2 . HIS A 1 122 ? 14.858  21.991 5.618   1.00 18.01  ? 140 HIS A CD2 1 
ATOM   882  C  CE1 . HIS A 1 122 ? 15.625  20.752 3.963   1.00 22.29  ? 140 HIS A CE1 1 
ATOM   883  N  NE2 . HIS A 1 122 ? 15.296  20.750 5.261   1.00 21.21  ? 140 HIS A NE2 1 
ATOM   884  N  N   . ARG A 1 123 ? 11.780  22.935 5.018   1.00 21.93  ? 141 ARG A N   1 
ATOM   885  C  CA  . ARG A 1 123 ? 10.979  22.369 6.100   1.00 22.51  ? 141 ARG A CA  1 
ATOM   886  C  C   . ARG A 1 123 ? 11.488  22.845 7.488   1.00 22.48  ? 141 ARG A C   1 
ATOM   887  O  O   . ARG A 1 123 ? 10.675  23.322 8.291   1.00 22.59  ? 141 ARG A O   1 
ATOM   888  C  CB  . ARG A 1 123 ? 11.015  20.829 5.929   1.00 24.86  ? 141 ARG A CB  1 
ATOM   889  C  CG  . ARG A 1 123 ? 10.209  19.972 6.888   1.00 25.29  ? 141 ARG A CG  1 
ATOM   890  C  CD  . ARG A 1 123 ? 10.944  18.614 7.051   1.00 28.32  ? 141 ARG A CD  1 
ATOM   891  N  NE  . ARG A 1 123 ? 10.889  18.290 8.460   1.00 36.39  ? 141 ARG A NE  1 
ATOM   892  C  CZ  . ARG A 1 123 ? 11.897  18.010 9.266   1.00 35.85  ? 141 ARG A CZ  1 
ATOM   893  N  NH1 . ARG A 1 123 ? 13.161  17.847 8.865   1.00 33.29  ? 141 ARG A NH1 1 
ATOM   894  N  NH2 . ARG A 1 123 ? 11.594  17.819 10.517  1.00 41.31  ? 141 ARG A NH2 1 
ATOM   895  N  N   . LEU A 1 124 ? 12.819  22.795 7.725   1.00 20.22  ? 142 LEU A N   1 
ATOM   896  C  CA  . LEU A 1 124 ? 13.429  23.268 8.975   1.00 18.70  ? 142 LEU A CA  1 
ATOM   897  C  C   . LEU A 1 124 ? 13.130  24.721 9.303   1.00 20.68  ? 142 LEU A C   1 
ATOM   898  O  O   . LEU A 1 124 ? 12.989  25.060 10.445  1.00 22.94  ? 142 LEU A O   1 
ATOM   899  C  CB  . LEU A 1 124 ? 14.962  22.992 9.041   1.00 16.26  ? 142 LEU A CB  1 
ATOM   900  C  CG  . LEU A 1 124 ? 15.274  21.497 9.123   1.00 17.06  ? 142 LEU A CG  1 
ATOM   901  C  CD1 . LEU A 1 124 ? 16.699  21.161 8.748   1.00 16.13  ? 142 LEU A CD1 1 
ATOM   902  C  CD2 . LEU A 1 124 ? 14.888  20.953 10.494  1.00 17.17  ? 142 LEU A CD2 1 
ATOM   903  N  N   . GLN A 1 125 ? 13.087  25.565 8.281   1.00 21.31  ? 143 GLN A N   1 
ATOM   904  C  CA  . GLN A 1 125 ? 12.733  26.972 8.376   1.00 22.21  ? 143 GLN A CA  1 
ATOM   905  C  C   . GLN A 1 125 ? 11.257  27.199 8.673   1.00 23.91  ? 143 GLN A C   1 
ATOM   906  O  O   . GLN A 1 125 ? 10.903  28.257 9.176   1.00 22.36  ? 143 GLN A O   1 
ATOM   907  C  CB  . GLN A 1 125 ? 13.149  27.727 7.087   1.00 22.05  ? 143 GLN A CB  1 
ATOM   908  C  CG  . GLN A 1 125 ? 14.579  27.471 6.596   1.00 20.17  ? 143 GLN A CG  1 
ATOM   909  C  CD  . GLN A 1 125 ? 14.943  28.361 5.449   1.00 21.99  ? 143 GLN A CD  1 
ATOM   910  O  OE1 . GLN A 1 125 ? 14.838  27.999 4.290   1.00 21.76  ? 143 GLN A OE1 1 
ATOM   911  N  NE2 . GLN A 1 125 ? 15.306  29.580 5.769   1.00 25.07  ? 143 GLN A NE2 1 
ATOM   912  N  N   . CYS A 1 126 ? 10.412  26.194 8.415   1.00 24.13  ? 144 CYS A N   1 
ATOM   913  C  CA  . CYS A 1 126 ? 8.937   26.348 8.626   1.00 26.11  ? 144 CYS A CA  1 
ATOM   914  C  C   . CYS A 1 126 ? 8.496   25.757 9.958   1.00 24.51  ? 144 CYS A C   1 
ATOM   915  O  O   . CYS A 1 126 ? 7.416   26.082 10.458  1.00 23.86  ? 144 CYS A O   1 
ATOM   916  C  CB  . CYS A 1 126 ? 8.093   25.734 7.487   1.00 21.74  ? 144 CYS A CB  1 
ATOM   917  S  SG  . CYS A 1 126 ? 8.472   26.435 5.869   1.00 26.01  ? 144 CYS A SG  1 
ATOM   918  N  N   . ALA A 1 127 ? 9.348   24.910 10.507  1.00 22.13  ? 145 ALA A N   1 
ATOM   919  C  CA  . ALA A 1 127 ? 9.145   24.247 11.780  1.00 24.42  ? 145 ALA A CA  1 
ATOM   920  C  C   . ALA A 1 127 ? 8.601   25.203 12.838  1.00 23.67  ? 145 ALA A C   1 
ATOM   921  O  O   . ALA A 1 127 ? 7.614   24.920 13.471  1.00 24.70  ? 145 ALA A O   1 
ATOM   922  C  CB  . ALA A 1 127 ? 10.465  23.645 12.249  1.00 24.74  ? 145 ALA A CB  1 
ATOM   923  N  N   . ARG A 1 128 ? 9.213   26.355 12.993  1.00 24.95  ? 146 ARG A N   1 
ATOM   924  C  CA  . ARG A 1 128 ? 8.857   27.221 14.126  1.00 28.76  ? 146 ARG A CA  1 
ATOM   925  C  C   . ARG A 1 128 ? 7.503   27.932 13.999  1.00 29.44  ? 146 ARG A C   1 
ATOM   926  O  O   . ARG A 1 128 ? 6.727   27.941 14.974  1.00 29.54  ? 146 ARG A O   1 
ATOM   927  C  CB  . ARG A 1 128 ? 9.999   28.176 14.484  1.00 31.61  ? 146 ARG A CB  1 
ATOM   928  C  CG  . ARG A 1 128 ? 11.025  27.489 15.403  1.00 32.86  ? 146 ARG A CG  1 
ATOM   929  C  CD  . ARG A 1 128 ? 12.329  28.282 15.580  1.00 34.93  ? 146 ARG A CD  1 
ATOM   930  N  NE  . ARG A 1 128 ? 12.201  29.588 16.251  1.00 41.98  ? 146 ARG A NE  1 
ATOM   931  C  CZ  . ARG A 1 128 ? 12.061  29.776 17.568  1.00 43.65  ? 146 ARG A CZ  1 
ATOM   932  N  NH1 . ARG A 1 128 ? 11.989  28.753 18.421  1.00 40.17  ? 146 ARG A NH1 1 
ATOM   933  N  NH2 . ARG A 1 128 ? 11.944  31.005 18.026  1.00 44.88  ? 146 ARG A NH2 1 
ATOM   934  N  N   . GLY A 1 129 ? 7.208   28.487 12.818  1.00 24.54  ? 147 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 129 ? 5.895   29.072 12.556  1.00 24.11  ? 147 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 129 ? 4.724   28.089 12.501  1.00 23.20  ? 147 GLY A C   1 
ATOM   937  O  O   . GLY A 1 129 ? 3.648   28.297 13.092  1.00 22.71  ? 147 GLY A O   1 
ATOM   938  N  N   . PHE A 1 130 ? 4.925   27.004 11.781  1.00 24.79  ? 148 PHE A N   1 
ATOM   939  C  CA  . PHE A 1 130 ? 3.824   26.180 11.275  1.00 21.54  ? 148 PHE A CA  1 
ATOM   940  C  C   . PHE A 1 130 ? 3.622   24.991 12.192  1.00 23.23  ? 148 PHE A C   1 
ATOM   941  O  O   . PHE A 1 130 ? 2.524   24.411 12.194  1.00 21.99  ? 148 PHE A O   1 
ATOM   942  C  CB  . PHE A 1 130 ? 4.223   25.673 9.889   1.00 23.24  ? 148 PHE A CB  1 
ATOM   943  C  CG  . PHE A 1 130 ? 4.081   26.696 8.783   1.00 22.21  ? 148 PHE A CG  1 
ATOM   944  C  CD1 . PHE A 1 130 ? 5.030   27.679 8.591   1.00 23.50  ? 148 PHE A CD1 1 
ATOM   945  C  CD2 . PHE A 1 130 ? 2.976   26.665 7.936   1.00 22.92  ? 148 PHE A CD2 1 
ATOM   946  C  CE1 . PHE A 1 130 ? 4.884   28.613 7.573   1.00 25.00  ? 148 PHE A CE1 1 
ATOM   947  C  CE2 . PHE A 1 130 ? 2.827   27.606 6.935   1.00 20.98  ? 148 PHE A CE2 1 
ATOM   948  C  CZ  . PHE A 1 130 ? 3.758   28.578 6.760   1.00 21.72  ? 148 PHE A CZ  1 
ATOM   949  N  N   . GLY A 1 131 ? 4.699   24.640 12.951  1.00 23.00  ? 149 GLY A N   1 
ATOM   950  C  CA  . GLY A 1 131 ? 4.768   23.441 13.784  1.00 23.29  ? 149 GLY A CA  1 
ATOM   951  C  C   . GLY A 1 131 ? 4.760   22.191 12.935  1.00 26.89  ? 149 GLY A C   1 
ATOM   952  O  O   . GLY A 1 131 ? 5.271   22.173 11.792  1.00 31.55  ? 149 GLY A O   1 
ATOM   953  N  N   . ASP A 1 132 ? 4.109   21.163 13.448  1.00 25.91  ? 150 ASP A N   1 
ATOM   954  C  CA  . ASP A 1 132 ? 4.051   19.853 12.775  1.00 28.94  ? 150 ASP A CA  1 
ATOM   955  C  C   . ASP A 1 132 ? 3.376   19.915 11.408  1.00 24.57  ? 150 ASP A C   1 
ATOM   956  O  O   . ASP A 1 132 ? 3.715   19.158 10.518  1.00 23.63  ? 150 ASP A O   1 
ATOM   957  C  CB  . ASP A 1 132 ? 3.260   18.839 13.651  1.00 37.13  ? 150 ASP A CB  1 
ATOM   958  C  CG  . ASP A 1 132 ? 3.765   18.756 15.095  1.00 49.04  ? 150 ASP A CG  1 
ATOM   959  O  OD1 . ASP A 1 132 ? 3.966   17.618 15.566  1.00 58.20  ? 150 ASP A OD1 1 
ATOM   960  O  OD2 . ASP A 1 132 ? 3.951   19.797 15.778  1.00 55.33  ? 150 ASP A OD2 1 
ATOM   961  N  N   . TRP A 1 133 ? 2.395   20.808 11.290  1.00 22.50  ? 151 TRP A N   1 
ATOM   962  C  CA  . TRP A 1 133 ? 1.525   20.991 10.129  1.00 22.85  ? 151 TRP A CA  1 
ATOM   963  C  C   . TRP A 1 133 ? 2.272   20.949 8.808   1.00 23.95  ? 151 TRP A C   1 
ATOM   964  O  O   . TRP A 1 133 ? 1.830   20.304 7.820   1.00 22.70  ? 151 TRP A O   1 
ATOM   965  C  CB  . TRP A 1 133 ? 0.726   22.309 10.288  1.00 22.27  ? 151 TRP A CB  1 
ATOM   966  C  CG  . TRP A 1 133 ? -0.359  22.587 9.259   1.00 19.87  ? 151 TRP A CG  1 
ATOM   967  C  CD1 . TRP A 1 133 ? -1.168  21.660 8.626   1.00 20.66  ? 151 TRP A CD1 1 
ATOM   968  C  CD2 . TRP A 1 133 ? -0.787  23.861 8.738   1.00 18.52  ? 151 TRP A CD2 1 
ATOM   969  N  NE1 . TRP A 1 133 ? -2.039  22.249 7.802   1.00 18.71  ? 151 TRP A NE1 1 
ATOM   970  C  CE2 . TRP A 1 133 ? -1.875  23.573 7.817   1.00 18.57  ? 151 TRP A CE2 1 
ATOM   971  C  CE3 . TRP A 1 133 ? -0.416  25.185 8.956   1.00 19.62  ? 151 TRP A CE3 1 
ATOM   972  C  CZ2 . TRP A 1 133 ? -2.515  24.558 7.106   1.00 16.43  ? 151 TRP A CZ2 1 
ATOM   973  C  CZ3 . TRP A 1 133 ? -1.068  26.187 8.239   1.00 19.20  ? 151 TRP A CZ3 1 
ATOM   974  C  CH2 . TRP A 1 133 ? -2.087  25.875 7.313   1.00 19.22  ? 151 TRP A CH2 1 
ATOM   975  N  N   . ILE A 1 134 ? 3.419   21.610 8.788   1.00 25.14  ? 152 ILE A N   1 
ATOM   976  C  CA  . ILE A 1 134 ? 4.190   21.753 7.569   1.00 26.27  ? 152 ILE A CA  1 
ATOM   977  C  C   . ILE A 1 134 ? 4.768   20.391 7.143   1.00 27.14  ? 152 ILE A C   1 
ATOM   978  O  O   . ILE A 1 134 ? 4.843   20.077 5.923   1.00 22.13  ? 152 ILE A O   1 
ATOM   979  C  CB  . ILE A 1 134 ? 5.284   22.834 7.718   1.00 28.92  ? 152 ILE A CB  1 
ATOM   980  C  CG1 . ILE A 1 134 ? 5.794   23.271 6.337   1.00 27.51  ? 152 ILE A CG1 1 
ATOM   981  C  CG2 . ILE A 1 134 ? 6.376   22.400 8.725   1.00 29.69  ? 152 ILE A CG2 1 
ATOM   982  C  CD1 . ILE A 1 134 ? 4.760   24.117 5.597   1.00 28.34  ? 152 ILE A CD1 1 
ATOM   983  N  N   . ASP A 1 135 ? 5.147   19.585 8.147   1.00 24.93  ? 153 ASP A N   1 
ATOM   984  C  CA  . ASP A 1 135 ? 5.655   18.234 7.877   1.00 24.75  ? 153 ASP A CA  1 
ATOM   985  C  C   . ASP A 1 135 ? 4.532   17.414 7.278   1.00 24.20  ? 153 ASP A C   1 
ATOM   986  O  O   . ASP A 1 135 ? 4.759   16.656 6.343   1.00 25.84  ? 153 ASP A O   1 
ATOM   987  C  CB  . ASP A 1 135 ? 6.195   17.493 9.142   1.00 25.04  ? 153 ASP A CB  1 
ATOM   988  C  CG  . ASP A 1 135 ? 7.321   18.243 9.827   1.00 27.60  ? 153 ASP A CG  1 
ATOM   989  O  OD1 . ASP A 1 135 ? 8.105   18.947 9.156   1.00 24.82  ? 153 ASP A OD1 1 
ATOM   990  O  OD2 . ASP A 1 135 ? 7.414   18.151 11.078  1.00 32.14  ? 153 ASP A OD2 1 
ATOM   991  N  N   . SER A 1 136 ? 3.342   17.499 7.878   1.00 23.34  ? 154 SER A N   1 
ATOM   992  C  CA  . SER A 1 136 ? 2.189   16.777 7.384   1.00 21.38  ? 154 SER A CA  1 
ATOM   993  C  C   . SER A 1 136 ? 1.837   17.301 5.962   1.00 20.17  ? 154 SER A C   1 
ATOM   994  O  O   . SER A 1 136 ? 1.468   16.501 5.086   1.00 19.74  ? 154 SER A O   1 
ATOM   995  C  CB  . SER A 1 136 ? 1.012   16.982 8.330   1.00 22.86  ? 154 SER A CB  1 
ATOM   996  O  OG  . SER A 1 136 ? 1.354   16.559 9.626   1.00 21.16  ? 154 SER A OG  1 
ATOM   997  N  N   . ILE A 1 137 ? 1.972   18.606 5.711   1.00 20.26  ? 155 ILE A N   1 
ATOM   998  C  CA  . ILE A 1 137 ? 1.698   19.141 4.305   1.00 21.15  ? 155 ILE A CA  1 
ATOM   999  C  C   . ILE A 1 137 ? 2.657   18.515 3.298   1.00 19.56  ? 155 ILE A C   1 
ATOM   1000 O  O   . ILE A 1 137 ? 2.282   18.170 2.189   1.00 19.91  ? 155 ILE A O   1 
ATOM   1001 C  CB  . ILE A 1 137 ? 1.727   20.674 4.224   1.00 22.58  ? 155 ILE A CB  1 
ATOM   1002 C  CG1 . ILE A 1 137 ? 0.510   21.285 4.957   1.00 23.34  ? 155 ILE A CG1 1 
ATOM   1003 C  CG2 . ILE A 1 137 ? 1.834   21.145 2.768   1.00 23.74  ? 155 ILE A CG2 1 
ATOM   1004 C  CD1 . ILE A 1 137 ? 0.718   22.775 5.292   1.00 25.02  ? 155 ILE A CD1 1 
ATOM   1005 N  N   . LEU A 1 138 ? 3.884   18.280 3.710   1.00 20.18  ? 156 LEU A N   1 
ATOM   1006 C  CA  . LEU A 1 138 ? 4.853   17.700 2.786   1.00 21.00  ? 156 LEU A CA  1 
ATOM   1007 C  C   . LEU A 1 138 ? 4.599   16.241 2.530   1.00 22.11  ? 156 LEU A C   1 
ATOM   1008 O  O   . LEU A 1 138 ? 4.907   15.762 1.462   1.00 24.58  ? 156 LEU A O   1 
ATOM   1009 C  CB  . LEU A 1 138 ? 6.289   17.884 3.254   1.00 19.63  ? 156 LEU A CB  1 
ATOM   1010 C  CG  . LEU A 1 138 ? 7.079   19.126 2.934   1.00 21.10  ? 156 LEU A CG  1 
ATOM   1011 C  CD1 . LEU A 1 138 ? 8.324   19.089 3.831   1.00 24.84  ? 156 LEU A CD1 1 
ATOM   1012 C  CD2 . LEU A 1 138 ? 7.433   19.434 1.476   1.00 21.42  ? 156 LEU A CD2 1 
ATOM   1013 N  N   . ALA A 1 139 ? 4.045   15.543 3.508   1.00 22.07  ? 157 ALA A N   1 
ATOM   1014 C  CA  . ALA A 1 139 ? 3.529   14.195 3.290   1.00 22.54  ? 157 ALA A CA  1 
ATOM   1015 C  C   . ALA A 1 139 ? 2.429   14.165 2.270   1.00 24.22  ? 157 ALA A C   1 
ATOM   1016 O  O   . ALA A 1 139 ? 2.396   13.279 1.412   1.00 23.26  ? 157 ALA A O   1 
ATOM   1017 C  CB  . ALA A 1 139 ? 3.042   13.595 4.590   1.00 22.40  ? 157 ALA A CB  1 
ATOM   1018 N  N   . PHE A 1 140 ? 1.506   15.129 2.378   1.00 23.31  ? 158 PHE A N   1 
ATOM   1019 C  CA  . PHE A 1 140 ? 0.466   15.207 1.405   1.00 23.66  ? 158 PHE A CA  1 
ATOM   1020 C  C   . PHE A 1 140 ? 1.009   15.545 -0.035  1.00 22.34  ? 158 PHE A C   1 
ATOM   1021 O  O   . PHE A 1 140 ? 0.513   15.014 -1.033  1.00 21.29  ? 158 PHE A O   1 
ATOM   1022 C  CB  . PHE A 1 140 ? -0.608  16.184 1.898   1.00 23.40  ? 158 PHE A CB  1 
ATOM   1023 C  CG  . PHE A 1 140 ? -1.750  16.304 0.983   1.00 23.93  ? 158 PHE A CG  1 
ATOM   1024 C  CD1 . PHE A 1 140 ? -2.593  15.241 0.788   1.00 24.02  ? 158 PHE A CD1 1 
ATOM   1025 C  CD2 . PHE A 1 140 ? -1.941  17.468 0.241   1.00 25.68  ? 158 PHE A CD2 1 
ATOM   1026 C  CE1 . PHE A 1 140 ? -3.658  15.342 -0.109  1.00 26.44  ? 158 PHE A CE1 1 
ATOM   1027 C  CE2 . PHE A 1 140 ? -2.999  17.581 -0.655  1.00 25.89  ? 158 PHE A CE2 1 
ATOM   1028 C  CZ  . PHE A 1 140 ? -3.871  16.519 -0.832  1.00 25.63  ? 158 PHE A CZ  1 
ATOM   1029 N  N   . SER A 1 141 ? 1.984   16.449 -0.122  1.00 21.37  ? 159 SER A N   1 
ATOM   1030 C  CA  . SER A 1 141 ? 2.749   16.689 -1.341  1.00 22.33  ? 159 SER A CA  1 
ATOM   1031 C  C   . SER A 1 141 ? 3.210   15.371 -1.968  1.00 22.90  ? 159 SER A C   1 
ATOM   1032 O  O   . SER A 1 141 ? 2.870   15.103 -3.137  1.00 23.02  ? 159 SER A O   1 
ATOM   1033 C  CB  . SER A 1 141 ? 3.919   17.660 -1.123  1.00 20.42  ? 159 SER A CB  1 
ATOM   1034 O  OG  . SER A 1 141 ? 4.489   18.055 -2.408  1.00 21.40  ? 159 SER A OG  1 
ATOM   1035 N  N   . ARG A 1 142 ? 3.920   14.518 -1.212  1.00 21.74  ? 160 ARG A N   1 
ATOM   1036 C  CA  . ARG A 1 142 ? 4.384   13.227 -1.763  1.00 21.26  ? 160 ARG A CA  1 
ATOM   1037 C  C   . ARG A 1 142 ? 3.140   12.391 -2.207  1.00 24.78  ? 160 ARG A C   1 
ATOM   1038 O  O   . ARG A 1 142 ? 3.068   11.791 -3.303  1.00 23.44  ? 160 ARG A O   1 
ATOM   1039 C  CB  . ARG A 1 142 ? 5.169   12.408 -0.712  1.00 20.87  ? 160 ARG A CB  1 
ATOM   1040 C  CG  . ARG A 1 142 ? 6.514   12.985 -0.290  1.00 22.38  ? 160 ARG A CG  1 
ATOM   1041 C  CD  . ARG A 1 142 ? 7.276   12.274 0.845   1.00 21.41  ? 160 ARG A CD  1 
ATOM   1042 N  NE  . ARG A 1 142 ? 8.260   13.270 1.278   1.00 20.32  ? 160 ARG A NE  1 
ATOM   1043 C  CZ  . ARG A 1 142 ? 8.231   13.953 2.427   1.00 21.38  ? 160 ARG A CZ  1 
ATOM   1044 N  NH1 . ARG A 1 142 ? 7.331   13.666 3.358   1.00 17.00  ? 160 ARG A NH1 1 
ATOM   1045 N  NH2 . ARG A 1 142 ? 9.158   14.933 2.635   1.00 23.39  ? 160 ARG A NH2 1 
ATOM   1046 N  N   . SER A 1 143 ? 2.153   12.351 -1.328  1.00 24.04  ? 161 SER A N   1 
ATOM   1047 C  CA  . SER A 1 143 ? 0.957   11.633 -1.623  1.00 25.47  ? 161 SER A CA  1 
ATOM   1048 C  C   . SER A 1 143 ? 0.337   12.172 -2.949  1.00 25.34  ? 161 SER A C   1 
ATOM   1049 O  O   . SER A 1 143 ? -0.028  11.389 -3.849  1.00 27.10  ? 161 SER A O   1 
ATOM   1050 C  CB  . SER A 1 143 ? 0.023   11.746 -0.430  1.00 26.02  ? 161 SER A CB  1 
ATOM   1051 O  OG  . SER A 1 143 ? -1.137  10.953 -0.605  1.00 35.47  ? 161 SER A OG  1 
ATOM   1052 N  N   . LEU A 1 144 ? 0.245   13.487 -3.082  1.00 24.68  ? 162 LEU A N   1 
ATOM   1053 C  CA  . LEU A 1 144 ? -0.394  14.090 -4.245  1.00 26.18  ? 162 LEU A CA  1 
ATOM   1054 C  C   . LEU A 1 144 ? 0.462   13.796 -5.483  1.00 30.16  ? 162 LEU A C   1 
ATOM   1055 O  O   . LEU A 1 144 ? -0.067  13.408 -6.518  1.00 32.00  ? 162 LEU A O   1 
ATOM   1056 C  CB  . LEU A 1 144 ? -0.508  15.605 -4.112  1.00 26.53  ? 162 LEU A CB  1 
ATOM   1057 C  CG  . LEU A 1 144 ? -1.771  16.284 -4.642  1.00 27.88  ? 162 LEU A CG  1 
ATOM   1058 C  CD1 . LEU A 1 144 ? -1.643  17.796 -4.514  1.00 25.97  ? 162 LEU A CD1 1 
ATOM   1059 C  CD2 . LEU A 1 144 ? -2.159  15.864 -6.054  1.00 26.12  ? 162 LEU A CD2 1 
ATOM   1060 N  N   . HIS A 1 145 ? 1.784   13.939 -5.351  1.00 31.01  ? 163 HIS A N   1 
ATOM   1061 C  CA  . HIS A 1 145 ? 2.686   13.904 -6.493  1.00 30.79  ? 163 HIS A CA  1 
ATOM   1062 C  C   . HIS A 1 145 ? 2.706   12.540 -7.090  1.00 32.24  ? 163 HIS A C   1 
ATOM   1063 O  O   . HIS A 1 145 ? 3.055   12.385 -8.248  1.00 31.09  ? 163 HIS A O   1 
ATOM   1064 C  CB  . HIS A 1 145 ? 4.115   14.244 -6.102  1.00 30.57  ? 163 HIS A CB  1 
ATOM   1065 C  CG  . HIS A 1 145 ? 4.375   15.719 -5.867  1.00 32.12  ? 163 HIS A CG  1 
ATOM   1066 N  ND1 . HIS A 1 145 ? 3.589   16.692 -6.360  1.00 32.04  ? 163 HIS A ND1 1 
ATOM   1067 C  CD2 . HIS A 1 145 ? 5.416   16.357 -5.198  1.00 30.67  ? 163 HIS A CD2 1 
ATOM   1068 C  CE1 . HIS A 1 145 ? 4.097   17.893 -6.007  1.00 30.94  ? 163 HIS A CE1 1 
ATOM   1069 N  NE2 . HIS A 1 145 ? 5.211   17.681 -5.298  1.00 33.64  ? 163 HIS A NE2 1 
ATOM   1070 N  N   . SER A 1 146 ? 2.365   11.535 -6.294  1.00 32.39  ? 164 SER A N   1 
ATOM   1071 C  CA  . SER A 1 146 ? 2.449   10.148 -6.756  1.00 35.51  ? 164 SER A CA  1 
ATOM   1072 C  C   . SER A 1 146 ? 1.263   9.758  -7.657  1.00 34.99  ? 164 SER A C   1 
ATOM   1073 O  O   . SER A 1 146 ? 1.333   8.757  -8.342  1.00 39.31  ? 164 SER A O   1 
ATOM   1074 C  CB  . SER A 1 146 ? 2.519   9.178  -5.582  1.00 34.53  ? 164 SER A CB  1 
ATOM   1075 O  OG  . SER A 1 146 ? 1.226   8.947  -5.055  1.00 33.61  ? 164 SER A OG  1 
ATOM   1076 N  N   . LEU A 1 147 ? 0.215   10.572 -7.658  1.00 34.55  ? 165 LEU A N   1 
ATOM   1077 C  CA  . LEU A 1 147 ? -0.933  10.394 -8.527  1.00 35.83  ? 165 LEU A CA  1 
ATOM   1078 C  C   . LEU A 1 147 ? -0.731  11.024 -9.891  1.00 35.97  ? 165 LEU A C   1 
ATOM   1079 O  O   . LEU A 1 147 ? -1.520  10.811 -10.788 1.00 39.84  ? 165 LEU A O   1 
ATOM   1080 C  CB  . LEU A 1 147 ? -2.190  10.964 -7.884  1.00 33.61  ? 165 LEU A CB  1 
ATOM   1081 C  CG  . LEU A 1 147 ? -3.240  10.005 -7.299  1.00 38.34  ? 165 LEU A CG  1 
ATOM   1082 C  CD1 . LEU A 1 147 ? -2.765  8.608  -6.914  1.00 35.12  ? 165 LEU A CD1 1 
ATOM   1083 C  CD2 . LEU A 1 147 ? -3.945  10.661 -6.114  1.00 39.67  ? 165 LEU A CD2 1 
ATOM   1084 N  N   . LEU A 1 148 ? 0.320   11.804 -10.054 1.00 35.52  ? 166 LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 148 ? 0.652   12.359 -11.359 1.00 35.60  ? 166 LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 148 ? -0.516  13.092 -12.000 1.00 34.26  ? 166 LEU A C   1 
ATOM   1087 O  O   . LEU A 1 148 ? -0.907  12.788 -13.109 1.00 32.35  ? 166 LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 148 ? 1.178   11.251 -12.298 1.00 38.14  ? 166 LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 148 ? 2.400   10.487 -11.798 1.00 36.14  ? 166 LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 148 ? 2.480   9.159  -12.512 1.00 36.59  ? 166 LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 148 ? 3.667   11.313 -11.969 1.00 35.99  ? 166 LEU A CD2 1 
ATOM   1092 N  N   . VAL A 1 149 ? -1.067  14.055 -11.274 1.00 34.62  ? 167 VAL A N   1 
ATOM   1093 C  CA  . VAL A 1 149 ? -2.148  14.912 -11.731 1.00 27.93  ? 167 VAL A CA  1 
ATOM   1094 C  C   . VAL A 1 149 ? -1.572  15.989 -12.589 1.00 26.41  ? 167 VAL A C   1 
ATOM   1095 O  O   . VAL A 1 149 ? -0.836  16.833 -12.126 1.00 23.07  ? 167 VAL A O   1 
ATOM   1096 C  CB  . VAL A 1 149 ? -2.841  15.550 -10.527 1.00 30.02  ? 167 VAL A CB  1 
ATOM   1097 C  CG1 . VAL A 1 149 ? -3.750  16.694 -10.947 1.00 28.89  ? 167 VAL A CG1 1 
ATOM   1098 C  CG2 . VAL A 1 149 ? -3.594  14.452 -9.744  1.00 33.88  ? 167 VAL A CG2 1 
ATOM   1099 N  N   . ASP A 1 150 ? -1.930  15.965 -13.873 1.00 30.51  ? 168 ASP A N   1 
ATOM   1100 C  CA  . ASP A 1 150 ? -1.360  16.882 -14.825 1.00 28.19  ? 168 ASP A CA  1 
ATOM   1101 C  C   . ASP A 1 150 ? -1.977  18.274 -14.567 1.00 27.23  ? 168 ASP A C   1 
ATOM   1102 O  O   . ASP A 1 150 ? -2.997  18.411 -13.853 1.00 27.73  ? 168 ASP A O   1 
ATOM   1103 C  CB  . ASP A 1 150 ? -1.535  16.346 -16.279 1.00 29.85  ? 168 ASP A CB  1 
ATOM   1104 C  CG  . ASP A 1 150 ? -2.987  16.405 -16.801 1.00 32.12  ? 168 ASP A CG  1 
ATOM   1105 O  OD1 . ASP A 1 150 ? -3.335  15.634 -17.743 1.00 34.78  ? 168 ASP A OD1 1 
ATOM   1106 O  OD2 . ASP A 1 150 ? -3.782  17.242 -16.331 1.00 29.36  ? 168 ASP A OD2 1 
ATOM   1107 N  N   . VAL A 1 151 ? -1.347  19.296 -15.133 1.00 26.09  ? 169 VAL A N   1 
ATOM   1108 C  CA  . VAL A 1 151 ? -1.728  20.659 -14.884 1.00 26.73  ? 169 VAL A CA  1 
ATOM   1109 C  C   . VAL A 1 151 ? -3.115  21.053 -15.339 1.00 28.53  ? 169 VAL A C   1 
ATOM   1110 O  O   . VAL A 1 151 ? -3.725  21.897 -14.722 1.00 29.57  ? 169 VAL A O   1 
ATOM   1111 C  CB  . VAL A 1 151 ? -0.731  21.604 -15.510 1.00 25.57  ? 169 VAL A CB  1 
ATOM   1112 C  CG1 . VAL A 1 151 ? -1.274  23.036 -15.498 1.00 23.26  ? 169 VAL A CG1 1 
ATOM   1113 C  CG2 . VAL A 1 151 ? 0.576   21.452 -14.753 1.00 28.19  ? 169 VAL A CG2 1 
ATOM   1114 N  N   . PRO A 1 152 ? -3.583  20.511 -16.479 1.00 31.98  ? 170 PRO A N   1 
ATOM   1115 C  CA  . PRO A 1 152 ? -4.976  20.876 -16.727 1.00 29.35  ? 170 PRO A CA  1 
ATOM   1116 C  C   . PRO A 1 152 ? -5.987  20.179 -15.761 1.00 27.35  ? 170 PRO A C   1 
ATOM   1117 O  O   . PRO A 1 152 ? -6.997  20.788 -15.429 1.00 25.05  ? 170 PRO A O   1 
ATOM   1118 C  CB  . PRO A 1 152 ? -5.151  20.524 -18.217 1.00 31.65  ? 170 PRO A CB  1 
ATOM   1119 C  CG  . PRO A 1 152 ? -3.758  20.841 -18.791 1.00 26.91  ? 170 PRO A CG  1 
ATOM   1120 C  CD  . PRO A 1 152 ? -2.877  20.178 -17.745 1.00 29.26  ? 170 PRO A CD  1 
ATOM   1121 N  N   . ALA A 1 153 ? -5.681  18.964 -15.283 1.00 25.08  ? 171 ALA A N   1 
ATOM   1122 C  CA  . ALA A 1 153 ? -6.527  18.294 -14.347 1.00 25.87  ? 171 ALA A CA  1 
ATOM   1123 C  C   . ALA A 1 153 ? -6.566  19.115 -13.031 1.00 27.95  ? 171 ALA A C   1 
ATOM   1124 O  O   . ALA A 1 153 ? -7.638  19.332 -12.449 1.00 24.89  ? 171 ALA A O   1 
ATOM   1125 C  CB  . ALA A 1 153 ? -6.029  16.892 -14.065 1.00 24.48  ? 171 ALA A CB  1 
ATOM   1126 N  N   . PHE A 1 154 ? -5.387  19.559 -12.596 1.00 27.27  ? 172 PHE A N   1 
ATOM   1127 C  CA  . PHE A 1 154 ? -5.264  20.360 -11.397 1.00 25.51  ? 172 PHE A CA  1 
ATOM   1128 C  C   . PHE A 1 154 ? -5.945  21.716 -11.494 1.00 23.83  ? 172 PHE A C   1 
ATOM   1129 O  O   . PHE A 1 154 ? -6.573  22.188 -10.526 1.00 23.59  ? 172 PHE A O   1 
ATOM   1130 C  CB  . PHE A 1 154 ? -3.799  20.536 -11.008 1.00 26.32  ? 172 PHE A CB  1 
ATOM   1131 C  CG  . PHE A 1 154 ? -3.632  21.133 -9.615  1.00 26.34  ? 172 PHE A CG  1 
ATOM   1132 C  CD1 . PHE A 1 154 ? -3.520  20.300 -8.488  1.00 23.21  ? 172 PHE A CD1 1 
ATOM   1133 C  CD2 . PHE A 1 154 ? -3.677  22.515 -9.423  1.00 25.12  ? 172 PHE A CD2 1 
ATOM   1134 C  CE1 . PHE A 1 154 ? -3.431  20.837 -7.212  1.00 22.92  ? 172 PHE A CE1 1 
ATOM   1135 C  CE2 . PHE A 1 154 ? -3.575  23.052 -8.127  1.00 27.56  ? 172 PHE A CE2 1 
ATOM   1136 C  CZ  . PHE A 1 154 ? -3.430  22.223 -7.025  1.00 23.05  ? 172 PHE A CZ  1 
ATOM   1137 N  N   . ALA A 1 155 ? -5.831  22.369 -12.642 1.00 21.76  ? 173 ALA A N   1 
ATOM   1138 C  CA  . ALA A 1 155 ? -6.558  23.662 -12.821 1.00 20.80  ? 173 ALA A CA  1 
ATOM   1139 C  C   . ALA A 1 155 ? -8.047  23.536 -12.532 1.00 20.61  ? 173 ALA A C   1 
ATOM   1140 O  O   . ALA A 1 155 ? -8.610  24.429 -11.899 1.00 21.15  ? 173 ALA A O   1 
ATOM   1141 C  CB  . ALA A 1 155 ? -6.362  24.226 -14.227 1.00 21.99  ? 173 ALA A CB  1 
ATOM   1142 N  N   . CYS A 1 156 ? -8.657  22.437 -13.022 1.00 20.56  ? 174 CYS A N   1 
ATOM   1143 C  CA  . CYS A 1 156 ? -10.093 22.109 -12.841 1.00 20.52  ? 174 CYS A CA  1 
ATOM   1144 C  C   . CYS A 1 156 ? -10.454 21.682 -11.411 1.00 20.77  ? 174 CYS A C   1 
ATOM   1145 O  O   . CYS A 1 156 ? -11.395 22.219 -10.815 1.00 19.89  ? 174 CYS A O   1 
ATOM   1146 C  CB  . CYS A 1 156 ? -10.525 20.997 -13.809 1.00 21.00  ? 174 CYS A CB  1 
ATOM   1147 S  SG  . CYS A 1 156 ? -10.445 21.485 -15.601 1.00 27.23  ? 174 CYS A SG  1 
ATOM   1148 N  N   . LEU A 1 157 ? -9.680  20.732 -10.879 1.00 20.06  ? 175 LEU A N   1 
ATOM   1149 C  CA  . LEU A 1 157 ? -9.741  20.322 -9.494  1.00 21.32  ? 175 LEU A CA  1 
ATOM   1150 C  C   . LEU A 1 157 ? -9.695  21.427 -8.399  1.00 20.07  ? 175 LEU A C   1 
ATOM   1151 O  O   . LEU A 1 157 ? -10.567 21.466 -7.534  1.00 22.71  ? 175 LEU A O   1 
ATOM   1152 C  CB  . LEU A 1 157 ? -8.708  19.204 -9.252  1.00 24.36  ? 175 LEU A CB  1 
ATOM   1153 C  CG  . LEU A 1 157 ? -9.033  17.835 -9.900  1.00 26.89  ? 175 LEU A CG  1 
ATOM   1154 C  CD1 . LEU A 1 157 ? -7.838  16.864 -10.057 1.00 28.30  ? 175 LEU A CD1 1 
ATOM   1155 C  CD2 . LEU A 1 157 ? -10.204 17.134 -9.217  1.00 24.03  ? 175 LEU A CD2 1 
ATOM   1156 N  N   . SER A 1 158 ? -8.693  22.296 -8.401  1.00 20.29  ? 176 SER A N   1 
ATOM   1157 C  CA  . SER A 1 158 ? -8.605  23.394 -7.429  1.00 19.89  ? 176 SER A CA  1 
ATOM   1158 C  C   . SER A 1 158 ? -9.820  24.279 -7.591  1.00 22.41  ? 176 SER A C   1 
ATOM   1159 O  O   . SER A 1 158 ? -10.469 24.704 -6.600  1.00 25.12  ? 176 SER A O   1 
ATOM   1160 C  CB  . SER A 1 158 ? -7.341  24.237 -7.657  1.00 20.46  ? 176 SER A CB  1 
ATOM   1161 O  OG  . SER A 1 158 ? -7.138  24.461 -9.061  1.00 19.57  ? 176 SER A OG  1 
ATOM   1162 N  N   . ALA A 1 159 ? -10.171 24.561 -8.852  1.00 23.56  ? 177 ALA A N   1 
ATOM   1163 C  CA  . ALA A 1 159 ? -11.327 25.416 -9.118  1.00 22.30  ? 177 ALA A CA  1 
ATOM   1164 C  C   . ALA A 1 159 ? -12.612 24.796 -8.567  1.00 20.71  ? 177 ALA A C   1 
ATOM   1165 O  O   . ALA A 1 159 ? -13.476 25.505 -8.079  1.00 21.73  ? 177 ALA A O   1 
ATOM   1166 C  CB  . ALA A 1 159 ? -11.459 25.694 -10.602 1.00 25.39  ? 177 ALA A CB  1 
ATOM   1167 N  N   . LEU A 1 160 ? -12.742 23.490 -8.665  1.00 19.61  ? 178 LEU A N   1 
ATOM   1168 C  CA  . LEU A 1 160 ? -13.884 22.778 -8.052  1.00 21.59  ? 178 LEU A CA  1 
ATOM   1169 C  C   . LEU A 1 160 ? -13.860 22.731 -6.495  1.00 20.59  ? 178 LEU A C   1 
ATOM   1170 O  O   . LEU A 1 160 ? -14.942 22.559 -5.865  1.00 20.37  ? 178 LEU A O   1 
ATOM   1171 C  CB  . LEU A 1 160 ? -13.992 21.341 -8.606  1.00 20.59  ? 178 LEU A CB  1 
ATOM   1172 C  CG  . LEU A 1 160 ? -14.650 21.201 -10.012 1.00 20.44  ? 178 LEU A CG  1 
ATOM   1173 C  CD1 . LEU A 1 160 ? -14.153 19.895 -10.643 1.00 20.93  ? 178 LEU A CD1 1 
ATOM   1174 C  CD2 . LEU A 1 160 ? -16.192 21.152 -10.005 1.00 19.49  ? 178 LEU A CD2 1 
ATOM   1175 N  N   . VAL A 1 161 ? -12.665 22.870 -5.899  1.00 19.52  ? 179 VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 161 ? -12.571 22.995 -4.395  1.00 21.74  ? 179 VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 161 ? -13.242 24.281 -3.922  1.00 20.01  ? 179 VAL A C   1 
ATOM   1178 O  O   . VAL A 1 161 ? -13.992 24.304 -2.970  1.00 22.32  ? 179 VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 161 ? -11.125 22.912 -3.867  1.00 20.29  ? 179 VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 161 ? -11.100 23.297 -2.368  1.00 22.20  ? 179 VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 161 ? -10.578 21.491 -4.067  1.00 16.81  ? 179 VAL A CG2 1 
ATOM   1182 N  N   . LEU A 1 162 ? -13.015 25.320 -4.690  1.00 19.78  ? 180 LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 162 ? -13.588 26.649 -4.521  1.00 19.68  ? 180 LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 162 ? -15.028 26.676 -4.890  1.00 18.71  ? 180 LEU A C   1 
ATOM   1185 O  O   . LEU A 1 162 ? -15.816 27.179 -4.114  1.00 17.99  ? 180 LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 162 ? -12.853 27.648 -5.453  1.00 18.21  ? 180 LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 162 ? -13.334 29.072 -5.435  1.00 19.42  ? 180 LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 162 ? -12.958 29.802 -4.139  1.00 18.66  ? 180 LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 162 ? -12.815 29.840 -6.657  1.00 18.78  ? 180 LEU A CD2 1 
ATOM   1190 N  N   . ILE A 1 163 ? -15.371 26.165 -6.092  1.00 17.46  ? 181 ILE A N   1 
ATOM   1191 C  CA  . ILE A 1 163 ? -16.740 26.316 -6.597  1.00 18.03  ? 181 ILE A CA  1 
ATOM   1192 C  C   . ILE A 1 163 ? -17.596 25.124 -6.191  1.00 17.01  ? 181 ILE A C   1 
ATOM   1193 O  O   . ILE A 1 163 ? -17.589 24.086 -6.827  1.00 17.58  ? 181 ILE A O   1 
ATOM   1194 C  CB  . ILE A 1 163 ? -16.779 26.448 -8.161  1.00 18.16  ? 181 ILE A CB  1 
ATOM   1195 C  CG1 . ILE A 1 163 ? -15.709 27.413 -8.701  1.00 19.29  ? 181 ILE A CG1 1 
ATOM   1196 C  CG2 . ILE A 1 163 ? -18.169 26.782 -8.641  1.00 16.08  ? 181 ILE A CG2 1 
ATOM   1197 C  CD1 . ILE A 1 163 ? -16.020 28.848 -8.604  1.00 18.24  ? 181 ILE A CD1 1 
ATOM   1198 N  N   . THR A 1 164 ? -18.379 25.300 -5.164  1.00 18.45  ? 182 THR A N   1 
ATOM   1199 C  CA  . THR A 1 164 ? -19.000 24.165 -4.465  1.00 18.67  ? 182 THR A CA  1 
ATOM   1200 C  C   . THR A 1 164 ? -20.072 24.728 -3.521  1.00 18.77  ? 182 THR A C   1 
ATOM   1201 O  O   . THR A 1 164 ? -20.072 25.910 -3.181  1.00 19.83  ? 182 THR A O   1 
ATOM   1202 C  CB  . THR A 1 164 ? -17.956 23.372 -3.643  1.00 18.72  ? 182 THR A CB  1 
ATOM   1203 O  OG1 . THR A 1 164 ? -18.525 22.143 -3.212  1.00 17.05  ? 182 THR A OG1 1 
ATOM   1204 C  CG2 . THR A 1 164 ? -17.479 24.144 -2.443  1.00 16.86  ? 182 THR A CG2 1 
ATOM   1205 N  N   . ASP A 1 165 ? -20.997 23.887 -3.116  1.00 19.39  ? 183 ASP A N   1 
ATOM   1206 C  CA  . ASP A 1 165 ? -21.990 24.269 -2.112  1.00 21.37  ? 183 ASP A CA  1 
ATOM   1207 C  C   . ASP A 1 165 ? -21.310 24.780 -0.819  1.00 21.27  ? 183 ASP A C   1 
ATOM   1208 O  O   . ASP A 1 165 ? -20.323 24.168 -0.366  1.00 20.28  ? 183 ASP A O   1 
ATOM   1209 C  CB  . ASP A 1 165 ? -22.876 23.051 -1.832  1.00 19.05  ? 183 ASP A CB  1 
ATOM   1210 C  CG  . ASP A 1 165 ? -23.691 22.717 -3.010  1.00 21.41  ? 183 ASP A CG  1 
ATOM   1211 O  OD1 . ASP A 1 165 ? -23.538 21.605 -3.568  1.00 22.52  ? 183 ASP A OD1 1 
ATOM   1212 O  OD2 . ASP A 1 165 ? -24.504 23.592 -3.407  1.00 20.40  ? 183 ASP A OD2 1 
ATOM   1213 N  N   . ARG A 1 166 ? -21.801 25.916 -0.314  1.00 20.80  ? 184 ARG A N   1 
ATOM   1214 C  CA  . ARG A 1 166 ? -21.497 26.377 1.034   1.00 24.03  ? 184 ARG A CA  1 
ATOM   1215 C  C   . ARG A 1 166 ? -22.798 26.829 1.704   1.00 24.54  ? 184 ARG A C   1 
ATOM   1216 O  O   . ARG A 1 166 ? -23.656 27.443 1.071   1.00 26.55  ? 184 ARG A O   1 
ATOM   1217 C  CB  . ARG A 1 166 ? -20.469 27.513 1.056   1.00 21.84  ? 184 ARG A CB  1 
ATOM   1218 C  CG  . ARG A 1 166 ? -19.101 27.139 0.451   1.00 25.59  ? 184 ARG A CG  1 
ATOM   1219 C  CD  . ARG A 1 166 ? -18.342 26.089 1.262   1.00 23.49  ? 184 ARG A CD  1 
ATOM   1220 N  NE  . ARG A 1 166 ? -17.078 25.785 0.599   1.00 25.57  ? 184 ARG A NE  1 
ATOM   1221 C  CZ  . ARG A 1 166 ? -16.141 24.926 1.022   1.00 26.52  ? 184 ARG A CZ  1 
ATOM   1222 N  NH1 . ARG A 1 166 ? -16.256 24.242 2.180   1.00 27.39  ? 184 ARG A NH1 1 
ATOM   1223 N  NH2 . ARG A 1 166 ? -15.069 24.747 0.279   1.00 25.18  ? 184 ARG A NH2 1 
ATOM   1224 N  N   . HIS A 1 167 ? -22.975 26.498 2.967   1.00 23.73  ? 185 HIS A N   1 
ATOM   1225 C  CA  . HIS A 1 167 ? -24.130 27.014 3.676   1.00 25.72  ? 185 HIS A CA  1 
ATOM   1226 C  C   . HIS A 1 167 ? -24.051 28.527 3.678   1.00 24.81  ? 185 HIS A C   1 
ATOM   1227 O  O   . HIS A 1 167 ? -23.003 29.085 4.024   1.00 22.15  ? 185 HIS A O   1 
ATOM   1228 C  CB  . HIS A 1 167 ? -24.110 26.456 5.099   1.00 28.52  ? 185 HIS A CB  1 
ATOM   1229 C  CG  . HIS A 1 167 ? -25.183 27.011 5.976   1.00 32.65  ? 185 HIS A CG  1 
ATOM   1230 N  ND1 . HIS A 1 167 ? -26.429 26.496 6.007   1.00 35.19  ? 185 HIS A ND1 1 
ATOM   1231 C  CD2 . HIS A 1 167 ? -25.176 28.105 6.859   1.00 34.05  ? 185 HIS A CD2 1 
ATOM   1232 C  CE1 . HIS A 1 167 ? -27.175 27.190 6.894   1.00 35.71  ? 185 HIS A CE1 1 
ATOM   1233 N  NE2 . HIS A 1 167 ? -26.399 28.178 7.413   1.00 32.91  ? 185 HIS A NE2 1 
ATOM   1234 N  N   . GLY A 1 168 ? -25.136 29.197 3.254   1.00 23.55  ? 186 GLY A N   1 
ATOM   1235 C  CA  . GLY A 1 168 ? -25.240 30.649 3.306   1.00 21.32  ? 186 GLY A CA  1 
ATOM   1236 C  C   . GLY A 1 168 ? -25.006 31.329 1.974   1.00 22.65  ? 186 GLY A C   1 
ATOM   1237 O  O   . GLY A 1 168 ? -25.010 32.562 1.868   1.00 22.85  ? 186 GLY A O   1 
ATOM   1238 N  N   . LEU A 1 169 ? -24.832 30.546 0.926   1.00 22.98  ? 187 LEU A N   1 
ATOM   1239 C  CA  . LEU A 1 169 ? -24.743 31.131 -0.405  1.00 21.13  ? 187 LEU A CA  1 
ATOM   1240 C  C   . LEU A 1 169 ? -26.051 31.858 -0.692  1.00 23.76  ? 187 LEU A C   1 
ATOM   1241 O  O   . LEU A 1 169 ? -27.122 31.358 -0.338  1.00 24.05  ? 187 LEU A O   1 
ATOM   1242 C  CB  . LEU A 1 169 ? -24.461 30.036 -1.462  1.00 19.71  ? 187 LEU A CB  1 
ATOM   1243 C  CG  . LEU A 1 169 ? -23.015 29.615 -1.619  1.00 18.41  ? 187 LEU A CG  1 
ATOM   1244 C  CD1 . LEU A 1 169 ? -22.858 28.438 -2.553  1.00 16.99  ? 187 LEU A CD1 1 
ATOM   1245 C  CD2 . LEU A 1 169 ? -22.167 30.825 -2.101  1.00 17.62  ? 187 LEU A CD2 1 
ATOM   1246 N  N   . GLN A 1 170 ? -25.986 33.039 -1.310  1.00 23.88  ? 188 GLN A N   1 
ATOM   1247 C  CA  . GLN A 1 170 ? -27.234 33.682 -1.746  1.00 24.38  ? 188 GLN A CA  1 
ATOM   1248 C  C   . GLN A 1 170 ? -27.720 33.030 -3.029  1.00 27.28  ? 188 GLN A C   1 
ATOM   1249 O  O   . GLN A 1 170 ? -28.941 32.995 -3.288  1.00 29.17  ? 188 GLN A O   1 
ATOM   1250 C  CB  . GLN A 1 170 ? -27.058 35.180 -1.973  1.00 28.05  ? 188 GLN A CB  1 
ATOM   1251 C  CG  . GLN A 1 170 ? -26.496 35.940 -0.756  1.00 29.03  ? 188 GLN A CG  1 
ATOM   1252 C  CD  . GLN A 1 170 ? -26.189 37.405 -1.010  1.00 27.96  ? 188 GLN A CD  1 
ATOM   1253 O  OE1 . GLN A 1 170 ? -26.608 38.249 -0.229  1.00 32.27  ? 188 GLN A OE1 1 
ATOM   1254 N  NE2 . GLN A 1 170 ? -25.435 37.707 -2.052  1.00 23.38  ? 188 GLN A NE2 1 
ATOM   1255 N  N   . GLU A 1 171 ? -26.803 32.504 -3.852  1.00 25.43  ? 189 GLU A N   1 
ATOM   1256 C  CA  . GLU A 1 171 ? -27.256 31.961 -5.137  1.00 22.65  ? 189 GLU A CA  1 
ATOM   1257 C  C   . GLU A 1 171 ? -26.685 30.589 -5.379  1.00 22.04  ? 189 GLU A C   1 
ATOM   1258 O  O   . GLU A 1 171 ? -25.934 30.356 -6.311  1.00 24.76  ? 189 GLU A O   1 
ATOM   1259 C  CB  . GLU A 1 171 ? -27.034 32.916 -6.310  1.00 24.32  ? 189 GLU A CB  1 
ATOM   1260 C  CG  . GLU A 1 171 ? -27.612 34.325 -6.076  1.00 25.00  ? 189 GLU A CG  1 
ATOM   1261 C  CD  . GLU A 1 171 ? -27.511 35.210 -7.293  1.00 25.29  ? 189 GLU A CD  1 
ATOM   1262 O  OE1 . GLU A 1 171 ? -26.408 35.704 -7.655  1.00 25.74  ? 189 GLU A OE1 1 
ATOM   1263 O  OE2 . GLU A 1 171 ? -28.557 35.402 -7.935  1.00 29.22  ? 189 GLU A OE2 1 
ATOM   1264 N  N   . PRO A 1 172 ? -27.086 29.648 -4.539  1.00 22.68  ? 190 PRO A N   1 
ATOM   1265 C  CA  . PRO A 1 172 ? -26.443 28.327 -4.580  1.00 23.78  ? 190 PRO A CA  1 
ATOM   1266 C  C   . PRO A 1 172 ? -26.554 27.672 -5.968  1.00 22.25  ? 190 PRO A C   1 
ATOM   1267 O  O   . PRO A 1 172 ? -25.600 26.995 -6.397  1.00 26.08  ? 190 PRO A O   1 
ATOM   1268 C  CB  . PRO A 1 172 ? -27.185 27.542 -3.475  1.00 22.08  ? 190 PRO A CB  1 
ATOM   1269 C  CG  . PRO A 1 172 ? -28.417 28.343 -3.146  1.00 19.85  ? 190 PRO A CG  1 
ATOM   1270 C  CD  . PRO A 1 172 ? -28.171 29.747 -3.535  1.00 21.43  ? 190 PRO A CD  1 
ATOM   1271 N  N   . ARG A 1 173 ? -27.648 27.909 -6.702  1.00 23.02  ? 191 ARG A N   1 
ATOM   1272 C  CA  . ARG A 1 173 ? -27.861 27.242 -8.055  1.00 22.27  ? 191 ARG A CA  1 
ATOM   1273 C  C   . ARG A 1 173 ? -26.920 27.774 -9.112  1.00 21.84  ? 191 ARG A C   1 
ATOM   1274 O  O   . ARG A 1 173 ? -26.590 27.044 -10.065 1.00 22.46  ? 191 ARG A O   1 
ATOM   1275 C  CB  . ARG A 1 173 ? -29.277 27.432 -8.627  1.00 23.87  ? 191 ARG A CB  1 
ATOM   1276 C  CG  . ARG A 1 173 ? -30.451 27.290 -7.682  1.00 26.23  ? 191 ARG A CG  1 
ATOM   1277 C  CD  . ARG A 1 173 ? -30.973 25.877 -7.471  1.00 26.26  ? 191 ARG A CD  1 
ATOM   1278 N  NE  . ARG A 1 173 ? -31.146 25.020 -8.640  1.00 26.35  ? 191 ARG A NE  1 
ATOM   1279 C  CZ  . ARG A 1 173 ? -32.317 24.650 -9.164  1.00 29.73  ? 191 ARG A CZ  1 
ATOM   1280 N  NH1 . ARG A 1 173 ? -32.365 23.826 -10.194 1.00 24.60  ? 191 ARG A NH1 1 
ATOM   1281 N  NH2 . ARG A 1 173 ? -33.455 25.123 -8.689  1.00 32.94  ? 191 ARG A NH2 1 
ATOM   1282 N  N   . ARG A 1 174 ? -26.481 29.038 -8.972  1.00 23.04  ? 192 ARG A N   1 
ATOM   1283 C  CA  . ARG A 1 174 ? -25.521 29.626 -9.967  1.00 23.10  ? 192 ARG A CA  1 
ATOM   1284 C  C   . ARG A 1 174 ? -24.167 29.053 -9.646  1.00 24.02  ? 192 ARG A C   1 
ATOM   1285 O  O   . ARG A 1 174 ? -23.363 28.872 -10.514 1.00 24.76  ? 192 ARG A O   1 
ATOM   1286 C  CB  . ARG A 1 174 ? -25.463 31.176 -9.935  1.00 22.13  ? 192 ARG A CB  1 
ATOM   1287 C  CG  . ARG A 1 174 ? -26.766 31.931 -10.337 1.00 19.01  ? 192 ARG A CG  1 
ATOM   1288 C  CD  . ARG A 1 174 ? -26.493 33.427 -10.219 1.00 20.82  ? 192 ARG A CD  1 
ATOM   1289 N  NE  . ARG A 1 174 ? -25.377 33.901 -11.081 1.00 20.22  ? 192 ARG A NE  1 
ATOM   1290 C  CZ  . ARG A 1 174 ? -24.696 35.044 -10.924 1.00 18.96  ? 192 ARG A CZ  1 
ATOM   1291 N  NH1 . ARG A 1 174 ? -23.767 35.356 -11.785 1.00 18.23  ? 192 ARG A NH1 1 
ATOM   1292 N  NH2 . ARG A 1 174 ? -24.921 35.870 -9.924  1.00 19.06  ? 192 ARG A NH2 1 
ATOM   1293 N  N   . VAL A 1 175 ? -23.933 28.709 -8.381  1.00 23.58  ? 193 VAL A N   1 
ATOM   1294 C  CA  . VAL A 1 175 ? -22.647 28.099 -8.017  1.00 21.77  ? 193 VAL A CA  1 
ATOM   1295 C  C   . VAL A 1 175 ? -22.668 26.668 -8.551  1.00 21.42  ? 193 VAL A C   1 
ATOM   1296 O  O   . VAL A 1 175 ? -21.700 26.233 -9.122  1.00 19.89  ? 193 VAL A O   1 
ATOM   1297 C  CB  . VAL A 1 175 ? -22.325 28.199 -6.497  1.00 20.35  ? 193 VAL A CB  1 
ATOM   1298 C  CG1 . VAL A 1 175 ? -20.947 27.568 -6.145  1.00 18.93  ? 193 VAL A CG1 1 
ATOM   1299 C  CG2 . VAL A 1 175 ? -22.331 29.668 -6.101  1.00 19.13  ? 193 VAL A CG2 1 
ATOM   1300 N  N   . GLU A 1 176 ? -23.784 25.949 -8.372  1.00 22.30  ? 194 GLU A N   1 
ATOM   1301 C  CA  . GLU A 1 176 ? -23.887 24.556 -8.876  1.00 21.84  ? 194 GLU A CA  1 
ATOM   1302 C  C   . GLU A 1 176 ? -23.809 24.490 -10.435 1.00 24.83  ? 194 GLU A C   1 
ATOM   1303 O  O   . GLU A 1 176 ? -23.109 23.631 -11.006 1.00 26.03  ? 194 GLU A O   1 
ATOM   1304 C  CB  . GLU A 1 176 ? -25.147 23.896 -8.335  1.00 21.70  ? 194 GLU A CB  1 
ATOM   1305 C  CG  . GLU A 1 176 ? -25.092 23.773 -6.805  1.00 23.06  ? 194 GLU A CG  1 
ATOM   1306 C  CD  . GLU A 1 176 ? -26.369 23.230 -6.234  1.00 22.51  ? 194 GLU A CD  1 
ATOM   1307 O  OE1 . GLU A 1 176 ? -26.426 22.843 -5.026  1.00 19.94  ? 194 GLU A OE1 1 
ATOM   1308 O  OE2 . GLU A 1 176 ? -27.313 23.157 -7.050  1.00 21.57  ? 194 GLU A OE2 1 
ATOM   1309 N  N   . GLU A 1 177 ? -24.498 25.416 -11.106 1.00 26.34  ? 195 GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 177 ? -24.327 25.630 -12.555 1.00 26.71  ? 195 GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 177 ? -22.850 25.719 -12.947 1.00 26.09  ? 195 GLU A C   1 
ATOM   1312 O  O   . GLU A 1 177 ? -22.415 25.018 -13.859 1.00 26.10  ? 195 GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 177 ? -25.132 26.866 -13.053 1.00 24.78  ? 195 GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 177 ? -24.899 27.223 -14.526 1.00 27.24  ? 195 GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 177 ? -25.074 26.036 -15.475 1.00 30.02  ? 195 GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 177 ? -24.453 26.070 -16.551 1.00 30.70  ? 195 GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 177 ? -25.830 25.062 -15.186 1.00 33.05  ? 195 GLU A OE2 1 
ATOM   1318 N  N   . LEU A 1 178 ? -22.077 26.536 -12.217 1.00 24.16  ? 196 LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 178 ? -20.642 26.721 -12.513 1.00 23.61  ? 196 LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 178 ? -19.797 25.461 -12.128 1.00 25.37  ? 196 LEU A C   1 
ATOM   1321 O  O   . LEU A 1 178 ? -18.887 25.034 -12.881 1.00 23.27  ? 196 LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 178 ? -20.148 27.994 -11.826 1.00 23.24  ? 196 LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 178 ? -18.764 28.543 -12.076 1.00 23.73  ? 196 LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 178 ? -18.590 28.756 -13.582 1.00 25.17  ? 196 LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 178 ? -18.596 29.839 -11.288 1.00 21.93  ? 196 LEU A CD2 1 
ATOM   1326 N  N   . GLN A 1 179 ? -20.111 24.866 -10.976 1.00 23.91  ? 197 GLN A N   1 
ATOM   1327 C  CA  . GLN A 1 179 ? -19.640 23.516 -10.651 1.00 25.15  ? 197 GLN A CA  1 
ATOM   1328 C  C   . GLN A 1 179 ? -19.900 22.484 -11.804 1.00 25.49  ? 197 GLN A C   1 
ATOM   1329 O  O   . GLN A 1 179 ? -19.024 21.639 -12.063 1.00 27.11  ? 197 GLN A O   1 
ATOM   1330 C  CB  . GLN A 1 179 ? -20.279 23.038 -9.318  1.00 23.17  ? 197 GLN A CB  1 
ATOM   1331 C  CG  . GLN A 1 179 ? -19.878 21.651 -8.812  1.00 22.17  ? 197 GLN A CG  1 
ATOM   1332 C  CD  . GLN A 1 179 ? -20.578 21.310 -7.503  1.00 22.86  ? 197 GLN A CD  1 
ATOM   1333 O  OE1 . GLN A 1 179 ? -21.799 21.174 -7.479  1.00 24.51  ? 197 GLN A OE1 1 
ATOM   1334 N  NE2 . GLN A 1 179 ? -19.831 21.176 -6.423  1.00 20.09  ? 197 GLN A NE2 1 
ATOM   1335 N  N   . ASN A 1 180 ? -21.089 22.495 -12.423 1.00 25.57  ? 198 ASN A N   1 
ATOM   1336 C  CA  . ASN A 1 180 ? -21.384 21.513 -13.499 1.00 26.08  ? 198 ASN A CA  1 
ATOM   1337 C  C   . ASN A 1 180 ? -20.449 21.804 -14.663 1.00 24.09  ? 198 ASN A C   1 
ATOM   1338 O  O   . ASN A 1 180 ? -19.929 20.885 -15.281 1.00 25.67  ? 198 ASN A O   1 
ATOM   1339 C  CB  . ASN A 1 180 ? -22.843 21.555 -14.059 1.00 23.56  ? 198 ASN A CB  1 
ATOM   1340 C  CG  . ASN A 1 180 ? -23.912 21.030 -13.098 1.00 26.71  ? 198 ASN A CG  1 
ATOM   1341 O  OD1 . ASN A 1 180 ? -23.644 20.273 -12.144 1.00 23.79  ? 198 ASN A OD1 1 
ATOM   1342 N  ND2 . ASN A 1 180 ? -25.174 21.450 -13.360 1.00 24.11  ? 198 ASN A ND2 1 
ATOM   1343 N  N   . ARG A 1 181 ? -20.265 23.092 -14.961 1.00 25.47  ? 199 ARG A N   1 
ATOM   1344 C  CA  . ARG A 1 181 ? -19.426 23.566 -16.101 1.00 27.48  ? 199 ARG A CA  1 
ATOM   1345 C  C   . ARG A 1 181 ? -17.975 23.068 -16.012 1.00 27.96  ? 199 ARG A C   1 
ATOM   1346 O  O   . ARG A 1 181 ? -17.396 22.623 -17.004 1.00 23.71  ? 199 ARG A O   1 
ATOM   1347 C  CB  . ARG A 1 181 ? -19.468 25.100 -16.220 1.00 25.86  ? 199 ARG A CB  1 
ATOM   1348 C  CG  . ARG A 1 181 ? -20.651 25.636 -17.063 1.00 27.51  ? 199 ARG A CG  1 
ATOM   1349 C  CD  . ARG A 1 181 ? -20.649 27.156 -17.120 1.00 29.86  ? 199 ARG A CD  1 
ATOM   1350 N  NE  . ARG A 1 181 ? -21.975 27.796 -17.105 1.00 34.03  ? 199 ARG A NE  1 
ATOM   1351 C  CZ  . ARG A 1 181 ? -22.166 29.111 -16.945 1.00 37.59  ? 199 ARG A CZ  1 
ATOM   1352 N  NH1 . ARG A 1 181 ? -23.392 29.665 -16.955 1.00 34.96  ? 199 ARG A NH1 1 
ATOM   1353 N  NH2 . ARG A 1 181 ? -21.112 29.899 -16.782 1.00 41.03  ? 199 ARG A NH2 1 
ATOM   1354 N  N   . ILE A 1 182 ? -17.420 23.129 -14.798 1.00 26.06  ? 200 ILE A N   1 
ATOM   1355 C  CA  . ILE A 1 182 ? -16.049 22.730 -14.568 1.00 25.47  ? 200 ILE A CA  1 
ATOM   1356 C  C   . ILE A 1 182 ? -15.923 21.217 -14.526 1.00 25.97  ? 200 ILE A C   1 
ATOM   1357 O  O   . ILE A 1 182 ? -14.934 20.659 -15.030 1.00 23.20  ? 200 ILE A O   1 
ATOM   1358 C  CB  . ILE A 1 182 ? -15.483 23.466 -13.337 1.00 24.36  ? 200 ILE A CB  1 
ATOM   1359 C  CG1 . ILE A 1 182 ? -15.822 24.945 -13.534 1.00 24.82  ? 200 ILE A CG1 1 
ATOM   1360 C  CG2 . ILE A 1 182 ? -13.964 23.295 -13.230 1.00 22.61  ? 200 ILE A CG2 1 
ATOM   1361 C  CD1 . ILE A 1 182 ? -15.633 25.852 -12.340 1.00 26.69  ? 200 ILE A CD1 1 
ATOM   1362 N  N   . ALA A 1 183 ? -16.933 20.537 -13.966 1.00 27.56  ? 201 ALA A N   1 
ATOM   1363 C  CA  . ALA A 1 183 ? -16.918 19.043 -14.000 1.00 28.92  ? 201 ALA A CA  1 
ATOM   1364 C  C   . ALA A 1 183 ? -16.955 18.492 -15.457 1.00 28.53  ? 201 ALA A C   1 
ATOM   1365 O  O   . ALA A 1 183 ? -16.168 17.614 -15.846 1.00 28.87  ? 201 ALA A O   1 
ATOM   1366 C  CB  . ALA A 1 183 ? -18.036 18.447 -13.152 1.00 27.43  ? 201 ALA A CB  1 
ATOM   1367 N  N   . SER A 1 184 ? -17.858 19.025 -16.260 1.00 26.84  ? 202 SER A N   1 
ATOM   1368 C  CA  . SER A 1 184 ? -17.918 18.598 -17.661 1.00 32.20  ? 202 SER A CA  1 
ATOM   1369 C  C   . SER A 1 184 ? -16.604 18.922 -18.309 1.00 31.12  ? 202 SER A C   1 
ATOM   1370 O  O   . SER A 1 184 ? -16.105 18.104 -19.062 1.00 29.24  ? 202 SER A O   1 
ATOM   1371 C  CB  . SER A 1 184 ? -19.040 19.304 -18.411 1.00 31.21  ? 202 SER A CB  1 
ATOM   1372 O  OG  . SER A 1 184 ? -20.257 18.969 -17.803 1.00 32.25  ? 202 SER A OG  1 
ATOM   1373 N  N   . CYS A 1 185 ? -16.043 20.094 -17.960 1.00 32.38  ? 203 CYS A N   1 
ATOM   1374 C  CA  . CYS A 1 185 ? -14.747 20.531 -18.473 1.00 34.51  ? 203 CYS A CA  1 
ATOM   1375 C  C   . CYS A 1 185 ? -13.664 19.553 -18.050 1.00 35.47  ? 203 CYS A C   1 
ATOM   1376 O  O   . CYS A 1 185 ? -12.793 19.194 -18.848 1.00 40.81  ? 203 CYS A O   1 
ATOM   1377 C  CB  . CYS A 1 185 ? -14.403 21.931 -17.945 1.00 31.44  ? 203 CYS A CB  1 
ATOM   1378 S  SG  . CYS A 1 185 ? -12.930 22.690 -18.663 1.00 39.96  ? 203 CYS A SG  1 
ATOM   1379 N  N   . LEU A 1 186 ? -13.699 19.099 -16.806 1.00 31.18  ? 204 LEU A N   1 
ATOM   1380 C  CA  . LEU A 1 186 ? -12.650 18.173 -16.376 1.00 30.38  ? 204 LEU A CA  1 
ATOM   1381 C  C   . LEU A 1 186 ? -12.784 16.826 -17.110 1.00 32.29  ? 204 LEU A C   1 
ATOM   1382 O  O   . LEU A 1 186 ? -11.780 16.217 -17.507 1.00 28.35  ? 204 LEU A O   1 
ATOM   1383 C  CB  . LEU A 1 186 ? -12.676 17.988 -14.855 1.00 26.87  ? 204 LEU A CB  1 
ATOM   1384 C  CG  . LEU A 1 186 ? -11.718 16.923 -14.278 1.00 29.58  ? 204 LEU A CG  1 
ATOM   1385 C  CD1 . LEU A 1 186 ? -10.278 17.342 -14.446 1.00 25.87  ? 204 LEU A CD1 1 
ATOM   1386 C  CD2 . LEU A 1 186 ? -11.966 16.601 -12.795 1.00 29.15  ? 204 LEU A CD2 1 
ATOM   1387 N  N   . LYS A 1 187 ? -14.035 16.388 -17.296 1.00 35.32  ? 205 LYS A N   1 
ATOM   1388 C  CA  . LYS A 1 187 ? -14.323 15.085 -17.884 1.00 39.23  ? 205 LYS A CA  1 
ATOM   1389 C  C   . LYS A 1 187 ? -13.810 15.037 -19.332 1.00 39.43  ? 205 LYS A C   1 
ATOM   1390 O  O   . LYS A 1 187 ? -13.077 14.102 -19.715 1.00 37.40  ? 205 LYS A O   1 
ATOM   1391 C  CB  . LYS A 1 187 ? -15.819 14.709 -17.774 1.00 40.26  ? 205 LYS A CB  1 
ATOM   1392 C  CG  . LYS A 1 187 ? -16.073 13.280 -18.248 1.00 41.39  ? 205 LYS A CG  1 
ATOM   1393 C  CD  . LYS A 1 187 ? -17.478 12.717 -18.037 1.00 45.17  ? 205 LYS A CD  1 
ATOM   1394 C  CE  . LYS A 1 187 ? -17.441 11.194 -18.227 1.00 40.93  ? 205 LYS A CE  1 
ATOM   1395 N  NZ  . LYS A 1 187 ? -18.540 10.421 -17.593 1.00 41.50  ? 205 LYS A NZ  1 
ATOM   1396 N  N   . GLU A 1 188 ? -14.150 16.068 -20.103 1.00 37.07  ? 206 GLU A N   1 
ATOM   1397 C  CA  . GLU A 1 188 ? -13.609 16.212 -21.444 1.00 40.36  ? 206 GLU A CA  1 
ATOM   1398 C  C   . GLU A 1 188 ? -12.099 16.044 -21.429 1.00 38.80  ? 206 GLU A C   1 
ATOM   1399 O  O   . GLU A 1 188 ? -11.601 15.246 -22.213 1.00 38.37  ? 206 GLU A O   1 
ATOM   1400 C  CB  . GLU A 1 188 ? -13.991 17.541 -22.096 1.00 39.80  ? 206 GLU A CB  1 
ATOM   1401 C  CG  . GLU A 1 188 ? -15.451 17.631 -22.515 1.00 50.15  ? 206 GLU A CG  1 
ATOM   1402 C  CD  . GLU A 1 188 ? -15.758 18.879 -23.339 1.00 58.17  ? 206 GLU A CD  1 
ATOM   1403 O  OE1 . GLU A 1 188 ? -15.408 18.902 -24.558 1.00 53.04  ? 206 GLU A OE1 1 
ATOM   1404 O  OE2 . GLU A 1 188 ? -16.355 19.832 -22.758 1.00 59.13  ? 206 GLU A OE2 1 
ATOM   1405 N  N   . HIS A 1 189 ? -11.387 16.787 -20.560 1.00 37.47  ? 207 HIS A N   1 
ATOM   1406 C  CA  . HIS A 1 189 ? -9.919  16.690 -20.476 1.00 38.71  ? 207 HIS A CA  1 
ATOM   1407 C  C   . HIS A 1 189 ? -9.414  15.294 -20.157 1.00 39.93  ? 207 HIS A C   1 
ATOM   1408 O  O   . HIS A 1 189 ? -8.578  14.773 -20.889 1.00 37.17  ? 207 HIS A O   1 
ATOM   1409 C  CB  . HIS A 1 189 ? -9.280  17.751 -19.569 1.00 36.91  ? 207 HIS A CB  1 
ATOM   1410 C  CG  . HIS A 1 189 ? -7.768  17.549 -19.317 1.00 37.93  ? 207 HIS A CG  1 
ATOM   1411 N  ND1 . HIS A 1 189 ? -6.826  17.794 -20.261 1.00 35.92  ? 207 HIS A ND1 1 
ATOM   1412 C  CD2 . HIS A 1 189 ? -7.061  17.137 -18.159 1.00 36.99  ? 207 HIS A CD2 1 
ATOM   1413 C  CE1 . HIS A 1 189 ? -5.592  17.546 -19.751 1.00 37.01  ? 207 HIS A CE1 1 
ATOM   1414 N  NE2 . HIS A 1 189 ? -5.739  17.132 -18.469 1.00 37.41  ? 207 HIS A NE2 1 
ATOM   1415 N  N   . VAL A 1 190 ? -9.912  14.667 -19.095 1.00 45.24  ? 208 VAL A N   1 
ATOM   1416 C  CA  . VAL A 1 190 ? -9.407  13.334 -18.726 1.00 49.17  ? 208 VAL A CA  1 
ATOM   1417 C  C   . VAL A 1 190 ? -9.747  12.270 -19.789 1.00 56.60  ? 208 VAL A C   1 
ATOM   1418 O  O   . VAL A 1 190 ? -9.030  11.276 -19.915 1.00 61.87  ? 208 VAL A O   1 
ATOM   1419 C  CB  . VAL A 1 190 ? -9.791  12.865 -17.288 1.00 49.39  ? 208 VAL A CB  1 
ATOM   1420 C  CG1 . VAL A 1 190 ? -9.358  13.875 -16.238 1.00 46.30  ? 208 VAL A CG1 1 
ATOM   1421 C  CG2 . VAL A 1 190 ? -11.273 12.598 -17.173 1.00 55.74  ? 208 VAL A CG2 1 
ATOM   1422 N  N   . ALA A 1 191 ? -10.806 12.497 -20.570 1.00 56.78  ? 209 ALA A N   1 
ATOM   1423 C  CA  . ALA A 1 191 ? -11.110 11.633 -21.730 1.00 56.08  ? 209 ALA A CA  1 
ATOM   1424 C  C   . ALA A 1 191 ? -10.254 11.944 -22.965 1.00 54.80  ? 209 ALA A C   1 
ATOM   1425 O  O   . ALA A 1 191 ? -10.122 11.109 -23.851 1.00 59.78  ? 209 ALA A O   1 
ATOM   1426 C  CB  . ALA A 1 191 ? -12.595 11.682 -22.079 1.00 51.09  ? 209 ALA A CB  1 
ATOM   1427 N  N   . ALA A 1 192 ? -9.677  13.138 -23.029 1.00 56.54  ? 210 ALA A N   1 
ATOM   1428 C  CA  . ALA A 1 192 ? -8.850  13.515 -24.177 1.00 57.75  ? 210 ALA A CA  1 
ATOM   1429 C  C   . ALA A 1 192 ? -7.432  13.011 -23.995 1.00 62.73  ? 210 ALA A C   1 
ATOM   1430 O  O   . ALA A 1 192 ? -6.670  12.911 -24.960 1.00 71.21  ? 210 ALA A O   1 
ATOM   1431 C  CB  . ALA A 1 192 ? -8.867  15.020 -24.397 1.00 51.78  ? 210 ALA A CB  1 
ATOM   1432 N  N   . VAL A 1 193 ? -7.089  12.692 -22.748 1.00 68.19  ? 211 VAL A N   1 
ATOM   1433 C  CA  . VAL A 1 193 ? -5.775  12.152 -22.394 1.00 68.47  ? 211 VAL A CA  1 
ATOM   1434 C  C   . VAL A 1 193 ? -5.894  10.648 -22.108 1.00 65.73  ? 211 VAL A C   1 
ATOM   1435 O  O   . VAL A 1 193 ? -5.662  10.196 -20.991 1.00 66.41  ? 211 VAL A O   1 
ATOM   1436 C  CB  . VAL A 1 193 ? -5.137  12.909 -21.181 1.00 70.48  ? 211 VAL A CB  1 
ATOM   1437 C  CG1 . VAL A 1 193 ? -3.730  12.405 -20.884 1.00 68.33  ? 211 VAL A CG1 1 
ATOM   1438 C  CG2 . VAL A 1 193 ? -5.078  14.409 -21.426 1.00 67.61  ? 211 VAL A CG2 1 
ATOM   1439 N  N   . ALA A 1 194 ? -6.268  9.881  -23.129 1.00 73.28  ? 212 ALA A N   1 
ATOM   1440 C  CA  . ALA A 1 194 ? -6.297  8.405  -23.063 1.00 74.57  ? 212 ALA A CA  1 
ATOM   1441 C  C   . ALA A 1 194 ? -6.854  7.855  -21.747 1.00 72.55  ? 212 ALA A C   1 
ATOM   1442 O  O   . ALA A 1 194 ? -7.946  8.231  -21.311 1.00 72.18  ? 212 ALA A O   1 
ATOM   1443 C  CB  . ALA A 1 194 ? -4.907  7.825  -23.339 1.00 75.47  ? 212 ALA A CB  1 
ATOM   1444 N  N   . PRO A 1 199 ? -15.211 2.561  -13.863 1.00 72.25  ? 217 PRO A N   1 
ATOM   1445 C  CA  . PRO A 1 199 ? -14.491 1.883  -12.794 1.00 76.96  ? 217 PRO A CA  1 
ATOM   1446 C  C   . PRO A 1 199 ? -13.962 2.879  -11.743 1.00 78.40  ? 217 PRO A C   1 
ATOM   1447 O  O   . PRO A 1 199 ? -14.194 4.081  -11.863 1.00 86.96  ? 217 PRO A O   1 
ATOM   1448 C  CB  . PRO A 1 199 ? -13.326 1.213  -13.549 1.00 78.01  ? 217 PRO A CB  1 
ATOM   1449 C  CG  . PRO A 1 199 ? -13.780 1.084  -14.982 1.00 77.14  ? 217 PRO A CG  1 
ATOM   1450 C  CD  . PRO A 1 199 ? -15.065 1.856  -15.151 1.00 77.56  ? 217 PRO A CD  1 
ATOM   1451 N  N   . ALA A 1 200 ? -13.274 2.386  -10.719 1.00 75.10  ? 218 ALA A N   1 
ATOM   1452 C  CA  . ALA A 1 200 ? -12.513 3.253  -9.814  1.00 72.15  ? 218 ALA A CA  1 
ATOM   1453 C  C   . ALA A 1 200 ? -11.270 3.899  -10.496 1.00 68.74  ? 218 ALA A C   1 
ATOM   1454 O  O   . ALA A 1 200 ? -10.247 3.239  -10.746 1.00 68.02  ? 218 ALA A O   1 
ATOM   1455 C  CB  . ALA A 1 200 ? -12.121 2.478  -8.560  1.00 74.08  ? 218 ALA A CB  1 
ATOM   1456 N  N   . SER A 1 201 ? -11.354 5.198  -10.772 1.00 68.67  ? 219 SER A N   1 
ATOM   1457 C  CA  . SER A 1 201 ? -10.364 5.871  -11.630 1.00 67.73  ? 219 SER A CA  1 
ATOM   1458 C  C   . SER A 1 201 ? -9.261  6.669  -10.883 1.00 68.71  ? 219 SER A C   1 
ATOM   1459 O  O   . SER A 1 201 ? -9.176  6.601  -9.644  1.00 69.35  ? 219 SER A O   1 
ATOM   1460 C  CB  . SER A 1 201 ? -11.108 6.746  -12.635 1.00 70.02  ? 219 SER A CB  1 
ATOM   1461 O  OG  . SER A 1 201 ? -12.050 5.970  -13.361 1.00 69.40  ? 219 SER A OG  1 
ATOM   1462 N  N   . CYS A 1 202 ? -8.401  7.393  -11.620 1.00 58.76  ? 220 CYS A N   1 
ATOM   1463 C  CA  . CYS A 1 202 ? -7.489  8.345  -10.969 1.00 60.93  ? 220 CYS A CA  1 
ATOM   1464 C  C   . CYS A 1 202 ? -8.299  9.258  -10.035 1.00 54.53  ? 220 CYS A C   1 
ATOM   1465 O  O   . CYS A 1 202 ? -7.832  9.568  -8.941  1.00 55.56  ? 220 CYS A O   1 
ATOM   1466 C  CB  . CYS A 1 202 ? -6.645  9.166  -11.975 1.00 64.96  ? 220 CYS A CB  1 
ATOM   1467 S  SG  . CYS A 1 202 ? -5.666  10.577 -11.317 1.00 65.88  ? 220 CYS A SG  1 
ATOM   1468 N  N   . LEU A 1 203 ? -9.510  9.642  -10.456 1.00 45.60  ? 221 LEU A N   1 
ATOM   1469 C  CA  . LEU A 1 203 ? -10.338 10.542 -9.672  1.00 48.25  ? 221 LEU A CA  1 
ATOM   1470 C  C   . LEU A 1 203 ? -10.819 9.834  -8.406  1.00 46.00  ? 221 LEU A C   1 
ATOM   1471 O  O   . LEU A 1 203 ? -10.640 10.350 -7.300  1.00 43.70  ? 221 LEU A O   1 
ATOM   1472 C  CB  . LEU A 1 203 ? -11.487 11.152 -10.498 1.00 48.25  ? 221 LEU A CB  1 
ATOM   1473 C  CG  . LEU A 1 203 ? -12.502 12.076 -9.794  1.00 53.06  ? 221 LEU A CG  1 
ATOM   1474 C  CD1 . LEU A 1 203 ? -11.895 13.306 -9.141  1.00 52.51  ? 221 LEU A CD1 1 
ATOM   1475 C  CD2 . LEU A 1 203 ? -13.578 12.541 -10.748 1.00 56.19  ? 221 LEU A CD2 1 
ATOM   1476 N  N   . SER A 1 204 ? -11.390 8.641  -8.554  1.00 45.65  ? 222 SER A N   1 
ATOM   1477 C  CA  . SER A 1 204 ? -11.621 7.794  -7.390  1.00 46.73  ? 222 SER A CA  1 
ATOM   1478 C  C   . SER A 1 204 ? -10.365 7.718  -6.470  1.00 43.07  ? 222 SER A C   1 
ATOM   1479 O  O   . SER A 1 204 ? -10.482 7.863  -5.243  1.00 33.47  ? 222 SER A O   1 
ATOM   1480 C  CB  . SER A 1 204 ? -12.039 6.389  -7.816  1.00 52.28  ? 222 SER A CB  1 
ATOM   1481 O  OG  . SER A 1 204 ? -10.930 5.491  -7.911  1.00 50.78  ? 222 SER A OG  1 
ATOM   1482 N  N   . ARG A 1 205 ? -9.181  7.527  -7.069  1.00 37.82  ? 223 ARG A N   1 
ATOM   1483 C  CA  . ARG A 1 205 ? -7.941  7.386  -6.278  1.00 45.42  ? 223 ARG A CA  1 
ATOM   1484 C  C   . ARG A 1 205 ? -7.683  8.697  -5.562  1.00 39.52  ? 223 ARG A C   1 
ATOM   1485 O  O   . ARG A 1 205 ? -7.359  8.725  -4.376  1.00 42.08  ? 223 ARG A O   1 
ATOM   1486 C  CB  . ARG A 1 205 ? -6.712  6.970  -7.128  1.00 45.06  ? 223 ARG A CB  1 
ATOM   1487 C  CG  . ARG A 1 205 ? -6.354  5.485  -7.088  1.00 48.53  ? 223 ARG A CG  1 
ATOM   1488 C  CD  . ARG A 1 205 ? -5.162  5.144  -7.996  1.00 53.78  ? 223 ARG A CD  1 
ATOM   1489 N  NE  . ARG A 1 205 ? -5.389  5.488  -9.417  1.00 57.20  ? 223 ARG A NE  1 
ATOM   1490 C  CZ  . ARG A 1 205 ? -5.816  4.642  -10.368 1.00 63.60  ? 223 ARG A CZ  1 
ATOM   1491 N  NH1 . ARG A 1 205 ? -6.072  3.366  -10.089 1.00 70.54  ? 223 ARG A NH1 1 
ATOM   1492 N  NH2 . ARG A 1 205 ? -5.990  5.061  -11.618 1.00 61.74  ? 223 ARG A NH2 1 
ATOM   1493 N  N   . LEU A 1 206 ? -7.871  9.775  -6.303  1.00 38.07  ? 224 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 206 ? -7.676  11.117 -5.811  1.00 40.28  ? 224 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 206 ? -8.670  11.428 -4.675  1.00 39.18  ? 224 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 206 ? -8.268  11.896 -3.595  1.00 40.52  ? 224 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 206 ? -7.792  12.093 -6.994  1.00 41.21  ? 224 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 206 ? -7.841  13.586 -6.707  1.00 43.75  ? 224 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 206 ? -6.989  14.338 -7.705  1.00 50.31  ? 224 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 206 ? -9.268  14.097 -6.755  1.00 46.79  ? 224 LEU A CD2 1 
ATOM   1501 N  N   . LEU A 1 207 ? -9.950  11.146 -4.904  1.00 35.84  ? 225 LEU A N   1 
ATOM   1502 C  CA  . LEU A 1 207 ? -10.974 11.308 -3.849  1.00 36.95  ? 225 LEU A CA  1 
ATOM   1503 C  C   . LEU A 1 207 ? -10.569 10.606 -2.551  1.00 35.73  ? 225 LEU A C   1 
ATOM   1504 O  O   . LEU A 1 207 ? -10.836 11.114 -1.478  1.00 36.86  ? 225 LEU A O   1 
ATOM   1505 C  CB  . LEU A 1 207 ? -12.350 10.822 -4.348  1.00 35.13  ? 225 LEU A CB  1 
ATOM   1506 C  CG  . LEU A 1 207 ? -13.341 11.912 -4.833  1.00 37.35  ? 225 LEU A CG  1 
ATOM   1507 C  CD1 . LEU A 1 207 ? -12.694 13.236 -5.270  1.00 33.24  ? 225 LEU A CD1 1 
ATOM   1508 C  CD2 . LEU A 1 207 ? -14.307 11.386 -5.875  1.00 30.21  ? 225 LEU A CD2 1 
ATOM   1509 N  N   . GLY A 1 208 ? -9.901  9.458  -2.672  1.00 35.18  ? 226 GLY A N   1 
ATOM   1510 C  CA  . GLY A 1 208 ? -9.290  8.739  -1.561  1.00 36.94  ? 226 GLY A CA  1 
ATOM   1511 C  C   . GLY A 1 208 ? -8.249  9.519  -0.740  1.00 38.44  ? 226 GLY A C   1 
ATOM   1512 O  O   . GLY A 1 208 ? -7.976  9.155  0.400   1.00 36.73  ? 226 GLY A O   1 
ATOM   1513 N  N   . LYS A 1 209 ? -7.664  10.579 -1.291  1.00 35.62  ? 227 LYS A N   1 
ATOM   1514 C  CA  . LYS A 1 209 ? -6.734  11.402 -0.527  1.00 35.38  ? 227 LYS A CA  1 
ATOM   1515 C  C   . LYS A 1 209 ? -7.478  12.521 0.204   1.00 37.66  ? 227 LYS A C   1 
ATOM   1516 O  O   . LYS A 1 209 ? -6.919  13.156 1.089   1.00 38.10  ? 227 LYS A O   1 
ATOM   1517 C  CB  . LYS A 1 209 ? -5.659  12.047 -1.419  1.00 38.51  ? 227 LYS A CB  1 
ATOM   1518 C  CG  . LYS A 1 209 ? -4.890  11.128 -2.365  1.00 40.54  ? 227 LYS A CG  1 
ATOM   1519 C  CD  . LYS A 1 209 ? -4.225  9.953  -1.657  1.00 42.25  ? 227 LYS A CD  1 
ATOM   1520 C  CE  . LYS A 1 209 ? -3.029  9.412  -2.460  1.00 43.39  ? 227 LYS A CE  1 
ATOM   1521 N  NZ  . LYS A 1 209 ? -2.286  8.429  -1.619  1.00 45.22  ? 227 LYS A NZ  1 
ATOM   1522 N  N   . LEU A 1 210 ? -8.725  12.789 -0.174  1.00 35.66  ? 228 LEU A N   1 
ATOM   1523 C  CA  . LEU A 1 210 ? -9.526  13.790 0.538   1.00 38.74  ? 228 LEU A CA  1 
ATOM   1524 C  C   . LEU A 1 210 ? -9.452  13.760 2.089   1.00 37.67  ? 228 LEU A C   1 
ATOM   1525 O  O   . LEU A 1 210 ? -9.318  14.804 2.674   1.00 41.56  ? 228 LEU A O   1 
ATOM   1526 C  CB  . LEU A 1 210 ? -10.977 13.794 0.045   1.00 40.32  ? 228 LEU A CB  1 
ATOM   1527 C  CG  . LEU A 1 210 ? -11.733 15.099 -0.265  1.00 42.45  ? 228 LEU A CG  1 
ATOM   1528 C  CD1 . LEU A 1 210 ? -10.858 16.296 -0.622  1.00 39.57  ? 228 LEU A CD1 1 
ATOM   1529 C  CD2 . LEU A 1 210 ? -12.705 14.796 -1.377  1.00 38.80  ? 228 LEU A CD2 1 
ATOM   1530 N  N   . PRO A 1 211 ? -9.527  12.577 2.754   1.00 39.66  ? 229 PRO A N   1 
ATOM   1531 C  CA  . PRO A 1 211 ? -9.372  12.603 4.256   1.00 36.91  ? 229 PRO A CA  1 
ATOM   1532 C  C   . PRO A 1 211 ? -8.042  13.148 4.739   1.00 31.98  ? 229 PRO A C   1 
ATOM   1533 O  O   . PRO A 1 211 ? -7.973  13.856 5.748   1.00 31.95  ? 229 PRO A O   1 
ATOM   1534 C  CB  . PRO A 1 211 ? -9.514  11.125 4.665   1.00 35.35  ? 229 PRO A CB  1 
ATOM   1535 C  CG  . PRO A 1 211 ? -10.327 10.520 3.554   1.00 38.85  ? 229 PRO A CG  1 
ATOM   1536 C  CD  . PRO A 1 211 ? -9.869  11.214 2.284   1.00 38.56  ? 229 PRO A CD  1 
ATOM   1537 N  N   . GLU A 1 212 ? -6.983  12.885 4.008   1.00 32.01  ? 230 GLU A N   1 
ATOM   1538 C  CA  . GLU A 1 212 ? -5.718  13.529 4.344   1.00 32.82  ? 230 GLU A CA  1 
ATOM   1539 C  C   . GLU A 1 212 ? -5.850  15.077 4.291   1.00 29.02  ? 230 GLU A C   1 
ATOM   1540 O  O   . GLU A 1 212 ? -5.461  15.747 5.221   1.00 29.19  ? 230 GLU A O   1 
ATOM   1541 C  CB  . GLU A 1 212 ? -4.607  13.022 3.432   1.00 37.19  ? 230 GLU A CB  1 
ATOM   1542 C  CG  . GLU A 1 212 ? -3.196  13.208 3.981   1.00 42.31  ? 230 GLU A CG  1 
ATOM   1543 C  CD  . GLU A 1 212 ? -2.140  12.460 3.175   1.00 44.22  ? 230 GLU A CD  1 
ATOM   1544 O  OE1 . GLU A 1 212 ? -0.935  12.751 3.418   1.00 37.27  ? 230 GLU A OE1 1 
ATOM   1545 O  OE2 . GLU A 1 212 ? -2.514  11.591 2.322   1.00 42.78  ? 230 GLU A OE2 1 
ATOM   1546 N  N   . LEU A 1 213 ? -6.418  15.612 3.210   1.00 25.88  ? 231 LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 213 ? -6.577  17.060 3.022   1.00 27.34  ? 231 LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 213 ? -7.466  17.660 4.106   1.00 27.16  ? 231 LEU A C   1 
ATOM   1549 O  O   . LEU A 1 213 ? -7.110  18.645 4.734   1.00 28.07  ? 231 LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 213 ? -7.111  17.381 1.608   1.00 25.99  ? 231 LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 213 ? -7.418  18.845 1.235   1.00 26.89  ? 231 LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 213 ? -6.238  19.773 1.513   1.00 26.29  ? 231 LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 213 ? -7.784  18.918 -0.238  1.00 27.10  ? 231 LEU A CD2 1 
ATOM   1554 N  N   . ARG A 1 214 ? -8.631  17.072 4.305   1.00 32.29  ? 232 ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 214 ? -9.507  17.333 5.456   1.00 35.63  ? 232 ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 214 ? -8.782  17.443 6.827   1.00 34.29  ? 232 ARG A C   1 
ATOM   1557 O  O   . ARG A 1 214 ? -8.954  18.408 7.562   1.00 40.34  ? 232 ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 214 ? -10.519 16.208 5.490   1.00 38.57  ? 232 ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 214 ? -11.916 16.605 5.941   1.00 52.28  ? 232 ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 214 ? -12.943 16.184 4.897   1.00 54.45  ? 232 ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 214 ? -12.706 14.796 4.508   1.00 57.88  ? 232 ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 214 ? -13.222 14.219 3.432   1.00 53.80  ? 232 ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 214 ? -14.029 14.908 2.635   1.00 48.33  ? 232 ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 214 ? -12.932 12.952 3.174   1.00 50.48  ? 232 ARG A NH2 1 
ATOM   1565 N  N   . THR A 1 215 ? -7.958  16.459 7.159   1.00 33.67  ? 233 THR A N   1 
ATOM   1566 C  CA  . THR A 1 215 ? -7.161  16.502 8.408   1.00 32.96  ? 233 THR A CA  1 
ATOM   1567 C  C   . THR A 1 215 ? -6.140  17.616 8.430   1.00 28.73  ? 233 THR A C   1 
ATOM   1568 O  O   . THR A 1 215 ? -5.776  18.112 9.467   1.00 29.46  ? 233 THR A O   1 
ATOM   1569 C  CB  . THR A 1 215 ? -6.447  15.161 8.659   1.00 31.71  ? 233 THR A CB  1 
ATOM   1570 O  OG1 . THR A 1 215 ? -7.432  14.185 9.003   1.00 33.35  ? 233 THR A OG1 1 
ATOM   1571 C  CG2 . THR A 1 215 ? -5.432  15.252 9.803   1.00 31.33  ? 233 THR A CG2 1 
ATOM   1572 N  N   . LEU A 1 216 ? -5.636  17.985 7.267   1.00 28.68  ? 234 LEU A N   1 
ATOM   1573 C  CA  . LEU A 1 216 ? -4.616  18.977 7.227   1.00 23.43  ? 234 LEU A CA  1 
ATOM   1574 C  C   . LEU A 1 216 ? -5.255  20.335 7.468   1.00 21.83  ? 234 LEU A C   1 
ATOM   1575 O  O   . LEU A 1 216 ? -4.608  21.239 8.045   1.00 21.15  ? 234 LEU A O   1 
ATOM   1576 C  CB  . LEU A 1 216 ? -3.881  18.900 5.886   1.00 25.48  ? 234 LEU A CB  1 
ATOM   1577 C  CG  . LEU A 1 216 ? -2.922  17.728 5.762   1.00 27.04  ? 234 LEU A CG  1 
ATOM   1578 C  CD1 . LEU A 1 216 ? -2.479  17.710 4.325   1.00 24.85  ? 234 LEU A CD1 1 
ATOM   1579 C  CD2 . LEU A 1 216 ? -1.698  17.848 6.661   1.00 23.47  ? 234 LEU A CD2 1 
ATOM   1580 N  N   . CYS A 1 217 ? -6.512  20.483 7.050   1.00 20.07  ? 235 CYS A N   1 
ATOM   1581 C  CA  . CYS A 1 217 ? -7.257  21.720 7.321   1.00 23.80  ? 235 CYS A CA  1 
ATOM   1582 C  C   . CYS A 1 217 ? -7.538  21.870 8.838   1.00 24.20  ? 235 CYS A C   1 
ATOM   1583 O  O   . CYS A 1 217 ? -7.293  22.923 9.387   1.00 25.36  ? 235 CYS A O   1 
ATOM   1584 C  CB  . CYS A 1 217 ? -8.594  21.750 6.580   1.00 25.38  ? 235 CYS A CB  1 
ATOM   1585 S  SG  . CYS A 1 217 ? -8.550  21.790 4.800   1.00 28.48  ? 235 CYS A SG  1 
ATOM   1586 N  N   . THR A 1 218 ? -8.085  20.817 9.462   1.00 21.60  ? 236 THR A N   1 
ATOM   1587 C  CA  . THR A 1 218 ? -8.152  20.715 10.892  1.00 25.07  ? 236 THR A CA  1 
ATOM   1588 C  C   . THR A 1 218 ? -6.781  21.111 11.492  1.00 24.60  ? 236 THR A C   1 
ATOM   1589 O  O   . THR A 1 218 ? -6.727  22.057 12.278  1.00 27.64  ? 236 THR A O   1 
ATOM   1590 C  CB  . THR A 1 218 ? -8.572  19.288 11.350  1.00 24.79  ? 236 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 218 ? -9.714  18.887 10.610  1.00 26.85  ? 236 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 218 ? -8.924  19.233 12.850  1.00 23.97  ? 236 THR A CG2 1 
ATOM   1593 N  N   . GLN A 1 219 ? -5.692  20.450 11.109  1.00 23.35  ? 237 GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 219 ? -4.383  20.791 11.688  1.00 25.73  ? 237 GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 219 ? -4.024  22.272 11.492  1.00 26.54  ? 237 GLN A C   1 
ATOM   1596 O  O   . GLN A 1 219 ? -3.316  22.865 12.329  1.00 26.09  ? 237 GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 219 ? -3.242  19.930 11.147  1.00 28.46  ? 237 GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 219 ? -3.261  18.438 11.501  1.00 32.93  ? 237 GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 219 ? -2.095  17.692 10.815  1.00 41.80  ? 237 GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 219 ? -0.915  18.143 10.819  1.00 39.57  ? 237 GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 219 ? -2.417  16.555 10.210  1.00 43.40  ? 237 GLN A NE2 1 
ATOM   1602 N  N   . GLY A 1 220 ? -4.492  22.878 10.397  1.00 23.71  ? 238 GLY A N   1 
ATOM   1603 C  CA  . GLY A 1 220 ? -4.255  24.321 10.200  1.00 20.34  ? 238 GLY A CA  1 
ATOM   1604 C  C   . GLY A 1 220 ? -5.054  25.108 11.219  1.00 20.68  ? 238 GLY A C   1 
ATOM   1605 O  O   . GLY A 1 220 ? -4.554  26.038 11.828  1.00 18.79  ? 238 GLY A O   1 
ATOM   1606 N  N   . LEU A 1 221 ? -6.311  24.719 11.411  1.00 21.42  ? 239 LEU A N   1 
ATOM   1607 C  CA  . LEU A 1 221 ? -7.161  25.442 12.338  1.00 24.06  ? 239 LEU A CA  1 
ATOM   1608 C  C   . LEU A 1 221 ? -6.548  25.350 13.756  1.00 24.51  ? 239 LEU A C   1 
ATOM   1609 O  O   . LEU A 1 221 ? -6.604  26.314 14.508  1.00 26.36  ? 239 LEU A O   1 
ATOM   1610 C  CB  . LEU A 1 221 ? -8.609  24.917 12.295  1.00 22.29  ? 239 LEU A CB  1 
ATOM   1611 C  CG  . LEU A 1 221 ? -9.474  25.305 11.075  1.00 25.27  ? 239 LEU A CG  1 
ATOM   1612 C  CD1 . LEU A 1 221 ? -10.805 24.579 11.081  1.00 24.29  ? 239 LEU A CD1 1 
ATOM   1613 C  CD2 . LEU A 1 221 ? -9.749  26.798 11.026  1.00 23.77  ? 239 LEU A CD2 1 
ATOM   1614 N  N   . GLN A 1 222 ? -5.940  24.215 14.091  1.00 23.31  ? 240 GLN A N   1 
ATOM   1615 C  CA  . GLN A 1 222 ? -5.325  24.033 15.405  1.00 24.30  ? 240 GLN A CA  1 
ATOM   1616 C  C   . GLN A 1 222 ? -4.066  24.864 15.591  1.00 25.25  ? 240 GLN A C   1 
ATOM   1617 O  O   . GLN A 1 222 ? -3.825  25.408 16.642  1.00 25.01  ? 240 GLN A O   1 
ATOM   1618 C  CB  . GLN A 1 222 ? -4.960  22.569 15.624  1.00 28.49  ? 240 GLN A CB  1 
ATOM   1619 C  CG  . GLN A 1 222 ? -6.117  21.621 15.761  1.00 27.42  ? 240 GLN A CG  1 
ATOM   1620 C  CD  . GLN A 1 222 ? -5.627  20.183 15.896  1.00 31.97  ? 240 GLN A CD  1 
ATOM   1621 O  OE1 . GLN A 1 222 ? -5.314  19.486 14.889  1.00 29.58  ? 240 GLN A OE1 1 
ATOM   1622 N  NE2 . GLN A 1 222 ? -5.582  19.710 17.142  1.00 30.42  ? 240 GLN A NE2 1 
ATOM   1623 N  N   . ARG A 1 223 ? -3.240  24.946 14.561  1.00 23.47  ? 241 ARG A N   1 
ATOM   1624 C  CA  . ARG A 1 223 ? -2.051  25.750 14.651  1.00 22.95  ? 241 ARG A CA  1 
ATOM   1625 C  C   . ARG A 1 223 ? -2.426  27.208 14.892  1.00 20.67  ? 241 ARG A C   1 
ATOM   1626 O  O   . ARG A 1 223 ? -1.849  27.842 15.740  1.00 20.44  ? 241 ARG A O   1 
ATOM   1627 C  CB  . ARG A 1 223 ? -1.194  25.615 13.374  1.00 22.08  ? 241 ARG A CB  1 
ATOM   1628 C  CG  . ARG A 1 223 ? 0.079   26.449 13.444  1.00 22.95  ? 241 ARG A CG  1 
ATOM   1629 C  CD  . ARG A 1 223 ? 0.974   25.867 14.549  1.00 22.85  ? 241 ARG A CD  1 
ATOM   1630 N  NE  . ARG A 1 223 ? 2.227   26.618 14.696  1.00 23.09  ? 241 ARG A NE  1 
ATOM   1631 C  CZ  . ARG A 1 223 ? 3.079   26.450 15.717  1.00 22.16  ? 241 ARG A CZ  1 
ATOM   1632 N  NH1 . ARG A 1 223 ? 2.803   25.544 16.648  1.00 21.88  ? 241 ARG A NH1 1 
ATOM   1633 N  NH2 . ARG A 1 223 ? 4.187   27.177 15.801  1.00 19.34  ? 241 ARG A NH2 1 
ATOM   1634 N  N   . ILE A 1 224 ? -3.417  27.709 14.158  1.00 21.22  ? 242 ILE A N   1 
ATOM   1635 C  CA  . ILE A 1 224 ? -3.908  29.102 14.332  1.00 21.00  ? 242 ILE A CA  1 
ATOM   1636 C  C   . ILE A 1 224 ? -4.507  29.320 15.738  1.00 19.89  ? 242 ILE A C   1 
ATOM   1637 O  O   . ILE A 1 224 ? -4.223  30.303 16.373  1.00 18.13  ? 242 ILE A O   1 
ATOM   1638 C  CB  . ILE A 1 224 ? -4.932  29.473 13.258  1.00 19.57  ? 242 ILE A CB  1 
ATOM   1639 C  CG1 . ILE A 1 224 ? -4.251  29.479 11.905  1.00 20.91  ? 242 ILE A CG1 1 
ATOM   1640 C  CG2 . ILE A 1 224 ? -5.567  30.845 13.509  1.00 18.95  ? 242 ILE A CG2 1 
ATOM   1641 C  CD1 . ILE A 1 224 ? -5.211  29.720 10.748  1.00 20.89  ? 242 ILE A CD1 1 
ATOM   1642 N  N   . PHE A 1 225 ? -5.319  28.379 16.211  1.00 22.03  ? 243 PHE A N   1 
ATOM   1643 C  CA  . PHE A 1 225 ? -5.770  28.472 17.578  1.00 24.68  ? 243 PHE A CA  1 
ATOM   1644 C  C   . PHE A 1 225 ? -4.551  28.632 18.514  1.00 25.17  ? 243 PHE A C   1 
ATOM   1645 O  O   . PHE A 1 225 ? -4.512  29.507 19.369  1.00 25.63  ? 243 PHE A O   1 
ATOM   1646 C  CB  . PHE A 1 225 ? -6.650  27.264 17.961  1.00 24.03  ? 243 PHE A CB  1 
ATOM   1647 C  CG  . PHE A 1 225 ? -6.982  27.216 19.441  1.00 22.76  ? 243 PHE A CG  1 
ATOM   1648 C  CD1 . PHE A 1 225 ? -7.916  28.093 19.991  1.00 24.74  ? 243 PHE A CD1 1 
ATOM   1649 C  CD2 . PHE A 1 225 ? -6.343  26.345 20.272  1.00 25.67  ? 243 PHE A CD2 1 
ATOM   1650 C  CE1 . PHE A 1 225 ? -8.190  28.067 21.351  1.00 26.35  ? 243 PHE A CE1 1 
ATOM   1651 C  CE2 . PHE A 1 225 ? -6.618  26.300 21.645  1.00 25.58  ? 243 PHE A CE2 1 
ATOM   1652 C  CZ  . PHE A 1 225 ? -7.532  27.157 22.172  1.00 26.10  ? 243 PHE A CZ  1 
ATOM   1653 N  N   . TYR A 1 226 ? -3.558  27.770 18.343  1.00 25.53  ? 244 TYR A N   1 
ATOM   1654 C  CA  . TYR A 1 226 ? -2.451  27.738 19.260  1.00 26.34  ? 244 TYR A CA  1 
ATOM   1655 C  C   . TYR A 1 226 ? -1.738  29.106 19.288  1.00 27.49  ? 244 TYR A C   1 
ATOM   1656 O  O   . TYR A 1 226 ? -1.469  29.664 20.358  1.00 28.85  ? 244 TYR A O   1 
ATOM   1657 C  CB  . TYR A 1 226 ? -1.491  26.598 18.917  1.00 25.56  ? 244 TYR A CB  1 
ATOM   1658 C  CG  . TYR A 1 226 ? -0.160  26.811 19.640  1.00 30.12  ? 244 TYR A CG  1 
ATOM   1659 C  CD1 . TYR A 1 226 ? 0.011   26.453 20.997  1.00 30.21  ? 244 TYR A CD1 1 
ATOM   1660 C  CD2 . TYR A 1 226 ? 0.914   27.398 18.988  1.00 27.61  ? 244 TYR A CD2 1 
ATOM   1661 C  CE1 . TYR A 1 226 ? 1.224   26.672 21.648  1.00 28.48  ? 244 TYR A CE1 1 
ATOM   1662 C  CE2 . TYR A 1 226 ? 2.113   27.617 19.631  1.00 30.21  ? 244 TYR A CE2 1 
ATOM   1663 C  CZ  . TYR A 1 226 ? 2.262   27.264 20.955  1.00 31.17  ? 244 TYR A CZ  1 
ATOM   1664 O  OH  . TYR A 1 226 ? 3.479   27.521 21.556  1.00 37.46  ? 244 TYR A OH  1 
ATOM   1665 N  N   . LEU A 1 227 ? -1.495  29.668 18.104  1.00 24.37  ? 245 LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 227 ? -0.769  30.915 17.959  1.00 21.88  ? 245 LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 227 ? -1.598  32.074 18.456  1.00 21.89  ? 245 LEU A C   1 
ATOM   1668 O  O   . LEU A 1 227 ? -1.060  33.043 18.913  1.00 20.66  ? 245 LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 227 ? -0.391  31.156 16.478  1.00 22.26  ? 245 LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 227 ? 0.503   30.171 15.716  1.00 20.44  ? 245 LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 227 ? 0.534   30.488 14.237  1.00 22.22  ? 245 LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 227 ? 1.897   30.296 16.198  1.00 20.19  ? 245 LEU A CD2 1 
ATOM   1673 N  N   . LYS A 1 228 ? -2.910  31.979 18.368  1.00 21.90  ? 246 LYS A N   1 
ATOM   1674 C  CA  . LYS A 1 228 ? -3.757  33.058 18.861  1.00 25.57  ? 246 LYS A CA  1 
ATOM   1675 C  C   . LYS A 1 228 ? -3.704  33.036 20.399  1.00 28.97  ? 246 LYS A C   1 
ATOM   1676 O  O   . LYS A 1 228 ? -3.726  34.071 21.048  1.00 29.36  ? 246 LYS A O   1 
ATOM   1677 C  CB  . LYS A 1 228 ? -5.203  32.862 18.382  1.00 23.45  ? 246 LYS A CB  1 
ATOM   1678 C  CG  . LYS A 1 228 ? -5.454  33.422 16.976  1.00 26.69  ? 246 LYS A CG  1 
ATOM   1679 C  CD  . LYS A 1 228 ? -6.773  32.993 16.341  1.00 26.13  ? 246 LYS A CD  1 
ATOM   1680 C  CE  . LYS A 1 228 ? -7.962  33.566 17.119  1.00 27.48  ? 246 LYS A CE  1 
ATOM   1681 N  NZ  . LYS A 1 228 ? -8.027  35.045 16.969  1.00 25.10  ? 246 LYS A NZ  1 
ATOM   1682 N  N   . LEU A 1 229 ? -3.675  31.833 20.944  1.00 27.72  ? 247 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 229 ? -3.613  31.604 22.355  1.00 33.37  ? 247 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 229 ? -2.307  32.261 22.819  1.00 34.97  ? 247 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 229 ? -2.315  33.079 23.744  1.00 32.78  ? 247 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 229 ? -3.654  30.083 22.592  1.00 33.19  ? 247 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 229 ? -4.144  29.596 23.932  1.00 39.85  ? 247 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 229 ? -5.258  30.464 24.483  1.00 39.07  ? 247 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 229 ? -4.596  28.161 23.825  1.00 41.54  ? 247 LEU A CD2 1 
ATOM   1690 N  N   . GLU A 1 230 ? -1.231  31.977 22.074  1.00 34.84  ? 248 GLU A N   1 
ATOM   1691 C  CA  . GLU A 1 230 ? 0.099   32.468 22.351  1.00 35.05  ? 248 GLU A CA  1 
ATOM   1692 C  C   . GLU A 1 230 ? 0.236   33.978 22.099  1.00 36.42  ? 248 GLU A C   1 
ATOM   1693 O  O   . GLU A 1 230 ? 0.948   34.680 22.810  1.00 37.86  ? 248 GLU A O   1 
ATOM   1694 C  CB  . GLU A 1 230 ? 1.130   31.670 21.541  1.00 33.99  ? 248 GLU A CB  1 
ATOM   1695 C  CG  . GLU A 1 230 ? 2.529   32.260 21.564  1.00 39.58  ? 248 GLU A CG  1 
ATOM   1696 C  CD  . GLU A 1 230 ? 3.571   31.410 20.839  1.00 41.32  ? 248 GLU A CD  1 
ATOM   1697 O  OE1 . GLU A 1 230 ? 3.487   31.316 19.602  1.00 38.56  ? 248 GLU A OE1 1 
ATOM   1698 O  OE2 . GLU A 1 230 ? 4.489   30.850 21.497  1.00 44.06  ? 248 GLU A OE2 1 
ATOM   1699 N  N   . ASP A 1 231 ? -0.440  34.463 21.080  1.00 32.55  ? 249 ASP A N   1 
ATOM   1700 C  CA  . ASP A 1 231 ? -0.630  35.878 20.865  1.00 32.19  ? 249 ASP A CA  1 
ATOM   1701 C  C   . ASP A 1 231 ? 0.657   36.714 20.798  1.00 31.28  ? 249 ASP A C   1 
ATOM   1702 O  O   . ASP A 1 231 ? 0.664   37.853 21.264  1.00 32.41  ? 249 ASP A O   1 
ATOM   1703 C  CB  . ASP A 1 231 ? -1.603  36.405 21.922  1.00 34.98  ? 249 ASP A CB  1 
ATOM   1704 C  CG  . ASP A 1 231 ? -1.985  37.849 21.701  1.00 39.91  ? 249 ASP A CG  1 
ATOM   1705 O  OD1 . ASP A 1 231 ? -2.441  38.196 20.592  1.00 40.28  ? 249 ASP A OD1 1 
ATOM   1706 O  OD2 . ASP A 1 231 ? -1.814  38.651 22.655  1.00 47.42  ? 249 ASP A OD2 1 
ATOM   1707 N  N   . LEU A 1 232 ? 1.739   36.181 20.200  1.00 29.48  ? 250 LEU A N   1 
ATOM   1708 C  CA  . LEU A 1 232 ? 2.965   36.989 19.961  1.00 24.43  ? 250 LEU A CA  1 
ATOM   1709 C  C   . LEU A 1 232 ? 2.728   38.198 19.112  1.00 26.59  ? 250 LEU A C   1 
ATOM   1710 O  O   . LEU A 1 232 ? 3.329   39.252 19.337  1.00 24.31  ? 250 LEU A O   1 
ATOM   1711 C  CB  . LEU A 1 232 ? 4.105   36.191 19.344  1.00 25.37  ? 250 LEU A CB  1 
ATOM   1712 C  CG  . LEU A 1 232 ? 4.549   34.950 20.154  1.00 25.68  ? 250 LEU A CG  1 
ATOM   1713 C  CD1 . LEU A 1 232 ? 5.811   34.338 19.564  1.00 25.31  ? 250 LEU A CD1 1 
ATOM   1714 C  CD2 . LEU A 1 232 ? 4.700   35.274 21.639  1.00 27.20  ? 250 LEU A CD2 1 
ATOM   1715 N  N   . VAL A 1 233 ? 1.868   38.036 18.115  1.00 30.08  ? 251 VAL A N   1 
ATOM   1716 C  CA  . VAL A 1 233 ? 1.480   39.117 17.194  1.00 30.90  ? 251 VAL A CA  1 
ATOM   1717 C  C   . VAL A 1 233 ? 0.025   38.913 16.758  1.00 30.61  ? 251 VAL A C   1 
ATOM   1718 O  O   . VAL A 1 233 ? -0.436  37.781 16.680  1.00 29.93  ? 251 VAL A O   1 
ATOM   1719 C  CB  . VAL A 1 233 ? 2.359   39.143 15.945  1.00 31.51  ? 251 VAL A CB  1 
ATOM   1720 C  CG1 . VAL A 1 233 ? 3.818   39.129 16.332  1.00 33.12  ? 251 VAL A CG1 1 
ATOM   1721 C  CG2 . VAL A 1 233 ? 2.050   37.954 15.034  1.00 35.80  ? 251 VAL A CG2 1 
ATOM   1722 N  N   . PRO A 1 234 ? -0.696  40.006 16.471  1.00 28.96  ? 252 PRO A N   1 
ATOM   1723 C  CA  . PRO A 1 234 ? -2.100  39.794 16.094  1.00 28.65  ? 252 PRO A CA  1 
ATOM   1724 C  C   . PRO A 1 234 ? -2.240  39.099 14.720  1.00 30.61  ? 252 PRO A C   1 
ATOM   1725 O  O   . PRO A 1 234 ? -1.410  39.307 13.845  1.00 33.25  ? 252 PRO A O   1 
ATOM   1726 C  CB  . PRO A 1 234 ? -2.687  41.208 16.033  1.00 30.11  ? 252 PRO A CB  1 
ATOM   1727 C  CG  . PRO A 1 234 ? -1.533  42.179 16.160  1.00 31.72  ? 252 PRO A CG  1 
ATOM   1728 C  CD  . PRO A 1 234 ? -0.264  41.420 16.464  1.00 27.52  ? 252 PRO A CD  1 
ATOM   1729 N  N   . PRO A 1 235 ? -3.298  38.299 14.509  1.00 30.14  ? 253 PRO A N   1 
ATOM   1730 C  CA  . PRO A 1 235 ? -3.419  37.781 13.132  1.00 28.14  ? 253 PRO A CA  1 
ATOM   1731 C  C   . PRO A 1 235 ? -4.013  38.794 12.148  1.00 31.03  ? 253 PRO A C   1 
ATOM   1732 O  O   . PRO A 1 235 ? -4.685  39.739 12.576  1.00 31.82  ? 253 PRO A O   1 
ATOM   1733 C  CB  . PRO A 1 235 ? -4.371  36.605 13.279  1.00 26.19  ? 253 PRO A CB  1 
ATOM   1734 C  CG  . PRO A 1 235 ? -4.686  36.471 14.735  1.00 28.33  ? 253 PRO A CG  1 
ATOM   1735 C  CD  . PRO A 1 235 ? -4.328  37.752 15.413  1.00 27.28  ? 253 PRO A CD  1 
ATOM   1736 N  N   . PRO A 1 236 ? -3.795  38.592 10.827  1.00 29.38  ? 254 PRO A N   1 
ATOM   1737 C  CA  . PRO A 1 236 ? -4.463  39.426 9.838   1.00 29.16  ? 254 PRO A CA  1 
ATOM   1738 C  C   . PRO A 1 236 ? -5.971  39.222 10.042  1.00 29.66  ? 254 PRO A C   1 
ATOM   1739 O  O   . PRO A 1 236 ? -6.388  38.116 10.334  1.00 28.59  ? 254 PRO A O   1 
ATOM   1740 C  CB  . PRO A 1 236 ? -4.012  38.822 8.491   1.00 28.23  ? 254 PRO A CB  1 
ATOM   1741 C  CG  . PRO A 1 236 ? -2.814  37.952 8.802   1.00 26.31  ? 254 PRO A CG  1 
ATOM   1742 C  CD  . PRO A 1 236 ? -3.111  37.451 10.191  1.00 29.24  ? 254 PRO A CD  1 
ATOM   1743 N  N   . PRO A 1 237 ? -6.768  40.300 9.934   1.00 29.98  ? 255 PRO A N   1 
ATOM   1744 C  CA  . PRO A 1 237 ? -8.227  40.313 10.123  1.00 27.28  ? 255 PRO A CA  1 
ATOM   1745 C  C   . PRO A 1 237 ? -8.946  39.275 9.289   1.00 28.48  ? 255 PRO A C   1 
ATOM   1746 O  O   . PRO A 1 237 ? -9.782  38.544 9.851   1.00 28.01  ? 255 PRO A O   1 
ATOM   1747 C  CB  . PRO A 1 237 ? -8.646  41.729 9.647   1.00 30.59  ? 255 PRO A CB  1 
ATOM   1748 C  CG  . PRO A 1 237 ? -7.403  42.564 9.782   1.00 32.14  ? 255 PRO A CG  1 
ATOM   1749 C  CD  . PRO A 1 237 ? -6.214  41.637 9.642   1.00 29.97  ? 255 PRO A CD  1 
ATOM   1750 N  N   . ILE A 1 238 ? -8.651  39.192 7.976   1.00 25.47  ? 256 ILE A N   1 
ATOM   1751 C  CA  . ILE A 1 238 ? -9.371  38.226 7.132   1.00 27.77  ? 256 ILE A CA  1 
ATOM   1752 C  C   . ILE A 1 238 ? -9.012  36.785 7.495   1.00 26.30  ? 256 ILE A C   1 
ATOM   1753 O  O   . ILE A 1 238 ? -9.863  35.904 7.477   1.00 29.80  ? 256 ILE A O   1 
ATOM   1754 C  CB  . ILE A 1 238 ? -9.318  38.520 5.596   1.00 29.69  ? 256 ILE A CB  1 
ATOM   1755 C  CG1 . ILE A 1 238 ? -9.790  39.943 5.286   1.00 32.02  ? 256 ILE A CG1 1 
ATOM   1756 C  CG2 . ILE A 1 238 ? -10.287 37.637 4.825   1.00 26.38  ? 256 ILE A CG2 1 
ATOM   1757 C  CD1 . ILE A 1 238 ? -8.938  40.644 4.224   1.00 38.02  ? 256 ILE A CD1 1 
ATOM   1758 N  N   . ILE A 1 239 ? -7.780  36.538 7.906   1.00 28.01  ? 257 ILE A N   1 
ATOM   1759 C  CA  . ILE A 1 239 ? -7.415  35.164 8.378   1.00 26.67  ? 257 ILE A CA  1 
ATOM   1760 C  C   . ILE A 1 239 ? -8.132  34.838 9.697   1.00 25.75  ? 257 ILE A C   1 
ATOM   1761 O  O   . ILE A 1 239 ? -8.672  33.745 9.906   1.00 24.09  ? 257 ILE A O   1 
ATOM   1762 C  CB  . ILE A 1 239 ? -5.875  34.948 8.486   1.00 24.77  ? 257 ILE A CB  1 
ATOM   1763 C  CG1 . ILE A 1 239 ? -5.173  35.208 7.135   1.00 22.84  ? 257 ILE A CG1 1 
ATOM   1764 C  CG2 . ILE A 1 239 ? -5.585  33.553 9.005   1.00 22.78  ? 257 ILE A CG2 1 
ATOM   1765 C  CD1 . ILE A 1 239 ? -5.671  34.385 5.955   1.00 23.05  ? 257 ILE A CD1 1 
ATOM   1766 N  N   . ASP A 1 240 ? -8.183  35.840 10.553  1.00 26.75  ? 258 ASP A N   1 
ATOM   1767 C  CA  . ASP A 1 240 ? -8.834  35.708 11.845  1.00 29.24  ? 258 ASP A CA  1 
ATOM   1768 C  C   . ASP A 1 240 ? -10.314 35.497 11.629  1.00 27.76  ? 258 ASP A C   1 
ATOM   1769 O  O   . ASP A 1 240 ? -10.936 34.725 12.354  1.00 28.66  ? 258 ASP A O   1 
ATOM   1770 C  CB  . ASP A 1 240 ? -8.525  36.946 12.755  1.00 30.34  ? 258 ASP A CB  1 
ATOM   1771 C  CG  . ASP A 1 240 ? -8.857  36.683 14.250  1.00 33.43  ? 258 ASP A CG  1 
ATOM   1772 O  OD1 . ASP A 1 240 ? -8.589  35.558 14.715  1.00 31.44  ? 258 ASP A OD1 1 
ATOM   1773 O  OD2 . ASP A 1 240 ? -9.395  37.587 14.969  1.00 32.90  ? 258 ASP A OD2 1 
ATOM   1774 N  N   . LYS A 1 241 ? -10.896 36.167 10.625  1.00 25.54  ? 259 LYS A N   1 
ATOM   1775 C  CA  . LYS A 1 241 ? -12.334 35.976 10.354  1.00 27.45  ? 259 LYS A CA  1 
ATOM   1776 C  C   . LYS A 1 241 ? -12.639 34.549 9.822   1.00 26.74  ? 259 LYS A C   1 
ATOM   1777 O  O   . LYS A 1 241 ? -13.628 33.909 10.231  1.00 23.96  ? 259 LYS A O   1 
ATOM   1778 C  CB  . LYS A 1 241 ? -12.871 37.101 9.410   1.00 29.91  ? 259 LYS A CB  1 
ATOM   1779 C  CG  . LYS A 1 241 ? -14.202 36.786 8.740   1.00 28.87  ? 259 LYS A CG  1 
ATOM   1780 C  CD  . LYS A 1 241 ? -14.447 37.754 7.581   1.00 31.20  ? 259 LYS A CD  1 
ATOM   1781 C  CE  . LYS A 1 241 ? -15.928 38.019 7.388   1.00 29.05  ? 259 LYS A CE  1 
ATOM   1782 N  NZ  . LYS A 1 241 ? -16.611 36.764 6.963   1.00 32.97  ? 259 LYS A NZ  1 
ATOM   1783 N  N   . ILE A 1 242 ? -11.758 34.050 8.933   1.00 27.20  ? 260 ILE A N   1 
ATOM   1784 C  CA  . ILE A 1 242 ? -11.861 32.681 8.400   1.00 26.58  ? 260 ILE A CA  1 
ATOM   1785 C  C   . ILE A 1 242 ? -11.790 31.642 9.535   1.00 26.69  ? 260 ILE A C   1 
ATOM   1786 O  O   . ILE A 1 242 ? -12.628 30.715 9.652   1.00 29.86  ? 260 ILE A O   1 
ATOM   1787 C  CB  . ILE A 1 242 ? -10.778 32.442 7.310   1.00 26.08  ? 260 ILE A CB  1 
ATOM   1788 C  CG1 . ILE A 1 242 ? -11.140 33.210 6.039   1.00 24.62  ? 260 ILE A CG1 1 
ATOM   1789 C  CG2 . ILE A 1 242 ? -10.646 30.964 7.018   1.00 26.48  ? 260 ILE A CG2 1 
ATOM   1790 C  CD1 . ILE A 1 242 ? -10.055 33.320 4.966   1.00 24.34  ? 260 ILE A CD1 1 
ATOM   1791 N  N   . PHE A 1 243 ? -10.789 31.787 10.375  1.00 23.94  ? 261 PHE A N   1 
ATOM   1792 C  CA  . PHE A 1 243 ? -10.681 30.936 11.561  1.00 25.60  ? 261 PHE A CA  1 
ATOM   1793 C  C   . PHE A 1 243 ? -11.980 30.997 12.351  1.00 26.74  ? 261 PHE A C   1 
ATOM   1794 O  O   . PHE A 1 243 ? -12.554 29.965 12.663  1.00 32.58  ? 261 PHE A O   1 
ATOM   1795 C  CB  . PHE A 1 243 ? -9.505  31.375 12.454  1.00 25.18  ? 261 PHE A CB  1 
ATOM   1796 C  CG  . PHE A 1 243 ? -9.415  30.630 13.779  1.00 27.23  ? 261 PHE A CG  1 
ATOM   1797 C  CD1 . PHE A 1 243 ? -8.864  29.358 13.837  1.00 23.21  ? 261 PHE A CD1 1 
ATOM   1798 C  CD2 . PHE A 1 243 ? -9.913  31.210 14.977  1.00 27.48  ? 261 PHE A CD2 1 
ATOM   1799 C  CE1 . PHE A 1 243 ? -8.770  28.677 15.047  1.00 24.94  ? 261 PHE A CE1 1 
ATOM   1800 C  CE2 . PHE A 1 243 ? -9.820  30.534 16.199  1.00 24.39  ? 261 PHE A CE2 1 
ATOM   1801 C  CZ  . PHE A 1 243 ? -9.239  29.271 16.227  1.00 25.09  ? 261 PHE A CZ  1 
ATOM   1802 N  N   . MET A 1 244 ? -12.447 32.203 12.656  1.00 29.27  ? 262 MET A N   1 
ATOM   1803 C  CA  . MET A 1 244 ? -13.629 32.383 13.501  1.00 30.43  ? 262 MET A CA  1 
ATOM   1804 C  C   . MET A 1 244 ? -14.905 31.855 12.786  1.00 32.30  ? 262 MET A C   1 
ATOM   1805 O  O   . MET A 1 244 ? -15.699 31.146 13.401  1.00 30.49  ? 262 MET A O   1 
ATOM   1806 C  CB  . MET A 1 244 ? -13.760 33.851 13.939  1.00 29.56  ? 262 MET A CB  1 
ATOM   1807 C  CG  . MET A 1 244 ? -12.698 34.400 14.909  1.00 28.64  ? 262 MET A CG  1 
ATOM   1808 S  SD  . MET A 1 244 ? -12.424 33.361 16.374  1.00 34.90  ? 262 MET A SD  1 
ATOM   1809 C  CE  . MET A 1 244 ? -11.271 34.393 17.242  1.00 35.02  ? 262 MET A CE  1 
ATOM   1810 N  N   . ASP A 1 245 ? -15.053 32.121 11.477  1.00 33.80  ? 263 ASP A N   1 
ATOM   1811 C  CA  . ASP A 1 245 ? -16.246 31.676 10.715  1.00 34.73  ? 263 ASP A CA  1 
ATOM   1812 C  C   . ASP A 1 245 ? -16.376 30.179 10.633  1.00 36.40  ? 263 ASP A C   1 
ATOM   1813 O  O   . ASP A 1 245 ? -17.479 29.664 10.521  1.00 35.24  ? 263 ASP A O   1 
ATOM   1814 C  CB  . ASP A 1 245 ? -16.311 32.262 9.279   1.00 34.14  ? 263 ASP A CB  1 
ATOM   1815 C  CG  . ASP A 1 245 ? -16.795 33.702 9.258   1.00 36.45  ? 263 ASP A CG  1 
ATOM   1816 O  OD1 . ASP A 1 245 ? -17.076 34.234 10.348  1.00 41.38  ? 263 ASP A OD1 1 
ATOM   1817 O  OD2 . ASP A 1 245 ? -16.882 34.318 8.175   1.00 38.50  ? 263 ASP A OD2 1 
ATOM   1818 N  N   . THR A 1 246 ? -15.244 29.480 10.676  1.00 40.60  ? 264 THR A N   1 
ATOM   1819 C  CA  . THR A 1 246 ? -15.224 28.027 10.474  1.00 38.70  ? 264 THR A CA  1 
ATOM   1820 C  C   . THR A 1 246 ? -15.565 27.242 11.743  1.00 43.94  ? 264 THR A C   1 
ATOM   1821 O  O   . THR A 1 246 ? -15.873 26.041 11.675  1.00 41.34  ? 264 THR A O   1 
ATOM   1822 C  CB  . THR A 1 246 ? -13.856 27.544 9.975   1.00 40.79  ? 264 THR A CB  1 
ATOM   1823 O  OG1 . THR A 1 246 ? -13.201 28.564 9.181   1.00 32.00  ? 264 THR A OG1 1 
ATOM   1824 C  CG2 . THR A 1 246 ? -14.050 26.254 9.161   1.00 41.39  ? 264 THR A CG2 1 
ATOM   1825 N  N   . LEU A 1 247 ? -15.524 27.917 12.896  1.00 43.60  ? 265 LEU A N   1 
ATOM   1826 C  CA  . LEU A 1 247 ? -15.809 27.243 14.152  1.00 46.20  ? 265 LEU A CA  1 
ATOM   1827 C  C   . LEU A 1 247 ? -17.298 27.007 14.231  1.00 43.98  ? 265 LEU A C   1 
ATOM   1828 O  O   . LEU A 1 247 ? -18.048 27.981 14.264  1.00 45.64  ? 265 LEU A O   1 
ATOM   1829 C  CB  . LEU A 1 247 ? -15.348 28.091 15.331  1.00 43.93  ? 265 LEU A CB  1 
ATOM   1830 C  CG  . LEU A 1 247 ? -13.854 28.082 15.714  1.00 51.39  ? 265 LEU A CG  1 
ATOM   1831 C  CD1 . LEU A 1 247 ? -12.949 27.516 14.631  1.00 37.74  ? 265 LEU A CD1 1 
ATOM   1832 C  CD2 . LEU A 1 247 ? -13.361 29.453 16.207  1.00 46.98  ? 265 LEU A CD2 1 
ATOM   1833 N  N   . PRO A 1 248 ? -17.721 25.725 14.287  1.00 46.34  ? 266 PRO A N   1 
ATOM   1834 C  CA  . PRO A 1 248 ? -19.129 25.307 14.351  1.00 50.10  ? 266 PRO A CA  1 
ATOM   1835 C  C   . PRO A 1 248 ? -19.806 25.601 15.704  1.00 56.64  ? 266 PRO A C   1 
ATOM   1836 O  O   . PRO A 1 248 ? -21.018 25.504 15.800  1.00 62.54  ? 266 PRO A O   1 
ATOM   1837 C  CB  . PRO A 1 248 ? -19.047 23.791 14.142  1.00 48.69  ? 266 PRO A CB  1 
ATOM   1838 C  CG  . PRO A 1 248 ? -17.759 23.405 14.798  1.00 47.27  ? 266 PRO A CG  1 
ATOM   1839 C  CD  . PRO A 1 248 ? -16.818 24.588 14.584  1.00 49.05  ? 266 PRO A CD  1 
ATOM   1840 N  N   . PHE A 1 249 ? -19.030 25.939 16.736  1.00 59.77  ? 267 PHE A N   1 
ATOM   1841 C  CA  . PHE A 1 249 ? -19.579 26.229 18.065  1.00 59.20  ? 267 PHE A CA  1 
ATOM   1842 C  C   . PHE A 1 249 ? -19.823 27.713 18.338  1.00 62.83  ? 267 PHE A C   1 
ATOM   1843 O  O   . PHE A 1 249 ? -20.469 28.058 19.334  1.00 67.82  ? 267 PHE A O   1 
ATOM   1844 C  CB  . PHE A 1 249 ? -18.698 25.631 19.178  1.00 53.81  ? 267 PHE A CB  1 
ATOM   1845 C  CG  . PHE A 1 249 ? -17.211 25.895 19.017  1.00 51.44  ? 267 PHE A CG  1 
ATOM   1846 C  CD1 . PHE A 1 249 ? -16.622 27.043 19.569  1.00 47.03  ? 267 PHE A CD1 1 
ATOM   1847 C  CD2 . PHE A 1 249 ? -16.387 24.968 18.344  1.00 47.22  ? 267 PHE A CD2 1 
ATOM   1848 C  CE1 . PHE A 1 249 ? -15.253 27.270 19.443  1.00 46.20  ? 267 PHE A CE1 1 
ATOM   1849 C  CE2 . PHE A 1 249 ? -15.022 25.205 18.208  1.00 44.42  ? 267 PHE A CE2 1 
ATOM   1850 C  CZ  . PHE A 1 249 ? -14.457 26.352 18.761  1.00 45.39  ? 267 PHE A CZ  1 
ATOM   1851 N  N   . LEU A 1 250 ? -19.290 28.584 17.477  1.00 61.33  ? 268 LEU A N   1 
ATOM   1852 C  CA  . LEU A 1 250 ? -19.420 30.036 17.656  1.00 58.50  ? 268 LEU A CA  1 
ATOM   1853 C  C   . LEU A 1 250 ? -20.815 30.543 17.290  1.00 63.06  ? 268 LEU A C   1 
ATOM   1854 O  O   . LEU A 1 250 ? -21.443 30.058 16.340  1.00 68.29  ? 268 LEU A O   1 
ATOM   1855 C  CB  . LEU A 1 250 ? -18.336 30.800 16.872  1.00 55.53  ? 268 LEU A CB  1 
ATOM   1856 C  CG  . LEU A 1 250 ? -17.120 31.302 17.668  1.00 52.53  ? 268 LEU A CG  1 
ATOM   1857 C  CD1 . LEU A 1 250 ? -16.258 30.141 18.101  1.00 54.66  ? 268 LEU A CD1 1 
ATOM   1858 C  CD2 . LEU A 1 250 ? -16.276 32.272 16.870  1.00 48.61  ? 268 LEU A CD2 1 
ATOM   1859 N  N   . PRO B 1 12  ? 1.423   22.009 63.922  1.00 91.61  ? 30  PRO B N   1 
ATOM   1860 C  CA  . PRO B 1 12  ? 1.754   23.371 63.481  1.00 87.20  ? 30  PRO B CA  1 
ATOM   1861 C  C   . PRO B 1 12  ? 1.823   23.539 61.941  1.00 84.38  ? 30  PRO B C   1 
ATOM   1862 O  O   . PRO B 1 12  ? 1.957   22.548 61.210  1.00 80.51  ? 30  PRO B O   1 
ATOM   1863 C  CB  . PRO B 1 12  ? 3.132   23.608 64.108  1.00 88.62  ? 30  PRO B CB  1 
ATOM   1864 C  CG  . PRO B 1 12  ? 3.142   22.741 65.325  1.00 93.13  ? 30  PRO B CG  1 
ATOM   1865 C  CD  . PRO B 1 12  ? 2.299   21.537 65.012  1.00 84.15  ? 30  PRO B CD  1 
ATOM   1866 N  N   . ALA B 1 13  ? 1.664   24.766 61.442  1.00 79.79  ? 31  ALA B N   1 
ATOM   1867 C  CA  . ALA B 1 13  ? 1.091   25.890 62.198  1.00 73.62  ? 31  ALA B CA  1 
ATOM   1868 C  C   . ALA B 1 13  ? -0.329  26.103 61.666  1.00 61.40  ? 31  ALA B C   1 
ATOM   1869 O  O   . ALA B 1 13  ? -0.768  25.320 60.836  1.00 58.35  ? 31  ALA B O   1 
ATOM   1870 C  CB  . ALA B 1 13  ? 1.951   27.142 62.055  1.00 74.22  ? 31  ALA B CB  1 
ATOM   1871 N  N   . ASN B 1 14  ? -1.044  27.130 62.137  1.00 52.67  ? 32  ASN B N   1 
ATOM   1872 C  CA  . ASN B 1 14  ? -2.478  27.282 61.815  1.00 51.09  ? 32  ASN B CA  1 
ATOM   1873 C  C   . ASN B 1 14  ? -2.878  27.514 60.333  1.00 42.98  ? 32  ASN B C   1 
ATOM   1874 O  O   . ASN B 1 14  ? -3.813  26.864 59.857  1.00 42.52  ? 32  ASN B O   1 
ATOM   1875 C  CB  . ASN B 1 14  ? -3.165  28.282 62.741  1.00 60.17  ? 32  ASN B CB  1 
ATOM   1876 C  CG  . ASN B 1 14  ? -4.675  28.278 62.582  1.00 63.74  ? 32  ASN B CG  1 
ATOM   1877 O  OD1 . ASN B 1 14  ? -5.312  27.222 62.636  1.00 62.42  ? 32  ASN B OD1 1 
ATOM   1878 N  ND2 . ASN B 1 14  ? -5.259  29.470 62.384  1.00 65.55  ? 32  ASN B ND2 1 
ATOM   1879 N  N   . LEU B 1 15  ? -2.191  28.400 59.610  1.00 34.59  ? 33  LEU B N   1 
ATOM   1880 C  CA  . LEU B 1 15  ? -2.366  28.448 58.134  1.00 32.35  ? 33  LEU B CA  1 
ATOM   1881 C  C   . LEU B 1 15  ? -1.920  27.116 57.479  1.00 33.34  ? 33  LEU B C   1 
ATOM   1882 O  O   . LEU B 1 15  ? -2.694  26.475 56.723  1.00 26.84  ? 33  LEU B O   1 
ATOM   1883 C  CB  . LEU B 1 15  ? -1.591  29.612 57.524  1.00 33.80  ? 33  LEU B CB  1 
ATOM   1884 C  CG  . LEU B 1 15  ? -1.677  29.734 55.978  1.00 37.10  ? 33  LEU B CG  1 
ATOM   1885 C  CD1 . LEU B 1 15  ? -3.135  29.749 55.531  1.00 34.64  ? 33  LEU B CD1 1 
ATOM   1886 C  CD2 . LEU B 1 15  ? -0.927  30.942 55.411  1.00 32.93  ? 33  LEU B CD2 1 
ATOM   1887 N  N   . LEU B 1 16  ? -0.691  26.681 57.812  1.00 31.05  ? 34  LEU B N   1 
ATOM   1888 C  CA  . LEU B 1 16  ? -0.145  25.429 57.250  1.00 33.54  ? 34  LEU B CA  1 
ATOM   1889 C  C   . LEU B 1 16  ? -1.045  24.206 57.490  1.00 33.97  ? 34  LEU B C   1 
ATOM   1890 O  O   . LEU B 1 16  ? -1.185  23.377 56.594  1.00 35.48  ? 34  LEU B O   1 
ATOM   1891 C  CB  . LEU B 1 16  ? 1.320   25.186 57.654  1.00 29.80  ? 34  LEU B CB  1 
ATOM   1892 C  CG  . LEU B 1 16  ? 2.143   24.066 56.945  1.00 34.26  ? 34  LEU B CG  1 
ATOM   1893 C  CD1 . LEU B 1 16  ? 2.353   24.273 55.439  1.00 33.08  ? 34  LEU B CD1 1 
ATOM   1894 C  CD2 . LEU B 1 16  ? 3.492   23.831 57.612  1.00 31.15  ? 34  LEU B CD2 1 
ATOM   1895 N  N   . THR B 1 17  ? -1.714  24.145 58.644  1.00 31.32  ? 35  THR B N   1 
ATOM   1896 C  CA  . THR B 1 17  ? -2.532  22.970 59.021  1.00 34.10  ? 35  THR B CA  1 
ATOM   1897 C  C   . THR B 1 17  ? -3.901  23.003 58.355  1.00 30.15  ? 35  THR B C   1 
ATOM   1898 O  O   . THR B 1 17  ? -4.461  21.959 58.016  1.00 30.44  ? 35  THR B O   1 
ATOM   1899 C  CB  . THR B 1 17  ? -2.714  22.864 60.587  1.00 36.37  ? 35  THR B CB  1 
ATOM   1900 O  OG1 . THR B 1 17  ? -1.468  22.503 61.194  1.00 37.18  ? 35  THR B OG1 1 
ATOM   1901 C  CG2 . THR B 1 17  ? -3.787  21.827 60.978  1.00 34.85  ? 35  THR B CG2 1 
ATOM   1902 N  N   . SER B 1 18  ? -4.462  24.197 58.207  1.00 31.70  ? 36  SER B N   1 
ATOM   1903 C  CA  . SER B 1 18  ? -5.715  24.331 57.460  1.00 34.59  ? 36  SER B CA  1 
ATOM   1904 C  C   . SER B 1 18  ? -5.491  23.935 55.999  1.00 28.93  ? 36  SER B C   1 
ATOM   1905 O  O   . SER B 1 18  ? -6.272  23.165 55.432  1.00 29.81  ? 36  SER B O   1 
ATOM   1906 C  CB  . SER B 1 18  ? -6.281  25.741 57.560  1.00 31.89  ? 36  SER B CB  1 
ATOM   1907 O  OG  . SER B 1 18  ? -6.768  25.959 58.873  1.00 39.54  ? 36  SER B OG  1 
ATOM   1908 N  N   . LEU B 1 19  ? -4.419  24.437 55.405  1.00 29.89  ? 37  LEU B N   1 
ATOM   1909 C  CA  . LEU B 1 19  ? -4.107  24.064 54.002  1.00 32.29  ? 37  LEU B CA  1 
ATOM   1910 C  C   . LEU B 1 19  ? -3.998  22.561 53.880  1.00 31.92  ? 37  LEU B C   1 
ATOM   1911 O  O   . LEU B 1 19  ? -4.716  21.963 53.056  1.00 34.56  ? 37  LEU B O   1 
ATOM   1912 C  CB  . LEU B 1 19  ? -2.808  24.732 53.514  1.00 32.07  ? 37  LEU B CB  1 
ATOM   1913 C  CG  . LEU B 1 19  ? -2.876  26.247 53.339  1.00 30.21  ? 37  LEU B CG  1 
ATOM   1914 C  CD1 . LEU B 1 19  ? -1.512  26.851 53.113  1.00 29.31  ? 37  LEU B CD1 1 
ATOM   1915 C  CD2 . LEU B 1 19  ? -3.846  26.628 52.224  1.00 31.85  ? 37  LEU B CD2 1 
ATOM   1916 N  N   . VAL B 1 20  ? -3.145  21.958 54.737  1.00 33.37  ? 38  VAL B N   1 
ATOM   1917 C  CA  . VAL B 1 20  ? -2.897  20.499 54.738  1.00 30.80  ? 38  VAL B CA  1 
ATOM   1918 C  C   . VAL B 1 20  ? -4.253  19.766 54.804  1.00 34.06  ? 38  VAL B C   1 
ATOM   1919 O  O   . VAL B 1 20  ? -4.561  18.912 53.943  1.00 34.43  ? 38  VAL B O   1 
ATOM   1920 C  CB  . VAL B 1 20  ? -1.895  20.011 55.849  1.00 33.28  ? 38  VAL B CB  1 
ATOM   1921 C  CG1 . VAL B 1 20  ? -1.986  18.495 56.071  1.00 26.48  ? 38  VAL B CG1 1 
ATOM   1922 C  CG2 . VAL B 1 20  ? -0.472  20.393 55.486  1.00 29.39  ? 38  VAL B CG2 1 
ATOM   1923 N  N   . ARG B 1 21  ? -5.073  20.126 55.782  1.00 32.04  ? 39  ARG B N   1 
ATOM   1924 C  CA  . ARG B 1 21  ? -6.422  19.531 55.922  1.00 34.31  ? 39  ARG B CA  1 
ATOM   1925 C  C   . ARG B 1 21  ? -7.344  19.753 54.683  1.00 32.12  ? 39  ARG B C   1 
ATOM   1926 O  O   . ARG B 1 21  ? -8.117  18.867 54.281  1.00 28.07  ? 39  ARG B O   1 
ATOM   1927 C  CB  . ARG B 1 21  ? -7.086  20.095 57.189  1.00 35.56  ? 39  ARG B CB  1 
ATOM   1928 C  CG  . ARG B 1 21  ? -8.370  19.427 57.616  1.00 39.45  ? 39  ARG B CG  1 
ATOM   1929 C  CD  . ARG B 1 21  ? -9.144  20.407 58.510  1.00 54.07  ? 39  ARG B CD  1 
ATOM   1930 N  NE  . ARG B 1 21  ? -10.375 20.973 57.902  1.00 56.04  ? 39  ARG B NE  1 
ATOM   1931 C  CZ  . ARG B 1 21  ? -10.476 22.103 57.183  1.00 56.86  ? 39  ARG B CZ  1 
ATOM   1932 N  NH1 . ARG B 1 21  ? -11.677 22.446 56.725  1.00 58.56  ? 39  ARG B NH1 1 
ATOM   1933 N  NH2 . ARG B 1 21  ? -9.420  22.891 56.914  1.00 49.76  ? 39  ARG B NH2 1 
ATOM   1934 N  N   . ALA B 1 22  ? -7.287  20.943 54.087  1.00 29.13  ? 40  ALA B N   1 
ATOM   1935 C  CA  . ALA B 1 22  ? -8.154  21.162 52.945  1.00 28.69  ? 40  ALA B CA  1 
ATOM   1936 C  C   . ALA B 1 22  ? -7.674  20.270 51.806  1.00 26.82  ? 40  ALA B C   1 
ATOM   1937 O  O   . ALA B 1 22  ? -8.457  19.592 51.191  1.00 26.99  ? 40  ALA B O   1 
ATOM   1938 C  CB  . ALA B 1 22  ? -8.184  22.620 52.544  1.00 28.61  ? 40  ALA B CB  1 
ATOM   1939 N  N   . HIS B 1 23  ? -6.366  20.220 51.588  1.00 28.88  ? 41  HIS B N   1 
ATOM   1940 C  CA  . HIS B 1 23  ? -5.776  19.290 50.599  1.00 29.60  ? 41  HIS B CA  1 
ATOM   1941 C  C   . HIS B 1 23  ? -6.168  17.819 50.808  1.00 29.97  ? 41  HIS B C   1 
ATOM   1942 O  O   . HIS B 1 23  ? -6.872  17.222 49.983  1.00 28.14  ? 41  HIS B O   1 
ATOM   1943 C  CB  . HIS B 1 23  ? -4.260  19.470 50.521  1.00 29.09  ? 41  HIS B CB  1 
ATOM   1944 C  CG  . HIS B 1 23  ? -3.585  18.382 49.753  1.00 33.50  ? 41  HIS B CG  1 
ATOM   1945 N  ND1 . HIS B 1 23  ? -3.780  18.206 48.427  1.00 31.78  ? 41  HIS B ND1 1 
ATOM   1946 C  CD2 . HIS B 1 23  ? -2.765  17.341 50.168  1.00 33.40  ? 41  HIS B CD2 1 
ATOM   1947 C  CE1 . HIS B 1 23  ? -3.095  17.138 48.010  1.00 31.13  ? 41  HIS B CE1 1 
ATOM   1948 N  NE2 . HIS B 1 23  ? -2.478  16.601 49.073  1.00 36.92  ? 41  HIS B NE2 1 
ATOM   1949 N  N   . LEU B 1 24  ? -5.778  17.230 51.926  1.00 30.52  ? 42  LEU B N   1 
ATOM   1950 C  CA  . LEU B 1 24  ? -6.156  15.809 52.211  1.00 34.42  ? 42  LEU B CA  1 
ATOM   1951 C  C   . LEU B 1 24  ? -7.637  15.493 52.194  1.00 31.29  ? 42  LEU B C   1 
ATOM   1952 O  O   . LEU B 1 24  ? -8.037  14.379 51.862  1.00 29.94  ? 42  LEU B O   1 
ATOM   1953 C  CB  . LEU B 1 24  ? -5.593  15.315 53.562  1.00 36.26  ? 42  LEU B CB  1 
ATOM   1954 C  CG  . LEU B 1 24  ? -4.089  15.159 53.738  1.00 40.56  ? 42  LEU B CG  1 
ATOM   1955 C  CD1 . LEU B 1 24  ? -3.792  14.836 55.205  1.00 42.35  ? 42  LEU B CD1 1 
ATOM   1956 C  CD2 . LEU B 1 24  ? -3.514  14.087 52.832  1.00 38.96  ? 42  LEU B CD2 1 
ATOM   1957 N  N   . ASP B 1 25  ? -8.467  16.450 52.587  1.00 33.21  ? 43  ASP B N   1 
ATOM   1958 C  CA  . ASP B 1 25  ? -9.912  16.209 52.562  1.00 29.45  ? 43  ASP B CA  1 
ATOM   1959 C  C   . ASP B 1 25  ? -10.510 16.258 51.148  1.00 30.07  ? 43  ASP B C   1 
ATOM   1960 O  O   . ASP B 1 25  ? -11.602 15.709 50.936  1.00 25.81  ? 43  ASP B O   1 
ATOM   1961 C  CB  . ASP B 1 25  ? -10.605 17.183 53.480  1.00 33.92  ? 43  ASP B CB  1 
ATOM   1962 C  CG  . ASP B 1 25  ? -10.568 16.733 54.903  1.00 36.00  ? 43  ASP B CG  1 
ATOM   1963 O  OD1 . ASP B 1 25  ? -10.768 15.526 55.145  1.00 38.61  ? 43  ASP B OD1 1 
ATOM   1964 O  OD2 . ASP B 1 25  ? -10.328 17.572 55.782  1.00 40.25  ? 43  ASP B OD2 1 
ATOM   1965 N  N   . SER B 1 26  ? -9.770  16.832 50.176  1.00 28.63  ? 44  SER B N   1 
ATOM   1966 C  CA  . SER B 1 26  ? -10.280 17.021 48.784  1.00 28.11  ? 44  SER B CA  1 
ATOM   1967 C  C   . SER B 1 26  ? -9.984  15.870 47.839  1.00 31.37  ? 44  SER B C   1 
ATOM   1968 O  O   . SER B 1 26  ? -10.019 16.055 46.620  1.00 31.66  ? 44  SER B O   1 
ATOM   1969 C  CB  . SER B 1 26  ? -9.691  18.292 48.148  1.00 26.23  ? 44  SER B CB  1 
ATOM   1970 O  OG  . SER B 1 26  ? -8.304  18.125 47.894  1.00 24.33  ? 44  SER B OG  1 
ATOM   1971 N  N   . GLY B 1 27  ? -9.652  14.700 48.387  1.00 33.22  ? 45  GLY B N   1 
ATOM   1972 C  CA  . GLY B 1 27  ? -9.190  13.557 47.579  1.00 30.99  ? 45  GLY B CA  1 
ATOM   1973 C  C   . GLY B 1 27  ? -9.290  12.194 48.276  1.00 31.88  ? 45  GLY B C   1 
ATOM   1974 O  O   . GLY B 1 27  ? -9.612  12.134 49.484  1.00 31.65  ? 45  GLY B O   1 
ATOM   1975 N  N   . PRO B 1 28  ? -9.035  11.087 47.521  1.00 29.24  ? 46  PRO B N   1 
ATOM   1976 C  CA  . PRO B 1 28  ? -9.326  9.729  48.007  1.00 29.19  ? 46  PRO B CA  1 
ATOM   1977 C  C   . PRO B 1 28  ? -8.278  9.184  48.972  1.00 26.97  ? 46  PRO B C   1 
ATOM   1978 O  O   . PRO B 1 28  ? -7.068  9.399  48.786  1.00 29.28  ? 46  PRO B O   1 
ATOM   1979 C  CB  . PRO B 1 28  ? -9.381  8.888  46.722  1.00 27.30  ? 46  PRO B CB  1 
ATOM   1980 C  CG  . PRO B 1 28  ? -8.849  9.709  45.616  1.00 25.96  ? 46  PRO B CG  1 
ATOM   1981 C  CD  . PRO B 1 28  ? -8.550  11.079 46.125  1.00 30.55  ? 46  PRO B CD  1 
ATOM   1982 N  N   . SER B 1 29  ? -8.725  8.514  50.020  1.00 29.25  ? 47  SER B N   1 
ATOM   1983 C  CA  . SER B 1 29  ? -7.753  7.818  50.890  1.00 34.68  ? 47  SER B CA  1 
ATOM   1984 C  C   . SER B 1 29  ? -7.235  6.626  50.101  1.00 35.50  ? 47  SER B C   1 
ATOM   1985 O  O   . SER B 1 29  ? -7.852  6.228  49.091  1.00 33.21  ? 47  SER B O   1 
ATOM   1986 C  CB  . SER B 1 29  ? -8.386  7.308  52.176  1.00 32.66  ? 47  SER B CB  1 
ATOM   1987 O  OG  . SER B 1 29  ? -9.534  6.547  51.856  1.00 39.59  ? 47  SER B OG  1 
ATOM   1988 N  N   . THR B 1 30  ? -6.119  6.064  50.557  1.00 37.49  ? 48  THR B N   1 
ATOM   1989 C  CA  . THR B 1 30  ? -5.584  4.859  49.954  1.00 41.70  ? 48  THR B CA  1 
ATOM   1990 C  C   . THR B 1 30  ? -6.633  3.720  49.939  1.00 45.57  ? 48  THR B C   1 
ATOM   1991 O  O   . THR B 1 30  ? -6.713  2.968  48.951  1.00 49.85  ? 48  THR B O   1 
ATOM   1992 C  CB  . THR B 1 30  ? -4.231  4.488  50.588  1.00 47.43  ? 48  THR B CB  1 
ATOM   1993 O  OG1 . THR B 1 30  ? -3.176  5.183  49.894  1.00 52.24  ? 48  THR B OG1 1 
ATOM   1994 C  CG2 . THR B 1 30  ? -3.989  3.044  50.484  1.00 52.89  ? 48  THR B CG2 1 
ATOM   1995 N  N   . ALA B 1 31  ? -7.467  3.623  50.980  1.00 44.73  ? 49  ALA B N   1 
ATOM   1996 C  CA  . ALA B 1 31  ? -8.431  2.518  51.066  1.00 45.23  ? 49  ALA B CA  1 
ATOM   1997 C  C   . ALA B 1 31  ? -9.675  2.649  50.145  1.00 42.46  ? 49  ALA B C   1 
ATOM   1998 O  O   . ALA B 1 31  ? -10.379 1.680  49.955  1.00 39.23  ? 49  ALA B O   1 
ATOM   1999 C  CB  . ALA B 1 31  ? -8.856  2.269  52.528  1.00 45.90  ? 49  ALA B CB  1 
ATOM   2000 N  N   . LYS B 1 32  ? -9.946  3.840  49.612  1.00 36.70  ? 50  LYS B N   1 
ATOM   2001 C  CA  . LYS B 1 32  ? -11.134 4.083  48.805  1.00 38.52  ? 50  LYS B CA  1 
ATOM   2002 C  C   . LYS B 1 32  ? -10.836 4.162  47.298  1.00 41.06  ? 50  LYS B C   1 
ATOM   2003 O  O   . LYS B 1 32  ? -11.650 4.606  46.495  1.00 44.35  ? 50  LYS B O   1 
ATOM   2004 C  CB  . LYS B 1 32  ? -11.802 5.368  49.289  1.00 41.91  ? 50  LYS B CB  1 
ATOM   2005 C  CG  . LYS B 1 32  ? -12.415 5.210  50.674  1.00 44.41  ? 50  LYS B CG  1 
ATOM   2006 C  CD  . LYS B 1 32  ? -13.319 3.980  50.665  1.00 46.48  ? 50  LYS B CD  1 
ATOM   2007 C  CE  . LYS B 1 32  ? -13.974 3.675  52.007  1.00 46.97  ? 50  LYS B CE  1 
ATOM   2008 N  NZ  . LYS B 1 32  ? -14.971 2.611  51.727  1.00 43.07  ? 50  LYS B NZ  1 
ATOM   2009 N  N   . LEU B 1 33  ? -9.633  3.765  46.921  1.00 37.96  ? 51  LEU B N   1 
ATOM   2010 C  CA  . LEU B 1 33  ? -9.276  3.698  45.535  1.00 33.46  ? 51  LEU B CA  1 
ATOM   2011 C  C   . LEU B 1 33  ? -10.147 2.648  44.836  1.00 31.40  ? 51  LEU B C   1 
ATOM   2012 O  O   . LEU B 1 33  ? -10.395 1.572  45.386  1.00 29.72  ? 51  LEU B O   1 
ATOM   2013 C  CB  . LEU B 1 33  ? -7.814  3.314  45.452  1.00 28.11  ? 51  LEU B CB  1 
ATOM   2014 C  CG  . LEU B 1 33  ? -6.715  4.317  45.258  1.00 27.83  ? 51  LEU B CG  1 
ATOM   2015 C  CD1 . LEU B 1 33  ? -7.019  5.772  45.583  1.00 26.59  ? 51  LEU B CD1 1 
ATOM   2016 C  CD2 . LEU B 1 33  ? -5.428  3.785  45.898  1.00 26.30  ? 51  LEU B CD2 1 
ATOM   2017 N  N   . ASP B 1 34  ? -10.589 2.969  43.618  1.00 29.11  ? 52  ASP B N   1 
ATOM   2018 C  CA  . ASP B 1 34  ? -11.464 2.112  42.849  1.00 27.29  ? 52  ASP B CA  1 
ATOM   2019 C  C   . ASP B 1 34  ? -10.738 1.572  41.592  1.00 29.40  ? 52  ASP B C   1 
ATOM   2020 O  O   . ASP B 1 34  ? -10.537 2.307  40.613  1.00 26.12  ? 52  ASP B O   1 
ATOM   2021 C  CB  . ASP B 1 34  ? -12.688 2.916  42.459  1.00 27.70  ? 52  ASP B CB  1 
ATOM   2022 C  CG  . ASP B 1 34  ? -13.695 2.095  41.702  1.00 30.95  ? 52  ASP B CG  1 
ATOM   2023 O  OD1 . ASP B 1 34  ? -14.739 2.687  41.315  1.00 30.21  ? 52  ASP B OD1 1 
ATOM   2024 O  OD2 . ASP B 1 34  ? -13.433 0.855  41.492  1.00 29.15  ? 52  ASP B OD2 1 
ATOM   2025 N  N   . TYR B 1 35  ? -10.329 0.307  41.647  1.00 24.60  ? 53  TYR B N   1 
ATOM   2026 C  CA  . TYR B 1 35  ? -9.682  -0.348 40.539  1.00 26.91  ? 53  TYR B CA  1 
ATOM   2027 C  C   . TYR B 1 35  ? -10.623 -1.130 39.626  1.00 27.72  ? 53  TYR B C   1 
ATOM   2028 O  O   . TYR B 1 35  ? -10.157 -1.709 38.684  1.00 27.60  ? 53  TYR B O   1 
ATOM   2029 C  CB  . TYR B 1 35  ? -8.605  -1.311 41.058  1.00 26.75  ? 53  TYR B CB  1 
ATOM   2030 C  CG  . TYR B 1 35  ? -7.355  -0.587 41.503  1.00 26.72  ? 53  TYR B CG  1 
ATOM   2031 C  CD1 . TYR B 1 35  ? -7.240  -0.064 42.796  1.00 26.23  ? 53  TYR B CD1 1 
ATOM   2032 C  CD2 . TYR B 1 35  ? -6.269  -0.419 40.625  1.00 26.04  ? 53  TYR B CD2 1 
ATOM   2033 C  CE1 . TYR B 1 35  ? -6.070  0.614  43.191  1.00 25.87  ? 53  TYR B CE1 1 
ATOM   2034 C  CE2 . TYR B 1 35  ? -5.111  0.258  41.013  1.00 26.64  ? 53  TYR B CE2 1 
ATOM   2035 C  CZ  . TYR B 1 35  ? -5.011  0.768  42.301  1.00 25.87  ? 53  TYR B CZ  1 
ATOM   2036 O  OH  . TYR B 1 35  ? -3.846  1.436  42.681  1.00 26.08  ? 53  TYR B OH  1 
ATOM   2037 N  N   . SER B 1 36  ? -11.925 -1.170 39.914  1.00 28.76  ? 54  SER B N   1 
ATOM   2038 C  CA  . SER B 1 36  ? -12.905 -1.967 39.140  1.00 30.67  ? 54  SER B CA  1 
ATOM   2039 C  C   . SER B 1 36  ? -12.939 -1.644 37.632  1.00 31.80  ? 54  SER B C   1 
ATOM   2040 O  O   . SER B 1 36  ? -13.638 -2.330 36.896  1.00 34.25  ? 54  SER B O   1 
ATOM   2041 C  CB  . SER B 1 36  ? -14.324 -1.707 39.664  1.00 29.15  ? 54  SER B CB  1 
ATOM   2042 O  OG  . SER B 1 36  ? -14.558 -0.304 39.784  1.00 30.07  ? 54  SER B OG  1 
ATOM   2043 N  N   . LYS B 1 37  ? -12.219 -0.614 37.184  1.00 30.65  ? 55  LYS B N   1 
ATOM   2044 C  CA  . LYS B 1 37  ? -12.278 -0.199 35.795  1.00 30.53  ? 55  LYS B CA  1 
ATOM   2045 C  C   . LYS B 1 37  ? -10.942 -0.299 35.136  1.00 29.87  ? 55  LYS B C   1 
ATOM   2046 O  O   . LYS B 1 37  ? -10.838 -0.263 33.915  1.00 32.48  ? 55  LYS B O   1 
ATOM   2047 C  CB  . LYS B 1 37  ? -12.816 1.237  35.650  1.00 35.79  ? 55  LYS B CB  1 
ATOM   2048 C  CG  . LYS B 1 37  ? -14.328 1.368  35.854  1.00 40.71  ? 55  LYS B CG  1 
ATOM   2049 C  CD  . LYS B 1 37  ? -14.791 2.834  35.951  1.00 47.56  ? 55  LYS B CD  1 
ATOM   2050 C  CE  . LYS B 1 37  ? -15.062 3.525  34.598  1.00 47.64  ? 55  LYS B CE  1 
ATOM   2051 N  NZ  . LYS B 1 37  ? -15.609 4.913  34.787  1.00 47.45  ? 55  LYS B NZ  1 
ATOM   2052 N  N   . PHE B 1 38  ? -9.903  -0.388 35.941  1.00 29.81  ? 56  PHE B N   1 
ATOM   2053 C  CA  . PHE B 1 38  ? -8.542  -0.363 35.473  1.00 30.58  ? 56  PHE B CA  1 
ATOM   2054 C  C   . PHE B 1 38  ? -8.192  -1.595 34.620  1.00 35.49  ? 56  PHE B C   1 
ATOM   2055 O  O   . PHE B 1 38  ? -8.399  -2.733 35.050  1.00 33.69  ? 56  PHE B O   1 
ATOM   2056 C  CB  . PHE B 1 38  ? -7.683  -0.375 36.684  1.00 29.37  ? 56  PHE B CB  1 
ATOM   2057 C  CG  . PHE B 1 38  ? -6.245  -0.375 36.384  1.00 31.68  ? 56  PHE B CG  1 
ATOM   2058 C  CD1 . PHE B 1 38  ? -5.547  0.829  36.277  1.00 28.90  ? 56  PHE B CD1 1 
ATOM   2059 C  CD2 . PHE B 1 38  ? -5.563  -1.583 36.244  1.00 31.25  ? 56  PHE B CD2 1 
ATOM   2060 C  CE1 . PHE B 1 38  ? -4.175  0.818  36.019  1.00 31.73  ? 56  PHE B CE1 1 
ATOM   2061 C  CE2 . PHE B 1 38  ? -4.196  -1.595 35.996  1.00 34.61  ? 56  PHE B CE2 1 
ATOM   2062 C  CZ  . PHE B 1 38  ? -3.494  -0.394 35.898  1.00 30.89  ? 56  PHE B CZ  1 
ATOM   2063 N  N   . GLN B 1 39  ? -7.690  -1.329 33.418  1.00 36.31  ? 57  GLN B N   1 
ATOM   2064 C  CA  . GLN B 1 39  ? -7.218  -2.324 32.443  1.00 41.50  ? 57  GLN B CA  1 
ATOM   2065 C  C   . GLN B 1 39  ? -5.923  -1.760 31.884  1.00 40.63  ? 57  GLN B C   1 
ATOM   2066 O  O   . GLN B 1 39  ? -5.923  -0.741 31.177  1.00 39.62  ? 57  GLN B O   1 
ATOM   2067 C  CB  . GLN B 1 39  ? -8.163  -2.483 31.222  1.00 43.83  ? 57  GLN B CB  1 
ATOM   2068 C  CG  . GLN B 1 39  ? -9.434  -3.323 31.331  1.00 47.55  ? 57  GLN B CG  1 
ATOM   2069 C  CD  . GLN B 1 39  ? -10.120 -3.578 29.967  1.00 55.58  ? 57  GLN B CD  1 
ATOM   2070 O  OE1 . GLN B 1 39  ? -9.772  -2.969 28.931  1.00 52.18  ? 57  GLN B OE1 1 
ATOM   2071 N  NE2 . GLN B 1 39  ? -11.101 -4.498 29.962  1.00 52.25  ? 57  GLN B NE2 1 
ATOM   2072 N  N   . GLU B 1 40  ? -4.842  -2.446 32.206  1.00 42.66  ? 58  GLU B N   1 
ATOM   2073 C  CA  . GLU B 1 40  ? -3.514  -2.232 31.667  1.00 44.87  ? 58  GLU B CA  1 
ATOM   2074 C  C   . GLU B 1 40  ? -3.515  -2.665 30.198  1.00 49.33  ? 58  GLU B C   1 
ATOM   2075 O  O   . GLU B 1 40  ? -3.095  -1.934 29.309  1.00 42.01  ? 58  GLU B O   1 
ATOM   2076 C  CB  . GLU B 1 40  ? -2.494  -3.026 32.503  1.00 47.85  ? 58  GLU B CB  1 
ATOM   2077 C  CG  . GLU B 1 40  ? -2.910  -4.444 32.971  1.00 57.09  ? 58  GLU B CG  1 
ATOM   2078 C  CD  . GLU B 1 40  ? -3.889  -4.515 34.176  1.00 60.21  ? 58  GLU B CD  1 
ATOM   2079 O  OE1 . GLU B 1 40  ? -3.484  -4.987 35.275  1.00 61.87  ? 58  GLU B OE1 1 
ATOM   2080 O  OE2 . GLU B 1 40  ? -5.079  -4.138 34.036  1.00 59.40  ? 58  GLU B OE2 1 
ATOM   2081 N  N   . LEU B 1 41  ? -4.045  -3.843 29.922  1.00 53.06  ? 59  LEU B N   1 
ATOM   2082 C  CA  . LEU B 1 41  ? -4.219  -4.207 28.523  1.00 53.88  ? 59  LEU B CA  1 
ATOM   2083 C  C   . LEU B 1 41  ? -5.490  -3.632 27.980  1.00 53.13  ? 59  LEU B C   1 
ATOM   2084 O  O   . LEU B 1 41  ? -6.539  -3.771 28.569  1.00 64.65  ? 59  LEU B O   1 
ATOM   2085 C  CB  . LEU B 1 41  ? -4.151  -5.722 28.301  1.00 49.01  ? 59  LEU B CB  1 
ATOM   2086 C  CG  . LEU B 1 41  ? -2.750  -6.242 28.002  1.00 47.56  ? 59  LEU B CG  1 
ATOM   2087 C  CD1 . LEU B 1 41  ? -2.779  -7.751 27.869  1.00 45.77  ? 59  LEU B CD1 1 
ATOM   2088 C  CD2 . LEU B 1 41  ? -2.174  -5.593 26.743  1.00 41.09  ? 59  LEU B CD2 1 
ATOM   2089 N  N   . VAL B 1 42  ? -5.351  -2.916 26.884  1.00 56.81  ? 60  VAL B N   1 
ATOM   2090 C  CA  . VAL B 1 42  ? -6.452  -2.461 26.058  1.00 61.14  ? 60  VAL B CA  1 
ATOM   2091 C  C   . VAL B 1 42  ? -5.812  -2.570 24.668  1.00 68.71  ? 60  VAL B C   1 
ATOM   2092 O  O   . VAL B 1 42  ? -4.725  -3.169 24.541  1.00 59.60  ? 60  VAL B O   1 
ATOM   2093 C  CB  . VAL B 1 42  ? -7.017  -1.036 26.442  1.00 60.26  ? 60  VAL B CB  1 
ATOM   2094 C  CG1 . VAL B 1 42  ? -6.190  -0.307 27.510  1.00 55.11  ? 60  VAL B CG1 1 
ATOM   2095 C  CG2 . VAL B 1 42  ? -7.209  -0.144 25.227  1.00 52.45  ? 60  VAL B CG2 1 
ATOM   2096 N  N   . LEU B 1 43  ? -6.475  -2.027 23.644  1.00 76.84  ? 61  LEU B N   1 
ATOM   2097 C  CA  . LEU B 1 43  ? -6.005  -2.102 22.266  1.00 79.26  ? 61  LEU B CA  1 
ATOM   2098 C  C   . LEU B 1 43  ? -6.163  -3.567 21.805  1.00 88.79  ? 61  LEU B C   1 
ATOM   2099 O  O   . LEU B 1 43  ? -6.746  -4.378 22.537  1.00 88.75  ? 61  LEU B O   1 
ATOM   2100 C  CB  . LEU B 1 43  ? -4.555  -1.575 22.174  1.00 79.15  ? 61  LEU B CB  1 
ATOM   2101 C  CG  . LEU B 1 43  ? -4.377  -0.082 22.461  1.00 76.38  ? 61  LEU B CG  1 
ATOM   2102 C  CD1 . LEU B 1 43  ? -3.168  0.197  23.350  1.00 77.28  ? 61  LEU B CD1 1 
ATOM   2103 C  CD2 . LEU B 1 43  ? -4.258  0.653  21.140  1.00 78.52  ? 61  LEU B CD2 1 
ATOM   2104 N  N   . PRO B 1 44  ? -5.681  -3.914 20.596  1.00 95.27  ? 62  PRO B N   1 
ATOM   2105 C  CA  . PRO B 1 44  ? -5.072  -3.058 19.590  1.00 95.82  ? 62  PRO B CA  1 
ATOM   2106 C  C   . PRO B 1 44  ? -6.170  -2.385 18.791  1.00 103.61 ? 62  PRO B C   1 
ATOM   2107 O  O   . PRO B 1 44  ? -6.863  -3.046 18.008  1.00 113.45 ? 62  PRO B O   1 
ATOM   2108 C  CB  . PRO B 1 44  ? -4.285  -4.044 18.718  1.00 94.38  ? 62  PRO B CB  1 
ATOM   2109 C  CG  . PRO B 1 44  ? -4.344  -5.362 19.428  1.00 91.77  ? 62  PRO B CG  1 
ATOM   2110 C  CD  . PRO B 1 44  ? -5.626  -5.323 20.182  1.00 93.74  ? 62  PRO B CD  1 
ATOM   2111 N  N   . HIS B 1 45  ? -6.340  -1.086 19.019  1.00 101.83 ? 63  HIS B N   1 
ATOM   2112 C  CA  . HIS B 1 45  ? -7.410  -0.322 18.396  1.00 105.19 ? 63  HIS B CA  1 
ATOM   2113 C  C   . HIS B 1 45  ? -7.125  1.155  18.479  1.00 107.44 ? 63  HIS B C   1 
ATOM   2114 O  O   . HIS B 1 45  ? -5.977  1.574  18.671  1.00 110.56 ? 63  HIS B O   1 
ATOM   2115 C  CB  . HIS B 1 45  ? -8.750  -0.674 19.060  1.00 106.36 ? 63  HIS B CB  1 
ATOM   2116 C  CG  . HIS B 1 45  ? -9.949  -0.582 18.131  1.00 104.52 ? 63  HIS B CG  1 
ATOM   2117 N  ND1 . HIS B 1 45  ? -9.865  -0.817 16.803  1.00 105.52 ? 63  HIS B ND1 1 
ATOM   2118 C  CD2 . HIS B 1 45  ? -11.285 -0.292 18.395  1.00 101.05 ? 63  HIS B CD2 1 
ATOM   2119 C  CE1 . HIS B 1 45  ? -11.080 -0.670 16.244  1.00 99.61  ? 63  HIS B CE1 1 
ATOM   2120 N  NE2 . HIS B 1 45  ? -11.949 -0.349 17.216  1.00 103.80 ? 63  HIS B NE2 1 
ATOM   2121 N  N   . PHE B 1 46  ? -8.170  1.949  18.269  1.00 104.09 ? 64  PHE B N   1 
ATOM   2122 C  CA  . PHE B 1 46  ? -8.205  3.383  18.568  1.00 100.67 ? 64  PHE B CA  1 
ATOM   2123 C  C   . PHE B 1 46  ? -9.670  3.750  18.767  1.00 94.10  ? 64  PHE B C   1 
ATOM   2124 O  O   . PHE B 1 46  ? -10.524 2.862  18.899  1.00 92.72  ? 64  PHE B O   1 
ATOM   2125 C  CB  . PHE B 1 46  ? -7.560  4.254  17.464  1.00 103.34 ? 64  PHE B CB  1 
ATOM   2126 C  CG  . PHE B 1 46  ? -7.133  3.491  16.239  1.00 102.81 ? 64  PHE B CG  1 
ATOM   2127 C  CD1 . PHE B 1 46  ? -5.788  3.392  15.913  1.00 98.57  ? 64  PHE B CD1 1 
ATOM   2128 C  CD2 . PHE B 1 46  ? -8.069  2.869  15.415  1.00 108.26 ? 64  PHE B CD2 1 
ATOM   2129 C  CE1 . PHE B 1 46  ? -5.382  2.691  14.787  1.00 98.83  ? 64  PHE B CE1 1 
ATOM   2130 C  CE2 . PHE B 1 46  ? -7.666  2.157  14.292  1.00 110.00 ? 64  PHE B CE2 1 
ATOM   2131 C  CZ  . PHE B 1 46  ? -6.319  2.071  13.976  1.00 103.38 ? 64  PHE B CZ  1 
ATOM   2132 N  N   . GLY B 1 47  ? -9.957  5.046  18.813  0.50 88.92  ? 65  GLY B N   1 
ATOM   2133 C  CA  . GLY B 1 47  ? -11.328 5.528  18.787  0.50 86.92  ? 65  GLY B CA  1 
ATOM   2134 C  C   . GLY B 1 47  ? -11.877 5.555  17.366  0.50 89.14  ? 65  GLY B C   1 
ATOM   2135 O  O   . GLY B 1 47  ? -12.920 4.955  17.103  0.50 84.70  ? 65  GLY B O   1 
ATOM   2136 N  N   . LYS B 1 48  ? -11.202 6.240  16.434  1.00 94.07  ? 66  LYS B N   1 
ATOM   2137 C  CA  . LYS B 1 48  ? -9.974  7.024  16.668  1.00 84.42  ? 66  LYS B CA  1 
ATOM   2138 C  C   . LYS B 1 48  ? -10.250 8.059  17.751  1.00 87.66  ? 66  LYS B C   1 
ATOM   2139 O  O   . LYS B 1 48  ? -9.395  8.336  18.592  1.00 89.41  ? 66  LYS B O   1 
ATOM   2140 C  CB  . LYS B 1 48  ? -9.489  7.673  15.367  1.00 75.65  ? 66  LYS B CB  1 
ATOM   2141 C  CG  . LYS B 1 48  ? -9.125  6.674  14.275  1.00 70.44  ? 66  LYS B CG  1 
ATOM   2142 C  CD  . LYS B 1 48  ? -10.336 5.891  13.783  1.00 70.17  ? 66  LYS B CD  1 
ATOM   2143 C  CE  . LYS B 1 48  ? -9.932  4.704  12.929  1.00 73.00  ? 66  LYS B CE  1 
ATOM   2144 N  NZ  . LYS B 1 48  ? -10.857 3.552  13.125  1.00 67.33  ? 66  LYS B NZ  1 
ATOM   2145 N  N   . GLU B 1 49  ? -11.457 8.625  17.699  1.00 86.27  ? 67  GLU B N   1 
ATOM   2146 C  CA  . GLU B 1 49  ? -12.153 9.130  18.878  1.00 76.17  ? 67  GLU B CA  1 
ATOM   2147 C  C   . GLU B 1 49  ? -13.488 8.452  18.926  1.00 73.15  ? 67  GLU B C   1 
ATOM   2148 O  O   . GLU B 1 49  ? -14.277 8.583  18.000  1.00 76.46  ? 67  GLU B O   1 
ATOM   2149 C  CB  . GLU B 1 49  ? -12.409 10.626 18.805  1.00 72.11  ? 67  GLU B CB  1 
ATOM   2150 C  CG  . GLU B 1 49  ? -11.344 11.451 19.469  1.00 59.67  ? 67  GLU B CG  1 
ATOM   2151 C  CD  . GLU B 1 49  ? -10.369 11.953 18.449  1.00 63.78  ? 67  GLU B CD  1 
ATOM   2152 O  OE1 . GLU B 1 49  ? -10.823 12.727 17.583  1.00 57.64  ? 67  GLU B OE1 1 
ATOM   2153 O  OE2 . GLU B 1 49  ? -9.171  11.563 18.508  1.00 66.35  ? 67  GLU B OE2 1 
ATOM   2154 N  N   . ASP B 1 50  ? -13.748 7.722  19.998  1.00 77.05  ? 68  ASP B N   1 
ATOM   2155 C  CA  . ASP B 1 50  ? -15.092 7.222  20.217  1.00 76.07  ? 68  ASP B CA  1 
ATOM   2156 C  C   . ASP B 1 50  ? -15.756 8.181  21.203  1.00 73.60  ? 68  ASP B C   1 
ATOM   2157 O  O   . ASP B 1 50  ? -15.076 8.816  22.032  1.00 66.64  ? 68  ASP B O   1 
ATOM   2158 C  CB  . ASP B 1 50  ? -15.073 5.763  20.712  1.00 75.42  ? 68  ASP B CB  1 
ATOM   2159 C  CG  . ASP B 1 50  ? -16.408 5.316  21.303  1.00 84.08  ? 68  ASP B CG  1 
ATOM   2160 O  OD1 . ASP B 1 50  ? -17.413 5.213  20.560  1.00 86.27  ? 68  ASP B OD1 1 
ATOM   2161 O  OD2 . ASP B 1 50  ? -16.448 5.060  22.525  1.00 88.14  ? 68  ASP B OD2 1 
ATOM   2162 N  N   . ALA B 1 51  ? -17.076 8.309  21.081  1.00 67.41  ? 69  ALA B N   1 
ATOM   2163 C  CA  . ALA B 1 51  ? -17.876 9.064  22.041  1.00 65.01  ? 69  ALA B CA  1 
ATOM   2164 C  C   . ALA B 1 51  ? -17.432 8.746  23.464  1.00 60.99  ? 69  ALA B C   1 
ATOM   2165 O  O   . ALA B 1 51  ? -17.142 9.654  24.240  1.00 56.48  ? 69  ALA B O   1 
ATOM   2166 C  CB  . ALA B 1 51  ? -19.364 8.759  21.872  1.00 64.69  ? 69  ALA B CB  1 
ATOM   2167 N  N   . GLY B 1 52  ? -17.368 7.451  23.780  1.00 55.99  ? 70  GLY B N   1 
ATOM   2168 C  CA  . GLY B 1 52  ? -17.005 6.982  25.109  1.00 52.45  ? 70  GLY B CA  1 
ATOM   2169 C  C   . GLY B 1 52  ? -15.763 7.656  25.654  1.00 48.40  ? 70  GLY B C   1 
ATOM   2170 O  O   . GLY B 1 52  ? -15.794 8.202  26.742  1.00 49.78  ? 70  GLY B O   1 
ATOM   2171 N  N   . ASP B 1 53  ? -14.671 7.605  24.894  1.00 46.51  ? 71  ASP B N   1 
ATOM   2172 C  CA  . ASP B 1 53  ? -13.437 8.312  25.238  1.00 45.56  ? 71  ASP B CA  1 
ATOM   2173 C  C   . ASP B 1 53  ? -13.721 9.794  25.614  1.00 41.89  ? 71  ASP B C   1 
ATOM   2174 O  O   . ASP B 1 53  ? -13.368 10.268 26.700  1.00 41.75  ? 71  ASP B O   1 
ATOM   2175 C  CB  . ASP B 1 53  ? -12.484 8.234  24.039  1.00 49.32  ? 71  ASP B CB  1 
ATOM   2176 C  CG  . ASP B 1 53  ? -12.301 6.816  23.531  1.00 47.94  ? 71  ASP B CG  1 
ATOM   2177 O  OD1 . ASP B 1 53  ? -12.043 5.951  24.387  1.00 44.26  ? 71  ASP B OD1 1 
ATOM   2178 O  OD2 . ASP B 1 53  ? -12.408 6.585  22.292  1.00 46.53  ? 71  ASP B OD2 1 
ATOM   2179 N  N   . VAL B 1 54  ? -14.433 10.480 24.729  1.00 39.45  ? 72  VAL B N   1 
ATOM   2180 C  CA  . VAL B 1 54  ? -14.677 11.902 24.858  1.00 38.66  ? 72  VAL B CA  1 
ATOM   2181 C  C   . VAL B 1 54  ? -15.577 12.225 26.046  1.00 39.30  ? 72  VAL B C   1 
ATOM   2182 O  O   . VAL B 1 54  ? -15.258 13.119 26.844  1.00 39.88  ? 72  VAL B O   1 
ATOM   2183 C  CB  . VAL B 1 54  ? -15.154 12.499 23.541  1.00 36.61  ? 72  VAL B CB  1 
ATOM   2184 C  CG1 . VAL B 1 54  ? -15.468 13.983 23.693  1.00 35.39  ? 72  VAL B CG1 1 
ATOM   2185 C  CG2 . VAL B 1 54  ? -14.051 12.297 22.507  1.00 33.91  ? 72  VAL B CG2 1 
ATOM   2186 N  N   . GLN B 1 55  ? -16.647 11.453 26.200  1.00 37.87  ? 73  GLN B N   1 
ATOM   2187 C  CA  . GLN B 1 55  ? -17.534 11.616 27.328  1.00 36.79  ? 73  GLN B CA  1 
ATOM   2188 C  C   . GLN B 1 55  ? -16.791 11.308 28.641  1.00 32.88  ? 73  GLN B C   1 
ATOM   2189 O  O   . GLN B 1 55  ? -17.028 11.948 29.634  1.00 35.86  ? 73  GLN B O   1 
ATOM   2190 C  CB  . GLN B 1 55  ? -18.812 10.774 27.132  1.00 38.03  ? 73  GLN B CB  1 
ATOM   2191 C  CG  . GLN B 1 55  ? -19.953 11.025 28.137  1.00 40.80  ? 73  GLN B CG  1 
ATOM   2192 C  CD  . GLN B 1 55  ? -20.473 12.461 28.144  1.00 47.22  ? 73  GLN B CD  1 
ATOM   2193 O  OE1 . GLN B 1 55  ? -21.200 12.887 27.226  1.00 52.67  ? 73  GLN B OE1 1 
ATOM   2194 N  NE2 . GLN B 1 55  ? -20.101 13.226 29.183  1.00 42.83  ? 73  GLN B NE2 1 
ATOM   2195 N  N   . GLN B 1 56  ? -15.875 10.353 28.651  1.00 34.30  ? 74  GLN B N   1 
ATOM   2196 C  CA  . GLN B 1 56  ? -15.065 10.116 29.853  1.00 38.21  ? 74  GLN B CA  1 
ATOM   2197 C  C   . GLN B 1 56  ? -14.092 11.272 30.177  1.00 37.60  ? 74  GLN B C   1 
ATOM   2198 O  O   . GLN B 1 56  ? -14.008 11.767 31.327  1.00 36.06  ? 74  GLN B O   1 
ATOM   2199 C  CB  . GLN B 1 56  ? -14.252 8.851  29.673  1.00 41.38  ? 74  GLN B CB  1 
ATOM   2200 C  CG  . GLN B 1 56  ? -13.546 8.456  30.945  1.00 45.95  ? 74  GLN B CG  1 
ATOM   2201 C  CD  . GLN B 1 56  ? -12.884 7.114  30.819  1.00 49.82  ? 74  GLN B CD  1 
ATOM   2202 O  OE1 . GLN B 1 56  ? -12.010 6.938  29.985  1.00 46.20  ? 74  GLN B OE1 1 
ATOM   2203 N  NE2 . GLN B 1 56  ? -13.315 6.145  31.643  1.00 55.77  ? 74  GLN B NE2 1 
ATOM   2204 N  N   . PHE B 1 57  ? -13.340 11.682 29.146  1.00 35.94  ? 75  PHE B N   1 
ATOM   2205 C  CA  . PHE B 1 57  ? -12.456 12.827 29.253  1.00 32.72  ? 75  PHE B CA  1 
ATOM   2206 C  C   . PHE B 1 57  ? -13.239 13.942 29.942  1.00 33.23  ? 75  PHE B C   1 
ATOM   2207 O  O   . PHE B 1 57  ? -12.824 14.430 31.017  1.00 31.80  ? 75  PHE B O   1 
ATOM   2208 C  CB  . PHE B 1 57  ? -12.011 13.264 27.852  1.00 31.59  ? 75  PHE B CB  1 
ATOM   2209 C  CG  . PHE B 1 57  ? -11.367 14.597 27.812  1.00 29.45  ? 75  PHE B CG  1 
ATOM   2210 C  CD1 . PHE B 1 57  ? -10.013 14.738 28.100  1.00 29.54  ? 75  PHE B CD1 1 
ATOM   2211 C  CD2 . PHE B 1 57  ? -12.091 15.722 27.440  1.00 29.52  ? 75  PHE B CD2 1 
ATOM   2212 C  CE1 . PHE B 1 57  ? -9.409  15.976 28.057  1.00 26.43  ? 75  PHE B CE1 1 
ATOM   2213 C  CE2 . PHE B 1 57  ? -11.479 16.970 27.401  1.00 27.74  ? 75  PHE B CE2 1 
ATOM   2214 C  CZ  . PHE B 1 57  ? -10.138 17.093 27.716  1.00 25.75  ? 75  PHE B CZ  1 
ATOM   2215 N  N   . TYR B 1 58  ? -14.387 14.324 29.369  1.00 28.56  ? 76  TYR B N   1 
ATOM   2216 C  CA  . TYR B 1 58  ? -15.162 15.404 29.988  1.00 29.78  ? 76  TYR B CA  1 
ATOM   2217 C  C   . TYR B 1 58  ? -15.659 15.117 31.422  1.00 30.76  ? 76  TYR B C   1 
ATOM   2218 O  O   . TYR B 1 58  ? -15.696 16.022 32.261  1.00 28.60  ? 76  TYR B O   1 
ATOM   2219 C  CB  . TYR B 1 58  ? -16.323 15.830 29.104  1.00 29.89  ? 76  TYR B CB  1 
ATOM   2220 C  CG  . TYR B 1 58  ? -15.932 16.626 27.869  1.00 32.53  ? 76  TYR B CG  1 
ATOM   2221 C  CD1 . TYR B 1 58  ? -15.059 17.726 27.961  1.00 31.32  ? 76  TYR B CD1 1 
ATOM   2222 C  CD2 . TYR B 1 58  ? -16.499 16.324 26.612  1.00 31.08  ? 76  TYR B CD2 1 
ATOM   2223 C  CE1 . TYR B 1 58  ? -14.717 18.477 26.837  1.00 33.92  ? 76  TYR B CE1 1 
ATOM   2224 C  CE2 . TYR B 1 58  ? -16.181 17.071 25.482  1.00 32.02  ? 76  TYR B CE2 1 
ATOM   2225 C  CZ  . TYR B 1 58  ? -15.296 18.152 25.585  1.00 34.66  ? 76  TYR B CZ  1 
ATOM   2226 O  OH  . TYR B 1 58  ? -14.988 18.911 24.452  1.00 34.13  ? 76  TYR B OH  1 
ATOM   2227 N  N   . ASP B 1 59  ? -16.046 13.867 31.683  1.00 31.45  ? 77  ASP B N   1 
ATOM   2228 C  CA  . ASP B 1 59  ? -16.536 13.460 33.003  1.00 34.55  ? 77  ASP B CA  1 
ATOM   2229 C  C   . ASP B 1 59  ? -15.409 13.502 34.048  1.00 31.55  ? 77  ASP B C   1 
ATOM   2230 O  O   . ASP B 1 59  ? -15.623 13.966 35.153  1.00 30.20  ? 77  ASP B O   1 
ATOM   2231 C  CB  . ASP B 1 59  ? -17.194 12.050 32.957  1.00 36.46  ? 77  ASP B CB  1 
ATOM   2232 C  CG  . ASP B 1 59  ? -18.557 12.056 32.275  1.00 33.76  ? 77  ASP B CG  1 
ATOM   2233 O  OD1 . ASP B 1 59  ? -19.182 13.105 32.229  1.00 33.08  ? 77  ASP B OD1 1 
ATOM   2234 O  OD2 . ASP B 1 59  ? -19.029 11.013 31.802  1.00 38.05  ? 77  ASP B OD2 1 
ATOM   2235 N  N   . LEU B 1 60  ? -14.219 13.041 33.685  1.00 31.89  ? 78  LEU B N   1 
ATOM   2236 C  CA  . LEU B 1 60  ? -13.056 13.192 34.579  1.00 30.86  ? 78  LEU B CA  1 
ATOM   2237 C  C   . LEU B 1 60  ? -12.871 14.673 34.907  1.00 31.48  ? 78  LEU B C   1 
ATOM   2238 O  O   . LEU B 1 60  ? -12.680 15.034 36.071  1.00 32.03  ? 78  LEU B O   1 
ATOM   2239 C  CB  . LEU B 1 60  ? -11.788 12.561 33.960  1.00 32.17  ? 78  LEU B CB  1 
ATOM   2240 C  CG  . LEU B 1 60  ? -11.681 11.010 33.984  1.00 36.87  ? 78  LEU B CG  1 
ATOM   2241 C  CD1 . LEU B 1 60  ? -12.976 10.373 34.431  1.00 34.83  ? 78  LEU B CD1 1 
ATOM   2242 C  CD2 . LEU B 1 60  ? -11.196 10.346 32.691  1.00 30.57  ? 78  LEU B CD2 1 
ATOM   2243 N  N   . LEU B 1 61  ? -13.003 15.529 33.891  1.00 29.24  ? 79  LEU B N   1 
ATOM   2244 C  CA  . LEU B 1 61  ? -12.841 16.961 34.034  1.00 31.31  ? 79  LEU B CA  1 
ATOM   2245 C  C   . LEU B 1 61  ? -13.904 17.583 35.015  1.00 32.32  ? 79  LEU B C   1 
ATOM   2246 O  O   . LEU B 1 61  ? -13.562 18.248 36.047  1.00 33.11  ? 79  LEU B O   1 
ATOM   2247 C  CB  . LEU B 1 61  ? -12.885 17.623 32.616  1.00 31.18  ? 79  LEU B CB  1 
ATOM   2248 C  CG  . LEU B 1 61  ? -11.688 18.458 32.162  1.00 32.62  ? 79  LEU B CG  1 
ATOM   2249 C  CD1 . LEU B 1 61  ? -10.318 17.894 32.607  1.00 30.19  ? 79  LEU B CD1 1 
ATOM   2250 C  CD2 . LEU B 1 61  ? -11.732 18.725 30.680  1.00 29.90  ? 79  LEU B CD2 1 
ATOM   2251 N  N   . SER B 1 62  ? -15.174 17.351 34.710  1.00 30.81  ? 80  SER B N   1 
ATOM   2252 C  CA  . SER B 1 62  ? -16.273 17.842 35.548  1.00 34.46  ? 80  SER B CA  1 
ATOM   2253 C  C   . SER B 1 62  ? -16.178 17.317 36.972  1.00 31.25  ? 80  SER B C   1 
ATOM   2254 O  O   . SER B 1 62  ? -16.431 18.037 37.924  1.00 34.30  ? 80  SER B O   1 
ATOM   2255 C  CB  . SER B 1 62  ? -17.615 17.413 34.958  1.00 36.15  ? 80  SER B CB  1 
ATOM   2256 O  OG  . SER B 1 62  ? -17.798 18.026 33.697  1.00 39.54  ? 80  SER B OG  1 
ATOM   2257 N  N   . GLY B 1 63  ? -15.814 16.058 37.120  1.00 31.20  ? 81  GLY B N   1 
ATOM   2258 C  CA  . GLY B 1 63  ? -15.709 15.466 38.454  1.00 34.45  ? 81  GLY B CA  1 
ATOM   2259 C  C   . GLY B 1 63  ? -14.947 16.324 39.459  1.00 32.97  ? 81  GLY B C   1 
ATOM   2260 O  O   . GLY B 1 63  ? -15.303 16.365 40.632  1.00 34.54  ? 81  GLY B O   1 
ATOM   2261 N  N   . SER B 1 64  ? -13.904 17.013 38.986  1.00 34.11  ? 82  SER B N   1 
ATOM   2262 C  CA  . SER B 1 64  ? -12.939 17.739 39.835  1.00 31.56  ? 82  SER B CA  1 
ATOM   2263 C  C   . SER B 1 64  ? -13.362 19.123 40.258  1.00 33.09  ? 82  SER B C   1 
ATOM   2264 O  O   . SER B 1 64  ? -12.823 19.686 41.225  1.00 31.25  ? 82  SER B O   1 
ATOM   2265 C  CB  . SER B 1 64  ? -11.638 17.835 39.114  1.00 31.02  ? 82  SER B CB  1 
ATOM   2266 O  OG  . SER B 1 64  ? -10.816 16.756 39.498  1.00 38.22  ? 82  SER B OG  1 
ATOM   2267 N  N   . LEU B 1 65  ? -14.365 19.603 39.534  1.00 33.13  ? 83  LEU B N   1 
ATOM   2268 C  CA  . LEU B 1 65  ? -14.932 20.923 39.577  1.00 37.80  ? 83  LEU B CA  1 
ATOM   2269 C  C   . LEU B 1 65  ? -15.484 21.206 40.943  1.00 35.58  ? 83  LEU B C   1 
ATOM   2270 O  O   . LEU B 1 65  ? -14.980 22.089 41.660  1.00 32.58  ? 83  LEU B O   1 
ATOM   2271 C  CB  . LEU B 1 65  ? -16.077 20.932 38.580  1.00 42.94  ? 83  LEU B CB  1 
ATOM   2272 C  CG  . LEU B 1 65  ? -16.513 22.066 37.656  1.00 47.94  ? 83  LEU B CG  1 
ATOM   2273 C  CD1 . LEU B 1 65  ? -15.363 22.946 37.147  1.00 42.75  ? 83  LEU B CD1 1 
ATOM   2274 C  CD2 . LEU B 1 65  ? -17.333 21.419 36.527  1.00 42.20  ? 83  LEU B CD2 1 
ATOM   2275 N  N   . GLU B 1 66  ? -16.497 20.422 41.298  1.00 33.66  ? 84  GLU B N   1 
ATOM   2276 C  CA  . GLU B 1 66  ? -17.114 20.487 42.596  1.00 36.60  ? 84  GLU B CA  1 
ATOM   2277 C  C   . GLU B 1 66  ? -16.090 20.226 43.680  1.00 35.81  ? 84  GLU B C   1 
ATOM   2278 O  O   . GLU B 1 66  ? -16.119 20.859 44.722  1.00 36.52  ? 84  GLU B O   1 
ATOM   2279 C  CB  . GLU B 1 66  ? -18.285 19.507 42.706  1.00 40.05  ? 84  GLU B CB  1 
ATOM   2280 C  CG  . GLU B 1 66  ? -19.313 19.945 43.727  1.00 48.82  ? 84  GLU B CG  1 
ATOM   2281 C  CD  . GLU B 1 66  ? -19.406 21.472 43.831  1.00 56.70  ? 84  GLU B CD  1 
ATOM   2282 O  OE1 . GLU B 1 66  ? -19.950 22.148 42.909  1.00 60.15  ? 84  GLU B OE1 1 
ATOM   2283 O  OE2 . GLU B 1 66  ? -18.908 22.005 44.846  1.00 58.52  ? 84  GLU B OE2 1 
ATOM   2284 N  N   . VAL B 1 67  ? -15.146 19.331 43.421  1.00 33.03  ? 85  VAL B N   1 
ATOM   2285 C  CA  . VAL B 1 67  ? -14.118 19.074 44.417  1.00 31.21  ? 85  VAL B CA  1 
ATOM   2286 C  C   . VAL B 1 67  ? -13.105 20.210 44.650  1.00 29.82  ? 85  VAL B C   1 
ATOM   2287 O  O   . VAL B 1 67  ? -12.831 20.553 45.815  1.00 30.80  ? 85  VAL B O   1 
ATOM   2288 C  CB  . VAL B 1 67  ? -13.417 17.745 44.173  1.00 29.03  ? 85  VAL B CB  1 
ATOM   2289 C  CG1 . VAL B 1 67  ? -12.207 17.671 45.057  1.00 27.53  ? 85  VAL B CG1 1 
ATOM   2290 C  CG2 . VAL B 1 67  ? -14.399 16.581 44.437  1.00 30.78  ? 85  VAL B CG2 1 
ATOM   2291 N  N   . ILE B 1 68  ? -12.583 20.800 43.567  1.00 25.77  ? 86  ILE B N   1 
ATOM   2292 C  CA  . ILE B 1 68  ? -11.700 21.932 43.661  1.00 22.39  ? 86  ILE B CA  1 
ATOM   2293 C  C   . ILE B 1 68  ? -12.456 23.110 44.239  1.00 21.48  ? 86  ILE B C   1 
ATOM   2294 O  O   . ILE B 1 68  ? -11.881 23.892 44.985  1.00 19.19  ? 86  ILE B O   1 
ATOM   2295 C  CB  . ILE B 1 68  ? -11.025 22.341 42.307  1.00 21.26  ? 86  ILE B CB  1 
ATOM   2296 C  CG1 . ILE B 1 68  ? -10.008 21.294 41.877  1.00 21.23  ? 86  ILE B CG1 1 
ATOM   2297 C  CG2 . ILE B 1 68  ? -10.309 23.691 42.462  1.00 18.96  ? 86  ILE B CG2 1 
ATOM   2298 C  CD1 . ILE B 1 68  ? -9.685  21.257 40.386  1.00 19.12  ? 86  ILE B CD1 1 
ATOM   2299 N  N   . ARG B 1 69  ? -13.738 23.247 43.918  1.00 24.76  ? 87  ARG B N   1 
ATOM   2300 C  CA  . ARG B 1 69  ? -14.497 24.378 44.471  1.00 26.82  ? 87  ARG B CA  1 
ATOM   2301 C  C   . ARG B 1 69  ? -14.682 24.257 46.035  1.00 30.91  ? 87  ARG B C   1 
ATOM   2302 O  O   . ARG B 1 69  ? -14.629 25.265 46.769  1.00 31.40  ? 87  ARG B O   1 
ATOM   2303 C  CB  . ARG B 1 69  ? -15.797 24.560 43.706  1.00 29.37  ? 87  ARG B CB  1 
ATOM   2304 C  CG  . ARG B 1 69  ? -16.701 25.709 44.169  1.00 38.55  ? 87  ARG B CG  1 
ATOM   2305 C  CD  . ARG B 1 69  ? -17.780 26.026 43.111  1.00 47.68  ? 87  ARG B CD  1 
ATOM   2306 N  NE  . ARG B 1 69  ? -17.920 24.937 42.112  1.00 59.34  ? 87  ARG B NE  1 
ATOM   2307 C  CZ  . ARG B 1 69  ? -18.151 25.095 40.798  1.00 67.61  ? 87  ARG B CZ  1 
ATOM   2308 N  NH1 . ARG B 1 69  ? -18.264 26.307 40.268  1.00 73.78  ? 87  ARG B NH1 1 
ATOM   2309 N  NH2 . ARG B 1 69  ? -18.256 24.031 39.996  1.00 66.44  ? 87  ARG B NH2 1 
ATOM   2310 N  N   . LYS B 1 70  ? -14.821 23.036 46.551  1.00 28.03  ? 88  LYS B N   1 
ATOM   2311 C  CA  . LYS B 1 70  ? -15.004 22.892 48.013  1.00 30.49  ? 88  LYS B CA  1 
ATOM   2312 C  C   . LYS B 1 70  ? -13.659 22.991 48.682  1.00 29.33  ? 88  LYS B C   1 
ATOM   2313 O  O   . LYS B 1 70  ? -13.581 23.508 49.781  1.00 26.87  ? 88  LYS B O   1 
ATOM   2314 C  CB  . LYS B 1 70  ? -15.675 21.585 48.431  1.00 28.50  ? 88  LYS B CB  1 
ATOM   2315 C  CG  . LYS B 1 70  ? -17.079 21.338 47.908  1.00 30.30  ? 88  LYS B CG  1 
ATOM   2316 C  CD  . LYS B 1 70  ? -17.470 19.909 48.321  1.00 35.86  ? 88  LYS B CD  1 
ATOM   2317 C  CE  . LYS B 1 70  ? -18.719 19.397 47.612  1.00 39.87  ? 88  LYS B CE  1 
ATOM   2318 N  NZ  . LYS B 1 70  ? -19.233 18.167 48.288  1.00 46.88  ? 88  LYS B NZ  1 
ATOM   2319 N  N   . TRP B 1 71  ? -12.603 22.494 48.016  1.00 27.76  ? 89  TRP B N   1 
ATOM   2320 C  CA  . TRP B 1 71  ? -11.239 22.685 48.528  1.00 26.35  ? 89  TRP B CA  1 
ATOM   2321 C  C   . TRP B 1 71  ? -10.894 24.171 48.714  1.00 26.41  ? 89  TRP B C   1 
ATOM   2322 O  O   . TRP B 1 71  ? -10.393 24.592 49.771  1.00 23.92  ? 89  TRP B O   1 
ATOM   2323 C  CB  . TRP B 1 71  ? -10.236 22.007 47.595  1.00 26.30  ? 89  TRP B CB  1 
ATOM   2324 C  CG  . TRP B 1 71  ? -8.777  22.375 47.829  1.00 25.07  ? 89  TRP B CG  1 
ATOM   2325 C  CD1 . TRP B 1 71  ? -7.906  21.885 48.824  1.00 24.81  ? 89  TRP B CD1 1 
ATOM   2326 C  CD2 . TRP B 1 71  ? -7.961  23.273 47.022  1.00 24.56  ? 89  TRP B CD2 1 
ATOM   2327 N  NE1 . TRP B 1 71  ? -6.662  22.438 48.708  1.00 23.30  ? 89  TRP B NE1 1 
ATOM   2328 C  CE2 . TRP B 1 71  ? -6.612  23.269 47.633  1.00 25.64  ? 89  TRP B CE2 1 
ATOM   2329 C  CE3 . TRP B 1 71  ? -8.196  24.063 45.912  1.00 24.37  ? 89  TRP B CE3 1 
ATOM   2330 C  CZ2 . TRP B 1 71  ? -5.572  24.043 47.123  1.00 24.85  ? 89  TRP B CZ2 1 
ATOM   2331 C  CZ3 . TRP B 1 71  ? -7.133  24.841 45.404  1.00 26.08  ? 89  TRP B CZ3 1 
ATOM   2332 C  CH2 . TRP B 1 71  ? -5.855  24.825 45.996  1.00 26.19  ? 89  TRP B CH2 1 
ATOM   2333 N  N   . ALA B 1 72  ? -11.203 24.972 47.697  1.00 24.67  ? 90  ALA B N   1 
ATOM   2334 C  CA  . ALA B 1 72  ? -10.892 26.402 47.699  1.00 23.33  ? 90  ALA B CA  1 
ATOM   2335 C  C   . ALA B 1 72  ? -11.548 27.079 48.914  1.00 23.20  ? 90  ALA B C   1 
ATOM   2336 O  O   . ALA B 1 72  ? -10.933 27.896 49.567  1.00 22.30  ? 90  ALA B O   1 
ATOM   2337 C  CB  . ALA B 1 72  ? -11.396 27.007 46.393  1.00 22.21  ? 90  ALA B CB  1 
ATOM   2338 N  N   . GLU B 1 73  ? -12.792 26.706 49.215  1.00 25.16  ? 91  GLU B N   1 
ATOM   2339 C  CA  . GLU B 1 73  ? -13.556 27.278 50.331  1.00 29.00  ? 91  GLU B CA  1 
ATOM   2340 C  C   . GLU B 1 73  ? -12.937 27.068 51.694  1.00 27.02  ? 91  GLU B C   1 
ATOM   2341 O  O   . GLU B 1 73  ? -13.243 27.791 52.591  1.00 26.27  ? 91  GLU B O   1 
ATOM   2342 C  CB  . GLU B 1 73  ? -15.001 26.760 50.386  1.00 35.49  ? 91  GLU B CB  1 
ATOM   2343 C  CG  . GLU B 1 73  ? -16.032 27.639 49.690  1.00 43.40  ? 91  GLU B CG  1 
ATOM   2344 C  CD  . GLU B 1 73  ? -15.841 29.148 49.926  1.00 48.75  ? 91  GLU B CD  1 
ATOM   2345 O  OE1 . GLU B 1 73  ? -15.957 29.590 51.120  1.00 49.81  ? 91  GLU B OE1 1 
ATOM   2346 O  OE2 . GLU B 1 73  ? -15.588 29.892 48.916  1.00 38.22  ? 91  GLU B OE2 1 
ATOM   2347 N  N   . LYS B 1 74  ? -12.095 26.057 51.833  1.00 25.45  ? 92  LYS B N   1 
ATOM   2348 C  CA  . LYS B 1 74  ? -11.473 25.777 53.079  1.00 25.47  ? 92  LYS B CA  1 
ATOM   2349 C  C   . LYS B 1 74  ? -10.137 26.439 53.204  1.00 26.31  ? 92  LYS B C   1 
ATOM   2350 O  O   . LYS B 1 74  ? -9.472  26.257 54.187  1.00 25.53  ? 92  LYS B O   1 
ATOM   2351 C  CB  . LYS B 1 74  ? -11.269 24.280 53.211  1.00 26.52  ? 92  LYS B CB  1 
ATOM   2352 C  CG  . LYS B 1 74  ? -12.575 23.565 53.497  1.00 30.05  ? 92  LYS B CG  1 
ATOM   2353 C  CD  . LYS B 1 74  ? -12.382 22.082 53.338  1.00 33.68  ? 92  LYS B CD  1 
ATOM   2354 C  CE  . LYS B 1 74  ? -13.712 21.374 53.477  1.00 34.24  ? 92  LYS B CE  1 
ATOM   2355 N  NZ  . LYS B 1 74  ? -13.518 19.917 53.241  1.00 37.70  ? 92  LYS B NZ  1 
ATOM   2356 N  N   . ILE B 1 75  ? -9.710  27.165 52.175  1.00 29.25  ? 93  ILE B N   1 
ATOM   2357 C  CA  . ILE B 1 75  ? -8.458  27.905 52.243  1.00 25.26  ? 93  ILE B CA  1 
ATOM   2358 C  C   . ILE B 1 75  ? -8.774  29.137 53.060  1.00 25.03  ? 93  ILE B C   1 
ATOM   2359 O  O   . ILE B 1 75  ? -9.651  29.910 52.678  1.00 21.82  ? 93  ILE B O   1 
ATOM   2360 C  CB  . ILE B 1 75  ? -7.931  28.241 50.816  1.00 26.15  ? 93  ILE B CB  1 
ATOM   2361 C  CG1 . ILE B 1 75  ? -7.517  26.937 50.120  1.00 26.72  ? 93  ILE B CG1 1 
ATOM   2362 C  CG2 . ILE B 1 75  ? -6.771  29.203 50.874  1.00 23.98  ? 93  ILE B CG2 1 
ATOM   2363 C  CD1 . ILE B 1 75  ? -7.238  27.093 48.652  1.00 28.67  ? 93  ILE B CD1 1 
ATOM   2364 N  N   . PRO B 1 76  ? -8.090  29.310 54.224  1.00 28.79  ? 94  PRO B N   1 
ATOM   2365 C  CA  . PRO B 1 76  ? -8.355  30.524 55.017  1.00 27.72  ? 94  PRO B CA  1 
ATOM   2366 C  C   . PRO B 1 76  ? -8.146  31.772 54.153  1.00 27.81  ? 94  PRO B C   1 
ATOM   2367 O  O   . PRO B 1 76  ? -7.165  31.880 53.419  1.00 28.73  ? 94  PRO B O   1 
ATOM   2368 C  CB  . PRO B 1 76  ? -7.305  30.453 56.113  1.00 30.84  ? 94  PRO B CB  1 
ATOM   2369 C  CG  . PRO B 1 76  ? -7.098  28.981 56.301  1.00 32.31  ? 94  PRO B CG  1 
ATOM   2370 C  CD  . PRO B 1 76  ? -7.144  28.402 54.909  1.00 28.14  ? 94  PRO B CD  1 
ATOM   2371 N  N   . GLY B 1 77  ? -9.110  32.661 54.179  1.00 22.29  ? 95  GLY B N   1 
ATOM   2372 C  CA  . GLY B 1 77  ? -9.009  33.880 53.442  1.00 23.67  ? 95  GLY B CA  1 
ATOM   2373 C  C   . GLY B 1 77  ? -9.714  33.860 52.115  1.00 22.08  ? 95  GLY B C   1 
ATOM   2374 O  O   . GLY B 1 77  ? -10.218 34.880 51.685  1.00 23.39  ? 95  GLY B O   1 
ATOM   2375 N  N   . PHE B 1 78  ? -9.798  32.694 51.486  1.00 23.72  ? 96  PHE B N   1 
ATOM   2376 C  CA  . PHE B 1 78  ? -10.424 32.612 50.150  1.00 22.26  ? 96  PHE B CA  1 
ATOM   2377 C  C   . PHE B 1 78  ? -11.867 33.041 50.210  1.00 23.44  ? 96  PHE B C   1 
ATOM   2378 O  O   . PHE B 1 78  ? -12.330 33.793 49.351  1.00 26.72  ? 96  PHE B O   1 
ATOM   2379 C  CB  . PHE B 1 78  ? -10.259 31.241 49.515  1.00 22.08  ? 96  PHE B CB  1 
ATOM   2380 C  CG  . PHE B 1 78  ? -10.749 31.169 48.076  1.00 23.12  ? 96  PHE B CG  1 
ATOM   2381 C  CD1 . PHE B 1 78  ? -9.973  31.657 47.040  1.00 23.26  ? 96  PHE B CD1 1 
ATOM   2382 C  CD2 . PHE B 1 78  ? -11.989 30.615 47.763  1.00 23.25  ? 96  PHE B CD2 1 
ATOM   2383 C  CE1 . PHE B 1 78  ? -10.427 31.577 45.703  1.00 24.38  ? 96  PHE B CE1 1 
ATOM   2384 C  CE2 . PHE B 1 78  ? -12.447 30.537 46.432  1.00 22.38  ? 96  PHE B CE2 1 
ATOM   2385 C  CZ  . PHE B 1 78  ? -11.660 31.017 45.401  1.00 19.85  ? 96  PHE B CZ  1 
ATOM   2386 N  N   . ALA B 1 79  ? -12.582 32.625 51.242  1.00 22.84  ? 97  ALA B N   1 
ATOM   2387 C  CA  . ALA B 1 79  ? -13.976 33.014 51.300  1.00 27.36  ? 97  ALA B CA  1 
ATOM   2388 C  C   . ALA B 1 79  ? -14.096 34.510 51.572  1.00 28.84  ? 97  ALA B C   1 
ATOM   2389 O  O   . ALA B 1 79  ? -15.175 35.094 51.449  1.00 28.00  ? 97  ALA B O   1 
ATOM   2390 C  CB  . ALA B 1 79  ? -14.724 32.189 52.362  1.00 29.75  ? 97  ALA B CB  1 
ATOM   2391 N  N   . GLU B 1 80  ? -12.967 35.150 51.883  1.00 28.40  ? 98  GLU B N   1 
ATOM   2392 C  CA  . GLU B 1 80  ? -13.013 36.586 52.181  1.00 28.70  ? 98  GLU B CA  1 
ATOM   2393 C  C   . GLU B 1 80  ? -12.728 37.502 51.001  1.00 26.99  ? 98  GLU B C   1 
ATOM   2394 O  O   . GLU B 1 80  ? -12.657 38.703 51.198  1.00 24.61  ? 98  GLU B O   1 
ATOM   2395 C  CB  . GLU B 1 80  ? -12.048 36.901 53.311  1.00 31.70  ? 98  GLU B CB  1 
ATOM   2396 C  CG  . GLU B 1 80  ? -12.645 37.204 54.656  1.00 33.07  ? 98  GLU B CG  1 
ATOM   2397 C  CD  . GLU B 1 80  ? -12.970 36.016 55.520  1.00 37.65  ? 98  GLU B CD  1 
ATOM   2398 O  OE1 . GLU B 1 80  ? -12.722 36.087 56.763  1.00 43.21  ? 98  GLU B OE1 1 
ATOM   2399 O  OE2 . GLU B 1 80  ? -13.525 35.050 54.996  1.00 34.91  ? 98  GLU B OE2 1 
ATOM   2400 N  N   . LEU B 1 81  ? -12.498 36.936 49.799  1.00 25.82  ? 99  LEU B N   1 
ATOM   2401 C  CA  . LEU B 1 81  ? -12.278 37.689 48.556  1.00 22.86  ? 99  LEU B CA  1 
ATOM   2402 C  C   . LEU B 1 81  ? -13.657 37.926 48.020  1.00 25.06  ? 99  LEU B C   1 
ATOM   2403 O  O   . LEU B 1 81  ? -14.554 37.136 48.326  1.00 26.56  ? 99  LEU B O   1 
ATOM   2404 C  CB  . LEU B 1 81  ? -11.528 36.818 47.545  1.00 24.06  ? 99  LEU B CB  1 
ATOM   2405 C  CG  . LEU B 1 81  ? -10.122 36.381 48.030  1.00 24.03  ? 99  LEU B CG  1 
ATOM   2406 C  CD1 . LEU B 1 81  ? -9.390  35.479 47.065  1.00 22.58  ? 99  LEU B CD1 1 
ATOM   2407 C  CD2 . LEU B 1 81  ? -9.213  37.578 48.364  1.00 25.56  ? 99  LEU B CD2 1 
ATOM   2408 N  N   . SER B 1 82  ? -13.866 38.999 47.238  1.00 24.02  ? 100 SER B N   1 
ATOM   2409 C  CA  . SER B 1 82  ? -15.140 39.207 46.574  1.00 25.83  ? 100 SER B CA  1 
ATOM   2410 C  C   . SER B 1 82  ? -15.620 37.917 45.878  1.00 25.92  ? 100 SER B C   1 
ATOM   2411 O  O   . SER B 1 82  ? -14.806 37.102 45.416  1.00 24.26  ? 100 SER B O   1 
ATOM   2412 C  CB  . SER B 1 82  ? -15.082 40.375 45.578  1.00 28.55  ? 100 SER B CB  1 
ATOM   2413 O  OG  . SER B 1 82  ? -14.504 40.008 44.313  1.00 25.85  ? 100 SER B OG  1 
ATOM   2414 N  N   . PRO B 1 83  ? -16.941 37.703 45.841  1.00 25.52  ? 101 PRO B N   1 
ATOM   2415 C  CA  . PRO B 1 83  ? -17.437 36.555 45.098  1.00 24.58  ? 101 PRO B CA  1 
ATOM   2416 C  C   . PRO B 1 83  ? -17.036 36.576 43.614  1.00 23.93  ? 101 PRO B C   1 
ATOM   2417 O  O   . PRO B 1 83  ? -16.803 35.493 43.062  1.00 25.01  ? 101 PRO B O   1 
ATOM   2418 C  CB  . PRO B 1 83  ? -18.957 36.670 45.219  1.00 23.13  ? 101 PRO B CB  1 
ATOM   2419 C  CG  . PRO B 1 83  ? -19.187 37.441 46.473  1.00 25.62  ? 101 PRO B CG  1 
ATOM   2420 C  CD  . PRO B 1 83  ? -18.000 38.372 46.617  1.00 27.11  ? 101 PRO B CD  1 
ATOM   2421 N  N   . ALA B 1 84  ? -17.007 37.741 42.969  1.00 21.92  ? 102 ALA B N   1 
ATOM   2422 C  CA  . ALA B 1 84  ? -16.487 37.820 41.559  1.00 23.75  ? 102 ALA B CA  1 
ATOM   2423 C  C   . ALA B 1 84  ? -14.998 37.384 41.482  1.00 22.99  ? 102 ALA B C   1 
ATOM   2424 O  O   . ALA B 1 84  ? -14.577 36.669 40.537  1.00 22.77  ? 102 ALA B O   1 
ATOM   2425 C  CB  . ALA B 1 84  ? -16.691 39.224 40.933  1.00 21.18  ? 102 ALA B CB  1 
ATOM   2426 N  N   . ASP B 1 85  ? -14.213 37.765 42.494  1.00 19.67  ? 103 ASP B N   1 
ATOM   2427 C  CA  . ASP B 1 85  ? -12.823 37.384 42.498  1.00 20.22  ? 103 ASP B CA  1 
ATOM   2428 C  C   . ASP B 1 85  ? -12.606 35.889 42.739  1.00 21.59  ? 103 ASP B C   1 
ATOM   2429 O  O   . ASP B 1 85  ? -11.632 35.305 42.172  1.00 20.14  ? 103 ASP B O   1 
ATOM   2430 C  CB  . ASP B 1 85  ? -11.972 38.211 43.452  1.00 19.72  ? 103 ASP B CB  1 
ATOM   2431 C  CG  . ASP B 1 85  ? -11.719 39.620 42.939  1.00 20.80  ? 103 ASP B CG  1 
ATOM   2432 O  OD1 . ASP B 1 85  ? -12.199 39.956 41.824  1.00 22.57  ? 103 ASP B OD1 1 
ATOM   2433 O  OD2 . ASP B 1 85  ? -11.022 40.390 43.622  1.00 19.47  ? 103 ASP B OD2 1 
ATOM   2434 N  N   . GLN B 1 86  ? -13.484 35.295 43.568  1.00 20.10  ? 104 GLN B N   1 
ATOM   2435 C  CA  . GLN B 1 86  ? -13.436 33.875 43.903  1.00 22.09  ? 104 GLN B CA  1 
ATOM   2436 C  C   . GLN B 1 86  ? -13.775 33.091 42.663  1.00 23.01  ? 104 GLN B C   1 
ATOM   2437 O  O   . GLN B 1 86  ? -13.141 32.081 42.367  1.00 22.11  ? 104 GLN B O   1 
ATOM   2438 C  CB  . GLN B 1 86  ? -14.449 33.481 44.987  1.00 21.39  ? 104 GLN B CB  1 
ATOM   2439 C  CG  . GLN B 1 86  ? -14.073 33.908 46.395  1.00 21.81  ? 104 GLN B CG  1 
ATOM   2440 C  CD  . GLN B 1 86  ? -15.186 33.604 47.376  1.00 24.84  ? 104 GLN B CD  1 
ATOM   2441 O  OE1 . GLN B 1 86  ? -15.675 32.461 47.459  1.00 25.83  ? 104 GLN B OE1 1 
ATOM   2442 N  NE2 . GLN B 1 86  ? -15.615 34.635 48.123  1.00 22.91  ? 104 GLN B NE2 1 
ATOM   2443 N  N   . ASP B 1 87  ? -14.803 33.519 41.953  1.00 25.44  ? 105 ASP B N   1 
ATOM   2444 C  CA  . ASP B 1 87  ? -15.164 32.781 40.736  1.00 26.19  ? 105 ASP B CA  1 
ATOM   2445 C  C   . ASP B 1 87  ? -14.126 32.922 39.588  1.00 29.46  ? 105 ASP B C   1 
ATOM   2446 O  O   . ASP B 1 87  ? -13.895 31.935 38.854  1.00 29.05  ? 105 ASP B O   1 
ATOM   2447 C  CB  . ASP B 1 87  ? -16.527 33.203 40.239  1.00 30.29  ? 105 ASP B CB  1 
ATOM   2448 C  CG  . ASP B 1 87  ? -17.644 32.663 41.097  1.00 33.97  ? 105 ASP B CG  1 
ATOM   2449 O  OD1 . ASP B 1 87  ? -17.519 31.599 41.780  1.00 37.73  ? 105 ASP B OD1 1 
ATOM   2450 O  OD2 . ASP B 1 87  ? -18.673 33.329 41.079  1.00 38.49  ? 105 ASP B OD2 1 
ATOM   2451 N  N   . LEU B 1 88  ? -13.499 34.111 39.446  1.00 25.74  ? 106 LEU B N   1 
ATOM   2452 C  CA  . LEU B 1 88  ? -12.462 34.289 38.424  1.00 24.90  ? 106 LEU B CA  1 
ATOM   2453 C  C   . LEU B 1 88  ? -11.209 33.424 38.732  1.00 25.91  ? 106 LEU B C   1 
ATOM   2454 O  O   . LEU B 1 88  ? -10.609 32.831 37.812  1.00 22.76  ? 106 LEU B O   1 
ATOM   2455 C  CB  . LEU B 1 88  ? -12.089 35.775 38.292  1.00 25.10  ? 106 LEU B CB  1 
ATOM   2456 C  CG  . LEU B 1 88  ? -11.048 36.201 37.215  1.00 27.48  ? 106 LEU B CG  1 
ATOM   2457 C  CD1 . LEU B 1 88  ? -11.537 35.947 35.766  1.00 20.95  ? 106 LEU B CD1 1 
ATOM   2458 C  CD2 . LEU B 1 88  ? -10.522 37.623 37.433  1.00 23.57  ? 106 LEU B CD2 1 
ATOM   2459 N  N   . LEU B 1 89  ? -10.787 33.389 40.006  1.00 21.26  ? 107 LEU B N   1 
ATOM   2460 C  CA  . LEU B 1 89  ? -9.597  32.606 40.388  1.00 20.78  ? 107 LEU B CA  1 
ATOM   2461 C  C   . LEU B 1 89  ? -9.844  31.186 40.111  1.00 21.98  ? 107 LEU B C   1 
ATOM   2462 O  O   . LEU B 1 89  ? -8.953  30.518 39.589  1.00 21.07  ? 107 LEU B O   1 
ATOM   2463 C  CB  . LEU B 1 89  ? -9.193  32.749 41.859  1.00 18.74  ? 107 LEU B CB  1 
ATOM   2464 C  CG  . LEU B 1 89  ? -8.756  34.197 42.207  1.00 19.31  ? 107 LEU B CG  1 
ATOM   2465 C  CD1 . LEU B 1 89  ? -8.698  34.532 43.681  1.00 18.11  ? 107 LEU B CD1 1 
ATOM   2466 C  CD2 . LEU B 1 89  ? -7.432  34.566 41.558  1.00 18.64  ? 107 LEU B CD2 1 
ATOM   2467 N  N   . LEU B 1 90  ? -11.053 30.720 40.456  1.00 24.32  ? 108 LEU B N   1 
ATOM   2468 C  CA  . LEU B 1 90  ? -11.380 29.295 40.379  1.00 25.29  ? 108 LEU B CA  1 
ATOM   2469 C  C   . LEU B 1 90  ? -11.432 28.890 38.892  1.00 27.86  ? 108 LEU B C   1 
ATOM   2470 O  O   . LEU B 1 90  ? -10.751 27.924 38.465  1.00 26.40  ? 108 LEU B O   1 
ATOM   2471 C  CB  . LEU B 1 90  ? -12.703 29.080 41.046  1.00 27.05  ? 108 LEU B CB  1 
ATOM   2472 C  CG  . LEU B 1 90  ? -13.060 27.964 42.044  1.00 32.31  ? 108 LEU B CG  1 
ATOM   2473 C  CD1 . LEU B 1 90  ? -11.928 27.105 42.668  1.00 24.68  ? 108 LEU B CD1 1 
ATOM   2474 C  CD2 . LEU B 1 90  ? -13.948 28.623 43.104  1.00 28.67  ? 108 LEU B CD2 1 
ATOM   2475 N  N   . GLU B 1 91  ? -12.172 29.665 38.088  1.00 26.32  ? 109 GLU B N   1 
ATOM   2476 C  CA  . GLU B 1 91  ? -12.235 29.419 36.636  1.00 30.14  ? 109 GLU B CA  1 
ATOM   2477 C  C   . GLU B 1 91  ? -10.896 29.423 35.931  1.00 25.81  ? 109 GLU B C   1 
ATOM   2478 O  O   . GLU B 1 91  ? -10.617 28.551 35.102  1.00 23.84  ? 109 GLU B O   1 
ATOM   2479 C  CB  . GLU B 1 91  ? -13.155 30.412 35.941  1.00 33.14  ? 109 GLU B CB  1 
ATOM   2480 C  CG  . GLU B 1 91  ? -14.609 30.199 36.325  1.00 45.11  ? 109 GLU B CG  1 
ATOM   2481 C  CD  . GLU B 1 91  ? -15.539 31.273 35.785  1.00 47.62  ? 109 GLU B CD  1 
ATOM   2482 O  OE1 . GLU B 1 91  ? -16.703 31.266 36.218  1.00 53.56  ? 109 GLU B OE1 1 
ATOM   2483 O  OE2 . GLU B 1 91  ? -15.123 32.098 34.931  1.00 53.71  ? 109 GLU B OE2 1 
ATOM   2484 N  N   . SER B 1 92  ? -10.090 30.431 36.244  1.00 23.98  ? 110 SER B N   1 
ATOM   2485 C  CA  . SER B 1 92  ? -8.780  30.604 35.619  1.00 24.46  ? 110 SER B CA  1 
ATOM   2486 C  C   . SER B 1 92  ? -7.726  29.566 36.053  1.00 25.24  ? 110 SER B C   1 
ATOM   2487 O  O   . SER B 1 92  ? -6.756  29.343 35.325  1.00 25.80  ? 110 SER B O   1 
ATOM   2488 C  CB  . SER B 1 92  ? -8.268  32.003 35.895  1.00 24.37  ? 110 SER B CB  1 
ATOM   2489 O  OG  . SER B 1 92  ? -9.244  32.907 35.446  1.00 24.18  ? 110 SER B OG  1 
ATOM   2490 N  N   . ALA B 1 93  ? -7.924  28.931 37.215  1.00 23.36  ? 111 ALA B N   1 
ATOM   2491 C  CA  . ALA B 1 93  ? -6.954  28.019 37.790  1.00 22.22  ? 111 ALA B CA  1 
ATOM   2492 C  C   . ALA B 1 93  ? -7.426  26.589 37.552  1.00 23.23  ? 111 ALA B C   1 
ATOM   2493 O  O   . ALA B 1 93  ? -6.696  25.616 37.831  1.00 25.53  ? 111 ALA B O   1 
ATOM   2494 C  CB  . ALA B 1 93  ? -6.851  28.283 39.306  1.00 23.05  ? 111 ALA B CB  1 
ATOM   2495 N  N   . PHE B 1 94  ? -8.652  26.436 37.073  1.00 24.04  ? 112 PHE B N   1 
ATOM   2496 C  CA  . PHE B 1 94  ? -9.235  25.100 37.034  1.00 24.35  ? 112 PHE B CA  1 
ATOM   2497 C  C   . PHE B 1 94  ? -8.380  24.028 36.343  1.00 26.04  ? 112 PHE B C   1 
ATOM   2498 O  O   . PHE B 1 94  ? -7.966  23.025 36.973  1.00 31.43  ? 112 PHE B O   1 
ATOM   2499 C  CB  . PHE B 1 94  ? -10.645 25.053 36.487  1.00 24.68  ? 112 PHE B CB  1 
ATOM   2500 C  CG  . PHE B 1 94  ? -11.098 23.637 36.249  1.00 25.30  ? 112 PHE B CG  1 
ATOM   2501 C  CD1 . PHE B 1 94  ? -11.327 22.780 37.336  1.00 24.23  ? 112 PHE B CD1 1 
ATOM   2502 C  CD2 . PHE B 1 94  ? -11.189 23.134 34.958  1.00 22.69  ? 112 PHE B CD2 1 
ATOM   2503 C  CE1 . PHE B 1 94  ? -11.650 21.446 37.132  1.00 25.33  ? 112 PHE B CE1 1 
ATOM   2504 C  CE2 . PHE B 1 94  ? -11.506 21.798 34.746  1.00 25.57  ? 112 PHE B CE2 1 
ATOM   2505 C  CZ  . PHE B 1 94  ? -11.778 20.960 35.819  1.00 25.22  ? 112 PHE B CZ  1 
ATOM   2506 N  N   . LEU B 1 95  ? -8.040  24.262 35.093  1.00 23.89  ? 113 LEU B N   1 
ATOM   2507 C  CA  . LEU B 1 95  ? -7.223  23.295 34.367  1.00 25.68  ? 113 LEU B CA  1 
ATOM   2508 C  C   . LEU B 1 95  ? -5.888  23.021 35.059  1.00 21.91  ? 113 LEU B C   1 
ATOM   2509 O  O   . LEU B 1 95  ? -5.529  21.861 35.290  1.00 21.38  ? 113 LEU B O   1 
ATOM   2510 C  CB  . LEU B 1 95  ? -7.036  23.727 32.921  1.00 25.22  ? 113 LEU B CB  1 
ATOM   2511 C  CG  . LEU B 1 95  ? -7.580  22.995 31.718  1.00 30.17  ? 113 LEU B CG  1 
ATOM   2512 C  CD1 . LEU B 1 95  ? -8.835  22.143 31.897  1.00 26.27  ? 113 LEU B CD1 1 
ATOM   2513 C  CD2 . LEU B 1 95  ? -7.715  23.979 30.538  1.00 29.62  ? 113 LEU B CD2 1 
ATOM   2514 N  N   . GLU B 1 96  ? -5.175  24.068 35.430  1.00 22.15  ? 114 GLU B N   1 
ATOM   2515 C  CA  . GLU B 1 96  ? -3.952  23.917 36.246  1.00 23.96  ? 114 GLU B CA  1 
ATOM   2516 C  C   . GLU B 1 96  ? -4.151  23.082 37.547  1.00 25.05  ? 114 GLU B C   1 
ATOM   2517 O  O   . GLU B 1 96  ? -3.346  22.202 37.866  1.00 27.06  ? 114 GLU B O   1 
ATOM   2518 C  CB  . GLU B 1 96  ? -3.370  25.279 36.628  1.00 25.74  ? 114 GLU B CB  1 
ATOM   2519 C  CG  . GLU B 1 96  ? -2.757  26.120 35.509  1.00 29.51  ? 114 GLU B CG  1 
ATOM   2520 C  CD  . GLU B 1 96  ? -2.731  27.600 35.906  1.00 30.37  ? 114 GLU B CD  1 
ATOM   2521 O  OE1 . GLU B 1 96  ? -3.716  28.358 35.608  1.00 27.45  ? 114 GLU B OE1 1 
ATOM   2522 O  OE2 . GLU B 1 96  ? -1.749  27.976 36.574  1.00 29.59  ? 114 GLU B OE2 1 
ATOM   2523 N  N   . LEU B 1 97  ? -5.203  23.346 38.307  1.00 24.26  ? 115 LEU B N   1 
ATOM   2524 C  CA  . LEU B 1 97  ? -5.373  22.611 39.582  1.00 22.57  ? 115 LEU B CA  1 
ATOM   2525 C  C   . LEU B 1 97  ? -5.686  21.175 39.269  1.00 22.68  ? 115 LEU B C   1 
ATOM   2526 O  O   . LEU B 1 97  ? -5.149  20.279 39.894  1.00 25.53  ? 115 LEU B O   1 
ATOM   2527 C  CB  . LEU B 1 97  ? -6.464  23.225 40.450  1.00 21.65  ? 115 LEU B CB  1 
ATOM   2528 C  CG  . LEU B 1 97  ? -6.171  24.629 40.978  1.00 19.46  ? 115 LEU B CG  1 
ATOM   2529 C  CD1 . LEU B 1 97  ? -7.441  25.285 41.475  1.00 18.87  ? 115 LEU B CD1 1 
ATOM   2530 C  CD2 . LEU B 1 97  ? -5.172  24.417 42.096  1.00 21.00  ? 115 LEU B CD2 1 
ATOM   2531 N  N   . PHE B 1 98  ? -6.487  20.952 38.229  1.00 26.08  ? 116 PHE B N   1 
ATOM   2532 C  CA  . PHE B 1 98  ? -6.801  19.620 37.783  1.00 24.12  ? 116 PHE B CA  1 
ATOM   2533 C  C   . PHE B 1 98  ? -5.545  18.803 37.420  1.00 26.31  ? 116 PHE B C   1 
ATOM   2534 O  O   . PHE B 1 98  ? -5.372  17.680 37.911  1.00 28.86  ? 116 PHE B O   1 
ATOM   2535 C  CB  . PHE B 1 98  ? -7.782  19.666 36.593  1.00 22.74  ? 116 PHE B CB  1 
ATOM   2536 C  CG  . PHE B 1 98  ? -7.972  18.337 35.943  1.00 21.57  ? 116 PHE B CG  1 
ATOM   2537 C  CD1 . PHE B 1 98  ? -8.831  17.404 36.498  1.00 22.63  ? 116 PHE B CD1 1 
ATOM   2538 C  CD2 . PHE B 1 98  ? -7.204  17.968 34.843  1.00 22.63  ? 116 PHE B CD2 1 
ATOM   2539 C  CE1 . PHE B 1 98  ? -8.975  16.134 35.918  1.00 25.73  ? 116 PHE B CE1 1 
ATOM   2540 C  CE2 . PHE B 1 98  ? -7.325  16.704 34.268  1.00 24.50  ? 116 PHE B CE2 1 
ATOM   2541 C  CZ  . PHE B 1 98  ? -8.224  15.784 34.791  1.00 23.72  ? 116 PHE B CZ  1 
ATOM   2542 N  N   . ILE B 1 99  ? -4.678  19.366 36.567  1.00 27.12  ? 117 ILE B N   1 
ATOM   2543 C  CA  . ILE B 1 99  ? -3.404  18.747 36.210  1.00 24.41  ? 117 ILE B CA  1 
ATOM   2544 C  C   . ILE B 1 99  ? -2.469  18.583 37.430  1.00 22.90  ? 117 ILE B C   1 
ATOM   2545 O  O   . ILE B 1 99  ? -1.789  17.541 37.600  1.00 20.20  ? 117 ILE B O   1 
ATOM   2546 C  CB  . ILE B 1 99  ? -2.692  19.589 35.135  1.00 24.99  ? 117 ILE B CB  1 
ATOM   2547 C  CG1 . ILE B 1 99  ? -3.537  19.748 33.895  1.00 26.43  ? 117 ILE B CG1 1 
ATOM   2548 C  CG2 . ILE B 1 99  ? -1.319  19.034 34.758  1.00 27.79  ? 117 ILE B CG2 1 
ATOM   2549 C  CD1 . ILE B 1 99  ? -3.231  21.065 33.173  1.00 31.32  ? 117 ILE B CD1 1 
ATOM   2550 N  N   . LEU B 1 100 ? -2.352  19.623 38.238  1.00 23.03  ? 118 LEU B N   1 
ATOM   2551 C  CA  . LEU B 1 100 ? -1.372  19.557 39.331  1.00 22.57  ? 118 LEU B CA  1 
ATOM   2552 C  C   . LEU B 1 100 ? -1.772  18.476 40.309  1.00 22.41  ? 118 LEU B C   1 
ATOM   2553 O  O   . LEU B 1 100 ? -0.961  17.667 40.693  1.00 23.95  ? 118 LEU B O   1 
ATOM   2554 C  CB  . LEU B 1 100 ? -1.256  20.874 40.061  1.00 22.52  ? 118 LEU B CB  1 
ATOM   2555 C  CG  . LEU B 1 100 ? -0.244  20.887 41.206  1.00 25.35  ? 118 LEU B CG  1 
ATOM   2556 C  CD1 . LEU B 1 100 ? 1.173   20.711 40.658  1.00 27.15  ? 118 LEU B CD1 1 
ATOM   2557 C  CD2 . LEU B 1 100 ? -0.287  22.204 41.930  1.00 25.07  ? 118 LEU B CD2 1 
ATOM   2558 N  N   . ARG B 1 101 ? -3.042  18.424 40.657  1.00 22.46  ? 119 ARG B N   1 
ATOM   2559 C  CA  . ARG B 1 101 ? -3.503  17.462 41.661  1.00 26.93  ? 119 ARG B CA  1 
ATOM   2560 C  C   . ARG B 1 101 ? -3.509  16.063 41.097  1.00 24.36  ? 119 ARG B C   1 
ATOM   2561 O  O   . ARG B 1 101 ? -3.186  15.122 41.795  1.00 23.47  ? 119 ARG B O   1 
ATOM   2562 C  CB  . ARG B 1 101 ? -4.877  17.839 42.249  1.00 22.95  ? 119 ARG B CB  1 
ATOM   2563 C  CG  . ARG B 1 101 ? -4.804  19.143 43.037  1.00 25.28  ? 119 ARG B CG  1 
ATOM   2564 C  CD  . ARG B 1 101 ? -6.131  19.910 43.091  1.00 24.23  ? 119 ARG B CD  1 
ATOM   2565 N  NE  . ARG B 1 101 ? -7.257  18.995 43.336  1.00 26.49  ? 119 ARG B NE  1 
ATOM   2566 C  CZ  . ARG B 1 101 ? -7.732  18.625 44.544  1.00 24.98  ? 119 ARG B CZ  1 
ATOM   2567 N  NH1 . ARG B 1 101 ? -7.201  19.063 45.659  1.00 20.91  ? 119 ARG B NH1 1 
ATOM   2568 N  NH2 . ARG B 1 101 ? -8.776  17.799 44.613  1.00 28.00  ? 119 ARG B NH2 1 
ATOM   2569 N  N   . LEU B 1 102 ? -3.873  15.932 39.836  1.00 25.19  ? 120 LEU B N   1 
ATOM   2570 C  CA  . LEU B 1 102 ? -3.795  14.630 39.162  1.00 25.24  ? 120 LEU B CA  1 
ATOM   2571 C  C   . LEU B 1 102 ? -2.337  14.083 39.163  1.00 25.30  ? 120 LEU B C   1 
ATOM   2572 O  O   . LEU B 1 102 ? -2.065  12.896 39.457  1.00 26.38  ? 120 LEU B O   1 
ATOM   2573 C  CB  . LEU B 1 102 ? -4.338  14.766 37.733  1.00 24.57  ? 120 LEU B CB  1 
ATOM   2574 C  CG  . LEU B 1 102 ? -4.418  13.473 36.941  1.00 25.65  ? 120 LEU B CG  1 
ATOM   2575 C  CD1 . LEU B 1 102 ? -5.334  12.473 37.663  1.00 26.00  ? 120 LEU B CD1 1 
ATOM   2576 C  CD2 . LEU B 1 102 ? -4.904  13.712 35.511  1.00 26.12  ? 120 LEU B CD2 1 
ATOM   2577 N  N   . ALA B 1 103 ? -1.409  14.980 38.878  1.00 24.46  ? 121 ALA B N   1 
ATOM   2578 C  CA  . ALA B 1 103 ? -0.036  14.622 38.651  1.00 25.24  ? 121 ALA B CA  1 
ATOM   2579 C  C   . ALA B 1 103 ? 0.597   14.136 39.947  1.00 26.84  ? 121 ALA B C   1 
ATOM   2580 O  O   . ALA B 1 103 ? 1.363   13.143 39.956  1.00 22.98  ? 121 ALA B O   1 
ATOM   2581 C  CB  . ALA B 1 103 ? 0.724   15.811 38.069  1.00 23.72  ? 121 ALA B CB  1 
ATOM   2582 N  N   . TYR B 1 104 ? 0.251   14.830 41.024  1.00 25.43  ? 122 TYR B N   1 
ATOM   2583 C  CA  . TYR B 1 104 ? 0.727   14.492 42.343  1.00 26.99  ? 122 TYR B CA  1 
ATOM   2584 C  C   . TYR B 1 104 ? 0.086   13.197 42.814  1.00 29.00  ? 122 TYR B C   1 
ATOM   2585 O  O   . TYR B 1 104 ? 0.759   12.377 43.388  1.00 31.57  ? 122 TYR B O   1 
ATOM   2586 C  CB  . TYR B 1 104 ? 0.405   15.629 43.310  1.00 26.57  ? 122 TYR B CB  1 
ATOM   2587 C  CG  . TYR B 1 104 ? 1.125   15.593 44.665  1.00 28.38  ? 122 TYR B CG  1 
ATOM   2588 C  CD1 . TYR B 1 104 ? 2.515   15.679 44.742  1.00 26.10  ? 122 TYR B CD1 1 
ATOM   2589 C  CD2 . TYR B 1 104 ? 0.394   15.510 45.868  1.00 28.27  ? 122 TYR B CD2 1 
ATOM   2590 C  CE1 . TYR B 1 104 ? 3.162   15.644 45.957  1.00 28.57  ? 122 TYR B CE1 1 
ATOM   2591 C  CE2 . TYR B 1 104 ? 1.032   15.489 47.100  1.00 27.32  ? 122 TYR B CE2 1 
ATOM   2592 C  CZ  . TYR B 1 104 ? 2.421   15.550 47.134  1.00 30.81  ? 122 TYR B CZ  1 
ATOM   2593 O  OH  . TYR B 1 104 ? 3.098   15.557 48.325  1.00 29.61  ? 122 TYR B OH  1 
ATOM   2594 N  N   . ARG B 1 105 ? -1.197  12.993 42.495  1.00 29.64  ? 123 ARG B N   1 
ATOM   2595 C  CA  . ARG B 1 105 ? -1.948  11.803 42.904  1.00 28.02  ? 123 ARG B CA  1 
ATOM   2596 C  C   . ARG B 1 105 ? -1.542  10.551 42.100  1.00 26.87  ? 123 ARG B C   1 
ATOM   2597 O  O   . ARG B 1 105 ? -1.662  9.454  42.565  1.00 23.64  ? 123 ARG B O   1 
ATOM   2598 C  CB  . ARG B 1 105 ? -3.441  12.070 42.679  1.00 26.56  ? 123 ARG B CB  1 
ATOM   2599 C  CG  . ARG B 1 105 ? -4.371  11.314 43.607  1.00 25.57  ? 123 ARG B CG  1 
ATOM   2600 C  CD  . ARG B 1 105 ? -5.878  11.670 43.453  1.00 24.75  ? 123 ARG B CD  1 
ATOM   2601 N  NE  . ARG B 1 105 ? -6.266  13.076 43.581  1.00 21.78  ? 123 ARG B NE  1 
ATOM   2602 C  CZ  . ARG B 1 105 ? -6.644  13.847 42.554  1.00 25.96  ? 123 ARG B CZ  1 
ATOM   2603 N  NH1 . ARG B 1 105 ? -6.698  13.367 41.291  1.00 20.92  ? 123 ARG B NH1 1 
ATOM   2604 N  NH2 . ARG B 1 105 ? -6.996  15.126 42.776  1.00 28.53  ? 123 ARG B NH2 1 
ATOM   2605 N  N   . SER B 1 106 ? -1.110  10.715 40.859  1.00 28.27  ? 124 SER B N   1 
ATOM   2606 C  CA  . SER B 1 106 ? -0.875  9.551  40.018  1.00 25.77  ? 124 SER B CA  1 
ATOM   2607 C  C   . SER B 1 106 ? 0.459   8.869  40.241  1.00 29.72  ? 124 SER B C   1 
ATOM   2608 O  O   . SER B 1 106 ? 1.262   9.255  41.119  1.00 28.04  ? 124 SER B O   1 
ATOM   2609 C  CB  . SER B 1 106 ? -0.999  9.926  38.552  1.00 23.69  ? 124 SER B CB  1 
ATOM   2610 O  OG  . SER B 1 106 ? -2.254  10.486 38.379  1.00 18.85  ? 124 SER B OG  1 
ATOM   2611 N  N   . LYS B 1 107 ? 0.696   7.834  39.439  1.00 28.23  ? 125 LYS B N   1 
ATOM   2612 C  CA  . LYS B 1 107 ? 1.856   6.983  39.659  1.00 29.09  ? 125 LYS B CA  1 
ATOM   2613 C  C   . LYS B 1 107 ? 2.374   6.751  38.277  1.00 29.60  ? 125 LYS B C   1 
ATOM   2614 O  O   . LYS B 1 107 ? 2.018   5.717  37.659  1.00 26.02  ? 125 LYS B O   1 
ATOM   2615 C  CB  . LYS B 1 107 ? 1.491   5.624  40.273  1.00 30.58  ? 125 LYS B CB  1 
ATOM   2616 C  CG  . LYS B 1 107 ? 0.625   5.680  41.523  1.00 35.58  ? 125 LYS B CG  1 
ATOM   2617 C  CD  . LYS B 1 107 ? 1.474   5.985  42.750  1.00 40.22  ? 125 LYS B CD  1 
ATOM   2618 C  CE  . LYS B 1 107 ? 0.573   6.160  43.966  1.00 46.89  ? 125 LYS B CE  1 
ATOM   2619 N  NZ  . LYS B 1 107 ? 1.342   6.399  45.231  1.00 50.63  ? 125 LYS B NZ  1 
ATOM   2620 N  N   . PRO B 1 108 ? 3.223   7.690  37.807  1.00 29.24  ? 126 PRO B N   1 
ATOM   2621 C  CA  . PRO B 1 108 ? 3.767   7.736  36.450  1.00 30.82  ? 126 PRO B CA  1 
ATOM   2622 C  C   . PRO B 1 108 ? 4.743   6.576  36.178  1.00 32.68  ? 126 PRO B C   1 
ATOM   2623 O  O   . PRO B 1 108 ? 4.894   6.163  35.019  1.00 31.98  ? 126 PRO B O   1 
ATOM   2624 C  CB  . PRO B 1 108 ? 4.484   9.105  36.392  1.00 30.24  ? 126 PRO B CB  1 
ATOM   2625 C  CG  . PRO B 1 108 ? 4.716   9.493  37.824  1.00 31.83  ? 126 PRO B CG  1 
ATOM   2626 C  CD  . PRO B 1 108 ? 3.572   8.894  38.595  1.00 28.76  ? 126 PRO B CD  1 
ATOM   2627 N  N   . GLY B 1 109 ? 5.395   6.055  37.231  1.00 34.50  ? 127 GLY B N   1 
ATOM   2628 C  CA  . GLY B 1 109 ? 6.236   4.864  37.068  1.00 31.89  ? 127 GLY B CA  1 
ATOM   2629 C  C   . GLY B 1 109 ? 5.423   3.687  36.507  1.00 36.05  ? 127 GLY B C   1 
ATOM   2630 O  O   . GLY B 1 109 ? 5.888   2.994  35.590  1.00 36.03  ? 127 GLY B O   1 
ATOM   2631 N  N   . GLU B 1 110 ? 4.218   3.459  37.047  1.00 33.93  ? 128 GLU B N   1 
ATOM   2632 C  CA  . GLU B 1 110 ? 3.300   2.414  36.526  1.00 36.97  ? 128 GLU B CA  1 
ATOM   2633 C  C   . GLU B 1 110 ? 2.279   2.816  35.478  1.00 34.57  ? 128 GLU B C   1 
ATOM   2634 O  O   . GLU B 1 110 ? 1.433   2.014  35.126  1.00 38.94  ? 128 GLU B O   1 
ATOM   2635 C  CB  . GLU B 1 110 ? 2.556   1.691  37.650  1.00 38.07  ? 128 GLU B CB  1 
ATOM   2636 C  CG  . GLU B 1 110 ? 2.649   2.390  38.980  1.00 47.98  ? 128 GLU B CG  1 
ATOM   2637 C  CD  . GLU B 1 110 ? 4.077   2.418  39.492  1.00 48.18  ? 128 GLU B CD  1 
ATOM   2638 O  OE1 . GLU B 1 110 ? 4.780   1.445  39.162  1.00 49.46  ? 128 GLU B OE1 1 
ATOM   2639 O  OE2 . GLU B 1 110 ? 4.481   3.394  40.184  1.00 43.45  ? 128 GLU B OE2 1 
ATOM   2640 N  N   . GLY B 1 111 ? 2.315   4.041  34.983  1.00 34.93  ? 129 GLY B N   1 
ATOM   2641 C  CA  . GLY B 1 111 ? 1.273   4.461  34.030  1.00 32.88  ? 129 GLY B CA  1 
ATOM   2642 C  C   . GLY B 1 111 ? -0.099  4.621  34.681  1.00 32.92  ? 129 GLY B C   1 
ATOM   2643 O  O   . GLY B 1 111 ? -1.093  4.566  33.999  1.00 31.33  ? 129 GLY B O   1 
ATOM   2644 N  N   . LYS B 1 112 ? -0.159  4.792  36.002  1.00 30.04  ? 130 LYS B N   1 
ATOM   2645 C  CA  . LYS B 1 112 ? -1.458  4.860  36.668  1.00 31.85  ? 130 LYS B CA  1 
ATOM   2646 C  C   . LYS B 1 112 ? -1.903  6.292  36.861  1.00 27.25  ? 130 LYS B C   1 
ATOM   2647 O  O   . LYS B 1 112 ? -1.201  7.040  37.502  1.00 24.99  ? 130 LYS B O   1 
ATOM   2648 C  CB  . LYS B 1 112 ? -1.382  4.249  38.074  1.00 39.57  ? 130 LYS B CB  1 
ATOM   2649 C  CG  . LYS B 1 112 ? -1.686  2.756  38.200  1.00 44.80  ? 130 LYS B CG  1 
ATOM   2650 C  CD  . LYS B 1 112 ? -2.063  2.463  39.654  1.00 49.44  ? 130 LYS B CD  1 
ATOM   2651 C  CE  . LYS B 1 112 ? -0.897  1.960  40.505  1.00 44.65  ? 130 LYS B CE  1 
ATOM   2652 N  NZ  . LYS B 1 112 ? -1.137  0.532  40.909  1.00 48.18  ? 130 LYS B NZ  1 
ATOM   2653 N  N   . LEU B 1 113 ? -3.081  6.641  36.339  1.00 25.20  ? 131 LEU B N   1 
ATOM   2654 C  CA  . LEU B 1 113 ? -3.781  7.900  36.670  1.00 23.60  ? 131 LEU B CA  1 
ATOM   2655 C  C   . LEU B 1 113 ? -4.783  7.596  37.755  1.00 22.24  ? 131 LEU B C   1 
ATOM   2656 O  O   . LEU B 1 113 ? -5.557  6.647  37.642  1.00 22.30  ? 131 LEU B O   1 
ATOM   2657 C  CB  . LEU B 1 113 ? -4.531  8.469  35.455  1.00 21.70  ? 131 LEU B CB  1 
ATOM   2658 C  CG  . LEU B 1 113 ? -3.758  9.063  34.243  1.00 23.32  ? 131 LEU B CG  1 
ATOM   2659 C  CD1 . LEU B 1 113 ? -2.670  10.098 34.656  1.00 21.31  ? 131 LEU B CD1 1 
ATOM   2660 C  CD2 . LEU B 1 113 ? -3.156  7.896  33.504  1.00 22.84  ? 131 LEU B CD2 1 
ATOM   2661 N  N   . ILE B 1 114 ? -4.764  8.411  38.796  1.00 24.67  ? 132 ILE B N   1 
ATOM   2662 C  CA  . ILE B 1 114 ? -5.708  8.311  39.904  1.00 26.12  ? 132 ILE B CA  1 
ATOM   2663 C  C   . ILE B 1 114 ? -6.435  9.620  40.031  1.00 26.55  ? 132 ILE B C   1 
ATOM   2664 O  O   . ILE B 1 114 ? -5.844  10.662 40.337  1.00 27.30  ? 132 ILE B O   1 
ATOM   2665 C  CB  . ILE B 1 114 ? -5.038  7.992  41.256  1.00 25.61  ? 132 ILE B CB  1 
ATOM   2666 C  CG1 . ILE B 1 114 ? -4.302  6.662  41.168  1.00 26.42  ? 132 ILE B CG1 1 
ATOM   2667 C  CG2 . ILE B 1 114 ? -6.085  7.984  42.357  1.00 25.30  ? 132 ILE B CG2 1 
ATOM   2668 C  CD1 . ILE B 1 114 ? -3.543  6.334  42.430  1.00 24.50  ? 132 ILE B CD1 1 
ATOM   2669 N  N   . PHE B 1 115 ? -7.731  9.561  39.783  1.00 25.21  ? 133 PHE B N   1 
ATOM   2670 C  CA  . PHE B 1 115 ? -8.546  10.756 39.793  1.00 23.95  ? 133 PHE B CA  1 
ATOM   2671 C  C   . PHE B 1 115 ? -9.073  11.017 41.197  1.00 22.60  ? 133 PHE B C   1 
ATOM   2672 O  O   . PHE B 1 115 ? -8.867  10.212 42.098  1.00 23.74  ? 133 PHE B O   1 
ATOM   2673 C  CB  . PHE B 1 115 ? -9.626  10.591 38.722  1.00 23.74  ? 133 PHE B CB  1 
ATOM   2674 C  CG  . PHE B 1 115 ? -9.041  10.444 37.355  1.00 22.57  ? 133 PHE B CG  1 
ATOM   2675 C  CD1 . PHE B 1 115 ? -8.756  9.188  36.826  1.00 21.97  ? 133 PHE B CD1 1 
ATOM   2676 C  CD2 . PHE B 1 115 ? -8.683  11.567 36.626  1.00 23.81  ? 133 PHE B CD2 1 
ATOM   2677 C  CE1 . PHE B 1 115 ? -8.169  9.051  35.573  1.00 21.08  ? 133 PHE B CE1 1 
ATOM   2678 C  CE2 . PHE B 1 115 ? -8.106  11.436 35.360  1.00 22.14  ? 133 PHE B CE2 1 
ATOM   2679 C  CZ  . PHE B 1 115 ? -7.861  10.172 34.837  1.00 20.96  ? 133 PHE B CZ  1 
ATOM   2680 N  N   . CYS B 1 116 ? -9.677  12.174 41.396  1.00 24.23  ? 134 CYS B N   1 
ATOM   2681 C  CA  . CYS B 1 116 ? -10.096 12.609 42.706  1.00 24.91  ? 134 CYS B CA  1 
ATOM   2682 C  C   . CYS B 1 116 ? -11.283 11.863 43.257  1.00 27.32  ? 134 CYS B C   1 
ATOM   2683 O  O   . CYS B 1 116 ? -11.424 11.849 44.457  1.00 28.08  ? 134 CYS B O   1 
ATOM   2684 C  CB  . CYS B 1 116 ? -10.363 14.106 42.747  1.00 27.99  ? 134 CYS B CB  1 
ATOM   2685 S  SG  . CYS B 1 116 ? -11.860 14.569 41.856  1.00 26.97  ? 134 CYS B SG  1 
ATOM   2686 N  N   . SER B 1 117 ? -12.111 11.221 42.414  1.00 30.22  ? 135 SER B N   1 
ATOM   2687 C  CA  . SER B 1 117 ? -13.226 10.348 42.904  1.00 29.39  ? 135 SER B CA  1 
ATOM   2688 C  C   . SER B 1 117 ? -12.720 9.088  43.582  1.00 30.60  ? 135 SER B C   1 
ATOM   2689 O  O   . SER B 1 117 ? -13.484 8.427  44.262  1.00 30.96  ? 135 SER B O   1 
ATOM   2690 C  CB  . SER B 1 117 ? -14.120 9.862  41.772  1.00 25.91  ? 135 SER B CB  1 
ATOM   2691 O  OG  . SER B 1 117 ? -13.392 8.950  40.922  1.00 25.93  ? 135 SER B OG  1 
ATOM   2692 N  N   . GLY B 1 118 ? -11.448 8.752  43.357  1.00 32.09  ? 136 GLY B N   1 
ATOM   2693 C  CA  . GLY B 1 118 ? -10.868 7.460  43.751  1.00 28.52  ? 136 GLY B CA  1 
ATOM   2694 C  C   . GLY B 1 118 ? -10.581 6.576  42.546  1.00 29.76  ? 136 GLY B C   1 
ATOM   2695 O  O   . GLY B 1 118 ? -9.759  5.646  42.660  1.00 27.20  ? 136 GLY B O   1 
ATOM   2696 N  N   . LEU B 1 119 ? -11.256 6.867  41.410  1.00 28.23  ? 137 LEU B N   1 
ATOM   2697 C  CA  . LEU B 1 119 ? -11.131 6.104  40.143  1.00 28.29  ? 137 LEU B CA  1 
ATOM   2698 C  C   . LEU B 1 119 ? -9.683  5.942  39.649  1.00 27.09  ? 137 LEU B C   1 
ATOM   2699 O  O   . LEU B 1 119 ? -8.956  6.916  39.494  1.00 23.82  ? 137 LEU B O   1 
ATOM   2700 C  CB  . LEU B 1 119 ? -11.983 6.700  39.021  1.00 29.67  ? 137 LEU B CB  1 
ATOM   2701 C  CG  . LEU B 1 119 ? -12.016 5.936  37.685  1.00 30.28  ? 137 LEU B CG  1 
ATOM   2702 C  CD1 . LEU B 1 119 ? -12.866 4.688  37.823  1.00 30.39  ? 137 LEU B CD1 1 
ATOM   2703 C  CD2 . LEU B 1 119 ? -12.580 6.781  36.584  1.00 29.85  ? 137 LEU B CD2 1 
ATOM   2704 N  N   . VAL B 1 120 ? -9.262  4.692  39.479  1.00 27.99  ? 138 VAL B N   1 
ATOM   2705 C  CA  . VAL B 1 120 ? -7.939  4.392  38.873  1.00 27.25  ? 138 VAL B CA  1 
ATOM   2706 C  C   . VAL B 1 120 ? -8.062  3.852  37.419  1.00 24.92  ? 138 VAL B C   1 
ATOM   2707 O  O   . VAL B 1 120 ? -8.885  2.977  37.103  1.00 22.33  ? 138 VAL B O   1 
ATOM   2708 C  CB  . VAL B 1 120 ? -7.063  3.517  39.779  1.00 25.98  ? 138 VAL B CB  1 
ATOM   2709 C  CG1 . VAL B 1 120 ? -5.678  3.447  39.193  1.00 25.44  ? 138 VAL B CG1 1 
ATOM   2710 C  CG2 . VAL B 1 120 ? -7.018  4.102  41.201  1.00 26.48  ? 138 VAL B CG2 1 
ATOM   2711 N  N   . LEU B 1 121 ? -7.303  4.501  36.546  1.00 26.51  ? 139 LEU B N   1 
ATOM   2712 C  CA  . LEU B 1 121 ? -7.306  4.242  35.102  1.00 28.98  ? 139 LEU B CA  1 
ATOM   2713 C  C   . LEU B 1 121 ? -5.864  4.150  34.597  1.00 27.24  ? 139 LEU B C   1 
ATOM   2714 O  O   . LEU B 1 121 ? -4.946  4.755  35.132  1.00 23.56  ? 139 LEU B O   1 
ATOM   2715 C  CB  . LEU B 1 121 ? -8.092  5.321  34.339  1.00 29.01  ? 139 LEU B CB  1 
ATOM   2716 C  CG  . LEU B 1 121 ? -9.502  5.030  33.812  1.00 31.29  ? 139 LEU B CG  1 
ATOM   2717 C  CD1 . LEU B 1 121 ? -10.254 3.943  34.578  1.00 34.19  ? 139 LEU B CD1 1 
ATOM   2718 C  CD2 . LEU B 1 121 ? -10.327 6.304  33.705  1.00 33.65  ? 139 LEU B CD2 1 
ATOM   2719 N  N   . HIS B 1 122 ? -5.658  3.321  33.599  1.00 30.69  ? 140 HIS B N   1 
ATOM   2720 C  CA  . HIS B 1 122 ? -4.351  3.256  32.992  1.00 29.32  ? 140 HIS B CA  1 
ATOM   2721 C  C   . HIS B 1 122 ? -4.209  4.339  31.940  1.00 26.60  ? 140 HIS B C   1 
ATOM   2722 O  O   . HIS B 1 122 ? -5.166  4.728  31.321  1.00 24.91  ? 140 HIS B O   1 
ATOM   2723 C  CB  . HIS B 1 122 ? -4.133  1.875  32.400  1.00 32.15  ? 140 HIS B CB  1 
ATOM   2724 C  CG  . HIS B 1 122 ? -2.712  1.646  32.000  1.00 29.93  ? 140 HIS B CG  1 
ATOM   2725 N  ND1 . HIS B 1 122 ? -1.814  1.072  32.822  1.00 27.66  ? 140 HIS B ND1 1 
ATOM   2726 C  CD2 . HIS B 1 122 ? -2.028  2.051  30.894  1.00 30.91  ? 140 HIS B CD2 1 
ATOM   2727 C  CE1 . HIS B 1 122 ? -0.625  1.061  32.237  1.00 30.07  ? 140 HIS B CE1 1 
ATOM   2728 N  NE2 . HIS B 1 122 ? -0.749  1.655  31.051  1.00 34.74  ? 140 HIS B NE2 1 
ATOM   2729 N  N   . ARG B 1 123 ? -3.020  4.878  31.769  1.00 26.72  ? 141 ARG B N   1 
ATOM   2730 C  CA  A ARG B 1 123 ? -2.710  5.822  30.655  0.50 27.67  ? 141 ARG B CA  1 
ATOM   2731 C  CA  B ARG B 1 123 ? -2.794  5.860  30.706  0.50 27.46  ? 141 ARG B CA  1 
ATOM   2732 C  C   . ARG B 1 123 ? -3.388  5.459  29.316  1.00 28.08  ? 141 ARG B C   1 
ATOM   2733 O  O   . ARG B 1 123 ? -3.938  6.335  28.588  1.00 27.10  ? 141 ARG B O   1 
ATOM   2734 C  CB  A ARG B 1 123 ? -1.185  5.903  30.408  0.50 27.27  ? 141 ARG B CB  1 
ATOM   2735 C  CB  B ARG B 1 123 ? -1.300  6.248  30.641  0.50 27.08  ? 141 ARG B CB  1 
ATOM   2736 C  CG  A ARG B 1 123 ? -0.810  6.799  29.217  0.50 28.20  ? 141 ARG B CG  1 
ATOM   2737 C  CG  B ARG B 1 123 ? -0.317  5.094  30.458  0.50 27.07  ? 141 ARG B CG  1 
ATOM   2738 C  CD  A ARG B 1 123 ? 0.188   6.214  28.201  0.50 25.39  ? 141 ARG B CD  1 
ATOM   2739 C  CD  B ARG B 1 123 ? 1.129   5.582  30.389  0.50 27.18  ? 141 ARG B CD  1 
ATOM   2740 N  NE  A ARG B 1 123 ? 0.109   7.008  26.978  0.50 26.13  ? 141 ARG B NE  1 
ATOM   2741 N  NE  B ARG B 1 123 ? 1.896   4.840  29.378  0.50 29.67  ? 141 ARG B NE  1 
ATOM   2742 C  CZ  A ARG B 1 123 ? -0.126  6.537  25.751  0.50 27.15  ? 141 ARG B CZ  1 
ATOM   2743 C  CZ  B ARG B 1 123 ? 2.775   3.888  29.655  0.50 26.79  ? 141 ARG B CZ  1 
ATOM   2744 N  NH1 A ARG B 1 123 ? -0.273  5.245  25.530  0.50 27.96  ? 141 ARG B NH1 1 
ATOM   2745 N  NH1 B ARG B 1 123 ? 3.041   3.551  30.923  0.50 25.70  ? 141 ARG B NH1 1 
ATOM   2746 N  NH2 A ARG B 1 123 ? -0.187  7.375  24.722  0.50 29.74  ? 141 ARG B NH2 1 
ATOM   2747 N  NH2 B ARG B 1 123 ? 3.399   3.296  28.666  0.50 25.21  ? 141 ARG B NH2 1 
ATOM   2748 N  N   . LEU B 1 124 ? -3.308  4.168  28.957  1.00 28.73  ? 142 LEU B N   1 
ATOM   2749 C  CA  . LEU B 1 124 ? -3.857  3.629  27.671  1.00 28.90  ? 142 LEU B CA  1 
ATOM   2750 C  C   . LEU B 1 124 ? -5.369  3.648  27.659  1.00 31.06  ? 142 LEU B C   1 
ATOM   2751 O  O   . LEU B 1 124 ? -6.007  3.548  26.603  1.00 34.45  ? 142 LEU B O   1 
ATOM   2752 C  CB  . LEU B 1 124 ? -3.369  2.176  27.422  1.00 28.40  ? 142 LEU B CB  1 
ATOM   2753 C  CG  . LEU B 1 124 ? -1.841  2.050  27.552  1.00 29.18  ? 142 LEU B CG  1 
ATOM   2754 C  CD1 . LEU B 1 124 ? -1.317  0.623  27.647  1.00 28.46  ? 142 LEU B CD1 1 
ATOM   2755 C  CD2 . LEU B 1 124 ? -1.127  2.860  26.455  1.00 26.45  ? 142 LEU B CD2 1 
ATOM   2756 N  N   . GLN B 1 125 ? -5.965  3.740  28.837  1.00 27.66  ? 143 GLN B N   1 
ATOM   2757 C  CA  . GLN B 1 125 ? -7.391  3.933  28.901  1.00 28.41  ? 143 GLN B CA  1 
ATOM   2758 C  C   . GLN B 1 125 ? -7.669  5.425  28.713  1.00 29.81  ? 143 GLN B C   1 
ATOM   2759 O  O   . GLN B 1 125 ? -8.722  5.824  28.247  1.00 31.71  ? 143 GLN B O   1 
ATOM   2760 C  CB  . GLN B 1 125 ? -7.946  3.376  30.229  1.00 26.17  ? 143 GLN B CB  1 
ATOM   2761 C  CG  . GLN B 1 125 ? -7.925  1.856  30.293  1.00 26.55  ? 143 GLN B CG  1 
ATOM   2762 C  CD  . GLN B 1 125 ? -8.277  1.332  31.663  1.00 30.18  ? 143 GLN B CD  1 
ATOM   2763 O  OE1 . GLN B 1 125 ? -7.562  1.596  32.638  1.00 32.86  ? 143 GLN B OE1 1 
ATOM   2764 N  NE2 . GLN B 1 125 ? -9.386  0.603  31.761  1.00 25.71  ? 143 GLN B NE2 1 
ATOM   2765 N  N   . CYS B 1 126 ? -6.708  6.270  29.057  1.00 33.97  ? 144 CYS B N   1 
ATOM   2766 C  CA  . CYS B 1 126 ? -6.920  7.724  28.913  1.00 31.59  ? 144 CYS B CA  1 
ATOM   2767 C  C   . CYS B 1 126 ? -6.534  8.314  27.573  1.00 32.40  ? 144 CYS B C   1 
ATOM   2768 O  O   . CYS B 1 126 ? -6.946  9.458  27.250  1.00 29.69  ? 144 CYS B O   1 
ATOM   2769 C  CB  . CYS B 1 126 ? -6.195  8.442  30.029  1.00 29.58  ? 144 CYS B CB  1 
ATOM   2770 S  SG  . CYS B 1 126 ? -6.983  8.048  31.572  1.00 34.17  ? 144 CYS B SG  1 
ATOM   2771 N  N   . ALA B 1 127 ? -5.775  7.536  26.788  1.00 31.31  ? 145 ALA B N   1 
ATOM   2772 C  CA  . ALA B 1 127 ? -5.090  8.084  25.620  1.00 32.08  ? 145 ALA B CA  1 
ATOM   2773 C  C   . ALA B 1 127 ? -6.050  8.669  24.627  1.00 38.40  ? 145 ALA B C   1 
ATOM   2774 O  O   . ALA B 1 127 ? -5.901  9.834  24.261  1.00 42.26  ? 145 ALA B O   1 
ATOM   2775 C  CB  . ALA B 1 127 ? -4.201  7.045  24.946  1.00 33.69  ? 145 ALA B CB  1 
ATOM   2776 N  N   . ARG B 1 128 ? -7.015  7.870  24.169  1.00 38.20  ? 146 ARG B N   1 
ATOM   2777 C  CA  . ARG B 1 128 ? -7.934  8.325  23.113  1.00 41.26  ? 146 ARG B CA  1 
ATOM   2778 C  C   . ARG B 1 128 ? -8.706  9.569  23.500  1.00 40.72  ? 146 ARG B C   1 
ATOM   2779 O  O   . ARG B 1 128 ? -8.956  10.437 22.667  1.00 40.66  ? 146 ARG B O   1 
ATOM   2780 C  CB  . ARG B 1 128 ? -8.928  7.236  22.759  1.00 44.36  ? 146 ARG B CB  1 
ATOM   2781 C  CG  . ARG B 1 128 ? -8.371  6.128  21.885  1.00 50.07  ? 146 ARG B CG  1 
ATOM   2782 C  CD  . ARG B 1 128 ? -8.930  4.757  22.302  1.00 59.00  ? 146 ARG B CD  1 
ATOM   2783 N  NE  . ARG B 1 128 ? -10.373 4.591  22.081  1.00 59.59  ? 146 ARG B NE  1 
ATOM   2784 C  CZ  . ARG B 1 128 ? -10.966 3.423  21.819  1.00 66.72  ? 146 ARG B CZ  1 
ATOM   2785 N  NH1 . ARG B 1 128 ? -10.251 2.302  21.707  1.00 69.48  ? 146 ARG B NH1 1 
ATOM   2786 N  NH2 . ARG B 1 128 ? -12.277 3.373  21.628  1.00 67.48  ? 146 ARG B NH2 1 
ATOM   2787 N  N   . GLY B 1 129 ? -9.104  9.638  24.768  1.00 40.39  ? 147 GLY B N   1 
ATOM   2788 C  CA  . GLY B 1 129 ? -9.801  10.794 25.277  1.00 37.78  ? 147 GLY B CA  1 
ATOM   2789 C  C   . GLY B 1 129 ? -8.904  12.014 25.369  1.00 40.38  ? 147 GLY B C   1 
ATOM   2790 O  O   . GLY B 1 129 ? -9.230  13.069 24.794  1.00 45.73  ? 147 GLY B O   1 
ATOM   2791 N  N   . PHE B 1 130 ? -7.778  11.888 26.067  1.00 33.95  ? 148 PHE B N   1 
ATOM   2792 C  CA  . PHE B 1 130 ? -6.962  13.069 26.380  1.00 34.91  ? 148 PHE B CA  1 
ATOM   2793 C  C   . PHE B 1 130 ? -6.035  13.414 25.245  1.00 32.02  ? 148 PHE B C   1 
ATOM   2794 O  O   . PHE B 1 130 ? -5.521  14.530 25.206  1.00 27.43  ? 148 PHE B O   1 
ATOM   2795 C  CB  . PHE B 1 130 ? -6.109  12.883 27.642  1.00 31.85  ? 148 PHE B CB  1 
ATOM   2796 C  CG  . PHE B 1 130 ? -6.891  12.897 28.941  1.00 33.04  ? 148 PHE B CG  1 
ATOM   2797 C  CD1 . PHE B 1 130 ? -7.747  11.861 29.275  1.00 34.83  ? 148 PHE B CD1 1 
ATOM   2798 C  CD2 . PHE B 1 130 ? -6.715  13.924 29.860  1.00 33.23  ? 148 PHE B CD2 1 
ATOM   2799 C  CE1 . PHE B 1 130 ? -8.454  11.872 30.481  1.00 36.54  ? 148 PHE B CE1 1 
ATOM   2800 C  CE2 . PHE B 1 130 ? -7.398  13.936 31.062  1.00 34.81  ? 148 PHE B CE2 1 
ATOM   2801 C  CZ  . PHE B 1 130 ? -8.259  12.904 31.379  1.00 34.82  ? 148 PHE B CZ  1 
ATOM   2802 N  N   . GLY B 1 131 ? -5.819  12.457 24.336  1.00 32.48  ? 149 GLY B N   1 
ATOM   2803 C  CA  . GLY B 1 131 ? -4.806  12.576 23.284  1.00 30.07  ? 149 GLY B CA  1 
ATOM   2804 C  C   . GLY B 1 131 ? -3.435  12.579 23.942  1.00 33.93  ? 149 GLY B C   1 
ATOM   2805 O  O   . GLY B 1 131 ? -3.247  12.110 25.116  1.00 30.81  ? 149 GLY B O   1 
ATOM   2806 N  N   . ASP B 1 132 ? -2.472  13.110 23.202  1.00 36.42  ? 150 ASP B N   1 
ATOM   2807 C  CA  A ASP B 1 132 ? -1.102  13.120 23.719  0.70 39.81  ? 150 ASP B CA  1 
ATOM   2808 C  CA  B ASP B 1 132 ? -1.081  13.259 23.635  0.30 35.70  ? 150 ASP B CA  1 
ATOM   2809 C  C   . ASP B 1 132 ? -0.980  13.958 24.987  1.00 37.72  ? 150 ASP B C   1 
ATOM   2810 O  O   . ASP B 1 132 ? -0.044  13.731 25.763  1.00 39.71  ? 150 ASP B O   1 
ATOM   2811 C  CB  A ASP B 1 132 ? -0.086  13.569 22.665  0.70 44.83  ? 150 ASP B CB  1 
ATOM   2812 C  CB  B ASP B 1 132 ? -0.291  14.049 22.574  0.30 34.23  ? 150 ASP B CB  1 
ATOM   2813 C  CG  A ASP B 1 132 ? -0.519  14.798 21.960  0.70 44.18  ? 150 ASP B CG  1 
ATOM   2814 C  CG  B ASP B 1 132 ? -0.137  13.280 21.269  0.30 31.43  ? 150 ASP B CG  1 
ATOM   2815 O  OD1 A ASP B 1 132 ? -1.014  14.652 20.835  0.70 47.58  ? 150 ASP B OD1 1 
ATOM   2816 O  OD1 B ASP B 1 132 ? 0.122   12.067 21.326  0.30 31.48  ? 150 ASP B OD1 1 
ATOM   2817 O  OD2 A ASP B 1 132 ? -0.388  15.893 22.543  0.70 46.69  ? 150 ASP B OD2 1 
ATOM   2818 O  OD2 B ASP B 1 132 ? -0.281  13.877 20.191  0.30 29.94  ? 150 ASP B OD2 1 
ATOM   2819 N  N   . TRP B 1 133 ? -1.941  14.848 25.251  1.00 31.83  ? 151 TRP B N   1 
ATOM   2820 C  CA  . TRP B 1 133 ? -1.933  15.577 26.507  1.00 28.11  ? 151 TRP B CA  1 
ATOM   2821 C  C   . TRP B 1 133 ? -1.557  14.701 27.728  1.00 31.00  ? 151 TRP B C   1 
ATOM   2822 O  O   . TRP B 1 133 ? -0.705  15.107 28.539  1.00 35.43  ? 151 TRP B O   1 
ATOM   2823 C  CB  . TRP B 1 133 ? -3.245  16.347 26.677  1.00 26.20  ? 151 TRP B CB  1 
ATOM   2824 C  CG  . TRP B 1 133 ? -3.241  17.397 27.775  1.00 27.12  ? 151 TRP B CG  1 
ATOM   2825 C  CD1 . TRP B 1 133 ? -2.194  18.242 28.149  1.00 26.34  ? 151 TRP B CD1 1 
ATOM   2826 C  CD2 . TRP B 1 133 ? -4.339  17.754 28.673  1.00 24.99  ? 151 TRP B CD2 1 
ATOM   2827 N  NE1 . TRP B 1 133 ? -2.570  19.079 29.168  1.00 26.10  ? 151 TRP B NE1 1 
ATOM   2828 C  CE2 . TRP B 1 133 ? -3.833  18.839 29.532  1.00 25.09  ? 151 TRP B CE2 1 
ATOM   2829 C  CE3 . TRP B 1 133 ? -5.638  17.325 28.826  1.00 26.32  ? 151 TRP B CE3 1 
ATOM   2830 C  CZ2 . TRP B 1 133 ? -4.607  19.436 30.496  1.00 26.14  ? 151 TRP B CZ2 1 
ATOM   2831 C  CZ3 . TRP B 1 133 ? -6.422  17.936 29.809  1.00 29.03  ? 151 TRP B CZ3 1 
ATOM   2832 C  CH2 . TRP B 1 133 ? -5.911  18.965 30.629  1.00 28.39  ? 151 TRP B CH2 1 
ATOM   2833 N  N   . ILE B 1 134 ? -2.104  13.480 27.827  1.00 29.75  ? 152 ILE B N   1 
ATOM   2834 C  CA  . ILE B 1 134 ? -1.913  12.569 28.982  1.00 31.91  ? 152 ILE B CA  1 
ATOM   2835 C  C   . ILE B 1 134 ? -0.434  12.272 29.208  1.00 32.99  ? 152 ILE B C   1 
ATOM   2836 O  O   . ILE B 1 134 ? 0.033   12.256 30.342  1.00 32.99  ? 152 ILE B O   1 
ATOM   2837 C  CB  . ILE B 1 134 ? -2.810  11.265 28.904  1.00 33.45  ? 152 ILE B CB  1 
ATOM   2838 C  CG1 . ILE B 1 134 ? -3.153  10.697 30.285  1.00 31.65  ? 152 ILE B CG1 1 
ATOM   2839 C  CG2 . ILE B 1 134 ? -2.226  10.147 28.040  1.00 29.64  ? 152 ILE B CG2 1 
ATOM   2840 C  CD1 . ILE B 1 134 ? -4.226  11.490 30.996  1.00 29.79  ? 152 ILE B CD1 1 
ATOM   2841 N  N   . ASP B 1 135 ? 0.287   12.102 28.100  1.00 32.54  ? 153 ASP B N   1 
ATOM   2842 C  CA  . ASP B 1 135 ? 1.736   11.966 28.055  1.00 30.24  ? 153 ASP B CA  1 
ATOM   2843 C  C   . ASP B 1 135 ? 2.483   13.168 28.617  1.00 27.26  ? 153 ASP B C   1 
ATOM   2844 O  O   . ASP B 1 135 ? 3.443   13.015 29.362  1.00 30.26  ? 153 ASP B O   1 
ATOM   2845 C  CB  . ASP B 1 135 ? 2.164   11.782 26.592  1.00 30.57  ? 153 ASP B CB  1 
ATOM   2846 C  CG  . ASP B 1 135 ? 1.792   10.441 26.058  1.00 31.63  ? 153 ASP B CG  1 
ATOM   2847 O  OD1 . ASP B 1 135 ? 1.857   9.465  26.833  1.00 35.03  ? 153 ASP B OD1 1 
ATOM   2848 O  OD2 . ASP B 1 135 ? 1.437   10.353 24.878  1.00 30.67  ? 153 ASP B OD2 1 
ATOM   2849 N  N   . SER B 1 136 ? 2.075   14.368 28.225  1.00 28.15  ? 154 SER B N   1 
ATOM   2850 C  CA  . SER B 1 136 ? 2.660   15.558 28.802  1.00 28.38  ? 154 SER B CA  1 
ATOM   2851 C  C   . SER B 1 136 ? 2.380   15.586 30.272  1.00 25.76  ? 154 SER B C   1 
ATOM   2852 O  O   . SER B 1 136 ? 3.257   15.909 31.022  1.00 28.96  ? 154 SER B O   1 
ATOM   2853 C  CB  . SER B 1 136 ? 2.124   16.831 28.158  1.00 26.87  ? 154 SER B CB  1 
ATOM   2854 O  OG  . SER B 1 136 ? 2.467   16.875 26.791  1.00 34.50  ? 154 SER B OG  1 
ATOM   2855 N  N   . ILE B 1 137 ? 1.169   15.233 30.686  1.00 25.47  ? 155 ILE B N   1 
ATOM   2856 C  CA  . ILE B 1 137 ? 0.807   15.295 32.137  1.00 25.26  ? 155 ILE B CA  1 
ATOM   2857 C  C   . ILE B 1 137 ? 1.669   14.304 32.939  1.00 25.37  ? 155 ILE B C   1 
ATOM   2858 O  O   . ILE B 1 137 ? 2.179   14.609 34.048  1.00 24.09  ? 155 ILE B O   1 
ATOM   2859 C  CB  . ILE B 1 137 ? -0.715  15.092 32.400  1.00 25.04  ? 155 ILE B CB  1 
ATOM   2860 C  CG1 . ILE B 1 137 ? -1.576  16.104 31.618  1.00 26.33  ? 155 ILE B CG1 1 
ATOM   2861 C  CG2 . ILE B 1 137 ? -1.066  15.220 33.903  1.00 28.38  ? 155 ILE B CG2 1 
ATOM   2862 C  CD1 . ILE B 1 137 ? -3.032  15.637 31.477  1.00 25.46  ? 155 ILE B CD1 1 
ATOM   2863 N  N   . LEU B 1 138 ? 1.832   13.125 32.351  1.00 23.81  ? 156 LEU B N   1 
ATOM   2864 C  CA  . LEU B 1 138 ? 2.666   12.079 32.900  1.00 24.35  ? 156 LEU B CA  1 
ATOM   2865 C  C   . LEU B 1 138 ? 4.104   12.479 33.040  1.00 25.49  ? 156 LEU B C   1 
ATOM   2866 O  O   . LEU B 1 138 ? 4.718   12.208 34.073  1.00 25.08  ? 156 LEU B O   1 
ATOM   2867 C  CB  . LEU B 1 138 ? 2.510   10.812 32.096  1.00 24.34  ? 156 LEU B CB  1 
ATOM   2868 C  CG  . LEU B 1 138 ? 1.239   10.102 32.569  1.00 25.56  ? 156 LEU B CG  1 
ATOM   2869 C  CD1 . LEU B 1 138 ? 0.768   9.068  31.561  1.00 24.60  ? 156 LEU B CD1 1 
ATOM   2870 C  CD2 . LEU B 1 138 ? 1.468   9.459  33.924  1.00 22.20  ? 156 LEU B CD2 1 
ATOM   2871 N  N   . ALA B 1 139 ? 4.627   13.198 32.052  1.00 26.83  ? 157 ALA B N   1 
ATOM   2872 C  CA  . ALA B 1 139 ? 6.005   13.685 32.155  1.00 29.15  ? 157 ALA B CA  1 
ATOM   2873 C  C   . ALA B 1 139 ? 6.161   14.659 33.328  1.00 26.99  ? 157 ALA B C   1 
ATOM   2874 O  O   . ALA B 1 139 ? 7.133   14.590 34.065  1.00 28.09  ? 157 ALA B O   1 
ATOM   2875 C  CB  . ALA B 1 139 ? 6.483   14.319 30.824  1.00 29.49  ? 157 ALA B CB  1 
ATOM   2876 N  N   . PHE B 1 140 ? 5.201   15.568 33.463  1.00 29.11  ? 158 PHE B N   1 
ATOM   2877 C  CA  . PHE B 1 140 ? 5.181   16.560 34.529  1.00 26.07  ? 158 PHE B CA  1 
ATOM   2878 C  C   . PHE B 1 140 ? 5.058   15.889 35.907  1.00 25.62  ? 158 PHE B C   1 
ATOM   2879 O  O   . PHE B 1 140 ? 5.725   16.288 36.864  1.00 24.52  ? 158 PHE B O   1 
ATOM   2880 C  CB  . PHE B 1 140 ? 4.056   17.493 34.275  1.00 25.67  ? 158 PHE B CB  1 
ATOM   2881 C  CG  . PHE B 1 140 ? 3.860   18.525 35.339  1.00 31.10  ? 158 PHE B CG  1 
ATOM   2882 C  CD1 . PHE B 1 140 ? 4.539   19.749 35.286  1.00 32.38  ? 158 PHE B CD1 1 
ATOM   2883 C  CD2 . PHE B 1 140 ? 2.937   18.317 36.383  1.00 30.85  ? 158 PHE B CD2 1 
ATOM   2884 C  CE1 . PHE B 1 140 ? 4.318   20.742 36.255  1.00 29.99  ? 158 PHE B CE1 1 
ATOM   2885 C  CE2 . PHE B 1 140 ? 2.743   19.303 37.372  1.00 32.80  ? 158 PHE B CE2 1 
ATOM   2886 C  CZ  . PHE B 1 140 ? 3.433   20.510 37.310  1.00 30.13  ? 158 PHE B CZ  1 
ATOM   2887 N  N   . SER B 1 141 ? 4.237   14.849 35.972  1.00 24.64  ? 159 SER B N   1 
ATOM   2888 C  CA  . SER B 1 141 ? 4.091   14.046 37.135  1.00 26.72  ? 159 SER B CA  1 
ATOM   2889 C  C   . SER B 1 141 ? 5.395   13.305 37.486  1.00 29.29  ? 159 SER B C   1 
ATOM   2890 O  O   . SER B 1 141 ? 5.782   13.267 38.680  1.00 31.09  ? 159 SER B O   1 
ATOM   2891 C  CB  . SER B 1 141 ? 2.917   13.075 36.967  1.00 26.30  ? 159 SER B CB  1 
ATOM   2892 O  OG  . SER B 1 141 ? 2.973   12.058 37.952  1.00 28.06  ? 159 SER B OG  1 
ATOM   2893 N  N   . ARG B 1 142 ? 6.077   12.731 36.485  1.00 28.96  ? 160 ARG B N   1 
ATOM   2894 C  CA  . ARG B 1 142 ? 7.418   12.161 36.713  1.00 33.59  ? 160 ARG B CA  1 
ATOM   2895 C  C   . ARG B 1 142 ? 8.305   13.260 37.304  1.00 33.94  ? 160 ARG B C   1 
ATOM   2896 O  O   . ARG B 1 142 ? 8.871   13.092 38.371  1.00 38.96  ? 160 ARG B O   1 
ATOM   2897 C  CB  . ARG B 1 142 ? 8.028   11.591 35.418  1.00 38.69  ? 160 ARG B CB  1 
ATOM   2898 C  CG  . ARG B 1 142 ? 8.278   10.074 35.399  1.00 44.09  ? 160 ARG B CG  1 
ATOM   2899 C  CD  . ARG B 1 142 ? 8.291   9.435  33.978  1.00 49.46  ? 160 ARG B CD  1 
ATOM   2900 N  NE  . ARG B 1 142 ? 7.038   8.770  33.557  1.00 47.88  ? 160 ARG B NE  1 
ATOM   2901 C  CZ  . ARG B 1 142 ? 6.317   9.058  32.450  1.00 51.66  ? 160 ARG B CZ  1 
ATOM   2902 N  NH1 . ARG B 1 142 ? 6.703   9.993  31.568  1.00 45.51  ? 160 ARG B NH1 1 
ATOM   2903 N  NH2 . ARG B 1 142 ? 5.198   8.381  32.201  1.00 46.56  ? 160 ARG B NH2 1 
ATOM   2904 N  N   . SER B 1 143 ? 8.356   14.431 36.672  1.00 32.68  ? 161 SER B N   1 
ATOM   2905 C  CA  . SER B 1 143 ? 9.210   15.496 37.198  1.00 31.28  ? 161 SER B CA  1 
ATOM   2906 C  C   . SER B 1 143 ? 8.812   15.982 38.605  1.00 29.23  ? 161 SER B C   1 
ATOM   2907 O  O   . SER B 1 143 ? 9.669   16.252 39.452  1.00 30.63  ? 161 SER B O   1 
ATOM   2908 C  CB  . SER B 1 143 ? 9.298   16.650 36.211  1.00 29.68  ? 161 SER B CB  1 
ATOM   2909 O  OG  . SER B 1 143 ? 9.996   17.759 36.789  1.00 36.94  ? 161 SER B OG  1 
ATOM   2910 N  N   . LEU B 1 144 ? 7.511   16.072 38.863  1.00 34.36  ? 162 LEU B N   1 
ATOM   2911 C  CA  . LEU B 1 144 ? 6.983   16.506 40.186  1.00 31.84  ? 162 LEU B CA  1 
ATOM   2912 C  C   . LEU B 1 144 ? 7.410   15.449 41.205  1.00 31.09  ? 162 LEU B C   1 
ATOM   2913 O  O   . LEU B 1 144 ? 7.942   15.761 42.245  1.00 33.91  ? 162 LEU B O   1 
ATOM   2914 C  CB  . LEU B 1 144 ? 5.442   16.618 40.148  1.00 30.32  ? 162 LEU B CB  1 
ATOM   2915 C  CG  . LEU B 1 144 ? 4.649   17.675 40.924  1.00 32.51  ? 162 LEU B CG  1 
ATOM   2916 C  CD1 . LEU B 1 144 ? 3.227   17.235 41.311  1.00 29.58  ? 162 LEU B CD1 1 
ATOM   2917 C  CD2 . LEU B 1 144 ? 5.388   18.232 42.132  1.00 30.38  ? 162 LEU B CD2 1 
ATOM   2918 N  N   . HIS B 1 145 ? 7.234   14.184 40.871  1.00 31.83  ? 163 HIS B N   1 
ATOM   2919 C  CA  . HIS B 1 145 ? 7.593   13.150 41.814  1.00 33.52  ? 163 HIS B CA  1 
ATOM   2920 C  C   . HIS B 1 145 ? 9.028   13.194 42.207  1.00 36.41  ? 163 HIS B C   1 
ATOM   2921 O  O   . HIS B 1 145 ? 9.360   13.031 43.377  1.00 36.71  ? 163 HIS B O   1 
ATOM   2922 C  CB  . HIS B 1 145 ? 7.231   11.789 41.269  1.00 33.97  ? 163 HIS B CB  1 
ATOM   2923 C  CG  . HIS B 1 145 ? 5.797   11.483 41.433  1.00 37.25  ? 163 HIS B CG  1 
ATOM   2924 N  ND1 . HIS B 1 145 ? 5.194   11.544 42.621  1.00 43.32  ? 163 HIS B ND1 1 
ATOM   2925 C  CD2 . HIS B 1 145 ? 4.831   11.154 40.520  1.00 39.98  ? 163 HIS B CD2 1 
ATOM   2926 C  CE1 . HIS B 1 145 ? 3.902   11.256 42.472  1.00 42.72  ? 163 HIS B CE1 1 
ATOM   2927 N  NE2 . HIS B 1 145 ? 3.682   11.030 41.183  1.00 37.09  ? 163 HIS B NE2 1 
ATOM   2928 N  N   . SER B 1 146 ? 9.920   13.418 41.253  1.00 37.09  ? 164 SER B N   1 
ATOM   2929 C  CA  . SER B 1 146 ? 11.303  13.352 41.643  1.00 38.45  ? 164 SER B CA  1 
ATOM   2930 C  C   . SER B 1 146 ? 11.714  14.553 42.503  1.00 39.22  ? 164 SER B C   1 
ATOM   2931 O  O   . SER B 1 146 ? 12.754  14.500 43.162  1.00 43.32  ? 164 SER B O   1 
ATOM   2932 C  CB  . SER B 1 146 ? 12.273  13.027 40.489  1.00 38.75  ? 164 SER B CB  1 
ATOM   2933 O  OG  . SER B 1 146 ? 12.106  13.852 39.349  1.00 44.79  ? 164 SER B OG  1 
ATOM   2934 N  N   . LEU B 1 147 ? 10.889  15.600 42.536  1.00 35.13  ? 165 LEU B N   1 
ATOM   2935 C  CA  . LEU B 1 147 ? 11.128  16.680 43.472  1.00 35.24  ? 165 LEU B CA  1 
ATOM   2936 C  C   . LEU B 1 147 ? 10.798  16.209 44.894  1.00 36.72  ? 165 LEU B C   1 
ATOM   2937 O  O   . LEU B 1 147 ? 11.172  16.851 45.888  1.00 34.74  ? 165 LEU B O   1 
ATOM   2938 C  CB  . LEU B 1 147 ? 10.306  17.904 43.124  1.00 36.61  ? 165 LEU B CB  1 
ATOM   2939 C  CG  . LEU B 1 147 ? 10.988  19.044 42.358  1.00 41.77  ? 165 LEU B CG  1 
ATOM   2940 C  CD1 . LEU B 1 147 ? 11.933  18.564 41.270  1.00 40.52  ? 165 LEU B CD1 1 
ATOM   2941 C  CD2 . LEU B 1 147 ? 9.927   19.964 41.776  1.00 39.65  ? 165 LEU B CD2 1 
ATOM   2942 N  N   . LEU B 1 148 ? 10.083  15.094 44.986  1.00 34.57  ? 166 LEU B N   1 
ATOM   2943 C  CA  . LEU B 1 148 ? 9.763   14.545 46.272  1.00 34.64  ? 166 LEU B CA  1 
ATOM   2944 C  C   . LEU B 1 148 ? 9.209   15.655 47.128  1.00 34.55  ? 166 LEU B C   1 
ATOM   2945 O  O   . LEU B 1 148 ? 9.808   15.973 48.132  1.00 40.20  ? 166 LEU B O   1 
ATOM   2946 C  CB  . LEU B 1 148 ? 11.031  14.002 46.946  1.00 36.84  ? 166 LEU B CB  1 
ATOM   2947 C  CG  . LEU B 1 148 ? 11.759  12.796 46.365  1.00 35.59  ? 166 LEU B CG  1 
ATOM   2948 C  CD1 . LEU B 1 148 ? 13.046  12.650 47.158  1.00 38.27  ? 166 LEU B CD1 1 
ATOM   2949 C  CD2 . LEU B 1 148 ? 10.860  11.569 46.497  1.00 34.65  ? 166 LEU B CD2 1 
ATOM   2950 N  N   . VAL B 1 149 ? 8.067   16.225 46.738  1.00 33.51  ? 167 VAL B N   1 
ATOM   2951 C  CA  . VAL B 1 149 ? 7.408   17.334 47.462  1.00 31.06  ? 167 VAL B CA  1 
ATOM   2952 C  C   . VAL B 1 149 ? 6.481   16.807 48.588  1.00 32.16  ? 167 VAL B C   1 
ATOM   2953 O  O   . VAL B 1 149 ? 5.588   16.017 48.327  1.00 28.93  ? 167 VAL B O   1 
ATOM   2954 C  CB  . VAL B 1 149 ? 6.571   18.145 46.449  1.00 30.04  ? 167 VAL B CB  1 
ATOM   2955 C  CG1 . VAL B 1 149 ? 6.021   19.434 47.050  1.00 30.88  ? 167 VAL B CG1 1 
ATOM   2956 C  CG2 . VAL B 1 149 ? 7.375   18.390 45.162  1.00 31.78  ? 167 VAL B CG2 1 
ATOM   2957 N  N   . ASP B 1 150 ? 6.652   17.260 49.832  1.00 34.02  ? 168 ASP B N   1 
ATOM   2958 C  CA  . ASP B 1 150 ? 5.831   16.694 50.914  1.00 33.59  ? 168 ASP B CA  1 
ATOM   2959 C  C   . ASP B 1 150 ? 4.442   17.256 50.881  1.00 34.42  ? 168 ASP B C   1 
ATOM   2960 O  O   . ASP B 1 150 ? 4.168   18.211 50.136  1.00 35.29  ? 168 ASP B O   1 
ATOM   2961 C  CB  . ASP B 1 150 ? 6.446   16.845 52.315  1.00 32.72  ? 168 ASP B CB  1 
ATOM   2962 C  CG  . ASP B 1 150 ? 6.680   18.283 52.716  1.00 38.96  ? 168 ASP B CG  1 
ATOM   2963 O  OD1 . ASP B 1 150 ? 7.568   18.504 53.556  1.00 46.35  ? 168 ASP B OD1 1 
ATOM   2964 O  OD2 . ASP B 1 150 ? 6.028   19.217 52.216  1.00 37.38  ? 168 ASP B OD2 1 
ATOM   2965 N  N   . VAL B 1 151 ? 3.557   16.669 51.680  1.00 32.54  ? 169 VAL B N   1 
ATOM   2966 C  CA  . VAL B 1 151 ? 2.164   17.111 51.677  1.00 35.04  ? 169 VAL B CA  1 
ATOM   2967 C  C   . VAL B 1 151 ? 1.927   18.615 52.011  1.00 37.30  ? 169 VAL B C   1 
ATOM   2968 O  O   . VAL B 1 151 ? 1.178   19.280 51.279  1.00 39.77  ? 169 VAL B O   1 
ATOM   2969 C  CB  . VAL B 1 151 ? 1.275   16.179 52.521  1.00 35.12  ? 169 VAL B CB  1 
ATOM   2970 C  CG1 . VAL B 1 151 ? -0.014  16.870 52.904  1.00 35.82  ? 169 VAL B CG1 1 
ATOM   2971 C  CG2 . VAL B 1 151 ? 0.989   14.897 51.750  1.00 34.77  ? 169 VAL B CG2 1 
ATOM   2972 N  N   . PRO B 1 152 ? 2.552   19.154 53.091  1.00 33.60  ? 170 PRO B N   1 
ATOM   2973 C  CA  . PRO B 1 152 ? 2.381   20.579 53.412  1.00 32.16  ? 170 PRO B CA  1 
ATOM   2974 C  C   . PRO B 1 152 ? 2.941   21.493 52.349  1.00 33.29  ? 170 PRO B C   1 
ATOM   2975 O  O   . PRO B 1 152 ? 2.370   22.569 52.087  1.00 37.08  ? 170 PRO B O   1 
ATOM   2976 C  CB  . PRO B 1 152 ? 3.160   20.761 54.732  1.00 33.70  ? 170 PRO B CB  1 
ATOM   2977 C  CG  . PRO B 1 152 ? 3.241   19.391 55.327  1.00 32.84  ? 170 PRO B CG  1 
ATOM   2978 C  CD  . PRO B 1 152 ? 3.288   18.440 54.157  1.00 36.59  ? 170 PRO B CD  1 
ATOM   2979 N  N   . ALA B 1 153 ? 4.039   21.083 51.727  1.00 29.32  ? 171 ALA B N   1 
ATOM   2980 C  CA  . ALA B 1 153 ? 4.585   21.869 50.620  1.00 31.28  ? 171 ALA B CA  1 
ATOM   2981 C  C   . ALA B 1 153 ? 3.613   21.813 49.486  1.00 31.52  ? 171 ALA B C   1 
ATOM   2982 O  O   . ALA B 1 153 ? 3.348   22.846 48.873  1.00 35.92  ? 171 ALA B O   1 
ATOM   2983 C  CB  . ALA B 1 153 ? 5.964   21.374 50.170  1.00 28.69  ? 171 ALA B CB  1 
ATOM   2984 N  N   . PHE B 1 154 ? 3.065   20.624 49.213  1.00 29.13  ? 172 PHE B N   1 
ATOM   2985 C  CA  . PHE B 1 154 ? 2.085   20.533 48.140  1.00 29.55  ? 172 PHE B CA  1 
ATOM   2986 C  C   . PHE B 1 154 ? 0.845   21.346 48.453  1.00 27.72  ? 172 PHE B C   1 
ATOM   2987 O  O   . PHE B 1 154 ? 0.201   21.850 47.541  1.00 28.45  ? 172 PHE B O   1 
ATOM   2988 C  CB  . PHE B 1 154 ? 1.655   19.096 47.813  1.00 26.07  ? 172 PHE B CB  1 
ATOM   2989 C  CG  . PHE B 1 154 ? 0.859   19.021 46.543  1.00 26.57  ? 172 PHE B CG  1 
ATOM   2990 C  CD1 . PHE B 1 154 ? 1.506   19.034 45.298  1.00 25.35  ? 172 PHE B CD1 1 
ATOM   2991 C  CD2 . PHE B 1 154 ? -0.551  19.050 46.564  1.00 25.06  ? 172 PHE B CD2 1 
ATOM   2992 C  CE1 . PHE B 1 154 ? 0.756   19.034 44.111  1.00 23.08  ? 172 PHE B CE1 1 
ATOM   2993 C  CE2 . PHE B 1 154 ? -1.311  19.015 45.387  1.00 23.27  ? 172 PHE B CE2 1 
ATOM   2994 C  CZ  . PHE B 1 154 ? -0.657  18.992 44.161  1.00 24.49  ? 172 PHE B CZ  1 
ATOM   2995 N  N   . ALA B 1 155 ? 0.482   21.425 49.735  1.00 29.47  ? 173 ALA B N   1 
ATOM   2996 C  CA  . ALA B 1 155 ? -0.803  22.052 50.161  1.00 27.89  ? 173 ALA B CA  1 
ATOM   2997 C  C   . ALA B 1 155 ? -0.708  23.526 49.872  1.00 26.56  ? 173 ALA B C   1 
ATOM   2998 O  O   . ALA B 1 155 ? -1.685  24.163 49.545  1.00 27.35  ? 173 ALA B O   1 
ATOM   2999 C  CB  . ALA B 1 155 ? -1.056  21.835 51.650  1.00 25.42  ? 173 ALA B CB  1 
ATOM   3000 N  N   . CYS B 1 156 ? 0.486   24.073 50.022  1.00 28.44  ? 174 CYS B N   1 
ATOM   3001 C  CA  . CYS B 1 156 ? 0.695   25.498 49.732  1.00 29.29  ? 174 CYS B CA  1 
ATOM   3002 C  C   . CYS B 1 156 ? 0.793   25.681 48.190  1.00 29.69  ? 174 CYS B C   1 
ATOM   3003 O  O   . CYS B 1 156 ? 0.205   26.612 47.649  1.00 27.75  ? 174 CYS B O   1 
ATOM   3004 C  CB  . CYS B 1 156 ? 1.942   26.049 50.442  1.00 28.57  ? 174 CYS B CB  1 
ATOM   3005 S  SG  . CYS B 1 156 ? 2.122   25.742 52.260  1.00 31.16  ? 174 CYS B SG  1 
ATOM   3006 N  N   . LEU B 1 157 ? 1.514   24.775 47.500  1.00 28.22  ? 175 LEU B N   1 
ATOM   3007 C  CA  . LEU B 1 157 ? 1.844   24.976 46.090  1.00 28.04  ? 175 LEU B CA  1 
ATOM   3008 C  C   . LEU B 1 157 ? 0.558   25.089 45.324  1.00 28.19  ? 175 LEU B C   1 
ATOM   3009 O  O   . LEU B 1 157 ? 0.451   26.015 44.536  1.00 25.64  ? 175 LEU B O   1 
ATOM   3010 C  CB  . LEU B 1 157 ? 2.724   23.855 45.508  1.00 27.97  ? 175 LEU B CB  1 
ATOM   3011 C  CG  . LEU B 1 157 ? 3.340   24.143 44.132  1.00 29.26  ? 175 LEU B CG  1 
ATOM   3012 C  CD1 . LEU B 1 157 ? 4.284   25.326 44.185  1.00 27.09  ? 175 LEU B CD1 1 
ATOM   3013 C  CD2 . LEU B 1 157 ? 4.028   22.916 43.532  1.00 26.10  ? 175 LEU B CD2 1 
ATOM   3014 N  N   . SER B 1 158 ? -0.406  24.169 45.569  1.00 26.79  ? 176 SER B N   1 
ATOM   3015 C  CA  . SER B 1 158 ? -1.720  24.169 44.868  1.00 26.62  ? 176 SER B CA  1 
ATOM   3016 C  C   . SER B 1 158 ? -2.550  25.406 45.228  1.00 29.24  ? 176 SER B C   1 
ATOM   3017 O  O   . SER B 1 158 ? -3.260  26.006 44.353  1.00 25.27  ? 176 SER B O   1 
ATOM   3018 C  CB  . SER B 1 158 ? -2.549  22.924 45.203  1.00 27.71  ? 176 SER B CB  1 
ATOM   3019 O  OG  . SER B 1 158 ? -2.602  22.735 46.624  1.00 27.89  ? 176 SER B OG  1 
ATOM   3020 N  N   . ALA B 1 159 ? -2.490  25.782 46.515  1.00 29.69  ? 177 ALA B N   1 
ATOM   3021 C  CA  . ALA B 1 159 ? -3.176  27.000 46.966  1.00 28.91  ? 177 ALA B CA  1 
ATOM   3022 C  C   . ALA B 1 159 ? -2.650  28.198 46.174  1.00 30.10  ? 177 ALA B C   1 
ATOM   3023 O  O   . ALA B 1 159 ? -3.428  29.068 45.736  1.00 27.98  ? 177 ALA B O   1 
ATOM   3024 C  CB  . ALA B 1 159 ? -2.998  27.223 48.460  1.00 29.13  ? 177 ALA B CB  1 
ATOM   3025 N  N   . LEU B 1 160 ? -1.326  28.234 46.003  1.00 30.21  ? 178 LEU B N   1 
ATOM   3026 C  CA  . LEU B 1 160 ? -0.679  29.327 45.270  1.00 28.02  ? 178 LEU B CA  1 
ATOM   3027 C  C   . LEU B 1 160 ? -1.022  29.293 43.762  1.00 25.45  ? 178 LEU B C   1 
ATOM   3028 O  O   . LEU B 1 160 ? -0.917  30.319 43.115  1.00 26.70  ? 178 LEU B O   1 
ATOM   3029 C  CB  . LEU B 1 160 ? 0.824   29.313 45.463  1.00 26.62  ? 178 LEU B CB  1 
ATOM   3030 C  CG  . LEU B 1 160 ? 1.569   29.827 46.697  1.00 27.28  ? 178 LEU B CG  1 
ATOM   3031 C  CD1 . LEU B 1 160 ? 3.028   29.333 46.619  1.00 21.73  ? 178 LEU B CD1 1 
ATOM   3032 C  CD2 . LEU B 1 160 ? 1.488   31.355 46.856  1.00 23.83  ? 178 LEU B CD2 1 
ATOM   3033 N  N   . VAL B 1 161 ? -1.454  28.143 43.220  1.00 23.51  ? 179 VAL B N   1 
ATOM   3034 C  CA  . VAL B 1 161 ? -1.878  28.073 41.790  1.00 22.62  ? 179 VAL B CA  1 
ATOM   3035 C  C   . VAL B 1 161 ? -3.185  28.822 41.628  1.00 21.70  ? 179 VAL B C   1 
ATOM   3036 O  O   . VAL B 1 161 ? -3.373  29.553 40.652  1.00 18.54  ? 179 VAL B O   1 
ATOM   3037 C  CB  . VAL B 1 161 ? -1.994  26.627 41.228  1.00 21.87  ? 179 VAL B CB  1 
ATOM   3038 C  CG1 . VAL B 1 161 ? -2.459  26.602 39.764  1.00 21.24  ? 179 VAL B CG1 1 
ATOM   3039 C  CG2 . VAL B 1 161 ? -0.651  25.978 41.220  1.00 22.49  ? 179 VAL B CG2 1 
ATOM   3040 N  N   . LEU B 1 162 ? -4.056  28.635 42.633  1.00 22.21  ? 180 LEU B N   1 
ATOM   3041 C  CA  . LEU B 1 162 ? -5.390  29.244 42.736  1.00 23.32  ? 180 LEU B CA  1 
ATOM   3042 C  C   . LEU B 1 162 ? -5.328  30.738 43.009  1.00 23.27  ? 180 LEU B C   1 
ATOM   3043 O  O   . LEU B 1 162 ? -5.985  31.527 42.328  1.00 21.37  ? 180 LEU B O   1 
ATOM   3044 C  CB  . LEU B 1 162 ? -6.227  28.562 43.839  1.00 21.29  ? 180 LEU B CB  1 
ATOM   3045 C  CG  . LEU B 1 162 ? -7.614  29.139 44.072  1.00 23.64  ? 180 LEU B CG  1 
ATOM   3046 C  CD1 . LEU B 1 162 ? -8.598  28.767 42.922  1.00 20.99  ? 180 LEU B CD1 1 
ATOM   3047 C  CD2 . LEU B 1 162 ? -8.177  28.681 45.419  1.00 21.06  ? 180 LEU B CD2 1 
ATOM   3048 N  N   . ILE B 1 163 ? -4.546  31.102 44.017  1.00 21.38  ? 181 ILE B N   1 
ATOM   3049 C  CA  . ILE B 1 163 ? -4.552  32.464 44.552  1.00 21.73  ? 181 ILE B CA  1 
ATOM   3050 C  C   . ILE B 1 163 ? -3.359  33.208 43.915  1.00 22.82  ? 181 ILE B C   1 
ATOM   3051 O  O   . ILE B 1 163 ? -2.235  33.156 44.437  1.00 21.20  ? 181 ILE B O   1 
ATOM   3052 C  CB  . ILE B 1 163 ? -4.416  32.504 46.098  1.00 21.81  ? 181 ILE B CB  1 
ATOM   3053 C  CG1 . ILE B 1 163 ? -5.345  31.533 46.780  1.00 22.91  ? 181 ILE B CG1 1 
ATOM   3054 C  CG2 . ILE B 1 163 ? -4.649  33.910 46.675  1.00 21.30  ? 181 ILE B CG2 1 
ATOM   3055 C  CD1 . ILE B 1 163 ? -6.789  31.771 46.519  1.00 23.16  ? 181 ILE B CD1 1 
ATOM   3056 N  N   . THR B 1 164 ? -3.643  33.912 42.811  1.00 21.56  ? 182 THR B N   1 
ATOM   3057 C  CA  . THR B 1 164 ? -2.620  34.421 41.926  1.00 25.10  ? 182 THR B CA  1 
ATOM   3058 C  C   . THR B 1 164 ? -3.234  35.542 41.069  1.00 25.42  ? 182 THR B C   1 
ATOM   3059 O  O   . THR B 1 164 ? -4.429  35.558 40.809  1.00 27.23  ? 182 THR B O   1 
ATOM   3060 C  CB  . THR B 1 164 ? -2.063  33.306 40.993  1.00 24.82  ? 182 THR B CB  1 
ATOM   3061 O  OG1 . THR B 1 164 ? -0.779  33.695 40.535  1.00 28.16  ? 182 THR B OG1 1 
ATOM   3062 C  CG2 . THR B 1 164 ? -2.942  33.100 39.770  1.00 23.27  ? 182 THR B CG2 1 
ATOM   3063 N  N   . ASP B 1 165 ? -2.430  36.478 40.624  1.00 25.57  ? 183 ASP B N   1 
ATOM   3064 C  CA  . ASP B 1 165 ? -3.003  37.596 39.866  1.00 26.54  ? 183 ASP B CA  1 
ATOM   3065 C  C   . ASP B 1 165 ? -3.671  37.113 38.574  1.00 27.00  ? 183 ASP B C   1 
ATOM   3066 O  O   . ASP B 1 165 ? -3.145  36.224 37.858  1.00 26.89  ? 183 ASP B O   1 
ATOM   3067 C  CB  . ASP B 1 165 ? -1.959  38.667 39.584  1.00 28.09  ? 183 ASP B CB  1 
ATOM   3068 C  CG  . ASP B 1 165 ? -2.583  39.943 39.088  1.00 29.84  ? 183 ASP B CG  1 
ATOM   3069 O  OD1 . ASP B 1 165 ? -2.596  40.139 37.875  1.00 26.47  ? 183 ASP B OD1 1 
ATOM   3070 O  OD2 . ASP B 1 165 ? -3.155  40.715 39.902  1.00 34.86  ? 183 ASP B OD2 1 
ATOM   3071 N  N   . ARG B 1 166 ? -4.851  37.660 38.325  1.00 25.73  ? 184 ARG B N   1 
ATOM   3072 C  CA  . ARG B 1 166 ? -5.615  37.426 37.093  1.00 28.85  ? 184 ARG B CA  1 
ATOM   3073 C  C   . ARG B 1 166 ? -6.185  38.766 36.617  1.00 28.98  ? 184 ARG B C   1 
ATOM   3074 O  O   . ARG B 1 166 ? -6.574  39.629 37.440  1.00 26.41  ? 184 ARG B O   1 
ATOM   3075 C  CB  . ARG B 1 166 ? -6.795  36.415 37.311  1.00 28.35  ? 184 ARG B CB  1 
ATOM   3076 C  CG  . ARG B 1 166 ? -6.400  35.031 37.831  1.00 28.58  ? 184 ARG B CG  1 
ATOM   3077 C  CD  . ARG B 1 166 ? -5.655  34.183 36.774  1.00 27.62  ? 184 ARG B CD  1 
ATOM   3078 N  NE  . ARG B 1 166 ? -5.369  32.837 37.314  1.00 26.34  ? 184 ARG B NE  1 
ATOM   3079 C  CZ  . ARG B 1 166 ? -4.799  31.831 36.643  1.00 28.98  ? 184 ARG B CZ  1 
ATOM   3080 N  NH1 . ARG B 1 166 ? -4.392  31.989 35.358  1.00 29.26  ? 184 ARG B NH1 1 
ATOM   3081 N  NH2 . ARG B 1 166 ? -4.621  30.658 37.247  1.00 25.69  ? 184 ARG B NH2 1 
ATOM   3082 N  N   . HIS B 1 167 ? -6.236  38.924 35.297  1.00 26.98  ? 185 HIS B N   1 
ATOM   3083 C  CA  . HIS B 1 167 ? -6.850  40.092 34.643  1.00 26.48  ? 185 HIS B CA  1 
ATOM   3084 C  C   . HIS B 1 167 ? -8.277  40.163 35.056  1.00 26.59  ? 185 HIS B C   1 
ATOM   3085 O  O   . HIS B 1 167 ? -8.906  39.116 35.121  1.00 28.22  ? 185 HIS B O   1 
ATOM   3086 C  CB  . HIS B 1 167 ? -6.820  39.903 33.140  1.00 27.55  ? 185 HIS B CB  1 
ATOM   3087 C  CG  . HIS B 1 167 ? -7.056  41.174 32.384  1.00 33.23  ? 185 HIS B CG  1 
ATOM   3088 N  ND1 . HIS B 1 167 ? -6.044  41.923 31.891  1.00 35.00  ? 185 HIS B ND1 1 
ATOM   3089 C  CD2 . HIS B 1 167 ? -8.237  41.827 32.043  1.00 34.12  ? 185 HIS B CD2 1 
ATOM   3090 C  CE1 . HIS B 1 167 ? -6.557  43.020 31.296  1.00 34.28  ? 185 HIS B CE1 1 
ATOM   3091 N  NE2 . HIS B 1 167 ? -7.898  42.960 31.392  1.00 35.05  ? 185 HIS B NE2 1 
ATOM   3092 N  N   . GLY B 1 168 ? -8.821  41.362 35.344  1.00 26.64  ? 186 GLY B N   1 
ATOM   3093 C  CA  . GLY B 1 168 ? -10.212 41.470 35.859  1.00 27.76  ? 186 GLY B CA  1 
ATOM   3094 C  C   . GLY B 1 168 ? -10.421 41.310 37.385  1.00 27.10  ? 186 GLY B C   1 
ATOM   3095 O  O   . GLY B 1 168 ? -11.556 41.271 37.885  1.00 26.54  ? 186 GLY B O   1 
ATOM   3096 N  N   . LEU B 1 169 ? -9.348  41.265 38.155  1.00 27.25  ? 187 LEU B N   1 
ATOM   3097 C  CA  . LEU B 1 169 ? -9.537  41.101 39.611  1.00 26.90  ? 187 LEU B CA  1 
ATOM   3098 C  C   . LEU B 1 169 ? -10.085 42.420 40.101  1.00 27.55  ? 187 LEU B C   1 
ATOM   3099 O  O   . LEU B 1 169 ? -9.786  43.425 39.494  1.00 25.80  ? 187 LEU B O   1 
ATOM   3100 C  CB  . LEU B 1 169 ? -8.263  40.681 40.307  1.00 22.17  ? 187 LEU B CB  1 
ATOM   3101 C  CG  . LEU B 1 169 ? -7.869  39.187 40.287  1.00 23.55  ? 187 LEU B CG  1 
ATOM   3102 C  CD1 . LEU B 1 169 ? -6.510  39.011 40.971  1.00 22.66  ? 187 LEU B CD1 1 
ATOM   3103 C  CD2 . LEU B 1 169 ? -8.896  38.319 41.020  1.00 23.94  ? 187 LEU B CD2 1 
ATOM   3104 N  N   . GLN B 1 170 ? -10.953 42.373 41.116  1.00 26.26  ? 188 GLN B N   1 
ATOM   3105 C  CA  . GLN B 1 170 ? -11.614 43.534 41.676  1.00 27.88  ? 188 GLN B CA  1 
ATOM   3106 C  C   . GLN B 1 170 ? -10.709 44.093 42.744  1.00 29.87  ? 188 GLN B C   1 
ATOM   3107 O  O   . GLN B 1 170 ? -10.564 45.304 42.866  1.00 28.80  ? 188 GLN B O   1 
ATOM   3108 C  CB  . GLN B 1 170 ? -12.979 43.146 42.300  1.00 28.64  ? 188 GLN B CB  1 
ATOM   3109 C  CG  . GLN B 1 170 ? -14.063 43.051 41.233  1.00 30.66  ? 188 GLN B CG  1 
ATOM   3110 C  CD  . GLN B 1 170 ? -15.431 42.669 41.743  1.00 35.85  ? 188 GLN B CD  1 
ATOM   3111 O  OE1 . GLN B 1 170 ? -16.439 43.004 41.107  1.00 40.56  ? 188 GLN B OE1 1 
ATOM   3112 N  NE2 . GLN B 1 170 ? -15.497 41.980 42.880  1.00 33.01  ? 188 GLN B NE2 1 
ATOM   3113 N  N   . GLU B 1 171 ? -10.089 43.182 43.497  1.00 27.70  ? 189 GLU B N   1 
ATOM   3114 C  CA  . GLU B 1 171 ? -9.228  43.527 44.597  1.00 28.40  ? 189 GLU B CA  1 
ATOM   3115 C  C   . GLU B 1 171 ? -7.900  42.809 44.451  1.00 28.57  ? 189 GLU B C   1 
ATOM   3116 O  O   . GLU B 1 171 ? -7.496  41.988 45.344  1.00 33.98  ? 189 GLU B O   1 
ATOM   3117 C  CB  . GLU B 1 171 ? -9.880  43.142 45.940  1.00 27.79  ? 189 GLU B CB  1 
ATOM   3118 C  CG  . GLU B 1 171 ? -11.343 43.513 46.069  1.00 28.31  ? 189 GLU B CG  1 
ATOM   3119 C  CD  . GLU B 1 171 ? -11.777 43.412 47.517  1.00 29.42  ? 189 GLU B CD  1 
ATOM   3120 O  OE1 . GLU B 1 171 ? -12.055 42.273 47.973  1.00 25.56  ? 189 GLU B OE1 1 
ATOM   3121 O  OE2 . GLU B 1 171 ? -11.727 44.456 48.209  1.00 29.15  ? 189 GLU B OE2 1 
ATOM   3122 N  N   . PRO B 1 172 ? -7.180  43.128 43.373  1.00 25.19  ? 190 PRO B N   1 
ATOM   3123 C  CA  . PRO B 1 172 ? -5.881  42.480 43.145  1.00 25.51  ? 190 PRO B CA  1 
ATOM   3124 C  C   . PRO B 1 172 ? -4.928  42.555 44.342  1.00 24.31  ? 190 PRO B C   1 
ATOM   3125 O  O   . PRO B 1 172 ? -4.128  41.630 44.564  1.00 27.38  ? 190 PRO B O   1 
ATOM   3126 C  CB  . PRO B 1 172 ? -5.316  43.224 41.912  1.00 24.06  ? 190 PRO B CB  1 
ATOM   3127 C  CG  . PRO B 1 172 ? -6.074  44.530 41.882  1.00 26.03  ? 190 PRO B CG  1 
ATOM   3128 C  CD  . PRO B 1 172 ? -7.449  44.200 42.381  1.00 27.29  ? 190 PRO B CD  1 
ATOM   3129 N  N   . ARG B 1 173 ? -5.022  43.610 45.130  1.00 22.80  ? 191 ARG B N   1 
ATOM   3130 C  CA  . ARG B 1 173 ? -4.135  43.745 46.281  1.00 24.73  ? 191 ARG B CA  1 
ATOM   3131 C  C   . ARG B 1 173 ? -4.459  42.737 47.405  1.00 24.07  ? 191 ARG B C   1 
ATOM   3132 O  O   . ARG B 1 173 ? -3.546  42.243 48.124  1.00 22.88  ? 191 ARG B O   1 
ATOM   3133 C  CB  . ARG B 1 173 ? -4.169  45.169 46.817  1.00 27.48  ? 191 ARG B CB  1 
ATOM   3134 C  CG  . ARG B 1 173 ? -3.596  46.238 45.868  1.00 31.58  ? 191 ARG B CG  1 
ATOM   3135 C  CD  . ARG B 1 173 ? -2.116  46.059 45.557  1.00 32.80  ? 191 ARG B CD  1 
ATOM   3136 N  NE  . ARG B 1 173 ? -1.993  45.315 44.298  1.00 42.71  ? 191 ARG B NE  1 
ATOM   3137 C  CZ  . ARG B 1 173 ? -1.233  44.234 44.104  1.00 41.11  ? 191 ARG B CZ  1 
ATOM   3138 N  NH1 . ARG B 1 173 ? -1.239  43.626 42.934  1.00 38.89  ? 191 ARG B NH1 1 
ATOM   3139 N  NH2 . ARG B 1 173 ? -0.456  43.768 45.067  1.00 43.25  ? 191 ARG B NH2 1 
ATOM   3140 N  N   . ARG B 1 174 ? -5.746  42.412 47.540  1.00 24.64  ? 192 ARG B N   1 
ATOM   3141 C  CA  . ARG B 1 174 ? -6.199  41.445 48.565  1.00 24.68  ? 192 ARG B CA  1 
ATOM   3142 C  C   . ARG B 1 174 ? -5.857  40.020 48.150  1.00 23.51  ? 192 ARG B C   1 
ATOM   3143 O  O   . ARG B 1 174 ? -5.356  39.255 48.968  1.00 22.56  ? 192 ARG B O   1 
ATOM   3144 C  CB  . ARG B 1 174 ? -7.675  41.643 48.884  1.00 23.54  ? 192 ARG B CB  1 
ATOM   3145 C  CG  . ARG B 1 174 ? -7.929  43.063 49.397  1.00 24.09  ? 192 ARG B CG  1 
ATOM   3146 C  CD  . ARG B 1 174 ? -9.168  43.132 50.259  1.00 24.46  ? 192 ARG B CD  1 
ATOM   3147 N  NE  . ARG B 1 174 ? -9.142  42.135 51.316  1.00 21.88  ? 192 ARG B NE  1 
ATOM   3148 C  CZ  . ARG B 1 174 ? -9.979  41.102 51.402  1.00 21.02  ? 192 ARG B CZ  1 
ATOM   3149 N  NH1 . ARG B 1 174 ? -9.843  40.222 52.395  1.00 20.26  ? 192 ARG B NH1 1 
ATOM   3150 N  NH2 . ARG B 1 174 ? -10.907 40.939 50.491  1.00 18.79  ? 192 ARG B NH2 1 
ATOM   3151 N  N   . VAL B 1 175 ? -6.059  39.695 46.863  1.00 24.09  ? 193 VAL B N   1 
ATOM   3152 C  CA  . VAL B 1 175 ? -5.514  38.437 46.272  1.00 23.23  ? 193 VAL B CA  1 
ATOM   3153 C  C   . VAL B 1 175 ? -3.990  38.328 46.512  1.00 24.44  ? 193 VAL B C   1 
ATOM   3154 O  O   . VAL B 1 175 ? -3.501  37.272 46.973  1.00 23.25  ? 193 VAL B O   1 
ATOM   3155 C  CB  . VAL B 1 175 ? -5.874  38.282 44.759  1.00 25.04  ? 193 VAL B CB  1 
ATOM   3156 C  CG1 . VAL B 1 175 ? -5.259  37.020 44.161  1.00 26.25  ? 193 VAL B CG1 1 
ATOM   3157 C  CG2 . VAL B 1 175 ? -7.376  38.208 44.563  1.00 23.07  ? 193 VAL B CG2 1 
ATOM   3158 N  N   . GLU B 1 176 ? -3.251  39.428 46.278  1.00 25.59  ? 194 GLU B N   1 
ATOM   3159 C  CA  A GLU B 1 176 ? -1.813  39.428 46.498  0.50 26.29  ? 194 GLU B CA  1 
ATOM   3160 C  CA  B GLU B 1 176 ? -1.802  39.451 46.517  0.50 25.75  ? 194 GLU B CA  1 
ATOM   3161 C  C   . GLU B 1 176 ? -1.417  39.287 47.986  1.00 26.50  ? 194 GLU B C   1 
ATOM   3162 O  O   . GLU B 1 176 ? -0.444  38.573 48.309  1.00 28.08  ? 194 GLU B O   1 
ATOM   3163 C  CB  A GLU B 1 176 ? -1.153  40.645 45.831  0.50 28.79  ? 194 GLU B CB  1 
ATOM   3164 C  CB  B GLU B 1 176 ? -1.119  40.709 45.961  0.50 27.73  ? 194 GLU B CB  1 
ATOM   3165 C  CG  A GLU B 1 176 ? 0.208   40.362 45.183  0.50 31.46  ? 194 GLU B CG  1 
ATOM   3166 C  CG  B GLU B 1 176 ? 0.402   40.545 45.968  0.50 29.27  ? 194 GLU B CG  1 
ATOM   3167 C  CD  A GLU B 1 176 ? 0.125   39.878 43.721  0.50 34.58  ? 194 GLU B CD  1 
ATOM   3168 C  CD  B GLU B 1 176 ? 1.193   41.823 45.777  0.50 31.48  ? 194 GLU B CD  1 
ATOM   3169 O  OE1 A GLU B 1 176 ? -0.678  38.943 43.414  0.50 32.04  ? 194 GLU B OE1 1 
ATOM   3170 O  OE1 B GLU B 1 176 ? 0.734   42.907 46.202  0.50 30.89  ? 194 GLU B OE1 1 
ATOM   3171 O  OE2 A GLU B 1 176 ? 0.882   40.436 42.874  0.50 32.47  ? 194 GLU B OE2 1 
ATOM   3172 O  OE2 B GLU B 1 176 ? 2.311   41.724 45.228  0.50 33.10  ? 194 GLU B OE2 1 
ATOM   3173 N  N   A GLU B 1 177 ? -2.132  39.911 48.918  0.50 27.52  ? 195 GLU B N   1 
ATOM   3174 N  N   B GLU B 1 177 ? -2.171  39.925 48.876  0.50 26.04  ? 195 GLU B N   1 
ATOM   3175 C  CA  A GLU B 1 177 ? -1.789  39.664 50.341  0.50 27.74  ? 195 GLU B CA  1 
ATOM   3176 C  CA  B GLU B 1 177 ? -1.965  39.736 50.317  0.50 25.70  ? 195 GLU B CA  1 
ATOM   3177 C  C   A GLU B 1 177 ? -2.128  38.253 50.760  0.50 28.18  ? 195 GLU B C   1 
ATOM   3178 C  C   B GLU B 1 177 ? -2.061  38.268 50.590  0.50 26.45  ? 195 GLU B C   1 
ATOM   3179 O  O   A GLU B 1 177 ? -1.426  37.683 51.601  0.50 30.64  ? 195 GLU B O   1 
ATOM   3180 O  O   B GLU B 1 177 ? -1.112  37.680 51.113  0.50 28.71  ? 195 GLU B O   1 
ATOM   3181 C  CB  A GLU B 1 177 ? -2.370  40.681 51.355  0.50 28.50  ? 195 GLU B CB  1 
ATOM   3182 C  CB  B GLU B 1 177 ? -2.987  40.509 51.177  0.50 24.40  ? 195 GLU B CB  1 
ATOM   3183 C  CG  A GLU B 1 177 ? -2.687  40.022 52.693  0.50 29.45  ? 195 GLU B CG  1 
ATOM   3184 C  CG  B GLU B 1 177 ? -2.624  41.978 51.370  0.50 24.43  ? 195 GLU B CG  1 
ATOM   3185 C  CD  A GLU B 1 177 ? -2.370  40.807 53.982  0.50 31.58  ? 195 GLU B CD  1 
ATOM   3186 C  CD  B GLU B 1 177 ? -3.823  42.884 51.552  0.50 21.95  ? 195 GLU B CD  1 
ATOM   3187 O  OE1 A GLU B 1 177 ? -1.569  40.294 54.823  0.50 30.97  ? 195 GLU B OE1 1 
ATOM   3188 O  OE1 B GLU B 1 177 ? -4.796  42.489 52.202  0.50 19.85  ? 195 GLU B OE1 1 
ATOM   3189 O  OE2 A GLU B 1 177 ? -2.973  41.881 54.211  0.50 28.98  ? 195 GLU B OE2 1 
ATOM   3190 O  OE2 B GLU B 1 177 ? -3.799  43.996 51.002  0.50 24.32  ? 195 GLU B OE2 1 
ATOM   3191 N  N   . LEU B 1 178 ? -3.194  37.681 50.198  1.00 27.41  ? 196 LEU B N   1 
ATOM   3192 C  CA  . LEU B 1 178 ? -3.514  36.293 50.503  1.00 26.74  ? 196 LEU B CA  1 
ATOM   3193 C  C   . LEU B 1 178 ? -2.459  35.374 49.886  1.00 28.28  ? 196 LEU B C   1 
ATOM   3194 O  O   . LEU B 1 178 ? -1.944  34.476 50.551  1.00 25.95  ? 196 LEU B O   1 
ATOM   3195 C  CB  . LEU B 1 178 ? -4.932  35.924 50.051  1.00 26.60  ? 196 LEU B CB  1 
ATOM   3196 C  CG  . LEU B 1 178 ? -5.327  34.455 50.326  1.00 28.24  ? 196 LEU B CG  1 
ATOM   3197 C  CD1 . LEU B 1 178 ? -5.157  34.017 51.785  1.00 32.86  ? 196 LEU B CD1 1 
ATOM   3198 C  CD2 . LEU B 1 178 ? -6.723  34.145 49.828  1.00 27.45  ? 196 LEU B CD2 1 
ATOM   3199 N  N   . GLN B 1 179 ? -2.083  35.625 48.636  1.00 27.02  ? 197 GLN B N   1 
ATOM   3200 C  CA  . GLN B 1 179 ? -0.966  34.846 48.079  1.00 30.74  ? 197 GLN B CA  1 
ATOM   3201 C  C   . GLN B 1 179 ? 0.358   34.973 48.900  1.00 34.01  ? 197 GLN B C   1 
ATOM   3202 O  O   . GLN B 1 179 ? 1.034   33.968 49.173  1.00 37.45  ? 197 GLN B O   1 
ATOM   3203 C  CB  . GLN B 1 179 ? -0.749  35.265 46.625  1.00 32.55  ? 197 GLN B CB  1 
ATOM   3204 C  CG  . GLN B 1 179 ? 0.602   34.907 46.013  1.00 35.09  ? 197 GLN B CG  1 
ATOM   3205 C  CD  . GLN B 1 179 ? 0.910   35.798 44.808  1.00 35.89  ? 197 GLN B CD  1 
ATOM   3206 O  OE1 . GLN B 1 179 ? 1.117   37.014 44.950  1.00 44.71  ? 197 GLN B OE1 1 
ATOM   3207 N  NE2 . GLN B 1 179 ? 0.916   35.217 43.638  1.00 30.64  ? 197 GLN B NE2 1 
ATOM   3208 N  N   . ASN B 1 180 ? 0.761   36.198 49.254  1.00 33.06  ? 198 ASN B N   1 
ATOM   3209 C  CA  . ASN B 1 180 ? 1.946   36.359 50.090  1.00 34.20  ? 198 ASN B CA  1 
ATOM   3210 C  C   . ASN B 1 180 ? 1.940   35.606 51.447  1.00 33.91  ? 198 ASN B C   1 
ATOM   3211 O  O   . ASN B 1 180 ? 2.966   35.003 51.783  1.00 32.84  ? 198 ASN B O   1 
ATOM   3212 C  CB  . ASN B 1 180 ? 2.287   37.825 50.298  1.00 35.93  ? 198 ASN B CB  1 
ATOM   3213 C  CG  . ASN B 1 180 ? 2.700   38.512 49.016  1.00 41.37  ? 198 ASN B CG  1 
ATOM   3214 O  OD1 . ASN B 1 180 ? 2.928   37.875 47.955  1.00 44.83  ? 198 ASN B OD1 1 
ATOM   3215 N  ND2 . ASN B 1 180 ? 2.794   39.827 49.092  1.00 39.77  ? 198 ASN B ND2 1 
ATOM   3216 N  N   . ARG B 1 181 ? 0.828   35.622 52.205  1.00 29.93  ? 199 ARG B N   1 
ATOM   3217 C  CA  . ARG B 1 181 ? 0.696   34.722 53.380  1.00 28.52  ? 199 ARG B CA  1 
ATOM   3218 C  C   . ARG B 1 181 ? 1.004   33.269 53.034  1.00 31.25  ? 199 ARG B C   1 
ATOM   3219 O  O   . ARG B 1 181 ? 1.651   32.555 53.792  1.00 30.87  ? 199 ARG B O   1 
ATOM   3220 C  CB  . ARG B 1 181 ? -0.696  34.774 53.998  1.00 28.88  ? 199 ARG B CB  1 
ATOM   3221 C  CG  . ARG B 1 181 ? -1.138  36.121 54.471  1.00 33.45  ? 199 ARG B CG  1 
ATOM   3222 C  CD  . ARG B 1 181 ? -2.629  36.140 54.794  1.00 33.85  ? 199 ARG B CD  1 
ATOM   3223 N  NE  . ARG B 1 181 ? -3.198  37.470 54.563  1.00 34.99  ? 199 ARG B NE  1 
ATOM   3224 C  CZ  . ARG B 1 181 ? -4.477  37.695 54.262  1.00 42.18  ? 199 ARG B CZ  1 
ATOM   3225 N  NH1 . ARG B 1 181 ? -4.921  38.946 54.091  1.00 43.19  ? 199 ARG B NH1 1 
ATOM   3226 N  NH2 . ARG B 1 181 ? -5.330  36.675 54.133  1.00 40.71  ? 199 ARG B NH2 1 
ATOM   3227 N  N   . ILE B 1 182 ? 0.515   32.810 51.878  1.00 33.31  ? 200 ILE B N   1 
ATOM   3228 C  CA  . ILE B 1 182 ? 0.677   31.418 51.527  1.00 30.35  ? 200 ILE B CA  1 
ATOM   3229 C  C   . ILE B 1 182 ? 2.119   31.155 51.122  1.00 33.54  ? 200 ILE B C   1 
ATOM   3230 O  O   . ILE B 1 182 ? 2.713   30.120 51.477  1.00 30.07  ? 200 ILE B O   1 
ATOM   3231 C  CB  . ILE B 1 182 ? -0.314  30.980 50.447  1.00 29.63  ? 200 ILE B CB  1 
ATOM   3232 C  CG1 . ILE B 1 182 ? -1.751  31.018 51.016  1.00 31.55  ? 200 ILE B CG1 1 
ATOM   3233 C  CG2 . ILE B 1 182 ? -0.009  29.547 50.001  1.00 29.71  ? 200 ILE B CG2 1 
ATOM   3234 C  CD1 . ILE B 1 182 ? -2.842  31.341 50.030  1.00 25.48  ? 200 ILE B CD1 1 
ATOM   3235 N  N   . ALA B 1 183 ? 2.706   32.089 50.381  1.00 35.63  ? 201 ALA B N   1 
ATOM   3236 C  CA  . ALA B 1 183 ? 4.063   31.845 49.918  1.00 34.89  ? 201 ALA B CA  1 
ATOM   3237 C  C   . ALA B 1 183 ? 4.985   31.847 51.140  1.00 33.65  ? 201 ALA B C   1 
ATOM   3238 O  O   . ALA B 1 183 ? 5.896   31.005 51.253  1.00 37.63  ? 201 ALA B O   1 
ATOM   3239 C  CB  . ALA B 1 183 ? 4.473   32.868 48.857  1.00 36.71  ? 201 ALA B CB  1 
ATOM   3240 N  N   . SER B 1 184 ? 4.705   32.748 52.085  1.00 34.64  ? 202 SER B N   1 
ATOM   3241 C  CA  . SER B 1 184 ? 5.469   32.830 53.370  1.00 37.03  ? 202 SER B CA  1 
ATOM   3242 C  C   . SER B 1 184 ? 5.408   31.539 54.192  1.00 37.30  ? 202 SER B C   1 
ATOM   3243 O  O   . SER B 1 184 ? 6.418   31.029 54.675  1.00 34.69  ? 202 SER B O   1 
ATOM   3244 C  CB  . SER B 1 184 ? 4.964   33.982 54.219  1.00 37.60  ? 202 SER B CB  1 
ATOM   3245 O  OG  . SER B 1 184 ? 5.274   35.220 53.600  1.00 45.99  ? 202 SER B OG  1 
ATOM   3246 N  N   . CYS B 1 185 ? 4.197   31.028 54.331  1.00 35.90  ? 203 CYS B N   1 
ATOM   3247 C  CA  . CYS B 1 185 ? 3.980   29.753 54.964  1.00 38.23  ? 203 CYS B CA  1 
ATOM   3248 C  C   . CYS B 1 185 ? 4.851   28.664 54.287  1.00 37.29  ? 203 CYS B C   1 
ATOM   3249 O  O   . CYS B 1 185 ? 5.481   27.811 54.967  1.00 34.04  ? 203 CYS B O   1 
ATOM   3250 C  CB  . CYS B 1 185 ? 2.493   29.456 54.833  1.00 36.74  ? 203 CYS B CB  1 
ATOM   3251 S  SG  . CYS B 1 185 ? 1.910   27.975 55.648  1.00 46.30  ? 203 CYS B SG  1 
ATOM   3252 N  N   . LEU B 1 186 ? 4.892   28.710 52.947  1.00 32.98  ? 204 LEU B N   1 
ATOM   3253 C  CA  . LEU B 1 186 ? 5.576   27.670 52.155  1.00 31.41  ? 204 LEU B CA  1 
ATOM   3254 C  C   . LEU B 1 186 ? 7.040   27.794 52.478  1.00 32.69  ? 204 LEU B C   1 
ATOM   3255 O  O   . LEU B 1 186 ? 7.625   26.893 53.043  1.00 35.32  ? 204 LEU B O   1 
ATOM   3256 C  CB  . LEU B 1 186 ? 5.325   27.810 50.631  1.00 28.06  ? 204 LEU B CB  1 
ATOM   3257 C  CG  . LEU B 1 186 ? 6.157   26.893 49.696  1.00 27.68  ? 204 LEU B CG  1 
ATOM   3258 C  CD1 . LEU B 1 186 ? 5.929   25.423 49.980  1.00 24.77  ? 204 LEU B CD1 1 
ATOM   3259 C  CD2 . LEU B 1 186 ? 5.958   27.133 48.197  1.00 25.51  ? 204 LEU B CD2 1 
ATOM   3260 N  N   . LYS B 1 187 ? 7.608   28.939 52.113  1.00 37.26  ? 205 LYS B N   1 
ATOM   3261 C  CA  . LYS B 1 187 ? 8.990   29.302 52.407  1.00 39.72  ? 205 LYS B CA  1 
ATOM   3262 C  C   . LYS B 1 187 ? 9.447   28.905 53.839  1.00 40.81  ? 205 LYS B C   1 
ATOM   3263 O  O   . LYS B 1 187 ? 10.455  28.240 53.993  1.00 38.44  ? 205 LYS B O   1 
ATOM   3264 C  CB  . LYS B 1 187 ? 9.183   30.796 52.148  1.00 40.15  ? 205 LYS B CB  1 
ATOM   3265 C  CG  . LYS B 1 187 ? 10.574  31.333 52.469  1.00 42.87  ? 205 LYS B CG  1 
ATOM   3266 C  CD  . LYS B 1 187 ? 10.606  32.867 52.462  1.00 47.16  ? 205 LYS B CD  1 
ATOM   3267 C  CE  . LYS B 1 187 ? 12.031  33.419 52.482  1.00 48.72  ? 205 LYS B CE  1 
ATOM   3268 N  NZ  . LYS B 1 187 ? 12.937  32.660 51.563  1.00 48.35  ? 205 LYS B NZ  1 
ATOM   3269 N  N   . GLU B 1 188 ? 8.719   29.276 54.884  1.00 42.23  ? 206 GLU B N   1 
ATOM   3270 C  CA  . GLU B 1 188 ? 9.202   28.868 56.197  1.00 49.42  ? 206 GLU B CA  1 
ATOM   3271 C  C   . GLU B 1 188 ? 8.992   27.367 56.454  1.00 50.23  ? 206 GLU B C   1 
ATOM   3272 O  O   . GLU B 1 188 ? 9.714   26.801 57.260  1.00 51.56  ? 206 GLU B O   1 
ATOM   3273 C  CB  . GLU B 1 188 ? 8.670   29.756 57.325  1.00 53.42  ? 206 GLU B CB  1 
ATOM   3274 C  CG  . GLU B 1 188 ? 7.366   29.291 57.974  1.00 64.89  ? 206 GLU B CG  1 
ATOM   3275 C  CD  . GLU B 1 188 ? 6.432   30.441 58.359  1.00 72.43  ? 206 GLU B CD  1 
ATOM   3276 O  OE1 . GLU B 1 188 ? 6.939   31.536 58.698  1.00 80.02  ? 206 GLU B OE1 1 
ATOM   3277 O  OE2 . GLU B 1 188 ? 5.188   30.256 58.325  1.00 70.81  ? 206 GLU B OE2 1 
ATOM   3278 N  N   . HIS B 1 189 ? 8.039   26.711 55.776  1.00 48.34  ? 207 HIS B N   1 
ATOM   3279 C  CA  . HIS B 1 189 ? 7.931   25.237 55.902  1.00 41.16  ? 207 HIS B CA  1 
ATOM   3280 C  C   . HIS B 1 189 ? 9.048   24.476 55.237  1.00 43.33  ? 207 HIS B C   1 
ATOM   3281 O  O   . HIS B 1 189 ? 9.533   23.471 55.779  1.00 41.82  ? 207 HIS B O   1 
ATOM   3282 C  CB  . HIS B 1 189 ? 6.601   24.678 55.434  1.00 41.96  ? 207 HIS B CB  1 
ATOM   3283 C  CG  . HIS B 1 189 ? 6.649   23.188 55.154  1.00 43.91  ? 207 HIS B CG  1 
ATOM   3284 N  ND1 . HIS B 1 189 ? 6.503   22.256 56.126  1.00 49.59  ? 207 HIS B ND1 1 
ATOM   3285 C  CD2 . HIS B 1 189 ? 6.894   22.488 53.982  1.00 42.97  ? 207 HIS B CD2 1 
ATOM   3286 C  CE1 . HIS B 1 189 ? 6.642   21.020 55.595  1.00 43.65  ? 207 HIS B CE1 1 
ATOM   3287 N  NE2 . HIS B 1 189 ? 6.867   21.163 54.281  1.00 45.39  ? 207 HIS B NE2 1 
ATOM   3288 N  N   . VAL B 1 190 ? 9.482   24.902 54.058  1.00 43.98  ? 208 VAL B N   1 
ATOM   3289 C  CA  . VAL B 1 190 ? 10.560  24.138 53.434  1.00 46.80  ? 208 VAL B CA  1 
ATOM   3290 C  C   . VAL B 1 190 ? 11.916  24.521 54.009  1.00 56.57  ? 208 VAL B C   1 
ATOM   3291 O  O   . VAL B 1 190 ? 12.894  23.792 53.801  1.00 54.62  ? 208 VAL B O   1 
ATOM   3292 C  CB  . VAL B 1 190 ? 10.591  24.194 51.894  1.00 44.34  ? 208 VAL B CB  1 
ATOM   3293 C  CG1 . VAL B 1 190 ? 9.205   23.891 51.309  1.00 41.51  ? 208 VAL B CG1 1 
ATOM   3294 C  CG2 . VAL B 1 190 ? 11.213  25.492 51.406  1.00 40.04  ? 208 VAL B CG2 1 
ATOM   3295 N  N   . ALA B 1 191 ? 11.977  25.654 54.717  1.00 55.80  ? 209 ALA B N   1 
ATOM   3296 C  CA  . ALA B 1 191 ? 13.136  25.929 55.572  1.00 61.87  ? 209 ALA B CA  1 
ATOM   3297 C  C   . ALA B 1 191 ? 13.038  25.222 56.954  1.00 59.80  ? 209 ALA B C   1 
ATOM   3298 O  O   . ALA B 1 191 ? 14.055  24.995 57.600  1.00 58.02  ? 209 ALA B O   1 
ATOM   3299 C  CB  . ALA B 1 191 ? 13.373  27.428 55.716  1.00 60.08  ? 209 ALA B CB  1 
ATOM   3300 N  N   . ALA B 1 192 ? 11.827  24.837 57.373  1.00 59.72  ? 210 ALA B N   1 
ATOM   3301 C  CA  . ALA B 1 192 ? 11.623  24.101 58.639  1.00 59.74  ? 210 ALA B CA  1 
ATOM   3302 C  C   . ALA B 1 192 ? 12.161  22.668 58.587  1.00 64.40  ? 210 ALA B C   1 
ATOM   3303 O  O   . ALA B 1 192 ? 12.330  22.006 59.618  1.00 67.57  ? 210 ALA B O   1 
ATOM   3304 C  CB  . ALA B 1 192 ? 10.160  24.108 59.044  1.00 55.56  ? 210 ALA B CB  1 
ATOM   3305 N  N   . VAL B 1 193 ? 12.382  22.182 57.373  1.00 74.33  ? 211 VAL B N   1 
ATOM   3306 C  CA  . VAL B 1 193 ? 13.262  21.050 57.135  1.00 76.47  ? 211 VAL B CA  1 
ATOM   3307 C  C   . VAL B 1 193 ? 14.615  21.689 56.760  1.00 86.58  ? 211 VAL B C   1 
ATOM   3308 O  O   . VAL B 1 193 ? 14.819  22.108 55.612  1.00 88.57  ? 211 VAL B O   1 
ATOM   3309 C  CB  . VAL B 1 193 ? 12.700  20.132 56.030  1.00 67.44  ? 211 VAL B CB  1 
ATOM   3310 C  CG1 . VAL B 1 193 ? 13.704  19.060 55.660  1.00 62.65  ? 211 VAL B CG1 1 
ATOM   3311 C  CG2 . VAL B 1 193 ? 11.378  19.510 56.473  1.00 63.96  ? 211 VAL B CG2 1 
ATOM   3312 N  N   . ALA B 1 194 ? 15.519  21.783 57.747  1.00 95.98  ? 212 ALA B N   1 
ATOM   3313 C  CA  . ALA B 1 194 ? 16.739  22.628 57.669  1.00 97.21  ? 212 ALA B CA  1 
ATOM   3314 C  C   . ALA B 1 194 ? 18.031  21.967 57.139  1.00 98.30  ? 212 ALA B C   1 
ATOM   3315 O  O   . ALA B 1 194 ? 18.652  22.486 56.215  1.00 98.69  ? 212 ALA B O   1 
ATOM   3316 C  CB  . ALA B 1 194 ? 17.000  23.317 59.013  1.00 94.69  ? 212 ALA B CB  1 
ATOM   3317 N  N   . GLY B 1 195 ? 18.448  20.854 57.739  1.00 97.24  ? 213 GLY B N   1 
ATOM   3318 C  CA  . GLY B 1 195 ? 19.628  20.123 57.276  1.00 98.98  ? 213 GLY B CA  1 
ATOM   3319 C  C   . GLY B 1 195 ? 19.204  18.990 56.354  1.00 111.15 ? 213 GLY B C   1 
ATOM   3320 O  O   . GLY B 1 195 ? 18.145  18.398 56.568  1.00 107.51 ? 213 GLY B O   1 
ATOM   3321 N  N   . GLU B 1 196 ? 19.974  18.704 55.298  1.00 122.20 ? 214 GLU B N   1 
ATOM   3322 C  CA  . GLU B 1 196 ? 21.094  19.536 54.839  1.00 123.96 ? 214 GLU B CA  1 
ATOM   3323 C  C   . GLU B 1 196 ? 20.537  20.787 54.164  1.00 125.36 ? 214 GLU B C   1 
ATOM   3324 O  O   . GLU B 1 196 ? 20.808  21.894 54.629  1.00 125.95 ? 214 GLU B O   1 
ATOM   3325 C  CB  . GLU B 1 196 ? 22.006  18.793 53.846  1.00 120.36 ? 214 GLU B CB  1 
ATOM   3326 C  CG  . GLU B 1 196 ? 22.455  17.399 54.258  1.00 123.74 ? 214 GLU B CG  1 
ATOM   3327 C  CD  . GLU B 1 196 ? 23.699  17.411 55.126  1.00 120.72 ? 214 GLU B CD  1 
ATOM   3328 O  OE1 . GLU B 1 196 ? 24.803  17.093 54.585  1.00 117.55 ? 214 GLU B OE1 1 
ATOM   3329 O  OE2 . GLU B 1 196 ? 23.570  17.738 56.346  1.00 110.58 ? 214 GLU B OE2 1 
ATOM   3330 N  N   . PRO B 1 197 ? 19.748  20.615 53.074  1.00 122.57 ? 215 PRO B N   1 
ATOM   3331 C  CA  . PRO B 1 197 ? 19.203  21.738 52.320  1.00 119.84 ? 215 PRO B CA  1 
ATOM   3332 C  C   . PRO B 1 197 ? 19.039  23.103 53.047  1.00 116.73 ? 215 PRO B C   1 
ATOM   3333 O  O   . PRO B 1 197 ? 19.958  23.927 52.962  1.00 117.93 ? 215 PRO B O   1 
ATOM   3334 C  CB  . PRO B 1 197 ? 17.885  21.162 51.799  1.00 116.81 ? 215 PRO B CB  1 
ATOM   3335 C  CG  . PRO B 1 197 ? 18.253  19.747 51.472  1.00 112.50 ? 215 PRO B CG  1 
ATOM   3336 C  CD  . PRO B 1 197 ? 19.337  19.339 52.445  1.00 112.26 ? 215 PRO B CD  1 
ATOM   3337 N  N   . GLN B 1 198 ? 17.916  23.335 53.744  1.00 109.14 ? 216 GLN B N   1 
ATOM   3338 C  CA  . GLN B 1 198 ? 17.460  24.704 54.129  1.00 94.79  ? 216 GLN B CA  1 
ATOM   3339 C  C   . GLN B 1 198 ? 17.631  25.693 52.955  1.00 98.24  ? 216 GLN B C   1 
ATOM   3340 O  O   . GLN B 1 198 ? 17.790  26.896 53.179  1.00 99.34  ? 216 GLN B O   1 
ATOM   3341 C  CB  . GLN B 1 198 ? 18.190  25.239 55.384  1.00 79.10  ? 216 GLN B CB  1 
ATOM   3342 C  CG  . GLN B 1 198 ? 17.459  26.357 56.140  1.00 71.98  ? 216 GLN B CG  1 
ATOM   3343 C  CD  . GLN B 1 198 ? 18.269  27.664 56.263  1.00 67.41  ? 216 GLN B CD  1 
ATOM   3344 O  OE1 . GLN B 1 198 ? 19.498  27.651 56.336  1.00 56.38  ? 216 GLN B OE1 1 
ATOM   3345 N  NE2 . GLN B 1 198 ? 17.567  28.803 56.278  1.00 61.63  ? 216 GLN B NE2 1 
ATOM   3346 N  N   . PRO B 1 199 ? 17.542  25.201 51.696  1.00 102.51 ? 217 PRO B N   1 
ATOM   3347 C  CA  . PRO B 1 199 ? 18.297  25.893 50.663  1.00 99.46  ? 217 PRO B CA  1 
ATOM   3348 C  C   . PRO B 1 199 ? 17.683  27.203 50.148  1.00 95.15  ? 217 PRO B C   1 
ATOM   3349 O  O   . PRO B 1 199 ? 18.377  28.223 50.109  1.00 98.33  ? 217 PRO B O   1 
ATOM   3350 C  CB  . PRO B 1 199 ? 18.385  24.841 49.544  1.00 97.66  ? 217 PRO B CB  1 
ATOM   3351 C  CG  . PRO B 1 199 ? 17.207  23.936 49.753  1.00 96.49  ? 217 PRO B CG  1 
ATOM   3352 C  CD  . PRO B 1 199 ? 16.582  24.253 51.092  1.00 100.60 ? 217 PRO B CD  1 
ATOM   3353 N  N   . ALA B 1 200 ? 16.395  27.172 49.805  1.00 91.41  ? 218 ALA B N   1 
ATOM   3354 C  CA  . ALA B 1 200 ? 15.792  28.128 48.864  1.00 91.85  ? 218 ALA B CA  1 
ATOM   3355 C  C   . ALA B 1 200 ? 16.196  27.715 47.441  1.00 86.35  ? 218 ALA B C   1 
ATOM   3356 O  O   . ALA B 1 200 ? 15.963  28.431 46.465  1.00 81.64  ? 218 ALA B O   1 
ATOM   3357 C  CB  . ALA B 1 200 ? 16.180  29.574 49.175  1.00 89.56  ? 218 ALA B CB  1 
ATOM   3358 N  N   . SER B 1 201 ? 16.816  26.542 47.351  1.00 85.77  ? 219 SER B N   1 
ATOM   3359 C  CA  . SER B 1 201 ? 16.970  25.835 46.095  1.00 82.78  ? 219 SER B CA  1 
ATOM   3360 C  C   . SER B 1 201 ? 15.756  24.931 45.926  1.00 79.80  ? 219 SER B C   1 
ATOM   3361 O  O   . SER B 1 201 ? 15.092  24.986 44.883  1.00 78.14  ? 219 SER B O   1 
ATOM   3362 C  CB  . SER B 1 201 ? 18.256  25.015 46.064  1.00 82.13  ? 219 SER B CB  1 
ATOM   3363 O  OG  . SER B 1 201 ? 18.371  24.341 44.824  1.00 82.06  ? 219 SER B OG  1 
ATOM   3364 N  N   . CYS B 1 202 ? 15.469  24.114 46.952  1.00 73.38  ? 220 CYS B N   1 
ATOM   3365 C  CA  . CYS B 1 202 ? 14.206  23.358 47.030  1.00 64.28  ? 220 CYS B CA  1 
ATOM   3366 C  C   . CYS B 1 202 ? 13.078  24.266 46.569  1.00 56.30  ? 220 CYS B C   1 
ATOM   3367 O  O   . CYS B 1 202 ? 12.336  23.918 45.667  1.00 53.21  ? 220 CYS B O   1 
ATOM   3368 C  CB  . CYS B 1 202 ? 13.937  22.827 48.456  1.00 62.71  ? 220 CYS B CB  1 
ATOM   3369 S  SG  . CYS B 1 202 ? 12.195  22.502 48.915  1.00 64.05  ? 220 CYS B SG  1 
ATOM   3370 N  N   . LEU B 1 203 ? 13.016  25.447 47.171  1.00 48.24  ? 221 LEU B N   1 
ATOM   3371 C  CA  . LEU B 1 203 ? 11.959  26.423 46.976  1.00 49.74  ? 221 LEU B CA  1 
ATOM   3372 C  C   . LEU B 1 203 ? 11.850  26.897 45.530  1.00 50.02  ? 221 LEU B C   1 
ATOM   3373 O  O   . LEU B 1 203 ? 10.790  26.818 44.925  1.00 52.39  ? 221 LEU B O   1 
ATOM   3374 C  CB  . LEU B 1 203 ? 12.231  27.613 47.891  1.00 49.27  ? 221 LEU B CB  1 
ATOM   3375 C  CG  . LEU B 1 203 ? 11.294  28.797 48.103  1.00 53.93  ? 221 LEU B CG  1 
ATOM   3376 C  CD1 . LEU B 1 203 ? 11.510  29.884 47.056  1.00 61.00  ? 221 LEU B CD1 1 
ATOM   3377 C  CD2 . LEU B 1 203 ? 9.848   28.351 48.175  1.00 53.04  ? 221 LEU B CD2 1 
ATOM   3378 N  N   . SER B 1 204 ? 12.942  27.403 44.976  1.00 51.07  ? 222 SER B N   1 
ATOM   3379 C  CA  . SER B 1 204 ? 12.903  27.880 43.604  1.00 48.81  ? 222 SER B CA  1 
ATOM   3380 C  C   . SER B 1 204 ? 12.731  26.724 42.613  1.00 44.95  ? 222 SER B C   1 
ATOM   3381 O  O   . SER B 1 204 ? 12.243  26.936 41.519  1.00 47.73  ? 222 SER B O   1 
ATOM   3382 C  CB  . SER B 1 204 ? 14.109  28.761 43.278  1.00 47.28  ? 222 SER B CB  1 
ATOM   3383 O  OG  . SER B 1 204 ? 15.186  27.980 42.817  1.00 57.79  ? 222 SER B OG  1 
ATOM   3384 N  N   . ARG B 1 205 ? 13.102  25.505 42.981  1.00 45.39  ? 223 ARG B N   1 
ATOM   3385 C  CA  . ARG B 1 205 ? 12.691  24.341 42.160  1.00 49.52  ? 223 ARG B CA  1 
ATOM   3386 C  C   . ARG B 1 205 ? 11.153  24.039 42.183  1.00 46.93  ? 223 ARG B C   1 
ATOM   3387 O  O   . ARG B 1 205 ? 10.531  23.947 41.134  1.00 45.33  ? 223 ARG B O   1 
ATOM   3388 C  CB  . ARG B 1 205 ? 13.548  23.099 42.421  1.00 53.26  ? 223 ARG B CB  1 
ATOM   3389 C  CG  . ARG B 1 205 ? 14.607  22.855 41.351  1.00 58.86  ? 223 ARG B CG  1 
ATOM   3390 C  CD  . ARG B 1 205 ? 15.299  21.514 41.553  1.00 66.96  ? 223 ARG B CD  1 
ATOM   3391 N  NE  . ARG B 1 205 ? 16.440  21.597 42.473  1.00 75.48  ? 223 ARG B NE  1 
ATOM   3392 C  CZ  . ARG B 1 205 ? 17.703  21.299 42.151  1.00 77.29  ? 223 ARG B CZ  1 
ATOM   3393 N  NH1 . ARG B 1 205 ? 18.000  20.867 40.929  1.00 78.03  ? 223 ARG B NH1 1 
ATOM   3394 N  NH2 . ARG B 1 205 ? 18.671  21.412 43.057  1.00 72.56  ? 223 ARG B NH2 1 
ATOM   3395 N  N   . LEU B 1 206 ? 10.529  23.963 43.353  1.00 44.09  ? 224 LEU B N   1 
ATOM   3396 C  CA  . LEU B 1 206 ? 9.095   23.783 43.376  1.00 44.00  ? 224 LEU B CA  1 
ATOM   3397 C  C   . LEU B 1 206 ? 8.364   24.926 42.646  1.00 42.29  ? 224 LEU B C   1 
ATOM   3398 O  O   . LEU B 1 206 ? 7.446   24.677 41.881  1.00 44.40  ? 224 LEU B O   1 
ATOM   3399 C  CB  . LEU B 1 206 ? 8.516   23.599 44.802  1.00 46.29  ? 224 LEU B CB  1 
ATOM   3400 C  CG  . LEU B 1 206 ? 9.259   23.261 46.093  1.00 49.16  ? 224 LEU B CG  1 
ATOM   3401 C  CD1 . LEU B 1 206 ? 8.307   23.413 47.264  1.00 48.81  ? 224 LEU B CD1 1 
ATOM   3402 C  CD2 . LEU B 1 206 ? 9.853   21.864 46.092  1.00 54.55  ? 224 LEU B CD2 1 
ATOM   3403 N  N   . LEU B 1 207 ? 8.745   26.176 42.893  1.00 40.83  ? 225 LEU B N   1 
ATOM   3404 C  CA  . LEU B 1 207 ? 8.101   27.299 42.221  1.00 37.80  ? 225 LEU B CA  1 
ATOM   3405 C  C   . LEU B 1 207 ? 8.360   27.331 40.705  1.00 37.67  ? 225 LEU B C   1 
ATOM   3406 O  O   . LEU B 1 207 ? 7.528   27.832 39.942  1.00 36.65  ? 225 LEU B O   1 
ATOM   3407 C  CB  . LEU B 1 207 ? 8.446   28.618 42.913  1.00 41.89  ? 225 LEU B CB  1 
ATOM   3408 C  CG  . LEU B 1 207 ? 7.501   29.165 44.017  1.00 44.55  ? 225 LEU B CG  1 
ATOM   3409 C  CD1 . LEU B 1 207 ? 6.603   28.106 44.610  1.00 47.31  ? 225 LEU B CD1 1 
ATOM   3410 C  CD2 . LEU B 1 207 ? 8.236   29.913 45.119  1.00 47.14  ? 225 LEU B CD2 1 
ATOM   3411 N  N   . GLY B 1 208 ? 9.492   26.769 40.271  1.00 36.26  ? 226 GLY B N   1 
ATOM   3412 C  CA  . GLY B 1 208 ? 9.745   26.492 38.868  1.00 32.91  ? 226 GLY B CA  1 
ATOM   3413 C  C   . GLY B 1 208 ? 8.665   25.642 38.197  1.00 36.25  ? 226 GLY B C   1 
ATOM   3414 O  O   . GLY B 1 208 ? 8.544   25.638 36.948  1.00 32.74  ? 226 GLY B O   1 
ATOM   3415 N  N   . LYS B 1 209 ? 7.867   24.928 38.999  1.00 32.57  ? 227 LYS B N   1 
ATOM   3416 C  CA  . LYS B 1 209 ? 6.820   24.069 38.427  1.00 36.22  ? 227 LYS B CA  1 
ATOM   3417 C  C   . LYS B 1 209 ? 5.541   24.798 37.978  1.00 37.17  ? 227 LYS B C   1 
ATOM   3418 O  O   . LYS B 1 209 ? 4.702   24.225 37.287  1.00 38.63  ? 227 LYS B O   1 
ATOM   3419 C  CB  . LYS B 1 209 ? 6.414   23.008 39.409  1.00 36.09  ? 227 LYS B CB  1 
ATOM   3420 C  CG  . LYS B 1 209 ? 6.443   21.667 38.779  1.00 37.51  ? 227 LYS B CG  1 
ATOM   3421 C  CD  . LYS B 1 209 ? 7.691   20.952 39.254  1.00 40.21  ? 227 LYS B CD  1 
ATOM   3422 C  CE  . LYS B 1 209 ? 7.966   19.725 38.406  1.00 37.13  ? 227 LYS B CE  1 
ATOM   3423 N  NZ  . LYS B 1 209 ? 8.827   20.196 37.309  1.00 38.33  ? 227 LYS B NZ  1 
ATOM   3424 N  N   . LEU B 1 210 ? 5.373   26.046 38.383  1.00 32.19  ? 228 LEU B N   1 
ATOM   3425 C  CA  . LEU B 1 210 ? 4.178   26.783 37.993  1.00 30.46  ? 228 LEU B CA  1 
ATOM   3426 C  C   . LEU B 1 210 ? 4.149   27.169 36.473  1.00 29.20  ? 228 LEU B C   1 
ATOM   3427 O  O   . LEU B 1 210 ? 3.165   26.842 35.798  1.00 30.11  ? 228 LEU B O   1 
ATOM   3428 C  CB  . LEU B 1 210 ? 3.954   27.954 38.961  1.00 29.01  ? 228 LEU B CB  1 
ATOM   3429 C  CG  . LEU B 1 210 ? 3.356   27.714 40.374  1.00 29.65  ? 228 LEU B CG  1 
ATOM   3430 C  CD1 . LEU B 1 210 ? 3.173   26.255 40.747  1.00 33.00  ? 228 LEU B CD1 1 
ATOM   3431 C  CD2 . LEU B 1 210 ? 4.108   28.410 41.485  1.00 27.98  ? 228 LEU B CD2 1 
ATOM   3432 N  N   . PRO B 1 211 ? 5.240   27.798 35.917  1.00 28.54  ? 229 PRO B N   1 
ATOM   3433 C  CA  . PRO B 1 211 ? 5.144   28.068 34.459  1.00 28.95  ? 229 PRO B CA  1 
ATOM   3434 C  C   . PRO B 1 211 ? 4.895   26.794 33.636  1.00 29.30  ? 229 PRO B C   1 
ATOM   3435 O  O   . PRO B 1 211 ? 3.963   26.738 32.846  1.00 31.22  ? 229 PRO B O   1 
ATOM   3436 C  CB  . PRO B 1 211 ? 6.483   28.730 34.109  1.00 27.47  ? 229 PRO B CB  1 
ATOM   3437 C  CG  . PRO B 1 211 ? 7.091   29.159 35.417  1.00 28.49  ? 229 PRO B CG  1 
ATOM   3438 C  CD  . PRO B 1 211 ? 6.474   28.381 36.528  1.00 25.66  ? 229 PRO B CD  1 
ATOM   3439 N  N   . GLU B 1 212 ? 5.660   25.743 33.878  1.00 33.32  ? 230 GLU B N   1 
ATOM   3440 C  CA  . GLU B 1 212 ? 5.450   24.470 33.157  1.00 34.25  ? 230 GLU B CA  1 
ATOM   3441 C  C   . GLU B 1 212 ? 3.979   24.041 33.221  1.00 30.23  ? 230 GLU B C   1 
ATOM   3442 O  O   . GLU B 1 212 ? 3.440   23.555 32.259  1.00 32.00  ? 230 GLU B O   1 
ATOM   3443 C  CB  . GLU B 1 212 ? 6.326   23.372 33.748  1.00 38.60  ? 230 GLU B CB  1 
ATOM   3444 C  CG  . GLU B 1 212 ? 7.731   23.828 34.117  1.00 41.63  ? 230 GLU B CG  1 
ATOM   3445 C  CD  . GLU B 1 212 ? 8.616   22.658 34.542  1.00 46.07  ? 230 GLU B CD  1 
ATOM   3446 O  OE1 . GLU B 1 212 ? 8.101   21.710 35.176  1.00 41.52  ? 230 GLU B OE1 1 
ATOM   3447 O  OE2 . GLU B 1 212 ? 9.819   22.674 34.214  1.00 50.73  ? 230 GLU B OE2 1 
ATOM   3448 N  N   . LEU B 1 213 ? 3.320   24.326 34.352  1.00 29.78  ? 231 LEU B N   1 
ATOM   3449 C  CA  . LEU B 1 213 ? 1.927   23.963 34.569  1.00 25.61  ? 231 LEU B CA  1 
ATOM   3450 C  C   . LEU B 1 213 ? 1.035   24.766 33.659  1.00 24.86  ? 231 LEU B C   1 
ATOM   3451 O  O   . LEU B 1 213 ? 0.102   24.211 33.049  1.00 25.91  ? 231 LEU B O   1 
ATOM   3452 C  CB  . LEU B 1 213 ? 1.548   24.218 36.012  1.00 25.03  ? 231 LEU B CB  1 
ATOM   3453 C  CG  . LEU B 1 213 ? 0.274   23.636 36.539  1.00 25.22  ? 231 LEU B CG  1 
ATOM   3454 C  CD1 . LEU B 1 213 ? 0.181   22.173 36.248  1.00 27.36  ? 231 LEU B CD1 1 
ATOM   3455 C  CD2 . LEU B 1 213 ? 0.213   23.875 38.059  1.00 24.15  ? 231 LEU B CD2 1 
ATOM   3456 N  N   . ARG B 1 214 ? 1.324   26.070 33.572  1.00 26.23  ? 232 ARG B N   1 
ATOM   3457 C  CA  . ARG B 1 214 ? 0.595   26.970 32.695  1.00 27.60  ? 232 ARG B CA  1 
ATOM   3458 C  C   . ARG B 1 214 ? 0.752   26.538 31.238  1.00 27.58  ? 232 ARG B C   1 
ATOM   3459 O  O   . ARG B 1 214 ? -0.207  26.547 30.501  1.00 28.39  ? 232 ARG B O   1 
ATOM   3460 C  CB  . ARG B 1 214 ? 1.030   28.411 32.904  1.00 29.24  ? 232 ARG B CB  1 
ATOM   3461 C  CG  . ARG B 1 214 ? 0.543   28.945 34.242  1.00 35.18  ? 232 ARG B CG  1 
ATOM   3462 C  CD  . ARG B 1 214 ? -0.748  29.728 34.105  1.00 35.03  ? 232 ARG B CD  1 
ATOM   3463 N  NE  . ARG B 1 214 ? -0.310  31.091 34.118  1.00 41.53  ? 232 ARG B NE  1 
ATOM   3464 C  CZ  . ARG B 1 214 ? -0.493  31.957 35.096  1.00 38.58  ? 232 ARG B CZ  1 
ATOM   3465 N  NH1 . ARG B 1 214 ? -1.188  31.666 36.197  1.00 35.03  ? 232 ARG B NH1 1 
ATOM   3466 N  NH2 . ARG B 1 214 ? 0.068   33.136 34.946  1.00 37.38  ? 232 ARG B NH2 1 
ATOM   3467 N  N   . THR B 1 215 ? 1.954   26.133 30.852  1.00 28.02  ? 233 THR B N   1 
ATOM   3468 C  CA  . THR B 1 215 ? 2.175   25.569 29.536  1.00 31.27  ? 233 THR B CA  1 
ATOM   3469 C  C   . THR B 1 215 ? 1.363   24.326 29.321  1.00 31.36  ? 233 THR B C   1 
ATOM   3470 O  O   . THR B 1 215 ? 0.903   24.067 28.216  1.00 39.36  ? 233 THR B O   1 
ATOM   3471 C  CB  . THR B 1 215 ? 3.665   25.222 29.320  1.00 33.76  ? 233 THR B CB  1 
ATOM   3472 O  OG1 . THR B 1 215 ? 4.430   26.446 29.308  1.00 32.35  ? 233 THR B OG1 1 
ATOM   3473 C  CG2 . THR B 1 215 ? 3.869   24.430 27.997  1.00 33.55  ? 233 THR B CG2 1 
ATOM   3474 N  N   . LEU B 1 216 ? 1.193   23.529 30.354  1.00 33.01  ? 234 LEU B N   1 
ATOM   3475 C  CA  . LEU B 1 216 ? 0.406   22.274 30.214  1.00 30.59  ? 234 LEU B CA  1 
ATOM   3476 C  C   . LEU B 1 216 ? -1.072  22.519 30.072  1.00 29.45  ? 234 LEU B C   1 
ATOM   3477 O  O   . LEU B 1 216 ? -1.746  21.772 29.383  1.00 32.29  ? 234 LEU B O   1 
ATOM   3478 C  CB  . LEU B 1 216 ? 0.612   21.410 31.458  1.00 29.26  ? 234 LEU B CB  1 
ATOM   3479 C  CG  . LEU B 1 216 ? 1.600   20.267 31.394  1.00 28.42  ? 234 LEU B CG  1 
ATOM   3480 C  CD1 . LEU B 1 216 ? 1.906   19.909 32.837  1.00 31.27  ? 234 LEU B CD1 1 
ATOM   3481 C  CD2 . LEU B 1 216 ? 0.979   19.082 30.625  1.00 24.84  ? 234 LEU B CD2 1 
ATOM   3482 N  N   . CYS B 1 217 ? -1.566  23.527 30.797  1.00 25.85  ? 235 CYS B N   1 
ATOM   3483 C  CA  . CYS B 1 217 ? -2.949  24.023 30.723  1.00 27.41  ? 235 CYS B CA  1 
ATOM   3484 C  C   . CYS B 1 217 ? -3.256  24.376 29.253  1.00 26.39  ? 235 CYS B C   1 
ATOM   3485 O  O   . CYS B 1 217 ? -4.233  23.927 28.717  1.00 23.95  ? 235 CYS B O   1 
ATOM   3486 C  CB  . CYS B 1 217 ? -3.119  25.253 31.698  1.00 28.93  ? 235 CYS B CB  1 
ATOM   3487 S  SG  . CYS B 1 217 ? -4.449  26.511 31.465  1.00 38.84  ? 235 CYS B SG  1 
ATOM   3488 N  N   . THR B 1 218 ? -2.354  25.106 28.590  1.00 28.67  ? 236 THR B N   1 
ATOM   3489 C  CA  . THR B 1 218 ? -2.537  25.484 27.169  1.00 30.42  ? 236 THR B CA  1 
ATOM   3490 C  C   . THR B 1 218 ? -2.769  24.272 26.284  1.00 30.19  ? 236 THR B C   1 
ATOM   3491 O  O   . THR B 1 218 ? -3.687  24.273 25.491  1.00 31.80  ? 236 THR B O   1 
ATOM   3492 C  CB  . THR B 1 218 ? -1.296  26.206 26.673  1.00 31.97  ? 236 THR B CB  1 
ATOM   3493 O  OG1 . THR B 1 218 ? -1.140  27.375 27.467  1.00 33.90  ? 236 THR B OG1 1 
ATOM   3494 C  CG2 . THR B 1 218 ? -1.414  26.568 25.199  1.00 32.42  ? 236 THR B CG2 1 
ATOM   3495 N  N   . GLN B 1 219 ? -1.928  23.251 26.444  1.00 29.74  ? 237 GLN B N   1 
ATOM   3496 C  CA  . GLN B 1 219 ? -2.169  21.931 25.853  1.00 33.33  ? 237 GLN B CA  1 
ATOM   3497 C  C   . GLN B 1 219 ? -3.564  21.348 26.153  1.00 34.73  ? 237 GLN B C   1 
ATOM   3498 O  O   . GLN B 1 219 ? -4.187  20.826 25.230  1.00 34.95  ? 237 GLN B O   1 
ATOM   3499 C  CB  . GLN B 1 219 ? -1.130  20.937 26.299  1.00 35.68  ? 237 GLN B CB  1 
ATOM   3500 C  CG  . GLN B 1 219 ? 0.278   21.243 25.864  1.00 39.32  ? 237 GLN B CG  1 
ATOM   3501 C  CD  . GLN B 1 219 ? 1.207   20.096 26.234  1.00 44.77  ? 237 GLN B CD  1 
ATOM   3502 O  OE1 . GLN B 1 219 ? 0.925   18.902 25.976  1.00 43.16  ? 237 GLN B OE1 1 
ATOM   3503 N  NE2 . GLN B 1 219 ? 2.317   20.449 26.847  1.00 42.10  ? 237 GLN B NE2 1 
ATOM   3504 N  N   . GLY B 1 220 ? -4.063  21.486 27.395  1.00 31.23  ? 238 GLY B N   1 
ATOM   3505 C  CA  . GLY B 1 220 ? -5.458  21.173 27.730  1.00 30.18  ? 238 GLY B CA  1 
ATOM   3506 C  C   . GLY B 1 220 ? -6.480  21.956 26.915  1.00 30.42  ? 238 GLY B C   1 
ATOM   3507 O  O   . GLY B 1 220 ? -7.462  21.377 26.389  1.00 27.17  ? 238 GLY B O   1 
ATOM   3508 N  N   . LEU B 1 221 ? -6.265  23.270 26.799  1.00 28.21  ? 239 LEU B N   1 
ATOM   3509 C  CA  . LEU B 1 221 ? -7.177  24.114 25.991  1.00 27.96  ? 239 LEU B CA  1 
ATOM   3510 C  C   . LEU B 1 221 ? -7.112  23.663 24.495  1.00 27.29  ? 239 LEU B C   1 
ATOM   3511 O  O   . LEU B 1 221 ? -8.131  23.584 23.775  1.00 27.83  ? 239 LEU B O   1 
ATOM   3512 C  CB  . LEU B 1 221 ? -6.815  25.608 26.152  1.00 26.85  ? 239 LEU B CB  1 
ATOM   3513 C  CG  . LEU B 1 221 ? -7.022  26.191 27.562  1.00 28.59  ? 239 LEU B CG  1 
ATOM   3514 C  CD1 . LEU B 1 221 ? -6.278  27.498 27.737  1.00 25.26  ? 239 LEU B CD1 1 
ATOM   3515 C  CD2 . LEU B 1 221 ? -8.506  26.394 27.852  1.00 27.00  ? 239 LEU B CD2 1 
ATOM   3516 N  N   . GLN B 1 222 ? -5.905  23.293 24.065  1.00 24.57  ? 240 GLN B N   1 
ATOM   3517 C  CA  . GLN B 1 222 ? -5.737  22.760 22.716  1.00 28.22  ? 240 GLN B CA  1 
ATOM   3518 C  C   . GLN B 1 222 ? -6.555  21.486 22.474  1.00 26.68  ? 240 GLN B C   1 
ATOM   3519 O  O   . GLN B 1 222 ? -7.252  21.370 21.465  1.00 29.73  ? 240 GLN B O   1 
ATOM   3520 C  CB  . GLN B 1 222 ? -4.260  22.573 22.397  1.00 25.87  ? 240 GLN B CB  1 
ATOM   3521 C  CG  . GLN B 1 222 ? -3.498  23.875 22.262  1.00 26.04  ? 240 GLN B CG  1 
ATOM   3522 C  CD  . GLN B 1 222 ? -2.094  23.531 21.817  1.00 32.92  ? 240 GLN B CD  1 
ATOM   3523 O  OE1 . GLN B 1 222 ? -1.240  23.174 22.624  1.00 36.48  ? 240 GLN B OE1 1 
ATOM   3524 N  NE2 . GLN B 1 222 ? -1.884  23.511 20.536  1.00 32.87  ? 240 GLN B NE2 1 
ATOM   3525 N  N   . ARG B 1 223 ? -6.519  20.556 23.424  1.00 26.75  ? 241 ARG B N   1 
ATOM   3526 C  CA  . ARG B 1 223 ? -7.316  19.322 23.318  1.00 25.90  ? 241 ARG B CA  1 
ATOM   3527 C  C   . ARG B 1 223 ? -8.806  19.616 23.266  1.00 26.43  ? 241 ARG B C   1 
ATOM   3528 O  O   . ARG B 1 223 ? -9.480  19.067 22.408  1.00 24.57  ? 241 ARG B O   1 
ATOM   3529 C  CB  . ARG B 1 223 ? -6.998  18.337 24.444  1.00 26.23  ? 241 ARG B CB  1 
ATOM   3530 C  CG  . ARG B 1 223 ? -7.774  17.028 24.334  1.00 29.95  ? 241 ARG B CG  1 
ATOM   3531 C  CD  . ARG B 1 223 ? -7.253  16.190 23.155  1.00 30.16  ? 241 ARG B CD  1 
ATOM   3532 N  NE  . ARG B 1 223 ? -8.062  15.005 22.909  1.00 28.82  ? 241 ARG B NE  1 
ATOM   3533 C  CZ  . ARG B 1 223 ? -8.011  14.308 21.779  1.00 32.90  ? 241 ARG B CZ  1 
ATOM   3534 N  NH1 . ARG B 1 223 ? -7.167  14.711 20.811  1.00 32.42  ? 241 ARG B NH1 1 
ATOM   3535 N  NH2 . ARG B 1 223 ? -8.804  13.232 21.613  1.00 27.19  ? 241 ARG B NH2 1 
ATOM   3536 N  N   . ILE B 1 224 ? -9.301  20.491 24.166  1.00 24.89  ? 242 ILE B N   1 
ATOM   3537 C  CA  . ILE B 1 224 ? -10.687 20.893 24.162  1.00 25.36  ? 242 ILE B CA  1 
ATOM   3538 C  C   . ILE B 1 224 ? -11.069 21.618 22.869  1.00 29.55  ? 242 ILE B C   1 
ATOM   3539 O  O   . ILE B 1 224 ? -12.144 21.343 22.319  1.00 29.11  ? 242 ILE B O   1 
ATOM   3540 C  CB  . ILE B 1 224 ? -11.074 21.802 25.346  1.00 25.99  ? 242 ILE B CB  1 
ATOM   3541 C  CG1 . ILE B 1 224 ? -10.814 21.058 26.690  1.00 25.70  ? 242 ILE B CG1 1 
ATOM   3542 C  CG2 . ILE B 1 224 ? -12.566 22.217 25.234  1.00 23.42  ? 242 ILE B CG2 1 
ATOM   3543 C  CD1 . ILE B 1 224 ? -10.678 21.964 27.896  1.00 22.13  ? 242 ILE B CD1 1 
ATOM   3544 N  N   . PHE B 1 225 ? -10.221 22.551 22.395  1.00 29.88  ? 243 PHE B N   1 
ATOM   3545 C  CA  . PHE B 1 225 ? -10.488 23.136 21.084  1.00 27.74  ? 243 PHE B CA  1 
ATOM   3546 C  C   . PHE B 1 225 ? -10.626 22.000 20.068  1.00 25.48  ? 243 PHE B C   1 
ATOM   3547 O  O   . PHE B 1 225 ? -11.595 21.915 19.372  1.00 25.83  ? 243 PHE B O   1 
ATOM   3548 C  CB  . PHE B 1 225 ? -9.420  24.143 20.668  1.00 26.02  ? 243 PHE B CB  1 
ATOM   3549 C  CG  . PHE B 1 225 ? -9.558  24.623 19.254  1.00 24.06  ? 243 PHE B CG  1 
ATOM   3550 C  CD1 . PHE B 1 225 ? -10.486 25.638 18.922  1.00 26.63  ? 243 PHE B CD1 1 
ATOM   3551 C  CD2 . PHE B 1 225 ? -8.799  24.047 18.232  1.00 23.82  ? 243 PHE B CD2 1 
ATOM   3552 C  CE1 . PHE B 1 225 ? -10.625 26.065 17.597  1.00 22.63  ? 243 PHE B CE1 1 
ATOM   3553 C  CE2 . PHE B 1 225 ? -8.936  24.488 16.908  1.00 22.90  ? 243 PHE B CE2 1 
ATOM   3554 C  CZ  . PHE B 1 225 ? -9.837  25.488 16.602  1.00 23.72  ? 243 PHE B CZ  1 
ATOM   3555 N  N   . TYR B 1 226 ? -9.680  21.096 20.009  1.00 25.85  ? 244 TYR B N   1 
ATOM   3556 C  CA  . TYR B 1 226 ? -9.790  20.066 18.994  1.00 26.89  ? 244 TYR B CA  1 
ATOM   3557 C  C   . TYR B 1 226 ? -11.154 19.300 19.084  1.00 30.16  ? 244 TYR B C   1 
ATOM   3558 O  O   . TYR B 1 226 ? -11.792 19.017 18.069  1.00 28.01  ? 244 TYR B O   1 
ATOM   3559 C  CB  . TYR B 1 226 ? -8.587  19.118 19.038  1.00 26.40  ? 244 TYR B CB  1 
ATOM   3560 C  CG  . TYR B 1 226 ? -8.803  17.895 18.177  1.00 34.37  ? 244 TYR B CG  1 
ATOM   3561 C  CD1 . TYR B 1 226 ? -8.699  17.961 16.756  1.00 35.94  ? 244 TYR B CD1 1 
ATOM   3562 C  CD2 . TYR B 1 226 ? -9.170  16.691 18.756  1.00 32.86  ? 244 TYR B CD2 1 
ATOM   3563 C  CE1 . TYR B 1 226 ? -8.943  16.838 15.974  1.00 36.53  ? 244 TYR B CE1 1 
ATOM   3564 C  CE2 . TYR B 1 226 ? -9.381  15.569 17.998  1.00 35.89  ? 244 TYR B CE2 1 
ATOM   3565 C  CZ  . TYR B 1 226 ? -9.283  15.634 16.621  1.00 38.41  ? 244 TYR B CZ  1 
ATOM   3566 O  OH  . TYR B 1 226 ? -9.536  14.483 15.935  1.00 38.26  ? 244 TYR B OH  1 
ATOM   3567 N  N   . LEU B 1 227 ? -11.598 18.996 20.300  1.00 28.56  ? 245 LEU B N   1 
ATOM   3568 C  CA  . LEU B 1 227 ? -12.791 18.207 20.478  1.00 29.39  ? 245 LEU B CA  1 
ATOM   3569 C  C   . LEU B 1 227 ? -14.012 19.052 20.222  1.00 28.63  ? 245 LEU B C   1 
ATOM   3570 O  O   . LEU B 1 227 ? -15.026 18.553 19.782  1.00 29.62  ? 245 LEU B O   1 
ATOM   3571 C  CB  . LEU B 1 227 ? -12.855 17.612 21.887  1.00 28.55  ? 245 LEU B CB  1 
ATOM   3572 C  CG  . LEU B 1 227 ? -11.698 16.730 22.339  1.00 28.23  ? 245 LEU B CG  1 
ATOM   3573 C  CD1 . LEU B 1 227 ? -11.608 16.683 23.857  1.00 25.67  ? 245 LEU B CD1 1 
ATOM   3574 C  CD2 . LEU B 1 227 ? -11.932 15.344 21.761  1.00 27.24  ? 245 LEU B CD2 1 
ATOM   3575 N  N   . LYS B 1 228 ? -13.938 20.343 20.482  1.00 29.40  ? 246 LYS B N   1 
ATOM   3576 C  CA  . LYS B 1 228 ? -15.080 21.151 20.127  1.00 30.39  ? 246 LYS B CA  1 
ATOM   3577 C  C   . LYS B 1 228 ? -15.153 21.199 18.601  1.00 33.93  ? 246 LYS B C   1 
ATOM   3578 O  O   . LYS B 1 228 ? -16.239 21.269 18.033  1.00 37.54  ? 246 LYS B O   1 
ATOM   3579 C  CB  . LYS B 1 228 ? -14.995 22.537 20.723  1.00 30.92  ? 246 LYS B CB  1 
ATOM   3580 C  CG  . LYS B 1 228 ? -15.064 22.568 22.250  1.00 30.26  ? 246 LYS B CG  1 
ATOM   3581 C  CD  . LYS B 1 228 ? -14.721 23.958 22.753  1.00 32.50  ? 246 LYS B CD  1 
ATOM   3582 C  CE  . LYS B 1 228 ? -15.607 25.057 22.151  1.00 34.67  ? 246 LYS B CE  1 
ATOM   3583 N  NZ  . LYS B 1 228 ? -17.008 24.984 22.672  1.00 38.60  ? 246 LYS B NZ  1 
ATOM   3584 N  N   . LEU B 1 229 ? -14.007 21.101 17.944  1.00 30.99  ? 247 LEU B N   1 
ATOM   3585 C  CA  . LEU B 1 229 ? -13.955 21.218 16.487  1.00 37.21  ? 247 LEU B CA  1 
ATOM   3586 C  C   . LEU B 1 229 ? -14.652 20.057 15.806  1.00 37.63  ? 247 LEU B C   1 
ATOM   3587 O  O   . LEU B 1 229 ? -15.454 20.231 14.912  1.00 38.93  ? 247 LEU B O   1 
ATOM   3588 C  CB  . LEU B 1 229 ? -12.497 21.264 15.995  1.00 35.45  ? 247 LEU B CB  1 
ATOM   3589 C  CG  . LEU B 1 229 ? -12.109 22.349 14.999  1.00 38.12  ? 247 LEU B CG  1 
ATOM   3590 C  CD1 . LEU B 1 229 ? -11.034 21.811 14.093  1.00 38.43  ? 247 LEU B CD1 1 
ATOM   3591 C  CD2 . LEU B 1 229 ? -13.271 22.834 14.134  1.00 36.65  ? 247 LEU B CD2 1 
ATOM   3592 N  N   . GLU B 1 230 ? -14.294 18.875 16.252  1.00 39.74  ? 248 GLU B N   1 
ATOM   3593 C  CA  A GLU B 1 230 ? -14.866 17.689 15.680  0.50 43.26  ? 248 GLU B CA  1 
ATOM   3594 C  CA  B GLU B 1 230 ? -14.835 17.605 15.816  0.50 41.64  ? 248 GLU B CA  1 
ATOM   3595 C  C   . GLU B 1 230 ? -16.328 17.482 16.111  1.00 45.56  ? 248 GLU B C   1 
ATOM   3596 O  O   . GLU B 1 230 ? -17.111 16.936 15.325  1.00 42.60  ? 248 GLU B O   1 
ATOM   3597 C  CB  A GLU B 1 230 ? -13.962 16.477 15.908  0.50 43.35  ? 248 GLU B CB  1 
ATOM   3598 C  CB  B GLU B 1 230 ? -14.053 16.503 16.536  0.50 37.86  ? 248 GLU B CB  1 
ATOM   3599 C  CG  A GLU B 1 230 ? -14.077 15.784 17.241  0.50 41.28  ? 248 GLU B CG  1 
ATOM   3600 C  CG  B GLU B 1 230 ? -12.662 16.366 15.961  0.50 36.19  ? 248 GLU B CG  1 
ATOM   3601 C  CD  A GLU B 1 230 ? -13.837 14.301 17.081  0.50 42.25  ? 248 GLU B CD  1 
ATOM   3602 C  CD  B GLU B 1 230 ? -12.732 16.313 14.452  0.50 35.10  ? 248 GLU B CD  1 
ATOM   3603 O  OE1 A GLU B 1 230 ? -13.368 13.671 18.044  0.50 38.59  ? 248 GLU B OE1 1 
ATOM   3604 O  OE1 B GLU B 1 230 ? -13.078 15.242 13.913  0.50 34.01  ? 248 GLU B OE1 1 
ATOM   3605 O  OE2 A GLU B 1 230 ? -14.120 13.770 15.973  0.50 41.52  ? 248 GLU B OE2 1 
ATOM   3606 O  OE2 B GLU B 1 230 ? -12.491 17.347 13.812  0.50 32.53  ? 248 GLU B OE2 1 
ATOM   3607 N  N   . ASP B 1 231 ? -16.703 17.969 17.294  1.00 45.84  ? 249 ASP B N   1 
ATOM   3608 C  CA  . ASP B 1 231 ? -18.098 17.988 17.708  1.00 49.02  ? 249 ASP B CA  1 
ATOM   3609 C  C   . ASP B 1 231 ? -18.781 16.613 17.766  1.00 49.52  ? 249 ASP B C   1 
ATOM   3610 O  O   . ASP B 1 231 ? -19.913 16.484 17.348  1.00 54.06  ? 249 ASP B O   1 
ATOM   3611 C  CB  . ASP B 1 231 ? -18.894 18.950 16.803  1.00 52.90  ? 249 ASP B CB  1 
ATOM   3612 C  CG  . ASP B 1 231 ? -20.118 19.550 17.489  1.00 59.04  ? 249 ASP B CG  1 
ATOM   3613 O  OD1 . ASP B 1 231 ? -20.502 19.059 18.584  1.00 58.38  ? 249 ASP B OD1 1 
ATOM   3614 O  OD2 . ASP B 1 231 ? -20.684 20.529 16.931  1.00 59.02  ? 249 ASP B OD2 1 
ATOM   3615 N  N   . LEU B 1 232 ? -18.111 15.590 18.296  1.00 55.90  ? 250 LEU B N   1 
ATOM   3616 C  CA  . LEU B 1 232 ? -18.769 14.290 18.538  1.00 53.09  ? 250 LEU B CA  1 
ATOM   3617 C  C   . LEU B 1 232 ? -19.672 14.363 19.751  1.00 52.90  ? 250 LEU B C   1 
ATOM   3618 O  O   . LEU B 1 232 ? -20.751 13.782 19.774  1.00 61.44  ? 250 LEU B O   1 
ATOM   3619 C  CB  . LEU B 1 232 ? -17.752 13.176 18.778  1.00 52.43  ? 250 LEU B CB  1 
ATOM   3620 C  CG  . LEU B 1 232 ? -16.851 12.707 17.642  1.00 57.86  ? 250 LEU B CG  1 
ATOM   3621 C  CD1 . LEU B 1 232 ? -15.994 11.564 18.174  1.00 57.82  ? 250 LEU B CD1 1 
ATOM   3622 C  CD2 . LEU B 1 232 ? -17.639 12.281 16.401  1.00 53.59  ? 250 LEU B CD2 1 
ATOM   3623 N  N   . VAL B 1 233 ? -19.190 15.034 20.784  1.00 51.42  ? 251 VAL B N   1 
ATOM   3624 C  CA  . VAL B 1 233 ? -19.912 15.163 22.046  1.00 53.01  ? 251 VAL B CA  1 
ATOM   3625 C  C   . VAL B 1 233 ? -19.486 16.471 22.704  1.00 49.70  ? 251 VAL B C   1 
ATOM   3626 O  O   . VAL B 1 233 ? -18.306 16.648 23.037  1.00 43.15  ? 251 VAL B O   1 
ATOM   3627 C  CB  . VAL B 1 233 ? -19.767 13.907 22.967  1.00 49.43  ? 251 VAL B CB  1 
ATOM   3628 C  CG1 . VAL B 1 233 ? -18.604 13.026 22.530  1.00 53.52  ? 251 VAL B CG1 1 
ATOM   3629 C  CG2 . VAL B 1 233 ? -19.691 14.274 24.438  1.00 44.44  ? 251 VAL B CG2 1 
ATOM   3630 N  N   . PRO B 1 234 ? -20.462 17.391 22.870  1.00 50.39  ? 252 PRO B N   1 
ATOM   3631 C  CA  . PRO B 1 234 ? -20.273 18.747 23.361  1.00 50.04  ? 252 PRO B CA  1 
ATOM   3632 C  C   . PRO B 1 234 ? -19.751 18.717 24.791  1.00 49.02  ? 252 PRO B C   1 
ATOM   3633 O  O   . PRO B 1 234 ? -20.034 17.778 25.542  1.00 57.58  ? 252 PRO B O   1 
ATOM   3634 C  CB  . PRO B 1 234 ? -21.693 19.325 23.359  1.00 47.30  ? 252 PRO B CB  1 
ATOM   3635 C  CG  . PRO B 1 234 ? -22.542 18.141 23.689  1.00 51.42  ? 252 PRO B CG  1 
ATOM   3636 C  CD  . PRO B 1 234 ? -21.890 17.001 22.923  1.00 54.76  ? 252 PRO B CD  1 
ATOM   3637 N  N   . PRO B 1 235 ? -18.991 19.741 25.177  1.00 47.47  ? 253 PRO B N   1 
ATOM   3638 C  CA  . PRO B 1 235 ? -18.544 19.708 26.555  1.00 45.59  ? 253 PRO B CA  1 
ATOM   3639 C  C   . PRO B 1 235 ? -19.689 20.079 27.468  1.00 41.11  ? 253 PRO B C   1 
ATOM   3640 O  O   . PRO B 1 235 ? -20.604 20.781 27.039  1.00 43.55  ? 253 PRO B O   1 
ATOM   3641 C  CB  . PRO B 1 235 ? -17.458 20.813 26.609  1.00 47.64  ? 253 PRO B CB  1 
ATOM   3642 C  CG  . PRO B 1 235 ? -17.364 21.394 25.229  1.00 46.52  ? 253 PRO B CG  1 
ATOM   3643 C  CD  . PRO B 1 235 ? -18.584 20.975 24.476  1.00 43.18  ? 253 PRO B CD  1 
ATOM   3644 N  N   . PRO B 1 236 ? -19.615 19.660 28.735  1.00 38.33  ? 254 PRO B N   1 
ATOM   3645 C  CA  . PRO B 1 236 ? -20.570 20.138 29.724  1.00 38.02  ? 254 PRO B CA  1 
ATOM   3646 C  C   . PRO B 1 236 ? -20.467 21.636 29.806  1.00 37.18  ? 254 PRO B C   1 
ATOM   3647 O  O   . PRO B 1 236 ? -19.364 22.179 29.665  1.00 38.48  ? 254 PRO B O   1 
ATOM   3648 C  CB  . PRO B 1 236 ? -20.053 19.535 31.049  1.00 39.19  ? 254 PRO B CB  1 
ATOM   3649 C  CG  . PRO B 1 236 ? -18.687 19.034 30.787  1.00 36.87  ? 254 PRO B CG  1 
ATOM   3650 C  CD  . PRO B 1 236 ? -18.594 18.771 29.312  1.00 36.15  ? 254 PRO B CD  1 
ATOM   3651 N  N   . PRO B 1 237 ? -21.599 22.317 30.021  1.00 37.37  ? 255 PRO B N   1 
ATOM   3652 C  CA  . PRO B 1 237 ? -21.590 23.802 29.990  1.00 36.94  ? 255 PRO B CA  1 
ATOM   3653 C  C   . PRO B 1 237 ? -20.554 24.534 30.877  1.00 39.29  ? 255 PRO B C   1 
ATOM   3654 O  O   . PRO B 1 237 ? -20.034 25.600 30.478  1.00 40.88  ? 255 PRO B O   1 
ATOM   3655 C  CB  . PRO B 1 237 ? -23.032 24.163 30.389  1.00 35.21  ? 255 PRO B CB  1 
ATOM   3656 C  CG  . PRO B 1 237 ? -23.844 22.996 29.891  1.00 34.53  ? 255 PRO B CG  1 
ATOM   3657 C  CD  . PRO B 1 237 ? -22.974 21.775 30.111  1.00 33.64  ? 255 PRO B CD  1 
ATOM   3658 N  N   . ILE B 1 238 ? -20.249 24.000 32.066  1.00 38.89  ? 256 ILE B N   1 
ATOM   3659 C  CA  . ILE B 1 238 ? -19.271 24.671 32.947  1.00 33.33  ? 256 ILE B CA  1 
ATOM   3660 C  C   . ILE B 1 238 ? -17.814 24.567 32.421  1.00 35.93  ? 256 ILE B C   1 
ATOM   3661 O  O   . ILE B 1 238 ? -17.004 25.530 32.583  1.00 35.58  ? 256 ILE B O   1 
ATOM   3662 C  CB  . ILE B 1 238 ? -19.347 24.207 34.412  1.00 34.77  ? 256 ILE B CB  1 
ATOM   3663 C  CG1 . ILE B 1 238 ? -20.807 23.891 34.832  1.00 34.21  ? 256 ILE B CG1 1 
ATOM   3664 C  CG2 . ILE B 1 238 ? -18.738 25.310 35.286  1.00 36.05  ? 256 ILE B CG2 1 
ATOM   3665 C  CD1 . ILE B 1 238 ? -20.972 23.316 36.232  1.00 32.91  ? 256 ILE B CD1 1 
ATOM   3666 N  N   . ILE B 1 239 ? -17.478 23.423 31.802  1.00 29.84  ? 257 ILE B N   1 
ATOM   3667 C  CA  . ILE B 1 239 ? -16.165 23.280 31.163  1.00 32.10  ? 257 ILE B CA  1 
ATOM   3668 C  C   . ILE B 1 239 ? -16.147 24.255 29.961  1.00 31.02  ? 257 ILE B C   1 
ATOM   3669 O  O   . ILE B 1 239 ? -15.342 25.188 29.880  1.00 32.99  ? 257 ILE B O   1 
ATOM   3670 C  CB  . ILE B 1 239 ? -15.855 21.791 30.798  1.00 29.65  ? 257 ILE B CB  1 
ATOM   3671 C  CG1 . ILE B 1 239 ? -15.883 20.868 32.047  1.00 27.98  ? 257 ILE B CG1 1 
ATOM   3672 C  CG2 . ILE B 1 239 ? -14.516 21.660 30.118  1.00 29.92  ? 257 ILE B CG2 1 
ATOM   3673 C  CD1 . ILE B 1 239 ? -15.051 21.326 33.212  1.00 26.85  ? 257 ILE B CD1 1 
ATOM   3674 N  N   . ASP B 1 240 ? -17.091 24.076 29.058  1.00 32.60  ? 258 ASP B N   1 
ATOM   3675 C  CA  . ASP B 1 240 ? -17.303 25.028 27.996  1.00 29.76  ? 258 ASP B CA  1 
ATOM   3676 C  C   . ASP B 1 240 ? -17.142 26.494 28.458  1.00 32.06  ? 258 ASP B C   1 
ATOM   3677 O  O   . ASP B 1 240 ? -16.310 27.260 27.890  1.00 30.64  ? 258 ASP B O   1 
ATOM   3678 C  CB  . ASP B 1 240 ? -18.688 24.808 27.444  1.00 30.74  ? 258 ASP B CB  1 
ATOM   3679 C  CG  . ASP B 1 240 ? -18.770 25.119 25.975  1.00 33.45  ? 258 ASP B CG  1 
ATOM   3680 O  OD1 . ASP B 1 240 ? -17.973 25.922 25.483  1.00 34.32  ? 258 ASP B OD1 1 
ATOM   3681 O  OD2 . ASP B 1 240 ? -19.655 24.570 25.309  1.00 43.55  ? 258 ASP B OD2 1 
ATOM   3682 N  N   . LYS B 1 241 ? -17.900 26.900 29.488  1.00 30.19  ? 259 LYS B N   1 
ATOM   3683 C  CA  . LYS B 1 241 ? -17.760 28.276 29.983  1.00 33.09  ? 259 LYS B CA  1 
ATOM   3684 C  C   . LYS B 1 241 ? -16.307 28.642 30.345  1.00 33.65  ? 259 LYS B C   1 
ATOM   3685 O  O   . LYS B 1 241 ? -15.830 29.713 29.956  1.00 30.03  ? 259 LYS B O   1 
ATOM   3686 C  CB  . LYS B 1 241 ? -18.726 28.580 31.144  1.00 40.33  ? 259 LYS B CB  1 
ATOM   3687 C  CG  . LYS B 1 241 ? -18.542 29.978 31.783  1.00 43.46  ? 259 LYS B CG  1 
ATOM   3688 C  CD  . LYS B 1 241 ? -19.835 30.519 32.407  1.00 46.99  ? 259 LYS B CD  1 
ATOM   3689 C  CE  . LYS B 1 241 ? -19.649 31.409 33.643  1.00 45.33  ? 259 LYS B CE  1 
ATOM   3690 N  NZ  . LYS B 1 241 ? -18.666 32.527 33.531  1.00 48.87  ? 259 LYS B NZ  1 
ATOM   3691 N  N   . ILE B 1 242 ? -15.612 27.746 31.079  1.00 34.25  ? 260 ILE B N   1 
ATOM   3692 C  CA  . ILE B 1 242 ? -14.183 27.942 31.383  1.00 34.36  ? 260 ILE B CA  1 
ATOM   3693 C  C   . ILE B 1 242 ? -13.366 28.015 30.090  1.00 33.54  ? 260 ILE B C   1 
ATOM   3694 O  O   . ILE B 1 242 ? -12.508 28.906 29.925  1.00 29.28  ? 260 ILE B O   1 
ATOM   3695 C  CB  . ILE B 1 242 ? -13.617 26.871 32.341  1.00 33.92  ? 260 ILE B CB  1 
ATOM   3696 C  CG1 . ILE B 1 242 ? -14.345 26.911 33.697  1.00 36.13  ? 260 ILE B CG1 1 
ATOM   3697 C  CG2 . ILE B 1 242 ? -12.135 27.093 32.553  1.00 31.85  ? 260 ILE B CG2 1 
ATOM   3698 C  CD1 . ILE B 1 242 ? -14.199 25.647 34.548  1.00 31.74  ? 260 ILE B CD1 1 
ATOM   3699 N  N   . PHE B 1 243 ? -13.650 27.122 29.147  1.00 32.11  ? 261 PHE B N   1 
ATOM   3700 C  CA  . PHE B 1 243 ? -12.901 27.209 27.864  1.00 34.84  ? 261 PHE B CA  1 
ATOM   3701 C  C   . PHE B 1 243 ? -13.093 28.589 27.256  1.00 34.12  ? 261 PHE B C   1 
ATOM   3702 O  O   . PHE B 1 243 ? -12.126 29.273 26.906  1.00 34.88  ? 261 PHE B O   1 
ATOM   3703 C  CB  . PHE B 1 243 ? -13.344 26.117 26.864  1.00 32.52  ? 261 PHE B CB  1 
ATOM   3704 C  CG  . PHE B 1 243 ? -12.651 26.163 25.511  1.00 29.80  ? 261 PHE B CG  1 
ATOM   3705 C  CD1 . PHE B 1 243 ? -11.398 25.599 25.326  1.00 28.17  ? 261 PHE B CD1 1 
ATOM   3706 C  CD2 . PHE B 1 243 ? -13.289 26.717 24.404  1.00 29.79  ? 261 PHE B CD2 1 
ATOM   3707 C  CE1 . PHE B 1 243 ? -10.797 25.578 24.060  1.00 26.93  ? 261 PHE B CE1 1 
ATOM   3708 C  CE2 . PHE B 1 243 ? -12.693 26.707 23.151  1.00 25.97  ? 261 PHE B CE2 1 
ATOM   3709 C  CZ  . PHE B 1 243 ? -11.454 26.128 22.983  1.00 25.18  ? 261 PHE B CZ  1 
ATOM   3710 N  N   . MET B 1 244 ? -14.340 29.015 27.143  1.00 36.32  ? 262 MET B N   1 
ATOM   3711 C  CA  . MET B 1 244 ? -14.589 30.259 26.413  1.00 37.87  ? 262 MET B CA  1 
ATOM   3712 C  C   . MET B 1 244 ? -14.220 31.464 27.263  1.00 38.80  ? 262 MET B C   1 
ATOM   3713 O  O   . MET B 1 244 ? -13.760 32.428 26.725  1.00 35.32  ? 262 MET B O   1 
ATOM   3714 C  CB  . MET B 1 244 ? -16.020 30.371 25.916  1.00 36.85  ? 262 MET B CB  1 
ATOM   3715 C  CG  . MET B 1 244 ? -16.502 29.177 25.126  1.00 40.26  ? 262 MET B CG  1 
ATOM   3716 S  SD  . MET B 1 244 ? -16.015 29.170 23.402  1.00 41.37  ? 262 MET B SD  1 
ATOM   3717 C  CE  . MET B 1 244 ? -17.336 28.110 22.842  1.00 46.77  ? 262 MET B CE  1 
ATOM   3718 N  N   . ASP B 1 245 ? -14.399 31.393 28.588  1.00 44.92  ? 263 ASP B N   1 
ATOM   3719 C  CA  . ASP B 1 245 ? -14.099 32.535 29.496  1.00 48.90  ? 263 ASP B CA  1 
ATOM   3720 C  C   . ASP B 1 245 ? -12.628 32.772 29.651  1.00 49.69  ? 263 ASP B C   1 
ATOM   3721 O  O   . ASP B 1 245 ? -12.210 33.815 30.139  1.00 50.97  ? 263 ASP B O   1 
ATOM   3722 C  CB  . ASP B 1 245 ? -14.672 32.308 30.908  1.00 53.00  ? 263 ASP B CB  1 
ATOM   3723 C  CG  . ASP B 1 245 ? -16.128 32.712 31.030  1.00 52.20  ? 263 ASP B CG  1 
ATOM   3724 O  OD1 . ASP B 1 245 ? -16.688 33.229 30.042  1.00 58.93  ? 263 ASP B OD1 1 
ATOM   3725 O  OD2 . ASP B 1 245 ? -16.720 32.518 32.120  1.00 52.52  ? 263 ASP B OD2 1 
ATOM   3726 N  N   . THR B 1 246 ? -11.827 31.789 29.255  1.00 57.11  ? 264 THR B N   1 
ATOM   3727 C  CA  . THR B 1 246 ? -10.407 31.839 29.551  1.00 55.54  ? 264 THR B CA  1 
ATOM   3728 C  C   . THR B 1 246 ? -9.589  31.833 28.260  1.00 58.58  ? 264 THR B C   1 
ATOM   3729 O  O   . THR B 1 246 ? -8.367  31.925 28.301  1.00 66.49  ? 264 THR B O   1 
ATOM   3730 C  CB  . THR B 1 246 ? -9.991  30.716 30.530  1.00 53.83  ? 264 THR B CB  1 
ATOM   3731 O  OG1 . THR B 1 246 ? -10.275 29.442 29.930  1.00 53.93  ? 264 THR B OG1 1 
ATOM   3732 C  CG2 . THR B 1 246 ? -10.745 30.848 31.887  1.00 44.94  ? 264 THR B CG2 1 
ATOM   3733 N  N   . LEU B 1 247 ? -10.264 31.730 27.117  1.00 57.42  ? 265 LEU B N   1 
ATOM   3734 C  CA  . LEU B 1 247 ? -9.604  31.921 25.826  1.00 54.75  ? 265 LEU B CA  1 
ATOM   3735 C  C   . LEU B 1 247 ? -9.515  33.398 25.605  1.00 57.82  ? 265 LEU B C   1 
ATOM   3736 O  O   . LEU B 1 247 ? -10.535 34.035 25.335  1.00 58.97  ? 265 LEU B O   1 
ATOM   3737 C  CB  . LEU B 1 247 ? -10.450 31.368 24.708  1.00 55.95  ? 265 LEU B CB  1 
ATOM   3738 C  CG  . LEU B 1 247 ? -10.057 30.088 24.009  1.00 54.95  ? 265 LEU B CG  1 
ATOM   3739 C  CD1 . LEU B 1 247 ? -10.187 28.915 24.946  1.00 49.09  ? 265 LEU B CD1 1 
ATOM   3740 C  CD2 . LEU B 1 247 ? -10.962 29.934 22.793  1.00 57.77  ? 265 LEU B CD2 1 
ATOM   3741 N  N   . PRO B 1 248 ? -8.301  33.959 25.688  1.00 60.91  ? 266 PRO B N   1 
ATOM   3742 C  CA  . PRO B 1 248 ? -8.140  35.409 25.804  1.00 57.43  ? 266 PRO B CA  1 
ATOM   3743 C  C   . PRO B 1 248 ? -8.480  36.249 24.568  1.00 59.08  ? 266 PRO B C   1 
ATOM   3744 O  O   . PRO B 1 248 ? -7.930  37.351 24.447  1.00 61.28  ? 266 PRO B O   1 
ATOM   3745 C  CB  . PRO B 1 248 ? -6.647  35.552 26.094  1.00 56.22  ? 266 PRO B CB  1 
ATOM   3746 C  CG  . PRO B 1 248 ? -6.046  34.412 25.317  1.00 63.52  ? 266 PRO B CG  1 
ATOM   3747 C  CD  . PRO B 1 248 ? -6.996  33.276 25.607  1.00 59.01  ? 266 PRO B CD  1 
ATOM   3748 N  N   . PHE B 1 249 ? -9.359  35.786 23.670  1.00 56.09  ? 267 PHE B N   1 
ATOM   3749 C  CA  . PHE B 1 249 ? -9.631  36.582 22.451  1.00 57.14  ? 267 PHE B CA  1 
ATOM   3750 C  C   . PHE B 1 249 ? -11.089 36.858 22.061  1.00 59.51  ? 267 PHE B C   1 
ATOM   3751 O  O   . PHE B 1 249 ? -12.018 36.265 22.619  1.00 74.99  ? 267 PHE B O   1 
ATOM   3752 C  CB  . PHE B 1 249 ? -8.816  36.073 21.254  1.00 56.37  ? 267 PHE B CB  1 
ATOM   3753 C  CG  . PHE B 1 249 ? -8.870  34.587 21.066  1.00 52.49  ? 267 PHE B CG  1 
ATOM   3754 C  CD1 . PHE B 1 249 ? -9.849  34.014 20.265  1.00 54.26  ? 267 PHE B CD1 1 
ATOM   3755 C  CD2 . PHE B 1 249 ? -7.937  33.767 21.685  1.00 50.71  ? 267 PHE B CD2 1 
ATOM   3756 C  CE1 . PHE B 1 249 ? -9.894  32.640 20.084  1.00 54.72  ? 267 PHE B CE1 1 
ATOM   3757 C  CE2 . PHE B 1 249 ? -7.959  32.401 21.501  1.00 49.50  ? 267 PHE B CE2 1 
ATOM   3758 C  CZ  . PHE B 1 249 ? -8.939  31.837 20.695  1.00 53.29  ? 267 PHE B CZ  1 
ATOM   3759 N  N   . GLU B 1 251 ? -13.423 39.492 20.888  1.00 72.35  ? 269 GLU B N   1 
ATOM   3760 C  CA  . GLU B 1 251 ? -14.803 39.856 20.581  1.00 78.71  ? 269 GLU B CA  1 
ATOM   3761 C  C   . GLU B 1 251 ? -15.707 38.632 20.557  1.00 82.71  ? 269 GLU B C   1 
ATOM   3762 O  O   . GLU B 1 251 ? -15.232 37.498 20.603  1.00 85.81  ? 269 GLU B O   1 
ATOM   3763 C  CB  . GLU B 1 251 ? -14.888 40.608 19.248  1.00 74.50  ? 269 GLU B CB  1 
ATOM   3764 C  CG  . GLU B 1 251 ? -14.396 42.046 19.345  1.00 72.52  ? 269 GLU B CG  1 
ATOM   3765 C  CD  . GLU B 1 251 ? -14.233 42.724 17.996  1.00 76.17  ? 269 GLU B CD  1 
ATOM   3766 O  OE1 . GLU B 1 251 ? -14.792 42.223 16.994  1.00 82.74  ? 269 GLU B OE1 1 
ATOM   3767 O  OE2 . GLU B 1 251 ? -13.550 43.769 17.934  1.00 71.76  ? 269 GLU B OE2 1 
HETATM 3768 C  C1  . TMY C 2 .   ? -11.127 24.278 5.558   1.00 51.34  ? 301 TMY A C1  1 
HETATM 3769 C  C2  . TMY C 2 .   ? -11.036 25.405 4.723   1.00 48.38  ? 301 TMY A C2  1 
HETATM 3770 C  C3  . TMY C 2 .   ? -11.189 26.703 5.297   1.00 48.54  ? 301 TMY A C3  1 
HETATM 3771 C  C4  . TMY C 2 .   ? -11.417 26.855 6.659   1.00 48.92  ? 301 TMY A C4  1 
HETATM 3772 C  C5  . TMY C 2 .   ? -11.501 25.763 7.494   1.00 60.30  ? 301 TMY A C5  1 
HETATM 3773 C  C6  . TMY C 2 .   ? -11.366 24.477 7.010   1.00 60.62  ? 301 TMY A C6  1 
HETATM 3774 C  C13 . TMY C 2 .   ? -11.006 22.870 5.143   1.00 57.84  ? 301 TMY A C13 1 
HETATM 3775 C  C14 . TMY C 2 .   ? -12.077 22.055 5.226   1.00 62.84  ? 301 TMY A C14 1 
HETATM 3776 O  O15 . TMY C 2 .   ? -13.248 22.566 5.622   1.00 77.69  ? 301 TMY A O15 1 
HETATM 3777 O  O16 . TMY C 2 .   ? -11.992 20.635 4.882   1.00 53.96  ? 301 TMY A O16 1 
HETATM 3778 C  C17 . TMY C 2 .   ? -11.335 19.721 5.770   1.00 50.07  ? 301 TMY A C17 1 
HETATM 3779 C  C18 . TMY C 2 .   ? -11.794 19.796 7.220   1.00 49.61  ? 301 TMY A C18 1 
HETATM 3780 C  C19 . TMY C 2 .   ? -11.501 23.356 8.010   1.00 64.38  ? 301 TMY A C19 1 
HETATM 3781 C  C20 . TMY C 2 .   ? -12.857 23.106 8.635   1.00 67.84  ? 301 TMY A C20 1 
HETATM 3782 C  C21 . TMY C 2 .   ? -13.150 21.706 9.186   1.00 68.30  ? 301 TMY A C21 1 
HETATM 3783 C  C22 . TMY C 2 .   ? -14.646 21.427 9.011   1.00 65.99  ? 301 TMY A C22 1 
HETATM 3784 C  C23 . TMY C 2 .   ? -15.538 22.477 9.692   1.00 69.59  ? 301 TMY A C23 1 
HETATM 3785 C  C24 . TMY C 2 .   ? -16.459 23.213 8.709   1.00 68.75  ? 301 TMY A C24 1 
HETATM 3786 C  C25 . TMY C 2 .   ? -17.247 24.337 9.379   1.00 63.40  ? 301 TMY A C25 1 
HETATM 3787 C  C26 . TMY C 2 .   ? -17.602 25.410 8.372   1.00 69.71  ? 301 TMY A C26 1 
HETATM 3788 O  O27 . TMY C 2 .   ? -10.529 22.706 8.329   1.00 68.48  ? 301 TMY A O27 1 
HETATM 3789 O  O28 . TMY C 2 .   ? -10.804 25.286 3.379   1.00 35.47  ? 301 TMY A O28 1 
HETATM 3790 O  O29 . TMY C 2 .   ? -11.079 27.845 4.554   1.00 34.98  ? 301 TMY A O29 1 
HETATM 3791 O  O30 . TMY C 2 .   ? -11.564 28.073 7.219   1.00 60.21  ? 301 TMY A O30 1 
HETATM 3792 C  C31 . TMY C 2 .   ? -11.669 24.432 2.623   1.00 47.05  ? 301 TMY A C31 1 
HETATM 3793 C  C32 . TMY C 2 .   ? -9.883  28.546 4.745   1.00 34.77  ? 301 TMY A C32 1 
HETATM 3794 C  C33 . TMY C 2 .   ? -11.096 28.304 8.553   1.00 60.96  ? 301 TMY A C33 1 
HETATM 3795 C  C1  . TMY D 2 .   ? 3.239   22.666 -11.496 1.00 74.05  ? 302 TMY A C1  1 
HETATM 3796 C  C2  . TMY D 2 .   ? 2.932   23.341 -12.657 1.00 74.36  ? 302 TMY A C2  1 
HETATM 3797 C  C3  . TMY D 2 .   ? 3.507   22.944 -13.868 1.00 75.76  ? 302 TMY A C3  1 
HETATM 3798 C  C4  . TMY D 2 .   ? 4.383   21.821 -13.891 1.00 80.39  ? 302 TMY A C4  1 
HETATM 3799 C  C5  . TMY D 2 .   ? 4.701   21.126 -12.716 1.00 78.54  ? 302 TMY A C5  1 
HETATM 3800 C  C6  . TMY D 2 .   ? 4.156   21.506 -11.498 1.00 78.14  ? 302 TMY A C6  1 
HETATM 3801 C  C13 . TMY D 2 .   ? 2.596   23.132 -10.261 1.00 64.41  ? 302 TMY A C13 1 
HETATM 3802 C  C14 . TMY D 2 .   ? 3.054   24.138 -9.535  1.00 55.38  ? 302 TMY A C14 1 
HETATM 3803 O  O15 . TMY D 2 .   ? 2.270   24.335 -8.514  1.00 52.30  ? 302 TMY A O15 1 
HETATM 3804 O  O16 . TMY D 2 .   ? 4.298   24.909 -9.815  1.00 54.08  ? 302 TMY A O16 1 
HETATM 3805 C  C17 . TMY D 2 .   ? 4.376   26.327 -9.975  1.00 45.02  ? 302 TMY A C17 1 
HETATM 3806 C  C18 . TMY D 2 .   ? 5.491   26.917 -9.183  1.00 39.12  ? 302 TMY A C18 1 
HETATM 3807 C  C19 . TMY D 2 .   ? 4.475   20.785 -10.215 1.00 76.72  ? 302 TMY A C19 1 
HETATM 3808 C  C20 . TMY D 2 .   ? 3.389   20.030 -9.492  1.00 69.22  ? 302 TMY A C20 1 
HETATM 3809 C  C21 . TMY D 2 .   ? 3.872   18.635 -9.142  1.00 60.99  ? 302 TMY A C21 1 
HETATM 3810 C  C22 . TMY D 2 .   ? 3.493   17.629 -10.205 1.00 58.32  ? 302 TMY A C22 1 
HETATM 3811 C  C23 . TMY D 2 .   ? 3.566   16.230 -9.594  1.00 55.86  ? 302 TMY A C23 1 
HETATM 3812 C  C24 . TMY D 2 .   ? 2.277   15.453 -9.773  1.00 47.01  ? 302 TMY A C24 1 
HETATM 3813 C  C25 . TMY D 2 .   ? 1.276   15.753 -8.664  1.00 47.10  ? 302 TMY A C25 1 
HETATM 3814 C  C26 . TMY D 2 .   ? -0.049  15.063 -8.893  1.00 33.90  ? 302 TMY A C26 1 
HETATM 3815 O  O27 . TMY D 2 .   ? 5.607   20.822 -9.762  1.00 85.05  ? 302 TMY A O27 1 
HETATM 3816 O  O28 . TMY D 2 .   ? 2.053   24.399 -12.538 1.00 66.84  ? 302 TMY A O28 1 
HETATM 3817 O  O29 . TMY D 2 .   ? 3.151   23.658 -15.013 1.00 71.48  ? 302 TMY A O29 1 
HETATM 3818 O  O30 . TMY D 2 .   ? 4.984   21.349 -15.053 1.00 80.49  ? 302 TMY A O30 1 
HETATM 3819 C  C31 . TMY D 2 .   ? 2.538   25.736 -12.397 1.00 75.54  ? 302 TMY A C31 1 
HETATM 3820 C  C32 . TMY D 2 .   ? 4.013   24.611 -15.637 1.00 72.87  ? 302 TMY A C32 1 
HETATM 3821 C  C33 . TMY D 2 .   ? 4.666   20.044 -15.569 1.00 75.78  ? 302 TMY A C33 1 
HETATM 3822 C  C1  . GOL E 3 .   ? -13.664 17.367 -4.365  1.00 49.84  ? 303 GOL A C1  1 
HETATM 3823 O  O1  . GOL E 3 .   ? -14.759 18.286 -4.259  1.00 52.64  ? 303 GOL A O1  1 
HETATM 3824 C  C2  . GOL E 3 .   ? -12.498 18.181 -4.923  1.00 54.61  ? 303 GOL A C2  1 
HETATM 3825 O  O2  . GOL E 3 .   ? -13.039 19.077 -5.903  1.00 55.95  ? 303 GOL A O2  1 
HETATM 3826 C  C3  . GOL E 3 .   ? -11.414 17.300 -5.566  1.00 50.64  ? 303 GOL A C3  1 
HETATM 3827 O  O3  . GOL E 3 .   ? -10.279 17.106 -4.695  1.00 54.76  ? 303 GOL A O3  1 
HETATM 3828 C  C1  . GOL F 3 .   ? 0.019   27.806 -9.896  1.00 43.69  ? 304 GOL A C1  1 
HETATM 3829 O  O1  . GOL F 3 .   ? 1.149   27.910 -10.794 1.00 50.99  ? 304 GOL A O1  1 
HETATM 3830 C  C2  . GOL F 3 .   ? 0.510   27.895 -8.479  1.00 41.12  ? 304 GOL A C2  1 
HETATM 3831 O  O2  . GOL F 3 .   ? -0.340  27.348 -7.449  1.00 33.20  ? 304 GOL A O2  1 
HETATM 3832 C  C3  . GOL F 3 .   ? 1.802   27.130 -8.548  1.00 43.01  ? 304 GOL A C3  1 
HETATM 3833 O  O3  . GOL F 3 .   ? 2.857   28.086 -8.643  1.00 45.55  ? 304 GOL A O3  1 
HETATM 3834 C  C1  . GOL G 3 .   ? -22.644 30.665 -13.300 1.00 37.23  ? 305 GOL A C1  1 
HETATM 3835 O  O1  . GOL G 3 .   ? -23.815 29.997 -12.928 1.00 32.49  ? 305 GOL A O1  1 
HETATM 3836 C  C2  . GOL G 3 .   ? -22.984 32.099 -13.024 1.00 40.17  ? 305 GOL A C2  1 
HETATM 3837 O  O2  . GOL G 3 .   ? -24.266 32.465 -13.625 1.00 33.98  ? 305 GOL A O2  1 
HETATM 3838 C  C3  . GOL G 3 .   ? -21.768 32.774 -13.627 1.00 34.96  ? 305 GOL A C3  1 
HETATM 3839 O  O3  . GOL G 3 .   ? -21.595 34.040 -13.000 1.00 33.83  ? 305 GOL A O3  1 
HETATM 3840 C  C1  . GOL H 3 .   ? -5.731  14.376 47.936  1.00 39.53  ? 301 GOL B C1  1 
HETATM 3841 O  O1  . GOL H 3 .   ? -5.804  13.612 46.699  1.00 38.30  ? 301 GOL B O1  1 
HETATM 3842 C  C2  . GOL H 3 .   ? -4.763  13.754 48.948  1.00 39.44  ? 301 GOL B C2  1 
HETATM 3843 O  O2  . GOL H 3 .   ? -4.949  12.328 49.058  1.00 45.46  ? 301 GOL B O2  1 
HETATM 3844 C  C3  . GOL H 3 .   ? -3.355  14.001 48.429  1.00 39.50  ? 301 GOL B C3  1 
HETATM 3845 O  O3  . GOL H 3 .   ? -2.290  13.511 49.229  1.00 29.13  ? 301 GOL B O3  1 
HETATM 3846 NA NA  . NA  I 4 .   ? -9.090  17.257 41.607  1.00 15.97  ? 302 NA  B NA  1 
HETATM 3847 O  O   . HOH J 5 .   ? 5.594   11.238 3.930   1.00 20.25  ? 401 HOH A O   1 
HETATM 3848 O  O   . HOH J 5 .   ? -1.573  29.874 -2.889  1.00 5.67   ? 402 HOH A O   1 
HETATM 3849 O  O   . HOH J 5 .   ? 13.974  31.964 -0.182  1.00 23.89  ? 403 HOH A O   1 
HETATM 3850 O  O   . HOH J 5 .   ? 0.539   41.268 13.585  1.00 30.45  ? 404 HOH A O   1 
HETATM 3851 O  O   . HOH J 5 .   ? 10.506  16.463 -4.666  1.00 15.06  ? 405 HOH A O   1 
HETATM 3852 O  O   . HOH J 5 .   ? -4.660  26.547 -8.599  1.00 19.88  ? 406 HOH A O   1 
HETATM 3853 O  O   . HOH J 5 .   ? -15.971 11.056 -20.581 1.00 47.05  ? 407 HOH A O   1 
HETATM 3854 O  O   . HOH J 5 .   ? -23.570 34.572 0.844   1.00 20.32  ? 408 HOH A O   1 
HETATM 3855 O  O   . HOH J 5 .   ? -15.857 27.342 -1.338  1.00 19.31  ? 409 HOH A O   1 
HETATM 3856 O  O   . HOH J 5 .   ? -25.770 22.797 -15.889 1.00 30.88  ? 410 HOH A O   1 
HETATM 3857 O  O   . HOH J 5 .   ? -27.677 24.289 -13.491 1.00 39.76  ? 411 HOH A O   1 
HETATM 3858 O  O   . HOH J 5 .   ? 15.839  17.981 3.325   1.00 18.20  ? 412 HOH A O   1 
HETATM 3859 O  O   . HOH J 5 .   ? -4.090  14.037 -14.599 1.00 33.71  ? 413 HOH A O   1 
HETATM 3860 O  O   . HOH J 5 .   ? -28.612 36.859 -10.126 1.00 27.19  ? 414 HOH A O   1 
HETATM 3861 O  O   . HOH J 5 .   ? -24.107 34.861 -6.390  1.00 30.96  ? 415 HOH A O   1 
HETATM 3862 O  O   . HOH J 5 .   ? -23.565 20.312 -5.777  1.00 19.01  ? 416 HOH A O   1 
HETATM 3863 O  O   . HOH J 5 .   ? -12.920 24.356 -22.243 1.00 52.07  ? 417 HOH A O   1 
HETATM 3864 O  O   . HOH J 5 .   ? 7.435   30.881 9.861   1.00 25.76  ? 418 HOH A O   1 
HETATM 3865 O  O   . HOH J 5 .   ? 0.676   23.755 17.279  1.00 35.12  ? 419 HOH A O   1 
HETATM 3866 O  O   . HOH J 5 .   ? -30.520 33.620 -8.662  1.00 31.96  ? 420 HOH A O   1 
HETATM 3867 O  O   . HOH J 5 .   ? -16.240 35.916 -15.308 1.00 21.09  ? 421 HOH A O   1 
HETATM 3868 O  O   . HOH J 5 .   ? -28.463 23.738 -9.786  1.00 23.06  ? 422 HOH A O   1 
HETATM 3869 O  O   . HOH J 5 .   ? -23.618 40.569 -1.771  1.00 39.25  ? 423 HOH A O   1 
HETATM 3870 O  O   . HOH J 5 .   ? 15.346  28.426 16.878  1.00 35.40  ? 424 HOH A O   1 
HETATM 3871 O  O   . HOH J 5 .   ? 1.540   33.748 18.581  1.00 39.32  ? 425 HOH A O   1 
HETATM 3872 O  O   . HOH J 5 .   ? 3.238   8.880  -0.725  1.00 41.35  ? 426 HOH A O   1 
HETATM 3873 O  O   . HOH J 5 .   ? 18.367  20.879 2.810   1.00 25.54  ? 427 HOH A O   1 
HETATM 3874 O  O   . HOH J 5 .   ? -7.430  26.989 -12.295 1.00 17.75  ? 428 HOH A O   1 
HETATM 3875 O  O   . HOH J 5 .   ? 2.829   10.500 1.703   1.00 32.02  ? 429 HOH A O   1 
HETATM 3876 O  O   . HOH J 5 .   ? 16.762  21.260 0.463   1.00 25.09  ? 430 HOH A O   1 
HETATM 3877 O  O   . HOH J 5 .   ? -29.867 23.847 -11.449 1.00 31.64  ? 431 HOH A O   1 
HETATM 3878 O  O   . HOH J 5 .   ? -14.512 35.525 -13.265 1.00 22.27  ? 432 HOH A O   1 
HETATM 3879 O  O   . HOH J 5 .   ? 17.093  24.320 6.723   1.00 32.91  ? 433 HOH A O   1 
HETATM 3880 O  O   . HOH J 5 .   ? 1.570   29.733 -0.727  1.00 20.91  ? 434 HOH A O   1 
HETATM 3881 O  O   . HOH J 5 .   ? -1.473  22.070 14.163  1.00 29.49  ? 435 HOH A O   1 
HETATM 3882 O  O   . HOH J 5 .   ? -7.586  39.196 0.887   1.00 33.38  ? 436 HOH A O   1 
HETATM 3883 O  O   . HOH J 5 .   ? 5.301   11.125 -4.667  1.00 41.15  ? 437 HOH A O   1 
HETATM 3884 O  O   . HOH J 5 .   ? 1.873   15.691 -12.247 1.00 27.80  ? 438 HOH A O   1 
HETATM 3885 O  O   . HOH J 5 .   ? -5.998  21.919 18.845  1.00 24.58  ? 439 HOH A O   1 
HETATM 3886 O  O   . HOH J 5 .   ? -27.082 34.097 2.857   1.00 41.70  ? 440 HOH A O   1 
HETATM 3887 O  O   . HOH J 5 .   ? 5.865   41.656 7.942   1.00 38.21  ? 441 HOH A O   1 
HETATM 3888 O  O   . HOH J 5 .   ? -5.673  17.137 13.251  1.00 55.89  ? 442 HOH A O   1 
HETATM 3889 O  O   . HOH J 5 .   ? -18.188 36.496 9.857   1.00 39.49  ? 443 HOH A O   1 
HETATM 3890 O  O   . HOH J 5 .   ? -12.067 15.822 -25.071 1.00 52.15  ? 444 HOH A O   1 
HETATM 3891 O  O   . HOH J 5 .   ? -14.701 41.511 0.811   1.00 37.59  ? 445 HOH A O   1 
HETATM 3892 O  O   . HOH J 5 .   ? 12.461  23.652 -8.255  1.00 42.81  ? 446 HOH A O   1 
HETATM 3893 O  O   . HOH J 5 .   ? -13.672 11.269 -18.463 1.00 49.36  ? 447 HOH A O   1 
HETATM 3894 O  O   . HOH J 5 .   ? -22.839 30.983 6.745   1.00 39.75  ? 448 HOH A O   1 
HETATM 3895 O  O   . HOH J 5 .   ? -16.009 28.201 -22.741 1.00 38.62  ? 449 HOH A O   1 
HETATM 3896 O  O   . HOH J 5 .   ? -14.124 40.153 -3.216  0.50 26.84  ? 450 HOH A O   1 
HETATM 3897 O  O   . HOH J 5 .   ? 8.517   35.649 4.348   1.00 42.79  ? 451 HOH A O   1 
HETATM 3898 O  O   . HOH J 5 .   ? 0.029   41.297 5.306   1.00 48.75  ? 452 HOH A O   1 
HETATM 3899 O  O   . HOH J 5 .   ? -11.254 39.905 11.800  1.00 35.99  ? 453 HOH A O   1 
HETATM 3900 O  O   . HOH J 5 .   ? -12.200 35.051 -17.338 1.00 43.24  ? 454 HOH A O   1 
HETATM 3901 O  O   . HOH J 5 .   ? -10.143 32.659 -25.132 1.00 67.14  ? 455 HOH A O   1 
HETATM 3902 O  O   . HOH J 5 .   ? 5.632   26.724 23.750  1.00 49.29  ? 456 HOH A O   1 
HETATM 3903 O  O   . HOH J 5 .   ? 9.466   13.056 -2.848  1.00 24.38  ? 457 HOH A O   1 
HETATM 3904 O  O   . HOH J 5 .   ? -20.734 40.785 -8.267  1.00 35.74  ? 458 HOH A O   1 
HETATM 3905 O  O   . HOH J 5 .   ? 3.576   7.150  -8.728  1.00 48.01  ? 459 HOH A O   1 
HETATM 3906 O  O   . HOH J 5 .   ? 6.929   25.643 16.943  1.00 30.78  ? 460 HOH A O   1 
HETATM 3907 O  O   . HOH J 5 .   ? 0.934   39.447 2.604   1.00 47.49  ? 461 HOH A O   1 
HETATM 3908 O  O   . HOH J 5 .   ? 13.556  37.050 -6.108  1.00 53.98  ? 462 HOH A O   1 
HETATM 3909 O  O   . HOH J 5 .   ? -19.702 40.238 1.126   1.00 59.33  ? 463 HOH A O   1 
HETATM 3910 O  O   . HOH J 5 .   ? 5.810   10.768 -7.357  1.00 43.40  ? 464 HOH A O   1 
HETATM 3911 O  O   . HOH J 5 .   ? 0.856   18.638 -17.074 1.00 51.47  ? 465 HOH A O   1 
HETATM 3912 O  O   . HOH J 5 .   ? 20.076  30.367 -1.235  1.00 48.81  ? 466 HOH A O   1 
HETATM 3913 O  O   . HOH J 5 .   ? -17.762 16.162 -20.958 1.00 53.39  ? 467 HOH A O   1 
HETATM 3914 O  O   . HOH J 5 .   ? -22.080 36.793 11.014  1.00 55.66  ? 468 HOH A O   1 
HETATM 3915 O  O   . HOH J 5 .   ? -0.645  6.607  -4.702  1.00 59.36  ? 469 HOH A O   1 
HETATM 3916 O  O   . HOH J 5 .   ? -16.477 30.348 5.673   1.00 46.71  ? 470 HOH A O   1 
HETATM 3917 O  O   . HOH J 5 .   ? -24.970 25.837 -1.513  1.00 26.95  ? 471 HOH A O   1 
HETATM 3918 O  O   . HOH J 5 .   ? 7.155   15.434 5.627   1.00 22.26  ? 472 HOH A O   1 
HETATM 3919 O  O   . HOH J 5 .   ? -15.261 29.816 -20.728 1.00 44.69  ? 473 HOH A O   1 
HETATM 3920 O  O   . HOH J 5 .   ? -21.958 20.966 -18.129 1.00 36.30  ? 474 HOH A O   1 
HETATM 3921 O  O   . HOH J 5 .   ? -15.336 40.719 -7.920  1.00 47.72  ? 475 HOH A O   1 
HETATM 3922 O  O   . HOH J 5 .   ? 2.827   21.887 16.441  1.00 49.88  ? 476 HOH A O   1 
HETATM 3923 O  O   . HOH J 5 .   ? -27.541 37.344 2.691   1.00 53.73  ? 477 HOH A O   1 
HETATM 3924 O  O   . HOH J 5 .   ? -31.607 31.448 -2.978  1.00 45.19  ? 478 HOH A O   1 
HETATM 3925 O  O   . HOH J 5 .   ? -8.339  1.202  -11.773 1.00 45.70  ? 479 HOH A O   1 
HETATM 3926 O  O   . HOH J 5 .   ? -3.378  34.857 -8.714  1.00 29.62  ? 480 HOH A O   1 
HETATM 3927 O  O   . HOH J 5 .   ? -14.750 42.050 -10.499 1.00 59.29  ? 481 HOH A O   1 
HETATM 3928 O  O   . HOH J 5 .   ? -19.966 36.454 2.248   1.00 34.15  ? 482 HOH A O   1 
HETATM 3929 O  O   . HOH J 5 .   ? -1.790  35.408 16.904  1.00 28.72  ? 483 HOH A O   1 
HETATM 3930 O  O   . HOH J 5 .   ? -1.480  22.826 16.636  1.00 44.05  ? 484 HOH A O   1 
HETATM 3931 O  O   . HOH J 5 .   ? -15.875 22.599 -21.604 1.00 43.34  ? 485 HOH A O   1 
HETATM 3932 O  O   . HOH J 5 .   ? 12.757  35.891 14.418  1.00 38.47  ? 486 HOH A O   1 
HETATM 3933 O  O   . HOH J 5 .   ? 17.236  17.050 0.966   1.00 40.19  ? 487 HOH A O   1 
HETATM 3934 O  O   . HOH J 5 .   ? 3.401   33.832 -13.216 1.00 51.31  ? 488 HOH A O   1 
HETATM 3935 O  O   . HOH J 5 .   ? -20.275 22.271 -19.936 1.00 44.44  ? 489 HOH A O   1 
HETATM 3936 O  O   . HOH J 5 .   ? -17.909 35.012 4.124   1.00 34.87  ? 490 HOH A O   1 
HETATM 3937 O  O   . HOH J 5 .   ? -4.511  40.038 21.415  1.00 60.09  ? 491 HOH A O   1 
HETATM 3938 O  O   . HOH J 5 .   ? 3.789   34.815 -9.203  1.00 49.23  ? 492 HOH A O   1 
HETATM 3939 O  O   . HOH J 5 .   ? -12.421 37.885 -15.591 1.00 41.77  ? 493 HOH A O   1 
HETATM 3940 O  O   . HOH J 5 .   ? 0.195   27.783 -1.244  1.00 24.91  ? 494 HOH A O   1 
HETATM 3941 O  O   . HOH J 5 .   ? 1.875   31.969 0.685   1.00 25.08  ? 495 HOH A O   1 
HETATM 3942 O  O   . HOH J 5 .   ? -11.946 33.788 -23.057 1.00 54.86  ? 496 HOH A O   1 
HETATM 3943 O  O   . HOH J 5 .   ? -0.624  31.404 -19.110 1.00 41.24  ? 497 HOH A O   1 
HETATM 3944 O  O   . HOH J 5 .   ? -11.759 20.214 -21.103 1.00 49.24  ? 498 HOH A O   1 
HETATM 3945 O  O   . HOH J 5 .   ? 15.116  33.255 18.654  1.00 56.28  ? 499 HOH A O   1 
HETATM 3946 O  O   . HOH J 5 .   ? -19.812 30.483 8.938   1.00 46.31  ? 500 HOH A O   1 
HETATM 3947 O  O   . HOH J 5 .   ? 1.173   22.151 13.680  0.50 24.90  ? 501 HOH A O   1 
HETATM 3948 O  O   . HOH J 5 .   ? -16.891 42.106 -0.876  1.00 41.09  ? 502 HOH A O   1 
HETATM 3949 O  O   . HOH J 5 .   ? -17.256 21.993 -24.963 1.00 55.79  ? 503 HOH A O   1 
HETATM 3950 O  O   . HOH J 5 .   ? 1.811   34.685 -7.439  1.00 48.11  ? 504 HOH A O   1 
HETATM 3951 O  O   . HOH J 5 .   ? 19.969  36.378 0.385   1.00 44.65  ? 505 HOH A O   1 
HETATM 3952 O  O   . HOH J 5 .   ? -9.504  13.269 -12.798 1.00 41.09  ? 506 HOH A O   1 
HETATM 3953 O  O   . HOH J 5 .   ? -13.256 41.344 9.998   1.00 49.07  ? 507 HOH A O   1 
HETATM 3954 O  O   . HOH J 5 .   ? -0.665  41.861 9.276   1.00 40.03  ? 508 HOH A O   1 
HETATM 3955 O  O   . HOH J 5 .   ? 7.330   13.981 -4.701  1.00 38.80  ? 509 HOH A O   1 
HETATM 3956 O  O   . HOH J 5 .   ? -20.772 44.285 -1.523  1.00 42.16  ? 510 HOH A O   1 
HETATM 3957 O  O   . HOH J 5 .   ? 0.608   18.962 13.355  1.00 43.16  ? 511 HOH A O   1 
HETATM 3958 O  O   . HOH J 5 .   ? 8.063   13.954 -7.306  1.00 35.84  ? 512 HOH A O   1 
HETATM 3959 O  O   . HOH J 5 .   ? -12.415 38.527 -3.801  1.00 42.65  ? 513 HOH A O   1 
HETATM 3960 O  O   . HOH J 5 .   ? -0.069  39.143 7.099   1.00 33.39  ? 514 HOH A O   1 
HETATM 3961 O  O   . HOH J 5 .   ? -6.231  40.894 6.960   1.00 42.23  ? 515 HOH A O   1 
HETATM 3962 O  O   . HOH J 5 .   ? 18.314  17.597 -1.199  1.00 47.71  ? 516 HOH A O   1 
HETATM 3963 O  O   . HOH J 5 .   ? 13.845  22.356 -10.633 1.00 58.57  ? 517 HOH A O   1 
HETATM 3964 O  O   . HOH J 5 .   ? -25.026 41.263 0.535   1.00 40.59  ? 518 HOH A O   1 
HETATM 3965 O  O   . HOH J 5 .   ? -13.090 42.212 12.342  1.00 43.51  ? 519 HOH A O   1 
HETATM 3966 O  O   . HOH J 5 .   ? 8.254   37.824 9.461   1.00 52.07  ? 520 HOH A O   1 
HETATM 3967 O  O   . HOH J 5 .   ? 6.624   18.476 -8.121  1.00 57.41  ? 521 HOH A O   1 
HETATM 3968 O  O   . HOH J 5 .   ? -1.904  5.592  -6.951  1.00 56.54  ? 522 HOH A O   1 
HETATM 3969 O  O   . HOH J 5 .   ? 0.658   13.352 -15.518 1.00 55.74  ? 523 HOH A O   1 
HETATM 3970 O  O   . HOH J 5 .   ? -24.737 32.184 7.380   1.00 48.81  ? 524 HOH A O   1 
HETATM 3971 O  O   . HOH J 5 .   ? 19.498  34.227 3.771   1.00 40.63  ? 525 HOH A O   1 
HETATM 3972 O  O   . HOH J 5 .   ? -12.519 38.221 1.793   1.00 38.92  ? 526 HOH A O   1 
HETATM 3973 O  O   . HOH J 5 .   ? -19.343 30.234 12.864  1.00 48.69  ? 527 HOH A O   1 
HETATM 3974 O  O   . HOH J 5 .   ? -20.135 23.381 2.372   1.00 42.14  ? 528 HOH A O   1 
HETATM 3975 O  O   . HOH J 5 .   ? -7.799  11.689 -13.425 1.00 48.44  ? 529 HOH A O   1 
HETATM 3976 O  O   . HOH J 5 .   ? -25.163 24.250 -17.912 1.00 42.03  ? 530 HOH A O   1 
HETATM 3977 O  O   . HOH J 5 .   ? -19.027 16.122 -15.271 1.00 47.87  ? 531 HOH A O   1 
HETATM 3978 O  O   . HOH J 5 .   ? -5.891  14.384 -16.567 1.00 51.30  ? 532 HOH A O   1 
HETATM 3979 O  O   . HOH J 5 .   ? -11.499 41.454 -1.563  1.00 38.93  ? 533 HOH A O   1 
HETATM 3980 O  O   . HOH J 5 .   ? -15.035 39.561 -15.448 1.00 40.80  ? 534 HOH A O   1 
HETATM 3981 O  O   . HOH J 5 .   ? 5.120   22.738 21.041  1.00 51.09  ? 535 HOH A O   1 
HETATM 3982 O  O   . HOH J 5 .   ? 7.072   37.703 6.830   1.00 49.33  ? 536 HOH A O   1 
HETATM 3983 O  O   . HOH J 5 .   ? 4.362   25.535 18.907  1.00 49.18  ? 537 HOH A O   1 
HETATM 3984 O  O   . HOH J 5 .   ? -6.540  40.789 14.085  1.00 41.79  ? 538 HOH A O   1 
HETATM 3985 O  O   . HOH J 5 .   ? -10.879 39.966 -7.202  1.00 37.19  ? 539 HOH A O   1 
HETATM 3986 O  O   . HOH J 5 .   ? -6.687  12.428 -27.862 1.00 65.64  ? 540 HOH A O   1 
HETATM 3987 O  O   . HOH J 5 .   ? -0.521  14.578 5.411   1.00 26.72  ? 541 HOH A O   1 
HETATM 3988 O  O   . HOH J 5 .   ? -12.027 0.181  -10.872 1.00 51.30  ? 542 HOH A O   1 
HETATM 3989 O  O   . HOH J 5 .   ? -29.434 30.695 -7.247  1.00 35.38  ? 543 HOH A O   1 
HETATM 3990 O  O   . HOH J 5 .   ? -11.409 19.696 2.981   1.00 42.32  ? 544 HOH A O   1 
HETATM 3991 O  O   . HOH J 5 .   ? -13.920 30.283 6.899   1.00 51.54  ? 545 HOH A O   1 
HETATM 3992 O  O   . HOH J 5 .   ? -21.154 24.831 4.253   1.00 40.15  ? 546 HOH A O   1 
HETATM 3993 O  O   . HOH J 5 .   ? -14.431 22.590 3.514   1.00 40.65  ? 547 HOH A O   1 
HETATM 3994 O  O   . HOH J 5 .   ? -12.778 38.435 -23.954 1.00 52.71  ? 548 HOH A O   1 
HETATM 3995 O  O   . HOH J 5 .   ? 7.707   20.617 14.558  1.00 49.67  ? 549 HOH A O   1 
HETATM 3996 O  O   . HOH J 5 .   ? -28.956 32.280 2.347   1.00 51.08  ? 550 HOH A O   1 
HETATM 3997 O  O   . HOH J 5 .   ? -18.305 34.562 14.039  1.00 55.85  ? 551 HOH A O   1 
HETATM 3998 O  O   . HOH J 5 .   ? 5.787   16.601 13.066  1.00 56.85  ? 552 HOH A O   1 
HETATM 3999 O  O   . HOH J 5 .   ? 6.781   16.428 15.798  1.00 57.75  ? 553 HOH A O   1 
HETATM 4000 O  O   . HOH J 5 .   ? -3.021  10.990 -14.256 1.00 58.91  ? 554 HOH A O   1 
HETATM 4001 O  O   . HOH J 5 .   ? -14.826 4.815  -8.654  1.00 46.04  ? 555 HOH A O   1 
HETATM 4002 O  O   . HOH J 5 .   ? 13.090  35.391 -8.440  1.00 64.16  ? 556 HOH A O   1 
HETATM 4003 O  O   . HOH J 5 .   ? -18.783 33.552 6.042   1.00 33.67  ? 557 HOH A O   1 
HETATM 4004 O  O   . HOH J 5 .   ? -10.276 10.240 -13.197 1.00 52.46  ? 558 HOH A O   1 
HETATM 4005 O  O   . HOH J 5 .   ? -29.131 29.882 8.488   1.00 47.44  ? 559 HOH A O   1 
HETATM 4006 O  O   . HOH J 5 .   ? 15.973  31.415 -9.103  1.00 53.72  ? 560 HOH A O   1 
HETATM 4007 O  O   . HOH J 5 .   ? 0.400   13.322 7.480   1.00 36.22  ? 561 HOH A O   1 
HETATM 4008 O  O   . HOH J 5 .   ? -2.063  7.641  -11.940 1.00 55.36  ? 562 HOH A O   1 
HETATM 4009 O  O   . HOH J 5 .   ? 19.181  23.935 -3.281  1.00 44.67  ? 563 HOH A O   1 
HETATM 4010 O  O   . HOH J 5 .   ? 3.210   29.086 -13.170 1.00 33.40  ? 564 HOH A O   1 
HETATM 4011 O  O   . HOH J 5 .   ? -10.712 3.999  -5.389  1.00 63.78  ? 565 HOH A O   1 
HETATM 4012 O  O   . HOH J 5 .   ? -2.164  15.321 8.274   1.00 45.52  ? 566 HOH A O   1 
HETATM 4013 O  O   . HOH J 5 .   ? -11.820 37.832 -6.416  1.00 39.73  ? 567 HOH A O   1 
HETATM 4014 O  O   . HOH J 5 .   ? 2.028   36.596 -12.830 1.00 42.75  ? 568 HOH A O   1 
HETATM 4015 O  O   . HOH J 5 .   ? -8.214  32.966 -17.169 1.00 42.49  ? 569 HOH A O   1 
HETATM 4016 O  O   . HOH J 5 .   ? -8.473  40.918 -5.839  1.00 41.87  ? 570 HOH A O   1 
HETATM 4017 O  O   . HOH J 5 .   ? -17.023 21.184 -0.684  1.00 43.35  ? 571 HOH A O   1 
HETATM 4018 O  O   . HOH J 5 .   ? -27.938 38.474 -4.108  1.00 60.62  ? 572 HOH A O   1 
HETATM 4019 O  O   . HOH J 5 .   ? -18.762 29.886 -16.548 1.00 33.08  ? 573 HOH A O   1 
HETATM 4020 O  O   . HOH J 5 .   ? -29.851 36.073 -2.919  1.00 54.86  ? 574 HOH A O   1 
HETATM 4021 O  O   . HOH J 5 .   ? 7.969   21.756 -15.240 1.00 50.17  ? 575 HOH A O   1 
HETATM 4022 O  O   . HOH J 5 .   ? 20.571  27.748 12.563  1.00 36.31  ? 576 HOH A O   1 
HETATM 4023 O  O   . HOH J 5 .   ? -5.376  38.341 5.236   1.00 35.86  ? 577 HOH A O   1 
HETATM 4024 O  O   . HOH J 5 .   ? 9.214   29.098 11.122  1.00 24.47  ? 578 HOH A O   1 
HETATM 4025 O  O   . HOH J 5 .   ? 11.601  30.866 8.636   1.00 32.73  ? 579 HOH A O   1 
HETATM 4026 O  O   . HOH J 5 .   ? 13.436  32.125 14.592  1.00 40.21  ? 580 HOH A O   1 
HETATM 4027 O  O   . HOH J 5 .   ? 14.035  29.588 12.144  1.00 38.89  ? 581 HOH A O   1 
HETATM 4028 O  O   . HOH J 5 .   ? 11.876  27.002 12.032  1.00 25.17  ? 582 HOH A O   1 
HETATM 4029 O  O   . HOH J 5 .   ? 0.162   24.742 -7.016  1.00 14.82  ? 583 HOH A O   1 
HETATM 4030 O  O   . HOH J 5 .   ? 15.092  30.768 8.794   1.00 38.27  ? 584 HOH A O   1 
HETATM 4031 O  O   . HOH J 5 .   ? 16.633  34.056 -5.679  1.00 42.40  ? 585 HOH A O   1 
HETATM 4032 O  O   . HOH J 5 .   ? -9.834  36.472 18.179  1.00 55.57  ? 586 HOH A O   1 
HETATM 4033 O  O   . HOH J 5 .   ? -16.342 38.302 4.629   1.00 41.82  ? 587 HOH A O   1 
HETATM 4034 O  O   . HOH J 5 .   ? 6.174   36.894 3.638   1.00 61.28  ? 588 HOH A O   1 
HETATM 4035 O  O   . HOH J 5 .   ? -8.737  38.719 18.520  1.00 39.93  ? 589 HOH A O   1 
HETATM 4036 O  O   . HOH J 5 .   ? 13.693  40.091 -9.970  1.00 62.18  ? 590 HOH A O   1 
HETATM 4037 O  O   . HOH J 5 .   ? -17.073 20.077 -3.502  1.00 37.64  ? 591 HOH A O   1 
HETATM 4038 O  O   . HOH J 5 .   ? -17.155 20.789 -6.317  1.00 31.98  ? 592 HOH A O   1 
HETATM 4039 O  O   . HOH J 5 .   ? 7.822   27.622 -15.179 1.00 56.97  ? 593 HOH A O   1 
HETATM 4040 O  O   . HOH J 5 .   ? -14.330 22.145 -1.527  1.00 38.22  ? 594 HOH A O   1 
HETATM 4041 O  O   . HOH J 5 .   ? -7.669  16.572 -3.313  1.00 35.08  ? 595 HOH A O   1 
HETATM 4042 O  O   . HOH J 5 .   ? 9.649   19.537 12.889  1.00 38.20  ? 596 HOH A O   1 
HETATM 4043 O  O   . HOH J 5 .   ? -17.681 23.025 -19.680 1.00 33.11  ? 597 HOH A O   1 
HETATM 4044 O  O   . HOH J 5 .   ? -3.537  36.276 19.230  1.00 46.39  ? 598 HOH A O   1 
HETATM 4045 O  O   . HOH J 5 .   ? 2.017   20.110 -12.035 1.00 44.27  ? 599 HOH A O   1 
HETATM 4046 O  O   . HOH J 5 .   ? 11.990  39.282 -5.642  1.00 50.10  ? 600 HOH A O   1 
HETATM 4047 O  O   . HOH J 5 .   ? -10.210 16.477 10.745  1.00 42.71  ? 601 HOH A O   1 
HETATM 4048 O  O   . HOH J 5 .   ? -15.595 27.711 6.557   1.00 45.46  ? 602 HOH A O   1 
HETATM 4049 O  O   . HOH J 5 .   ? -14.061 26.060 5.457   1.00 22.57  ? 603 HOH A O   1 
HETATM 4050 O  O   . HOH J 5 .   ? 10.185  23.208 3.039   0.50 28.32  ? 604 HOH A O   1 
HETATM 4051 O  O   . HOH J 5 .   ? 4.292   28.796 -15.697 1.00 47.43  ? 605 HOH A O   1 
HETATM 4052 O  O   . HOH J 5 .   ? -3.338  11.847 6.777   1.00 51.41  ? 606 HOH A O   1 
HETATM 4053 O  O   . HOH J 5 .   ? -6.183  5.862  1.938   1.00 64.79  ? 607 HOH A O   1 
HETATM 4054 O  O   . HOH J 5 .   ? -6.594  6.790  -2.391  1.00 43.71  ? 608 HOH A O   1 
HETATM 4055 O  O   . HOH K 5 .   ? -12.219 30.282 52.709  1.00 19.73  ? 401 HOH B O   1 
HETATM 4056 O  O   . HOH K 5 .   ? -6.449  31.752 39.711  1.00 19.49  ? 402 HOH B O   1 
HETATM 4057 O  O   . HOH K 5 .   ? -3.630  34.644 33.745  1.00 30.45  ? 403 HOH B O   1 
HETATM 4058 O  O   . HOH K 5 .   ? -0.572  30.724 60.578  1.00 32.94  ? 404 HOH B O   1 
HETATM 4059 O  O   . HOH K 5 .   ? -7.849  5.270  25.481  1.00 28.27  ? 405 HOH B O   1 
HETATM 4060 O  O   . HOH K 5 .   ? 4.146   14.385 53.203  1.00 42.34  ? 406 HOH B O   1 
HETATM 4061 O  O   . HOH K 5 .   ? -10.677 1.485  38.004  1.00 25.64  ? 407 HOH B O   1 
HETATM 4062 O  O   . HOH K 5 .   ? -10.170 7.354  26.282  1.00 27.50  ? 408 HOH B O   1 
HETATM 4063 O  O   . HOH K 5 .   ? -4.623  20.447 46.624  1.00 25.21  ? 409 HOH B O   1 
HETATM 4064 O  O   . HOH K 5 .   ? 0.133   39.201 53.309  1.00 40.24  ? 410 HOH B O   1 
HETATM 4065 O  O   . HOH K 5 .   ? -6.593  4.253  53.456  1.00 41.63  ? 411 HOH B O   1 
HETATM 4066 O  O   . HOH K 5 .   ? -7.493  43.036 53.195  1.00 34.57  ? 412 HOH B O   1 
HETATM 4067 O  O   . HOH K 5 .   ? -14.298 24.807 39.047  1.00 46.82  ? 413 HOH B O   1 
HETATM 4068 O  O   . HOH K 5 .   ? -1.006  34.748 38.027  1.00 28.37  ? 414 HOH B O   1 
HETATM 4069 O  O   . HOH K 5 .   ? 11.724  20.514 46.331  1.00 53.91  ? 415 HOH B O   1 
HETATM 4070 O  O   . HOH K 5 .   ? -3.334  40.012 42.473  1.00 26.55  ? 416 HOH B O   1 
HETATM 4071 O  O   . HOH K 5 .   ? 9.049   19.199 50.028  1.00 34.06  ? 417 HOH B O   1 
HETATM 4072 O  O   . HOH K 5 .   ? -9.125  13.960 39.312  1.00 23.01  ? 418 HOH B O   1 
HETATM 4073 O  O   . HOH K 5 .   ? -7.018  15.879 39.442  1.00 19.93  ? 419 HOH B O   1 
HETATM 4074 O  O   . HOH K 5 .   ? -9.196  37.367 52.092  1.00 29.26  ? 420 HOH B O   1 
HETATM 4075 O  O   . HOH K 5 .   ? 0.431   36.961 41.281  1.00 38.67  ? 421 HOH B O   1 
HETATM 4076 O  O   . HOH K 5 .   ? -16.235 18.234 22.699  1.00 38.04  ? 422 HOH B O   1 
HETATM 4077 O  O   . HOH K 5 .   ? -17.951 40.451 43.649  1.00 29.38  ? 423 HOH B O   1 
HETATM 4078 O  O   . HOH K 5 .   ? -18.997 41.916 45.821  1.00 24.40  ? 424 HOH B O   1 
HETATM 4079 O  O   . HOH K 5 .   ? -11.838 32.224 55.112  1.00 38.54  ? 425 HOH B O   1 
HETATM 4080 O  O   . HOH K 5 .   ? -6.906  45.681 45.266  1.00 32.37  ? 426 HOH B O   1 
HETATM 4081 O  O   . HOH K 5 .   ? -7.663  47.881 41.499  1.00 37.14  ? 427 HOH B O   1 
HETATM 4082 O  O   . HOH K 5 .   ? -11.217 19.557 51.092  1.00 37.18  ? 428 HOH B O   1 
HETATM 4083 O  O   . HOH K 5 .   ? 7.531   5.171  28.177  1.00 45.97  ? 429 HOH B O   1 
HETATM 4084 O  O   . HOH K 5 .   ? -11.863 13.980 38.443  1.00 24.85  ? 430 HOH B O   1 
HETATM 4085 O  O   . HOH K 5 .   ? -18.178 28.232 38.454  1.00 56.45  ? 431 HOH B O   1 
HETATM 4086 O  O   . HOH K 5 .   ? -15.199 -0.809 43.532  1.00 55.58  ? 432 HOH B O   1 
HETATM 4087 O  O   . HOH K 5 .   ? -17.600 7.525  28.399  1.00 34.04  ? 433 HOH B O   1 
HETATM 4088 O  O   . HOH K 5 .   ? -4.829  3.107  23.708  1.00 46.21  ? 434 HOH B O   1 
HETATM 4089 O  O   . HOH K 5 .   ? -10.586 11.938 51.851  1.00 41.13  ? 435 HOH B O   1 
HETATM 4090 O  O   . HOH K 5 .   ? -17.714 31.384 49.616  1.00 39.86  ? 436 HOH B O   1 
HETATM 4091 O  O   . HOH K 5 .   ? -12.095 3.395  31.067  1.00 37.85  ? 437 HOH B O   1 
HETATM 4092 O  O   . HOH K 5 .   ? -16.018 4.863  28.010  1.00 47.57  ? 438 HOH B O   1 
HETATM 4093 O  O   . HOH K 5 .   ? 16.388  21.880 45.855  0.50 45.27  ? 439 HOH B O   1 
HETATM 4094 O  O   . HOH K 5 .   ? 9.714   6.728  31.408  1.00 60.65  ? 440 HOH B O   1 
HETATM 4095 O  O   . HOH K 5 .   ? -13.537 19.808 57.953  1.00 44.49  ? 441 HOH B O   1 
HETATM 4096 O  O   . HOH K 5 .   ? 0.963   22.449 19.611  1.00 37.85  ? 442 HOH B O   1 
HETATM 4097 O  O   . HOH K 5 .   ? 8.156   8.300  38.208  1.00 36.74  ? 443 HOH B O   1 
HETATM 4098 O  O   . HOH K 5 .   ? 3.717   8.739  28.491  1.00 33.25  ? 444 HOH B O   1 
HETATM 4099 O  O   . HOH K 5 .   ? -20.553 35.066 42.367  1.00 40.25  ? 445 HOH B O   1 
HETATM 4100 O  O   . HOH K 5 .   ? -14.247 5.291  41.214  1.00 41.64  ? 446 HOH B O   1 
HETATM 4101 O  O   . HOH K 5 .   ? 2.258   20.522 58.971  1.00 61.45  ? 447 HOH B O   1 
HETATM 4102 O  O   . HOH K 5 .   ? 6.768   7.660  40.772  1.00 40.82  ? 448 HOH B O   1 
HETATM 4103 O  O   . HOH K 5 .   ? 5.653   8.282  26.239  1.00 43.26  ? 449 HOH B O   1 
HETATM 4104 O  O   . HOH K 5 .   ? -25.316 14.857 28.045  1.00 50.87  ? 450 HOH B O   1 
HETATM 4105 O  O   . HOH K 5 .   ? -20.707 15.887 49.996  1.00 54.64  ? 451 HOH B O   1 
HETATM 4106 O  O   . HOH K 5 .   ? 5.247   10.794 29.504  1.00 39.19  ? 452 HOH B O   1 
HETATM 4107 O  O   . HOH K 5 .   ? -18.106 29.457 44.072  1.00 42.67  ? 453 HOH B O   1 
HETATM 4108 O  O   . HOH K 5 .   ? -15.405 7.215  33.382  1.00 39.70  ? 454 HOH B O   1 
HETATM 4109 O  O   . HOH K 5 .   ? 8.752   33.387 55.684  1.00 44.05  ? 455 HOH B O   1 
HETATM 4110 O  O   . HOH K 5 .   ? -24.658 18.228 29.806  1.00 46.99  ? 456 HOH B O   1 
HETATM 4111 O  O   . HOH K 5 .   ? -13.413 -0.797 45.859  1.00 54.48  ? 457 HOH B O   1 
HETATM 4112 O  O   . HOH K 5 .   ? 12.189  16.186 49.851  1.00 48.52  ? 458 HOH B O   1 
HETATM 4113 O  O   . HOH K 5 .   ? -17.972 13.741 36.426  1.00 46.10  ? 459 HOH B O   1 
HETATM 4114 O  O   . HOH K 5 .   ? -15.428 44.162 45.973  1.00 46.84  ? 460 HOH B O   1 
HETATM 4115 O  O   . HOH K 5 .   ? -21.374 9.682  31.815  1.00 43.33  ? 461 HOH B O   1 
HETATM 4116 O  O   . HOH K 5 .   ? -10.226 46.882 39.808  1.00 44.30  ? 462 HOH B O   1 
HETATM 4117 O  O   . HOH K 5 .   ? -9.254  37.335 33.272  1.00 45.03  ? 463 HOH B O   1 
HETATM 4118 O  O   . HOH K 5 .   ? 0.083   -0.295 35.206  1.00 41.10  ? 464 HOH B O   1 
HETATM 4119 O  O   . HOH K 5 .   ? -20.072 39.595 42.752  1.00 33.18  ? 465 HOH B O   1 
HETATM 4120 O  O   . HOH K 5 .   ? -20.650 13.914 34.772  1.00 57.79  ? 466 HOH B O   1 
HETATM 4121 O  O   . HOH K 5 .   ? -15.817 27.552 53.482  1.00 58.62  ? 467 HOH B O   1 
HETATM 4122 O  O   . HOH K 5 .   ? -5.902  -5.694 31.133  1.00 30.50  ? 468 HOH B O   1 
HETATM 4123 O  O   . HOH K 5 .   ? 11.223  32.134 55.625  1.00 42.54  ? 469 HOH B O   1 
HETATM 4124 O  O   . HOH K 5 .   ? -16.124 36.469 38.482  1.00 36.00  ? 470 HOH B O   1 
HETATM 4125 O  O   . HOH K 5 .   ? -15.415 27.245 37.882  1.00 40.94  ? 471 HOH B O   1 
HETATM 4126 O  O   . HOH K 5 .   ? -13.325 39.920 39.440  1.00 33.00  ? 472 HOH B O   1 
HETATM 4127 O  O   . HOH K 5 .   ? 5.002   5.919  40.064  1.00 38.64  ? 473 HOH B O   1 
HETATM 4128 O  O   . HOH K 5 .   ? -21.162 15.966 29.307  1.00 43.16  ? 474 HOH B O   1 
HETATM 4129 O  O   . HOH K 5 .   ? -15.555 23.694 51.417  1.00 31.40  ? 475 HOH B O   1 
HETATM 4130 O  O   . HOH K 5 .   ? -22.016 39.104 44.506  1.00 36.76  ? 476 HOH B O   1 
HETATM 4131 O  O   . HOH K 5 .   ? -20.610 27.298 41.800  1.00 66.92  ? 477 HOH B O   1 
HETATM 4132 O  O   . HOH K 5 .   ? -28.341 13.401 27.412  1.00 55.91  ? 478 HOH B O   1 
HETATM 4133 O  O   . HOH K 5 .   ? -6.572  13.072 18.399  1.00 38.63  ? 479 HOH B O   1 
HETATM 4134 O  O   . HOH K 5 .   ? 5.843   12.598 45.164  1.00 39.33  ? 480 HOH B O   1 
HETATM 4135 O  O   . HOH K 5 .   ? -4.169  23.810 18.993  1.00 22.73  ? 481 HOH B O   1 
HETATM 4136 O  O   . HOH K 5 .   ? 6.260   30.297 39.434  1.00 40.38  ? 482 HOH B O   1 
HETATM 4137 O  O   . HOH K 5 .   ? -9.284  37.313 30.392  1.00 49.86  ? 483 HOH B O   1 
HETATM 4138 O  O   . HOH K 5 .   ? -23.485 18.531 32.454  1.00 53.50  ? 484 HOH B O   1 
HETATM 4139 O  O   . HOH K 5 .   ? -14.269 1.326  47.529  1.00 38.65  ? 485 HOH B O   1 
HETATM 4140 O  O   . HOH K 5 .   ? -16.091 24.658 54.633  1.00 51.46  ? 486 HOH B O   1 
HETATM 4141 O  O   . HOH K 5 .   ? -15.176 38.941 37.221  1.00 43.40  ? 487 HOH B O   1 
HETATM 4142 O  O   . HOH K 5 .   ? 0.830   29.685 39.175  1.00 31.22  ? 488 HOH B O   1 
HETATM 4143 O  O   . HOH K 5 .   ? -15.068 27.758 46.945  1.00 35.04  ? 489 HOH B O   1 
HETATM 4144 O  O   . HOH K 5 .   ? -4.515  7.174  52.675  1.00 44.93  ? 490 HOH B O   1 
HETATM 4145 O  O   . HOH K 5 .   ? 0.942   47.278 47.628  1.00 44.41  ? 491 HOH B O   1 
HETATM 4146 O  O   . HOH K 5 .   ? -20.270 8.917  16.683  1.00 38.37  ? 492 HOH B O   1 
HETATM 4147 O  O   . HOH K 5 .   ? 1.992   2.591  41.906  1.00 44.24  ? 493 HOH B O   1 
HETATM 4148 O  O   . HOH K 5 .   ? 0.673   27.635 37.662  1.00 30.18  ? 494 HOH B O   1 
HETATM 4149 O  O   . HOH K 5 .   ? 16.326  18.733 42.718  1.00 49.90  ? 495 HOH B O   1 
HETATM 4150 O  O   . HOH K 5 .   ? -0.172  -2.691 33.550  1.00 48.48  ? 496 HOH B O   1 
HETATM 4151 O  O   . HOH K 5 .   ? -0.733  18.018 24.361  1.00 37.82  ? 497 HOH B O   1 
HETATM 4152 O  O   . HOH K 5 .   ? -18.231 18.409 40.105  1.00 38.59  ? 498 HOH B O   1 
HETATM 4153 O  O   . HOH K 5 .   ? -6.013  9.904  21.659  1.00 46.92  ? 499 HOH B O   1 
HETATM 4154 O  O   . HOH K 5 .   ? -9.100  37.350 54.594  1.00 27.13  ? 500 HOH B O   1 
HETATM 4155 O  O   . HOH K 5 .   ? 6.787   14.988 44.564  1.00 34.81  ? 501 HOH B O   1 
HETATM 4156 O  O   . HOH K 5 .   ? 2.658   12.045 54.182  1.00 51.55  ? 502 HOH B O   1 
HETATM 4157 O  O   . HOH K 5 .   ? -9.847  46.449 48.836  1.00 38.85  ? 503 HOH B O   1 
HETATM 4158 O  O   . HOH K 5 .   ? -13.747 19.392 55.501  1.00 50.72  ? 504 HOH B O   1 
HETATM 4159 O  O   . HOH K 5 .   ? -13.315 12.202 39.237  1.00 34.44  ? 505 HOH B O   1 
HETATM 4160 O  O   . HOH K 5 .   ? 7.158   6.088  26.046  1.00 41.94  ? 506 HOH B O   1 
HETATM 4161 O  O   . HOH K 5 .   ? 9.746   10.269 38.835  1.00 32.77  ? 507 HOH B O   1 
HETATM 4162 O  O   . HOH K 5 .   ? -20.394 29.610 39.666  1.00 49.94  ? 508 HOH B O   1 
HETATM 4163 O  O   . HOH K 5 .   ? -1.584  30.061 38.498  1.00 28.96  ? 509 HOH B O   1 
HETATM 4164 O  O   . HOH K 5 .   ? -16.739 34.826 53.884  1.00 40.39  ? 510 HOH B O   1 
HETATM 4165 O  O   . HOH K 5 .   ? 14.410  16.882 46.017  1.00 49.57  ? 511 HOH B O   1 
HETATM 4166 O  O   . HOH K 5 .   ? 1.171   31.504 40.659  1.00 36.11  ? 512 HOH B O   1 
HETATM 4167 O  O   . HOH K 5 .   ? -21.975 8.778  18.842  1.00 61.30  ? 513 HOH B O   1 
HETATM 4168 O  O   . HOH K 5 .   ? -0.778  44.821 48.948  1.00 51.09  ? 514 HOH B O   1 
HETATM 4169 O  O   . HOH K 5 .   ? -24.296 17.343 48.790  1.00 52.22  ? 515 HOH B O   1 
HETATM 4170 O  O   . HOH K 5 .   ? 8.103   5.732  39.843  1.00 45.34  ? 516 HOH B O   1 
HETATM 4171 O  O   . HOH K 5 .   ? -14.633 41.539 48.896  1.00 30.45  ? 517 HOH B O   1 
HETATM 4172 O  O   . HOH K 5 .   ? 3.846   5.463  45.623  1.00 36.78  ? 518 HOH B O   1 
HETATM 4173 O  O   . HOH K 5 .   ? -5.860  29.304 65.037  1.00 62.47  ? 519 HOH B O   1 
HETATM 4174 O  O   . HOH K 5 .   ? -6.050  24.623 61.468  1.00 58.28  ? 520 HOH B O   1 
HETATM 4175 O  O   . HOH K 5 .   ? -12.520 18.856 48.244  1.00 28.56  ? 521 HOH B O   1 
HETATM 4176 O  O   . HOH K 5 .   ? 9.809   6.654  34.274  1.00 50.68  ? 522 HOH B O   1 
HETATM 4177 O  O   . HOH K 5 .   ? -6.232  28.958 59.840  1.00 52.89  ? 523 HOH B O   1 
HETATM 4178 O  O   . HOH K 5 .   ? 10.199  10.276 41.443  1.00 51.74  ? 524 HOH B O   1 
HETATM 4179 O  O   . HOH K 5 .   ? -6.697  38.882 51.495  1.00 40.44  ? 525 HOH B O   1 
HETATM 4180 O  O   . HOH K 5 .   ? -25.305 18.802 47.126  1.00 47.92  ? 526 HOH B O   1 
HETATM 4181 O  O   . HOH K 5 .   ? 2.764   45.569 46.403  1.00 53.69  ? 527 HOH B O   1 
HETATM 4182 O  O   . HOH K 5 .   ? -5.964  36.411 22.580  1.00 55.32  ? 528 HOH B O   1 
HETATM 4183 O  O   . HOH K 5 .   ? 3.015   1.003  32.344  1.00 44.46  ? 529 HOH B O   1 
HETATM 4184 O  O   . HOH K 5 .   ? -9.551  -5.004 33.546  1.00 54.97  ? 530 HOH B O   1 
HETATM 4185 O  O   . HOH K 5 .   ? -16.843 16.718 20.041  1.00 50.08  ? 531 HOH B O   1 
HETATM 4186 O  O   . HOH K 5 .   ? -16.597 34.192 36.583  1.00 46.61  ? 532 HOH B O   1 
HETATM 4187 O  O   . HOH K 5 .   ? -5.691  36.656 33.574  1.00 39.24  ? 533 HOH B O   1 
HETATM 4188 O  O   . HOH K 5 .   ? 20.195  22.988 60.341  1.00 48.74  ? 534 HOH B O   1 
HETATM 4189 O  O   . HOH K 5 .   ? -5.597  16.524 20.220  1.00 35.82  ? 535 HOH B O   1 
HETATM 4190 O  O   . HOH K 5 .   ? -11.334 8.746  28.063  0.50 30.25  ? 536 HOH B O   1 
HETATM 4191 O  O   . HOH K 5 .   ? -4.336  16.320 17.683  1.00 42.96  ? 537 HOH B O   1 
HETATM 4192 O  O   . HOH K 5 .   ? 1.360   9.577  44.205  1.00 42.57  ? 538 HOH B O   1 
HETATM 4193 O  O   . HOH K 5 .   ? -10.716 48.405 44.592  1.00 56.43  ? 539 HOH B O   1 
HETATM 4194 O  O   . HOH K 5 .   ? -5.975  34.399 55.122  1.00 43.37  ? 540 HOH B O   1 
HETATM 4195 O  O   . HOH K 5 .   ? -13.104 24.824 57.401  1.00 63.64  ? 541 HOH B O   1 
HETATM 4196 O  O   . HOH K 5 .   ? -22.048 22.812 17.289  1.00 54.72  ? 542 HOH B O   1 
HETATM 4197 O  O   . HOH K 5 .   ? 6.055   37.325 55.332  1.00 50.94  ? 543 HOH B O   1 
HETATM 4198 O  O   . HOH K 5 .   ? 8.449   20.996 32.462  1.00 52.22  ? 544 HOH B O   1 
HETATM 4199 O  O   . HOH K 5 .   ? 5.006   17.642 30.185  1.00 29.36  ? 545 HOH B O   1 
HETATM 4200 O  O   . HOH K 5 .   ? -1.927  29.825 30.880  1.00 39.51  ? 546 HOH B O   1 
HETATM 4201 O  O   . HOH K 5 .   ? 10.303  26.715 35.425  1.00 44.59  ? 547 HOH B O   1 
HETATM 4202 O  O   . HOH K 5 .   ? 1.771   28.352 59.490  1.00 34.98  ? 548 HOH B O   1 
HETATM 4203 O  O   . HOH K 5 .   ? 5.184   3.755  26.254  1.00 42.07  ? 549 HOH B O   1 
HETATM 4204 O  O   . HOH K 5 .   ? 7.351   19.556 33.854  1.00 48.80  ? 550 HOH B O   1 
HETATM 4205 O  O   . HOH K 5 .   ? -8.476  26.581 34.006  1.00 22.11  ? 551 HOH B O   1 
HETATM 4206 O  O   . HOH K 5 .   ? -0.830  10.596 46.220  1.00 38.22  ? 552 HOH B O   1 
HETATM 4207 O  O   . HOH K 5 .   ? 0.634   32.423 32.099  1.00 45.87  ? 553 HOH B O   1 
HETATM 4208 O  O   . HOH K 5 .   ? 11.506  13.472 35.846  1.00 43.77  ? 554 HOH B O   1 
HETATM 4209 O  O   . HOH K 5 .   ? -0.009  31.140 30.200  1.00 31.52  ? 555 HOH B O   1 
HETATM 4210 O  O   . HOH K 5 .   ? -3.788  28.797 29.282  1.00 34.95  ? 556 HOH B O   1 
HETATM 4211 O  O   . HOH K 5 .   ? -7.941  27.916 31.394  1.00 35.30  ? 557 HOH B O   1 
HETATM 4212 O  O   . HOH K 5 .   ? 10.628  10.893 33.826  1.00 44.67  ? 558 HOH B O   1 
HETATM 4213 O  O   . HOH K 5 .   ? -22.718 11.237 20.337  1.00 48.42  ? 559 HOH B O   1 
HETATM 4214 O  O   . HOH K 5 .   ? -12.213 13.548 53.657  1.00 58.82  ? 560 HOH B O   1 
HETATM 4215 O  O   . HOH K 5 .   ? -4.691  18.630 20.534  1.00 41.14  ? 561 HOH B O   1 
HETATM 4216 O  O   . HOH K 5 .   ? 20.841  20.893 39.663  1.00 61.54  ? 562 HOH B O   1 
HETATM 4217 O  O   . HOH K 5 .   ? -5.963  26.899 34.696  1.00 32.52  ? 563 HOH B O   1 
HETATM 4218 O  O   . HOH K 5 .   ? -14.771 10.877 52.738  1.00 55.95  ? 564 HOH B O   1 
HETATM 4219 O  O   . HOH K 5 .   ? 12.973  19.878 36.691  1.00 48.77  ? 565 HOH B O   1 
HETATM 4220 O  O   . HOH K 5 .   ? 13.602  21.079 38.975  1.00 59.18  ? 566 HOH B O   1 
HETATM 4221 O  O   . HOH K 5 .   ? -16.139 30.113 33.556  1.00 52.80  ? 567 HOH B O   1 
HETATM 4222 O  O   . HOH K 5 .   ? -3.640  30.053 33.577  1.00 34.55  ? 568 HOH B O   1 
HETATM 4223 O  O   . HOH K 5 .   ? -4.487  22.858 49.967  1.00 29.02  ? 569 HOH B O   1 
HETATM 4224 O  O   . HOH K 5 .   ? 2.389   12.454 49.321  1.00 51.64  ? 570 HOH B O   1 
HETATM 4225 O  O   . HOH K 5 .   ? -10.159 -4.068 36.971  1.00 35.03  ? 571 HOH B O   1 
HETATM 4226 O  O   . HOH K 5 .   ? 20.869  23.742 43.107  1.00 48.39  ? 572 HOH B O   1 
HETATM 4227 O  O   . HOH K 5 .   ? 14.167  16.597 39.037  1.00 54.79  ? 573 HOH B O   1 
HETATM 4228 O  O   . HOH K 5 .   ? -2.426  13.390 46.192  1.00 29.17  ? 574 HOH B O   1 
HETATM 4229 O  O   . HOH K 5 .   ? -5.812  15.988 45.576  1.00 25.56  ? 575 HOH B O   1 
HETATM 4230 O  O   . HOH K 5 .   ? -3.413  15.461 44.466  1.00 26.05  ? 576 HOH B O   1 
HETATM 4231 O  O   . HOH K 5 .   ? -2.139  8.871  45.303  1.00 26.52  ? 577 HOH B O   1 
HETATM 4232 O  O   . HOH K 5 .   ? -4.977  10.693 47.274  1.00 28.16  ? 578 HOH B O   1 
HETATM 4233 O  O   . HOH K 5 .   ? -11.725 -5.258 26.230  1.00 41.87  ? 579 HOH B O   1 
HETATM 4234 O  O   . HOH K 5 .   ? -11.715 40.891 16.233  1.00 62.78  ? 580 HOH B O   1 
HETATM 4235 O  O   . HOH K 5 .   ? -10.024 -3.333 25.912  1.00 42.14  ? 581 HOH B O   1 
HETATM 4236 O  O   . HOH K 5 .   ? 6.159   27.113 57.720  1.00 52.48  ? 582 HOH B O   1 
HETATM 4237 O  O   . HOH K 5 .   ? -5.802  38.091 57.428  1.00 58.44  ? 583 HOH B O   1 
HETATM 4238 O  O   . HOH K 5 .   ? -11.729 33.855 27.543  1.00 53.72  ? 584 HOH B O   1 
HETATM 4239 O  O   . HOH K 5 .   ? 18.451  20.317 46.007  1.00 58.78  ? 585 HOH B O   1 
HETATM 4240 O  O   . HOH K 5 .   ? 1.462   15.681 56.503  1.00 38.17  ? 586 HOH B O   1 
HETATM 4241 O  O   . HOH K 5 .   ? -13.946 14.132 11.516  1.00 57.31  ? 587 HOH B O   1 
HETATM 4242 O  O   . HOH K 5 .   ? -11.553 39.822 46.390  1.00 34.09  ? 588 HOH B O   1 
HETATM 4243 O  O   . HOH K 5 .   ? -13.081 13.797 47.821  1.00 41.87  ? 589 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   19  ?   ?   ?   A . n 
A 1 2   SER 2   20  ?   ?   ?   A . n 
A 1 3   LYS 3   21  ?   ?   ?   A . n 
A 1 4   PRO 4   22  ?   ?   ?   A . n 
A 1 5   LYS 5   23  ?   ?   ?   A . n 
A 1 6   GLN 6   24  ?   ?   ?   A . n 
A 1 7   PRO 7   25  ?   ?   ?   A . n 
A 1 8   PRO 8   26  ?   ?   ?   A . n 
A 1 9   ASP 9   27  27  ASP ASP A . n 
A 1 10  ALA 10  28  28  ALA ALA A . n 
A 1 11  SER 11  29  ?   ?   ?   A . n 
A 1 12  PRO 12  30  30  PRO PRO A . n 
A 1 13  ALA 13  31  31  ALA ALA A . n 
A 1 14  ASN 14  32  32  ASN ASN A . n 
A 1 15  LEU 15  33  33  LEU LEU A . n 
A 1 16  LEU 16  34  34  LEU LEU A . n 
A 1 17  THR 17  35  35  THR THR A . n 
A 1 18  SER 18  36  36  SER SER A . n 
A 1 19  LEU 19  37  37  LEU LEU A . n 
A 1 20  VAL 20  38  38  VAL VAL A . n 
A 1 21  ARG 21  39  39  ARG ARG A . n 
A 1 22  ALA 22  40  40  ALA ALA A . n 
A 1 23  HIS 23  41  41  HIS HIS A . n 
A 1 24  LEU 24  42  42  LEU LEU A . n 
A 1 25  ASP 25  43  43  ASP ASP A . n 
A 1 26  SER 26  44  44  SER SER A . n 
A 1 27  GLY 27  45  45  GLY GLY A . n 
A 1 28  PRO 28  46  46  PRO PRO A . n 
A 1 29  SER 29  47  47  SER SER A . n 
A 1 30  THR 30  48  48  THR THR A . n 
A 1 31  ALA 31  49  49  ALA ALA A . n 
A 1 32  LYS 32  50  50  LYS LYS A . n 
A 1 33  LEU 33  51  51  LEU LEU A . n 
A 1 34  ASP 34  52  52  ASP ASP A . n 
A 1 35  TYR 35  53  53  TYR TYR A . n 
A 1 36  SER 36  54  54  SER SER A . n 
A 1 37  LYS 37  55  55  LYS LYS A . n 
A 1 38  PHE 38  56  56  PHE PHE A . n 
A 1 39  GLN 39  57  57  GLN GLN A . n 
A 1 40  GLU 40  58  58  GLU GLU A . n 
A 1 41  LEU 41  59  59  LEU LEU A . n 
A 1 42  VAL 42  60  60  VAL VAL A . n 
A 1 43  LEU 43  61  61  LEU LEU A . n 
A 1 44  PRO 44  62  62  PRO PRO A . n 
A 1 45  HIS 45  63  63  HIS HIS A . n 
A 1 46  PHE 46  64  64  PHE PHE A . n 
A 1 47  GLY 47  65  65  GLY GLY A . n 
A 1 48  LYS 48  66  66  LYS LYS A . n 
A 1 49  GLU 49  67  67  GLU GLU A . n 
A 1 50  ASP 50  68  68  ASP ASP A . n 
A 1 51  ALA 51  69  69  ALA ALA A . n 
A 1 52  GLY 52  70  70  GLY GLY A . n 
A 1 53  ASP 53  71  71  ASP ASP A . n 
A 1 54  VAL 54  72  72  VAL VAL A . n 
A 1 55  GLN 55  73  73  GLN GLN A . n 
A 1 56  GLN 56  74  74  GLN GLN A . n 
A 1 57  PHE 57  75  75  PHE PHE A . n 
A 1 58  TYR 58  76  76  TYR TYR A . n 
A 1 59  ASP 59  77  77  ASP ASP A . n 
A 1 60  LEU 60  78  78  LEU LEU A . n 
A 1 61  LEU 61  79  79  LEU LEU A . n 
A 1 62  SER 62  80  80  SER SER A . n 
A 1 63  GLY 63  81  81  GLY GLY A . n 
A 1 64  SER 64  82  82  SER SER A . n 
A 1 65  LEU 65  83  83  LEU LEU A . n 
A 1 66  GLU 66  84  84  GLU GLU A . n 
A 1 67  VAL 67  85  85  VAL VAL A . n 
A 1 68  ILE 68  86  86  ILE ILE A . n 
A 1 69  ARG 69  87  87  ARG ARG A . n 
A 1 70  LYS 70  88  88  LYS LYS A . n 
A 1 71  TRP 71  89  89  TRP TRP A . n 
A 1 72  ALA 72  90  90  ALA ALA A . n 
A 1 73  GLU 73  91  91  GLU GLU A . n 
A 1 74  LYS 74  92  92  LYS LYS A . n 
A 1 75  ILE 75  93  93  ILE ILE A . n 
A 1 76  PRO 76  94  94  PRO PRO A . n 
A 1 77  GLY 77  95  95  GLY GLY A . n 
A 1 78  PHE 78  96  96  PHE PHE A . n 
A 1 79  ALA 79  97  97  ALA ALA A . n 
A 1 80  GLU 80  98  98  GLU GLU A . n 
A 1 81  LEU 81  99  99  LEU LEU A . n 
A 1 82  SER 82  100 100 SER SER A . n 
A 1 83  PRO 83  101 101 PRO PRO A . n 
A 1 84  ALA 84  102 102 ALA ALA A . n 
A 1 85  ASP 85  103 103 ASP ASP A . n 
A 1 86  GLN 86  104 104 GLN GLN A . n 
A 1 87  ASP 87  105 105 ASP ASP A . n 
A 1 88  LEU 88  106 106 LEU LEU A . n 
A 1 89  LEU 89  107 107 LEU LEU A . n 
A 1 90  LEU 90  108 108 LEU LEU A . n 
A 1 91  GLU 91  109 109 GLU GLU A . n 
A 1 92  SER 92  110 110 SER SER A . n 
A 1 93  ALA 93  111 111 ALA ALA A . n 
A 1 94  PHE 94  112 112 PHE PHE A . n 
A 1 95  LEU 95  113 113 LEU LEU A . n 
A 1 96  GLU 96  114 114 GLU GLU A . n 
A 1 97  LEU 97  115 115 LEU LEU A . n 
A 1 98  PHE 98  116 116 PHE PHE A . n 
A 1 99  ILE 99  117 117 ILE ILE A . n 
A 1 100 LEU 100 118 118 LEU LEU A . n 
A 1 101 ARG 101 119 119 ARG ARG A . n 
A 1 102 LEU 102 120 120 LEU LEU A . n 
A 1 103 ALA 103 121 121 ALA ALA A . n 
A 1 104 TYR 104 122 122 TYR TYR A . n 
A 1 105 ARG 105 123 123 ARG ARG A . n 
A 1 106 SER 106 124 124 SER SER A . n 
A 1 107 LYS 107 125 125 LYS LYS A . n 
A 1 108 PRO 108 126 126 PRO PRO A . n 
A 1 109 GLY 109 127 127 GLY GLY A . n 
A 1 110 GLU 110 128 128 GLU GLU A . n 
A 1 111 GLY 111 129 129 GLY GLY A . n 
A 1 112 LYS 112 130 130 LYS LYS A . n 
A 1 113 LEU 113 131 131 LEU LEU A . n 
A 1 114 ILE 114 132 132 ILE ILE A . n 
A 1 115 PHE 115 133 133 PHE PHE A . n 
A 1 116 CYS 116 134 134 CYS CYS A . n 
A 1 117 SER 117 135 135 SER SER A . n 
A 1 118 GLY 118 136 136 GLY GLY A . n 
A 1 119 LEU 119 137 137 LEU LEU A . n 
A 1 120 VAL 120 138 138 VAL VAL A . n 
A 1 121 LEU 121 139 139 LEU LEU A . n 
A 1 122 HIS 122 140 140 HIS HIS A . n 
A 1 123 ARG 123 141 141 ARG ARG A . n 
A 1 124 LEU 124 142 142 LEU LEU A . n 
A 1 125 GLN 125 143 143 GLN GLN A . n 
A 1 126 CYS 126 144 144 CYS CYS A . n 
A 1 127 ALA 127 145 145 ALA ALA A . n 
A 1 128 ARG 128 146 146 ARG ARG A . n 
A 1 129 GLY 129 147 147 GLY GLY A . n 
A 1 130 PHE 130 148 148 PHE PHE A . n 
A 1 131 GLY 131 149 149 GLY GLY A . n 
A 1 132 ASP 132 150 150 ASP ASP A . n 
A 1 133 TRP 133 151 151 TRP TRP A . n 
A 1 134 ILE 134 152 152 ILE ILE A . n 
A 1 135 ASP 135 153 153 ASP ASP A . n 
A 1 136 SER 136 154 154 SER SER A . n 
A 1 137 ILE 137 155 155 ILE ILE A . n 
A 1 138 LEU 138 156 156 LEU LEU A . n 
A 1 139 ALA 139 157 157 ALA ALA A . n 
A 1 140 PHE 140 158 158 PHE PHE A . n 
A 1 141 SER 141 159 159 SER SER A . n 
A 1 142 ARG 142 160 160 ARG ARG A . n 
A 1 143 SER 143 161 161 SER SER A . n 
A 1 144 LEU 144 162 162 LEU LEU A . n 
A 1 145 HIS 145 163 163 HIS HIS A . n 
A 1 146 SER 146 164 164 SER SER A . n 
A 1 147 LEU 147 165 165 LEU LEU A . n 
A 1 148 LEU 148 166 166 LEU LEU A . n 
A 1 149 VAL 149 167 167 VAL VAL A . n 
A 1 150 ASP 150 168 168 ASP ASP A . n 
A 1 151 VAL 151 169 169 VAL VAL A . n 
A 1 152 PRO 152 170 170 PRO PRO A . n 
A 1 153 ALA 153 171 171 ALA ALA A . n 
A 1 154 PHE 154 172 172 PHE PHE A . n 
A 1 155 ALA 155 173 173 ALA ALA A . n 
A 1 156 CYS 156 174 174 CYS CYS A . n 
A 1 157 LEU 157 175 175 LEU LEU A . n 
A 1 158 SER 158 176 176 SER SER A . n 
A 1 159 ALA 159 177 177 ALA ALA A . n 
A 1 160 LEU 160 178 178 LEU LEU A . n 
A 1 161 VAL 161 179 179 VAL VAL A . n 
A 1 162 LEU 162 180 180 LEU LEU A . n 
A 1 163 ILE 163 181 181 ILE ILE A . n 
A 1 164 THR 164 182 182 THR THR A . n 
A 1 165 ASP 165 183 183 ASP ASP A . n 
A 1 166 ARG 166 184 184 ARG ARG A . n 
A 1 167 HIS 167 185 185 HIS HIS A . n 
A 1 168 GLY 168 186 186 GLY GLY A . n 
A 1 169 LEU 169 187 187 LEU LEU A . n 
A 1 170 GLN 170 188 188 GLN GLN A . n 
A 1 171 GLU 171 189 189 GLU GLU A . n 
A 1 172 PRO 172 190 190 PRO PRO A . n 
A 1 173 ARG 173 191 191 ARG ARG A . n 
A 1 174 ARG 174 192 192 ARG ARG A . n 
A 1 175 VAL 175 193 193 VAL VAL A . n 
A 1 176 GLU 176 194 194 GLU GLU A . n 
A 1 177 GLU 177 195 195 GLU GLU A . n 
A 1 178 LEU 178 196 196 LEU LEU A . n 
A 1 179 GLN 179 197 197 GLN GLN A . n 
A 1 180 ASN 180 198 198 ASN ASN A . n 
A 1 181 ARG 181 199 199 ARG ARG A . n 
A 1 182 ILE 182 200 200 ILE ILE A . n 
A 1 183 ALA 183 201 201 ALA ALA A . n 
A 1 184 SER 184 202 202 SER SER A . n 
A 1 185 CYS 185 203 203 CYS CYS A . n 
A 1 186 LEU 186 204 204 LEU LEU A . n 
A 1 187 LYS 187 205 205 LYS LYS A . n 
A 1 188 GLU 188 206 206 GLU GLU A . n 
A 1 189 HIS 189 207 207 HIS HIS A . n 
A 1 190 VAL 190 208 208 VAL VAL A . n 
A 1 191 ALA 191 209 209 ALA ALA A . n 
A 1 192 ALA 192 210 210 ALA ALA A . n 
A 1 193 VAL 193 211 211 VAL VAL A . n 
A 1 194 ALA 194 212 212 ALA ALA A . n 
A 1 195 GLY 195 213 ?   ?   ?   A . n 
A 1 196 GLU 196 214 ?   ?   ?   A . n 
A 1 197 PRO 197 215 ?   ?   ?   A . n 
A 1 198 GLN 198 216 ?   ?   ?   A . n 
A 1 199 PRO 199 217 217 PRO PRO A . n 
A 1 200 ALA 200 218 218 ALA ALA A . n 
A 1 201 SER 201 219 219 SER SER A . n 
A 1 202 CYS 202 220 220 CYS CYS A . n 
A 1 203 LEU 203 221 221 LEU LEU A . n 
A 1 204 SER 204 222 222 SER SER A . n 
A 1 205 ARG 205 223 223 ARG ARG A . n 
A 1 206 LEU 206 224 224 LEU LEU A . n 
A 1 207 LEU 207 225 225 LEU LEU A . n 
A 1 208 GLY 208 226 226 GLY GLY A . n 
A 1 209 LYS 209 227 227 LYS LYS A . n 
A 1 210 LEU 210 228 228 LEU LEU A . n 
A 1 211 PRO 211 229 229 PRO PRO A . n 
A 1 212 GLU 212 230 230 GLU GLU A . n 
A 1 213 LEU 213 231 231 LEU LEU A . n 
A 1 214 ARG 214 232 232 ARG ARG A . n 
A 1 215 THR 215 233 233 THR THR A . n 
A 1 216 LEU 216 234 234 LEU LEU A . n 
A 1 217 CYS 217 235 235 CYS CYS A . n 
A 1 218 THR 218 236 236 THR THR A . n 
A 1 219 GLN 219 237 237 GLN GLN A . n 
A 1 220 GLY 220 238 238 GLY GLY A . n 
A 1 221 LEU 221 239 239 LEU LEU A . n 
A 1 222 GLN 222 240 240 GLN GLN A . n 
A 1 223 ARG 223 241 241 ARG ARG A . n 
A 1 224 ILE 224 242 242 ILE ILE A . n 
A 1 225 PHE 225 243 243 PHE PHE A . n 
A 1 226 TYR 226 244 244 TYR TYR A . n 
A 1 227 LEU 227 245 245 LEU LEU A . n 
A 1 228 LYS 228 246 246 LYS LYS A . n 
A 1 229 LEU 229 247 247 LEU LEU A . n 
A 1 230 GLU 230 248 248 GLU GLU A . n 
A 1 231 ASP 231 249 249 ASP ASP A . n 
A 1 232 LEU 232 250 250 LEU LEU A . n 
A 1 233 VAL 233 251 251 VAL VAL A . n 
A 1 234 PRO 234 252 252 PRO PRO A . n 
A 1 235 PRO 235 253 253 PRO PRO A . n 
A 1 236 PRO 236 254 254 PRO PRO A . n 
A 1 237 PRO 237 255 255 PRO PRO A . n 
A 1 238 ILE 238 256 256 ILE ILE A . n 
A 1 239 ILE 239 257 257 ILE ILE A . n 
A 1 240 ASP 240 258 258 ASP ASP A . n 
A 1 241 LYS 241 259 259 LYS LYS A . n 
A 1 242 ILE 242 260 260 ILE ILE A . n 
A 1 243 PHE 243 261 261 PHE PHE A . n 
A 1 244 MET 244 262 262 MET MET A . n 
A 1 245 ASP 245 263 263 ASP ASP A . n 
A 1 246 THR 246 264 264 THR THR A . n 
A 1 247 LEU 247 265 265 LEU LEU A . n 
A 1 248 PRO 248 266 266 PRO PRO A . n 
A 1 249 PHE 249 267 267 PHE PHE A . n 
A 1 250 LEU 250 268 268 LEU LEU A . n 
A 1 251 GLU 251 269 ?   ?   ?   A . n 
A 1 252 HIS 252 270 ?   ?   ?   A . n 
A 1 253 HIS 253 271 ?   ?   ?   A . n 
A 1 254 HIS 254 272 ?   ?   ?   A . n 
A 1 255 HIS 255 273 ?   ?   ?   A . n 
A 1 256 HIS 256 274 ?   ?   ?   A . n 
A 1 257 HIS 257 275 ?   ?   ?   A . n 
B 1 1   MET 1   19  ?   ?   ?   B . n 
B 1 2   SER 2   20  ?   ?   ?   B . n 
B 1 3   LYS 3   21  ?   ?   ?   B . n 
B 1 4   PRO 4   22  ?   ?   ?   B . n 
B 1 5   LYS 5   23  ?   ?   ?   B . n 
B 1 6   GLN 6   24  ?   ?   ?   B . n 
B 1 7   PRO 7   25  ?   ?   ?   B . n 
B 1 8   PRO 8   26  ?   ?   ?   B . n 
B 1 9   ASP 9   27  ?   ?   ?   B . n 
B 1 10  ALA 10  28  ?   ?   ?   B . n 
B 1 11  SER 11  29  ?   ?   ?   B . n 
B 1 12  PRO 12  30  30  PRO PRO B . n 
B 1 13  ALA 13  31  31  ALA ALA B . n 
B 1 14  ASN 14  32  32  ASN ASN B . n 
B 1 15  LEU 15  33  33  LEU LEU B . n 
B 1 16  LEU 16  34  34  LEU LEU B . n 
B 1 17  THR 17  35  35  THR THR B . n 
B 1 18  SER 18  36  36  SER SER B . n 
B 1 19  LEU 19  37  37  LEU LEU B . n 
B 1 20  VAL 20  38  38  VAL VAL B . n 
B 1 21  ARG 21  39  39  ARG ARG B . n 
B 1 22  ALA 22  40  40  ALA ALA B . n 
B 1 23  HIS 23  41  41  HIS HIS B . n 
B 1 24  LEU 24  42  42  LEU LEU B . n 
B 1 25  ASP 25  43  43  ASP ASP B . n 
B 1 26  SER 26  44  44  SER SER B . n 
B 1 27  GLY 27  45  45  GLY GLY B . n 
B 1 28  PRO 28  46  46  PRO PRO B . n 
B 1 29  SER 29  47  47  SER SER B . n 
B 1 30  THR 30  48  48  THR THR B . n 
B 1 31  ALA 31  49  49  ALA ALA B . n 
B 1 32  LYS 32  50  50  LYS LYS B . n 
B 1 33  LEU 33  51  51  LEU LEU B . n 
B 1 34  ASP 34  52  52  ASP ASP B . n 
B 1 35  TYR 35  53  53  TYR TYR B . n 
B 1 36  SER 36  54  54  SER SER B . n 
B 1 37  LYS 37  55  55  LYS LYS B . n 
B 1 38  PHE 38  56  56  PHE PHE B . n 
B 1 39  GLN 39  57  57  GLN GLN B . n 
B 1 40  GLU 40  58  58  GLU GLU B . n 
B 1 41  LEU 41  59  59  LEU LEU B . n 
B 1 42  VAL 42  60  60  VAL VAL B . n 
B 1 43  LEU 43  61  61  LEU LEU B . n 
B 1 44  PRO 44  62  62  PRO PRO B . n 
B 1 45  HIS 45  63  63  HIS HIS B . n 
B 1 46  PHE 46  64  64  PHE PHE B . n 
B 1 47  GLY 47  65  65  GLY GLY B . n 
B 1 48  LYS 48  66  66  LYS LYS B . n 
B 1 49  GLU 49  67  67  GLU GLU B . n 
B 1 50  ASP 50  68  68  ASP ASP B . n 
B 1 51  ALA 51  69  69  ALA ALA B . n 
B 1 52  GLY 52  70  70  GLY GLY B . n 
B 1 53  ASP 53  71  71  ASP ASP B . n 
B 1 54  VAL 54  72  72  VAL VAL B . n 
B 1 55  GLN 55  73  73  GLN GLN B . n 
B 1 56  GLN 56  74  74  GLN GLN B . n 
B 1 57  PHE 57  75  75  PHE PHE B . n 
B 1 58  TYR 58  76  76  TYR TYR B . n 
B 1 59  ASP 59  77  77  ASP ASP B . n 
B 1 60  LEU 60  78  78  LEU LEU B . n 
B 1 61  LEU 61  79  79  LEU LEU B . n 
B 1 62  SER 62  80  80  SER SER B . n 
B 1 63  GLY 63  81  81  GLY GLY B . n 
B 1 64  SER 64  82  82  SER SER B . n 
B 1 65  LEU 65  83  83  LEU LEU B . n 
B 1 66  GLU 66  84  84  GLU GLU B . n 
B 1 67  VAL 67  85  85  VAL VAL B . n 
B 1 68  ILE 68  86  86  ILE ILE B . n 
B 1 69  ARG 69  87  87  ARG ARG B . n 
B 1 70  LYS 70  88  88  LYS LYS B . n 
B 1 71  TRP 71  89  89  TRP TRP B . n 
B 1 72  ALA 72  90  90  ALA ALA B . n 
B 1 73  GLU 73  91  91  GLU GLU B . n 
B 1 74  LYS 74  92  92  LYS LYS B . n 
B 1 75  ILE 75  93  93  ILE ILE B . n 
B 1 76  PRO 76  94  94  PRO PRO B . n 
B 1 77  GLY 77  95  95  GLY GLY B . n 
B 1 78  PHE 78  96  96  PHE PHE B . n 
B 1 79  ALA 79  97  97  ALA ALA B . n 
B 1 80  GLU 80  98  98  GLU GLU B . n 
B 1 81  LEU 81  99  99  LEU LEU B . n 
B 1 82  SER 82  100 100 SER SER B . n 
B 1 83  PRO 83  101 101 PRO PRO B . n 
B 1 84  ALA 84  102 102 ALA ALA B . n 
B 1 85  ASP 85  103 103 ASP ASP B . n 
B 1 86  GLN 86  104 104 GLN GLN B . n 
B 1 87  ASP 87  105 105 ASP ASP B . n 
B 1 88  LEU 88  106 106 LEU LEU B . n 
B 1 89  LEU 89  107 107 LEU LEU B . n 
B 1 90  LEU 90  108 108 LEU LEU B . n 
B 1 91  GLU 91  109 109 GLU GLU B . n 
B 1 92  SER 92  110 110 SER SER B . n 
B 1 93  ALA 93  111 111 ALA ALA B . n 
B 1 94  PHE 94  112 112 PHE PHE B . n 
B 1 95  LEU 95  113 113 LEU LEU B . n 
B 1 96  GLU 96  114 114 GLU GLU B . n 
B 1 97  LEU 97  115 115 LEU LEU B . n 
B 1 98  PHE 98  116 116 PHE PHE B . n 
B 1 99  ILE 99  117 117 ILE ILE B . n 
B 1 100 LEU 100 118 118 LEU LEU B . n 
B 1 101 ARG 101 119 119 ARG ARG B . n 
B 1 102 LEU 102 120 120 LEU LEU B . n 
B 1 103 ALA 103 121 121 ALA ALA B . n 
B 1 104 TYR 104 122 122 TYR TYR B . n 
B 1 105 ARG 105 123 123 ARG ARG B . n 
B 1 106 SER 106 124 124 SER SER B . n 
B 1 107 LYS 107 125 125 LYS LYS B . n 
B 1 108 PRO 108 126 126 PRO PRO B . n 
B 1 109 GLY 109 127 127 GLY GLY B . n 
B 1 110 GLU 110 128 128 GLU GLU B . n 
B 1 111 GLY 111 129 129 GLY GLY B . n 
B 1 112 LYS 112 130 130 LYS LYS B . n 
B 1 113 LEU 113 131 131 LEU LEU B . n 
B 1 114 ILE 114 132 132 ILE ILE B . n 
B 1 115 PHE 115 133 133 PHE PHE B . n 
B 1 116 CYS 116 134 134 CYS CYS B . n 
B 1 117 SER 117 135 135 SER SER B . n 
B 1 118 GLY 118 136 136 GLY GLY B . n 
B 1 119 LEU 119 137 137 LEU LEU B . n 
B 1 120 VAL 120 138 138 VAL VAL B . n 
B 1 121 LEU 121 139 139 LEU LEU B . n 
B 1 122 HIS 122 140 140 HIS HIS B . n 
B 1 123 ARG 123 141 141 ARG ARG B . n 
B 1 124 LEU 124 142 142 LEU LEU B . n 
B 1 125 GLN 125 143 143 GLN GLN B . n 
B 1 126 CYS 126 144 144 CYS CYS B . n 
B 1 127 ALA 127 145 145 ALA ALA B . n 
B 1 128 ARG 128 146 146 ARG ARG B . n 
B 1 129 GLY 129 147 147 GLY GLY B . n 
B 1 130 PHE 130 148 148 PHE PHE B . n 
B 1 131 GLY 131 149 149 GLY GLY B . n 
B 1 132 ASP 132 150 150 ASP ASP B . n 
B 1 133 TRP 133 151 151 TRP TRP B . n 
B 1 134 ILE 134 152 152 ILE ILE B . n 
B 1 135 ASP 135 153 153 ASP ASP B . n 
B 1 136 SER 136 154 154 SER SER B . n 
B 1 137 ILE 137 155 155 ILE ILE B . n 
B 1 138 LEU 138 156 156 LEU LEU B . n 
B 1 139 ALA 139 157 157 ALA ALA B . n 
B 1 140 PHE 140 158 158 PHE PHE B . n 
B 1 141 SER 141 159 159 SER SER B . n 
B 1 142 ARG 142 160 160 ARG ARG B . n 
B 1 143 SER 143 161 161 SER SER B . n 
B 1 144 LEU 144 162 162 LEU LEU B . n 
B 1 145 HIS 145 163 163 HIS HIS B . n 
B 1 146 SER 146 164 164 SER SER B . n 
B 1 147 LEU 147 165 165 LEU LEU B . n 
B 1 148 LEU 148 166 166 LEU LEU B . n 
B 1 149 VAL 149 167 167 VAL VAL B . n 
B 1 150 ASP 150 168 168 ASP ASP B . n 
B 1 151 VAL 151 169 169 VAL VAL B . n 
B 1 152 PRO 152 170 170 PRO PRO B . n 
B 1 153 ALA 153 171 171 ALA ALA B . n 
B 1 154 PHE 154 172 172 PHE PHE B . n 
B 1 155 ALA 155 173 173 ALA ALA B . n 
B 1 156 CYS 156 174 174 CYS CYS B . n 
B 1 157 LEU 157 175 175 LEU LEU B . n 
B 1 158 SER 158 176 176 SER SER B . n 
B 1 159 ALA 159 177 177 ALA ALA B . n 
B 1 160 LEU 160 178 178 LEU LEU B . n 
B 1 161 VAL 161 179 179 VAL VAL B . n 
B 1 162 LEU 162 180 180 LEU LEU B . n 
B 1 163 ILE 163 181 181 ILE ILE B . n 
B 1 164 THR 164 182 182 THR THR B . n 
B 1 165 ASP 165 183 183 ASP ASP B . n 
B 1 166 ARG 166 184 184 ARG ARG B . n 
B 1 167 HIS 167 185 185 HIS HIS B . n 
B 1 168 GLY 168 186 186 GLY GLY B . n 
B 1 169 LEU 169 187 187 LEU LEU B . n 
B 1 170 GLN 170 188 188 GLN GLN B . n 
B 1 171 GLU 171 189 189 GLU GLU B . n 
B 1 172 PRO 172 190 190 PRO PRO B . n 
B 1 173 ARG 173 191 191 ARG ARG B . n 
B 1 174 ARG 174 192 192 ARG ARG B . n 
B 1 175 VAL 175 193 193 VAL VAL B . n 
B 1 176 GLU 176 194 194 GLU GLU B . n 
B 1 177 GLU 177 195 195 GLU GLU B . n 
B 1 178 LEU 178 196 196 LEU LEU B . n 
B 1 179 GLN 179 197 197 GLN GLN B . n 
B 1 180 ASN 180 198 198 ASN ASN B . n 
B 1 181 ARG 181 199 199 ARG ARG B . n 
B 1 182 ILE 182 200 200 ILE ILE B . n 
B 1 183 ALA 183 201 201 ALA ALA B . n 
B 1 184 SER 184 202 202 SER SER B . n 
B 1 185 CYS 185 203 203 CYS CYS B . n 
B 1 186 LEU 186 204 204 LEU LEU B . n 
B 1 187 LYS 187 205 205 LYS LYS B . n 
B 1 188 GLU 188 206 206 GLU GLU B . n 
B 1 189 HIS 189 207 207 HIS HIS B . n 
B 1 190 VAL 190 208 208 VAL VAL B . n 
B 1 191 ALA 191 209 209 ALA ALA B . n 
B 1 192 ALA 192 210 210 ALA ALA B . n 
B 1 193 VAL 193 211 211 VAL VAL B . n 
B 1 194 ALA 194 212 212 ALA ALA B . n 
B 1 195 GLY 195 213 213 GLY GLY B . n 
B 1 196 GLU 196 214 214 GLU GLU B . n 
B 1 197 PRO 197 215 215 PRO PRO B . n 
B 1 198 GLN 198 216 216 GLN GLN B . n 
B 1 199 PRO 199 217 217 PRO PRO B . n 
B 1 200 ALA 200 218 218 ALA ALA B . n 
B 1 201 SER 201 219 219 SER SER B . n 
B 1 202 CYS 202 220 220 CYS CYS B . n 
B 1 203 LEU 203 221 221 LEU LEU B . n 
B 1 204 SER 204 222 222 SER SER B . n 
B 1 205 ARG 205 223 223 ARG ARG B . n 
B 1 206 LEU 206 224 224 LEU LEU B . n 
B 1 207 LEU 207 225 225 LEU LEU B . n 
B 1 208 GLY 208 226 226 GLY GLY B . n 
B 1 209 LYS 209 227 227 LYS LYS B . n 
B 1 210 LEU 210 228 228 LEU LEU B . n 
B 1 211 PRO 211 229 229 PRO PRO B . n 
B 1 212 GLU 212 230 230 GLU GLU B . n 
B 1 213 LEU 213 231 231 LEU LEU B . n 
B 1 214 ARG 214 232 232 ARG ARG B . n 
B 1 215 THR 215 233 233 THR THR B . n 
B 1 216 LEU 216 234 234 LEU LEU B . n 
B 1 217 CYS 217 235 235 CYS CYS B . n 
B 1 218 THR 218 236 236 THR THR B . n 
B 1 219 GLN 219 237 237 GLN GLN B . n 
B 1 220 GLY 220 238 238 GLY GLY B . n 
B 1 221 LEU 221 239 239 LEU LEU B . n 
B 1 222 GLN 222 240 240 GLN GLN B . n 
B 1 223 ARG 223 241 241 ARG ARG B . n 
B 1 224 ILE 224 242 242 ILE ILE B . n 
B 1 225 PHE 225 243 243 PHE PHE B . n 
B 1 226 TYR 226 244 244 TYR TYR B . n 
B 1 227 LEU 227 245 245 LEU LEU B . n 
B 1 228 LYS 228 246 246 LYS LYS B . n 
B 1 229 LEU 229 247 247 LEU LEU B . n 
B 1 230 GLU 230 248 248 GLU GLU B . n 
B 1 231 ASP 231 249 249 ASP ASP B . n 
B 1 232 LEU 232 250 250 LEU LEU B . n 
B 1 233 VAL 233 251 251 VAL VAL B . n 
B 1 234 PRO 234 252 252 PRO PRO B . n 
B 1 235 PRO 235 253 253 PRO PRO B . n 
B 1 236 PRO 236 254 254 PRO PRO B . n 
B 1 237 PRO 237 255 255 PRO PRO B . n 
B 1 238 ILE 238 256 256 ILE ILE B . n 
B 1 239 ILE 239 257 257 ILE ILE B . n 
B 1 240 ASP 240 258 258 ASP ASP B . n 
B 1 241 LYS 241 259 259 LYS LYS B . n 
B 1 242 ILE 242 260 260 ILE ILE B . n 
B 1 243 PHE 243 261 261 PHE PHE B . n 
B 1 244 MET 244 262 262 MET MET B . n 
B 1 245 ASP 245 263 263 ASP ASP B . n 
B 1 246 THR 246 264 264 THR THR B . n 
B 1 247 LEU 247 265 265 LEU LEU B . n 
B 1 248 PRO 248 266 266 PRO PRO B . n 
B 1 249 PHE 249 267 267 PHE PHE B . n 
B 1 250 LEU 250 268 ?   ?   ?   B . n 
B 1 251 GLU 251 269 269 GLU GLU B . n 
B 1 252 HIS 252 270 ?   ?   ?   B . n 
B 1 253 HIS 253 271 ?   ?   ?   B . n 
B 1 254 HIS 254 272 ?   ?   ?   B . n 
B 1 255 HIS 255 273 ?   ?   ?   B . n 
B 1 256 HIS 256 274 ?   ?   ?   B . n 
B 1 257 HIS 257 275 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2430  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  22830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-09-26 
2 'Structure model' 1 1 2013-07-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_phasing_MR.entry_id                     3V3Q 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     42.370 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           49.330 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        49.330 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHASER      2.1.4    'Mon Jan 29 16:49:23 2007' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
2 REFMAC      5.6.0117 ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.10     'June 10, 2010'            package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 MAR345dtb   .        ?                          ?       ?                    ?                           'data collection' ? ? ? 
5 AUTOMAR     .        ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH2 B ARG 191 ? ? OE1 B GLU 194 ? B 1.86 
2 1 O   A HOH 422 ? ? O   A HOH 431 ? ? 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             207 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             207 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.418 
_pdbx_validate_rmsd_bond.bond_target_value         1.354 
_pdbx_validate_rmsd_bond.bond_deviation            0.064 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.009 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LEU 59  ? ? CG A LEU 59  ? ? CD2 A LEU 59  ? ? 121.47 111.00 10.47 1.70 N 
2 1 NE A ARG 141 ? ? CZ A ARG 141 ? ? NH1 A ARG 141 ? ? 124.39 120.30 4.09  0.50 N 
3 1 NE A ARG 141 ? ? CZ A ARG 141 ? ? NH2 A ARG 141 ? ? 116.11 120.30 -4.19 0.50 N 
4 1 NE B ARG 232 ? ? CZ B ARG 232 ? ? NH2 B ARG 232 ? ? 116.43 120.30 -3.87 0.50 N 
5 1 CA B CYS 235 ? ? CB B CYS 235 ? ? SG  B CYS 235 ? ? 122.05 114.20 7.85  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 67  ? ? -170.45 144.74  
2 1 VAL A 211 ? ? -105.07 63.66   
3 1 SER B 54  ? ? -56.31  -6.96   
4 1 LEU B 61  ? ? 70.44   -174.13 
5 1 HIS B 63  ? ? -162.53 -162.99 
6 1 PRO B 215 ? ? -24.12  -86.18  
7 1 GLN B 216 ? ? 42.89   29.48   
8 1 PRO B 266 ? ? -70.21  26.14   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 19  ? A MET 1   
2  1 Y 1 A SER 20  ? A SER 2   
3  1 Y 1 A LYS 21  ? A LYS 3   
4  1 Y 1 A PRO 22  ? A PRO 4   
5  1 Y 1 A LYS 23  ? A LYS 5   
6  1 Y 1 A GLN 24  ? A GLN 6   
7  1 Y 1 A PRO 25  ? A PRO 7   
8  1 Y 1 A PRO 26  ? A PRO 8   
9  1 Y 1 A SER 29  ? A SER 11  
10 1 Y 1 A GLY 213 ? A GLY 195 
11 1 Y 1 A GLU 214 ? A GLU 196 
12 1 Y 1 A PRO 215 ? A PRO 197 
13 1 Y 1 A GLN 216 ? A GLN 198 
14 1 Y 1 A GLU 269 ? A GLU 251 
15 1 Y 1 A HIS 270 ? A HIS 252 
16 1 Y 1 A HIS 271 ? A HIS 253 
17 1 Y 1 A HIS 272 ? A HIS 254 
18 1 Y 1 A HIS 273 ? A HIS 255 
19 1 Y 1 A HIS 274 ? A HIS 256 
20 1 Y 1 A HIS 275 ? A HIS 257 
21 1 Y 1 B MET 19  ? B MET 1   
22 1 Y 1 B SER 20  ? B SER 2   
23 1 Y 1 B LYS 21  ? B LYS 3   
24 1 Y 1 B PRO 22  ? B PRO 4   
25 1 Y 1 B LYS 23  ? B LYS 5   
26 1 Y 1 B GLN 24  ? B GLN 6   
27 1 Y 1 B PRO 25  ? B PRO 7   
28 1 Y 1 B PRO 26  ? B PRO 8   
29 1 Y 1 B ASP 27  ? B ASP 9   
30 1 Y 1 B ALA 28  ? B ALA 10  
31 1 Y 1 B SER 29  ? B SER 11  
32 1 Y 1 B LEU 268 ? B LEU 250 
33 1 Y 1 B HIS 270 ? B HIS 252 
34 1 Y 1 B HIS 271 ? B HIS 253 
35 1 Y 1 B HIS 272 ? B HIS 254 
36 1 Y 1 B HIS 273 ? B HIS 255 
37 1 Y 1 B HIS 274 ? B HIS 256 
38 1 Y 1 B HIS 275 ? B HIS 257 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ethyl (2,3,4-trimethoxy-6-octanoylphenyl)acetate' TMY 
3 GLYCEROL                                           GOL 
4 'SODIUM ION'                                       NA  
5 water                                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 TMY 1   301 1   TMY TMP A . 
D 2 TMY 1   302 1   TMY TMP A . 
E 3 GOL 1   303 1   GOL GOL A . 
F 3 GOL 1   304 2   GOL GOL A . 
G 3 GOL 1   305 4   GOL GOL A . 
H 3 GOL 1   301 3   GOL GOL B . 
I 4 NA  1   302 1   NA  NA  B . 
J 5 HOH 1   401 2   HOH HOH A . 
J 5 HOH 2   402 3   HOH HOH A . 
J 5 HOH 3   403 5   HOH HOH A . 
J 5 HOH 4   404 6   HOH HOH A . 
J 5 HOH 5   405 7   HOH HOH A . 
J 5 HOH 6   406 8   HOH HOH A . 
J 5 HOH 7   407 11  HOH HOH A . 
J 5 HOH 8   408 12  HOH HOH A . 
J 5 HOH 9   409 14  HOH HOH A . 
J 5 HOH 10  410 17  HOH HOH A . 
J 5 HOH 11  411 19  HOH HOH A . 
J 5 HOH 12  412 20  HOH HOH A . 
J 5 HOH 13  413 21  HOH HOH A . 
J 5 HOH 14  414 22  HOH HOH A . 
J 5 HOH 15  415 23  HOH HOH A . 
J 5 HOH 16  416 24  HOH HOH A . 
J 5 HOH 17  417 25  HOH HOH A . 
J 5 HOH 18  418 26  HOH HOH A . 
J 5 HOH 19  419 29  HOH HOH A . 
J 5 HOH 20  420 30  HOH HOH A . 
J 5 HOH 21  421 31  HOH HOH A . 
J 5 HOH 22  422 32  HOH HOH A . 
J 5 HOH 23  423 33  HOH HOH A . 
J 5 HOH 24  424 34  HOH HOH A . 
J 5 HOH 25  425 35  HOH HOH A . 
J 5 HOH 26  426 36  HOH HOH A . 
J 5 HOH 27  427 37  HOH HOH A . 
J 5 HOH 28  428 42  HOH HOH A . 
J 5 HOH 29  429 48  HOH HOH A . 
J 5 HOH 30  430 49  HOH HOH A . 
J 5 HOH 31  431 51  HOH HOH A . 
J 5 HOH 32  432 52  HOH HOH A . 
J 5 HOH 33  433 55  HOH HOH A . 
J 5 HOH 34  434 56  HOH HOH A . 
J 5 HOH 35  435 59  HOH HOH A . 
J 5 HOH 36  436 60  HOH HOH A . 
J 5 HOH 37  437 64  HOH HOH A . 
J 5 HOH 38  438 65  HOH HOH A . 
J 5 HOH 39  439 67  HOH HOH A . 
J 5 HOH 40  440 70  HOH HOH A . 
J 5 HOH 41  441 71  HOH HOH A . 
J 5 HOH 42  442 72  HOH HOH A . 
J 5 HOH 43  443 76  HOH HOH A . 
J 5 HOH 44  444 77  HOH HOH A . 
J 5 HOH 45  445 78  HOH HOH A . 
J 5 HOH 46  446 80  HOH HOH A . 
J 5 HOH 47  447 82  HOH HOH A . 
J 5 HOH 48  448 84  HOH HOH A . 
J 5 HOH 49  449 88  HOH HOH A . 
J 5 HOH 50  450 89  HOH HOH A . 
J 5 HOH 51  451 90  HOH HOH A . 
J 5 HOH 52  452 96  HOH HOH A . 
J 5 HOH 53  453 98  HOH HOH A . 
J 5 HOH 54  454 99  HOH HOH A . 
J 5 HOH 55  455 100 HOH HOH A . 
J 5 HOH 56  456 101 HOH HOH A . 
J 5 HOH 57  457 103 HOH HOH A . 
J 5 HOH 58  458 104 HOH HOH A . 
J 5 HOH 59  459 107 HOH HOH A . 
J 5 HOH 60  460 112 HOH HOH A . 
J 5 HOH 61  461 113 HOH HOH A . 
J 5 HOH 62  462 114 HOH HOH A . 
J 5 HOH 63  463 116 HOH HOH A . 
J 5 HOH 64  464 118 HOH HOH A . 
J 5 HOH 65  465 119 HOH HOH A . 
J 5 HOH 66  466 120 HOH HOH A . 
J 5 HOH 67  467 123 HOH HOH A . 
J 5 HOH 68  468 125 HOH HOH A . 
J 5 HOH 69  469 128 HOH HOH A . 
J 5 HOH 70  470 129 HOH HOH A . 
J 5 HOH 71  471 131 HOH HOH A . 
J 5 HOH 72  472 132 HOH HOH A . 
J 5 HOH 73  473 133 HOH HOH A . 
J 5 HOH 74  474 134 HOH HOH A . 
J 5 HOH 75  475 135 HOH HOH A . 
J 5 HOH 76  476 137 HOH HOH A . 
J 5 HOH 77  477 138 HOH HOH A . 
J 5 HOH 78  478 139 HOH HOH A . 
J 5 HOH 79  479 142 HOH HOH A . 
J 5 HOH 80  480 147 HOH HOH A . 
J 5 HOH 81  481 148 HOH HOH A . 
J 5 HOH 82  482 150 HOH HOH A . 
J 5 HOH 83  483 151 HOH HOH A . 
J 5 HOH 84  484 152 HOH HOH A . 
J 5 HOH 85  485 155 HOH HOH A . 
J 5 HOH 86  486 158 HOH HOH A . 
J 5 HOH 87  487 159 HOH HOH A . 
J 5 HOH 88  488 161 HOH HOH A . 
J 5 HOH 89  489 165 HOH HOH A . 
J 5 HOH 90  490 167 HOH HOH A . 
J 5 HOH 91  491 168 HOH HOH A . 
J 5 HOH 92  492 170 HOH HOH A . 
J 5 HOH 93  493 171 HOH HOH A . 
J 5 HOH 94  494 172 HOH HOH A . 
J 5 HOH 95  495 175 HOH HOH A . 
J 5 HOH 96  496 180 HOH HOH A . 
J 5 HOH 97  497 182 HOH HOH A . 
J 5 HOH 98  498 185 HOH HOH A . 
J 5 HOH 99  499 187 HOH HOH A . 
J 5 HOH 100 500 188 HOH HOH A . 
J 5 HOH 101 501 189 HOH HOH A . 
J 5 HOH 102 502 190 HOH HOH A . 
J 5 HOH 103 503 193 HOH HOH A . 
J 5 HOH 104 504 194 HOH HOH A . 
J 5 HOH 105 505 199 HOH HOH A . 
J 5 HOH 106 506 201 HOH HOH A . 
J 5 HOH 107 507 202 HOH HOH A . 
J 5 HOH 108 508 203 HOH HOH A . 
J 5 HOH 109 509 205 HOH HOH A . 
J 5 HOH 110 510 207 HOH HOH A . 
J 5 HOH 111 511 218 HOH HOH A . 
J 5 HOH 112 512 221 HOH HOH A . 
J 5 HOH 113 513 225 HOH HOH A . 
J 5 HOH 114 514 232 HOH HOH A . 
J 5 HOH 115 515 238 HOH HOH A . 
J 5 HOH 116 516 242 HOH HOH A . 
J 5 HOH 117 517 247 HOH HOH A . 
J 5 HOH 118 518 254 HOH HOH A . 
J 5 HOH 119 519 256 HOH HOH A . 
J 5 HOH 120 520 258 HOH HOH A . 
J 5 HOH 121 521 260 HOH HOH A . 
J 5 HOH 122 522 266 HOH HOH A . 
J 5 HOH 123 523 268 HOH HOH A . 
J 5 HOH 124 524 269 HOH HOH A . 
J 5 HOH 125 525 272 HOH HOH A . 
J 5 HOH 126 526 283 HOH HOH A . 
J 5 HOH 127 527 284 HOH HOH A . 
J 5 HOH 128 528 290 HOH HOH A . 
J 5 HOH 129 529 293 HOH HOH A . 
J 5 HOH 130 530 294 HOH HOH A . 
J 5 HOH 131 531 296 HOH HOH A . 
J 5 HOH 132 532 297 HOH HOH A . 
J 5 HOH 133 533 302 HOH HOH A . 
J 5 HOH 134 534 303 HOH HOH A . 
J 5 HOH 135 535 307 HOH HOH A . 
J 5 HOH 136 536 309 HOH HOH A . 
J 5 HOH 137 537 313 HOH HOH A . 
J 5 HOH 138 538 317 HOH HOH A . 
J 5 HOH 139 539 318 HOH HOH A . 
J 5 HOH 140 540 319 HOH HOH A . 
J 5 HOH 141 541 320 HOH HOH A . 
J 5 HOH 142 542 322 HOH HOH A . 
J 5 HOH 143 543 325 HOH HOH A . 
J 5 HOH 144 544 326 HOH HOH A . 
J 5 HOH 145 545 327 HOH HOH A . 
J 5 HOH 146 546 328 HOH HOH A . 
J 5 HOH 147 547 333 HOH HOH A . 
J 5 HOH 148 548 334 HOH HOH A . 
J 5 HOH 149 549 335 HOH HOH A . 
J 5 HOH 150 550 338 HOH HOH A . 
J 5 HOH 151 551 340 HOH HOH A . 
J 5 HOH 152 552 341 HOH HOH A . 
J 5 HOH 153 553 348 HOH HOH A . 
J 5 HOH 154 554 350 HOH HOH A . 
J 5 HOH 155 555 352 HOH HOH A . 
J 5 HOH 156 556 353 HOH HOH A . 
J 5 HOH 157 557 358 HOH HOH A . 
J 5 HOH 158 558 359 HOH HOH A . 
J 5 HOH 159 559 362 HOH HOH A . 
J 5 HOH 160 560 365 HOH HOH A . 
J 5 HOH 161 561 366 HOH HOH A . 
J 5 HOH 162 562 367 HOH HOH A . 
J 5 HOH 163 563 368 HOH HOH A . 
J 5 HOH 164 564 370 HOH HOH A . 
J 5 HOH 165 565 371 HOH HOH A . 
J 5 HOH 166 566 375 HOH HOH A . 
J 5 HOH 167 567 380 HOH HOH A . 
J 5 HOH 168 568 388 HOH HOH A . 
J 5 HOH 169 569 389 HOH HOH A . 
J 5 HOH 170 570 390 HOH HOH A . 
J 5 HOH 171 571 399 HOH HOH A . 
J 5 HOH 172 572 400 HOH HOH A . 
J 5 HOH 173 573 401 HOH HOH A . 
J 5 HOH 174 574 405 HOH HOH A . 
J 5 HOH 175 575 407 HOH HOH A . 
J 5 HOH 176 576 409 HOH HOH A . 
J 5 HOH 177 577 410 HOH HOH A . 
J 5 HOH 178 578 411 HOH HOH A . 
J 5 HOH 179 579 412 HOH HOH A . 
J 5 HOH 180 580 418 HOH HOH A . 
J 5 HOH 181 581 419 HOH HOH A . 
J 5 HOH 182 582 421 HOH HOH A . 
J 5 HOH 183 583 422 HOH HOH A . 
J 5 HOH 184 584 423 HOH HOH A . 
J 5 HOH 185 585 425 HOH HOH A . 
J 5 HOH 186 586 428 HOH HOH A . 
J 5 HOH 187 587 431 HOH HOH A . 
J 5 HOH 188 588 437 HOH HOH A . 
J 5 HOH 189 589 438 HOH HOH A . 
J 5 HOH 190 590 443 HOH HOH A . 
J 5 HOH 191 591 449 HOH HOH A . 
J 5 HOH 192 592 451 HOH HOH A . 
J 5 HOH 193 593 454 HOH HOH A . 
J 5 HOH 194 594 457 HOH HOH A . 
J 5 HOH 195 595 462 HOH HOH A . 
J 5 HOH 196 596 474 HOH HOH A . 
J 5 HOH 197 597 475 HOH HOH A . 
J 5 HOH 198 598 477 HOH HOH A . 
J 5 HOH 199 599 481 HOH HOH A . 
J 5 HOH 200 600 482 HOH HOH A . 
J 5 HOH 201 601 485 HOH HOH A . 
J 5 HOH 202 602 487 HOH HOH A . 
J 5 HOH 203 603 488 HOH HOH A . 
J 5 HOH 204 604 490 HOH HOH A . 
J 5 HOH 205 605 491 HOH HOH A . 
J 5 HOH 206 606 493 HOH HOH A . 
J 5 HOH 207 607 494 HOH HOH A . 
J 5 HOH 208 608 495 HOH HOH A . 
K 5 HOH 1   401 4   HOH HOH B . 
K 5 HOH 2   402 10  HOH HOH B . 
K 5 HOH 3   403 13  HOH HOH B . 
K 5 HOH 4   404 15  HOH HOH B . 
K 5 HOH 5   405 16  HOH HOH B . 
K 5 HOH 6   406 18  HOH HOH B . 
K 5 HOH 7   407 27  HOH HOH B . 
K 5 HOH 8   408 28  HOH HOH B . 
K 5 HOH 9   409 38  HOH HOH B . 
K 5 HOH 10  410 39  HOH HOH B . 
K 5 HOH 11  411 41  HOH HOH B . 
K 5 HOH 12  412 43  HOH HOH B . 
K 5 HOH 13  413 44  HOH HOH B . 
K 5 HOH 14  414 45  HOH HOH B . 
K 5 HOH 15  415 46  HOH HOH B . 
K 5 HOH 16  416 47  HOH HOH B . 
K 5 HOH 17  417 50  HOH HOH B . 
K 5 HOH 18  418 53  HOH HOH B . 
K 5 HOH 19  419 57  HOH HOH B . 
K 5 HOH 20  420 58  HOH HOH B . 
K 5 HOH 21  421 62  HOH HOH B . 
K 5 HOH 22  422 63  HOH HOH B . 
K 5 HOH 23  423 66  HOH HOH B . 
K 5 HOH 24  424 68  HOH HOH B . 
K 5 HOH 25  425 73  HOH HOH B . 
K 5 HOH 26  426 74  HOH HOH B . 
K 5 HOH 27  427 75  HOH HOH B . 
K 5 HOH 28  428 79  HOH HOH B . 
K 5 HOH 29  429 83  HOH HOH B . 
K 5 HOH 30  430 86  HOH HOH B . 
K 5 HOH 31  431 87  HOH HOH B . 
K 5 HOH 32  432 91  HOH HOH B . 
K 5 HOH 33  433 92  HOH HOH B . 
K 5 HOH 34  434 93  HOH HOH B . 
K 5 HOH 35  435 94  HOH HOH B . 
K 5 HOH 36  436 95  HOH HOH B . 
K 5 HOH 37  437 97  HOH HOH B . 
K 5 HOH 38  438 102 HOH HOH B . 
K 5 HOH 39  439 105 HOH HOH B . 
K 5 HOH 40  440 106 HOH HOH B . 
K 5 HOH 41  441 108 HOH HOH B . 
K 5 HOH 42  442 109 HOH HOH B . 
K 5 HOH 43  443 110 HOH HOH B . 
K 5 HOH 44  444 111 HOH HOH B . 
K 5 HOH 45  445 115 HOH HOH B . 
K 5 HOH 46  446 117 HOH HOH B . 
K 5 HOH 47  447 121 HOH HOH B . 
K 5 HOH 48  448 122 HOH HOH B . 
K 5 HOH 49  449 124 HOH HOH B . 
K 5 HOH 50  450 126 HOH HOH B . 
K 5 HOH 51  451 127 HOH HOH B . 
K 5 HOH 52  452 136 HOH HOH B . 
K 5 HOH 53  453 140 HOH HOH B . 
K 5 HOH 54  454 141 HOH HOH B . 
K 5 HOH 55  455 143 HOH HOH B . 
K 5 HOH 56  456 144 HOH HOH B . 
K 5 HOH 57  457 145 HOH HOH B . 
K 5 HOH 58  458 146 HOH HOH B . 
K 5 HOH 59  459 149 HOH HOH B . 
K 5 HOH 60  460 153 HOH HOH B . 
K 5 HOH 61  461 154 HOH HOH B . 
K 5 HOH 62  462 157 HOH HOH B . 
K 5 HOH 63  463 160 HOH HOH B . 
K 5 HOH 64  464 162 HOH HOH B . 
K 5 HOH 65  465 164 HOH HOH B . 
K 5 HOH 66  466 166 HOH HOH B . 
K 5 HOH 67  467 169 HOH HOH B . 
K 5 HOH 68  468 173 HOH HOH B . 
K 5 HOH 69  469 174 HOH HOH B . 
K 5 HOH 70  470 176 HOH HOH B . 
K 5 HOH 71  471 177 HOH HOH B . 
K 5 HOH 72  472 178 HOH HOH B . 
K 5 HOH 73  473 179 HOH HOH B . 
K 5 HOH 74  474 181 HOH HOH B . 
K 5 HOH 75  475 183 HOH HOH B . 
K 5 HOH 76  476 184 HOH HOH B . 
K 5 HOH 77  477 186 HOH HOH B . 
K 5 HOH 78  478 191 HOH HOH B . 
K 5 HOH 79  479 195 HOH HOH B . 
K 5 HOH 80  480 197 HOH HOH B . 
K 5 HOH 81  481 198 HOH HOH B . 
K 5 HOH 82  482 200 HOH HOH B . 
K 5 HOH 83  483 206 HOH HOH B . 
K 5 HOH 84  484 208 HOH HOH B . 
K 5 HOH 85  485 210 HOH HOH B . 
K 5 HOH 86  486 211 HOH HOH B . 
K 5 HOH 87  487 212 HOH HOH B . 
K 5 HOH 88  488 213 HOH HOH B . 
K 5 HOH 89  489 215 HOH HOH B . 
K 5 HOH 90  490 216 HOH HOH B . 
K 5 HOH 91  491 217 HOH HOH B . 
K 5 HOH 92  492 220 HOH HOH B . 
K 5 HOH 93  493 223 HOH HOH B . 
K 5 HOH 94  494 224 HOH HOH B . 
K 5 HOH 95  495 227 HOH HOH B . 
K 5 HOH 96  496 228 HOH HOH B . 
K 5 HOH 97  497 229 HOH HOH B . 
K 5 HOH 98  498 230 HOH HOH B . 
K 5 HOH 99  499 233 HOH HOH B . 
K 5 HOH 100 500 234 HOH HOH B . 
K 5 HOH 101 501 235 HOH HOH B . 
K 5 HOH 102 502 236 HOH HOH B . 
K 5 HOH 103 503 240 HOH HOH B . 
K 5 HOH 104 504 241 HOH HOH B . 
K 5 HOH 105 505 249 HOH HOH B . 
K 5 HOH 106 506 250 HOH HOH B . 
K 5 HOH 107 507 251 HOH HOH B . 
K 5 HOH 108 508 255 HOH HOH B . 
K 5 HOH 109 509 259 HOH HOH B . 
K 5 HOH 110 510 261 HOH HOH B . 
K 5 HOH 111 511 263 HOH HOH B . 
K 5 HOH 112 512 264 HOH HOH B . 
K 5 HOH 113 513 265 HOH HOH B . 
K 5 HOH 114 514 267 HOH HOH B . 
K 5 HOH 115 515 270 HOH HOH B . 
K 5 HOH 116 516 274 HOH HOH B . 
K 5 HOH 117 517 280 HOH HOH B . 
K 5 HOH 118 518 281 HOH HOH B . 
K 5 HOH 119 519 282 HOH HOH B . 
K 5 HOH 120 520 285 HOH HOH B . 
K 5 HOH 121 521 287 HOH HOH B . 
K 5 HOH 122 522 289 HOH HOH B . 
K 5 HOH 123 523 291 HOH HOH B . 
K 5 HOH 124 524 292 HOH HOH B . 
K 5 HOH 125 525 298 HOH HOH B . 
K 5 HOH 126 526 300 HOH HOH B . 
K 5 HOH 127 527 305 HOH HOH B . 
K 5 HOH 128 528 308 HOH HOH B . 
K 5 HOH 129 529 311 HOH HOH B . 
K 5 HOH 130 530 312 HOH HOH B . 
K 5 HOH 131 531 321 HOH HOH B . 
K 5 HOH 132 532 332 HOH HOH B . 
K 5 HOH 133 533 337 HOH HOH B . 
K 5 HOH 134 534 339 HOH HOH B . 
K 5 HOH 135 535 342 HOH HOH B . 
K 5 HOH 136 536 343 HOH HOH B . 
K 5 HOH 137 537 345 HOH HOH B . 
K 5 HOH 138 538 346 HOH HOH B . 
K 5 HOH 139 539 349 HOH HOH B . 
K 5 HOH 140 540 357 HOH HOH B . 
K 5 HOH 141 541 360 HOH HOH B . 
K 5 HOH 142 542 363 HOH HOH B . 
K 5 HOH 143 543 369 HOH HOH B . 
K 5 HOH 144 544 373 HOH HOH B . 
K 5 HOH 145 545 374 HOH HOH B . 
K 5 HOH 146 546 376 HOH HOH B . 
K 5 HOH 147 547 378 HOH HOH B . 
K 5 HOH 148 548 384 HOH HOH B . 
K 5 HOH 149 549 386 HOH HOH B . 
K 5 HOH 150 550 391 HOH HOH B . 
K 5 HOH 151 551 392 HOH HOH B . 
K 5 HOH 152 552 393 HOH HOH B . 
K 5 HOH 153 553 394 HOH HOH B . 
K 5 HOH 154 554 397 HOH HOH B . 
K 5 HOH 155 555 402 HOH HOH B . 
K 5 HOH 156 556 403 HOH HOH B . 
K 5 HOH 157 557 406 HOH HOH B . 
K 5 HOH 158 558 408 HOH HOH B . 
K 5 HOH 159 559 413 HOH HOH B . 
K 5 HOH 160 560 414 HOH HOH B . 
K 5 HOH 161 561 415 HOH HOH B . 
K 5 HOH 162 562 416 HOH HOH B . 
K 5 HOH 163 563 417 HOH HOH B . 
K 5 HOH 164 564 420 HOH HOH B . 
K 5 HOH 165 565 426 HOH HOH B . 
K 5 HOH 166 566 427 HOH HOH B . 
K 5 HOH 167 567 430 HOH HOH B . 
K 5 HOH 168 568 432 HOH HOH B . 
K 5 HOH 169 569 434 HOH HOH B . 
K 5 HOH 170 570 435 HOH HOH B . 
K 5 HOH 171 571 439 HOH HOH B . 
K 5 HOH 172 572 440 HOH HOH B . 
K 5 HOH 173 573 441 HOH HOH B . 
K 5 HOH 174 574 444 HOH HOH B . 
K 5 HOH 175 575 445 HOH HOH B . 
K 5 HOH 176 576 446 HOH HOH B . 
K 5 HOH 177 577 447 HOH HOH B . 
K 5 HOH 178 578 448 HOH HOH B . 
K 5 HOH 179 579 450 HOH HOH B . 
K 5 HOH 180 580 453 HOH HOH B . 
K 5 HOH 181 581 458 HOH HOH B . 
K 5 HOH 182 582 459 HOH HOH B . 
K 5 HOH 183 583 461 HOH HOH B . 
K 5 HOH 184 584 473 HOH HOH B . 
K 5 HOH 185 585 479 HOH HOH B . 
K 5 HOH 186 586 483 HOH HOH B . 
K 5 HOH 187 587 486 HOH HOH B . 
K 5 HOH 188 588 489 HOH HOH B . 
K 5 HOH 189 589 496 HOH HOH B . 
#