data_3V4O
# 
_entry.id   3V4O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V4O         
RCSB  RCSB069590   
WWPDB D_1000069590 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3V4L . unspecified 
NDB 3V55 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3V4O 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Renatus, M.'  1 
'Wiesmann, C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural Determinants of MALT1 Protease Activity.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            419 
_citation.page_first                4 
_citation.page_last                 21 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22366302 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.02.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wiesmann, C.'  1  
primary 'Leder, L.'     2  
primary 'Blank, J.'     3  
primary 'Bernardi, A.'  4  
primary 'Melkko, S.'    5  
primary 'Decock, A.'    6  
primary 
;D'Arcy, A.
;
7  
primary 'Villard, F.'   8  
primary 'Erbel, P.'     9  
primary 'Hughes, N.'    10 
primary 'Freuler, F.'   11 
primary 'Nikolay, R.'   12 
primary 'Alves, J.'     13 
primary 'Bornancin, F.' 14 
primary 'Renatus, M.'   15 
# 
_cell.entry_id           3V4O 
_cell.length_a           77.500 
_cell.length_b           77.500 
_cell.length_c           180.493 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V4O 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mucosa-associated lymphoid tissue lymphoma translocation protein 1' 27709.799 1   3.4.22.- ? 'UNP residues 329-569' 
? 
2 polymer syn 'MALT1 Inhibitor'                                                    697.244   1   ?        ? ?                      
? 
3 water   nat water                                                                18.015    150 ?        ? ?                      
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MALT lymphoma-associated translocation, Paracaspase' 
2 Z-VRPR-FMK                                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPGSDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDK
GVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTA
NIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPI
QGTEY
;
;GPGSDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDK
GVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTA
NIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPI
QGTEY
;
A ? 
2 'polypeptide(L)' no yes '(PHQ)VRPR(CF0)' XVRPRX B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   ASP n 
1 6   ASN n 
1 7   LYS n 
1 8   GLU n 
1 9   GLN n 
1 10  THR n 
1 11  THR n 
1 12  ASP n 
1 13  GLN n 
1 14  PRO n 
1 15  LEU n 
1 16  ALA n 
1 17  LYS n 
1 18  ASP n 
1 19  LYS n 
1 20  VAL n 
1 21  ALA n 
1 22  LEU n 
1 23  LEU n 
1 24  ILE n 
1 25  GLY n 
1 26  ASN n 
1 27  MET n 
1 28  ASN n 
1 29  TYR n 
1 30  ARG n 
1 31  GLU n 
1 32  HIS n 
1 33  PRO n 
1 34  LYS n 
1 35  LEU n 
1 36  LYS n 
1 37  ALA n 
1 38  PRO n 
1 39  LEU n 
1 40  VAL n 
1 41  ASP n 
1 42  VAL n 
1 43  TYR n 
1 44  GLU n 
1 45  LEU n 
1 46  THR n 
1 47  ASN n 
1 48  LEU n 
1 49  LEU n 
1 50  ARG n 
1 51  GLN n 
1 52  LEU n 
1 53  ASP n 
1 54  PHE n 
1 55  LYS n 
1 56  VAL n 
1 57  VAL n 
1 58  SER n 
1 59  LEU n 
1 60  LEU n 
1 61  ASP n 
1 62  LEU n 
1 63  THR n 
1 64  GLU n 
1 65  TYR n 
1 66  GLU n 
1 67  MET n 
1 68  ARG n 
1 69  ASN n 
1 70  ALA n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  PHE n 
1 75  LEU n 
1 76  LEU n 
1 77  LEU n 
1 78  LEU n 
1 79  ASP n 
1 80  LYS n 
1 81  GLY n 
1 82  VAL n 
1 83  TYR n 
1 84  GLY n 
1 85  LEU n 
1 86  LEU n 
1 87  TYR n 
1 88  TYR n 
1 89  ALA n 
1 90  GLY n 
1 91  HIS n 
1 92  GLY n 
1 93  TYR n 
1 94  GLU n 
1 95  ASN n 
1 96  PHE n 
1 97  GLY n 
1 98  ASN n 
1 99  SER n 
1 100 PHE n 
1 101 MET n 
1 102 VAL n 
1 103 PRO n 
1 104 VAL n 
1 105 ASP n 
1 106 ALA n 
1 107 PRO n 
1 108 ASN n 
1 109 PRO n 
1 110 TYR n 
1 111 ARG n 
1 112 SER n 
1 113 GLU n 
1 114 ASN n 
1 115 CYS n 
1 116 LEU n 
1 117 CYS n 
1 118 VAL n 
1 119 GLN n 
1 120 ASN n 
1 121 ILE n 
1 122 LEU n 
1 123 LYS n 
1 124 LEU n 
1 125 MET n 
1 126 GLN n 
1 127 GLU n 
1 128 LYS n 
1 129 GLU n 
1 130 THR n 
1 131 GLY n 
1 132 LEU n 
1 133 ASN n 
1 134 VAL n 
1 135 PHE n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 MET n 
1 140 CYS n 
1 141 ARG n 
1 142 LYS n 
1 143 ARG n 
1 144 ASN n 
1 145 ASP n 
1 146 TYR n 
1 147 ASP n 
1 148 ASP n 
1 149 THR n 
1 150 ILE n 
1 151 PRO n 
1 152 ILE n 
1 153 LEU n 
1 154 ASP n 
1 155 ALA n 
1 156 LEU n 
1 157 LYS n 
1 158 VAL n 
1 159 THR n 
1 160 ALA n 
1 161 ASN n 
1 162 ILE n 
1 163 VAL n 
1 164 PHE n 
1 165 GLY n 
1 166 TYR n 
1 167 ALA n 
1 168 THR n 
1 169 CYS n 
1 170 GLN n 
1 171 GLY n 
1 172 ALA n 
1 173 GLU n 
1 174 ALA n 
1 175 PHE n 
1 176 GLU n 
1 177 ILE n 
1 178 GLN n 
1 179 HIS n 
1 180 SER n 
1 181 GLY n 
1 182 LEU n 
1 183 ALA n 
1 184 ASN n 
1 185 GLY n 
1 186 ILE n 
1 187 PHE n 
1 188 MET n 
1 189 LYS n 
1 190 PHE n 
1 191 LEU n 
1 192 LYS n 
1 193 ASP n 
1 194 ARG n 
1 195 LEU n 
1 196 LEU n 
1 197 GLU n 
1 198 ASP n 
1 199 LYS n 
1 200 LYS n 
1 201 ILE n 
1 202 THR n 
1 203 VAL n 
1 204 LEU n 
1 205 LEU n 
1 206 ASP n 
1 207 GLU n 
1 208 VAL n 
1 209 ALA n 
1 210 GLU n 
1 211 ASP n 
1 212 MET n 
1 213 GLY n 
1 214 LYS n 
1 215 CYS n 
1 216 HIS n 
1 217 LEU n 
1 218 THR n 
1 219 LYS n 
1 220 GLY n 
1 221 LYS n 
1 222 GLN n 
1 223 ALA n 
1 224 LEU n 
1 225 GLU n 
1 226 ILE n 
1 227 ARG n 
1 228 SER n 
1 229 SER n 
1 230 LEU n 
1 231 SER n 
1 232 GLU n 
1 233 LYS n 
1 234 ARG n 
1 235 ALA n 
1 236 LEU n 
1 237 THR n 
1 238 ASP n 
1 239 PRO n 
1 240 ILE n 
1 241 GLN n 
1 242 GLY n 
1 243 THR n 
1 244 GLU n 
1 245 TYR n 
2 1   PHQ n 
2 2   VAL n 
2 3   ARG n 
2 4   PRO n 
2 5   ARG n 
2 6   CF0 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MALT1, MLT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MALT1_HUMAN Q9UDY8 1 
;DNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYG
LLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVF
GYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTE
Y
;
329 ? 
2 PDB 3V4O        3v4l   2 XVRPRX 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V4O A 5 ? 245 ? Q9UDY8 329 ? 569 ? 329 569 
2 2 3V4O B 1 ? 6   ? 3V4O   1   ? 6   ? 1   6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V4O GLY A 1 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 325 1 
1 3V4O PRO A 2 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 326 2 
1 3V4O GLY A 3 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 327 3 
1 3V4O SER A 4 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 328 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                     'C4 H7 N O4'     133.103 
CF0 non-polymer         . fluoromethane            'Fluoro methyl group' 'C H3 F'         34.033  
CYS 'L-peptide linking' y CYSTEINE                 ?                     'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                     'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                     'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate' ?                     'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                  ?                     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                     'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                 ?                     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3V4O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.density_percent_sol   55.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'20% PeG3550, 0.4 Ammonium nitrate, 0.1M Bis-tris propane, VAPOR DIFFUSION, temperature 298K, pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-04-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00000 1.0 
2 1       1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             1.00000 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3V4O 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             67.11 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   19456 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.095 
_reflns.pdbx_netI_over_sigmaI        13.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.536 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3V4O 
_refine.ls_number_reflns_obs                     18482 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.86 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.17856 
_refine.ls_R_factor_R_work                       0.17598 
_refine.ls_R_factor_R_free                       0.22827 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  973 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2PYO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'FREE R VALUE TEST SET SIZE   (%) :  5.0' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1910 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             150 
_refine_hist.number_atoms_total               2060 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        53.86 
# 
_struct.entry_id                  3V4O 
_struct.title                     'Human MALT1 (caspase domain) in complex with an irreversible peptidic inhibitor' 
_struct.pdbx_descriptor           
'Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (E.C.3.4.22.-), MALT1 Inhibitor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V4O 
_struct_keywords.pdbx_keywords   HYDROLASE/INHIBITOR 
_struct_keywords.text            'Caspase, Hydrolase, TRAF6, BCL10, Cytosolic, HYDROLASE-INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 37  ? LEU A 52  ? ALA A 361 LEU A 376 1 ? 16 
HELX_P HELX_P2 2 THR A 63  ? LEU A 77  ? THR A 387 LEU A 401 1 ? 15 
HELX_P HELX_P3 3 ARG A 111 ? CYS A 115 ? ARG A 435 CYS A 439 5 ? 5  
HELX_P HELX_P4 4 VAL A 118 ? LYS A 128 ? VAL A 442 LYS A 452 1 ? 11 
HELX_P HELX_P5 5 GLY A 185 ? LYS A 192 ? GLY A 509 LYS A 516 1 ? 8  
HELX_P HELX_P6 6 LYS A 200 ? GLY A 213 ? LYS A 524 GLY A 537 1 ? 14 
HELX_P HELX_P7 7 LYS A 214 ? LYS A 219 ? LYS A 538 LYS A 543 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B PHQ 1   C1 ? ? ? 1_555 B VAL 2 N  ? ? B PHQ 1   B VAL 2 1_555 ? ? ? ? ? ? ? 1.343 sing 
covale2 covale ? ? B ARG 5   C  ? ? ? 1_555 B CF0 6 C1 ? ? B ARG 5   B CF0 6 1_555 ? ? ? ? ? ? ? 1.510 sing 
covale3 covale ? ? A CYS 140 SG ? ? ? 1_555 B CF0 6 C1 ? ? A CYS 464 B CF0 6 1_555 ? ? ? ? ? ? ? 1.877 ?    
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           108 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            432 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    109 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     433 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.82 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 55  ? LEU A 60  ? LYS A 379 LEU A 384 
A 2 LYS A 19  ? GLY A 25  ? LYS A 343 GLY A 349 
A 3 TYR A 83  ? ALA A 89  ? TYR A 407 ALA A 413 
A 4 LEU A 132 ? ASP A 138 ? LEU A 456 ASP A 462 
A 5 ILE A 162 ? TYR A 166 ? ILE A 486 TYR A 490 
A 6 GLU A 225 ? SER A 228 ? GLU A 549 SER A 552 
B 1 GLY A 92  ? ASN A 95  ? GLY A 416 ASN A 419 
B 2 ASN A 98  ? MET A 101 ? ASN A 422 MET A 425 
B 3 LEU A 116 ? CYS A 117 ? LEU A 440 CYS A 441 
C 1 PHE A 175 ? GLU A 176 ? PHE A 499 GLU A 500 
C 2 ARG B 3   ? PRO B 4   ? ARG B 3   PRO B 4   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 55  ? O LYS A 379 N LYS A 19  ? N LYS A 343 
A 2 3 N VAL A 20  ? N VAL A 344 O TYR A 83  ? O TYR A 407 
A 3 4 N TYR A 88  ? N TYR A 412 O ASP A 138 ? O ASP A 462 
A 4 5 N PHE A 135 ? N PHE A 459 O GLY A 165 ? O GLY A 489 
A 5 6 N PHE A 164 ? N PHE A 488 O ARG A 227 ? O ARG A 551 
B 1 2 N TYR A 93  ? N TYR A 417 O PHE A 100 ? O PHE A 424 
B 2 3 N MET A 101 ? N MET A 425 O LEU A 116 ? O LEU A 440 
C 1 2 N GLU A 176 ? N GLU A 500 O ARG B 3   ? O ARG B 3   
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    19 
_struct_site.details              'BINDING SITE FOR CHAIN B OF MALT1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 LYS A 34  ? LYS A 358 . ? 1_555 ? 
2  AC1 19 LEU A 35  ? LEU A 359 . ? 1_555 ? 
3  AC1 19 ALA A 37  ? ALA A 361 . ? 1_555 ? 
4  AC1 19 PRO A 38  ? PRO A 362 . ? 1_555 ? 
5  AC1 19 ASP A 41  ? ASP A 365 . ? 1_555 ? 
6  AC1 19 ALA A 89  ? ALA A 413 . ? 1_555 ? 
7  AC1 19 GLY A 90  ? GLY A 414 . ? 1_555 ? 
8  AC1 19 HIS A 91  ? HIS A 415 . ? 1_555 ? 
9  AC1 19 GLY A 92  ? GLY A 416 . ? 1_555 ? 
10 AC1 19 ASP A 138 ? ASP A 462 . ? 1_555 ? 
11 AC1 19 CYS A 140 ? CYS A 464 . ? 1_555 ? 
12 AC1 19 GLU A 173 ? GLU A 497 . ? 1_555 ? 
13 AC1 19 ALA A 174 ? ALA A 498 . ? 1_555 ? 
14 AC1 19 PHE A 175 ? PHE A 499 . ? 1_555 ? 
15 AC1 19 GLU A 176 ? GLU A 500 . ? 1_555 ? 
16 AC1 19 ILE A 177 ? ILE A 501 . ? 1_555 ? 
17 AC1 19 GLN A 178 ? GLN A 502 . ? 1_555 ? 
18 AC1 19 LEU A 217 ? LEU A 541 . ? 1_555 ? 
19 AC1 19 HOH D .   ? HOH B 101 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3V4O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3V4O 
_atom_sites.fract_transf_matrix[1][1]   0.012903 
_atom_sites.fract_transf_matrix[1][2]   0.007450 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014899 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005540 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 12  ? -56.926 23.907 -1.440  1.00 49.14 ? 336 ASP A N   1 
ATOM   2    C CA  . ASP A 1 12  ? -56.451 23.763 -0.032  1.00 48.03 ? 336 ASP A CA  1 
ATOM   3    C C   . ASP A 1 12  ? -55.514 22.553 0.225   1.00 49.28 ? 336 ASP A C   1 
ATOM   4    O O   . ASP A 1 12  ? -55.006 22.387 1.339   1.00 51.75 ? 336 ASP A O   1 
ATOM   5    C CB  . ASP A 1 12  ? -57.638 23.703 0.930   1.00 41.28 ? 336 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 12  ? -57.448 22.628 1.997   1.00 40.12 ? 336 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 12  ? -56.713 22.863 2.998   1.00 37.25 ? 336 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 12  ? -58.019 21.522 1.831   1.00 39.35 ? 336 ASP A OD2 1 
ATOM   9    N N   . GLN A 1 13  ? -55.308 21.687 -0.764  1.00 47.58 ? 337 GLN A N   1 
ATOM   10   C CA  . GLN A 1 13  ? -54.198 20.736 -0.657  1.00 44.68 ? 337 GLN A CA  1 
ATOM   11   C C   . GLN A 1 13  ? -52.976 21.519 -1.142  1.00 40.57 ? 337 GLN A C   1 
ATOM   12   O O   . GLN A 1 13  ? -53.007 22.084 -2.238  1.00 40.34 ? 337 GLN A O   1 
ATOM   13   C CB  . GLN A 1 13  ? -54.442 19.480 -1.504  1.00 45.25 ? 337 GLN A CB  1 
ATOM   14   C CG  . GLN A 1 13  ? -53.192 18.649 -1.835  1.00 46.66 ? 337 GLN A CG  1 
ATOM   15   C CD  . GLN A 1 13  ? -52.667 17.849 -0.655  1.00 50.15 ? 337 GLN A CD  1 
ATOM   16   O OE1 . GLN A 1 13  ? -53.380 17.035 -0.088  1.00 53.55 ? 337 GLN A OE1 1 
ATOM   17   N NE2 . GLN A 1 13  ? -51.408 18.070 -0.292  1.00 49.35 ? 337 GLN A NE2 1 
ATOM   18   N N   . PRO A 1 14  ? -51.934 21.634 -0.297  1.00 35.94 ? 338 PRO A N   1 
ATOM   19   C CA  . PRO A 1 14  ? -50.716 22.298 -0.781  1.00 32.70 ? 338 PRO A CA  1 
ATOM   20   C C   . PRO A 1 14  ? -50.117 21.460 -1.922  1.00 29.80 ? 338 PRO A C   1 
ATOM   21   O O   . PRO A 1 14  ? -50.184 20.240 -1.894  1.00 28.17 ? 338 PRO A O   1 
ATOM   22   C CB  . PRO A 1 14  ? -49.784 22.293 0.442   1.00 33.72 ? 338 PRO A CB  1 
ATOM   23   C CG  . PRO A 1 14  ? -50.686 22.048 1.633   1.00 33.53 ? 338 PRO A CG  1 
ATOM   24   C CD  . PRO A 1 14  ? -51.847 21.245 1.121   1.00 36.25 ? 338 PRO A CD  1 
ATOM   25   N N   . LEU A 1 15  ? -49.578 22.126 -2.925  1.00 28.70 ? 339 LEU A N   1 
ATOM   26   C CA  . LEU A 1 15  ? -49.021 21.454 -4.078  1.00 29.21 ? 339 LEU A CA  1 
ATOM   27   C C   . LEU A 1 15  ? -47.619 21.952 -4.306  1.00 26.46 ? 339 LEU A C   1 
ATOM   28   O O   . LEU A 1 15  ? -47.277 23.083 -3.947  1.00 24.96 ? 339 LEU A O   1 
ATOM   29   C CB  . LEU A 1 15  ? -49.836 21.777 -5.331  1.00 30.97 ? 339 LEU A CB  1 
ATOM   30   C CG  . LEU A 1 15  ? -51.355 21.586 -5.281  1.00 36.04 ? 339 LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 15  ? -52.032 22.419 -6.387  1.00 41.03 ? 339 LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 15  ? -51.704 20.126 -5.388  1.00 40.44 ? 339 LEU A CD2 1 
ATOM   33   N N   . ALA A 1 16  ? -46.820 21.090 -4.917  1.00 24.44 ? 340 ALA A N   1 
ATOM   34   C CA  . ALA A 1 16  ? -45.481 21.409 -5.347  1.00 23.48 ? 340 ALA A CA  1 
ATOM   35   C C   . ALA A 1 16  ? -45.485 21.637 -6.843  1.00 24.68 ? 340 ALA A C   1 
ATOM   36   O O   . ALA A 1 16  ? -46.198 20.954 -7.581  1.00 28.46 ? 340 ALA A O   1 
ATOM   37   C CB  . ALA A 1 16  ? -44.559 20.234 -5.009  1.00 23.72 ? 340 ALA A CB  1 
ATOM   38   N N   . LYS A 1 17  ? -44.683 22.577 -7.310  1.00 25.68 ? 341 LYS A N   1 
ATOM   39   C CA  . LYS A 1 17  ? -44.517 22.767 -8.744  1.00 27.16 ? 341 LYS A CA  1 
ATOM   40   C C   . LYS A 1 17  ? -43.722 21.604 -9.338  1.00 28.61 ? 341 LYS A C   1 
ATOM   41   O O   . LYS A 1 17  ? -44.010 21.150 -10.447 1.00 30.24 ? 341 LYS A O   1 
ATOM   42   C CB  . LYS A 1 17  ? -43.786 24.068 -9.049  1.00 24.83 ? 341 LYS A CB  1 
ATOM   43   C CG  . LYS A 1 17  ? -44.244 24.688 -10.345 1.00 40.35 ? 341 LYS A CG  1 
ATOM   44   C CD  . LYS A 1 17  ? -43.076 25.184 -11.182 1.00 52.47 ? 341 LYS A CD  1 
ATOM   45   C CE  . LYS A 1 17  ? -43.444 25.172 -12.667 1.00 59.58 ? 341 LYS A CE  1 
ATOM   46   N NZ  . LYS A 1 17  ? -42.240 25.400 -13.517 1.00 64.95 ? 341 LYS A NZ  1 
ATOM   47   N N   . ASP A 1 18  ? -42.708 21.148 -8.596  1.00 26.40 ? 342 ASP A N   1 
ATOM   48   C CA  . ASP A 1 18  ? -41.961 19.936 -8.897  1.00 25.06 ? 342 ASP A CA  1 
ATOM   49   C C   . ASP A 1 18  ? -41.321 19.517 -7.578  1.00 24.57 ? 342 ASP A C   1 
ATOM   50   O O   . ASP A 1 18  ? -41.398 20.261 -6.598  1.00 24.29 ? 342 ASP A O   1 
ATOM   51   C CB  . ASP A 1 18  ? -40.875 20.228 -9.933  1.00 25.65 ? 342 ASP A CB  1 
ATOM   52   C CG  . ASP A 1 18  ? -40.311 18.945 -10.595 1.00 29.82 ? 342 ASP A CG  1 
ATOM   53   O OD1 . ASP A 1 18  ? -40.708 17.822 -10.209 1.00 29.73 ? 342 ASP A OD1 1 
ATOM   54   O OD2 . ASP A 1 18  ? -39.430 19.074 -11.479 1.00 31.11 ? 342 ASP A OD2 1 
ATOM   55   N N   . LYS A 1 19  ? -40.700 18.338 -7.538  1.00 20.43 ? 343 LYS A N   1 
ATOM   56   C CA  . LYS A 1 19  ? -40.029 17.869 -6.334  1.00 19.78 ? 343 LYS A CA  1 
ATOM   57   C C   . LYS A 1 19  ? -38.647 17.344 -6.712  1.00 20.71 ? 343 LYS A C   1 
ATOM   58   O O   . LYS A 1 19  ? -38.510 16.382 -7.490  1.00 20.13 ? 343 LYS A O   1 
ATOM   59   C CB  . LYS A 1 19  ? -40.876 16.837 -5.574  1.00 18.30 ? 343 LYS A CB  1 
ATOM   60   C CG  . LYS A 1 19  ? -42.213 17.438 -5.035  1.00 22.00 ? 343 LYS A CG  1 
ATOM   61   C CD  . LYS A 1 19  ? -42.986 16.542 -4.029  1.00 22.02 ? 343 LYS A CD  1 
ATOM   62   C CE  . LYS A 1 19  ? -43.547 15.255 -4.644  1.00 20.20 ? 343 LYS A CE  1 
ATOM   63   N NZ  . LYS A 1 19  ? -44.401 14.489 -3.679  1.00 20.52 ? 343 LYS A NZ  1 
ATOM   64   N N   . VAL A 1 20  ? -37.626 18.014 -6.194  1.00 18.84 ? 344 VAL A N   1 
ATOM   65   C CA  . VAL A 1 20  ? -36.252 17.813 -6.629  1.00 18.88 ? 344 VAL A CA  1 
ATOM   66   C C   . VAL A 1 20  ? -35.326 17.553 -5.435  1.00 18.85 ? 344 VAL A C   1 
ATOM   67   O O   . VAL A 1 20  ? -35.387 18.265 -4.452  1.00 20.19 ? 344 VAL A O   1 
ATOM   68   C CB  . VAL A 1 20  ? -35.778 19.081 -7.376  1.00 20.83 ? 344 VAL A CB  1 
ATOM   69   C CG1 . VAL A 1 20  ? -34.333 18.950 -7.806  1.00 22.01 ? 344 VAL A CG1 1 
ATOM   70   C CG2 . VAL A 1 20  ? -36.710 19.345 -8.622  1.00 22.24 ? 344 VAL A CG2 1 
ATOM   71   N N   . ALA A 1 21  ? -34.452 16.557 -5.503  1.00 16.36 ? 345 ALA A N   1 
ATOM   72   C CA  . ALA A 1 21  ? -33.558 16.319 -4.373  1.00 14.63 ? 345 ALA A CA  1 
ATOM   73   C C   . ALA A 1 21  ? -32.134 16.065 -4.840  1.00 17.38 ? 345 ALA A C   1 
ATOM   74   O O   . ALA A 1 21  ? -31.924 15.492 -5.905  1.00 19.27 ? 345 ALA A O   1 
ATOM   75   C CB  . ALA A 1 21  ? -34.061 15.150 -3.518  1.00 14.87 ? 345 ALA A CB  1 
ATOM   76   N N   . LEU A 1 22  ? -31.164 16.535 -4.056  1.00 15.65 ? 346 LEU A N   1 
ATOM   77   C CA  . LEU A 1 22  ? -29.783 16.155 -4.214  1.00 15.81 ? 346 LEU A CA  1 
ATOM   78   C C   . LEU A 1 22  ? -29.296 15.383 -2.975  1.00 16.35 ? 346 LEU A C   1 
ATOM   79   O O   . LEU A 1 22  ? -29.447 15.870 -1.837  1.00 17.32 ? 346 LEU A O   1 
ATOM   80   C CB  . LEU A 1 22  ? -28.923 17.411 -4.439  1.00 13.80 ? 346 LEU A CB  1 
ATOM   81   C CG  . LEU A 1 22  ? -27.400 17.227 -4.398  1.00 13.01 ? 346 LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 22  ? -26.913 16.358 -5.508  1.00 11.47 ? 346 LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 22  ? -26.719 18.622 -4.438  1.00 14.75 ? 346 LEU A CD2 1 
ATOM   84   N N   . LEU A 1 23  ? -28.677 14.220 -3.189  1.00 13.10 ? 347 LEU A N   1 
ATOM   85   C CA  . LEU A 1 23  ? -28.222 13.396 -2.081  1.00 15.00 ? 347 LEU A CA  1 
ATOM   86   C C   . LEU A 1 23  ? -26.756 13.131 -2.266  1.00 15.92 ? 347 LEU A C   1 
ATOM   87   O O   . LEU A 1 23  ? -26.362 12.693 -3.334  1.00 15.78 ? 347 LEU A O   1 
ATOM   88   C CB  . LEU A 1 23  ? -28.962 12.041 -2.057  1.00 14.06 ? 347 LEU A CB  1 
ATOM   89   C CG  . LEU A 1 23  ? -30.339 11.882 -1.410  1.00 17.34 ? 347 LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 23  ? -31.270 13.053 -1.714  1.00 13.43 ? 347 LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 23  ? -30.991 10.518 -1.766  1.00 15.79 ? 347 LEU A CD2 1 
ATOM   92   N N   . ILE A 1 24  ? -25.957 13.347 -1.225  1.00 14.79 ? 348 ILE A N   1 
ATOM   93   C CA  . ILE A 1 24  ? -24.503 13.148 -1.320  1.00 14.27 ? 348 ILE A CA  1 
ATOM   94   C C   . ILE A 1 24  ? -24.063 12.318 -0.149  1.00 14.99 ? 348 ILE A C   1 
ATOM   95   O O   . ILE A 1 24  ? -24.380 12.643 1.003   1.00 15.43 ? 348 ILE A O   1 
ATOM   96   C CB  . ILE A 1 24  ? -23.753 14.498 -1.336  1.00 15.59 ? 348 ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 24  ? -24.134 15.287 -2.593  1.00 18.15 ? 348 ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 24  ? -22.250 14.309 -1.285  1.00 15.86 ? 348 ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 24  ? -23.609 16.744 -2.633  1.00 17.66 ? 348 ILE A CD1 1 
ATOM   100  N N   . GLY A 1 25  ? -23.352 11.222 -0.417  1.00 12.49 ? 349 GLY A N   1 
ATOM   101  C CA  . GLY A 1 25  ? -22.737 10.461 0.685   1.00 13.31 ? 349 GLY A CA  1 
ATOM   102  C C   . GLY A 1 25  ? -21.231 10.360 0.495   1.00 16.00 ? 349 GLY A C   1 
ATOM   103  O O   . GLY A 1 25  ? -20.753 9.848  -0.527  1.00 18.41 ? 349 GLY A O   1 
ATOM   104  N N   . ASN A 1 26  ? -20.474 10.863 1.461   1.00 11.64 ? 350 ASN A N   1 
ATOM   105  C CA  . ASN A 1 26  ? -19.020 10.896 1.347   1.00 15.18 ? 350 ASN A CA  1 
ATOM   106  C C   . ASN A 1 26  ? -18.422 9.920  2.335   1.00 16.72 ? 350 ASN A C   1 
ATOM   107  O O   . ASN A 1 26  ? -18.760 9.947  3.518   1.00 15.16 ? 350 ASN A O   1 
ATOM   108  C CB  . ASN A 1 26  ? -18.510 12.299 1.638   1.00 14.51 ? 350 ASN A CB  1 
ATOM   109  C CG  . ASN A 1 26  ? -18.703 13.260 0.470   1.00 18.58 ? 350 ASN A CG  1 
ATOM   110  O OD1 . ASN A 1 26  ? -18.945 12.846 -0.687  1.00 18.75 ? 350 ASN A OD1 1 
ATOM   111  N ND2 . ASN A 1 26  ? -18.530 14.551 0.750   1.00 19.05 ? 350 ASN A ND2 1 
ATOM   112  N N   . MET A 1 27  ? -17.543 9.048  1.841   1.00 16.83 ? 351 MET A N   1 
ATOM   113  C CA  . MET A 1 27  ? -16.998 7.960  2.636   1.00 19.93 ? 351 MET A CA  1 
ATOM   114  C C   . MET A 1 27  ? -15.481 7.814  2.584   1.00 21.84 ? 351 MET A C   1 
ATOM   115  O O   . MET A 1 27  ? -14.835 7.640  3.615   1.00 21.55 ? 351 MET A O   1 
ATOM   116  C CB  . MET A 1 27  ? -17.571 6.652  2.129   1.00 19.44 ? 351 MET A CB  1 
ATOM   117  C CG  . MET A 1 27  ? -19.015 6.523  2.408   1.00 24.75 ? 351 MET A CG  1 
ATOM   118  S SD  . MET A 1 27  ? -19.689 5.214  1.430   1.00 29.07 ? 351 MET A SD  1 
ATOM   119  C CE  . MET A 1 27  ? -19.802 6.061  -0.132  1.00 31.68 ? 351 MET A CE  1 
ATOM   120  N N   . ASN A 1 28  ? -14.927 7.874  1.373   1.00 22.54 ? 352 ASN A N   1 
ATOM   121  C CA  . ASN A 1 28  ? -13.517 7.529  1.141   1.00 25.58 ? 352 ASN A CA  1 
ATOM   122  C C   . ASN A 1 28  ? -12.676 8.782  1.279   1.00 25.70 ? 352 ASN A C   1 
ATOM   123  O O   . ASN A 1 28  ? -12.211 9.333  0.281   1.00 24.89 ? 352 ASN A O   1 
ATOM   124  C CB  . ASN A 1 28  ? -13.384 6.918  -0.277  1.00 29.15 ? 352 ASN A CB  1 
ATOM   125  C CG  . ASN A 1 28  ? -11.947 6.477  -0.629  1.00 36.16 ? 352 ASN A CG  1 
ATOM   126  O OD1 . ASN A 1 28  ? -11.103 6.235  0.238   1.00 44.93 ? 352 ASN A OD1 1 
ATOM   127  N ND2 . ASN A 1 28  ? -11.675 6.391  -1.924  1.00 40.54 ? 352 ASN A ND2 1 
ATOM   128  N N   . TYR A 1 29  ? -12.538 9.280  2.506   1.00 22.41 ? 353 TYR A N   1 
ATOM   129  C CA  . TYR A 1 29  ? -11.772 10.504 2.712   1.00 24.37 ? 353 TYR A CA  1 
ATOM   130  C C   . TYR A 1 29  ? -10.281 10.210 2.588   1.00 25.42 ? 353 TYR A C   1 
ATOM   131  O O   . TYR A 1 29  ? -9.799  9.192  3.096   1.00 23.72 ? 353 TYR A O   1 
ATOM   132  C CB  . TYR A 1 29  ? -12.090 11.128 4.080   1.00 21.88 ? 353 TYR A CB  1 
ATOM   133  C CG  . TYR A 1 29  ? -13.448 11.823 4.111   1.00 19.67 ? 353 TYR A CG  1 
ATOM   134  C CD1 . TYR A 1 29  ? -13.549 13.195 3.913   1.00 20.16 ? 353 TYR A CD1 1 
ATOM   135  C CD2 . TYR A 1 29  ? -14.621 11.104 4.317   1.00 18.50 ? 353 TYR A CD2 1 
ATOM   136  C CE1 . TYR A 1 29  ? -14.797 13.842 3.908   1.00 17.39 ? 353 TYR A CE1 1 
ATOM   137  C CE2 . TYR A 1 29  ? -15.860 11.741 4.334   1.00 16.63 ? 353 TYR A CE2 1 
ATOM   138  C CZ  . TYR A 1 29  ? -15.935 13.110 4.120   1.00 16.41 ? 353 TYR A CZ  1 
ATOM   139  O OH  . TYR A 1 29  ? -17.152 13.760 4.154   1.00 17.04 ? 353 TYR A OH  1 
ATOM   140  N N   . ARG A 1 30  ? -9.559  11.116 1.942   1.00 27.28 ? 354 ARG A N   1 
ATOM   141  C CA  . ARG A 1 30  ? -8.127  10.925 1.729   1.00 30.49 ? 354 ARG A CA  1 
ATOM   142  C C   . ARG A 1 30  ? -7.333  11.217 2.971   1.00 30.94 ? 354 ARG A C   1 
ATOM   143  O O   . ARG A 1 30  ? -6.329  10.550 3.235   1.00 33.04 ? 354 ARG A O   1 
ATOM   144  C CB  . ARG A 1 30  ? -7.649  11.786 0.572   1.00 30.95 ? 354 ARG A CB  1 
ATOM   145  C CG  . ARG A 1 30  ? -8.182  11.262 -0.746  1.00 41.64 ? 354 ARG A CG  1 
ATOM   146  C CD  . ARG A 1 30  ? -7.977  12.258 -1.851  1.00 51.21 ? 354 ARG A CD  1 
ATOM   147  N NE  . ARG A 1 30  ? -8.866  12.000 -2.978  1.00 53.47 ? 354 ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 30  ? -8.922  12.778 -4.052  1.00 57.25 ? 354 ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 30  ? -8.144  13.853 -4.129  1.00 55.65 ? 354 ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 30  ? -9.755  12.489 -5.040  1.00 56.96 ? 354 ARG A NH2 1 
ATOM   151  N N   . GLU A 1 31  ? -7.798  12.182 3.760   1.00 29.06 ? 355 GLU A N   1 
ATOM   152  C CA  . GLU A 1 31  ? -7.033  12.639 4.914   1.00 30.52 ? 355 GLU A CA  1 
ATOM   153  C C   . GLU A 1 31  ? -7.805  12.624 6.213   1.00 29.12 ? 355 GLU A C   1 
ATOM   154  O O   . GLU A 1 31  ? -7.344  13.194 7.200   1.00 28.79 ? 355 GLU A O   1 
ATOM   155  C CB  . GLU A 1 31  ? -6.555  14.075 4.676   1.00 30.88 ? 355 GLU A CB  1 
ATOM   156  C CG  . GLU A 1 31  ? -5.882  14.259 3.343   1.00 38.78 ? 355 GLU A CG  1 
ATOM   157  C CD  . GLU A 1 31  ? -4.399  14.037 3.436   1.00 48.77 ? 355 GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 31  ? -3.979  12.876 3.608   1.00 49.92 ? 355 GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 31  ? -3.655  15.037 3.361   1.00 57.13 ? 355 GLU A OE2 1 
ATOM   160  N N   . HIS A 1 32  ? -8.977  11.992 6.214   1.00 25.90 ? 356 HIS A N   1 
ATOM   161  C CA  . HIS A 1 32  ? -9.778  11.913 7.419   1.00 23.55 ? 356 HIS A CA  1 
ATOM   162  C C   . HIS A 1 32  ? -10.316 10.507 7.579   1.00 22.70 ? 356 HIS A C   1 
ATOM   163  O O   . HIS A 1 32  ? -10.257 9.732  6.647   1.00 23.68 ? 356 HIS A O   1 
ATOM   164  C CB  . HIS A 1 32  ? -10.876 12.982 7.351   1.00 23.00 ? 356 HIS A CB  1 
ATOM   165  C CG  . HIS A 1 32  ? -10.320 14.370 7.302   1.00 23.56 ? 356 HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 32  ? -10.068 15.028 6.116   1.00 29.18 ? 356 HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 32  ? -9.889  15.193 8.291   1.00 20.67 ? 356 HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 32  ? -9.535  16.210 6.378   1.00 25.97 ? 356 HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 32  ? -9.425  16.339 7.690   1.00 27.87 ? 356 HIS A NE2 1 
ATOM   170  N N   . PRO A 1 33  ? -10.828 10.157 8.763   1.00 21.74 ? 357 PRO A N   1 
ATOM   171  C CA  . PRO A 1 33  ? -11.322 8.791  8.875   1.00 22.37 ? 357 PRO A CA  1 
ATOM   172  C C   . PRO A 1 33  ? -12.407 8.465  7.845   1.00 22.50 ? 357 PRO A C   1 
ATOM   173  O O   . PRO A 1 33  ? -13.294 9.306  7.538   1.00 21.89 ? 357 PRO A O   1 
ATOM   174  C CB  . PRO A 1 33  ? -11.862 8.729  10.313  1.00 23.92 ? 357 PRO A CB  1 
ATOM   175  C CG  . PRO A 1 33  ? -11.079 9.789  11.038  1.00 24.14 ? 357 PRO A CG  1 
ATOM   176  C CD  . PRO A 1 33  ? -10.865 10.884 10.045  1.00 21.82 ? 357 PRO A CD  1 
ATOM   177  N N   . LYS A 1 34  ? -12.311 7.269  7.276   1.00 22.25 ? 358 LYS A N   1 
ATOM   178  C CA  . LYS A 1 34  ? -13.279 6.815  6.287   1.00 23.95 ? 358 LYS A CA  1 
ATOM   179  C C   . LYS A 1 34  ? -14.594 6.429  6.956   1.00 22.42 ? 358 LYS A C   1 
ATOM   180  O O   . LYS A 1 34  ? -14.615 6.048  8.114   1.00 21.04 ? 358 LYS A O   1 
ATOM   181  C CB  . LYS A 1 34  ? -12.733 5.629  5.486   1.00 26.96 ? 358 LYS A CB  1 
ATOM   182  C CG  . LYS A 1 34  ? -11.490 5.995  4.634   1.00 27.78 ? 358 LYS A CG  1 
ATOM   183  C CD  . LYS A 1 34  ? -11.111 4.867  3.689   1.00 34.40 ? 358 LYS A CD  1 
ATOM   184  C CE  . LYS A 1 34  ? -9.704  5.049  3.103   1.00 34.66 ? 358 LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 34  ? -9.459  6.440  2.772   1.00 40.22 ? 358 LYS A NZ  1 
ATOM   186  N N   . LEU A 1 35  ? -15.690 6.550  6.215   1.00 20.54 ? 359 LEU A N   1 
ATOM   187  C CA  . LEU A 1 35  ? -17.014 6.194  6.718   1.00 21.02 ? 359 LEU A CA  1 
ATOM   188  C C   . LEU A 1 35  ? -17.554 5.055  5.862   1.00 22.13 ? 359 LEU A C   1 
ATOM   189  O O   . LEU A 1 35  ? -17.074 4.837  4.737   1.00 22.64 ? 359 LEU A O   1 
ATOM   190  C CB  . LEU A 1 35  ? -17.941 7.417  6.614   1.00 19.30 ? 359 LEU A CB  1 
ATOM   191  C CG  . LEU A 1 35  ? -17.500 8.635  7.445   1.00 16.24 ? 359 LEU A CG  1 
ATOM   192  C CD1 . LEU A 1 35  ? -18.482 9.800  7.285   1.00 15.87 ? 359 LEU A CD1 1 
ATOM   193  C CD2 . LEU A 1 35  ? -17.396 8.237  8.908   1.00 17.47 ? 359 LEU A CD2 1 
ATOM   194  N N   . LYS A 1 36  ? -18.571 4.350  6.347   1.00 20.52 ? 360 LYS A N   1 
ATOM   195  C CA  . LYS A 1 36  ? -19.103 3.217  5.571   1.00 21.59 ? 360 LYS A CA  1 
ATOM   196  C C   . LYS A 1 36  ? -20.565 3.373  5.197   1.00 19.29 ? 360 LYS A C   1 
ATOM   197  O O   . LYS A 1 36  ? -20.964 3.132  4.050   1.00 19.84 ? 360 LYS A O   1 
ATOM   198  C CB  . LYS A 1 36  ? -18.898 1.904  6.324   1.00 21.92 ? 360 LYS A CB  1 
ATOM   199  C CG  . LYS A 1 36  ? -17.413 1.502  6.352   1.00 32.11 ? 360 LYS A CG  1 
ATOM   200  C CD  . LYS A 1 36  ? -17.209 0.138  6.995   1.00 42.77 ? 360 LYS A CD  1 
ATOM   201  C CE  . LYS A 1 36  ? -15.815 -0.403 6.641   1.00 50.74 ? 360 LYS A CE  1 
ATOM   202  N NZ  . LYS A 1 36  ? -15.341 -1.425 7.632   1.00 54.93 ? 360 LYS A NZ  1 
ATOM   203  N N   . ALA A 1 37  ? -21.349 3.775  6.179   1.00 17.55 ? 361 ALA A N   1 
ATOM   204  C CA  . ALA A 1 37  ? -22.806 3.873  6.046   1.00 17.10 ? 361 ALA A CA  1 
ATOM   205  C C   . ALA A 1 37  ? -23.408 4.902  5.060   1.00 16.65 ? 361 ALA A C   1 
ATOM   206  O O   . ALA A 1 37  ? -24.583 4.757  4.670   1.00 16.92 ? 361 ALA A O   1 
ATOM   207  C CB  . ALA A 1 37  ? -23.425 4.025  7.475   1.00 17.46 ? 361 ALA A CB  1 
ATOM   208  N N   . PRO A 1 38  ? -22.659 5.987  4.689   1.00 15.16 ? 362 PRO A N   1 
ATOM   209  C CA  . PRO A 1 38  ? -23.302 6.903  3.748   1.00 14.42 ? 362 PRO A CA  1 
ATOM   210  C C   . PRO A 1 38  ? -23.823 6.216  2.499   1.00 14.71 ? 362 PRO A C   1 
ATOM   211  O O   . PRO A 1 38  ? -24.825 6.638  1.925   1.00 15.68 ? 362 PRO A O   1 
ATOM   212  C CB  . PRO A 1 38  ? -22.172 7.906  3.402   1.00 13.77 ? 362 PRO A CB  1 
ATOM   213  C CG  . PRO A 1 38  ? -21.446 8.014  4.704   1.00 13.01 ? 362 PRO A CG  1 
ATOM   214  C CD  . PRO A 1 38  ? -21.386 6.539  5.185   1.00 13.73 ? 362 PRO A CD  1 
ATOM   215  N N   . LEU A 1 39  ? -23.150 5.167  2.043   1.00 17.95 ? 363 LEU A N   1 
ATOM   216  C CA  . LEU A 1 39  ? -23.618 4.504  0.807   1.00 17.03 ? 363 LEU A CA  1 
ATOM   217  C C   . LEU A 1 39  ? -25.039 3.969  0.975   1.00 14.42 ? 363 LEU A C   1 
ATOM   218  O O   . LEU A 1 39  ? -25.979 4.278  0.222   1.00 15.28 ? 363 LEU A O   1 
ATOM   219  C CB  . LEU A 1 39  ? -22.661 3.382  0.431   1.00 18.76 ? 363 LEU A CB  1 
ATOM   220  C CG  . LEU A 1 39  ? -23.035 2.313  -0.597  1.00 27.56 ? 363 LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 39  ? -23.899 2.808  -1.698  1.00 29.05 ? 363 LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 39  ? -21.695 1.856  -1.191  1.00 39.85 ? 363 LEU A CD2 1 
ATOM   223  N N   . VAL A 1 40  ? -25.219 3.150  1.971   1.00 14.30 ? 364 VAL A N   1 
ATOM   224  C CA  A VAL A 1 40  ? -26.525 2.559  2.256   0.50 16.00 ? 364 VAL A CA  1 
ATOM   225  C CA  B VAL A 1 40  ? -26.562 2.613  2.151   0.50 15.66 ? 364 VAL A CA  1 
ATOM   226  C C   . VAL A 1 40  ? -27.582 3.648  2.628   1.00 16.75 ? 364 VAL A C   1 
ATOM   227  O O   . VAL A 1 40  ? -28.792 3.524  2.324   1.00 17.01 ? 364 VAL A O   1 
ATOM   228  C CB  A VAL A 1 40  ? -26.287 1.436  3.324   0.50 17.31 ? 364 VAL A CB  1 
ATOM   229  C CB  B VAL A 1 40  ? -26.580 1.401  3.048   0.50 16.12 ? 364 VAL A CB  1 
ATOM   230  C CG1 A VAL A 1 40  ? -27.254 1.454  4.451   0.50 14.40 ? 364 VAL A CG1 1 
ATOM   231  C CG1 B VAL A 1 40  ? -26.285 1.778  4.496   0.50 9.72  ? 364 VAL A CG1 1 
ATOM   232  C CG2 A VAL A 1 40  ? -26.099 0.025  2.643   0.50 13.46 ? 364 VAL A CG2 1 
ATOM   233  C CG2 B VAL A 1 40  ? -27.873 0.744  2.898   0.50 17.18 ? 364 VAL A CG2 1 
ATOM   234  N N   . ASP A 1 41  ? -27.128 4.715  3.295   1.00 15.44 ? 365 ASP A N   1 
ATOM   235  C CA  . ASP A 1 41  ? -28.070 5.789  3.696   1.00 13.05 ? 365 ASP A CA  1 
ATOM   236  C C   . ASP A 1 41  ? -28.585 6.491  2.454   1.00 13.22 ? 365 ASP A C   1 
ATOM   237  O O   . ASP A 1 41  ? -29.782 6.770  2.307   1.00 14.14 ? 365 ASP A O   1 
ATOM   238  C CB  . ASP A 1 41  ? -27.396 6.789  4.638   1.00 11.49 ? 365 ASP A CB  1 
ATOM   239  C CG  . ASP A 1 41  ? -27.168 6.228  6.027   1.00 18.16 ? 365 ASP A CG  1 
ATOM   240  O OD1 . ASP A 1 41  ? -27.685 5.128  6.314   1.00 19.48 ? 365 ASP A OD1 1 
ATOM   241  O OD2 . ASP A 1 41  ? -26.475 6.889  6.838   1.00 21.59 ? 365 ASP A OD2 1 
ATOM   242  N N   . VAL A 1 42  ? -27.674 6.774  1.537   1.00 13.76 ? 366 VAL A N   1 
ATOM   243  C CA  . VAL A 1 42  ? -28.049 7.413  0.297   1.00 12.96 ? 366 VAL A CA  1 
ATOM   244  C C   . VAL A 1 42  ? -28.894 6.483  -0.552  1.00 14.33 ? 366 VAL A C   1 
ATOM   245  O O   . VAL A 1 42  ? -29.880 6.895  -1.135  1.00 14.42 ? 366 VAL A O   1 
ATOM   246  C CB  . VAL A 1 42  ? -26.780 7.903  -0.485  1.00 13.19 ? 366 VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 42  ? -27.115 8.280  -1.908  1.00 13.83 ? 366 VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 42  ? -26.182 9.142  0.239   1.00 14.92 ? 366 VAL A CG2 1 
ATOM   249  N N   . TYR A 1 43  ? -28.498 5.222  -0.651  1.00 16.02 ? 367 TYR A N   1 
ATOM   250  C CA  . TYR A 1 43  ? -29.295 4.283  -1.433  1.00 15.35 ? 367 TYR A CA  1 
ATOM   251  C C   . TYR A 1 43  ? -30.747 4.277  -0.902  1.00 15.12 ? 367 TYR A C   1 
ATOM   252  O O   . TYR A 1 43  ? -31.702 4.348  -1.658  1.00 14.41 ? 367 TYR A O   1 
ATOM   253  C CB  . TYR A 1 43  ? -28.675 2.875  -1.357  1.00 14.50 ? 367 TYR A CB  1 
ATOM   254  C CG  . TYR A 1 43  ? -29.484 1.820  -2.115  1.00 16.70 ? 367 TYR A CG  1 
ATOM   255  C CD1 . TYR A 1 43  ? -29.240 1.573  -3.462  1.00 17.99 ? 367 TYR A CD1 1 
ATOM   256  C CD2 . TYR A 1 43  ? -30.516 1.111  -1.486  1.00 19.35 ? 367 TYR A CD2 1 
ATOM   257  C CE1 . TYR A 1 43  ? -29.979 0.633  -4.179  1.00 15.34 ? 367 TYR A CE1 1 
ATOM   258  C CE2 . TYR A 1 43  ? -31.269 0.142  -2.183  1.00 17.30 ? 367 TYR A CE2 1 
ATOM   259  C CZ  . TYR A 1 43  ? -30.982 -0.075 -3.546  1.00 19.00 ? 367 TYR A CZ  1 
ATOM   260  O OH  . TYR A 1 43  ? -31.701 -0.999 -4.286  1.00 19.73 ? 367 TYR A OH  1 
ATOM   261  N N   . GLU A 1 44  ? -30.899 4.208  0.409   1.00 15.17 ? 368 GLU A N   1 
ATOM   262  C CA  . GLU A 1 44  ? -32.236 4.077  1.009   1.00 16.41 ? 368 GLU A CA  1 
ATOM   263  C C   . GLU A 1 44  ? -33.110 5.329  0.736   1.00 16.96 ? 368 GLU A C   1 
ATOM   264  O O   . GLU A 1 44  ? -34.274 5.239  0.326   1.00 15.58 ? 368 GLU A O   1 
ATOM   265  C CB  . GLU A 1 44  ? -32.080 3.849  2.522   1.00 16.37 ? 368 GLU A CB  1 
ATOM   266  C CG  . GLU A 1 44  ? -33.413 3.821  3.322   1.00 22.08 ? 368 GLU A CG  1 
ATOM   267  C CD  . GLU A 1 44  ? -34.299 2.639  2.893   1.00 28.64 ? 368 GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 44  ? -33.755 1.559  2.590   1.00 29.00 ? 368 GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 44  ? -35.528 2.793  2.841   1.00 26.09 ? 368 GLU A OE2 1 
ATOM   270  N N   . LEU A 1 45  ? -32.527 6.514  0.926   1.00 17.78 ? 369 LEU A N   1 
ATOM   271  C CA  . LEU A 1 45  ? -33.300 7.757  0.813   1.00 16.16 ? 369 LEU A CA  1 
ATOM   272  C C   . LEU A 1 45  ? -33.614 7.990  -0.655  1.00 13.71 ? 369 LEU A C   1 
ATOM   273  O O   . LEU A 1 45  ? -34.659 8.519  -1.002  1.00 14.83 ? 369 LEU A O   1 
ATOM   274  C CB  . LEU A 1 45  ? -32.489 8.935  1.355   1.00 16.67 ? 369 LEU A CB  1 
ATOM   275  C CG  . LEU A 1 45  ? -33.134 10.045 2.173   1.00 25.95 ? 369 LEU A CG  1 
ATOM   276  C CD1 . LEU A 1 45  ? -32.419 11.356 1.918   1.00 9.78  ? 369 LEU A CD1 1 
ATOM   277  C CD2 . LEU A 1 45  ? -34.605 10.216 1.978   1.00 15.91 ? 369 LEU A CD2 1 
ATOM   278  N N   . THR A 1 46  ? -32.727 7.567  -1.539  1.00 13.50 ? 370 THR A N   1 
ATOM   279  C CA  . THR A 1 46  ? -33.026 7.667  -2.977  1.00 15.45 ? 370 THR A CA  1 
ATOM   280  C C   . THR A 1 46  ? -34.318 6.904  -3.332  1.00 17.70 ? 370 THR A C   1 
ATOM   281  O O   . THR A 1 46  ? -35.218 7.416  -4.007  1.00 16.05 ? 370 THR A O   1 
ATOM   282  C CB  . THR A 1 46  ? -31.836 7.097  -3.831  1.00 16.36 ? 370 THR A CB  1 
ATOM   283  O OG1 . THR A 1 46  ? -30.628 7.806  -3.479  1.00 15.62 ? 370 THR A OG1 1 
ATOM   284  C CG2 . THR A 1 46  ? -32.113 7.301  -5.299  1.00 16.29 ? 370 THR A CG2 1 
ATOM   285  N N   . ASN A 1 47  ? -34.387 5.663  -2.864  1.00 17.58 ? 371 ASN A N   1 
ATOM   286  C CA  . ASN A 1 47  ? -35.533 4.797  -3.090  1.00 22.84 ? 371 ASN A CA  1 
ATOM   287  C C   . ASN A 1 47  ? -36.834 5.399  -2.542  1.00 22.09 ? 371 ASN A C   1 
ATOM   288  O O   . ASN A 1 47  ? -37.844 5.514  -3.240  1.00 22.42 ? 371 ASN A O   1 
ATOM   289  C CB  . ASN A 1 47  ? -35.251 3.489  -2.345  1.00 26.81 ? 371 ASN A CB  1 
ATOM   290  C CG  . ASN A 1 47  ? -35.528 2.292  -3.177  1.00 42.00 ? 371 ASN A CG  1 
ATOM   291  O OD1 . ASN A 1 47  ? -34.608 1.728  -3.815  1.00 54.15 ? 371 ASN A OD1 1 
ATOM   292  N ND2 . ASN A 1 47  ? -36.804 1.888  -3.214  1.00 43.84 ? 371 ASN A ND2 1 
ATOM   293  N N   . LEU A 1 48  ? -36.793 5.782  -1.280  1.00 18.71 ? 372 LEU A N   1 
ATOM   294  C CA  . LEU A 1 48  ? -37.939 6.435  -0.626  1.00 21.34 ? 372 LEU A CA  1 
ATOM   295  C C   . LEU A 1 48  ? -38.399 7.712  -1.345  1.00 20.26 ? 372 LEU A C   1 
ATOM   296  O O   . LEU A 1 48  ? -39.583 7.892  -1.629  1.00 21.01 ? 372 LEU A O   1 
ATOM   297  C CB  . LEU A 1 48  ? -37.544 6.773  0.813   1.00 20.20 ? 372 LEU A CB  1 
ATOM   298  C CG  . LEU A 1 48  ? -37.844 5.910  2.031   1.00 27.09 ? 372 LEU A CG  1 
ATOM   299  C CD1 . LEU A 1 48  ? -38.301 4.525  1.703   1.00 29.10 ? 372 LEU A CD1 1 
ATOM   300  C CD2 . LEU A 1 48  ? -36.699 5.920  3.062   1.00 23.29 ? 372 LEU A CD2 1 
ATOM   301  N N   . LEU A 1 49  ? -37.471 8.616  -1.649  1.00 19.32 ? 373 LEU A N   1 
ATOM   302  C CA  . LEU A 1 49  ? -37.859 9.839  -2.332  1.00 18.05 ? 373 LEU A CA  1 
ATOM   303  C C   . LEU A 1 49  ? -38.362 9.581  -3.749  1.00 20.90 ? 373 LEU A C   1 
ATOM   304  O O   . LEU A 1 49  ? -39.242 10.304 -4.223  1.00 18.86 ? 373 LEU A O   1 
ATOM   305  C CB  . LEU A 1 49  ? -36.724 10.842 -2.391  1.00 17.63 ? 373 LEU A CB  1 
ATOM   306  C CG  . LEU A 1 49  ? -36.312 11.423 -1.036  1.00 20.27 ? 373 LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 49  ? -34.996 12.199 -1.157  1.00 16.61 ? 373 LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 49  ? -37.460 12.311 -0.475  1.00 13.19 ? 373 LEU A CD2 1 
ATOM   309  N N   . ARG A 1 50  ? -37.792 8.595  -4.455  1.00 19.62 ? 374 ARG A N   1 
ATOM   310  C CA  . ARG A 1 50  ? -38.384 8.244  -5.750  1.00 20.27 ? 374 ARG A CA  1 
ATOM   311  C C   . ARG A 1 50  ? -39.824 7.761  -5.597  1.00 19.35 ? 374 ARG A C   1 
ATOM   312  O O   . ARG A 1 50  ? -40.659 8.092  -6.425  1.00 20.59 ? 374 ARG A O   1 
ATOM   313  C CB  . ARG A 1 50  ? -37.543 7.235  -6.535  1.00 19.38 ? 374 ARG A CB  1 
ATOM   314  C CG  . ARG A 1 50  ? -36.413 7.925  -7.260  1.00 20.99 ? 374 ARG A CG  1 
ATOM   315  C CD  . ARG A 1 50  ? -35.360 6.975  -7.802  1.00 27.23 ? 374 ARG A CD  1 
ATOM   316  N NE  . ARG A 1 50  ? -34.297 7.764  -8.414  1.00 28.45 ? 374 ARG A NE  1 
ATOM   317  C CZ  . ARG A 1 50  ? -33.083 7.314  -8.684  1.00 33.97 ? 374 ARG A CZ  1 
ATOM   318  N NH1 . ARG A 1 50  ? -32.763 6.052  -8.422  1.00 35.36 ? 374 ARG A NH1 1 
ATOM   319  N NH2 . ARG A 1 50  ? -32.191 8.134  -9.208  1.00 34.91 ? 374 ARG A NH2 1 
ATOM   320  N N   . GLN A 1 51  ? -40.119 7.008  -4.536  1.00 20.03 ? 375 GLN A N   1 
ATOM   321  C CA  . GLN A 1 51  ? -41.496 6.579  -4.283  1.00 22.79 ? 375 GLN A CA  1 
ATOM   322  C C   . GLN A 1 51  ? -42.418 7.765  -4.107  1.00 25.04 ? 375 GLN A C   1 
ATOM   323  O O   . GLN A 1 51  ? -43.610 7.672  -4.427  1.00 26.73 ? 375 GLN A O   1 
ATOM   324  C CB  . GLN A 1 51  ? -41.581 5.710  -3.042  1.00 24.04 ? 375 GLN A CB  1 
ATOM   325  C CG  . GLN A 1 51  ? -40.900 4.380  -3.213  1.00 26.54 ? 375 GLN A CG  1 
ATOM   326  C CD  . GLN A 1 51  ? -41.158 3.502  -2.042  1.00 31.94 ? 375 GLN A CD  1 
ATOM   327  O OE1 . GLN A 1 51  ? -42.314 3.289  -1.668  1.00 33.09 ? 375 GLN A OE1 1 
ATOM   328  N NE2 . GLN A 1 51  ? -40.092 3.007  -1.422  1.00 32.07 ? 375 GLN A NE2 1 
ATOM   329  N N   . LEU A 1 52  ? -41.866 8.874  -3.597  1.00 24.49 ? 376 LEU A N   1 
ATOM   330  C CA  . LEU A 1 52  ? -42.624 10.111 -3.387  1.00 25.11 ? 376 LEU A CA  1 
ATOM   331  C C   . LEU A 1 52  ? -42.561 11.054 -4.583  1.00 24.15 ? 376 LEU A C   1 
ATOM   332  O O   . LEU A 1 52  ? -42.884 12.235 -4.464  1.00 23.36 ? 376 LEU A O   1 
ATOM   333  C CB  . LEU A 1 52  ? -42.136 10.847 -2.132  1.00 22.52 ? 376 LEU A CB  1 
ATOM   334  C CG  . LEU A 1 52  ? -42.311 10.070 -0.836  1.00 24.49 ? 376 LEU A CG  1 
ATOM   335  C CD1 . LEU A 1 52  ? -41.505 10.714 0.293   1.00 27.84 ? 376 LEU A CD1 1 
ATOM   336  C CD2 . LEU A 1 52  ? -43.761 9.935  -0.442  1.00 30.07 ? 376 LEU A CD2 1 
ATOM   337  N N   . ASP A 1 53  ? -42.120 10.538 -5.723  1.00 22.50 ? 377 ASP A N   1 
ATOM   338  C CA  . ASP A 1 53  ? -42.134 11.297 -6.977  1.00 23.61 ? 377 ASP A CA  1 
ATOM   339  C C   . ASP A 1 53  ? -41.128 12.429 -7.080  1.00 22.82 ? 377 ASP A C   1 
ATOM   340  O O   . ASP A 1 53  ? -41.281 13.311 -7.905  1.00 23.09 ? 377 ASP A O   1 
ATOM   341  C CB  . ASP A 1 53  ? -43.557 11.740 -7.361  1.00 25.84 ? 377 ASP A CB  1 
ATOM   342  C CG  . ASP A 1 53  ? -44.468 10.537 -7.634  1.00 30.52 ? 377 ASP A CG  1 
ATOM   343  O OD1 . ASP A 1 53  ? -44.160 9.765  -8.565  1.00 35.61 ? 377 ASP A OD1 1 
ATOM   344  O OD2 . ASP A 1 53  ? -45.449 10.328 -6.886  1.00 37.16 ? 377 ASP A OD2 1 
ATOM   345  N N   . PHE A 1 54  ? -40.063 12.368 -6.288  1.00 22.11 ? 378 PHE A N   1 
ATOM   346  C CA  . PHE A 1 54  ? -38.958 13.306 -6.462  1.00 20.25 ? 378 PHE A CA  1 
ATOM   347  C C   . PHE A 1 54  ? -38.121 12.920 -7.647  1.00 20.71 ? 378 PHE A C   1 
ATOM   348  O O   . PHE A 1 54  ? -37.920 11.738 -7.897  1.00 20.49 ? 378 PHE A O   1 
ATOM   349  C CB  . PHE A 1 54  ? -38.046 13.316 -5.227  1.00 18.35 ? 378 PHE A CB  1 
ATOM   350  C CG  . PHE A 1 54  ? -38.548 14.205 -4.117  1.00 17.08 ? 378 PHE A CG  1 
ATOM   351  C CD1 . PHE A 1 54  ? -37.866 15.359 -3.773  1.00 14.81 ? 378 PHE A CD1 1 
ATOM   352  C CD2 . PHE A 1 54  ? -39.699 13.886 -3.432  1.00 13.41 ? 378 PHE A CD2 1 
ATOM   353  C CE1 . PHE A 1 54  ? -38.337 16.191 -2.735  1.00 15.90 ? 378 PHE A CE1 1 
ATOM   354  C CE2 . PHE A 1 54  ? -40.186 14.704 -2.400  1.00 13.22 ? 378 PHE A CE2 1 
ATOM   355  C CZ  . PHE A 1 54  ? -39.475 15.878 -2.060  1.00 14.47 ? 378 PHE A CZ  1 
ATOM   356  N N   . LYS A 1 55  ? -37.585 13.925 -8.337  1.00 20.67 ? 379 LYS A N   1 
ATOM   357  C CA  . LYS A 1 55  ? -36.436 13.703 -9.203  1.00 22.73 ? 379 LYS A CA  1 
ATOM   358  C C   . LYS A 1 55  ? -35.202 13.749 -8.313  1.00 21.48 ? 379 LYS A C   1 
ATOM   359  O O   . LYS A 1 55  ? -34.966 14.748 -7.643  1.00 17.62 ? 379 LYS A O   1 
ATOM   360  C CB  . LYS A 1 55  ? -36.374 14.792 -10.261 1.00 22.94 ? 379 LYS A CB  1 
ATOM   361  C CG  . LYS A 1 55  ? -37.638 14.804 -11.112 1.00 29.96 ? 379 LYS A CG  1 
ATOM   362  C CD  . LYS A 1 55  ? -37.633 16.011 -12.016 1.00 32.92 ? 379 LYS A CD  1 
ATOM   363  C CE  . LYS A 1 55  ? -38.930 16.069 -12.807 1.00 36.43 ? 379 LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 55  ? -38.971 17.401 -13.435 1.00 32.36 ? 379 LYS A NZ  1 
ATOM   365  N N   . VAL A 1 56  ? -34.445 12.655 -8.276  1.00 20.49 ? 380 VAL A N   1 
ATOM   366  C CA  . VAL A 1 56  ? -33.329 12.521 -7.333  1.00 19.07 ? 380 VAL A CA  1 
ATOM   367  C C   . VAL A 1 56  ? -31.985 12.331 -8.026  1.00 20.10 ? 380 VAL A C   1 
ATOM   368  O O   . VAL A 1 56  ? -31.835 11.423 -8.820  1.00 19.60 ? 380 VAL A O   1 
ATOM   369  C CB  . VAL A 1 56  ? -33.543 11.296 -6.418  1.00 20.76 ? 380 VAL A CB  1 
ATOM   370  C CG1 . VAL A 1 56  ? -32.425 11.179 -5.415  1.00 16.28 ? 380 VAL A CG1 1 
ATOM   371  C CG2 . VAL A 1 56  ? -34.883 11.386 -5.695  1.00 15.16 ? 380 VAL A CG2 1 
ATOM   372  N N   . VAL A 1 57  ? -31.009 13.164 -7.694  1.00 18.17 ? 381 VAL A N   1 
ATOM   373  C CA  . VAL A 1 57  ? -29.630 12.938 -8.086  1.00 17.76 ? 381 VAL A CA  1 
ATOM   374  C C   . VAL A 1 57  ? -28.906 12.442 -6.854  1.00 18.41 ? 381 VAL A C   1 
ATOM   375  O O   . VAL A 1 57  ? -29.015 13.070 -5.800  1.00 18.64 ? 381 VAL A O   1 
ATOM   376  C CB  . VAL A 1 57  ? -28.985 14.246 -8.598  1.00 18.57 ? 381 VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 57  ? -27.449 14.109 -8.754  1.00 14.35 ? 381 VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 57  ? -29.636 14.657 -9.957  1.00 20.16 ? 381 VAL A CG2 1 
ATOM   379  N N   . SER A 1 58  ? -28.200 11.313 -6.960  1.00 15.46 ? 382 SER A N   1 
ATOM   380  C CA  . SER A 1 58  ? -27.599 10.685 -5.792  1.00 19.42 ? 382 SER A CA  1 
ATOM   381  C C   . SER A 1 58  ? -26.164 10.354 -6.140  1.00 20.09 ? 382 SER A C   1 
ATOM   382  O O   . SER A 1 58  ? -25.926 9.691  -7.137  1.00 17.77 ? 382 SER A O   1 
ATOM   383  C CB  . SER A 1 58  ? -28.332 9.382  -5.491  1.00 19.90 ? 382 SER A CB  1 
ATOM   384  O OG  . SER A 1 58  ? -29.723 9.651  -5.427  1.00 30.78 ? 382 SER A OG  1 
ATOM   385  N N   . LEU A 1 59  ? -25.221 10.772 -5.299  1.00 17.58 ? 383 LEU A N   1 
ATOM   386  C CA  . LEU A 1 59  ? -23.815 10.827 -5.673  1.00 17.14 ? 383 LEU A CA  1 
ATOM   387  C C   . LEU A 1 59  ? -22.975 10.451 -4.490  1.00 17.04 ? 383 LEU A C   1 
ATOM   388  O O   . LEU A 1 59  ? -23.352 10.751 -3.361  1.00 17.54 ? 383 LEU A O   1 
ATOM   389  C CB  . LEU A 1 59  ? -23.452 12.265 -6.106  1.00 16.67 ? 383 LEU A CB  1 
ATOM   390  C CG  . LEU A 1 59  ? -24.108 12.731 -7.406  1.00 22.21 ? 383 LEU A CG  1 
ATOM   391  C CD1 . LEU A 1 59  ? -23.851 14.224 -7.705  1.00 19.67 ? 383 LEU A CD1 1 
ATOM   392  C CD2 . LEU A 1 59  ? -23.684 11.814 -8.612  1.00 20.55 ? 383 LEU A CD2 1 
ATOM   393  N N   . LEU A 1 60  ? -21.833 9.806  -4.723  1.00 16.88 ? 384 LEU A N   1 
ATOM   394  C CA  . LEU A 1 60  ? -20.983 9.335  -3.624  1.00 18.10 ? 384 LEU A CA  1 
ATOM   395  C C   . LEU A 1 60  ? -19.566 9.868  -3.767  1.00 19.28 ? 384 LEU A C   1 
ATOM   396  O O   . LEU A 1 60  ? -19.096 10.071 -4.881  1.00 21.25 ? 384 LEU A O   1 
ATOM   397  C CB  . LEU A 1 60  ? -20.906 7.811  -3.631  1.00 15.54 ? 384 LEU A CB  1 
ATOM   398  C CG  . LEU A 1 60  ? -22.186 7.021  -3.423  1.00 24.94 ? 384 LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 60  ? -21.773 5.545  -3.504  1.00 31.00 ? 384 LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 60  ? -22.875 7.357  -2.062  1.00 18.93 ? 384 LEU A CD2 1 
ATOM   401  N N   . ASP A 1 61  ? -18.887 10.040 -2.640  1.00 18.04 ? 385 ASP A N   1 
ATOM   402  C CA  . ASP A 1 61  ? -17.442 10.300 -2.615  1.00 18.34 ? 385 ASP A CA  1 
ATOM   403  C C   . ASP A 1 61  ? -17.102 11.471 -3.500  1.00 18.57 ? 385 ASP A C   1 
ATOM   404  O O   . ASP A 1 61  ? -16.331 11.337 -4.428  1.00 17.80 ? 385 ASP A O   1 
ATOM   405  C CB  . ASP A 1 61  ? -16.628 9.055  -3.051  1.00 17.40 ? 385 ASP A CB  1 
ATOM   406  C CG  . ASP A 1 61  ? -16.548 8.020  -1.975  1.00 21.80 ? 385 ASP A CG  1 
ATOM   407  O OD1 . ASP A 1 61  ? -16.734 8.365  -0.777  1.00 26.54 ? 385 ASP A OD1 1 
ATOM   408  O OD2 . ASP A 1 61  ? -16.313 6.845  -2.311  1.00 24.84 ? 385 ASP A OD2 1 
ATOM   409  N N   . LEU A 1 62  ? -17.641 12.641 -3.185  1.00 19.18 ? 386 LEU A N   1 
ATOM   410  C CA  . LEU A 1 62  ? -17.425 13.792 -4.025  1.00 18.10 ? 386 LEU A CA  1 
ATOM   411  C C   . LEU A 1 62  ? -16.283 14.654 -3.497  1.00 20.84 ? 386 LEU A C   1 
ATOM   412  O O   . LEU A 1 62  ? -16.172 14.882 -2.289  1.00 17.28 ? 386 LEU A O   1 
ATOM   413  C CB  . LEU A 1 62  ? -18.698 14.641 -4.147  1.00 18.74 ? 386 LEU A CB  1 
ATOM   414  C CG  . LEU A 1 62  ? -19.916 13.976 -4.770  1.00 17.42 ? 386 LEU A CG  1 
ATOM   415  C CD1 . LEU A 1 62  ? -21.032 15.001 -5.003  1.00 15.25 ? 386 LEU A CD1 1 
ATOM   416  C CD2 . LEU A 1 62  ? -19.515 13.275 -6.110  1.00 18.51 ? 386 LEU A CD2 1 
ATOM   417  N N   . THR A 1 63  ? -15.425 15.114 -4.426  1.00 21.49 ? 387 THR A N   1 
ATOM   418  C CA  . THR A 1 63  ? -14.386 16.070 -4.109  1.00 21.60 ? 387 THR A CA  1 
ATOM   419  C C   . THR A 1 63  ? -15.070 17.422 -4.009  1.00 22.30 ? 387 THR A C   1 
ATOM   420  O O   . THR A 1 63  ? -16.220 17.565 -4.398  1.00 20.55 ? 387 THR A O   1 
ATOM   421  C CB  . THR A 1 63  ? -13.342 16.197 -5.238  1.00 22.17 ? 387 THR A CB  1 
ATOM   422  O OG1 . THR A 1 63  ? -14.009 16.522 -6.458  1.00 19.66 ? 387 THR A OG1 1 
ATOM   423  C CG2 . THR A 1 63  ? -12.504 14.904 -5.415  1.00 20.33 ? 387 THR A CG2 1 
ATOM   424  N N   . GLU A 1 64  ? -14.346 18.435 -3.539  1.00 24.14 ? 388 GLU A N   1 
ATOM   425  C CA  . GLU A 1 64  ? -14.909 19.764 -3.441  1.00 23.17 ? 388 GLU A CA  1 
ATOM   426  C C   . GLU A 1 64  ? -15.472 20.228 -4.779  1.00 23.04 ? 388 GLU A C   1 
ATOM   427  O O   . GLU A 1 64  ? -16.588 20.742 -4.877  1.00 21.60 ? 388 GLU A O   1 
ATOM   428  C CB  . GLU A 1 64  ? -13.842 20.750 -2.950  1.00 26.43 ? 388 GLU A CB  1 
ATOM   429  C CG  . GLU A 1 64  ? -14.412 22.164 -2.804  1.00 27.15 ? 388 GLU A CG  1 
ATOM   430  C CD  . GLU A 1 64  ? -13.325 23.261 -2.744  1.00 33.69 ? 388 GLU A CD  1 
ATOM   431  O OE1 . GLU A 1 64  ? -12.138 22.936 -2.593  1.00 32.57 ? 388 GLU A OE1 1 
ATOM   432  O OE2 . GLU A 1 64  ? -13.685 24.450 -2.829  1.00 33.18 ? 388 GLU A OE2 1 
ATOM   433  N N   . TYR A 1 65  ? -14.674 20.051 -5.823  1.00 23.93 ? 389 TYR A N   1 
ATOM   434  C CA  . TYR A 1 65  ? -15.077 20.438 -7.169  1.00 24.49 ? 389 TYR A CA  1 
ATOM   435  C C   . TYR A 1 65  ? -16.384 19.733 -7.596  1.00 22.63 ? 389 TYR A C   1 
ATOM   436  O O   . TYR A 1 65  ? -17.302 20.371 -8.107  1.00 21.39 ? 389 TYR A O   1 
ATOM   437  C CB  . TYR A 1 65  ? -13.929 20.093 -8.134  1.00 25.86 ? 389 TYR A CB  1 
ATOM   438  C CG  . TYR A 1 65  ? -14.238 20.228 -9.602  1.00 27.23 ? 389 TYR A CG  1 
ATOM   439  C CD1 . TYR A 1 65  ? -14.489 21.487 -10.174 1.00 34.34 ? 389 TYR A CD1 1 
ATOM   440  C CD2 . TYR A 1 65  ? -14.249 19.112 -10.429 1.00 33.50 ? 389 TYR A CD2 1 
ATOM   441  C CE1 . TYR A 1 65  ? -14.754 21.622 -11.542 1.00 31.68 ? 389 TYR A CE1 1 
ATOM   442  C CE2 . TYR A 1 65  ? -14.521 19.239 -11.797 1.00 35.25 ? 389 TYR A CE2 1 
ATOM   443  C CZ  . TYR A 1 65  ? -14.764 20.496 -12.337 1.00 35.70 ? 389 TYR A CZ  1 
ATOM   444  O OH  . TYR A 1 65  ? -15.031 20.621 -13.683 1.00 40.69 ? 389 TYR A OH  1 
ATOM   445  N N   . GLU A 1 66  ? -16.465 18.421 -7.385  1.00 22.59 ? 390 GLU A N   1 
ATOM   446  C CA  . GLU A 1 66  ? -17.698 17.673 -7.733  1.00 21.95 ? 390 GLU A CA  1 
ATOM   447  C C   . GLU A 1 66  ? -18.907 18.103 -6.883  1.00 21.69 ? 390 GLU A C   1 
ATOM   448  O O   . GLU A 1 66  ? -20.054 18.134 -7.371  1.00 20.97 ? 390 GLU A O   1 
ATOM   449  C CB  . GLU A 1 66  ? -17.460 16.173 -7.603  1.00 21.47 ? 390 GLU A CB  1 
ATOM   450  C CG  . GLU A 1 66  ? -16.319 15.628 -8.510  1.00 22.69 ? 390 GLU A CG  1 
ATOM   451  C CD  . GLU A 1 66  ? -15.879 14.218 -8.141  1.00 30.01 ? 390 GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 66  ? -15.729 13.895 -6.936  1.00 27.66 ? 390 GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 66  ? -15.675 13.419 -9.070  1.00 36.73 ? 390 GLU A OE2 1 
ATOM   454  N N   . MET A 1 67  ? -18.654 18.419 -5.608  1.00 21.19 ? 391 MET A N   1 
ATOM   455  C CA  . MET A 1 67  ? -19.722 18.931 -4.736  1.00 20.15 ? 391 MET A CA  1 
ATOM   456  C C   . MET A 1 67  ? -20.271 20.259 -5.227  1.00 20.78 ? 391 MET A C   1 
ATOM   457  O O   . MET A 1 67  ? -21.505 20.460 -5.299  1.00 18.02 ? 391 MET A O   1 
ATOM   458  C CB  . MET A 1 67  ? -19.249 19.040 -3.272  1.00 19.90 ? 391 MET A CB  1 
ATOM   459  C CG  . MET A 1 67  ? -19.039 17.685 -2.604  1.00 16.37 ? 391 MET A CG  1 
ATOM   460  S SD  . MET A 1 67  ? -18.838 17.724 -0.828  1.00 23.36 ? 391 MET A SD  1 
ATOM   461  C CE  . MET A 1 67  ? -20.425 18.353 -0.272  1.00 22.99 ? 391 MET A CE  1 
ATOM   462  N N   . ARG A 1 68  ? -19.381 21.185 -5.596  1.00 21.55 ? 392 ARG A N   1 
ATOM   463  C CA  . ARG A 1 68  ? -19.885 22.491 -6.078  1.00 20.78 ? 392 ARG A CA  1 
ATOM   464  C C   . ARG A 1 68  ? -20.632 22.307 -7.380  1.00 20.19 ? 392 ARG A C   1 
ATOM   465  O O   . ARG A 1 68  ? -21.699 22.902 -7.588  1.00 19.22 ? 392 ARG A O   1 
ATOM   466  C CB  . ARG A 1 68  ? -18.748 23.513 -6.230  1.00 22.31 ? 392 ARG A CB  1 
ATOM   467  C CG  . ARG A 1 68  ? -17.948 23.690 -4.927  1.00 26.30 ? 392 ARG A CG  1 
ATOM   468  C CD  . ARG A 1 68  ? -17.066 24.967 -4.934  1.00 30.42 ? 392 ARG A CD  1 
ATOM   469  N NE  . ARG A 1 68  ? -16.164 24.982 -3.781  1.00 32.03 ? 392 ARG A NE  1 
ATOM   470  C CZ  . ARG A 1 68  ? -16.454 25.579 -2.629  1.00 33.85 ? 392 ARG A CZ  1 
ATOM   471  N NH1 . ARG A 1 68  ? -15.593 25.568 -1.594  1.00 31.70 ? 392 ARG A NH1 1 
ATOM   472  N NH2 . ARG A 1 68  ? -17.604 26.206 -2.523  1.00 27.55 ? 392 ARG A NH2 1 
ATOM   473  N N   . ASN A 1 69  ? -20.117 21.446 -8.258  1.00 20.36 ? 393 ASN A N   1 
ATOM   474  C CA  . ASN A 1 69  ? -20.860 21.172 -9.511  1.00 23.52 ? 393 ASN A CA  1 
ATOM   475  C C   . ASN A 1 69  ? -22.249 20.563 -9.279  1.00 22.69 ? 393 ASN A C   1 
ATOM   476  O O   . ASN A 1 69  ? -23.231 20.968 -9.910  1.00 23.35 ? 393 ASN A O   1 
ATOM   477  C CB  . ASN A 1 69  ? -20.053 20.258 -10.442 1.00 25.16 ? 393 ASN A CB  1 
ATOM   478  C CG  . ASN A 1 69  ? -18.855 20.962 -11.041 1.00 33.07 ? 393 ASN A CG  1 
ATOM   479  O OD1 . ASN A 1 69  ? -18.897 22.163 -11.278 1.00 31.80 ? 393 ASN A OD1 1 
ATOM   480  N ND2 . ASN A 1 69  ? -17.767 20.218 -11.261 1.00 37.33 ? 393 ASN A ND2 1 
ATOM   481  N N   . ALA A 1 70  ? -22.306 19.560 -8.401  1.00 21.02 ? 394 ALA A N   1 
ATOM   482  C CA  . ALA A 1 70  ? -23.576 18.901 -8.041  1.00 19.28 ? 394 ALA A CA  1 
ATOM   483  C C   . ALA A 1 70  ? -24.546 19.927 -7.481  1.00 18.78 ? 394 ALA A C   1 
ATOM   484  O O   . ALA A 1 70  ? -25.718 19.943 -7.839  1.00 16.53 ? 394 ALA A O   1 
ATOM   485  C CB  . ALA A 1 70  ? -23.348 17.831 -7.020  1.00 16.82 ? 394 ALA A CB  1 
ATOM   486  N N   . VAL A 1 71  ? -24.097 20.825 -6.611  1.00 20.54 ? 395 VAL A N   1 
ATOM   487  C CA  . VAL A 1 71  ? -25.133 21.765 -6.159  1.00 20.40 ? 395 VAL A CA  1 
ATOM   488  C C   . VAL A 1 71  ? -25.582 22.771 -7.251  1.00 20.11 ? 395 VAL A C   1 
ATOM   489  O O   . VAL A 1 71  ? -26.756 23.132 -7.307  1.00 22.10 ? 395 VAL A O   1 
ATOM   490  C CB  . VAL A 1 71  ? -24.908 22.396 -4.714  1.00 24.58 ? 395 VAL A CB  1 
ATOM   491  C CG1 . VAL A 1 71  ? -24.064 21.473 -3.788  1.00 20.45 ? 395 VAL A CG1 1 
ATOM   492  C CG2 . VAL A 1 71  ? -24.404 23.769 -4.776  1.00 25.04 ? 395 VAL A CG2 1 
ATOM   493  N N   . ASP A 1 72  ? -24.680 23.191 -8.130  1.00 20.19 ? 396 ASP A N   1 
ATOM   494  C CA  . ASP A 1 72  ? -25.077 24.050 -9.260  1.00 22.28 ? 396 ASP A CA  1 
ATOM   495  C C   . ASP A 1 72  ? -26.114 23.367 -10.127 1.00 21.31 ? 396 ASP A C   1 
ATOM   496  O O   . ASP A 1 72  ? -27.063 23.988 -10.567 1.00 21.82 ? 396 ASP A O   1 
ATOM   497  C CB  . ASP A 1 72  ? -23.869 24.409 -10.144 1.00 23.84 ? 396 ASP A CB  1 
ATOM   498  C CG  . ASP A 1 72  ? -22.932 25.387 -9.471  1.00 32.64 ? 396 ASP A CG  1 
ATOM   499  O OD1 . ASP A 1 72  ? -23.413 26.193 -8.645  1.00 37.30 ? 396 ASP A OD1 1 
ATOM   500  O OD2 . ASP A 1 72  ? -21.714 25.344 -9.753  1.00 37.74 ? 396 ASP A OD2 1 
ATOM   501  N N   . GLU A 1 73  ? -25.933 22.072 -10.378 1.00 22.93 ? 397 GLU A N   1 
ATOM   502  C CA  . GLU A 1 73  ? -26.908 21.333 -11.178 1.00 23.67 ? 397 GLU A CA  1 
ATOM   503  C C   . GLU A 1 73  ? -28.250 21.256 -10.472 1.00 21.67 ? 397 GLU A C   1 
ATOM   504  O O   . GLU A 1 73  ? -29.301 21.390 -11.083 1.00 23.43 ? 397 GLU A O   1 
ATOM   505  C CB  . GLU A 1 73  ? -26.403 19.915 -11.475 1.00 25.24 ? 397 GLU A CB  1 
ATOM   506  C CG  . GLU A 1 73  ? -25.086 19.898 -12.224 1.00 35.19 ? 397 GLU A CG  1 
ATOM   507  C CD  . GLU A 1 73  ? -25.165 20.688 -13.525 1.00 49.15 ? 397 GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 73  ? -25.999 20.326 -14.388 1.00 52.22 ? 397 GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 73  ? -24.413 21.686 -13.671 1.00 55.04 ? 397 GLU A OE2 1 
ATOM   510  N N   . PHE A 1 74  ? -28.211 21.001 -9.180  1.00 19.18 ? 398 PHE A N   1 
ATOM   511  C CA  . PHE A 1 74  ? -29.419 20.963 -8.357  1.00 19.50 ? 398 PHE A CA  1 
ATOM   512  C C   . PHE A 1 74  ? -30.158 22.317 -8.375  1.00 20.94 ? 398 PHE A C   1 
ATOM   513  O O   . PHE A 1 74  ? -31.371 22.384 -8.591  1.00 20.36 ? 398 PHE A O   1 
ATOM   514  C CB  . PHE A 1 74  ? -28.962 20.597 -6.928  1.00 19.74 ? 398 PHE A CB  1 
ATOM   515  C CG  . PHE A 1 74  ? -30.018 20.746 -5.867  1.00 21.27 ? 398 PHE A CG  1 
ATOM   516  C CD1 . PHE A 1 74  ? -31.176 19.952 -5.891  1.00 15.32 ? 398 PHE A CD1 1 
ATOM   517  C CD2 . PHE A 1 74  ? -29.826 21.639 -4.799  1.00 22.39 ? 398 PHE A CD2 1 
ATOM   518  C CE1 . PHE A 1 74  ? -32.148 20.051 -4.858  1.00 16.79 ? 398 PHE A CE1 1 
ATOM   519  C CE2 . PHE A 1 74  ? -30.790 21.759 -3.771  1.00 20.27 ? 398 PHE A CE2 1 
ATOM   520  C CZ  . PHE A 1 74  ? -31.960 20.947 -3.806  1.00 17.41 ? 398 PHE A CZ  1 
ATOM   521  N N   . LEU A 1 75  ? -29.404 23.391 -8.164  1.00 21.21 ? 399 LEU A N   1 
ATOM   522  C CA  . LEU A 1 75  ? -29.935 24.757 -8.259  1.00 25.73 ? 399 LEU A CA  1 
ATOM   523  C C   . LEU A 1 75  ? -30.671 25.047 -9.590  1.00 25.32 ? 399 LEU A C   1 
ATOM   524  O O   . LEU A 1 75  ? -31.740 25.669 -9.618  1.00 25.65 ? 399 LEU A O   1 
ATOM   525  C CB  . LEU A 1 75  ? -28.761 25.727 -8.086  1.00 25.44 ? 399 LEU A CB  1 
ATOM   526  C CG  . LEU A 1 75  ? -28.406 26.418 -6.767  1.00 34.66 ? 399 LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 75  ? -29.352 26.098 -5.609  1.00 25.12 ? 399 LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 75  ? -26.921 26.225 -6.426  1.00 28.79 ? 399 LEU A CD2 1 
ATOM   529  N N   . LEU A 1 76  ? -30.098 24.589 -10.697 1.00 26.28 ? 400 LEU A N   1 
ATOM   530  C CA  . LEU A 1 76  ? -30.713 24.763 -12.011 1.00 27.69 ? 400 LEU A CA  1 
ATOM   531  C C   . LEU A 1 76  ? -32.061 24.080 -12.140 1.00 26.74 ? 400 LEU A C   1 
ATOM   532  O O   . LEU A 1 76  ? -32.883 24.486 -12.948 1.00 27.05 ? 400 LEU A O   1 
ATOM   533  C CB  . LEU A 1 76  ? -29.784 24.216 -13.100 1.00 29.75 ? 400 LEU A CB  1 
ATOM   534  C CG  . LEU A 1 76  ? -28.750 25.165 -13.711 1.00 39.51 ? 400 LEU A CG  1 
ATOM   535  C CD1 . LEU A 1 76  ? -28.093 24.477 -14.925 1.00 42.07 ? 400 LEU A CD1 1 
ATOM   536  C CD2 . LEU A 1 76  ? -29.411 26.478 -14.118 1.00 36.18 ? 400 LEU A CD2 1 
ATOM   537  N N   . LEU A 1 77  ? -32.286 23.029 -11.359 1.00 26.06 ? 401 LEU A N   1 
ATOM   538  C CA  . LEU A 1 77  ? -33.560 22.305 -11.400 1.00 26.49 ? 401 LEU A CA  1 
ATOM   539  C C   . LEU A 1 77  ? -34.638 22.959 -10.516 1.00 26.32 ? 401 LEU A C   1 
ATOM   540  O O   . LEU A 1 77  ? -35.812 22.579 -10.549 1.00 26.89 ? 401 LEU A O   1 
ATOM   541  C CB  . LEU A 1 77  ? -33.343 20.842 -10.996 1.00 27.00 ? 401 LEU A CB  1 
ATOM   542  C CG  . LEU A 1 77  ? -32.540 20.023 -12.006 1.00 29.30 ? 401 LEU A CG  1 
ATOM   543  C CD1 . LEU A 1 77  ? -32.240 18.640 -11.450 1.00 27.57 ? 401 LEU A CD1 1 
ATOM   544  C CD2 . LEU A 1 77  ? -33.312 19.908 -13.331 1.00 24.68 ? 401 LEU A CD2 1 
ATOM   545  N N   . LEU A 1 78  ? -34.242 23.971 -9.744  1.00 26.26 ? 402 LEU A N   1 
ATOM   546  C CA  . LEU A 1 78  ? -35.188 24.653 -8.863  1.00 24.00 ? 402 LEU A CA  1 
ATOM   547  C C   . LEU A 1 78  ? -35.811 25.880 -9.540  1.00 25.02 ? 402 LEU A C   1 
ATOM   548  O O   . LEU A 1 78  ? -35.162 26.609 -10.307 1.00 25.02 ? 402 LEU A O   1 
ATOM   549  C CB  . LEU A 1 78  ? -34.499 25.070 -7.552  1.00 22.29 ? 402 LEU A CB  1 
ATOM   550  C CG  . LEU A 1 78  ? -33.893 23.899 -6.756  1.00 17.41 ? 402 LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 78  ? -33.223 24.416 -5.470  1.00 16.96 ? 402 LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 78  ? -35.009 22.922 -6.381  1.00 16.25 ? 402 LEU A CD2 1 
ATOM   553  N N   . ASP A 1 79  ? -37.063 26.113 -9.209  1.00 25.50 ? 403 ASP A N   1 
ATOM   554  C CA  . ASP A 1 79  ? -37.794 27.243 -9.725  1.00 28.83 ? 403 ASP A CA  1 
ATOM   555  C C   . ASP A 1 79  ? -38.929 27.531 -8.763  1.00 27.18 ? 403 ASP A C   1 
ATOM   556  O O   . ASP A 1 79  ? -39.067 26.877 -7.712  1.00 25.81 ? 403 ASP A O   1 
ATOM   557  C CB  . ASP A 1 79  ? -38.390 26.883 -11.090 1.00 30.89 ? 403 ASP A CB  1 
ATOM   558  C CG  . ASP A 1 79  ? -38.466 28.061 -12.010 1.00 39.17 ? 403 ASP A CG  1 
ATOM   559  O OD1 . ASP A 1 79  ? -39.031 29.119 -11.613 1.00 42.94 ? 403 ASP A OD1 1 
ATOM   560  O OD2 . ASP A 1 79  ? -37.963 27.919 -13.142 1.00 48.06 ? 403 ASP A OD2 1 
ATOM   561  N N   . LYS A 1 80  ? -39.764 28.483 -9.145  1.00 26.00 ? 404 LYS A N   1 
ATOM   562  C CA  . LYS A 1 80  ? -40.813 28.982 -8.274  1.00 26.81 ? 404 LYS A CA  1 
ATOM   563  C C   . LYS A 1 80  ? -41.813 27.917 -7.883  1.00 25.10 ? 404 LYS A C   1 
ATOM   564  O O   . LYS A 1 80  ? -42.448 27.272 -8.727  1.00 25.69 ? 404 LYS A O   1 
ATOM   565  C CB  . LYS A 1 80  ? -41.524 30.193 -8.911  1.00 28.23 ? 404 LYS A CB  1 
ATOM   566  C CG  . LYS A 1 80  ? -42.677 30.771 -8.062  1.00 35.07 ? 404 LYS A CG  1 
ATOM   567  C CD  . LYS A 1 80  ? -43.040 32.193 -8.536  1.00 44.00 ? 404 LYS A CD  1 
ATOM   568  C CE  . LYS A 1 80  ? -44.086 32.865 -7.653  1.00 45.32 ? 404 LYS A CE  1 
ATOM   569  N NZ  . LYS A 1 80  ? -44.388 34.248 -8.151  1.00 48.97 ? 404 LYS A NZ  1 
ATOM   570  N N   . GLY A 1 81  ? -41.973 27.732 -6.583  1.00 22.18 ? 405 GLY A N   1 
ATOM   571  C CA  . GLY A 1 81  ? -42.909 26.742 -6.117  1.00 20.63 ? 405 GLY A CA  1 
ATOM   572  C C   . GLY A 1 81  ? -42.352 25.328 -6.038  1.00 19.07 ? 405 GLY A C   1 
ATOM   573  O O   . GLY A 1 81  ? -43.059 24.430 -5.631  1.00 21.14 ? 405 GLY A O   1 
ATOM   574  N N   . VAL A 1 82  ? -41.102 25.119 -6.435  1.00 21.15 ? 406 VAL A N   1 
ATOM   575  C CA  . VAL A 1 82  ? -40.529 23.758 -6.425  1.00 21.62 ? 406 VAL A CA  1 
ATOM   576  C C   . VAL A 1 82  ? -40.111 23.399 -5.010  1.00 20.34 ? 406 VAL A C   1 
ATOM   577  O O   . VAL A 1 82  ? -39.681 24.279 -4.251  1.00 20.16 ? 406 VAL A O   1 
ATOM   578  C CB  . VAL A 1 82  ? -39.334 23.656 -7.397  1.00 20.70 ? 406 VAL A CB  1 
ATOM   579  C CG1 . VAL A 1 82  ? -38.555 22.355 -7.203  1.00 21.54 ? 406 VAL A CG1 1 
ATOM   580  C CG2 . VAL A 1 82  ? -39.842 23.757 -8.834  1.00 25.47 ? 406 VAL A CG2 1 
ATOM   581  N N   . TYR A 1 83  ? -40.292 22.136 -4.632  1.00 21.80 ? 407 TYR A N   1 
ATOM   582  C CA  . TYR A 1 83  ? -39.808 21.605 -3.336  1.00 18.83 ? 407 TYR A CA  1 
ATOM   583  C C   . TYR A 1 83  ? -38.384 21.115 -3.552  1.00 20.81 ? 407 TYR A C   1 
ATOM   584  O O   . TYR A 1 83  ? -38.158 20.156 -4.322  1.00 22.71 ? 407 TYR A O   1 
ATOM   585  C CB  . TYR A 1 83  ? -40.649 20.420 -2.861  1.00 18.82 ? 407 TYR A CB  1 
ATOM   586  C CG  . TYR A 1 83  ? -42.043 20.729 -2.340  1.00 16.41 ? 407 TYR A CG  1 
ATOM   587  C CD1 . TYR A 1 83  ? -42.656 21.955 -2.567  1.00 19.17 ? 407 TYR A CD1 1 
ATOM   588  C CD2 . TYR A 1 83  ? -42.734 19.785 -1.613  1.00 21.60 ? 407 TYR A CD2 1 
ATOM   589  C CE1 . TYR A 1 83  ? -43.939 22.208 -2.085  1.00 21.94 ? 407 TYR A CE1 1 
ATOM   590  C CE2 . TYR A 1 83  ? -43.997 20.031 -1.118  1.00 19.55 ? 407 TYR A CE2 1 
ATOM   591  C CZ  . TYR A 1 83  ? -44.606 21.234 -1.386  1.00 23.62 ? 407 TYR A CZ  1 
ATOM   592  O OH  . TYR A 1 83  ? -45.869 21.452 -0.895  1.00 20.54 ? 407 TYR A OH  1 
ATOM   593  N N   . GLY A 1 84  ? -37.419 21.776 -2.917  1.00 17.64 ? 408 GLY A N   1 
ATOM   594  C CA  . GLY A 1 84  ? -36.026 21.355 -3.000  1.00 17.27 ? 408 GLY A CA  1 
ATOM   595  C C   . GLY A 1 84  ? -35.559 20.682 -1.717  1.00 17.63 ? 408 GLY A C   1 
ATOM   596  O O   . GLY A 1 84  ? -35.814 21.185 -0.627  1.00 15.35 ? 408 GLY A O   1 
ATOM   597  N N   . LEU A 1 85  ? -34.877 19.543 -1.846  1.00 16.92 ? 409 LEU A N   1 
ATOM   598  C CA  . LEU A 1 85  ? -34.315 18.847 -0.682  1.00 16.05 ? 409 LEU A CA  1 
ATOM   599  C C   . LEU A 1 85  ? -32.846 18.453 -0.894  1.00 15.54 ? 409 LEU A C   1 
ATOM   600  O O   . LEU A 1 85  ? -32.465 17.913 -1.946  1.00 16.19 ? 409 LEU A O   1 
ATOM   601  C CB  . LEU A 1 85  ? -35.158 17.604 -0.338  1.00 15.98 ? 409 LEU A CB  1 
ATOM   602  C CG  . LEU A 1 85  ? -34.859 16.715 0.871   1.00 15.46 ? 409 LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 85  ? -36.159 16.038 1.318   1.00 17.61 ? 409 LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 85  ? -33.757 15.654 0.589   1.00 11.52 ? 409 LEU A CD2 1 
ATOM   605  N N   . LEU A 1 86  ? -32.042 18.681 0.136   1.00 14.23 ? 410 LEU A N   1 
ATOM   606  C CA  . LEU A 1 86  ? -30.640 18.325 0.130   1.00 14.64 ? 410 LEU A CA  1 
ATOM   607  C C   . LEU A 1 86  ? -30.400 17.370 1.279   1.00 16.24 ? 410 LEU A C   1 
ATOM   608  O O   . LEU A 1 86  ? -30.809 17.658 2.405   1.00 17.72 ? 410 LEU A O   1 
ATOM   609  C CB  . LEU A 1 86  ? -29.732 19.545 0.303   1.00 14.31 ? 410 LEU A CB  1 
ATOM   610  C CG  . LEU A 1 86  ? -28.263 19.094 0.441   1.00 19.98 ? 410 LEU A CG  1 
ATOM   611  C CD1 . LEU A 1 86  ? -27.649 18.848 -0.902  1.00 24.11 ? 410 LEU A CD1 1 
ATOM   612  C CD2 . LEU A 1 86  ? -27.424 20.077 1.243   1.00 22.85 ? 410 LEU A CD2 1 
ATOM   613  N N   . TYR A 1 87  ? -29.795 16.217 0.990   1.00 11.49 ? 411 TYR A N   1 
ATOM   614  C CA  . TYR A 1 87  ? -29.383 15.300 2.039   1.00 11.83 ? 411 TYR A CA  1 
ATOM   615  C C   . TYR A 1 87  ? -27.879 15.086 1.926   1.00 14.25 ? 411 TYR A C   1 
ATOM   616  O O   . TYR A 1 87  ? -27.365 14.841 0.833   1.00 12.61 ? 411 TYR A O   1 
ATOM   617  C CB  . TYR A 1 87  ? -30.154 13.964 1.996   1.00 10.64 ? 411 TYR A CB  1 
ATOM   618  C CG  . TYR A 1 87  ? -29.575 12.900 2.906   1.00 14.59 ? 411 TYR A CG  1 
ATOM   619  C CD1 . TYR A 1 87  ? -29.890 12.863 4.261   1.00 9.56  ? 411 TYR A CD1 1 
ATOM   620  C CD2 . TYR A 1 87  ? -28.675 11.944 2.420   1.00 13.43 ? 411 TYR A CD2 1 
ATOM   621  C CE1 . TYR A 1 87  ? -29.364 11.870 5.105   1.00 10.36 ? 411 TYR A CE1 1 
ATOM   622  C CE2 . TYR A 1 87  ? -28.135 10.974 3.258   1.00 15.70 ? 411 TYR A CE2 1 
ATOM   623  C CZ  . TYR A 1 87  ? -28.491 10.942 4.607   1.00 16.54 ? 411 TYR A CZ  1 
ATOM   624  O OH  . TYR A 1 87  ? -27.948 9.984  5.461   1.00 13.94 ? 411 TYR A OH  1 
ATOM   625  N N   . TYR A 1 88  ? -27.177 15.178 3.053   1.00 11.62 ? 412 TYR A N   1 
ATOM   626  C CA  . TYR A 1 88  ? -25.724 14.997 3.042   1.00 12.04 ? 412 TYR A CA  1 
ATOM   627  C C   . TYR A 1 88  ? -25.371 14.070 4.184   1.00 15.79 ? 412 TYR A C   1 
ATOM   628  O O   . TYR A 1 88  ? -25.770 14.319 5.319   1.00 14.61 ? 412 TYR A O   1 
ATOM   629  C CB  . TYR A 1 88  ? -24.992 16.342 3.244   1.00 13.27 ? 412 TYR A CB  1 
ATOM   630  C CG  . TYR A 1 88  ? -23.510 16.138 3.458   1.00 15.63 ? 412 TYR A CG  1 
ATOM   631  C CD1 . TYR A 1 88  ? -22.692 15.795 2.384   1.00 14.11 ? 412 TYR A CD1 1 
ATOM   632  C CD2 . TYR A 1 88  ? -22.939 16.225 4.725   1.00 14.01 ? 412 TYR A CD2 1 
ATOM   633  C CE1 . TYR A 1 88  ? -21.356 15.562 2.553   1.00 12.04 ? 412 TYR A CE1 1 
ATOM   634  C CE2 . TYR A 1 88  ? -21.582 16.035 4.901   1.00 13.55 ? 412 TYR A CE2 1 
ATOM   635  C CZ  . TYR A 1 88  ? -20.798 15.694 3.786   1.00 16.95 ? 412 TYR A CZ  1 
ATOM   636  O OH  . TYR A 1 88  ? -19.462 15.440 3.885   1.00 14.06 ? 412 TYR A OH  1 
ATOM   637  N N   . ALA A 1 89  ? -24.663 12.989 3.868   1.00 15.30 ? 413 ALA A N   1 
ATOM   638  C CA  . ALA A 1 89  ? -24.091 12.064 4.849   1.00 17.33 ? 413 ALA A CA  1 
ATOM   639  C C   . ALA A 1 89  ? -22.566 12.049 4.685   1.00 17.32 ? 413 ALA A C   1 
ATOM   640  O O   . ALA A 1 89  ? -22.064 11.733 3.601   1.00 18.71 ? 413 ALA A O   1 
ATOM   641  C CB  . ALA A 1 89  ? -24.648 10.674 4.630   1.00 14.59 ? 413 ALA A CB  1 
ATOM   642  N N   . GLY A 1 90  ? -21.824 12.381 5.742   1.00 16.17 ? 414 GLY A N   1 
ATOM   643  C CA  . GLY A 1 90  ? -20.372 12.392 5.650   1.00 17.82 ? 414 GLY A CA  1 
ATOM   644  C C   . GLY A 1 90  ? -19.833 13.307 6.720   1.00 19.30 ? 414 GLY A C   1 
ATOM   645  O O   . GLY A 1 90  ? -20.573 13.675 7.630   1.00 18.31 ? 414 GLY A O   1 
ATOM   646  N N   . HIS A 1 91  ? -18.549 13.660 6.641   1.00 18.14 ? 415 HIS A N   1 
ATOM   647  C CA  . HIS A 1 91  ? -17.947 14.569 7.646   1.00 16.02 ? 415 HIS A CA  1 
ATOM   648  C C   . HIS A 1 91  ? -18.458 15.974 7.472   1.00 17.15 ? 415 HIS A C   1 
ATOM   649  O O   . HIS A 1 91  ? -18.690 16.441 6.329   1.00 16.58 ? 415 HIS A O   1 
ATOM   650  C CB  . HIS A 1 91  ? -16.416 14.562 7.548   1.00 18.89 ? 415 HIS A CB  1 
ATOM   651  C CG  . HIS A 1 91  ? -15.792 13.295 8.047   1.00 20.93 ? 415 HIS A CG  1 
ATOM   652  N ND1 . HIS A 1 91  ? -16.099 12.749 9.276   1.00 24.45 ? 415 HIS A ND1 1 
ATOM   653  C CD2 . HIS A 1 91  ? -14.884 12.466 7.480   1.00 19.69 ? 415 HIS A CD2 1 
ATOM   654  C CE1 . HIS A 1 91  ? -15.405 11.637 9.443   1.00 26.08 ? 415 HIS A CE1 1 
ATOM   655  N NE2 . HIS A 1 91  ? -14.661 11.442 8.366   1.00 19.86 ? 415 HIS A NE2 1 
ATOM   656  N N   . GLY A 1 92  ? -18.673 16.655 8.600   1.00 16.03 ? 416 GLY A N   1 
ATOM   657  C CA  . GLY A 1 92  ? -19.105 18.027 8.548   1.00 15.46 ? 416 GLY A CA  1 
ATOM   658  C C   . GLY A 1 92  ? -18.638 18.756 9.804   1.00 17.42 ? 416 GLY A C   1 
ATOM   659  O O   . GLY A 1 92  ? -18.037 18.166 10.699  1.00 15.35 ? 416 GLY A O   1 
ATOM   660  N N   . TYR A 1 93  ? -18.876 20.059 9.864   1.00 17.58 ? 417 TYR A N   1 
ATOM   661  C CA  . TYR A 1 93  ? -18.600 20.772 11.099  1.00 18.19 ? 417 TYR A CA  1 
ATOM   662  C C   . TYR A 1 93  ? -19.449 22.016 11.155  1.00 20.33 ? 417 TYR A C   1 
ATOM   663  O O   . TYR A 1 93  ? -20.129 22.354 10.178  1.00 18.41 ? 417 TYR A O   1 
ATOM   664  C CB  . TYR A 1 93  ? -17.118 21.094 11.230  1.00 16.90 ? 417 TYR A CB  1 
ATOM   665  C CG  . TYR A 1 93  ? -16.622 22.229 10.345  1.00 22.48 ? 417 TYR A CG  1 
ATOM   666  C CD1 . TYR A 1 93  ? -16.590 23.538 10.815  1.00 21.78 ? 417 TYR A CD1 1 
ATOM   667  C CD2 . TYR A 1 93  ? -16.151 21.986 9.043   1.00 21.34 ? 417 TYR A CD2 1 
ATOM   668  C CE1 . TYR A 1 93  ? -16.125 24.589 10.013  1.00 24.53 ? 417 TYR A CE1 1 
ATOM   669  C CE2 . TYR A 1 93  ? -15.669 23.037 8.241   1.00 24.59 ? 417 TYR A CE2 1 
ATOM   670  C CZ  . TYR A 1 93  ? -15.662 24.317 8.727   1.00 24.35 ? 417 TYR A CZ  1 
ATOM   671  O OH  . TYR A 1 93  ? -15.188 25.338 7.945   1.00 31.05 ? 417 TYR A OH  1 
ATOM   672  N N   . GLU A 1 94  ? -19.427 22.682 12.306  1.00 18.58 ? 418 GLU A N   1 
ATOM   673  C CA  . GLU A 1 94  ? -20.251 23.836 12.485  1.00 18.11 ? 418 GLU A CA  1 
ATOM   674  C C   . GLU A 1 94  ? -19.486 24.917 13.267  1.00 18.80 ? 418 GLU A C   1 
ATOM   675  O O   . GLU A 1 94  ? -19.052 24.686 14.392  1.00 17.24 ? 418 GLU A O   1 
ATOM   676  C CB  . GLU A 1 94  ? -21.541 23.434 13.190  1.00 19.08 ? 418 GLU A CB  1 
ATOM   677  C CG  . GLU A 1 94  ? -22.559 24.606 13.308  1.00 21.64 ? 418 GLU A CG  1 
ATOM   678  C CD  . GLU A 1 94  ? -24.007 24.134 13.216  1.00 30.04 ? 418 GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 94  ? -24.306 23.155 12.462  1.00 23.89 ? 418 GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 94  ? -24.857 24.769 13.874  1.00 29.60 ? 418 GLU A OE2 1 
ATOM   681  N N   . ASN A 1 95  ? -19.299 26.087 12.650  1.00 19.27 ? 419 ASN A N   1 
ATOM   682  C CA  . ASN A 1 95  ? -18.630 27.197 13.325  1.00 22.66 ? 419 ASN A CA  1 
ATOM   683  C C   . ASN A 1 95  ? -19.569 28.370 13.334  1.00 25.62 ? 419 ASN A C   1 
ATOM   684  O O   . ASN A 1 95  ? -20.067 28.776 12.280  1.00 23.92 ? 419 ASN A O   1 
ATOM   685  C CB  . ASN A 1 95  ? -17.351 27.608 12.595  1.00 22.19 ? 419 ASN A CB  1 
ATOM   686  C CG  . ASN A 1 95  ? -16.137 26.824 13.054  1.00 27.42 ? 419 ASN A CG  1 
ATOM   687  O OD1 . ASN A 1 95  ? -15.022 27.345 13.109  1.00 33.57 ? 419 ASN A OD1 1 
ATOM   688  N ND2 . ASN A 1 95  ? -16.343 25.569 13.383  1.00 22.76 ? 419 ASN A ND2 1 
ATOM   689  N N   . PHE A 1 96  ? -19.842 28.891 14.526  1.00 27.39 ? 420 PHE A N   1 
ATOM   690  C CA  . PHE A 1 96  ? -20.672 30.085 14.651  1.00 31.18 ? 420 PHE A CA  1 
ATOM   691  C C   . PHE A 1 96  ? -22.025 29.924 13.984  1.00 30.93 ? 420 PHE A C   1 
ATOM   692  O O   . PHE A 1 96  ? -22.515 30.843 13.341  1.00 33.96 ? 420 PHE A O   1 
ATOM   693  C CB  . PHE A 1 96  ? -19.927 31.295 14.098  1.00 30.26 ? 420 PHE A CB  1 
ATOM   694  C CG  . PHE A 1 96  ? -18.560 31.463 14.706  1.00 37.83 ? 420 PHE A CG  1 
ATOM   695  C CD1 . PHE A 1 96  ? -18.410 31.505 16.094  1.00 42.55 ? 420 PHE A CD1 1 
ATOM   696  C CD2 . PHE A 1 96  ? -17.425 31.529 13.913  1.00 37.93 ? 420 PHE A CD2 1 
ATOM   697  C CE1 . PHE A 1 96  ? -17.152 31.635 16.670  1.00 40.88 ? 420 PHE A CE1 1 
ATOM   698  C CE2 . PHE A 1 96  ? -16.168 31.655 14.487  1.00 41.71 ? 420 PHE A CE2 1 
ATOM   699  C CZ  . PHE A 1 96  ? -16.032 31.710 15.861  1.00 40.05 ? 420 PHE A CZ  1 
ATOM   700  N N   . GLY A 1 97  ? -22.613 28.747 14.129  1.00 30.35 ? 421 GLY A N   1 
ATOM   701  C CA  . GLY A 1 97  ? -23.938 28.504 13.603  1.00 30.33 ? 421 GLY A CA  1 
ATOM   702  C C   . GLY A 1 97  ? -23.991 28.177 12.127  1.00 29.03 ? 421 GLY A C   1 
ATOM   703  O O   . GLY A 1 97  ? -25.033 27.777 11.647  1.00 31.07 ? 421 GLY A O   1 
ATOM   704  N N   . ASN A 1 98  ? -22.888 28.339 11.395  1.00 27.10 ? 422 ASN A N   1 
ATOM   705  C CA  . ASN A 1 98  ? -22.876 27.870 10.017  1.00 26.23 ? 422 ASN A CA  1 
ATOM   706  C C   . ASN A 1 98  ? -22.361 26.444 9.909   1.00 24.25 ? 422 ASN A C   1 
ATOM   707  O O   . ASN A 1 98  ? -21.353 26.086 10.528  1.00 24.25 ? 422 ASN A O   1 
ATOM   708  C CB  . ASN A 1 98  ? -22.071 28.796 9.103   1.00 26.88 ? 422 ASN A CB  1 
ATOM   709  C CG  . ASN A 1 98  ? -22.616 30.208 9.096   1.00 30.32 ? 422 ASN A CG  1 
ATOM   710  O OD1 . ASN A 1 98  ? -23.812 30.422 8.902   1.00 37.48 ? 422 ASN A OD1 1 
ATOM   711  N ND2 . ASN A 1 98  ? -21.745 31.175 9.339   1.00 22.69 ? 422 ASN A ND2 1 
ATOM   712  N N   . SER A 1 99  ? -23.066 25.644 9.116   1.00 23.52 ? 423 SER A N   1 
ATOM   713  C CA  . SER A 1 99  ? -22.736 24.238 8.907   1.00 23.19 ? 423 SER A CA  1 
ATOM   714  C C   . SER A 1 99  ? -21.968 24.083 7.623   1.00 21.27 ? 423 SER A C   1 
ATOM   715  O O   . SER A 1 99  ? -22.332 24.670 6.596   1.00 20.45 ? 423 SER A O   1 
ATOM   716  C CB  . SER A 1 99  ? -24.027 23.418 8.758   1.00 23.88 ? 423 SER A CB  1 
ATOM   717  O OG  . SER A 1 99  ? -24.770 23.430 9.956   1.00 26.40 ? 423 SER A OG  1 
ATOM   718  N N   . PHE A 1 100 ? -20.952 23.242 7.660   1.00 18.36 ? 424 PHE A N   1 
ATOM   719  C CA  . PHE A 1 100 ? -20.109 23.032 6.496   1.00 21.54 ? 424 PHE A CA  1 
ATOM   720  C C   . PHE A 1 100 ? -20.019 21.531 6.175   1.00 20.33 ? 424 PHE A C   1 
ATOM   721  O O   . PHE A 1 100 ? -19.917 20.701 7.081   1.00 17.15 ? 424 PHE A O   1 
ATOM   722  C CB  . PHE A 1 100 ? -18.712 23.582 6.778   1.00 21.95 ? 424 PHE A CB  1 
ATOM   723  C CG  . PHE A 1 100 ? -18.672 25.076 6.898   1.00 25.41 ? 424 PHE A CG  1 
ATOM   724  C CD1 . PHE A 1 100 ? -18.383 25.868 5.797   1.00 27.58 ? 424 PHE A CD1 1 
ATOM   725  C CD2 . PHE A 1 100 ? -18.925 25.694 8.119   1.00 22.87 ? 424 PHE A CD2 1 
ATOM   726  C CE1 . PHE A 1 100 ? -18.334 27.269 5.914   1.00 30.89 ? 424 PHE A CE1 1 
ATOM   727  C CE2 . PHE A 1 100 ? -18.872 27.090 8.240   1.00 29.43 ? 424 PHE A CE2 1 
ATOM   728  C CZ  . PHE A 1 100 ? -18.591 27.868 7.148   1.00 27.92 ? 424 PHE A CZ  1 
ATOM   729  N N   . MET A 1 101 ? -20.058 21.210 4.887   1.00 17.28 ? 425 MET A N   1 
ATOM   730  C CA  . MET A 1 101 ? -19.925 19.841 4.448   1.00 18.34 ? 425 MET A CA  1 
ATOM   731  C C   . MET A 1 101 ? -18.506 19.675 3.952   1.00 19.06 ? 425 MET A C   1 
ATOM   732  O O   . MET A 1 101 ? -18.020 20.518 3.199   1.00 18.96 ? 425 MET A O   1 
ATOM   733  C CB  . MET A 1 101 ? -20.944 19.554 3.348   1.00 17.36 ? 425 MET A CB  1 
ATOM   734  C CG  . MET A 1 101 ? -22.367 19.711 3.844   1.00 12.97 ? 425 MET A CG  1 
ATOM   735  S SD  . MET A 1 101 ? -23.537 19.501 2.499   1.00 23.17 ? 425 MET A SD  1 
ATOM   736  C CE  . MET A 1 101 ? -23.271 21.048 1.592   1.00 17.96 ? 425 MET A CE  1 
ATOM   737  N N   . VAL A 1 102 ? -17.842 18.605 4.390   1.00 19.35 ? 426 VAL A N   1 
ATOM   738  C CA  . VAL A 1 102 ? -16.436 18.366 4.072   1.00 18.25 ? 426 VAL A CA  1 
ATOM   739  C C   . VAL A 1 102 ? -16.251 17.327 2.932   1.00 20.23 ? 426 VAL A C   1 
ATOM   740  O O   . VAL A 1 102 ? -16.654 16.184 3.077   1.00 19.32 ? 426 VAL A O   1 
ATOM   741  C CB  . VAL A 1 102 ? -15.700 17.840 5.312   1.00 19.21 ? 426 VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 102 ? -14.210 17.688 4.996   1.00 19.65 ? 426 VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 102 ? -15.894 18.792 6.543   1.00 16.71 ? 426 VAL A CG2 1 
ATOM   744  N N   . PRO A 1 103 ? -15.636 17.731 1.803   1.00 20.78 ? 427 PRO A N   1 
ATOM   745  C CA  . PRO A 1 103 ? -15.413 16.860 0.634   1.00 19.03 ? 427 PRO A CA  1 
ATOM   746  C C   . PRO A 1 103 ? -14.324 15.826 0.880   1.00 19.77 ? 427 PRO A C   1 
ATOM   747  O O   . PRO A 1 103 ? -13.506 15.984 1.812   1.00 18.07 ? 427 PRO A O   1 
ATOM   748  C CB  . PRO A 1 103 ? -14.926 17.837 -0.450  1.00 22.18 ? 427 PRO A CB  1 
ATOM   749  C CG  . PRO A 1 103 ? -15.424 19.224 0.016   1.00 24.97 ? 427 PRO A CG  1 
ATOM   750  C CD  . PRO A 1 103 ? -15.322 19.150 1.520   1.00 18.03 ? 427 PRO A CD  1 
ATOM   751  N N   . VAL A 1 104 ? -14.256 14.803 0.026   1.00 18.50 ? 428 VAL A N   1 
ATOM   752  C CA  . VAL A 1 104 ? -13.352 13.682 0.317   1.00 19.30 ? 428 VAL A CA  1 
ATOM   753  C C   . VAL A 1 104 ? -11.887 14.122 0.144   1.00 21.59 ? 428 VAL A C   1 
ATOM   754  O O   . VAL A 1 104 ? -11.005 13.523 0.717   1.00 23.71 ? 428 VAL A O   1 
ATOM   755  C CB  . VAL A 1 104 ? -13.673 12.411 -0.520  1.00 20.92 ? 428 VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 104 ? -15.049 11.807 -0.115  1.00 18.90 ? 428 VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 104 ? -13.634 12.684 -2.045  1.00 14.30 ? 428 VAL A CG2 1 
ATOM   758  N N   . ASP A 1 105 ? -11.653 15.163 -0.651  1.00 24.41 ? 429 ASP A N   1 
ATOM   759  C CA  . ASP A 1 105 ? -10.292 15.688 -0.852  1.00 28.18 ? 429 ASP A CA  1 
ATOM   760  C C   . ASP A 1 105 ? -9.885  16.817 0.118   1.00 28.72 ? 429 ASP A C   1 
ATOM   761  O O   . ASP A 1 105 ? -8.871  17.478 -0.104  1.00 28.27 ? 429 ASP A O   1 
ATOM   762  C CB  . ASP A 1 105 ? -10.062 16.133 -2.317  1.00 25.74 ? 429 ASP A CB  1 
ATOM   763  C CG  . ASP A 1 105 ? -10.964 17.296 -2.739  1.00 34.56 ? 429 ASP A CG  1 
ATOM   764  O OD1 . ASP A 1 105 ? -12.024 17.550 -2.109  1.00 31.30 ? 429 ASP A OD1 1 
ATOM   765  O OD2 . ASP A 1 105 ? -10.624 17.957 -3.737  1.00 31.21 ? 429 ASP A OD2 1 
ATOM   766  N N   . ALA A 1 106 ? -10.659 17.046 1.182   1.00 26.60 ? 430 ALA A N   1 
ATOM   767  C CA  . ALA A 1 106 ? -10.243 18.019 2.199   1.00 25.98 ? 430 ALA A CA  1 
ATOM   768  C C   . ALA A 1 106 ? -8.842  17.697 2.758   1.00 27.03 ? 430 ALA A C   1 
ATOM   769  O O   . ALA A 1 106 ? -8.551  16.542 3.088   1.00 24.43 ? 430 ALA A O   1 
ATOM   770  C CB  . ALA A 1 106 ? -11.255 18.082 3.335   1.00 25.28 ? 430 ALA A CB  1 
ATOM   771  N N   . PRO A 1 107 ? -7.970  18.723 2.860   1.00 27.36 ? 431 PRO A N   1 
ATOM   772  C CA  . PRO A 1 107 ? -6.678  18.492 3.487   1.00 28.97 ? 431 PRO A CA  1 
ATOM   773  C C   . PRO A 1 107 ? -6.881  18.346 4.995   1.00 31.80 ? 431 PRO A C   1 
ATOM   774  O O   . PRO A 1 107 ? -8.005  18.541 5.497   1.00 28.12 ? 431 PRO A O   1 
ATOM   775  C CB  . PRO A 1 107 ? -5.889  19.777 3.185   1.00 28.37 ? 431 PRO A CB  1 
ATOM   776  C CG  . PRO A 1 107 ? -6.912  20.824 2.966   1.00 29.31 ? 431 PRO A CG  1 
ATOM   777  C CD  . PRO A 1 107 ? -8.161  20.125 2.445   1.00 26.66 ? 431 PRO A CD  1 
ATOM   778  N N   . ASN A 1 108 ? -5.812  17.990 5.712   1.00 33.97 ? 432 ASN A N   1 
ATOM   779  C CA  . ASN A 1 108 ? -5.855  17.976 7.169   1.00 34.98 ? 432 ASN A CA  1 
ATOM   780  C C   . ASN A 1 108 ? -4.694  18.799 7.749   1.00 35.85 ? 432 ASN A C   1 
ATOM   781  O O   . ASN A 1 108 ? -3.545  18.388 7.616   1.00 34.55 ? 432 ASN A O   1 
ATOM   782  C CB  . ASN A 1 108 ? -5.792  16.552 7.680   1.00 33.47 ? 432 ASN A CB  1 
ATOM   783  C CG  . ASN A 1 108 ? -5.918  16.487 9.183   1.00 39.05 ? 432 ASN A CG  1 
ATOM   784  O OD1 . ASN A 1 108 ? -6.614  17.297 9.785   1.00 38.63 ? 432 ASN A OD1 1 
ATOM   785  N ND2 . ASN A 1 108 ? -5.237  15.535 9.799   1.00 41.28 ? 432 ASN A ND2 1 
ATOM   786  N N   . PRO A 1 109 ? -4.983  19.952 8.392   1.00 34.59 ? 433 PRO A N   1 
ATOM   787  C CA  . PRO A 1 109 ? -6.293  20.540 8.682   1.00 33.44 ? 433 PRO A CA  1 
ATOM   788  C C   . PRO A 1 109 ? -6.931  21.161 7.456   1.00 32.39 ? 433 PRO A C   1 
ATOM   789  O O   . PRO A 1 109 ? -6.303  21.265 6.413   1.00 30.66 ? 433 PRO A O   1 
ATOM   790  C CB  . PRO A 1 109 ? -5.951  21.665 9.661   1.00 34.16 ? 433 PRO A CB  1 
ATOM   791  C CG  . PRO A 1 109 ? -4.583  22.144 9.176   1.00 32.91 ? 433 PRO A CG  1 
ATOM   792  C CD  . PRO A 1 109 ? -3.887  20.812 8.892   1.00 35.32 ? 433 PRO A CD  1 
ATOM   793  N N   . TYR A 1 110 ? -8.189  21.557 7.584   1.00 31.49 ? 434 TYR A N   1 
ATOM   794  C CA  . TYR A 1 110 ? -8.893  22.185 6.477   1.00 30.33 ? 434 TYR A CA  1 
ATOM   795  C C   . TYR A 1 110 ? -9.640  23.390 7.020   1.00 28.17 ? 434 TYR A C   1 
ATOM   796  O O   . TYR A 1 110 ? -9.842  23.484 8.214   1.00 27.55 ? 434 TYR A O   1 
ATOM   797  C CB  . TYR A 1 110 ? -9.832  21.195 5.794   1.00 29.43 ? 434 TYR A CB  1 
ATOM   798  C CG  . TYR A 1 110 ? -10.859 20.580 6.733   1.00 29.02 ? 434 TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 110 ? -10.642 19.320 7.297   1.00 33.05 ? 434 TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 110 ? -12.039 21.251 7.055   1.00 26.40 ? 434 TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 110 ? -11.578 18.737 8.153   1.00 35.11 ? 434 TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 110 ? -12.986 20.668 7.916   1.00 29.64 ? 434 TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 110 ? -12.735 19.422 8.466   1.00 29.31 ? 434 TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 110 ? -13.633 18.827 9.317   1.00 32.75 ? 434 TYR A OH  1 
ATOM   805  N N   . ARG A 1 111 ? -10.022 24.320 6.155   1.00 30.24 ? 435 ARG A N   1 
ATOM   806  C CA  . ARG A 1 111 ? -10.754 25.516 6.596   1.00 32.82 ? 435 ARG A CA  1 
ATOM   807  C C   . ARG A 1 111 ? -12.050 25.616 5.820   1.00 31.55 ? 435 ARG A C   1 
ATOM   808  O O   . ARG A 1 111 ? -12.337 24.746 5.011   1.00 30.22 ? 435 ARG A O   1 
ATOM   809  C CB  . ARG A 1 111 ? -9.920  26.773 6.345   1.00 35.25 ? 435 ARG A CB  1 
ATOM   810  C CG  . ARG A 1 111 ? -8.534  26.757 6.994   1.00 45.25 ? 435 ARG A CG  1 
ATOM   811  C CD  . ARG A 1 111 ? -7.642  27.808 6.332   1.00 57.83 ? 435 ARG A CD  1 
ATOM   812  N NE  . ARG A 1 111 ? -6.503  28.191 7.167   1.00 67.19 ? 435 ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 111 ? -6.482  29.258 7.969   1.00 71.81 ? 435 ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 111 ? -7.544  30.059 8.060   1.00 71.58 ? 435 ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 111 ? -5.394  29.527 8.685   1.00 72.21 ? 435 ARG A NH2 1 
ATOM   816  N N   . SER A 1 112 ? -12.800 26.695 6.024   1.00 28.88 ? 436 SER A N   1 
ATOM   817  C CA  . SER A 1 112 ? -14.084 26.862 5.350   1.00 32.16 ? 436 SER A CA  1 
ATOM   818  C C   . SER A 1 112 ? -13.977 26.910 3.824   1.00 31.12 ? 436 SER A C   1 
ATOM   819  O O   . SER A 1 112 ? -14.883 26.468 3.117   1.00 30.50 ? 436 SER A O   1 
ATOM   820  C CB  . SER A 1 112 ? -14.815 28.098 5.883   1.00 32.36 ? 436 SER A CB  1 
ATOM   821  O OG  . SER A 1 112 ? -14.065 29.248 5.589   1.00 38.24 ? 436 SER A OG  1 
ATOM   822  N N   . GLU A 1 113 ? -12.861 27.421 3.314   1.00 30.45 ? 437 GLU A N   1 
ATOM   823  C CA  . GLU A 1 113 ? -12.668 27.536 1.869   1.00 31.63 ? 437 GLU A CA  1 
ATOM   824  C C   . GLU A 1 113 ? -12.537 26.175 1.155   1.00 29.14 ? 437 GLU A C   1 
ATOM   825  O O   . GLU A 1 113 ? -12.744 26.093 -0.046  1.00 30.94 ? 437 GLU A O   1 
ATOM   826  C CB  . GLU A 1 113 ? -11.449 28.419 1.553   1.00 34.16 ? 437 GLU A CB  1 
ATOM   827  C CG  . GLU A 1 113 ? -10.137 27.871 2.102   1.00 40.33 ? 437 GLU A CG  1 
ATOM   828  C CD  . GLU A 1 113 ? -8.947  28.814 1.881   1.00 54.35 ? 437 GLU A CD  1 
ATOM   829  O OE1 . GLU A 1 113 ? -7.796  28.397 2.150   1.00 56.74 ? 437 GLU A OE1 1 
ATOM   830  O OE2 . GLU A 1 113 ? -9.162  29.968 1.443   1.00 59.26 ? 437 GLU A OE2 1 
ATOM   831  N N   . ASN A 1 114 ? -12.175 25.125 1.886   1.00 26.26 ? 438 ASN A N   1 
ATOM   832  C CA  . ASN A 1 114 ? -12.146 23.763 1.337   1.00 26.34 ? 438 ASN A CA  1 
ATOM   833  C C   . ASN A 1 114 ? -13.532 23.073 1.356   1.00 26.31 ? 438 ASN A C   1 
ATOM   834  O O   . ASN A 1 114 ? -13.663 21.942 0.894   1.00 23.76 ? 438 ASN A O   1 
ATOM   835  C CB  . ASN A 1 114 ? -11.189 22.891 2.140   1.00 24.89 ? 438 ASN A CB  1 
ATOM   836  C CG  . ASN A 1 114 ? -9.770  23.493 2.254   1.00 33.64 ? 438 ASN A CG  1 
ATOM   837  O OD1 . ASN A 1 114 ? -9.058  23.679 1.252   1.00 34.34 ? 438 ASN A OD1 1 
ATOM   838  N ND2 . ASN A 1 114 ? -9.355  23.756 3.473   1.00 24.64 ? 438 ASN A ND2 1 
ATOM   839  N N   . CYS A 1 115 ? -14.552 23.744 1.902   1.00 24.86 ? 439 CYS A N   1 
ATOM   840  C CA  . CYS A 1 115 ? -15.817 23.067 2.235   1.00 25.53 ? 439 CYS A CA  1 
ATOM   841  C C   . CYS A 1 115 ? -16.994 23.807 1.672   1.00 24.89 ? 439 CYS A C   1 
ATOM   842  O O   . CYS A 1 115 ? -16.851 24.958 1.280   1.00 24.96 ? 439 CYS A O   1 
ATOM   843  C CB  . CYS A 1 115 ? -15.996 22.984 3.752   1.00 23.42 ? 439 CYS A CB  1 
ATOM   844  S SG  . CYS A 1 115 ? -14.753 22.070 4.580   1.00 25.90 ? 439 CYS A SG  1 
ATOM   845  N N   . LEU A 1 116 ? -18.165 23.169 1.638   1.00 22.04 ? 440 LEU A N   1 
ATOM   846  C CA  . LEU A 1 116 ? -19.374 23.906 1.229   1.00 21.27 ? 440 LEU A CA  1 
ATOM   847  C C   . LEU A 1 116 ? -20.205 24.327 2.416   1.00 21.55 ? 440 LEU A C   1 
ATOM   848  O O   . LEU A 1 116 ? -20.487 23.518 3.299   1.00 20.14 ? 440 LEU A O   1 
ATOM   849  C CB  . LEU A 1 116 ? -20.248 23.105 0.276   1.00 23.00 ? 440 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 116 ? -19.751 23.096 -1.163  1.00 21.49 ? 440 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 116 ? -18.451 22.295 -1.236  1.00 19.86 ? 440 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 116 ? -20.836 22.480 -2.022  1.00 22.86 ? 440 LEU A CD2 1 
ATOM   853  N N   . CYS A 1 117 ? -20.616 25.593 2.412   1.00 21.28 ? 441 CYS A N   1 
ATOM   854  C CA  . CYS A 1 117 ? -21.433 26.144 3.466   1.00 21.11 ? 441 CYS A CA  1 
ATOM   855  C C   . CYS A 1 117 ? -22.913 25.972 3.135   1.00 20.73 ? 441 CYS A C   1 
ATOM   856  O O   . CYS A 1 117 ? -23.390 26.487 2.129   1.00 21.18 ? 441 CYS A O   1 
ATOM   857  C CB  . CYS A 1 117 ? -21.101 27.636 3.630   1.00 23.18 ? 441 CYS A CB  1 
ATOM   858  S SG  . CYS A 1 117 ? -22.082 28.411 4.884   1.00 27.25 ? 441 CYS A SG  1 
ATOM   859  N N   . VAL A 1 118 ? -23.647 25.277 4.005   1.00 18.29 ? 442 VAL A N   1 
ATOM   860  C CA  . VAL A 1 118 ? -25.030 24.973 3.753   1.00 17.90 ? 442 VAL A CA  1 
ATOM   861  C C   . VAL A 1 118 ? -25.902 26.233 3.646   1.00 17.69 ? 442 VAL A C   1 
ATOM   862  O O   . VAL A 1 118 ? -26.808 26.297 2.805   1.00 15.06 ? 442 VAL A O   1 
ATOM   863  C CB  . VAL A 1 118 ? -25.629 24.066 4.869   1.00 19.63 ? 442 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 118 ? -27.134 23.853 4.607   1.00 22.81 ? 442 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 118 ? -24.910 22.681 4.906   1.00 18.60 ? 442 VAL A CG2 1 
ATOM   866  N N   . GLN A 1 119 ? -25.624 27.223 4.500   1.00 18.15 ? 443 GLN A N   1 
ATOM   867  C CA  . GLN A 1 119 ? -26.366 28.478 4.478   1.00 18.37 ? 443 GLN A CA  1 
ATOM   868  C C   . GLN A 1 119 ? -26.274 29.209 3.111   1.00 20.17 ? 443 GLN A C   1 
ATOM   869  O O   . GLN A 1 119 ? -27.266 29.798 2.655   1.00 19.52 ? 443 GLN A O   1 
ATOM   870  C CB  . GLN A 1 119 ? -25.890 29.404 5.629   1.00 17.09 ? 443 GLN A CB  1 
ATOM   871  C CG  . GLN A 1 119 ? -26.502 29.050 7.017   1.00 24.44 ? 443 GLN A CG  1 
ATOM   872  C CD  . GLN A 1 119 ? -26.145 27.635 7.528   1.00 26.48 ? 443 GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 119 ? -25.047 27.138 7.290   1.00 23.70 ? 443 GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 119 ? -27.071 27.008 8.245   1.00 31.27 ? 443 GLN A NE2 1 
ATOM   875  N N   . ASN A 1 120 ? -25.095 29.196 2.481   1.00 19.95 ? 444 ASN A N   1 
ATOM   876  C CA  . ASN A 1 120 ? -24.942 29.776 1.122   1.00 22.51 ? 444 ASN A CA  1 
ATOM   877  C C   . ASN A 1 120 ? -25.825 29.051 0.105   1.00 20.77 ? 444 ASN A C   1 
ATOM   878  O O   . ASN A 1 120 ? -26.365 29.655 -0.826  1.00 19.85 ? 444 ASN A O   1 
ATOM   879  C CB  . ASN A 1 120 ? -23.489 29.696 0.622   1.00 26.20 ? 444 ASN A CB  1 
ATOM   880  C CG  . ASN A 1 120 ? -22.537 30.623 1.382   1.00 34.85 ? 444 ASN A CG  1 
ATOM   881  O OD1 . ASN A 1 120 ? -21.315 30.544 1.217   1.00 38.38 ? 444 ASN A OD1 1 
ATOM   882  N ND2 . ASN A 1 120 ? -23.087 31.481 2.230   1.00 43.59 ? 444 ASN A ND2 1 
ATOM   883  N N   . ILE A 1 121 ? -25.971 27.737 0.276   1.00 19.74 ? 445 ILE A N   1 
ATOM   884  C CA  . ILE A 1 121 ? -26.784 26.992 -0.655  1.00 17.79 ? 445 ILE A CA  1 
ATOM   885  C C   . ILE A 1 121 ? -28.205 27.416 -0.440  1.00 18.05 ? 445 ILE A C   1 
ATOM   886  O O   . ILE A 1 121 ? -28.929 27.631 -1.395  1.00 20.06 ? 445 ILE A O   1 
ATOM   887  C CB  . ILE A 1 121 ? -26.649 25.476 -0.453  1.00 19.87 ? 445 ILE A CB  1 
ATOM   888  C CG1 . ILE A 1 121 ? -25.195 25.055 -0.669  1.00 18.67 ? 445 ILE A CG1 1 
ATOM   889  C CG2 . ILE A 1 121 ? -27.623 24.720 -1.404  1.00 16.17 ? 445 ILE A CG2 1 
ATOM   890  C CD1 . ILE A 1 121 ? -24.958 23.557 -0.455  1.00 22.93 ? 445 ILE A CD1 1 
ATOM   891  N N   . LEU A 1 122 ? -28.616 27.552 0.821   1.00 17.51 ? 446 LEU A N   1 
ATOM   892  C CA  . LEU A 1 122 ? -30.010 27.952 1.106   1.00 18.49 ? 446 LEU A CA  1 
ATOM   893  C C   . LEU A 1 122 ? -30.325 29.347 0.499   1.00 17.63 ? 446 LEU A C   1 
ATOM   894  O O   . LEU A 1 122 ? -31.381 29.569 -0.060  1.00 19.43 ? 446 LEU A O   1 
ATOM   895  C CB  . LEU A 1 122 ? -30.262 27.971 2.617   1.00 16.55 ? 446 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 122 ? -31.553 28.612 3.165   1.00 19.86 ? 446 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 122 ? -32.813 27.976 2.613   1.00 15.94 ? 446 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 122 ? -31.542 28.524 4.726   1.00 20.58 ? 446 LEU A CD2 1 
ATOM   899  N N   . LYS A 1 123 ? -29.394 30.269 0.614   1.00 18.42 ? 447 LYS A N   1 
ATOM   900  C CA  . LYS A 1 123 ? -29.563 31.592 -0.002  1.00 22.60 ? 447 LYS A CA  1 
ATOM   901  C C   . LYS A 1 123 ? -29.843 31.447 -1.515  1.00 21.55 ? 447 LYS A C   1 
ATOM   902  O O   . LYS A 1 123 ? -30.782 32.058 -2.050  1.00 20.36 ? 447 LYS A O   1 
ATOM   903  C CB  . LYS A 1 123 ? -28.319 32.467 0.264   1.00 22.33 ? 447 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 123 ? -28.462 33.908 -0.251  1.00 29.03 ? 447 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 123 ? -27.244 34.756 0.049   1.00 37.50 ? 447 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 123 ? -26.123 34.568 -0.986  1.00 47.30 ? 447 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 123 ? -26.621 34.621 -2.394  1.00 52.66 ? 447 LYS A NZ  1 
ATOM   908  N N   . LEU A 1 124 ? -29.037 30.617 -2.189  1.00 22.27 ? 448 LEU A N   1 
ATOM   909  C CA  . LEU A 1 124 ? -29.197 30.389 -3.643  1.00 23.64 ? 448 LEU A CA  1 
ATOM   910  C C   . LEU A 1 124 ? -30.540 29.770 -3.970  1.00 20.95 ? 448 LEU A C   1 
ATOM   911  O O   . LEU A 1 124 ? -31.143 30.103 -4.972  1.00 23.28 ? 448 LEU A O   1 
ATOM   912  C CB  . LEU A 1 124 ? -28.041 29.530 -4.200  1.00 22.48 ? 448 LEU A CB  1 
ATOM   913  C CG  . LEU A 1 124 ? -26.743 30.221 -4.667  1.00 29.61 ? 448 LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 124 ? -26.656 31.680 -4.312  1.00 31.69 ? 448 LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 124 ? -25.462 29.462 -4.280  1.00 26.03 ? 448 LEU A CD2 1 
ATOM   916  N N   . MET A 1 125 ? -31.040 28.898 -3.098  1.00 19.68 ? 449 MET A N   1 
ATOM   917  C CA  . MET A 1 125 ? -32.346 28.268 -3.304  1.00 18.90 ? 449 MET A CA  1 
ATOM   918  C C   . MET A 1 125 ? -33.483 29.270 -3.155  1.00 22.65 ? 449 MET A C   1 
ATOM   919  O O   . MET A 1 125 ? -34.482 29.244 -3.926  1.00 20.63 ? 449 MET A O   1 
ATOM   920  C CB  . MET A 1 125 ? -32.534 27.112 -2.313  1.00 19.20 ? 449 MET A CB  1 
ATOM   921  C CG  . MET A 1 125 ? -31.536 25.954 -2.511  1.00 16.59 ? 449 MET A CG  1 
ATOM   922  S SD  . MET A 1 125 ? -31.626 24.685 -1.217  1.00 21.09 ? 449 MET A SD  1 
ATOM   923  C CE  . MET A 1 125 ? -33.215 23.978 -1.532  1.00 12.34 ? 449 MET A CE  1 
ATOM   924  N N   . GLN A 1 126 ? -33.352 30.168 -2.169  1.00 21.28 ? 450 GLN A N   1 
ATOM   925  C CA  . GLN A 1 126 ? -34.400 31.147 -1.959  1.00 24.19 ? 450 GLN A CA  1 
ATOM   926  C C   . GLN A 1 126 ? -34.479 32.084 -3.149  1.00 23.62 ? 450 GLN A C   1 
ATOM   927  O O   . GLN A 1 126 ? -35.557 32.512 -3.497  1.00 24.86 ? 450 GLN A O   1 
ATOM   928  C CB  . GLN A 1 126 ? -34.175 31.980 -0.704  1.00 24.78 ? 450 GLN A CB  1 
ATOM   929  C CG  . GLN A 1 126 ? -34.319 31.224 0.576   1.00 29.91 ? 450 GLN A CG  1 
ATOM   930  C CD  . GLN A 1 126 ? -34.124 32.144 1.762   1.00 30.28 ? 450 GLN A CD  1 
ATOM   931  O OE1 . GLN A 1 126 ? -35.042 32.372 2.566   1.00 25.66 ? 450 GLN A OE1 1 
ATOM   932  N NE2 . GLN A 1 126 ? -32.927 32.694 1.866   1.00 28.27 ? 450 GLN A NE2 1 
ATOM   933  N N   . GLU A 1 127 ? -33.343 32.395 -3.763  1.00 24.56 ? 451 GLU A N   1 
ATOM   934  C CA  . GLU A 1 127 ? -33.343 33.214 -4.983  1.00 27.58 ? 451 GLU A CA  1 
ATOM   935  C C   . GLU A 1 127 ? -34.132 32.578 -6.126  1.00 28.95 ? 451 GLU A C   1 
ATOM   936  O O   . GLU A 1 127 ? -34.597 33.297 -7.019  1.00 31.68 ? 451 GLU A O   1 
ATOM   937  C CB  . GLU A 1 127 ? -31.922 33.550 -5.436  1.00 24.10 ? 451 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 127 ? -31.217 34.494 -4.477  1.00 32.85 ? 451 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 127 ? -29.705 34.640 -4.743  1.00 38.10 ? 451 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 127 ? -29.215 34.183 -5.806  1.00 42.81 ? 451 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 127 ? -29.010 35.233 -3.888  1.00 45.78 ? 451 GLU A OE2 1 
ATOM   942  N N   . LYS A 1 128 ? -34.315 31.254 -6.092  1.00 26.85 ? 452 LYS A N   1 
ATOM   943  C CA  . LYS A 1 128 ? -35.165 30.570 -7.082  1.00 25.64 ? 452 LYS A CA  1 
ATOM   944  C C   . LYS A 1 128 ? -36.615 30.544 -6.677  1.00 25.54 ? 452 LYS A C   1 
ATOM   945  O O   . LYS A 1 128 ? -37.434 29.957 -7.386  1.00 26.77 ? 452 LYS A O   1 
ATOM   946  C CB  . LYS A 1 128 ? -34.726 29.117 -7.293  1.00 25.22 ? 452 LYS A CB  1 
ATOM   947  C CG  . LYS A 1 128 ? -33.291 28.934 -7.742  1.00 30.65 ? 452 LYS A CG  1 
ATOM   948  C CD  . LYS A 1 128 ? -33.002 29.750 -8.974  1.00 34.98 ? 452 LYS A CD  1 
ATOM   949  C CE  . LYS A 1 128 ? -31.827 29.243 -9.762  1.00 37.91 ? 452 LYS A CE  1 
ATOM   950  N NZ  . LYS A 1 128 ? -32.318 28.396 -10.907 1.00 46.82 ? 452 LYS A NZ  1 
ATOM   951  N N   . GLU A 1 129 ? -36.934 31.118 -5.518  1.00 23.50 ? 453 GLU A N   1 
ATOM   952  C CA  . GLU A 1 129 ? -38.316 31.153 -4.996  1.00 24.51 ? 453 GLU A CA  1 
ATOM   953  C C   . GLU A 1 129 ? -38.983 29.796 -4.793  1.00 24.08 ? 453 GLU A C   1 
ATOM   954  O O   . GLU A 1 129 ? -40.191 29.617 -5.049  1.00 22.08 ? 453 GLU A O   1 
ATOM   955  C CB  . GLU A 1 129 ? -39.221 32.043 -5.882  1.00 25.59 ? 453 GLU A CB  1 
ATOM   956  C CG  . GLU A 1 129 ? -38.591 33.400 -6.175  1.00 32.49 ? 453 GLU A CG  1 
ATOM   957  C CD  . GLU A 1 129 ? -39.620 34.440 -6.592  1.00 45.75 ? 453 GLU A CD  1 
ATOM   958  O OE1 . GLU A 1 129 ? -40.287 35.028 -5.710  1.00 49.53 ? 453 GLU A OE1 1 
ATOM   959  O OE2 . GLU A 1 129 ? -39.773 34.648 -7.805  1.00 47.86 ? 453 GLU A OE2 1 
ATOM   960  N N   . THR A 1 130 ? -38.210 28.822 -4.343  1.00 22.94 ? 454 THR A N   1 
ATOM   961  C CA  . THR A 1 130 ? -38.772 27.495 -4.105  1.00 21.00 ? 454 THR A CA  1 
ATOM   962  C C   . THR A 1 130 ? -39.949 27.613 -3.175  1.00 21.94 ? 454 THR A C   1 
ATOM   963  O O   . THR A 1 130 ? -40.008 28.558 -2.401  1.00 21.02 ? 454 THR A O   1 
ATOM   964  C CB  . THR A 1 130 ? -37.742 26.636 -3.426  1.00 21.99 ? 454 THR A CB  1 
ATOM   965  O OG1 . THR A 1 130 ? -37.112 27.414 -2.388  1.00 16.84 ? 454 THR A OG1 1 
ATOM   966  C CG2 . THR A 1 130 ? -36.692 26.261 -4.440  1.00 20.89 ? 454 THR A CG2 1 
ATOM   967  N N   . GLY A 1 131 ? -40.877 26.655 -3.249  1.00 21.15 ? 455 GLY A N   1 
ATOM   968  C CA  . GLY A 1 131 ? -41.973 26.552 -2.299  1.00 22.37 ? 455 GLY A CA  1 
ATOM   969  C C   . GLY A 1 131 ? -41.603 25.851 -0.992  1.00 22.43 ? 455 GLY A C   1 
ATOM   970  O O   . GLY A 1 131 ? -42.272 26.035 0.018   1.00 23.28 ? 455 GLY A O   1 
ATOM   971  N N   . LEU A 1 132 ? -40.533 25.061 -0.998  1.00 20.79 ? 456 LEU A N   1 
ATOM   972  C CA  . LEU A 1 132 ? -40.102 24.356 0.208   1.00 20.96 ? 456 LEU A CA  1 
ATOM   973  C C   . LEU A 1 132 ? -38.607 24.114 0.131   1.00 18.31 ? 456 LEU A C   1 
ATOM   974  O O   . LEU A 1 132 ? -38.123 23.695 -0.928  1.00 18.81 ? 456 LEU A O   1 
ATOM   975  C CB  . LEU A 1 132 ? -40.821 22.998 0.301   1.00 20.35 ? 456 LEU A CB  1 
ATOM   976  C CG  . LEU A 1 132 ? -41.124 22.334 1.648   1.00 26.78 ? 456 LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 132 ? -40.887 20.837 1.572   1.00 17.95 ? 456 LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 132 ? -40.476 22.921 2.898   1.00 20.12 ? 456 LEU A CD2 1 
ATOM   979  N N   . ASN A 1 133 ? -37.886 24.358 1.230   1.00 14.82 ? 457 ASN A N   1 
ATOM   980  C CA  . ASN A 1 133 ? -36.446 24.049 1.341   1.00 14.81 ? 457 ASN A CA  1 
ATOM   981  C C   . ASN A 1 133 ? -36.172 23.123 2.518   1.00 16.29 ? 457 ASN A C   1 
ATOM   982  O O   . ASN A 1 133 ? -36.362 23.526 3.673   1.00 13.09 ? 457 ASN A O   1 
ATOM   983  C CB  . ASN A 1 133 ? -35.605 25.320 1.550   1.00 13.05 ? 457 ASN A CB  1 
ATOM   984  C CG  . ASN A 1 133 ? -35.941 26.439 0.536   1.00 22.31 ? 457 ASN A CG  1 
ATOM   985  O OD1 . ASN A 1 133 ? -35.707 26.294 -0.662  1.00 18.80 ? 457 ASN A OD1 1 
ATOM   986  N ND2 . ASN A 1 133 ? -36.476 27.568 1.037   1.00 18.89 ? 457 ASN A ND2 1 
ATOM   987  N N   . VAL A 1 134 ? -35.696 21.899 2.243   1.00 16.48 ? 458 VAL A N   1 
ATOM   988  C CA  . VAL A 1 134 ? -35.424 20.911 3.314   1.00 14.44 ? 458 VAL A CA  1 
ATOM   989  C C   . VAL A 1 134 ? -33.962 20.531 3.283   1.00 15.15 ? 458 VAL A C   1 
ATOM   990  O O   . VAL A 1 134 ? -33.443 20.191 2.220   1.00 17.78 ? 458 VAL A O   1 
ATOM   991  C CB  . VAL A 1 134 ? -36.285 19.643 3.112   1.00 15.74 ? 458 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 134 ? -36.040 18.627 4.280   1.00 14.63 ? 458 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 134 ? -37.746 20.052 3.047   1.00 15.87 ? 458 VAL A CG2 1 
ATOM   994  N N   . PHE A 1 135 ? -33.282 20.592 4.432   1.00 13.10 ? 459 PHE A N   1 
ATOM   995  C CA  . PHE A 1 135 ? -31.893 20.157 4.530   1.00 15.46 ? 459 PHE A CA  1 
ATOM   996  C C   . PHE A 1 135 ? -31.848 19.064 5.580   1.00 15.54 ? 459 PHE A C   1 
ATOM   997  O O   . PHE A 1 135 ? -32.258 19.275 6.722   1.00 17.15 ? 459 PHE A O   1 
ATOM   998  C CB  . PHE A 1 135 ? -30.959 21.330 4.911   1.00 15.04 ? 459 PHE A CB  1 
ATOM   999  C CG  . PHE A 1 135 ? -31.092 22.504 3.980   1.00 20.57 ? 459 PHE A CG  1 
ATOM   1000 C CD1 . PHE A 1 135 ? -32.128 23.405 4.136   1.00 25.48 ? 459 PHE A CD1 1 
ATOM   1001 C CD2 . PHE A 1 135 ? -30.225 22.665 2.924   1.00 20.37 ? 459 PHE A CD2 1 
ATOM   1002 C CE1 . PHE A 1 135 ? -32.281 24.440 3.255   1.00 33.14 ? 459 PHE A CE1 1 
ATOM   1003 C CE2 . PHE A 1 135 ? -30.381 23.698 2.043   1.00 26.33 ? 459 PHE A CE2 1 
ATOM   1004 C CZ  . PHE A 1 135 ? -31.405 24.580 2.203   1.00 25.13 ? 459 PHE A CZ  1 
ATOM   1005 N N   . LEU A 1 136 ? -31.353 17.892 5.194   1.00 14.57 ? 460 LEU A N   1 
ATOM   1006 C CA  . LEU A 1 136 ? -31.184 16.788 6.140   1.00 14.53 ? 460 LEU A CA  1 
ATOM   1007 C C   . LEU A 1 136 ? -29.679 16.577 6.207   1.00 14.09 ? 460 LEU A C   1 
ATOM   1008 O O   . LEU A 1 136 ? -29.074 16.131 5.251   1.00 13.40 ? 460 LEU A O   1 
ATOM   1009 C CB  . LEU A 1 136 ? -31.942 15.535 5.668   1.00 13.02 ? 460 LEU A CB  1 
ATOM   1010 C CG  . LEU A 1 136 ? -33.422 15.792 5.327   1.00 13.26 ? 460 LEU A CG  1 
ATOM   1011 C CD1 . LEU A 1 136 ? -34.066 14.535 4.724   1.00 15.59 ? 460 LEU A CD1 1 
ATOM   1012 C CD2 . LEU A 1 136 ? -34.179 16.242 6.585   1.00 8.89  ? 460 LEU A CD2 1 
ATOM   1013 N N   . LEU A 1 137 ? -29.081 16.983 7.319   1.00 13.25 ? 461 LEU A N   1 
ATOM   1014 C CA  . LEU A 1 137 ? -27.637 17.037 7.436   1.00 12.55 ? 461 LEU A CA  1 
ATOM   1015 C C   . LEU A 1 137 ? -27.227 15.969 8.419   1.00 13.77 ? 461 LEU A C   1 
ATOM   1016 O O   . LEU A 1 137 ? -27.392 16.120 9.634   1.00 15.56 ? 461 LEU A O   1 
ATOM   1017 C CB  . LEU A 1 137 ? -27.188 18.432 7.932   1.00 13.80 ? 461 LEU A CB  1 
ATOM   1018 C CG  . LEU A 1 137 ? -27.661 19.607 7.050   1.00 14.44 ? 461 LEU A CG  1 
ATOM   1019 C CD1 . LEU A 1 137 ? -27.106 20.943 7.641   1.00 13.22 ? 461 LEU A CD1 1 
ATOM   1020 C CD2 . LEU A 1 137 ? -27.173 19.418 5.566   1.00 12.12 ? 461 LEU A CD2 1 
ATOM   1021 N N   . ASP A 1 138 ? -26.671 14.890 7.880   1.00 13.95 ? 462 ASP A N   1 
ATOM   1022 C CA  . ASP A 1 138 ? -26.367 13.693 8.634   1.00 14.82 ? 462 ASP A CA  1 
ATOM   1023 C C   . ASP A 1 138 ? -24.843 13.678 8.807   1.00 16.03 ? 462 ASP A C   1 
ATOM   1024 O O   . ASP A 1 138 ? -24.133 12.946 8.100   1.00 16.19 ? 462 ASP A O   1 
ATOM   1025 C CB  . ASP A 1 138 ? -26.810 12.497 7.793   1.00 17.08 ? 462 ASP A CB  1 
ATOM   1026 C CG  . ASP A 1 138 ? -26.952 11.223 8.592   1.00 19.24 ? 462 ASP A CG  1 
ATOM   1027 O OD1 . ASP A 1 138 ? -27.643 10.300 8.066   1.00 18.24 ? 462 ASP A OD1 1 
ATOM   1028 O OD2 . ASP A 1 138 ? -26.385 11.150 9.723   1.00 17.64 ? 462 ASP A OD2 1 
ATOM   1029 N N   . MET A 1 139 ? -24.356 14.497 9.744   1.00 14.80 ? 463 MET A N   1 
ATOM   1030 C CA  . MET A 1 139 ? -22.947 14.813 9.883   1.00 14.68 ? 463 MET A CA  1 
ATOM   1031 C C   . MET A 1 139 ? -22.746 15.413 11.289  1.00 15.14 ? 463 MET A C   1 
ATOM   1032 O O   . MET A 1 139 ? -23.714 15.880 11.918  1.00 16.77 ? 463 MET A O   1 
ATOM   1033 C CB  . MET A 1 139 ? -22.544 15.853 8.823   1.00 12.44 ? 463 MET A CB  1 
ATOM   1034 C CG  . MET A 1 139 ? -23.284 17.182 8.994   1.00 15.99 ? 463 MET A CG  1 
ATOM   1035 S SD  . MET A 1 139 ? -22.906 18.454 7.733   1.00 19.23 ? 463 MET A SD  1 
ATOM   1036 C CE  . MET A 1 139 ? -22.912 19.917 8.778   1.00 22.24 ? 463 MET A CE  1 
ATOM   1037 N N   . CYS A 1 140 ? -21.516 15.372 11.775  1.00 14.01 ? 464 CYS A N   1 
ATOM   1038 C CA  . CYS A 1 140 ? -21.131 16.029 13.029  1.00 17.11 ? 464 CYS A CA  1 
ATOM   1039 C C   . CYS A 1 140 ? -21.242 17.549 12.951  1.00 16.81 ? 464 CYS A C   1 
ATOM   1040 O O   . CYS A 1 140 ? -21.200 18.150 11.871  1.00 14.79 ? 464 CYS A O   1 
ATOM   1041 C CB  . CYS A 1 140 ? -19.693 15.669 13.419  1.00 17.83 ? 464 CYS A CB  1 
ATOM   1042 S SG  . CYS A 1 140 ? -19.428 13.906 13.766  1.00 22.51 ? 464 CYS A SG  1 
ATOM   1043 N N   . ARG A 1 141 ? -21.384 18.170 14.113  1.00 16.71 ? 465 ARG A N   1 
ATOM   1044 C CA  . ARG A 1 141 ? -21.572 19.612 14.162  1.00 17.72 ? 465 ARG A CA  1 
ATOM   1045 C C   . ARG A 1 141 ? -20.657 20.246 15.229  1.00 19.08 ? 465 ARG A C   1 
ATOM   1046 O O   . ARG A 1 141 ? -21.071 21.133 15.961  1.00 19.42 ? 465 ARG A O   1 
ATOM   1047 C CB  . ARG A 1 141 ? -23.039 19.910 14.486  1.00 13.93 ? 465 ARG A CB  1 
ATOM   1048 C CG  . ARG A 1 141 ? -24.049 19.532 13.360  1.00 14.37 ? 465 ARG A CG  1 
ATOM   1049 C CD  . ARG A 1 141 ? -25.456 19.761 13.849  1.00 16.63 ? 465 ARG A CD  1 
ATOM   1050 N NE  . ARG A 1 141 ? -25.766 21.196 13.906  1.00 17.65 ? 465 ARG A NE  1 
ATOM   1051 C CZ  . ARG A 1 141 ? -26.848 21.691 14.496  1.00 22.59 ? 465 ARG A CZ  1 
ATOM   1052 N NH1 . ARG A 1 141 ? -27.740 20.870 15.053  1.00 13.90 ? 465 ARG A NH1 1 
ATOM   1053 N NH2 . ARG A 1 141 ? -27.062 23.002 14.486  1.00 18.73 ? 465 ARG A NH2 1 
ATOM   1054 N N   . LYS A 1 142 ? -19.430 19.754 15.336  1.00 22.70 ? 466 LYS A N   1 
ATOM   1055 C CA  . LYS A 1 142 ? -18.452 20.322 16.265  1.00 20.89 ? 466 LYS A CA  1 
ATOM   1056 C C   . LYS A 1 142 ? -17.706 21.422 15.571  1.00 21.81 ? 466 LYS A C   1 
ATOM   1057 O O   . LYS A 1 142 ? -17.741 21.515 14.340  1.00 20.21 ? 466 LYS A O   1 
ATOM   1058 C CB  . LYS A 1 142 ? -17.494 19.244 16.735  1.00 20.54 ? 466 LYS A CB  1 
ATOM   1059 C CG  . LYS A 1 142 ? -18.180 18.216 17.640  1.00 25.06 ? 466 LYS A CG  1 
ATOM   1060 C CD  . LYS A 1 142 ? -17.177 17.242 18.203  1.00 30.13 ? 466 LYS A CD  1 
ATOM   1061 C CE  . LYS A 1 142 ? -16.445 16.549 17.077  1.00 43.37 ? 466 LYS A CE  1 
ATOM   1062 N NZ  . LYS A 1 142 ? -15.670 15.376 17.602  1.00 50.85 ? 466 LYS A NZ  1 
ATOM   1063 N N   . ARG A 1 143 ? -17.042 22.266 16.358  1.00 22.72 ? 467 ARG A N   1 
ATOM   1064 C CA  . ARG A 1 143 ? -16.247 23.380 15.840  1.00 26.34 ? 467 ARG A CA  1 
ATOM   1065 C C   . ARG A 1 143 ? -15.049 22.850 15.066  1.00 25.28 ? 467 ARG A C   1 
ATOM   1066 O O   . ARG A 1 143 ? -14.541 21.783 15.374  1.00 23.05 ? 467 ARG A O   1 
ATOM   1067 C CB  . ARG A 1 143 ? -15.689 24.228 16.988  1.00 27.94 ? 467 ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 143 ? -16.577 25.370 17.406  1.00 40.18 ? 467 ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 143 ? -15.778 26.493 18.133  1.00 46.95 ? 467 ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 143 ? -15.399 27.579 17.224  1.00 51.78 ? 467 ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 143 ? -14.145 27.835 16.847  1.00 54.33 ? 467 ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 143 ? -13.136 27.094 17.308  1.00 51.14 ? 467 ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 143 ? -13.902 28.835 16.010  1.00 53.13 ? 467 ARG A NH2 1 
ATOM   1074 N N   . ASN A 1 144 ? -14.610 23.606 14.073  1.00 25.72 ? 468 ASN A N   1 
ATOM   1075 C CA  . ASN A 1 144 ? -13.336 23.365 13.428  1.00 28.55 ? 468 ASN A CA  1 
ATOM   1076 C C   . ASN A 1 144 ? -12.375 24.422 13.972  1.00 32.14 ? 468 ASN A C   1 
ATOM   1077 O O   . ASN A 1 144 ? -12.476 25.591 13.606  1.00 32.31 ? 468 ASN A O   1 
ATOM   1078 C CB  . ASN A 1 144 ? -13.493 23.483 11.915  1.00 26.25 ? 468 ASN A CB  1 
ATOM   1079 C CG  . ASN A 1 144 ? -12.166 23.330 11.149  1.00 31.38 ? 468 ASN A CG  1 
ATOM   1080 O OD1 . ASN A 1 144 ? -11.104 23.095 11.734  1.00 28.89 ? 468 ASN A OD1 1 
ATOM   1081 N ND2 . ASN A 1 144 ? -12.232 23.493 9.827   1.00 29.83 ? 468 ASN A ND2 1 
ATOM   1082 N N   . ASP A 1 145 ? -11.477 24.013 14.865  1.00 36.80 ? 469 ASP A N   1 
ATOM   1083 C CA  . ASP A 1 145 ? -10.504 24.934 15.485  1.00 41.61 ? 469 ASP A CA  1 
ATOM   1084 C C   . ASP A 1 145 ? -9.579  25.633 14.494  1.00 43.16 ? 469 ASP A C   1 
ATOM   1085 O O   . ASP A 1 145 ? -9.126  26.743 14.762  1.00 44.36 ? 469 ASP A O   1 
ATOM   1086 C CB  . ASP A 1 145 ? -9.637  24.210 16.518  1.00 41.99 ? 469 ASP A CB  1 
ATOM   1087 C CG  . ASP A 1 145 ? -10.430 23.739 17.724  1.00 47.40 ? 469 ASP A CG  1 
ATOM   1088 O OD1 . ASP A 1 145 ? -9.983  22.756 18.366  1.00 51.93 ? 469 ASP A OD1 1 
ATOM   1089 O OD2 . ASP A 1 145 ? -11.499 24.330 18.022  1.00 44.74 ? 469 ASP A OD2 1 
ATOM   1090 N N   . TYR A 1 146 ? -9.288  24.990 13.363  1.00 43.69 ? 470 TYR A N   1 
ATOM   1091 C CA  . TYR A 1 146 ? -8.375  25.566 12.377  1.00 45.61 ? 470 TYR A CA  1 
ATOM   1092 C C   . TYR A 1 146 ? -9.052  26.581 11.476  1.00 45.84 ? 470 TYR A C   1 
ATOM   1093 O O   . TYR A 1 146 ? -8.390  27.347 10.778  1.00 45.70 ? 470 TYR A O   1 
ATOM   1094 C CB  . TYR A 1 146 ? -7.682  24.469 11.565  1.00 45.37 ? 470 TYR A CB  1 
ATOM   1095 C CG  . TYR A 1 146 ? -6.916  23.551 12.481  1.00 55.02 ? 470 TYR A CG  1 
ATOM   1096 C CD1 . TYR A 1 146 ? -5.609  23.861 12.884  1.00 60.38 ? 470 TYR A CD1 1 
ATOM   1097 C CD2 . TYR A 1 146 ? -7.510  22.402 13.000  1.00 59.09 ? 470 TYR A CD2 1 
ATOM   1098 C CE1 . TYR A 1 146 ? -4.914  23.032 13.751  1.00 58.85 ? 470 TYR A CE1 1 
ATOM   1099 C CE2 . TYR A 1 146 ? -6.824  21.576 13.866  1.00 61.28 ? 470 TYR A CE2 1 
ATOM   1100 C CZ  . TYR A 1 146 ? -5.531  21.897 14.233  1.00 61.03 ? 470 TYR A CZ  1 
ATOM   1101 O OH  . TYR A 1 146 ? -4.864  21.071 15.092  1.00 65.49 ? 470 TYR A OH  1 
ATOM   1102 N N   . ASP A 1 147 ? -10.375 26.589 11.495  1.00 45.92 ? 471 ASP A N   1 
ATOM   1103 C CA  . ASP A 1 147 ? -11.100 27.511 10.659  1.00 48.34 ? 471 ASP A CA  1 
ATOM   1104 C C   . ASP A 1 147 ? -11.094 28.887 11.311  1.00 51.03 ? 471 ASP A C   1 
ATOM   1105 O O   . ASP A 1 147 ? -11.828 29.155 12.243  1.00 51.54 ? 471 ASP A O   1 
ATOM   1106 C CB  . ASP A 1 147 ? -12.518 27.029 10.391  1.00 47.05 ? 471 ASP A CB  1 
ATOM   1107 C CG  . ASP A 1 147 ? -13.236 27.914 9.429   1.00 48.83 ? 471 ASP A CG  1 
ATOM   1108 O OD1 . ASP A 1 147 ? -14.496 27.872 9.389   1.00 48.49 ? 471 ASP A OD1 1 
ATOM   1109 O OD2 . ASP A 1 147 ? -12.528 28.662 8.710   1.00 51.76 ? 471 ASP A OD2 1 
ATOM   1110 N N   . ASP A 1 148 ? -10.238 29.742 10.784  1.00 54.38 ? 472 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 148 ? -9.979  31.069 11.298  1.00 57.68 ? 472 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 148 ? -11.163 31.994 11.106  1.00 58.65 ? 472 ASP A C   1 
ATOM   1113 O O   . ASP A 1 148 ? -11.469 32.834 11.958  1.00 58.49 ? 472 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 148 ? -8.822  31.649 10.480  1.00 58.59 ? 472 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 148 ? -7.781  32.294 11.333  1.00 61.60 ? 472 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 148 ? -7.887  32.146 12.569  1.00 60.99 ? 472 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 148 ? -6.858  32.935 10.767  1.00 68.82 ? 472 ASP A OD2 1 
ATOM   1118 N N   . THR A 1 149 ? -11.815 31.819 9.965   1.00 59.53 ? 473 THR A N   1 
ATOM   1119 C CA  . THR A 1 149 ? -12.650 32.840 9.363   1.00 61.50 ? 473 THR A CA  1 
ATOM   1120 C C   . THR A 1 149 ? -13.990 33.087 10.067  1.00 62.78 ? 473 THR A C   1 
ATOM   1121 O O   . THR A 1 149 ? -14.396 32.335 10.946  1.00 63.34 ? 473 THR A O   1 
ATOM   1122 C CB  . THR A 1 149 ? -12.890 32.495 7.889   1.00 61.69 ? 473 THR A CB  1 
ATOM   1123 O OG1 . THR A 1 149 ? -13.722 31.335 7.817   1.00 64.05 ? 473 THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 149 ? -11.562 32.184 7.205   1.00 60.38 ? 473 THR A CG2 1 
ATOM   1125 N N   . ILE A 1 150 ? -14.659 34.163 9.665   1.00 64.24 ? 474 ILE A N   1 
ATOM   1126 C CA  . ILE A 1 150 ? -15.926 34.582 10.247  1.00 65.46 ? 474 ILE A CA  1 
ATOM   1127 C C   . ILE A 1 150 ? -16.982 34.635 9.155   1.00 65.66 ? 474 ILE A C   1 
ATOM   1128 O O   . ILE A 1 150 ? -16.673 34.935 8.009   1.00 66.26 ? 474 ILE A O   1 
ATOM   1129 C CB  . ILE A 1 150 ? -15.792 35.973 10.905  1.00 66.41 ? 474 ILE A CB  1 
ATOM   1130 C CG1 . ILE A 1 150 ? -15.725 35.850 12.434  1.00 67.54 ? 474 ILE A CG1 1 
ATOM   1131 C CG2 . ILE A 1 150 ? -16.944 36.880 10.497  1.00 66.63 ? 474 ILE A CG2 1 
ATOM   1132 C CD1 . ILE A 1 150 ? -14.510 35.094 12.956  1.00 71.76 ? 474 ILE A CD1 1 
ATOM   1133 N N   . PRO A 1 151 ? -18.240 34.322 9.495   1.00 66.31 ? 475 PRO A N   1 
ATOM   1134 C CA  . PRO A 1 151 ? -19.272 34.406 8.466   1.00 65.69 ? 475 PRO A CA  1 
ATOM   1135 C C   . PRO A 1 151 ? -19.511 35.823 7.957   1.00 65.62 ? 475 PRO A C   1 
ATOM   1136 O O   . PRO A 1 151 ? -19.149 36.145 6.828   1.00 65.64 ? 475 PRO A O   1 
ATOM   1137 C CB  . PRO A 1 151 ? -20.542 33.912 9.183   1.00 65.64 ? 475 PRO A CB  1 
ATOM   1138 C CG  . PRO A 1 151 ? -20.237 33.965 10.644  1.00 66.12 ? 475 PRO A CG  1 
ATOM   1139 C CD  . PRO A 1 151 ? -18.750 33.741 10.751  1.00 66.29 ? 475 PRO A CD  1 
ATOM   1140 N N   . ILE A 1 152 ? -20.113 36.656 8.802   1.00 64.85 ? 476 ILE A N   1 
ATOM   1141 C CA  . ILE A 1 152 ? -20.839 37.839 8.345   1.00 64.23 ? 476 ILE A CA  1 
ATOM   1142 C C   . ILE A 1 152 ? -21.529 37.622 6.973   1.00 62.16 ? 476 ILE A C   1 
ATOM   1143 O O   . ILE A 1 152 ? -21.291 38.360 6.018   1.00 62.05 ? 476 ILE A O   1 
ATOM   1144 C CB  . ILE A 1 152 ? -19.979 39.143 8.414   1.00 65.03 ? 476 ILE A CB  1 
ATOM   1145 C CG1 . ILE A 1 152 ? -18.556 38.917 7.864   1.00 67.87 ? 476 ILE A CG1 1 
ATOM   1146 C CG2 . ILE A 1 152 ? -19.917 39.637 9.854   1.00 66.46 ? 476 ILE A CG2 1 
ATOM   1147 C CD1 . ILE A 1 152 ? -17.679 40.181 7.795   1.00 67.31 ? 476 ILE A CD1 1 
ATOM   1148 N N   . LEU A 1 153 ? -22.377 36.592 6.891   1.00 60.24 ? 477 LEU A N   1 
ATOM   1149 C CA  . LEU A 1 153 ? -23.250 36.386 5.723   1.00 58.09 ? 477 LEU A CA  1 
ATOM   1150 C C   . LEU A 1 153 ? -24.453 37.318 5.818   1.00 56.63 ? 477 LEU A C   1 
ATOM   1151 O O   . LEU A 1 153 ? -24.805 37.776 6.908   1.00 57.38 ? 477 LEU A O   1 
ATOM   1152 C CB  . LEU A 1 153 ? -23.734 34.939 5.639   1.00 57.30 ? 477 LEU A CB  1 
ATOM   1153 C CG  . LEU A 1 153 ? -22.666 33.853 5.747   1.00 58.05 ? 477 LEU A CG  1 
ATOM   1154 C CD1 . LEU A 1 153 ? -23.292 32.465 5.598   1.00 57.49 ? 477 LEU A CD1 1 
ATOM   1155 C CD2 . LEU A 1 153 ? -21.571 34.070 4.714   1.00 55.06 ? 477 LEU A CD2 1 
ATOM   1156 N N   . ASP A 1 154 ? -25.074 37.624 4.683   1.00 53.60 ? 478 ASP A N   1 
ATOM   1157 C CA  . ASP A 1 154 ? -26.248 38.484 4.695   1.00 50.65 ? 478 ASP A CA  1 
ATOM   1158 C C   . ASP A 1 154 ? -27.396 37.745 5.370   1.00 47.34 ? 478 ASP A C   1 
ATOM   1159 O O   . ASP A 1 154 ? -27.458 36.520 5.314   1.00 45.99 ? 478 ASP A O   1 
ATOM   1160 C CB  . ASP A 1 154 ? -26.653 38.866 3.271   1.00 52.58 ? 478 ASP A CB  1 
ATOM   1161 C CG  . ASP A 1 154 ? -25.838 40.029 2.721   1.00 56.89 ? 478 ASP A CG  1 
ATOM   1162 O OD1 . ASP A 1 154 ? -24.976 40.558 3.458   1.00 57.29 ? 478 ASP A OD1 1 
ATOM   1163 O OD2 . ASP A 1 154 ? -26.067 40.411 1.553   1.00 59.99 ? 478 ASP A OD2 1 
ATOM   1164 N N   . ALA A 1 155 ? -28.297 38.479 6.012   1.00 41.72 ? 479 ALA A N   1 
ATOM   1165 C CA  . ALA A 1 155 ? -29.494 37.856 6.547   1.00 38.89 ? 479 ALA A CA  1 
ATOM   1166 C C   . ALA A 1 155 ? -30.308 37.231 5.399   1.00 36.21 ? 479 ALA A C   1 
ATOM   1167 O O   . ALA A 1 155 ? -30.359 37.772 4.291   1.00 33.37 ? 479 ALA A O   1 
ATOM   1168 C CB  . ALA A 1 155 ? -30.328 38.863 7.326   1.00 37.37 ? 479 ALA A CB  1 
ATOM   1169 N N   . LEU A 1 156 ? -30.923 36.081 5.658   1.00 30.75 ? 480 LEU A N   1 
ATOM   1170 C CA  . LEU A 1 156 ? -31.775 35.478 4.655   1.00 29.77 ? 480 LEU A CA  1 
ATOM   1171 C C   . LEU A 1 156 ? -33.147 36.125 4.659   1.00 28.14 ? 480 LEU A C   1 
ATOM   1172 O O   . LEU A 1 156 ? -33.600 36.608 5.703   1.00 26.54 ? 480 LEU A O   1 
ATOM   1173 C CB  . LEU A 1 156 ? -31.906 33.974 4.927   1.00 31.83 ? 480 LEU A CB  1 
ATOM   1174 C CG  . LEU A 1 156 ? -30.627 33.138 5.068   1.00 36.48 ? 480 LEU A CG  1 
ATOM   1175 C CD1 . LEU A 1 156 ? -31.005 31.753 5.584   1.00 41.02 ? 480 LEU A CD1 1 
ATOM   1176 C CD2 . LEU A 1 156 ? -29.862 33.023 3.768   1.00 36.12 ? 480 LEU A CD2 1 
ATOM   1177 N N   . LYS A 1 157 ? -33.823 36.122 3.511   1.00 25.84 ? 481 LYS A N   1 
ATOM   1178 C CA  . LYS A 1 157 ? -35.230 36.501 3.460   1.00 25.15 ? 481 LYS A CA  1 
ATOM   1179 C C   . LYS A 1 157 ? -36.062 35.631 4.365   1.00 24.93 ? 481 LYS A C   1 
ATOM   1180 O O   . LYS A 1 157 ? -35.744 34.449 4.593   1.00 23.71 ? 481 LYS A O   1 
ATOM   1181 C CB  . LYS A 1 157 ? -35.822 36.345 2.061   1.00 26.98 ? 481 LYS A CB  1 
ATOM   1182 C CG  . LYS A 1 157 ? -35.128 37.130 0.966   1.00 35.65 ? 481 LYS A CG  1 
ATOM   1183 C CD  . LYS A 1 157 ? -36.018 37.131 -0.287  1.00 47.36 ? 481 LYS A CD  1 
ATOM   1184 C CE  . LYS A 1 157 ? -35.253 36.659 -1.528  1.00 57.78 ? 481 LYS A CE  1 
ATOM   1185 N NZ  . LYS A 1 157 ? -33.973 37.409 -1.714  1.00 59.20 ? 481 LYS A NZ  1 
ATOM   1186 N N   . VAL A 1 158 ? -37.170 36.197 4.827   1.00 23.63 ? 482 VAL A N   1 
ATOM   1187 C CA  . VAL A 1 158 ? -38.159 35.455 5.583   1.00 23.56 ? 482 VAL A CA  1 
ATOM   1188 C C   . VAL A 1 158 ? -39.138 34.789 4.618   1.00 24.27 ? 482 VAL A C   1 
ATOM   1189 O O   . VAL A 1 158 ? -40.143 35.395 4.194   1.00 23.81 ? 482 VAL A O   1 
ATOM   1190 C CB  . VAL A 1 158 ? -38.905 36.375 6.569   1.00 25.57 ? 482 VAL A CB  1 
ATOM   1191 C CG1 . VAL A 1 158 ? -39.897 35.575 7.400   1.00 21.85 ? 482 VAL A CG1 1 
ATOM   1192 C CG2 . VAL A 1 158 ? -37.892 37.064 7.472   1.00 26.12 ? 482 VAL A CG2 1 
ATOM   1193 N N   . THR A 1 159 ? -38.851 33.540 4.252   1.00 21.52 ? 483 THR A N   1 
ATOM   1194 C CA  . THR A 1 159 ? -39.711 32.850 3.253   1.00 21.15 ? 483 THR A CA  1 
ATOM   1195 C C   . THR A 1 159 ? -40.651 31.877 3.955   1.00 18.96 ? 483 THR A C   1 
ATOM   1196 O O   . THR A 1 159 ? -41.540 31.298 3.344   1.00 19.81 ? 483 THR A O   1 
ATOM   1197 C CB  . THR A 1 159 ? -38.865 32.144 2.162   1.00 22.56 ? 483 THR A CB  1 
ATOM   1198 O OG1 . THR A 1 159 ? -37.782 31.395 2.773   1.00 19.11 ? 483 THR A OG1 1 
ATOM   1199 C CG2 . THR A 1 159 ? -38.261 33.185 1.222   1.00 21.51 ? 483 THR A CG2 1 
ATOM   1200 N N   . ALA A 1 160 ? -40.412 31.661 5.247   1.00 16.71 ? 484 ALA A N   1 
ATOM   1201 C CA  . ALA A 1 160 ? -41.294 30.840 6.047   1.00 16.52 ? 484 ALA A CA  1 
ATOM   1202 C C   . ALA A 1 160 ? -41.489 29.434 5.454   1.00 15.39 ? 484 ALA A C   1 
ATOM   1203 O O   . ALA A 1 160 ? -42.591 28.899 5.494   1.00 15.36 ? 484 ALA A O   1 
ATOM   1204 C CB  . ALA A 1 160 ? -42.672 31.577 6.205   1.00 18.10 ? 484 ALA A CB  1 
ATOM   1205 N N   . ASN A 1 161 ? -40.429 28.834 4.907   1.00 16.91 ? 485 ASN A N   1 
ATOM   1206 C CA  . ASN A 1 161 ? -40.587 27.553 4.206   1.00 18.62 ? 485 ASN A CA  1 
ATOM   1207 C C   . ASN A 1 161 ? -39.324 26.699 4.269   1.00 17.79 ? 485 ASN A C   1 
ATOM   1208 O O   . ASN A 1 161 ? -38.990 25.988 3.326   1.00 20.82 ? 485 ASN A O   1 
ATOM   1209 C CB  . ASN A 1 161 ? -40.964 27.832 2.737   1.00 17.59 ? 485 ASN A CB  1 
ATOM   1210 C CG  . ASN A 1 161 ? -39.896 28.600 2.024   1.00 16.89 ? 485 ASN A CG  1 
ATOM   1211 O OD1 . ASN A 1 161 ? -38.915 29.034 2.646   1.00 21.01 ? 485 ASN A OD1 1 
ATOM   1212 N ND2 . ASN A 1 161 ? -40.031 28.738 0.694   1.00 16.70 ? 485 ASN A ND2 1 
ATOM   1213 N N   . ILE A 1 162 ? -38.620 26.805 5.388   1.00 16.97 ? 486 ILE A N   1 
ATOM   1214 C CA  . ILE A 1 162 ? -37.313 26.219 5.560   1.00 16.88 ? 486 ILE A CA  1 
ATOM   1215 C C   . ILE A 1 162 ? -37.379 25.210 6.690   1.00 18.39 ? 486 ILE A C   1 
ATOM   1216 O O   . ILE A 1 162 ? -37.816 25.550 7.803   1.00 16.65 ? 486 ILE A O   1 
ATOM   1217 C CB  . ILE A 1 162 ? -36.300 27.313 5.942   1.00 17.83 ? 486 ILE A CB  1 
ATOM   1218 C CG1 . ILE A 1 162 ? -36.228 28.342 4.806   1.00 17.07 ? 486 ILE A CG1 1 
ATOM   1219 C CG2 . ILE A 1 162 ? -34.925 26.689 6.286   1.00 17.34 ? 486 ILE A CG2 1 
ATOM   1220 C CD1 . ILE A 1 162 ? -35.590 29.663 5.183   1.00 17.21 ? 486 ILE A CD1 1 
ATOM   1221 N N   . VAL A 1 163 ? -36.966 23.970 6.417   1.00 16.10 ? 487 VAL A N   1 
ATOM   1222 C CA  . VAL A 1 163 ? -36.873 22.969 7.469   1.00 14.64 ? 487 VAL A CA  1 
ATOM   1223 C C   . VAL A 1 163 ? -35.469 22.349 7.452   1.00 17.34 ? 487 VAL A C   1 
ATOM   1224 O O   . VAL A 1 163 ? -35.029 21.858 6.408   1.00 17.99 ? 487 VAL A O   1 
ATOM   1225 C CB  . VAL A 1 163 ? -37.924 21.873 7.247   1.00 17.01 ? 487 VAL A CB  1 
ATOM   1226 C CG1 . VAL A 1 163 ? -37.904 20.861 8.411   1.00 15.34 ? 487 VAL A CG1 1 
ATOM   1227 C CG2 . VAL A 1 163 ? -39.338 22.498 7.108   1.00 15.84 ? 487 VAL A CG2 1 
ATOM   1228 N N   . PHE A 1 164 ? -34.775 22.360 8.585   1.00 14.31 ? 488 PHE A N   1 
ATOM   1229 C CA  . PHE A 1 164 ? -33.538 21.589 8.754   1.00 16.27 ? 488 PHE A CA  1 
ATOM   1230 C C   . PHE A 1 164 ? -33.859 20.376 9.627   1.00 16.69 ? 488 PHE A C   1 
ATOM   1231 O O   . PHE A 1 164 ? -34.463 20.520 10.682  1.00 16.79 ? 488 PHE A O   1 
ATOM   1232 C CB  . PHE A 1 164 ? -32.440 22.405 9.473   1.00 15.72 ? 488 PHE A CB  1 
ATOM   1233 C CG  . PHE A 1 164 ? -31.730 23.370 8.587   1.00 18.65 ? 488 PHE A CG  1 
ATOM   1234 C CD1 . PHE A 1 164 ? -30.404 23.185 8.271   1.00 13.17 ? 488 PHE A CD1 1 
ATOM   1235 C CD2 . PHE A 1 164 ? -32.407 24.454 8.031   1.00 22.29 ? 488 PHE A CD2 1 
ATOM   1236 C CE1 . PHE A 1 164 ? -29.740 24.065 7.413   1.00 18.57 ? 488 PHE A CE1 1 
ATOM   1237 C CE2 . PHE A 1 164 ? -31.742 25.341 7.197   1.00 27.73 ? 488 PHE A CE2 1 
ATOM   1238 C CZ  . PHE A 1 164 ? -30.408 25.120 6.868   1.00 18.12 ? 488 PHE A CZ  1 
ATOM   1239 N N   . GLY A 1 165 ? -33.467 19.191 9.176   1.00 14.21 ? 489 GLY A N   1 
ATOM   1240 C CA  . GLY A 1 165 ? -33.386 18.032 10.051  1.00 14.58 ? 489 GLY A CA  1 
ATOM   1241 C C   . GLY A 1 165 ? -31.918 17.691 10.261  1.00 14.79 ? 489 GLY A C   1 
ATOM   1242 O O   . GLY A 1 165 ? -31.290 17.092 9.400   1.00 15.66 ? 489 GLY A O   1 
ATOM   1243 N N   . TYR A 1 166 ? -31.346 18.098 11.382  1.00 12.25 ? 490 TYR A N   1 
ATOM   1244 C CA  . TYR A 1 166 ? -29.965 17.756 11.651  1.00 13.29 ? 490 TYR A CA  1 
ATOM   1245 C C   . TYR A 1 166 ? -29.952 16.427 12.418  1.00 15.62 ? 490 TYR A C   1 
ATOM   1246 O O   . TYR A 1 166 ? -30.638 16.290 13.439  1.00 14.68 ? 490 TYR A O   1 
ATOM   1247 C CB  . TYR A 1 166 ? -29.296 18.772 12.561  1.00 10.84 ? 490 TYR A CB  1 
ATOM   1248 C CG  . TYR A 1 166 ? -29.255 20.235 12.132  1.00 17.91 ? 490 TYR A CG  1 
ATOM   1249 C CD1 . TYR A 1 166 ? -28.164 20.750 11.426  1.00 14.68 ? 490 TYR A CD1 1 
ATOM   1250 C CD2 . TYR A 1 166 ? -30.252 21.124 12.543  1.00 17.99 ? 490 TYR A CD2 1 
ATOM   1251 C CE1 . TYR A 1 166 ? -28.106 22.116 11.093  1.00 20.87 ? 490 TYR A CE1 1 
ATOM   1252 C CE2 . TYR A 1 166 ? -30.191 22.491 12.231  1.00 22.54 ? 490 TYR A CE2 1 
ATOM   1253 C CZ  . TYR A 1 166 ? -29.140 22.972 11.508  1.00 21.98 ? 490 TYR A CZ  1 
ATOM   1254 O OH  . TYR A 1 166 ? -29.117 24.319 11.198  1.00 25.62 ? 490 TYR A OH  1 
ATOM   1255 N N   . ALA A 1 167 ? -29.119 15.498 11.963  1.00 14.93 ? 491 ALA A N   1 
ATOM   1256 C CA  . ALA A 1 167 ? -28.939 14.202 12.627  1.00 15.37 ? 491 ALA A CA  1 
ATOM   1257 C C   . ALA A 1 167 ? -28.558 14.397 14.085  1.00 15.46 ? 491 ALA A C   1 
ATOM   1258 O O   . ALA A 1 167 ? -28.853 13.552 14.923  1.00 14.72 ? 491 ALA A O   1 
ATOM   1259 C CB  . ALA A 1 167 ? -27.840 13.411 11.927  1.00 14.00 ? 491 ALA A CB  1 
ATOM   1260 N N   . THR A 1 168 ? -27.877 15.495 14.382  1.00 14.84 ? 492 THR A N   1 
ATOM   1261 C CA  . THR A 1 168 ? -27.416 15.734 15.756  1.00 14.61 ? 492 THR A CA  1 
ATOM   1262 C C   . THR A 1 168 ? -27.506 17.218 16.169  1.00 15.36 ? 492 THR A C   1 
ATOM   1263 O O   . THR A 1 168 ? -27.866 18.034 15.356  1.00 14.27 ? 492 THR A O   1 
ATOM   1264 C CB  . THR A 1 168 ? -25.991 15.176 15.998  1.00 16.92 ? 492 THR A CB  1 
ATOM   1265 O OG1 . THR A 1 168 ? -25.828 14.950 17.407  1.00 16.32 ? 492 THR A OG1 1 
ATOM   1266 C CG2 . THR A 1 168 ? -24.857 16.153 15.494  1.00 14.84 ? 492 THR A CG2 1 
ATOM   1267 N N   . CYS A 1 169 ? -27.211 17.538 17.435  1.00 13.72 ? 493 CYS A N   1 
ATOM   1268 C CA  . CYS A 1 169 ? -27.246 18.893 17.950  1.00 16.52 ? 493 CYS A CA  1 
ATOM   1269 C C   . CYS A 1 169 ? -25.902 19.620 17.758  1.00 18.11 ? 493 CYS A C   1 
ATOM   1270 O O   . CYS A 1 169 ? -24.850 18.988 17.547  1.00 15.56 ? 493 CYS A O   1 
ATOM   1271 C CB  . CYS A 1 169 ? -27.580 18.881 19.464  1.00 16.97 ? 493 CYS A CB  1 
ATOM   1272 S SG  . CYS A 1 169 ? -29.243 18.259 19.794  1.00 22.92 ? 493 CYS A SG  1 
ATOM   1273 N N   . GLN A 1 170 ? -25.953 20.952 17.803  1.00 17.58 ? 494 GLN A N   1 
ATOM   1274 C CA  . GLN A 1 170 ? -24.750 21.768 17.630  1.00 19.99 ? 494 GLN A CA  1 
ATOM   1275 C C   . GLN A 1 170 ? -23.705 21.391 18.663  1.00 19.93 ? 494 GLN A C   1 
ATOM   1276 O O   . GLN A 1 170 ? -24.049 21.189 19.828  1.00 18.21 ? 494 GLN A O   1 
ATOM   1277 C CB  . GLN A 1 170 ? -25.111 23.227 17.796  1.00 22.88 ? 494 GLN A CB  1 
ATOM   1278 C CG  . GLN A 1 170 ? -24.003 24.220 17.459  1.00 28.96 ? 494 GLN A CG  1 
ATOM   1279 C CD  . GLN A 1 170 ? -24.569 25.640 17.371  1.00 40.89 ? 494 GLN A CD  1 
ATOM   1280 O OE1 . GLN A 1 170 ? -25.046 26.178 18.366  1.00 33.56 ? 494 GLN A OE1 1 
ATOM   1281 N NE2 . GLN A 1 170 ? -24.538 26.235 16.171  1.00 43.24 ? 494 GLN A NE2 1 
ATOM   1282 N N   . GLY A 1 171 ? -22.439 21.302 18.236  1.00 20.37 ? 495 GLY A N   1 
ATOM   1283 C CA  . GLY A 1 171 ? -21.341 20.912 19.132  1.00 19.42 ? 495 GLY A CA  1 
ATOM   1284 C C   . GLY A 1 171 ? -21.327 19.418 19.424  1.00 22.67 ? 495 GLY A C   1 
ATOM   1285 O O   . GLY A 1 171 ? -20.575 18.947 20.272  1.00 23.29 ? 495 GLY A O   1 
ATOM   1286 N N   . ALA A 1 172 ? -22.167 18.653 18.737  1.00 20.44 ? 496 ALA A N   1 
ATOM   1287 C CA  . ALA A 1 172 ? -22.220 17.218 19.011  1.00 19.21 ? 496 ALA A CA  1 
ATOM   1288 C C   . ALA A 1 172 ? -21.917 16.369 17.753  1.00 19.27 ? 496 ALA A C   1 
ATOM   1289 O O   . ALA A 1 172 ? -21.767 16.896 16.635  1.00 18.83 ? 496 ALA A O   1 
ATOM   1290 C CB  . ALA A 1 172 ? -23.562 16.870 19.564  1.00 18.59 ? 496 ALA A CB  1 
ATOM   1291 N N   . GLU A 1 173 ? -21.862 15.053 17.929  1.00 19.55 ? 497 GLU A N   1 
ATOM   1292 C CA  . GLU A 1 173 ? -21.499 14.161 16.833  1.00 18.86 ? 497 GLU A CA  1 
ATOM   1293 C C   . GLU A 1 173 ? -22.728 13.428 16.329  1.00 18.62 ? 497 GLU A C   1 
ATOM   1294 O O   . GLU A 1 173 ? -23.683 13.251 17.074  1.00 15.99 ? 497 GLU A O   1 
ATOM   1295 C CB  . GLU A 1 173 ? -20.412 13.167 17.317  1.00 18.89 ? 497 GLU A CB  1 
ATOM   1296 C CG  . GLU A 1 173 ? -19.052 13.824 17.527  1.00 21.16 ? 497 GLU A CG  1 
ATOM   1297 C CD  . GLU A 1 173 ? -17.952 12.828 18.021  1.00 24.58 ? 497 GLU A CD  1 
ATOM   1298 O OE1 . GLU A 1 173 ? -18.187 12.064 18.961  1.00 23.95 ? 497 GLU A OE1 1 
ATOM   1299 O OE2 . GLU A 1 173 ? -16.848 12.814 17.462  1.00 30.31 ? 497 GLU A OE2 1 
ATOM   1300 N N   . ALA A 1 174 ? -22.708 13.028 15.054  1.00 17.14 ? 498 ALA A N   1 
ATOM   1301 C CA  . ALA A 1 174 ? -23.705 12.148 14.496  1.00 16.50 ? 498 ALA A CA  1 
ATOM   1302 C C   . ALA A 1 174 ? -22.981 10.823 14.186  1.00 18.28 ? 498 ALA A C   1 
ATOM   1303 O O   . ALA A 1 174 ? -21.791 10.830 13.867  1.00 17.98 ? 498 ALA A O   1 
ATOM   1304 C CB  . ALA A 1 174 ? -24.268 12.745 13.218  1.00 18.38 ? 498 ALA A CB  1 
ATOM   1305 N N   . PHE A 1 175 ? -23.697 9.710  14.249  1.00 15.66 ? 499 PHE A N   1 
ATOM   1306 C CA  . PHE A 1 175 ? -23.057 8.391  14.250  1.00 18.72 ? 499 PHE A CA  1 
ATOM   1307 C C   . PHE A 1 175 ? -23.593 7.391  13.230  1.00 17.62 ? 499 PHE A C   1 
ATOM   1308 O O   . PHE A 1 175 ? -24.706 7.506  12.709  1.00 18.47 ? 499 PHE A O   1 
ATOM   1309 C CB  . PHE A 1 175 ? -23.139 7.748  15.650  1.00 17.52 ? 499 PHE A CB  1 
ATOM   1310 C CG  . PHE A 1 175 ? -22.422 8.534  16.725  1.00 21.35 ? 499 PHE A CG  1 
ATOM   1311 C CD1 . PHE A 1 175 ? -21.043 8.423  16.891  1.00 20.62 ? 499 PHE A CD1 1 
ATOM   1312 C CD2 . PHE A 1 175 ? -23.124 9.363  17.578  1.00 23.20 ? 499 PHE A CD2 1 
ATOM   1313 C CE1 . PHE A 1 175 ? -20.377 9.149  17.885  1.00 20.50 ? 499 PHE A CE1 1 
ATOM   1314 C CE2 . PHE A 1 175 ? -22.464 10.090 18.581  1.00 21.48 ? 499 PHE A CE2 1 
ATOM   1315 C CZ  . PHE A 1 175 ? -21.092 9.964  18.734  1.00 24.82 ? 499 PHE A CZ  1 
ATOM   1316 N N   . GLU A 1 176 ? -22.749 6.410  12.941  1.00 19.46 ? 500 GLU A N   1 
ATOM   1317 C CA  . GLU A 1 176 ? -23.148 5.198  12.273  1.00 19.01 ? 500 GLU A CA  1 
ATOM   1318 C C   . GLU A 1 176 ? -22.543 4.062  13.094  1.00 21.38 ? 500 GLU A C   1 
ATOM   1319 O O   . GLU A 1 176 ? -21.778 4.298  14.040  1.00 22.89 ? 500 GLU A O   1 
ATOM   1320 C CB  . GLU A 1 176 ? -22.651 5.181  10.835  1.00 17.74 ? 500 GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 176 ? -21.127 5.294  10.692  1.00 17.69 ? 500 GLU A CG  1 
ATOM   1322 C CD  . GLU A 1 176 ? -20.673 5.346  9.231   1.00 21.50 ? 500 GLU A CD  1 
ATOM   1323 O OE1 . GLU A 1 176 ? -21.138 6.247  8.505   1.00 18.02 ? 500 GLU A OE1 1 
ATOM   1324 O OE2 . GLU A 1 176 ? -19.835 4.485  8.801   1.00 21.08 ? 500 GLU A OE2 1 
ATOM   1325 N N   . ILE A 1 177 ? -22.893 2.835  12.757  1.00 22.65 ? 501 ILE A N   1 
ATOM   1326 C CA  . ILE A 1 177 ? -22.468 1.713  13.556  1.00 26.22 ? 501 ILE A CA  1 
ATOM   1327 C C   . ILE A 1 177 ? -21.074 1.318  13.098  1.00 27.09 ? 501 ILE A C   1 
ATOM   1328 O O   . ILE A 1 177 ? -20.790 1.262  11.885  1.00 24.95 ? 501 ILE A O   1 
ATOM   1329 C CB  . ILE A 1 177 ? -23.470 0.552  13.469  1.00 27.83 ? 501 ILE A CB  1 
ATOM   1330 C CG1 . ILE A 1 177 ? -24.745 0.917  14.253  1.00 33.00 ? 501 ILE A CG1 1 
ATOM   1331 C CG2 . ILE A 1 177 ? -22.887 -0.704 14.116  1.00 27.62 ? 501 ILE A CG2 1 
ATOM   1332 C CD1 . ILE A 1 177 ? -25.912 1.243  13.401  1.00 44.35 ? 501 ILE A CD1 1 
ATOM   1333 N N   . GLN A 1 178 ? -20.199 1.107  14.073  1.00 27.23 ? 502 GLN A N   1 
ATOM   1334 C CA  . GLN A 1 178 ? -18.801 0.756  13.828  1.00 31.29 ? 502 GLN A CA  1 
ATOM   1335 C C   . GLN A 1 178 ? -18.737 -0.488 12.937  1.00 30.50 ? 502 GLN A C   1 
ATOM   1336 O O   . GLN A 1 178 ? -19.535 -1.420 13.116  1.00 27.83 ? 502 GLN A O   1 
ATOM   1337 C CB  . GLN A 1 178 ? -18.110 0.530  15.181  1.00 32.82 ? 502 GLN A CB  1 
ATOM   1338 C CG  . GLN A 1 178 ? -16.596 0.531  15.143  1.00 38.63 ? 502 GLN A CG  1 
ATOM   1339 C CD  . GLN A 1 178 ? -16.016 1.821  14.604  1.00 45.29 ? 502 GLN A CD  1 
ATOM   1340 O OE1 . GLN A 1 178 ? -15.689 1.930  13.406  1.00 42.13 ? 502 GLN A OE1 1 
ATOM   1341 N NE2 . GLN A 1 178 ? -15.871 2.809  15.483  1.00 44.83 ? 502 GLN A NE2 1 
ATOM   1342 N N   . HIS A 1 179 ? -17.816 -0.495 11.972  1.00 35.41 ? 503 HIS A N   1 
ATOM   1343 C CA  . HIS A 1 179 ? -17.750 -1.577 10.950  1.00 41.70 ? 503 HIS A CA  1 
ATOM   1344 C C   . HIS A 1 179 ? -19.169 -1.853 10.430  1.00 42.17 ? 503 HIS A C   1 
ATOM   1345 O O   . HIS A 1 179 ? -19.713 -2.945 10.586  1.00 42.79 ? 503 HIS A O   1 
ATOM   1346 C CB  . HIS A 1 179 ? -17.153 -2.878 11.537  1.00 43.44 ? 503 HIS A CB  1 
ATOM   1347 C CG  . HIS A 1 179 ? -16.016 -2.654 12.488  1.00 50.26 ? 503 HIS A CG  1 
ATOM   1348 N ND1 . HIS A 1 179 ? -14.852 -2.008 12.122  1.00 54.95 ? 503 HIS A ND1 1 
ATOM   1349 C CD2 . HIS A 1 179 ? -15.861 -2.996 13.792  1.00 53.90 ? 503 HIS A CD2 1 
ATOM   1350 C CE1 . HIS A 1 179 ? -14.035 -1.952 13.161  1.00 55.35 ? 503 HIS A CE1 1 
ATOM   1351 N NE2 . HIS A 1 179 ? -14.623 -2.547 14.186  1.00 55.67 ? 503 HIS A NE2 1 
ATOM   1352 N N   . SER A 1 180 ? -19.777 -0.836 9.842   1.00 41.94 ? 504 SER A N   1 
ATOM   1353 C CA  . SER A 1 180 ? -21.236 -0.816 9.703   1.00 42.95 ? 504 SER A CA  1 
ATOM   1354 C C   . SER A 1 180 ? -21.841 -1.944 8.864   1.00 41.33 ? 504 SER A C   1 
ATOM   1355 O O   . SER A 1 180 ? -22.932 -2.468 9.181   1.00 41.47 ? 504 SER A O   1 
ATOM   1356 C CB  . SER A 1 180 ? -21.682 0.559  9.186   1.00 41.99 ? 504 SER A CB  1 
ATOM   1357 O OG  . SER A 1 180 ? -22.472 0.432  8.037   1.00 47.78 ? 504 SER A OG  1 
ATOM   1358 N N   . GLY A 1 181 ? -21.145 -2.293 7.788   1.00 39.44 ? 505 GLY A N   1 
ATOM   1359 C CA  . GLY A 1 181 ? -21.653 -3.264 6.826   1.00 35.80 ? 505 GLY A CA  1 
ATOM   1360 C C   . GLY A 1 181 ? -22.952 -2.832 6.162   1.00 33.28 ? 505 GLY A C   1 
ATOM   1361 O O   . GLY A 1 181 ? -22.992 -1.904 5.348   1.00 33.23 ? 505 GLY A O   1 
ATOM   1362 N N   . LEU A 1 182 ? -24.033 -3.513 6.518   1.00 30.79 ? 506 LEU A N   1 
ATOM   1363 C CA  . LEU A 1 182 ? -25.319 -3.256 5.901   1.00 27.82 ? 506 LEU A CA  1 
ATOM   1364 C C   . LEU A 1 182 ? -26.162 -2.233 6.652   1.00 25.28 ? 506 LEU A C   1 
ATOM   1365 O O   . LEU A 1 182 ? -27.209 -1.858 6.168   1.00 23.45 ? 506 LEU A O   1 
ATOM   1366 C CB  . LEU A 1 182 ? -26.154 -4.520 5.943   1.00 26.96 ? 506 LEU A CB  1 
ATOM   1367 C CG  . LEU A 1 182 ? -26.151 -5.553 4.855   1.00 30.31 ? 506 LEU A CG  1 
ATOM   1368 C CD1 . LEU A 1 182 ? -25.627 -4.943 3.565   1.00 26.61 ? 506 LEU A CD1 1 
ATOM   1369 C CD2 . LEU A 1 182 ? -25.356 -6.732 5.331   1.00 25.64 ? 506 LEU A CD2 1 
ATOM   1370 N N   . ALA A 1 183 ? -25.776 -1.905 7.879   1.00 21.66 ? 507 ALA A N   1 
ATOM   1371 C CA  . ALA A 1 183 ? -26.597 -1.050 8.747   1.00 19.16 ? 507 ALA A CA  1 
ATOM   1372 C C   . ALA A 1 183 ? -26.616 0.412  8.272   1.00 18.08 ? 507 ALA A C   1 
ATOM   1373 O O   . ALA A 1 183 ? -25.622 0.969  7.843   1.00 20.49 ? 507 ALA A O   1 
ATOM   1374 C CB  . ALA A 1 183 ? -26.098 -1.128 10.193  1.00 17.51 ? 507 ALA A CB  1 
ATOM   1375 N N   . ASN A 1 184 ? -27.771 1.021  8.329   1.00 19.72 ? 508 ASN A N   1 
ATOM   1376 C CA  . ASN A 1 184 ? -27.866 2.455  8.166   1.00 20.51 ? 508 ASN A CA  1 
ATOM   1377 C C   . ASN A 1 184 ? -27.173 3.150  9.322   1.00 18.16 ? 508 ASN A C   1 
ATOM   1378 O O   . ASN A 1 184 ? -27.031 2.576  10.416  1.00 19.52 ? 508 ASN A O   1 
ATOM   1379 C CB  . ASN A 1 184 ? -29.334 2.872  8.156   1.00 20.23 ? 508 ASN A CB  1 
ATOM   1380 C CG  . ASN A 1 184 ? -30.047 2.410  6.916   1.00 22.28 ? 508 ASN A CG  1 
ATOM   1381 O OD1 . ASN A 1 184 ? -30.918 1.545  6.983   1.00 24.92 ? 508 ASN A OD1 1 
ATOM   1382 N ND2 . ASN A 1 184 ? -29.680 2.979  5.770   1.00 22.26 ? 508 ASN A ND2 1 
ATOM   1383 N N   . GLY A 1 185 ? -26.758 4.388  9.096   1.00 17.51 ? 509 GLY A N   1 
ATOM   1384 C CA  . GLY A 1 185 ? -26.370 5.253  10.229  1.00 18.65 ? 509 GLY A CA  1 
ATOM   1385 C C   . GLY A 1 185 ? -27.607 5.576  11.078  1.00 17.68 ? 509 GLY A C   1 
ATOM   1386 O O   . GLY A 1 185 ? -28.749 5.265  10.689  1.00 16.37 ? 509 GLY A O   1 
ATOM   1387 N N   . ILE A 1 186 ? -27.398 6.220  12.223  1.00 18.14 ? 510 ILE A N   1 
ATOM   1388 C CA  . ILE A 1 186 ? -28.459 6.323  13.222  1.00 17.76 ? 510 ILE A CA  1 
ATOM   1389 C C   . ILE A 1 186 ? -29.641 7.154  12.711  1.00 19.35 ? 510 ILE A C   1 
ATOM   1390 O O   . ILE A 1 186 ? -30.811 6.765  12.846  1.00 22.99 ? 510 ILE A O   1 
ATOM   1391 C CB  . ILE A 1 186 ? -27.902 6.920  14.534  1.00 18.81 ? 510 ILE A CB  1 
ATOM   1392 C CG1 . ILE A 1 186 ? -26.894 5.955  15.208  1.00 22.38 ? 510 ILE A CG1 1 
ATOM   1393 C CG2 . ILE A 1 186 ? -29.034 7.368  15.464  1.00 17.67 ? 510 ILE A CG2 1 
ATOM   1394 C CD1 . ILE A 1 186 ? -27.307 4.472  15.208  1.00 22.17 ? 510 ILE A CD1 1 
ATOM   1395 N N   . PHE A 1 187 ? -29.336 8.288  12.089  1.00 17.49 ? 511 PHE A N   1 
ATOM   1396 C CA  . PHE A 1 187 ? -30.374 9.158  11.529  1.00 14.66 ? 511 PHE A CA  1 
ATOM   1397 C C   . PHE A 1 187 ? -31.289 8.423  10.517  1.00 15.92 ? 511 PHE A C   1 
ATOM   1398 O O   . PHE A 1 187 ? -32.512 8.408  10.651  1.00 14.37 ? 511 PHE A O   1 
ATOM   1399 C CB  . PHE A 1 187 ? -29.692 10.369 10.882  1.00 12.60 ? 511 PHE A CB  1 
ATOM   1400 C CG  . PHE A 1 187 ? -30.645 11.406 10.325  1.00 17.70 ? 511 PHE A CG  1 
ATOM   1401 C CD1 . PHE A 1 187 ? -31.551 12.063 11.151  1.00 23.38 ? 511 PHE A CD1 1 
ATOM   1402 C CD2 . PHE A 1 187 ? -30.594 11.760 9.001   1.00 18.32 ? 511 PHE A CD2 1 
ATOM   1403 C CE1 . PHE A 1 187 ? -32.410 13.049 10.644  1.00 27.35 ? 511 PHE A CE1 1 
ATOM   1404 C CE2 . PHE A 1 187 ? -31.434 12.769 8.479   1.00 24.90 ? 511 PHE A CE2 1 
ATOM   1405 C CZ  . PHE A 1 187 ? -32.348 13.408 9.320   1.00 22.78 ? 511 PHE A CZ  1 
ATOM   1406 N N   . MET A 1 188 ? -30.691 7.800  9.511   1.00 14.09 ? 512 MET A N   1 
ATOM   1407 C CA  . MET A 1 188 ? -31.457 7.121  8.482   1.00 14.89 ? 512 MET A CA  1 
ATOM   1408 C C   . MET A 1 188 ? -32.186 5.878  9.022   1.00 14.51 ? 512 MET A C   1 
ATOM   1409 O O   . MET A 1 188 ? -33.274 5.548  8.578   1.00 17.21 ? 512 MET A O   1 
ATOM   1410 C CB  . MET A 1 188 ? -30.527 6.744  7.301   1.00 14.63 ? 512 MET A CB  1 
ATOM   1411 C CG  . MET A 1 188 ? -31.266 6.361  6.031   1.00 14.93 ? 512 MET A CG  1 
ATOM   1412 S SD  . MET A 1 188 ? -32.477 7.560  5.402   1.00 21.05 ? 512 MET A SD  1 
ATOM   1413 C CE  . MET A 1 188 ? -31.399 8.980  5.043   1.00 20.85 ? 512 MET A CE  1 
ATOM   1414 N N   . LYS A 1 189 ? -31.590 5.211  9.988   1.00 16.54 ? 513 LYS A N   1 
ATOM   1415 C CA  . LYS A 1 189 ? -32.240 4.043  10.596  1.00 18.68 ? 513 LYS A CA  1 
ATOM   1416 C C   . LYS A 1 189 ? -33.662 4.436  10.980  1.00 21.05 ? 513 LYS A C   1 
ATOM   1417 O O   . LYS A 1 189 ? -34.639 3.724  10.718  1.00 20.79 ? 513 LYS A O   1 
ATOM   1418 C CB  . LYS A 1 189 ? -31.453 3.618  11.827  1.00 18.23 ? 513 LYS A CB  1 
ATOM   1419 C CG  . LYS A 1 189 ? -32.158 2.507  12.607  1.00 24.90 ? 513 LYS A CG  1 
ATOM   1420 C CD  . LYS A 1 189 ? -31.351 2.053  13.785  1.00 25.48 ? 513 LYS A CD  1 
ATOM   1421 C CE  . LYS A 1 189 ? -32.239 1.267  14.724  1.00 39.22 ? 513 LYS A CE  1 
ATOM   1422 N NZ  . LYS A 1 189 ? -31.515 0.095  15.292  1.00 40.92 ? 513 LYS A NZ  1 
ATOM   1423 N N   . PHE A 1 190 ? -33.788 5.613  11.577  1.00 20.51 ? 514 PHE A N   1 
ATOM   1424 C CA  . PHE A 1 190 ? -35.082 6.052  12.079  1.00 20.95 ? 514 PHE A CA  1 
ATOM   1425 C C   . PHE A 1 190 ? -35.896 6.837  11.047  1.00 21.50 ? 514 PHE A C   1 
ATOM   1426 O O   . PHE A 1 190 ? -37.114 6.651  10.923  1.00 23.03 ? 514 PHE A O   1 
ATOM   1427 C CB  . PHE A 1 190 ? -34.867 6.831  13.368  1.00 20.59 ? 514 PHE A CB  1 
ATOM   1428 C CG  . PHE A 1 190 ? -34.324 5.971  14.483  1.00 18.71 ? 514 PHE A CG  1 
ATOM   1429 C CD1 . PHE A 1 190 ? -35.125 4.994  15.078  1.00 21.52 ? 514 PHE A CD1 1 
ATOM   1430 C CD2 . PHE A 1 190 ? -33.021 6.115  14.913  1.00 19.48 ? 514 PHE A CD2 1 
ATOM   1431 C CE1 . PHE A 1 190 ? -34.643 4.195  16.104  1.00 19.47 ? 514 PHE A CE1 1 
ATOM   1432 C CE2 . PHE A 1 190 ? -32.534 5.336  15.926  1.00 19.27 ? 514 PHE A CE2 1 
ATOM   1433 C CZ  . PHE A 1 190 ? -33.348 4.360  16.530  1.00 22.09 ? 514 PHE A CZ  1 
ATOM   1434 N N   . LEU A 1 191 ? -35.228 7.670  10.261  1.00 19.59 ? 515 LEU A N   1 
ATOM   1435 C CA  . LEU A 1 191 ? -35.918 8.407  9.216   1.00 17.94 ? 515 LEU A CA  1 
ATOM   1436 C C   . LEU A 1 191 ? -36.621 7.488  8.216   1.00 18.93 ? 515 LEU A C   1 
ATOM   1437 O O   . LEU A 1 191 ? -37.735 7.776  7.804   1.00 19.22 ? 515 LEU A O   1 
ATOM   1438 C CB  . LEU A 1 191 ? -34.928 9.351  8.491   1.00 18.21 ? 515 LEU A CB  1 
ATOM   1439 C CG  . LEU A 1 191 ? -35.494 10.171 7.344   1.00 19.50 ? 515 LEU A CG  1 
ATOM   1440 C CD1 . LEU A 1 191 ? -36.427 11.202 7.925   1.00 18.80 ? 515 LEU A CD1 1 
ATOM   1441 C CD2 . LEU A 1 191 ? -34.387 10.849 6.513   1.00 18.98 ? 515 LEU A CD2 1 
ATOM   1442 N N   . LYS A 1 192 ? -35.968 6.394  7.802   1.00 20.38 ? 516 LYS A N   1 
ATOM   1443 C CA  . LYS A 1 192 ? -36.513 5.559  6.739   1.00 22.19 ? 516 LYS A CA  1 
ATOM   1444 C C   . LYS A 1 192 ? -37.876 4.955  7.084   1.00 23.47 ? 516 LYS A C   1 
ATOM   1445 O O   . LYS A 1 192 ? -38.623 4.665  6.203   1.00 24.77 ? 516 LYS A O   1 
ATOM   1446 C CB  . LYS A 1 192 ? -35.544 4.442  6.307   1.00 21.73 ? 516 LYS A CB  1 
ATOM   1447 C CG  . LYS A 1 192 ? -35.320 3.358  7.337   1.00 17.26 ? 516 LYS A CG  1 
ATOM   1448 C CD  . LYS A 1 192 ? -34.384 2.322  6.812   1.00 23.54 ? 516 LYS A CD  1 
ATOM   1449 C CE  . LYS A 1 192 ? -34.351 1.145  7.755   1.00 30.72 ? 516 LYS A CE  1 
ATOM   1450 N NZ  . LYS A 1 192 ? -33.543 0.113  7.102   1.00 38.46 ? 516 LYS A NZ  1 
ATOM   1451 N N   . ASP A 1 193 ? -38.188 4.777  8.357   1.00 25.64 ? 517 ASP A N   1 
ATOM   1452 C CA  . ASP A 1 193 ? -39.475 4.206  8.736   1.00 27.34 ? 517 ASP A CA  1 
ATOM   1453 C C   . ASP A 1 193 ? -40.637 5.214  8.798   1.00 27.16 ? 517 ASP A C   1 
ATOM   1454 O O   . ASP A 1 193 ? -41.798 4.816  8.920   1.00 25.93 ? 517 ASP A O   1 
ATOM   1455 C CB  . ASP A 1 193 ? -39.346 3.423  10.044  1.00 26.82 ? 517 ASP A CB  1 
ATOM   1456 C CG  . ASP A 1 193 ? -38.561 2.112  9.863   1.00 35.35 ? 517 ASP A CG  1 
ATOM   1457 O OD1 . ASP A 1 193 ? -37.961 1.656  10.856  1.00 40.57 ? 517 ASP A OD1 1 
ATOM   1458 O OD2 . ASP A 1 193 ? -38.518 1.558  8.729   1.00 28.80 ? 517 ASP A OD2 1 
ATOM   1459 N N   . ARG A 1 194 ? -40.334 6.503  8.657   1.00 25.77 ? 518 ARG A N   1 
ATOM   1460 C CA  . ARG A 1 194 ? -41.369 7.550  8.727   1.00 24.36 ? 518 ARG A CA  1 
ATOM   1461 C C   . ARG A 1 194 ? -41.537 8.395  7.481   1.00 23.23 ? 518 ARG A C   1 
ATOM   1462 O O   . ARG A 1 194 ? -42.545 9.112  7.337   1.00 23.03 ? 518 ARG A O   1 
ATOM   1463 C CB  . ARG A 1 194 ? -41.018 8.506  9.856   1.00 24.98 ? 518 ARG A CB  1 
ATOM   1464 C CG  . ARG A 1 194 ? -40.860 7.846  11.200  1.00 27.52 ? 518 ARG A CG  1 
ATOM   1465 C CD  . ARG A 1 194 ? -42.183 7.817  11.933  1.00 23.44 ? 518 ARG A CD  1 
ATOM   1466 N NE  . ARG A 1 194 ? -42.066 7.439  13.340  1.00 28.45 ? 518 ARG A NE  1 
ATOM   1467 C CZ  . ARG A 1 194 ? -43.133 7.264  14.114  1.00 30.96 ? 518 ARG A CZ  1 
ATOM   1468 N NH1 . ARG A 1 194 ? -44.333 7.446  13.594  1.00 26.10 ? 518 ARG A NH1 1 
ATOM   1469 N NH2 . ARG A 1 194 ? -43.013 6.907  15.381  1.00 27.76 ? 518 ARG A NH2 1 
ATOM   1470 N N   . LEU A 1 195 ? -40.554 8.343  6.584   1.00 20.97 ? 519 LEU A N   1 
ATOM   1471 C CA  . LEU A 1 195 ? -40.484 9.321  5.495   1.00 21.14 ? 519 LEU A CA  1 
ATOM   1472 C C   . LEU A 1 195 ? -41.676 9.263  4.536   1.00 20.76 ? 519 LEU A C   1 
ATOM   1473 O O   . LEU A 1 195 ? -42.021 10.275 3.911   1.00 20.87 ? 519 LEU A O   1 
ATOM   1474 C CB  . LEU A 1 195 ? -39.166 9.179  4.716   1.00 21.13 ? 519 LEU A CB  1 
ATOM   1475 C CG  . LEU A 1 195 ? -38.723 10.411 3.907   1.00 26.13 ? 519 LEU A CG  1 
ATOM   1476 C CD1 . LEU A 1 195 ? -38.320 11.581 4.821   1.00 28.06 ? 519 LEU A CD1 1 
ATOM   1477 C CD2 . LEU A 1 195 ? -37.581 10.068 2.992   1.00 31.59 ? 519 LEU A CD2 1 
ATOM   1478 N N   . LEU A 1 196 ? -42.298 8.090  4.414   1.00 19.95 ? 520 LEU A N   1 
ATOM   1479 C CA  . LEU A 1 196 ? -43.456 7.933  3.520   1.00 22.37 ? 520 LEU A CA  1 
ATOM   1480 C C   . LEU A 1 196 ? -44.771 8.486  4.114   1.00 23.53 ? 520 LEU A C   1 
ATOM   1481 O O   . LEU A 1 196 ? -45.774 8.595  3.408   1.00 23.15 ? 520 LEU A O   1 
ATOM   1482 C CB  . LEU A 1 196 ? -43.626 6.461  3.065   1.00 22.17 ? 520 LEU A CB  1 
ATOM   1483 C CG  . LEU A 1 196 ? -42.362 5.894  2.357   1.00 26.10 ? 520 LEU A CG  1 
ATOM   1484 C CD1 . LEU A 1 196 ? -42.527 4.432  1.961   1.00 25.08 ? 520 LEU A CD1 1 
ATOM   1485 C CD2 . LEU A 1 196 ? -41.965 6.743  1.139   1.00 23.45 ? 520 LEU A CD2 1 
ATOM   1486 N N   . GLU A 1 197 ? -44.772 8.853  5.395   1.00 22.82 ? 521 GLU A N   1 
ATOM   1487 C CA  . GLU A 1 197 ? -46.004 9.331  5.999   1.00 25.72 ? 521 GLU A CA  1 
ATOM   1488 C C   . GLU A 1 197 ? -46.495 10.617 5.353   1.00 26.04 ? 521 GLU A C   1 
ATOM   1489 O O   . GLU A 1 197 ? -45.705 11.501 4.961   1.00 27.16 ? 521 GLU A O   1 
ATOM   1490 C CB  . GLU A 1 197 ? -45.840 9.548  7.491   1.00 25.23 ? 521 GLU A CB  1 
ATOM   1491 C CG  . GLU A 1 197 ? -45.472 8.301  8.265   1.00 29.66 ? 521 GLU A CG  1 
ATOM   1492 C CD  . GLU A 1 197 ? -45.281 8.632  9.732   1.00 33.23 ? 521 GLU A CD  1 
ATOM   1493 O OE1 . GLU A 1 197 ? -45.464 9.810  10.097  1.00 36.55 ? 521 GLU A OE1 1 
ATOM   1494 O OE2 . GLU A 1 197 ? -44.952 7.731  10.522  1.00 36.67 ? 521 GLU A OE2 1 
ATOM   1495 N N   . ASP A 1 198 ? -47.806 10.738 5.249   1.00 24.57 ? 522 ASP A N   1 
ATOM   1496 C CA  . ASP A 1 198 ? -48.387 11.934 4.654   1.00 28.03 ? 522 ASP A CA  1 
ATOM   1497 C C   . ASP A 1 198 ? -48.672 12.919 5.793   1.00 26.92 ? 522 ASP A C   1 
ATOM   1498 O O   . ASP A 1 198 ? -49.808 13.026 6.244   1.00 27.11 ? 522 ASP A O   1 
ATOM   1499 C CB  . ASP A 1 198 ? -49.658 11.578 3.883   1.00 28.94 ? 522 ASP A CB  1 
ATOM   1500 C CG  . ASP A 1 198 ? -50.342 12.793 3.279   1.00 36.04 ? 522 ASP A CG  1 
ATOM   1501 O OD1 . ASP A 1 198 ? -49.666 13.797 2.951   1.00 41.85 ? 522 ASP A OD1 1 
ATOM   1502 O OD2 . ASP A 1 198 ? -51.573 12.738 3.127   1.00 42.51 ? 522 ASP A OD2 1 
ATOM   1503 N N   . LYS A 1 199 ? -47.613 13.594 6.257   1.00 25.13 ? 523 LYS A N   1 
ATOM   1504 C CA  . LYS A 1 199 ? -47.659 14.567 7.352   1.00 23.04 ? 523 LYS A CA  1 
ATOM   1505 C C   . LYS A 1 199 ? -46.683 15.678 7.049   1.00 21.19 ? 523 LYS A C   1 
ATOM   1506 O O   . LYS A 1 199 ? -45.670 15.454 6.375   1.00 17.84 ? 523 LYS A O   1 
ATOM   1507 C CB  . LYS A 1 199 ? -47.231 13.929 8.665   1.00 23.90 ? 523 LYS A CB  1 
ATOM   1508 C CG  . LYS A 1 199 ? -48.177 12.870 9.165   1.00 30.55 ? 523 LYS A CG  1 
ATOM   1509 C CD  . LYS A 1 199 ? -47.796 12.398 10.549  1.00 32.82 ? 523 LYS A CD  1 
ATOM   1510 C CE  . LYS A 1 199 ? -48.883 11.491 11.068  1.00 42.11 ? 523 LYS A CE  1 
ATOM   1511 N NZ  . LYS A 1 199 ? -48.362 10.180 11.510  1.00 38.18 ? 523 LYS A NZ  1 
ATOM   1512 N N   . LYS A 1 200 ? -46.974 16.871 7.558   1.00 18.57 ? 524 LYS A N   1 
ATOM   1513 C CA  . LYS A 1 200 ? -46.091 18.028 7.363   1.00 17.73 ? 524 LYS A CA  1 
ATOM   1514 C C   . LYS A 1 200 ? -44.681 17.570 7.778   1.00 15.71 ? 524 LYS A C   1 
ATOM   1515 O O   . LYS A 1 200 ? -44.543 16.859 8.756   1.00 15.99 ? 524 LYS A O   1 
ATOM   1516 C CB  . LYS A 1 200 ? -46.573 19.193 8.243   1.00 17.07 ? 524 LYS A CB  1 
ATOM   1517 C CG  . LYS A 1 200 ? -45.704 20.452 8.220   1.00 15.46 ? 524 LYS A CG  1 
ATOM   1518 C CD  . LYS A 1 200 ? -46.204 21.509 9.280   1.00 16.63 ? 524 LYS A CD  1 
ATOM   1519 C CE  . LYS A 1 200 ? -45.575 22.861 8.942   1.00 20.28 ? 524 LYS A CE  1 
ATOM   1520 N NZ  . LYS A 1 200 ? -45.916 23.971 9.872   1.00 24.77 ? 524 LYS A NZ  1 
ATOM   1521 N N   . ILE A 1 201 ? -43.666 17.946 7.011   1.00 16.98 ? 525 ILE A N   1 
ATOM   1522 C CA  . ILE A 1 201 ? -42.301 17.450 7.186   1.00 16.86 ? 525 ILE A CA  1 
ATOM   1523 C C   . ILE A 1 201 ? -41.802 17.747 8.620   1.00 18.44 ? 525 ILE A C   1 
ATOM   1524 O O   . ILE A 1 201 ? -41.096 16.944 9.238   1.00 16.83 ? 525 ILE A O   1 
ATOM   1525 C CB  . ILE A 1 201 ? -41.353 18.002 6.047   1.00 16.13 ? 525 ILE A CB  1 
ATOM   1526 C CG1 . ILE A 1 201 ? -39.912 17.483 6.207   1.00 17.67 ? 525 ILE A CG1 1 
ATOM   1527 C CG2 . ILE A 1 201 ? -41.372 19.543 5.946   1.00 14.46 ? 525 ILE A CG2 1 
ATOM   1528 C CD1 . ILE A 1 201 ? -39.824 15.952 6.230   1.00 14.23 ? 525 ILE A CD1 1 
ATOM   1529 N N   . THR A 1 202 ? -42.232 18.882 9.171   1.00 19.98 ? 526 THR A N   1 
ATOM   1530 C CA  . THR A 1 202 ? -41.854 19.262 10.534  1.00 22.12 ? 526 THR A CA  1 
ATOM   1531 C C   . THR A 1 202 ? -42.325 18.234 11.544  1.00 20.59 ? 526 THR A C   1 
ATOM   1532 O O   . THR A 1 202 ? -41.585 17.841 12.448  1.00 20.02 ? 526 THR A O   1 
ATOM   1533 C CB  . THR A 1 202 ? -42.382 20.672 10.917  1.00 22.13 ? 526 THR A CB  1 
ATOM   1534 O OG1 . THR A 1 202 ? -41.831 21.634 10.019  1.00 27.49 ? 526 THR A OG1 1 
ATOM   1535 C CG2 . THR A 1 202 ? -41.823 21.059 12.276  1.00 31.87 ? 526 THR A CG2 1 
ATOM   1536 N N   . VAL A 1 203 ? -43.544 17.760 11.348  1.00 18.19 ? 527 VAL A N   1 
ATOM   1537 C CA  . VAL A 1 203 ? -44.170 16.880 12.306  1.00 20.93 ? 527 VAL A CA  1 
ATOM   1538 C C   . VAL A 1 203 ? -43.565 15.498 12.145  1.00 19.77 ? 527 VAL A C   1 
ATOM   1539 O O   . VAL A 1 203 ? -43.313 14.797 13.111  1.00 21.84 ? 527 VAL A O   1 
ATOM   1540 C CB  . VAL A 1 203 ? -45.695 16.816 12.062  1.00 21.30 ? 527 VAL A CB  1 
ATOM   1541 C CG1 . VAL A 1 203 ? -46.305 15.623 12.791  1.00 22.51 ? 527 VAL A CG1 1 
ATOM   1542 C CG2 . VAL A 1 203 ? -46.361 18.163 12.479  1.00 26.00 ? 527 VAL A CG2 1 
ATOM   1543 N N   . LEU A 1 204 ? -43.311 15.124 10.894  1.00 20.94 ? 528 LEU A N   1 
ATOM   1544 C CA  . LEU A 1 204 ? -42.709 13.838 10.583  1.00 20.16 ? 528 LEU A CA  1 
ATOM   1545 C C   . LEU A 1 204 ? -41.327 13.751 11.241  1.00 20.25 ? 528 LEU A C   1 
ATOM   1546 O O   . LEU A 1 204 ? -40.961 12.724 11.814  1.00 20.01 ? 528 LEU A O   1 
ATOM   1547 C CB  . LEU A 1 204 ? -42.630 13.697 9.061   1.00 21.51 ? 528 LEU A CB  1 
ATOM   1548 C CG  . LEU A 1 204 ? -42.179 12.401 8.390   1.00 22.23 ? 528 LEU A CG  1 
ATOM   1549 C CD1 . LEU A 1 204 ? -42.515 12.504 6.926   1.00 20.89 ? 528 LEU A CD1 1 
ATOM   1550 C CD2 . LEU A 1 204 ? -40.671 12.120 8.579   1.00 25.06 ? 528 LEU A CD2 1 
ATOM   1551 N N   . LEU A 1 205 ? -40.547 14.835 11.153  1.00 18.58 ? 529 LEU A N   1 
ATOM   1552 C CA  . LEU A 1 205 ? -39.192 14.831 11.740  1.00 17.15 ? 529 LEU A CA  1 
ATOM   1553 C C   . LEU A 1 205 ? -39.254 14.752 13.265  1.00 16.71 ? 529 LEU A C   1 
ATOM   1554 O O   . LEU A 1 205 ? -38.381 14.159 13.893  1.00 15.99 ? 529 LEU A O   1 
ATOM   1555 C CB  . LEU A 1 205 ? -38.425 16.092 11.331  1.00 16.32 ? 529 LEU A CB  1 
ATOM   1556 C CG  . LEU A 1 205 ? -37.385 16.107 10.200  1.00 24.44 ? 529 LEU A CG  1 
ATOM   1557 C CD1 . LEU A 1 205 ? -37.238 14.865 9.400   1.00 21.78 ? 529 LEU A CD1 1 
ATOM   1558 C CD2 . LEU A 1 205 ? -37.478 17.354 9.334   1.00 21.93 ? 529 LEU A CD2 1 
ATOM   1559 N N   . ASP A 1 206 ? -40.282 15.380 13.850  1.00 16.17 ? 530 ASP A N   1 
ATOM   1560 C CA  . ASP A 1 206 ? -40.504 15.322 15.283  1.00 18.17 ? 530 ASP A CA  1 
ATOM   1561 C C   . ASP A 1 206 ? -40.743 13.880 15.785  1.00 19.90 ? 530 ASP A C   1 
ATOM   1562 O O   . ASP A 1 206 ? -40.240 13.505 16.849  1.00 18.62 ? 530 ASP A O   1 
ATOM   1563 C CB  . ASP A 1 206 ? -41.668 16.225 15.677  1.00 21.72 ? 530 ASP A CB  1 
ATOM   1564 C CG  . ASP A 1 206 ? -41.705 16.509 17.187  1.00 27.25 ? 530 ASP A CG  1 
ATOM   1565 O OD1 . ASP A 1 206 ? -40.652 16.827 17.824  1.00 27.95 ? 530 ASP A OD1 1 
ATOM   1566 O OD2 . ASP A 1 206 ? -42.818 16.406 17.737  1.00 38.01 ? 530 ASP A OD2 1 
ATOM   1567 N N   . GLU A 1 207 ? -41.483 13.089 15.004  1.00 18.22 ? 531 GLU A N   1 
ATOM   1568 C CA  . GLU A 1 207 ? -41.710 11.676 15.313  1.00 20.15 ? 531 GLU A CA  1 
ATOM   1569 C C   . GLU A 1 207 ? -40.406 10.906 15.234  1.00 19.11 ? 531 GLU A C   1 
ATOM   1570 O O   . GLU A 1 207 ? -40.133 10.101 16.096  1.00 21.50 ? 531 GLU A O   1 
ATOM   1571 C CB  . GLU A 1 207 ? -42.703 11.043 14.330  1.00 17.77 ? 531 GLU A CB  1 
ATOM   1572 C CG  . GLU A 1 207 ? -44.162 11.537 14.479  1.00 19.45 ? 531 GLU A CG  1 
ATOM   1573 C CD  . GLU A 1 207 ? -45.027 11.103 13.299  1.00 29.06 ? 531 GLU A CD  1 
ATOM   1574 O OE1 . GLU A 1 207 ? -44.471 10.755 12.221  1.00 33.16 ? 531 GLU A OE1 1 
ATOM   1575 O OE2 . GLU A 1 207 ? -46.271 11.113 13.430  1.00 37.71 ? 531 GLU A OE2 1 
ATOM   1576 N N   . VAL A 1 208 ? -39.615 11.157 14.187  1.00 18.11 ? 532 VAL A N   1 
ATOM   1577 C CA  . VAL A 1 208 ? -38.284 10.587 14.081  1.00 17.13 ? 532 VAL A CA  1 
ATOM   1578 C C   . VAL A 1 208 ? -37.402 10.949 15.278  1.00 17.22 ? 532 VAL A C   1 
ATOM   1579 O O   . VAL A 1 208 ? -36.631 10.098 15.781  1.00 18.38 ? 532 VAL A O   1 
ATOM   1580 C CB  . VAL A 1 208 ? -37.591 10.987 12.750  1.00 17.05 ? 532 VAL A CB  1 
ATOM   1581 C CG1 . VAL A 1 208 ? -36.154 10.425 12.711  1.00 19.61 ? 532 VAL A CG1 1 
ATOM   1582 C CG2 . VAL A 1 208 ? -38.393 10.459 11.532  1.00 12.78 ? 532 VAL A CG2 1 
ATOM   1583 N N   . ALA A 1 209 ? -37.482 12.193 15.748  1.00 14.21 ? 533 ALA A N   1 
ATOM   1584 C CA  . ALA A 1 209 ? -36.726 12.577 16.959  1.00 14.16 ? 533 ALA A CA  1 
ATOM   1585 C C   . ALA A 1 209 ? -37.099 11.706 18.178  1.00 16.42 ? 533 ALA A C   1 
ATOM   1586 O O   . ALA A 1 209 ? -36.246 11.294 18.983  1.00 16.46 ? 533 ALA A O   1 
ATOM   1587 C CB  . ALA A 1 209 ? -36.930 14.064 17.282  1.00 15.03 ? 533 ALA A CB  1 
ATOM   1588 N N   . GLU A 1 210 ? -38.386 11.435 18.307  1.00 18.03 ? 534 GLU A N   1 
ATOM   1589 C CA  . GLU A 1 210 ? -38.886 10.607 19.384  1.00 21.44 ? 534 GLU A CA  1 
ATOM   1590 C C   . GLU A 1 210 ? -38.410 9.151  19.238  1.00 20.89 ? 534 GLU A C   1 
ATOM   1591 O O   . GLU A 1 210 ? -37.979 8.554  20.223  1.00 22.02 ? 534 GLU A O   1 
ATOM   1592 C CB  . GLU A 1 210 ? -40.409 10.660 19.320  1.00 24.65 ? 534 GLU A CB  1 
ATOM   1593 C CG  . GLU A 1 210 ? -41.114 10.641 20.627  1.00 38.24 ? 534 GLU A CG  1 
ATOM   1594 C CD  . GLU A 1 210 ? -42.467 11.344 20.506  1.00 51.35 ? 534 GLU A CD  1 
ATOM   1595 O OE1 . GLU A 1 210 ? -43.473 10.627 20.338  1.00 49.67 ? 534 GLU A OE1 1 
ATOM   1596 O OE2 . GLU A 1 210 ? -42.507 12.605 20.536  1.00 51.93 ? 534 GLU A OE2 1 
ATOM   1597 N N   . ASP A 1 211 ? -38.469 8.592  18.022  1.00 18.75 ? 535 ASP A N   1 
ATOM   1598 C CA  . ASP A 1 211 ? -37.988 7.209  17.805  1.00 22.62 ? 535 ASP A CA  1 
ATOM   1599 C C   . ASP A 1 211 ? -36.523 7.089  18.155  1.00 22.98 ? 535 ASP A C   1 
ATOM   1600 O O   . ASP A 1 211 ? -36.107 6.108  18.769  1.00 23.78 ? 535 ASP A O   1 
ATOM   1601 C CB  . ASP A 1 211 ? -38.135 6.742  16.349  1.00 20.62 ? 535 ASP A CB  1 
ATOM   1602 C CG  . ASP A 1 211 ? -39.555 6.782  15.852  1.00 26.99 ? 535 ASP A CG  1 
ATOM   1603 O OD1 . ASP A 1 211 ? -40.508 6.729  16.679  1.00 30.42 ? 535 ASP A OD1 1 
ATOM   1604 O OD2 . ASP A 1 211 ? -39.726 6.893  14.612  1.00 30.10 ? 535 ASP A OD2 1 
ATOM   1605 N N   . MET A 1 212 ? -35.730 8.078  17.740  1.00 22.86 ? 536 MET A N   1 
ATOM   1606 C CA  . MET A 1 212 ? -34.291 8.055  17.965  1.00 21.29 ? 536 MET A CA  1 
ATOM   1607 C C   . MET A 1 212 ? -33.979 8.135  19.451  1.00 23.88 ? 536 MET A C   1 
ATOM   1608 O O   . MET A 1 212 ? -32.960 7.579  19.934  1.00 20.26 ? 536 MET A O   1 
ATOM   1609 C CB  . MET A 1 212 ? -33.595 9.182  17.214  1.00 20.79 ? 536 MET A CB  1 
ATOM   1610 C CG  . MET A 1 212 ? -32.066 9.180  17.371  1.00 24.19 ? 536 MET A CG  1 
ATOM   1611 S SD  . MET A 1 212 ? -31.184 10.563 16.564  1.00 26.15 ? 536 MET A SD  1 
ATOM   1612 C CE  . MET A 1 212 ? -31.967 10.520 14.946  1.00 16.62 ? 536 MET A CE  1 
ATOM   1613 N N   . GLY A 1 213 ? -34.852 8.808  20.196  1.00 21.85 ? 537 GLY A N   1 
ATOM   1614 C CA  . GLY A 1 213 ? -34.609 8.923  21.638  1.00 23.48 ? 537 GLY A CA  1 
ATOM   1615 C C   . GLY A 1 213 ? -34.719 7.595  22.380  1.00 23.76 ? 537 GLY A C   1 
ATOM   1616 O O   . GLY A 1 213 ? -34.324 7.504  23.527  1.00 24.13 ? 537 GLY A O   1 
ATOM   1617 N N   . LYS A 1 214 ? -35.264 6.568  21.735  1.00 27.04 ? 538 LYS A N   1 
ATOM   1618 C CA  . LYS A 1 214 ? -35.339 5.220  22.346  1.00 29.82 ? 538 LYS A CA  1 
ATOM   1619 C C   . LYS A 1 214 ? -34.103 4.352  22.058  1.00 31.97 ? 538 LYS A C   1 
ATOM   1620 O O   . LYS A 1 214 ? -33.982 3.221  22.530  1.00 33.19 ? 538 LYS A O   1 
ATOM   1621 C CB  . LYS A 1 214 ? -36.580 4.507  21.845  1.00 29.61 ? 538 LYS A CB  1 
ATOM   1622 C CG  . LYS A 1 214 ? -37.863 5.111  22.412  1.00 35.55 ? 538 LYS A CG  1 
ATOM   1623 C CD  . LYS A 1 214 ? -39.015 4.855  21.475  1.00 41.31 ? 538 LYS A CD  1 
ATOM   1624 C CE  . LYS A 1 214 ? -40.275 5.518  21.991  1.00 47.98 ? 538 LYS A CE  1 
ATOM   1625 N NZ  . LYS A 1 214 ? -41.406 5.217  21.069  1.00 51.12 ? 538 LYS A NZ  1 
ATOM   1626 N N   . CYS A 1 215 ? -33.184 4.888  21.271  1.00 31.56 ? 539 CYS A N   1 
ATOM   1627 C CA  . CYS A 1 215 ? -32.005 4.149  20.870  1.00 31.31 ? 539 CYS A CA  1 
ATOM   1628 C C   . CYS A 1 215 ? -30.938 4.287  21.937  1.00 30.01 ? 539 CYS A C   1 
ATOM   1629 O O   . CYS A 1 215 ? -30.416 5.374  22.197  1.00 26.02 ? 539 CYS A O   1 
ATOM   1630 C CB  . CYS A 1 215 ? -31.488 4.655  19.530  1.00 33.24 ? 539 CYS A CB  1 
ATOM   1631 S SG  . CYS A 1 215 ? -29.923 3.937  19.047  1.00 34.50 ? 539 CYS A SG  1 
ATOM   1632 N N   . HIS A 1 216 ? -30.625 3.159  22.557  1.00 30.23 ? 540 HIS A N   1 
ATOM   1633 C CA  . HIS A 1 216 ? -29.700 3.101  23.659  1.00 30.47 ? 540 HIS A CA  1 
ATOM   1634 C C   . HIS A 1 216 ? -28.298 3.508  23.284  1.00 29.47 ? 540 HIS A C   1 
ATOM   1635 O O   . HIS A 1 216 ? -27.656 4.202  24.031  1.00 29.44 ? 540 HIS A O   1 
ATOM   1636 C CB  . HIS A 1 216 ? -29.724 1.683  24.258  1.00 34.21 ? 540 HIS A CB  1 
ATOM   1637 C CG  . HIS A 1 216 ? -30.956 1.408  25.061  1.00 36.42 ? 540 HIS A CG  1 
ATOM   1638 N ND1 . HIS A 1 216 ? -31.987 0.612  24.599  1.00 40.24 ? 540 HIS A ND1 1 
ATOM   1639 C CD2 . HIS A 1 216 ? -31.345 1.865  26.279  1.00 41.71 ? 540 HIS A CD2 1 
ATOM   1640 C CE1 . HIS A 1 216 ? -32.949 0.570  25.509  1.00 39.57 ? 540 HIS A CE1 1 
ATOM   1641 N NE2 . HIS A 1 216 ? -32.586 1.322  26.535  1.00 46.21 ? 540 HIS A NE2 1 
ATOM   1642 N N   . LEU A 1 217 ? -27.834 3.096  22.111  1.00 30.01 ? 541 LEU A N   1 
ATOM   1643 C CA  . LEU A 1 217 ? -26.488 3.428  21.659  1.00 30.48 ? 541 LEU A CA  1 
ATOM   1644 C C   . LEU A 1 217 ? -26.179 4.922  21.702  1.00 29.35 ? 541 LEU A C   1 
ATOM   1645 O O   . LEU A 1 217 ? -25.057 5.321  21.993  1.00 29.26 ? 541 LEU A O   1 
ATOM   1646 C CB  . LEU A 1 217 ? -26.262 2.932  20.224  1.00 29.47 ? 541 LEU A CB  1 
ATOM   1647 C CG  . LEU A 1 217 ? -25.307 1.811  19.885  1.00 31.98 ? 541 LEU A CG  1 
ATOM   1648 C CD1 . LEU A 1 217 ? -24.959 1.889  18.397  1.00 31.79 ? 541 LEU A CD1 1 
ATOM   1649 C CD2 . LEU A 1 217 ? -24.052 1.814  20.785  1.00 29.00 ? 541 LEU A CD2 1 
ATOM   1650 N N   . THR A 1 218 ? -27.163 5.758  21.409  1.00 30.81 ? 542 THR A N   1 
ATOM   1651 C CA  . THR A 1 218 ? -26.869 7.184  21.235  1.00 30.35 ? 542 THR A CA  1 
ATOM   1652 C C   . THR A 1 218 ? -27.345 8.116  22.373  1.00 31.95 ? 542 THR A C   1 
ATOM   1653 O O   . THR A 1 218 ? -27.111 9.334  22.329  1.00 28.97 ? 542 THR A O   1 
ATOM   1654 C CB  . THR A 1 218 ? -27.402 7.668  19.874  1.00 31.44 ? 542 THR A CB  1 
ATOM   1655 O OG1 . THR A 1 218 ? -28.792 7.326  19.768  1.00 31.05 ? 542 THR A OG1 1 
ATOM   1656 C CG2 . THR A 1 218 ? -26.614 6.985  18.745  1.00 30.41 ? 542 THR A CG2 1 
ATOM   1657 N N   . LYS A 1 219 ? -27.978 7.549  23.403  1.00 31.22 ? 543 LYS A N   1 
ATOM   1658 C CA  . LYS A 1 219 ? -28.429 8.371  24.534  1.00 32.15 ? 543 LYS A CA  1 
ATOM   1659 C C   . LYS A 1 219 ? -27.293 9.208  25.049  1.00 30.07 ? 543 LYS A C   1 
ATOM   1660 O O   . LYS A 1 219 ? -26.210 8.700  25.292  1.00 32.74 ? 543 LYS A O   1 
ATOM   1661 C CB  . LYS A 1 219 ? -29.019 7.517  25.669  1.00 33.21 ? 543 LYS A CB  1 
ATOM   1662 C CG  . LYS A 1 219 ? -30.222 6.707  25.194  1.00 37.63 ? 543 LYS A CG  1 
ATOM   1663 C CD  . LYS A 1 219 ? -31.406 6.676  26.188  1.00 50.09 ? 543 LYS A CD  1 
ATOM   1664 C CE  . LYS A 1 219 ? -32.442 5.635  25.722  1.00 53.03 ? 543 LYS A CE  1 
ATOM   1665 N NZ  . LYS A 1 219 ? -33.769 5.724  26.415  1.00 58.69 ? 543 LYS A NZ  1 
ATOM   1666 N N   . GLY A 1 220 ? -27.518 10.506 25.176  1.00 26.57 ? 544 GLY A N   1 
ATOM   1667 C CA  . GLY A 1 220 ? -26.500 11.397 25.692  1.00 24.28 ? 544 GLY A CA  1 
ATOM   1668 C C   . GLY A 1 220 ? -25.430 11.812 24.696  1.00 25.97 ? 544 GLY A C   1 
ATOM   1669 O O   . GLY A 1 220 ? -24.475 12.519 25.056  1.00 25.50 ? 544 GLY A O   1 
ATOM   1670 N N   . LYS A 1 221 ? -25.537 11.380 23.442  1.00 23.69 ? 545 LYS A N   1 
ATOM   1671 C CA  . LYS A 1 221 ? -24.507 11.811 22.488  1.00 23.90 ? 545 LYS A CA  1 
ATOM   1672 C C   . LYS A 1 221 ? -25.003 12.239 21.107  1.00 21.54 ? 545 LYS A C   1 
ATOM   1673 O O   . LYS A 1 221 ? -24.341 13.031 20.445  1.00 21.17 ? 545 LYS A O   1 
ATOM   1674 C CB  . LYS A 1 221 ? -23.369 10.798 22.351  1.00 26.94 ? 545 LYS A CB  1 
ATOM   1675 C CG  . LYS A 1 221 ? -23.744 9.354  22.374  1.00 37.17 ? 545 LYS A CG  1 
ATOM   1676 C CD  . LYS A 1 221 ? -22.447 8.540  22.377  1.00 42.63 ? 545 LYS A CD  1 
ATOM   1677 C CE  . LYS A 1 221 ? -22.556 7.307  23.227  1.00 50.17 ? 545 LYS A CE  1 
ATOM   1678 N NZ  . LYS A 1 221 ? -21.189 6.922  23.665  1.00 49.30 ? 545 LYS A NZ  1 
ATOM   1679 N N   . GLN A 1 222 ? -26.139 11.705 20.680  1.00 18.69 ? 546 GLN A N   1 
ATOM   1680 C CA  . GLN A 1 222 ? -26.763 12.178 19.450  1.00 20.65 ? 546 GLN A CA  1 
ATOM   1681 C C   . GLN A 1 222 ? -28.273 12.341 19.649  1.00 19.92 ? 546 GLN A C   1 
ATOM   1682 O O   . GLN A 1 222 ? -28.953 11.439 20.131  1.00 18.68 ? 546 GLN A O   1 
ATOM   1683 C CB  . GLN A 1 222 ? -26.490 11.239 18.275  1.00 18.11 ? 546 GLN A CB  1 
ATOM   1684 C CG  . GLN A 1 222 ? -27.406 11.484 17.057  1.00 19.32 ? 546 GLN A CG  1 
ATOM   1685 C CD  . GLN A 1 222 ? -26.943 10.717 15.828  1.00 18.88 ? 546 GLN A CD  1 
ATOM   1686 O OE1 . GLN A 1 222 ? -26.029 9.882  15.910  1.00 17.89 ? 546 GLN A OE1 1 
ATOM   1687 N NE2 . GLN A 1 222 ? -27.569 10.987 14.690  1.00 13.84 ? 546 GLN A NE2 1 
ATOM   1688 N N   . ALA A 1 223 ? -28.794 13.488 19.226  1.00 17.79 ? 547 ALA A N   1 
ATOM   1689 C CA  . ALA A 1 223 ? -30.241 13.689 19.192  1.00 16.78 ? 547 ALA A CA  1 
ATOM   1690 C C   . ALA A 1 223 ? -30.611 14.539 17.984  1.00 14.79 ? 547 ALA A C   1 
ATOM   1691 O O   . ALA A 1 223 ? -29.947 15.538 17.699  1.00 13.26 ? 547 ALA A O   1 
ATOM   1692 C CB  . ALA A 1 223 ? -30.704 14.365 20.491  1.00 15.38 ? 547 ALA A CB  1 
ATOM   1693 N N   . LEU A 1 224 ? -31.664 14.126 17.282  1.00 13.70 ? 548 LEU A N   1 
ATOM   1694 C CA  . LEU A 1 224 ? -32.136 14.849 16.155  1.00 16.06 ? 548 LEU A CA  1 
ATOM   1695 C C   . LEU A 1 224 ? -32.452 16.294 16.587  1.00 18.32 ? 548 LEU A C   1 
ATOM   1696 O O   . LEU A 1 224 ? -33.036 16.501 17.646  1.00 19.58 ? 548 LEU A O   1 
ATOM   1697 C CB  . LEU A 1 224 ? -33.409 14.174 15.651  1.00 16.61 ? 548 LEU A CB  1 
ATOM   1698 C CG  . LEU A 1 224 ? -33.733 14.329 14.161  1.00 21.69 ? 548 LEU A CG  1 
ATOM   1699 C CD1 . LEU A 1 224 ? -34.714 13.272 13.745  1.00 27.63 ? 548 LEU A CD1 1 
ATOM   1700 C CD2 . LEU A 1 224 ? -34.335 15.675 13.873  1.00 25.09 ? 548 LEU A CD2 1 
ATOM   1701 N N   . GLU A 1 225 ? -32.029 17.276 15.790  1.00 16.06 ? 549 GLU A N   1 
ATOM   1702 C CA  . GLU A 1 225 ? -32.485 18.653 15.961  1.00 16.45 ? 549 GLU A CA  1 
ATOM   1703 C C   . GLU A 1 225 ? -33.295 19.132 14.754  1.00 15.90 ? 549 GLU A C   1 
ATOM   1704 O O   . GLU A 1 225 ? -32.853 19.067 13.605  1.00 14.83 ? 549 GLU A O   1 
ATOM   1705 C CB  . GLU A 1 225 ? -31.334 19.633 16.273  1.00 16.44 ? 549 GLU A CB  1 
ATOM   1706 C CG  . GLU A 1 225 ? -31.882 21.012 16.674  1.00 22.13 ? 549 GLU A CG  1 
ATOM   1707 C CD  . GLU A 1 225 ? -30.832 21.975 17.168  1.00 28.68 ? 549 GLU A CD  1 
ATOM   1708 O OE1 . GLU A 1 225 ? -29.944 22.349 16.367  1.00 30.93 ? 549 GLU A OE1 1 
ATOM   1709 O OE2 . GLU A 1 225 ? -30.907 22.361 18.365  1.00 29.61 ? 549 GLU A OE2 1 
ATOM   1710 N N   . ILE A 1 226 ? -34.497 19.604 15.013  1.00 14.67 ? 550 ILE A N   1 
ATOM   1711 C CA  . ILE A 1 226 ? -35.293 20.193 13.961  1.00 17.01 ? 550 ILE A CA  1 
ATOM   1712 C C   . ILE A 1 226 ? -35.231 21.694 14.102  1.00 18.00 ? 550 ILE A C   1 
ATOM   1713 O O   . ILE A 1 226 ? -35.333 22.227 15.225  1.00 16.74 ? 550 ILE A O   1 
ATOM   1714 C CB  . ILE A 1 226 ? -36.729 19.800 14.109  1.00 17.46 ? 550 ILE A CB  1 
ATOM   1715 C CG1 . ILE A 1 226 ? -36.844 18.285 14.156  1.00 22.19 ? 550 ILE A CG1 1 
ATOM   1716 C CG2 . ILE A 1 226 ? -37.557 20.366 12.943  1.00 22.68 ? 550 ILE A CG2 1 
ATOM   1717 C CD1 . ILE A 1 226 ? -38.222 17.786 14.606  1.00 23.65 ? 550 ILE A CD1 1 
ATOM   1718 N N   . ARG A 1 227 ? -35.049 22.384 12.982  1.00 15.53 ? 551 ARG A N   1 
ATOM   1719 C CA  . ARG A 1 227 ? -35.132 23.820 12.991  1.00 15.71 ? 551 ARG A CA  1 
ATOM   1720 C C   . ARG A 1 227 ? -35.984 24.196 11.808  1.00 18.31 ? 551 ARG A C   1 
ATOM   1721 O O   . ARG A 1 227 ? -35.638 23.875 10.679  1.00 18.88 ? 551 ARG A O   1 
ATOM   1722 C CB  . ARG A 1 227 ? -33.753 24.462 12.897  1.00 14.88 ? 551 ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 227 ? -33.869 25.977 12.904  1.00 23.58 ? 551 ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 227 ? -32.561 26.676 13.162  1.00 27.54 ? 551 ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 227 ? -31.539 26.405 12.151  1.00 34.26 ? 551 ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 227 ? -31.452 27.019 10.974  1.00 37.92 ? 551 ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 227 ? -32.365 27.910 10.620  1.00 36.90 ? 551 ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 227 ? -30.467 26.709 10.132  1.00 35.78 ? 551 ARG A NH2 1 
ATOM   1729 N N   . SER A 1 228 ? -37.106 24.870 12.059  1.00 17.92 ? 552 SER A N   1 
ATOM   1730 C CA  . SER A 1 228 ? -38.119 25.065 11.029  1.00 17.67 ? 552 SER A CA  1 
ATOM   1731 C C   . SER A 1 228 ? -38.773 26.432 11.145  1.00 17.80 ? 552 SER A C   1 
ATOM   1732 O O   . SER A 1 228 ? -39.168 26.847 12.254  1.00 15.06 ? 552 SER A O   1 
ATOM   1733 C CB  . SER A 1 228 ? -39.219 24.003 11.190  1.00 18.30 ? 552 SER A CB  1 
ATOM   1734 O OG  . SER A 1 228 ? -40.372 24.273 10.401  1.00 18.06 ? 552 SER A OG  1 
ATOM   1735 N N   . SER A 1 229 ? -38.924 27.106 10.008  1.00 16.68 ? 553 SER A N   1 
ATOM   1736 C CA  . SER A 1 229 ? -39.817 28.257 9.934   1.00 16.72 ? 553 SER A CA  1 
ATOM   1737 C C   . SER A 1 229 ? -40.949 27.995 8.933   1.00 18.25 ? 553 SER A C   1 
ATOM   1738 O O   . SER A 1 229 ? -41.649 28.908 8.500   1.00 18.31 ? 553 SER A O   1 
ATOM   1739 C CB  . SER A 1 229 ? -39.027 29.528 9.590   1.00 18.44 ? 553 SER A CB  1 
ATOM   1740 O OG  . SER A 1 229 ? -38.406 29.447 8.321   1.00 19.73 ? 553 SER A OG  1 
ATOM   1741 N N   . LEU A 1 230 ? -41.159 26.726 8.594   1.00 18.01 ? 554 LEU A N   1 
ATOM   1742 C CA  . LEU A 1 230 ? -42.210 26.387 7.651   1.00 18.29 ? 554 LEU A CA  1 
ATOM   1743 C C   . LEU A 1 230 ? -43.589 26.691 8.262   1.00 19.65 ? 554 LEU A C   1 
ATOM   1744 O O   . LEU A 1 230 ? -43.971 26.075 9.250   1.00 17.73 ? 554 LEU A O   1 
ATOM   1745 C CB  . LEU A 1 230 ? -42.088 24.899 7.266   1.00 16.59 ? 554 LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 230 ? -43.215 24.319 6.395   1.00 22.56 ? 554 LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 230 ? -43.285 25.060 5.034   1.00 12.18 ? 554 LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 230 ? -43.009 22.819 6.190   1.00 18.09 ? 554 LEU A CD2 1 
ATOM   1749 N N   . SER A 1 231 ? -44.328 27.659 7.712   1.00 20.80 ? 555 SER A N   1 
ATOM   1750 C CA  . SER A 1 231 ? -45.653 27.941 8.244   1.00 24.48 ? 555 SER A CA  1 
ATOM   1751 C C   . SER A 1 231 ? -46.712 27.078 7.547   1.00 27.84 ? 555 SER A C   1 
ATOM   1752 O O   . SER A 1 231 ? -47.477 26.382 8.213   1.00 32.53 ? 555 SER A O   1 
ATOM   1753 C CB  . SER A 1 231 ? -46.030 29.449 8.210   1.00 24.44 ? 555 SER A CB  1 
ATOM   1754 O OG  . SER A 1 231 ? -45.527 30.088 7.058   1.00 30.75 ? 555 SER A OG  1 
ATOM   1755 N N   . GLU A 1 232 ? -46.735 27.062 6.224   1.00 27.85 ? 556 GLU A N   1 
ATOM   1756 C CA  . GLU A 1 232 ? -47.702 26.205 5.535   1.00 28.78 ? 556 GLU A CA  1 
ATOM   1757 C C   . GLU A 1 232 ? -47.470 24.711 5.775   1.00 28.32 ? 556 GLU A C   1 
ATOM   1758 O O   . GLU A 1 232 ? -46.334 24.263 5.982   1.00 27.10 ? 556 GLU A O   1 
ATOM   1759 C CB  . GLU A 1 232 ? -47.692 26.489 4.038   1.00 29.85 ? 556 GLU A CB  1 
ATOM   1760 C CG  . GLU A 1 232 ? -48.386 27.781 3.660   1.00 40.11 ? 556 GLU A CG  1 
ATOM   1761 C CD  . GLU A 1 232 ? -48.728 27.810 2.180   1.00 49.18 ? 556 GLU A CD  1 
ATOM   1762 O OE1 . GLU A 1 232 ? -49.883 27.486 1.823   1.00 55.80 ? 556 GLU A OE1 1 
ATOM   1763 O OE2 . GLU A 1 232 ? -47.827 28.105 1.373   1.00 50.31 ? 556 GLU A OE2 1 
ATOM   1764 N N   . LYS A 1 233 ? -48.552 23.946 5.681   1.00 26.24 ? 557 LYS A N   1 
ATOM   1765 C CA  . LYS A 1 233 ? -48.582 22.538 6.030   1.00 27.18 ? 557 LYS A CA  1 
ATOM   1766 C C   . LYS A 1 233 ? -48.025 21.661 4.896   1.00 26.30 ? 557 LYS A C   1 
ATOM   1767 O O   . LYS A 1 233 ? -48.756 20.866 4.288   1.00 28.05 ? 557 LYS A O   1 
ATOM   1768 C CB  . LYS A 1 233 ? -50.022 22.167 6.322   1.00 27.44 ? 557 LYS A CB  1 
ATOM   1769 C CG  . LYS A 1 233 ? -50.191 20.977 7.205   1.00 36.09 ? 557 LYS A CG  1 
ATOM   1770 C CD  . LYS A 1 233 ? -51.663 20.622 7.261   1.00 48.07 ? 557 LYS A CD  1 
ATOM   1771 C CE  . LYS A 1 233 ? -51.840 19.111 7.295   1.00 54.53 ? 557 LYS A CE  1 
ATOM   1772 N NZ  . LYS A 1 233 ? -52.990 18.645 6.463   1.00 53.01 ? 557 LYS A NZ  1 
ATOM   1773 N N   . ARG A 1 234 ? -46.743 21.835 4.582   1.00 23.14 ? 558 ARG A N   1 
ATOM   1774 C CA  . ARG A 1 234 ? -46.190 21.191 3.415   1.00 22.93 ? 558 ARG A CA  1 
ATOM   1775 C C   . ARG A 1 234 ? -45.584 19.839 3.768   1.00 22.99 ? 558 ARG A C   1 
ATOM   1776 O O   . ARG A 1 234 ? -45.063 19.655 4.876   1.00 24.22 ? 558 ARG A O   1 
ATOM   1777 C CB  . ARG A 1 234 ? -45.246 22.139 2.664   1.00 22.84 ? 558 ARG A CB  1 
ATOM   1778 C CG  . ARG A 1 234 ? -46.042 23.287 1.964   1.00 19.56 ? 558 ARG A CG  1 
ATOM   1779 C CD  . ARG A 1 234 ? -45.190 24.159 1.048   1.00 21.13 ? 558 ARG A CD  1 
ATOM   1780 N NE  . ARG A 1 234 ? -45.978 25.278 0.502   1.00 26.16 ? 558 ARG A NE  1 
ATOM   1781 C CZ  . ARG A 1 234 ? -46.847 25.185 -0.506  1.00 28.69 ? 558 ARG A CZ  1 
ATOM   1782 N NH1 . ARG A 1 234 ? -47.080 24.027 -1.113  1.00 22.13 ? 558 ARG A NH1 1 
ATOM   1783 N NH2 . ARG A 1 234 ? -47.486 26.262 -0.925  1.00 32.99 ? 558 ARG A NH2 1 
ATOM   1784 N N   . ALA A 1 235 ? -45.686 18.886 2.850   1.00 22.64 ? 559 ALA A N   1 
ATOM   1785 C CA  . ALA A 1 235 ? -45.246 17.498 3.114   1.00 22.18 ? 559 ALA A CA  1 
ATOM   1786 C C   . ALA A 1 235 ? -44.524 16.956 1.886   1.00 21.24 ? 559 ALA A C   1 
ATOM   1787 O O   . ALA A 1 235 ? -44.808 17.389 0.793   1.00 20.33 ? 559 ALA A O   1 
ATOM   1788 C CB  . ALA A 1 235 ? -46.411 16.647 3.434   1.00 21.98 ? 559 ALA A CB  1 
ATOM   1789 N N   . LEU A 1 236 ? -43.558 16.054 2.074   1.00 19.38 ? 560 LEU A N   1 
ATOM   1790 C CA  . LEU A 1 236 ? -42.856 15.451 0.941   1.00 20.09 ? 560 LEU A CA  1 
ATOM   1791 C C   . LEU A 1 236 ? -43.811 14.636 0.029   1.00 20.69 ? 560 LEU A C   1 
ATOM   1792 O O   . LEU A 1 236 ? -43.544 14.410 -1.152  1.00 20.47 ? 560 LEU A O   1 
ATOM   1793 C CB  . LEU A 1 236 ? -41.767 14.539 1.483   1.00 20.95 ? 560 LEU A CB  1 
ATOM   1794 C CG  . LEU A 1 236 ? -40.393 15.119 1.851   1.00 24.55 ? 560 LEU A CG  1 
ATOM   1795 C CD1 . LEU A 1 236 ? -40.314 16.643 2.012   1.00 20.73 ? 560 LEU A CD1 1 
ATOM   1796 C CD2 . LEU A 1 236 ? -39.730 14.358 2.990   1.00 22.14 ? 560 LEU A CD2 1 
ATOM   1797 N N   . THR A 1 237 ? -44.932 14.213 0.585   1.00 20.48 ? 561 THR A N   1 
ATOM   1798 C CA  . THR A 1 237 ? -45.976 13.516 -0.173  1.00 23.09 ? 561 THR A CA  1 
ATOM   1799 C C   . THR A 1 237 ? -46.886 14.458 -0.982  1.00 25.41 ? 561 THR A C   1 
ATOM   1800 O O   . THR A 1 237 ? -47.776 13.984 -1.693  1.00 26.69 ? 561 THR A O   1 
ATOM   1801 C CB  . THR A 1 237 ? -46.887 12.779 0.798   1.00 23.56 ? 561 THR A CB  1 
ATOM   1802 O OG1 . THR A 1 237 ? -47.190 13.682 1.861   1.00 23.38 ? 561 THR A OG1 1 
ATOM   1803 C CG2 . THR A 1 237 ? -46.182 11.569 1.390   1.00 17.59 ? 561 THR A CG2 1 
ATOM   1804 N N   . ASP A 1 238 ? -46.715 15.775 -0.876  1.00 24.70 ? 562 ASP A N   1 
ATOM   1805 C CA  . ASP A 1 238 ? -47.639 16.665 -1.602  1.00 24.85 ? 562 ASP A CA  1 
ATOM   1806 C C   . ASP A 1 238 ? -47.601 16.386 -3.093  1.00 26.20 ? 562 ASP A C   1 
ATOM   1807 O O   . ASP A 1 238 ? -46.533 16.196 -3.688  1.00 25.40 ? 562 ASP A O   1 
ATOM   1808 C CB  . ASP A 1 238 ? -47.370 18.163 -1.387  1.00 22.67 ? 562 ASP A CB  1 
ATOM   1809 C CG  . ASP A 1 238 ? -47.657 18.632 0.045   1.00 25.99 ? 562 ASP A CG  1 
ATOM   1810 O OD1 . ASP A 1 238 ? -48.393 17.925 0.776   1.00 23.10 ? 562 ASP A OD1 1 
ATOM   1811 O OD2 . ASP A 1 238 ? -47.141 19.726 0.428   1.00 22.05 ? 562 ASP A OD2 1 
ATOM   1812 N N   . PRO A 1 239 ? -48.777 16.395 -3.719  1.00 28.34 ? 563 PRO A N   1 
ATOM   1813 C CA  . PRO A 1 239 ? -48.845 16.124 -5.157  1.00 29.82 ? 563 PRO A CA  1 
ATOM   1814 C C   . PRO A 1 239 ? -48.211 17.225 -5.987  1.00 29.69 ? 563 PRO A C   1 
ATOM   1815 O O   . PRO A 1 239 ? -48.237 18.388 -5.595  1.00 29.85 ? 563 PRO A O   1 
ATOM   1816 C CB  . PRO A 1 239 ? -50.355 16.057 -5.440  1.00 30.02 ? 563 PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 239 ? -51.003 15.824 -4.075  1.00 31.68 ? 563 PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 239 ? -50.104 16.518 -3.091  1.00 27.59 ? 563 PRO A CD  1 
ATOM   1819 N N   . ILE A 1 240 ? -47.640 16.846 -7.130  1.00 29.57 ? 564 ILE A N   1 
ATOM   1820 C CA  . ILE A 1 240 ? -47.099 17.803 -8.086  1.00 30.45 ? 564 ILE A CA  1 
ATOM   1821 C C   . ILE A 1 240 ? -48.220 18.392 -8.954  1.00 34.36 ? 564 ILE A C   1 
ATOM   1822 O O   . ILE A 1 240 ? -49.032 17.661 -9.540  1.00 31.79 ? 564 ILE A O   1 
ATOM   1823 C CB  . ILE A 1 240 ? -46.024 17.153 -8.954  1.00 28.91 ? 564 ILE A CB  1 
ATOM   1824 C CG1 . ILE A 1 240 ? -44.836 16.743 -8.079  1.00 29.21 ? 564 ILE A CG1 1 
ATOM   1825 C CG2 . ILE A 1 240 ? -45.560 18.084 -10.091 1.00 30.02 ? 564 ILE A CG2 1 
ATOM   1826 C CD1 . ILE A 1 240 ? -43.808 15.897 -8.835  1.00 21.95 ? 564 ILE A CD1 1 
ATOM   1827 N N   . GLN A 1 241 ? -48.259 19.721 -9.011  1.00 37.26 ? 565 GLN A N   1 
ATOM   1828 C CA  . GLN A 1 241 ? -49.329 20.448 -9.686  1.00 41.79 ? 565 GLN A CA  1 
ATOM   1829 C C   . GLN A 1 241 ? -49.539 19.959 -11.104 1.00 43.92 ? 565 GLN A C   1 
ATOM   1830 O O   . GLN A 1 241 ? -48.576 19.755 -11.840 1.00 41.89 ? 565 GLN A O   1 
ATOM   1831 C CB  . GLN A 1 241 ? -48.984 21.924 -9.729  1.00 42.13 ? 565 GLN A CB  1 
ATOM   1832 C CG  . GLN A 1 241 ? -49.917 22.767 -10.558 1.00 47.47 ? 565 GLN A CG  1 
ATOM   1833 C CD  . GLN A 1 241 ? -49.792 24.213 -10.179 1.00 51.46 ? 565 GLN A CD  1 
ATOM   1834 O OE1 . GLN A 1 241 ? -50.696 24.778 -9.567  1.00 55.75 ? 565 GLN A OE1 1 
ATOM   1835 N NE2 . GLN A 1 241 ? -48.639 24.809 -10.475 1.00 53.68 ? 565 GLN A NE2 1 
ATOM   1836 N N   . GLY A 1 242 ? -50.795 19.761 -11.484 1.00 47.11 ? 566 GLY A N   1 
ATOM   1837 C CA  . GLY A 1 242 ? -51.090 19.392 -12.859 1.00 51.75 ? 566 GLY A CA  1 
ATOM   1838 C C   . GLY A 1 242 ? -50.949 17.915 -13.172 1.00 54.33 ? 566 GLY A C   1 
ATOM   1839 O O   . GLY A 1 242 ? -51.170 17.509 -14.310 1.00 55.49 ? 566 GLY A O   1 
ATOM   1840 N N   . THR A 1 243 ? -50.568 17.104 -12.187 1.00 56.10 ? 567 THR A N   1 
ATOM   1841 C CA  . THR A 1 243 ? -50.631 15.644 -12.355 1.00 57.85 ? 567 THR A CA  1 
ATOM   1842 C C   . THR A 1 243 ? -51.905 15.210 -11.667 1.00 57.67 ? 567 THR A C   1 
ATOM   1843 O O   . THR A 1 243 ? -52.599 16.042 -11.085 1.00 59.64 ? 567 THR A O   1 
ATOM   1844 C CB  . THR A 1 243 ? -49.413 14.874 -11.751 1.00 58.44 ? 567 THR A CB  1 
ATOM   1845 O OG1 . THR A 1 243 ? -49.497 14.855 -10.317 1.00 61.23 ? 567 THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 243 ? -48.074 15.480 -12.195 1.00 57.92 ? 567 THR A CG2 1 
ATOM   1847 N N   . GLU A 1 244 ? -52.228 13.924 -11.721 1.00 56.51 ? 568 GLU A N   1 
ATOM   1848 C CA  . GLU A 1 244 ? -53.494 13.468 -11.131 1.00 54.07 ? 568 GLU A CA  1 
ATOM   1849 C C   . GLU A 1 244 ? -53.297 12.738 -9.805  1.00 54.01 ? 568 GLU A C   1 
ATOM   1850 O O   . GLU A 1 244 ? -52.507 11.788 -9.714  1.00 55.49 ? 568 GLU A O   1 
ATOM   1851 C CB  . GLU A 1 244 ? -54.297 12.614 -12.130 1.00 49.81 ? 568 GLU A CB  1 
ATOM   1852 C CG  . GLU A 1 244 ? -54.841 13.426 -13.334 1.00 42.26 ? 568 GLU A CG  1 
ATOM   1853 C CD  . GLU A 1 244 ? -56.210 14.047 -13.047 1.00 42.10 ? 568 GLU A CD  1 
ATOM   1854 O OE1 . GLU A 1 244 ? -56.951 13.495 -12.184 1.00 39.28 ? 568 GLU A OE1 1 
ATOM   1855 O OE2 . GLU A 1 244 ? -56.565 15.081 -13.685 1.00 40.75 ? 568 GLU A OE2 1 
ATOM   1856 N N   . TYR A 1 245 ? -54.030 13.191 -8.785  1.00 49.23 ? 569 TYR A N   1 
ATOM   1857 C CA  . TYR A 1 245 ? -53.883 12.678 -7.414  1.00 45.40 ? 569 TYR A CA  1 
ATOM   1858 C C   . TYR A 1 245 ? -55.188 12.147 -6.834  1.00 45.83 ? 569 TYR A C   1 
ATOM   1859 O O   . TYR A 1 245 ? -55.231 11.001 -6.351  1.00 46.66 ? 569 TYR A O   1 
ATOM   1860 C CB  . TYR A 1 245 ? -53.298 13.744 -6.466  1.00 41.64 ? 569 TYR A CB  1 
ATOM   1861 C CG  . TYR A 1 245 ? -53.486 15.196 -6.905  1.00 37.77 ? 569 TYR A CG  1 
ATOM   1862 C CD1 . TYR A 1 245 ? -54.410 16.049 -6.265  1.00 32.76 ? 569 TYR A CD1 1 
ATOM   1863 C CD2 . TYR A 1 245 ? -52.692 15.730 -7.929  1.00 34.07 ? 569 TYR A CD2 1 
ATOM   1864 C CE1 . TYR A 1 245 ? -54.547 17.411 -6.688  1.00 32.96 ? 569 TYR A CE1 1 
ATOM   1865 C CE2 . TYR A 1 245 ? -52.821 17.065 -8.341  1.00 32.29 ? 569 TYR A CE2 1 
ATOM   1866 C CZ  . TYR A 1 245 ? -53.743 17.883 -7.732  1.00 35.23 ? 569 TYR A CZ  1 
ATOM   1867 O OH  . TYR A 1 245 ? -53.833 19.195 -8.207  1.00 38.61 ? 569 TYR A OH  1 
HETATM 1868 C C1  . PHQ B 2 1   ? -20.594 1.710  17.903  1.00 31.16 ? 1   PHQ B C1  1 
HETATM 1869 O O1  . PHQ B 2 1   ? -21.261 1.320  16.947  1.00 32.64 ? 1   PHQ B O1  1 
HETATM 1870 O O2  . PHQ B 2 1   ? -20.218 0.925  18.920  1.00 33.90 ? 1   PHQ B O2  1 
HETATM 1871 C C2  . PHQ B 2 1   ? -20.925 -0.343 18.941  1.00 37.23 ? 1   PHQ B C2  1 
HETATM 1872 C C3  . PHQ B 2 1   ? -20.005 -1.313 18.171  1.00 33.60 ? 1   PHQ B C3  1 
HETATM 1873 C C4  . PHQ B 2 1   ? -20.484 -1.954 17.017  1.00 36.23 ? 1   PHQ B C4  1 
HETATM 1874 C C5  . PHQ B 2 1   ? -19.652 -2.839 16.311  1.00 36.06 ? 1   PHQ B C5  1 
HETATM 1875 C C6  . PHQ B 2 1   ? -18.336 -3.083 16.743  1.00 35.78 ? 1   PHQ B C6  1 
HETATM 1876 C C7  . PHQ B 2 1   ? -17.852 -2.426 17.894  1.00 39.07 ? 1   PHQ B C7  1 
HETATM 1877 C C8  . PHQ B 2 1   ? -18.689 -1.544 18.609  1.00 32.56 ? 1   PHQ B C8  1 
ATOM   1878 N N   . VAL B 2 2   ? -20.153 2.969  18.057  1.00 26.77 ? 2   VAL B N   1 
ATOM   1879 C CA  . VAL B 2 2   ? -20.560 3.904  17.037  1.00 24.75 ? 2   VAL B CA  1 
ATOM   1880 C C   . VAL B 2 2   ? -19.304 4.462  16.455  1.00 24.40 ? 2   VAL B C   1 
ATOM   1881 O O   . VAL B 2 2   ? -18.276 4.399  17.096  1.00 28.30 ? 2   VAL B O   1 
ATOM   1882 C CB  . VAL B 2 2   ? -21.363 5.022  17.775  1.00 26.56 ? 2   VAL B CB  1 
ATOM   1883 C CG1 . VAL B 2 2   ? -22.644 4.446  18.409  1.00 29.44 ? 2   VAL B CG1 1 
ATOM   1884 C CG2 . VAL B 2 2   ? -20.507 5.687  18.912  1.00 31.97 ? 2   VAL B CG2 1 
ATOM   1885 N N   . ARG B 2 3   ? -19.417 5.028  15.235  1.00 23.28 ? 3   ARG B N   1 
ATOM   1886 C CA  . ARG B 2 3   ? -18.287 5.692  14.596  1.00 23.11 ? 3   ARG B CA  1 
ATOM   1887 C C   . ARG B 2 3   ? -18.814 7.109  14.293  1.00 21.44 ? 3   ARG B C   1 
ATOM   1888 O O   . ARG B 2 3   ? -19.873 7.230  13.664  1.00 19.61 ? 3   ARG B O   1 
ATOM   1889 C CB  . ARG B 2 3   ? -17.867 4.923  13.306  1.00 23.53 ? 3   ARG B CB  1 
ATOM   1890 C CG  . ARG B 2 3   ? -16.876 5.765  12.443  1.00 22.38 ? 3   ARG B CG  1 
ATOM   1891 C CD  . ARG B 2 3   ? -16.613 5.067  11.066  1.00 30.51 ? 3   ARG B CD  1 
ATOM   1892 N NE  . ARG B 2 3   ? -15.616 3.993  11.163  1.00 36.38 ? 3   ARG B NE  1 
ATOM   1893 C CZ  . ARG B 2 3   ? -14.336 4.273  11.411  1.00 42.52 ? 3   ARG B CZ  1 
ATOM   1894 N NH1 . ARG B 2 3   ? -13.693 5.194  10.749  1.00 38.54 ? 3   ARG B NH1 1 
ATOM   1895 N NH2 . ARG B 2 3   ? -13.746 3.572  12.358  1.00 34.33 ? 3   ARG B NH2 1 
ATOM   1896 N N   . PRO B 2 4   ? -18.158 8.222  14.692  1.00 21.95 ? 4   PRO B N   1 
ATOM   1897 C CA  . PRO B 2 4   ? -18.747 9.515  14.370  1.00 20.91 ? 4   PRO B CA  1 
ATOM   1898 C C   . PRO B 2 4   ? -18.518 10.005 12.948  1.00 24.38 ? 4   PRO B C   1 
ATOM   1899 O O   . PRO B 2 4   ? -17.593 9.578  12.252  1.00 19.80 ? 4   PRO B O   1 
ATOM   1900 C CB  . PRO B 2 4   ? -17.972 10.432 15.358  1.00 21.44 ? 4   PRO B CB  1 
ATOM   1901 C CG  . PRO B 2 4   ? -16.601 9.723  15.552  1.00 23.00 ? 4   PRO B CG  1 
ATOM   1902 C CD  . PRO B 2 4   ? -16.898 8.192  15.473  1.00 18.52 ? 4   PRO B CD  1 
ATOM   1903 N N   . ARG B 2 5   ? -19.379 10.947 12.527  1.00 21.09 ? 5   ARG B N   1 
ATOM   1904 C CA  . ARG B 2 5   ? -19.298 11.574 11.213  1.00 23.09 ? 5   ARG B CA  1 
ATOM   1905 C C   . ARG B 2 5   ? -18.841 13.019 11.425  1.00 21.50 ? 5   ARG B C   1 
ATOM   1906 O O   . ARG B 2 5   ? -19.223 13.898 10.659  1.00 26.07 ? 5   ARG B O   1 
ATOM   1907 C CB  . ARG B 2 5   ? -20.703 11.526 10.535  1.00 19.39 ? 5   ARG B CB  1 
ATOM   1908 C CG  . ARG B 2 5   ? -21.011 10.125 9.970   1.00 19.01 ? 5   ARG B CG  1 
ATOM   1909 C CD  . ARG B 2 5   ? -22.498 9.970  9.540   1.00 23.18 ? 5   ARG B CD  1 
ATOM   1910 N NE  . ARG B 2 5   ? -22.723 8.640  8.945   1.00 19.56 ? 5   ARG B NE  1 
ATOM   1911 C CZ  . ARG B 2 5   ? -23.778 8.401  8.211   1.00 23.49 ? 5   ARG B CZ  1 
ATOM   1912 N NH1 . ARG B 2 5   ? -23.884 7.210  7.663   1.00 22.60 ? 5   ARG B NH1 1 
ATOM   1913 N NH2 . ARG B 2 5   ? -24.679 9.302  8.033   1.00 21.48 ? 5   ARG B NH2 1 
HETATM 1914 C C1  . CF0 B 2 6   ? -18.018 13.444 12.617  1.00 22.70 ? 6   CF0 B C1  1 
HETATM 1915 O O   . HOH C 3 .   ? -21.440 8.961  -7.516  1.00 29.83 ? 601 HOH A O   1 
HETATM 1916 O O   . HOH C 3 .   ? -21.927 13.886 20.706  1.00 19.28 ? 602 HOH A O   1 
HETATM 1917 O O   . HOH C 3 .   ? -33.662 12.208 19.111  1.00 18.46 ? 603 HOH A O   1 
HETATM 1918 O O   . HOH C 3 .   ? -26.513 9.679  12.082  1.00 13.44 ? 604 HOH A O   1 
HETATM 1919 O O   . HOH C 3 .   ? -27.384 -0.038 23.298  1.00 39.03 ? 605 HOH A O   1 
HETATM 1920 O O   . HOH C 3 .   ? -49.454 25.017 -2.715  1.00 27.95 ? 606 HOH A O   1 
HETATM 1921 O O   . HOH C 3 .   ? -41.802 5.574  5.782   1.00 35.89 ? 607 HOH A O   1 
HETATM 1922 O O   . HOH C 3 .   ? -28.315 10.183 -9.669  1.00 26.52 ? 608 HOH A O   1 
HETATM 1923 O O   . HOH C 3 .   ? -17.575 18.231 13.484  1.00 18.27 ? 609 HOH A O   1 
HETATM 1924 O O   . HOH C 3 .   ? -43.388 15.116 4.801   1.00 18.85 ? 610 HOH A O   1 
HETATM 1925 O O   . HOH C 3 .   ? -26.289 17.033 12.059  1.00 17.46 ? 611 HOH A O   1 
HETATM 1926 O O   . HOH C 3 .   ? -28.634 0.956  11.909  1.00 37.84 ? 612 HOH A O   1 
HETATM 1927 O O   . HOH C 3 .   ? -49.470 18.473 2.949   1.00 22.89 ? 613 HOH A O   1 
HETATM 1928 O O   . HOH C 3 .   ? -38.408 5.390  12.933  1.00 20.78 ? 614 HOH A O   1 
HETATM 1929 O O   . HOH C 3 .   ? -46.082 13.122 -5.519  1.00 34.62 ? 615 HOH A O   1 
HETATM 1930 O O   . HOH C 3 .   ? -38.315 17.663 18.506  1.00 21.63 ? 616 HOH A O   1 
HETATM 1931 O O   . HOH C 3 .   ? -31.583 21.736 20.914  1.00 21.02 ? 617 HOH A O   1 
HETATM 1932 O O   . HOH C 3 .   ? -27.858 7.952  8.986   1.00 15.57 ? 618 HOH A O   1 
HETATM 1933 O O   . HOH C 3 .   ? -44.674 27.535 1.797   1.00 43.68 ? 619 HOH A O   1 
HETATM 1934 O O   . HOH C 3 .   ? -49.843 15.552 1.121   1.00 35.27 ? 620 HOH A O   1 
HETATM 1935 O O   . HOH C 3 .   ? -20.337 24.051 16.765  1.00 36.02 ? 621 HOH A O   1 
HETATM 1936 O O   . HOH C 3 .   ? -30.536 34.989 8.200   1.00 27.41 ? 622 HOH A O   1 
HETATM 1937 O O   . HOH C 3 .   ? -37.560 29.833 -0.880  1.00 19.31 ? 623 HOH A O   1 
HETATM 1938 O O   . HOH C 3 .   ? -35.103 10.213 -9.700  1.00 29.47 ? 624 HOH A O   1 
HETATM 1939 O O   . HOH C 3 .   ? -9.729  14.015 2.970   1.00 22.80 ? 625 HOH A O   1 
HETATM 1940 O O   . HOH C 3 .   ? -14.204 4.689  0.898   1.00 34.96 ? 626 HOH A O   1 
HETATM 1941 O O   . HOH C 3 .   ? -26.705 25.332 10.347  1.00 37.57 ? 627 HOH A O   1 
HETATM 1942 O O   . HOH C 3 .   ? -29.883 -0.377 9.612   1.00 47.40 ? 628 HOH A O   1 
HETATM 1943 O O   . HOH C 3 .   ? -10.024 21.346 -1.158  1.00 38.92 ? 629 HOH A O   1 
HETATM 1944 O O   . HOH C 3 .   ? -50.842 13.214 -0.640  1.00 47.69 ? 630 HOH A O   1 
HETATM 1945 O O   . HOH C 3 .   ? -37.600 38.817 4.235   1.00 36.63 ? 631 HOH A O   1 
HETATM 1946 O O   . HOH C 3 .   ? -15.149 19.556 13.848  1.00 21.77 ? 632 HOH A O   1 
HETATM 1947 O O   . HOH C 3 .   ? -22.856 17.521 -11.212 1.00 51.45 ? 633 HOH A O   1 
HETATM 1948 O O   . HOH C 3 .   ? -22.089 26.652 16.004  1.00 46.26 ? 634 HOH A O   1 
HETATM 1949 O O   . HOH C 3 .   ? -8.245  8.288  5.503   1.00 38.04 ? 635 HOH A O   1 
HETATM 1950 O O   . HOH C 3 .   ? -17.197 10.778 -7.122  1.00 42.78 ? 636 HOH A O   1 
HETATM 1951 O O   . HOH C 3 .   ? -20.471 16.680 -9.600  1.00 30.38 ? 637 HOH A O   1 
HETATM 1952 O O   . HOH C 3 .   ? -38.278 9.118  22.977  1.00 30.24 ? 638 HOH A O   1 
HETATM 1953 O O   . HOH C 3 .   ? -18.864 2.421  10.188  1.00 24.21 ? 639 HOH A O   1 
HETATM 1954 O O   . HOH C 3 .   ? -42.923 30.096 10.618  1.00 13.57 ? 640 HOH A O   1 
HETATM 1955 O O   . HOH C 3 .   ? -29.522 25.611 14.404  1.00 44.73 ? 641 HOH A O   1 
HETATM 1956 O O   . HOH C 3 .   ? -43.493 12.478 3.658   1.00 17.63 ? 642 HOH A O   1 
HETATM 1957 O O   . HOH C 3 .   ? -49.311 17.012 9.225   1.00 27.68 ? 643 HOH A O   1 
HETATM 1958 O O   . HOH C 3 .   ? -19.813 12.478 21.017  1.00 29.10 ? 644 HOH A O   1 
HETATM 1959 O O   . HOH C 3 .   ? -26.996 17.739 -8.963  1.00 33.28 ? 645 HOH A O   1 
HETATM 1960 O O   . HOH C 3 .   ? -20.068 13.714 -9.949  1.00 36.21 ? 646 HOH A O   1 
HETATM 1961 O O   . HOH C 3 .   ? -13.427 20.152 11.636  1.00 34.39 ? 647 HOH A O   1 
HETATM 1962 O O   . HOH C 3 .   ? -10.053 5.583  8.209   1.00 33.23 ? 648 HOH A O   1 
HETATM 1963 O O   . HOH C 3 .   ? -23.991 2.169  10.355  1.00 27.83 ? 649 HOH A O   1 
HETATM 1964 O O   . HOH C 3 .   ? -17.635 21.939 19.264  1.00 35.59 ? 650 HOH A O   1 
HETATM 1965 O O   . HOH C 3 .   ? -38.154 31.821 6.970   1.00 16.27 ? 651 HOH A O   1 
HETATM 1966 O O   . HOH C 3 .   ? -13.414 15.599 10.017  1.00 43.36 ? 652 HOH A O   1 
HETATM 1967 O O   . HOH C 3 .   ? -9.426  20.754 10.537  1.00 42.38 ? 653 HOH A O   1 
HETATM 1968 O O   . HOH C 3 .   ? -49.242 8.845  7.985   1.00 48.92 ? 654 HOH A O   1 
HETATM 1969 O O   . HOH C 3 .   ? -47.254 13.871 -7.774  1.00 42.40 ? 655 HOH A O   1 
HETATM 1970 O O   . HOH C 3 .   ? -42.256 31.646 0.876   1.00 33.11 ? 656 HOH A O   1 
HETATM 1971 O O   . HOH C 3 .   ? -35.623 33.311 7.139   1.00 25.04 ? 657 HOH A O   1 
HETATM 1972 O O   . HOH C 3 .   ? -27.041 26.605 -11.080 1.00 32.66 ? 658 HOH A O   1 
HETATM 1973 O O   . HOH C 3 .   ? -9.208  14.787 -6.904  1.00 51.02 ? 659 HOH A O   1 
HETATM 1974 O O   . HOH C 3 .   ? -49.469 8.009  12.474  1.00 49.96 ? 660 HOH A O   1 
HETATM 1975 O O   . HOH C 3 .   ? -37.865 32.274 -1.781  1.00 34.48 ? 661 HOH A O   1 
HETATM 1976 O O   . HOH C 3 .   ? -32.081 11.000 20.847  1.00 34.42 ? 662 HOH A O   1 
HETATM 1977 O O   . HOH C 3 .   ? -4.075  22.181 5.224   1.00 34.90 ? 663 HOH A O   1 
HETATM 1978 O O   . HOH C 3 .   ? -29.483 20.533 -13.660 1.00 28.14 ? 664 HOH A O   1 
HETATM 1979 O O   . HOH C 3 .   ? -29.811 -2.974 6.626   1.00 45.83 ? 665 HOH A O   1 
HETATM 1980 O O   . HOH C 3 .   ? -11.737 19.342 -5.388  1.00 29.38 ? 666 HOH A O   1 
HETATM 1981 O O   . HOH C 3 .   ? -34.141 31.216 8.396   1.00 30.51 ? 667 HOH A O   1 
HETATM 1982 O O   . HOH C 3 .   ? -18.451 17.368 -11.508 1.00 32.48 ? 668 HOH A O   1 
HETATM 1983 O O   . HOH C 3 .   ? -38.131 2.863  13.778  1.00 39.78 ? 669 HOH A O   1 
HETATM 1984 O O   . HOH C 3 .   ? -41.475 8.902  23.266  1.00 43.02 ? 670 HOH A O   1 
HETATM 1985 O O   . HOH C 3 .   ? -32.222 3.458  -4.242  1.00 29.00 ? 671 HOH A O   1 
HETATM 1986 O O   . HOH C 3 .   ? -3.525  17.657 4.214   1.00 40.33 ? 672 HOH A O   1 
HETATM 1987 O O   . HOH C 3 .   ? -18.950 24.912 -9.555  1.00 46.57 ? 673 HOH A O   1 
HETATM 1988 O O   . HOH C 3 .   ? -51.261 16.208 7.083   1.00 44.08 ? 674 HOH A O   1 
HETATM 1989 O O   . HOH C 3 .   ? -38.092 3.660  -5.303  1.00 29.18 ? 675 HOH A O   1 
HETATM 1990 O O   . HOH C 3 .   ? -44.632 5.235  9.464   1.00 34.48 ? 676 HOH A O   1 
HETATM 1991 O O   . HOH C 3 .   ? -49.750 16.109 4.881   1.00 30.97 ? 677 HOH A O   1 
HETATM 1992 O O   . HOH C 3 .   ? -19.612 1.283  2.296   1.00 37.72 ? 678 HOH A O   1 
HETATM 1993 O O   . HOH C 3 .   ? -19.049 30.289 10.073  1.00 36.34 ? 679 HOH A O   1 
HETATM 1994 O O   . HOH C 3 .   ? -30.831 8.003  21.575  1.00 31.26 ? 680 HOH A O   1 
HETATM 1995 O O   . HOH C 3 .   ? -41.863 7.393  18.959  1.00 44.76 ? 681 HOH A O   1 
HETATM 1996 O O   . HOH C 3 .   ? -29.768 28.939 8.346   1.00 41.82 ? 682 HOH A O   1 
HETATM 1997 O O   . HOH C 3 .   ? -28.378 22.372 19.014  1.00 28.13 ? 683 HOH A O   1 
HETATM 1998 O O   . HOH C 3 .   ? -20.516 -3.826 13.124  1.00 46.68 ? 684 HOH A O   1 
HETATM 1999 O O   . HOH C 3 .   ? -18.355 28.050 16.792  1.00 40.56 ? 685 HOH A O   1 
HETATM 2000 O O   . HOH C 3 .   ? -10.597 21.075 15.166  1.00 43.15 ? 686 HOH A O   1 
HETATM 2001 O O   . HOH C 3 .   ? -32.175 34.648 1.327   1.00 38.65 ? 687 HOH A O   1 
HETATM 2002 O O   . HOH C 3 .   ? -24.414 -4.105 11.664  1.00 51.56 ? 688 HOH A O   1 
HETATM 2003 O O   . HOH C 3 .   ? -46.941 10.919 -2.344  1.00 52.72 ? 689 HOH A O   1 
HETATM 2004 O O   . HOH C 3 .   ? -29.164 0.388  21.297  1.00 49.36 ? 690 HOH A O   1 
HETATM 2005 O O   . HOH C 3 .   ? -44.465 13.352 18.092  1.00 60.35 ? 691 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? -23.512 0.481  6.297   1.00 35.59 ? 692 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? -40.292 23.890 -12.514 1.00 44.79 ? 693 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? -44.717 15.255 15.890  1.00 47.63 ? 694 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? -46.684 7.801  1.172   1.00 41.37 ? 695 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? -21.241 23.667 -12.344 1.00 44.31 ? 696 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? -45.186 24.925 -4.126  1.00 34.23 ? 697 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? -13.800 10.969 -5.680  1.00 48.30 ? 698 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? -30.117 31.111 -7.183  1.00 33.03 ? 699 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? -44.921 28.560 4.098   1.00 36.36 ? 700 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? -27.595 3.475  27.213  1.00 42.02 ? 701 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? -15.792 4.689  -0.930  1.00 40.41 ? 702 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? -10.909 18.207 -7.926  1.00 47.52 ? 703 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? -37.544 21.436 -11.918 1.00 40.21 ? 704 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? -17.312 27.683 2.541   1.00 39.63 ? 705 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? -4.369  12.620 7.408   1.00 39.30 ? 706 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? -37.339 24.055 -13.544 1.00 52.34 ? 707 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? -31.795 29.776 13.688  1.00 42.01 ? 708 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? -23.258 1.665  3.361   1.00 33.77 ? 709 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? -50.966 25.400 4.905   1.00 40.22 ? 710 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? -46.962 14.686 16.130  1.00 36.70 ? 711 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? -53.080 22.662 4.223   1.00 54.39 ? 712 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? -12.641 16.063 -8.886  1.00 40.70 ? 713 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? -26.547 28.707 15.942  1.00 42.79 ? 714 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? -34.495 35.530 8.298   1.00 29.68 ? 715 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? -7.219  25.538 3.370   1.00 45.00 ? 716 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? -31.217 17.146 -8.096  1.00 30.02 ? 717 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? -35.329 1.088  11.209  1.00 38.31 ? 718 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? -24.108 31.923 -0.694  1.00 54.89 ? 719 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? -40.951 14.641 -9.944  1.00 43.79 ? 720 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? -46.150 21.546 -12.056 1.00 43.56 ? 721 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? -54.476 24.072 -4.251  1.00 48.15 ? 722 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? -28.777 29.690 -8.504  1.00 50.80 ? 723 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? -38.210 9.650  -9.814  1.00 42.55 ? 724 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? -39.775 34.318 -2.157  1.00 42.13 ? 725 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? -24.788 32.462 12.614  1.00 48.53 ? 726 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? -49.109 16.013 15.222  0.50 38.71 ? 727 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? -37.711 10.990 -12.349 1.00 38.84 ? 728 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? -19.557 27.499 0.206   1.00 26.36 ? 729 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? -9.402  14.209 10.820  1.00 37.89 ? 730 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? -16.072 15.993 10.961  1.00 40.09 ? 731 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? -49.483 8.564  5.760   1.00 35.68 ? 732 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? -11.199 29.533 4.756   1.00 43.02 ? 733 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? -33.560 27.223 -13.015 1.00 56.42 ? 734 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? -52.847 15.260 3.173   1.00 44.55 ? 735 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? -16.260 16.027 13.597  1.00 31.36 ? 736 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? -40.320 1.133  0.771   1.00 44.26 ? 737 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? -15.037 17.754 -15.126 1.00 46.00 ? 738 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? -31.725 28.736 -14.940 1.00 46.51 ? 739 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? -26.841 34.603 -6.737  1.00 46.79 ? 740 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? -32.934 34.219 -9.618  1.00 44.96 ? 741 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? -29.128 28.500 -10.798 1.00 46.03 ? 742 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? -6.428  23.983 0.777   1.00 42.15 ? 743 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? -14.154 6.785  -3.680  1.00 39.35 ? 744 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? -16.210 9.080  -6.426  1.00 47.21 ? 745 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? -25.129 39.151 9.125   1.00 46.24 ? 746 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? -35.868 36.037 -6.062  1.00 56.55 ? 747 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? -36.574 1.682  -0.278  1.00 60.75 ? 748 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? -21.779 15.573 22.686  1.00 30.40 ? 749 HOH A O   1 
HETATM 2064 O O   . HOH D 3 .   ? -14.820 9.258  11.967  1.00 22.59 ? 101 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   325 ?   ?   ?   A . n 
A 1 2   PRO 2   326 ?   ?   ?   A . n 
A 1 3   GLY 3   327 ?   ?   ?   A . n 
A 1 4   SER 4   328 ?   ?   ?   A . n 
A 1 5   ASP 5   329 ?   ?   ?   A . n 
A 1 6   ASN 6   330 ?   ?   ?   A . n 
A 1 7   LYS 7   331 ?   ?   ?   A . n 
A 1 8   GLU 8   332 ?   ?   ?   A . n 
A 1 9   GLN 9   333 ?   ?   ?   A . n 
A 1 10  THR 10  334 ?   ?   ?   A . n 
A 1 11  THR 11  335 ?   ?   ?   A . n 
A 1 12  ASP 12  336 336 ASP ASP A . n 
A 1 13  GLN 13  337 337 GLN GLN A . n 
A 1 14  PRO 14  338 338 PRO PRO A . n 
A 1 15  LEU 15  339 339 LEU LEU A . n 
A 1 16  ALA 16  340 340 ALA ALA A . n 
A 1 17  LYS 17  341 341 LYS LYS A . n 
A 1 18  ASP 18  342 342 ASP ASP A . n 
A 1 19  LYS 19  343 343 LYS LYS A . n 
A 1 20  VAL 20  344 344 VAL VAL A . n 
A 1 21  ALA 21  345 345 ALA ALA A . n 
A 1 22  LEU 22  346 346 LEU LEU A . n 
A 1 23  LEU 23  347 347 LEU LEU A . n 
A 1 24  ILE 24  348 348 ILE ILE A . n 
A 1 25  GLY 25  349 349 GLY GLY A . n 
A 1 26  ASN 26  350 350 ASN ASN A . n 
A 1 27  MET 27  351 351 MET MET A . n 
A 1 28  ASN 28  352 352 ASN ASN A . n 
A 1 29  TYR 29  353 353 TYR TYR A . n 
A 1 30  ARG 30  354 354 ARG ARG A . n 
A 1 31  GLU 31  355 355 GLU GLU A . n 
A 1 32  HIS 32  356 356 HIS HIS A . n 
A 1 33  PRO 33  357 357 PRO PRO A . n 
A 1 34  LYS 34  358 358 LYS LYS A . n 
A 1 35  LEU 35  359 359 LEU LEU A . n 
A 1 36  LYS 36  360 360 LYS LYS A . n 
A 1 37  ALA 37  361 361 ALA ALA A . n 
A 1 38  PRO 38  362 362 PRO PRO A . n 
A 1 39  LEU 39  363 363 LEU LEU A . n 
A 1 40  VAL 40  364 364 VAL VAL A . n 
A 1 41  ASP 41  365 365 ASP ASP A . n 
A 1 42  VAL 42  366 366 VAL VAL A . n 
A 1 43  TYR 43  367 367 TYR TYR A . n 
A 1 44  GLU 44  368 368 GLU GLU A . n 
A 1 45  LEU 45  369 369 LEU LEU A . n 
A 1 46  THR 46  370 370 THR THR A . n 
A 1 47  ASN 47  371 371 ASN ASN A . n 
A 1 48  LEU 48  372 372 LEU LEU A . n 
A 1 49  LEU 49  373 373 LEU LEU A . n 
A 1 50  ARG 50  374 374 ARG ARG A . n 
A 1 51  GLN 51  375 375 GLN GLN A . n 
A 1 52  LEU 52  376 376 LEU LEU A . n 
A 1 53  ASP 53  377 377 ASP ASP A . n 
A 1 54  PHE 54  378 378 PHE PHE A . n 
A 1 55  LYS 55  379 379 LYS LYS A . n 
A 1 56  VAL 56  380 380 VAL VAL A . n 
A 1 57  VAL 57  381 381 VAL VAL A . n 
A 1 58  SER 58  382 382 SER SER A . n 
A 1 59  LEU 59  383 383 LEU LEU A . n 
A 1 60  LEU 60  384 384 LEU LEU A . n 
A 1 61  ASP 61  385 385 ASP ASP A . n 
A 1 62  LEU 62  386 386 LEU LEU A . n 
A 1 63  THR 63  387 387 THR THR A . n 
A 1 64  GLU 64  388 388 GLU GLU A . n 
A 1 65  TYR 65  389 389 TYR TYR A . n 
A 1 66  GLU 66  390 390 GLU GLU A . n 
A 1 67  MET 67  391 391 MET MET A . n 
A 1 68  ARG 68  392 392 ARG ARG A . n 
A 1 69  ASN 69  393 393 ASN ASN A . n 
A 1 70  ALA 70  394 394 ALA ALA A . n 
A 1 71  VAL 71  395 395 VAL VAL A . n 
A 1 72  ASP 72  396 396 ASP ASP A . n 
A 1 73  GLU 73  397 397 GLU GLU A . n 
A 1 74  PHE 74  398 398 PHE PHE A . n 
A 1 75  LEU 75  399 399 LEU LEU A . n 
A 1 76  LEU 76  400 400 LEU LEU A . n 
A 1 77  LEU 77  401 401 LEU LEU A . n 
A 1 78  LEU 78  402 402 LEU LEU A . n 
A 1 79  ASP 79  403 403 ASP ASP A . n 
A 1 80  LYS 80  404 404 LYS LYS A . n 
A 1 81  GLY 81  405 405 GLY GLY A . n 
A 1 82  VAL 82  406 406 VAL VAL A . n 
A 1 83  TYR 83  407 407 TYR TYR A . n 
A 1 84  GLY 84  408 408 GLY GLY A . n 
A 1 85  LEU 85  409 409 LEU LEU A . n 
A 1 86  LEU 86  410 410 LEU LEU A . n 
A 1 87  TYR 87  411 411 TYR TYR A . n 
A 1 88  TYR 88  412 412 TYR TYR A . n 
A 1 89  ALA 89  413 413 ALA ALA A . n 
A 1 90  GLY 90  414 414 GLY GLY A . n 
A 1 91  HIS 91  415 415 HIS HIS A . n 
A 1 92  GLY 92  416 416 GLY GLY A . n 
A 1 93  TYR 93  417 417 TYR TYR A . n 
A 1 94  GLU 94  418 418 GLU GLU A . n 
A 1 95  ASN 95  419 419 ASN ASN A . n 
A 1 96  PHE 96  420 420 PHE PHE A . n 
A 1 97  GLY 97  421 421 GLY GLY A . n 
A 1 98  ASN 98  422 422 ASN ASN A . n 
A 1 99  SER 99  423 423 SER SER A . n 
A 1 100 PHE 100 424 424 PHE PHE A . n 
A 1 101 MET 101 425 425 MET MET A . n 
A 1 102 VAL 102 426 426 VAL VAL A . n 
A 1 103 PRO 103 427 427 PRO PRO A . n 
A 1 104 VAL 104 428 428 VAL VAL A . n 
A 1 105 ASP 105 429 429 ASP ASP A . n 
A 1 106 ALA 106 430 430 ALA ALA A . n 
A 1 107 PRO 107 431 431 PRO PRO A . n 
A 1 108 ASN 108 432 432 ASN ASN A . n 
A 1 109 PRO 109 433 433 PRO PRO A . n 
A 1 110 TYR 110 434 434 TYR TYR A . n 
A 1 111 ARG 111 435 435 ARG ARG A . n 
A 1 112 SER 112 436 436 SER SER A . n 
A 1 113 GLU 113 437 437 GLU GLU A . n 
A 1 114 ASN 114 438 438 ASN ASN A . n 
A 1 115 CYS 115 439 439 CYS CYS A . n 
A 1 116 LEU 116 440 440 LEU LEU A . n 
A 1 117 CYS 117 441 441 CYS CYS A . n 
A 1 118 VAL 118 442 442 VAL VAL A . n 
A 1 119 GLN 119 443 443 GLN GLN A . n 
A 1 120 ASN 120 444 444 ASN ASN A . n 
A 1 121 ILE 121 445 445 ILE ILE A . n 
A 1 122 LEU 122 446 446 LEU LEU A . n 
A 1 123 LYS 123 447 447 LYS LYS A . n 
A 1 124 LEU 124 448 448 LEU LEU A . n 
A 1 125 MET 125 449 449 MET MET A . n 
A 1 126 GLN 126 450 450 GLN GLN A . n 
A 1 127 GLU 127 451 451 GLU GLU A . n 
A 1 128 LYS 128 452 452 LYS LYS A . n 
A 1 129 GLU 129 453 453 GLU GLU A . n 
A 1 130 THR 130 454 454 THR THR A . n 
A 1 131 GLY 131 455 455 GLY GLY A . n 
A 1 132 LEU 132 456 456 LEU LEU A . n 
A 1 133 ASN 133 457 457 ASN ASN A . n 
A 1 134 VAL 134 458 458 VAL VAL A . n 
A 1 135 PHE 135 459 459 PHE PHE A . n 
A 1 136 LEU 136 460 460 LEU LEU A . n 
A 1 137 LEU 137 461 461 LEU LEU A . n 
A 1 138 ASP 138 462 462 ASP ASP A . n 
A 1 139 MET 139 463 463 MET MET A . n 
A 1 140 CYS 140 464 464 CYS CYS A . n 
A 1 141 ARG 141 465 465 ARG ARG A . n 
A 1 142 LYS 142 466 466 LYS LYS A . n 
A 1 143 ARG 143 467 467 ARG ARG A . n 
A 1 144 ASN 144 468 468 ASN ASN A . n 
A 1 145 ASP 145 469 469 ASP ASP A . n 
A 1 146 TYR 146 470 470 TYR TYR A . n 
A 1 147 ASP 147 471 471 ASP ASP A . n 
A 1 148 ASP 148 472 472 ASP ASP A . n 
A 1 149 THR 149 473 473 THR THR A . n 
A 1 150 ILE 150 474 474 ILE ILE A . n 
A 1 151 PRO 151 475 475 PRO PRO A . n 
A 1 152 ILE 152 476 476 ILE ILE A . n 
A 1 153 LEU 153 477 477 LEU LEU A . n 
A 1 154 ASP 154 478 478 ASP ASP A . n 
A 1 155 ALA 155 479 479 ALA ALA A . n 
A 1 156 LEU 156 480 480 LEU LEU A . n 
A 1 157 LYS 157 481 481 LYS LYS A . n 
A 1 158 VAL 158 482 482 VAL VAL A . n 
A 1 159 THR 159 483 483 THR THR A . n 
A 1 160 ALA 160 484 484 ALA ALA A . n 
A 1 161 ASN 161 485 485 ASN ASN A . n 
A 1 162 ILE 162 486 486 ILE ILE A . n 
A 1 163 VAL 163 487 487 VAL VAL A . n 
A 1 164 PHE 164 488 488 PHE PHE A . n 
A 1 165 GLY 165 489 489 GLY GLY A . n 
A 1 166 TYR 166 490 490 TYR TYR A . n 
A 1 167 ALA 167 491 491 ALA ALA A . n 
A 1 168 THR 168 492 492 THR THR A . n 
A 1 169 CYS 169 493 493 CYS CYS A . n 
A 1 170 GLN 170 494 494 GLN GLN A . n 
A 1 171 GLY 171 495 495 GLY GLY A . n 
A 1 172 ALA 172 496 496 ALA ALA A . n 
A 1 173 GLU 173 497 497 GLU GLU A . n 
A 1 174 ALA 174 498 498 ALA ALA A . n 
A 1 175 PHE 175 499 499 PHE PHE A . n 
A 1 176 GLU 176 500 500 GLU GLU A . n 
A 1 177 ILE 177 501 501 ILE ILE A . n 
A 1 178 GLN 178 502 502 GLN GLN A . n 
A 1 179 HIS 179 503 503 HIS HIS A . n 
A 1 180 SER 180 504 504 SER SER A . n 
A 1 181 GLY 181 505 505 GLY GLY A . n 
A 1 182 LEU 182 506 506 LEU LEU A . n 
A 1 183 ALA 183 507 507 ALA ALA A . n 
A 1 184 ASN 184 508 508 ASN ASN A . n 
A 1 185 GLY 185 509 509 GLY GLY A . n 
A 1 186 ILE 186 510 510 ILE ILE A . n 
A 1 187 PHE 187 511 511 PHE PHE A . n 
A 1 188 MET 188 512 512 MET MET A . n 
A 1 189 LYS 189 513 513 LYS LYS A . n 
A 1 190 PHE 190 514 514 PHE PHE A . n 
A 1 191 LEU 191 515 515 LEU LEU A . n 
A 1 192 LYS 192 516 516 LYS LYS A . n 
A 1 193 ASP 193 517 517 ASP ASP A . n 
A 1 194 ARG 194 518 518 ARG ARG A . n 
A 1 195 LEU 195 519 519 LEU LEU A . n 
A 1 196 LEU 196 520 520 LEU LEU A . n 
A 1 197 GLU 197 521 521 GLU GLU A . n 
A 1 198 ASP 198 522 522 ASP ASP A . n 
A 1 199 LYS 199 523 523 LYS LYS A . n 
A 1 200 LYS 200 524 524 LYS LYS A . n 
A 1 201 ILE 201 525 525 ILE ILE A . n 
A 1 202 THR 202 526 526 THR THR A . n 
A 1 203 VAL 203 527 527 VAL VAL A . n 
A 1 204 LEU 204 528 528 LEU LEU A . n 
A 1 205 LEU 205 529 529 LEU LEU A . n 
A 1 206 ASP 206 530 530 ASP ASP A . n 
A 1 207 GLU 207 531 531 GLU GLU A . n 
A 1 208 VAL 208 532 532 VAL VAL A . n 
A 1 209 ALA 209 533 533 ALA ALA A . n 
A 1 210 GLU 210 534 534 GLU GLU A . n 
A 1 211 ASP 211 535 535 ASP ASP A . n 
A 1 212 MET 212 536 536 MET MET A . n 
A 1 213 GLY 213 537 537 GLY GLY A . n 
A 1 214 LYS 214 538 538 LYS LYS A . n 
A 1 215 CYS 215 539 539 CYS CYS A . n 
A 1 216 HIS 216 540 540 HIS HIS A . n 
A 1 217 LEU 217 541 541 LEU LEU A . n 
A 1 218 THR 218 542 542 THR THR A . n 
A 1 219 LYS 219 543 543 LYS LYS A . n 
A 1 220 GLY 220 544 544 GLY GLY A . n 
A 1 221 LYS 221 545 545 LYS LYS A . n 
A 1 222 GLN 222 546 546 GLN GLN A . n 
A 1 223 ALA 223 547 547 ALA ALA A . n 
A 1 224 LEU 224 548 548 LEU LEU A . n 
A 1 225 GLU 225 549 549 GLU GLU A . n 
A 1 226 ILE 226 550 550 ILE ILE A . n 
A 1 227 ARG 227 551 551 ARG ARG A . n 
A 1 228 SER 228 552 552 SER SER A . n 
A 1 229 SER 229 553 553 SER SER A . n 
A 1 230 LEU 230 554 554 LEU LEU A . n 
A 1 231 SER 231 555 555 SER SER A . n 
A 1 232 GLU 232 556 556 GLU GLU A . n 
A 1 233 LYS 233 557 557 LYS LYS A . n 
A 1 234 ARG 234 558 558 ARG ARG A . n 
A 1 235 ALA 235 559 559 ALA ALA A . n 
A 1 236 LEU 236 560 560 LEU LEU A . n 
A 1 237 THR 237 561 561 THR THR A . n 
A 1 238 ASP 238 562 562 ASP ASP A . n 
A 1 239 PRO 239 563 563 PRO PRO A . n 
A 1 240 ILE 240 564 564 ILE ILE A . n 
A 1 241 GLN 241 565 565 GLN GLN A . n 
A 1 242 GLY 242 566 566 GLY GLY A . n 
A 1 243 THR 243 567 567 THR THR A . n 
A 1 244 GLU 244 568 568 GLU GLU A . n 
A 1 245 TYR 245 569 569 TYR TYR A . n 
B 2 1   PHQ 1   1   1   PHQ LI1 B . n 
B 2 2   VAL 2   2   1   VAL LI1 B . n 
B 2 3   ARG 3   3   1   ARG LI1 B . n 
B 2 4   PRO 4   4   1   PRO LI1 B . n 
B 2 5   ARG 5   5   1   ARG LI1 B . n 
B 2 6   CF0 6   6   1   CF0 LI1 B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   601 11  HOH HOH A . 
C 3 HOH 2   602 12  HOH HOH A . 
C 3 HOH 3   603 13  HOH HOH A . 
C 3 HOH 4   604 14  HOH HOH A . 
C 3 HOH 5   605 15  HOH HOH A . 
C 3 HOH 6   606 16  HOH HOH A . 
C 3 HOH 7   607 17  HOH HOH A . 
C 3 HOH 8   608 18  HOH HOH A . 
C 3 HOH 9   609 19  HOH HOH A . 
C 3 HOH 10  610 20  HOH HOH A . 
C 3 HOH 11  611 21  HOH HOH A . 
C 3 HOH 12  612 22  HOH HOH A . 
C 3 HOH 13  613 23  HOH HOH A . 
C 3 HOH 14  614 24  HOH HOH A . 
C 3 HOH 15  615 25  HOH HOH A . 
C 3 HOH 16  616 26  HOH HOH A . 
C 3 HOH 17  617 27  HOH HOH A . 
C 3 HOH 18  618 28  HOH HOH A . 
C 3 HOH 19  619 29  HOH HOH A . 
C 3 HOH 20  620 30  HOH HOH A . 
C 3 HOH 21  621 31  HOH HOH A . 
C 3 HOH 22  622 32  HOH HOH A . 
C 3 HOH 23  623 33  HOH HOH A . 
C 3 HOH 24  624 34  HOH HOH A . 
C 3 HOH 25  625 35  HOH HOH A . 
C 3 HOH 26  626 37  HOH HOH A . 
C 3 HOH 27  627 38  HOH HOH A . 
C 3 HOH 28  628 39  HOH HOH A . 
C 3 HOH 29  629 40  HOH HOH A . 
C 3 HOH 30  630 41  HOH HOH A . 
C 3 HOH 31  631 42  HOH HOH A . 
C 3 HOH 32  632 43  HOH HOH A . 
C 3 HOH 33  633 44  HOH HOH A . 
C 3 HOH 34  634 45  HOH HOH A . 
C 3 HOH 35  635 46  HOH HOH A . 
C 3 HOH 36  636 47  HOH HOH A . 
C 3 HOH 37  637 48  HOH HOH A . 
C 3 HOH 38  638 49  HOH HOH A . 
C 3 HOH 39  639 50  HOH HOH A . 
C 3 HOH 40  640 51  HOH HOH A . 
C 3 HOH 41  641 52  HOH HOH A . 
C 3 HOH 42  642 53  HOH HOH A . 
C 3 HOH 43  643 54  HOH HOH A . 
C 3 HOH 44  644 55  HOH HOH A . 
C 3 HOH 45  645 56  HOH HOH A . 
C 3 HOH 46  646 57  HOH HOH A . 
C 3 HOH 47  647 58  HOH HOH A . 
C 3 HOH 48  648 59  HOH HOH A . 
C 3 HOH 49  649 60  HOH HOH A . 
C 3 HOH 50  650 61  HOH HOH A . 
C 3 HOH 51  651 62  HOH HOH A . 
C 3 HOH 52  652 63  HOH HOH A . 
C 3 HOH 53  653 64  HOH HOH A . 
C 3 HOH 54  654 65  HOH HOH A . 
C 3 HOH 55  655 66  HOH HOH A . 
C 3 HOH 56  656 68  HOH HOH A . 
C 3 HOH 57  657 69  HOH HOH A . 
C 3 HOH 58  658 70  HOH HOH A . 
C 3 HOH 59  659 71  HOH HOH A . 
C 3 HOH 60  660 72  HOH HOH A . 
C 3 HOH 61  661 73  HOH HOH A . 
C 3 HOH 62  662 74  HOH HOH A . 
C 3 HOH 63  663 75  HOH HOH A . 
C 3 HOH 64  664 76  HOH HOH A . 
C 3 HOH 65  665 77  HOH HOH A . 
C 3 HOH 66  666 78  HOH HOH A . 
C 3 HOH 67  667 79  HOH HOH A . 
C 3 HOH 68  668 80  HOH HOH A . 
C 3 HOH 69  669 81  HOH HOH A . 
C 3 HOH 70  670 82  HOH HOH A . 
C 3 HOH 71  671 83  HOH HOH A . 
C 3 HOH 72  672 84  HOH HOH A . 
C 3 HOH 73  673 85  HOH HOH A . 
C 3 HOH 74  674 86  HOH HOH A . 
C 3 HOH 75  675 87  HOH HOH A . 
C 3 HOH 76  676 88  HOH HOH A . 
C 3 HOH 77  677 89  HOH HOH A . 
C 3 HOH 78  678 90  HOH HOH A . 
C 3 HOH 79  679 91  HOH HOH A . 
C 3 HOH 80  680 92  HOH HOH A . 
C 3 HOH 81  681 93  HOH HOH A . 
C 3 HOH 82  682 94  HOH HOH A . 
C 3 HOH 83  683 95  HOH HOH A . 
C 3 HOH 84  684 96  HOH HOH A . 
C 3 HOH 85  685 97  HOH HOH A . 
C 3 HOH 86  686 98  HOH HOH A . 
C 3 HOH 87  687 99  HOH HOH A . 
C 3 HOH 88  688 100 HOH HOH A . 
C 3 HOH 89  689 101 HOH HOH A . 
C 3 HOH 90  690 102 HOH HOH A . 
C 3 HOH 91  691 103 HOH HOH A . 
C 3 HOH 92  692 104 HOH HOH A . 
C 3 HOH 93  693 105 HOH HOH A . 
C 3 HOH 94  694 106 HOH HOH A . 
C 3 HOH 95  695 107 HOH HOH A . 
C 3 HOH 96  696 108 HOH HOH A . 
C 3 HOH 97  697 109 HOH HOH A . 
C 3 HOH 98  698 110 HOH HOH A . 
C 3 HOH 99  699 111 HOH HOH A . 
C 3 HOH 100 700 112 HOH HOH A . 
C 3 HOH 101 701 113 HOH HOH A . 
C 3 HOH 102 702 114 HOH HOH A . 
C 3 HOH 103 703 115 HOH HOH A . 
C 3 HOH 104 704 116 HOH HOH A . 
C 3 HOH 105 705 117 HOH HOH A . 
C 3 HOH 106 706 118 HOH HOH A . 
C 3 HOH 107 707 119 HOH HOH A . 
C 3 HOH 108 708 120 HOH HOH A . 
C 3 HOH 109 709 121 HOH HOH A . 
C 3 HOH 110 710 122 HOH HOH A . 
C 3 HOH 111 711 123 HOH HOH A . 
C 3 HOH 112 712 124 HOH HOH A . 
C 3 HOH 113 713 125 HOH HOH A . 
C 3 HOH 114 714 126 HOH HOH A . 
C 3 HOH 115 715 127 HOH HOH A . 
C 3 HOH 116 716 128 HOH HOH A . 
C 3 HOH 117 717 129 HOH HOH A . 
C 3 HOH 118 718 130 HOH HOH A . 
C 3 HOH 119 719 131 HOH HOH A . 
C 3 HOH 120 720 132 HOH HOH A . 
C 3 HOH 121 721 133 HOH HOH A . 
C 3 HOH 122 722 134 HOH HOH A . 
C 3 HOH 123 723 135 HOH HOH A . 
C 3 HOH 124 724 136 HOH HOH A . 
C 3 HOH 125 725 137 HOH HOH A . 
C 3 HOH 126 726 138 HOH HOH A . 
C 3 HOH 127 727 139 HOH HOH A . 
C 3 HOH 128 728 140 HOH HOH A . 
C 3 HOH 129 729 141 HOH HOH A . 
C 3 HOH 130 730 142 HOH HOH A . 
C 3 HOH 131 731 143 HOH HOH A . 
C 3 HOH 132 732 144 HOH HOH A . 
C 3 HOH 133 733 145 HOH HOH A . 
C 3 HOH 134 734 146 HOH HOH A . 
C 3 HOH 135 735 147 HOH HOH A . 
C 3 HOH 136 736 148 HOH HOH A . 
C 3 HOH 137 737 149 HOH HOH A . 
C 3 HOH 138 738 150 HOH HOH A . 
C 3 HOH 139 739 151 HOH HOH A . 
C 3 HOH 140 740 152 HOH HOH A . 
C 3 HOH 141 741 153 HOH HOH A . 
C 3 HOH 142 742 154 HOH HOH A . 
C 3 HOH 143 743 155 HOH HOH A . 
C 3 HOH 144 744 156 HOH HOH A . 
C 3 HOH 145 745 157 HOH HOH A . 
C 3 HOH 146 746 158 HOH HOH A . 
C 3 HOH 147 747 159 HOH HOH A . 
C 3 HOH 148 748 160 HOH HOH A . 
C 3 HOH 149 749 161 HOH HOH A . 
D 3 HOH 1   101 36  HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_001076 
_pdbx_molecule_features.name      
;"N-[(benzyloxy)carbonyl]-L-valyl-N~5~-[amino(iminio)methyl]-L-ornithyl-N-[(3R)-6-{[amino(iminio)methyl]amino}-1-fluoro-2-oxohexan-3-yl]-L-prolinamide
;
_pdbx_molecule_features.type      Oligopeptide 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_001076 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  19290 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 -38.7500000000 0.8660254038 
-0.5000000000 0.0000000000 67.1169687933 0.0000000000 0.0000000000 -1.0000000000 30.0821666667 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-03-14 
2 'Structure model' 1 1 2012-05-09 
3 'Structure model' 1 2 2012-12-12 
4 'Structure model' 1 3 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' Other                    
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Adxv   'data processing' .        ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  A SER 504 ? ? O A HOH 692 ? ? 2.03 
2 1 O   A HOH 636 ? ? O A HOH 745 ? ? 2.08 
3 1 NE2 A GLN 450 ? ? O A HOH 687 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     714 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     714 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   12_565 
_pdbx_validate_symm_contact.dist              2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.85 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.45 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 351 ? ? -131.19 -46.21 
2 1 ASP A 462 ? ? -106.40 77.66  
3 1 PRO A 475 ? ? -64.90  -70.99 
4 1 ILE A 476 ? ? 33.28   56.19  
5 1 ASN A 485 ? ? -151.20 34.04  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     3 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.228 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 325 ? A GLY 1  
2  1 Y 1 A PRO 326 ? A PRO 2  
3  1 Y 1 A GLY 327 ? A GLY 3  
4  1 Y 1 A SER 328 ? A SER 4  
5  1 Y 1 A ASP 329 ? A ASP 5  
6  1 Y 1 A ASN 330 ? A ASN 6  
7  1 Y 1 A LYS 331 ? A LYS 7  
8  1 Y 1 A GLU 332 ? A GLU 8  
9  1 Y 1 A GLN 333 ? A GLN 9  
10 1 Y 1 A THR 334 ? A THR 10 
11 1 Y 1 A THR 335 ? A THR 11 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#