data_3V4R
# 
_entry.id   3V4R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V4R         
NDB   NA1504       
RCSB  RCSB069593   
WWPDB D_1000069593 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3V4R 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Webster, M.P.J.' 1 
'Jukes, R.'       2 
'Barrett, T.'     3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            40 
_citation.page_first                8743 
_citation.page_last                 8758 
_citation.year                      2012 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22753105 
_citation.pdbx_database_id_DOI      10.1093/nar/gks633 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Webster, M.P.' 1 
primary 'Jukes, R.'     2 
primary 'Zamfir, V.S.'  3 
primary 'Kay, C.W.'     4 
primary 'Bagneris, C.'  5 
primary 'Barrett, T.'   6 
# 
_cell.entry_id           3V4R 
_cell.length_a           95.940 
_cell.length_b           100.310 
_cell.length_c           163.630 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V4R 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'UvrABC system protein B'  77269.016 2 3.1.21.5 ? ? ? 
2 polymer     syn 'DNA: 5 -TACTGTTT-3'       2407.601  2 ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   2 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein UvrB, Excinuclease ABC subunit B, Protein DinA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;HHHHHHMKDRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLY
SEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEY
REMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEI
LGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLT
LRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSA
TPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNY
LHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYAD
KITKSMEIAINETKRRREQQERFNEEHGITPKTINKEIRDVIRATVAAEDKAEYKTKAAPKLSKMTKKERQKVVEQMEHE
MKEAAKALDFERAAELRDLLLELKAEG
;
;HHHHHHMKDRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLY
SEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEY
REMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEI
LGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLT
LRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSA
TPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNY
LHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYAD
KITKSMEIAINETKRRREQQERFNEEHGITPKTINKEIRDVIRATVAAEDKAEYKTKAAPKLSKMTKKERQKVVEQMEHE
MKEAAKALDFERAAELRDLLLELKAEG
;
A,B ? 
2 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DT)(DG)(DT)(DT)(DT)' TACTGTTT C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   LYS n 
1 9   ASP n 
1 10  ARG n 
1 11  PHE n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  SER n 
1 16  LYS n 
1 17  TYR n 
1 18  GLN n 
1 19  PRO n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  GLN n 
1 24  PRO n 
1 25  LYS n 
1 26  ALA n 
1 27  ILE n 
1 28  GLU n 
1 29  LYS n 
1 30  LEU n 
1 31  VAL n 
1 32  LYS n 
1 33  GLY n 
1 34  ILE n 
1 35  GLN n 
1 36  GLU n 
1 37  GLY n 
1 38  LYS n 
1 39  LYS n 
1 40  HIS n 
1 41  GLN n 
1 42  THR n 
1 43  LEU n 
1 44  LEU n 
1 45  GLY n 
1 46  ALA n 
1 47  THR n 
1 48  GLY n 
1 49  THR n 
1 50  GLY n 
1 51  LYS n 
1 52  THR n 
1 53  PHE n 
1 54  THR n 
1 55  VAL n 
1 56  SER n 
1 57  ASN n 
1 58  LEU n 
1 59  ILE n 
1 60  LYS n 
1 61  GLU n 
1 62  VAL n 
1 63  ASN n 
1 64  LYS n 
1 65  PRO n 
1 66  THR n 
1 67  LEU n 
1 68  VAL n 
1 69  ILE n 
1 70  ALA n 
1 71  HIS n 
1 72  ASN n 
1 73  LYS n 
1 74  THR n 
1 75  LEU n 
1 76  ALA n 
1 77  GLY n 
1 78  GLN n 
1 79  LEU n 
1 80  TYR n 
1 81  SER n 
1 82  GLU n 
1 83  PHE n 
1 84  LYS n 
1 85  GLU n 
1 86  PHE n 
1 87  PHE n 
1 88  PRO n 
1 89  ASN n 
1 90  ASN n 
1 91  ALA n 
1 92  VAL n 
1 93  GLU n 
1 94  TYR n 
1 95  PHE n 
1 96  VAL n 
1 97  SER n 
1 98  TYR n 
1 99  TYR n 
1 100 ASP n 
1 101 TYR n 
1 102 TYR n 
1 103 GLN n 
1 104 PRO n 
1 105 GLU n 
1 106 ALA n 
1 107 TYR n 
1 108 VAL n 
1 109 PRO n 
1 110 GLN n 
1 111 THR n 
1 112 ASP n 
1 113 THR n 
1 114 PHE n 
1 115 ILE n 
1 116 GLU n 
1 117 LYS n 
1 118 ASP n 
1 119 ALA n 
1 120 SER n 
1 121 ILE n 
1 122 ASN n 
1 123 ASP n 
1 124 GLU n 
1 125 ILE n 
1 126 ASP n 
1 127 LYS n 
1 128 LEU n 
1 129 ARG n 
1 130 HIS n 
1 131 SER n 
1 132 ALA n 
1 133 THR n 
1 134 SER n 
1 135 ALA n 
1 136 LEU n 
1 137 PHE n 
1 138 GLU n 
1 139 ARG n 
1 140 ARG n 
1 141 ASP n 
1 142 VAL n 
1 143 ILE n 
1 144 ILE n 
1 145 ILE n 
1 146 ALA n 
1 147 SER n 
1 148 VAL n 
1 149 SER n 
1 150 CYS n 
1 151 ILE n 
1 152 TYR n 
1 153 GLY n 
1 154 LEU n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 GLU n 
1 159 GLU n 
1 160 TYR n 
1 161 ARG n 
1 162 GLU n 
1 163 MET n 
1 164 VAL n 
1 165 VAL n 
1 166 SER n 
1 167 LEU n 
1 168 ARG n 
1 169 THR n 
1 170 GLU n 
1 171 MET n 
1 172 GLU n 
1 173 ILE n 
1 174 GLU n 
1 175 ARG n 
1 176 ASN n 
1 177 GLU n 
1 178 LEU n 
1 179 LEU n 
1 180 ARG n 
1 181 LYS n 
1 182 LEU n 
1 183 VAL n 
1 184 ASP n 
1 185 ILE n 
1 186 GLN n 
1 187 TYR n 
1 188 ALA n 
1 189 ARG n 
1 190 ASN n 
1 191 ASP n 
1 192 ILE n 
1 193 ASP n 
1 194 PHE n 
1 195 GLN n 
1 196 ARG n 
1 197 GLY n 
1 198 THR n 
1 199 PHE n 
1 200 ARG n 
1 201 VAL n 
1 202 ARG n 
1 203 GLY n 
1 204 ASP n 
1 205 VAL n 
1 206 VAL n 
1 207 GLU n 
1 208 ILE n 
1 209 PHE n 
1 210 PRO n 
1 211 ALA n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 GLU n 
1 216 HIS n 
1 217 CYS n 
1 218 VAL n 
1 219 ARG n 
1 220 VAL n 
1 221 GLU n 
1 222 PHE n 
1 223 PHE n 
1 224 GLY n 
1 225 ASP n 
1 226 GLU n 
1 227 ILE n 
1 228 GLU n 
1 229 ARG n 
1 230 ILE n 
1 231 ARG n 
1 232 GLU n 
1 233 VAL n 
1 234 ASP n 
1 235 ALA n 
1 236 LEU n 
1 237 THR n 
1 238 GLY n 
1 239 GLU n 
1 240 ILE n 
1 241 LEU n 
1 242 GLY n 
1 243 ASP n 
1 244 ARG n 
1 245 ASP n 
1 246 HIS n 
1 247 VAL n 
1 248 ALA n 
1 249 ILE n 
1 250 PHE n 
1 251 PRO n 
1 252 ALA n 
1 253 SER n 
1 254 HIS n 
1 255 PHE n 
1 256 VAL n 
1 257 THR n 
1 258 ARG n 
1 259 ALA n 
1 260 GLU n 
1 261 LYS n 
1 262 MET n 
1 263 GLU n 
1 264 LYS n 
1 265 ALA n 
1 266 ILE n 
1 267 GLN n 
1 268 ASN n 
1 269 ILE n 
1 270 GLU n 
1 271 LYS n 
1 272 GLU n 
1 273 LEU n 
1 274 GLU n 
1 275 GLU n 
1 276 GLN n 
1 277 LEU n 
1 278 LYS n 
1 279 VAL n 
1 280 MET n 
1 281 HIS n 
1 282 GLU n 
1 283 ASN n 
1 284 GLY n 
1 285 LYS n 
1 286 LEU n 
1 287 LEU n 
1 288 GLU n 
1 289 ALA n 
1 290 GLN n 
1 291 ARG n 
1 292 LEU n 
1 293 GLU n 
1 294 GLN n 
1 295 ARG n 
1 296 THR n 
1 297 ARG n 
1 298 TYR n 
1 299 ASP n 
1 300 LEU n 
1 301 GLU n 
1 302 MET n 
1 303 MET n 
1 304 ARG n 
1 305 GLU n 
1 306 MET n 
1 307 GLY n 
1 308 PHE n 
1 309 CYS n 
1 310 SER n 
1 311 GLY n 
1 312 ILE n 
1 313 GLU n 
1 314 ASN n 
1 315 TYR n 
1 316 SER n 
1 317 ARG n 
1 318 HIS n 
1 319 LEU n 
1 320 THR n 
1 321 LEU n 
1 322 ARG n 
1 323 PRO n 
1 324 PRO n 
1 325 GLY n 
1 326 SER n 
1 327 THR n 
1 328 PRO n 
1 329 TYR n 
1 330 THR n 
1 331 LEU n 
1 332 LEU n 
1 333 ASP n 
1 334 TYR n 
1 335 PHE n 
1 336 PRO n 
1 337 ASP n 
1 338 ASP n 
1 339 PHE n 
1 340 MET n 
1 341 ILE n 
1 342 VAL n 
1 343 VAL n 
1 344 ASP n 
1 345 GLU n 
1 346 SER n 
1 347 HIS n 
1 348 VAL n 
1 349 THR n 
1 350 ILE n 
1 351 PRO n 
1 352 GLN n 
1 353 VAL n 
1 354 ARG n 
1 355 GLY n 
1 356 MET n 
1 357 PHE n 
1 358 ASN n 
1 359 GLY n 
1 360 ASP n 
1 361 GLN n 
1 362 ALA n 
1 363 ARG n 
1 364 LYS n 
1 365 GLN n 
1 366 VAL n 
1 367 LEU n 
1 368 VAL n 
1 369 ASP n 
1 370 HIS n 
1 371 GLY n 
1 372 PHE n 
1 373 ARG n 
1 374 LEU n 
1 375 PRO n 
1 376 SER n 
1 377 ALA n 
1 378 LEU n 
1 379 ASP n 
1 380 ASN n 
1 381 ARG n 
1 382 PRO n 
1 383 LEU n 
1 384 ARG n 
1 385 PHE n 
1 386 GLU n 
1 387 GLU n 
1 388 PHE n 
1 389 GLU n 
1 390 LYS n 
1 391 HIS n 
1 392 MET n 
1 393 HIS n 
1 394 ASN n 
1 395 ILE n 
1 396 VAL n 
1 397 TYR n 
1 398 VAL n 
1 399 SER n 
1 400 ALA n 
1 401 THR n 
1 402 PRO n 
1 403 GLY n 
1 404 PRO n 
1 405 TYR n 
1 406 GLU n 
1 407 ILE n 
1 408 GLU n 
1 409 HIS n 
1 410 THR n 
1 411 ASP n 
1 412 GLU n 
1 413 MET n 
1 414 VAL n 
1 415 GLU n 
1 416 GLN n 
1 417 ILE n 
1 418 ILE n 
1 419 ARG n 
1 420 PRO n 
1 421 THR n 
1 422 GLY n 
1 423 LEU n 
1 424 LEU n 
1 425 ASP n 
1 426 PRO n 
1 427 LEU n 
1 428 ILE n 
1 429 ASP n 
1 430 VAL n 
1 431 ARG n 
1 432 PRO n 
1 433 ILE n 
1 434 GLU n 
1 435 GLY n 
1 436 GLN n 
1 437 ILE n 
1 438 ASP n 
1 439 ASP n 
1 440 LEU n 
1 441 ILE n 
1 442 GLY n 
1 443 GLU n 
1 444 ILE n 
1 445 GLN n 
1 446 ALA n 
1 447 ARG n 
1 448 ILE n 
1 449 GLU n 
1 450 ARG n 
1 451 ASN n 
1 452 GLU n 
1 453 ARG n 
1 454 VAL n 
1 455 LEU n 
1 456 VAL n 
1 457 THR n 
1 458 THR n 
1 459 LEU n 
1 460 THR n 
1 461 LYS n 
1 462 LYS n 
1 463 MET n 
1 464 SER n 
1 465 GLU n 
1 466 ASP n 
1 467 LEU n 
1 468 THR n 
1 469 ASP n 
1 470 TYR n 
1 471 LEU n 
1 472 LYS n 
1 473 GLU n 
1 474 ILE n 
1 475 GLY n 
1 476 ILE n 
1 477 LYS n 
1 478 VAL n 
1 479 ASN n 
1 480 TYR n 
1 481 LEU n 
1 482 HIS n 
1 483 SER n 
1 484 GLU n 
1 485 ILE n 
1 486 LYS n 
1 487 THR n 
1 488 LEU n 
1 489 GLU n 
1 490 ARG n 
1 491 ILE n 
1 492 GLU n 
1 493 ILE n 
1 494 ILE n 
1 495 ARG n 
1 496 ASP n 
1 497 LEU n 
1 498 ARG n 
1 499 LEU n 
1 500 GLY n 
1 501 LYS n 
1 502 TYR n 
1 503 ASP n 
1 504 VAL n 
1 505 LEU n 
1 506 VAL n 
1 507 GLY n 
1 508 ILE n 
1 509 ASN n 
1 510 LEU n 
1 511 LEU n 
1 512 ARG n 
1 513 GLU n 
1 514 GLY n 
1 515 LEU n 
1 516 ASP n 
1 517 ILE n 
1 518 PRO n 
1 519 GLU n 
1 520 VAL n 
1 521 SER n 
1 522 LEU n 
1 523 VAL n 
1 524 ALA n 
1 525 ILE n 
1 526 LEU n 
1 527 ASP n 
1 528 ALA n 
1 529 ASP n 
1 530 LYS n 
1 531 GLU n 
1 532 GLY n 
1 533 PHE n 
1 534 LEU n 
1 535 ARG n 
1 536 SER n 
1 537 GLU n 
1 538 ARG n 
1 539 SER n 
1 540 LEU n 
1 541 ILE n 
1 542 GLN n 
1 543 THR n 
1 544 ILE n 
1 545 GLY n 
1 546 ARG n 
1 547 ALA n 
1 548 ALA n 
1 549 ARG n 
1 550 ASN n 
1 551 ALA n 
1 552 GLU n 
1 553 GLY n 
1 554 ARG n 
1 555 VAL n 
1 556 ILE n 
1 557 MET n 
1 558 TYR n 
1 559 ALA n 
1 560 ASP n 
1 561 LYS n 
1 562 ILE n 
1 563 THR n 
1 564 LYS n 
1 565 SER n 
1 566 MET n 
1 567 GLU n 
1 568 ILE n 
1 569 ALA n 
1 570 ILE n 
1 571 ASN n 
1 572 GLU n 
1 573 THR n 
1 574 LYS n 
1 575 ARG n 
1 576 ARG n 
1 577 ARG n 
1 578 GLU n 
1 579 GLN n 
1 580 GLN n 
1 581 GLU n 
1 582 ARG n 
1 583 PHE n 
1 584 ASN n 
1 585 GLU n 
1 586 GLU n 
1 587 HIS n 
1 588 GLY n 
1 589 ILE n 
1 590 THR n 
1 591 PRO n 
1 592 LYS n 
1 593 THR n 
1 594 ILE n 
1 595 ASN n 
1 596 LYS n 
1 597 GLU n 
1 598 ILE n 
1 599 ARG n 
1 600 ASP n 
1 601 VAL n 
1 602 ILE n 
1 603 ARG n 
1 604 ALA n 
1 605 THR n 
1 606 VAL n 
1 607 ALA n 
1 608 ALA n 
1 609 GLU n 
1 610 ASP n 
1 611 LYS n 
1 612 ALA n 
1 613 GLU n 
1 614 TYR n 
1 615 LYS n 
1 616 THR n 
1 617 LYS n 
1 618 ALA n 
1 619 ALA n 
1 620 PRO n 
1 621 LYS n 
1 622 LEU n 
1 623 SER n 
1 624 LYS n 
1 625 MET n 
1 626 THR n 
1 627 LYS n 
1 628 LYS n 
1 629 GLU n 
1 630 ARG n 
1 631 GLN n 
1 632 LYS n 
1 633 VAL n 
1 634 VAL n 
1 635 GLU n 
1 636 GLN n 
1 637 MET n 
1 638 GLU n 
1 639 HIS n 
1 640 GLU n 
1 641 MET n 
1 642 LYS n 
1 643 GLU n 
1 644 ALA n 
1 645 ALA n 
1 646 LYS n 
1 647 ALA n 
1 648 LEU n 
1 649 ASP n 
1 650 PHE n 
1 651 GLU n 
1 652 ARG n 
1 653 ALA n 
1 654 ALA n 
1 655 GLU n 
1 656 LEU n 
1 657 ARG n 
1 658 ASP n 
1 659 LEU n 
1 660 LEU n 
1 661 LEU n 
1 662 GLU n 
1 663 LEU n 
1 664 LYS n 
1 665 ALA n 
1 666 GLU n 
1 667 GLY n 
2 1   DT  n 
2 2   DA  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DT  n 
2 7   DT  n 
2 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BSU35170, dinA, uvr, uvrB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3 pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 8c' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthesised DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP UVRB_BACSU P37954 1 
;MKDRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEF
FPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVS
LRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDH
VAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGS
TPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYE
IEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIK
TLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSM
EIAINETKRRREQQERFNEEHGITPKTINKEIRDVIRATVAAEDKAEYKTKAAPKLSKMTKKERQKVVEQMEHEMKEAAK
ALDFERAAELRDLLLELKAEG
;
1 ? 
2 PDB 3V4R       3V4R   2 TACTGTTT ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V4R A 7 ? 667 ? P37954 1 ? 661 ? 1 661 
2 1 3V4R B 7 ? 667 ? P37954 1 ? 661 ? 1 661 
3 2 3V4R C 1 ? 8   ? 3V4R   1 ? 8   ? 1 8   
4 2 3V4R D 1 ? 8   ? 3V4R   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V4R HIS A 1 ? UNP P37954 ? ? 'EXPRESSION TAG' -5 1  
1 3V4R HIS A 2 ? UNP P37954 ? ? 'EXPRESSION TAG' -4 2  
1 3V4R HIS A 3 ? UNP P37954 ? ? 'EXPRESSION TAG' -3 3  
1 3V4R HIS A 4 ? UNP P37954 ? ? 'EXPRESSION TAG' -2 4  
1 3V4R HIS A 5 ? UNP P37954 ? ? 'EXPRESSION TAG' -1 5  
1 3V4R HIS A 6 ? UNP P37954 ? ? 'EXPRESSION TAG' 0  6  
2 3V4R HIS B 1 ? UNP P37954 ? ? 'EXPRESSION TAG' -5 7  
2 3V4R HIS B 2 ? UNP P37954 ? ? 'EXPRESSION TAG' -4 8  
2 3V4R HIS B 3 ? UNP P37954 ? ? 'EXPRESSION TAG' -3 9  
2 3V4R HIS B 4 ? UNP P37954 ? ? 'EXPRESSION TAG' -2 10 
2 3V4R HIS B 5 ? UNP P37954 ? ? 'EXPRESSION TAG' -1 11 
2 3V4R HIS B 6 ? UNP P37954 ? ? 'EXPRESSION TAG' 0  12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3V4R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'Crystals were grown from 0.1M MES ph 6.5, 12% PEG 20,0000, Microbatch, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-15 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
# 
_reflns.entry_id                     3V4R 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             19.91 
_reflns.d_resolution_high            3.25 
_reflns.number_obs                   ? 
_reflns.number_all                   25439 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.149 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        89.37 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.25 
_reflns_shell.d_res_low              3.33 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.761 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.72 
_reflns_shell.pdbx_redundancy        7.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      13804 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3V4R 
_refine.ls_number_reflns_obs                     25392 
_refine.ls_number_reflns_all                     25439 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.91 
_refine.ls_d_res_high                            3.25 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1817 
_refine.ls_R_factor_all                          0.1817 
_refine.ls_R_factor_R_work                       0.1797 
_refine.ls_R_factor_R_free                       0.2187 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.11 
_refine.ls_number_reflns_R_free                  1297 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9306 
_refine.correlation_coeff_Fo_to_Fc_free          0.9044 
_refine.B_iso_mean                               68.80 
_refine.aniso_B[1][1]                            -10.2322 
_refine.aniso_B[2][2]                            12.1259 
_refine.aniso_B[3][3]                            -1.8937 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Protein co-ordinates from 2D7D' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3V4R 
_refine_analyze.Luzzati_coordinate_error_obs    0.522 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8526 
_refine_hist.pdbx_number_atoms_nucleic_acid   254 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8815 
_refine_hist.d_res_high                       3.25 
_refine_hist.d_res_low                        19.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010  ? 2.00  8998  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.22   ? 2.00  12331 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        20.95  ? 2.00  3000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           0.0076 ? 2.00  183   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              0.0131 ? 5.00  1358  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      0.010  ? 20.00 8998  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           2.56   ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_other_torsion           20.97  ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 20.95  ? 5.00  1292  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_ideal_dist_contact      20.95  ? 4.00  9787  SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   13 
_refine_ls_shell.d_res_high                       3.25 
_refine_ls_shell.d_res_low                        3.38 
_refine_ls_shell.number_reflns_R_work             2677 
_refine_ls_shell.R_factor_R_work                  0.2237 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.R_factor_R_free                  0.2877 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.41 
_refine_ls_shell.number_reflns_R_free             153 
_refine_ls_shell.number_reflns_all                2830 
_refine_ls_shell.R_factor_all                     0.2271 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3V4R 
_struct.title                     'Crystal structure of a UvrB dimer-DNA complex' 
_struct.pdbx_descriptor           'UvrABC system protein B (E.C.3.1.21.5)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V4R 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'Helicase motifs and a beta-hairpin, DNA helicase, UvrA, ATP hydrolysis, HYDROLASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The asymmetric unit is comprised of a UvrB dimer, two DNA 7mers and 2 molecules of ADP' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 22  ? GLU A 36  ? ASP A 16  GLU A 30  1 ? 15 
HELX_P HELX_P2  2  GLY A 50  ? ASN A 63  ? GLY A 44  ASN A 57  1 ? 14 
HELX_P HELX_P3  3  ASN A 72  ? PHE A 87  ? ASN A 66  PHE A 81  1 ? 16 
HELX_P HELX_P4  4  ASN A 122 ? ARG A 139 ? ASN A 116 ARG A 133 1 ? 18 
HELX_P HELX_P5  5  VAL A 148 ? TYR A 152 ? VAL A 142 TYR A 146 5 ? 5  
HELX_P HELX_P6  6  SER A 156 ? MET A 163 ? SER A 150 MET A 157 1 ? 8  
HELX_P HELX_P7  7  GLU A 174 ? ASP A 184 ? GLU A 168 ASP A 178 1 ? 11 
HELX_P HELX_P8  8  LYS A 261 ? GLU A 282 ? LYS A 255 GLU A 276 1 ? 22 
HELX_P HELX_P9  9  LYS A 285 ? MET A 306 ? LYS A 279 MET A 300 1 ? 22 
HELX_P HELX_P10 10 GLY A 311 ? ASN A 314 ? GLY A 305 ASN A 308 5 ? 4  
HELX_P HELX_P11 11 TYR A 315 ? THR A 320 ? TYR A 309 THR A 314 1 ? 6  
HELX_P HELX_P12 12 THR A 330 ? PHE A 335 ? THR A 324 PHE A 329 5 ? 6  
HELX_P HELX_P13 13 GLU A 345 ? HIS A 370 ? GLU A 339 HIS A 364 1 ? 26 
HELX_P HELX_P14 14 LEU A 374 ? ASN A 380 ? LEU A 368 ASN A 374 5 ? 7  
HELX_P HELX_P15 15 ARG A 384 ? LYS A 390 ? ARG A 378 LYS A 384 1 ? 7  
HELX_P HELX_P16 16 GLY A 403 ? THR A 410 ? GLY A 397 THR A 404 1 ? 8  
HELX_P HELX_P17 17 GLY A 435 ? ARG A 450 ? GLY A 429 ARG A 444 1 ? 16 
HELX_P HELX_P18 18 THR A 460 ? GLY A 475 ? THR A 454 GLY A 469 1 ? 16 
HELX_P HELX_P19 19 LEU A 488 ? GLY A 500 ? LEU A 482 GLY A 494 1 ? 13 
HELX_P HELX_P20 20 GLY A 532 ? ARG A 535 ? GLY A 526 ARG A 529 5 ? 4  
HELX_P HELX_P21 21 SER A 536 ? GLY A 545 ? SER A 530 GLY A 539 1 ? 10 
HELX_P HELX_P22 22 ARG A 546 ? ALA A 548 ? ARG A 540 ALA A 542 5 ? 3  
HELX_P HELX_P23 23 THR A 563 ? HIS A 587 ? THR A 557 HIS A 581 1 ? 25 
HELX_P HELX_P24 24 ASP B 22  ? GLU B 36  ? ASP B 16  GLU B 30  1 ? 15 
HELX_P HELX_P25 25 GLY B 50  ? ASN B 63  ? GLY B 44  ASN B 57  1 ? 14 
HELX_P HELX_P26 26 ASN B 72  ? PHE B 87  ? ASN B 66  PHE B 81  1 ? 16 
HELX_P HELX_P27 27 ASN B 122 ? ARG B 139 ? ASN B 116 ARG B 133 1 ? 18 
HELX_P HELX_P28 28 VAL B 148 ? TYR B 152 ? VAL B 142 TYR B 146 5 ? 5  
HELX_P HELX_P29 29 SER B 156 ? VAL B 164 ? SER B 150 VAL B 158 1 ? 9  
HELX_P HELX_P30 30 GLU B 174 ? ILE B 185 ? GLU B 168 ILE B 179 1 ? 12 
HELX_P HELX_P31 31 GLU B 263 ? ASN B 283 ? GLU B 257 ASN B 277 1 ? 21 
HELX_P HELX_P32 32 LYS B 285 ? MET B 306 ? LYS B 279 MET B 300 1 ? 22 
HELX_P HELX_P33 33 GLY B 311 ? ASN B 314 ? GLY B 305 ASN B 308 5 ? 4  
HELX_P HELX_P34 34 TYR B 315 ? THR B 320 ? TYR B 309 THR B 314 1 ? 6  
HELX_P HELX_P35 35 THR B 330 ? PHE B 335 ? THR B 324 PHE B 329 5 ? 6  
HELX_P HELX_P36 36 GLU B 345 ? HIS B 370 ? GLU B 339 HIS B 364 1 ? 26 
HELX_P HELX_P37 37 LEU B 374 ? ASN B 380 ? LEU B 368 ASN B 374 5 ? 7  
HELX_P HELX_P38 38 ARG B 384 ? LYS B 390 ? ARG B 378 LYS B 384 1 ? 7  
HELX_P HELX_P39 39 GLY B 403 ? THR B 410 ? GLY B 397 THR B 404 1 ? 8  
HELX_P HELX_P40 40 GLY B 435 ? ARG B 450 ? GLY B 429 ARG B 444 1 ? 16 
HELX_P HELX_P41 41 THR B 460 ? GLY B 475 ? THR B 454 GLY B 469 1 ? 16 
HELX_P HELX_P42 42 LYS B 486 ? GLY B 500 ? LYS B 480 GLY B 494 1 ? 15 
HELX_P HELX_P43 43 GLY B 532 ? ARG B 535 ? GLY B 526 ARG B 529 5 ? 4  
HELX_P HELX_P44 44 SER B 536 ? GLY B 545 ? SER B 530 GLY B 539 1 ? 10 
HELX_P HELX_P45 45 ARG B 546 ? ALA B 548 ? ARG B 540 ALA B 542 5 ? 3  
HELX_P HELX_P46 46 THR B 563 ? HIS B 587 ? THR B 557 HIS B 581 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            32 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     33 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       19.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 6 ? 
F ? 6 ? 
G ? 7 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 91  ? PHE A 95  ? ALA A 85  PHE A 89  
A 2 VAL A 142 ? ALA A 146 ? VAL A 136 ALA A 140 
A 3 THR A 66  ? ILE A 69  ? THR A 60  ILE A 63  
A 4 MET A 340 ? ASP A 344 ? MET A 334 ASP A 338 
A 5 ASN A 394 ? SER A 399 ? ASN A 388 SER A 393 
A 6 HIS A 40  ? GLY A 45  ? HIS A 34  GLY A 39  
A 7 VAL A 414 ? GLN A 416 ? VAL A 408 GLN A 410 
B 1 TYR A 99  ? GLN A 103 ? TYR A 93  GLN A 97  
B 2 ASP A 118 ? ILE A 121 ? ASP A 112 ILE A 115 
C 1 ALA A 106 ? VAL A 108 ? ALA A 100 VAL A 102 
C 2 THR A 113 ? ILE A 115 ? THR A 107 ILE A 109 
D 1 VAL A 165 ? ARG A 168 ? VAL A 159 ARG A 162 
D 2 HIS A 246 ? ILE A 249 ? HIS A 240 ILE A 243 
E 1 ALA A 188 ? ARG A 189 ? ALA A 182 ARG A 183 
E 2 THR A 198 ? VAL A 201 ? THR A 192 VAL A 195 
E 3 VAL A 205 ? PHE A 209 ? VAL A 199 PHE A 203 
E 4 HIS A 216 ? PHE A 222 ? HIS A 210 PHE A 216 
E 5 ILE A 227 ? ASP A 234 ? ILE A 221 ASP A 228 
E 6 GLY A 242 ? ARG A 244 ? GLY A 236 ARG A 238 
F 1 LEU A 427 ? ARG A 431 ? LEU A 421 ARG A 425 
F 2 ARG A 554 ? TYR A 558 ? ARG A 548 TYR A 552 
F 3 VAL A 520 ? LEU A 526 ? VAL A 514 LEU A 520 
F 4 ARG A 453 ? THR A 457 ? ARG A 447 THR A 451 
F 5 VAL A 504 ? VAL A 506 ? VAL A 498 VAL A 500 
F 6 VAL A 478 ? TYR A 480 ? VAL A 472 TYR A 474 
G 1 ALA B 91  ? PHE B 95  ? ALA B 85  PHE B 89  
G 2 VAL B 142 ? ALA B 146 ? VAL B 136 ALA B 140 
G 3 THR B 66  ? ILE B 69  ? THR B 60  ILE B 63  
G 4 MET B 340 ? ASP B 344 ? MET B 334 ASP B 338 
G 5 ASN B 394 ? SER B 399 ? ASN B 388 SER B 393 
G 6 GLN B 41  ? GLY B 45  ? GLN B 35  GLY B 39  
G 7 VAL B 414 ? GLN B 416 ? VAL B 408 GLN B 410 
H 1 TYR B 99  ? GLN B 103 ? TYR B 93  GLN B 97  
H 2 ASP B 118 ? ILE B 121 ? ASP B 112 ILE B 115 
I 1 ALA B 106 ? VAL B 108 ? ALA B 100 VAL B 102 
I 2 THR B 113 ? ILE B 115 ? THR B 107 ILE B 109 
J 1 VAL B 165 ? ARG B 168 ? VAL B 159 ARG B 162 
J 2 HIS B 246 ? ILE B 249 ? HIS B 240 ILE B 243 
K 1 ALA B 188 ? ARG B 189 ? ALA B 182 ARG B 183 
K 2 THR B 198 ? PHE B 199 ? THR B 192 PHE B 193 
L 1 VAL B 205 ? ILE B 208 ? VAL B 199 ILE B 202 
L 2 HIS B 216 ? PHE B 223 ? HIS B 210 PHE B 217 
L 3 GLU B 226 ? ASP B 234 ? GLU B 220 ASP B 228 
L 4 GLY B 242 ? ARG B 244 ? GLY B 236 ARG B 238 
M 1 LEU B 427 ? ARG B 431 ? LEU B 421 ARG B 425 
M 2 ARG B 554 ? TYR B 558 ? ARG B 548 TYR B 552 
M 3 VAL B 520 ? LEU B 526 ? VAL B 514 LEU B 520 
M 4 ARG B 453 ? THR B 457 ? ARG B 447 THR B 451 
M 5 VAL B 504 ? GLY B 507 ? VAL B 498 GLY B 501 
M 6 VAL B 478 ? TYR B 480 ? VAL B 472 TYR B 474 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 93  ? N GLU A 87  O ILE A 143 ? O ILE A 137 
A 2 3 O ALA A 146 ? O ALA A 140 N VAL A 68  ? N VAL A 62  
A 3 4 N LEU A 67  ? N LEU A 61  O VAL A 342 ? O VAL A 336 
A 4 5 N VAL A 343 ? N VAL A 337 O VAL A 398 ? O VAL A 392 
A 5 6 O TYR A 397 ? O TYR A 391 N LEU A 43  ? N LEU A 37  
A 6 7 N LEU A 44  ? N LEU A 38  O GLN A 416 ? O GLN A 410 
B 1 2 N ASP A 100 ? N ASP A 94  O SER A 120 ? O SER A 114 
C 1 2 N ALA A 106 ? N ALA A 100 O ILE A 115 ? O ILE A 109 
D 1 2 N LEU A 167 ? N LEU A 161 O VAL A 247 ? O VAL A 241 
E 1 2 N ALA A 188 ? N ALA A 182 O PHE A 199 ? O PHE A 193 
E 2 3 N THR A 198 ? N THR A 192 O PHE A 209 ? O PHE A 203 
E 3 4 N ILE A 208 ? N ILE A 202 O VAL A 218 ? O VAL A 212 
E 4 5 N GLU A 221 ? N GLU A 215 O ARG A 229 ? O ARG A 223 
E 5 6 N ILE A 230 ? N ILE A 224 O ARG A 244 ? O ARG A 238 
F 1 2 N ARG A 431 ? N ARG A 425 O MET A 557 ? O MET A 551 
F 2 3 O ILE A 556 ? O ILE A 550 N ILE A 525 ? N ILE A 519 
F 3 4 O ALA A 524 ? O ALA A 518 N LEU A 455 ? N LEU A 449 
F 4 5 N VAL A 456 ? N VAL A 450 O LEU A 505 ? O LEU A 499 
F 5 6 O VAL A 506 ? O VAL A 500 N ASN A 479 ? N ASN A 473 
G 1 2 N GLU B 93  ? N GLU B 87  O ILE B 143 ? O ILE B 137 
G 2 3 O ALA B 146 ? O ALA B 140 N VAL B 68  ? N VAL B 62  
G 3 4 N LEU B 67  ? N LEU B 61  O VAL B 342 ? O VAL B 336 
G 4 5 N VAL B 343 ? N VAL B 337 O VAL B 398 ? O VAL B 392 
G 5 6 O TYR B 397 ? O TYR B 391 N LEU B 43  ? N LEU B 37  
G 6 7 N LEU B 44  ? N LEU B 38  O GLN B 416 ? O GLN B 410 
H 1 2 N ASP B 100 ? N ASP B 94  O SER B 120 ? O SER B 114 
I 1 2 N ALA B 106 ? N ALA B 100 O ILE B 115 ? O ILE B 109 
J 1 2 N LEU B 167 ? N LEU B 161 O VAL B 247 ? O VAL B 241 
K 1 2 N ALA B 188 ? N ALA B 182 O PHE B 199 ? O PHE B 193 
L 1 2 N VAL B 206 ? N VAL B 200 O VAL B 220 ? O VAL B 214 
L 2 3 N GLU B 221 ? N GLU B 215 O ARG B 229 ? O ARG B 223 
L 3 4 N ILE B 230 ? N ILE B 224 O ARG B 244 ? O ARG B 238 
M 1 2 N LEU B 427 ? N LEU B 421 O VAL B 555 ? O VAL B 549 
M 2 3 O ILE B 556 ? O ILE B 550 N ILE B 525 ? N ILE B 519 
M 3 4 O ALA B 524 ? O ALA B 518 N LEU B 455 ? N LEU B 449 
M 4 5 N VAL B 456 ? N VAL B 450 O LEU B 505 ? O LEU B 499 
M 5 6 O VAL B 506 ? O VAL B 500 N ASN B 479 ? N ASN B 473 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ADP A 701' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ADP B 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 TYR A 17  ? TYR A 11  . ? 1_555 ? 
2  AC1 10 GLN A 18  ? GLN A 12  . ? 1_555 ? 
3  AC1 10 GLN A 23  ? GLN A 17  . ? 1_555 ? 
4  AC1 10 GLY A 48  ? GLY A 42  . ? 1_555 ? 
5  AC1 10 GLY A 50  ? GLY A 44  . ? 1_555 ? 
6  AC1 10 LYS A 51  ? LYS A 45  . ? 1_555 ? 
7  AC1 10 THR A 52  ? THR A 46  . ? 1_555 ? 
8  AC1 10 PHE A 53  ? PHE A 47  . ? 1_555 ? 
9  AC1 10 GLU A 82  ? GLU A 76  . ? 1_555 ? 
10 AC1 10 ARG A 549 ? ARG A 543 . ? 1_555 ? 
11 AC2 4  GLY B 48  ? GLY B 42  . ? 1_555 ? 
12 AC2 4  GLY B 50  ? GLY B 44  . ? 1_555 ? 
13 AC2 4  LYS B 51  ? LYS B 45  . ? 1_555 ? 
14 AC2 4  THR B 52  ? THR B 46  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3V4R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3V4R 
_atom_sites.fract_transf_matrix[1][1]   0.010423 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009969 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006111 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ASP A 1 9   ? 20.883  23.316  -44.092  1.00 70.79  ? 3   ASP A N     1 
ATOM   2    C CA    . ASP A 1 9   ? 19.901  22.341  -44.608  1.00 68.96  ? 3   ASP A CA    1 
ATOM   3    C C     . ASP A 1 9   ? 19.188  21.581  -43.446  1.00 69.12  ? 3   ASP A C     1 
ATOM   4    O O     . ASP A 1 9   ? 19.694  20.551  -42.977  1.00 68.09  ? 3   ASP A O     1 
ATOM   5    C CB    . ASP A 1 9   ? 20.591  21.362  -45.601  1.00 70.86  ? 3   ASP A CB    1 
ATOM   6    C CG    . ASP A 1 9   ? 19.835  21.045  -46.894  1.00 85.11  ? 3   ASP A CG    1 
ATOM   7    O OD1   . ASP A 1 9   ? 18.997  21.878  -47.318  1.00 86.95  ? 3   ASP A OD1   1 
ATOM   8    O OD2   . ASP A 1 9   ? 20.129  19.987  -47.516  1.00 89.63  ? 3   ASP A OD2   1 
ATOM   9    N N     . ARG A 1 10  ? 18.033  22.124  -42.964  1.00 63.13  ? 4   ARG A N     1 
ATOM   10   C CA    . ARG A 1 10  ? 17.259  21.582  -41.835  1.00 61.09  ? 4   ARG A CA    1 
ATOM   11   C C     . ARG A 1 10  ? 15.768  21.326  -42.138  1.00 62.91  ? 4   ARG A C     1 
ATOM   12   O O     . ARG A 1 10  ? 15.189  21.984  -42.995  1.00 61.20  ? 4   ARG A O     1 
ATOM   13   C CB    . ARG A 1 10  ? 17.416  22.484  -40.612  1.00 62.77  ? 4   ARG A CB    1 
ATOM   14   N N     . PHE A 1 11  ? 15.165  20.351  -41.431  1.00 60.56  ? 5   PHE A N     1 
ATOM   15   C CA    . PHE A 1 11  ? 13.753  19.963  -41.538  1.00 60.40  ? 5   PHE A CA    1 
ATOM   16   C C     . PHE A 1 11  ? 12.873  20.962  -40.777  1.00 66.54  ? 5   PHE A C     1 
ATOM   17   O O     . PHE A 1 11  ? 13.091  21.169  -39.579  1.00 68.75  ? 5   PHE A O     1 
ATOM   18   C CB    . PHE A 1 11  ? 13.531  18.542  -40.970  1.00 61.50  ? 5   PHE A CB    1 
ATOM   19   C CG    . PHE A 1 11  ? 13.912  17.391  -41.873  1.00 62.32  ? 5   PHE A CG    1 
ATOM   20   C CD1   . PHE A 1 11  ? 14.987  16.563  -41.562  1.00 65.93  ? 5   PHE A CD1   1 
ATOM   21   C CD2   . PHE A 1 11  ? 13.182  17.115  -43.023  1.00 63.78  ? 5   PHE A CD2   1 
ATOM   22   C CE1   . PHE A 1 11  ? 15.341  15.494  -42.401  1.00 65.82  ? 5   PHE A CE1   1 
ATOM   23   C CE2   . PHE A 1 11  ? 13.542  16.053  -43.864  1.00 65.48  ? 5   PHE A CE2   1 
ATOM   24   C CZ    . PHE A 1 11  ? 14.609  15.241  -43.539  1.00 63.35  ? 5   PHE A CZ    1 
ATOM   25   N N     . GLU A 1 12  ? 11.888  21.581  -41.465  1.00 61.56  ? 6   GLU A N     1 
ATOM   26   C CA    . GLU A 1 12  ? 10.961  22.560  -40.871  1.00 61.56  ? 6   GLU A CA    1 
ATOM   27   C C     . GLU A 1 12  ? 9.599   21.895  -40.717  1.00 63.54  ? 6   GLU A C     1 
ATOM   28   O O     . GLU A 1 12  ? 8.924   21.639  -41.726  1.00 64.50  ? 6   GLU A O     1 
ATOM   29   C CB    . GLU A 1 12  ? 10.893  23.845  -41.736  1.00 63.59  ? 6   GLU A CB    1 
ATOM   30   C CG    . GLU A 1 12  ? 9.768   24.842  -41.455  1.00 73.19  ? 6   GLU A CG    1 
ATOM   31   C CD    . GLU A 1 12  ? 9.353   25.715  -42.635  1.00 94.44  ? 6   GLU A CD    1 
ATOM   32   O OE1   . GLU A 1 12  ? 8.227   26.264  -42.597  1.00 69.86  ? 6   GLU A OE1   1 
ATOM   33   O OE2   . GLU A 1 12  ? 10.142  25.846  -43.601  1.00 97.04  ? 6   GLU A OE2   1 
ATOM   34   N N     . LEU A 1 13  ? 9.231   21.560  -39.460  1.00 56.94  ? 7   LEU A N     1 
ATOM   35   C CA    . LEU A 1 13  ? 7.970   20.904  -39.109  1.00 54.78  ? 7   LEU A CA    1 
ATOM   36   C C     . LEU A 1 13  ? 6.859   21.934  -38.937  1.00 59.97  ? 7   LEU A C     1 
ATOM   37   O O     . LEU A 1 13  ? 6.885   22.760  -38.032  1.00 60.58  ? 7   LEU A O     1 
ATOM   38   C CB    . LEU A 1 13  ? 8.158   19.993  -37.879  1.00 54.30  ? 7   LEU A CB    1 
ATOM   39   C CG    . LEU A 1 13  ? 6.964   19.431  -37.091  1.00 57.78  ? 7   LEU A CG    1 
ATOM   40   C CD1   . LEU A 1 13  ? 5.853   18.924  -37.983  1.00 56.40  ? 7   LEU A CD1   1 
ATOM   41   C CD2   . LEU A 1 13  ? 7.426   18.328  -36.140  1.00 59.07  ? 7   LEU A CD2   1 
ATOM   42   N N     . VAL A 1 14  ? 5.898   21.886  -39.845  1.00 57.89  ? 8   VAL A N     1 
ATOM   43   C CA    . VAL A 1 14  ? 4.758   22.794  -39.906  1.00 58.88  ? 8   VAL A CA    1 
ATOM   44   C C     . VAL A 1 14  ? 3.487   22.137  -39.330  1.00 64.88  ? 8   VAL A C     1 
ATOM   45   O O     . VAL A 1 14  ? 2.784   21.374  -40.010  1.00 62.71  ? 8   VAL A O     1 
ATOM   46   C CB    . VAL A 1 14  ? 4.563   23.337  -41.337  1.00 62.32  ? 8   VAL A CB    1 
ATOM   47   C CG1   . VAL A 1 14  ? 3.393   24.304  -41.396  1.00 63.61  ? 8   VAL A CG1   1 
ATOM   48   C CG2   . VAL A 1 14  ? 5.836   24.001  -41.846  1.00 62.34  ? 8   VAL A CG2   1 
ATOM   49   N N     . SER A 1 15  ? 3.219   22.444  -38.058  1.00 64.97  ? 9   SER A N     1 
ATOM   50   C CA    . SER A 1 15  ? 2.059   21.963  -37.323  1.00 65.60  ? 9   SER A CA    1 
ATOM   51   C C     . SER A 1 15  ? 1.508   23.068  -36.437  1.00 73.70  ? 9   SER A C     1 
ATOM   52   O O     . SER A 1 15  ? 2.281   23.873  -35.897  1.00 74.86  ? 9   SER A O     1 
ATOM   53   C CB    . SER A 1 15  ? 2.427   20.762  -36.469  1.00 68.26  ? 9   SER A CB    1 
ATOM   54   O OG    . SER A 1 15  ? 1.257   20.289  -35.827  1.00 78.84  ? 9   SER A OG    1 
ATOM   55   N N     . LYS A 1 16  ? 0.166   23.113  -36.292  1.00 71.78  ? 10  LYS A N     1 
ATOM   56   C CA    . LYS A 1 16  ? -0.510  24.090  -35.421  1.00 73.33  ? 10  LYS A CA    1 
ATOM   57   C C     . LYS A 1 16  ? -0.508  23.555  -33.990  1.00 76.57  ? 10  LYS A C     1 
ATOM   58   O O     . LYS A 1 16  ? -0.506  24.342  -33.042  1.00 77.45  ? 10  LYS A O     1 
ATOM   59   C CB    . LYS A 1 16  ? -1.946  24.375  -35.895  1.00 76.16  ? 10  LYS A CB    1 
ATOM   60   N N     . TYR A 1 17  ? -0.473  22.209  -33.853  1.00 71.20  ? 11  TYR A N     1 
ATOM   61   C CA    . TYR A 1 17  ? -0.460  21.488  -32.581  1.00 70.70  ? 11  TYR A CA    1 
ATOM   62   C C     . TYR A 1 17  ? 0.919   21.232  -31.958  1.00 72.82  ? 11  TYR A C     1 
ATOM   63   O O     . TYR A 1 17  ? 1.944   21.277  -32.641  1.00 71.32  ? 11  TYR A O     1 
ATOM   64   C CB    . TYR A 1 17  ? -1.303  20.201  -32.630  1.00 70.94  ? 11  TYR A CB    1 
ATOM   65   C CG    . TYR A 1 17  ? -1.447  19.494  -33.960  1.00 71.03  ? 11  TYR A CG    1 
ATOM   66   C CD1   . TYR A 1 17  ? -0.640  18.406  -34.283  1.00 71.40  ? 11  TYR A CD1   1 
ATOM   67   C CD2   . TYR A 1 17  ? -2.509  19.787  -34.811  1.00 71.83  ? 11  TYR A CD2   1 
ATOM   68   C CE1   . TYR A 1 17  ? -0.832  17.683  -35.462  1.00 70.37  ? 11  TYR A CE1   1 
ATOM   69   C CE2   . TYR A 1 17  ? -2.719  19.066  -35.987  1.00 71.41  ? 11  TYR A CE2   1 
ATOM   70   C CZ    . TYR A 1 17  ? -1.878  18.014  -36.311  1.00 74.79  ? 11  TYR A CZ    1 
ATOM   71   O OH    . TYR A 1 17  ? -2.098  17.303  -37.469  1.00 69.67  ? 11  TYR A OH    1 
ATOM   72   N N     . GLN A 1 18  ? 0.918   20.969  -30.645  1.00 70.09  ? 12  GLN A N     1 
ATOM   73   C CA    . GLN A 1 18  ? 2.093   20.675  -29.827  1.00 70.65  ? 12  GLN A CA    1 
ATOM   74   C C     . GLN A 1 18  ? 1.966   19.237  -29.220  1.00 73.10  ? 12  GLN A C     1 
ATOM   75   O O     . GLN A 1 18  ? 0.836   18.780  -29.034  1.00 72.89  ? 12  GLN A O     1 
ATOM   76   C CB    . GLN A 1 18  ? 2.263   21.757  -28.722  1.00 73.92  ? 12  GLN A CB    1 
ATOM   77   N N     . PRO A 1 19  ? 3.082   18.509  -28.925  1.00 68.07  ? 13  PRO A N     1 
ATOM   78   C CA    . PRO A 1 19  ? 2.966   17.151  -28.360  1.00 66.72  ? 13  PRO A CA    1 
ATOM   79   C C     . PRO A 1 19  ? 2.210   17.051  -27.044  1.00 69.70  ? 13  PRO A C     1 
ATOM   80   O O     . PRO A 1 19  ? 2.539   17.728  -26.066  1.00 71.15  ? 13  PRO A O     1 
ATOM   81   C CB    . PRO A 1 19  ? 4.424   16.697  -28.210  1.00 68.47  ? 13  PRO A CB    1 
ATOM   82   C CG    . PRO A 1 19  ? 5.171   17.525  -29.178  1.00 72.96  ? 13  PRO A CG    1 
ATOM   83   C CD    . PRO A 1 19  ? 4.500   18.858  -29.130  1.00 69.92  ? 13  PRO A CD    1 
ATOM   84   N N     . GLN A 1 20  ? 1.174   16.202  -27.063  1.00 63.66  ? 14  GLN A N     1 
ATOM   85   C CA    . GLN A 1 20  ? 0.255   15.910  -25.974  1.00 63.91  ? 14  GLN A CA    1 
ATOM   86   C C     . GLN A 1 20  ? 0.464   14.485  -25.496  1.00 67.47  ? 14  GLN A C     1 
ATOM   87   O O     . GLN A 1 20  ? 1.142   13.730  -26.172  1.00 65.91  ? 14  GLN A O     1 
ATOM   88   C CB    . GLN A 1 20  ? -1.185  16.080  -26.481  1.00 64.89  ? 14  GLN A CB    1 
ATOM   89   C CG    . GLN A 1 20  ? -1.580  17.503  -26.824  1.00 84.55  ? 14  GLN A CG    1 
ATOM   90   C CD    . GLN A 1 20  ? -1.584  18.336  -25.584  1.00 117.86 ? 14  GLN A CD    1 
ATOM   91   O OE1   . GLN A 1 20  ? -2.485  18.216  -24.749  1.00 121.66 ? 14  GLN A OE1   1 
ATOM   92   N NE2   . GLN A 1 20  ? -0.526  19.117  -25.391  1.00 109.71 ? 14  GLN A NE2   1 
ATOM   93   N N     . GLY A 1 21  ? -0.133  14.129  -24.353  1.00 66.13  ? 15  GLY A N     1 
ATOM   94   C CA    . GLY A 1 21  ? -0.068  12.792  -23.761  1.00 65.97  ? 15  GLY A CA    1 
ATOM   95   C C     . GLY A 1 21  ? 1.337   12.333  -23.462  1.00 70.20  ? 15  GLY A C     1 
ATOM   96   O O     . GLY A 1 21  ? 2.074   13.057  -22.786  1.00 70.80  ? 15  GLY A O     1 
ATOM   97   N N     . ASP A 1 22  ? 1.733   11.141  -23.981  1.00 65.74  ? 16  ASP A N     1 
ATOM   98   C CA    . ASP A 1 22  ? 3.106   10.670  -23.760  1.00 65.96  ? 16  ASP A CA    1 
ATOM   99   C C     . ASP A 1 22  ? 4.047   10.812  -24.963  1.00 65.06  ? 16  ASP A C     1 
ATOM   100  O O     . ASP A 1 22  ? 5.136   10.225  -24.981  1.00 64.38  ? 16  ASP A O     1 
ATOM   101  C CB    . ASP A 1 22  ? 3.248   9.345   -22.956  1.00 68.84  ? 16  ASP A CB    1 
ATOM   102  C CG    . ASP A 1 22  ? 2.563   8.132   -23.535  1.00 82.19  ? 16  ASP A CG    1 
ATOM   103  O OD1   . ASP A 1 22  ? 2.654   7.036   -22.906  1.00 82.50  ? 16  ASP A OD1   1 
ATOM   104  O OD2   . ASP A 1 22  ? 1.920   8.271   -24.607  1.00 89.73  ? 16  ASP A OD2   1 
ATOM   105  N N     . GLN A 1 23  ? 3.655   11.665  -25.928  1.00 57.83  ? 17  GLN A N     1 
ATOM   106  C CA    . GLN A 1 23  ? 4.488   12.033  -27.069  1.00 55.29  ? 17  GLN A CA    1 
ATOM   107  C C     . GLN A 1 23  ? 5.724   12.821  -26.566  1.00 60.97  ? 17  GLN A C     1 
ATOM   108  O O     . GLN A 1 23  ? 6.805   12.445  -27.002  1.00 60.65  ? 17  GLN A O     1 
ATOM   109  C CB    . GLN A 1 23  ? 3.728   12.859  -28.118  1.00 54.93  ? 17  GLN A CB    1 
ATOM   110  C CG    . GLN A 1 23  ? 2.599   12.116  -28.808  1.00 52.26  ? 17  GLN A CG    1 
ATOM   111  C CD    . GLN A 1 23  ? 1.883   12.984  -29.830  1.00 70.92  ? 17  GLN A CD    1 
ATOM   112  O OE1   . GLN A 1 23  ? 1.551   14.154  -29.584  1.00 65.66  ? 17  GLN A OE1   1 
ATOM   113  N NE2   . GLN A 1 23  ? 1.592   12.419  -30.999  1.00 62.59  ? 17  GLN A NE2   1 
ATOM   114  N N     . PRO A 1 24  ? 5.647   13.828  -25.623  1.00 58.74  ? 18  PRO A N     1 
ATOM   115  C CA    . PRO A 1 24  ? 6.872   14.527  -25.194  1.00 58.97  ? 18  PRO A CA    1 
ATOM   116  C C     . PRO A 1 24  ? 7.943   13.628  -24.588  1.00 61.36  ? 18  PRO A C     1 
ATOM   117  O O     . PRO A 1 24  ? 9.106   13.741  -24.995  1.00 60.83  ? 18  PRO A O     1 
ATOM   118  C CB    . PRO A 1 24  ? 6.361   15.579  -24.210  1.00 62.32  ? 18  PRO A CB    1 
ATOM   119  C CG    . PRO A 1 24  ? 4.959   15.797  -24.599  1.00 66.55  ? 18  PRO A CG    1 
ATOM   120  C CD    . PRO A 1 24  ? 4.469   14.441  -24.972  1.00 61.04  ? 18  PRO A CD    1 
ATOM   121  N N     . LYS A 1 25  ? 7.557   12.712  -23.669  1.00 57.24  ? 19  LYS A N     1 
ATOM   122  C CA    . LYS A 1 25  ? 8.502   11.781  -23.044  1.00 57.67  ? 19  LYS A CA    1 
ATOM   123  C C     . LYS A 1 25  ? 9.119   10.852  -24.086  1.00 60.75  ? 19  LYS A C     1 
ATOM   124  O O     . LYS A 1 25  ? 10.328  10.643  -24.059  1.00 60.54  ? 19  LYS A O     1 
ATOM   125  C CB    . LYS A 1 25  ? 7.828   10.985  -21.940  1.00 59.21  ? 19  LYS A CB    1 
ATOM   126  N N     . ALA A 1 26  ? 8.305   10.364  -25.051  1.00 57.05  ? 20  ALA A N     1 
ATOM   127  C CA    . ALA A 1 26  ? 8.751   9.502   -26.156  1.00 55.70  ? 20  ALA A CA    1 
ATOM   128  C C     . ALA A 1 26  ? 9.835   10.183  -27.018  1.00 58.62  ? 20  ALA A C     1 
ATOM   129  O O     . ALA A 1 26  ? 10.935  9.637   -27.116  1.00 59.68  ? 20  ALA A O     1 
ATOM   130  C CB    . ALA A 1 26  ? 7.568   9.071   -27.016  1.00 55.00  ? 20  ALA A CB    1 
ATOM   131  N N     . ILE A 1 27  ? 9.548   11.392  -27.577  1.00 52.15  ? 21  ILE A N     1 
ATOM   132  C CA    . ILE A 1 27  ? 10.486  12.174  -28.397  1.00 50.83  ? 21  ILE A CA    1 
ATOM   133  C C     . ILE A 1 27  ? 11.801  12.421  -27.655  1.00 55.62  ? 21  ILE A C     1 
ATOM   134  O O     . ILE A 1 27  ? 12.849  12.116  -28.214  1.00 53.84  ? 21  ILE A O     1 
ATOM   135  C CB    . ILE A 1 27  ? 9.886   13.493  -29.000  1.00 53.47  ? 21  ILE A CB    1 
ATOM   136  C CG1   . ILE A 1 27  ? 8.490   13.271  -29.640  1.00 52.81  ? 21  ILE A CG1   1 
ATOM   137  C CG2   . ILE A 1 27  ? 10.847  14.121  -30.026  1.00 52.98  ? 21  ILE A CG2   1 
ATOM   138  C CD1   . ILE A 1 27  ? 7.514   14.434  -29.493  1.00 61.48  ? 21  ILE A CD1   1 
ATOM   139  N N     . GLU A 1 28  ? 11.749  12.923  -26.392  1.00 55.01  ? 22  GLU A N     1 
ATOM   140  C CA    . GLU A 1 28  ? 12.961  13.181  -25.603  1.00 56.96  ? 22  GLU A CA    1 
ATOM   141  C C     . GLU A 1 28  ? 13.832  11.910  -25.488  1.00 62.53  ? 22  GLU A C     1 
ATOM   142  O O     . GLU A 1 28  ? 15.027  11.971  -25.811  1.00 63.38  ? 22  GLU A O     1 
ATOM   143  C CB    . GLU A 1 28  ? 12.612  13.734  -24.223  1.00 59.07  ? 22  GLU A CB    1 
ATOM   144  N N     . LYS A 1 29  ? 13.209  10.754  -25.130  1.00 57.48  ? 23  LYS A N     1 
ATOM   145  C CA    . LYS A 1 29  ? 13.889  9.469   -24.964  1.00 57.12  ? 23  LYS A CA    1 
ATOM   146  C C     . LYS A 1 29  ? 14.495  8.929   -26.269  1.00 59.79  ? 23  LYS A C     1 
ATOM   147  O O     . LYS A 1 29  ? 15.618  8.412   -26.249  1.00 59.89  ? 23  LYS A O     1 
ATOM   148  C CB    . LYS A 1 29  ? 12.975  8.441   -24.279  1.00 58.92  ? 23  LYS A CB    1 
ATOM   149  N N     . LEU A 1 30  ? 13.773  9.080   -27.396  1.00 54.41  ? 24  LEU A N     1 
ATOM   150  C CA    . LEU A 1 30  ? 14.226  8.608   -28.709  1.00 52.44  ? 24  LEU A CA    1 
ATOM   151  C C     . LEU A 1 30  ? 15.310  9.477   -29.325  1.00 59.04  ? 24  LEU A C     1 
ATOM   152  O O     . LEU A 1 30  ? 16.163  8.944   -30.030  1.00 59.09  ? 24  LEU A O     1 
ATOM   153  C CB    . LEU A 1 30  ? 13.066  8.420   -29.683  1.00 50.06  ? 24  LEU A CB    1 
ATOM   154  C CG    . LEU A 1 30  ? 12.273  7.146   -29.501  1.00 53.59  ? 24  LEU A CG    1 
ATOM   155  C CD1   . LEU A 1 30  ? 10.941  7.245   -30.162  1.00 52.38  ? 24  LEU A CD1   1 
ATOM   156  C CD2   . LEU A 1 30  ? 13.010  5.952   -30.046  1.00 56.01  ? 24  LEU A CD2   1 
ATOM   157  N N     . VAL A 1 31  ? 15.303  10.801  -29.060  1.00 56.92  ? 25  VAL A N     1 
ATOM   158  C CA    . VAL A 1 31  ? 16.322  11.721  -29.601  1.00 57.03  ? 25  VAL A CA    1 
ATOM   159  C C     . VAL A 1 31  ? 17.629  11.527  -28.823  1.00 61.10  ? 25  VAL A C     1 
ATOM   160  O O     . VAL A 1 31  ? 18.701  11.464  -29.433  1.00 58.68  ? 25  VAL A O     1 
ATOM   161  C CB    . VAL A 1 31  ? 15.868  13.216  -29.687  1.00 61.19  ? 25  VAL A CB    1 
ATOM   162  C CG1   . VAL A 1 31  ? 16.950  14.088  -30.303  1.00 61.57  ? 25  VAL A CG1   1 
ATOM   163  C CG2   . VAL A 1 31  ? 14.577  13.359  -30.487  1.00 59.60  ? 25  VAL A CG2   1 
ATOM   164  N N     . LYS A 1 32  ? 17.519  11.381  -27.474  1.00 60.21  ? 26  LYS A N     1 
ATOM   165  C CA    . LYS A 1 32  ? 18.652  11.132  -26.578  1.00 61.53  ? 26  LYS A CA    1 
ATOM   166  C C     . LYS A 1 32  ? 19.345  9.818   -26.986  1.00 63.79  ? 26  LYS A C     1 
ATOM   167  O O     . LYS A 1 32  ? 20.572  9.761   -27.004  1.00 64.00  ? 26  LYS A O     1 
ATOM   168  C CB    . LYS A 1 32  ? 18.185  11.074  -25.123  1.00 63.29  ? 26  LYS A CB    1 
ATOM   169  N N     . GLY A 1 33  ? 18.547  8.818   -27.373  1.00 57.81  ? 27  GLY A N     1 
ATOM   170  C CA    . GLY A 1 33  ? 19.029  7.515   -27.819  1.00 56.72  ? 27  GLY A CA    1 
ATOM   171  C C     . GLY A 1 33  ? 19.947  7.604   -29.015  1.00 58.02  ? 27  GLY A C     1 
ATOM   172  O O     . GLY A 1 33  ? 21.048  7.045   -28.995  1.00 56.48  ? 27  GLY A O     1 
ATOM   173  N N     . ILE A 1 34  ? 19.508  8.350   -30.049  1.00 53.88  ? 28  ILE A N     1 
ATOM   174  C CA    . ILE A 1 34  ? 20.283  8.599   -31.271  1.00 52.80  ? 28  ILE A CA    1 
ATOM   175  C C     . ILE A 1 34  ? 21.595  9.348   -30.933  1.00 60.36  ? 28  ILE A C     1 
ATOM   176  O O     . ILE A 1 34  ? 22.677  8.894   -31.334  1.00 59.88  ? 28  ILE A O     1 
ATOM   177  C CB    . ILE A 1 34  ? 19.406  9.263   -32.374  1.00 52.95  ? 28  ILE A CB    1 
ATOM   178  C CG1   . ILE A 1 34  ? 18.627  8.163   -33.125  1.00 50.91  ? 28  ILE A CG1   1 
ATOM   179  C CG2   . ILE A 1 34  ? 20.233  10.127  -33.341  1.00 51.62  ? 28  ILE A CG2   1 
ATOM   180  C CD1   . ILE A 1 34  ? 17.296  8.532   -33.645  1.00 49.39  ? 28  ILE A CD1   1 
ATOM   181  N N     . GLN A 1 35  ? 21.485  10.437  -30.120  1.00 58.73  ? 29  GLN A N     1 
ATOM   182  C CA    . GLN A 1 35  ? 22.603  11.252  -29.650  1.00 60.17  ? 29  GLN A CA    1 
ATOM   183  C C     . GLN A 1 35  ? 23.593  10.392  -28.858  1.00 68.22  ? 29  GLN A C     1 
ATOM   184  O O     . GLN A 1 35  ? 24.794  10.533  -29.071  1.00 69.36  ? 29  GLN A O     1 
ATOM   185  C CB    . GLN A 1 35  ? 22.108  12.455  -28.818  1.00 61.90  ? 29  GLN A CB    1 
ATOM   186  N N     . GLU A 1 36  ? 23.094  9.464   -27.984  1.00 66.18  ? 30  GLU A N     1 
ATOM   187  C CA    . GLU A 1 36  ? 23.920  8.561   -27.150  1.00 67.17  ? 30  GLU A CA    1 
ATOM   188  C C     . GLU A 1 36  ? 24.534  7.382   -27.948  1.00 72.95  ? 30  GLU A C     1 
ATOM   189  O O     . GLU A 1 36  ? 25.240  6.544   -27.375  1.00 74.36  ? 30  GLU A O     1 
ATOM   190  C CB    . GLU A 1 36  ? 23.161  8.074   -25.897  1.00 68.35  ? 30  GLU A CB    1 
ATOM   191  N N     . GLY A 1 37  ? 24.273  7.345   -29.259  1.00 68.32  ? 31  GLY A N     1 
ATOM   192  C CA    . GLY A 1 37  ? 24.812  6.339   -30.167  1.00 67.04  ? 31  GLY A CA    1 
ATOM   193  C C     . GLY A 1 37  ? 24.008  5.069   -30.341  1.00 67.73  ? 31  GLY A C     1 
ATOM   194  O O     . GLY A 1 37  ? 24.503  4.131   -30.972  1.00 67.41  ? 31  GLY A O     1 
ATOM   195  N N     . LYS A 1 38  ? 22.774  5.016   -29.789  1.00 61.61  ? 32  LYS A N     1 
ATOM   196  C CA    . LYS A 1 38  ? 21.919  3.837   -29.911  1.00 59.88  ? 32  LYS A CA    1 
ATOM   197  C C     . LYS A 1 38  ? 21.428  3.714   -31.365  1.00 65.27  ? 32  LYS A C     1 
ATOM   198  O O     . LYS A 1 38  ? 20.914  4.696   -31.932  1.00 67.22  ? 32  LYS A O     1 
ATOM   199  C CB    . LYS A 1 38  ? 20.751  3.908   -28.931  1.00 59.92  ? 32  LYS A CB    1 
ATOM   200  N N     . LYS A 1 39  ? 21.697  2.517   -31.964  1.00 59.08  ? 33  LYS A N     1 
ATOM   201  C CA    . LYS A 1 39  ? 21.371  2.038   -33.316  1.00 55.92  ? 33  LYS A CA    1 
ATOM   202  C C     . LYS A 1 39  ? 19.912  1.567   -33.288  1.00 59.14  ? 33  LYS A C     1 
ATOM   203  O O     . LYS A 1 39  ? 19.024  2.293   -33.744  1.00 59.83  ? 33  LYS A O     1 
ATOM   204  C CB    . LYS A 1 39  ? 22.334  0.882   -33.678  1.00 56.18  ? 33  LYS A CB    1 
ATOM   205  C CG    . LYS A 1 39  ? 22.108  0.163   -34.989  1.00 48.03  ? 33  LYS A CG    1 
ATOM   206  C CD    . LYS A 1 39  ? 23.209  -0.874  -35.189  1.00 56.39  ? 33  LYS A CD    1 
ATOM   207  C CE    . LYS A 1 39  ? 23.085  -1.630  -36.493  1.00 75.08  ? 33  LYS A CE    1 
ATOM   208  N NZ    . LYS A 1 39  ? 23.995  -2.808  -36.572  1.00 84.71  ? 33  LYS A NZ    1 
ATOM   209  N N     . HIS A 1 40  ? 19.666  0.395   -32.688  1.00 53.45  ? 34  HIS A N     1 
ATOM   210  C CA    . HIS A 1 40  ? 18.334  -0.182  -32.544  1.00 51.78  ? 34  HIS A CA    1 
ATOM   211  C C     . HIS A 1 40  ? 17.570  0.508   -31.430  1.00 55.69  ? 34  HIS A C     1 
ATOM   212  O O     . HIS A 1 40  ? 18.052  0.594   -30.302  1.00 57.04  ? 34  HIS A O     1 
ATOM   213  C CB    . HIS A 1 40  ? 18.408  -1.695  -32.222  1.00 52.51  ? 34  HIS A CB    1 
ATOM   214  C CG    . HIS A 1 40  ? 19.176  -2.512  -33.210  1.00 55.30  ? 34  HIS A CG    1 
ATOM   215  N ND1   . HIS A 1 40  ? 18.645  -2.841  -34.451  1.00 55.65  ? 34  HIS A ND1   1 
ATOM   216  C CD2   . HIS A 1 40  ? 20.400  -3.075  -33.094  1.00 57.58  ? 34  HIS A CD2   1 
ATOM   217  C CE1   . HIS A 1 40  ? 19.575  -3.559  -35.058  1.00 55.13  ? 34  HIS A CE1   1 
ATOM   218  N NE2   . HIS A 1 40  ? 20.645  -3.740  -34.272  1.00 56.74  ? 34  HIS A NE2   1 
ATOM   219  N N     . GLN A 1 41  ? 16.362  0.964   -31.743  1.00 50.74  ? 35  GLN A N     1 
ATOM   220  C CA    . GLN A 1 41  ? 15.400  1.547   -30.805  1.00 49.99  ? 35  GLN A CA    1 
ATOM   221  C C     . GLN A 1 41  ? 14.008  1.133   -31.259  1.00 54.75  ? 35  GLN A C     1 
ATOM   222  O O     . GLN A 1 41  ? 13.779  0.947   -32.454  1.00 53.54  ? 35  GLN A O     1 
ATOM   223  C CB    . GLN A 1 41  ? 15.511  3.078   -30.736  1.00 50.58  ? 35  GLN A CB    1 
ATOM   224  C CG    . GLN A 1 41  ? 16.740  3.578   -30.000  1.00 58.51  ? 35  GLN A CG    1 
ATOM   225  C CD    . GLN A 1 41  ? 16.818  5.076   -29.952  1.00 74.21  ? 35  GLN A CD    1 
ATOM   226  O OE1   . GLN A 1 41  ? 16.419  5.713   -28.962  1.00 57.03  ? 35  GLN A OE1   1 
ATOM   227  N NE2   . GLN A 1 41  ? 17.355  5.667   -31.023  1.00 77.97  ? 35  GLN A NE2   1 
ATOM   228  N N     . THR A 1 42  ? 13.077  0.988   -30.314  1.00 53.40  ? 36  THR A N     1 
ATOM   229  C CA    . THR A 1 42  ? 11.691  0.615   -30.615  1.00 52.06  ? 36  THR A CA    1 
ATOM   230  C C     . THR A 1 42  ? 10.728  1.555   -29.934  1.00 56.20  ? 36  THR A C     1 
ATOM   231  O O     . THR A 1 42  ? 10.870  1.829   -28.737  1.00 56.14  ? 36  THR A O     1 
ATOM   232  C CB    . THR A 1 42  ? 11.426  -0.861  -30.265  1.00 61.00  ? 36  THR A CB    1 
ATOM   233  O OG1   . THR A 1 42  ? 12.232  -1.670  -31.116  1.00 67.24  ? 36  THR A OG1   1 
ATOM   234  C CG2   . THR A 1 42  ? 9.967   -1.271  -30.434  1.00 55.41  ? 36  THR A CG2   1 
ATOM   235  N N     . LEU A 1 43  ? 9.775   2.080   -30.716  1.00 53.03  ? 37  LEU A N     1 
ATOM   236  C CA    . LEU A 1 43  ? 8.688   2.893   -30.192  1.00 53.39  ? 37  LEU A CA    1 
ATOM   237  C C     . LEU A 1 43  ? 7.469   1.974   -30.114  1.00 58.94  ? 37  LEU A C     1 
ATOM   238  O O     . LEU A 1 43  ? 6.989   1.470   -31.150  1.00 56.78  ? 37  LEU A O     1 
ATOM   239  C CB    . LEU A 1 43  ? 8.382   4.153   -31.026  1.00 52.32  ? 37  LEU A CB    1 
ATOM   240  C CG    . LEU A 1 43  ? 7.239   5.028   -30.481  1.00 56.36  ? 37  LEU A CG    1 
ATOM   241  C CD1   . LEU A 1 43  ? 7.687   5.896   -29.293  1.00 57.31  ? 37  LEU A CD1   1 
ATOM   242  C CD2   . LEU A 1 43  ? 6.640   5.873   -31.572  1.00 57.63  ? 37  LEU A CD2   1 
ATOM   243  N N     . LEU A 1 44  ? 7.037   1.685   -28.865  1.00 57.56  ? 38  LEU A N     1 
ATOM   244  C CA    . LEU A 1 44  ? 5.856   0.874   -28.612  1.00 57.55  ? 38  LEU A CA    1 
ATOM   245  C C     . LEU A 1 44  ? 4.754   1.882   -28.552  1.00 65.41  ? 38  LEU A C     1 
ATOM   246  O O     . LEU A 1 44  ? 4.497   2.468   -27.499  1.00 67.23  ? 38  LEU A O     1 
ATOM   247  C CB    . LEU A 1 44  ? 5.943   0.083   -27.299  1.00 57.97  ? 38  LEU A CB    1 
ATOM   248  C CG    . LEU A 1 44  ? 5.018   -1.130  -27.212  1.00 60.97  ? 38  LEU A CG    1 
ATOM   249  C CD1   . LEU A 1 44  ? 5.635   -2.192  -26.347  1.00 62.42  ? 38  LEU A CD1   1 
ATOM   250  C CD2   . LEU A 1 44  ? 3.648   -0.763  -26.672  1.00 60.19  ? 38  LEU A CD2   1 
ATOM   251  N N     . GLY A 1 45  ? 4.170   2.137   -29.708  1.00 62.41  ? 39  GLY A N     1 
ATOM   252  C CA    . GLY A 1 45  ? 3.115   3.117   -29.846  1.00 63.17  ? 39  GLY A CA    1 
ATOM   253  C C     . GLY A 1 45  ? 1.792   2.454   -30.113  1.00 69.73  ? 39  GLY A C     1 
ATOM   254  O O     . GLY A 1 45  ? 1.639   1.760   -31.124  1.00 68.03  ? 39  GLY A O     1 
ATOM   255  N N     . ALA A 1 46  ? 0.825   2.673   -29.201  1.00 69.51  ? 40  ALA A N     1 
ATOM   256  C CA    . ALA A 1 46  ? -0.531  2.164   -29.346  1.00 70.04  ? 40  ALA A CA    1 
ATOM   257  C C     . ALA A 1 46  ? -1.242  2.926   -30.517  1.00 74.70  ? 40  ALA A C     1 
ATOM   258  O O     . ALA A 1 46  ? -0.832  4.042   -30.873  1.00 74.31  ? 40  ALA A O     1 
ATOM   259  C CB    . ALA A 1 46  ? -1.276  2.351   -28.038  1.00 71.76  ? 40  ALA A CB    1 
ATOM   260  N N     . THR A 1 47  ? -2.259  2.313   -31.141  1.00 71.05  ? 41  THR A N     1 
ATOM   261  C CA    . THR A 1 47  ? -2.975  2.995   -32.222  1.00 70.56  ? 41  THR A CA    1 
ATOM   262  C C     . THR A 1 47  ? -3.885  4.064   -31.613  1.00 74.02  ? 41  THR A C     1 
ATOM   263  O O     . THR A 1 47  ? -4.711  3.756   -30.743  1.00 74.88  ? 41  THR A O     1 
ATOM   264  C CB    . THR A 1 47  ? -3.720  2.016   -33.151  1.00 83.57  ? 41  THR A CB    1 
ATOM   265  O OG1   . THR A 1 47  ? -4.708  1.303   -32.411  1.00 86.56  ? 41  THR A OG1   1 
ATOM   266  C CG2   . THR A 1 47  ? -2.780  1.050   -33.880  1.00 81.66  ? 41  THR A CG2   1 
ATOM   267  N N     . GLY A 1 48  ? -3.668  5.311   -32.028  1.00 68.23  ? 42  GLY A N     1 
ATOM   268  C CA    . GLY A 1 48  ? -4.416  6.468   -31.539  1.00 66.82  ? 42  GLY A CA    1 
ATOM   269  C C     . GLY A 1 48  ? -3.574  7.486   -30.794  1.00 66.35  ? 42  GLY A C     1 
ATOM   270  O O     . GLY A 1 48  ? -4.081  8.539   -30.413  1.00 66.17  ? 42  GLY A O     1 
ATOM   271  N N     . THR A 1 49  ? -2.282  7.188   -30.606  1.00 61.30  ? 43  THR A N     1 
ATOM   272  C CA    . THR A 1 49  ? -1.316  8.037   -29.911  1.00 62.16  ? 43  THR A CA    1 
ATOM   273  C C     . THR A 1 49  ? -0.559  9.044   -30.816  1.00 65.95  ? 43  THR A C     1 
ATOM   274  O O     . THR A 1 49  ? 0.195   9.857   -30.290  1.00 68.71  ? 43  THR A O     1 
ATOM   275  C CB    . THR A 1 49  ? -0.352  7.184   -29.058  1.00 74.56  ? 43  THR A CB    1 
ATOM   276  O OG1   . THR A 1 49  ? 0.543   6.474   -29.924  1.00 73.73  ? 43  THR A OG1   1 
ATOM   277  C CG2   . THR A 1 49  ? -1.076  6.235   -28.099  1.00 74.47  ? 43  THR A CG2   1 
ATOM   278  N N     . GLY A 1 50  ? -0.774  9.005   -32.133  1.00 58.75  ? 44  GLY A N     1 
ATOM   279  C CA    . GLY A 1 50  ? -0.117  9.902   -33.080  1.00 56.95  ? 44  GLY A CA    1 
ATOM   280  C C     . GLY A 1 50  ? 1.336   9.532   -33.301  1.00 58.53  ? 44  GLY A C     1 
ATOM   281  O O     . GLY A 1 50  ? 2.234   10.346  -33.052  1.00 58.36  ? 44  GLY A O     1 
ATOM   282  N N     . LYS A 1 51  ? 1.566   8.281   -33.760  1.00 52.71  ? 45  LYS A N     1 
ATOM   283  C CA    . LYS A 1 51  ? 2.882   7.708   -34.036  1.00 51.72  ? 45  LYS A CA    1 
ATOM   284  C C     . LYS A 1 51  ? 3.671   8.557   -35.050  1.00 54.81  ? 45  LYS A C     1 
ATOM   285  O O     . LYS A 1 51  ? 4.818   8.926   -34.764  1.00 56.50  ? 45  LYS A O     1 
ATOM   286  C CB    . LYS A 1 51  ? 2.761   6.232   -34.483  1.00 53.57  ? 45  LYS A CB    1 
ATOM   287  C CG    . LYS A 1 51  ? 2.318   5.260   -33.381  1.00 67.45  ? 45  LYS A CG    1 
ATOM   288  C CD    . LYS A 1 51  ? 1.193   4.323   -33.815  1.00 74.74  ? 45  LYS A CD    1 
ATOM   289  C CE    . LYS A 1 51  ? 1.674   2.955   -34.239  1.00 82.27  ? 45  LYS A CE    1 
ATOM   290  N NZ    . LYS A 1 51  ? 0.567   1.952   -34.284  1.00 88.78  ? 45  LYS A NZ    1 
ATOM   291  N N     . THR A 1 52  ? 3.039   8.925   -36.194  1.00 47.96  ? 46  THR A N     1 
ATOM   292  C CA    . THR A 1 52  ? 3.654   9.738   -37.254  1.00 46.46  ? 46  THR A CA    1 
ATOM   293  C C     . THR A 1 52  ? 4.141   11.091  -36.735  1.00 49.33  ? 46  THR A C     1 
ATOM   294  O O     . THR A 1 52  ? 5.272   11.489  -37.031  1.00 49.67  ? 46  THR A O     1 
ATOM   295  C CB    . THR A 1 52  ? 2.727   9.823   -38.474  1.00 53.23  ? 46  THR A CB    1 
ATOM   296  O OG1   . THR A 1 52  ? 2.540   8.504   -38.987  1.00 55.37  ? 46  THR A OG1   1 
ATOM   297  C CG2   . THR A 1 52  ? 3.273   10.723  -39.586  1.00 48.91  ? 46  THR A CG2   1 
ATOM   298  N N     . PHE A 1 53  ? 3.315   11.747  -35.904  1.00 44.50  ? 47  PHE A N     1 
ATOM   299  C CA    . PHE A 1 53  ? 3.684   13.017  -35.304  1.00 44.60  ? 47  PHE A CA    1 
ATOM   300  C C     . PHE A 1 53  ? 4.889   12.862  -34.362  1.00 48.93  ? 47  PHE A C     1 
ATOM   301  O O     . PHE A 1 53  ? 5.812   13.674  -34.441  1.00 50.09  ? 47  PHE A O     1 
ATOM   302  C CB    . PHE A 1 53  ? 2.485   13.707  -34.649  1.00 46.79  ? 47  PHE A CB    1 
ATOM   303  C CG    . PHE A 1 53  ? 2.764   15.092  -34.105  1.00 49.65  ? 47  PHE A CG    1 
ATOM   304  C CD1   . PHE A 1 53  ? 3.169   16.122  -34.944  1.00 52.81  ? 47  PHE A CD1   1 
ATOM   305  C CD2   . PHE A 1 53  ? 2.596   15.374  -32.757  1.00 53.09  ? 47  PHE A CD2   1 
ATOM   306  C CE1   . PHE A 1 53  ? 3.427   17.398  -34.440  1.00 54.52  ? 47  PHE A CE1   1 
ATOM   307  C CE2   . PHE A 1 53  ? 2.817   16.660  -32.262  1.00 57.04  ? 47  PHE A CE2   1 
ATOM   308  C CZ    . PHE A 1 53  ? 3.238   17.660  -33.107  1.00 55.09  ? 47  PHE A CZ    1 
ATOM   309  N N     . THR A 1 54  ? 4.943   11.788  -33.551  1.00 44.00  ? 48  THR A N     1 
ATOM   310  C CA    . THR A 1 54  ? 6.115   11.549  -32.693  1.00 44.07  ? 48  THR A CA    1 
ATOM   311  C C     . THR A 1 54  ? 7.349   11.421  -33.595  1.00 47.14  ? 48  THR A C     1 
ATOM   312  O O     . THR A 1 54  ? 8.356   12.123  -33.395  1.00 46.74  ? 48  THR A O     1 
ATOM   313  C CB    . THR A 1 54  ? 5.889   10.310  -31.817  1.00 46.39  ? 48  THR A CB    1 
ATOM   314  O OG1   . THR A 1 54  ? 5.060   10.695  -30.732  1.00 52.06  ? 48  THR A OG1   1 
ATOM   315  C CG2   . THR A 1 54  ? 7.164   9.734   -31.255  1.00 38.28  ? 48  THR A CG2   1 
ATOM   316  N N     . VAL A 1 55  ? 7.218   10.569  -34.634  1.00 41.74  ? 49  VAL A N     1 
ATOM   317  C CA    . VAL A 1 55  ? 8.274   10.303  -35.603  1.00 40.87  ? 49  VAL A CA    1 
ATOM   318  C C     . VAL A 1 55  ? 8.752   11.607  -36.288  1.00 45.19  ? 49  VAL A C     1 
ATOM   319  O O     . VAL A 1 55  ? 9.960   11.846  -36.381  1.00 43.74  ? 49  VAL A O     1 
ATOM   320  C CB    . VAL A 1 55  ? 7.842   9.178   -36.581  1.00 42.04  ? 49  VAL A CB    1 
ATOM   321  C CG1   . VAL A 1 55  ? 8.781   9.074   -37.780  1.00 40.71  ? 49  VAL A CG1   1 
ATOM   322  C CG2   . VAL A 1 55  ? 7.781   7.848   -35.848  1.00 41.69  ? 49  VAL A CG2   1 
ATOM   323  N N     . SER A 1 56  ? 7.792   12.465  -36.684  1.00 41.92  ? 50  SER A N     1 
ATOM   324  C CA    . SER A 1 56  ? 8.058   13.726  -37.348  1.00 42.38  ? 50  SER A CA    1 
ATOM   325  C C     . SER A 1 56  ? 8.863   14.635  -36.446  1.00 51.15  ? 50  SER A C     1 
ATOM   326  O O     . SER A 1 56  ? 9.807   15.285  -36.921  1.00 52.28  ? 50  SER A O     1 
ATOM   327  C CB    . SER A 1 56  ? 6.756   14.387  -37.768  1.00 44.10  ? 50  SER A CB    1 
ATOM   328  O OG    . SER A 1 56  ? 6.054   13.518  -38.635  1.00 48.80  ? 50  SER A OG    1 
ATOM   329  N N     . ASN A 1 57  ? 8.531   14.645  -35.140  1.00 49.19  ? 51  ASN A N     1 
ATOM   330  C CA    . ASN A 1 57  ? 9.261   15.442  -34.160  1.00 50.93  ? 51  ASN A CA    1 
ATOM   331  C C     . ASN A 1 57  ? 10.702  14.929  -34.056  1.00 54.87  ? 51  ASN A C     1 
ATOM   332  O O     . ASN A 1 57  ? 11.614  15.739  -34.163  1.00 54.96  ? 51  ASN A O     1 
ATOM   333  C CB    . ASN A 1 57  ? 8.549   15.471  -32.801  1.00 54.44  ? 51  ASN A CB    1 
ATOM   334  C CG    . ASN A 1 57  ? 7.472   16.533  -32.687  1.00 65.84  ? 51  ASN A CG    1 
ATOM   335  O OD1   . ASN A 1 57  ? 7.734   17.687  -32.308  1.00 64.91  ? 51  ASN A OD1   1 
ATOM   336  N ND2   . ASN A 1 57  ? 6.235   16.161  -32.986  1.00 44.75  ? 51  ASN A ND2   1 
ATOM   337  N N     . LEU A 1 58  ? 10.903  13.589  -33.980  1.00 50.80  ? 52  LEU A N     1 
ATOM   338  C CA    . LEU A 1 58  ? 12.221  12.936  -33.971  1.00 50.35  ? 52  LEU A CA    1 
ATOM   339  C C     . LEU A 1 58  ? 13.023  13.279  -35.258  1.00 54.67  ? 52  LEU A C     1 
ATOM   340  O O     . LEU A 1 58  ? 14.184  13.666  -35.143  1.00 55.05  ? 52  LEU A O     1 
ATOM   341  C CB    . LEU A 1 58  ? 12.050  11.412  -33.821  1.00 48.98  ? 52  LEU A CB    1 
ATOM   342  C CG    . LEU A 1 58  ? 13.252  10.535  -34.159  1.00 52.22  ? 52  LEU A CG    1 
ATOM   343  C CD1   . LEU A 1 58  ? 14.214  10.453  -32.993  1.00 54.00  ? 52  LEU A CD1   1 
ATOM   344  C CD2   . LEU A 1 58  ? 12.796  9.154   -34.570  1.00 51.16  ? 52  LEU A CD2   1 
ATOM   345  N N     . ILE A 1 59  ? 12.388  13.175  -36.460  1.00 50.45  ? 53  ILE A N     1 
ATOM   346  C CA    . ILE A 1 59  ? 13.009  13.489  -37.755  1.00 50.13  ? 53  ILE A CA    1 
ATOM   347  C C     . ILE A 1 59  ? 13.573  14.926  -37.765  1.00 57.64  ? 53  ILE A C     1 
ATOM   348  O O     . ILE A 1 59  ? 14.688  15.144  -38.251  1.00 58.58  ? 53  ILE A O     1 
ATOM   349  C CB    . ILE A 1 59  ? 12.046  13.255  -38.952  1.00 51.27  ? 53  ILE A CB    1 
ATOM   350  C CG1   . ILE A 1 59  ? 11.686  11.778  -39.150  1.00 49.79  ? 53  ILE A CG1   1 
ATOM   351  C CG2   . ILE A 1 59  ? 12.651  13.802  -40.252  1.00 51.77  ? 53  ILE A CG2   1 
ATOM   352  C CD1   . ILE A 1 59  ? 10.555  11.570  -40.182  1.00 50.03  ? 53  ILE A CD1   1 
ATOM   353  N N     . LYS A 1 60  ? 12.809  15.887  -37.214  1.00 55.10  ? 54  LYS A N     1 
ATOM   354  C CA    . LYS A 1 60  ? 13.192  17.295  -37.123  1.00 56.35  ? 54  LYS A CA    1 
ATOM   355  C C     . LYS A 1 60  ? 14.385  17.481  -36.172  1.00 63.00  ? 54  LYS A C     1 
ATOM   356  O O     . LYS A 1 60  ? 15.385  18.071  -36.582  1.00 64.07  ? 54  LYS A O     1 
ATOM   357  C CB    . LYS A 1 60  ? 11.976  18.140  -36.687  1.00 58.98  ? 54  LYS A CB    1 
ATOM   358  C CG    . LYS A 1 60  ? 12.223  19.636  -36.474  1.00 64.57  ? 54  LYS A CG    1 
ATOM   359  C CD    . LYS A 1 60  ? 11.108  20.267  -35.636  1.00 68.79  ? 54  LYS A CD    1 
ATOM   360  C CE    . LYS A 1 60  ? 11.225  19.946  -34.157  1.00 74.10  ? 54  LYS A CE    1 
ATOM   361  N NZ    . LYS A 1 60  ? 9.908   19.950  -33.464  1.00 79.59  ? 54  LYS A NZ    1 
ATOM   362  N N     . GLU A 1 61  ? 14.290  16.959  -34.928  1.00 60.06  ? 55  GLU A N     1 
ATOM   363  C CA    . GLU A 1 61  ? 15.329  17.090  -33.905  1.00 61.43  ? 55  GLU A CA    1 
ATOM   364  C C     . GLU A 1 61  ? 16.670  16.496  -34.313  1.00 64.97  ? 55  GLU A C     1 
ATOM   365  O O     . GLU A 1 61  ? 17.702  17.144  -34.106  1.00 66.81  ? 55  GLU A O     1 
ATOM   366  C CB    . GLU A 1 61  ? 14.905  16.486  -32.557  1.00 63.53  ? 55  GLU A CB    1 
ATOM   367  C CG    . GLU A 1 61  ? 13.459  16.670  -32.120  1.00 80.13  ? 55  GLU A CG    1 
ATOM   368  C CD    . GLU A 1 61  ? 12.946  18.034  -31.687  1.00 116.85 ? 55  GLU A CD    1 
ATOM   369  O OE1   . GLU A 1 61  ? 11.842  18.077  -31.093  1.00 105.47 ? 55  GLU A OE1   1 
ATOM   370  O OE2   . GLU A 1 61  ? 13.615  19.056  -31.967  1.00 124.20 ? 55  GLU A OE2   1 
ATOM   371  N N     . VAL A 1 62  ? 16.665  15.275  -34.879  1.00 58.20  ? 56  VAL A N     1 
ATOM   372  C CA    . VAL A 1 62  ? 17.903  14.581  -35.253  1.00 57.13  ? 56  VAL A CA    1 
ATOM   373  C C     . VAL A 1 62  ? 18.549  15.083  -36.538  1.00 61.09  ? 56  VAL A C     1 
ATOM   374  O O     . VAL A 1 62  ? 19.754  14.887  -36.715  1.00 61.31  ? 56  VAL A O     1 
ATOM   375  C CB    . VAL A 1 62  ? 17.832  13.027  -35.175  1.00 59.19  ? 56  VAL A CB    1 
ATOM   376  C CG1   . VAL A 1 62  ? 17.356  12.557  -33.811  1.00 58.97  ? 56  VAL A CG1   1 
ATOM   377  C CG2   . VAL A 1 62  ? 16.980  12.428  -36.297  1.00 57.28  ? 56  VAL A CG2   1 
ATOM   378  N N     . ASN A 1 63  ? 17.751  15.718  -37.429  1.00 57.49  ? 57  ASN A N     1 
ATOM   379  C CA    . ASN A 1 63  ? 18.152  16.249  -38.748  1.00 57.56  ? 57  ASN A CA    1 
ATOM   380  C C     . ASN A 1 63  ? 19.093  15.333  -39.548  1.00 62.16  ? 57  ASN A C     1 
ATOM   381  O O     . ASN A 1 63  ? 20.301  15.585  -39.628  1.00 62.98  ? 57  ASN A O     1 
ATOM   382  C CB    . ASN A 1 63  ? 18.680  17.670  -38.661  1.00 58.76  ? 57  ASN A CB    1 
ATOM   383  C CG    . ASN A 1 63  ? 18.167  18.519  -39.786  1.00 88.91  ? 57  ASN A CG    1 
ATOM   384  O OD1   . ASN A 1 63  ? 17.018  18.979  -39.770  1.00 82.30  ? 57  ASN A OD1   1 
ATOM   385  N ND2   . ASN A 1 63  ? 18.990  18.699  -40.811  1.00 87.08  ? 57  ASN A ND2   1 
ATOM   386  N N     . LYS A 1 64  ? 18.527  14.242  -40.097  1.00 56.63  ? 58  LYS A N     1 
ATOM   387  C CA    . LYS A 1 64  ? 19.263  13.214  -40.832  1.00 55.16  ? 58  LYS A CA    1 
ATOM   388  C C     . LYS A 1 64  ? 18.375  12.704  -41.958  1.00 56.22  ? 58  LYS A C     1 
ATOM   389  O O     . LYS A 1 64  ? 17.168  12.502  -41.718  1.00 54.61  ? 58  LYS A O     1 
ATOM   390  C CB    . LYS A 1 64  ? 19.584  12.043  -39.882  1.00 58.21  ? 58  LYS A CB    1 
ATOM   391  C CG    . LYS A 1 64  ? 21.017  11.528  -39.918  1.00 69.61  ? 58  LYS A CG    1 
ATOM   392  C CD    . LYS A 1 64  ? 21.201  10.248  -39.063  1.00 72.27  ? 58  LYS A CD    1 
ATOM   393  C CE    . LYS A 1 64  ? 21.417  10.482  -37.589  1.00 74.88  ? 58  LYS A CE    1 
ATOM   394  N NZ    . LYS A 1 64  ? 22.823  10.851  -37.277  1.00 83.94  ? 58  LYS A NZ    1 
ATOM   395  N N     . PRO A 1 65  ? 18.941  12.469  -43.184  1.00 51.27  ? 59  PRO A N     1 
ATOM   396  C CA    . PRO A 1 65  ? 18.124  11.924  -44.281  1.00 49.32  ? 59  PRO A CA    1 
ATOM   397  C C     . PRO A 1 65  ? 17.417  10.662  -43.785  1.00 51.76  ? 59  PRO A C     1 
ATOM   398  O O     . PRO A 1 65  ? 18.047  9.815   -43.143  1.00 53.79  ? 59  PRO A O     1 
ATOM   399  C CB    . PRO A 1 65  ? 19.160  11.601  -45.366  1.00 50.73  ? 59  PRO A CB    1 
ATOM   400  C CG    . PRO A 1 65  ? 20.283  12.453  -45.086  1.00 55.83  ? 59  PRO A CG    1 
ATOM   401  C CD    . PRO A 1 65  ? 20.347  12.612  -43.605  1.00 52.70  ? 59  PRO A CD    1 
ATOM   402  N N     . THR A 1 66  ? 16.108  10.581  -43.981  1.00 44.67  ? 60  THR A N     1 
ATOM   403  C CA    . THR A 1 66  ? 15.386  9.447   -43.453  1.00 43.04  ? 60  THR A CA    1 
ATOM   404  C C     . THR A 1 66  ? 14.674  8.557   -44.472  1.00 41.46  ? 60  THR A C     1 
ATOM   405  O O     . THR A 1 66  ? 14.288  9.009   -45.560  1.00 40.15  ? 60  THR A O     1 
ATOM   406  C CB    . THR A 1 66  ? 14.589  9.862   -42.208  1.00 60.74  ? 60  THR A CB    1 
ATOM   407  O OG1   . THR A 1 66  ? 14.646  8.819   -41.240  1.00 67.18  ? 60  THR A OG1   1 
ATOM   408  C CG2   . THR A 1 66  ? 13.144  10.208  -42.514  1.00 61.04  ? 60  THR A CG2   1 
ATOM   409  N N     . LEU A 1 67  ? 14.504  7.279   -44.090  1.00 34.95  ? 61  LEU A N     1 
ATOM   410  C CA    . LEU A 1 67  ? 13.821  6.262   -44.884  1.00 32.61  ? 61  LEU A CA    1 
ATOM   411  C C     . LEU A 1 67  ? 12.742  5.606   -44.038  1.00 36.47  ? 61  LEU A C     1 
ATOM   412  O O     . LEU A 1 67  ? 13.046  5.074   -42.963  1.00 36.70  ? 61  LEU A O     1 
ATOM   413  C CB    . LEU A 1 67  ? 14.818  5.216   -45.410  1.00 31.62  ? 61  LEU A CB    1 
ATOM   414  C CG    . LEU A 1 67  ? 14.231  4.091   -46.218  1.00 34.00  ? 61  LEU A CG    1 
ATOM   415  C CD1   . LEU A 1 67  ? 13.800  4.545   -47.575  1.00 33.15  ? 61  LEU A CD1   1 
ATOM   416  C CD2   . LEU A 1 67  ? 15.213  2.996   -46.342  1.00 37.19  ? 61  LEU A CD2   1 
ATOM   417  N N     . VAL A 1 68  ? 11.477  5.672   -44.514  1.00 31.34  ? 62  VAL A N     1 
ATOM   418  C CA    . VAL A 1 68  ? 10.331  5.085   -43.821  1.00 29.93  ? 62  VAL A CA    1 
ATOM   419  C C     . VAL A 1 68  ? 9.907   3.837   -44.579  1.00 34.49  ? 62  VAL A C     1 
ATOM   420  O O     . VAL A 1 68  ? 9.591   3.910   -45.767  1.00 33.97  ? 62  VAL A O     1 
ATOM   421  C CB    . VAL A 1 68  ? 9.165   6.078   -43.626  1.00 32.81  ? 62  VAL A CB    1 
ATOM   422  C CG1   . VAL A 1 68  ? 8.117   5.512   -42.680  1.00 32.28  ? 62  VAL A CG1   1 
ATOM   423  C CG2   . VAL A 1 68  ? 9.665   7.420   -43.109  1.00 33.42  ? 62  VAL A CG2   1 
ATOM   424  N N     . ILE A 1 69  ? 9.946   2.682   -43.918  1.00 31.71  ? 63  ILE A N     1 
ATOM   425  C CA    . ILE A 1 69  ? 9.542   1.460   -44.604  1.00 31.04  ? 63  ILE A CA    1 
ATOM   426  C C     . ILE A 1 69  ? 8.147   1.017   -44.135  1.00 38.87  ? 63  ILE A C     1 
ATOM   427  O O     . ILE A 1 69  ? 7.899   0.932   -42.922  1.00 38.36  ? 63  ILE A O     1 
ATOM   428  C CB    . ILE A 1 69  ? 10.606  0.326   -44.567  1.00 32.42  ? 63  ILE A CB    1 
ATOM   429  C CG1   . ILE A 1 69  ? 12.019  0.880   -44.870  1.00 32.13  ? 63  ILE A CG1   1 
ATOM   430  C CG2   . ILE A 1 69  ? 10.212  -0.784  -45.545  1.00 30.39  ? 63  ILE A CG2   1 
ATOM   431  C CD1   . ILE A 1 69  ? 13.213  -0.121  -44.914  1.00 32.87  ? 63  ILE A CD1   1 
ATOM   432  N N     . ALA A 1 70  ? 7.224   0.806   -45.107  1.00 36.96  ? 64  ALA A N     1 
ATOM   433  C CA    . ALA A 1 70  ? 5.859   0.321   -44.866  1.00 36.71  ? 64  ALA A CA    1 
ATOM   434  C C     . ALA A 1 70  ? 5.720   -1.068  -45.500  1.00 43.58  ? 64  ALA A C     1 
ATOM   435  O O     . ALA A 1 70  ? 6.331   -1.346  -46.550  1.00 43.29  ? 64  ALA A O     1 
ATOM   436  C CB    . ALA A 1 70  ? 4.833   1.274   -45.448  1.00 36.45  ? 64  ALA A CB    1 
ATOM   437  N N     . HIS A 1 71  ? 4.942   -1.945  -44.847  1.00 41.60  ? 65  HIS A N     1 
ATOM   438  C CA    . HIS A 1 71  ? 4.758   -3.315  -45.312  1.00 42.54  ? 65  HIS A CA    1 
ATOM   439  C C     . HIS A 1 71  ? 3.752   -3.465  -46.459  1.00 44.81  ? 65  HIS A C     1 
ATOM   440  O O     . HIS A 1 71  ? 3.613   -4.567  -47.015  1.00 46.23  ? 65  HIS A O     1 
ATOM   441  C CB    . HIS A 1 71  ? 4.497   -4.291  -44.144  1.00 44.85  ? 65  HIS A CB    1 
ATOM   442  C CG    . HIS A 1 71  ? 3.143   -4.163  -43.534  1.00 48.95  ? 65  HIS A CG    1 
ATOM   443  N ND1   . HIS A 1 71  ? 2.055   -4.862  -44.042  1.00 50.45  ? 65  HIS A ND1   1 
ATOM   444  C CD2   . HIS A 1 71  ? 2.740   -3.417  -42.476  1.00 51.95  ? 65  HIS A CD2   1 
ATOM   445  C CE1   . HIS A 1 71  ? 1.033   -4.529  -43.274  1.00 50.74  ? 65  HIS A CE1   1 
ATOM   446  N NE2   . HIS A 1 71  ? 1.393   -3.657  -42.318  1.00 51.74  ? 65  HIS A NE2   1 
ATOM   447  N N     . ASN A 1 72  ? 3.042   -2.368  -46.803  1.00 37.37  ? 66  ASN A N     1 
ATOM   448  C CA    . ASN A 1 72  ? 2.103   -2.312  -47.929  1.00 35.54  ? 66  ASN A CA    1 
ATOM   449  C C     . ASN A 1 72  ? 1.978   -0.898  -48.484  1.00 38.72  ? 66  ASN A C     1 
ATOM   450  O O     . ASN A 1 72  ? 2.170   0.067   -47.743  1.00 39.48  ? 66  ASN A O     1 
ATOM   451  C CB    . ASN A 1 72  ? 0.730   -2.968  -47.630  1.00 32.79  ? 66  ASN A CB    1 
ATOM   452  C CG    . ASN A 1 72  ? -0.202  -2.169  -46.766  1.00 51.68  ? 66  ASN A CG    1 
ATOM   453  O OD1   . ASN A 1 72  ? -0.588  -1.038  -47.083  1.00 41.76  ? 66  ASN A OD1   1 
ATOM   454  N ND2   . ASN A 1 72  ? -0.638  -2.776  -45.682  1.00 47.30  ? 66  ASN A ND2   1 
ATOM   455  N N     . LYS A 1 73  ? 1.618   -0.787  -49.780  1.00 34.35  ? 67  LYS A N     1 
ATOM   456  C CA    . LYS A 1 73  ? 1.458   0.468   -50.518  1.00 34.04  ? 67  LYS A CA    1 
ATOM   457  C C     . LYS A 1 73  ? 0.336   1.351   -50.005  1.00 42.21  ? 67  LYS A C     1 
ATOM   458  O O     . LYS A 1 73  ? 0.464   2.572   -50.065  1.00 43.07  ? 67  LYS A O     1 
ATOM   459  C CB    . LYS A 1 73  ? 1.301   0.208   -52.012  1.00 35.00  ? 67  LYS A CB    1 
ATOM   460  C CG    . LYS A 1 73  ? 2.555   -0.359  -52.662  1.00 33.18  ? 67  LYS A CG    1 
ATOM   461  C CD    . LYS A 1 73  ? 2.403   -0.433  -54.149  1.00 44.94  ? 67  LYS A CD    1 
ATOM   462  C CE    . LYS A 1 73  ? 2.118   -1.810  -54.686  1.00 56.25  ? 67  LYS A CE    1 
ATOM   463  N NZ    . LYS A 1 73  ? 2.629   -1.910  -56.082  1.00 67.86  ? 67  LYS A NZ    1 
ATOM   464  N N     . THR A 1 74  ? -0.759  0.755   -49.490  1.00 41.62  ? 68  THR A N     1 
ATOM   465  C CA    . THR A 1 74  ? -1.890  1.519   -48.927  1.00 42.47  ? 68  THR A CA    1 
ATOM   466  C C     . THR A 1 74  ? -1.397  2.364   -47.754  1.00 47.30  ? 68  THR A C     1 
ATOM   467  O O     . THR A 1 74  ? -1.654  3.569   -47.680  1.00 47.20  ? 68  THR A O     1 
ATOM   468  C CB    . THR A 1 74  ? -3.062  0.569   -48.552  1.00 47.07  ? 68  THR A CB    1 
ATOM   469  O OG1   . THR A 1 74  ? -3.905  0.412   -49.699  1.00 52.22  ? 68  THR A OG1   1 
ATOM   470  C CG2   . THR A 1 74  ? -3.896  1.076   -47.378  1.00 40.77  ? 68  THR A CG2   1 
ATOM   471  N N     . LEU A 1 75  ? -0.650  1.703   -46.866  1.00 44.37  ? 69  LEU A N     1 
ATOM   472  C CA    . LEU A 1 75  ? -0.114  2.255   -45.642  1.00 44.82  ? 69  LEU A CA    1 
ATOM   473  C C     . LEU A 1 75  ? 0.960   3.264   -45.976  1.00 48.47  ? 69  LEU A C     1 
ATOM   474  O O     . LEU A 1 75  ? 0.996   4.329   -45.361  1.00 48.58  ? 69  LEU A O     1 
ATOM   475  C CB    . LEU A 1 75  ? 0.393   1.087   -44.789  1.00 45.30  ? 69  LEU A CB    1 
ATOM   476  C CG    . LEU A 1 75  ? 0.716   1.335   -43.324  1.00 52.80  ? 69  LEU A CG    1 
ATOM   477  C CD1   . LEU A 1 75  ? -0.523  1.330   -42.415  1.00 54.20  ? 69  LEU A CD1   1 
ATOM   478  C CD2   . LEU A 1 75  ? 1.712   0.265   -42.815  1.00 58.71  ? 69  LEU A CD2   1 
ATOM   479  N N     . ALA A 1 76  ? 1.786   2.967   -47.000  1.00 44.78  ? 70  ALA A N     1 
ATOM   480  C CA    . ALA A 1 76  ? 2.850   3.853   -47.485  1.00 44.34  ? 70  ALA A CA    1 
ATOM   481  C C     . ALA A 1 76  ? 2.196   5.139   -48.000  1.00 50.35  ? 70  ALA A C     1 
ATOM   482  O O     . ALA A 1 76  ? 2.621   6.236   -47.620  1.00 52.18  ? 70  ALA A O     1 
ATOM   483  C CB    . ALA A 1 76  ? 3.642   3.178   -48.598  1.00 44.07  ? 70  ALA A CB    1 
ATOM   484  N N     . GLY A 1 77  ? 1.117   4.982   -48.770  1.00 44.82  ? 71  GLY A N     1 
ATOM   485  C CA    . GLY A 1 77  ? 0.362   6.090   -49.332  1.00 44.00  ? 71  GLY A CA    1 
ATOM   486  C C     . GLY A 1 77  ? -0.057  7.082   -48.275  1.00 47.48  ? 71  GLY A C     1 
ATOM   487  O O     . GLY A 1 77  ? 0.266   8.269   -48.388  1.00 48.09  ? 71  GLY A O     1 
ATOM   488  N N     . GLN A 1 78  ? -0.716  6.582   -47.202  1.00 42.45  ? 72  GLN A N     1 
ATOM   489  C CA    . GLN A 1 78  ? -1.193  7.395   -46.076  1.00 41.56  ? 72  GLN A CA    1 
ATOM   490  C C     . GLN A 1 78  ? -0.051  8.123   -45.376  1.00 44.01  ? 72  GLN A C     1 
ATOM   491  O O     . GLN A 1 78  ? -0.201  9.304   -45.051  1.00 44.68  ? 72  GLN A O     1 
ATOM   492  C CB    . GLN A 1 78  ? -1.940  6.555   -45.045  1.00 43.02  ? 72  GLN A CB    1 
ATOM   493  C CG    . GLN A 1 78  ? -3.151  5.795   -45.548  1.00 69.50  ? 72  GLN A CG    1 
ATOM   494  C CD    . GLN A 1 78  ? -3.748  4.964   -44.437  1.00 103.05 ? 72  GLN A CD    1 
ATOM   495  O OE1   . GLN A 1 78  ? -3.055  4.511   -43.496  1.00 101.77 ? 72  GLN A OE1   1 
ATOM   496  N NE2   . GLN A 1 78  ? -5.058  4.759   -44.518  1.00 94.58  ? 72  GLN A NE2   1 
ATOM   497  N N     . LEU A 1 79  ? 1.083   7.423   -45.147  1.00 38.55  ? 73  LEU A N     1 
ATOM   498  C CA    . LEU A 1 79  ? 2.266   7.975   -44.484  1.00 38.12  ? 73  LEU A CA    1 
ATOM   499  C C     . LEU A 1 79  ? 2.859   9.133   -45.263  1.00 43.70  ? 73  LEU A C     1 
ATOM   500  O O     . LEU A 1 79  ? 3.236   10.131  -44.659  1.00 42.59  ? 73  LEU A O     1 
ATOM   501  C CB    . LEU A 1 79  ? 3.323   6.882   -44.266  1.00 37.28  ? 73  LEU A CB    1 
ATOM   502  C CG    . LEU A 1 79  ? 3.091   5.899   -43.113  1.00 39.86  ? 73  LEU A CG    1 
ATOM   503  C CD1   . LEU A 1 79  ? 4.134   4.826   -43.116  1.00 37.99  ? 73  LEU A CD1   1 
ATOM   504  C CD2   . LEU A 1 79  ? 3.093   6.613   -41.769  1.00 43.27  ? 73  LEU A CD2   1 
ATOM   505  N N     . TYR A 1 80  ? 2.906   9.010   -46.607  1.00 42.80  ? 74  TYR A N     1 
ATOM   506  C CA    . TYR A 1 80  ? 3.398   10.051  -47.511  1.00 44.11  ? 74  TYR A CA    1 
ATOM   507  C C     . TYR A 1 80  ? 2.563   11.314  -47.349  1.00 48.50  ? 74  TYR A C     1 
ATOM   508  O O     . TYR A 1 80  ? 3.128   12.381  -47.126  1.00 47.72  ? 74  TYR A O     1 
ATOM   509  C CB    . TYR A 1 80  ? 3.396   9.549   -48.960  1.00 46.09  ? 74  TYR A CB    1 
ATOM   510  C CG    . TYR A 1 80  ? 3.738   10.597  -49.992  1.00 50.55  ? 74  TYR A CG    1 
ATOM   511  C CD1   . TYR A 1 80  ? 5.059   10.916  -50.276  1.00 53.95  ? 74  TYR A CD1   1 
ATOM   512  C CD2   . TYR A 1 80  ? 2.743   11.225  -50.731  1.00 52.32  ? 74  TYR A CD2   1 
ATOM   513  C CE1   . TYR A 1 80  ? 5.383   11.874  -51.240  1.00 57.90  ? 74  TYR A CE1   1 
ATOM   514  C CE2   . TYR A 1 80  ? 3.053   12.172  -51.710  1.00 54.48  ? 74  TYR A CE2   1 
ATOM   515  C CZ    . TYR A 1 80  ? 4.376   12.498  -51.961  1.00 63.89  ? 74  TYR A CZ    1 
ATOM   516  O OH    . TYR A 1 80  ? 4.693   13.443  -52.915  1.00 62.71  ? 74  TYR A OH    1 
ATOM   517  N N     . SER A 1 81  ? 1.223   11.170  -47.382  1.00 46.65  ? 75  SER A N     1 
ATOM   518  C CA    . SER A 1 81  ? 0.250   12.252  -47.178  1.00 48.03  ? 75  SER A CA    1 
ATOM   519  C C     . SER A 1 81  ? 0.523   12.925  -45.846  1.00 51.67  ? 75  SER A C     1 
ATOM   520  O O     . SER A 1 81  ? 0.779   14.127  -45.822  1.00 53.10  ? 75  SER A O     1 
ATOM   521  C CB    . SER A 1 81  ? -1.175  11.708  -47.183  1.00 53.74  ? 75  SER A CB    1 
ATOM   522  O OG    . SER A 1 81  ? -1.344  10.698  -48.166  1.00 68.58  ? 75  SER A OG    1 
ATOM   523  N N     . GLU A 1 82  ? 0.550   12.134  -44.761  1.00 46.42  ? 76  GLU A N     1 
ATOM   524  C CA    . GLU A 1 82  ? 0.842   12.581  -43.402  1.00 47.38  ? 76  GLU A CA    1 
ATOM   525  C C     . GLU A 1 82  ? 2.175   13.356  -43.302  1.00 48.97  ? 76  GLU A C     1 
ATOM   526  O O     . GLU A 1 82  ? 2.201   14.426  -42.691  1.00 49.44  ? 76  GLU A O     1 
ATOM   527  C CB    . GLU A 1 82  ? 0.824   11.384  -42.420  1.00 49.52  ? 76  GLU A CB    1 
ATOM   528  C CG    . GLU A 1 82  ? -0.571  10.888  -42.049  1.00 69.25  ? 76  GLU A CG    1 
ATOM   529  C CD    . GLU A 1 82  ? -0.693  9.500   -41.443  1.00 105.90 ? 76  GLU A CD    1 
ATOM   530  O OE1   . GLU A 1 82  ? -0.169  8.530   -42.040  1.00 110.65 ? 76  GLU A OE1   1 
ATOM   531  O OE2   . GLU A 1 82  ? -1.392  9.371   -40.411  1.00 106.60 ? 76  GLU A OE2   1 
ATOM   532  N N     . PHE A 1 83  ? 3.262   12.848  -43.932  1.00 43.01  ? 77  PHE A N     1 
ATOM   533  C CA    . PHE A 1 83  ? 4.572   13.511  -43.884  1.00 42.24  ? 77  PHE A CA    1 
ATOM   534  C C     . PHE A 1 83  ? 4.663   14.747  -44.757  1.00 47.14  ? 77  PHE A C     1 
ATOM   535  O O     . PHE A 1 83  ? 5.329   15.708  -44.361  1.00 47.07  ? 77  PHE A O     1 
ATOM   536  C CB    . PHE A 1 83  ? 5.738   12.550  -44.163  1.00 42.65  ? 77  PHE A CB    1 
ATOM   537  C CG    . PHE A 1 83  ? 6.105   11.624  -43.022  1.00 42.96  ? 77  PHE A CG    1 
ATOM   538  C CD1   . PHE A 1 83  ? 5.926   10.244  -43.134  1.00 43.97  ? 77  PHE A CD1   1 
ATOM   539  C CD2   . PHE A 1 83  ? 6.640   12.124  -41.844  1.00 44.47  ? 77  PHE A CD2   1 
ATOM   540  C CE1   . PHE A 1 83  ? 6.289   9.385   -42.098  1.00 43.70  ? 77  PHE A CE1   1 
ATOM   541  C CE2   . PHE A 1 83  ? 6.977   11.261  -40.795  1.00 46.85  ? 77  PHE A CE2   1 
ATOM   542  C CZ    . PHE A 1 83  ? 6.805   9.899   -40.933  1.00 43.53  ? 77  PHE A CZ    1 
ATOM   543  N N     . LYS A 1 84  ? 3.982   14.743  -45.927  1.00 43.87  ? 78  LYS A N     1 
ATOM   544  C CA    . LYS A 1 84  ? 3.954   15.892  -46.835  1.00 44.71  ? 78  LYS A CA    1 
ATOM   545  C C     . LYS A 1 84  ? 3.250   17.086  -46.162  1.00 54.33  ? 78  LYS A C     1 
ATOM   546  O O     . LYS A 1 84  ? 3.618   18.236  -46.413  1.00 55.26  ? 78  LYS A O     1 
ATOM   547  C CB    . LYS A 1 84  ? 3.266   15.531  -48.148  1.00 45.23  ? 78  LYS A CB    1 
ATOM   548  C CG    . LYS A 1 84  ? 3.715   16.390  -49.314  1.00 56.69  ? 78  LYS A CG    1 
ATOM   549  C CD    . LYS A 1 84  ? 4.643   15.661  -50.280  1.00 71.35  ? 78  LYS A CD    1 
ATOM   550  C CE    . LYS A 1 84  ? 5.378   16.646  -51.173  1.00 86.62  ? 78  LYS A CE    1 
ATOM   551  N NZ    . LYS A 1 84  ? 6.572   16.050  -51.839  1.00 89.41  ? 78  LYS A NZ    1 
ATOM   552  N N     . GLU A 1 85  ? 2.263   16.805  -45.282  1.00 53.16  ? 79  GLU A N     1 
ATOM   553  C CA    . GLU A 1 85  ? 1.532   17.825  -44.535  1.00 54.67  ? 79  GLU A CA    1 
ATOM   554  C C     . GLU A 1 85  ? 2.422   18.484  -43.464  1.00 59.53  ? 79  GLU A C     1 
ATOM   555  O O     . GLU A 1 85  ? 2.314   19.691  -43.237  1.00 61.79  ? 79  GLU A O     1 
ATOM   556  C CB    . GLU A 1 85  ? 0.270   17.228  -43.905  1.00 56.34  ? 79  GLU A CB    1 
ATOM   557  C CG    . GLU A 1 85  ? -0.741  18.274  -43.462  1.00 78.61  ? 79  GLU A CG    1 
ATOM   558  C CD    . GLU A 1 85  ? -2.004  17.718  -42.832  1.00 123.19 ? 79  GLU A CD    1 
ATOM   559  O OE1   . GLU A 1 85  ? -2.813  17.111  -43.571  1.00 132.60 ? 79  GLU A OE1   1 
ATOM   560  O OE2   . GLU A 1 85  ? -2.190  17.896  -41.605  1.00 121.97 ? 79  GLU A OE2   1 
ATOM   561  N N     . PHE A 1 86  ? 3.296   17.698  -42.822  1.00 53.87  ? 80  PHE A N     1 
ATOM   562  C CA    . PHE A 1 86  ? 4.188   18.182  -41.775  1.00 53.91  ? 80  PHE A CA    1 
ATOM   563  C C     . PHE A 1 86  ? 5.448   18.870  -42.298  1.00 56.17  ? 80  PHE A C     1 
ATOM   564  O O     . PHE A 1 86  ? 5.973   19.756  -41.629  1.00 55.12  ? 80  PHE A O     1 
ATOM   565  C CB    . PHE A 1 86  ? 4.592   17.027  -40.846  1.00 55.77  ? 80  PHE A CB    1 
ATOM   566  C CG    . PHE A 1 86  ? 3.535   16.508  -39.895  1.00 57.87  ? 80  PHE A CG    1 
ATOM   567  C CD1   . PHE A 1 86  ? 2.819   17.378  -39.077  1.00 61.66  ? 80  PHE A CD1   1 
ATOM   568  C CD2   . PHE A 1 86  ? 3.319   15.142  -39.750  1.00 58.99  ? 80  PHE A CD2   1 
ATOM   569  C CE1   . PHE A 1 86  ? 1.870   16.891  -38.184  1.00 62.14  ? 80  PHE A CE1   1 
ATOM   570  C CE2   . PHE A 1 86  ? 2.371   14.660  -38.851  1.00 61.19  ? 80  PHE A CE2   1 
ATOM   571  C CZ    . PHE A 1 86  ? 1.657   15.534  -38.074  1.00 59.87  ? 80  PHE A CZ    1 
ATOM   572  N N     . PHE A 1 87  ? 5.959   18.432  -43.469  1.00 52.07  ? 81  PHE A N     1 
ATOM   573  C CA    . PHE A 1 87  ? 7.207   18.963  -44.040  1.00 51.46  ? 81  PHE A CA    1 
ATOM   574  C C     . PHE A 1 87  ? 6.952   19.453  -45.489  1.00 54.65  ? 81  PHE A C     1 
ATOM   575  O O     . PHE A 1 87  ? 7.330   18.791  -46.467  1.00 51.22  ? 81  PHE A O     1 
ATOM   576  C CB    . PHE A 1 87  ? 8.337   17.904  -43.917  1.00 51.95  ? 81  PHE A CB    1 
ATOM   577  C CG    . PHE A 1 87  ? 8.567   17.336  -42.525  1.00 52.39  ? 81  PHE A CG    1 
ATOM   578  C CD1   . PHE A 1 87  ? 8.062   16.093  -42.171  1.00 53.90  ? 81  PHE A CD1   1 
ATOM   579  C CD2   . PHE A 1 87  ? 9.274   18.054  -41.568  1.00 54.94  ? 81  PHE A CD2   1 
ATOM   580  C CE1   . PHE A 1 87  ? 8.270   15.572  -40.887  1.00 54.70  ? 81  PHE A CE1   1 
ATOM   581  C CE2   . PHE A 1 87  ? 9.471   17.535  -40.282  1.00 57.66  ? 81  PHE A CE2   1 
ATOM   582  C CZ    . PHE A 1 87  ? 8.980   16.291  -39.956  1.00 54.54  ? 81  PHE A CZ    1 
ATOM   583  N N     . PRO A 1 88  ? 6.216   20.587  -45.634  1.00 54.40  ? 82  PRO A N     1 
ATOM   584  C CA    . PRO A 1 88  ? 5.843   21.047  -46.988  1.00 54.41  ? 82  PRO A CA    1 
ATOM   585  C C     . PRO A 1 88  ? 6.986   21.659  -47.787  1.00 60.85  ? 82  PRO A C     1 
ATOM   586  O O     . PRO A 1 88  ? 6.989   21.621  -49.022  1.00 61.13  ? 82  PRO A O     1 
ATOM   587  C CB    . PRO A 1 88  ? 4.725   22.060  -46.727  1.00 56.48  ? 82  PRO A CB    1 
ATOM   588  C CG    . PRO A 1 88  ? 4.420   21.981  -45.235  1.00 61.17  ? 82  PRO A CG    1 
ATOM   589  C CD    . PRO A 1 88  ? 5.660   21.490  -44.601  1.00 56.92  ? 82  PRO A CD    1 
ATOM   590  N N     . ASN A 1 89  ? 7.971   22.199  -47.073  1.00 58.07  ? 83  ASN A N     1 
ATOM   591  C CA    . ASN A 1 89  ? 9.124   22.852  -47.666  1.00 57.90  ? 83  ASN A CA    1 
ATOM   592  C C     . ASN A 1 89  ? 10.399  21.974  -47.687  1.00 59.76  ? 83  ASN A C     1 
ATOM   593  O O     . ASN A 1 89  ? 11.504  22.492  -47.899  1.00 61.14  ? 83  ASN A O     1 
ATOM   594  C CB    . ASN A 1 89  ? 9.326   24.193  -46.966  1.00 59.78  ? 83  ASN A CB    1 
ATOM   595  C CG    . ASN A 1 89  ? 8.125   25.096  -47.110  1.00 72.96  ? 83  ASN A CG    1 
ATOM   596  O OD1   . ASN A 1 89  ? 7.250   24.883  -47.959  1.00 63.29  ? 83  ASN A OD1   1 
ATOM   597  N ND2   . ASN A 1 89  ? 8.053   26.118  -46.283  1.00 64.68  ? 83  ASN A ND2   1 
ATOM   598  N N     . ASN A 1 90  ? 10.234  20.645  -47.506  1.00 51.85  ? 84  ASN A N     1 
ATOM   599  C CA    . ASN A 1 90  ? 11.322  19.671  -47.516  1.00 50.01  ? 84  ASN A CA    1 
ATOM   600  C C     . ASN A 1 90  ? 11.056  18.597  -48.574  1.00 55.10  ? 84  ASN A C     1 
ATOM   601  O O     . ASN A 1 90  ? 9.976   18.575  -49.172  1.00 57.28  ? 84  ASN A O     1 
ATOM   602  C CB    . ASN A 1 90  ? 11.516  19.054  -46.133  1.00 45.28  ? 84  ASN A CB    1 
ATOM   603  C CG    . ASN A 1 90  ? 11.797  20.070  -45.056  1.00 68.72  ? 84  ASN A CG    1 
ATOM   604  O OD1   . ASN A 1 90  ? 10.883  20.561  -44.359  1.00 66.14  ? 84  ASN A OD1   1 
ATOM   605  N ND2   . ASN A 1 90  ? 13.069  20.425  -44.915  1.00 58.06  ? 84  ASN A ND2   1 
ATOM   606  N N     . ALA A 1 91  ? 12.034  17.727  -48.824  1.00 49.21  ? 85  ALA A N     1 
ATOM   607  C CA    . ALA A 1 91  ? 11.892  16.680  -49.811  1.00 47.58  ? 85  ALA A CA    1 
ATOM   608  C C     . ALA A 1 91  ? 11.195  15.410  -49.262  1.00 50.35  ? 85  ALA A C     1 
ATOM   609  O O     . ALA A 1 91  ? 11.863  14.475  -48.795  1.00 50.27  ? 85  ALA A O     1 
ATOM   610  C CB    . ALA A 1 91  ? 13.252  16.339  -50.375  1.00 48.54  ? 85  ALA A CB    1 
ATOM   611  N N     . VAL A 1 92  ? 9.850   15.375  -49.322  1.00 44.43  ? 86  VAL A N     1 
ATOM   612  C CA    . VAL A 1 92  ? 9.082   14.200  -48.890  1.00 42.20  ? 86  VAL A CA    1 
ATOM   613  C C     . VAL A 1 92  ? 8.791   13.409  -50.162  1.00 45.61  ? 86  VAL A C     1 
ATOM   614  O O     . VAL A 1 92  ? 8.080   13.887  -51.039  1.00 47.24  ? 86  VAL A O     1 
ATOM   615  C CB    . VAL A 1 92  ? 7.810   14.561  -48.084  1.00 45.10  ? 86  VAL A CB    1 
ATOM   616  C CG1   . VAL A 1 92  ? 6.895   13.352  -47.901  1.00 43.61  ? 86  VAL A CG1   1 
ATOM   617  C CG2   . VAL A 1 92  ? 8.177   15.169  -46.739  1.00 45.62  ? 86  VAL A CG2   1 
ATOM   618  N N     . GLU A 1 93  ? 9.399   12.236  -50.285  1.00 40.20  ? 87  GLU A N     1 
ATOM   619  C CA    . GLU A 1 93  ? 9.331   11.397  -51.473  1.00 38.86  ? 87  GLU A CA    1 
ATOM   620  C C     . GLU A 1 93  ? 8.687   10.029  -51.270  1.00 40.13  ? 87  GLU A C     1 
ATOM   621  O O     . GLU A 1 93  ? 8.642   9.510   -50.156  1.00 38.26  ? 87  GLU A O     1 
ATOM   622  C CB    . GLU A 1 93  ? 10.736  11.244  -52.069  1.00 40.87  ? 87  GLU A CB    1 
ATOM   623  C CG    . GLU A 1 93  ? 11.510  12.543  -52.259  1.00 52.30  ? 87  GLU A CG    1 
ATOM   624  C CD    . GLU A 1 93  ? 10.994  13.474  -53.337  1.00 85.86  ? 87  GLU A CD    1 
ATOM   625  O OE1   . GLU A 1 93  ? 10.295  13.005  -54.269  1.00 86.70  ? 87  GLU A OE1   1 
ATOM   626  O OE2   . GLU A 1 93  ? 11.319  14.681  -53.258  1.00 82.76  ? 87  GLU A OE2   1 
ATOM   627  N N     . TYR A 1 94  ? 8.229   9.437   -52.384  1.00 37.34  ? 88  TYR A N     1 
ATOM   628  C CA    . TYR A 1 94  ? 7.527   8.156   -52.439  1.00 36.54  ? 88  TYR A CA    1 
ATOM   629  C C     . TYR A 1 94  ? 8.243   7.203   -53.398  1.00 41.13  ? 88  TYR A C     1 
ATOM   630  O O     . TYR A 1 94  ? 8.377   7.502   -54.589  1.00 40.75  ? 88  TYR A O     1 
ATOM   631  C CB    . TYR A 1 94  ? 6.079   8.421   -52.892  1.00 36.93  ? 88  TYR A CB    1 
ATOM   632  C CG    . TYR A 1 94  ? 5.135   7.246   -52.798  1.00 36.56  ? 88  TYR A CG    1 
ATOM   633  C CD1   . TYR A 1 94  ? 4.522   6.911   -51.589  1.00 38.16  ? 88  TYR A CD1   1 
ATOM   634  C CD2   . TYR A 1 94  ? 4.763   6.538   -53.934  1.00 36.20  ? 88  TYR A CD2   1 
ATOM   635  C CE1   . TYR A 1 94  ? 3.616   5.848   -51.503  1.00 37.26  ? 88  TYR A CE1   1 
ATOM   636  C CE2   . TYR A 1 94  ? 3.862   5.472   -53.861  1.00 36.84  ? 88  TYR A CE2   1 
ATOM   637  C CZ    . TYR A 1 94  ? 3.292   5.128   -52.645  1.00 45.04  ? 88  TYR A CZ    1 
ATOM   638  O OH    . TYR A 1 94  ? 2.367   4.107   -52.610  1.00 47.42  ? 88  TYR A OH    1 
ATOM   639  N N     . PHE A 1 95  ? 8.704   6.058   -52.862  1.00 37.95  ? 89  PHE A N     1 
ATOM   640  C CA    . PHE A 1 95  ? 9.449   5.037   -53.593  1.00 37.74  ? 89  PHE A CA    1 
ATOM   641  C C     . PHE A 1 95  ? 8.831   3.671   -53.378  1.00 40.41  ? 89  PHE A C     1 
ATOM   642  O O     . PHE A 1 95  ? 9.103   2.995   -52.395  1.00 39.27  ? 89  PHE A O     1 
ATOM   643  C CB    . PHE A 1 95  ? 10.917  5.045   -53.138  1.00 40.39  ? 89  PHE A CB    1 
ATOM   644  C CG    . PHE A 1 95  ? 11.860  4.238   -53.994  1.00 41.77  ? 89  PHE A CG    1 
ATOM   645  C CD1   . PHE A 1 95  ? 12.565  4.834   -55.030  1.00 44.32  ? 89  PHE A CD1   1 
ATOM   646  C CD2   . PHE A 1 95  ? 12.070  2.890   -53.742  1.00 43.49  ? 89  PHE A CD2   1 
ATOM   647  C CE1   . PHE A 1 95  ? 13.438  4.089   -55.818  1.00 45.10  ? 89  PHE A CE1   1 
ATOM   648  C CE2   . PHE A 1 95  ? 12.935  2.146   -54.536  1.00 46.49  ? 89  PHE A CE2   1 
ATOM   649  C CZ    . PHE A 1 95  ? 13.610  2.750   -55.573  1.00 44.55  ? 89  PHE A CZ    1 
ATOM   650  N N     . VAL A 1 96  ? 8.033   3.249   -54.334  1.00 38.45  ? 90  VAL A N     1 
ATOM   651  C CA    . VAL A 1 96  ? 7.303   1.974   -54.333  1.00 38.11  ? 90  VAL A CA    1 
ATOM   652  C C     . VAL A 1 96  ? 7.503   1.293   -55.725  1.00 45.66  ? 90  VAL A C     1 
ATOM   653  O O     . VAL A 1 96  ? 8.136   1.908   -56.584  1.00 48.16  ? 90  VAL A O     1 
ATOM   654  C CB    . VAL A 1 96  ? 5.838   2.341   -53.971  1.00 40.01  ? 90  VAL A CB    1 
ATOM   655  C CG1   . VAL A 1 96  ? 4.834   2.021   -55.061  1.00 39.52  ? 90  VAL A CG1   1 
ATOM   656  C CG2   . VAL A 1 96  ? 5.432   1.762   -52.647  1.00 39.35  ? 90  VAL A CG2   1 
ATOM   657  N N     . SER A 1 97  ? 7.017   0.056   -55.959  1.00 42.27  ? 91  SER A N     1 
ATOM   658  C CA    . SER A 1 97  ? 7.183   -0.565  -57.286  1.00 43.63  ? 91  SER A CA    1 
ATOM   659  C C     . SER A 1 97  ? 6.377   0.148   -58.394  1.00 50.27  ? 91  SER A C     1 
ATOM   660  O O     . SER A 1 97  ? 5.196   0.467   -58.191  1.00 51.52  ? 91  SER A O     1 
ATOM   661  C CB    . SER A 1 97  ? 6.794   -2.037  -57.262  1.00 47.18  ? 91  SER A CB    1 
ATOM   662  O OG    . SER A 1 97  ? 6.728   -2.578  -58.574  1.00 52.77  ? 91  SER A OG    1 
ATOM   663  N N     . TYR A 1 98  ? 6.996   0.339   -59.582  1.00 45.50  ? 92  TYR A N     1 
ATOM   664  C CA    . TYR A 1 98  ? 6.265   0.959   -60.685  1.00 44.21  ? 92  TYR A CA    1 
ATOM   665  C C     . TYR A 1 98  ? 5.348   0.020   -61.453  1.00 47.71  ? 92  TYR A C     1 
ATOM   666  O O     . TYR A 1 98  ? 4.636   0.479   -62.328  1.00 47.82  ? 92  TYR A O     1 
ATOM   667  C CB    . TYR A 1 98  ? 7.150   1.818   -61.608  1.00 44.65  ? 92  TYR A CB    1 
ATOM   668  C CG    . TYR A 1 98  ? 8.293   1.125   -62.304  1.00 44.73  ? 92  TYR A CG    1 
ATOM   669  C CD1   . TYR A 1 98  ? 8.110   -0.093  -62.945  1.00 47.29  ? 92  TYR A CD1   1 
ATOM   670  C CD2   . TYR A 1 98  ? 9.519   1.756   -62.454  1.00 45.29  ? 92  TYR A CD2   1 
ATOM   671  C CE1   . TYR A 1 98  ? 9.149   -0.715  -63.636  1.00 49.21  ? 92  TYR A CE1   1 
ATOM   672  C CE2   . TYR A 1 98  ? 10.562  1.155   -63.153  1.00 46.60  ? 92  TYR A CE2   1 
ATOM   673  C CZ    . TYR A 1 98  ? 10.374  -0.084  -63.745  1.00 53.82  ? 92  TYR A CZ    1 
ATOM   674  O OH    . TYR A 1 98  ? 11.397  -0.688  -64.444  1.00 54.76  ? 92  TYR A OH    1 
ATOM   675  N N     . TYR A 1 99  ? 5.331   -1.272  -61.126  1.00 44.46  ? 93  TYR A N     1 
ATOM   676  C CA    . TYR A 1 99  ? 4.447   -2.198  -61.821  1.00 45.18  ? 93  TYR A CA    1 
ATOM   677  C C     . TYR A 1 99  ? 3.035   -2.148  -61.283  1.00 56.00  ? 93  TYR A C     1 
ATOM   678  O O     . TYR A 1 99  ? 2.829   -2.284  -60.069  1.00 56.24  ? 93  TYR A O     1 
ATOM   679  C CB    . TYR A 1 99  ? 4.979   -3.626  -61.729  1.00 45.14  ? 93  TYR A CB    1 
ATOM   680  C CG    . TYR A 1 99  ? 6.268   -3.867  -62.481  1.00 46.48  ? 93  TYR A CG    1 
ATOM   681  C CD1   . TYR A 1 99  ? 7.453   -4.158  -61.804  1.00 47.20  ? 93  TYR A CD1   1 
ATOM   682  C CD2   . TYR A 1 99  ? 6.296   -3.859  -63.871  1.00 47.96  ? 93  TYR A CD2   1 
ATOM   683  C CE1   . TYR A 1 99  ? 8.633   -4.419  -62.492  1.00 45.57  ? 93  TYR A CE1   1 
ATOM   684  C CE2   . TYR A 1 99  ? 7.469   -4.122  -64.569  1.00 49.35  ? 93  TYR A CE2   1 
ATOM   685  C CZ    . TYR A 1 99  ? 8.632   -4.404  -63.874  1.00 57.36  ? 93  TYR A CZ    1 
ATOM   686  O OH    . TYR A 1 99  ? 9.781   -4.655  -64.574  1.00 65.37  ? 93  TYR A OH    1 
ATOM   687  N N     . ASP A 1 100 ? 2.052   -1.958  -62.169  1.00 57.83  ? 94  ASP A N     1 
ATOM   688  C CA    . ASP A 1 100 ? 0.643   -1.994  -61.757  1.00 60.14  ? 94  ASP A CA    1 
ATOM   689  C C     . ASP A 1 100 ? 0.177   -3.441  -61.566  1.00 66.81  ? 94  ASP A C     1 
ATOM   690  O O     . ASP A 1 100 ? -0.697  -3.699  -60.741  1.00 66.79  ? 94  ASP A O     1 
ATOM   691  C CB    . ASP A 1 100 ? -0.274  -1.190  -62.694  1.00 63.08  ? 94  ASP A CB    1 
ATOM   692  C CG    . ASP A 1 100 ? -0.344  0.280   -62.284  1.00 77.34  ? 94  ASP A CG    1 
ATOM   693  O OD1   . ASP A 1 100 ? -0.118  0.588   -61.069  1.00 76.85  ? 94  ASP A OD1   1 
ATOM   694  O OD2   . ASP A 1 100 ? -0.717  1.100   -63.121  1.00 86.70  ? 94  ASP A OD2   1 
ATOM   695  N N     . TYR A 1 101 ? 0.794   -4.375  -62.306  1.00 64.21  ? 95  TYR A N     1 
ATOM   696  C CA    . TYR A 1 101 ? 0.564   -5.803  -62.210  1.00 64.41  ? 95  TYR A CA    1 
ATOM   697  C C     . TYR A 1 101 ? 1.900   -6.474  -62.514  1.00 63.35  ? 95  TYR A C     1 
ATOM   698  O O     . TYR A 1 101 ? 2.537   -6.099  -63.501  1.00 63.39  ? 95  TYR A O     1 
ATOM   699  C CB    . TYR A 1 101 ? -0.536  -6.254  -63.200  1.00 68.97  ? 95  TYR A CB    1 
ATOM   700  C CG    . TYR A 1 101 ? -0.610  -7.757  -63.435  1.00 76.03  ? 95  TYR A CG    1 
ATOM   701  C CD1   . TYR A 1 101 ? -0.818  -8.646  -62.372  1.00 78.41  ? 95  TYR A CD1   1 
ATOM   702  C CD2   . TYR A 1 101 ? -0.494  -8.290  -64.718  1.00 78.84  ? 95  TYR A CD2   1 
ATOM   703  C CE1   . TYR A 1 101 ? -0.875  -10.026 -62.581  1.00 79.88  ? 95  TYR A CE1   1 
ATOM   704  C CE2   . TYR A 1 101 ? -0.563  -9.668  -64.939  1.00 81.17  ? 95  TYR A CE2   1 
ATOM   705  C CZ    . TYR A 1 101 ? -0.759  -10.532 -63.869  1.00 91.93  ? 95  TYR A CZ    1 
ATOM   706  O OH    . TYR A 1 101 ? -0.837  -11.891 -64.093  1.00 99.17  ? 95  TYR A OH    1 
ATOM   707  N N     . TYR A 1 102 ? 2.343   -7.434  -61.661  1.00 55.03  ? 96  TYR A N     1 
ATOM   708  C CA    . TYR A 1 102 ? 3.588   -8.171  -61.895  1.00 52.86  ? 96  TYR A CA    1 
ATOM   709  C C     . TYR A 1 102 ? 3.441   -9.673  -61.671  1.00 55.16  ? 96  TYR A C     1 
ATOM   710  O O     . TYR A 1 102 ? 3.319   -10.114 -60.532  1.00 56.64  ? 96  TYR A O     1 
ATOM   711  C CB    . TYR A 1 102 ? 4.780   -7.602  -61.105  1.00 52.41  ? 96  TYR A CB    1 
ATOM   712  N N     . GLN A 1 103 ? 3.433   -10.455 -62.753  1.00 48.08  ? 97  GLN A N     1 
ATOM   713  C CA    . GLN A 1 103 ? 3.400   -11.904 -62.674  1.00 46.76  ? 97  GLN A CA    1 
ATOM   714  C C     . GLN A 1 103 ? 4.847   -12.335 -62.958  1.00 48.24  ? 97  GLN A C     1 
ATOM   715  O O     . GLN A 1 103 ? 5.309   -12.213 -64.100  1.00 48.48  ? 97  GLN A O     1 
ATOM   716  C CB    . GLN A 1 103 ? 2.408   -12.524 -63.701  1.00 48.58  ? 97  GLN A CB    1 
ATOM   717  C CG    . GLN A 1 103 ? 2.383   -14.067 -63.751  1.00 45.27  ? 97  GLN A CG    1 
ATOM   718  C CD    . GLN A 1 103 ? 2.222   -14.728 -62.398  1.00 66.99  ? 97  GLN A CD    1 
ATOM   719  O OE1   . GLN A 1 103 ? 3.194   -15.272 -61.807  1.00 50.09  ? 97  GLN A OE1   1 
ATOM   720  N NE2   . GLN A 1 103 ? 0.988   -14.701 -61.887  1.00 70.51  ? 97  GLN A NE2   1 
ATOM   721  N N     . PRO A 1 104 ? 5.601   -12.777 -61.936  1.00 42.12  ? 98  PRO A N     1 
ATOM   722  C CA    . PRO A 1 104 ? 6.981   -13.203 -62.188  1.00 41.84  ? 98  PRO A CA    1 
ATOM   723  C C     . PRO A 1 104 ? 7.053   -14.466 -63.028  1.00 48.08  ? 98  PRO A C     1 
ATOM   724  O O     . PRO A 1 104 ? 6.095   -15.238 -63.059  1.00 48.87  ? 98  PRO A O     1 
ATOM   725  C CB    . PRO A 1 104 ? 7.533   -13.443 -60.786  1.00 43.15  ? 98  PRO A CB    1 
ATOM   726  C CG    . PRO A 1 104 ? 6.356   -13.794 -59.966  1.00 47.84  ? 98  PRO A CG    1 
ATOM   727  C CD    . PRO A 1 104 ? 5.219   -12.987 -60.527  1.00 43.41  ? 98  PRO A CD    1 
ATOM   728  N N     . GLU A 1 105 ? 8.176   -14.670 -63.718  1.00 46.88  ? 99  GLU A N     1 
ATOM   729  C CA    . GLU A 1 105 ? 8.398   -15.874 -64.529  1.00 48.32  ? 99  GLU A CA    1 
ATOM   730  C C     . GLU A 1 105 ? 8.615   -16.992 -63.538  1.00 54.16  ? 99  GLU A C     1 
ATOM   731  O O     . GLU A 1 105 ? 9.342   -16.808 -62.560  1.00 53.79  ? 99  GLU A O     1 
ATOM   732  C CB    . GLU A 1 105 ? 9.598   -15.682 -65.461  1.00 50.14  ? 99  GLU A CB    1 
ATOM   733  C CG    . GLU A 1 105 ? 10.126  -16.913 -66.155  1.00 60.52  ? 99  GLU A CG    1 
ATOM   734  C CD    . GLU A 1 105 ? 11.361  -16.640 -66.991  1.00 90.77  ? 99  GLU A CD    1 
ATOM   735  O OE1   . GLU A 1 105 ? 11.263  -15.873 -67.977  1.00 90.93  ? 99  GLU A OE1   1 
ATOM   736  O OE2   . GLU A 1 105 ? 12.438  -17.179 -66.646  1.00 90.66  ? 99  GLU A OE2   1 
ATOM   737  N N     . ALA A 1 106 ? 7.886   -18.099 -63.723  1.00 52.22  ? 100 ALA A N     1 
ATOM   738  C CA    . ALA A 1 106 ? 7.918   -19.237 -62.814  1.00 52.56  ? 100 ALA A CA    1 
ATOM   739  C C     . ALA A 1 106 ? 7.614   -20.552 -63.510  1.00 60.47  ? 100 ALA A C     1 
ATOM   740  O O     . ALA A 1 106 ? 7.061   -20.571 -64.620  1.00 60.50  ? 100 ALA A O     1 
ATOM   741  C CB    . ALA A 1 106 ? 6.928   -19.015 -61.691  1.00 52.12  ? 100 ALA A CB    1 
ATOM   742  N N     . TYR A 1 107 ? 7.975   -21.653 -62.828  1.00 59.47  ? 101 TYR A N     1 
ATOM   743  C CA    . TYR A 1 107 ? 7.726   -23.018 -63.262  1.00 61.09  ? 101 TYR A CA    1 
ATOM   744  C C     . TYR A 1 107 ? 7.024   -23.777 -62.155  1.00 68.03  ? 101 TYR A C     1 
ATOM   745  O O     . TYR A 1 107 ? 7.440   -23.706 -60.992  1.00 67.55  ? 101 TYR A O     1 
ATOM   746  C CB    . TYR A 1 107 ? 9.018   -23.715 -63.650  1.00 62.88  ? 101 TYR A CB    1 
ATOM   747  C CG    . TYR A 1 107 ? 8.804   -25.130 -64.135  1.00 65.85  ? 101 TYR A CG    1 
ATOM   748  C CD1   . TYR A 1 107 ? 8.359   -25.385 -65.427  1.00 68.47  ? 101 TYR A CD1   1 
ATOM   749  C CD2   . TYR A 1 107 ? 9.069   -26.216 -63.309  1.00 67.13  ? 101 TYR A CD2   1 
ATOM   750  C CE1   . TYR A 1 107 ? 8.204   -26.686 -65.892  1.00 70.74  ? 101 TYR A CE1   1 
ATOM   751  C CE2   . TYR A 1 107 ? 8.912   -27.520 -63.761  1.00 69.32  ? 101 TYR A CE2   1 
ATOM   752  C CZ    . TYR A 1 107 ? 8.461   -27.752 -65.047  1.00 78.28  ? 101 TYR A CZ    1 
ATOM   753  O OH    . TYR A 1 107 ? 8.305   -29.046 -65.481  1.00 82.88  ? 101 TYR A OH    1 
ATOM   754  N N     . VAL A 1 108 ? 5.942   -24.482 -62.522  1.00 66.85  ? 102 VAL A N     1 
ATOM   755  C CA    . VAL A 1 108 ? 5.126   -25.271 -61.603  1.00 67.46  ? 102 VAL A CA    1 
ATOM   756  C C     . VAL A 1 108 ? 5.442   -26.742 -61.875  1.00 75.30  ? 102 VAL A C     1 
ATOM   757  O O     . VAL A 1 108 ? 4.840   -27.333 -62.782  1.00 75.07  ? 102 VAL A O     1 
ATOM   758  C CB    . VAL A 1 108 ? 3.625   -24.913 -61.728  1.00 70.77  ? 102 VAL A CB    1 
ATOM   759  C CG1   . VAL A 1 108 ? 2.749   -25.877 -60.937  1.00 71.46  ? 102 VAL A CG1   1 
ATOM   760  C CG2   . VAL A 1 108 ? 3.376   -23.485 -61.268  1.00 68.99  ? 102 VAL A CG2   1 
ATOM   761  N N     . PRO A 1 109 ? 6.458   -27.320 -61.159  1.00 74.47  ? 103 PRO A N     1 
ATOM   762  C CA    . PRO A 1 109 ? 6.838   -28.731 -61.403  1.00 75.79  ? 103 PRO A CA    1 
ATOM   763  C C     . PRO A 1 109 ? 5.698   -29.698 -61.117  1.00 79.98  ? 103 PRO A C     1 
ATOM   764  O O     . PRO A 1 109 ? 5.555   -30.712 -61.814  1.00 79.40  ? 103 PRO A O     1 
ATOM   765  C CB    . PRO A 1 109 ? 8.045   -28.942 -60.487  1.00 77.44  ? 103 PRO A CB    1 
ATOM   766  C CG    . PRO A 1 109 ? 7.905   -27.926 -59.427  1.00 80.30  ? 103 PRO A CG    1 
ATOM   767  C CD    . PRO A 1 109 ? 7.281   -26.733 -60.076  1.00 74.97  ? 103 PRO A CD    1 
ATOM   768  N N     . GLN A 1 110 ? 4.847   -29.316 -60.129  1.00 76.74  ? 104 GLN A N     1 
ATOM   769  C CA    . GLN A 1 110 ? 3.637   -30.008 -59.703  1.00 77.43  ? 104 GLN A CA    1 
ATOM   770  C C     . GLN A 1 110 ? 2.751   -30.390 -60.926  1.00 85.30  ? 104 GLN A C     1 
ATOM   771  O O     . GLN A 1 110 ? 2.075   -31.419 -60.881  1.00 87.57  ? 104 GLN A O     1 
ATOM   772  C CB    . GLN A 1 110 ? 2.860   -29.118 -58.714  1.00 76.57  ? 104 GLN A CB    1 
ATOM   773  N N     . THR A 1 111 ? 2.804   -29.586 -62.030  1.00 80.56  ? 105 THR A N     1 
ATOM   774  C CA    . THR A 1 111 ? 2.012   -29.780 -63.253  1.00 79.59  ? 105 THR A CA    1 
ATOM   775  C C     . THR A 1 111 ? 2.789   -29.598 -64.577  1.00 81.29  ? 105 THR A C     1 
ATOM   776  O O     . THR A 1 111 ? 2.150   -29.620 -65.629  1.00 81.43  ? 105 THR A O     1 
ATOM   777  C CB    . THR A 1 111 ? 0.799   -28.849 -63.227  1.00 79.08  ? 105 THR A CB    1 
ATOM   778  N N     . ASP A 1 112 ? 4.150   -29.431 -64.534  1.00 75.39  ? 106 ASP A N     1 
ATOM   779  C CA    . ASP A 1 112 ? 5.043   -29.209 -65.701  1.00 73.96  ? 106 ASP A CA    1 
ATOM   780  C C     . ASP A 1 112 ? 4.637   -27.935 -66.520  1.00 73.09  ? 106 ASP A C     1 
ATOM   781  O O     . ASP A 1 112 ? 4.844   -27.837 -67.733  1.00 72.01  ? 106 ASP A O     1 
ATOM   782  C CB    . ASP A 1 112 ? 5.195   -30.501 -66.548  1.00 78.15  ? 106 ASP A CB    1 
ATOM   783  C CG    . ASP A 1 112 ? 6.172   -30.454 -67.725  1.00 98.70  ? 106 ASP A CG    1 
ATOM   784  O OD1   . ASP A 1 112 ? 5.719   -30.612 -68.890  1.00 101.91 ? 106 ASP A OD1   1 
ATOM   785  O OD2   . ASP A 1 112 ? 7.393   -30.317 -67.485  1.00 106.93 ? 106 ASP A OD2   1 
ATOM   786  N N     . THR A 1 113 ? 4.096   -26.935 -65.810  1.00 67.33  ? 107 THR A N     1 
ATOM   787  C CA    . THR A 1 113 ? 3.612   -25.680 -66.379  1.00 65.41  ? 107 THR A CA    1 
ATOM   788  C C     . THR A 1 113 ? 4.593   -24.516 -66.191  1.00 64.53  ? 107 THR A C     1 
ATOM   789  O O     . THR A 1 113 ? 5.073   -24.257 -65.080  1.00 62.46  ? 107 THR A O     1 
ATOM   790  C CB    . THR A 1 113 ? 2.223   -25.365 -65.798  1.00 76.03  ? 107 THR A CB    1 
ATOM   791  O OG1   . THR A 1 113 ? 1.360   -26.486 -65.999  1.00 76.53  ? 107 THR A OG1   1 
ATOM   792  C CG2   . THR A 1 113 ? 1.605   -24.120 -66.384  1.00 75.00  ? 107 THR A CG2   1 
ATOM   793  N N     . PHE A 1 114 ? 4.840   -23.795 -67.288  1.00 59.02  ? 108 PHE A N     1 
ATOM   794  C CA    . PHE A 1 114 ? 5.685   -22.617 -67.301  1.00 57.11  ? 108 PHE A CA    1 
ATOM   795  C C     . PHE A 1 114 ? 4.849   -21.337 -67.406  1.00 63.15  ? 108 PHE A C     1 
ATOM   796  O O     . PHE A 1 114 ? 4.037   -21.175 -68.334  1.00 64.31  ? 108 PHE A O     1 
ATOM   797  C CB    . PHE A 1 114 ? 6.730   -22.686 -68.419  1.00 58.55  ? 108 PHE A CB    1 
ATOM   798  C CG    . PHE A 1 114 ? 7.525   -21.413 -68.575  1.00 57.79  ? 108 PHE A CG    1 
ATOM   799  C CD1   . PHE A 1 114 ? 8.401   -20.992 -67.581  1.00 57.88  ? 108 PHE A CD1   1 
ATOM   800  C CD2   . PHE A 1 114 ? 7.372   -20.614 -69.699  1.00 59.07  ? 108 PHE A CD2   1 
ATOM   801  C CE1   . PHE A 1 114 ? 9.124   -19.812 -67.720  1.00 56.93  ? 108 PHE A CE1   1 
ATOM   802  C CE2   . PHE A 1 114 ? 8.085   -19.419 -69.828  1.00 59.83  ? 108 PHE A CE2   1 
ATOM   803  C CZ    . PHE A 1 114 ? 8.957   -19.029 -68.838  1.00 55.96  ? 108 PHE A CZ    1 
ATOM   804  N N     . ILE A 1 115 ? 5.072   -20.425 -66.444  1.00 58.31  ? 109 ILE A N     1 
ATOM   805  C CA    . ILE A 1 115 ? 4.392   -19.143 -66.364  1.00 56.59  ? 109 ILE A CA    1 
ATOM   806  C C     . ILE A 1 115 ? 5.345   -18.077 -66.841  1.00 60.98  ? 109 ILE A C     1 
ATOM   807  O O     . ILE A 1 115 ? 6.383   -17.867 -66.217  1.00 58.82  ? 109 ILE A O     1 
ATOM   808  C CB    . ILE A 1 115 ? 3.847   -18.897 -64.926  1.00 58.46  ? 109 ILE A CB    1 
ATOM   809  C CG1   . ILE A 1 115 ? 2.624   -19.790 -64.630  1.00 58.67  ? 109 ILE A CG1   1 
ATOM   810  C CG2   . ILE A 1 115 ? 3.502   -17.427 -64.679  1.00 58.80  ? 109 ILE A CG2   1 
ATOM   811  C CD1   . ILE A 1 115 ? 2.922   -20.907 -63.785  1.00 63.55  ? 109 ILE A CD1   1 
ATOM   812  N N     . GLU A 1 116 ? 5.013   -17.437 -67.977  1.00 61.58  ? 110 GLU A N     1 
ATOM   813  C CA    . GLU A 1 116 ? 5.811   -16.351 -68.565  1.00 63.21  ? 110 GLU A CA    1 
ATOM   814  C C     . GLU A 1 116 ? 5.631   -15.098 -67.712  1.00 67.40  ? 110 GLU A C     1 
ATOM   815  O O     . GLU A 1 116 ? 4.535   -14.878 -67.182  1.00 66.22  ? 110 GLU A O     1 
ATOM   816  C CB    . GLU A 1 116 ? 5.347   -16.018 -70.000  1.00 65.92  ? 110 GLU A CB    1 
ATOM   817  C CG    . GLU A 1 116 ? 5.445   -17.146 -71.015  1.00 84.94  ? 110 GLU A CG    1 
ATOM   818  C CD    . GLU A 1 116 ? 4.656   -16.962 -72.305  1.00 125.43 ? 110 GLU A CD    1 
ATOM   819  O OE1   . GLU A 1 116 ? 3.582   -16.312 -72.277  1.00 130.97 ? 110 GLU A OE1   1 
ATOM   820  O OE2   . GLU A 1 116 ? 5.091   -17.515 -73.342  1.00 125.64 ? 110 GLU A OE2   1 
ATOM   821  N N     . LYS A 1 117 ? 6.683   -14.263 -67.605  1.00 64.84  ? 111 LYS A N     1 
ATOM   822  C CA    . LYS A 1 117 ? 6.587   -12.997 -66.874  1.00 64.40  ? 111 LYS A CA    1 
ATOM   823  C C     . LYS A 1 117 ? 5.624   -12.079 -67.632  1.00 71.38  ? 111 LYS A C     1 
ATOM   824  O O     . LYS A 1 117 ? 5.684   -12.006 -68.870  1.00 72.22  ? 111 LYS A O     1 
ATOM   825  C CB    . LYS A 1 117 ? 7.957   -12.330 -66.748  1.00 64.63  ? 111 LYS A CB    1 
ATOM   826  N N     . ASP A 1 118 ? 4.689   -11.453 -66.899  1.00 68.09  ? 112 ASP A N     1 
ATOM   827  C CA    . ASP A 1 118 ? 3.738   -10.501 -67.462  1.00 68.90  ? 112 ASP A CA    1 
ATOM   828  C C     . ASP A 1 118 ? 3.636   -9.333  -66.512  1.00 72.11  ? 112 ASP A C     1 
ATOM   829  O O     . ASP A 1 118 ? 3.249   -9.509  -65.351  1.00 71.08  ? 112 ASP A O     1 
ATOM   830  C CB    . ASP A 1 118 ? 2.354   -11.123 -67.731  1.00 72.52  ? 112 ASP A CB    1 
ATOM   831  C CG    . ASP A 1 118 ? 1.367   -10.185 -68.432  1.00 91.96  ? 112 ASP A CG    1 
ATOM   832  O OD1   . ASP A 1 118 ? 0.140   -10.317 -68.186  1.00 94.21  ? 112 ASP A OD1   1 
ATOM   833  O OD2   . ASP A 1 118 ? 1.821   -9.313  -69.220  1.00 100.10 ? 112 ASP A OD2   1 
ATOM   834  N N     . ALA A 1 119 ? 3.985   -8.130  -66.995  1.00 68.30  ? 113 ALA A N     1 
ATOM   835  C CA    . ALA A 1 119 ? 3.962   -6.933  -66.157  1.00 66.47  ? 113 ALA A CA    1 
ATOM   836  C C     . ALA A 1 119 ? 3.534   -5.658  -66.896  1.00 69.09  ? 113 ALA A C     1 
ATOM   837  O O     . ALA A 1 119 ? 3.716   -5.559  -68.113  1.00 69.72  ? 113 ALA A O     1 
ATOM   838  C CB    . ALA A 1 119 ? 5.314   -6.748  -65.493  1.00 66.60  ? 113 ALA A CB    1 
ATOM   839  N N     . SER A 1 120 ? 2.958   -4.693  -66.142  1.00 63.37  ? 114 SER A N     1 
ATOM   840  C CA    . SER A 1 120 ? 2.446   -3.407  -66.629  1.00 62.52  ? 114 SER A CA    1 
ATOM   841  C C     . SER A 1 120 ? 2.961   -2.275  -65.742  1.00 61.65  ? 114 SER A C     1 
ATOM   842  O O     . SER A 1 120 ? 2.595   -2.214  -64.568  1.00 60.77  ? 114 SER A O     1 
ATOM   843  C CB    . SER A 1 120 ? 0.913   -3.392  -66.634  1.00 68.90  ? 114 SER A CB    1 
ATOM   844  O OG    . SER A 1 120 ? 0.307   -4.647  -66.353  1.00 85.87  ? 114 SER A OG    1 
ATOM   845  N N     . ILE A 1 121 ? 3.775   -1.366  -66.318  1.00 54.62  ? 115 ILE A N     1 
ATOM   846  C CA    . ILE A 1 121 ? 4.404   -0.224  -65.640  1.00 52.19  ? 115 ILE A CA    1 
ATOM   847  C C     . ILE A 1 121 ? 3.483   0.997   -65.499  1.00 56.74  ? 115 ILE A C     1 
ATOM   848  O O     . ILE A 1 121 ? 2.903   1.445   -66.483  1.00 57.74  ? 115 ILE A O     1 
ATOM   849  C CB    . ILE A 1 121 ? 5.719   0.165   -66.368  1.00 54.58  ? 115 ILE A CB    1 
ATOM   850  C CG1   . ILE A 1 121 ? 6.712   -1.009  -66.450  1.00 54.97  ? 115 ILE A CG1   1 
ATOM   851  C CG2   . ILE A 1 121 ? 6.375   1.431   -65.794  1.00 54.30  ? 115 ILE A CG2   1 
ATOM   852  C CD1   . ILE A 1 121 ? 6.614   -1.848  -67.807  1.00 72.26  ? 115 ILE A CD1   1 
ATOM   853  N N     . ASN A 1 122 ? 3.419   1.574   -64.290  1.00 52.94  ? 116 ASN A N     1 
ATOM   854  C CA    . ASN A 1 122 ? 2.709   2.809   -63.989  1.00 52.49  ? 116 ASN A CA    1 
ATOM   855  C C     . ASN A 1 122 ? 3.747   3.921   -64.101  1.00 57.52  ? 116 ASN A C     1 
ATOM   856  O O     . ASN A 1 122 ? 4.646   4.035   -63.250  1.00 57.06  ? 116 ASN A O     1 
ATOM   857  C CB    . ASN A 1 122 ? 2.151   2.781   -62.582  1.00 52.64  ? 116 ASN A CB    1 
ATOM   858  C CG    . ASN A 1 122 ? 1.261   3.956   -62.240  1.00 74.65  ? 116 ASN A CG    1 
ATOM   859  O OD1   . ASN A 1 122 ? 1.578   5.121   -62.492  1.00 63.42  ? 116 ASN A OD1   1 
ATOM   860  N ND2   . ASN A 1 122 ? 0.158   3.672   -61.567  1.00 68.68  ? 116 ASN A ND2   1 
ATOM   861  N N     . ASP A 1 123 ? 3.619   4.744   -65.154  1.00 54.52  ? 117 ASP A N     1 
ATOM   862  C CA    . ASP A 1 123 ? 4.556   5.830   -65.416  1.00 54.25  ? 117 ASP A CA    1 
ATOM   863  C C     . ASP A 1 123 ? 4.624   6.927   -64.368  1.00 54.49  ? 117 ASP A C     1 
ATOM   864  O O     . ASP A 1 123 ? 5.712   7.467   -64.154  1.00 54.35  ? 117 ASP A O     1 
ATOM   865  C CB    . ASP A 1 123 ? 4.409   6.380   -66.834  1.00 58.00  ? 117 ASP A CB    1 
ATOM   866  C CG    . ASP A 1 123 ? 5.508   5.866   -67.753  1.00 78.13  ? 117 ASP A CG    1 
ATOM   867  O OD1   . ASP A 1 123 ? 6.713   6.165   -67.475  1.00 80.49  ? 117 ASP A OD1   1 
ATOM   868  O OD2   . ASP A 1 123 ? 5.175   5.131   -68.732  1.00 83.20  ? 117 ASP A OD2   1 
ATOM   869  N N     . GLU A 1 124 ? 3.486   7.232   -63.692  1.00 48.23  ? 118 GLU A N     1 
ATOM   870  C CA    . GLU A 1 124 ? 3.410   8.242   -62.627  1.00 47.03  ? 118 GLU A CA    1 
ATOM   871  C C     . GLU A 1 124 ? 4.295   7.843   -61.433  1.00 50.06  ? 118 GLU A C     1 
ATOM   872  O O     . GLU A 1 124 ? 5.000   8.704   -60.869  1.00 50.31  ? 118 GLU A O     1 
ATOM   873  C CB    . GLU A 1 124 ? 1.969   8.465   -62.183  1.00 47.33  ? 118 GLU A CB    1 
ATOM   874  N N     . ILE A 1 125 ? 4.280   6.523   -61.085  1.00 43.61  ? 119 ILE A N     1 
ATOM   875  C CA    . ILE A 1 125 ? 5.052   5.947   -59.991  1.00 41.61  ? 119 ILE A CA    1 
ATOM   876  C C     . ILE A 1 125 ? 6.524   6.002   -60.360  1.00 45.77  ? 119 ILE A C     1 
ATOM   877  O O     . ILE A 1 125 ? 7.334   6.377   -59.516  1.00 45.52  ? 119 ILE A O     1 
ATOM   878  C CB    . ILE A 1 125 ? 4.544   4.534   -59.621  1.00 43.65  ? 119 ILE A CB    1 
ATOM   879  C CG1   . ILE A 1 125 ? 3.097   4.615   -59.131  1.00 43.03  ? 119 ILE A CG1   1 
ATOM   880  C CG2   . ILE A 1 125 ? 5.453   3.863   -58.556  1.00 44.97  ? 119 ILE A CG2   1 
ATOM   881  C CD1   . ILE A 1 125 ? 2.417   3.286   -58.898  1.00 56.33  ? 119 ILE A CD1   1 
ATOM   882  N N     . ASP A 1 126 ? 6.859   5.696   -61.630  1.00 42.46  ? 120 ASP A N     1 
ATOM   883  C CA    . ASP A 1 126 ? 8.228   5.769   -62.143  1.00 43.00  ? 120 ASP A CA    1 
ATOM   884  C C     . ASP A 1 126 ? 8.817   7.215   -61.994  1.00 44.85  ? 120 ASP A C     1 
ATOM   885  O O     . ASP A 1 126 ? 9.955   7.376   -61.539  1.00 43.16  ? 120 ASP A O     1 
ATOM   886  C CB    . ASP A 1 126 ? 8.261   5.279   -63.600  1.00 46.92  ? 120 ASP A CB    1 
ATOM   887  C CG    . ASP A 1 126 ? 9.649   5.190   -64.243  1.00 69.36  ? 120 ASP A CG    1 
ATOM   888  O OD1   . ASP A 1 126 ? 9.786   5.609   -65.420  1.00 73.62  ? 120 ASP A OD1   1 
ATOM   889  O OD2   . ASP A 1 126 ? 10.594  4.664   -63.581  1.00 74.11  ? 120 ASP A OD2   1 
ATOM   890  N N     . LYS A 1 127 ? 7.998   8.255   -62.308  1.00 40.97  ? 121 LYS A N     1 
ATOM   891  C CA    . LYS A 1 127 ? 8.347   9.679   -62.163  1.00 40.44  ? 121 LYS A CA    1 
ATOM   892  C C     . LYS A 1 127 ? 8.658   9.989   -60.688  1.00 42.17  ? 121 LYS A C     1 
ATOM   893  O O     . LYS A 1 127 ? 9.652   10.660  -60.397  1.00 41.62  ? 121 LYS A O     1 
ATOM   894  C CB    . LYS A 1 127 ? 7.193   10.554  -62.684  1.00 43.28  ? 121 LYS A CB    1 
ATOM   895  C CG    . LYS A 1 127 ? 7.349   12.064  -62.490  1.00 64.43  ? 121 LYS A CG    1 
ATOM   896  C CD    . LYS A 1 127 ? 6.536   12.848  -63.548  1.00 80.16  ? 121 LYS A CD    1 
ATOM   897  C CE    . LYS A 1 127 ? 7.393   13.390  -64.684  1.00 91.45  ? 121 LYS A CE    1 
ATOM   898  N NZ    . LYS A 1 127 ? 6.593   13.779  -65.877  1.00 97.56  ? 121 LYS A NZ    1 
ATOM   899  N N     . LEU A 1 128 ? 7.827   9.447   -59.771  1.00 36.78  ? 122 LEU A N     1 
ATOM   900  C CA    . LEU A 1 128 ? 7.947   9.615   -58.323  1.00 35.76  ? 122 LEU A CA    1 
ATOM   901  C C     . LEU A 1 128 ? 9.222   9.003   -57.769  1.00 41.49  ? 122 LEU A C     1 
ATOM   902  O O     . LEU A 1 128 ? 9.817   9.571   -56.842  1.00 41.77  ? 122 LEU A O     1 
ATOM   903  C CB    . LEU A 1 128 ? 6.746   8.982   -57.612  1.00 34.70  ? 122 LEU A CB    1 
ATOM   904  C CG    . LEU A 1 128 ? 5.441   9.742   -57.616  1.00 38.20  ? 122 LEU A CG    1 
ATOM   905  C CD1   . LEU A 1 128 ? 4.331   8.849   -57.205  1.00 37.38  ? 122 LEU A CD1   1 
ATOM   906  C CD2   . LEU A 1 128 ? 5.493   10.939  -56.691  1.00 39.55  ? 122 LEU A CD2   1 
ATOM   907  N N     . ARG A 1 129 ? 9.603   7.819   -58.308  1.00 38.51  ? 123 ARG A N     1 
ATOM   908  C CA    . ARG A 1 129 ? 10.794  7.060   -57.936  1.00 38.79  ? 123 ARG A CA    1 
ATOM   909  C C     . ARG A 1 129 ? 12.025  7.862   -58.335  1.00 47.10  ? 123 ARG A C     1 
ATOM   910  O O     . ARG A 1 129 ? 12.999  7.917   -57.574  1.00 46.66  ? 123 ARG A O     1 
ATOM   911  C CB    . ARG A 1 129 ? 10.813  5.704   -58.653  1.00 38.01  ? 123 ARG A CB    1 
ATOM   912  C CG    . ARG A 1 129 ? 9.814   4.675   -58.123  1.00 50.92  ? 123 ARG A CG    1 
ATOM   913  C CD    . ARG A 1 129 ? 9.796   3.428   -58.995  1.00 63.14  ? 123 ARG A CD    1 
ATOM   914  N NE    . ARG A 1 129 ? 11.123  2.815   -59.083  1.00 67.91  ? 123 ARG A NE    1 
ATOM   915  C CZ    . ARG A 1 129 ? 11.518  1.784   -58.345  1.00 80.10  ? 123 ARG A CZ    1 
ATOM   916  N NH1   . ARG A 1 129 ? 12.755  1.312   -58.460  1.00 66.58  ? 123 ARG A NH1   1 
ATOM   917  N NH2   . ARG A 1 129 ? 10.682  1.213   -57.490  1.00 62.67  ? 123 ARG A NH2   1 
ATOM   918  N N     . HIS A 1 130 ? 11.969  8.502   -59.533  1.00 46.87  ? 124 HIS A N     1 
ATOM   919  C CA    . HIS A 1 130 ? 13.041  9.334   -60.074  1.00 48.38  ? 124 HIS A CA    1 
ATOM   920  C C     . HIS A 1 130 ? 13.206  10.581  -59.250  1.00 53.96  ? 124 HIS A C     1 
ATOM   921  O O     . HIS A 1 130 ? 14.343  11.005  -59.052  1.00 55.32  ? 124 HIS A O     1 
ATOM   922  C CB    . HIS A 1 130 ? 12.751  9.719   -61.511  1.00 50.06  ? 124 HIS A CB    1 
ATOM   923  C CG    . HIS A 1 130 ? 12.948  8.617   -62.478  1.00 53.79  ? 124 HIS A CG    1 
ATOM   924  N ND1   . HIS A 1 130 ? 12.214  8.551   -63.658  1.00 56.21  ? 124 HIS A ND1   1 
ATOM   925  C CD2   . HIS A 1 130 ? 13.805  7.577   -62.426  1.00 55.85  ? 124 HIS A CD2   1 
ATOM   926  C CE1   . HIS A 1 130 ? 12.644  7.464   -64.274  1.00 56.30  ? 124 HIS A CE1   1 
ATOM   927  N NE2   . HIS A 1 130 ? 13.607  6.847   -63.571  1.00 56.26  ? 124 HIS A NE2   1 
ATOM   928  N N     . SER A 1 131 ? 12.082  11.167  -58.765  1.00 49.85  ? 125 SER A N     1 
ATOM   929  C CA    . SER A 1 131 ? 12.094  12.349  -57.901  1.00 49.87  ? 125 SER A CA    1 
ATOM   930  C C     . SER A 1 131 ? 12.794  12.008  -56.603  1.00 51.61  ? 125 SER A C     1 
ATOM   931  O O     . SER A 1 131 ? 13.598  12.805  -56.129  1.00 51.36  ? 125 SER A O     1 
ATOM   932  C CB    . SER A 1 131 ? 10.678  12.826  -57.612  1.00 55.00  ? 125 SER A CB    1 
ATOM   933  O OG    . SER A 1 131 ? 10.162  13.554  -58.715  1.00 71.26  ? 125 SER A OG    1 
ATOM   934  N N     . ALA A 1 132 ? 12.537  10.792  -56.078  1.00 46.62  ? 126 ALA A N     1 
ATOM   935  C CA    . ALA A 1 132 ? 13.114  10.256  -54.852  1.00 45.92  ? 126 ALA A CA    1 
ATOM   936  C C     . ALA A 1 132 ? 14.622  10.056  -54.969  1.00 48.38  ? 126 ALA A C     1 
ATOM   937  O O     . ALA A 1 132 ? 15.348  10.661  -54.176  1.00 46.70  ? 126 ALA A O     1 
ATOM   938  C CB    . ALA A 1 132 ? 12.415  8.950   -54.457  1.00 46.14  ? 126 ALA A CB    1 
ATOM   939  N N     . THR A 1 133 ? 15.095  9.236   -55.964  1.00 45.23  ? 127 THR A N     1 
ATOM   940  C CA    . THR A 1 133 ? 16.531  8.957   -56.184  1.00 45.90  ? 127 THR A CA    1 
ATOM   941  C C     . THR A 1 133 ? 17.353  10.215  -56.440  1.00 49.78  ? 127 THR A C     1 
ATOM   942  O O     . THR A 1 133 ? 18.361  10.436  -55.743  1.00 49.55  ? 127 THR A O     1 
ATOM   943  C CB    . THR A 1 133 ? 16.779  7.871   -57.233  1.00 58.34  ? 127 THR A CB    1 
ATOM   944  O OG1   . THR A 1 133 ? 15.855  7.999   -58.322  1.00 63.90  ? 127 THR A OG1   1 
ATOM   945  C CG2   . THR A 1 133 ? 16.713  6.490   -56.644  1.00 56.79  ? 127 THR A CG2   1 
ATOM   946  N N     . SER A 1 134 ? 16.894  11.073  -57.393  1.00 44.93  ? 128 SER A N     1 
ATOM   947  C CA    . SER A 1 134 ? 17.600  12.310  -57.685  1.00 44.99  ? 128 SER A CA    1 
ATOM   948  C C     . SER A 1 134 ? 17.616  13.311  -56.525  1.00 49.19  ? 128 SER A C     1 
ATOM   949  O O     . SER A 1 134 ? 18.603  14.034  -56.388  1.00 50.12  ? 128 SER A O     1 
ATOM   950  C CB    . SER A 1 134 ? 17.202  12.905  -59.030  1.00 49.14  ? 128 SER A CB    1 
ATOM   951  O OG    . SER A 1 134 ? 15.806  13.085  -59.150  1.00 63.20  ? 128 SER A OG    1 
ATOM   952  N N     . ALA A 1 135 ? 16.597  13.275  -55.628  1.00 45.22  ? 129 ALA A N     1 
ATOM   953  C CA    . ALA A 1 135 ? 16.543  14.146  -54.433  1.00 45.13  ? 129 ALA A CA    1 
ATOM   954  C C     . ALA A 1 135 ? 17.652  13.845  -53.445  1.00 47.08  ? 129 ALA A C     1 
ATOM   955  O O     . ALA A 1 135 ? 18.098  14.748  -52.746  1.00 45.43  ? 129 ALA A O     1 
ATOM   956  C CB    . ALA A 1 135 ? 15.203  14.019  -53.725  1.00 45.49  ? 129 ALA A CB    1 
ATOM   957  N N     . LEU A 1 136 ? 18.085  12.576  -53.378  1.00 44.98  ? 130 LEU A N     1 
ATOM   958  C CA    . LEU A 1 136 ? 19.129  12.144  -52.447  1.00 46.44  ? 130 LEU A CA    1 
ATOM   959  C C     . LEU A 1 136 ? 20.523  12.699  -52.777  1.00 56.94  ? 130 LEU A C     1 
ATOM   960  O O     . LEU A 1 136 ? 21.393  12.728  -51.898  1.00 57.58  ? 130 LEU A O     1 
ATOM   961  C CB    . LEU A 1 136 ? 19.156  10.610  -52.298  1.00 45.04  ? 130 LEU A CB    1 
ATOM   962  C CG    . LEU A 1 136 ? 18.244  9.998   -51.260  1.00 46.73  ? 130 LEU A CG    1 
ATOM   963  C CD1   . LEU A 1 136 ? 18.413  8.517   -51.233  1.00 45.41  ? 130 LEU A CD1   1 
ATOM   964  C CD2   . LEU A 1 136 ? 18.481  10.588  -49.890  1.00 47.87  ? 130 LEU A CD2   1 
ATOM   965  N N     . PHE A 1 137 ? 20.724  13.144  -54.038  1.00 56.66  ? 131 PHE A N     1 
ATOM   966  C CA    . PHE A 1 137 ? 21.975  13.748  -54.505  1.00 58.50  ? 131 PHE A CA    1 
ATOM   967  C C     . PHE A 1 137 ? 21.956  15.249  -54.246  1.00 63.84  ? 131 PHE A C     1 
ATOM   968  O O     . PHE A 1 137 ? 22.983  15.814  -53.876  1.00 65.25  ? 131 PHE A O     1 
ATOM   969  C CB    . PHE A 1 137 ? 22.189  13.493  -56.000  1.00 60.91  ? 131 PHE A CB    1 
ATOM   970  C CG    . PHE A 1 137 ? 22.444  12.062  -56.393  1.00 62.97  ? 131 PHE A CG    1 
ATOM   971  C CD1   . PHE A 1 137 ? 21.399  11.234  -56.775  1.00 65.76  ? 131 PHE A CD1   1 
ATOM   972  C CD2   . PHE A 1 137 ? 23.738  11.558  -56.439  1.00 66.99  ? 131 PHE A CD2   1 
ATOM   973  C CE1   . PHE A 1 137 ? 21.638  9.915   -57.163  1.00 66.96  ? 131 PHE A CE1   1 
ATOM   974  C CE2   . PHE A 1 137 ? 23.977  10.234  -56.825  1.00 70.01  ? 131 PHE A CE2   1 
ATOM   975  C CZ    . PHE A 1 137 ? 22.923  9.422   -57.187  1.00 67.16  ? 131 PHE A CZ    1 
ATOM   976  N N     . GLU A 1 138 ? 20.778  15.887  -54.411  1.00 59.84  ? 132 GLU A N     1 
ATOM   977  C CA    . GLU A 1 138 ? 20.568  17.332  -54.242  1.00 59.79  ? 132 GLU A CA    1 
ATOM   978  C C     . GLU A 1 138 ? 20.617  17.849  -52.794  1.00 61.53  ? 132 GLU A C     1 
ATOM   979  O O     . GLU A 1 138 ? 21.384  18.773  -52.504  1.00 62.43  ? 132 GLU A O     1 
ATOM   980  C CB    . GLU A 1 138 ? 19.283  17.796  -54.952  1.00 60.81  ? 132 GLU A CB    1 
ATOM   981  C CG    . GLU A 1 138 ? 19.290  17.481  -56.440  1.00 80.62  ? 132 GLU A CG    1 
ATOM   982  C CD    . GLU A 1 138 ? 17.992  17.702  -57.195  1.00 124.62 ? 132 GLU A CD    1 
ATOM   983  O OE1   . GLU A 1 138 ? 16.913  17.390  -56.639  1.00 128.27 ? 132 GLU A OE1   1 
ATOM   984  O OE2   . GLU A 1 138 ? 18.060  18.142  -58.368  1.00 127.32 ? 132 GLU A OE2   1 
ATOM   985  N N     . ARG A 1 139 ? 19.806  17.273  -51.895  1.00 54.90  ? 133 ARG A N     1 
ATOM   986  C CA    . ARG A 1 139 ? 19.696  17.760  -50.518  1.00 54.10  ? 133 ARG A CA    1 
ATOM   987  C C     . ARG A 1 139 ? 19.730  16.702  -49.425  1.00 57.50  ? 133 ARG A C     1 
ATOM   988  O O     . ARG A 1 139 ? 19.540  15.524  -49.704  1.00 56.80  ? 133 ARG A O     1 
ATOM   989  C CB    . ARG A 1 139 ? 18.446  18.636  -50.368  1.00 51.94  ? 133 ARG A CB    1 
ATOM   990  C CG    . ARG A 1 139 ? 17.208  18.109  -51.093  1.00 51.54  ? 133 ARG A CG    1 
ATOM   991  C CD    . ARG A 1 139 ? 15.977  18.642  -50.429  1.00 56.48  ? 133 ARG A CD    1 
ATOM   992  N NE    . ARG A 1 139 ? 15.102  19.358  -51.346  1.00 66.81  ? 133 ARG A NE    1 
ATOM   993  C CZ    . ARG A 1 139 ? 14.221  20.269  -50.954  1.00 92.25  ? 133 ARG A CZ    1 
ATOM   994  N NH1   . ARG A 1 139 ? 14.119  20.596  -49.672  1.00 73.64  ? 133 ARG A NH1   1 
ATOM   995  N NH2   . ARG A 1 139 ? 13.448  20.879  -51.844  1.00 93.07  ? 133 ARG A NH2   1 
ATOM   996  N N     . ARG A 1 140 ? 19.988  17.134  -48.175  1.00 54.32  ? 134 ARG A N     1 
ATOM   997  C CA    . ARG A 1 140 ? 20.056  16.263  -47.006  1.00 53.71  ? 134 ARG A CA    1 
ATOM   998  C C     . ARG A 1 140 ? 18.715  16.214  -46.235  1.00 58.99  ? 134 ARG A C     1 
ATOM   999  O O     . ARG A 1 140 ? 18.513  15.311  -45.413  1.00 59.32  ? 134 ARG A O     1 
ATOM   1000 C CB    . ARG A 1 140 ? 21.197  16.691  -46.096  1.00 55.27  ? 134 ARG A CB    1 
ATOM   1001 N N     . ASP A 1 141 ? 17.788  17.156  -46.527  1.00 55.29  ? 135 ASP A N     1 
ATOM   1002 C CA    . ASP A 1 141 ? 16.468  17.205  -45.890  1.00 54.79  ? 135 ASP A CA    1 
ATOM   1003 C C     . ASP A 1 141 ? 15.450  16.341  -46.678  1.00 58.41  ? 135 ASP A C     1 
ATOM   1004 O O     . ASP A 1 141 ? 14.436  16.824  -47.200  1.00 57.75  ? 135 ASP A O     1 
ATOM   1005 C CB    . ASP A 1 141 ? 16.001  18.652  -45.663  1.00 57.22  ? 135 ASP A CB    1 
ATOM   1006 C CG    . ASP A 1 141 ? 15.877  19.485  -46.920  1.00 70.21  ? 135 ASP A CG    1 
ATOM   1007 O OD1   . ASP A 1 141 ? 16.917  19.800  -47.527  1.00 72.03  ? 135 ASP A OD1   1 
ATOM   1008 O OD2   . ASP A 1 141 ? 14.744  19.839  -47.283  1.00 78.45  ? 135 ASP A OD2   1 
ATOM   1009 N N     . VAL A 1 142 ? 15.737  15.032  -46.743  1.00 53.94  ? 136 VAL A N     1 
ATOM   1010 C CA    . VAL A 1 142 ? 14.921  14.086  -47.484  1.00 51.94  ? 136 VAL A CA    1 
ATOM   1011 C C     . VAL A 1 142 ? 14.296  13.051  -46.562  1.00 55.07  ? 136 VAL A C     1 
ATOM   1012 O O     . VAL A 1 142 ? 14.964  12.539  -45.669  1.00 56.67  ? 136 VAL A O     1 
ATOM   1013 C CB    . VAL A 1 142 ? 15.739  13.412  -48.612  1.00 55.61  ? 136 VAL A CB    1 
ATOM   1014 C CG1   . VAL A 1 142 ? 14.835  12.629  -49.547  1.00 54.41  ? 136 VAL A CG1   1 
ATOM   1015 C CG2   . VAL A 1 142 ? 16.538  14.436  -49.410  1.00 56.55  ? 136 VAL A CG2   1 
ATOM   1016 N N     . ILE A 1 143 ? 13.009  12.748  -46.791  1.00 48.77  ? 137 ILE A N     1 
ATOM   1017 C CA    . ILE A 1 143 ? 12.240  11.695  -46.130  1.00 46.85  ? 137 ILE A CA    1 
ATOM   1018 C C     . ILE A 1 143 ? 11.678  10.870  -47.282  1.00 48.33  ? 137 ILE A C     1 
ATOM   1019 O O     . ILE A 1 143 ? 10.958  11.422  -48.112  1.00 48.85  ? 137 ILE A O     1 
ATOM   1020 C CB    . ILE A 1 143 ? 11.085  12.203  -45.227  1.00 49.76  ? 137 ILE A CB    1 
ATOM   1021 C CG1   . ILE A 1 143 ? 11.584  13.104  -44.106  1.00 50.28  ? 137 ILE A CG1   1 
ATOM   1022 C CG2   . ILE A 1 143 ? 10.286  11.017  -44.669  1.00 50.69  ? 137 ILE A CG2   1 
ATOM   1023 C CD1   . ILE A 1 143 ? 10.461  13.816  -43.341  1.00 55.72  ? 137 ILE A CD1   1 
ATOM   1024 N N     . ILE A 1 144 ? 12.028  9.578   -47.358  1.00 41.58  ? 138 ILE A N     1 
ATOM   1025 C CA    . ILE A 1 144 ? 11.526  8.716   -48.415  1.00 39.06  ? 138 ILE A CA    1 
ATOM   1026 C C     . ILE A 1 144 ? 10.651  7.635   -47.804  1.00 42.48  ? 138 ILE A C     1 
ATOM   1027 O O     . ILE A 1 144 ? 11.124  6.837   -46.988  1.00 42.23  ? 138 ILE A O     1 
ATOM   1028 C CB    . ILE A 1 144 ? 12.650  8.147   -49.321  1.00 41.45  ? 138 ILE A CB    1 
ATOM   1029 C CG1   . ILE A 1 144 ? 13.348  9.268   -50.102  1.00 40.82  ? 138 ILE A CG1   1 
ATOM   1030 C CG2   . ILE A 1 144 ? 12.081  7.095   -50.291  1.00 42.32  ? 138 ILE A CG2   1 
ATOM   1031 C CD1   . ILE A 1 144 ? 14.694  8.953   -50.546  1.00 40.39  ? 138 ILE A CD1   1 
ATOM   1032 N N     . ILE A 1 145 ? 9.366   7.635   -48.186  1.00 38.34  ? 139 ILE A N     1 
ATOM   1033 C CA    . ILE A 1 145 ? 8.372   6.653   -47.755  1.00 36.87  ? 139 ILE A CA    1 
ATOM   1034 C C     . ILE A 1 145 ? 8.457   5.600   -48.808  1.00 40.25  ? 139 ILE A C     1 
ATOM   1035 O O     . ILE A 1 145 ? 8.124   5.863   -49.968  1.00 39.06  ? 139 ILE A O     1 
ATOM   1036 C CB    . ILE A 1 145 ? 6.936   7.231   -47.697  1.00 39.80  ? 139 ILE A CB    1 
ATOM   1037 C CG1   . ILE A 1 145 ? 6.864   8.726   -47.251  1.00 40.93  ? 139 ILE A CG1   1 
ATOM   1038 C CG2   . ILE A 1 145 ? 5.984   6.303   -46.943  1.00 39.82  ? 139 ILE A CG2   1 
ATOM   1039 C CD1   . ILE A 1 145 ? 7.378   9.072   -45.909  1.00 46.84  ? 139 ILE A CD1   1 
ATOM   1040 N N     . ALA A 1 146 ? 8.950   4.424   -48.423  1.00 38.25  ? 140 ALA A N     1 
ATOM   1041 C CA    . ALA A 1 146 ? 9.153   3.307   -49.333  1.00 37.53  ? 140 ALA A CA    1 
ATOM   1042 C C     . ALA A 1 146 ? 8.589   1.992   -48.838  1.00 41.05  ? 140 ALA A C     1 
ATOM   1043 O O     . ALA A 1 146 ? 8.277   1.830   -47.654  1.00 39.80  ? 140 ALA A O     1 
ATOM   1044 C CB    . ALA A 1 146 ? 10.634  3.159   -49.643  1.00 38.40  ? 140 ALA A CB    1 
ATOM   1045 N N     . SER A 1 147 ? 8.435   1.062   -49.779  1.00 39.24  ? 141 SER A N     1 
ATOM   1046 C CA    . SER A 1 147 ? 8.026   -0.320  -49.552  1.00 39.75  ? 141 SER A CA    1 
ATOM   1047 C C     . SER A 1 147 ? 9.335   -1.143  -49.668  1.00 46.02  ? 141 SER A C     1 
ATOM   1048 O O     . SER A 1 147 ? 10.414  -0.554  -49.857  1.00 45.52  ? 141 SER A O     1 
ATOM   1049 C CB    . SER A 1 147 ? 7.054   -0.765  -50.638  1.00 41.42  ? 141 SER A CB    1 
ATOM   1050 O OG    . SER A 1 147 ? 7.701   -0.767  -51.903  1.00 46.17  ? 141 SER A OG    1 
ATOM   1051 N N     . VAL A 1 148 ? 9.233   -2.491  -49.628  1.00 42.88  ? 142 VAL A N     1 
ATOM   1052 C CA    . VAL A 1 148 ? 10.383  -3.392  -49.777  1.00 43.19  ? 142 VAL A CA    1 
ATOM   1053 C C     . VAL A 1 148 ? 11.134  -3.187  -51.092  1.00 47.49  ? 142 VAL A C     1 
ATOM   1054 O O     . VAL A 1 148 ? 12.201  -3.772  -51.276  1.00 47.42  ? 142 VAL A O     1 
ATOM   1055 C CB    . VAL A 1 148 ? 10.033  -4.875  -49.551  1.00 48.00  ? 142 VAL A CB    1 
ATOM   1056 C CG1   . VAL A 1 148 ? 10.028  -5.200  -48.075  1.00 48.49  ? 142 VAL A CG1   1 
ATOM   1057 C CG2   . VAL A 1 148 ? 8.702   -5.251  -50.202  1.00 47.83  ? 142 VAL A CG2   1 
ATOM   1058 N N     . SER A 1 149 ? 10.592  -2.334  -51.998  1.00 43.77  ? 143 SER A N     1 
ATOM   1059 C CA    . SER A 1 149 ? 11.200  -1.981  -53.274  1.00 43.41  ? 143 SER A CA    1 
ATOM   1060 C C     . SER A 1 149 ? 12.583  -1.336  -53.057  1.00 48.31  ? 143 SER A C     1 
ATOM   1061 O O     . SER A 1 149 ? 13.411  -1.297  -53.977  1.00 49.98  ? 143 SER A O     1 
ATOM   1062 C CB    . SER A 1 149 ? 10.288  -1.028  -54.027  1.00 46.56  ? 143 SER A CB    1 
ATOM   1063 O OG    . SER A 1 149 ? 10.834  -0.771  -55.311  1.00 59.85  ? 143 SER A OG    1 
ATOM   1064 N N     . CYS A 1 150 ? 12.830  -0.856  -51.821  1.00 43.07  ? 144 CYS A N     1 
ATOM   1065 C CA    . CYS A 1 150 ? 14.070  -0.226  -51.385  1.00 42.68  ? 144 CYS A CA    1 
ATOM   1066 C C     . CYS A 1 150 ? 15.209  -1.240  -51.145  1.00 44.96  ? 144 CYS A C     1 
ATOM   1067 O O     . CYS A 1 150 ? 16.357  -0.818  -50.967  1.00 45.49  ? 144 CYS A O     1 
ATOM   1068 C CB    . CYS A 1 150 ? 13.810  0.618   -50.147  1.00 43.19  ? 144 CYS A CB    1 
ATOM   1069 S SG    . CYS A 1 150 ? 13.339  -0.351  -48.695  1.00 47.39  ? 144 CYS A SG    1 
ATOM   1070 N N     . ILE A 1 151 ? 14.898  -2.559  -51.094  1.00 39.01  ? 145 ILE A N     1 
ATOM   1071 C CA    . ILE A 1 151 ? 15.904  -3.619  -50.914  1.00 38.23  ? 145 ILE A CA    1 
ATOM   1072 C C     . ILE A 1 151 ? 16.173  -4.396  -52.201  1.00 42.29  ? 145 ILE A C     1 
ATOM   1073 O O     . ILE A 1 151 ? 17.054  -5.256  -52.255  1.00 42.49  ? 145 ILE A O     1 
ATOM   1074 C CB    . ILE A 1 151 ? 15.748  -4.499  -49.647  1.00 40.70  ? 145 ILE A CB    1 
ATOM   1075 C CG1   . ILE A 1 151 ? 14.446  -5.324  -49.660  1.00 39.62  ? 145 ILE A CG1   1 
ATOM   1076 C CG2   . ILE A 1 151 ? 15.886  -3.655  -48.378  1.00 40.87  ? 145 ILE A CG2   1 
ATOM   1077 C CD1   . ILE A 1 151 ? 14.623  -6.760  -49.788  1.00 36.00  ? 145 ILE A CD1   1 
ATOM   1078 N N     . TYR A 1 152 ? 15.456  -4.028  -53.258  1.00 39.43  ? 146 TYR A N     1 
ATOM   1079 C CA    . TYR A 1 152 ? 15.608  -4.610  -54.585  1.00 39.92  ? 146 TYR A CA    1 
ATOM   1080 C C     . TYR A 1 152 ? 16.694  -3.915  -55.395  1.00 48.44  ? 146 TYR A C     1 
ATOM   1081 O O     . TYR A 1 152 ? 17.100  -2.788  -55.068  1.00 48.56  ? 146 TYR A O     1 
ATOM   1082 C CB    . TYR A 1 152 ? 14.266  -4.607  -55.323  1.00 38.71  ? 146 TYR A CB    1 
ATOM   1083 C CG    . TYR A 1 152 ? 13.463  -5.830  -54.985  1.00 38.44  ? 146 TYR A CG    1 
ATOM   1084 C CD1   . TYR A 1 152 ? 12.689  -5.879  -53.837  1.00 38.06  ? 146 TYR A CD1   1 
ATOM   1085 C CD2   . TYR A 1 152 ? 13.549  -6.975  -55.763  1.00 41.39  ? 146 TYR A CD2   1 
ATOM   1086 C CE1   . TYR A 1 152 ? 11.999  -7.031  -53.482  1.00 38.04  ? 146 TYR A CE1   1 
ATOM   1087 C CE2   . TYR A 1 152 ? 12.853  -8.130  -55.429  1.00 43.77  ? 146 TYR A CE2   1 
ATOM   1088 C CZ    . TYR A 1 152 ? 12.071  -8.153  -54.289  1.00 54.67  ? 146 TYR A CZ    1 
ATOM   1089 O OH    . TYR A 1 152 ? 11.362  -9.298  -53.996  1.00 65.55  ? 146 TYR A OH    1 
ATOM   1090 N N     . GLY A 1 153 ? 17.146  -4.605  -56.441  1.00 46.87  ? 147 GLY A N     1 
ATOM   1091 C CA    . GLY A 1 153 ? 18.186  -4.124  -57.339  1.00 47.40  ? 147 GLY A CA    1 
ATOM   1092 C C     . GLY A 1 153 ? 17.903  -2.800  -58.024  1.00 50.57  ? 147 GLY A C     1 
ATOM   1093 O O     . GLY A 1 153 ? 16.773  -2.525  -58.462  1.00 50.65  ? 147 GLY A O     1 
ATOM   1094 N N     . LEU A 1 154 ? 18.956  -1.973  -58.092  1.00 45.26  ? 148 LEU A N     1 
ATOM   1095 C CA    . LEU A 1 154 ? 19.020  -0.651  -58.720  1.00 44.06  ? 148 LEU A CA    1 
ATOM   1096 C C     . LEU A 1 154 ? 20.445  -0.479  -59.274  1.00 46.61  ? 148 LEU A C     1 
ATOM   1097 O O     . LEU A 1 154 ? 21.358  -1.238  -58.922  1.00 45.88  ? 148 LEU A O     1 
ATOM   1098 C CB    . LEU A 1 154 ? 18.750  0.470   -57.694  1.00 43.53  ? 148 LEU A CB    1 
ATOM   1099 C CG    . LEU A 1 154 ? 17.316  0.878   -57.451  1.00 47.34  ? 148 LEU A CG    1 
ATOM   1100 C CD1   . LEU A 1 154 ? 16.801  0.310   -56.107  1.00 48.47  ? 148 LEU A CD1   1 
ATOM   1101 C CD2   . LEU A 1 154 ? 17.229  2.354   -57.351  1.00 47.86  ? 148 LEU A CD2   1 
ATOM   1102 N N     . GLY A 1 155 ? 20.626  0.537   -60.102  1.00 42.25  ? 149 GLY A N     1 
ATOM   1103 C CA    . GLY A 1 155 ? 21.933  0.850   -60.638  1.00 42.66  ? 149 GLY A CA    1 
ATOM   1104 C C     . GLY A 1 155 ? 22.834  1.484   -59.595  1.00 47.51  ? 149 GLY A C     1 
ATOM   1105 O O     . GLY A 1 155 ? 22.377  1.988   -58.567  1.00 45.01  ? 149 GLY A O     1 
ATOM   1106 N N     . SER A 1 156 ? 24.136  1.466   -59.872  1.00 47.62  ? 150 SER A N     1 
ATOM   1107 C CA    . SER A 1 156 ? 25.169  2.089   -59.065  1.00 48.22  ? 150 SER A CA    1 
ATOM   1108 C C     . SER A 1 156 ? 24.834  3.589   -58.998  1.00 55.10  ? 150 SER A C     1 
ATOM   1109 O O     . SER A 1 156 ? 24.397  4.161   -60.011  1.00 53.93  ? 150 SER A O     1 
ATOM   1110 C CB    . SER A 1 156 ? 26.520  1.888   -59.743  1.00 50.29  ? 150 SER A CB    1 
ATOM   1111 O OG    . SER A 1 156 ? 27.460  2.856   -59.316  1.00 57.93  ? 150 SER A OG    1 
ATOM   1112 N N     . PRO A 1 157 ? 25.011  4.255   -57.831  1.00 54.12  ? 151 PRO A N     1 
ATOM   1113 C CA    . PRO A 1 157 ? 24.729  5.709   -57.775  1.00 53.68  ? 151 PRO A CA    1 
ATOM   1114 C C     . PRO A 1 157 ? 25.557  6.484   -58.806  1.00 56.64  ? 151 PRO A C     1 
ATOM   1115 O O     . PRO A 1 157 ? 25.014  7.374   -59.457  1.00 55.29  ? 151 PRO A O     1 
ATOM   1116 C CB    . PRO A 1 157 ? 25.028  6.084   -56.318  1.00 55.64  ? 151 PRO A CB    1 
ATOM   1117 C CG    . PRO A 1 157 ? 24.937  4.768   -55.555  1.00 60.08  ? 151 PRO A CG    1 
ATOM   1118 C CD    . PRO A 1 157 ? 25.494  3.751   -56.528  1.00 56.07  ? 151 PRO A CD    1 
ATOM   1119 N N     . GLU A 1 158 ? 26.828  6.065   -59.037  1.00 54.59  ? 152 GLU A N     1 
ATOM   1120 C CA    . GLU A 1 158 ? 27.716  6.647   -60.057  1.00 55.78  ? 152 GLU A CA    1 
ATOM   1121 C C     . GLU A 1 158 ? 27.095  6.493   -61.480  1.00 60.36  ? 152 GLU A C     1 
ATOM   1122 O O     . GLU A 1 158 ? 27.045  7.471   -62.236  1.00 59.64  ? 152 GLU A O     1 
ATOM   1123 C CB    . GLU A 1 158 ? 29.095  6.006   -59.988  1.00 57.28  ? 152 GLU A CB    1 
ATOM   1124 N N     . GLU A 1 159 ? 26.547  5.287   -61.789  1.00 56.90  ? 153 GLU A N     1 
ATOM   1125 C CA    . GLU A 1 159 ? 25.847  4.975   -63.036  1.00 56.39  ? 153 GLU A CA    1 
ATOM   1126 C C     . GLU A 1 159 ? 24.609  5.907   -63.256  1.00 60.93  ? 153 GLU A C     1 
ATOM   1127 O O     . GLU A 1 159 ? 24.373  6.342   -64.385  1.00 60.03  ? 153 GLU A O     1 
ATOM   1128 C CB    . GLU A 1 159 ? 25.425  3.516   -63.033  1.00 56.37  ? 153 GLU A CB    1 
ATOM   1129 N N     . TYR A 1 160 ? 23.860  6.244   -62.167  1.00 58.19  ? 154 TYR A N     1 
ATOM   1130 C CA    . TYR A 1 160 ? 22.687  7.148   -62.172  1.00 57.49  ? 154 TYR A CA    1 
ATOM   1131 C C     . TYR A 1 160 ? 23.097  8.582   -62.605  1.00 64.96  ? 154 TYR A C     1 
ATOM   1132 O O     . TYR A 1 160 ? 22.454  9.176   -63.476  1.00 63.52  ? 154 TYR A O     1 
ATOM   1133 C CB    . TYR A 1 160 ? 22.035  7.157   -60.777  1.00 56.84  ? 154 TYR A CB    1 
ATOM   1134 C CG    . TYR A 1 160 ? 20.693  7.849   -60.685  1.00 57.19  ? 154 TYR A CG    1 
ATOM   1135 C CD1   . TYR A 1 160 ? 19.506  7.136   -60.830  1.00 58.79  ? 154 TYR A CD1   1 
ATOM   1136 C CD2   . TYR A 1 160 ? 20.603  9.194   -60.342  1.00 57.59  ? 154 TYR A CD2   1 
ATOM   1137 C CE1   . TYR A 1 160 ? 18.260  7.758   -60.687  1.00 57.61  ? 154 TYR A CE1   1 
ATOM   1138 C CE2   . TYR A 1 160 ? 19.363  9.827   -60.205  1.00 57.33  ? 154 TYR A CE2   1 
ATOM   1139 C CZ    . TYR A 1 160 ? 18.196  9.105   -60.381  1.00 57.72  ? 154 TYR A CZ    1 
ATOM   1140 O OH    . TYR A 1 160 ? 16.985  9.723   -60.243  1.00 53.24  ? 154 TYR A OH    1 
ATOM   1141 N N     . ARG A 1 161 ? 24.198  9.108   -62.014  1.00 65.25  ? 155 ARG A N     1 
ATOM   1142 C CA    . ARG A 1 161 ? 24.782  10.426  -62.313  1.00 66.77  ? 155 ARG A CA    1 
ATOM   1143 C C     . ARG A 1 161 ? 25.212  10.540  -63.804  1.00 73.08  ? 155 ARG A C     1 
ATOM   1144 O O     . ARG A 1 161 ? 25.056  11.599  -64.417  1.00 73.27  ? 155 ARG A O     1 
ATOM   1145 C CB    . ARG A 1 161 ? 25.976  10.684  -61.393  1.00 67.91  ? 155 ARG A CB    1 
ATOM   1146 N N     . GLU A 1 162 ? 25.710  9.423   -64.376  1.00 70.13  ? 156 GLU A N     1 
ATOM   1147 C CA    . GLU A 1 162 ? 26.160  9.304   -65.755  1.00 70.78  ? 156 GLU A CA    1 
ATOM   1148 C C     . GLU A 1 162 ? 24.993  9.168   -66.744  1.00 76.42  ? 156 GLU A C     1 
ATOM   1149 O O     . GLU A 1 162 ? 24.932  9.930   -67.706  1.00 77.90  ? 156 GLU A O     1 
ATOM   1150 C CB    . GLU A 1 162 ? 27.111  8.121   -65.891  1.00 71.87  ? 156 GLU A CB    1 
ATOM   1151 N N     . MET A 1 163 ? 24.059  8.229   -66.505  1.00 72.17  ? 157 MET A N     1 
ATOM   1152 C CA    . MET A 1 163 ? 22.917  7.962   -67.386  1.00 71.32  ? 157 MET A CA    1 
ATOM   1153 C C     . MET A 1 163 ? 21.690  8.948   -67.312  1.00 74.29  ? 157 MET A C     1 
ATOM   1154 O O     . MET A 1 163 ? 20.587  8.577   -67.733  1.00 75.17  ? 157 MET A O     1 
ATOM   1155 C CB    . MET A 1 163 ? 22.476  6.511   -67.222  1.00 71.35  ? 157 MET A CB    1 
ATOM   1156 N N     . VAL A 1 164 ? 21.872  10.190  -66.799  1.00 68.86  ? 158 VAL A N     1 
ATOM   1157 C CA    . VAL A 1 164 ? 20.790  11.198  -66.728  1.00 67.76  ? 158 VAL A CA    1 
ATOM   1158 C C     . VAL A 1 164 ? 21.298  12.525  -67.279  1.00 72.77  ? 158 VAL A C     1 
ATOM   1159 O O     . VAL A 1 164 ? 22.266  13.066  -66.740  1.00 72.61  ? 158 VAL A O     1 
ATOM   1160 C CB    . VAL A 1 164 ? 20.163  11.369  -65.308  1.00 70.38  ? 158 VAL A CB    1 
ATOM   1161 C CG1   . VAL A 1 164 ? 19.183  12.538  -65.255  1.00 69.83  ? 158 VAL A CG1   1 
ATOM   1162 C CG2   . VAL A 1 164 ? 19.480  10.095  -64.847  1.00 69.25  ? 158 VAL A CG2   1 
ATOM   1163 N N     . VAL A 1 165 ? 20.637  13.054  -68.335  1.00 70.71  ? 159 VAL A N     1 
ATOM   1164 C CA    . VAL A 1 165 ? 21.010  14.334  -68.957  1.00 72.10  ? 159 VAL A CA    1 
ATOM   1165 C C     . VAL A 1 165 ? 20.370  15.509  -68.199  1.00 78.19  ? 159 VAL A C     1 
ATOM   1166 O O     . VAL A 1 165 ? 19.194  15.830  -68.396  1.00 77.59  ? 159 VAL A O     1 
ATOM   1167 C CB    . VAL A 1 165 ? 20.778  14.391  -70.495  1.00 76.13  ? 159 VAL A CB    1 
ATOM   1168 C CG1   . VAL A 1 165 ? 21.155  15.756  -71.063  1.00 76.95  ? 159 VAL A CG1   1 
ATOM   1169 C CG2   . VAL A 1 165 ? 21.554  13.291  -71.215  1.00 76.15  ? 159 VAL A CG2   1 
ATOM   1170 N N     . SER A 1 166 ? 21.159  16.127  -67.312  1.00 76.10  ? 160 SER A N     1 
ATOM   1171 C CA    . SER A 1 166 ? 20.723  17.262  -66.507  1.00 76.00  ? 160 SER A CA    1 
ATOM   1172 C C     . SER A 1 166 ? 21.170  18.570  -67.175  1.00 79.24  ? 160 SER A C     1 
ATOM   1173 O O     . SER A 1 166 ? 22.358  18.753  -67.446  1.00 79.55  ? 160 SER A O     1 
ATOM   1174 C CB    . SER A 1 166 ? 21.253  17.142  -65.080  1.00 79.82  ? 160 SER A CB    1 
ATOM   1175 O OG    . SER A 1 166 ? 20.623  18.077  -64.220  1.00 90.98  ? 160 SER A OG    1 
ATOM   1176 N N     . LEU A 1 167 ? 20.204  19.452  -67.476  1.00 74.61  ? 161 LEU A N     1 
ATOM   1177 C CA    . LEU A 1 167 ? 20.439  20.727  -68.149  1.00 75.23  ? 161 LEU A CA    1 
ATOM   1178 C C     . LEU A 1 167 ? 19.981  21.902  -67.308  1.00 81.22  ? 161 LEU A C     1 
ATOM   1179 O O     . LEU A 1 167 ? 18.880  21.880  -66.749  1.00 80.70  ? 161 LEU A O     1 
ATOM   1180 C CB    . LEU A 1 167 ? 19.739  20.777  -69.522  1.00 75.18  ? 161 LEU A CB    1 
ATOM   1181 C CG    . LEU A 1 167 ? 19.949  19.590  -70.469  1.00 78.76  ? 161 LEU A CG    1 
ATOM   1182 C CD1   . LEU A 1 167 ? 18.944  19.616  -71.583  1.00 78.55  ? 161 LEU A CD1   1 
ATOM   1183 C CD2   . LEU A 1 167 ? 21.344  19.571  -71.039  1.00 81.58  ? 161 LEU A CD2   1 
ATOM   1184 N N     . ARG A 1 168 ? 20.830  22.936  -67.236  1.00 79.03  ? 162 ARG A N     1 
ATOM   1185 C CA    . ARG A 1 168 ? 20.590  24.174  -66.497  1.00 78.82  ? 162 ARG A CA    1 
ATOM   1186 C C     . ARG A 1 168 ? 20.628  25.359  -67.482  1.00 82.91  ? 162 ARG A C     1 
ATOM   1187 O O     . ARG A 1 168 ? 21.238  25.246  -68.553  1.00 81.49  ? 162 ARG A O     1 
ATOM   1188 C CB    . ARG A 1 168 ? 21.653  24.341  -65.405  1.00 79.54  ? 162 ARG A CB    1 
ATOM   1189 N N     . THR A 1 169 ? 19.941  26.472  -67.154  1.00 80.46  ? 163 THR A N     1 
ATOM   1190 C CA    . THR A 1 169 ? 19.974  27.663  -68.008  1.00 81.87  ? 163 THR A CA    1 
ATOM   1191 C C     . THR A 1 169 ? 21.365  28.280  -67.865  1.00 87.96  ? 163 THR A C     1 
ATOM   1192 O O     . THR A 1 169 ? 22.027  28.084  -66.839  1.00 87.80  ? 163 THR A O     1 
ATOM   1193 C CB    . THR A 1 169 ? 18.807  28.623  -67.700  1.00 89.19  ? 163 THR A CB    1 
ATOM   1194 O OG1   . THR A 1 169 ? 17.581  27.897  -67.773  1.00 90.46  ? 163 THR A OG1   1 
ATOM   1195 C CG2   . THR A 1 169 ? 18.723  29.795  -68.678  1.00 87.18  ? 163 THR A CG2   1 
ATOM   1196 N N     . GLU A 1 170 ? 21.826  28.960  -68.927  1.00 86.18  ? 164 GLU A N     1 
ATOM   1197 C CA    . GLU A 1 170 ? 23.136  29.603  -69.038  1.00 86.87  ? 164 GLU A CA    1 
ATOM   1198 C C     . GLU A 1 170 ? 24.267  28.585  -68.929  1.00 90.11  ? 164 GLU A C     1 
ATOM   1199 O O     . GLU A 1 170 ? 25.366  28.948  -68.522  1.00 91.74  ? 164 GLU A O     1 
ATOM   1200 C CB    . GLU A 1 170 ? 23.297  30.805  -68.068  1.00 88.90  ? 164 GLU A CB    1 
ATOM   1201 N N     . MET A 1 171 ? 24.003  27.307  -69.286  1.00 84.24  ? 165 MET A N     1 
ATOM   1202 C CA    . MET A 1 171 ? 25.039  26.277  -69.253  1.00 83.40  ? 165 MET A CA    1 
ATOM   1203 C C     . MET A 1 171 ? 25.780  26.128  -70.602  1.00 88.09  ? 165 MET A C     1 
ATOM   1204 O O     . MET A 1 171 ? 25.160  26.180  -71.668  1.00 87.34  ? 165 MET A O     1 
ATOM   1205 C CB    . MET A 1 171 ? 24.545  24.944  -68.642  1.00 83.97  ? 165 MET A CB    1 
ATOM   1206 C CG    . MET A 1 171 ? 23.920  23.971  -69.627  1.00 86.88  ? 165 MET A CG    1 
ATOM   1207 S SD    . MET A 1 171 ? 23.708  22.264  -69.024  1.00 89.15  ? 165 MET A SD    1 
ATOM   1208 C CE    . MET A 1 171 ? 25.198  21.522  -69.648  1.00 86.39  ? 165 MET A CE    1 
ATOM   1209 N N     . GLU A 1 172 ? 27.115  26.014  -70.541  1.00 85.88  ? 166 GLU A N     1 
ATOM   1210 C CA    . GLU A 1 172 ? 27.974  25.871  -71.715  1.00 86.72  ? 166 GLU A CA    1 
ATOM   1211 C C     . GLU A 1 172 ? 28.058  24.384  -72.103  1.00 89.36  ? 166 GLU A C     1 
ATOM   1212 O O     . GLU A 1 172 ? 28.553  23.549  -71.330  1.00 89.08  ? 166 GLU A O     1 
ATOM   1213 C CB    . GLU A 1 172 ? 29.360  26.457  -71.444  1.00 88.68  ? 166 GLU A CB    1 
ATOM   1214 N N     . ILE A 1 173 ? 27.478  24.058  -73.275  1.00 83.60  ? 167 ILE A N     1 
ATOM   1215 C CA    . ILE A 1 173 ? 27.429  22.727  -73.883  1.00 81.42  ? 167 ILE A CA    1 
ATOM   1216 C C     . ILE A 1 173 ? 27.252  22.889  -75.388  1.00 84.57  ? 167 ILE A C     1 
ATOM   1217 O O     . ILE A 1 173 ? 26.442  23.714  -75.822  1.00 83.76  ? 167 ILE A O     1 
ATOM   1218 C CB    . ILE A 1 173 ? 26.316  21.839  -73.262  1.00 82.26  ? 167 ILE A CB    1 
ATOM   1219 N N     . GLU A 1 174 ? 28.030  22.129  -76.180  1.00 80.94  ? 168 GLU A N     1 
ATOM   1220 C CA    . GLU A 1 174 ? 27.923  22.158  -77.641  1.00 80.88  ? 168 GLU A CA    1 
ATOM   1221 C C     . GLU A 1 174 ? 26.642  21.414  -78.028  1.00 81.68  ? 168 GLU A C     1 
ATOM   1222 O O     . GLU A 1 174 ? 26.436  20.284  -77.562  1.00 80.45  ? 168 GLU A O     1 
ATOM   1223 C CB    . GLU A 1 174 ? 29.145  21.503  -78.285  1.00 82.24  ? 168 GLU A CB    1 
ATOM   1224 N N     . ARG A 1 175 ? 25.755  22.075  -78.822  1.00 76.42  ? 169 ARG A N     1 
ATOM   1225 C CA    . ARG A 1 175 ? 24.484  21.519  -79.306  1.00 74.43  ? 169 ARG A CA    1 
ATOM   1226 C C     . ARG A 1 175 ? 24.667  20.062  -79.750  1.00 76.15  ? 169 ARG A C     1 
ATOM   1227 O O     . ARG A 1 175 ? 23.859  19.210  -79.366  1.00 74.38  ? 169 ARG A O     1 
ATOM   1228 C CB    . ARG A 1 175 ? 23.896  22.374  -80.445  1.00 74.93  ? 169 ARG A CB    1 
ATOM   1229 N N     . ASN A 1 176 ? 25.795  19.772  -80.457  1.00 72.01  ? 170 ASN A N     1 
ATOM   1230 C CA    . ASN A 1 176 ? 26.169  18.442  -80.943  1.00 70.85  ? 170 ASN A CA    1 
ATOM   1231 C C     . ASN A 1 176 ? 26.444  17.398  -79.824  1.00 70.87  ? 170 ASN A C     1 
ATOM   1232 O O     . ASN A 1 176 ? 26.045  16.238  -79.974  1.00 69.97  ? 170 ASN A O     1 
ATOM   1233 C CB    . ASN A 1 176 ? 27.331  18.548  -81.912  1.00 74.19  ? 170 ASN A CB    1 
ATOM   1234 N N     . GLU A 1 177 ? 27.097  17.810  -78.703  1.00 64.90  ? 171 GLU A N     1 
ATOM   1235 C CA    . GLU A 1 177 ? 27.380  16.933  -77.547  1.00 62.32  ? 171 GLU A CA    1 
ATOM   1236 C C     . GLU A 1 177 ? 26.095  16.574  -76.829  1.00 63.97  ? 171 GLU A C     1 
ATOM   1237 O O     . GLU A 1 177 ? 25.971  15.441  -76.355  1.00 62.84  ? 171 GLU A O     1 
ATOM   1238 C CB    . GLU A 1 177 ? 28.341  17.587  -76.549  1.00 63.66  ? 171 GLU A CB    1 
ATOM   1239 N N     . LEU A 1 178 ? 25.130  17.538  -76.752  1.00 59.24  ? 172 LEU A N     1 
ATOM   1240 C CA    . LEU A 1 178 ? 23.814  17.332  -76.133  1.00 56.87  ? 172 LEU A CA    1 
ATOM   1241 C C     . LEU A 1 178 ? 23.139  16.185  -76.866  1.00 59.30  ? 172 LEU A C     1 
ATOM   1242 O O     . LEU A 1 178 ? 22.695  15.231  -76.215  1.00 58.47  ? 172 LEU A O     1 
ATOM   1243 C CB    . LEU A 1 178 ? 22.951  18.620  -76.193  1.00 56.70  ? 172 LEU A CB    1 
ATOM   1244 C CG    . LEU A 1 178 ? 21.610  18.735  -75.377  1.00 59.39  ? 172 LEU A CG    1 
ATOM   1245 C CD1   . LEU A 1 178 ? 20.415  18.877  -76.287  1.00 59.92  ? 172 LEU A CD1   1 
ATOM   1246 C CD2   . LEU A 1 178 ? 21.397  17.619  -74.342  1.00 58.45  ? 172 LEU A CD2   1 
ATOM   1247 N N     . LEU A 1 179 ? 23.161  16.237  -78.218  1.00 54.21  ? 173 LEU A N     1 
ATOM   1248 C CA    . LEU A 1 179 ? 22.591  15.206  -79.073  1.00 53.08  ? 173 LEU A CA    1 
ATOM   1249 C C     . LEU A 1 179 ? 23.229  13.844  -78.767  1.00 58.63  ? 173 LEU A C     1 
ATOM   1250 O O     . LEU A 1 179 ? 22.498  12.872  -78.511  1.00 57.81  ? 173 LEU A O     1 
ATOM   1251 C CB    . LEU A 1 179 ? 22.733  15.565  -80.560  1.00 53.90  ? 173 LEU A CB    1 
ATOM   1252 C CG    . LEU A 1 179 ? 22.338  16.977  -81.008  1.00 59.25  ? 173 LEU A CG    1 
ATOM   1253 C CD1   . LEU A 1 179 ? 22.260  17.061  -82.497  1.00 60.43  ? 173 LEU A CD1   1 
ATOM   1254 C CD2   . LEU A 1 179 ? 21.006  17.414  -80.451  1.00 62.74  ? 173 LEU A CD2   1 
ATOM   1255 N N     . ARG A 1 180 ? 24.587  13.799  -78.710  1.00 55.80  ? 174 ARG A N     1 
ATOM   1256 C CA    . ARG A 1 180 ? 25.339  12.582  -78.396  1.00 55.20  ? 174 ARG A CA    1 
ATOM   1257 C C     . ARG A 1 180 ? 24.915  12.021  -77.022  1.00 57.35  ? 174 ARG A C     1 
ATOM   1258 O O     . ARG A 1 180 ? 24.610  10.825  -76.919  1.00 54.80  ? 174 ARG A O     1 
ATOM   1259 C CB    . ARG A 1 180 ? 26.832  12.860  -78.431  1.00 56.86  ? 174 ARG A CB    1 
ATOM   1260 N N     . LYS A 1 181 ? 24.811  12.908  -76.000  1.00 54.58  ? 175 LYS A N     1 
ATOM   1261 C CA    . LYS A 1 181 ? 24.415  12.551  -74.632  1.00 53.49  ? 175 LYS A CA    1 
ATOM   1262 C C     . LYS A 1 181 ? 22.985  11.994  -74.596  1.00 58.52  ? 175 LYS A C     1 
ATOM   1263 O O     . LYS A 1 181 ? 22.690  11.148  -73.749  1.00 57.16  ? 175 LYS A O     1 
ATOM   1264 C CB    . LYS A 1 181 ? 24.573  13.752  -73.691  1.00 53.71  ? 175 LYS A CB    1 
ATOM   1265 N N     . LEU A 1 182 ? 22.121  12.441  -75.548  1.00 56.72  ? 176 LEU A N     1 
ATOM   1266 C CA    . LEU A 1 182 ? 20.730  12.000  -75.691  1.00 56.36  ? 176 LEU A CA    1 
ATOM   1267 C C     . LEU A 1 182 ? 20.671  10.651  -76.385  1.00 62.92  ? 176 LEU A C     1 
ATOM   1268 O O     . LEU A 1 182 ? 19.951  9.767   -75.913  1.00 60.83  ? 176 LEU A O     1 
ATOM   1269 C CB    . LEU A 1 182 ? 19.879  13.021  -76.450  1.00 56.80  ? 176 LEU A CB    1 
ATOM   1270 C CG    . LEU A 1 182 ? 19.579  14.319  -75.729  1.00 61.48  ? 176 LEU A CG    1 
ATOM   1271 C CD1   . LEU A 1 182 ? 19.087  15.355  -76.700  1.00 62.95  ? 176 LEU A CD1   1 
ATOM   1272 C CD2   . LEU A 1 182 ? 18.579  14.115  -74.605  1.00 62.75  ? 176 LEU A CD2   1 
ATOM   1273 N N     . VAL A 1 183 ? 21.436  10.476  -77.498  1.00 62.60  ? 177 VAL A N     1 
ATOM   1274 C CA    . VAL A 1 183 ? 21.499  9.188   -78.205  1.00 62.93  ? 177 VAL A CA    1 
ATOM   1275 C C     . VAL A 1 183 ? 22.055  8.129   -77.252  1.00 66.78  ? 177 VAL A C     1 
ATOM   1276 O O     . VAL A 1 183 ? 21.496  7.029   -77.183  1.00 64.44  ? 177 VAL A O     1 
ATOM   1277 C CB    . VAL A 1 183 ? 22.292  9.219   -79.525  1.00 68.00  ? 177 VAL A CB    1 
ATOM   1278 C CG1   . VAL A 1 183 ? 22.018  7.957   -80.338  1.00 68.04  ? 177 VAL A CG1   1 
ATOM   1279 C CG2   . VAL A 1 183 ? 21.960  10.458  -80.342  1.00 68.82  ? 177 VAL A CG2   1 
ATOM   1280 N N     . ASP A 1 184 ? 23.105  8.508   -76.463  1.00 65.34  ? 178 ASP A N     1 
ATOM   1281 C CA    . ASP A 1 184 ? 23.744  7.657   -75.452  1.00 65.28  ? 178 ASP A CA    1 
ATOM   1282 C C     . ASP A 1 184 ? 22.705  7.092   -74.436  1.00 66.92  ? 178 ASP A C     1 
ATOM   1283 O O     . ASP A 1 184 ? 22.908  5.997   -73.916  1.00 66.46  ? 178 ASP A O     1 
ATOM   1284 C CB    . ASP A 1 184 ? 24.867  8.415   -74.738  1.00 66.40  ? 178 ASP A CB    1 
ATOM   1285 N N     . ILE A 1 185 ? 21.571  7.801   -74.230  1.00 61.44  ? 179 ILE A N     1 
ATOM   1286 C CA    . ILE A 1 185 ? 20.506  7.349   -73.329  1.00 59.77  ? 179 ILE A CA    1 
ATOM   1287 C C     . ILE A 1 185 ? 19.246  6.818   -74.059  1.00 64.03  ? 179 ILE A C     1 
ATOM   1288 O O     . ILE A 1 185 ? 18.122  6.987   -73.562  1.00 61.63  ? 179 ILE A O     1 
ATOM   1289 C CB    . ILE A 1 185 ? 20.213  8.291   -72.104  1.00 61.44  ? 179 ILE A CB    1 
ATOM   1290 C CG1   . ILE A 1 185 ? 19.684  9.673   -72.514  1.00 61.87  ? 179 ILE A CG1   1 
ATOM   1291 C CG2   . ILE A 1 185 ? 21.416  8.404   -71.186  1.00 61.71  ? 179 ILE A CG2   1 
ATOM   1292 C CD1   . ILE A 1 185 ? 18.739  10.309  -71.501  1.00 66.36  ? 179 ILE A CD1   1 
ATOM   1293 N N     . GLN A 1 186 ? 19.446  6.169   -75.243  1.00 62.43  ? 180 GLN A N     1 
ATOM   1294 C CA    . GLN A 1 186 ? 18.380  5.556   -76.078  1.00 62.68  ? 180 GLN A CA    1 
ATOM   1295 C C     . GLN A 1 186 ? 17.350  6.497   -76.871  1.00 64.28  ? 180 GLN A C     1 
ATOM   1296 O O     . GLN A 1 186 ? 16.312  6.024   -77.371  1.00 62.93  ? 180 GLN A O     1 
ATOM   1297 C CB    . GLN A 1 186 ? 17.660  4.443   -75.295  1.00 62.56  ? 180 GLN A CB    1 
ATOM   1298 N N     . TYR A 1 187 ? 17.671  7.761   -77.025  1.00 58.99  ? 181 TYR A N     1 
ATOM   1299 C CA    . TYR A 1 187 ? 16.825  8.594   -77.827  1.00 58.26  ? 181 TYR A CA    1 
ATOM   1300 C C     . TYR A 1 187 ? 17.282  8.513   -79.244  1.00 63.41  ? 181 TYR A C     1 
ATOM   1301 O O     . TYR A 1 187 ? 18.445  8.396   -79.510  1.00 65.19  ? 181 TYR A O     1 
ATOM   1302 C CB    . TYR A 1 187 ? 16.874  10.023  -77.346  1.00 20.00  ? 181 TYR A CB    1 
ATOM   1303 C CG    . TYR A 1 187 ? 15.997  10.222  -76.165  1.00 20.00  ? 181 TYR A CG    1 
ATOM   1304 C CD1   . TYR A 1 187 ? 15.263  11.360  -75.995  1.00 20.00  ? 181 TYR A CD1   1 
ATOM   1305 C CD2   . TYR A 1 187 ? 15.888  9.246   -75.230  1.00 20.00  ? 181 TYR A CD2   1 
ATOM   1306 C CE1   . TYR A 1 187 ? 14.473  11.510  -74.927  1.00 20.00  ? 181 TYR A CE1   1 
ATOM   1307 C CE2   . TYR A 1 187 ? 15.097  9.392   -74.173  1.00 20.00  ? 181 TYR A CE2   1 
ATOM   1308 C CZ    . TYR A 1 187 ? 14.397  10.520  -74.028  1.00 20.00  ? 181 TYR A CZ    1 
ATOM   1309 O OH    . TYR A 1 187 ? 13.612  10.644  -72.943  1.00 20.00  ? 181 TYR A OH    1 
ATOM   1310 N N     . ALA A 1 188 ? 16.344  8.555   -80.159  1.00 57.60  ? 182 ALA A N     1 
ATOM   1311 C CA    . ALA A 1 188 ? 16.626  8.583   -81.594  1.00 57.29  ? 182 ALA A CA    1 
ATOM   1312 C C     . ALA A 1 188 ? 16.399  9.972   -82.120  1.00 58.69  ? 182 ALA A C     1 
ATOM   1313 O O     . ALA A 1 188 ? 15.723  10.750  -81.469  1.00 58.77  ? 182 ALA A O     1 
ATOM   1314 C CB    . ALA A 1 188 ? 15.694  7.618   -82.306  1.00 58.38  ? 182 ALA A CB    1 
ATOM   1315 N N     . ARG A 1 189 ? 16.933  10.301  -83.291  1.00 54.36  ? 183 ARG A N     1 
ATOM   1316 C CA    . ARG A 1 189 ? 16.652  11.620  -83.858  1.00 54.01  ? 183 ARG A CA    1 
ATOM   1317 C C     . ARG A 1 189 ? 15.634  11.472  -84.989  1.00 57.72  ? 183 ARG A C     1 
ATOM   1318 O O     . ARG A 1 189 ? 15.802  10.619  -85.859  1.00 58.21  ? 183 ARG A O     1 
ATOM   1319 C CB    . ARG A 1 189 ? 17.917  12.354  -84.303  1.00 51.92  ? 183 ARG A CB    1 
ATOM   1320 C CG    . ARG A 1 189 ? 17.631  13.809  -84.615  1.00 55.63  ? 183 ARG A CG    1 
ATOM   1321 C CD    . ARG A 1 189 ? 18.846  14.518  -85.116  1.00 64.14  ? 183 ARG A CD    1 
ATOM   1322 N NE    . ARG A 1 189 ? 18.480  15.723  -85.847  1.00 69.42  ? 183 ARG A NE    1 
ATOM   1323 C CZ    . ARG A 1 189 ? 19.347  16.643  -86.253  1.00 85.29  ? 183 ARG A CZ    1 
ATOM   1324 N NH1   . ARG A 1 189 ? 20.644  16.506  -85.994  1.00 70.22  ? 183 ARG A NH1   1 
ATOM   1325 N NH2   . ARG A 1 189 ? 18.925  17.714  -86.910  1.00 75.62  ? 183 ARG A NH2   1 
ATOM   1326 N N     . ASN A 1 190 ? 14.580  12.294  -84.964  1.00 53.40  ? 184 ASN A N     1 
ATOM   1327 C CA    . ASN A 1 190 ? 13.488  12.227  -85.919  1.00 54.51  ? 184 ASN A CA    1 
ATOM   1328 C C     . ASN A 1 190 ? 12.897  13.601  -86.071  1.00 61.16  ? 184 ASN A C     1 
ATOM   1329 O O     . ASN A 1 190 ? 12.067  14.008  -85.258  1.00 59.70  ? 184 ASN A O     1 
ATOM   1330 C CB    . ASN A 1 190 ? 12.409  11.273  -85.382  1.00 55.37  ? 184 ASN A CB    1 
ATOM   1331 C CG    . ASN A 1 190 ? 11.922  10.201  -86.327  1.00 68.97  ? 184 ASN A CG    1 
ATOM   1332 O OD1   . ASN A 1 190 ? 11.860  10.387  -87.561  1.00 55.54  ? 184 ASN A OD1   1 
ATOM   1333 N ND2   . ASN A 1 190 ? 11.499  9.065   -85.736  1.00 54.75  ? 184 ASN A ND2   1 
ATOM   1334 N N     . ASP A 1 191 ? 13.333  14.332  -87.101  1.00 61.85  ? 185 ASP A N     1 
ATOM   1335 C CA    . ASP A 1 191 ? 12.834  15.683  -87.389  1.00 62.97  ? 185 ASP A CA    1 
ATOM   1336 C C     . ASP A 1 191 ? 11.571  15.561  -88.230  1.00 67.58  ? 185 ASP A C     1 
ATOM   1337 O O     . ASP A 1 191 ? 10.766  16.497  -88.255  1.00 68.79  ? 185 ASP A O     1 
ATOM   1338 C CB    . ASP A 1 191 ? 13.882  16.549  -88.136  1.00 66.58  ? 185 ASP A CB    1 
ATOM   1339 C CG    . ASP A 1 191 ? 15.276  16.701  -87.532  1.00 74.73  ? 185 ASP A CG    1 
ATOM   1340 O OD1   . ASP A 1 191 ? 15.488  16.241  -86.367  1.00 74.12  ? 185 ASP A OD1   1 
ATOM   1341 O OD2   . ASP A 1 191 ? 16.151  17.283  -88.214  1.00 76.96  ? 185 ASP A OD2   1 
ATOM   1342 N N     . ILE A 1 192 ? 11.391  14.399  -88.903  1.00 63.64  ? 186 ILE A N     1 
ATOM   1343 C CA    . ILE A 1 192 ? 10.243  14.112  -89.776  1.00 64.06  ? 186 ILE A CA    1 
ATOM   1344 C C     . ILE A 1 192 ? 9.042   13.577  -88.996  1.00 67.81  ? 186 ILE A C     1 
ATOM   1345 O O     . ILE A 1 192 ? 7.924   14.065  -89.202  1.00 69.66  ? 186 ILE A O     1 
ATOM   1346 C CB    . ILE A 1 192 ? 10.629  13.188  -90.961  1.00 67.49  ? 186 ILE A CB    1 
ATOM   1347 C CG1   . ILE A 1 192 ? 11.840  13.720  -91.761  1.00 69.19  ? 186 ILE A CG1   1 
ATOM   1348 C CG2   . ILE A 1 192 ? 9.444   12.894  -91.876  1.00 68.56  ? 186 ILE A CG2   1 
ATOM   1349 C CD1   . ILE A 1 192 ? 11.823  15.238  -92.218  1.00 75.81  ? 186 ILE A CD1   1 
ATOM   1350 N N     . ASP A 1 193 ? 9.266   12.564  -88.134  1.00 60.57  ? 187 ASP A N     1 
ATOM   1351 C CA    . ASP A 1 193 ? 8.213   11.932  -87.348  1.00 58.39  ? 187 ASP A CA    1 
ATOM   1352 C C     . ASP A 1 193 ? 8.496   12.060  -85.843  1.00 58.30  ? 187 ASP A C     1 
ATOM   1353 O O     . ASP A 1 193 ? 8.868   11.084  -85.182  1.00 56.80  ? 187 ASP A O     1 
ATOM   1354 C CB    . ASP A 1 193 ? 8.026   10.460  -87.786  1.00 60.41  ? 187 ASP A CB    1 
ATOM   1355 C CG    . ASP A 1 193 ? 7.425   10.228  -89.169  1.00 72.05  ? 187 ASP A CG    1 
ATOM   1356 O OD1   . ASP A 1 193 ? 7.362   11.189  -89.963  1.00 71.63  ? 187 ASP A OD1   1 
ATOM   1357 O OD2   . ASP A 1 193 ? 7.027   9.072   -89.460  1.00 83.24  ? 187 ASP A OD2   1 
ATOM   1358 N N     . PHE A 1 194 ? 8.313   13.279  -85.306  1.00 52.96  ? 188 PHE A N     1 
ATOM   1359 C CA    . PHE A 1 194 ? 8.574   13.612  -83.898  1.00 50.13  ? 188 PHE A CA    1 
ATOM   1360 C C     . PHE A 1 194 ? 7.587   12.958  -82.944  1.00 52.42  ? 188 PHE A C     1 
ATOM   1361 O O     . PHE A 1 194 ? 6.383   13.137  -83.091  1.00 53.85  ? 188 PHE A O     1 
ATOM   1362 C CB    . PHE A 1 194 ? 8.635   15.143  -83.716  1.00 51.61  ? 188 PHE A CB    1 
ATOM   1363 C CG    . PHE A 1 194 ? 9.030   15.654  -82.360  1.00 50.63  ? 188 PHE A CG    1 
ATOM   1364 C CD1   . PHE A 1 194 ? 10.214  15.242  -81.761  1.00 53.13  ? 188 PHE A CD1   1 
ATOM   1365 C CD2   . PHE A 1 194 ? 8.246   16.585  -81.700  1.00 51.62  ? 188 PHE A CD2   1 
ATOM   1366 C CE1   . PHE A 1 194 ? 10.581  15.720  -80.503  1.00 53.33  ? 188 PHE A CE1   1 
ATOM   1367 C CE2   . PHE A 1 194 ? 8.625   17.084  -80.455  1.00 54.01  ? 188 PHE A CE2   1 
ATOM   1368 C CZ    . PHE A 1 194 ? 9.788   16.648  -79.862  1.00 51.96  ? 188 PHE A CZ    1 
ATOM   1369 N N     . GLN A 1 195 ? 8.103   12.178  -81.981  1.00 46.60  ? 189 GLN A N     1 
ATOM   1370 C CA    . GLN A 1 195 ? 7.318   11.422  -81.002  1.00 44.99  ? 189 GLN A CA    1 
ATOM   1371 C C     . GLN A 1 195 ? 8.149   11.066  -79.771  1.00 47.59  ? 189 GLN A C     1 
ATOM   1372 O O     . GLN A 1 195 ? 9.371   11.250  -79.766  1.00 45.60  ? 189 GLN A O     1 
ATOM   1373 C CB    . GLN A 1 195 ? 6.812   10.106  -81.645  1.00 46.82  ? 189 GLN A CB    1 
ATOM   1374 C CG    . GLN A 1 195 ? 7.899   9.013   -81.859  1.00 50.88  ? 189 GLN A CG    1 
ATOM   1375 C CD    . GLN A 1 195 ? 7.835   8.330   -83.202  1.00 65.42  ? 189 GLN A CD    1 
ATOM   1376 O OE1   . GLN A 1 195 ? 6.764   8.077   -83.767  1.00 51.21  ? 189 GLN A OE1   1 
ATOM   1377 N NE2   . GLN A 1 195 ? 8.997   8.003   -83.739  1.00 73.48  ? 189 GLN A NE2   1 
ATOM   1378 N N     . ARG A 1 196 ? 7.475   10.449  -78.767  1.00 45.08  ? 190 ARG A N     1 
ATOM   1379 C CA    . ARG A 1 196 ? 8.060   9.925   -77.534  1.00 43.66  ? 190 ARG A CA    1 
ATOM   1380 C C     . ARG A 1 196 ? 9.306   9.115   -77.886  1.00 47.53  ? 190 ARG A C     1 
ATOM   1381 O O     . ARG A 1 196 ? 9.303   8.391   -78.881  1.00 48.38  ? 190 ARG A O     1 
ATOM   1382 C CB    . ARG A 1 196 ? 7.041   9.051   -76.805  1.00 43.39  ? 190 ARG A CB    1 
ATOM   1383 N N     . GLY A 1 197 ? 10.374  9.312   -77.123  1.00 43.30  ? 191 GLY A N     1 
ATOM   1384 C CA    . GLY A 1 197 ? 11.653  8.635   -77.327  1.00 43.30  ? 191 GLY A CA    1 
ATOM   1385 C C     . GLY A 1 197 ? 12.569  9.269   -78.360  1.00 49.10  ? 191 GLY A C     1 
ATOM   1386 O O     . GLY A 1 197 ? 13.691  8.790   -78.551  1.00 50.03  ? 191 GLY A O     1 
ATOM   1387 N N     . THR A 1 198 ? 12.097  10.325  -79.059  1.00 45.53  ? 192 THR A N     1 
ATOM   1388 C CA    . THR A 1 198 ? 12.875  11.024  -80.076  1.00 46.40  ? 192 THR A CA    1 
ATOM   1389 C C     . THR A 1 198 ? 13.116  12.500  -79.725  1.00 50.51  ? 192 THR A C     1 
ATOM   1390 O O     . THR A 1 198 ? 12.477  13.046  -78.817  1.00 48.77  ? 192 THR A O     1 
ATOM   1391 C CB    . THR A 1 198 ? 12.304  10.823  -81.519  1.00 54.49  ? 192 THR A CB    1 
ATOM   1392 O OG1   . THR A 1 198 ? 11.221  11.711  -81.780  1.00 53.87  ? 192 THR A OG1   1 
ATOM   1393 C CG2   . THR A 1 198 ? 11.884  9.404   -81.808  1.00 54.55  ? 192 THR A CG2   1 
ATOM   1394 N N     . PHE A 1 199 ? 14.052  13.136  -80.469  1.00 47.90  ? 193 PHE A N     1 
ATOM   1395 C CA    . PHE A 1 199 ? 14.382  14.551  -80.374  1.00 47.91  ? 193 PHE A CA    1 
ATOM   1396 C C     . PHE A 1 199 ? 14.535  15.093  -81.757  1.00 50.71  ? 193 PHE A C     1 
ATOM   1397 O O     . PHE A 1 199 ? 14.968  14.356  -82.634  1.00 52.33  ? 193 PHE A O     1 
ATOM   1398 C CB    . PHE A 1 199 ? 15.645  14.807  -79.553  1.00 50.10  ? 193 PHE A CB    1 
ATOM   1399 C CG    . PHE A 1 199 ? 16.931  14.236  -80.107  1.00 53.57  ? 193 PHE A CG    1 
ATOM   1400 C CD1   . PHE A 1 199 ? 17.735  14.988  -80.958  1.00 58.74  ? 193 PHE A CD1   1 
ATOM   1401 C CD2   . PHE A 1 199 ? 17.387  12.984  -79.701  1.00 56.02  ? 193 PHE A CD2   1 
ATOM   1402 C CE1   . PHE A 1 199 ? 18.948  14.482  -81.423  1.00 60.41  ? 193 PHE A CE1   1 
ATOM   1403 C CE2   . PHE A 1 199 ? 18.607  12.486  -80.155  1.00 59.45  ? 193 PHE A CE2   1 
ATOM   1404 C CZ    . PHE A 1 199 ? 19.375  13.237  -81.018  1.00 59.08  ? 193 PHE A CZ    1 
ATOM   1405 N N     . ARG A 1 200 ? 14.198  16.370  -81.962  1.00 45.41  ? 194 ARG A N     1 
ATOM   1406 C CA    . ARG A 1 200 ? 14.307  17.020  -83.260  1.00 46.37  ? 194 ARG A CA    1 
ATOM   1407 C C     . ARG A 1 200 ? 15.124  18.299  -83.138  1.00 51.60  ? 194 ARG A C     1 
ATOM   1408 O O     . ARG A 1 200 ? 15.110  18.931  -82.083  1.00 50.57  ? 194 ARG A O     1 
ATOM   1409 C CB    . ARG A 1 200 ? 12.899  17.298  -83.843  1.00 46.80  ? 194 ARG A CB    1 
ATOM   1410 C CG    . ARG A 1 200 ? 12.306  18.699  -83.566  1.00 53.07  ? 194 ARG A CG    1 
ATOM   1411 C CD    . ARG A 1 200 ? 10.911  18.662  -82.972  1.00 59.13  ? 194 ARG A CD    1 
ATOM   1412 N NE    . ARG A 1 200 ? 9.874   18.486  -83.988  1.00 67.87  ? 194 ARG A NE    1 
ATOM   1413 C CZ    . ARG A 1 200 ? 8.682   19.087  -83.969  1.00 74.89  ? 194 ARG A CZ    1 
ATOM   1414 N NH1   . ARG A 1 200 ? 8.350   19.899  -82.962  1.00 25.22  ? 194 ARG A NH1   1 
ATOM   1415 N NH2   . ARG A 1 200 ? 7.815   18.887  -84.958  1.00 73.01  ? 194 ARG A NH2   1 
ATOM   1416 N N     . VAL A 1 201 ? 15.821  18.691  -84.211  1.00 50.47  ? 195 VAL A N     1 
ATOM   1417 C CA    . VAL A 1 201 ? 16.580  19.942  -84.232  1.00 51.43  ? 195 VAL A CA    1 
ATOM   1418 C C     . VAL A 1 201 ? 15.923  20.872  -85.221  1.00 60.49  ? 195 VAL A C     1 
ATOM   1419 O O     . VAL A 1 201 ? 16.045  20.656  -86.430  1.00 63.12  ? 195 VAL A O     1 
ATOM   1420 C CB    . VAL A 1 201 ? 18.096  19.785  -84.502  1.00 54.74  ? 195 VAL A CB    1 
ATOM   1421 C CG1   . VAL A 1 201 ? 18.799  21.140  -84.481  1.00 55.02  ? 195 VAL A CG1   1 
ATOM   1422 C CG2   . VAL A 1 201 ? 18.731  18.844  -83.485  1.00 53.32  ? 195 VAL A CG2   1 
ATOM   1423 N N     . ARG A 1 202 ? 15.199  21.885  -84.721  1.00 58.20  ? 196 ARG A N     1 
ATOM   1424 C CA    . ARG A 1 202 ? 14.555  22.853  -85.596  1.00 60.29  ? 196 ARG A CA    1 
ATOM   1425 C C     . ARG A 1 202 ? 15.623  23.890  -86.065  1.00 68.95  ? 196 ARG A C     1 
ATOM   1426 O O     . ARG A 1 202 ? 16.239  23.678  -87.123  1.00 70.56  ? 196 ARG A O     1 
ATOM   1427 C CB    . ARG A 1 202 ? 13.360  23.504  -84.903  1.00 60.27  ? 196 ARG A CB    1 
ATOM   1428 N N     . GLY A 1 203 ? 15.881  24.938  -85.272  1.00 66.10  ? 197 GLY A N     1 
ATOM   1429 C CA    . GLY A 1 203 ? 16.882  25.946  -85.611  1.00 67.59  ? 197 GLY A CA    1 
ATOM   1430 C C     . GLY A 1 203 ? 18.014  25.847  -84.630  1.00 71.01  ? 197 GLY A C     1 
ATOM   1431 O O     . GLY A 1 203 ? 18.692  24.816  -84.576  1.00 70.32  ? 197 GLY A O     1 
ATOM   1432 N N     . ASP A 1 204 ? 18.163  26.875  -83.781  1.00 67.30  ? 198 ASP A N     1 
ATOM   1433 C CA    . ASP A 1 204 ? 19.127  26.844  -82.683  1.00 66.14  ? 198 ASP A CA    1 
ATOM   1434 C C     . ASP A 1 204 ? 18.339  26.244  -81.479  1.00 68.28  ? 198 ASP A C     1 
ATOM   1435 O O     . ASP A 1 204 ? 18.535  26.615  -80.314  1.00 67.51  ? 198 ASP A O     1 
ATOM   1436 C CB    . ASP A 1 204 ? 19.602  28.254  -82.379  1.00 68.10  ? 198 ASP A CB    1 
ATOM   1437 N N     . VAL A 1 205 ? 17.426  25.299  -81.799  1.00 63.36  ? 199 VAL A N     1 
ATOM   1438 C CA    . VAL A 1 205 ? 16.510  24.651  -80.872  1.00 60.71  ? 199 VAL A CA    1 
ATOM   1439 C C     . VAL A 1 205 ? 16.546  23.123  -80.958  1.00 65.23  ? 199 VAL A C     1 
ATOM   1440 O O     . VAL A 1 205 ? 16.564  22.557  -82.057  1.00 66.83  ? 199 VAL A O     1 
ATOM   1441 C CB    . VAL A 1 205 ? 15.079  25.229  -81.052  1.00 63.25  ? 199 VAL A CB    1 
ATOM   1442 C CG1   . VAL A 1 205 ? 13.995  24.228  -80.689  1.00 61.32  ? 199 VAL A CG1   1 
ATOM   1443 C CG2   . VAL A 1 205 ? 14.908  26.501  -80.245  1.00 63.24  ? 199 VAL A CG2   1 
ATOM   1444 N N     . VAL A 1 206 ? 16.543  22.471  -79.776  1.00 58.81  ? 200 VAL A N     1 
ATOM   1445 C CA    . VAL A 1 206 ? 16.461  21.027  -79.614  1.00 56.62  ? 200 VAL A CA    1 
ATOM   1446 C C     . VAL A 1 206 ? 15.173  20.759  -78.802  1.00 59.20  ? 200 VAL A C     1 
ATOM   1447 O O     . VAL A 1 206 ? 15.048  21.242  -77.674  1.00 59.44  ? 200 VAL A O     1 
ATOM   1448 C CB    . VAL A 1 206 ? 17.721  20.401  -78.952  1.00 59.09  ? 200 VAL A CB    1 
ATOM   1449 C CG1   . VAL A 1 206 ? 17.560  18.887  -78.789  1.00 57.68  ? 200 VAL A CG1   1 
ATOM   1450 C CG2   . VAL A 1 206 ? 18.982  20.718  -79.745  1.00 59.90  ? 200 VAL A CG2   1 
ATOM   1451 N N     . GLU A 1 207 ? 14.206  20.046  -79.403  1.00 53.40  ? 201 GLU A N     1 
ATOM   1452 C CA    . GLU A 1 207 ? 12.949  19.676  -78.758  1.00 50.88  ? 201 GLU A CA    1 
ATOM   1453 C C     . GLU A 1 207 ? 13.067  18.201  -78.416  1.00 51.02  ? 201 GLU A C     1 
ATOM   1454 O O     . GLU A 1 207 ? 13.401  17.405  -79.291  1.00 50.25  ? 201 GLU A O     1 
ATOM   1455 C CB    . GLU A 1 207 ? 11.740  19.951  -79.672  1.00 53.08  ? 201 GLU A CB    1 
ATOM   1456 C CG    . GLU A 1 207 ? 11.417  21.425  -79.872  1.00 65.24  ? 201 GLU A CG    1 
ATOM   1457 C CD    . GLU A 1 207 ? 10.151  21.764  -80.645  1.00 86.66  ? 201 GLU A CD    1 
ATOM   1458 O OE1   . GLU A 1 207 ? 9.067   21.253  -80.278  1.00 98.13  ? 201 GLU A OE1   1 
ATOM   1459 O OE2   . GLU A 1 207 ? 10.229  22.623  -81.555  1.00 67.98  ? 201 GLU A OE2   1 
ATOM   1460 N N     . ILE A 1 208 ? 12.873  17.851  -77.135  1.00 45.78  ? 202 ILE A N     1 
ATOM   1461 C CA    . ILE A 1 208 ? 13.011  16.479  -76.637  1.00 44.90  ? 202 ILE A CA    1 
ATOM   1462 C C     . ILE A 1 208 ? 11.670  15.961  -76.162  1.00 49.12  ? 202 ILE A C     1 
ATOM   1463 O O     . ILE A 1 208 ? 11.047  16.586  -75.316  1.00 48.57  ? 202 ILE A O     1 
ATOM   1464 C CB    . ILE A 1 208 ? 14.081  16.359  -75.510  1.00 47.32  ? 202 ILE A CB    1 
ATOM   1465 C CG1   . ILE A 1 208 ? 15.394  17.102  -75.843  1.00 48.84  ? 202 ILE A CG1   1 
ATOM   1466 C CG2   . ILE A 1 208 ? 14.353  14.898  -75.167  1.00 46.39  ? 202 ILE A CG2   1 
ATOM   1467 C CD1   . ILE A 1 208 ? 15.818  18.101  -74.794  1.00 51.50  ? 202 ILE A CD1   1 
ATOM   1468 N N     . PHE A 1 209 ? 11.277  14.779  -76.646  1.00 46.22  ? 203 PHE A N     1 
ATOM   1469 C CA    . PHE A 1 209 ? 10.009  14.143  -76.342  1.00 45.58  ? 203 PHE A CA    1 
ATOM   1470 C C     . PHE A 1 209 ? 10.158  12.850  -75.507  1.00 50.08  ? 203 PHE A C     1 
ATOM   1471 O O     . PHE A 1 209 ? 10.228  11.777  -76.101  1.00 49.23  ? 203 PHE A O     1 
ATOM   1472 C CB    . PHE A 1 209 ? 9.324   13.828  -77.671  1.00 48.40  ? 203 PHE A CB    1 
ATOM   1473 C CG    . PHE A 1 209 ? 7.819   13.745  -77.660  1.00 50.54  ? 203 PHE A CG    1 
ATOM   1474 C CD1   . PHE A 1 209 ? 7.073   14.276  -78.701  1.00 54.89  ? 203 PHE A CD1   1 
ATOM   1475 C CD2   . PHE A 1 209 ? 7.144   13.105  -76.622  1.00 52.15  ? 203 PHE A CD2   1 
ATOM   1476 C CE1   . PHE A 1 209 ? 5.684   14.158  -78.711  1.00 56.32  ? 203 PHE A CE1   1 
ATOM   1477 C CE2   . PHE A 1 209 ? 5.751   12.999  -76.630  1.00 55.01  ? 203 PHE A CE2   1 
ATOM   1478 C CZ    . PHE A 1 209 ? 5.028   13.540  -77.665  1.00 54.14  ? 203 PHE A CZ    1 
ATOM   1479 N N     . PRO A 1 210 ? 10.110  12.881  -74.150  1.00 47.30  ? 204 PRO A N     1 
ATOM   1480 C CA    . PRO A 1 210 ? 10.228  11.613  -73.390  1.00 48.70  ? 204 PRO A CA    1 
ATOM   1481 C C     . PRO A 1 210 ? 8.954   10.759  -73.318  1.00 77.91  ? 204 PRO A C     1 
ATOM   1482 O O     . PRO A 1 210 ? 9.026   9.521   -73.266  1.00 42.51  ? 204 PRO A O     1 
ATOM   1483 C CB    . PRO A 1 210 ? 10.713  12.062  -72.016  1.00 49.11  ? 204 PRO A CB    1 
ATOM   1484 C CG    . PRO A 1 210 ? 10.233  13.473  -71.874  1.00 52.90  ? 204 PRO A CG    1 
ATOM   1485 C CD    . PRO A 1 210 ? 10.032  14.055  -73.251  1.00 49.45  ? 204 PRO A CD    1 
ATOM   1486 N N     . ARG A 1 213 ? 4.778   8.300   -70.569  1.00 78.94  ? 207 ARG A N     1 
ATOM   1487 C CA    . ARG A 1 213 ? 3.419   8.856   -70.644  1.00 79.30  ? 207 ARG A CA    1 
ATOM   1488 C C     . ARG A 1 213 ? 3.421   10.358  -70.430  1.00 84.59  ? 207 ARG A C     1 
ATOM   1489 O O     . ARG A 1 213 ? 4.510   10.935  -70.417  1.00 84.90  ? 207 ARG A O     1 
ATOM   1490 C CB    . ARG A 1 213 ? 2.425   8.130   -69.718  1.00 77.72  ? 207 ARG A CB    1 
ATOM   1491 C CG    . ARG A 1 213 ? 1.440   7.239   -70.475  1.00 84.20  ? 207 ARG A CG    1 
ATOM   1492 C CD    . ARG A 1 213 ? 1.148   5.957   -69.719  1.00 85.08  ? 207 ARG A CD    1 
ATOM   1493 N NE    . ARG A 1 213 ? 0.660   4.893   -70.594  1.00 91.39  ? 207 ARG A NE    1 
ATOM   1494 C CZ    . ARG A 1 213 ? 0.336   3.672   -70.180  1.00 108.73 ? 207 ARG A CZ    1 
ATOM   1495 N NH1   . ARG A 1 213 ? 0.442   3.349   -68.895  1.00 102.02 ? 207 ARG A NH1   1 
ATOM   1496 N NH2   . ARG A 1 213 ? -0.089  2.760   -71.048  1.00 89.70  ? 207 ARG A NH2   1 
ATOM   1497 N N     . ASP A 1 214 ? 2.230   10.937  -70.416  1.00 81.71  ? 208 ASP A N     1 
ATOM   1498 C CA    . ASP A 1 214 ? 2.037   12.358  -70.266  1.00 82.68  ? 208 ASP A CA    1 
ATOM   1499 C C     . ASP A 1 214 ? 2.645   13.186  -71.401  1.00 87.72  ? 208 ASP A C     1 
ATOM   1500 O O     . ASP A 1 214 ? 3.784   13.605  -71.320  1.00 87.60  ? 208 ASP A O     1 
ATOM   1501 C CB    . ASP A 1 214 ? 2.596   12.765  -68.930  1.00 20.00  ? 208 ASP A CB    1 
ATOM   1502 N N     . GLU A 1 215 ? 1.857   13.420  -72.452  1.00 84.57  ? 209 GLU A N     1 
ATOM   1503 C CA    . GLU A 1 215 ? 2.299   14.068  -73.692  1.00 84.66  ? 209 GLU A CA    1 
ATOM   1504 C C     . GLU A 1 215 ? 2.915   15.479  -73.465  1.00 88.84  ? 209 GLU A C     1 
ATOM   1505 O O     . GLU A 1 215 ? 2.309   16.502  -73.803  1.00 89.28  ? 209 GLU A O     1 
ATOM   1506 C CB    . GLU A 1 215 ? 1.156   14.092  -74.692  1.00 86.09  ? 209 GLU A CB    1 
ATOM   1507 N N     . HIS A 1 216 ? 4.133   15.493  -72.841  1.00 84.62  ? 210 HIS A N     1 
ATOM   1508 C CA    . HIS A 1 216 ? 4.961   16.651  -72.445  1.00 84.42  ? 210 HIS A CA    1 
ATOM   1509 C C     . HIS A 1 216 ? 6.319   16.578  -73.103  1.00 85.37  ? 210 HIS A C     1 
ATOM   1510 O O     . HIS A 1 216 ? 6.850   15.474  -73.287  1.00 85.90  ? 210 HIS A O     1 
ATOM   1511 C CB    . HIS A 1 216 ? 5.190   16.669  -70.920  1.00 84.66  ? 210 HIS A CB    1 
ATOM   1512 C CG    . HIS A 1 216 ? 3.991   17.096  -70.150  1.00 88.52  ? 210 HIS A CG    1 
ATOM   1513 N ND1   . HIS A 1 216 ? 3.873   18.381  -69.666  1.00 91.12  ? 210 HIS A ND1   1 
ATOM   1514 C CD2   . HIS A 1 216 ? 2.865   16.403  -69.853  1.00 90.36  ? 210 HIS A CD2   1 
ATOM   1515 C CE1   . HIS A 1 216 ? 2.689   18.428  -69.076  1.00 90.80  ? 210 HIS A CE1   1 
ATOM   1516 N NE2   . HIS A 1 216 ? 2.044   17.259  -69.167  1.00 90.52  ? 210 HIS A NE2   1 
ATOM   1517 N N     . CYS A 1 217 ? 6.903   17.748  -73.420  1.00 77.86  ? 211 CYS A N     1 
ATOM   1518 C CA    . CYS A 1 217 ? 8.218   17.805  -74.035  1.00 76.00  ? 211 CYS A CA    1 
ATOM   1519 C C     . CYS A 1 217 ? 8.968   19.118  -73.815  1.00 72.70  ? 211 CYS A C     1 
ATOM   1520 O O     . CYS A 1 217 ? 8.397   20.206  -73.852  1.00 72.31  ? 211 CYS A O     1 
ATOM   1521 C CB    . CYS A 1 217 ? 8.169   17.400  -75.504  1.00 78.16  ? 211 CYS A CB    1 
ATOM   1522 S SG    . CYS A 1 217 ? 7.416   18.627  -76.591  1.00 84.42  ? 211 CYS A SG    1 
ATOM   1523 N N     . VAL A 1 218 ? 10.267  18.974  -73.601  1.00 63.96  ? 212 VAL A N     1 
ATOM   1524 C CA    . VAL A 1 218 ? 11.275  19.975  -73.253  1.00 61.76  ? 212 VAL A CA    1 
ATOM   1525 C C     . VAL A 1 218 ? 11.823  20.650  -74.500  1.00 66.00  ? 212 VAL A C     1 
ATOM   1526 O O     . VAL A 1 218 ? 12.294  19.954  -75.400  1.00 66.42  ? 212 VAL A O     1 
ATOM   1527 C CB    . VAL A 1 218 ? 12.407  19.256  -72.464  1.00 63.07  ? 212 VAL A CB    1 
ATOM   1528 C CG1   . VAL A 1 218 ? 13.512  20.219  -72.069  1.00 63.24  ? 212 VAL A CG1   1 
ATOM   1529 C CG2   . VAL A 1 218 ? 11.860  18.519  -71.243  1.00 61.11  ? 212 VAL A CG2   1 
ATOM   1530 N N     . ARG A 1 219 ? 11.781  21.999  -74.549  1.00 62.21  ? 213 ARG A N     1 
ATOM   1531 C CA    . ARG A 1 219 ? 12.300  22.786  -75.675  1.00 62.11  ? 213 ARG A CA    1 
ATOM   1532 C C     . ARG A 1 219 ? 13.476  23.626  -75.219  1.00 66.27  ? 213 ARG A C     1 
ATOM   1533 O O     . ARG A 1 219 ? 13.331  24.604  -74.467  1.00 65.54  ? 213 ARG A O     1 
ATOM   1534 C CB    . ARG A 1 219 ? 11.227  23.634  -76.357  1.00 60.13  ? 213 ARG A CB    1 
ATOM   1535 C CG    . ARG A 1 219 ? 11.796  24.508  -77.473  1.00 69.89  ? 213 ARG A CG    1 
ATOM   1536 C CD    . ARG A 1 219 ? 10.799  25.530  -77.971  1.00 78.00  ? 213 ARG A CD    1 
ATOM   1537 N NE    . ARG A 1 219 ? 9.545   24.885  -78.355  1.00 80.97  ? 213 ARG A NE    1 
ATOM   1538 C CZ    . ARG A 1 219 ? 8.396   25.523  -78.521  1.00 88.56  ? 213 ARG A CZ    1 
ATOM   1539 N NH1   . ARG A 1 219 ? 8.329   26.840  -78.349  1.00 70.06  ? 213 ARG A NH1   1 
ATOM   1540 N NH2   . ARG A 1 219 ? 7.302   24.852  -78.867  1.00 71.21  ? 213 ARG A NH2   1 
ATOM   1541 N N     . VAL A 1 220 ? 14.649  23.215  -75.694  1.00 63.31  ? 214 VAL A N     1 
ATOM   1542 C CA    . VAL A 1 220 ? 15.928  23.809  -75.370  1.00 63.39  ? 214 VAL A CA    1 
ATOM   1543 C C     . VAL A 1 220 ? 16.345  24.751  -76.488  1.00 71.34  ? 214 VAL A C     1 
ATOM   1544 O O     . VAL A 1 220 ? 16.589  24.302  -77.610  1.00 71.40  ? 214 VAL A O     1 
ATOM   1545 C CB    . VAL A 1 220 ? 16.984  22.713  -75.096  1.00 65.25  ? 214 VAL A CB    1 
ATOM   1546 C CG1   . VAL A 1 220 ? 18.354  23.321  -74.830  1.00 65.69  ? 214 VAL A CG1   1 
ATOM   1547 C CG2   . VAL A 1 220 ? 16.557  21.812  -73.944  1.00 62.99  ? 214 VAL A CG2   1 
ATOM   1548 N N     . GLU A 1 221 ? 16.393  26.058  -76.175  1.00 70.86  ? 215 GLU A N     1 
ATOM   1549 C CA    . GLU A 1 221 ? 16.823  27.119  -77.083  1.00 73.35  ? 215 GLU A CA    1 
ATOM   1550 C C     . GLU A 1 221 ? 18.288  27.431  -76.780  1.00 79.73  ? 215 GLU A C     1 
ATOM   1551 O O     . GLU A 1 221 ? 18.648  27.623  -75.611  1.00 79.19  ? 215 GLU A O     1 
ATOM   1552 C CB    . GLU A 1 221 ? 15.964  28.358  -76.888  1.00 74.79  ? 215 GLU A CB    1 
ATOM   1553 N N     . PHE A 1 222 ? 19.131  27.452  -77.829  1.00 77.80  ? 216 PHE A N     1 
ATOM   1554 C CA    . PHE A 1 222 ? 20.567  27.714  -77.727  1.00 78.54  ? 216 PHE A CA    1 
ATOM   1555 C C     . PHE A 1 222 ? 20.952  29.099  -78.258  1.00 89.08  ? 216 PHE A C     1 
ATOM   1556 O O     . PHE A 1 222 ? 20.510  29.489  -79.341  1.00 89.85  ? 216 PHE A O     1 
ATOM   1557 C CB    . PHE A 1 222 ? 21.373  26.636  -78.462  1.00 79.29  ? 216 PHE A CB    1 
ATOM   1558 C CG    . PHE A 1 222 ? 21.527  25.311  -77.758  1.00 78.38  ? 216 PHE A CG    1 
ATOM   1559 C CD1   . PHE A 1 222 ? 22.256  25.211  -76.580  1.00 80.25  ? 216 PHE A CD1   1 
ATOM   1560 C CD2   . PHE A 1 222 ? 21.033  24.145  -78.324  1.00 79.39  ? 216 PHE A CD2   1 
ATOM   1561 C CE1   . PHE A 1 222 ? 22.448  23.974  -75.963  1.00 79.34  ? 216 PHE A CE1   1 
ATOM   1562 C CE2   . PHE A 1 222 ? 21.210  22.912  -77.692  1.00 80.50  ? 216 PHE A CE2   1 
ATOM   1563 C CZ    . PHE A 1 222 ? 21.908  22.837  -76.512  1.00 77.55  ? 216 PHE A CZ    1 
ATOM   1564 N N     . PHE A 1 223 ? 21.807  29.825  -77.499  1.00 89.43  ? 217 PHE A N     1 
ATOM   1565 C CA    . PHE A 1 223 ? 22.307  31.177  -77.814  1.00 91.87  ? 217 PHE A CA    1 
ATOM   1566 C C     . PHE A 1 223 ? 23.517  31.159  -78.753  1.00 96.36  ? 217 PHE A C     1 
ATOM   1567 O O     . PHE A 1 223 ? 23.773  32.141  -79.454  1.00 97.94  ? 217 PHE A O     1 
ATOM   1568 C CB    . PHE A 1 223 ? 22.658  31.916  -76.525  1.00 92.90  ? 217 PHE A CB    1 
ATOM   1569 N N     . GLY A 1 224 ? 24.227  30.039  -78.740  1.00 91.48  ? 218 GLY A N     1 
ATOM   1570 C CA    . GLY A 1 224 ? 25.430  29.767  -79.520  1.00 92.58  ? 218 GLY A CA    1 
ATOM   1571 C C     . GLY A 1 224 ? 26.111  28.490  -79.067  1.00 96.55  ? 218 GLY A C     1 
ATOM   1572 O O     . GLY A 1 224 ? 26.438  27.629  -79.888  1.00 97.29  ? 218 GLY A O     1 
ATOM   1573 N N     . ASP A 1 225 ? 26.322  28.362  -77.746  1.00 91.29  ? 219 ASP A N     1 
ATOM   1574 C CA    . ASP A 1 225 ? 26.939  27.212  -77.077  1.00 89.27  ? 219 ASP A CA    1 
ATOM   1575 C C     . ASP A 1 225 ? 26.511  27.220  -75.619  1.00 89.44  ? 219 ASP A C     1 
ATOM   1576 O O     . ASP A 1 225 ? 26.994  26.441  -74.799  1.00 88.17  ? 219 ASP A O     1 
ATOM   1577 C CB    . ASP A 1 225 ? 28.463  27.281  -77.190  1.00 92.70  ? 219 ASP A CB    1 
ATOM   1578 C CG    . ASP A 1 225 ? 29.036  26.018  -77.777  1.00 108.67 ? 219 ASP A CG    1 
ATOM   1579 O OD1   . ASP A 1 225 ? 29.381  25.103  -76.993  1.00 109.32 ? 219 ASP A OD1   1 
ATOM   1580 O OD2   . ASP A 1 225 ? 29.117  25.929  -79.023  1.00 117.24 ? 219 ASP A OD2   1 
ATOM   1581 N N     . GLU A 1 226 ? 25.562  28.100  -75.335  1.00 84.40  ? 220 GLU A N     1 
ATOM   1582 C CA    . GLU A 1 226 ? 24.979  28.344  -74.038  1.00 83.02  ? 220 GLU A CA    1 
ATOM   1583 C C     . GLU A 1 226 ? 23.486  28.073  -74.159  1.00 84.69  ? 220 GLU A C     1 
ATOM   1584 O O     . GLU A 1 226 ? 22.862  28.488  -75.145  1.00 85.87  ? 220 GLU A O     1 
ATOM   1585 C CB    . GLU A 1 226 ? 25.215  29.812  -73.685  1.00 85.93  ? 220 GLU A CB    1 
ATOM   1586 C CG    . GLU A 1 226 ? 25.051  30.162  -72.221  1.00 97.75  ? 220 GLU A CG    1 
ATOM   1587 C CD    . GLU A 1 226 ? 24.771  31.638  -72.023  1.00 124.58 ? 220 GLU A CD    1 
ATOM   1588 O OE1   . GLU A 1 226 ? 23.852  31.958  -71.235  1.00 132.77 ? 220 GLU A OE1   1 
ATOM   1589 O OE2   . GLU A 1 226 ? 25.429  32.473  -72.689  1.00 111.11 ? 220 GLU A OE2   1 
ATOM   1590 N N     . ILE A 1 227 ? 22.908  27.388  -73.159  1.00 76.71  ? 221 ILE A N     1 
ATOM   1591 C CA    . ILE A 1 227 ? 21.482  27.090  -73.149  1.00 73.84  ? 221 ILE A CA    1 
ATOM   1592 C C     . ILE A 1 227 ? 20.763  28.389  -72.785  1.00 77.06  ? 221 ILE A C     1 
ATOM   1593 O O     . ILE A 1 227 ? 20.755  28.786  -71.617  1.00 75.40  ? 221 ILE A O     1 
ATOM   1594 C CB    . ILE A 1 227 ? 21.126  25.881  -72.233  1.00 74.31  ? 221 ILE A CB    1 
ATOM   1595 C CG1   . ILE A 1 227 ? 21.809  24.590  -72.750  1.00 73.04  ? 221 ILE A CG1   1 
ATOM   1596 C CG2   . ILE A 1 227 ? 19.603  25.713  -72.123  1.00 74.25  ? 221 ILE A CG2   1 
ATOM   1597 C CD1   . ILE A 1 227 ? 21.507  23.288  -72.049  1.00 69.79  ? 221 ILE A CD1   1 
ATOM   1598 N N     . GLU A 1 228 ? 20.244  29.092  -73.818  1.00 74.68  ? 222 GLU A N     1 
ATOM   1599 C CA    . GLU A 1 228 ? 19.542  30.370  -73.656  1.00 74.97  ? 222 GLU A CA    1 
ATOM   1600 C C     . GLU A 1 228 ? 18.250  30.232  -72.816  1.00 76.76  ? 222 GLU A C     1 
ATOM   1601 O O     . GLU A 1 228 ? 18.088  30.985  -71.857  1.00 76.80  ? 222 GLU A O     1 
ATOM   1602 C CB    . GLU A 1 228 ? 19.261  31.012  -75.015  1.00 76.85  ? 222 GLU A CB    1 
ATOM   1603 N N     . ARG A 1 229 ? 17.365  29.248  -73.140  1.00 70.46  ? 223 ARG A N     1 
ATOM   1604 C CA    . ARG A 1 229 ? 16.109  29.003  -72.416  1.00 68.48  ? 223 ARG A CA    1 
ATOM   1605 C C     . ARG A 1 229 ? 15.653  27.551  -72.518  1.00 71.01  ? 223 ARG A C     1 
ATOM   1606 O O     . ARG A 1 229 ? 15.905  26.897  -73.526  1.00 71.11  ? 223 ARG A O     1 
ATOM   1607 C CB    . ARG A 1 229 ? 15.007  29.933  -72.919  1.00 69.94  ? 223 ARG A CB    1 
ATOM   1608 N N     . ILE A 1 230 ? 14.931  27.075  -71.482  1.00 66.28  ? 224 ILE A N     1 
ATOM   1609 C CA    . ILE A 1 230 ? 14.367  25.718  -71.326  1.00 64.42  ? 224 ILE A CA    1 
ATOM   1610 C C     . ILE A 1 230 ? 12.870  25.844  -70.987  1.00 68.94  ? 224 ILE A C     1 
ATOM   1611 O O     . ILE A 1 230 ? 12.531  26.375  -69.925  1.00 68.54  ? 224 ILE A O     1 
ATOM   1612 C CB    . ILE A 1 230 ? 15.090  24.930  -70.178  1.00 65.57  ? 224 ILE A CB    1 
ATOM   1613 C CG1   . ILE A 1 230 ? 16.608  24.886  -70.360  1.00 66.07  ? 224 ILE A CG1   1 
ATOM   1614 C CG2   . ILE A 1 230 ? 14.492  23.526  -69.981  1.00 64.00  ? 224 ILE A CG2   1 
ATOM   1615 C CD1   . ILE A 1 230 ? 17.388  24.712  -69.070  1.00 74.92  ? 224 ILE A CD1   1 
ATOM   1616 N N     . ARG A 1 231 ? 11.981  25.332  -71.845  1.00 65.44  ? 225 ARG A N     1 
ATOM   1617 C CA    . ARG A 1 231 ? 10.555  25.422  -71.532  1.00 64.80  ? 225 ARG A CA    1 
ATOM   1618 C C     . ARG A 1 231 ? 9.716   24.209  -71.898  1.00 67.54  ? 225 ARG A C     1 
ATOM   1619 O O     . ARG A 1 231 ? 9.888   23.650  -72.975  1.00 66.60  ? 225 ARG A O     1 
ATOM   1620 C CB    . ARG A 1 231 ? 9.910   26.758  -71.982  1.00 65.23  ? 225 ARG A CB    1 
ATOM   1621 C CG    . ARG A 1 231 ? 10.485  27.401  -73.236  1.00 69.23  ? 225 ARG A CG    1 
ATOM   1622 C CD    . ARG A 1 231 ? 9.407   28.146  -73.993  1.00 76.03  ? 225 ARG A CD    1 
ATOM   1623 N NE    . ARG A 1 231 ? 9.043   29.414  -73.360  1.00 83.74  ? 225 ARG A NE    1 
ATOM   1624 C CZ    . ARG A 1 231 ? 9.398   30.610  -73.823  1.00 96.36  ? 225 ARG A CZ    1 
ATOM   1625 N NH1   . ARG A 1 231 ? 10.125  30.714  -74.930  1.00 85.69  ? 225 ARG A NH1   1 
ATOM   1626 N NH2   . ARG A 1 231 ? 9.021   31.712  -73.188  1.00 77.27  ? 225 ARG A NH2   1 
ATOM   1627 N N     . GLU A 1 232 ? 8.811   23.806  -70.979  1.00 64.21  ? 226 GLU A N     1 
ATOM   1628 C CA    . GLU A 1 232 ? 7.877   22.687  -71.139  1.00 63.64  ? 226 GLU A CA    1 
ATOM   1629 C C     . GLU A 1 232 ? 6.733   23.056  -72.094  1.00 69.19  ? 226 GLU A C     1 
ATOM   1630 O O     . GLU A 1 232 ? 6.216   24.170  -72.035  1.00 68.44  ? 226 GLU A O     1 
ATOM   1631 C CB    . GLU A 1 232 ? 7.306   22.258  -69.785  1.00 63.91  ? 226 GLU A CB    1 
ATOM   1632 C CG    . GLU A 1 232 ? 8.204   21.342  -68.989  1.00 77.13  ? 226 GLU A CG    1 
ATOM   1633 C CD    . GLU A 1 232 ? 7.501   20.742  -67.788  1.00 109.04 ? 226 GLU A CD    1 
ATOM   1634 O OE1   . GLU A 1 232 ? 7.696   21.262  -66.664  1.00 104.86 ? 226 GLU A OE1   1 
ATOM   1635 O OE2   . GLU A 1 232 ? 6.730   19.773  -67.977  1.00 111.00 ? 226 GLU A OE2   1 
ATOM   1636 N N     . VAL A 1 233 ? 6.360   22.121  -72.990  1.00 68.00  ? 227 VAL A N     1 
ATOM   1637 C CA    . VAL A 1 233 ? 5.304   22.316  -73.998  1.00 69.99  ? 227 VAL A CA    1 
ATOM   1638 C C     . VAL A 1 233 ? 4.301   21.152  -73.951  1.00 77.35  ? 227 VAL A C     1 
ATOM   1639 O O     . VAL A 1 233 ? 4.728   19.989  -73.887  1.00 74.99  ? 227 VAL A O     1 
ATOM   1640 C CB    . VAL A 1 233 ? 5.901   22.446  -75.433  1.00 74.73  ? 227 VAL A CB    1 
ATOM   1641 C CG1   . VAL A 1 233 ? 4.812   22.771  -76.460  1.00 75.81  ? 227 VAL A CG1   1 
ATOM   1642 C CG2   . VAL A 1 233 ? 7.049   23.463  -75.499  1.00 75.08  ? 227 VAL A CG2   1 
ATOM   1643 N N     . ASP A 1 234 ? 2.978   21.443  -74.016  1.00 79.00  ? 228 ASP A N     1 
ATOM   1644 C CA    . ASP A 1 234 ? 1.988   20.353  -74.069  1.00 80.22  ? 228 ASP A CA    1 
ATOM   1645 C C     . ASP A 1 234 ? 1.975   19.847  -75.509  1.00 87.12  ? 228 ASP A C     1 
ATOM   1646 O O     . ASP A 1 234 ? 1.817   20.639  -76.447  1.00 88.38  ? 228 ASP A O     1 
ATOM   1647 C CB    . ASP A 1 234 ? 0.592   20.792  -73.613  1.00 82.72  ? 228 ASP A CB    1 
ATOM   1648 N N     . ALA A 1 235 ? 2.253   18.551  -75.681  1.00 83.44  ? 229 ALA A N     1 
ATOM   1649 C CA    . ALA A 1 235 ? 2.385   17.935  -77.000  1.00 84.52  ? 229 ALA A CA    1 
ATOM   1650 C C     . ALA A 1 235 ? 1.115   17.935  -77.833  1.00 90.82  ? 229 ALA A C     1 
ATOM   1651 O O     . ALA A 1 235 ? 1.178   18.230  -79.038  1.00 92.13  ? 229 ALA A O     1 
ATOM   1652 C CB    . ALA A 1 235 ? 2.953   16.530  -76.883  1.00 84.19  ? 229 ALA A CB    1 
ATOM   1653 N N     . LEU A 1 236 ? -0.034  17.644  -77.181  1.00 86.86  ? 230 LEU A N     1 
ATOM   1654 C CA    . LEU A 1 236 ? -1.367  17.567  -77.797  1.00 87.08  ? 230 LEU A CA    1 
ATOM   1655 C C     . LEU A 1 236 ? -1.965  18.932  -78.195  1.00 90.80  ? 230 LEU A C     1 
ATOM   1656 O O     . LEU A 1 236 ? -2.852  18.966  -79.045  1.00 90.73  ? 230 LEU A O     1 
ATOM   1657 C CB    . LEU A 1 236 ? -2.342  16.784  -76.895  1.00 86.21  ? 230 LEU A CB    1 
ATOM   1658 C CG    . LEU A 1 236 ? -1.807  15.505  -76.216  1.00 90.09  ? 230 LEU A CG    1 
ATOM   1659 C CD1   . LEU A 1 236 ? -2.523  15.227  -74.900  1.00 89.45  ? 230 LEU A CD1   1 
ATOM   1660 C CD2   . LEU A 1 236 ? -1.923  14.301  -77.116  1.00 93.90  ? 230 LEU A CD2   1 
ATOM   1661 N N     . THR A 1 237 ? -1.466  20.044  -77.612  1.00 87.99  ? 231 THR A N     1 
ATOM   1662 C CA    . THR A 1 237 ? -1.963  21.406  -77.869  1.00 89.68  ? 231 THR A CA    1 
ATOM   1663 C C     . THR A 1 237 ? -0.924  22.391  -78.391  1.00 93.61  ? 231 THR A C     1 
ATOM   1664 O O     . THR A 1 237 ? -1.274  23.315  -79.135  1.00 93.58  ? 231 THR A O     1 
ATOM   1665 C CB    . THR A 1 237 ? -2.710  21.983  -76.635  1.00 101.99 ? 231 THR A CB    1 
ATOM   1666 O OG1   . THR A 1 237 ? -3.021  23.359  -76.877  1.00 107.10 ? 231 THR A OG1   1 
ATOM   1667 C CG2   . THR A 1 237 ? -1.917  21.876  -75.343  1.00 97.10  ? 231 THR A CG2   1 
ATOM   1668 N N     . GLY A 1 238 ? 0.320   22.207  -77.962  1.00 90.00  ? 232 GLY A N     1 
ATOM   1669 C CA    . GLY A 1 238 ? 1.424   23.085  -78.325  1.00 90.95  ? 232 GLY A CA    1 
ATOM   1670 C C     . GLY A 1 238 ? 1.446   24.356  -77.509  1.00 94.96  ? 232 GLY A C     1 
ATOM   1671 O O     . GLY A 1 238 ? 1.970   25.382  -77.964  1.00 94.73  ? 232 GLY A O     1 
ATOM   1672 N N     . GLU A 1 239 ? 0.853   24.286  -76.294  1.00 91.07  ? 233 GLU A N     1 
ATOM   1673 C CA    . GLU A 1 239 ? 0.786   25.401  -75.350  1.00 90.89  ? 233 GLU A CA    1 
ATOM   1674 C C     . GLU A 1 239 ? 2.069   25.391  -74.553  1.00 91.14  ? 233 GLU A C     1 
ATOM   1675 O O     . GLU A 1 239 ? 2.481   24.323  -74.074  1.00 88.52  ? 233 GLU A O     1 
ATOM   1676 C CB    . GLU A 1 239 ? -0.415  25.245  -74.422  1.00 91.15  ? 233 GLU A CB    1 
ATOM   1677 N N     . ILE A 1 240 ? 2.732   26.562  -74.456  1.00 86.94  ? 234 ILE A N     1 
ATOM   1678 C CA    . ILE A 1 240 ? 3.984   26.670  -73.709  1.00 85.75  ? 234 ILE A CA    1 
ATOM   1679 C C     . ILE A 1 240 ? 3.721   26.616  -72.186  1.00 88.84  ? 234 ILE A C     1 
ATOM   1680 O O     . ILE A 1 240 ? 3.828   27.622  -71.480  1.00 89.10  ? 234 ILE A O     1 
ATOM   1681 C CB    . ILE A 1 240 ? 4.741   27.932  -74.108  1.00 87.73  ? 234 ILE A CB    1 
ATOM   1682 N N     . LEU A 1 241 ? 3.386   25.399  -71.702  1.00 83.69  ? 235 LEU A N     1 
ATOM   1683 C CA    . LEU A 1 241 ? 3.049   24.967  -70.336  1.00 81.91  ? 235 LEU A CA    1 
ATOM   1684 C C     . LEU A 1 241 ? 3.819   25.627  -69.159  1.00 84.98  ? 235 LEU A C     1 
ATOM   1685 O O     . LEU A 1 241 ? 3.349   25.558  -68.018  1.00 84.93  ? 235 LEU A O     1 
ATOM   1686 C CB    . LEU A 1 241 ? 3.193   23.442  -70.278  1.00 80.61  ? 235 LEU A CB    1 
ATOM   1687 C CG    . LEU A 1 241 ? 2.258   22.682  -69.384  1.00 84.94  ? 235 LEU A CG    1 
ATOM   1688 C CD1   . LEU A 1 241 ? 1.381   21.761  -70.199  1.00 85.06  ? 235 LEU A CD1   1 
ATOM   1689 C CD2   . LEU A 1 241 ? 3.043   21.888  -68.348  1.00 86.71  ? 235 LEU A CD2   1 
ATOM   1690 N N     . GLY A 1 242 ? 4.976   26.238  -69.438  1.00 80.50  ? 236 GLY A N     1 
ATOM   1691 C CA    . GLY A 1 242 ? 5.798   26.900  -68.428  1.00 79.90  ? 236 GLY A CA    1 
ATOM   1692 C C     . GLY A 1 242 ? 7.285   26.889  -68.717  1.00 83.50  ? 236 GLY A C     1 
ATOM   1693 O O     . GLY A 1 242 ? 7.788   25.935  -69.314  1.00 83.09  ? 236 GLY A O     1 
ATOM   1694 N N     . ASP A 1 243 ? 8.003   27.951  -68.269  1.00 80.08  ? 237 ASP A N     1 
ATOM   1695 C CA    . ASP A 1 243 ? 9.454   28.138  -68.451  1.00 79.54  ? 237 ASP A CA    1 
ATOM   1696 C C     . ASP A 1 243 ? 10.252  27.555  -67.281  1.00 79.29  ? 237 ASP A C     1 
ATOM   1697 O O     . ASP A 1 243 ? 9.892   27.791  -66.126  1.00 78.97  ? 237 ASP A O     1 
ATOM   1698 C CB    . ASP A 1 243 ? 9.773   29.630  -68.634  1.00 83.59  ? 237 ASP A CB    1 
ATOM   1699 C CG    . ASP A 1 243 ? 10.995  29.909  -69.479  1.00 98.14  ? 237 ASP A CG    1 
ATOM   1700 O OD1   . ASP A 1 243 ? 10.894  30.750  -70.406  1.00 100.00 ? 237 ASP A OD1   1 
ATOM   1701 O OD2   . ASP A 1 243 ? 12.059  29.298  -69.207  1.00 106.53 ? 237 ASP A OD2   1 
ATOM   1702 N N     . ARG A 1 244 ? 11.340  26.810  -67.583  1.00 72.99  ? 238 ARG A N     1 
ATOM   1703 C CA    . ARG A 1 244 ? 12.189  26.132  -66.585  1.00 70.68  ? 238 ARG A CA    1 
ATOM   1704 C C     . ARG A 1 244 ? 13.633  26.682  -66.509  1.00 73.16  ? 238 ARG A C     1 
ATOM   1705 O O     . ARG A 1 244 ? 14.095  27.350  -67.443  1.00 72.87  ? 238 ARG A O     1 
ATOM   1706 C CB    . ARG A 1 244 ? 12.199  24.605  -66.824  1.00 67.66  ? 238 ARG A CB    1 
ATOM   1707 C CG    . ARG A 1 244 ? 10.834  23.969  -67.130  1.00 75.20  ? 238 ARG A CG    1 
ATOM   1708 C CD    . ARG A 1 244 ? 10.076  23.528  -65.899  1.00 88.22  ? 238 ARG A CD    1 
ATOM   1709 N NE    . ARG A 1 244 ? 10.908  22.694  -65.022  1.00 105.37 ? 238 ARG A NE    1 
ATOM   1710 C CZ    . ARG A 1 244 ? 10.971  21.364  -65.061  1.00 113.67 ? 238 ARG A CZ    1 
ATOM   1711 N NH1   . ARG A 1 244 ? 10.237  20.681  -65.931  1.00 98.85  ? 238 ARG A NH1   1 
ATOM   1712 N NH2   . ARG A 1 244 ? 11.765  20.706  -64.225  1.00 92.77  ? 238 ARG A NH2   1 
ATOM   1713 N N     . ASP A 1 245 ? 14.323  26.413  -65.370  1.00 68.64  ? 239 ASP A N     1 
ATOM   1714 C CA    . ASP A 1 245 ? 15.712  26.815  -65.093  1.00 69.26  ? 239 ASP A CA    1 
ATOM   1715 C C     . ASP A 1 245 ? 16.633  25.580  -65.042  1.00 74.03  ? 239 ASP A C     1 
ATOM   1716 O O     . ASP A 1 245 ? 17.823  25.663  -65.371  1.00 74.42  ? 239 ASP A O     1 
ATOM   1717 C CB    . ASP A 1 245 ? 15.801  27.594  -63.785  1.00 70.00  ? 239 ASP A CB    1 
ATOM   1718 N N     . HIS A 1 246 ? 16.064  24.436  -64.641  1.00 69.26  ? 240 HIS A N     1 
ATOM   1719 C CA    . HIS A 1 246 ? 16.754  23.158  -64.548  1.00 67.75  ? 240 HIS A CA    1 
ATOM   1720 C C     . HIS A 1 246 ? 15.846  22.089  -65.142  1.00 68.76  ? 240 HIS A C     1 
ATOM   1721 O O     . HIS A 1 246 ? 14.622  22.236  -65.103  1.00 68.59  ? 240 HIS A O     1 
ATOM   1722 C CB    . HIS A 1 246 ? 17.042  22.831  -63.068  1.00 68.03  ? 240 HIS A CB    1 
ATOM   1723 N N     . VAL A 1 247 ? 16.437  21.014  -65.686  1.00 62.80  ? 241 VAL A N     1 
ATOM   1724 C CA    . VAL A 1 247 ? 15.692  19.868  -66.222  1.00 60.72  ? 241 VAL A CA    1 
ATOM   1725 C C     . VAL A 1 247 ? 16.538  18.610  -66.302  1.00 62.26  ? 241 VAL A C     1 
ATOM   1726 O O     . VAL A 1 247 ? 17.716  18.689  -66.648  1.00 61.15  ? 241 VAL A O     1 
ATOM   1727 C CB    . VAL A 1 247 ? 14.851  20.155  -67.494  1.00 64.23  ? 241 VAL A CB    1 
ATOM   1728 C CG1   . VAL A 1 247 ? 15.512  19.622  -68.762  1.00 63.64  ? 241 VAL A CG1   1 
ATOM   1729 C CG2   . VAL A 1 247 ? 13.446  19.602  -67.332  1.00 63.37  ? 241 VAL A CG2   1 
ATOM   1730 N N     . ALA A 1 248 ? 15.951  17.462  -65.941  1.00 57.94  ? 242 ALA A N     1 
ATOM   1731 C CA    . ALA A 1 248 ? 16.659  16.186  -65.986  1.00 57.61  ? 242 ALA A CA    1 
ATOM   1732 C C     . ALA A 1 248 ? 15.943  15.244  -66.922  1.00 62.94  ? 242 ALA A C     1 
ATOM   1733 O O     . ALA A 1 248 ? 14.782  14.877  -66.688  1.00 62.38  ? 242 ALA A O     1 
ATOM   1734 C CB    . ALA A 1 248 ? 16.772  15.575  -64.603  1.00 57.41  ? 242 ALA A CB    1 
ATOM   1735 N N     . ILE A 1 249 ? 16.626  14.904  -68.025  1.00 60.02  ? 243 ILE A N     1 
ATOM   1736 C CA    . ILE A 1 249 ? 16.105  14.004  -69.043  1.00 59.25  ? 243 ILE A CA    1 
ATOM   1737 C C     . ILE A 1 249 ? 16.478  12.581  -68.640  1.00 63.96  ? 243 ILE A C     1 
ATOM   1738 O O     . ILE A 1 249 ? 17.640  12.305  -68.301  1.00 62.58  ? 243 ILE A O     1 
ATOM   1739 C CB    . ILE A 1 249 ? 16.613  14.375  -70.475  1.00 62.64  ? 243 ILE A CB    1 
ATOM   1740 C CG1   . ILE A 1 249 ? 16.489  15.883  -70.793  1.00 63.27  ? 243 ILE A CG1   1 
ATOM   1741 C CG2   . ILE A 1 249 ? 15.962  13.500  -71.564  1.00 63.13  ? 243 ILE A CG2   1 
ATOM   1742 C CD1   . ILE A 1 249 ? 15.048  16.443  -70.945  1.00 70.10  ? 243 ILE A CD1   1 
ATOM   1743 N N     . PHE A 1 250 ? 15.482  11.684  -68.659  1.00 61.99  ? 244 PHE A N     1 
ATOM   1744 C CA    . PHE A 1 250 ? 15.696  10.279  -68.327  1.00 62.05  ? 244 PHE A CA    1 
ATOM   1745 C C     . PHE A 1 250 ? 15.632  9.377   -69.570  1.00 70.51  ? 244 PHE A C     1 
ATOM   1746 O O     . PHE A 1 250 ? 14.940  9.729   -70.533  1.00 70.60  ? 244 PHE A O     1 
ATOM   1747 C CB    . PHE A 1 250 ? 14.713  9.836   -67.264  1.00 62.00  ? 244 PHE A CB    1 
ATOM   1748 C CG    . PHE A 1 250 ? 15.109  10.257  -65.870  1.00 61.80  ? 244 PHE A CG    1 
ATOM   1749 C CD1   . PHE A 1 250 ? 14.754  11.506  -65.376  1.00 64.16  ? 244 PHE A CD1   1 
ATOM   1750 C CD2   . PHE A 1 250 ? 15.816  9.398   -65.044  1.00 62.17  ? 244 PHE A CD2   1 
ATOM   1751 C CE1   . PHE A 1 250 ? 15.086  11.878  -64.075  1.00 63.97  ? 244 PHE A CE1   1 
ATOM   1752 C CE2   . PHE A 1 250 ? 16.135  9.768   -63.745  1.00 64.47  ? 244 PHE A CE2   1 
ATOM   1753 C CZ    . PHE A 1 250 ? 15.756  11.000  -63.266  1.00 62.58  ? 244 PHE A CZ    1 
ATOM   1754 N N     . PRO A 1 251 ? 16.361  8.234   -69.580  1.00 69.82  ? 245 PRO A N     1 
ATOM   1755 C CA    . PRO A 1 251 ? 16.376  7.376   -70.777  1.00 71.63  ? 245 PRO A CA    1 
ATOM   1756 C C     . PRO A 1 251 ? 15.019  6.933   -71.331  1.00 80.39  ? 245 PRO A C     1 
ATOM   1757 O O     . PRO A 1 251 ? 14.103  6.641   -70.560  1.00 79.48  ? 245 PRO A O     1 
ATOM   1758 C CB    . PRO A 1 251 ? 17.228  6.188   -70.342  1.00 72.78  ? 245 PRO A CB    1 
ATOM   1759 C CG    . PRO A 1 251 ? 18.119  6.746   -69.290  1.00 76.16  ? 245 PRO A CG    1 
ATOM   1760 C CD    . PRO A 1 251 ? 17.256  7.696   -68.534  1.00 70.91  ? 245 PRO A CD    1 
ATOM   1761 N N     . ALA A 1 252 ? 14.911  6.879   -72.681  1.00 80.98  ? 246 ALA A N     1 
ATOM   1762 C CA    . ALA A 1 252 ? 13.721  6.471   -73.434  1.00 82.09  ? 246 ALA A CA    1 
ATOM   1763 C C     . ALA A 1 252 ? 13.361  4.999   -73.211  1.00 89.40  ? 246 ALA A C     1 
ATOM   1764 O O     . ALA A 1 252 ? 12.176  4.661   -73.268  1.00 89.52  ? 246 ALA A O     1 
ATOM   1765 C CB    . ALA A 1 252 ? 13.917  6.743   -74.912  1.00 84.07  ? 246 ALA A CB    1 
ATOM   1766 N N     . SER A 1 253 ? 14.365  4.119   -72.982  1.00 88.04  ? 247 SER A N     1 
ATOM   1767 C CA    . SER A 1 253 ? 14.133  2.703   -72.677  1.00 88.02  ? 247 SER A CA    1 
ATOM   1768 C C     . SER A 1 253 ? 13.775  2.545   -71.168  1.00 93.83  ? 247 SER A C     1 
ATOM   1769 O O     . SER A 1 253 ? 13.796  3.530   -70.410  1.00 92.80  ? 247 SER A O     1 
ATOM   1770 C CB    . SER A 1 253 ? 15.364  1.881   -73.030  1.00 89.03  ? 247 SER A CB    1 
ATOM   1771 N N     . HIS A 1 254 ? 13.410  1.314   -70.748  1.00 92.01  ? 248 HIS A N     1 
ATOM   1772 C CA    . HIS A 1 254 ? 13.062  0.991   -69.354  1.00 91.41  ? 248 HIS A CA    1 
ATOM   1773 C C     . HIS A 1 254 ? 14.230  0.266   -68.620  1.00 96.72  ? 248 HIS A C     1 
ATOM   1774 O O     . HIS A 1 254 ? 14.146  -0.016  -67.414  1.00 95.77  ? 248 HIS A O     1 
ATOM   1775 C CB    . HIS A 1 254 ? 11.786  0.156   -69.314  1.00 91.72  ? 248 HIS A CB    1 
ATOM   1776 N N     . PHE A 1 255 ? 15.323  -0.014  -69.366  1.00 94.85  ? 249 PHE A N     1 
ATOM   1777 C CA    . PHE A 1 255 ? 16.539  -0.677  -68.887  1.00 94.91  ? 249 PHE A CA    1 
ATOM   1778 C C     . PHE A 1 255 ? 17.790  0.028   -69.452  1.00 101.89 ? 249 PHE A C     1 
ATOM   1779 O O     . PHE A 1 255 ? 18.635  0.476   -68.666  1.00 101.46 ? 249 PHE A O     1 
ATOM   1780 C CB    . PHE A 1 255 ? 16.539  -2.180  -69.265  1.00 96.20  ? 249 PHE A CB    1 
ATOM   1781 C CG    . PHE A 1 255 ? 17.339  -3.068  -68.340  1.00 96.44  ? 249 PHE A CG    1 
ATOM   1782 C CD1   . PHE A 1 255 ? 18.725  -2.956  -68.263  1.00 98.69  ? 249 PHE A CD1   1 
ATOM   1783 C CD2   . PHE A 1 255 ? 16.712  -4.029  -67.561  1.00 97.27  ? 249 PHE A CD2   1 
ATOM   1784 C CE1   . PHE A 1 255 ? 19.462  -3.757  -67.391  1.00 98.96  ? 249 PHE A CE1   1 
ATOM   1785 C CE2   . PHE A 1 255 ? 17.453  -4.832  -66.689  1.00 99.63  ? 249 PHE A CE2   1 
ATOM   1786 C CZ    . PHE A 1 255 ? 18.824  -4.696  -66.617  1.00 97.65  ? 249 PHE A CZ    1 
ATOM   1787 N N     . VAL A 1 256 ? 17.886  0.125   -70.811  1.00 100.55 ? 250 VAL A N     1 
ATOM   1788 C CA    . VAL A 1 256 ? 18.979  0.743   -71.578  1.00 102.01 ? 250 VAL A CA    1 
ATOM   1789 C C     . VAL A 1 256 ? 20.397  0.449   -71.037  1.00 107.23 ? 250 VAL A C     1 
ATOM   1790 O O     . VAL A 1 256 ? 20.881  1.139   -70.128  1.00 106.43 ? 250 VAL A O     1 
ATOM   1791 C CB    . VAL A 1 256 ? 18.743  2.239   -71.915  1.00 105.88 ? 250 VAL A CB    1 
ATOM   1792 N N     . THR A 1 257 ? 21.037  -0.603  -71.590  1.00 104.60 ? 251 THR A N     1 
ATOM   1793 C CA    . THR A 1 257 ? 22.381  -1.037  -71.210  1.00 104.96 ? 251 THR A CA    1 
ATOM   1794 C C     . THR A 1 257 ? 23.446  -0.148  -71.846  1.00 110.33 ? 251 THR A C     1 
ATOM   1795 O O     . THR A 1 257 ? 23.229  0.372   -72.949  1.00 110.89 ? 251 THR A O     1 
ATOM   1796 C CB    . THR A 1 257 ? 22.592  -2.498  -71.606  1.00 111.76 ? 251 THR A CB    1 
ATOM   1797 N N     . ARG A 1 258 ? 24.599  0.023   -71.147  1.00 106.59 ? 252 ARG A N     1 
ATOM   1798 C CA    . ARG A 1 258 ? 25.745  0.799   -71.619  1.00 107.12 ? 252 ARG A CA    1 
ATOM   1799 C C     . ARG A 1 258 ? 26.354  0.032   -72.816  1.00 113.92 ? 252 ARG A C     1 
ATOM   1800 O O     . ARG A 1 258 ? 26.910  -1.054  -72.626  1.00 114.40 ? 252 ARG A O     1 
ATOM   1801 C CB    . ARG A 1 258 ? 26.756  1.004   -70.477  1.00 105.21 ? 252 ARG A CB    1 
ATOM   1802 N N     . ALA A 1 259 ? 26.154  0.567   -74.054  1.00 111.50 ? 253 ALA A N     1 
ATOM   1803 C CA    . ALA A 1 259 ? 26.548  0.003   -75.364  1.00 112.56 ? 253 ALA A CA    1 
ATOM   1804 C C     . ALA A 1 259 ? 27.974  -0.557  -75.507  1.00 117.60 ? 253 ALA A C     1 
ATOM   1805 O O     . ALA A 1 259 ? 28.169  -1.565  -76.205  1.00 117.61 ? 253 ALA A O     1 
ATOM   1806 C CB    . ALA A 1 259 ? 26.276  1.011   -76.469  1.00 113.75 ? 253 ALA A CB    1 
ATOM   1807 N N     . GLU A 1 260 ? 28.962  0.118   -74.870  1.00 114.17 ? 254 GLU A N     1 
ATOM   1808 C CA    . GLU A 1 260 ? 30.388  -0.223  -74.903  1.00 114.82 ? 254 GLU A CA    1 
ATOM   1809 C C     . GLU A 1 260 ? 30.677  -1.606  -74.318  1.00 118.20 ? 254 GLU A C     1 
ATOM   1810 O O     . GLU A 1 260 ? 31.125  -2.507  -75.042  1.00 119.68 ? 254 GLU A O     1 
ATOM   1811 C CB    . GLU A 1 260 ? 31.202  0.845   -74.173  1.00 115.47 ? 254 GLU A CB    1 
ATOM   1812 N N     . LYS A 1 261 ? 30.362  -1.777  -73.022  1.00 111.50 ? 255 LYS A N     1 
ATOM   1813 C CA    . LYS A 1 261 ? 30.594  -2.985  -72.228  1.00 109.97 ? 255 LYS A CA    1 
ATOM   1814 C C     . LYS A 1 261 ? 29.655  -4.195  -72.535  1.00 109.46 ? 255 LYS A C     1 
ATOM   1815 O O     . LYS A 1 261 ? 29.642  -5.164  -71.761  1.00 109.45 ? 255 LYS A O     1 
ATOM   1816 C CB    . LYS A 1 261 ? 30.520  -2.613  -70.753  1.00 109.77 ? 255 LYS A CB    1 
ATOM   1817 N N     . MET A 1 262 ? 28.919  -4.162  -73.673  1.00 101.26 ? 256 MET A N     1 
ATOM   1818 C CA    . MET A 1 262 ? 27.921  -5.168  -74.033  1.00 98.27  ? 256 MET A CA    1 
ATOM   1819 C C     . MET A 1 262 ? 28.440  -6.426  -74.712  1.00 99.30  ? 256 MET A C     1 
ATOM   1820 O O     . MET A 1 262 ? 27.859  -7.494  -74.510  1.00 98.28  ? 256 MET A O     1 
ATOM   1821 C CB    . MET A 1 262 ? 26.815  -4.534  -74.858  1.00 98.24  ? 256 MET A CB    1 
ATOM   1822 N N     . GLU A 1 263 ? 29.489  -6.304  -75.544  1.00 93.96  ? 257 GLU A N     1 
ATOM   1823 C CA    . GLU A 1 263 ? 30.051  -7.436  -76.285  1.00 92.82  ? 257 GLU A CA    1 
ATOM   1824 C C     . GLU A 1 263 ? 30.734  -8.460  -75.372  1.00 90.86  ? 257 GLU A C     1 
ATOM   1825 O O     . GLU A 1 263 ? 30.574  -9.666  -75.598  1.00 89.63  ? 257 GLU A O     1 
ATOM   1826 C CB    . GLU A 1 263 ? 31.012  -6.941  -77.355  1.00 95.01  ? 257 GLU A CB    1 
ATOM   1827 N N     . LYS A 1 264 ? 31.478  -7.980  -74.335  1.00 83.91  ? 258 LYS A N     1 
ATOM   1828 C CA    . LYS A 1 264 ? 32.177  -8.833  -73.357  1.00 82.82  ? 258 LYS A CA    1 
ATOM   1829 C C     . LYS A 1 264 ? 31.173  -9.598  -72.506  1.00 82.85  ? 258 LYS A C     1 
ATOM   1830 O O     . LYS A 1 264 ? 31.405  -10.760 -72.160  1.00 83.22  ? 258 LYS A O     1 
ATOM   1831 C CB    . LYS A 1 264 ? 33.098  -8.002  -72.471  1.00 83.41  ? 258 LYS A CB    1 
ATOM   1832 N N     . ALA A 1 265 ? 30.038  -8.948  -72.211  1.00 75.62  ? 259 ALA A N     1 
ATOM   1833 C CA    . ALA A 1 265 ? 28.935  -9.519  -71.459  1.00 73.29  ? 259 ALA A CA    1 
ATOM   1834 C C     . ALA A 1 265 ? 28.320  -10.718 -72.212  1.00 73.08  ? 259 ALA A C     1 
ATOM   1835 O O     . ALA A 1 265 ? 28.152  -11.783 -71.613  1.00 72.36  ? 259 ALA A O     1 
ATOM   1836 C CB    . ALA A 1 265 ? 27.884  -8.453  -71.211  1.00 72.87  ? 259 ALA A CB    1 
ATOM   1837 N N     . ILE A 1 266 ? 28.047  -10.560 -73.529  1.00 67.36  ? 260 ILE A N     1 
ATOM   1838 C CA    . ILE A 1 266 ? 27.513  -11.621 -74.398  1.00 66.96  ? 260 ILE A CA    1 
ATOM   1839 C C     . ILE A 1 266 ? 28.507  -12.804 -74.479  1.00 68.73  ? 260 ILE A C     1 
ATOM   1840 O O     . ILE A 1 266 ? 28.082  -13.965 -74.429  1.00 67.13  ? 260 ILE A O     1 
ATOM   1841 C CB    . ILE A 1 266 ? 27.073  -11.059 -75.788  1.00 70.73  ? 260 ILE A CB    1 
ATOM   1842 C CG1   . ILE A 1 266 ? 25.913  -10.061 -75.622  1.00 70.76  ? 260 ILE A CG1   1 
ATOM   1843 C CG2   . ILE A 1 266 ? 26.660  -12.167 -76.759  1.00 71.56  ? 260 ILE A CG2   1 
ATOM   1844 C CD1   . ILE A 1 266 ? 25.736  -9.048  -76.757  1.00 82.69  ? 260 ILE A CD1   1 
ATOM   1845 N N     . GLN A 1 267 ? 29.830  -12.500 -74.539  1.00 64.85  ? 261 GLN A N     1 
ATOM   1846 C CA    . GLN A 1 267 ? 30.887  -13.510 -74.556  1.00 65.02  ? 261 GLN A CA    1 
ATOM   1847 C C     . GLN A 1 267 ? 30.889  -14.286 -73.231  1.00 66.22  ? 261 GLN A C     1 
ATOM   1848 O O     . GLN A 1 267 ? 30.970  -15.516 -73.254  1.00 66.07  ? 261 GLN A O     1 
ATOM   1849 C CB    . GLN A 1 267 ? 32.242  -12.860 -74.812  1.00 66.66  ? 261 GLN A CB    1 
ATOM   1850 N N     . ASN A 1 268 ? 30.708  -13.576 -72.093  1.00 60.97  ? 262 ASN A N     1 
ATOM   1851 C CA    . ASN A 1 268 ? 30.672  -14.170 -70.749  1.00 60.44  ? 262 ASN A CA    1 
ATOM   1852 C C     . ASN A 1 268 ? 29.495  -15.078 -70.467  1.00 63.81  ? 262 ASN A C     1 
ATOM   1853 O O     . ASN A 1 268 ? 29.673  -16.082 -69.778  1.00 64.07  ? 262 ASN A O     1 
ATOM   1854 C CB    . ASN A 1 268 ? 30.826  -13.122 -69.660  1.00 62.54  ? 262 ASN A CB    1 
ATOM   1855 C CG    . ASN A 1 268 ? 32.231  -12.568 -69.541  1.00 100.88 ? 262 ASN A CG    1 
ATOM   1856 O OD1   . ASN A 1 268 ? 33.246  -13.220 -69.877  1.00 92.99  ? 262 ASN A OD1   1 
ATOM   1857 N ND2   . ASN A 1 268 ? 32.319  -11.349 -69.035  1.00 96.68  ? 262 ASN A ND2   1 
ATOM   1858 N N     . ILE A 1 269 ? 28.294  -14.728 -70.976  1.00 59.86  ? 263 ILE A N     1 
ATOM   1859 C CA    . ILE A 1 269 ? 27.073  -15.544 -70.832  1.00 58.68  ? 263 ILE A CA    1 
ATOM   1860 C C     . ILE A 1 269 ? 27.300  -16.873 -71.568  1.00 62.37  ? 263 ILE A C     1 
ATOM   1861 O O     . ILE A 1 269 ? 27.141  -17.930 -70.952  1.00 61.65  ? 263 ILE A O     1 
ATOM   1862 C CB    . ILE A 1 269 ? 25.787  -14.810 -71.323  1.00 60.19  ? 263 ILE A CB    1 
ATOM   1863 C CG1   . ILE A 1 269 ? 25.470  -13.631 -70.410  1.00 59.39  ? 263 ILE A CG1   1 
ATOM   1864 C CG2   . ILE A 1 269 ? 24.582  -15.766 -71.423  1.00 58.48  ? 263 ILE A CG2   1 
ATOM   1865 C CD1   . ILE A 1 269 ? 24.847  -12.475 -71.113  1.00 71.27  ? 263 ILE A CD1   1 
ATOM   1866 N N     . GLU A 1 270 ? 27.734  -16.804 -72.863  1.00 58.76  ? 264 GLU A N     1 
ATOM   1867 C CA    . GLU A 1 270 ? 28.032  -17.971 -73.693  1.00 59.64  ? 264 GLU A CA    1 
ATOM   1868 C C     . GLU A 1 270 ? 29.045  -18.887 -72.985  1.00 62.69  ? 264 GLU A C     1 
ATOM   1869 O O     . GLU A 1 270 ? 28.871  -20.105 -73.008  1.00 62.80  ? 264 GLU A O     1 
ATOM   1870 C CB    . GLU A 1 270 ? 28.532  -17.544 -75.067  1.00 61.44  ? 264 GLU A CB    1 
ATOM   1871 N N     . LYS A 1 271 ? 30.032  -18.298 -72.274  1.00 58.40  ? 265 LYS A N     1 
ATOM   1872 C CA    . LYS A 1 271 ? 31.021  -19.057 -71.508  1.00 59.30  ? 265 LYS A CA    1 
ATOM   1873 C C     . LYS A 1 271 ? 30.359  -19.818 -70.338  1.00 64.70  ? 265 LYS A C     1 
ATOM   1874 O O     . LYS A 1 271 ? 30.717  -20.976 -70.091  1.00 64.98  ? 265 LYS A O     1 
ATOM   1875 C CB    . LYS A 1 271 ? 32.136  -18.138 -71.010  1.00 59.50  ? 265 LYS A CB    1 
ATOM   1876 N N     . GLU A 1 272 ? 29.372  -19.178 -69.649  1.00 61.22  ? 266 GLU A N     1 
ATOM   1877 C CA    . GLU A 1 272 ? 28.623  -19.776 -68.530  1.00 60.47  ? 266 GLU A CA    1 
ATOM   1878 C C     . GLU A 1 272 ? 27.676  -20.862 -69.050  1.00 64.26  ? 266 GLU A C     1 
ATOM   1879 O O     . GLU A 1 272 ? 27.506  -21.899 -68.394  1.00 64.45  ? 266 GLU A O     1 
ATOM   1880 C CB    . GLU A 1 272 ? 27.824  -18.716 -67.753  1.00 59.92  ? 266 GLU A CB    1 
ATOM   1881 C CG    . GLU A 1 272 ? 27.191  -19.260 -66.475  1.00 70.56  ? 266 GLU A CG    1 
ATOM   1882 C CD    . GLU A 1 272 ? 26.096  -18.441 -65.814  1.00 92.63  ? 266 GLU A CD    1 
ATOM   1883 O OE1   . GLU A 1 272 ? 25.882  -18.631 -64.594  1.00 95.23  ? 266 GLU A OE1   1 
ATOM   1884 O OE2   . GLU A 1 272 ? 25.425  -17.645 -66.513  1.00 79.62  ? 266 GLU A OE2   1 
ATOM   1885 N N     . LEU A 1 273 ? 27.051  -20.601 -70.220  1.00 59.58  ? 267 LEU A N     1 
ATOM   1886 C CA    . LEU A 1 273 ? 26.117  -21.495 -70.893  1.00 59.43  ? 267 LEU A CA    1 
ATOM   1887 C C     . LEU A 1 273 ? 26.803  -22.798 -71.281  1.00 66.90  ? 267 LEU A C     1 
ATOM   1888 O O     . LEU A 1 273 ? 26.272  -23.869 -70.991  1.00 67.76  ? 267 LEU A O     1 
ATOM   1889 C CB    . LEU A 1 273 ? 25.488  -20.798 -72.119  1.00 58.76  ? 267 LEU A CB    1 
ATOM   1890 C CG    . LEU A 1 273 ? 24.579  -21.642 -73.031  1.00 63.77  ? 267 LEU A CG    1 
ATOM   1891 C CD1   . LEU A 1 273 ? 23.311  -22.105 -72.310  1.00 63.30  ? 267 LEU A CD1   1 
ATOM   1892 C CD2   . LEU A 1 273 ? 24.226  -20.896 -74.279  1.00 64.67  ? 267 LEU A CD2   1 
ATOM   1893 N N     . GLU A 1 274 ? 27.986  -22.710 -71.902  1.00 65.20  ? 268 GLU A N     1 
ATOM   1894 C CA    . GLU A 1 274 ? 28.730  -23.890 -72.302  1.00 67.58  ? 268 GLU A CA    1 
ATOM   1895 C C     . GLU A 1 274 ? 29.098  -24.724 -71.080  1.00 72.93  ? 268 GLU A C     1 
ATOM   1896 O O     . GLU A 1 274 ? 28.902  -25.936 -71.104  1.00 75.18  ? 268 GLU A O     1 
ATOM   1897 C CB    . GLU A 1 274 ? 29.961  -23.514 -73.132  1.00 70.52  ? 268 GLU A CB    1 
ATOM   1898 C CG    . GLU A 1 274 ? 29.637  -23.282 -74.600  1.00 87.42  ? 268 GLU A CG    1 
ATOM   1899 C CD    . GLU A 1 274 ? 30.846  -23.109 -75.502  1.00 124.29 ? 268 GLU A CD    1 
ATOM   1900 O OE1   . GLU A 1 274 ? 31.569  -22.097 -75.338  1.00 125.57 ? 268 GLU A OE1   1 
ATOM   1901 O OE2   . GLU A 1 274 ? 31.056  -23.970 -76.390  1.00 121.05 ? 268 GLU A OE2   1 
ATOM   1902 N N     . GLU A 1 275 ? 29.547  -24.074 -69.988  1.00 68.08  ? 269 GLU A N     1 
ATOM   1903 C CA    . GLU A 1 275 ? 29.924  -24.747 -68.741  1.00 67.92  ? 269 GLU A CA    1 
ATOM   1904 C C     . GLU A 1 275 ? 28.720  -25.440 -68.090  1.00 68.86  ? 269 GLU A C     1 
ATOM   1905 O O     . GLU A 1 275 ? 28.856  -26.560 -67.603  1.00 69.69  ? 269 GLU A O     1 
ATOM   1906 C CB    . GLU A 1 275 ? 30.566  -23.757 -67.777  1.00 67.89  ? 269 GLU A CB    1 
ATOM   1907 N N     . GLN A 1 276 ? 27.542  -24.800 -68.139  1.00 61.90  ? 270 GLN A N     1 
ATOM   1908 C CA    . GLN A 1 276 ? 26.294  -25.333 -67.586  1.00 60.19  ? 270 GLN A CA    1 
ATOM   1909 C C     . GLN A 1 276 ? 25.741  -26.508 -68.399  1.00 63.79  ? 270 GLN A C     1 
ATOM   1910 O O     . GLN A 1 276 ? 25.075  -27.388 -67.855  1.00 63.64  ? 270 GLN A O     1 
ATOM   1911 C CB    . GLN A 1 276 ? 25.257  -24.208 -67.422  1.00 59.19  ? 270 GLN A CB    1 
ATOM   1912 C CG    . GLN A 1 276 ? 24.019  -24.576 -66.594  1.00 72.18  ? 270 GLN A CG    1 
ATOM   1913 C CD    . GLN A 1 276 ? 24.239  -24.963 -65.141  1.00 87.23  ? 270 GLN A CD    1 
ATOM   1914 O OE1   . GLN A 1 276 ? 25.355  -25.266 -64.668  1.00 79.11  ? 270 GLN A OE1   1 
ATOM   1915 N NE2   . GLN A 1 276 ? 23.137  -25.025 -64.415  1.00 81.20  ? 270 GLN A NE2   1 
ATOM   1916 N N     . LEU A 1 277 ? 26.048  -26.539 -69.688  1.00 60.35  ? 271 LEU A N     1 
ATOM   1917 C CA    . LEU A 1 277 ? 25.609  -27.623 -70.555  1.00 60.58  ? 271 LEU A CA    1 
ATOM   1918 C C     . LEU A 1 277 ? 26.434  -28.887 -70.299  1.00 65.93  ? 271 LEU A C     1 
ATOM   1919 O O     . LEU A 1 277 ? 25.849  -29.968 -70.248  1.00 65.04  ? 271 LEU A O     1 
ATOM   1920 C CB    . LEU A 1 277 ? 25.655  -27.194 -72.035  1.00 60.56  ? 271 LEU A CB    1 
ATOM   1921 C CG    . LEU A 1 277 ? 24.367  -26.714 -72.733  1.00 62.43  ? 271 LEU A CG    1 
ATOM   1922 C CD1   . LEU A 1 277 ? 23.159  -26.731 -71.836  1.00 61.03  ? 271 LEU A CD1   1 
ATOM   1923 C CD2   . LEU A 1 277 ? 24.572  -25.394 -73.397  1.00 61.32  ? 271 LEU A CD2   1 
ATOM   1924 N N     . LYS A 1 278 ? 27.774  -28.755 -70.082  1.00 65.13  ? 272 LYS A N     1 
ATOM   1925 C CA    . LYS A 1 278 ? 28.639  -29.913 -69.782  1.00 68.03  ? 272 LYS A CA    1 
ATOM   1926 C C     . LYS A 1 278 ? 28.142  -30.531 -68.472  1.00 76.55  ? 272 LYS A C     1 
ATOM   1927 O O     . LYS A 1 278 ? 28.018  -31.753 -68.381  1.00 77.95  ? 272 LYS A O     1 
ATOM   1928 C CB    . LYS A 1 278 ? 30.114  -29.504 -69.676  1.00 68.87  ? 272 LYS A CB    1 
ATOM   1929 N N     . VAL A 1 279 ? 27.730  -29.654 -67.520  1.00 74.04  ? 273 VAL A N     1 
ATOM   1930 C CA    . VAL A 1 279 ? 27.180  -29.971 -66.201  1.00 74.58  ? 273 VAL A CA    1 
ATOM   1931 C C     . VAL A 1 279 ? 25.864  -30.747 -66.299  1.00 79.56  ? 273 VAL A C     1 
ATOM   1932 O O     . VAL A 1 279 ? 25.753  -31.830 -65.722  1.00 80.48  ? 273 VAL A O     1 
ATOM   1933 C CB    . VAL A 1 279 ? 27.055  -28.674 -65.364  1.00 77.81  ? 273 VAL A CB    1 
ATOM   1934 C CG1   . VAL A 1 279 ? 26.112  -28.844 -64.158  1.00 76.66  ? 273 VAL A CG1   1 
ATOM   1935 C CG2   . VAL A 1 279 ? 28.438  -28.190 -64.926  1.00 78.47  ? 273 VAL A CG2   1 
ATOM   1936 N N     . MET A 1 280 ? 24.888  -30.203 -67.039  1.00 75.66  ? 274 MET A N     1 
ATOM   1937 C CA    . MET A 1 280 ? 23.575  -30.812 -67.242  1.00 75.77  ? 274 MET A CA    1 
ATOM   1938 C C     . MET A 1 280 ? 23.649  -32.149 -67.982  1.00 80.64  ? 274 MET A C     1 
ATOM   1939 O O     . MET A 1 280 ? 22.825  -33.027 -67.735  1.00 79.59  ? 274 MET A O     1 
ATOM   1940 C CB    . MET A 1 280 ? 22.657  -29.848 -67.990  1.00 77.18  ? 274 MET A CB    1 
ATOM   1941 C CG    . MET A 1 280 ? 22.142  -28.739 -67.133  1.00 79.47  ? 274 MET A CG    1 
ATOM   1942 S SD    . MET A 1 280 ? 20.460  -28.336 -67.614  1.00 83.58  ? 274 MET A SD    1 
ATOM   1943 C CE    . MET A 1 280 ? 20.317  -26.648 -66.936  1.00 78.48  ? 274 MET A CE    1 
ATOM   1944 N N     . HIS A 1 281 ? 24.622  -32.292 -68.895  1.00 79.45  ? 275 HIS A N     1 
ATOM   1945 C CA    . HIS A 1 281 ? 24.818  -33.507 -69.675  1.00 81.95  ? 275 HIS A CA    1 
ATOM   1946 C C     . HIS A 1 281 ? 25.466  -34.571 -68.844  1.00 89.43  ? 275 HIS A C     1 
ATOM   1947 O O     . HIS A 1 281 ? 24.958  -35.686 -68.797  1.00 89.68  ? 275 HIS A O     1 
ATOM   1948 C CB    . HIS A 1 281 ? 25.614  -33.234 -70.955  1.00 83.70  ? 275 HIS A CB    1 
ATOM   1949 C CG    . HIS A 1 281 ? 24.822  -32.542 -72.018  1.00 86.32  ? 275 HIS A CG    1 
ATOM   1950 N ND1   . HIS A 1 281 ? 23.451  -32.731 -72.146  1.00 87.58  ? 275 HIS A ND1   1 
ATOM   1951 C CD2   . HIS A 1 281 ? 25.232  -31.679 -72.974  1.00 87.93  ? 275 HIS A CD2   1 
ATOM   1952 C CE1   . HIS A 1 281 ? 23.075  -31.972 -73.161  1.00 86.42  ? 275 HIS A CE1   1 
ATOM   1953 N NE2   . HIS A 1 281 ? 24.108  -31.316 -73.689  1.00 86.94  ? 275 HIS A NE2   1 
ATOM   1954 N N     . GLU A 1 282 ? 26.547  -34.221 -68.127  1.00 89.13  ? 276 GLU A N     1 
ATOM   1955 C CA    . GLU A 1 282 ? 27.264  -35.145 -67.237  1.00 91.81  ? 276 GLU A CA    1 
ATOM   1956 C C     . GLU A 1 282 ? 26.442  -35.409 -65.947  1.00 95.38  ? 276 GLU A C     1 
ATOM   1957 O O     . GLU A 1 282 ? 26.994  -35.814 -64.917  1.00 95.99  ? 276 GLU A O     1 
ATOM   1958 C CB    . GLU A 1 282 ? 28.681  -34.612 -66.929  1.00 93.96  ? 276 GLU A CB    1 
ATOM   1959 C CG    . GLU A 1 282 ? 29.616  -34.624 -68.131  1.00 109.52 ? 276 GLU A CG    1 
ATOM   1960 C CD    . GLU A 1 282 ? 30.887  -33.803 -67.992  1.00 140.05 ? 276 GLU A CD    1 
ATOM   1961 O OE1   . GLU A 1 282 ? 31.984  -34.389 -68.146  1.00 144.61 ? 276 GLU A OE1   1 
ATOM   1962 O OE2   . GLU A 1 282 ? 30.791  -32.574 -67.759  1.00 129.61 ? 276 GLU A OE2   1 
ATOM   1963 N N     . ASN A 1 283 ? 25.105  -35.196 -66.045  1.00 89.58  ? 277 ASN A N     1 
ATOM   1964 C CA    . ASN A 1 283 ? 24.104  -35.367 -64.997  1.00 87.48  ? 277 ASN A CA    1 
ATOM   1965 C C     . ASN A 1 283 ? 22.834  -36.086 -65.516  1.00 89.97  ? 277 ASN A C     1 
ATOM   1966 O O     . ASN A 1 283 ? 21.973  -36.488 -64.725  1.00 88.80  ? 277 ASN A O     1 
ATOM   1967 C CB    . ASN A 1 283 ? 23.749  -34.011 -64.424  1.00 85.35  ? 277 ASN A CB    1 
ATOM   1968 C CG    . ASN A 1 283 ? 23.271  -34.088 -63.012  1.00 116.35 ? 277 ASN A CG    1 
ATOM   1969 O OD1   . ASN A 1 283 ? 23.967  -34.605 -62.127  1.00 112.18 ? 277 ASN A OD1   1 
ATOM   1970 N ND2   . ASN A 1 283 ? 22.067  -33.577 -62.775  1.00 109.41 ? 277 ASN A ND2   1 
ATOM   1971 N N     . GLY A 1 284 ? 22.749  -36.245 -66.836  1.00 86.59  ? 278 GLY A N     1 
ATOM   1972 C CA    . GLY A 1 284 ? 21.633  -36.893 -67.520  1.00 86.61  ? 278 GLY A CA    1 
ATOM   1973 C C     . GLY A 1 284 ? 20.407  -36.034 -67.759  1.00 88.33  ? 278 GLY A C     1 
ATOM   1974 O O     . GLY A 1 284 ? 19.418  -36.534 -68.292  1.00 88.14  ? 278 GLY A O     1 
ATOM   1975 N N     . LYS A 1 285 ? 20.451  -34.743 -67.364  1.00 83.49  ? 279 LYS A N     1 
ATOM   1976 C CA    . LYS A 1 285 ? 19.339  -33.796 -67.502  1.00 81.38  ? 279 LYS A CA    1 
ATOM   1977 C C     . LYS A 1 285 ? 19.297  -33.198 -68.935  1.00 85.98  ? 279 LYS A C     1 
ATOM   1978 O O     . LYS A 1 285 ? 19.515  -31.996 -69.119  1.00 84.91  ? 279 LYS A O     1 
ATOM   1979 C CB    . LYS A 1 285 ? 19.441  -32.706 -66.429  1.00 79.84  ? 279 LYS A CB    1 
ATOM   1980 N N     . LEU A 1 286 ? 19.009  -34.065 -69.946  1.00 83.12  ? 280 LEU A N     1 
ATOM   1981 C CA    . LEU A 1 286 ? 18.959  -33.743 -71.386  1.00 82.48  ? 280 LEU A CA    1 
ATOM   1982 C C     . LEU A 1 286 ? 17.807  -32.840 -71.870  1.00 82.14  ? 280 LEU A C     1 
ATOM   1983 O O     . LEU A 1 286 ? 18.016  -32.042 -72.781  1.00 80.54  ? 280 LEU A O     1 
ATOM   1984 C CB    . LEU A 1 286 ? 19.054  -35.010 -72.252  1.00 84.76  ? 280 LEU A CB    1 
ATOM   1985 N N     . LEU A 1 287 ? 16.600  -32.994 -71.316  1.00 77.73  ? 281 LEU A N     1 
ATOM   1986 C CA    . LEU A 1 287 ? 15.458  -32.157 -71.718  1.00 76.43  ? 281 LEU A CA    1 
ATOM   1987 C C     . LEU A 1 287 ? 15.711  -30.721 -71.261  1.00 78.03  ? 281 LEU A C     1 
ATOM   1988 O O     . LEU A 1 287 ? 15.526  -29.772 -72.034  1.00 77.04  ? 281 LEU A O     1 
ATOM   1989 C CB    . LEU A 1 287 ? 14.141  -32.685 -71.123  1.00 76.00  ? 281 LEU A CB    1 
ATOM   1990 N N     . GLU A 1 288 ? 16.187  -30.588 -70.011  1.00 72.36  ? 282 GLU A N     1 
ATOM   1991 C CA    . GLU A 1 288 ? 16.542  -29.333 -69.372  1.00 70.09  ? 282 GLU A CA    1 
ATOM   1992 C C     . GLU A 1 288 ? 17.704  -28.674 -70.131  1.00 73.03  ? 282 GLU A C     1 
ATOM   1993 O O     . GLU A 1 288 ? 17.737  -27.443 -70.262  1.00 72.26  ? 282 GLU A O     1 
ATOM   1994 C CB    . GLU A 1 288 ? 16.943  -29.583 -67.910  1.00 71.13  ? 282 GLU A CB    1 
ATOM   1995 C CG    . GLU A 1 288 ? 15.823  -30.108 -67.025  1.00 81.04  ? 282 GLU A CG    1 
ATOM   1996 C CD    . GLU A 1 288 ? 15.709  -31.613 -66.847  1.00 110.11 ? 282 GLU A CD    1 
ATOM   1997 O OE1   . GLU A 1 288 ? 16.004  -32.371 -67.803  1.00 112.76 ? 282 GLU A OE1   1 
ATOM   1998 O OE2   . GLU A 1 288 ? 15.272  -32.028 -65.747  1.00 102.94 ? 282 GLU A OE2   1 
ATOM   1999 N N     . ALA A 1 289 ? 18.653  -29.489 -70.635  1.00 68.34  ? 283 ALA A N     1 
ATOM   2000 C CA    . ALA A 1 289 ? 19.802  -28.968 -71.363  1.00 67.36  ? 283 ALA A CA    1 
ATOM   2001 C C     . ALA A 1 289 ? 19.409  -28.437 -72.737  1.00 70.17  ? 283 ALA A C     1 
ATOM   2002 O O     . ALA A 1 289 ? 19.979  -27.446 -73.200  1.00 69.46  ? 283 ALA A O     1 
ATOM   2003 C CB    . ALA A 1 289 ? 20.876  -30.025 -71.473  1.00 69.86  ? 283 ALA A CB    1 
ATOM   2004 N N     . GLN A 1 290 ? 18.409  -29.071 -73.368  1.00 66.66  ? 284 GLN A N     1 
ATOM   2005 C CA    . GLN A 1 290 ? 17.894  -28.662 -74.672  1.00 66.52  ? 284 GLN A CA    1 
ATOM   2006 C C     . GLN A 1 290 ? 17.172  -27.308 -74.510  1.00 67.85  ? 284 GLN A C     1 
ATOM   2007 O O     . GLN A 1 290 ? 17.445  -26.362 -75.262  1.00 67.18  ? 284 GLN A O     1 
ATOM   2008 C CB    . GLN A 1 290 ? 16.951  -29.730 -75.213  1.00 68.40  ? 284 GLN A CB    1 
ATOM   2009 N N     . ARG A 1 291 ? 16.317  -27.209 -73.467  1.00 61.98  ? 285 ARG A N     1 
ATOM   2010 C CA    . ARG A 1 291 ? 15.538  -26.023 -73.107  1.00 59.20  ? 285 ARG A CA    1 
ATOM   2011 C C     . ARG A 1 291 ? 16.462  -24.831 -72.808  1.00 62.54  ? 285 ARG A C     1 
ATOM   2012 O O     . ARG A 1 291 ? 16.189  -23.717 -73.258  1.00 61.87  ? 285 ARG A O     1 
ATOM   2013 C CB    . ARG A 1 291 ? 14.634  -26.359 -71.915  1.00 55.26  ? 285 ARG A CB    1 
ATOM   2014 C CG    . ARG A 1 291 ? 13.892  -25.186 -71.319  1.00 62.30  ? 285 ARG A CG    1 
ATOM   2015 C CD    . ARG A 1 291 ? 13.231  -25.593 -70.026  1.00 68.78  ? 285 ARG A CD    1 
ATOM   2016 N NE    . ARG A 1 291 ? 12.004  -26.340 -70.280  1.00 68.62  ? 285 ARG A NE    1 
ATOM   2017 C CZ    . ARG A 1 291 ? 11.654  -27.452 -69.645  1.00 74.06  ? 285 ARG A CZ    1 
ATOM   2018 N NH1   . ARG A 1 291 ? 12.436  -27.957 -68.699  1.00 48.01  ? 285 ARG A NH1   1 
ATOM   2019 N NH2   . ARG A 1 291 ? 10.522  -28.072 -69.955  1.00 61.32  ? 285 ARG A NH2   1 
ATOM   2020 N N     . LEU A 1 292 ? 17.565  -25.077 -72.082  1.00 58.41  ? 286 LEU A N     1 
ATOM   2021 C CA    . LEU A 1 292 ? 18.520  -24.032 -71.748  1.00 56.96  ? 286 LEU A CA    1 
ATOM   2022 C C     . LEU A 1 292 ? 19.204  -23.459 -72.996  1.00 60.93  ? 286 LEU A C     1 
ATOM   2023 O O     . LEU A 1 292 ? 19.187  -22.244 -73.173  1.00 59.04  ? 286 LEU A O     1 
ATOM   2024 C CB    . LEU A 1 292 ? 19.541  -24.508 -70.691  1.00 56.88  ? 286 LEU A CB    1 
ATOM   2025 C CG    . LEU A 1 292 ? 20.458  -23.419 -70.110  1.00 59.93  ? 286 LEU A CG    1 
ATOM   2026 C CD1   . LEU A 1 292 ? 19.727  -22.535 -69.135  1.00 58.13  ? 286 LEU A CD1   1 
ATOM   2027 C CD2   . LEU A 1 292 ? 21.625  -24.020 -69.426  1.00 63.36  ? 286 LEU A CD2   1 
ATOM   2028 N N     . GLU A 1 293 ? 19.769  -24.315 -73.864  1.00 58.86  ? 287 GLU A N     1 
ATOM   2029 C CA    . GLU A 1 293 ? 20.433  -23.826 -75.061  1.00 59.88  ? 287 GLU A CA    1 
ATOM   2030 C C     . GLU A 1 293 ? 19.451  -22.998 -75.896  1.00 64.54  ? 287 GLU A C     1 
ATOM   2031 O O     . GLU A 1 293 ? 19.729  -21.819 -76.149  1.00 64.61  ? 287 GLU A O     1 
ATOM   2032 C CB    . GLU A 1 293 ? 21.015  -24.984 -75.869  1.00 62.68  ? 287 GLU A CB    1 
ATOM   2033 N N     . GLN A 1 294 ? 18.256  -23.573 -76.203  1.00 60.15  ? 288 GLN A N     1 
ATOM   2034 C CA    . GLN A 1 294 ? 17.203  -22.943 -77.003  1.00 59.44  ? 288 GLN A CA    1 
ATOM   2035 C C     . GLN A 1 294 ? 16.846  -21.548 -76.480  1.00 62.83  ? 288 GLN A C     1 
ATOM   2036 O O     . GLN A 1 294 ? 16.898  -20.573 -77.238  1.00 63.56  ? 288 GLN A O     1 
ATOM   2037 C CB    . GLN A 1 294 ? 15.971  -23.834 -77.044  1.00 60.45  ? 288 GLN A CB    1 
ATOM   2038 N N     . ARG A 1 295 ? 16.559  -21.444 -75.176  1.00 56.99  ? 289 ARG A N     1 
ATOM   2039 C CA    . ARG A 1 295 ? 16.209  -20.179 -74.542  1.00 54.61  ? 289 ARG A CA    1 
ATOM   2040 C C     . ARG A 1 295 ? 17.378  -19.177 -74.485  1.00 59.08  ? 289 ARG A C     1 
ATOM   2041 O O     . ARG A 1 295 ? 17.207  -18.027 -74.892  1.00 57.99  ? 289 ARG A O     1 
ATOM   2042 C CB    . ARG A 1 295 ? 15.537  -20.407 -73.178  1.00 51.69  ? 289 ARG A CB    1 
ATOM   2043 C CG    . ARG A 1 295 ? 14.090  -20.902 -73.314  1.00 58.98  ? 289 ARG A CG    1 
ATOM   2044 C CD    . ARG A 1 295 ? 13.446  -21.266 -71.996  1.00 61.39  ? 289 ARG A CD    1 
ATOM   2045 N NE    . ARG A 1 295 ? 12.523  -20.237 -71.510  1.00 67.31  ? 289 ARG A NE    1 
ATOM   2046 C CZ    . ARG A 1 295 ? 12.867  -19.208 -70.729  1.00 84.88  ? 289 ARG A CZ    1 
ATOM   2047 N NH1   . ARG A 1 295 ? 14.136  -19.027 -70.374  1.00 70.85  ? 289 ARG A NH1   1 
ATOM   2048 N NH2   . ARG A 1 295 ? 11.948  -18.341 -70.318  1.00 66.94  ? 289 ARG A NH2   1 
ATOM   2049 N N     . THR A 1 296 ? 18.568  -19.622 -74.056  1.00 57.09  ? 290 THR A N     1 
ATOM   2050 C CA    . THR A 1 296 ? 19.732  -18.744 -73.968  1.00 57.08  ? 290 THR A CA    1 
ATOM   2051 C C     . THR A 1 296 ? 20.177  -18.248 -75.323  1.00 64.02  ? 290 THR A C     1 
ATOM   2052 O O     . THR A 1 296 ? 20.221  -17.034 -75.510  1.00 62.87  ? 290 THR A O     1 
ATOM   2053 C CB    . THR A 1 296 ? 20.854  -19.368 -73.165  1.00 62.64  ? 290 THR A CB    1 
ATOM   2054 O OG1   . THR A 1 296 ? 20.300  -20.122 -72.090  1.00 60.99  ? 290 THR A OG1   1 
ATOM   2055 C CG2   . THR A 1 296 ? 21.810  -18.332 -72.621  1.00 60.59  ? 290 THR A CG2   1 
ATOM   2056 N N     . ARG A 1 297 ? 20.442  -19.164 -76.280  1.00 64.46  ? 291 ARG A N     1 
ATOM   2057 C CA    . ARG A 1 297 ? 20.881  -18.796 -77.631  1.00 67.04  ? 291 ARG A CA    1 
ATOM   2058 C C     . ARG A 1 297 ? 19.940  -17.809 -78.324  1.00 72.99  ? 291 ARG A C     1 
ATOM   2059 O O     . ARG A 1 297 ? 20.420  -16.915 -79.019  1.00 73.73  ? 291 ARG A O     1 
ATOM   2060 C CB    . ARG A 1 297 ? 21.166  -20.023 -78.511  1.00 70.30  ? 291 ARG A CB    1 
ATOM   2061 C CG    . ARG A 1 297 ? 22.322  -20.894 -78.005  1.00 82.97  ? 291 ARG A CG    1 
ATOM   2062 C CD    . ARG A 1 297 ? 23.584  -20.800 -78.846  1.00 92.83  ? 291 ARG A CD    1 
ATOM   2063 N NE    . ARG A 1 297 ? 24.664  -21.594 -78.254  1.00 100.98 ? 291 ARG A NE    1 
ATOM   2064 C CZ    . ARG A 1 297 ? 25.736  -21.080 -77.654  1.00 119.34 ? 291 ARG A CZ    1 
ATOM   2065 N NH1   . ARG A 1 297 ? 25.910  -19.763 -77.597  1.00 109.32 ? 291 ARG A NH1   1 
ATOM   2066 N NH2   . ARG A 1 297 ? 26.653  -21.882 -77.121  1.00 104.77 ? 291 ARG A NH2   1 
ATOM   2067 N N     . TYR A 1 298 ? 18.620  -17.929 -78.093  1.00 69.94  ? 292 TYR A N     1 
ATOM   2068 C CA    . TYR A 1 298 ? 17.628  -17.011 -78.654  1.00 70.29  ? 292 TYR A CA    1 
ATOM   2069 C C     . TYR A 1 298 ? 17.843  -15.595 -78.090  1.00 74.70  ? 292 TYR A C     1 
ATOM   2070 O O     . TYR A 1 298 ? 17.973  -14.647 -78.860  1.00 74.19  ? 292 TYR A O     1 
ATOM   2071 C CB    . TYR A 1 298 ? 16.196  -17.520 -78.378  1.00 71.24  ? 292 TYR A CB    1 
ATOM   2072 C CG    . TYR A 1 298 ? 15.088  -16.541 -78.722  1.00 73.22  ? 292 TYR A CG    1 
ATOM   2073 C CD1   . TYR A 1 298 ? 14.504  -16.532 -79.982  1.00 76.00  ? 292 TYR A CD1   1 
ATOM   2074 C CD2   . TYR A 1 298 ? 14.589  -15.657 -77.769  1.00 73.31  ? 292 TYR A CD2   1 
ATOM   2075 C CE1   . TYR A 1 298 ? 13.471  -15.647 -80.296  1.00 76.05  ? 292 TYR A CE1   1 
ATOM   2076 C CE2   . TYR A 1 298 ? 13.568  -14.757 -78.075  1.00 74.06  ? 292 TYR A CE2   1 
ATOM   2077 C CZ    . TYR A 1 298 ? 13.005  -14.759 -79.338  1.00 82.30  ? 292 TYR A CZ    1 
ATOM   2078 O OH    . TYR A 1 298 ? 11.969  -13.885 -79.600  1.00 81.50  ? 292 TYR A OH    1 
ATOM   2079 N N     . ASP A 1 299 ? 17.896  -15.476 -76.749  1.00 72.00  ? 293 ASP A N     1 
ATOM   2080 C CA    . ASP A 1 299 ? 18.077  -14.227 -76.008  1.00 71.81  ? 293 ASP A CA    1 
ATOM   2081 C C     . ASP A 1 299 ? 19.357  -13.493 -76.437  1.00 76.73  ? 293 ASP A C     1 
ATOM   2082 O O     . ASP A 1 299 ? 19.353  -12.265 -76.565  1.00 74.72  ? 293 ASP A O     1 
ATOM   2083 C CB    . ASP A 1 299 ? 18.069  -14.498 -74.478  1.00 73.40  ? 293 ASP A CB    1 
ATOM   2084 C CG    . ASP A 1 299 ? 16.701  -14.688 -73.811  1.00 84.57  ? 293 ASP A CG    1 
ATOM   2085 O OD1   . ASP A 1 299 ? 15.704  -14.909 -74.535  1.00 85.30  ? 293 ASP A OD1   1 
ATOM   2086 O OD2   . ASP A 1 299 ? 16.635  -14.628 -72.561  1.00 88.69  ? 293 ASP A OD2   1 
ATOM   2087 N N     . LEU A 1 300 ? 20.430  -14.256 -76.704  1.00 76.06  ? 294 LEU A N     1 
ATOM   2088 C CA    . LEU A 1 300 ? 21.717  -13.709 -77.128  1.00 77.57  ? 294 LEU A CA    1 
ATOM   2089 C C     . LEU A 1 300 ? 21.662  -13.125 -78.536  1.00 86.92  ? 294 LEU A C     1 
ATOM   2090 O O     . LEU A 1 300 ? 22.356  -12.143 -78.813  1.00 87.38  ? 294 LEU A O     1 
ATOM   2091 C CB    . LEU A 1 300 ? 22.836  -14.753 -77.008  1.00 78.39  ? 294 LEU A CB    1 
ATOM   2092 C CG    . LEU A 1 300 ? 23.175  -15.210 -75.591  1.00 81.95  ? 294 LEU A CG    1 
ATOM   2093 C CD1   . LEU A 1 300 ? 23.649  -16.634 -75.581  1.00 83.33  ? 294 LEU A CD1   1 
ATOM   2094 C CD2   . LEU A 1 300 ? 24.195  -14.310 -74.938  1.00 83.40  ? 294 LEU A CD2   1 
ATOM   2095 N N     . GLU A 1 301 ? 20.827  -13.704 -79.422  1.00 86.27  ? 295 GLU A N     1 
ATOM   2096 C CA    . GLU A 1 301 ? 20.678  -13.179 -80.776  1.00 87.84  ? 295 GLU A CA    1 
ATOM   2097 C C     . GLU A 1 301 ? 19.831  -11.913 -80.751  1.00 92.02  ? 295 GLU A C     1 
ATOM   2098 O O     . GLU A 1 301 ? 20.113  -10.972 -81.490  1.00 92.08  ? 295 GLU A O     1 
ATOM   2099 C CB    . GLU A 1 301 ? 20.105  -14.229 -81.735  1.00 90.70  ? 295 GLU A CB    1 
ATOM   2100 C CG    . GLU A 1 301 ? 20.562  -14.037 -83.180  1.00 104.06 ? 295 GLU A CG    1 
ATOM   2101 C CD    . GLU A 1 301 ? 22.041  -14.246 -83.471  1.00 128.55 ? 295 GLU A CD    1 
ATOM   2102 O OE1   . GLU A 1 301 ? 22.640  -13.386 -84.161  1.00 129.34 ? 295 GLU A OE1   1 
ATOM   2103 O OE2   . GLU A 1 301 ? 22.593  -15.285 -83.038  1.00 118.16 ? 295 GLU A OE2   1 
ATOM   2104 N N     . MET A 1 302 ? 18.827  -11.886 -79.859  1.00 88.73  ? 296 MET A N     1 
ATOM   2105 C CA    . MET A 1 302 ? 17.940  -10.749 -79.619  1.00 88.07  ? 296 MET A CA    1 
ATOM   2106 C C     . MET A 1 302 ? 18.750  -9.575  -79.072  1.00 89.48  ? 296 MET A C     1 
ATOM   2107 O O     . MET A 1 302 ? 18.481  -8.428  -79.426  1.00 89.08  ? 296 MET A O     1 
ATOM   2108 C CB    . MET A 1 302 ? 16.851  -11.139 -78.617  1.00 90.07  ? 296 MET A CB    1 
ATOM   2109 C CG    . MET A 1 302 ? 15.689  -11.856 -79.244  1.00 95.46  ? 296 MET A CG    1 
ATOM   2110 S SD    . MET A 1 302 ? 14.742  -10.744 -80.306  1.00 101.23 ? 296 MET A SD    1 
ATOM   2111 C CE    . MET A 1 302 ? 14.222  -9.435  -79.080  1.00 95.86  ? 296 MET A CE    1 
ATOM   2112 N N     . MET A 1 303 ? 19.742  -9.868  -78.214  1.00 83.72  ? 297 MET A N     1 
ATOM   2113 C CA    . MET A 1 303 ? 20.638  -8.869  -77.660  1.00 82.00  ? 297 MET A CA    1 
ATOM   2114 C C     . MET A 1 303 ? 21.554  -8.296  -78.755  1.00 86.21  ? 297 MET A C     1 
ATOM   2115 O O     . MET A 1 303 ? 21.679  -7.079  -78.845  1.00 84.34  ? 297 MET A O     1 
ATOM   2116 C CB    . MET A 1 303 ? 21.496  -9.485  -76.561  1.00 83.76  ? 297 MET A CB    1 
ATOM   2117 C CG    . MET A 1 303 ? 20.787  -9.674  -75.285  1.00 86.00  ? 297 MET A CG    1 
ATOM   2118 S SD    . MET A 1 303 ? 21.956  -10.265 -74.047  1.00 90.46  ? 297 MET A SD    1 
ATOM   2119 C CE    . MET A 1 303 ? 21.070  -11.665 -73.433  1.00 86.97  ? 297 MET A CE    1 
ATOM   2120 N N     . ARG A 1 304 ? 22.191  -9.169  -79.582  1.00 84.81  ? 298 ARG A N     1 
ATOM   2121 C CA    . ARG A 1 304 ? 23.134  -8.752  -80.630  1.00 86.40  ? 298 ARG A CA    1 
ATOM   2122 C C     . ARG A 1 304 ? 22.488  -7.828  -81.672  1.00 90.46  ? 298 ARG A C     1 
ATOM   2123 O O     . ARG A 1 304 ? 23.119  -6.859  -82.108  1.00 90.33  ? 298 ARG A O     1 
ATOM   2124 C CB    . ARG A 1 304 ? 23.773  -9.967  -81.304  1.00 88.79  ? 298 ARG A CB    1 
ATOM   2125 N N     . GLU A 1 305 ? 21.215  -8.108  -82.026  1.00 86.19  ? 299 GLU A N     1 
ATOM   2126 C CA    . GLU A 1 305 ? 20.448  -7.336  -82.993  1.00 85.74  ? 299 GLU A CA    1 
ATOM   2127 C C     . GLU A 1 305 ? 19.903  -6.051  -82.371  1.00 89.05  ? 299 GLU A C     1 
ATOM   2128 O O     . GLU A 1 305 ? 20.430  -4.975  -82.658  1.00 88.21  ? 299 GLU A O     1 
ATOM   2129 C CB    . GLU A 1 305 ? 19.324  -8.185  -83.578  1.00 86.55  ? 299 GLU A CB    1 
ATOM   2130 N N     . MET A 1 306 ? 18.882  -6.166  -81.494  1.00 85.93  ? 300 MET A N     1 
ATOM   2131 C CA    . MET A 1 306 ? 18.212  -5.033  -80.842  1.00 85.07  ? 300 MET A CA    1 
ATOM   2132 C C     . MET A 1 306 ? 19.081  -4.342  -79.806  1.00 85.82  ? 300 MET A C     1 
ATOM   2133 O O     . MET A 1 306 ? 19.199  -3.118  -79.835  1.00 85.12  ? 300 MET A O     1 
ATOM   2134 C CB    . MET A 1 306 ? 16.857  -5.424  -80.192  1.00 87.27  ? 300 MET A CB    1 
ATOM   2135 C CG    . MET A 1 306 ? 16.111  -6.574  -80.854  1.00 93.43  ? 300 MET A CG    1 
ATOM   2136 S SD    . MET A 1 306 ? 15.646  -6.328  -82.587  1.00 101.23 ? 300 MET A SD    1 
ATOM   2137 C CE    . MET A 1 306 ? 15.666  -8.069  -83.181  1.00 99.30  ? 300 MET A CE    1 
ATOM   2138 N N     . GLY A 1 307 ? 19.663  -5.127  -78.900  1.00 80.42  ? 301 GLY A N     1 
ATOM   2139 C CA    . GLY A 1 307 ? 20.445  -4.638  -77.767  1.00 78.53  ? 301 GLY A CA    1 
ATOM   2140 C C     . GLY A 1 307 ? 19.725  -4.975  -76.473  1.00 79.35  ? 301 GLY A C     1 
ATOM   2141 O O     . GLY A 1 307 ? 20.292  -4.870  -75.384  1.00 78.07  ? 301 GLY A O     1 
ATOM   2142 N N     . PHE A 1 308 ? 18.448  -5.374  -76.600  1.00 74.28  ? 302 PHE A N     1 
ATOM   2143 C CA    . PHE A 1 308 ? 17.549  -5.755  -75.524  1.00 72.16  ? 302 PHE A CA    1 
ATOM   2144 C C     . PHE A 1 308 ? 16.968  -7.126  -75.832  1.00 77.38  ? 302 PHE A C     1 
ATOM   2145 O O     . PHE A 1 308 ? 17.050  -7.596  -76.965  1.00 79.07  ? 302 PHE A O     1 
ATOM   2146 C CB    . PHE A 1 308 ? 16.417  -4.740  -75.425  1.00 71.75  ? 302 PHE A CB    1 
ATOM   2147 N N     . CYS A 1 309 ? 16.370  -7.758  -74.821  1.00 72.97  ? 303 CYS A N     1 
ATOM   2148 C CA    . CYS A 1 309 ? 15.638  -9.025  -74.903  1.00 72.85  ? 303 CYS A CA    1 
ATOM   2149 C C     . CYS A 1 309 ? 14.651  -9.083  -73.736  1.00 73.59  ? 303 CYS A C     1 
ATOM   2150 O O     . CYS A 1 309 ? 14.837  -8.364  -72.749  1.00 72.27  ? 303 CYS A O     1 
ATOM   2151 C CB    . CYS A 1 309 ? 16.583  -10.225 -74.904  1.00 74.33  ? 303 CYS A CB    1 
ATOM   2152 S SG    . CYS A 1 309 ? 17.463  -10.492 -73.342  1.00 77.55  ? 303 CYS A SG    1 
ATOM   2153 N N     . SER A 1 310 ? 13.603  -9.916  -73.836  1.00 68.71  ? 304 SER A N     1 
ATOM   2154 C CA    . SER A 1 310 ? 12.677  -10.049 -72.713  1.00 66.97  ? 304 SER A CA    1 
ATOM   2155 C C     . SER A 1 310 ? 13.416  -10.788 -71.587  1.00 69.31  ? 304 SER A C     1 
ATOM   2156 O O     . SER A 1 310 ? 14.098  -11.795 -71.838  1.00 70.14  ? 304 SER A O     1 
ATOM   2157 C CB    . SER A 1 310 ? 11.406  -10.796 -73.116  1.00 70.62  ? 304 SER A CB    1 
ATOM   2158 O OG    . SER A 1 310 ? 10.540  -10.985 -72.007  1.00 73.85  ? 304 SER A OG    1 
ATOM   2159 N N     . GLY A 1 311 ? 13.323  -10.236 -70.381  1.00 62.22  ? 305 GLY A N     1 
ATOM   2160 C CA    . GLY A 1 311 ? 13.970  -10.805 -69.210  1.00 60.11  ? 305 GLY A CA    1 
ATOM   2161 C C     . GLY A 1 311 ? 15.463  -10.560 -69.181  1.00 59.52  ? 305 GLY A C     1 
ATOM   2162 O O     . GLY A 1 311 ? 16.201  -11.358 -68.595  1.00 59.42  ? 305 GLY A O     1 
ATOM   2163 N N     . ILE A 1 312 ? 15.912  -9.431  -69.790  1.00 51.99  ? 306 ILE A N     1 
ATOM   2164 C CA    . ILE A 1 312 ? 17.323  -8.992  -69.843  1.00 50.36  ? 306 ILE A CA    1 
ATOM   2165 C C     . ILE A 1 312 ? 17.914  -8.825  -68.446  1.00 51.52  ? 306 ILE A C     1 
ATOM   2166 O O     . ILE A 1 312 ? 19.122  -9.013  -68.245  1.00 49.47  ? 306 ILE A O     1 
ATOM   2167 C CB    . ILE A 1 312 ? 17.500  -7.730  -70.729  1.00 52.78  ? 306 ILE A CB    1 
ATOM   2168 C CG1   . ILE A 1 312 ? 18.979  -7.353  -70.912  1.00 53.62  ? 306 ILE A CG1   1 
ATOM   2169 C CG2   . ILE A 1 312 ? 16.650  -6.548  -70.270  1.00 51.12  ? 306 ILE A CG2   1 
ATOM   2170 C CD1   . ILE A 1 312 ? 19.444  -7.507  -72.292  1.00 63.35  ? 306 ILE A CD1   1 
ATOM   2171 N N     . GLU A 1 313 ? 17.020  -8.510  -67.476  1.00 47.98  ? 307 GLU A N     1 
ATOM   2172 C CA    . GLU A 1 313 ? 17.311  -8.350  -66.055  1.00 46.97  ? 307 GLU A CA    1 
ATOM   2173 C C     . GLU A 1 313 ? 17.987  -9.592  -65.473  1.00 49.78  ? 307 GLU A C     1 
ATOM   2174 O O     . GLU A 1 313 ? 18.818  -9.460  -64.583  1.00 47.83  ? 307 GLU A O     1 
ATOM   2175 C CB    . GLU A 1 313 ? 16.047  -7.963  -65.262  1.00 47.28  ? 307 GLU A CB    1 
ATOM   2176 C CG    . GLU A 1 313 ? 14.892  -8.959  -65.318  1.00 63.87  ? 307 GLU A CG    1 
ATOM   2177 C CD    . GLU A 1 313 ? 13.805  -8.739  -66.359  1.00 102.91 ? 307 GLU A CD    1 
ATOM   2178 O OE1   . GLU A 1 313 ? 12.734  -9.375  -66.217  1.00 85.87  ? 307 GLU A OE1   1 
ATOM   2179 O OE2   . GLU A 1 313 ? 14.017  -7.958  -67.319  1.00 113.66 ? 307 GLU A OE2   1 
ATOM   2180 N N     . ASN A 1 314 ? 17.665  -10.785 -66.009  1.00 47.37  ? 308 ASN A N     1 
ATOM   2181 C CA    . ASN A 1 314 ? 18.244  -12.038 -65.549  1.00 48.60  ? 308 ASN A CA    1 
ATOM   2182 C C     . ASN A 1 314 ? 19.737  -12.096 -65.823  1.00 57.77  ? 308 ASN A C     1 
ATOM   2183 O O     . ASN A 1 314 ? 20.483  -12.726 -65.058  1.00 60.23  ? 308 ASN A O     1 
ATOM   2184 C CB    . ASN A 1 314 ? 17.521  -13.226 -66.166  1.00 46.08  ? 308 ASN A CB    1 
ATOM   2185 C CG    . ASN A 1 314 ? 16.213  -13.532 -65.506  1.00 64.42  ? 308 ASN A CG    1 
ATOM   2186 O OD1   . ASN A 1 314 ? 15.151  -13.472 -66.128  1.00 66.46  ? 308 ASN A OD1   1 
ATOM   2187 N ND2   . ASN A 1 314 ? 16.255  -13.846 -64.217  1.00 49.35  ? 308 ASN A ND2   1 
ATOM   2188 N N     . TYR A 1 315 ? 20.173  -11.404 -66.894  1.00 54.04  ? 309 TYR A N     1 
ATOM   2189 C CA    . TYR A 1 315 ? 21.563  -11.359 -67.317  1.00 54.14  ? 309 TYR A CA    1 
ATOM   2190 C C     . TYR A 1 315 ? 22.341  -10.241 -66.653  1.00 58.14  ? 309 TYR A C     1 
ATOM   2191 O O     . TYR A 1 315 ? 23.555  -10.210 -66.808  1.00 58.36  ? 309 TYR A O     1 
ATOM   2192 C CB    . TYR A 1 315 ? 21.661  -11.282 -68.852  1.00 55.42  ? 309 TYR A CB    1 
ATOM   2193 C CG    . TYR A 1 315 ? 20.984  -12.439 -69.556  1.00 55.88  ? 309 TYR A CG    1 
ATOM   2194 C CD1   . TYR A 1 315 ? 19.716  -12.301 -70.110  1.00 56.92  ? 309 TYR A CD1   1 
ATOM   2195 C CD2   . TYR A 1 315 ? 21.589  -13.689 -69.620  1.00 57.80  ? 309 TYR A CD2   1 
ATOM   2196 C CE1   . TYR A 1 315 ? 19.077  -13.373 -70.736  1.00 58.90  ? 309 TYR A CE1   1 
ATOM   2197 C CE2   . TYR A 1 315 ? 20.963  -14.768 -70.245  1.00 59.58  ? 309 TYR A CE2   1 
ATOM   2198 C CZ    . TYR A 1 315 ? 19.706  -14.609 -70.805  1.00 66.19  ? 309 TYR A CZ    1 
ATOM   2199 O OH    . TYR A 1 315 ? 19.102  -15.698 -71.407  1.00 65.37  ? 309 TYR A OH    1 
ATOM   2200 N N     . SER A 1 316 ? 21.660  -9.364  -65.868  1.00 55.28  ? 310 SER A N     1 
ATOM   2201 C CA    . SER A 1 316 ? 22.226  -8.206  -65.132  1.00 54.94  ? 310 SER A CA    1 
ATOM   2202 C C     . SER A 1 316 ? 23.660  -8.329  -64.599  1.00 60.56  ? 310 SER A C     1 
ATOM   2203 O O     . SER A 1 316 ? 24.443  -7.418  -64.853  1.00 61.63  ? 310 SER A O     1 
ATOM   2204 C CB    . SER A 1 316 ? 21.291  -7.720  -64.027  1.00 56.28  ? 310 SER A CB    1 
ATOM   2205 O OG    . SER A 1 316 ? 21.517  -8.419  -62.813  1.00 65.28  ? 310 SER A OG    1 
ATOM   2206 N N     . ARG A 1 317 ? 24.008  -9.427  -63.874  1.00 57.29  ? 311 ARG A N     1 
ATOM   2207 C CA    . ARG A 1 317 ? 25.370  -9.630  -63.332  1.00 58.12  ? 311 ARG A CA    1 
ATOM   2208 C C     . ARG A 1 317 ? 26.453  -9.596  -64.428  1.00 62.26  ? 311 ARG A C     1 
ATOM   2209 O O     . ARG A 1 317 ? 27.513  -9.003  -64.231  1.00 60.96  ? 311 ARG A O     1 
ATOM   2210 C CB    . ARG A 1 317 ? 25.456  -10.929 -62.503  1.00 58.02  ? 311 ARG A CB    1 
ATOM   2211 C CG    . ARG A 1 317 ? 26.716  -11.047 -61.646  1.00 62.61  ? 311 ARG A CG    1 
ATOM   2212 C CD    . ARG A 1 317 ? 27.726  -11.983 -62.279  1.00 75.29  ? 311 ARG A CD    1 
ATOM   2213 N NE    . ARG A 1 317 ? 27.416  -13.392 -62.015  1.00 85.16  ? 311 ARG A NE    1 
ATOM   2214 C CZ    . ARG A 1 317 ? 27.988  -14.418 -62.642  1.00 106.53 ? 311 ARG A CZ    1 
ATOM   2215 N NH1   . ARG A 1 317 ? 28.887  -14.206 -63.594  1.00 101.73 ? 311 ARG A NH1   1 
ATOM   2216 N NH2   . ARG A 1 317 ? 27.654  -15.665 -62.330  1.00 91.29  ? 311 ARG A NH2   1 
ATOM   2217 N N     . HIS A 1 318 ? 26.169  -10.237 -65.568  1.00 60.46  ? 312 HIS A N     1 
ATOM   2218 C CA    . HIS A 1 318 ? 27.063  -10.289 -66.719  1.00 62.11  ? 312 HIS A CA    1 
ATOM   2219 C C     . HIS A 1 318 ? 27.154  -8.945  -67.426  1.00 66.49  ? 312 HIS A C     1 
ATOM   2220 O O     . HIS A 1 318 ? 28.221  -8.594  -67.909  1.00 66.93  ? 312 HIS A O     1 
ATOM   2221 C CB    . HIS A 1 318 ? 26.608  -11.369 -67.696  1.00 63.80  ? 312 HIS A CB    1 
ATOM   2222 C CG    . HIS A 1 318 ? 26.875  -12.757 -67.208  1.00 68.34  ? 312 HIS A CG    1 
ATOM   2223 N ND1   . HIS A 1 318 ? 28.141  -13.310 -67.273  1.00 71.74  ? 312 HIS A ND1   1 
ATOM   2224 C CD2   . HIS A 1 318 ? 26.028  -13.670 -66.682  1.00 69.75  ? 312 HIS A CD2   1 
ATOM   2225 C CE1   . HIS A 1 318 ? 28.027  -14.531 -66.780  1.00 71.37  ? 312 HIS A CE1   1 
ATOM   2226 N NE2   . HIS A 1 318 ? 26.776  -14.796 -66.416  1.00 70.57  ? 312 HIS A NE2   1 
ATOM   2227 N N     . LEU A 1 319 ? 26.043  -8.195  -67.486  1.00 63.01  ? 313 LEU A N     1 
ATOM   2228 C CA    . LEU A 1 319 ? 25.974  -6.883  -68.146  1.00 62.65  ? 313 LEU A CA    1 
ATOM   2229 C C     . LEU A 1 319 ? 26.764  -5.800  -67.386  1.00 69.49  ? 313 LEU A C     1 
ATOM   2230 O O     . LEU A 1 319 ? 27.292  -4.877  -68.007  1.00 70.32  ? 313 LEU A O     1 
ATOM   2231 C CB    . LEU A 1 319 ? 24.511  -6.450  -68.398  1.00 60.83  ? 313 LEU A CB    1 
ATOM   2232 C CG    . LEU A 1 319 ? 23.575  -7.506  -68.957  1.00 64.74  ? 313 LEU A CG    1 
ATOM   2233 C CD1   . LEU A 1 319 ? 22.163  -7.019  -68.964  1.00 64.03  ? 313 LEU A CD1   1 
ATOM   2234 C CD2   . LEU A 1 319 ? 23.992  -7.947  -70.334  1.00 68.29  ? 313 LEU A CD2   1 
ATOM   2235 N N     . THR A 1 320 ? 26.868  -5.925  -66.054  1.00 66.94  ? 314 THR A N     1 
ATOM   2236 C CA    . THR A 1 320 ? 27.597  -4.959  -65.226  1.00 67.53  ? 314 THR A CA    1 
ATOM   2237 C C     . THR A 1 320 ? 29.059  -5.391  -65.040  1.00 75.42  ? 314 THR A C     1 
ATOM   2238 O O     . THR A 1 320 ? 29.838  -4.676  -64.397  1.00 75.03  ? 314 THR A O     1 
ATOM   2239 C CB    . THR A 1 320 ? 26.863  -4.698  -63.892  1.00 69.17  ? 314 THR A CB    1 
ATOM   2240 O OG1   . THR A 1 320 ? 26.925  -5.861  -63.065  1.00 64.86  ? 314 THR A OG1   1 
ATOM   2241 C CG2   . THR A 1 320 ? 25.417  -4.256  -64.087  1.00 65.64  ? 314 THR A CG2   1 
ATOM   2242 N N     . LEU A 1 321 ? 29.414  -6.579  -65.591  1.00 74.46  ? 315 LEU A N     1 
ATOM   2243 C CA    . LEU A 1 321 ? 30.747  -7.200  -65.540  1.00 76.34  ? 315 LEU A CA    1 
ATOM   2244 C C     . LEU A 1 321 ? 31.252  -7.413  -64.100  1.00 81.45  ? 315 LEU A C     1 
ATOM   2245 O O     . LEU A 1 321 ? 32.436  -7.652  -63.872  1.00 82.01  ? 315 LEU A O     1 
ATOM   2246 C CB    . LEU A 1 321 ? 31.763  -6.470  -66.460  1.00 77.62  ? 315 LEU A CB    1 
ATOM   2247 C CG    . LEU A 1 321 ? 31.366  -6.403  -67.966  1.00 82.87  ? 315 LEU A CG    1 
ATOM   2248 C CD1   . LEU A 1 321 ? 30.681  -5.099  -68.307  1.00 82.18  ? 315 LEU A CD1   1 
ATOM   2249 C CD2   . LEU A 1 321 ? 32.556  -6.588  -68.871  1.00 86.46  ? 315 LEU A CD2   1 
ATOM   2250 N N     . ARG A 1 322 ? 30.316  -7.368  -63.137  1.00 78.34  ? 316 ARG A N     1 
ATOM   2251 C CA    . ARG A 1 322 ? 30.527  -7.573  -61.704  1.00 78.61  ? 316 ARG A CA    1 
ATOM   2252 C C     . ARG A 1 322 ? 30.860  -9.055  -61.417  1.00 83.95  ? 316 ARG A C     1 
ATOM   2253 O O     . ARG A 1 322 ? 30.492  -9.923  -62.224  1.00 83.23  ? 316 ARG A O     1 
ATOM   2254 C CB    . ARG A 1 322 ? 29.257  -7.152  -60.933  1.00 78.48  ? 316 ARG A CB    1 
ATOM   2255 C CG    . ARG A 1 322 ? 29.117  -5.654  -60.690  1.00 90.99  ? 316 ARG A CG    1 
ATOM   2256 C CD    . ARG A 1 322 ? 29.568  -5.242  -59.297  1.00 103.81 ? 316 ARG A CD    1 
ATOM   2257 N NE    . ARG A 1 322 ? 28.453  -5.156  -58.351  1.00 109.72 ? 316 ARG A NE    1 
ATOM   2258 C CZ    . ARG A 1 322 ? 28.554  -4.689  -57.108  1.00 122.53 ? 316 ARG A CZ    1 
ATOM   2259 N NH1   . ARG A 1 322 ? 29.720  -4.244  -56.649  1.00 103.20 ? 316 ARG A NH1   1 
ATOM   2260 N NH2   . ARG A 1 322 ? 27.490  -4.645  -56.323  1.00 112.27 ? 316 ARG A NH2   1 
ATOM   2261 N N     . PRO A 1 323 ? 31.542  -9.384  -60.292  1.00 82.70  ? 317 PRO A N     1 
ATOM   2262 C CA    . PRO A 1 323 ? 31.863  -10.803 -60.036  1.00 84.14  ? 317 PRO A CA    1 
ATOM   2263 C C     . PRO A 1 323 ? 30.663  -11.652 -59.579  1.00 86.63  ? 317 PRO A C     1 
ATOM   2264 O O     . PRO A 1 323 ? 29.683  -11.076 -59.094  1.00 84.46  ? 317 PRO A O     1 
ATOM   2265 C CB    . PRO A 1 323 ? 32.972  -10.734 -58.971  1.00 86.90  ? 317 PRO A CB    1 
ATOM   2266 C CG    . PRO A 1 323 ? 32.734  -9.468  -58.260  1.00 90.06  ? 317 PRO A CG    1 
ATOM   2267 C CD    . PRO A 1 323 ? 32.073  -8.511  -59.222  1.00 84.42  ? 317 PRO A CD    1 
ATOM   2268 N N     . PRO A 1 324 ? 30.715  -13.012 -59.708  1.00 83.40  ? 318 PRO A N     1 
ATOM   2269 C CA    . PRO A 1 324 ? 29.592  -13.840 -59.229  1.00 81.87  ? 318 PRO A CA    1 
ATOM   2270 C C     . PRO A 1 324 ? 29.456  -13.766 -57.710  1.00 82.37  ? 318 PRO A C     1 
ATOM   2271 O O     . PRO A 1 324 ? 30.457  -13.607 -57.005  1.00 83.26  ? 318 PRO A O     1 
ATOM   2272 C CB    . PRO A 1 324 ? 29.980  -15.262 -59.667  1.00 85.06  ? 318 PRO A CB    1 
ATOM   2273 C CG    . PRO A 1 324 ? 31.043  -15.092 -60.684  1.00 90.94  ? 318 PRO A CG    1 
ATOM   2274 C CD    . PRO A 1 324 ? 31.783  -13.863 -60.267  1.00 86.54  ? 318 PRO A CD    1 
ATOM   2275 N N     . GLY A 1 325 ? 28.223  -13.856 -57.229  1.00 74.81  ? 319 GLY A N     1 
ATOM   2276 C CA    . GLY A 1 325 ? 27.915  -13.797 -55.803  1.00 72.93  ? 319 GLY A CA    1 
ATOM   2277 C C     . GLY A 1 325 ? 27.635  -12.396 -55.294  1.00 72.91  ? 319 GLY A C     1 
ATOM   2278 O O     . GLY A 1 325 ? 26.955  -12.238 -54.274  1.00 72.09  ? 319 GLY A O     1 
ATOM   2279 N N     . SER A 1 326 ? 28.156  -11.373 -56.023  1.00 66.30  ? 320 SER A N     1 
ATOM   2280 C CA    . SER A 1 326 ? 28.062  -9.935  -55.746  1.00 63.78  ? 320 SER A CA    1 
ATOM   2281 C C     . SER A 1 326 ? 26.703  -9.440  -55.231  1.00 64.29  ? 320 SER A C     1 
ATOM   2282 O O     . SER A 1 326 ? 25.650  -9.904  -55.708  1.00 63.62  ? 320 SER A O     1 
ATOM   2283 C CB    . SER A 1 326 ? 28.498  -9.129  -56.964  1.00 65.74  ? 320 SER A CB    1 
ATOM   2284 O OG    . SER A 1 326 ? 29.249  -8.000  -56.553  1.00 73.00  ? 320 SER A OG    1 
ATOM   2285 N N     . THR A 1 327 ? 26.753  -8.511  -54.230  1.00 57.60  ? 321 THR A N     1 
ATOM   2286 C CA    . THR A 1 327 ? 25.613  -7.865  -53.567  1.00 54.71  ? 321 THR A CA    1 
ATOM   2287 C C     . THR A 1 327 ? 25.066  -6.780  -54.501  1.00 57.48  ? 321 THR A C     1 
ATOM   2288 O O     . THR A 1 327 ? 25.853  -5.995  -55.022  1.00 56.75  ? 321 THR A O     1 
ATOM   2289 C CB    . THR A 1 327 ? 26.039  -7.315  -52.175  1.00 56.69  ? 321 THR A CB    1 
ATOM   2290 O OG1   . THR A 1 327 ? 26.308  -8.398  -51.289  1.00 57.38  ? 321 THR A OG1   1 
ATOM   2291 C CG2   . THR A 1 327 ? 24.992  -6.412  -51.531  1.00 49.69  ? 321 THR A CG2   1 
ATOM   2292 N N     . PRO A 1 328 ? 23.735  -6.712  -54.734  1.00 54.26  ? 322 PRO A N     1 
ATOM   2293 C CA    . PRO A 1 328 ? 23.194  -5.674  -55.635  1.00 53.31  ? 322 PRO A CA    1 
ATOM   2294 C C     . PRO A 1 328 ? 23.209  -4.251  -55.066  1.00 56.58  ? 322 PRO A C     1 
ATOM   2295 O O     . PRO A 1 328 ? 23.201  -4.058  -53.842  1.00 55.43  ? 322 PRO A O     1 
ATOM   2296 C CB    . PRO A 1 328 ? 21.744  -6.132  -55.873  1.00 54.09  ? 322 PRO A CB    1 
ATOM   2297 C CG    . PRO A 1 328 ? 21.650  -7.519  -55.319  1.00 59.26  ? 322 PRO A CG    1 
ATOM   2298 C CD    . PRO A 1 328 ? 22.658  -7.579  -54.224  1.00 55.73  ? 322 PRO A CD    1 
ATOM   2299 N N     . TYR A 1 329 ? 23.198  -3.247  -55.962  1.00 53.42  ? 323 TYR A N     1 
ATOM   2300 C CA    . TYR A 1 329 ? 23.081  -1.856  -55.534  1.00 53.15  ? 323 TYR A CA    1 
ATOM   2301 C C     . TYR A 1 329 ? 21.590  -1.585  -55.237  1.00 56.03  ? 323 TYR A C     1 
ATOM   2302 O O     . TYR A 1 329 ? 20.728  -2.022  -56.010  1.00 55.17  ? 323 TYR A O     1 
ATOM   2303 C CB    . TYR A 1 329 ? 23.610  -0.898  -56.603  1.00 54.56  ? 323 TYR A CB    1 
ATOM   2304 C CG    . TYR A 1 329 ? 25.117  -0.763  -56.613  1.00 57.50  ? 323 TYR A CG    1 
ATOM   2305 C CD1   . TYR A 1 329 ? 25.881  -1.355  -57.611  1.00 60.95  ? 323 TYR A CD1   1 
ATOM   2306 C CD2   . TYR A 1 329 ? 25.777  0.002   -55.653  1.00 57.83  ? 323 TYR A CD2   1 
ATOM   2307 C CE1   . TYR A 1 329 ? 27.267  -1.205  -57.647  1.00 63.78  ? 323 TYR A CE1   1 
ATOM   2308 C CE2   . TYR A 1 329 ? 27.163  0.144   -55.667  1.00 59.49  ? 323 TYR A CE2   1 
ATOM   2309 C CZ    . TYR A 1 329 ? 27.908  -0.466  -56.663  1.00 68.14  ? 323 TYR A CZ    1 
ATOM   2310 O OH    . TYR A 1 329 ? 29.281  -0.324  -56.707  1.00 67.55  ? 323 TYR A OH    1 
ATOM   2311 N N     . THR A 1 330 ? 21.282  -0.956  -54.085  1.00 51.33  ? 324 THR A N     1 
ATOM   2312 C CA    . THR A 1 330 ? 19.894  -0.668  -53.684  1.00 49.93  ? 324 THR A CA    1 
ATOM   2313 C C     . THR A 1 330 ? 19.669  0.816   -53.368  1.00 52.86  ? 324 THR A C     1 
ATOM   2314 O O     . THR A 1 330 ? 20.637  1.583   -53.333  1.00 53.16  ? 324 THR A O     1 
ATOM   2315 C CB    . THR A 1 330 ? 19.487  -1.528  -52.494  1.00 56.37  ? 324 THR A CB    1 
ATOM   2316 O OG1   . THR A 1 330 ? 20.338  -1.217  -51.394  1.00 55.90  ? 324 THR A OG1   1 
ATOM   2317 C CG2   . THR A 1 330 ? 19.503  -3.018  -52.811  1.00 55.86  ? 324 THR A CG2   1 
ATOM   2318 N N     . LEU A 1 331 ? 18.398  1.226   -53.110  1.00 47.03  ? 325 LEU A N     1 
ATOM   2319 C CA    . LEU A 1 331 ? 18.127  2.620   -52.754  1.00 45.68  ? 325 LEU A CA    1 
ATOM   2320 C C     . LEU A 1 331 ? 18.969  3.011   -51.523  1.00 53.46  ? 325 LEU A C     1 
ATOM   2321 O O     . LEU A 1 331 ? 19.465  4.139   -51.434  1.00 53.87  ? 325 LEU A O     1 
ATOM   2322 C CB    . LEU A 1 331 ? 16.631  2.843   -52.503  1.00 43.46  ? 325 LEU A CB    1 
ATOM   2323 C CG    . LEU A 1 331 ? 16.191  4.260   -52.116  1.00 44.70  ? 325 LEU A CG    1 
ATOM   2324 C CD1   . LEU A 1 331 ? 16.317  5.225   -53.261  1.00 43.00  ? 325 LEU A CD1   1 
ATOM   2325 C CD2   . LEU A 1 331 ? 14.781  4.254   -51.602  1.00 45.52  ? 325 LEU A CD2   1 
ATOM   2326 N N     . LEU A 1 332 ? 19.201  2.041   -50.624  1.00 51.27  ? 326 LEU A N     1 
ATOM   2327 C CA    . LEU A 1 332 ? 19.999  2.227   -49.410  1.00 51.85  ? 326 LEU A CA    1 
ATOM   2328 C C     . LEU A 1 332 ? 21.424  2.760   -49.674  1.00 54.28  ? 326 LEU A C     1 
ATOM   2329 O O     . LEU A 1 332 ? 21.986  3.432   -48.808  1.00 55.19  ? 326 LEU A O     1 
ATOM   2330 C CB    . LEU A 1 332 ? 20.037  0.917   -48.595  1.00 52.29  ? 326 LEU A CB    1 
ATOM   2331 C CG    . LEU A 1 332 ? 18.691  0.365   -48.097  1.00 55.52  ? 326 LEU A CG    1 
ATOM   2332 C CD1   . LEU A 1 332 ? 18.829  -1.071  -47.663  1.00 55.22  ? 326 LEU A CD1   1 
ATOM   2333 C CD2   . LEU A 1 332 ? 18.160  1.170   -46.949  1.00 56.86  ? 326 LEU A CD2   1 
ATOM   2334 N N     . ASP A 1 333 ? 21.990  2.479   -50.867  1.00 48.62  ? 327 ASP A N     1 
ATOM   2335 C CA    . ASP A 1 333 ? 23.329  2.930   -51.285  1.00 48.39  ? 327 ASP A CA    1 
ATOM   2336 C C     . ASP A 1 333 ? 23.358  4.413   -51.678  1.00 51.53  ? 327 ASP A C     1 
ATOM   2337 O O     . ASP A 1 333 ? 24.407  5.048   -51.586  1.00 51.29  ? 327 ASP A O     1 
ATOM   2338 C CB    . ASP A 1 333 ? 23.870  2.055   -52.428  1.00 49.99  ? 327 ASP A CB    1 
ATOM   2339 C CG    . ASP A 1 333 ? 24.101  0.609   -52.024  1.00 60.10  ? 327 ASP A CG    1 
ATOM   2340 O OD1   . ASP A 1 333 ? 23.491  -0.294  -52.650  1.00 62.90  ? 327 ASP A OD1   1 
ATOM   2341 O OD2   . ASP A 1 333 ? 24.873  0.377   -51.072  1.00 60.65  ? 327 ASP A OD2   1 
ATOM   2342 N N     . TYR A 1 334 ? 22.202  4.960   -52.107  1.00 46.97  ? 328 TYR A N     1 
ATOM   2343 C CA    . TYR A 1 334 ? 22.044  6.363   -52.503  1.00 45.49  ? 328 TYR A CA    1 
ATOM   2344 C C     . TYR A 1 334 ? 21.930  7.285   -51.257  1.00 48.78  ? 328 TYR A C     1 
ATOM   2345 O O     . TYR A 1 334 ? 21.996  8.513   -51.386  1.00 48.41  ? 328 TYR A O     1 
ATOM   2346 C CB    . TYR A 1 334 ? 20.811  6.521   -53.395  1.00 44.72  ? 328 TYR A CB    1 
ATOM   2347 C CG    . TYR A 1 334 ? 20.914  5.963   -54.794  1.00 46.36  ? 328 TYR A CG    1 
ATOM   2348 C CD1   . TYR A 1 334 ? 21.139  4.608   -55.009  1.00 48.26  ? 328 TYR A CD1   1 
ATOM   2349 C CD2   . TYR A 1 334 ? 20.616  6.758   -55.904  1.00 47.74  ? 328 TYR A CD2   1 
ATOM   2350 C CE1   . TYR A 1 334 ? 21.165  4.076   -56.300  1.00 50.67  ? 328 TYR A CE1   1 
ATOM   2351 C CE2   . TYR A 1 334 ? 20.624  6.236   -57.199  1.00 48.34  ? 328 TYR A CE2   1 
ATOM   2352 C CZ    . TYR A 1 334 ? 20.899  4.895   -57.393  1.00 55.34  ? 328 TYR A CZ    1 
ATOM   2353 O OH    . TYR A 1 334 ? 20.902  4.386   -58.670  1.00 54.71  ? 328 TYR A OH    1 
ATOM   2354 N N     . PHE A 1 335 ? 21.732  6.689   -50.062  1.00 44.46  ? 329 PHE A N     1 
ATOM   2355 C CA    . PHE A 1 335 ? 21.635  7.416   -48.796  1.00 43.95  ? 329 PHE A CA    1 
ATOM   2356 C C     . PHE A 1 335 ? 23.024  7.611   -48.199  1.00 52.86  ? 329 PHE A C     1 
ATOM   2357 O O     . PHE A 1 335 ? 23.871  6.710   -48.323  1.00 52.95  ? 329 PHE A O     1 
ATOM   2358 C CB    . PHE A 1 335 ? 20.782  6.651   -47.772  1.00 43.79  ? 329 PHE A CB    1 
ATOM   2359 C CG    . PHE A 1 335 ? 19.298  6.879   -47.840  1.00 42.75  ? 329 PHE A CG    1 
ATOM   2360 C CD1   . PHE A 1 335 ? 18.468  5.968   -48.483  1.00 43.82  ? 329 PHE A CD1   1 
ATOM   2361 C CD2   . PHE A 1 335 ? 18.722  7.979   -47.226  1.00 43.64  ? 329 PHE A CD2   1 
ATOM   2362 C CE1   . PHE A 1 335 ? 17.085  6.153   -48.514  1.00 43.16  ? 329 PHE A CE1   1 
ATOM   2363 C CE2   . PHE A 1 335 ? 17.339  8.172   -47.265  1.00 45.77  ? 329 PHE A CE2   1 
ATOM   2364 C CZ    . PHE A 1 335 ? 16.530  7.257   -47.912  1.00 42.84  ? 329 PHE A CZ    1 
ATOM   2365 N N     . PRO A 1 336 ? 23.241  8.736   -47.461  1.00 52.36  ? 330 PRO A N     1 
ATOM   2366 C CA    . PRO A 1 336 ? 24.540  8.951   -46.806  1.00 54.13  ? 330 PRO A CA    1 
ATOM   2367 C C     . PRO A 1 336 ? 24.806  7.930   -45.709  1.00 62.73  ? 330 PRO A C     1 
ATOM   2368 O O     . PRO A 1 336 ? 23.853  7.369   -45.164  1.00 62.13  ? 330 PRO A O     1 
ATOM   2369 C CB    . PRO A 1 336 ? 24.383  10.334  -46.176  1.00 56.21  ? 330 PRO A CB    1 
ATOM   2370 C CG    . PRO A 1 336 ? 23.244  10.954  -46.864  1.00 59.59  ? 330 PRO A CG    1 
ATOM   2371 C CD    . PRO A 1 336 ? 22.321  9.855   -47.176  1.00 53.78  ? 330 PRO A CD    1 
ATOM   2372 N N     . ASP A 1 337 ? 26.094  7.715   -45.356  1.00 63.69  ? 331 ASP A N     1 
ATOM   2373 C CA    . ASP A 1 337 ? 26.505  6.813   -44.269  1.00 65.49  ? 331 ASP A CA    1 
ATOM   2374 C C     . ASP A 1 337 ? 25.666  7.083   -43.015  1.00 68.94  ? 331 ASP A C     1 
ATOM   2375 O O     . ASP A 1 337 ? 25.098  6.144   -42.446  1.00 68.51  ? 331 ASP A O     1 
ATOM   2376 C CB    . ASP A 1 337 ? 27.992  7.025   -43.941  1.00 70.11  ? 331 ASP A CB    1 
ATOM   2377 C CG    . ASP A 1 337 ? 28.936  6.024   -44.564  1.00 86.06  ? 331 ASP A CG    1 
ATOM   2378 O OD1   . ASP A 1 337 ? 28.674  5.597   -45.722  1.00 85.08  ? 331 ASP A OD1   1 
ATOM   2379 O OD2   . ASP A 1 337 ? 29.973  5.704   -43.916  1.00 95.41  ? 331 ASP A OD2   1 
ATOM   2380 N N     . ASP A 1 338 ? 25.549  8.386   -42.643  1.00 65.19  ? 332 ASP A N     1 
ATOM   2381 C CA    . ASP A 1 338 ? 24.774  8.889   -41.514  1.00 65.19  ? 332 ASP A CA    1 
ATOM   2382 C C     . ASP A 1 338 ? 23.328  9.154   -41.961  1.00 65.27  ? 332 ASP A C     1 
ATOM   2383 O O     . ASP A 1 338 ? 23.014  10.270  -42.400  1.00 65.97  ? 332 ASP A O     1 
ATOM   2384 C CB    . ASP A 1 338 ? 25.421  10.179  -40.978  1.00 69.43  ? 332 ASP A CB    1 
ATOM   2385 C CG    . ASP A 1 338 ? 25.192  10.471  -39.502  1.00 88.86  ? 332 ASP A CG    1 
ATOM   2386 O OD1   . ASP A 1 338 ? 24.562  11.512  -39.190  1.00 89.90  ? 332 ASP A OD1   1 
ATOM   2387 O OD2   . ASP A 1 338 ? 25.730  9.721   -38.658  1.00 99.76  ? 332 ASP A OD2   1 
ATOM   2388 N N     . PHE A 1 339 ? 22.462  8.114   -41.876  1.00 57.12  ? 333 PHE A N     1 
ATOM   2389 C CA    . PHE A 1 339 ? 21.041  8.176   -42.225  1.00 54.52  ? 333 PHE A CA    1 
ATOM   2390 C C     . PHE A 1 339 ? 20.161  7.314   -41.294  1.00 54.93  ? 333 PHE A C     1 
ATOM   2391 O O     . PHE A 1 339 ? 20.631  6.312   -40.734  1.00 54.88  ? 333 PHE A O     1 
ATOM   2392 C CB    . PHE A 1 339 ? 20.826  7.824   -43.702  1.00 55.86  ? 333 PHE A CB    1 
ATOM   2393 C CG    . PHE A 1 339 ? 20.580  6.369   -44.045  1.00 57.23  ? 333 PHE A CG    1 
ATOM   2394 C CD1   . PHE A 1 339 ? 19.336  5.945   -44.504  1.00 58.37  ? 333 PHE A CD1   1 
ATOM   2395 C CD2   . PHE A 1 339 ? 21.596  5.421   -43.915  1.00 60.17  ? 333 PHE A CD2   1 
ATOM   2396 C CE1   . PHE A 1 339 ? 19.117  4.608   -44.848  1.00 58.31  ? 333 PHE A CE1   1 
ATOM   2397 C CE2   . PHE A 1 339 ? 21.368  4.079   -44.243  1.00 61.67  ? 333 PHE A CE2   1 
ATOM   2398 C CZ    . PHE A 1 339 ? 20.132  3.684   -44.711  1.00 57.91  ? 333 PHE A CZ    1 
ATOM   2399 N N     . MET A 1 340 ? 18.885  7.702   -41.149  1.00 48.17  ? 334 MET A N     1 
ATOM   2400 C CA    . MET A 1 340 ? 17.941  7.013   -40.279  1.00 46.81  ? 334 MET A CA    1 
ATOM   2401 C C     . MET A 1 340 ? 16.895  6.208   -41.038  1.00 45.73  ? 334 MET A C     1 
ATOM   2402 O O     . MET A 1 340 ? 16.501  6.576   -42.143  1.00 45.03  ? 334 MET A O     1 
ATOM   2403 C CB    . MET A 1 340 ? 17.284  8.013   -39.331  1.00 50.38  ? 334 MET A CB    1 
ATOM   2404 C CG    . MET A 1 340 ? 16.486  7.366   -38.230  1.00 55.87  ? 334 MET A CG    1 
ATOM   2405 S SD    . MET A 1 340 ? 15.798  8.554   -37.056  1.00 63.21  ? 334 MET A SD    1 
ATOM   2406 C CE    . MET A 1 340 ? 14.480  9.360   -38.066  1.00 58.87  ? 334 MET A CE    1 
ATOM   2407 N N     . ILE A 1 341 ? 16.469  5.096   -40.433  1.00 39.95  ? 335 ILE A N     1 
ATOM   2408 C CA    . ILE A 1 341 ? 15.450  4.196   -40.944  1.00 38.73  ? 335 ILE A CA    1 
ATOM   2409 C C     . ILE A 1 341 ? 14.338  4.150   -39.892  1.00 45.92  ? 335 ILE A C     1 
ATOM   2410 O O     . ILE A 1 341 ? 14.617  4.086   -38.690  1.00 47.00  ? 335 ILE A O     1 
ATOM   2411 C CB    . ILE A 1 341 ? 16.026  2.770   -41.288  1.00 41.10  ? 335 ILE A CB    1 
ATOM   2412 C CG1   . ILE A 1 341 ? 16.931  2.809   -42.530  1.00 41.03  ? 335 ILE A CG1   1 
ATOM   2413 C CG2   . ILE A 1 341 ? 14.912  1.731   -41.519  1.00 40.93  ? 335 ILE A CG2   1 
ATOM   2414 C CD1   . ILE A 1 341 ? 17.634  1.468   -42.897  1.00 43.97  ? 335 ILE A CD1   1 
ATOM   2415 N N     . VAL A 1 342 ? 13.079  4.209   -40.341  1.00 43.15  ? 336 VAL A N     1 
ATOM   2416 C CA    . VAL A 1 342 ? 11.927  4.084   -39.459  1.00 43.53  ? 336 VAL A CA    1 
ATOM   2417 C C     . VAL A 1 342 ? 11.036  3.010   -40.056  1.00 49.21  ? 336 VAL A C     1 
ATOM   2418 O O     . VAL A 1 342 ? 10.527  3.177   -41.175  1.00 47.86  ? 336 VAL A O     1 
ATOM   2419 C CB    . VAL A 1 342 ? 11.186  5.417   -39.222  1.00 47.73  ? 336 VAL A CB    1 
ATOM   2420 C CG1   . VAL A 1 342 ? 9.931   5.211   -38.376  1.00 47.40  ? 336 VAL A CG1   1 
ATOM   2421 C CG2   . VAL A 1 342 ? 12.108  6.443   -38.569  1.00 48.75  ? 336 VAL A CG2   1 
ATOM   2422 N N     . VAL A 1 343 ? 10.873  1.886   -39.322  1.00 47.59  ? 337 VAL A N     1 
ATOM   2423 C CA    . VAL A 1 343 ? 10.057  0.744   -39.769  1.00 46.92  ? 337 VAL A CA    1 
ATOM   2424 C C     . VAL A 1 343 ? 8.622   0.829   -39.224  1.00 52.83  ? 337 VAL A C     1 
ATOM   2425 O O     . VAL A 1 343 ? 8.443   0.649   -38.027  1.00 54.82  ? 337 VAL A O     1 
ATOM   2426 C CB    . VAL A 1 343 ? 10.727  -0.605  -39.406  1.00 49.92  ? 337 VAL A CB    1 
ATOM   2427 C CG1   . VAL A 1 343 ? 9.948   -1.768  -39.983  1.00 49.04  ? 337 VAL A CG1   1 
ATOM   2428 C CG2   . VAL A 1 343 ? 12.167  -0.651  -39.886  1.00 50.09  ? 337 VAL A CG2   1 
ATOM   2429 N N     . ASP A 1 344 ? 7.610   1.097   -40.072  1.00 48.87  ? 338 ASP A N     1 
ATOM   2430 C CA    . ASP A 1 344 ? 6.232   1.115   -39.581  1.00 49.78  ? 338 ASP A CA    1 
ATOM   2431 C C     . ASP A 1 344 ? 5.697   -0.339  -39.514  1.00 55.50  ? 338 ASP A C     1 
ATOM   2432 O O     . ASP A 1 344 ? 6.010   -1.134  -40.408  1.00 56.03  ? 338 ASP A O     1 
ATOM   2433 C CB    . ASP A 1 344 ? 5.326   2.003   -40.441  1.00 51.88  ? 338 ASP A CB    1 
ATOM   2434 C CG    . ASP A 1 344 ? 3.990   2.305   -39.762  1.00 72.00  ? 338 ASP A CG    1 
ATOM   2435 O OD1   . ASP A 1 344 ? 3.996   2.671   -38.546  1.00 74.86  ? 338 ASP A OD1   1 
ATOM   2436 O OD2   . ASP A 1 344 ? 2.937   2.173   -40.433  1.00 78.91  ? 338 ASP A OD2   1 
ATOM   2437 N N     . GLU A 1 345 ? 4.908   -0.687  -38.442  1.00 51.08  ? 339 GLU A N     1 
ATOM   2438 C CA    . GLU A 1 345 ? 4.345   -2.034  -38.172  1.00 49.21  ? 339 GLU A CA    1 
ATOM   2439 C C     . GLU A 1 345 ? 5.465   -3.066  -38.305  1.00 50.25  ? 339 GLU A C     1 
ATOM   2440 O O     . GLU A 1 345 ? 5.371   -4.015  -39.071  1.00 51.28  ? 339 GLU A O     1 
ATOM   2441 C CB    . GLU A 1 345 ? 3.128   -2.357  -39.082  1.00 49.89  ? 339 GLU A CB    1 
ATOM   2442 C CG    . GLU A 1 345 ? 1.959   -1.387  -38.989  1.00 64.52  ? 339 GLU A CG    1 
ATOM   2443 C CD    . GLU A 1 345 ? 1.261   -1.291  -37.643  1.00 101.07 ? 339 GLU A CD    1 
ATOM   2444 O OE1   . GLU A 1 345 ? 1.763   -0.583  -36.735  1.00 86.59  ? 339 GLU A OE1   1 
ATOM   2445 O OE2   . GLU A 1 345 ? 0.176   -1.901  -37.516  1.00 111.81 ? 339 GLU A OE2   1 
ATOM   2446 N N     . SER A 1 346 ? 6.568   -2.805  -37.607  1.00 43.91  ? 340 SER A N     1 
ATOM   2447 C CA    . SER A 1 346 ? 7.793   -3.580  -37.633  1.00 42.52  ? 340 SER A CA    1 
ATOM   2448 C C     . SER A 1 346 ? 7.604   -5.060  -37.596  1.00 43.17  ? 340 SER A C     1 
ATOM   2449 O O     . SER A 1 346 ? 8.232   -5.735  -38.397  1.00 41.32  ? 340 SER A O     1 
ATOM   2450 C CB    . SER A 1 346 ? 8.735   -3.126  -36.529  1.00 47.69  ? 340 SER A CB    1 
ATOM   2451 O OG    . SER A 1 346 ? 8.119   -3.234  -35.258  1.00 57.54  ? 340 SER A OG    1 
ATOM   2452 N N     . HIS A 1 347 ? 6.698   -5.565  -36.718  1.00 40.82  ? 341 HIS A N     1 
ATOM   2453 C CA    . HIS A 1 347 ? 6.374   -6.990  -36.534  1.00 40.98  ? 341 HIS A CA    1 
ATOM   2454 C C     . HIS A 1 347 ? 5.802   -7.617  -37.804  1.00 43.33  ? 341 HIS A C     1 
ATOM   2455 O O     . HIS A 1 347 ? 5.671   -8.835  -37.869  1.00 44.28  ? 341 HIS A O     1 
ATOM   2456 C CB    . HIS A 1 347 ? 5.404   -7.169  -35.361  1.00 42.41  ? 341 HIS A CB    1 
ATOM   2457 C CG    . HIS A 1 347 ? 4.021   -6.669  -35.656  1.00 45.56  ? 341 HIS A CG    1 
ATOM   2458 N ND1   . HIS A 1 347 ? 3.749   -5.317  -35.756  1.00 47.17  ? 341 HIS A ND1   1 
ATOM   2459 C CD2   . HIS A 1 347 ? 2.880   -7.361  -35.896  1.00 46.64  ? 341 HIS A CD2   1 
ATOM   2460 C CE1   . HIS A 1 347 ? 2.454   -5.230  -36.030  1.00 45.67  ? 341 HIS A CE1   1 
ATOM   2461 N NE2   . HIS A 1 347 ? 1.890   -6.432  -36.119  1.00 45.77  ? 341 HIS A NE2   1 
ATOM   2462 N N     . VAL A 1 348 ? 5.469   -6.784  -38.803  1.00 36.86  ? 342 VAL A N     1 
ATOM   2463 C CA    . VAL A 1 348 ? 4.965   -7.225  -40.094  1.00 35.50  ? 342 VAL A CA    1 
ATOM   2464 C C     . VAL A 1 348 ? 6.027   -7.016  -41.169  1.00 41.05  ? 342 VAL A C     1 
ATOM   2465 O O     . VAL A 1 348 ? 6.279   -7.922  -41.979  1.00 42.23  ? 342 VAL A O     1 
ATOM   2466 C CB    . VAL A 1 348 ? 3.658   -6.543  -40.505  1.00 37.97  ? 342 VAL A CB    1 
ATOM   2467 C CG1   . VAL A 1 348 ? 3.083   -7.230  -41.728  1.00 37.80  ? 342 VAL A CG1   1 
ATOM   2468 C CG2   . VAL A 1 348 ? 2.657   -6.550  -39.369  1.00 37.88  ? 342 VAL A CG2   1 
ATOM   2469 N N     . THR A 1 349 ? 6.636   -5.819  -41.186  1.00 36.12  ? 343 THR A N     1 
ATOM   2470 C CA    . THR A 1 349 ? 7.641   -5.411  -42.163  1.00 34.18  ? 343 THR A CA    1 
ATOM   2471 C C     . THR A 1 349 ? 8.924   -6.222  -42.032  1.00 35.79  ? 343 THR A C     1 
ATOM   2472 O O     . THR A 1 349 ? 9.400   -6.748  -43.038  1.00 35.04  ? 343 THR A O     1 
ATOM   2473 C CB    . THR A 1 349 ? 7.860   -3.909  -42.085  1.00 35.85  ? 343 THR A CB    1 
ATOM   2474 O OG1   . THR A 1 349 ? 6.604   -3.263  -41.894  1.00 37.12  ? 343 THR A OG1   1 
ATOM   2475 C CG2   . THR A 1 349 ? 8.532   -3.367  -43.313  1.00 32.09  ? 343 THR A CG2   1 
ATOM   2476 N N     . ILE A 1 350 ? 9.483   -6.325  -40.805  1.00 29.97  ? 344 ILE A N     1 
ATOM   2477 C CA    . ILE A 1 350 ? 10.709  -7.079  -40.572  1.00 29.25  ? 344 ILE A CA    1 
ATOM   2478 C C     . ILE A 1 350 ? 10.634  -8.502  -41.168  1.00 35.08  ? 344 ILE A C     1 
ATOM   2479 O O     . ILE A 1 350 ? 11.479  -8.810  -42.009  1.00 33.63  ? 344 ILE A O     1 
ATOM   2480 C CB    . ILE A 1 350 ? 11.257  -6.980  -39.117  1.00 31.83  ? 344 ILE A CB    1 
ATOM   2481 C CG1   . ILE A 1 350 ? 11.630  -5.528  -38.749  1.00 31.71  ? 344 ILE A CG1   1 
ATOM   2482 C CG2   . ILE A 1 350 ? 12.422  -7.953  -38.854  1.00 31.87  ? 344 ILE A CG2   1 
ATOM   2483 C CD1   . ILE A 1 350 ? 12.634  -4.785  -39.691  1.00 34.51  ? 344 ILE A CD1   1 
ATOM   2484 N N     . PRO A 1 351 ? 9.597   -9.337  -40.862  1.00 33.64  ? 345 PRO A N     1 
ATOM   2485 C CA    . PRO A 1 351 ? 9.521   -10.673 -41.494  1.00 33.70  ? 345 PRO A CA    1 
ATOM   2486 C C     . PRO A 1 351 ? 9.408   -10.615 -43.025  1.00 35.56  ? 345 PRO A C     1 
ATOM   2487 O O     . PRO A 1 351 ? 9.967   -11.488 -43.695  1.00 34.06  ? 345 PRO A O     1 
ATOM   2488 C CB    . PRO A 1 351 ? 8.270   -11.292 -40.865  1.00 35.44  ? 345 PRO A CB    1 
ATOM   2489 C CG    . PRO A 1 351 ? 8.062   -10.526 -39.608  1.00 39.44  ? 345 PRO A CG    1 
ATOM   2490 C CD    . PRO A 1 351 ? 8.485   -9.147  -39.905  1.00 34.48  ? 345 PRO A CD    1 
ATOM   2491 N N     . GLN A 1 352 ? 8.703   -9.563  -43.563  1.00 30.63  ? 346 GLN A N     1 
ATOM   2492 C CA    . GLN A 1 352 ? 8.524   -9.308  -44.988  1.00 29.42  ? 346 GLN A CA    1 
ATOM   2493 C C     . GLN A 1 352 ? 9.867   -9.087  -45.637  1.00 37.39  ? 346 GLN A C     1 
ATOM   2494 O O     . GLN A 1 352 ? 10.178  -9.806  -46.579  1.00 38.80  ? 346 GLN A O     1 
ATOM   2495 C CB    . GLN A 1 352 ? 7.624   -8.095  -45.241  1.00 29.19  ? 346 GLN A CB    1 
ATOM   2496 C CG    . GLN A 1 352 ? 7.528   -7.724  -46.729  1.00 33.02  ? 346 GLN A CG    1 
ATOM   2497 C CD    . GLN A 1 352 ? 6.500   -6.667  -47.004  1.00 52.91  ? 346 GLN A CD    1 
ATOM   2498 O OE1   . GLN A 1 352 ? 6.786   -5.458  -47.003  1.00 53.62  ? 346 GLN A OE1   1 
ATOM   2499 N NE2   . GLN A 1 352 ? 5.283   -7.108  -47.290  1.00 36.10  ? 346 GLN A NE2   1 
ATOM   2500 N N     . VAL A 1 353 ? 10.650  -8.090  -45.143  1.00 35.07  ? 347 VAL A N     1 
ATOM   2501 C CA    . VAL A 1 353 ? 11.985  -7.719  -45.630  1.00 35.51  ? 347 VAL A CA    1 
ATOM   2502 C C     . VAL A 1 353 ? 12.886  -8.953  -45.631  1.00 45.40  ? 347 VAL A C     1 
ATOM   2503 O O     . VAL A 1 353 ? 13.498  -9.273  -46.660  1.00 46.98  ? 347 VAL A O     1 
ATOM   2504 C CB    . VAL A 1 353 ? 12.590  -6.587  -44.771  1.00 38.25  ? 347 VAL A CB    1 
ATOM   2505 C CG1   . VAL A 1 353 ? 14.064  -6.349  -45.114  1.00 38.27  ? 347 VAL A CG1   1 
ATOM   2506 C CG2   . VAL A 1 353 ? 11.780  -5.305  -44.902  1.00 37.05  ? 347 VAL A CG2   1 
ATOM   2507 N N     . ARG A 1 354 ? 12.923  -9.653  -44.478  1.00 43.29  ? 348 ARG A N     1 
ATOM   2508 C CA    . ARG A 1 354 ? 13.682  -10.860 -44.221  1.00 44.70  ? 348 ARG A CA    1 
ATOM   2509 C C     . ARG A 1 354 ? 13.310  -11.975 -45.180  1.00 49.85  ? 348 ARG A C     1 
ATOM   2510 O O     . ARG A 1 354 ? 14.177  -12.758 -45.545  1.00 51.41  ? 348 ARG A O     1 
ATOM   2511 C CB    . ARG A 1 354 ? 13.413  -11.310 -42.781  1.00 48.45  ? 348 ARG A CB    1 
ATOM   2512 C CG    . ARG A 1 354 ? 14.379  -12.336 -42.196  1.00 56.56  ? 348 ARG A CG    1 
ATOM   2513 C CD    . ARG A 1 354 ? 13.668  -13.263 -41.254  1.00 59.84  ? 348 ARG A CD    1 
ATOM   2514 N NE    . ARG A 1 354 ? 13.326  -12.646 -39.971  1.00 71.52  ? 348 ARG A NE    1 
ATOM   2515 C CZ    . ARG A 1 354 ? 12.141  -12.770 -39.361  1.00 87.67  ? 348 ARG A CZ    1 
ATOM   2516 N NH1   . ARG A 1 354 ? 11.150  -13.447 -39.941  1.00 73.67  ? 348 ARG A NH1   1 
ATOM   2517 N NH2   . ARG A 1 354 ? 11.934  -12.205 -38.174  1.00 69.94  ? 348 ARG A NH2   1 
ATOM   2518 N N     . GLY A 1 355 ? 12.041  -12.027 -45.581  1.00 45.44  ? 349 GLY A N     1 
ATOM   2519 C CA    . GLY A 1 355 ? 11.504  -13.061 -46.454  1.00 45.10  ? 349 GLY A CA    1 
ATOM   2520 C C     . GLY A 1 355 ? 11.635  -12.877 -47.952  1.00 47.81  ? 349 GLY A C     1 
ATOM   2521 O O     . GLY A 1 355 ? 11.458  -13.866 -48.644  1.00 48.81  ? 349 GLY A O     1 
ATOM   2522 N N     . MET A 1 356 ? 11.909  -11.646 -48.489  1.00 42.09  ? 350 MET A N     1 
ATOM   2523 C CA    . MET A 1 356 ? 12.012  -11.396 -49.943  1.00 41.29  ? 350 MET A CA    1 
ATOM   2524 C C     . MET A 1 356 ? 13.122  -12.169 -50.622  1.00 46.97  ? 350 MET A C     1 
ATOM   2525 O O     . MET A 1 356 ? 12.877  -12.688 -51.714  1.00 46.17  ? 350 MET A O     1 
ATOM   2526 C CB    . MET A 1 356 ? 12.147  -9.912  -50.324  1.00 43.40  ? 350 MET A CB    1 
ATOM   2527 C CG    . MET A 1 356 ? 11.041  -8.964  -49.825  1.00 47.12  ? 350 MET A CG    1 
ATOM   2528 S SD    . MET A 1 356 ? 9.312   -9.473  -50.005  1.00 51.46  ? 350 MET A SD    1 
ATOM   2529 C CE    . MET A 1 356 ? 9.020   -9.204  -51.762  1.00 47.39  ? 350 MET A CE    1 
ATOM   2530 N N     . PHE A 1 357 ? 14.354  -12.225 -50.012  1.00 45.74  ? 351 PHE A N     1 
ATOM   2531 C CA    . PHE A 1 357 ? 15.495  -12.976 -50.569  1.00 45.81  ? 351 PHE A CA    1 
ATOM   2532 C C     . PHE A 1 357 ? 15.193  -14.471 -50.685  1.00 52.93  ? 351 PHE A C     1 
ATOM   2533 O O     . PHE A 1 357 ? 15.423  -15.037 -51.748  1.00 53.97  ? 351 PHE A O     1 
ATOM   2534 C CB    . PHE A 1 357 ? 16.795  -12.750 -49.779  1.00 46.75  ? 351 PHE A CB    1 
ATOM   2535 C CG    . PHE A 1 357 ? 17.946  -13.662 -50.155  1.00 47.58  ? 351 PHE A CG    1 
ATOM   2536 C CD1   . PHE A 1 357 ? 18.870  -13.281 -51.114  1.00 49.22  ? 351 PHE A CD1   1 
ATOM   2537 C CD2   . PHE A 1 357 ? 18.107  -14.902 -49.540  1.00 49.61  ? 351 PHE A CD2   1 
ATOM   2538 C CE1   . PHE A 1 357 ? 19.930  -14.126 -51.462  1.00 50.29  ? 351 PHE A CE1   1 
ATOM   2539 C CE2   . PHE A 1 357 ? 19.162  -15.749 -49.900  1.00 52.46  ? 351 PHE A CE2   1 
ATOM   2540 C CZ    . PHE A 1 357 ? 20.069  -15.350 -50.852  1.00 49.94  ? 351 PHE A CZ    1 
ATOM   2541 N N     . ASN A 1 358 ? 14.693  -15.106 -49.614  1.00 50.61  ? 352 ASN A N     1 
ATOM   2542 C CA    . ASN A 1 358 ? 14.409  -16.544 -49.596  1.00 52.08  ? 352 ASN A CA    1 
ATOM   2543 C C     . ASN A 1 358 ? 13.406  -17.000 -50.627  1.00 54.40  ? 352 ASN A C     1 
ATOM   2544 O O     . ASN A 1 358 ? 13.638  -18.005 -51.276  1.00 54.89  ? 352 ASN A O     1 
ATOM   2545 C CB    . ASN A 1 358 ? 14.073  -17.039 -48.193  1.00 58.46  ? 352 ASN A CB    1 
ATOM   2546 C CG    . ASN A 1 358 ? 15.196  -16.769 -47.221  1.00 88.79  ? 352 ASN A CG    1 
ATOM   2547 O OD1   . ASN A 1 358 ? 16.288  -17.363 -47.281  1.00 81.82  ? 352 ASN A OD1   1 
ATOM   2548 N ND2   . ASN A 1 358 ? 14.983  -15.802 -46.365  1.00 82.17  ? 352 ASN A ND2   1 
ATOM   2549 N N     . GLY A 1 359 ? 12.348  -16.227 -50.819  1.00 49.64  ? 353 GLY A N     1 
ATOM   2550 C CA    . GLY A 1 359 ? 11.320  -16.511 -51.810  1.00 49.62  ? 353 GLY A CA    1 
ATOM   2551 C C     . GLY A 1 359 ? 11.821  -16.378 -53.233  1.00 53.27  ? 353 GLY A C     1 
ATOM   2552 O O     . GLY A 1 359 ? 11.543  -17.244 -54.063  1.00 52.76  ? 353 GLY A O     1 
ATOM   2553 N N     . ASP A 1 360 ? 12.570  -15.288 -53.506  1.00 49.10  ? 354 ASP A N     1 
ATOM   2554 C CA    . ASP A 1 360 ? 13.168  -14.952 -54.792  1.00 48.71  ? 354 ASP A CA    1 
ATOM   2555 C C     . ASP A 1 360 ? 14.095  -16.061 -55.237  1.00 50.78  ? 354 ASP A C     1 
ATOM   2556 O O     . ASP A 1 360 ? 13.983  -16.557 -56.362  1.00 51.34  ? 354 ASP A O     1 
ATOM   2557 C CB    . ASP A 1 360 ? 13.938  -13.631 -54.680  1.00 51.26  ? 354 ASP A CB    1 
ATOM   2558 C CG    . ASP A 1 360 ? 14.658  -13.234 -55.941  1.00 74.17  ? 354 ASP A CG    1 
ATOM   2559 O OD1   . ASP A 1 360 ? 15.900  -13.381 -55.982  1.00 77.19  ? 354 ASP A OD1   1 
ATOM   2560 O OD2   . ASP A 1 360 ? 13.980  -12.780 -56.897  1.00 84.11  ? 354 ASP A OD2   1 
ATOM   2561 N N     . GLN A 1 361 ? 14.987  -16.473 -54.336  1.00 45.12  ? 355 GLN A N     1 
ATOM   2562 C CA    . GLN A 1 361 ? 15.957  -17.516 -54.608  1.00 44.63  ? 355 GLN A CA    1 
ATOM   2563 C C     . GLN A 1 361 ? 15.261  -18.843 -54.868  1.00 48.57  ? 355 GLN A C     1 
ATOM   2564 O O     . GLN A 1 361 ? 15.627  -19.528 -55.817  1.00 48.06  ? 355 GLN A O     1 
ATOM   2565 C CB    . GLN A 1 361 ? 16.980  -17.624 -53.470  1.00 45.63  ? 355 GLN A CB    1 
ATOM   2566 C CG    . GLN A 1 361 ? 17.872  -16.402 -53.319  1.00 45.55  ? 355 GLN A CG    1 
ATOM   2567 C CD    . GLN A 1 361 ? 18.749  -16.127 -54.506  1.00 67.96  ? 355 GLN A CD    1 
ATOM   2568 O OE1   . GLN A 1 361 ? 18.461  -15.238 -55.323  1.00 65.01  ? 355 GLN A OE1   1 
ATOM   2569 N NE2   . GLN A 1 361 ? 19.837  -16.890 -54.624  1.00 58.48  ? 355 GLN A NE2   1 
ATOM   2570 N N     . ALA A 1 362 ? 14.209  -19.162 -54.065  1.00 45.12  ? 356 ALA A N     1 
ATOM   2571 C CA    . ALA A 1 362 ? 13.402  -20.381 -54.149  1.00 45.00  ? 356 ALA A CA    1 
ATOM   2572 C C     . ALA A 1 362 ? 12.792  -20.523 -55.540  1.00 49.27  ? 356 ALA A C     1 
ATOM   2573 O O     . ALA A 1 362 ? 13.065  -21.541 -56.184  1.00 50.45  ? 356 ALA A O     1 
ATOM   2574 C CB    . ALA A 1 362 ? 12.321  -20.373 -53.089  1.00 44.82  ? 356 ALA A CB    1 
ATOM   2575 N N     . ARG A 1 363 ? 12.055  -19.479 -56.036  1.00 43.06  ? 357 ARG A N     1 
ATOM   2576 C CA    . ARG A 1 363 ? 11.473  -19.434 -57.376  1.00 42.74  ? 357 ARG A CA    1 
ATOM   2577 C C     . ARG A 1 363 ? 12.566  -19.513 -58.445  1.00 47.58  ? 357 ARG A C     1 
ATOM   2578 O O     . ARG A 1 363 ? 12.422  -20.294 -59.389  1.00 48.02  ? 357 ARG A O     1 
ATOM   2579 C CB    . ARG A 1 363 ? 10.638  -18.163 -57.565  1.00 43.12  ? 357 ARG A CB    1 
ATOM   2580 C CG    . ARG A 1 363 ? 10.223  -17.851 -59.020  1.00 56.06  ? 357 ARG A CG    1 
ATOM   2581 C CD    . ARG A 1 363 ? 9.309   -16.640 -59.168  1.00 66.07  ? 357 ARG A CD    1 
ATOM   2582 N NE    . ARG A 1 363 ? 9.964   -15.386 -58.787  1.00 82.10  ? 357 ARG A NE    1 
ATOM   2583 C CZ    . ARG A 1 363 ? 9.784   -14.770 -57.621  1.00 104.10 ? 357 ARG A CZ    1 
ATOM   2584 N NH1   . ARG A 1 363 ? 8.972   -15.290 -56.702  1.00 90.55  ? 357 ARG A NH1   1 
ATOM   2585 N NH2   . ARG A 1 363 ? 10.420  -13.635 -57.359  1.00 95.32  ? 357 ARG A NH2   1 
ATOM   2586 N N     . LYS A 1 364 ? 13.646  -18.712 -58.311  1.00 44.11  ? 358 LYS A N     1 
ATOM   2587 C CA    . LYS A 1 364 ? 14.717  -18.740 -59.304  1.00 45.40  ? 358 LYS A CA    1 
ATOM   2588 C C     . LYS A 1 364 ? 15.492  -20.049 -59.328  1.00 52.04  ? 358 LYS A C     1 
ATOM   2589 O O     . LYS A 1 364 ? 15.937  -20.445 -60.402  1.00 52.83  ? 358 LYS A O     1 
ATOM   2590 C CB    . LYS A 1 364 ? 15.635  -17.508 -59.247  1.00 47.66  ? 358 LYS A CB    1 
ATOM   2591 C CG    . LYS A 1 364 ? 15.453  -16.636 -60.486  1.00 60.72  ? 358 LYS A CG    1 
ATOM   2592 C CD    . LYS A 1 364 ? 16.179  -15.295 -60.465  1.00 72.26  ? 358 LYS A CD    1 
ATOM   2593 C CE    . LYS A 1 364 ? 15.574  -14.248 -59.565  1.00 92.95  ? 358 LYS A CE    1 
ATOM   2594 N NZ    . LYS A 1 364 ? 16.215  -14.279 -58.229  1.00 106.06 ? 358 LYS A NZ    1 
ATOM   2595 N N     . GLN A 1 365 ? 15.617  -20.749 -58.167  1.00 48.29  ? 359 GLN A N     1 
ATOM   2596 C CA    . GLN A 1 365 ? 16.320  -22.031 -58.120  1.00 48.02  ? 359 GLN A CA    1 
ATOM   2597 C C     . GLN A 1 365 ? 15.580  -23.094 -58.911  1.00 51.70  ? 359 GLN A C     1 
ATOM   2598 O O     . GLN A 1 365 ? 16.221  -23.776 -59.708  1.00 53.19  ? 359 GLN A O     1 
ATOM   2599 C CB    . GLN A 1 365 ? 16.654  -22.490 -56.704  1.00 48.84  ? 359 GLN A CB    1 
ATOM   2600 C CG    . GLN A 1 365 ? 18.161  -22.522 -56.430  1.00 59.57  ? 359 GLN A CG    1 
ATOM   2601 C CD    . GLN A 1 365 ? 18.923  -23.451 -57.351  1.00 81.89  ? 359 GLN A CD    1 
ATOM   2602 O OE1   . GLN A 1 365 ? 18.574  -24.620 -57.537  1.00 74.81  ? 359 GLN A OE1   1 
ATOM   2603 N NE2   . GLN A 1 365 ? 19.991  -22.947 -57.952  1.00 80.91  ? 359 GLN A NE2   1 
ATOM   2604 N N     . VAL A 1 366 ? 14.235  -23.178 -58.773  1.00 45.07  ? 360 VAL A N     1 
ATOM   2605 C CA    . VAL A 1 366 ? 13.457  -24.133 -59.564  1.00 44.58  ? 360 VAL A CA    1 
ATOM   2606 C C     . VAL A 1 366 ? 13.635  -23.893 -61.057  1.00 47.44  ? 360 VAL A C     1 
ATOM   2607 O O     . VAL A 1 366 ? 13.923  -24.855 -61.764  1.00 49.95  ? 360 VAL A O     1 
ATOM   2608 C CB    . VAL A 1 366 ? 12.001  -24.455 -59.090  1.00 47.37  ? 360 VAL A CB    1 
ATOM   2609 C CG1   . VAL A 1 366 ? 11.486  -23.440 -58.092  1.00 45.41  ? 360 VAL A CG1   1 
ATOM   2610 C CG2   . VAL A 1 366 ? 11.021  -24.634 -60.252  1.00 47.24  ? 360 VAL A CG2   1 
ATOM   2611 N N     . LEU A 1 367 ? 13.595  -22.614 -61.510  1.00 40.93  ? 361 LEU A N     1 
ATOM   2612 C CA    . LEU A 1 367 ? 13.818  -22.244 -62.916  1.00 41.04  ? 361 LEU A CA    1 
ATOM   2613 C C     . LEU A 1 367 ? 15.209  -22.690 -63.390  1.00 49.07  ? 361 LEU A C     1 
ATOM   2614 O O     . LEU A 1 367 ? 15.328  -23.235 -64.496  1.00 50.18  ? 361 LEU A O     1 
ATOM   2615 C CB    . LEU A 1 367 ? 13.635  -20.741 -63.162  1.00 39.24  ? 361 LEU A CB    1 
ATOM   2616 C CG    . LEU A 1 367 ? 12.221  -20.187 -63.099  1.00 41.12  ? 361 LEU A CG    1 
ATOM   2617 C CD1   . LEU A 1 367 ? 12.238  -18.726 -62.755  1.00 38.61  ? 361 LEU A CD1   1 
ATOM   2618 C CD2   . LEU A 1 367 ? 11.482  -20.406 -64.394  1.00 42.37  ? 361 LEU A CD2   1 
ATOM   2619 N N     . VAL A 1 368 ? 16.243  -22.522 -62.526  1.00 46.90  ? 362 VAL A N     1 
ATOM   2620 C CA    . VAL A 1 368 ? 17.617  -22.957 -62.824  1.00 48.36  ? 362 VAL A CA    1 
ATOM   2621 C C     . VAL A 1 368 ? 17.655  -24.494 -62.995  1.00 55.21  ? 362 VAL A C     1 
ATOM   2622 O O     . VAL A 1 368 ? 18.098  -24.981 -64.047  1.00 54.09  ? 362 VAL A O     1 
ATOM   2623 C CB    . VAL A 1 368 ? 18.674  -22.419 -61.810  1.00 51.10  ? 362 VAL A CB    1 
ATOM   2624 C CG1   . VAL A 1 368 ? 20.059  -22.992 -62.091  1.00 52.20  ? 362 VAL A CG1   1 
ATOM   2625 C CG2   . VAL A 1 368 ? 18.733  -20.895 -61.822  1.00 49.37  ? 362 VAL A CG2   1 
ATOM   2626 N N     . ASP A 1 369 ? 17.119  -25.229 -61.986  1.00 54.69  ? 363 ASP A N     1 
ATOM   2627 C CA    . ASP A 1 369 ? 17.050  -26.695 -61.918  1.00 57.00  ? 363 ASP A CA    1 
ATOM   2628 C C     . ASP A 1 369 ? 16.458  -27.323 -63.164  1.00 62.46  ? 363 ASP A C     1 
ATOM   2629 O O     . ASP A 1 369 ? 16.943  -28.374 -63.590  1.00 63.75  ? 363 ASP A O     1 
ATOM   2630 C CB    . ASP A 1 369 ? 16.224  -27.155 -60.709  1.00 59.23  ? 363 ASP A CB    1 
ATOM   2631 C CG    . ASP A 1 369 ? 16.802  -26.853 -59.338  1.00 77.23  ? 363 ASP A CG    1 
ATOM   2632 O OD1   . ASP A 1 369 ? 18.041  -27.020 -59.159  1.00 79.42  ? 363 ASP A OD1   1 
ATOM   2633 O OD2   . ASP A 1 369 ? 16.004  -26.518 -58.414  1.00 84.02  ? 363 ASP A OD2   1 
ATOM   2634 N N     . HIS A 1 370 ? 15.424  -26.676 -63.753  1.00 58.00  ? 364 HIS A N     1 
ATOM   2635 C CA    . HIS A 1 370 ? 14.724  -27.166 -64.936  1.00 58.86  ? 364 HIS A CA    1 
ATOM   2636 C C     . HIS A 1 370 ? 15.197  -26.594 -66.287  1.00 63.20  ? 364 HIS A C     1 
ATOM   2637 O O     . HIS A 1 370 ? 14.595  -26.868 -67.324  1.00 62.95  ? 364 HIS A O     1 
ATOM   2638 C CB    . HIS A 1 370 ? 13.210  -27.086 -64.732  1.00 59.04  ? 364 HIS A CB    1 
ATOM   2639 C CG    . HIS A 1 370 ? 12.746  -27.906 -63.563  1.00 62.98  ? 364 HIS A CG    1 
ATOM   2640 N ND1   . HIS A 1 370 ? 12.252  -29.195 -63.728  1.00 66.39  ? 364 HIS A ND1   1 
ATOM   2641 C CD2   . HIS A 1 370 ? 12.759  -27.614 -62.239  1.00 63.95  ? 364 HIS A CD2   1 
ATOM   2642 C CE1   . HIS A 1 370 ? 11.961  -29.627 -62.506  1.00 65.72  ? 364 HIS A CE1   1 
ATOM   2643 N NE2   . HIS A 1 370 ? 12.249  -28.710 -61.577  1.00 64.60  ? 364 HIS A NE2   1 
ATOM   2644 N N     . GLY A 1 371 ? 16.309  -25.867 -66.268  1.00 59.70  ? 365 GLY A N     1 
ATOM   2645 C CA    . GLY A 1 371 ? 16.910  -25.316 -67.475  1.00 59.40  ? 365 GLY A CA    1 
ATOM   2646 C C     . GLY A 1 371 ? 16.198  -24.132 -68.094  1.00 59.39  ? 365 GLY A C     1 
ATOM   2647 O O     . GLY A 1 371 ? 16.356  -23.877 -69.290  1.00 58.87  ? 365 GLY A O     1 
ATOM   2648 N N     . PHE A 1 372 ? 15.432  -23.391 -67.299  1.00 53.08  ? 366 PHE A N     1 
ATOM   2649 C CA    . PHE A 1 372 ? 14.780  -22.198 -67.818  1.00 51.39  ? 366 PHE A CA    1 
ATOM   2650 C C     . PHE A 1 372 ? 15.737  -21.023 -67.770  1.00 56.71  ? 366 PHE A C     1 
ATOM   2651 O O     . PHE A 1 372 ? 15.688  -20.190 -68.671  1.00 58.16  ? 366 PHE A O     1 
ATOM   2652 C CB    . PHE A 1 372 ? 13.477  -21.883 -67.074  1.00 51.18  ? 366 PHE A CB    1 
ATOM   2653 C CG    . PHE A 1 372 ? 12.325  -22.767 -67.509  1.00 52.27  ? 366 PHE A CG    1 
ATOM   2654 C CD1   . PHE A 1 372 ? 12.041  -23.951 -66.838  1.00 54.63  ? 366 PHE A CD1   1 
ATOM   2655 C CD2   . PHE A 1 372 ? 11.550  -22.433 -68.614  1.00 53.41  ? 366 PHE A CD2   1 
ATOM   2656 C CE1   . PHE A 1 372 ? 10.990  -24.770 -67.253  1.00 55.33  ? 366 PHE A CE1   1 
ATOM   2657 C CE2   . PHE A 1 372 ? 10.514  -23.263 -69.037  1.00 55.74  ? 366 PHE A CE2   1 
ATOM   2658 C CZ    . PHE A 1 372 ? 10.220  -24.405 -68.333  1.00 54.09  ? 366 PHE A CZ    1 
ATOM   2659 N N     . ARG A 1 373 ? 16.614  -20.955 -66.740  1.00 51.42  ? 367 ARG A N     1 
ATOM   2660 C CA    . ARG A 1 373 ? 17.591  -19.870 -66.576  1.00 50.27  ? 367 ARG A CA    1 
ATOM   2661 C C     . ARG A 1 373 ? 18.937  -20.402 -66.157  1.00 55.96  ? 367 ARG A C     1 
ATOM   2662 O O     . ARG A 1 373 ? 19.012  -21.493 -65.605  1.00 57.32  ? 367 ARG A O     1 
ATOM   2663 C CB    . ARG A 1 373 ? 17.109  -18.808 -65.544  1.00 47.25  ? 367 ARG A CB    1 
ATOM   2664 C CG    . ARG A 1 373 ? 15.906  -17.954 -65.962  1.00 49.68  ? 367 ARG A CG    1 
ATOM   2665 C CD    . ARG A 1 373 ? 16.216  -16.915 -67.019  1.00 50.29  ? 367 ARG A CD    1 
ATOM   2666 N NE    . ARG A 1 373 ? 14.985  -16.375 -67.590  1.00 63.04  ? 367 ARG A NE    1 
ATOM   2667 C CZ    . ARG A 1 373 ? 14.928  -15.546 -68.627  1.00 84.22  ? 367 ARG A CZ    1 
ATOM   2668 N NH1   . ARG A 1 373 ? 16.040  -15.134 -69.222  1.00 77.42  ? 367 ARG A NH1   1 
ATOM   2669 N NH2   . ARG A 1 373 ? 13.757  -15.116 -69.075  1.00 74.15  ? 367 ARG A NH2   1 
ATOM   2670 N N     . LEU A 1 374 ? 20.004  -19.621 -66.391  1.00 53.09  ? 368 LEU A N     1 
ATOM   2671 C CA    . LEU A 1 374 ? 21.373  -19.974 -66.001  1.00 54.28  ? 368 LEU A CA    1 
ATOM   2672 C C     . LEU A 1 374 ? 21.552  -19.692 -64.502  1.00 60.13  ? 368 LEU A C     1 
ATOM   2673 O O     . LEU A 1 374 ? 20.815  -18.853 -63.971  1.00 59.28  ? 368 LEU A O     1 
ATOM   2674 C CB    . LEU A 1 374 ? 22.355  -19.101 -66.777  1.00 54.45  ? 368 LEU A CB    1 
ATOM   2675 C CG    . LEU A 1 374 ? 22.675  -19.535 -68.167  1.00 59.96  ? 368 LEU A CG    1 
ATOM   2676 C CD1   . LEU A 1 374 ? 23.022  -18.341 -69.011  1.00 59.70  ? 368 LEU A CD1   1 
ATOM   2677 C CD2   . LEU A 1 374 ? 23.776  -20.563 -68.163  1.00 64.15  ? 368 LEU A CD2   1 
ATOM   2678 N N     . PRO A 1 375 ? 22.557  -20.280 -63.807  1.00 57.70  ? 369 PRO A N     1 
ATOM   2679 C CA    . PRO A 1 375 ? 22.723  -19.982 -62.377  1.00 57.23  ? 369 PRO A CA    1 
ATOM   2680 C C     . PRO A 1 375 ? 23.020  -18.519 -62.022  1.00 62.49  ? 369 PRO A C     1 
ATOM   2681 O O     . PRO A 1 375 ? 22.799  -18.129 -60.872  1.00 61.65  ? 369 PRO A O     1 
ATOM   2682 C CB    . PRO A 1 375 ? 23.852  -20.913 -61.950  1.00 60.15  ? 369 PRO A CB    1 
ATOM   2683 C CG    . PRO A 1 375 ? 23.866  -21.977 -62.959  1.00 65.73  ? 369 PRO A CG    1 
ATOM   2684 C CD    . PRO A 1 375 ? 23.530  -21.294 -64.239  1.00 61.01  ? 369 PRO A CD    1 
ATOM   2685 N N     . SER A 1 376 ? 23.473  -17.696 -62.997  1.00 60.27  ? 370 SER A N     1 
ATOM   2686 C CA    . SER A 1 376 ? 23.755  -16.266 -62.776  1.00 59.85  ? 370 SER A CA    1 
ATOM   2687 C C     . SER A 1 376 ? 22.472  -15.427 -62.597  1.00 65.20  ? 370 SER A C     1 
ATOM   2688 O O     . SER A 1 376 ? 22.556  -14.226 -62.260  1.00 64.66  ? 370 SER A O     1 
ATOM   2689 C CB    . SER A 1 376 ? 24.593  -15.693 -63.912  1.00 62.41  ? 370 SER A CB    1 
ATOM   2690 O OG    . SER A 1 376 ? 23.966  -15.875 -65.171  1.00 67.73  ? 370 SER A OG    1 
ATOM   2691 N N     . ALA A 1 377 ? 21.283  -16.061 -62.837  1.00 61.00  ? 371 ALA A N     1 
ATOM   2692 C CA    . ALA A 1 377 ? 19.987  -15.401 -62.699  1.00 59.02  ? 371 ALA A CA    1 
ATOM   2693 C C     . ALA A 1 377 ? 19.726  -15.085 -61.234  1.00 60.00  ? 371 ALA A C     1 
ATOM   2694 O O     . ALA A 1 377 ? 19.113  -14.057 -60.926  1.00 59.05  ? 371 ALA A O     1 
ATOM   2695 C CB    . ALA A 1 377 ? 18.885  -16.286 -63.256  1.00 60.04  ? 371 ALA A CB    1 
ATOM   2696 N N     . LEU A 1 378 ? 20.245  -15.955 -60.334  1.00 54.43  ? 372 LEU A N     1 
ATOM   2697 C CA    . LEU A 1 378 ? 20.124  -15.829 -58.885  1.00 52.12  ? 372 LEU A CA    1 
ATOM   2698 C C     . LEU A 1 378 ? 20.854  -14.583 -58.370  1.00 56.84  ? 372 LEU A C     1 
ATOM   2699 O O     . LEU A 1 378 ? 20.477  -14.070 -57.316  1.00 55.81  ? 372 LEU A O     1 
ATOM   2700 C CB    . LEU A 1 378 ? 20.619  -17.108 -58.176  1.00 51.68  ? 372 LEU A CB    1 
ATOM   2701 C CG    . LEU A 1 378 ? 19.833  -18.392 -58.485  1.00 54.35  ? 372 LEU A CG    1 
ATOM   2702 C CD1   . LEU A 1 378 ? 20.745  -19.562 -58.623  1.00 55.81  ? 372 LEU A CD1   1 
ATOM   2703 C CD2   . LEU A 1 378 ? 18.819  -18.682 -57.447  1.00 53.33  ? 372 LEU A CD2   1 
ATOM   2704 N N     . ASP A 1 379 ? 21.862  -14.075 -59.135  1.00 53.93  ? 373 ASP A N     1 
ATOM   2705 C CA    . ASP A 1 379 ? 22.628  -12.871 -58.787  1.00 53.84  ? 373 ASP A CA    1 
ATOM   2706 C C     . ASP A 1 379 ? 21.826  -11.564 -58.909  1.00 54.15  ? 373 ASP A C     1 
ATOM   2707 O O     . ASP A 1 379 ? 22.195  -10.539 -58.312  1.00 53.81  ? 373 ASP A O     1 
ATOM   2708 C CB    . ASP A 1 379 ? 23.963  -12.807 -59.550  1.00 58.04  ? 373 ASP A CB    1 
ATOM   2709 C CG    . ASP A 1 379 ? 25.108  -13.588 -58.906  1.00 78.66  ? 373 ASP A CG    1 
ATOM   2710 O OD1   . ASP A 1 379 ? 25.049  -13.832 -57.667  1.00 80.65  ? 373 ASP A OD1   1 
ATOM   2711 O OD2   . ASP A 1 379 ? 26.092  -13.907 -59.627  1.00 87.09  ? 373 ASP A OD2   1 
ATOM   2712 N N     . ASN A 1 380 ? 20.732  -11.615 -59.673  1.00 48.95  ? 374 ASN A N     1 
ATOM   2713 C CA    . ASN A 1 380 ? 19.766  -10.540 -59.864  1.00 47.73  ? 374 ASN A CA    1 
ATOM   2714 C C     . ASN A 1 380 ? 18.708  -10.890 -58.831  1.00 52.96  ? 374 ASN A C     1 
ATOM   2715 O O     . ASN A 1 380 ? 17.927  -11.831 -59.039  1.00 53.28  ? 374 ASN A O     1 
ATOM   2716 C CB    . ASN A 1 380 ? 19.203  -10.609 -61.284  1.00 47.32  ? 374 ASN A CB    1 
ATOM   2717 C CG    . ASN A 1 380 ? 18.058  -9.684  -61.559  1.00 62.57  ? 374 ASN A CG    1 
ATOM   2718 O OD1   . ASN A 1 380 ? 16.941  -10.132 -61.847  1.00 54.91  ? 374 ASN A OD1   1 
ATOM   2719 N ND2   . ASN A 1 380 ? 18.333  -8.380  -61.563  1.00 55.07  ? 374 ASN A ND2   1 
ATOM   2720 N N     . ARG A 1 381 ? 18.759  -10.203 -57.660  1.00 48.98  ? 375 ARG A N     1 
ATOM   2721 C CA    . ARG A 1 381 ? 17.937  -10.526 -56.483  1.00 47.11  ? 375 ARG A CA    1 
ATOM   2722 C C     . ARG A 1 381 ? 17.781  -9.353  -55.512  1.00 48.51  ? 375 ARG A C     1 
ATOM   2723 O O     . ARG A 1 381 ? 18.610  -8.438  -55.544  1.00 48.92  ? 375 ARG A O     1 
ATOM   2724 C CB    . ARG A 1 381 ? 18.677  -11.644 -55.709  1.00 47.82  ? 375 ARG A CB    1 
ATOM   2725 C CG    . ARG A 1 381 ? 20.133  -11.288 -55.351  1.00 51.13  ? 375 ARG A CG    1 
ATOM   2726 C CD    . ARG A 1 381 ? 20.689  -12.196 -54.292  1.00 55.80  ? 375 ARG A CD    1 
ATOM   2727 N NE    . ARG A 1 381 ? 22.058  -11.823 -53.933  1.00 59.88  ? 375 ARG A NE    1 
ATOM   2728 C CZ    . ARG A 1 381 ? 22.390  -11.004 -52.935  1.00 60.92  ? 375 ARG A CZ    1 
ATOM   2729 N NH1   . ARG A 1 381 ? 21.451  -10.452 -52.177  1.00 35.01  ? 375 ARG A NH1   1 
ATOM   2730 N NH2   . ARG A 1 381 ? 23.662  -10.731 -52.691  1.00 45.48  ? 375 ARG A NH2   1 
ATOM   2731 N N     . PRO A 1 382 ? 16.840  -9.430  -54.527  1.00 42.91  ? 376 PRO A N     1 
ATOM   2732 C CA    . PRO A 1 382 ? 16.820  -8.408  -53.479  1.00 41.89  ? 376 PRO A CA    1 
ATOM   2733 C C     . PRO A 1 382 ? 17.952  -8.705  -52.472  1.00 45.64  ? 376 PRO A C     1 
ATOM   2734 O O     . PRO A 1 382 ? 18.685  -9.693  -52.604  1.00 45.07  ? 376 PRO A O     1 
ATOM   2735 C CB    . PRO A 1 382 ? 15.431  -8.586  -52.854  1.00 42.64  ? 376 PRO A CB    1 
ATOM   2736 C CG    . PRO A 1 382 ? 15.143  -10.013 -52.991  1.00 47.39  ? 376 PRO A CG    1 
ATOM   2737 C CD    . PRO A 1 382 ? 15.805  -10.460 -54.269  1.00 43.79  ? 376 PRO A CD    1 
ATOM   2738 N N     . LEU A 1 383 ? 18.099  -7.844  -51.481  1.00 42.50  ? 377 LEU A N     1 
ATOM   2739 C CA    . LEU A 1 383 ? 19.115  -7.984  -50.456  1.00 43.04  ? 377 LEU A CA    1 
ATOM   2740 C C     . LEU A 1 383 ? 18.835  -9.127  -49.503  1.00 48.04  ? 377 LEU A C     1 
ATOM   2741 O O     . LEU A 1 383 ? 17.672  -9.428  -49.191  1.00 48.10  ? 377 LEU A O     1 
ATOM   2742 C CB    . LEU A 1 383 ? 19.160  -6.704  -49.609  1.00 42.65  ? 377 LEU A CB    1 
ATOM   2743 C CG    . LEU A 1 383 ? 19.897  -5.502  -50.134  1.00 46.99  ? 377 LEU A CG    1 
ATOM   2744 C CD1   . LEU A 1 383 ? 20.144  -4.529  -49.005  1.00 47.20  ? 377 LEU A CD1   1 
ATOM   2745 C CD2   . LEU A 1 383 ? 21.227  -5.890  -50.786  1.00 50.17  ? 377 LEU A CD2   1 
ATOM   2746 N N     . ARG A 1 384 ? 19.924  -9.704  -48.968  1.00 44.62  ? 378 ARG A N     1 
ATOM   2747 C CA    . ARG A 1 384 ? 19.873  -10.678 -47.891  1.00 44.15  ? 378 ARG A CA    1 
ATOM   2748 C C     . ARG A 1 384 ? 19.569  -9.820  -46.646  1.00 46.95  ? 378 ARG A C     1 
ATOM   2749 O O     . ARG A 1 384 ? 19.939  -8.638  -46.616  1.00 44.66  ? 378 ARG A O     1 
ATOM   2750 C CB    . ARG A 1 384 ? 21.233  -11.363 -47.704  1.00 42.57  ? 378 ARG A CB    1 
ATOM   2751 C CG    . ARG A 1 384 ? 21.312  -12.732 -48.322  1.00 52.14  ? 378 ARG A CG    1 
ATOM   2752 C CD    . ARG A 1 384 ? 22.619  -13.440 -47.983  1.00 68.31  ? 378 ARG A CD    1 
ATOM   2753 N NE    . ARG A 1 384 ? 22.685  -14.751 -48.630  1.00 84.82  ? 378 ARG A NE    1 
ATOM   2754 C CZ    . ARG A 1 384 ? 23.300  -14.993 -49.786  1.00 108.78 ? 378 ARG A CZ    1 
ATOM   2755 N NH1   . ARG A 1 384 ? 23.951  -14.021 -50.419  1.00 100.01 ? 378 ARG A NH1   1 
ATOM   2756 N NH2   . ARG A 1 384 ? 23.277  -16.211 -50.314  1.00 97.18  ? 378 ARG A NH2   1 
ATOM   2757 N N     . PHE A 1 385 ? 18.889  -10.400 -45.629  1.00 43.36  ? 379 PHE A N     1 
ATOM   2758 C CA    . PHE A 1 385 ? 18.612  -9.643  -44.422  1.00 42.15  ? 379 PHE A CA    1 
ATOM   2759 C C     . PHE A 1 385 ? 19.925  -9.235  -43.777  1.00 46.85  ? 379 PHE A C     1 
ATOM   2760 O O     . PHE A 1 385 ? 20.034  -8.083  -43.363  1.00 47.03  ? 379 PHE A O     1 
ATOM   2761 C CB    . PHE A 1 385 ? 17.676  -10.376 -43.471  1.00 43.58  ? 379 PHE A CB    1 
ATOM   2762 C CG    . PHE A 1 385 ? 17.166  -9.485  -42.369  1.00 45.31  ? 379 PHE A CG    1 
ATOM   2763 C CD1   . PHE A 1 385 ? 16.140  -8.575  -42.604  1.00 48.48  ? 379 PHE A CD1   1 
ATOM   2764 C CD2   . PHE A 1 385 ? 17.717  -9.545  -41.099  1.00 48.48  ? 379 PHE A CD2   1 
ATOM   2765 C CE1   . PHE A 1 385 ? 15.672  -7.749  -41.579  1.00 49.61  ? 379 PHE A CE1   1 
ATOM   2766 C CE2   . PHE A 1 385 ? 17.248  -8.720  -40.078  1.00 50.94  ? 379 PHE A CE2   1 
ATOM   2767 C CZ    . PHE A 1 385 ? 16.230  -7.831  -40.323  1.00 48.40  ? 379 PHE A CZ    1 
ATOM   2768 N N     . GLU A 1 386 ? 20.952  -10.134 -43.800  1.00 43.60  ? 380 GLU A N     1 
ATOM   2769 C CA    . GLU A 1 386 ? 22.316  -9.874  -43.325  1.00 44.07  ? 380 GLU A CA    1 
ATOM   2770 C C     . GLU A 1 386 ? 22.898  -8.611  -44.006  1.00 49.42  ? 380 GLU A C     1 
ATOM   2771 O O     . GLU A 1 386 ? 23.499  -7.773  -43.334  1.00 49.17  ? 380 GLU A O     1 
ATOM   2772 C CB    . GLU A 1 386 ? 23.203  -11.075 -43.612  1.00 45.35  ? 380 GLU A CB    1 
ATOM   2773 N N     . GLU A 1 387 ? 22.664  -8.470  -45.331  1.00 47.20  ? 381 GLU A N     1 
ATOM   2774 C CA    . GLU A 1 387 ? 23.100  -7.354  -46.181  1.00 47.59  ? 381 GLU A CA    1 
ATOM   2775 C C     . GLU A 1 387 ? 22.408  -6.051  -45.776  1.00 53.10  ? 381 GLU A C     1 
ATOM   2776 O O     . GLU A 1 387 ? 23.047  -4.992  -45.725  1.00 54.60  ? 381 GLU A O     1 
ATOM   2777 C CB    . GLU A 1 387 ? 22.811  -7.662  -47.668  1.00 48.22  ? 381 GLU A CB    1 
ATOM   2778 C CG    . GLU A 1 387 ? 23.906  -8.449  -48.370  1.00 57.23  ? 381 GLU A CG    1 
ATOM   2779 C CD    . GLU A 1 387 ? 23.475  -9.284  -49.558  1.00 83.69  ? 381 GLU A CD    1 
ATOM   2780 O OE1   . GLU A 1 387 ? 22.765  -8.754  -50.443  1.00 81.07  ? 381 GLU A OE1   1 
ATOM   2781 O OE2   . GLU A 1 387 ? 23.863  -10.474 -49.610  1.00 89.30  ? 381 GLU A OE2   1 
ATOM   2782 N N     . PHE A 1 388 ? 21.095  -6.136  -45.503  1.00 47.35  ? 382 PHE A N     1 
ATOM   2783 C CA    . PHE A 1 388 ? 20.255  -5.017  -45.088  1.00 45.48  ? 382 PHE A CA    1 
ATOM   2784 C C     . PHE A 1 388 ? 20.669  -4.547  -43.699  1.00 48.78  ? 382 PHE A C     1 
ATOM   2785 O O     . PHE A 1 388 ? 20.655  -3.356  -43.428  1.00 46.82  ? 382 PHE A O     1 
ATOM   2786 C CB    . PHE A 1 388 ? 18.785  -5.450  -45.123  1.00 46.32  ? 382 PHE A CB    1 
ATOM   2787 C CG    . PHE A 1 388 ? 17.819  -4.543  -44.415  1.00 47.92  ? 382 PHE A CG    1 
ATOM   2788 C CD1   . PHE A 1 388 ? 17.430  -3.336  -44.979  1.00 51.43  ? 382 PHE A CD1   1 
ATOM   2789 C CD2   . PHE A 1 388 ? 17.269  -4.906  -43.196  1.00 51.01  ? 382 PHE A CD2   1 
ATOM   2790 C CE1   . PHE A 1 388 ? 16.514  -2.499  -44.329  1.00 52.13  ? 382 PHE A CE1   1 
ATOM   2791 C CE2   . PHE A 1 388 ? 16.354  -4.067  -42.545  1.00 53.84  ? 382 PHE A CE2   1 
ATOM   2792 C CZ    . PHE A 1 388 ? 15.989  -2.866  -43.112  1.00 51.28  ? 382 PHE A CZ    1 
ATOM   2793 N N     . GLU A 1 389 ? 21.047  -5.491  -42.825  1.00 47.22  ? 383 GLU A N     1 
ATOM   2794 C CA    . GLU A 1 389 ? 21.475  -5.220  -41.458  1.00 47.94  ? 383 GLU A CA    1 
ATOM   2795 C C     . GLU A 1 389 ? 22.760  -4.389  -41.460  1.00 52.76  ? 383 GLU A C     1 
ATOM   2796 O O     . GLU A 1 389 ? 22.937  -3.521  -40.593  1.00 52.76  ? 383 GLU A O     1 
ATOM   2797 C CB    . GLU A 1 389 ? 21.701  -6.544  -40.697  1.00 50.20  ? 383 GLU A CB    1 
ATOM   2798 C CG    . GLU A 1 389 ? 20.442  -7.208  -40.168  1.00 61.15  ? 383 GLU A CG    1 
ATOM   2799 C CD    . GLU A 1 389 ? 20.663  -8.413  -39.267  1.00 89.01  ? 383 GLU A CD    1 
ATOM   2800 O OE1   . GLU A 1 389 ? 20.355  -8.303  -38.060  1.00 93.30  ? 383 GLU A OE1   1 
ATOM   2801 O OE2   . GLU A 1 389 ? 21.121  -9.469  -39.760  1.00 82.10  ? 383 GLU A OE2   1 
ATOM   2802 N N     . LYS A 1 390 ? 23.654  -4.657  -42.443  1.00 50.00  ? 384 LYS A N     1 
ATOM   2803 C CA    . LYS A 1 390 ? 24.946  -3.987  -42.580  1.00 51.31  ? 384 LYS A CA    1 
ATOM   2804 C C     . LYS A 1 390 ? 24.787  -2.515  -42.946  1.00 59.94  ? 384 LYS A C     1 
ATOM   2805 O O     . LYS A 1 390 ? 25.727  -1.742  -42.776  1.00 60.57  ? 384 LYS A O     1 
ATOM   2806 C CB    . LYS A 1 390 ? 25.829  -4.723  -43.580  1.00 51.87  ? 384 LYS A CB    1 
ATOM   2807 N N     . HIS A 1 391 ? 23.570  -2.119  -43.365  1.00 59.28  ? 385 HIS A N     1 
ATOM   2808 C CA    . HIS A 1 391 ? 23.215  -0.751  -43.743  1.00 60.55  ? 385 HIS A CA    1 
ATOM   2809 C C     . HIS A 1 391 ? 22.578  0.061   -42.613  1.00 64.83  ? 385 HIS A C     1 
ATOM   2810 O O     . HIS A 1 391 ? 22.507  1.286   -42.729  1.00 65.68  ? 385 HIS A O     1 
ATOM   2811 C CB    . HIS A 1 391 ? 22.255  -0.772  -44.930  1.00 61.47  ? 385 HIS A CB    1 
ATOM   2812 C CG    . HIS A 1 391 ? 22.925  -0.844  -46.253  1.00 66.00  ? 385 HIS A CG    1 
ATOM   2813 N ND1   . HIS A 1 391 ? 23.418  0.290   -46.867  1.00 68.55  ? 385 HIS A ND1   1 
ATOM   2814 C CD2   . HIS A 1 391 ? 23.121  -1.910  -47.061  1.00 68.75  ? 385 HIS A CD2   1 
ATOM   2815 C CE1   . HIS A 1 391 ? 23.908  -0.121  -48.021  1.00 68.73  ? 385 HIS A CE1   1 
ATOM   2816 N NE2   . HIS A 1 391 ? 23.752  -1.439  -48.182  1.00 69.06  ? 385 HIS A NE2   1 
ATOM   2817 N N     . MET A 1 392 ? 22.073  -0.603  -41.557  1.00 60.76  ? 386 MET A N     1 
ATOM   2818 C CA    . MET A 1 392 ? 21.417  0.049   -40.419  1.00 60.36  ? 386 MET A CA    1 
ATOM   2819 C C     . MET A 1 392 ? 22.422  0.916   -39.679  1.00 66.31  ? 386 MET A C     1 
ATOM   2820 O O     . MET A 1 392 ? 23.364  0.388   -39.093  1.00 67.99  ? 386 MET A O     1 
ATOM   2821 C CB    . MET A 1 392 ? 20.839  -0.984  -39.441  1.00 62.77  ? 386 MET A CB    1 
ATOM   2822 C CG    . MET A 1 392 ? 19.870  -1.947  -40.048  1.00 65.88  ? 386 MET A CG    1 
ATOM   2823 S SD    . MET A 1 392 ? 19.450  -3.197  -38.818  1.00 71.41  ? 386 MET A SD    1 
ATOM   2824 C CE    . MET A 1 392 ? 18.252  -4.118  -39.676  1.00 66.51  ? 386 MET A CE    1 
ATOM   2825 N N     . HIS A 1 393 ? 22.254  2.241   -39.747  1.00 63.00  ? 387 HIS A N     1 
ATOM   2826 C CA    . HIS A 1 393 ? 23.131  3.196   -39.061  1.00 64.15  ? 387 HIS A CA    1 
ATOM   2827 C C     . HIS A 1 393 ? 22.467  3.592   -37.729  1.00 64.65  ? 387 HIS A C     1 
ATOM   2828 O O     . HIS A 1 393 ? 23.081  3.467   -36.664  1.00 64.19  ? 387 HIS A O     1 
ATOM   2829 C CB    . HIS A 1 393 ? 23.425  4.411   -39.960  1.00 65.84  ? 387 HIS A CB    1 
ATOM   2830 C CG    . HIS A 1 393 ? 24.273  5.443   -39.295  1.00 71.64  ? 387 HIS A CG    1 
ATOM   2831 N ND1   . HIS A 1 393 ? 25.653  5.316   -39.238  1.00 75.28  ? 387 HIS A ND1   1 
ATOM   2832 C CD2   . HIS A 1 393 ? 23.909  6.581   -38.657  1.00 74.68  ? 387 HIS A CD2   1 
ATOM   2833 C CE1   . HIS A 1 393 ? 26.084  6.378   -38.569  1.00 76.06  ? 387 HIS A CE1   1 
ATOM   2834 N NE2   . HIS A 1 393 ? 25.070  7.167   -38.195  1.00 76.06  ? 387 HIS A NE2   1 
ATOM   2835 N N     . ASN A 1 394 ? 21.191  4.034   -37.817  1.00 58.59  ? 388 ASN A N     1 
ATOM   2836 C CA    . ASN A 1 394 ? 20.273  4.392   -36.738  1.00 56.73  ? 388 ASN A CA    1 
ATOM   2837 C C     . ASN A 1 394 ? 18.913  3.875   -37.151  1.00 56.49  ? 388 ASN A C     1 
ATOM   2838 O O     . ASN A 1 394 ? 18.400  4.303   -38.195  1.00 56.67  ? 388 ASN A O     1 
ATOM   2839 C CB    . ASN A 1 394 ? 20.226  5.901   -36.559  1.00 55.93  ? 388 ASN A CB    1 
ATOM   2840 C CG    . ASN A 1 394 ? 21.312  6.404   -35.659  1.00 81.43  ? 388 ASN A CG    1 
ATOM   2841 O OD1   . ASN A 1 394 ? 21.491  5.903   -34.544  1.00 80.44  ? 388 ASN A OD1   1 
ATOM   2842 N ND2   . ASN A 1 394 ? 22.049  7.417   -36.113  1.00 70.98  ? 388 ASN A ND2   1 
ATOM   2843 N N     . ILE A 1 395 ? 18.355  2.901   -36.394  1.00 49.50  ? 389 ILE A N     1 
ATOM   2844 C CA    . ILE A 1 395 ? 17.040  2.313   -36.730  1.00 46.78  ? 389 ILE A CA    1 
ATOM   2845 C C     . ILE A 1 395 ? 15.963  2.429   -35.629  1.00 50.06  ? 389 ILE A C     1 
ATOM   2846 O O     . ILE A 1 395 ? 16.242  2.160   -34.456  1.00 51.35  ? 389 ILE A O     1 
ATOM   2847 C CB    . ILE A 1 395 ? 17.152  0.887   -37.337  1.00 48.22  ? 389 ILE A CB    1 
ATOM   2848 C CG1   . ILE A 1 395 ? 15.798  0.398   -37.915  1.00 46.13  ? 389 ILE A CG1   1 
ATOM   2849 C CG2   . ILE A 1 395 ? 17.783  -0.099  -36.334  1.00 49.86  ? 389 ILE A CG2   1 
ATOM   2850 C CD1   . ILE A 1 395 ? 15.885  -0.752  -38.900  1.00 47.33  ? 389 ILE A CD1   1 
ATOM   2851 N N     . VAL A 1 396 ? 14.737  2.828   -36.019  1.00 43.42  ? 390 VAL A N     1 
ATOM   2852 C CA    . VAL A 1 396 ? 13.620  2.943   -35.079  1.00 42.01  ? 390 VAL A CA    1 
ATOM   2853 C C     . VAL A 1 396 ? 12.453  2.097   -35.554  1.00 45.78  ? 390 VAL A C     1 
ATOM   2854 O O     . VAL A 1 396 ? 11.854  2.384   -36.595  1.00 44.98  ? 390 VAL A O     1 
ATOM   2855 C CB    . VAL A 1 396 ? 13.204  4.394   -34.756  1.00 44.62  ? 390 VAL A CB    1 
ATOM   2856 C CG1   . VAL A 1 396 ? 12.010  4.412   -33.818  1.00 43.69  ? 390 VAL A CG1   1 
ATOM   2857 C CG2   . VAL A 1 396 ? 14.366  5.176   -34.153  1.00 45.81  ? 390 VAL A CG2   1 
ATOM   2858 N N     . TYR A 1 397 ? 12.148  1.041   -34.795  1.00 42.33  ? 391 TYR A N     1 
ATOM   2859 C CA    . TYR A 1 397 ? 11.045  0.133   -35.086  1.00 41.12  ? 391 TYR A CA    1 
ATOM   2860 C C     . TYR A 1 397 ? 9.811   0.686   -34.428  1.00 44.00  ? 391 TYR A C     1 
ATOM   2861 O O     . TYR A 1 397 ? 9.855   1.053   -33.255  1.00 44.00  ? 391 TYR A O     1 
ATOM   2862 C CB    . TYR A 1 397 ? 11.338  -1.281  -34.568  1.00 43.14  ? 391 TYR A CB    1 
ATOM   2863 C CG    . TYR A 1 397 ? 12.686  -1.834  -34.978  1.00 45.93  ? 391 TYR A CG    1 
ATOM   2864 C CD1   . TYR A 1 397 ? 13.775  -1.777  -34.114  1.00 49.00  ? 391 TYR A CD1   1 
ATOM   2865 C CD2   . TYR A 1 397 ? 12.869  -2.430  -36.225  1.00 46.05  ? 391 TYR A CD2   1 
ATOM   2866 C CE1   . TYR A 1 397 ? 15.020  -2.267  -34.488  1.00 49.88  ? 391 TYR A CE1   1 
ATOM   2867 C CE2   . TYR A 1 397 ? 14.104  -2.954  -36.598  1.00 47.07  ? 391 TYR A CE2   1 
ATOM   2868 C CZ    . TYR A 1 397 ? 15.177  -2.868  -35.724  1.00 55.78  ? 391 TYR A CZ    1 
ATOM   2869 O OH    . TYR A 1 397 ? 16.412  -3.362  -36.064  1.00 57.42  ? 391 TYR A OH    1 
ATOM   2870 N N     . VAL A 1 398 ? 8.733   0.819   -35.195  1.00 40.51  ? 392 VAL A N     1 
ATOM   2871 C CA    . VAL A 1 398 ? 7.477   1.361   -34.690  1.00 40.80  ? 392 VAL A CA    1 
ATOM   2872 C C     . VAL A 1 398 ? 6.431   0.272   -34.824  1.00 48.26  ? 392 VAL A C     1 
ATOM   2873 O O     . VAL A 1 398 ? 6.246   -0.269  -35.911  1.00 46.39  ? 392 VAL A O     1 
ATOM   2874 C CB    . VAL A 1 398 ? 7.041   2.697   -35.357  1.00 42.30  ? 392 VAL A CB    1 
ATOM   2875 C CG1   . VAL A 1 398 ? 5.874   3.301   -34.610  1.00 42.34  ? 392 VAL A CG1   1 
ATOM   2876 C CG2   . VAL A 1 398 ? 8.183   3.698   -35.414  1.00 41.84  ? 392 VAL A CG2   1 
ATOM   2877 N N     . SER A 1 399 ? 5.784   -0.086  -33.704  1.00 49.04  ? 393 SER A N     1 
ATOM   2878 C CA    . SER A 1 399 ? 4.746   -1.130  -33.661  1.00 49.37  ? 393 SER A CA    1 
ATOM   2879 C C     . SER A 1 399 ? 3.958   -1.060  -32.375  1.00 56.70  ? 393 SER A C     1 
ATOM   2880 O O     . SER A 1 399 ? 4.517   -0.695  -31.335  1.00 59.00  ? 393 SER A O     1 
ATOM   2881 C CB    . SER A 1 399 ? 5.362   -2.521  -33.777  1.00 50.68  ? 393 SER A CB    1 
ATOM   2882 O OG    . SER A 1 399 ? 4.348   -3.507  -33.798  1.00 51.31  ? 393 SER A OG    1 
ATOM   2883 N N     . ALA A 1 400 ? 2.669   -1.437  -32.425  1.00 52.64  ? 394 ALA A N     1 
ATOM   2884 C CA    . ALA A 1 400 ? 1.874   -1.486  -31.196  1.00 53.23  ? 394 ALA A CA    1 
ATOM   2885 C C     . ALA A 1 400 ? 2.225   -2.790  -30.444  1.00 57.53  ? 394 ALA A C     1 
ATOM   2886 O O     . ALA A 1 400 ? 2.110   -2.866  -29.225  1.00 57.26  ? 394 ALA A O     1 
ATOM   2887 C CB    . ALA A 1 400 ? 0.392   -1.434  -31.523  1.00 53.58  ? 394 ALA A CB    1 
ATOM   2888 N N     . THR A 1 401 ? 2.695   -3.798  -31.194  1.00 55.21  ? 395 THR A N     1 
ATOM   2889 C CA    . THR A 1 401 ? 3.076   -5.124  -30.708  1.00 55.85  ? 395 THR A CA    1 
ATOM   2890 C C     . THR A 1 401 ? 4.396   -5.545  -31.350  1.00 58.32  ? 395 THR A C     1 
ATOM   2891 O O     . THR A 1 401 ? 4.387   -6.378  -32.268  1.00 56.61  ? 395 THR A O     1 
ATOM   2892 C CB    . THR A 1 401 ? 1.956   -6.147  -30.988  1.00 67.74  ? 395 THR A CB    1 
ATOM   2893 O OG1   . THR A 1 401 ? 1.588   -6.119  -32.375  1.00 62.58  ? 395 THR A OG1   1 
ATOM   2894 C CG2   . THR A 1 401 ? 0.762   -5.932  -30.116  1.00 69.01  ? 395 THR A CG2   1 
ATOM   2895 N N     . PRO A 1 402 ? 5.546   -4.971  -30.897  1.00 54.42  ? 396 PRO A N     1 
ATOM   2896 C CA    . PRO A 1 402 ? 6.837   -5.322  -31.515  1.00 53.49  ? 396 PRO A CA    1 
ATOM   2897 C C     . PRO A 1 402 ? 7.146   -6.810  -31.595  1.00 54.88  ? 396 PRO A C     1 
ATOM   2898 O O     . PRO A 1 402 ? 6.755   -7.582  -30.721  1.00 53.49  ? 396 PRO A O     1 
ATOM   2899 C CB    . PRO A 1 402 ? 7.866   -4.565  -30.666  1.00 56.01  ? 396 PRO A CB    1 
ATOM   2900 C CG    . PRO A 1 402 ? 7.153   -4.163  -29.455  1.00 61.25  ? 396 PRO A CG    1 
ATOM   2901 C CD    . PRO A 1 402 ? 5.734   -3.945  -29.857  1.00 56.02  ? 396 PRO A CD    1 
ATOM   2902 N N     . GLY A 1 403 ? 7.822   -7.179  -32.677  1.00 51.12  ? 397 GLY A N     1 
ATOM   2903 C CA    . GLY A 1 403 ? 8.236   -8.544  -32.969  1.00 51.46  ? 397 GLY A CA    1 
ATOM   2904 C C     . GLY A 1 403 ? 9.496   -8.993  -32.247  1.00 56.47  ? 397 GLY A C     1 
ATOM   2905 O O     . GLY A 1 403 ? 10.214  -8.170  -31.659  1.00 56.56  ? 397 GLY A O     1 
ATOM   2906 N N     . PRO A 1 404 ? 9.788   -10.319 -32.311  1.00 52.69  ? 398 PRO A N     1 
ATOM   2907 C CA    . PRO A 1 404 ? 10.966  -10.877 -31.623  1.00 53.14  ? 398 PRO A CA    1 
ATOM   2908 C C     . PRO A 1 404 ? 12.292  -10.222 -31.960  1.00 55.87  ? 398 PRO A C     1 
ATOM   2909 O O     . PRO A 1 404 ? 13.105  -10.060 -31.048  1.00 56.70  ? 398 PRO A O     1 
ATOM   2910 C CB    . PRO A 1 404 ? 10.971  -12.338 -32.076  1.00 55.25  ? 398 PRO A CB    1 
ATOM   2911 C CG    . PRO A 1 404 ? 9.582   -12.637 -32.405  1.00 59.17  ? 398 PRO A CG    1 
ATOM   2912 C CD    . PRO A 1 404 ? 9.029   -11.384 -32.994  1.00 53.77  ? 398 PRO A CD    1 
ATOM   2913 N N     . TYR A 1 405 ? 12.513  -9.870  -33.258  1.00 50.52  ? 399 TYR A N     1 
ATOM   2914 C CA    . TYR A 1 405 ? 13.733  -9.223  -33.745  1.00 50.13  ? 399 TYR A CA    1 
ATOM   2915 C C     . TYR A 1 405 ? 13.976  -7.896  -33.008  1.00 57.14  ? 399 TYR A C     1 
ATOM   2916 O O     . TYR A 1 405 ? 15.061  -7.672  -32.462  1.00 58.38  ? 399 TYR A O     1 
ATOM   2917 C CB    . TYR A 1 405 ? 13.661  -8.976  -35.271  1.00 49.04  ? 399 TYR A CB    1 
ATOM   2918 C CG    . TYR A 1 405 ? 14.929  -8.358  -35.828  1.00 49.12  ? 399 TYR A CG    1 
ATOM   2919 C CD1   . TYR A 1 405 ? 15.997  -9.153  -36.225  1.00 50.46  ? 399 TYR A CD1   1 
ATOM   2920 C CD2   . TYR A 1 405 ? 15.073  -6.976  -35.927  1.00 49.87  ? 399 TYR A CD2   1 
ATOM   2921 C CE1   . TYR A 1 405 ? 17.185  -8.593  -36.686  1.00 50.05  ? 399 TYR A CE1   1 
ATOM   2922 C CE2   . TYR A 1 405 ? 16.260  -6.405  -36.378  1.00 51.32  ? 399 TYR A CE2   1 
ATOM   2923 C CZ    . TYR A 1 405 ? 17.313  -7.219  -36.760  1.00 59.62  ? 399 TYR A CZ    1 
ATOM   2924 O OH    . TYR A 1 405 ? 18.480  -6.661  -37.211  1.00 65.19  ? 399 TYR A OH    1 
ATOM   2925 N N     . GLU A 1 406 ? 12.956  -7.019  -33.014  1.00 53.10  ? 400 GLU A N     1 
ATOM   2926 C CA    . GLU A 1 406 ? 12.984  -5.705  -32.388  1.00 52.99  ? 400 GLU A CA    1 
ATOM   2927 C C     . GLU A 1 406 ? 13.224  -5.866  -30.898  1.00 59.02  ? 400 GLU A C     1 
ATOM   2928 O O     . GLU A 1 406 ? 14.042  -5.132  -30.335  1.00 60.73  ? 400 GLU A O     1 
ATOM   2929 C CB    . GLU A 1 406 ? 11.683  -4.940  -32.658  1.00 53.12  ? 400 GLU A CB    1 
ATOM   2930 C CG    . GLU A 1 406 ? 11.249  -4.942  -34.115  1.00 60.01  ? 400 GLU A CG    1 
ATOM   2931 C CD    . GLU A 1 406 ? 10.308  -6.060  -34.520  1.00 70.74  ? 400 GLU A CD    1 
ATOM   2932 O OE1   . GLU A 1 406 ? 9.096   -5.778  -34.662  1.00 44.42  ? 400 GLU A OE1   1 
ATOM   2933 O OE2   . GLU A 1 406 ? 10.777  -7.209  -34.700  1.00 62.55  ? 400 GLU A OE2   1 
ATOM   2934 N N     . ILE A 1 407 ? 12.562  -6.863  -30.272  1.00 54.40  ? 401 ILE A N     1 
ATOM   2935 C CA    . ILE A 1 407 ? 12.713  -7.150  -28.837  1.00 54.54  ? 401 ILE A CA    1 
ATOM   2936 C C     . ILE A 1 407 ? 14.144  -7.564  -28.496  1.00 58.73  ? 401 ILE A C     1 
ATOM   2937 O O     . ILE A 1 407 ? 14.692  -7.056  -27.524  1.00 60.41  ? 401 ILE A O     1 
ATOM   2938 C CB    . ILE A 1 407 ? 11.621  -8.121  -28.316  1.00 56.83  ? 401 ILE A CB    1 
ATOM   2939 C CG1   . ILE A 1 407 ? 10.225  -7.491  -28.444  1.00 56.24  ? 401 ILE A CG1   1 
ATOM   2940 C CG2   . ILE A 1 407 ? 11.875  -8.541  -26.885  1.00 57.45  ? 401 ILE A CG2   1 
ATOM   2941 C CD1   . ILE A 1 407 ? 9.092   -8.526  -28.565  1.00 66.35  ? 401 ILE A CD1   1 
ATOM   2942 N N     . GLU A 1 408 ? 14.763  -8.408  -29.328  1.00 55.04  ? 402 GLU A N     1 
ATOM   2943 C CA    . GLU A 1 408 ? 16.142  -8.862  -29.122  1.00 56.78  ? 402 GLU A CA    1 
ATOM   2944 C C     . GLU A 1 408 ? 17.197  -7.774  -29.332  1.00 61.05  ? 402 GLU A C     1 
ATOM   2945 O O     . GLU A 1 408 ? 18.272  -7.857  -28.750  1.00 61.47  ? 402 GLU A O     1 
ATOM   2946 C CB    . GLU A 1 408 ? 16.466  -10.058 -30.025  1.00 58.20  ? 402 GLU A CB    1 
ATOM   2947 C CG    . GLU A 1 408 ? 17.377  -11.067 -29.350  1.00 74.02  ? 402 GLU A CG    1 
ATOM   2948 C CD    . GLU A 1 408 ? 16.777  -11.771 -28.143  1.00 115.51 ? 402 GLU A CD    1 
ATOM   2949 O OE1   . GLU A 1 408 ? 15.842  -12.590 -28.319  1.00 117.46 ? 402 GLU A OE1   1 
ATOM   2950 O OE2   . GLU A 1 408 ? 17.252  -11.500 -27.015  1.00 117.17 ? 402 GLU A OE2   1 
ATOM   2951 N N     . HIS A 1 409 ? 16.901  -6.771  -30.167  1.00 57.14  ? 403 HIS A N     1 
ATOM   2952 C CA    . HIS A 1 409 ? 17.849  -5.721  -30.529  1.00 57.35  ? 403 HIS A CA    1 
ATOM   2953 C C     . HIS A 1 409 ? 17.717  -4.399  -29.767  1.00 63.65  ? 403 HIS A C     1 
ATOM   2954 O O     . HIS A 1 409 ? 18.697  -3.650  -29.670  1.00 64.75  ? 403 HIS A O     1 
ATOM   2955 C CB    . HIS A 1 409 ? 17.847  -5.526  -32.051  1.00 56.53  ? 403 HIS A CB    1 
ATOM   2956 C CG    . HIS A 1 409 ? 18.391  -6.714  -32.784  1.00 59.94  ? 403 HIS A CG    1 
ATOM   2957 N ND1   . HIS A 1 409 ? 17.739  -7.933  -32.764  1.00 61.72  ? 403 HIS A ND1   1 
ATOM   2958 C CD2   . HIS A 1 409 ? 19.533  -6.844  -33.498  1.00 61.79  ? 403 HIS A CD2   1 
ATOM   2959 C CE1   . HIS A 1 409 ? 18.497  -8.759  -33.465  1.00 61.17  ? 403 HIS A CE1   1 
ATOM   2960 N NE2   . HIS A 1 409 ? 19.574  -8.142  -33.946  1.00 61.56  ? 403 HIS A NE2   1 
ATOM   2961 N N     . THR A 1 410 ? 16.524  -4.122  -29.202  1.00 59.44  ? 404 THR A N     1 
ATOM   2962 C CA    . THR A 1 410 ? 16.275  -2.907  -28.419  1.00 58.70  ? 404 THR A CA    1 
ATOM   2963 C C     . THR A 1 410 ? 16.642  -3.183  -26.946  1.00 64.20  ? 404 THR A C     1 
ATOM   2964 O O     . THR A 1 410 ? 16.154  -4.165  -26.370  1.00 63.71  ? 404 THR A O     1 
ATOM   2965 C CB    . THR A 1 410 ? 14.812  -2.433  -28.611  1.00 52.76  ? 404 THR A CB    1 
ATOM   2966 O OG1   . THR A 1 410 ? 14.499  -2.447  -30.002  1.00 34.18  ? 404 THR A OG1   1 
ATOM   2967 C CG2   . THR A 1 410 ? 14.565  -1.029  -28.044  1.00 53.18  ? 404 THR A CG2   1 
ATOM   2968 N N     . ASP A 1 411 ? 17.513  -2.333  -26.348  1.00 62.36  ? 405 ASP A N     1 
ATOM   2969 C CA    . ASP A 1 411 ? 17.912  -2.487  -24.939  1.00 63.95  ? 405 ASP A CA    1 
ATOM   2970 C C     . ASP A 1 411 ? 16.754  -2.089  -24.007  1.00 68.41  ? 405 ASP A C     1 
ATOM   2971 O O     . ASP A 1 411 ? 16.404  -2.862  -23.108  1.00 68.58  ? 405 ASP A O     1 
ATOM   2972 C CB    . ASP A 1 411 ? 19.226  -1.751  -24.607  1.00 66.59  ? 405 ASP A CB    1 
ATOM   2973 N N     . GLU A 1 412 ? 16.122  -0.923  -24.266  1.00 64.79  ? 406 GLU A N     1 
ATOM   2974 C CA    . GLU A 1 412 ? 14.962  -0.439  -23.506  1.00 65.24  ? 406 GLU A CA    1 
ATOM   2975 C C     . GLU A 1 412 ? 13.858  0.010   -24.461  1.00 70.55  ? 406 GLU A C     1 
ATOM   2976 O O     . GLU A 1 412 ? 14.127  0.712   -25.453  1.00 71.14  ? 406 GLU A O     1 
ATOM   2977 C CB    . GLU A 1 412 ? 15.356  0.702   -22.577  1.00 67.11  ? 406 GLU A CB    1 
ATOM   2978 N N     . MET A 1 413 ? 12.620  -0.429  -24.178  1.00 66.29  ? 407 MET A N     1 
ATOM   2979 C CA    . MET A 1 413 ? 11.432  -0.092  -24.964  1.00 64.71  ? 407 MET A CA    1 
ATOM   2980 C C     . MET A 1 413 ? 11.010  1.356   -24.694  1.00 65.43  ? 407 MET A C     1 
ATOM   2981 O O     . MET A 1 413 ? 11.236  1.871   -23.595  1.00 67.08  ? 407 MET A O     1 
ATOM   2982 C CB    . MET A 1 413 ? 10.298  -1.029  -24.586  1.00 67.98  ? 407 MET A CB    1 
ATOM   2983 C CG    . MET A 1 413 ? 10.448  -2.391  -25.165  1.00 73.02  ? 407 MET A CG    1 
ATOM   2984 S SD    . MET A 1 413 ? 9.696   -2.456  -26.802  1.00 77.37  ? 407 MET A SD    1 
ATOM   2985 C CE    . MET A 1 413 ? 10.754  -3.715  -27.602  1.00 74.16  ? 407 MET A CE    1 
ATOM   2986 N N     . VAL A 1 414 ? 10.412  2.024   -25.689  1.00 57.49  ? 408 VAL A N     1 
ATOM   2987 C CA    . VAL A 1 414 ? 9.964   3.423   -25.549  1.00 55.82  ? 408 VAL A CA    1 
ATOM   2988 C C     . VAL A 1 414 ? 8.445   3.421   -25.701  1.00 59.27  ? 408 VAL A C     1 
ATOM   2989 O O     . VAL A 1 414 ? 7.920   3.487   -26.817  1.00 58.26  ? 408 VAL A O     1 
ATOM   2990 C CB    . VAL A 1 414 ? 10.656  4.413   -26.539  1.00 57.23  ? 408 VAL A CB    1 
ATOM   2991 C CG1   . VAL A 1 414 ? 10.368  5.863   -26.169  1.00 56.84  ? 408 VAL A CG1   1 
ATOM   2992 C CG2   . VAL A 1 414 ? 12.157  4.161   -26.644  1.00 57.18  ? 408 VAL A CG2   1 
ATOM   2993 N N     . GLU A 1 415 ? 7.743   3.277   -24.586  1.00 56.18  ? 409 GLU A N     1 
ATOM   2994 C CA    . GLU A 1 415 ? 6.297   3.211   -24.614  1.00 55.41  ? 409 GLU A CA    1 
ATOM   2995 C C     . GLU A 1 415 ? 5.628   4.586   -24.875  1.00 58.93  ? 409 GLU A C     1 
ATOM   2996 O O     . GLU A 1 415 ? 6.083   5.620   -24.378  1.00 60.32  ? 409 GLU A O     1 
ATOM   2997 C CB    . GLU A 1 415 ? 5.784   2.565   -23.332  1.00 56.97  ? 409 GLU A CB    1 
ATOM   2998 N N     . GLN A 1 416 ? 4.567   4.576   -25.705  1.00 52.85  ? 410 GLN A N     1 
ATOM   2999 C CA    . GLN A 1 416 ? 3.706   5.715   -26.029  1.00 52.32  ? 410 GLN A CA    1 
ATOM   3000 C C     . GLN A 1 416 ? 2.273   5.150   -26.047  1.00 59.50  ? 410 GLN A C     1 
ATOM   3001 O O     . GLN A 1 416 ? 1.734   4.798   -27.108  1.00 59.17  ? 410 GLN A O     1 
ATOM   3002 C CB    . GLN A 1 416 ? 4.094   6.387   -27.351  1.00 51.80  ? 410 GLN A CB    1 
ATOM   3003 C CG    . GLN A 1 416 ? 3.187   7.567   -27.688  1.00 53.80  ? 410 GLN A CG    1 
ATOM   3004 C CD    . GLN A 1 416 ? 3.597   8.298   -28.938  1.00 59.01  ? 410 GLN A CD    1 
ATOM   3005 O OE1   . GLN A 1 416 ? 4.631   8.970   -28.975  1.00 51.24  ? 410 GLN A OE1   1 
ATOM   3006 N NE2   . GLN A 1 416 ? 2.761   8.230   -29.969  1.00 42.92  ? 410 GLN A NE2   1 
ATOM   3007 N N     . ILE A 1 417 ? 1.690   4.987   -24.840  1.00 57.36  ? 411 ILE A N     1 
ATOM   3008 C CA    . ILE A 1 417 ? 0.377   4.377   -24.702  1.00 56.63  ? 411 ILE A CA    1 
ATOM   3009 C C     . ILE A 1 417 ? -0.767  5.332   -24.426  1.00 62.80  ? 411 ILE A C     1 
ATOM   3010 O O     . ILE A 1 417 ? -1.890  5.012   -24.777  1.00 62.52  ? 411 ILE A O     1 
ATOM   3011 C CB    . ILE A 1 417 ? 0.380   3.076   -23.859  1.00 59.95  ? 411 ILE A CB    1 
ATOM   3012 C CG1   . ILE A 1 417 ? 0.828   3.340   -22.422  1.00 62.81  ? 411 ILE A CG1   1 
ATOM   3013 C CG2   . ILE A 1 417 ? 1.248   1.990   -24.526  1.00 59.14  ? 411 ILE A CG2   1 
ATOM   3014 C CD1   . ILE A 1 417 ? 0.800   2.101   -21.469  1.00 76.46  ? 411 ILE A CD1   1 
ATOM   3015 N N     . ILE A 1 418 ? -0.490  6.524   -23.865  1.00 61.48  ? 412 ILE A N     1 
ATOM   3016 C CA    . ILE A 1 418 ? -1.508  7.546   -23.555  1.00 61.87  ? 412 ILE A CA    1 
ATOM   3017 C C     . ILE A 1 418 ? -2.037  8.272   -24.815  1.00 67.10  ? 412 ILE A C     1 
ATOM   3018 O O     . ILE A 1 418 ? -1.269  8.868   -25.572  1.00 65.15  ? 412 ILE A O     1 
ATOM   3019 C CB    . ILE A 1 418 ? -1.012  8.551   -22.485  1.00 65.57  ? 412 ILE A CB    1 
ATOM   3020 C CG1   . ILE A 1 418 ? -0.303  7.885   -21.278  1.00 66.55  ? 412 ILE A CG1   1 
ATOM   3021 C CG2   . ILE A 1 418 ? -2.111  9.512   -22.097  1.00 66.84  ? 412 ILE A CG2   1 
ATOM   3022 C CD1   . ILE A 1 418 ? -1.138  6.980   -20.396  1.00 76.67  ? 412 ILE A CD1   1 
ATOM   3023 N N     . ARG A 1 419 ? -3.350  8.240   -25.007  1.00 67.03  ? 413 ARG A N     1 
ATOM   3024 C CA    . ARG A 1 419 ? -4.028  8.885   -26.130  1.00 67.74  ? 413 ARG A CA    1 
ATOM   3025 C C     . ARG A 1 419 ? -4.369  10.356  -25.807  1.00 76.69  ? 413 ARG A C     1 
ATOM   3026 O O     . ARG A 1 419 ? -4.708  10.648  -24.652  1.00 76.19  ? 413 ARG A O     1 
ATOM   3027 C CB    . ARG A 1 419 ? -5.305  8.107   -26.506  1.00 66.46  ? 413 ARG A CB    1 
ATOM   3028 C CG    . ARG A 1 419 ? -5.035  6.878   -27.366  1.00 75.67  ? 413 ARG A CG    1 
ATOM   3029 C CD    . ARG A 1 419 ? -6.280  6.066   -27.636  1.00 79.98  ? 413 ARG A CD    1 
ATOM   3030 N NE    . ARG A 1 419 ? -5.967  4.736   -28.167  1.00 77.19  ? 413 ARG A NE    1 
ATOM   3031 C CZ    . ARG A 1 419 ? -5.785  3.649   -27.424  1.00 93.24  ? 413 ARG A CZ    1 
ATOM   3032 N NH1   . ARG A 1 419 ? -5.878  3.716   -26.102  1.00 84.37  ? 413 ARG A NH1   1 
ATOM   3033 N NH2   . ARG A 1 419 ? -5.512  2.485   -27.997  1.00 83.09  ? 413 ARG A NH2   1 
ATOM   3034 N N     . PRO A 1 420 ? -4.309  11.293  -26.799  1.00 76.80  ? 414 PRO A N     1 
ATOM   3035 C CA    . PRO A 1 420 ? -4.684  12.692  -26.511  1.00 78.50  ? 414 PRO A CA    1 
ATOM   3036 C C     . PRO A 1 420 ? -6.173  12.832  -26.178  1.00 85.28  ? 414 PRO A C     1 
ATOM   3037 O O     . PRO A 1 420 ? -6.526  13.650  -25.321  1.00 87.44  ? 414 PRO A O     1 
ATOM   3038 C CB    . PRO A 1 420 ? -4.320  13.445  -27.798  1.00 79.43  ? 414 PRO A CB    1 
ATOM   3039 C CG    . PRO A 1 420 ? -3.524  12.479  -28.638  1.00 82.42  ? 414 PRO A CG    1 
ATOM   3040 C CD    . PRO A 1 420 ? -3.955  11.120  -28.224  1.00 77.57  ? 414 PRO A CD    1 
ATOM   3041 N N     . THR A 1 421 ? -7.033  11.998  -26.816  1.00 80.85  ? 415 THR A N     1 
ATOM   3042 C CA    . THR A 1 421 ? -8.488  11.959  -26.606  1.00 81.16  ? 415 THR A CA    1 
ATOM   3043 C C     . THR A 1 421 ? -8.880  11.370  -25.240  1.00 84.96  ? 415 THR A C     1 
ATOM   3044 O O     . THR A 1 421 ? -10.028 11.539  -24.801  1.00 86.23  ? 415 THR A O     1 
ATOM   3045 C CB    . THR A 1 421 ? -9.183  11.194  -27.744  1.00 90.57  ? 415 THR A CB    1 
ATOM   3046 O OG1   . THR A 1 421 ? -8.632  9.878   -27.858  1.00 92.02  ? 415 THR A OG1   1 
ATOM   3047 C CG2   . THR A 1 421 ? -9.125  11.921  -29.078  1.00 88.80  ? 415 THR A CG2   1 
ATOM   3048 N N     . GLY A 1 422 ? -7.945  10.661  -24.606  1.00 79.56  ? 416 GLY A N     1 
ATOM   3049 C CA    . GLY A 1 422 ? -8.167  10.024  -23.315  1.00 80.22  ? 416 GLY A CA    1 
ATOM   3050 C C     . GLY A 1 422 ? -8.849  8.674   -23.423  1.00 83.59  ? 416 GLY A C     1 
ATOM   3051 O O     . GLY A 1 422 ? -9.046  8.003   -22.406  1.00 84.15  ? 416 GLY A O     1 
ATOM   3052 N N     . LEU A 1 423 ? -9.200  8.263   -24.668  1.00 77.98  ? 417 LEU A N     1 
ATOM   3053 C CA    . LEU A 1 423 ? -9.856  6.999   -25.033  1.00 76.18  ? 417 LEU A CA    1 
ATOM   3054 C C     . LEU A 1 423 ? -9.046  5.802   -24.490  1.00 77.14  ? 417 LEU A C     1 
ATOM   3055 O O     . LEU A 1 423 ? -7.821  5.771   -24.638  1.00 75.60  ? 417 LEU A O     1 
ATOM   3056 C CB    . LEU A 1 423 ? -9.983  6.917   -26.580  1.00 74.77  ? 417 LEU A CB    1 
ATOM   3057 C CG    . LEU A 1 423 ? -11.277 7.372   -27.298  1.00 79.61  ? 417 LEU A CG    1 
ATOM   3058 C CD1   . LEU A 1 423 ? -12.393 6.399   -27.103  1.00 80.12  ? 417 LEU A CD1   1 
ATOM   3059 C CD2   . LEU A 1 423 ? -11.725 8.762   -26.911  1.00 84.75  ? 417 LEU A CD2   1 
ATOM   3060 N N     . LEU A 1 424 ? -9.723  4.849   -23.826  1.00 72.60  ? 418 LEU A N     1 
ATOM   3061 C CA    . LEU A 1 424 ? -9.063  3.684   -23.213  1.00 71.61  ? 418 LEU A CA    1 
ATOM   3062 C C     . LEU A 1 424 ? -9.151  2.421   -24.050  1.00 74.44  ? 418 LEU A C     1 
ATOM   3063 O O     . LEU A 1 424 ? -10.118 2.247   -24.810  1.00 73.33  ? 418 LEU A O     1 
ATOM   3064 C CB    . LEU A 1 424 ? -9.666  3.368   -21.830  1.00 72.64  ? 418 LEU A CB    1 
ATOM   3065 C CG    . LEU A 1 424 ? -10.054 4.508   -20.927  1.00 77.89  ? 418 LEU A CG    1 
ATOM   3066 C CD1   . LEU A 1 424 ? -11.139 4.069   -19.989  1.00 79.48  ? 418 LEU A CD1   1 
ATOM   3067 C CD2   . LEU A 1 424 ? -8.855  5.026   -20.160  1.00 80.14  ? 418 LEU A CD2   1 
ATOM   3068 N N     . ASP A 1 425 ? -8.176  1.496   -23.840  1.00 71.42  ? 419 ASP A N     1 
ATOM   3069 C CA    . ASP A 1 425 ? -8.145  0.171   -24.477  1.00 70.78  ? 419 ASP A CA    1 
ATOM   3070 C C     . ASP A 1 425 ? -9.322  -0.653  -23.926  1.00 73.40  ? 419 ASP A C     1 
ATOM   3071 O O     . ASP A 1 425 ? -9.649  -0.498  -22.752  1.00 74.51  ? 419 ASP A O     1 
ATOM   3072 C CB    . ASP A 1 425 ? -6.781  -0.531  -24.291  1.00 73.19  ? 419 ASP A CB    1 
ATOM   3073 C CG    . ASP A 1 425 ? -5.770  -0.206  -25.391  1.00 88.25  ? 419 ASP A CG    1 
ATOM   3074 O OD1   . ASP A 1 425 ? -4.703  0.357   -25.073  1.00 88.90  ? 419 ASP A OD1   1 
ATOM   3075 O OD2   . ASP A 1 425 ? -6.045  -0.532  -26.571  1.00 97.20  ? 419 ASP A OD2   1 
ATOM   3076 N N     . PRO A 1 426 ? -10.040 -1.430  -24.763  1.00 67.93  ? 420 PRO A N     1 
ATOM   3077 C CA    . PRO A 1 426 ? -11.277 -2.088  -24.294  1.00 68.51  ? 420 PRO A CA    1 
ATOM   3078 C C     . PRO A 1 426 ? -11.280 -3.049  -23.096  1.00 73.19  ? 420 PRO A C     1 
ATOM   3079 O O     . PRO A 1 426 ? -10.239 -3.435  -22.551  1.00 73.97  ? 420 PRO A O     1 
ATOM   3080 C CB    . PRO A 1 426 ? -11.827 -2.748  -25.566  1.00 69.28  ? 420 PRO A CB    1 
ATOM   3081 C CG    . PRO A 1 426 ? -10.681 -2.835  -26.486  1.00 72.15  ? 420 PRO A CG    1 
ATOM   3082 C CD    . PRO A 1 426 ? -9.838  -1.651  -26.207  1.00 67.71  ? 420 PRO A CD    1 
ATOM   3083 N N     . LEU A 1 427 ? -12.498 -3.410  -22.678  1.00 69.24  ? 421 LEU A N     1 
ATOM   3084 C CA    . LEU A 1 427 ? -12.749 -4.361  -21.608  1.00 70.34  ? 421 LEU A CA    1 
ATOM   3085 C C     . LEU A 1 427 ? -12.951 -5.707  -22.301  1.00 74.14  ? 421 LEU A C     1 
ATOM   3086 O O     . LEU A 1 427 ? -13.756 -5.807  -23.233  1.00 73.98  ? 421 LEU A O     1 
ATOM   3087 C CB    . LEU A 1 427 ? -14.003 -3.963  -20.804  1.00 71.68  ? 421 LEU A CB    1 
ATOM   3088 N N     . ILE A 1 428 ? -12.196 -6.729  -21.886  1.00 69.85  ? 422 ILE A N     1 
ATOM   3089 C CA    . ILE A 1 428 ? -12.294 -8.049  -22.507  1.00 68.05  ? 422 ILE A CA    1 
ATOM   3090 C C     . ILE A 1 428 ? -13.065 -8.996  -21.617  1.00 72.48  ? 422 ILE A C     1 
ATOM   3091 O O     . ILE A 1 428 ? -12.678 -9.208  -20.456  1.00 73.90  ? 422 ILE A O     1 
ATOM   3092 C CB    . ILE A 1 428 ? -10.914 -8.639  -22.900  1.00 69.85  ? 422 ILE A CB    1 
ATOM   3093 C CG1   . ILE A 1 428 ? -10.071 -7.620  -23.696  1.00 69.13  ? 422 ILE A CG1   1 
ATOM   3094 C CG2   . ILE A 1 428 ? -11.084 -9.975  -23.652  1.00 69.66  ? 422 ILE A CG2   1 
ATOM   3095 C CD1   . ILE A 1 428 ? -8.577  -7.908  -23.728  1.00 76.71  ? 422 ILE A CD1   1 
ATOM   3096 N N     . ASP A 1 429 ? -14.151 -9.570  -22.167  1.00 66.82  ? 423 ASP A N     1 
ATOM   3097 C CA    . ASP A 1 429 ? -14.959 -10.578 -21.488  1.00 66.83  ? 423 ASP A CA    1 
ATOM   3098 C C     . ASP A 1 429 ? -14.762 -11.886 -22.251  1.00 69.43  ? 423 ASP A C     1 
ATOM   3099 O O     . ASP A 1 429 ? -14.790 -11.897 -23.492  1.00 68.98  ? 423 ASP A O     1 
ATOM   3100 C CB    . ASP A 1 429 ? -16.432 -10.178 -21.460  1.00 67.81  ? 423 ASP A CB    1 
ATOM   3101 N N     . VAL A 1 430 ? -14.478 -12.969 -21.517  1.00 64.18  ? 424 VAL A N     1 
ATOM   3102 C CA    . VAL A 1 430 ? -14.298 -14.280 -22.125  1.00 62.45  ? 424 VAL A CA    1 
ATOM   3103 C C     . VAL A 1 430 ? -15.530 -15.117 -21.825  1.00 69.53  ? 424 VAL A C     1 
ATOM   3104 O O     . VAL A 1 430 ? -15.921 -15.269 -20.662  1.00 71.67  ? 424 VAL A O     1 
ATOM   3105 C CB    . VAL A 1 430 ? -12.968 -14.968 -21.769  1.00 64.81  ? 424 VAL A CB    1 
ATOM   3106 C CG1   . VAL A 1 430 ? -12.802 -16.255 -22.576  1.00 64.20  ? 424 VAL A CG1   1 
ATOM   3107 C CG2   . VAL A 1 430 ? -11.793 -14.029 -22.023  1.00 63.23  ? 424 VAL A CG2   1 
ATOM   3108 N N     . ARG A 1 431 ? -16.184 -15.597 -22.886  1.00 66.02  ? 425 ARG A N     1 
ATOM   3109 C CA    . ARG A 1 431 ? -17.429 -16.356 -22.791  1.00 67.17  ? 425 ARG A CA    1 
ATOM   3110 C C     . ARG A 1 431 ? -17.290 -17.794 -23.348  1.00 74.09  ? 425 ARG A C     1 
ATOM   3111 O O     . ARG A 1 431 ? -16.405 -18.027 -24.186  1.00 73.15  ? 425 ARG A O     1 
ATOM   3112 C CB    . ARG A 1 431 ? -18.577 -15.567 -23.455  1.00 63.41  ? 425 ARG A CB    1 
ATOM   3113 C CG    . ARG A 1 431 ? -18.851 -14.261 -22.735  1.00 61.48  ? 425 ARG A CG    1 
ATOM   3114 C CD    . ARG A 1 431 ? -19.966 -13.457 -23.338  1.00 60.29  ? 425 ARG A CD    1 
ATOM   3115 N NE    . ARG A 1 431 ? -20.024 -12.142 -22.706  1.00 72.55  ? 425 ARG A NE    1 
ATOM   3116 C CZ    . ARG A 1 431 ? -20.926 -11.213 -22.991  1.00 93.19  ? 425 ARG A CZ    1 
ATOM   3117 N NH1   . ARG A 1 431 ? -21.868 -11.448 -23.896  1.00 85.17  ? 425 ARG A NH1   1 
ATOM   3118 N NH2   . ARG A 1 431 ? -20.895 -10.040 -22.372  1.00 82.01  ? 425 ARG A NH2   1 
ATOM   3119 N N     . PRO A 1 432 ? -18.130 -18.773 -22.883  1.00 71.83  ? 426 PRO A N     1 
ATOM   3120 C CA    . PRO A 1 432 ? -17.995 -20.155 -23.382  1.00 71.94  ? 426 PRO A CA    1 
ATOM   3121 C C     . PRO A 1 432 ? -18.422 -20.349 -24.830  1.00 76.60  ? 426 PRO A C     1 
ATOM   3122 O O     . PRO A 1 432 ? -19.235 -19.576 -25.351  1.00 75.71  ? 426 PRO A O     1 
ATOM   3123 C CB    . PRO A 1 432 ? -18.910 -20.957 -22.452  1.00 74.95  ? 426 PRO A CB    1 
ATOM   3124 C CG    . PRO A 1 432 ? -19.271 -20.034 -21.341  1.00 79.03  ? 426 PRO A CG    1 
ATOM   3125 C CD    . PRO A 1 432 ? -19.220 -18.678 -21.890  1.00 73.30  ? 426 PRO A CD    1 
ATOM   3126 N N     . ILE A 1 433 ? -17.900 -21.411 -25.466  1.00 74.81  ? 427 ILE A N     1 
ATOM   3127 C CA    . ILE A 1 433 ? -18.271 -21.747 -26.842  1.00 74.65  ? 427 ILE A CA    1 
ATOM   3128 C C     . ILE A 1 433 ? -19.725 -22.259 -26.913  1.00 81.80  ? 427 ILE A C     1 
ATOM   3129 O O     . ILE A 1 433 ? -20.392 -22.026 -27.919  1.00 80.50  ? 427 ILE A O     1 
ATOM   3130 C CB    . ILE A 1 433 ? -17.294 -22.753 -27.443  1.00 74.83  ? 427 ILE A CB    1 
ATOM   3131 N N     . GLU A 1 434 ? -20.231 -22.894 -25.817  1.00 81.59  ? 428 GLU A N     1 
ATOM   3132 C CA    . GLU A 1 434 ? -21.610 -23.400 -25.730  1.00 82.83  ? 428 GLU A CA    1 
ATOM   3133 C C     . GLU A 1 434 ? -22.586 -22.238 -25.594  1.00 86.31  ? 428 GLU A C     1 
ATOM   3134 O O     . GLU A 1 434 ? -22.698 -21.641 -24.515  1.00 86.09  ? 428 GLU A O     1 
ATOM   3135 C CB    . GLU A 1 434 ? -21.768 -24.385 -24.568  1.00 85.19  ? 428 GLU A CB    1 
ATOM   3136 N N     . GLY A 1 435 ? -23.250 -21.922 -26.713  1.00 82.12  ? 429 GLY A N     1 
ATOM   3137 C CA    . GLY A 1 435 ? -24.219 -20.840 -26.826  1.00 81.89  ? 429 GLY A CA    1 
ATOM   3138 C C     . GLY A 1 435 ? -23.632 -19.602 -27.470  1.00 84.40  ? 429 GLY A C     1 
ATOM   3139 O O     . GLY A 1 435 ? -24.223 -18.521 -27.392  1.00 83.41  ? 429 GLY A O     1 
ATOM   3140 N N     . GLN A 1 436 ? -22.442 -19.767 -28.091  1.00 80.43  ? 430 GLN A N     1 
ATOM   3141 C CA    . GLN A 1 436 ? -21.637 -18.766 -28.801  1.00 78.76  ? 430 GLN A CA    1 
ATOM   3142 C C     . GLN A 1 436 ? -22.505 -17.787 -29.584  1.00 82.68  ? 430 GLN A C     1 
ATOM   3143 O O     . GLN A 1 436 ? -22.556 -16.606 -29.256  1.00 81.87  ? 430 GLN A O     1 
ATOM   3144 C CB    . GLN A 1 436 ? -20.698 -19.481 -29.791  1.00 79.24  ? 430 GLN A CB    1 
ATOM   3145 C CG    . GLN A 1 436 ? -19.206 -19.351 -29.515  1.00 96.60  ? 430 GLN A CG    1 
ATOM   3146 C CD    . GLN A 1 436 ? -18.355 -19.909 -30.649  1.00 117.26 ? 430 GLN A CD    1 
ATOM   3147 O OE1   . GLN A 1 436 ? -18.852 -20.233 -31.737  1.00 112.11 ? 430 GLN A OE1   1 
ATOM   3148 N NE2   . GLN A 1 436 ? -17.041 -19.998 -30.444  1.00 109.25 ? 430 GLN A NE2   1 
ATOM   3149 N N     . ILE A 1 437 ? -23.208 -18.303 -30.603  1.00 80.10  ? 431 ILE A N     1 
ATOM   3150 C CA    . ILE A 1 437 ? -24.029 -17.533 -31.529  1.00 79.74  ? 431 ILE A CA    1 
ATOM   3151 C C     . ILE A 1 437 ? -25.181 -16.762 -30.880  1.00 87.62  ? 431 ILE A C     1 
ATOM   3152 O O     . ILE A 1 437 ? -25.199 -15.540 -30.987  1.00 87.91  ? 431 ILE A O     1 
ATOM   3153 C CB    . ILE A 1 437 ? -24.409 -18.337 -32.811  1.00 81.92  ? 431 ILE A CB    1 
ATOM   3154 C CG1   . ILE A 1 437 ? -23.204 -19.094 -33.480  1.00 80.56  ? 431 ILE A CG1   1 
ATOM   3155 C CG2   . ILE A 1 437 ? -25.234 -17.509 -33.805  1.00 81.96  ? 431 ILE A CG2   1 
ATOM   3156 C CD1   . ILE A 1 437 ? -21.801 -18.433 -33.693  1.00 75.92  ? 431 ILE A CD1   1 
ATOM   3157 N N     . ASP A 1 438 ? -26.093 -17.450 -30.171  1.00 86.02  ? 432 ASP A N     1 
ATOM   3158 C CA    . ASP A 1 438 ? -27.238 -16.824 -29.488  1.00 86.90  ? 432 ASP A CA    1 
ATOM   3159 C C     . ASP A 1 438 ? -26.808 -15.625 -28.650  1.00 88.63  ? 432 ASP A C     1 
ATOM   3160 O O     . ASP A 1 438 ? -27.480 -14.595 -28.662  1.00 87.97  ? 432 ASP A O     1 
ATOM   3161 C CB    . ASP A 1 438 ? -27.962 -17.843 -28.590  1.00 91.01  ? 432 ASP A CB    1 
ATOM   3162 C CG    . ASP A 1 438 ? -28.316 -19.144 -29.284  1.00 104.72 ? 432 ASP A CG    1 
ATOM   3163 O OD1   . ASP A 1 438 ? -29.513 -19.345 -29.589  1.00 107.79 ? 432 ASP A OD1   1 
ATOM   3164 O OD2   . ASP A 1 438 ? -27.394 -19.964 -29.520  1.00 108.09 ? 432 ASP A OD2   1 
ATOM   3165 N N     . ASP A 1 439 ? -25.666 -15.771 -27.946  1.00 84.29  ? 433 ASP A N     1 
ATOM   3166 C CA    . ASP A 1 439 ? -25.054 -14.763 -27.084  1.00 83.53  ? 433 ASP A CA    1 
ATOM   3167 C C     . ASP A 1 439 ? -24.588 -13.568 -27.909  1.00 83.25  ? 433 ASP A C     1 
ATOM   3168 O O     . ASP A 1 439 ? -24.925 -12.421 -27.591  1.00 83.50  ? 433 ASP A O     1 
ATOM   3169 C CB    . ASP A 1 439 ? -23.886 -15.373 -26.297  1.00 85.66  ? 433 ASP A CB    1 
ATOM   3170 C CG    . ASP A 1 439 ? -23.346 -14.433 -25.243  1.00 98.15  ? 433 ASP A CG    1 
ATOM   3171 O OD1   . ASP A 1 439 ? -23.950 -14.365 -24.141  1.00 99.78  ? 433 ASP A OD1   1 
ATOM   3172 O OD2   . ASP A 1 439 ? -22.361 -13.720 -25.537  1.00 103.65 ? 433 ASP A OD2   1 
ATOM   3173 N N     . LEU A 1 440 ? -23.836 -13.854 -28.983  1.00 75.35  ? 434 LEU A N     1 
ATOM   3174 C CA    . LEU A 1 440 ? -23.334 -12.876 -29.936  1.00 72.09  ? 434 LEU A CA    1 
ATOM   3175 C C     . LEU A 1 440 ? -24.520 -12.115 -30.547  1.00 72.86  ? 434 LEU A C     1 
ATOM   3176 O O     . LEU A 1 440 ? -24.490 -10.887 -30.538  1.00 70.48  ? 434 LEU A O     1 
ATOM   3177 C CB    . LEU A 1 440 ? -22.495 -13.599 -31.007  1.00 70.85  ? 434 LEU A CB    1 
ATOM   3178 C CG    . LEU A 1 440 ? -22.096 -12.815 -32.237  1.00 74.41  ? 434 LEU A CG    1 
ATOM   3179 C CD1   . LEU A 1 440 ? -21.171 -11.662 -31.887  1.00 74.25  ? 434 LEU A CD1   1 
ATOM   3180 C CD2   . LEU A 1 440 ? -21.450 -13.720 -33.267  1.00 75.70  ? 434 LEU A CD2   1 
ATOM   3181 N N     . ILE A 1 441 ? -25.589 -12.851 -30.985  1.00 69.28  ? 435 ILE A N     1 
ATOM   3182 C CA    . ILE A 1 441 ? -26.854 -12.339 -31.556  1.00 68.34  ? 435 ILE A CA    1 
ATOM   3183 C C     . ILE A 1 441 ? -27.481 -11.289 -30.634  1.00 70.66  ? 435 ILE A C     1 
ATOM   3184 O O     . ILE A 1 441 ? -27.793 -10.186 -31.086  1.00 69.25  ? 435 ILE A O     1 
ATOM   3185 C CB    . ILE A 1 441 ? -27.844 -13.501 -31.902  1.00 71.99  ? 435 ILE A CB    1 
ATOM   3186 C CG1   . ILE A 1 441 ? -27.323 -14.432 -33.039  1.00 71.46  ? 435 ILE A CG1   1 
ATOM   3187 C CG2   . ILE A 1 441 ? -29.280 -13.014 -32.157  1.00 73.31  ? 435 ILE A CG2   1 
ATOM   3188 C CD1   . ILE A 1 441 ? -27.233 -13.882 -34.436  1.00 73.91  ? 435 ILE A CD1   1 
ATOM   3189 N N     . GLY A 1 442 ? -27.608 -11.634 -29.355  1.00 67.72  ? 436 GLY A N     1 
ATOM   3190 C CA    . GLY A 1 442 ? -28.142 -10.753 -28.321  1.00 68.91  ? 436 GLY A CA    1 
ATOM   3191 C C     . GLY A 1 442 ? -27.341 -9.476  -28.146  1.00 72.75  ? 436 GLY A C     1 
ATOM   3192 O O     . GLY A 1 442 ? -27.919 -8.398  -27.956  1.00 72.65  ? 436 GLY A O     1 
ATOM   3193 N N     . GLU A 1 443 ? -25.994 -9.597  -28.241  1.00 68.59  ? 437 GLU A N     1 
ATOM   3194 C CA    . GLU A 1 443 ? -25.043 -8.483  -28.153  1.00 67.10  ? 437 GLU A CA    1 
ATOM   3195 C C     . GLU A 1 443 ? -25.145 -7.592  -29.393  1.00 67.90  ? 437 GLU A C     1 
ATOM   3196 O O     . GLU A 1 443 ? -25.163 -6.368  -29.255  1.00 65.91  ? 437 GLU A O     1 
ATOM   3197 C CB    . GLU A 1 443 ? -23.607 -8.999  -27.951  1.00 67.79  ? 437 GLU A CB    1 
ATOM   3198 C CG    . GLU A 1 443 ? -23.338 -9.589  -26.569  1.00 81.04  ? 437 GLU A CG    1 
ATOM   3199 C CD    . GLU A 1 443 ? -23.295 -8.646  -25.369  1.00 102.81 ? 437 GLU A CD    1 
ATOM   3200 O OE1   . GLU A 1 443 ? -23.328 -9.157  -24.224  1.00 96.61  ? 437 GLU A OE1   1 
ATOM   3201 O OE2   . GLU A 1 443 ? -23.221 -7.409  -25.561  1.00 89.48  ? 437 GLU A OE2   1 
ATOM   3202 N N     . ILE A 1 444 ? -25.257 -8.207  -30.599  1.00 64.04  ? 438 ILE A N     1 
ATOM   3203 C CA    . ILE A 1 444 ? -25.416 -7.467  -31.851  1.00 63.46  ? 438 ILE A CA    1 
ATOM   3204 C C     . ILE A 1 444 ? -26.739 -6.691  -31.788  1.00 70.92  ? 438 ILE A C     1 
ATOM   3205 O O     . ILE A 1 444 ? -26.735 -5.473  -31.983  1.00 70.59  ? 438 ILE A O     1 
ATOM   3206 C CB    . ILE A 1 444 ? -25.383 -8.358  -33.116  1.00 65.59  ? 438 ILE A CB    1 
ATOM   3207 C CG1   . ILE A 1 444 ? -24.297 -9.419  -33.111  1.00 64.77  ? 438 ILE A CG1   1 
ATOM   3208 C CG2   . ILE A 1 444 ? -25.292 -7.483  -34.375  1.00 66.19  ? 438 ILE A CG2   1 
ATOM   3209 C CD1   . ILE A 1 444 ? -24.683 -10.615 -33.913  1.00 69.30  ? 438 ILE A CD1   1 
ATOM   3210 N N     . GLN A 1 445 ? -27.857 -7.389  -31.460  1.00 69.78  ? 439 GLN A N     1 
ATOM   3211 C CA    . GLN A 1 445 ? -29.197 -6.790  -31.351  1.00 71.73  ? 439 GLN A CA    1 
ATOM   3212 C C     . GLN A 1 445 ? -29.218 -5.555  -30.438  1.00 76.62  ? 439 GLN A C     1 
ATOM   3213 O O     . GLN A 1 445 ? -29.826 -4.534  -30.791  1.00 76.30  ? 439 GLN A O     1 
ATOM   3214 C CB    . GLN A 1 445 ? -30.235 -7.830  -30.891  1.00 74.77  ? 439 GLN A CB    1 
ATOM   3215 C CG    . GLN A 1 445 ? -30.661 -8.819  -31.990  1.00 93.69  ? 439 GLN A CG    1 
ATOM   3216 C CD    . GLN A 1 445 ? -31.594 -9.926  -31.518  1.00 119.59 ? 439 GLN A CD    1 
ATOM   3217 O OE1   . GLN A 1 445 ? -32.435 -10.415 -32.285  1.00 118.25 ? 439 GLN A OE1   1 
ATOM   3218 N NE2   . GLN A 1 445 ? -31.456 -10.377 -30.262  1.00 110.59 ? 439 GLN A NE2   1 
ATOM   3219 N N     . ALA A 1 446 ? -28.504 -5.652  -29.295  1.00 73.40  ? 440 ALA A N     1 
ATOM   3220 C CA    . ALA A 1 446 ? -28.360 -4.611  -28.280  1.00 73.69  ? 440 ALA A CA    1 
ATOM   3221 C C     . ALA A 1 446 ? -27.593 -3.390  -28.800  1.00 75.94  ? 440 ALA A C     1 
ATOM   3222 O O     . ALA A 1 446 ? -27.906 -2.258  -28.413  1.00 75.99  ? 440 ALA A O     1 
ATOM   3223 C CB    . ALA A 1 446 ? -27.655 -5.182  -27.061  1.00 74.63  ? 440 ALA A CB    1 
ATOM   3224 N N     . ARG A 1 447 ? -26.579 -3.622  -29.657  1.00 70.61  ? 441 ARG A N     1 
ATOM   3225 C CA    . ARG A 1 447 ? -25.776 -2.534  -30.212  1.00 69.61  ? 441 ARG A CA    1 
ATOM   3226 C C     . ARG A 1 447 ? -26.545 -1.732  -31.242  1.00 76.16  ? 441 ARG A C     1 
ATOM   3227 O O     . ARG A 1 447 ? -26.310 -0.528  -31.360  1.00 76.05  ? 441 ARG A O     1 
ATOM   3228 C CB    . ARG A 1 447 ? -24.440 -3.032  -30.797  1.00 66.17  ? 441 ARG A CB    1 
ATOM   3229 C CG    . ARG A 1 447 ? -23.453 -3.646  -29.805  1.00 64.71  ? 441 ARG A CG    1 
ATOM   3230 C CD    . ARG A 1 447 ? -23.227 -2.795  -28.570  1.00 57.33  ? 441 ARG A CD    1 
ATOM   3231 N NE    . ARG A 1 447 ? -22.060 -3.202  -27.792  1.00 55.90  ? 441 ARG A NE    1 
ATOM   3232 C CZ    . ARG A 1 447 ? -21.956 -4.338  -27.107  1.00 71.66  ? 441 ARG A CZ    1 
ATOM   3233 N NH1   . ARG A 1 447 ? -22.934 -5.237  -27.144  1.00 50.10  ? 441 ARG A NH1   1 
ATOM   3234 N NH2   . ARG A 1 447 ? -20.859 -4.600  -26.407  1.00 67.95  ? 441 ARG A NH2   1 
ATOM   3235 N N     . ILE A 1 448 ? -27.466 -2.397  -31.983  1.00 74.38  ? 442 ILE A N     1 
ATOM   3236 C CA    . ILE A 1 448 ? -28.305 -1.754  -33.001  1.00 74.95  ? 442 ILE A CA    1 
ATOM   3237 C C     . ILE A 1 448 ? -29.204 -0.716  -32.326  1.00 80.26  ? 442 ILE A C     1 
ATOM   3238 O O     . ILE A 1 448 ? -29.294 0.416   -32.807  1.00 79.55  ? 442 ILE A O     1 
ATOM   3239 C CB    . ILE A 1 448 ? -29.100 -2.779  -33.846  1.00 78.30  ? 442 ILE A CB    1 
ATOM   3240 C CG1   . ILE A 1 448 ? -28.147 -3.757  -34.579  1.00 76.85  ? 442 ILE A CG1   1 
ATOM   3241 C CG2   . ILE A 1 448 ? -30.006 -2.050  -34.847  1.00 80.16  ? 442 ILE A CG2   1 
ATOM   3242 C CD1   . ILE A 1 448 ? -28.715 -5.145  -34.840  1.00 79.39  ? 442 ILE A CD1   1 
ATOM   3243 N N     . GLU A 1 449 ? -29.805 -1.097  -31.175  1.00 78.43  ? 443 GLU A N     1 
ATOM   3244 C CA    . GLU A 1 449 ? -30.662 -0.246  -30.342  1.00 79.79  ? 443 GLU A CA    1 
ATOM   3245 C C     . GLU A 1 449 ? -29.905 1.006   -29.870  1.00 84.51  ? 443 GLU A C     1 
ATOM   3246 O O     . GLU A 1 449 ? -30.488 2.091   -29.825  1.00 85.66  ? 443 GLU A O     1 
ATOM   3247 C CB    . GLU A 1 449 ? -31.223 -1.035  -29.143  1.00 82.05  ? 443 GLU A CB    1 
ATOM   3248 N N     . ARG A 1 450 ? -28.604 0.862   -29.566  1.00 79.58  ? 444 ARG A N     1 
ATOM   3249 C CA    . ARG A 1 450 ? -27.774 1.969   -29.105  1.00 79.13  ? 444 ARG A CA    1 
ATOM   3250 C C     . ARG A 1 450 ? -27.062 2.739   -30.266  1.00 82.11  ? 444 ARG A C     1 
ATOM   3251 O O     . ARG A 1 450 ? -26.327 3.700   -30.005  1.00 80.98  ? 444 ARG A O     1 
ATOM   3252 C CB    . ARG A 1 450 ? -26.796 1.463   -28.024  1.00 78.21  ? 444 ARG A CB    1 
ATOM   3253 N N     . ASN A 1 451 ? -27.335 2.347   -31.541  1.00 78.61  ? 445 ASN A N     1 
ATOM   3254 C CA    . ASN A 1 451 ? -26.734 2.893   -32.778  1.00 77.48  ? 445 ASN A CA    1 
ATOM   3255 C C     . ASN A 1 451 ? -25.200 2.733   -32.798  1.00 80.95  ? 445 ASN A C     1 
ATOM   3256 O O     . ASN A 1 451 ? -24.445 3.687   -33.035  1.00 81.18  ? 445 ASN A O     1 
ATOM   3257 C CB    . ASN A 1 451 ? -27.177 4.337   -33.094  1.00 76.80  ? 445 ASN A CB    1 
ATOM   3258 C CG    . ASN A 1 451 ? -26.753 4.800   -34.476  1.00 90.51  ? 445 ASN A CG    1 
ATOM   3259 O OD1   . ASN A 1 451 ? -27.009 4.135   -35.489  1.00 83.09  ? 445 ASN A OD1   1 
ATOM   3260 N ND2   . ASN A 1 451 ? -26.024 5.910   -34.539  1.00 78.28  ? 445 ASN A ND2   1 
ATOM   3261 N N     . GLU A 1 452 ? -24.750 1.516   -32.520  1.00 75.55  ? 446 GLU A N     1 
ATOM   3262 C CA    . GLU A 1 452 ? -23.338 1.170   -32.499  1.00 73.12  ? 446 GLU A CA    1 
ATOM   3263 C C     . GLU A 1 452 ? -23.106 0.034   -33.531  1.00 74.12  ? 446 GLU A C     1 
ATOM   3264 O O     . GLU A 1 452 ? -24.081 -0.596  -33.965  1.00 74.91  ? 446 GLU A O     1 
ATOM   3265 C CB    . GLU A 1 452 ? -22.935 0.770   -31.069  1.00 74.73  ? 446 GLU A CB    1 
ATOM   3266 N N     . ARG A 1 453 ? -21.837 -0.201  -33.946  1.00 66.33  ? 447 ARG A N     1 
ATOM   3267 C CA    . ARG A 1 453 ? -21.492 -1.240  -34.932  1.00 64.23  ? 447 ARG A CA    1 
ATOM   3268 C C     . ARG A 1 453 ? -20.641 -2.377  -34.364  1.00 66.48  ? 447 ARG A C     1 
ATOM   3269 O O     . ARG A 1 453 ? -19.888 -2.169  -33.403  1.00 66.72  ? 447 ARG A O     1 
ATOM   3270 C CB    . ARG A 1 453 ? -20.823 -0.661  -36.196  1.00 62.15  ? 447 ARG A CB    1 
ATOM   3271 C CG    . ARG A 1 453 ? -21.391 0.664   -36.702  1.00 67.38  ? 447 ARG A CG    1 
ATOM   3272 C CD    . ARG A 1 453 ? -22.719 0.595   -37.425  1.00 66.24  ? 447 ARG A CD    1 
ATOM   3273 N NE    . ARG A 1 453 ? -23.109 1.940   -37.848  1.00 69.18  ? 447 ARG A NE    1 
ATOM   3274 C CZ    . ARG A 1 453 ? -23.910 2.738   -37.151  1.00 87.20  ? 447 ARG A CZ    1 
ATOM   3275 N NH1   . ARG A 1 453 ? -24.456 2.316   -36.015  1.00 79.97  ? 447 ARG A NH1   1 
ATOM   3276 N NH2   . ARG A 1 453 ? -24.186 3.958   -37.592  1.00 72.61  ? 447 ARG A NH2   1 
ATOM   3277 N N     . VAL A 1 454 ? -20.771 -3.588  -34.964  1.00 60.44  ? 448 VAL A N     1 
ATOM   3278 C CA    . VAL A 1 454 ? -20.047 -4.787  -34.527  1.00 58.96  ? 448 VAL A CA    1 
ATOM   3279 C C     . VAL A 1 454 ? -19.102 -5.318  -35.636  1.00 63.59  ? 448 VAL A C     1 
ATOM   3280 O O     . VAL A 1 454 ? -19.430 -5.255  -36.826  1.00 63.84  ? 448 VAL A O     1 
ATOM   3281 C CB    . VAL A 1 454 ? -20.988 -5.914  -33.980  1.00 62.06  ? 448 VAL A CB    1 
ATOM   3282 C CG1   . VAL A 1 454 ? -20.188 -7.034  -33.319  1.00 61.40  ? 448 VAL A CG1   1 
ATOM   3283 C CG2   . VAL A 1 454 ? -22.034 -5.376  -33.008  1.00 62.71  ? 448 VAL A CG2   1 
ATOM   3284 N N     . LEU A 1 455 ? -17.938 -5.848  -35.230  1.00 58.77  ? 449 LEU A N     1 
ATOM   3285 C CA    . LEU A 1 455 ? -16.979 -6.500  -36.120  1.00 56.86  ? 449 LEU A CA    1 
ATOM   3286 C C     . LEU A 1 455 ? -16.768 -7.906  -35.559  1.00 60.66  ? 449 LEU A C     1 
ATOM   3287 O O     . LEU A 1 455 ? -16.432 -8.055  -34.377  1.00 60.98  ? 449 LEU A O     1 
ATOM   3288 C CB    . LEU A 1 455 ? -15.627 -5.753  -36.196  1.00 55.73  ? 449 LEU A CB    1 
ATOM   3289 C CG    . LEU A 1 455 ? -15.623 -4.291  -36.641  1.00 59.70  ? 449 LEU A CG    1 
ATOM   3290 C CD1   . LEU A 1 455 ? -14.222 -3.722  -36.608  1.00 58.90  ? 449 LEU A CD1   1 
ATOM   3291 C CD2   . LEU A 1 455 ? -16.190 -4.117  -38.029  1.00 61.36  ? 449 LEU A CD2   1 
ATOM   3292 N N     . VAL A 1 456 ? -17.013 -8.934  -36.380  1.00 56.02  ? 450 VAL A N     1 
ATOM   3293 C CA    . VAL A 1 456 ? -16.843 -10.333 -35.951  1.00 55.44  ? 450 VAL A CA    1 
ATOM   3294 C C     . VAL A 1 456 ? -15.749 -11.051 -36.781  1.00 60.50  ? 450 VAL A C     1 
ATOM   3295 O O     . VAL A 1 456 ? -15.653 -10.840 -37.996  1.00 59.68  ? 450 VAL A O     1 
ATOM   3296 C CB    . VAL A 1 456 ? -18.177 -11.138 -35.870  1.00 58.52  ? 450 VAL A CB    1 
ATOM   3297 C CG1   . VAL A 1 456 ? -17.993 -12.492 -35.213  1.00 58.69  ? 450 VAL A CG1   1 
ATOM   3298 C CG2   . VAL A 1 456 ? -19.299 -10.352 -35.203  1.00 58.78  ? 450 VAL A CG2   1 
ATOM   3299 N N     . THR A 1 457 ? -14.927 -11.895 -36.115  1.00 58.36  ? 451 THR A N     1 
ATOM   3300 C CA    . THR A 1 457 ? -13.851 -12.691 -36.729  1.00 58.12  ? 451 THR A CA    1 
ATOM   3301 C C     . THR A 1 457 ? -14.120 -14.178 -36.600  1.00 63.97  ? 451 THR A C     1 
ATOM   3302 O O     . THR A 1 457 ? -14.533 -14.648 -35.538  1.00 65.02  ? 451 THR A O     1 
ATOM   3303 C CB    . THR A 1 457 ? -12.485 -12.446 -36.057  1.00 67.32  ? 451 THR A CB    1 
ATOM   3304 O OG1   . THR A 1 457 ? -12.470 -11.202 -35.362  1.00 70.78  ? 451 THR A OG1   1 
ATOM   3305 C CG2   . THR A 1 457 ? -11.310 -12.568 -37.034  1.00 64.21  ? 451 THR A CG2   1 
ATOM   3306 N N     . THR A 1 458 ? -13.819 -14.926 -37.659  1.00 60.61  ? 452 THR A N     1 
ATOM   3307 C CA    . THR A 1 458 ? -13.920 -16.389 -37.678  1.00 60.98  ? 452 THR A CA    1 
ATOM   3308 C C     . THR A 1 458 ? -12.562 -17.001 -38.092  1.00 64.91  ? 452 THR A C     1 
ATOM   3309 O O     . THR A 1 458 ? -11.592 -16.269 -38.314  1.00 64.83  ? 452 THR A O     1 
ATOM   3310 C CB    . THR A 1 458 ? -15.116 -16.842 -38.525  1.00 66.03  ? 452 THR A CB    1 
ATOM   3311 O OG1   . THR A 1 458 ? -15.284 -15.946 -39.625  1.00 66.12  ? 452 THR A OG1   1 
ATOM   3312 C CG2   . THR A 1 458 ? -16.396 -16.920 -37.717  1.00 62.26  ? 452 THR A CG2   1 
ATOM   3313 N N     . LEU A 1 459 ? -12.461 -18.317 -38.141  1.00 61.78  ? 453 LEU A N     1 
ATOM   3314 C CA    . LEU A 1 459 ? -11.202 -18.922 -38.570  1.00 61.60  ? 453 LEU A CA    1 
ATOM   3315 C C     . LEU A 1 459 ? -11.276 -19.294 -40.049  1.00 66.76  ? 453 LEU A C     1 
ATOM   3316 O O     . LEU A 1 459 ? -10.309 -19.081 -40.788  1.00 65.87  ? 453 LEU A O     1 
ATOM   3317 C CB    . LEU A 1 459 ? -10.877 -20.188 -37.771  1.00 62.33  ? 453 LEU A CB    1 
ATOM   3318 C CG    . LEU A 1 459 ? -10.379 -20.082 -36.369  1.00 66.96  ? 453 LEU A CG    1 
ATOM   3319 C CD1   . LEU A 1 459 ? -10.333 -21.445 -35.800  1.00 69.24  ? 453 LEU A CD1   1 
ATOM   3320 C CD2   . LEU A 1 459 ? -8.978  -19.532 -36.317  1.00 66.75  ? 453 LEU A CD2   1 
ATOM   3321 N N     . THR A 1 460 ? -12.413 -19.895 -40.460  1.00 64.06  ? 454 THR A N     1 
ATOM   3322 C CA    . THR A 1 460 ? -12.661 -20.364 -41.814  1.00 64.09  ? 454 THR A CA    1 
ATOM   3323 C C     . THR A 1 460 ? -13.542 -19.382 -42.558  1.00 67.51  ? 454 THR A C     1 
ATOM   3324 O O     . THR A 1 460 ? -14.365 -18.689 -41.940  1.00 67.10  ? 454 THR A O     1 
ATOM   3325 C CB    . THR A 1 460 ? -13.369 -21.723 -41.759  1.00 77.18  ? 454 THR A CB    1 
ATOM   3326 O OG1   . THR A 1 460 ? -12.860 -22.467 -40.656  1.00 78.57  ? 454 THR A OG1   1 
ATOM   3327 C CG2   . THR A 1 460 ? -13.225 -22.528 -43.063  1.00 77.69  ? 454 THR A CG2   1 
ATOM   3328 N N     . LYS A 1 461 ? -13.390 -19.354 -43.905  1.00 62.82  ? 455 LYS A N     1 
ATOM   3329 C CA    . LYS A 1 461 ? -14.243 -18.556 -44.773  1.00 61.61  ? 455 LYS A CA    1 
ATOM   3330 C C     . LYS A 1 461 ? -15.639 -19.192 -44.675  1.00 65.11  ? 455 LYS A C     1 
ATOM   3331 O O     . LYS A 1 461 ? -16.611 -18.464 -44.490  1.00 63.75  ? 455 LYS A O     1 
ATOM   3332 C CB    . LYS A 1 461 ? -13.731 -18.584 -46.207  1.00 61.71  ? 455 LYS A CB    1 
ATOM   3333 N N     . LYS A 1 462 ? -15.718 -20.557 -44.690  1.00 62.45  ? 456 LYS A N     1 
ATOM   3334 C CA    . LYS A 1 462 ? -16.978 -21.304 -44.563  1.00 63.04  ? 456 LYS A CA    1 
ATOM   3335 C C     . LYS A 1 462 ? -17.720 -20.870 -43.282  1.00 68.48  ? 456 LYS A C     1 
ATOM   3336 O O     . LYS A 1 462 ? -18.859 -20.401 -43.371  1.00 68.23  ? 456 LYS A O     1 
ATOM   3337 C CB    . LYS A 1 462 ? -16.720 -22.808 -44.573  1.00 64.06  ? 456 LYS A CB    1 
ATOM   3338 N N     . MET A 1 463 ? -17.028 -20.903 -42.121  1.00 65.55  ? 457 MET A N     1 
ATOM   3339 C CA    . MET A 1 463 ? -17.580 -20.502 -40.825  1.00 66.19  ? 457 MET A CA    1 
ATOM   3340 C C     . MET A 1 463 ? -18.235 -19.108 -40.892  1.00 70.14  ? 457 MET A C     1 
ATOM   3341 O O     . MET A 1 463 ? -19.364 -18.917 -40.432  1.00 69.66  ? 457 MET A O     1 
ATOM   3342 C CB    . MET A 1 463 ? -16.476 -20.547 -39.752  1.00 68.43  ? 457 MET A CB    1 
ATOM   3343 N N     . SER A 1 464 ? -17.525 -18.168 -41.540  1.00 66.82  ? 458 SER A N     1 
ATOM   3344 C CA    . SER A 1 464 ? -17.874 -16.766 -41.757  1.00 65.50  ? 458 SER A CA    1 
ATOM   3345 C C     . SER A 1 464 ? -19.131 -16.560 -42.659  1.00 70.07  ? 458 SER A C     1 
ATOM   3346 O O     . SER A 1 464 ? -20.018 -15.781 -42.290  1.00 68.91  ? 458 SER A O     1 
ATOM   3347 C CB    . SER A 1 464 ? -16.668 -16.048 -42.346  1.00 65.68  ? 458 SER A CB    1 
ATOM   3348 O OG    . SER A 1 464 ? -16.894 -14.656 -42.325  1.00 74.03  ? 458 SER A OG    1 
ATOM   3349 N N     . GLU A 1 465 ? -19.182 -17.253 -43.844  1.00 67.18  ? 459 GLU A N     1 
ATOM   3350 C CA    . GLU A 1 465 ? -20.265 -17.207 -44.844  1.00 67.10  ? 459 GLU A CA    1 
ATOM   3351 C C     . GLU A 1 465 ? -21.543 -17.688 -44.202  1.00 71.49  ? 459 GLU A C     1 
ATOM   3352 O O     . GLU A 1 465 ? -22.602 -17.095 -44.408  1.00 69.88  ? 459 GLU A O     1 
ATOM   3353 C CB    . GLU A 1 465 ? -19.958 -18.125 -46.045  1.00 68.67  ? 459 GLU A CB    1 
ATOM   3354 C CG    . GLU A 1 465 ? -18.824 -17.671 -46.945  1.00 80.57  ? 459 GLU A CG    1 
ATOM   3355 C CD    . GLU A 1 465 ? -18.053 -18.763 -47.676  1.00 104.18 ? 459 GLU A CD    1 
ATOM   3356 O OE1   . GLU A 1 465 ? -16.959 -18.448 -48.203  1.00 104.54 ? 459 GLU A OE1   1 
ATOM   3357 O OE2   . GLU A 1 465 ? -18.531 -19.922 -47.728  1.00 88.63  ? 459 GLU A OE2   1 
ATOM   3358 N N     . ASP A 1 466 ? -21.433 -18.785 -43.428  1.00 70.42  ? 460 ASP A N     1 
ATOM   3359 C CA    . ASP A 1 466 ? -22.547 -19.391 -42.711  1.00 72.35  ? 460 ASP A CA    1 
ATOM   3360 C C     . ASP A 1 466 ? -23.164 -18.446 -41.679  1.00 72.97  ? 460 ASP A C     1 
ATOM   3361 O O     . ASP A 1 466 ? -24.391 -18.407 -41.578  1.00 72.45  ? 460 ASP A O     1 
ATOM   3362 C CB    . ASP A 1 466 ? -22.138 -20.738 -42.083  1.00 76.23  ? 460 ASP A CB    1 
ATOM   3363 C CG    . ASP A 1 466 ? -21.725 -21.840 -43.064  1.00 93.32  ? 460 ASP A CG    1 
ATOM   3364 O OD1   . ASP A 1 466 ? -22.073 -21.738 -44.270  1.00 96.00  ? 460 ASP A OD1   1 
ATOM   3365 O OD2   . ASP A 1 466 ? -21.084 -22.815 -42.621  1.00 98.59  ? 460 ASP A OD2   1 
ATOM   3366 N N     . LEU A 1 467 ? -22.330 -17.675 -40.940  1.00 67.44  ? 461 LEU A N     1 
ATOM   3367 C CA    . LEU A 1 467 ? -22.840 -16.707 -39.971  1.00 67.53  ? 461 LEU A CA    1 
ATOM   3368 C C     . LEU A 1 467 ? -23.495 -15.516 -40.682  1.00 72.40  ? 461 LEU A C     1 
ATOM   3369 O O     . LEU A 1 467 ? -24.514 -15.018 -40.216  1.00 73.18  ? 461 LEU A O     1 
ATOM   3370 C CB    . LEU A 1 467 ? -21.753 -16.239 -38.992  1.00 66.91  ? 461 LEU A CB    1 
ATOM   3371 C CG    . LEU A 1 467 ? -22.222 -15.268 -37.889  1.00 72.44  ? 461 LEU A CG    1 
ATOM   3372 C CD1   . LEU A 1 467 ? -22.757 -16.006 -36.669  1.00 73.96  ? 461 LEU A CD1   1 
ATOM   3373 C CD2   . LEU A 1 467 ? -21.132 -14.304 -37.496  1.00 74.65  ? 461 LEU A CD2   1 
ATOM   3374 N N     . THR A 1 468 ? -22.942 -15.095 -41.823  1.00 68.65  ? 462 THR A N     1 
ATOM   3375 C CA    . THR A 1 468 ? -23.497 -13.995 -42.612  1.00 68.75  ? 462 THR A CA    1 
ATOM   3376 C C     . THR A 1 468 ? -24.901 -14.364 -43.114  1.00 78.91  ? 462 THR A C     1 
ATOM   3377 O O     . THR A 1 468 ? -25.829 -13.573 -42.959  1.00 80.06  ? 462 THR A O     1 
ATOM   3378 C CB    . THR A 1 468 ? -22.550 -13.649 -43.755  1.00 67.62  ? 462 THR A CB    1 
ATOM   3379 O OG1   . THR A 1 468 ? -21.215 -13.599 -43.253  1.00 64.46  ? 462 THR A OG1   1 
ATOM   3380 C CG2   . THR A 1 468 ? -22.901 -12.339 -44.427  1.00 62.88  ? 462 THR A CG2   1 
ATOM   3381 N N     . ASP A 1 469 ? -25.056 -15.575 -43.680  1.00 79.09  ? 463 ASP A N     1 
ATOM   3382 C CA    . ASP A 1 469 ? -26.326 -16.085 -44.207  1.00 81.34  ? 463 ASP A CA    1 
ATOM   3383 C C     . ASP A 1 469 ? -27.407 -16.217 -43.116  1.00 85.72  ? 463 ASP A C     1 
ATOM   3384 O O     . ASP A 1 469 ? -28.566 -15.878 -43.365  1.00 85.90  ? 463 ASP A O     1 
ATOM   3385 C CB    . ASP A 1 469 ? -26.117 -17.420 -44.957  1.00 84.60  ? 463 ASP A CB    1 
ATOM   3386 C CG    . ASP A 1 469 ? -25.263 -17.358 -46.226  1.00 99.92  ? 463 ASP A CG    1 
ATOM   3387 O OD1   . ASP A 1 469 ? -25.451 -16.411 -47.032  1.00 100.16 ? 463 ASP A OD1   1 
ATOM   3388 O OD2   . ASP A 1 469 ? -24.488 -18.311 -46.466  1.00 108.91 ? 463 ASP A OD2   1 
ATOM   3389 N N     . TYR A 1 470 ? -27.018 -16.674 -41.912  1.00 82.38  ? 464 TYR A N     1 
ATOM   3390 C CA    . TYR A 1 470 ? -27.929 -16.821 -40.787  1.00 83.68  ? 464 TYR A CA    1 
ATOM   3391 C C     . TYR A 1 470 ? -28.317 -15.452 -40.230  1.00 89.14  ? 464 TYR A C     1 
ATOM   3392 O O     . TYR A 1 470 ? -29.497 -15.233 -39.960  1.00 90.69  ? 464 TYR A O     1 
ATOM   3393 C CB    . TYR A 1 470 ? -27.334 -17.745 -39.711  1.00 85.38  ? 464 TYR A CB    1 
ATOM   3394 C CG    . TYR A 1 470 ? -28.157 -17.878 -38.443  1.00 89.86  ? 464 TYR A CG    1 
ATOM   3395 C CD1   . TYR A 1 470 ? -29.511 -18.193 -38.495  1.00 93.85  ? 464 TYR A CD1   1 
ATOM   3396 C CD2   . TYR A 1 470 ? -27.567 -17.750 -37.187  1.00 90.82  ? 464 TYR A CD2   1 
ATOM   3397 C CE1   . TYR A 1 470 ? -30.268 -18.329 -37.329  1.00 97.00  ? 464 TYR A CE1   1 
ATOM   3398 C CE2   . TYR A 1 470 ? -28.315 -17.874 -36.014  1.00 93.06  ? 464 TYR A CE2   1 
ATOM   3399 C CZ    . TYR A 1 470 ? -29.668 -18.158 -36.088  1.00 101.62 ? 464 TYR A CZ    1 
ATOM   3400 O OH    . TYR A 1 470 ? -30.399 -18.288 -34.927  1.00 100.33 ? 464 TYR A OH    1 
ATOM   3401 N N     . LEU A 1 471 ? -27.344 -14.523 -40.089  1.00 84.70  ? 465 LEU A N     1 
ATOM   3402 C CA    . LEU A 1 471 ? -27.605 -13.163 -39.600  1.00 84.20  ? 465 LEU A CA    1 
ATOM   3403 C C     . LEU A 1 471 ? -28.521 -12.396 -40.571  1.00 87.54  ? 465 LEU A C     1 
ATOM   3404 O O     . LEU A 1 471 ? -29.346 -11.602 -40.121  1.00 88.06  ? 465 LEU A O     1 
ATOM   3405 C CB    . LEU A 1 471 ? -26.298 -12.385 -39.409  1.00 82.80  ? 465 LEU A CB    1 
ATOM   3406 C CG    . LEU A 1 471 ? -25.424 -12.674 -38.207  1.00 87.40  ? 465 LEU A CG    1 
ATOM   3407 C CD1   . LEU A 1 471 ? -24.046 -12.079 -38.419  1.00 86.68  ? 465 LEU A CD1   1 
ATOM   3408 C CD2   . LEU A 1 471 ? -25.997 -12.074 -36.968  1.00 89.92  ? 465 LEU A CD2   1 
ATOM   3409 N N     . LYS A 1 472 ? -28.385 -12.647 -41.891  1.00 82.72  ? 466 LYS A N     1 
ATOM   3410 C CA    . LYS A 1 472 ? -29.218 -12.028 -42.921  1.00 82.93  ? 466 LYS A CA    1 
ATOM   3411 C C     . LYS A 1 472 ? -30.646 -12.599 -42.866  1.00 89.71  ? 466 LYS A C     1 
ATOM   3412 O O     . LYS A 1 472 ? -31.603 -11.863 -43.130  1.00 89.90  ? 466 LYS A O     1 
ATOM   3413 C CB    . LYS A 1 472 ? -28.595 -12.185 -44.319  1.00 84.29  ? 466 LYS A CB    1 
ATOM   3414 N N     . GLU A 1 473 ? -30.786 -13.899 -42.482  1.00 88.00  ? 467 GLU A N     1 
ATOM   3415 C CA    . GLU A 1 473 ? -32.081 -14.588 -42.320  1.00 89.99  ? 467 GLU A CA    1 
ATOM   3416 C C     . GLU A 1 473 ? -32.878 -13.975 -41.160  1.00 95.84  ? 467 GLU A C     1 
ATOM   3417 O O     . GLU A 1 473 ? -34.077 -13.734 -41.316  1.00 97.36  ? 467 GLU A O     1 
ATOM   3418 C CB    . GLU A 1 473 ? -31.901 -16.105 -42.112  1.00 91.66  ? 467 GLU A CB    1 
ATOM   3419 N N     . ILE A 1 474 ? -32.199 -13.696 -40.018  1.00 91.51  ? 468 ILE A N     1 
ATOM   3420 C CA    . ILE A 1 474 ? -32.768 -13.053 -38.822  1.00 91.58  ? 468 ILE A CA    1 
ATOM   3421 C C     . ILE A 1 474 ? -33.225 -11.604 -39.145  1.00 93.59  ? 468 ILE A C     1 
ATOM   3422 O O     . ILE A 1 474 ? -34.282 -11.180 -38.674  1.00 94.90  ? 468 ILE A O     1 
ATOM   3423 C CB    . ILE A 1 474 ? -31.788 -13.132 -37.602  1.00 94.09  ? 468 ILE A CB    1 
ATOM   3424 C CG1   . ILE A 1 474 ? -31.281 -14.578 -37.328  1.00 94.04  ? 468 ILE A CG1   1 
ATOM   3425 C CG2   . ILE A 1 474 ? -32.357 -12.470 -36.320  1.00 95.94  ? 468 ILE A CG2   1 
ATOM   3426 C CD1   . ILE A 1 474 ? -32.353 -15.650 -37.061  1.00 97.99  ? 468 ILE A CD1   1 
ATOM   3427 N N     . GLY A 1 475 ? -32.450 -10.895 -39.966  1.00 87.02  ? 469 GLY A N     1 
ATOM   3428 C CA    . GLY A 1 475 ? -32.764 -9.538  -40.403  1.00 86.47  ? 469 GLY A CA    1 
ATOM   3429 C C     . GLY A 1 475 ? -31.717 -8.476  -40.118  1.00 88.20  ? 469 GLY A C     1 
ATOM   3430 O O     . GLY A 1 475 ? -31.961 -7.285  -40.341  1.00 87.93  ? 469 GLY A O     1 
ATOM   3431 N N     . ILE A 1 476 ? -30.541 -8.896  -39.628  1.00 82.43  ? 470 ILE A N     1 
ATOM   3432 C CA    . ILE A 1 476 ? -29.425 -8.005  -39.297  1.00 79.96  ? 470 ILE A CA    1 
ATOM   3433 C C     . ILE A 1 476 ? -28.724 -7.569  -40.596  1.00 83.38  ? 470 ILE A C     1 
ATOM   3434 O O     . ILE A 1 476 ? -28.390 -8.430  -41.416  1.00 83.08  ? 470 ILE A O     1 
ATOM   3435 C CB    . ILE A 1 476 ? -28.468 -8.702  -38.278  1.00 81.35  ? 470 ILE A CB    1 
ATOM   3436 C CG1   . ILE A 1 476 ? -29.211 -9.081  -36.997  1.00 82.47  ? 470 ILE A CG1   1 
ATOM   3437 C CG2   . ILE A 1 476 ? -27.279 -7.831  -37.921  1.00 80.47  ? 470 ILE A CG2   1 
ATOM   3438 C CD1   . ILE A 1 476 ? -29.282 -10.492 -36.761  1.00 91.16  ? 470 ILE A CD1   1 
ATOM   3439 N N     . LYS A 1 477 ? -28.534 -6.238  -40.792  1.00 79.34  ? 471 LYS A N     1 
ATOM   3440 C CA    . LYS A 1 477 ? -27.855 -5.688  -41.968  1.00 78.37  ? 471 LYS A CA    1 
ATOM   3441 C C     . LYS A 1 477 ? -26.358 -6.031  -41.853  1.00 81.65  ? 471 LYS A C     1 
ATOM   3442 O O     . LYS A 1 477 ? -25.652 -5.454  -41.024  1.00 80.88  ? 471 LYS A O     1 
ATOM   3443 C CB    . LYS A 1 477 ? -28.104 -4.177  -42.087  1.00 80.79  ? 471 LYS A CB    1 
ATOM   3444 N N     . VAL A 1 478 ? -25.908 -7.054  -42.619  1.00 77.83  ? 472 VAL A N     1 
ATOM   3445 C CA    . VAL A 1 478 ? -24.543 -7.601  -42.562  1.00 76.51  ? 472 VAL A CA    1 
ATOM   3446 C C     . VAL A 1 478 ? -23.799 -7.593  -43.898  1.00 80.69  ? 472 VAL A C     1 
ATOM   3447 O O     . VAL A 1 478 ? -24.411 -7.634  -44.967  1.00 82.38  ? 472 VAL A O     1 
ATOM   3448 C CB    . VAL A 1 478 ? -24.567 -9.040  -41.956  1.00 80.33  ? 472 VAL A CB    1 
ATOM   3449 C CG1   . VAL A 1 478 ? -23.180 -9.678  -41.917  1.00 78.47  ? 472 VAL A CG1   1 
ATOM   3450 C CG2   . VAL A 1 478 ? -25.171 -9.036  -40.561  1.00 81.26  ? 472 VAL A CG2   1 
ATOM   3451 N N     . ASN A 1 479 ? -22.464 -7.577  -43.813  1.00 75.11  ? 473 ASN A N     1 
ATOM   3452 C CA    . ASN A 1 479 ? -21.568 -7.732  -44.940  1.00 74.14  ? 473 ASN A CA    1 
ATOM   3453 C C     . ASN A 1 479 ? -20.377 -8.614  -44.568  1.00 78.78  ? 473 ASN A C     1 
ATOM   3454 O O     . ASN A 1 479 ? -19.743 -8.413  -43.525  1.00 78.58  ? 473 ASN A O     1 
ATOM   3455 C CB    . ASN A 1 479 ? -21.121 -6.420  -45.552  1.00 71.43  ? 473 ASN A CB    1 
ATOM   3456 C CG    . ASN A 1 479 ? -20.688 -6.605  -46.993  1.00 85.32  ? 473 ASN A CG    1 
ATOM   3457 O OD1   . ASN A 1 479 ? -21.514 -6.648  -47.914  1.00 80.42  ? 473 ASN A OD1   1 
ATOM   3458 N ND2   . ASN A 1 479 ? -19.394 -6.811  -47.213  1.00 70.51  ? 473 ASN A ND2   1 
ATOM   3459 N N     . TYR A 1 480 ? -20.100 -9.605  -45.430  1.00 74.44  ? 474 TYR A N     1 
ATOM   3460 C CA    . TYR A 1 480 ? -18.999 -10.542 -45.305  1.00 73.22  ? 474 TYR A CA    1 
ATOM   3461 C C     . TYR A 1 480 ? -17.790 -9.981  -46.080  1.00 76.57  ? 474 TYR A C     1 
ATOM   3462 O O     . TYR A 1 480 ? -17.910 -9.602  -47.256  1.00 76.14  ? 474 TYR A O     1 
ATOM   3463 C CB    . TYR A 1 480 ? -19.462 -11.934 -45.796  1.00 74.91  ? 474 TYR A CB    1 
ATOM   3464 C CG    . TYR A 1 480 ? -18.378 -12.913 -46.209  1.00 76.15  ? 474 TYR A CG    1 
ATOM   3465 C CD1   . TYR A 1 480 ? -18.254 -13.328 -47.532  1.00 77.88  ? 474 TYR A CD1   1 
ATOM   3466 C CD2   . TYR A 1 480 ? -17.521 -13.475 -45.267  1.00 76.63  ? 474 TYR A CD2   1 
ATOM   3467 C CE1   . TYR A 1 480 ? -17.274 -14.245 -47.915  1.00 78.60  ? 474 TYR A CE1   1 
ATOM   3468 C CE2   . TYR A 1 480 ? -16.526 -14.379 -45.640  1.00 77.28  ? 474 TYR A CE2   1 
ATOM   3469 C CZ    . TYR A 1 480 ? -16.404 -14.762 -46.967  1.00 85.02  ? 474 TYR A CZ    1 
ATOM   3470 O OH    . TYR A 1 480 ? -15.419 -15.656 -47.335  1.00 84.81  ? 474 TYR A OH    1 
ATOM   3471 N N     . LEU A 1 481 ? -16.643 -9.874  -45.394  1.00 72.36  ? 475 LEU A N     1 
ATOM   3472 C CA    . LEU A 1 481 ? -15.406 -9.376  -45.978  1.00 71.55  ? 475 LEU A CA    1 
ATOM   3473 C C     . LEU A 1 481 ? -14.612 -10.493 -46.620  1.00 77.69  ? 475 LEU A C     1 
ATOM   3474 O O     . LEU A 1 481 ? -14.211 -11.430 -45.926  1.00 77.20  ? 475 LEU A O     1 
ATOM   3475 C CB    . LEU A 1 481 ? -14.567 -8.685  -44.901  1.00 70.94  ? 475 LEU A CB    1 
ATOM   3476 C CG    . LEU A 1 481 ? -14.317 -7.207  -45.144  1.00 74.62  ? 475 LEU A CG    1 
ATOM   3477 C CD1   . LEU A 1 481 ? -15.499 -6.384  -44.680  1.00 75.21  ? 475 LEU A CD1   1 
ATOM   3478 C CD2   . LEU A 1 481 ? -13.056 -6.752  -44.462  1.00 75.89  ? 475 LEU A CD2   1 
ATOM   3479 N N     . HIS A 1 482 ? -14.418 -10.417 -47.945  1.00 77.48  ? 476 HIS A N     1 
ATOM   3480 C CA    . HIS A 1 482 ? -13.654 -11.404 -48.715  1.00 79.56  ? 476 HIS A CA    1 
ATOM   3481 C C     . HIS A 1 482 ? -12.158 -11.217 -48.466  1.00 84.36  ? 476 HIS A C     1 
ATOM   3482 O O     . HIS A 1 482 ? -11.715 -10.084 -48.298  1.00 82.84  ? 476 HIS A O     1 
ATOM   3483 C CB    . HIS A 1 482 ? -13.925 -11.255 -50.222  1.00 81.93  ? 476 HIS A CB    1 
ATOM   3484 C CG    . HIS A 1 482 ? -15.363 -11.405 -50.632  1.00 87.32  ? 476 HIS A CG    1 
ATOM   3485 N ND1   . HIS A 1 482 ? -15.995 -12.646 -50.629  1.00 90.32  ? 476 HIS A ND1   1 
ATOM   3486 C CD2   . HIS A 1 482 ? -16.225 -10.477 -51.113  1.00 89.86  ? 476 HIS A CD2   1 
ATOM   3487 C CE1   . HIS A 1 482 ? -17.227 -12.422 -51.060  1.00 90.64  ? 476 HIS A CE1   1 
ATOM   3488 N NE2   . HIS A 1 482 ? -17.413 -11.133 -51.365  1.00 90.80  ? 476 HIS A NE2   1 
ATOM   3489 N N     . SER A 1 483 ? -11.379 -12.324 -48.483  1.00 83.94  ? 477 SER A N     1 
ATOM   3490 C CA    . SER A 1 483 ? -9.918  -12.382 -48.283  1.00 84.24  ? 477 SER A CA    1 
ATOM   3491 C C     . SER A 1 483 ? -9.171  -11.461 -49.268  1.00 90.01  ? 477 SER A C     1 
ATOM   3492 O O     . SER A 1 483 ? -8.194  -10.805 -48.892  1.00 88.88  ? 477 SER A O     1 
ATOM   3493 C CB    . SER A 1 483 ? -9.428  -13.818 -48.434  1.00 85.32  ? 477 SER A CB    1 
ATOM   3494 N N     . GLU A 1 484 ? -9.671  -11.398 -50.522  1.00 88.58  ? 478 GLU A N     1 
ATOM   3495 C CA    . GLU A 1 484 ? -9.170  -10.566 -51.620  1.00 88.42  ? 478 GLU A CA    1 
ATOM   3496 C C     . GLU A 1 484 ? -10.155 -9.402  -51.869  1.00 92.80  ? 478 GLU A C     1 
ATOM   3497 O O     . GLU A 1 484 ? -11.240 -9.585  -52.451  1.00 93.27  ? 478 GLU A O     1 
ATOM   3498 C CB    . GLU A 1 484 ? -8.994  -11.409 -52.882  1.00 89.57  ? 478 GLU A CB    1 
ATOM   3499 N N     . ILE A 1 485 ? -9.800  -8.220  -51.346  1.00 88.23  ? 479 ILE A N     1 
ATOM   3500 C CA    . ILE A 1 485 ? -10.626 -7.028  -51.484  1.00 88.04  ? 479 ILE A CA    1 
ATOM   3501 C C     . ILE A 1 485 ? -9.767  -5.868  -51.963  1.00 91.16  ? 479 ILE A C     1 
ATOM   3502 O O     . ILE A 1 485 ? -8.667  -5.644  -51.437  1.00 90.85  ? 479 ILE A O     1 
ATOM   3503 C CB    . ILE A 1 485 ? -11.326 -6.700  -50.166  1.00 88.89  ? 479 ILE A CB    1 
ATOM   3504 N N     . LYS A 1 486 ? -10.260 -5.169  -53.006  1.00 86.27  ? 480 LYS A N     1 
ATOM   3505 C CA    . LYS A 1 486 ? -9.610  -4.028  -53.648  1.00 84.66  ? 480 LYS A CA    1 
ATOM   3506 C C     . LYS A 1 486 ? -9.703  -2.771  -52.776  1.00 85.56  ? 480 LYS A C     1 
ATOM   3507 O O     . LYS A 1 486 ? -10.626 -2.634  -51.960  1.00 84.35  ? 480 LYS A O     1 
ATOM   3508 C CB    . LYS A 1 486 ? -10.209 -3.790  -55.053  1.00 87.81  ? 480 LYS A CB    1 
ATOM   3509 C CG    . LYS A 1 486 ? -10.151 -5.013  -56.004  1.00 96.39  ? 480 LYS A CG    1 
ATOM   3510 C CD    . LYS A 1 486 ? -8.858  -5.126  -56.853  1.00 98.23  ? 480 LYS A CD    1 
ATOM   3511 C CE    . LYS A 1 486 ? -7.766  -5.970  -56.226  1.00 96.04  ? 480 LYS A CE    1 
ATOM   3512 N NZ    . LYS A 1 486 ? -6.619  -5.142  -55.768  1.00 93.39  ? 480 LYS A NZ    1 
ATOM   3513 N N     . THR A 1 487 ? -8.712  -1.871  -52.945  1.00 81.16  ? 481 THR A N     1 
ATOM   3514 C CA    . THR A 1 487 ? -8.568  -0.603  -52.212  1.00 80.60  ? 481 THR A CA    1 
ATOM   3515 C C     . THR A 1 487 ? -9.606  0.395   -52.714  1.00 82.87  ? 481 THR A C     1 
ATOM   3516 O O     . THR A 1 487 ? -9.253  1.479   -53.171  1.00 83.34  ? 481 THR A O     1 
ATOM   3517 C CB    . THR A 1 487 ? -7.098  -0.090  -52.298  1.00 89.23  ? 481 THR A CB    1 
ATOM   3518 O OG1   . THR A 1 487 ? -6.189  -1.176  -52.095  1.00 89.77  ? 481 THR A OG1   1 
ATOM   3519 C CG2   . THR A 1 487 ? -6.791  1.011   -51.285  1.00 86.83  ? 481 THR A CG2   1 
ATOM   3520 N N     . LEU A 1 488 ? -10.881 -0.004  -52.671  1.00 77.32  ? 482 LEU A N     1 
ATOM   3521 C CA    . LEU A 1 488 ? -12.043 0.756   -53.121  1.00 77.04  ? 482 LEU A CA    1 
ATOM   3522 C C     . LEU A 1 488 ? -13.213 0.023   -52.546  1.00 80.16  ? 482 LEU A C     1 
ATOM   3523 O O     . LEU A 1 488 ? -14.006 0.635   -51.847  1.00 81.06  ? 482 LEU A O     1 
ATOM   3524 C CB    . LEU A 1 488 ? -12.136 0.823   -54.652  1.00 77.47  ? 482 LEU A CB    1 
ATOM   3525 C CG    . LEU A 1 488 ? -13.307 1.625   -55.209  1.00 83.50  ? 482 LEU A CG    1 
ATOM   3526 C CD1   . LEU A 1 488 ? -12.866 2.523   -56.332  1.00 83.71  ? 482 LEU A CD1   1 
ATOM   3527 C CD2   . LEU A 1 488 ? -14.415 0.706   -55.694  1.00 88.24  ? 482 LEU A CD2   1 
ATOM   3528 N N     . GLU A 1 489 ? -13.310 -1.300  -52.797  1.00 75.41  ? 483 GLU A N     1 
ATOM   3529 C CA    . GLU A 1 489 ? -14.318 -2.164  -52.170  1.00 75.06  ? 483 GLU A CA    1 
ATOM   3530 C C     . GLU A 1 489 ? -14.171 -2.037  -50.642  1.00 76.75  ? 483 GLU A C     1 
ATOM   3531 O O     . GLU A 1 489 ? -15.181 -2.000  -49.933  1.00 75.85  ? 483 GLU A O     1 
ATOM   3532 C CB    . GLU A 1 489 ? -14.122 -3.631  -52.601  1.00 76.45  ? 483 GLU A CB    1 
ATOM   3533 N N     . ARG A 1 490 ? -12.894 -1.926  -50.155  1.00 71.81  ? 484 ARG A N     1 
ATOM   3534 C CA    . ARG A 1 490 ? -12.534 -1.708  -48.752  1.00 70.20  ? 484 ARG A CA    1 
ATOM   3535 C C     . ARG A 1 490 ? -13.155 -0.348  -48.339  1.00 72.32  ? 484 ARG A C     1 
ATOM   3536 O O     . ARG A 1 490 ? -14.125 -0.345  -47.583  1.00 72.51  ? 484 ARG A O     1 
ATOM   3537 C CB    . ARG A 1 490 ? -10.997 -1.735  -48.568  1.00 67.70  ? 484 ARG A CB    1 
ATOM   3538 C CG    . ARG A 1 490 ? -10.507 -1.493  -47.127  1.00 74.19  ? 484 ARG A CG    1 
ATOM   3539 C CD    . ARG A 1 490 ? -8.985  -1.354  -46.977  1.00 77.16  ? 484 ARG A CD    1 
ATOM   3540 N NE    . ARG A 1 490 ? -8.427  -0.294  -47.824  1.00 79.74  ? 484 ARG A NE    1 
ATOM   3541 C CZ    . ARG A 1 490 ? -8.065  0.921   -47.408  1.00 87.02  ? 484 ARG A CZ    1 
ATOM   3542 N NH1   . ARG A 1 490 ? -7.600  1.813   -48.274  1.00 68.58  ? 484 ARG A NH1   1 
ATOM   3543 N NH2   . ARG A 1 490 ? -8.158  1.248   -46.124  1.00 68.00  ? 484 ARG A NH2   1 
ATOM   3544 N N     . ILE A 1 491 ? -12.670 0.774   -48.931  1.00 66.73  ? 485 ILE A N     1 
ATOM   3545 C CA    . ILE A 1 491 ? -13.136 2.156   -48.710  1.00 66.77  ? 485 ILE A CA    1 
ATOM   3546 C C     . ILE A 1 491 ? -14.667 2.308   -48.668  1.00 72.59  ? 485 ILE A C     1 
ATOM   3547 O O     . ILE A 1 491 ? -15.188 3.047   -47.813  1.00 73.28  ? 485 ILE A O     1 
ATOM   3548 C CB    . ILE A 1 491 ? -12.467 3.136   -49.709  1.00 69.36  ? 485 ILE A CB    1 
ATOM   3549 C CG1   . ILE A 1 491 ? -10.944 3.221   -49.421  1.00 69.46  ? 485 ILE A CG1   1 
ATOM   3550 C CG2   . ILE A 1 491 ? -13.124 4.530   -49.662  1.00 69.66  ? 485 ILE A CG2   1 
ATOM   3551 C CD1   . ILE A 1 491 ? -10.072 3.612   -50.562  1.00 79.17  ? 485 ILE A CD1   1 
ATOM   3552 N N     . GLU A 1 492 ? -15.371 1.598   -49.588  1.00 69.21  ? 486 GLU A N     1 
ATOM   3553 C CA    . GLU A 1 492 ? -16.833 1.563   -49.710  1.00 69.42  ? 486 GLU A CA    1 
ATOM   3554 C C     . GLU A 1 492 ? -17.470 0.795   -48.537  1.00 73.91  ? 486 GLU A C     1 
ATOM   3555 O O     . GLU A 1 492 ? -18.463 1.251   -47.970  1.00 73.34  ? 486 GLU A O     1 
ATOM   3556 C CB    . GLU A 1 492 ? -17.241 0.942   -51.040  1.00 69.96  ? 486 GLU A CB    1 
ATOM   3557 N N     . ILE A 1 493 ? -16.864 -0.337  -48.143  1.00 71.35  ? 487 ILE A N     1 
ATOM   3558 C CA    . ILE A 1 493 ? -17.339 -1.183  -47.042  1.00 71.76  ? 487 ILE A CA    1 
ATOM   3559 C C     . ILE A 1 493 ? -17.249 -0.497  -45.653  1.00 73.53  ? 487 ILE A C     1 
ATOM   3560 O O     . ILE A 1 493 ? -18.209 -0.572  -44.871  1.00 72.75  ? 487 ILE A O     1 
ATOM   3561 C CB    . ILE A 1 493 ? -16.725 -2.614  -47.148  1.00 74.71  ? 487 ILE A CB    1 
ATOM   3562 C CG1   . ILE A 1 493 ? -17.774 -3.623  -47.671  1.00 75.79  ? 487 ILE A CG1   1 
ATOM   3563 C CG2   . ILE A 1 493 ? -16.065 -3.093  -45.856  1.00 75.62  ? 487 ILE A CG2   1 
ATOM   3564 C CD1   . ILE A 1 493 ? -17.376 -4.320  -48.949  1.00 80.38  ? 487 ILE A CD1   1 
ATOM   3565 N N     . ILE A 1 494 ? -16.112 0.196   -45.384  1.00 68.57  ? 488 ILE A N     1 
ATOM   3566 C CA    . ILE A 1 494 ? -15.882 0.962   -44.156  1.00 67.93  ? 488 ILE A CA    1 
ATOM   3567 C C     . ILE A 1 494 ? -16.881 2.140   -44.125  1.00 72.89  ? 488 ILE A C     1 
ATOM   3568 O O     . ILE A 1 494 ? -17.484 2.395   -43.079  1.00 73.25  ? 488 ILE A O     1 
ATOM   3569 C CB    . ILE A 1 494 ? -14.442 1.474   -44.106  1.00 67.44  ? 488 ILE A CB    1 
ATOM   3570 N N     . ARG A 1 495 ? -17.120 2.783   -45.301  1.00 68.88  ? 489 ARG A N     1 
ATOM   3571 C CA    . ARG A 1 495 ? -18.051 3.900   -45.488  1.00 69.36  ? 489 ARG A CA    1 
ATOM   3572 C C     . ARG A 1 495 ? -19.509 3.549   -45.103  1.00 73.81  ? 489 ARG A C     1 
ATOM   3573 O O     . ARG A 1 495 ? -20.137 4.272   -44.320  1.00 73.21  ? 489 ARG A O     1 
ATOM   3574 C CB    . ARG A 1 495 ? -17.975 4.416   -46.944  1.00 68.04  ? 489 ARG A CB    1 
ATOM   3575 C CG    . ARG A 1 495 ? -19.038 5.468   -47.294  1.00 73.99  ? 489 ARG A CG    1 
ATOM   3576 C CD    . ARG A 1 495 ? -19.272 5.602   -48.779  1.00 77.12  ? 489 ARG A CD    1 
ATOM   3577 N NE    . ARG A 1 495 ? -19.880 4.397   -49.351  1.00 76.03  ? 489 ARG A NE    1 
ATOM   3578 C CZ    . ARG A 1 495 ? -20.013 4.169   -50.655  1.00 82.58  ? 489 ARG A CZ    1 
ATOM   3579 N NH1   . ARG A 1 495 ? -19.593 5.068   -51.542  1.00 58.64  ? 489 ARG A NH1   1 
ATOM   3580 N NH2   . ARG A 1 495 ? -20.577 3.048   -51.082  1.00 68.27  ? 489 ARG A NH2   1 
ATOM   3581 N N     . ASP A 1 496 ? -20.017 2.432   -45.648  1.00 70.60  ? 490 ASP A N     1 
ATOM   3582 C CA    . ASP A 1 496 ? -21.376 1.931   -45.451  1.00 70.86  ? 490 ASP A CA    1 
ATOM   3583 C C     . ASP A 1 496 ? -21.656 1.488   -44.024  1.00 71.41  ? 490 ASP A C     1 
ATOM   3584 O O     . ASP A 1 496 ? -22.742 1.747   -43.510  1.00 70.50  ? 490 ASP A O     1 
ATOM   3585 C CB    . ASP A 1 496 ? -21.671 0.825   -46.469  1.00 73.58  ? 490 ASP A CB    1 
ATOM   3586 C CG    . ASP A 1 496 ? -21.595 1.287   -47.918  1.00 88.82  ? 490 ASP A CG    1 
ATOM   3587 O OD1   . ASP A 1 496 ? -22.168 2.365   -48.237  1.00 90.28  ? 490 ASP A OD1   1 
ATOM   3588 O OD2   . ASP A 1 496 ? -20.974 0.573   -48.734  1.00 95.73  ? 490 ASP A OD2   1 
ATOM   3589 N N     . LEU A 1 497 ? -20.667 0.851   -43.378  1.00 67.28  ? 491 LEU A N     1 
ATOM   3590 C CA    . LEU A 1 497 ? -20.758 0.431   -41.978  1.00 67.33  ? 491 LEU A CA    1 
ATOM   3591 C C     . LEU A 1 497 ? -20.819 1.692   -41.107  1.00 71.42  ? 491 LEU A C     1 
ATOM   3592 O O     . LEU A 1 497 ? -21.666 1.750   -40.212  1.00 72.04  ? 491 LEU A O     1 
ATOM   3593 C CB    . LEU A 1 497 ? -19.559 -0.457  -41.586  1.00 66.43  ? 491 LEU A CB    1 
ATOM   3594 C CG    . LEU A 1 497 ? -19.581 -1.072  -40.177  1.00 71.37  ? 491 LEU A CG    1 
ATOM   3595 C CD1   . LEU A 1 497 ? -20.416 -2.342  -40.124  1.00 72.07  ? 491 LEU A CD1   1 
ATOM   3596 C CD2   . LEU A 1 497 ? -18.191 -1.398  -39.727  1.00 73.06  ? 491 LEU A CD2   1 
ATOM   3597 N N     . ARG A 1 498 ? -19.961 2.722   -41.415  1.00 66.34  ? 492 ARG A N     1 
ATOM   3598 C CA    . ARG A 1 498 ? -19.952 4.015   -40.710  1.00 65.52  ? 492 ARG A CA    1 
ATOM   3599 C C     . ARG A 1 498 ? -21.326 4.688   -40.829  1.00 70.25  ? 492 ARG A C     1 
ATOM   3600 O O     . ARG A 1 498 ? -21.937 4.993   -39.807  1.00 71.74  ? 492 ARG A O     1 
ATOM   3601 C CB    . ARG A 1 498 ? -18.868 4.957   -41.255  1.00 62.30  ? 492 ARG A CB    1 
ATOM   3602 C CG    . ARG A 1 498 ? -17.459 4.634   -40.789  1.00 67.95  ? 492 ARG A CG    1 
ATOM   3603 C CD    . ARG A 1 498 ? -16.584 5.871   -40.749  1.00 67.45  ? 492 ARG A CD    1 
ATOM   3604 N NE    . ARG A 1 498 ? -17.002 6.781   -39.684  1.00 68.68  ? 492 ARG A NE    1 
ATOM   3605 C CZ    . ARG A 1 498 ? -16.218 7.705   -39.140  1.00 81.37  ? 492 ARG A CZ    1 
ATOM   3606 N NH1   . ARG A 1 498 ? -14.963 7.848   -39.550  1.00 65.75  ? 492 ARG A NH1   1 
ATOM   3607 N NH2   . ARG A 1 498 ? -16.678 8.483   -38.167  1.00 69.94  ? 492 ARG A NH2   1 
ATOM   3608 N N     . LEU A 1 499 ? -21.833 4.857   -42.065  1.00 65.39  ? 493 LEU A N     1 
ATOM   3609 C CA    . LEU A 1 499 ? -23.123 5.485   -42.326  1.00 66.13  ? 493 LEU A CA    1 
ATOM   3610 C C     . LEU A 1 499 ? -24.330 4.674   -41.843  1.00 72.26  ? 493 LEU A C     1 
ATOM   3611 O O     . LEU A 1 499 ? -25.415 5.250   -41.642  1.00 74.42  ? 493 LEU A O     1 
ATOM   3612 C CB    . LEU A 1 499 ? -23.260 5.861   -43.797  1.00 66.23  ? 493 LEU A CB    1 
ATOM   3613 C CG    . LEU A 1 499 ? -22.289 6.902   -44.300  1.00 71.49  ? 493 LEU A CG    1 
ATOM   3614 C CD1   . LEU A 1 499 ? -22.042 6.715   -45.784  1.00 72.18  ? 493 LEU A CD1   1 
ATOM   3615 C CD2   . LEU A 1 499 ? -22.737 8.327   -43.945  1.00 74.04  ? 493 LEU A CD2   1 
ATOM   3616 N N     . GLY A 1 500 ? -24.132 3.370   -41.633  1.00 67.32  ? 494 GLY A N     1 
ATOM   3617 C CA    . GLY A 1 500 ? -25.179 2.491   -41.128  1.00 67.92  ? 494 GLY A CA    1 
ATOM   3618 C C     . GLY A 1 500 ? -25.864 1.572   -42.122  1.00 73.17  ? 494 GLY A C     1 
ATOM   3619 O O     . GLY A 1 500 ? -26.801 0.869   -41.726  1.00 74.01  ? 494 GLY A O     1 
ATOM   3620 N N     . LYS A 1 501 ? -25.403 1.533   -43.411  1.00 69.92  ? 495 LYS A N     1 
ATOM   3621 C CA    . LYS A 1 501 ? -25.936 0.621   -44.451  1.00 70.77  ? 495 LYS A CA    1 
ATOM   3622 C C     . LYS A 1 501 ? -25.800 -0.852  -43.996  1.00 78.70  ? 495 LYS A C     1 
ATOM   3623 O O     . LYS A 1 501 ? -26.583 -1.707  -44.422  1.00 79.70  ? 495 LYS A O     1 
ATOM   3624 C CB    . LYS A 1 501 ? -25.244 0.830   -45.808  1.00 71.52  ? 495 LYS A CB    1 
ATOM   3625 N N     . TYR A 1 502 ? -24.803 -1.117  -43.108  1.00 75.97  ? 496 TYR A N     1 
ATOM   3626 C CA    . TYR A 1 502 ? -24.503 -2.381  -42.431  1.00 75.67  ? 496 TYR A CA    1 
ATOM   3627 C C     . TYR A 1 502 ? -24.282 -2.098  -40.939  1.00 77.76  ? 496 TYR A C     1 
ATOM   3628 O O     . TYR A 1 502 ? -23.581 -1.140  -40.587  1.00 77.01  ? 496 TYR A O     1 
ATOM   3629 C CB    . TYR A 1 502 ? -23.201 -3.003  -42.948  1.00 76.38  ? 496 TYR A CB    1 
ATOM   3630 C CG    . TYR A 1 502 ? -23.103 -3.203  -44.434  1.00 79.28  ? 496 TYR A CG    1 
ATOM   3631 C CD1   . TYR A 1 502 ? -22.088 -2.599  -45.169  1.00 80.68  ? 496 TYR A CD1   1 
ATOM   3632 C CD2   . TYR A 1 502 ? -23.964 -4.074  -45.096  1.00 81.74  ? 496 TYR A CD2   1 
ATOM   3633 C CE1   . TYR A 1 502 ? -21.953 -2.824  -46.536  1.00 83.17  ? 496 TYR A CE1   1 
ATOM   3634 C CE2   . TYR A 1 502 ? -23.856 -4.293  -46.468  1.00 83.33  ? 496 TYR A CE2   1 
ATOM   3635 C CZ    . TYR A 1 502 ? -22.843 -3.671  -47.185  1.00 94.21  ? 496 TYR A CZ    1 
ATOM   3636 O OH    . TYR A 1 502 ? -22.714 -3.903  -48.537  1.00 98.51  ? 496 TYR A OH    1 
ATOM   3637 N N     . ASP A 1 503 ? -24.799 -2.965  -40.068  1.00 73.16  ? 497 ASP A N     1 
ATOM   3638 C CA    . ASP A 1 503 ? -24.569 -2.797  -38.637  1.00 72.60  ? 497 ASP A CA    1 
ATOM   3639 C C     . ASP A 1 503 ? -23.479 -3.736  -38.143  1.00 72.30  ? 497 ASP A C     1 
ATOM   3640 O O     . ASP A 1 503 ? -22.845 -3.438  -37.135  1.00 71.15  ? 497 ASP A O     1 
ATOM   3641 C CB    . ASP A 1 503 ? -25.863 -2.991  -37.835  1.00 76.88  ? 497 ASP A CB    1 
ATOM   3642 C CG    . ASP A 1 503 ? -26.964 -1.986  -38.155  1.00 96.70  ? 497 ASP A CG    1 
ATOM   3643 O OD1   . ASP A 1 503 ? -26.715 -0.753  -38.010  1.00 97.79  ? 497 ASP A OD1   1 
ATOM   3644 O OD2   . ASP A 1 503 ? -28.088 -2.429  -38.507  1.00 106.40 ? 497 ASP A OD2   1 
ATOM   3645 N N     . VAL A 1 504 ? -23.255 -4.870  -38.850  1.00 66.45  ? 498 VAL A N     1 
ATOM   3646 C CA    . VAL A 1 504 ? -22.247 -5.870  -38.487  1.00 63.99  ? 498 VAL A CA    1 
ATOM   3647 C C     . VAL A 1 504 ? -21.371 -6.256  -39.673  1.00 64.74  ? 498 VAL A C     1 
ATOM   3648 O O     . VAL A 1 504 ? -21.880 -6.321  -40.785  1.00 64.22  ? 498 VAL A O     1 
ATOM   3649 C CB    . VAL A 1 504 ? -22.924 -7.105  -37.904  1.00 65.15  ? 498 VAL A CB    1 
ATOM   3650 N N     . LEU A 1 505 ? -20.055 -6.486  -39.443  1.00 60.19  ? 499 LEU A N     1 
ATOM   3651 C CA    . LEU A 1 505 ? -19.079 -6.960  -40.448  1.00 58.81  ? 499 LEU A CA    1 
ATOM   3652 C C     . LEU A 1 505 ? -18.536 -8.321  -40.020  1.00 63.32  ? 499 LEU A C     1 
ATOM   3653 O O     . LEU A 1 505 ? -18.062 -8.465  -38.890  1.00 63.70  ? 499 LEU A O     1 
ATOM   3654 C CB    . LEU A 1 505 ? -17.887 -6.009  -40.630  1.00 57.62  ? 499 LEU A CB    1 
ATOM   3655 C CG    . LEU A 1 505 ? -17.998 -4.834  -41.595  1.00 60.98  ? 499 LEU A CG    1 
ATOM   3656 C CD1   . LEU A 1 505 ? -16.618 -4.252  -41.862  1.00 58.96  ? 499 LEU A CD1   1 
ATOM   3657 C CD2   . LEU A 1 505 ? -18.620 -5.239  -42.921  1.00 63.94  ? 499 LEU A CD2   1 
ATOM   3658 N N     . VAL A 1 506 ? -18.617 -9.319  -40.901  1.00 59.62  ? 500 VAL A N     1 
ATOM   3659 C CA    . VAL A 1 506 ? -18.137 -10.672 -40.593  1.00 59.45  ? 500 VAL A CA    1 
ATOM   3660 C C     . VAL A 1 506 ? -16.970 -10.970 -41.528  1.00 63.85  ? 500 VAL A C     1 
ATOM   3661 O O     . VAL A 1 506 ? -16.943 -10.472 -42.661  1.00 64.45  ? 500 VAL A O     1 
ATOM   3662 C CB    . VAL A 1 506 ? -19.251 -11.757 -40.680  1.00 64.00  ? 500 VAL A CB    1 
ATOM   3663 C CG1   . VAL A 1 506 ? -18.769 -13.091 -40.130  1.00 64.19  ? 500 VAL A CG1   1 
ATOM   3664 C CG2   . VAL A 1 506 ? -20.506 -11.329 -39.932  1.00 64.80  ? 500 VAL A CG2   1 
ATOM   3665 N N     . GLY A 1 507 ? -16.008 -11.741 -41.035  1.00 59.14  ? 501 GLY A N     1 
ATOM   3666 C CA    . GLY A 1 507 ? -14.842 -12.131 -41.809  1.00 58.28  ? 501 GLY A CA    1 
ATOM   3667 C C     . GLY A 1 507 ? -13.666 -12.546 -40.959  1.00 62.63  ? 501 GLY A C     1 
ATOM   3668 O O     . GLY A 1 507 ? -13.570 -12.175 -39.789  1.00 63.33  ? 501 GLY A O     1 
ATOM   3669 N N     . ILE A 1 508 ? -12.777 -13.338 -41.545  1.00 57.66  ? 502 ILE A N     1 
ATOM   3670 C CA    . ILE A 1 508 ? -11.515 -13.720 -40.934  1.00 56.42  ? 502 ILE A CA    1 
ATOM   3671 C C     . ILE A 1 508 ? -10.662 -12.495 -41.321  1.00 59.60  ? 502 ILE A C     1 
ATOM   3672 O O     . ILE A 1 508 ? -10.892 -11.945 -42.410  1.00 60.35  ? 502 ILE A O     1 
ATOM   3673 C CB    . ILE A 1 508 ? -11.032 -15.091 -41.545  1.00 59.56  ? 502 ILE A CB    1 
ATOM   3674 C CG1   . ILE A 1 508 ? -10.418 -14.971 -42.961  1.00 58.60  ? 502 ILE A CG1   1 
ATOM   3675 C CG2   . ILE A 1 508 ? -12.188 -16.119 -41.593  1.00 61.51  ? 502 ILE A CG2   1 
ATOM   3676 C CD1   . ILE A 1 508 ? -9.095  -15.560 -43.113  1.00 57.09  ? 502 ILE A CD1   1 
ATOM   3677 N N     . ASN A 1 509 ? -9.800  -11.973 -40.436  1.00 55.14  ? 503 ASN A N     1 
ATOM   3678 C CA    . ASN A 1 509 ? -8.947  -10.793 -40.777  1.00 54.17  ? 503 ASN A CA    1 
ATOM   3679 C C     . ASN A 1 509 ? -9.590  -9.372  -40.760  1.00 57.77  ? 503 ASN A C     1 
ATOM   3680 O O     . ASN A 1 509 ? -9.917  -8.789  -41.811  1.00 56.52  ? 503 ASN A O     1 
ATOM   3681 C CB    . ASN A 1 509 ? -8.088  -11.017 -42.057  1.00 50.17  ? 503 ASN A CB    1 
ATOM   3682 C CG    . ASN A 1 509 ? -6.864  -10.163 -42.131  1.00 70.82  ? 503 ASN A CG    1 
ATOM   3683 O OD1   . ASN A 1 509 ? -6.919  -8.935  -42.068  1.00 74.11  ? 503 ASN A OD1   1 
ATOM   3684 N ND2   . ASN A 1 509 ? -5.723  -10.795 -42.280  1.00 62.87  ? 503 ASN A ND2   1 
ATOM   3685 N N     . LEU A 1 510 ? -9.664  -8.798  -39.554  1.00 53.69  ? 504 LEU A N     1 
ATOM   3686 C CA    . LEU A 1 510 ? -10.157 -7.451  -39.320  1.00 52.99  ? 504 LEU A CA    1 
ATOM   3687 C C     . LEU A 1 510 ? -8.964  -6.500  -39.307  1.00 58.85  ? 504 LEU A C     1 
ATOM   3688 O O     . LEU A 1 510 ? -9.131  -5.276  -39.160  1.00 58.76  ? 504 LEU A O     1 
ATOM   3689 C CB    . LEU A 1 510 ? -10.835 -7.396  -37.959  1.00 53.21  ? 504 LEU A CB    1 
ATOM   3690 C CG    . LEU A 1 510 ? -12.010 -8.304  -37.735  1.00 58.23  ? 504 LEU A CG    1 
ATOM   3691 C CD1   . LEU A 1 510 ? -12.543 -8.115  -36.337  1.00 59.01  ? 504 LEU A CD1   1 
ATOM   3692 C CD2   . LEU A 1 510 ? -13.098 -8.074  -38.774  1.00 60.30  ? 504 LEU A CD2   1 
ATOM   3693 N N     . LEU A 1 511 ? -7.748  -7.070  -39.458  1.00 55.57  ? 505 LEU A N     1 
ATOM   3694 C CA    . LEU A 1 511 ? -6.497  -6.319  -39.431  1.00 54.85  ? 505 LEU A CA    1 
ATOM   3695 C C     . LEU A 1 511 ? -6.242  -5.532  -40.727  1.00 60.34  ? 505 LEU A C     1 
ATOM   3696 O O     . LEU A 1 511 ? -5.143  -5.005  -40.933  1.00 60.77  ? 505 LEU A O     1 
ATOM   3697 C CB    . LEU A 1 511 ? -5.312  -7.211  -39.021  1.00 54.44  ? 505 LEU A CB    1 
ATOM   3698 C CG    . LEU A 1 511 ? -5.519  -8.160  -37.818  1.00 59.55  ? 505 LEU A CG    1 
ATOM   3699 C CD1   . LEU A 1 511 ? -4.293  -8.959  -37.554  1.00 60.39  ? 505 LEU A CD1   1 
ATOM   3700 C CD2   . LEU A 1 511 ? -5.903  -7.428  -36.547  1.00 60.06  ? 505 LEU A CD2   1 
ATOM   3701 N N     . ARG A 1 512 ? -7.292  -5.387  -41.563  1.00 56.63  ? 506 ARG A N     1 
ATOM   3702 C CA    . ARG A 1 512 ? -7.234  -4.618  -42.805  1.00 56.29  ? 506 ARG A CA    1 
ATOM   3703 C C     . ARG A 1 512 ? -7.270  -3.141  -42.474  1.00 59.45  ? 506 ARG A C     1 
ATOM   3704 O O     . ARG A 1 512 ? -7.819  -2.777  -41.435  1.00 60.21  ? 506 ARG A O     1 
ATOM   3705 C CB    . ARG A 1 512 ? -8.363  -5.015  -43.756  1.00 59.36  ? 506 ARG A CB    1 
ATOM   3706 N N     . GLU A 1 513 ? -6.644  -2.301  -43.305  1.00 55.35  ? 507 GLU A N     1 
ATOM   3707 C CA    . GLU A 1 513 ? -6.533  -0.861  -43.057  1.00 56.05  ? 507 GLU A CA    1 
ATOM   3708 C C     . GLU A 1 513 ? -7.876  -0.139  -42.935  1.00 61.92  ? 507 GLU A C     1 
ATOM   3709 O O     . GLU A 1 513 ? -8.827  -0.475  -43.631  1.00 62.63  ? 507 GLU A O     1 
ATOM   3710 C CB    . GLU A 1 513 ? -5.656  -0.208  -44.124  1.00 56.45  ? 507 GLU A CB    1 
ATOM   3711 N N     . GLY A 1 514 ? -7.963  0.790   -42.003  1.00 59.97  ? 508 GLY A N     1 
ATOM   3712 C CA    . GLY A 1 514 ? -9.166  1.596   -41.809  1.00 61.18  ? 508 GLY A CA    1 
ATOM   3713 C C     . GLY A 1 514 ? -10.386 0.993   -41.132  1.00 65.63  ? 508 GLY A C     1 
ATOM   3714 O O     . GLY A 1 514 ? -11.406 1.690   -41.019  1.00 66.23  ? 508 GLY A O     1 
ATOM   3715 N N     . LEU A 1 515 ? -10.303 -0.267  -40.629  1.00 60.71  ? 509 LEU A N     1 
ATOM   3716 C CA    . LEU A 1 515 ? -11.428 -0.900  -39.913  1.00 60.41  ? 509 LEU A CA    1 
ATOM   3717 C C     . LEU A 1 515 ? -11.627 -0.384  -38.465  1.00 66.45  ? 509 LEU A C     1 
ATOM   3718 O O     . LEU A 1 515 ? -12.611 -0.743  -37.805  1.00 67.01  ? 509 LEU A O     1 
ATOM   3719 C CB    . LEU A 1 515 ? -11.371 -2.432  -39.989  1.00 59.49  ? 509 LEU A CB    1 
ATOM   3720 C CG    . LEU A 1 515 ? -11.657 -3.009  -41.364  1.00 62.50  ? 509 LEU A CG    1 
ATOM   3721 C CD1   . LEU A 1 515 ? -11.268 -4.438  -41.440  1.00 62.62  ? 509 LEU A CD1   1 
ATOM   3722 C CD2   . LEU A 1 515 ? -13.101 -2.893  -41.714  1.00 64.48  ? 509 LEU A CD2   1 
ATOM   3723 N N     . ASP A 1 516 ? -10.690 0.482   -37.997  1.00 62.94  ? 510 ASP A N     1 
ATOM   3724 C CA    . ASP A 1 516 ? -10.677 1.166   -36.705  1.00 63.48  ? 510 ASP A CA    1 
ATOM   3725 C C     . ASP A 1 516 ? -11.715 2.298   -36.815  1.00 65.96  ? 510 ASP A C     1 
ATOM   3726 O O     . ASP A 1 516 ? -11.360 3.444   -37.117  1.00 66.46  ? 510 ASP A O     1 
ATOM   3727 C CB    . ASP A 1 516 ? -9.269  1.769   -36.475  1.00 66.26  ? 510 ASP A CB    1 
ATOM   3728 C CG    . ASP A 1 516 ? -8.475  1.157   -35.334  1.00 90.28  ? 510 ASP A CG    1 
ATOM   3729 O OD1   . ASP A 1 516 ? -7.789  0.137   -35.570  1.00 93.32  ? 510 ASP A OD1   1 
ATOM   3730 O OD2   . ASP A 1 516 ? -8.481  1.741   -34.218  1.00 99.74  ? 510 ASP A OD2   1 
ATOM   3731 N N     . ILE A 1 517 ? -13.000 1.985   -36.662  1.00 60.45  ? 511 ILE A N     1 
ATOM   3732 C CA    . ILE A 1 517 ? -13.967 3.067   -36.830  1.00 59.77  ? 511 ILE A CA    1 
ATOM   3733 C C     . ILE A 1 517 ? -14.604 3.536   -35.520  1.00 65.07  ? 511 ILE A C     1 
ATOM   3734 O O     . ILE A 1 517 ? -14.887 2.696   -34.660  1.00 66.40  ? 511 ILE A O     1 
ATOM   3735 C CB    . ILE A 1 517 ? -14.954 2.887   -38.023  1.00 61.82  ? 511 ILE A CB    1 
ATOM   3736 C CG1   . ILE A 1 517 ? -15.805 1.628   -37.897  1.00 61.73  ? 511 ILE A CG1   1 
ATOM   3737 C CG2   . ILE A 1 517 ? -14.218 2.924   -39.359  1.00 61.20  ? 511 ILE A CG2   1 
ATOM   3738 C CD1   . ILE A 1 517 ? -17.240 1.874   -38.059  1.00 66.76  ? 511 ILE A CD1   1 
ATOM   3739 N N     . PRO A 1 518 ? -14.820 4.862   -35.321  1.00 60.39  ? 512 PRO A N     1 
ATOM   3740 C CA    . PRO A 1 518 ? -15.396 5.328   -34.047  1.00 61.01  ? 512 PRO A CA    1 
ATOM   3741 C C     . PRO A 1 518 ? -16.764 4.752   -33.701  1.00 66.84  ? 512 PRO A C     1 
ATOM   3742 O O     . PRO A 1 518 ? -17.091 4.653   -32.516  1.00 67.50  ? 512 PRO A O     1 
ATOM   3743 C CB    . PRO A 1 518 ? -15.444 6.838   -34.219  1.00 63.03  ? 512 PRO A CB    1 
ATOM   3744 C CG    . PRO A 1 518 ? -14.401 7.133   -35.247  1.00 66.65  ? 512 PRO A CG    1 
ATOM   3745 C CD    . PRO A 1 518 ? -14.489 6.000   -36.198  1.00 61.26  ? 512 PRO A CD    1 
ATOM   3746 N N     . GLU A 1 519 ? -17.539 4.330   -34.725  1.00 63.19  ? 513 GLU A N     1 
ATOM   3747 C CA    . GLU A 1 519 ? -18.885 3.763   -34.557  1.00 62.88  ? 513 GLU A CA    1 
ATOM   3748 C C     . GLU A 1 519 ? -18.891 2.337   -33.964  1.00 66.06  ? 513 GLU A C     1 
ATOM   3749 O O     . GLU A 1 519 ? -19.874 1.955   -33.328  1.00 66.08  ? 513 GLU A O     1 
ATOM   3750 C CB    . GLU A 1 519 ? -19.684 3.842   -35.866  1.00 63.77  ? 513 GLU A CB    1 
ATOM   3751 C CG    . GLU A 1 519 ? -19.989 5.258   -36.346  1.00 72.38  ? 513 GLU A CG    1 
ATOM   3752 C CD    . GLU A 1 519 ? -18.869 6.018   -37.039  1.00 84.79  ? 513 GLU A CD    1 
ATOM   3753 O OE1   . GLU A 1 519 ? -17.929 5.369   -37.552  1.00 86.68  ? 513 GLU A OE1   1 
ATOM   3754 O OE2   . GLU A 1 519 ? -18.925 7.268   -37.061  1.00 70.23  ? 513 GLU A OE2   1 
ATOM   3755 N N     . VAL A 1 520 ? -17.796 1.561   -34.158  1.00 61.84  ? 514 VAL A N     1 
ATOM   3756 C CA    . VAL A 1 520 ? -17.651 0.187   -33.641  1.00 61.08  ? 514 VAL A CA    1 
ATOM   3757 C C     . VAL A 1 520 ? -17.395 0.192   -32.135  1.00 63.21  ? 514 VAL A C     1 
ATOM   3758 O O     . VAL A 1 520 ? -16.333 0.657   -31.687  1.00 61.79  ? 514 VAL A O     1 
ATOM   3759 C CB    . VAL A 1 520 ? -16.599 -0.669  -34.427  1.00 63.76  ? 514 VAL A CB    1 
ATOM   3760 C CG1   . VAL A 1 520 ? -16.248 -1.960  -33.680  1.00 63.91  ? 514 VAL A CG1   1 
ATOM   3761 C CG2   . VAL A 1 520 ? -17.095 -0.994  -35.824  1.00 62.73  ? 514 VAL A CG2   1 
ATOM   3762 N N     . SER A 1 521 ? -18.364 -0.347  -31.366  1.00 59.76  ? 515 SER A N     1 
ATOM   3763 C CA    . SER A 1 521 ? -18.283 -0.457  -29.905  1.00 60.22  ? 515 SER A CA    1 
ATOM   3764 C C     . SER A 1 521 ? -18.077 -1.914  -29.455  1.00 65.78  ? 515 SER A C     1 
ATOM   3765 O O     . SER A 1 521 ? -17.905 -2.155  -28.250  1.00 67.16  ? 515 SER A O     1 
ATOM   3766 C CB    . SER A 1 521 ? -19.524 0.131   -29.242  1.00 62.23  ? 515 SER A CB    1 
ATOM   3767 O OG    . SER A 1 521 ? -20.652 -0.703  -29.428  1.00 67.60  ? 515 SER A OG    1 
ATOM   3768 N N     . LEU A 1 522 ? -18.101 -2.882  -30.410  1.00 60.16  ? 516 LEU A N     1 
ATOM   3769 C CA    . LEU A 1 522 ? -17.928 -4.295  -30.083  1.00 59.62  ? 516 LEU A CA    1 
ATOM   3770 C C     . LEU A 1 522 ? -17.171 -5.106  -31.120  1.00 65.74  ? 516 LEU A C     1 
ATOM   3771 O O     . LEU A 1 522 ? -17.524 -5.101  -32.303  1.00 65.88  ? 516 LEU A O     1 
ATOM   3772 C CB    . LEU A 1 522 ? -19.276 -4.979  -29.748  1.00 59.84  ? 516 LEU A CB    1 
ATOM   3773 C CG    . LEU A 1 522 ? -19.227 -6.477  -29.379  1.00 63.34  ? 516 LEU A CG    1 
ATOM   3774 C CD1   . LEU A 1 522 ? -18.554 -6.706  -28.041  1.00 63.22  ? 516 LEU A CD1   1 
ATOM   3775 C CD2   . LEU A 1 522 ? -20.603 -7.076  -29.357  1.00 66.93  ? 516 LEU A CD2   1 
ATOM   3776 N N     . VAL A 1 523 ? -16.158 -5.854  -30.648  1.00 62.20  ? 517 VAL A N     1 
ATOM   3777 C CA    . VAL A 1 523 ? -15.386 -6.798  -31.455  1.00 60.06  ? 517 VAL A CA    1 
ATOM   3778 C C     . VAL A 1 523 ? -15.682 -8.170  -30.848  1.00 65.42  ? 517 VAL A C     1 
ATOM   3779 O O     . VAL A 1 523 ? -15.571 -8.339  -29.625  1.00 66.16  ? 517 VAL A O     1 
ATOM   3780 C CB    . VAL A 1 523 ? -13.869 -6.486  -31.504  1.00 61.51  ? 517 VAL A CB    1 
ATOM   3781 C CG1   . VAL A 1 523 ? -13.096 -7.608  -32.179  1.00 60.50  ? 517 VAL A CG1   1 
ATOM   3782 C CG2   . VAL A 1 523 ? -13.611 -5.183  -32.229  1.00 60.32  ? 517 VAL A CG2   1 
ATOM   3783 N N     . ALA A 1 524 ? -16.105 -9.126  -31.689  1.00 61.39  ? 518 ALA A N     1 
ATOM   3784 C CA    . ALA A 1 524 ? -16.378 -10.491 -31.241  1.00 61.56  ? 518 ALA A CA    1 
ATOM   3785 C C     . ALA A 1 524 ? -15.390 -11.464 -31.904  1.00 66.60  ? 518 ALA A C     1 
ATOM   3786 O O     . ALA A 1 524 ? -15.393 -11.625 -33.132  1.00 65.95  ? 518 ALA A O     1 
ATOM   3787 C CB    . ALA A 1 524 ? -17.808 -10.877 -31.547  1.00 62.33  ? 518 ALA A CB    1 
ATOM   3788 N N     . ILE A 1 525 ? -14.518 -12.072 -31.080  1.00 63.55  ? 519 ILE A N     1 
ATOM   3789 C CA    . ILE A 1 525 ? -13.504 -13.023 -31.533  1.00 62.65  ? 519 ILE A CA    1 
ATOM   3790 C C     . ILE A 1 525 ? -14.023 -14.449 -31.308  1.00 68.08  ? 519 ILE A C     1 
ATOM   3791 O O     . ILE A 1 525 ? -13.866 -14.994 -30.214  1.00 68.21  ? 519 ILE A O     1 
ATOM   3792 C CB    . ILE A 1 525 ? -12.111 -12.747 -30.877  1.00 65.21  ? 519 ILE A CB    1 
ATOM   3793 C CG1   . ILE A 1 525 ? -11.679 -11.278 -31.096  1.00 64.70  ? 519 ILE A CG1   1 
ATOM   3794 C CG2   . ILE A 1 525 ? -11.038 -13.713 -31.398  1.00 65.21  ? 519 ILE A CG2   1 
ATOM   3795 C CD1   . ILE A 1 525 ? -10.613 -10.770 -30.168  1.00 70.85  ? 519 ILE A CD1   1 
ATOM   3796 N N     . LEU A 1 526 ? -14.691 -15.025 -32.338  1.00 65.48  ? 520 LEU A N     1 
ATOM   3797 C CA    . LEU A 1 526 ? -15.215 -16.400 -32.321  1.00 66.19  ? 520 LEU A CA    1 
ATOM   3798 C C     . LEU A 1 526 ? -14.015 -17.346 -32.469  1.00 71.84  ? 520 LEU A C     1 
ATOM   3799 O O     . LEU A 1 526 ? -13.124 -17.062 -33.277  1.00 71.08  ? 520 LEU A O     1 
ATOM   3800 C CB    . LEU A 1 526 ? -16.199 -16.612 -33.472  1.00 66.49  ? 520 LEU A CB    1 
ATOM   3801 N N     . ASP A 1 527 ? -13.985 -18.461 -31.698  1.00 70.55  ? 521 ASP A N     1 
ATOM   3802 C CA    . ASP A 1 527 ? -12.891 -19.464 -31.693  1.00 70.84  ? 521 ASP A CA    1 
ATOM   3803 C C     . ASP A 1 527 ? -11.526 -18.833 -31.328  1.00 71.02  ? 521 ASP A C     1 
ATOM   3804 O O     . ASP A 1 527 ? -10.513 -19.066 -31.999  1.00 68.39  ? 521 ASP A O     1 
ATOM   3805 C CB    . ASP A 1 527 ? -12.839 -20.291 -33.012  1.00 73.21  ? 521 ASP A CB    1 
ATOM   3806 C CG    . ASP A 1 527 ? -13.771 -21.503 -33.074  1.00 91.58  ? 521 ASP A CG    1 
ATOM   3807 O OD1   . ASP A 1 527 ? -13.998 -22.146 -32.014  1.00 93.91  ? 521 ASP A OD1   1 
ATOM   3808 O OD2   . ASP A 1 527 ? -14.224 -21.845 -34.189  1.00 100.09 ? 521 ASP A OD2   1 
ATOM   3809 N N     . ALA A 1 528 ? -11.538 -18.024 -30.245  1.00 66.85  ? 522 ALA A N     1 
ATOM   3810 C CA    . ALA A 1 528 ? -10.404 -17.271 -29.702  1.00 65.86  ? 522 ALA A CA    1 
ATOM   3811 C C     . ALA A 1 528 ? -9.235  -18.153 -29.234  1.00 70.04  ? 522 ALA A C     1 
ATOM   3812 O O     . ALA A 1 528 ? -8.075  -17.717 -29.285  1.00 69.31  ? 522 ALA A O     1 
ATOM   3813 C CB    . ALA A 1 528 ? -10.879 -16.385 -28.563  1.00 66.98  ? 522 ALA A CB    1 
ATOM   3814 N N     . ASP A 1 529 ? -9.557  -19.389 -28.773  1.00 66.22  ? 523 ASP A N     1 
ATOM   3815 C CA    . ASP A 1 529 ? -8.637  -20.401 -28.249  1.00 65.34  ? 523 ASP A CA    1 
ATOM   3816 C C     . ASP A 1 529 ? -8.124  -21.370 -29.328  1.00 67.19  ? 523 ASP A C     1 
ATOM   3817 O O     . ASP A 1 529 ? -7.342  -22.265 -29.000  1.00 67.80  ? 523 ASP A O     1 
ATOM   3818 C CB    . ASP A 1 529 ? -9.333  -21.198 -27.135  1.00 68.14  ? 523 ASP A CB    1 
ATOM   3819 C CG    . ASP A 1 529 ? -10.578 -21.967 -27.576  1.00 79.34  ? 523 ASP A CG    1 
ATOM   3820 O OD1   . ASP A 1 529 ? -10.993 -22.897 -26.842  1.00 82.56  ? 523 ASP A OD1   1 
ATOM   3821 O OD2   . ASP A 1 529 ? -11.163 -21.615 -28.638  1.00 81.75  ? 523 ASP A OD2   1 
ATOM   3822 N N     . LYS A 1 530 ? -8.537  -21.203 -30.605  1.00 60.70  ? 524 LYS A N     1 
ATOM   3823 C CA    . LYS A 1 530 ? -8.090  -22.100 -31.683  1.00 58.89  ? 524 LYS A CA    1 
ATOM   3824 C C     . LYS A 1 530 ? -6.757  -21.712 -32.337  1.00 59.91  ? 524 LYS A C     1 
ATOM   3825 O O     . LYS A 1 530 ? -6.408  -20.532 -32.403  1.00 58.37  ? 524 LYS A O     1 
ATOM   3826 C CB    . LYS A 1 530 ? -9.190  -22.329 -32.736  1.00 60.06  ? 524 LYS A CB    1 
ATOM   3827 C CG    . LYS A 1 530 ? -10.474 -23.000 -32.227  1.00 77.46  ? 524 LYS A CG    1 
ATOM   3828 C CD    . LYS A 1 530 ? -10.297 -24.466 -31.787  1.00 89.19  ? 524 LYS A CD    1 
ATOM   3829 C CE    . LYS A 1 530 ? -11.598 -25.141 -31.426  1.00 99.42  ? 524 LYS A CE    1 
ATOM   3830 N NZ    . LYS A 1 530 ? -12.079 -24.722 -30.084  1.00 110.66 ? 524 LYS A NZ    1 
ATOM   3831 N N     . GLU A 1 531 ? -6.018  -22.723 -32.824  1.00 55.47  ? 525 GLU A N     1 
ATOM   3832 C CA    . GLU A 1 531 ? -4.728  -22.556 -33.497  1.00 53.54  ? 525 GLU A CA    1 
ATOM   3833 C C     . GLU A 1 531 ? -4.884  -21.831 -34.863  1.00 55.46  ? 525 GLU A C     1 
ATOM   3834 O O     . GLU A 1 531 ? -5.527  -22.347 -35.779  1.00 54.55  ? 525 GLU A O     1 
ATOM   3835 C CB    . GLU A 1 531 ? -4.031  -23.918 -33.660  1.00 54.56  ? 525 GLU A CB    1 
ATOM   3836 N N     . GLY A 1 532 ? -4.316  -20.636 -34.961  1.00 51.81  ? 526 GLY A N     1 
ATOM   3837 C CA    . GLY A 1 532 ? -4.344  -19.849 -36.183  1.00 51.61  ? 526 GLY A CA    1 
ATOM   3838 C C     . GLY A 1 532 ? -3.485  -18.609 -36.064  1.00 57.28  ? 526 GLY A C     1 
ATOM   3839 O O     . GLY A 1 532 ? -3.294  -18.104 -34.947  1.00 59.59  ? 526 GLY A O     1 
ATOM   3840 N N     . PHE A 1 533 ? -2.986  -18.096 -37.208  1.00 51.40  ? 527 PHE A N     1 
ATOM   3841 C CA    . PHE A 1 533 ? -2.131  -16.914 -37.225  1.00 50.82  ? 527 PHE A CA    1 
ATOM   3842 C C     . PHE A 1 533 ? -2.823  -15.735 -36.552  1.00 57.63  ? 527 PHE A C     1 
ATOM   3843 O O     . PHE A 1 533 ? -2.209  -15.009 -35.760  1.00 57.99  ? 527 PHE A O     1 
ATOM   3844 C CB    . PHE A 1 533 ? -1.740  -16.543 -38.668  1.00 51.64  ? 527 PHE A CB    1 
ATOM   3845 C CG    . PHE A 1 533 ? -0.997  -15.229 -38.761  1.00 52.31  ? 527 PHE A CG    1 
ATOM   3846 C CD1   . PHE A 1 533 ? 0.381   -15.177 -38.583  1.00 54.65  ? 527 PHE A CD1   1 
ATOM   3847 C CD2   . PHE A 1 533 ? -1.684  -14.037 -38.968  1.00 53.72  ? 527 PHE A CD2   1 
ATOM   3848 C CE1   . PHE A 1 533 ? 1.057   -13.966 -38.626  1.00 54.67  ? 527 PHE A CE1   1 
ATOM   3849 C CE2   . PHE A 1 533 ? -1.006  -12.823 -38.999  1.00 55.91  ? 527 PHE A CE2   1 
ATOM   3850 C CZ    . PHE A 1 533 ? 0.361   -12.797 -38.838  1.00 53.81  ? 527 PHE A CZ    1 
ATOM   3851 N N     . LEU A 1 534 ? -4.108  -15.539 -36.899  1.00 54.73  ? 528 LEU A N     1 
ATOM   3852 C CA    . LEU A 1 534 ? -4.933  -14.438 -36.402  1.00 53.43  ? 528 LEU A CA    1 
ATOM   3853 C C     . LEU A 1 534 ? -5.450  -14.686 -34.998  1.00 54.13  ? 528 LEU A C     1 
ATOM   3854 O O     . LEU A 1 534 ? -6.290  -13.928 -34.516  1.00 52.96  ? 528 LEU A O     1 
ATOM   3855 C CB    . LEU A 1 534 ? -6.070  -14.094 -37.383  1.00 53.20  ? 528 LEU A CB    1 
ATOM   3856 C CG    . LEU A 1 534 ? -5.644  -13.618 -38.771  1.00 56.53  ? 528 LEU A CG    1 
ATOM   3857 C CD1   . LEU A 1 534 ? -6.798  -13.676 -39.736  1.00 56.71  ? 528 LEU A CD1   1 
ATOM   3858 C CD2   . LEU A 1 534 ? -4.992  -12.257 -38.716  1.00 56.84  ? 528 LEU A CD2   1 
ATOM   3859 N N     . ARG A 1 535 ? -4.910  -15.730 -34.334  1.00 49.90  ? 529 ARG A N     1 
ATOM   3860 C CA    . ARG A 1 535 ? -5.234  -16.093 -32.963  1.00 50.99  ? 529 ARG A CA    1 
ATOM   3861 C C     . ARG A 1 535 ? -4.010  -16.025 -32.031  1.00 56.23  ? 529 ARG A C     1 
ATOM   3862 O O     . ARG A 1 535 ? -4.111  -16.311 -30.827  1.00 56.65  ? 529 ARG A O     1 
ATOM   3863 C CB    . ARG A 1 535 ? -5.995  -17.431 -32.895  1.00 52.13  ? 529 ARG A CB    1 
ATOM   3864 C CG    . ARG A 1 535 ? -7.440  -17.391 -33.464  1.00 58.90  ? 529 ARG A CG    1 
ATOM   3865 C CD    . ARG A 1 535 ? -8.355  -16.354 -32.790  1.00 53.05  ? 529 ARG A CD    1 
ATOM   3866 N NE    . ARG A 1 535 ? -9.685  -16.239 -33.399  1.00 49.50  ? 529 ARG A NE    1 
ATOM   3867 C CZ    . ARG A 1 535 ? -9.951  -15.565 -34.517  1.00 66.83  ? 529 ARG A CZ    1 
ATOM   3868 N NH1   . ARG A 1 535 ? -8.973  -14.998 -35.209  1.00 63.73  ? 529 ARG A NH1   1 
ATOM   3869 N NH2   . ARG A 1 535 ? -11.195 -15.483 -34.970  1.00 49.71  ? 529 ARG A NH2   1 
ATOM   3870 N N     . SER A 1 536 ? -2.880  -15.537 -32.587  1.00 53.10  ? 530 SER A N     1 
ATOM   3871 C CA    . SER A 1 536 ? -1.598  -15.344 -31.899  1.00 54.10  ? 530 SER A CA    1 
ATOM   3872 C C     . SER A 1 536 ? -1.657  -14.117 -30.982  1.00 59.42  ? 530 SER A C     1 
ATOM   3873 O O     . SER A 1 536 ? -2.478  -13.246 -31.238  1.00 58.49  ? 530 SER A O     1 
ATOM   3874 C CB    . SER A 1 536 ? -0.492  -15.151 -32.930  1.00 57.96  ? 530 SER A CB    1 
ATOM   3875 O OG    . SER A 1 536 ? -0.695  -13.995 -33.730  1.00 67.50  ? 530 SER A OG    1 
ATOM   3876 N N     . GLU A 1 537 ? -0.794  -14.011 -29.938  1.00 57.70  ? 531 GLU A N     1 
ATOM   3877 C CA    . GLU A 1 537 ? -0.779  -12.849 -29.010  1.00 57.14  ? 531 GLU A CA    1 
ATOM   3878 C C     . GLU A 1 537 ? -0.853  -11.498 -29.738  1.00 58.46  ? 531 GLU A C     1 
ATOM   3879 O O     . GLU A 1 537 ? -1.758  -10.708 -29.459  1.00 57.21  ? 531 GLU A O     1 
ATOM   3880 C CB    . GLU A 1 537 ? 0.397   -12.889 -27.992  1.00 59.54  ? 531 GLU A CB    1 
ATOM   3881 C CG    . GLU A 1 537 ? 1.769   -13.246 -28.573  1.00 76.86  ? 531 GLU A CG    1 
ATOM   3882 C CD    . GLU A 1 537 ? 3.018   -12.914 -27.762  1.00 109.84 ? 531 GLU A CD    1 
ATOM   3883 O OE1   . GLU A 1 537 ? 3.853   -13.826 -27.552  1.00 98.58  ? 531 GLU A OE1   1 
ATOM   3884 O OE2   . GLU A 1 537 ? 3.198   -11.727 -27.400  1.00 110.63 ? 531 GLU A OE2   1 
ATOM   3885 N N     . ARG A 1 538 ? 0.026   -11.294 -30.746  1.00 53.99  ? 532 ARG A N     1 
ATOM   3886 C CA    . ARG A 1 538 ? 0.119   -10.056 -31.533  1.00 51.94  ? 532 ARG A CA    1 
ATOM   3887 C C     . ARG A 1 538 ? -1.114  -9.762  -32.358  1.00 52.56  ? 532 ARG A C     1 
ATOM   3888 O O     . ARG A 1 538 ? -1.593  -8.640  -32.305  1.00 51.95  ? 532 ARG A O     1 
ATOM   3889 C CB    . ARG A 1 538 ? 1.397   -10.011 -32.384  1.00 51.22  ? 532 ARG A CB    1 
ATOM   3890 C CG    . ARG A 1 538 ? 2.673   -9.870  -31.569  1.00 56.67  ? 532 ARG A CG    1 
ATOM   3891 C CD    . ARG A 1 538 ? 3.884   -9.951  -32.460  1.00 59.68  ? 532 ARG A CD    1 
ATOM   3892 N NE    . ARG A 1 538 ? 5.126   -9.845  -31.700  1.00 62.33  ? 532 ARG A NE    1 
ATOM   3893 C CZ    . ARG A 1 538 ? 5.775   -10.879 -31.176  1.00 76.95  ? 532 ARG A CZ    1 
ATOM   3894 N NH1   . ARG A 1 538 ? 5.298   -12.111 -31.313  1.00 69.13  ? 532 ARG A NH1   1 
ATOM   3895 N NH2   . ARG A 1 538 ? 6.897   -10.689 -30.502  1.00 62.28  ? 532 ARG A NH2   1 
ATOM   3896 N N     . SER A 1 539 ? -1.648  -10.762 -33.087  1.00 48.07  ? 533 SER A N     1 
ATOM   3897 C CA    . SER A 1 539 ? -2.870  -10.613 -33.877  1.00 47.10  ? 533 SER A CA    1 
ATOM   3898 C C     . SER A 1 539 ? -4.041  -10.252 -32.966  1.00 51.05  ? 533 SER A C     1 
ATOM   3899 O O     . SER A 1 539 ? -4.770  -9.322  -33.290  1.00 51.16  ? 533 SER A O     1 
ATOM   3900 C CB    . SER A 1 539 ? -3.182  -11.886 -34.661  1.00 50.90  ? 533 SER A CB    1 
ATOM   3901 O OG    . SER A 1 539 ? -2.350  -12.074 -35.794  1.00 56.72  ? 533 SER A OG    1 
ATOM   3902 N N     . LEU A 1 540 ? -4.187  -10.935 -31.813  1.00 48.02  ? 534 LEU A N     1 
ATOM   3903 C CA    . LEU A 1 540 ? -5.243  -10.644 -30.841  1.00 48.85  ? 534 LEU A CA    1 
ATOM   3904 C C     . LEU A 1 540 ? -5.177  -9.192  -30.336  1.00 52.33  ? 534 LEU A C     1 
ATOM   3905 O O     . LEU A 1 540 ? -6.208  -8.509  -30.334  1.00 52.11  ? 534 LEU A O     1 
ATOM   3906 C CB    . LEU A 1 540 ? -5.236  -11.625 -29.645  1.00 49.73  ? 534 LEU A CB    1 
ATOM   3907 C CG    . LEU A 1 540 ? -5.663  -13.071 -29.896  1.00 53.25  ? 534 LEU A CG    1 
ATOM   3908 C CD1   . LEU A 1 540 ? -5.529  -13.875 -28.628  1.00 53.99  ? 534 LEU A CD1   1 
ATOM   3909 C CD2   . LEU A 1 540 ? -7.083  -13.171 -30.428  1.00 52.69  ? 534 LEU A CD2   1 
ATOM   3910 N N     . ILE A 1 541 ? -3.974  -8.706  -29.967  1.00 46.97  ? 535 ILE A N     1 
ATOM   3911 C CA    . ILE A 1 541 ? -3.813  -7.326  -29.486  1.00 46.07  ? 535 ILE A CA    1 
ATOM   3912 C C     . ILE A 1 541 ? -4.258  -6.307  -30.547  1.00 48.65  ? 535 ILE A C     1 
ATOM   3913 O O     . ILE A 1 541 ? -4.933  -5.317  -30.230  1.00 47.67  ? 535 ILE A O     1 
ATOM   3914 C CB    . ILE A 1 541 ? -2.394  -7.044  -28.937  1.00 48.82  ? 535 ILE A CB    1 
ATOM   3915 C CG1   . ILE A 1 541 ? -2.087  -7.965  -27.733  1.00 50.07  ? 535 ILE A CG1   1 
ATOM   3916 C CG2   . ILE A 1 541 ? -2.279  -5.587  -28.525  1.00 49.52  ? 535 ILE A CG2   1 
ATOM   3917 C CD1   . ILE A 1 541 ? -0.657  -8.046  -27.289  1.00 55.23  ? 535 ILE A CD1   1 
ATOM   3918 N N     . GLN A 1 542 ? -3.899  -6.582  -31.804  1.00 44.20  ? 536 GLN A N     1 
ATOM   3919 C CA    . GLN A 1 542 ? -4.243  -5.750  -32.948  1.00 42.39  ? 536 GLN A CA    1 
ATOM   3920 C C     . GLN A 1 542 ? -5.761  -5.780  -33.213  1.00 45.19  ? 536 GLN A C     1 
ATOM   3921 O O     . GLN A 1 542 ? -6.326  -4.728  -33.508  1.00 44.76  ? 536 GLN A O     1 
ATOM   3922 C CB    . GLN A 1 542 ? -3.403  -6.149  -34.177  1.00 42.68  ? 536 GLN A CB    1 
ATOM   3923 C CG    . GLN A 1 542 ? -1.890  -5.863  -34.047  1.00 60.82  ? 536 GLN A CG    1 
ATOM   3924 C CD    . GLN A 1 542 ? -1.482  -4.428  -34.332  1.00 99.46  ? 536 GLN A CD    1 
ATOM   3925 O OE1   . GLN A 1 542 ? -0.574  -3.885  -33.694  1.00 97.25  ? 536 GLN A OE1   1 
ATOM   3926 N NE2   . GLN A 1 542 ? -2.101  -3.783  -35.329  1.00 100.01 ? 536 GLN A NE2   1 
ATOM   3927 N N     . THR A 1 543 ? -6.418  -6.964  -33.036  1.00 41.64  ? 537 THR A N     1 
ATOM   3928 C CA    . THR A 1 543 ? -7.868  -7.184  -33.190  1.00 41.76  ? 537 THR A CA    1 
ATOM   3929 C C     . THR A 1 543 ? -8.628  -6.418  -32.106  1.00 49.92  ? 537 THR A C     1 
ATOM   3930 O O     . THR A 1 543 ? -9.647  -5.782  -32.410  1.00 48.97  ? 537 THR A O     1 
ATOM   3931 C CB    . THR A 1 543 ? -8.221  -8.678  -33.118  1.00 44.16  ? 537 THR A CB    1 
ATOM   3932 O OG1   . THR A 1 543 ? -7.405  -9.410  -34.029  1.00 47.16  ? 537 THR A OG1   1 
ATOM   3933 C CG2   . THR A 1 543 ? -9.681  -8.949  -33.432  1.00 39.14  ? 537 THR A CG2   1 
ATOM   3934 N N     . ILE A 1 544 ? -8.127  -6.485  -30.841  1.00 49.65  ? 538 ILE A N     1 
ATOM   3935 C CA    . ILE A 1 544 ? -8.689  -5.786  -29.679  1.00 51.29  ? 538 ILE A CA    1 
ATOM   3936 C C     . ILE A 1 544 ? -8.709  -4.265  -29.959  1.00 59.32  ? 538 ILE A C     1 
ATOM   3937 O O     . ILE A 1 544 ? -9.721  -3.612  -29.700  1.00 62.13  ? 538 ILE A O     1 
ATOM   3938 C CB    . ILE A 1 544 ? -7.930  -6.169  -28.368  1.00 54.73  ? 538 ILE A CB    1 
ATOM   3939 C CG1   . ILE A 1 544 ? -8.145  -7.645  -27.990  1.00 54.61  ? 538 ILE A CG1   1 
ATOM   3940 C CG2   . ILE A 1 544 ? -8.314  -5.268  -27.199  1.00 56.34  ? 538 ILE A CG2   1 
ATOM   3941 C CD1   . ILE A 1 544 ? -7.011  -8.260  -27.196  1.00 55.62  ? 538 ILE A CD1   1 
ATOM   3942 N N     . GLY A 1 545 ? -7.633  -3.747  -30.556  1.00 55.27  ? 539 GLY A N     1 
ATOM   3943 C CA    . GLY A 1 545 ? -7.498  -2.338  -30.914  1.00 55.26  ? 539 GLY A CA    1 
ATOM   3944 C C     . GLY A 1 545 ? -8.566  -1.762  -31.825  1.00 58.98  ? 539 GLY A C     1 
ATOM   3945 O O     . GLY A 1 545 ? -8.739  -0.541  -31.879  1.00 58.99  ? 539 GLY A O     1 
ATOM   3946 N N     . ARG A 1 546 ? -9.301  -2.630  -32.531  1.00 55.69  ? 540 ARG A N     1 
ATOM   3947 C CA    . ARG A 1 546 ? -10.384 -2.224  -33.430  1.00 55.89  ? 540 ARG A CA    1 
ATOM   3948 C C     . ARG A 1 546 ? -11.626 -1.695  -32.671  1.00 64.00  ? 540 ARG A C     1 
ATOM   3949 O O     . ARG A 1 546 ? -12.518 -1.099  -33.294  1.00 65.21  ? 540 ARG A O     1 
ATOM   3950 C CB    . ARG A 1 546 ? -10.747 -3.359  -34.419  1.00 52.73  ? 540 ARG A CB    1 
ATOM   3951 C CG    . ARG A 1 546 ? -9.560  -3.920  -35.222  1.00 54.06  ? 540 ARG A CG    1 
ATOM   3952 C CD    . ARG A 1 546 ? -8.976  -2.847  -36.090  1.00 62.83  ? 540 ARG A CD    1 
ATOM   3953 N NE    . ARG A 1 546 ? -7.931  -3.312  -36.981  1.00 78.36  ? 540 ARG A NE    1 
ATOM   3954 C CZ    . ARG A 1 546 ? -7.318  -2.532  -37.866  1.00 103.98 ? 540 ARG A CZ    1 
ATOM   3955 N NH1   . ARG A 1 546 ? -7.642  -1.247  -37.967  1.00 85.28  ? 540 ARG A NH1   1 
ATOM   3956 N NH2   . ARG A 1 546 ? -6.371  -3.027  -38.653  1.00 106.87 ? 540 ARG A NH2   1 
ATOM   3957 N N     . ALA A 1 547 ? -11.659 -1.884  -31.327  1.00 61.27  ? 541 ALA A N     1 
ATOM   3958 C CA    . ALA A 1 547 ? -12.741 -1.439  -30.450  1.00 62.14  ? 541 ALA A CA    1 
ATOM   3959 C C     . ALA A 1 547 ? -12.336 -0.227  -29.586  1.00 67.18  ? 541 ALA A C     1 
ATOM   3960 O O     . ALA A 1 547 ? -13.164 0.311   -28.844  1.00 68.23  ? 541 ALA A O     1 
ATOM   3961 C CB    . ALA A 1 547 ? -13.173 -2.589  -29.559  1.00 63.65  ? 541 ALA A CB    1 
ATOM   3962 N N     . ALA A 1 548 ? -11.068 0.201   -29.686  1.00 62.46  ? 542 ALA A N     1 
ATOM   3963 C CA    . ALA A 1 548 ? -10.525 1.298   -28.896  1.00 62.22  ? 542 ALA A CA    1 
ATOM   3964 C C     . ALA A 1 548 ? -10.841 2.744   -29.372  1.00 65.46  ? 542 ALA A C     1 
ATOM   3965 O O     . ALA A 1 548 ? -10.491 3.680   -28.654  1.00 65.84  ? 542 ALA A O     1 
ATOM   3966 C CB    . ALA A 1 548 ? -9.035  1.089   -28.695  1.00 62.51  ? 542 ALA A CB    1 
ATOM   3967 N N     . ARG A 1 549 ? -11.518 2.950   -30.540  1.00 60.89  ? 543 ARG A N     1 
ATOM   3968 C CA    . ARG A 1 549 ? -11.856 4.323   -30.993  1.00 60.17  ? 543 ARG A CA    1 
ATOM   3969 C C     . ARG A 1 549 ? -13.169 4.771   -30.357  1.00 64.50  ? 543 ARG A C     1 
ATOM   3970 O O     . ARG A 1 549 ? -13.571 5.922   -30.526  1.00 64.77  ? 543 ARG A O     1 
ATOM   3971 C CB    . ARG A 1 549 ? -11.943 4.461   -32.537  1.00 58.51  ? 543 ARG A CB    1 
ATOM   3972 C CG    . ARG A 1 549 ? -10.669 4.121   -33.310  1.00 71.48  ? 543 ARG A CG    1 
ATOM   3973 C CD    . ARG A 1 549 ? -9.849  5.302   -33.839  1.00 83.11  ? 543 ARG A CD    1 
ATOM   3974 N NE    . ARG A 1 549 ? -8.543  4.847   -34.358  1.00 89.39  ? 543 ARG A NE    1 
ATOM   3975 C CZ    . ARG A 1 549 ? -7.490  5.630   -34.607  1.00 99.70  ? 543 ARG A CZ    1 
ATOM   3976 N NH1   . ARG A 1 549 ? -7.564  6.941   -34.408  1.00 88.54  ? 543 ARG A NH1   1 
ATOM   3977 N NH2   . ARG A 1 549 ? -6.354  5.105   -35.051  1.00 82.14  ? 543 ARG A NH2   1 
ATOM   3978 N N     . ASN A 1 550 ? -13.831 3.856   -29.623  1.00 61.13  ? 544 ASN A N     1 
ATOM   3979 C CA    . ASN A 1 550 ? -15.123 4.030   -28.974  1.00 61.63  ? 544 ASN A CA    1 
ATOM   3980 C C     . ASN A 1 550 ? -14.996 4.089   -27.455  1.00 67.41  ? 544 ASN A C     1 
ATOM   3981 O O     . ASN A 1 550 ? -14.301 3.272   -26.852  1.00 66.54  ? 544 ASN A O     1 
ATOM   3982 C CB    . ASN A 1 550 ? -15.995 2.874   -29.374  1.00 60.43  ? 544 ASN A CB    1 
ATOM   3983 C CG    . ASN A 1 550 ? -17.441 3.100   -29.130  1.00 69.72  ? 544 ASN A CG    1 
ATOM   3984 O OD1   . ASN A 1 550 ? -17.944 2.866   -28.029  1.00 60.93  ? 544 ASN A OD1   1 
ATOM   3985 N ND2   . ASN A 1 550 ? -18.138 3.528   -30.169  1.00 57.19  ? 544 ASN A ND2   1 
ATOM   3986 N N     . ALA A 1 551 ? -15.669 5.075   -26.842  1.00 67.10  ? 545 ALA A N     1 
ATOM   3987 C CA    . ALA A 1 551 ? -15.673 5.319   -25.396  1.00 68.58  ? 545 ALA A CA    1 
ATOM   3988 C C     . ALA A 1 551 ? -16.235 4.156   -24.587  1.00 73.93  ? 545 ALA A C     1 
ATOM   3989 O O     . ALA A 1 551 ? -15.852 4.000   -23.431  1.00 74.82  ? 545 ALA A O     1 
ATOM   3990 C CB    . ALA A 1 551 ? -16.435 6.597   -25.084  1.00 70.46  ? 545 ALA A CB    1 
ATOM   3991 N N     . GLU A 1 552 ? -17.143 3.351   -25.186  1.00 70.64  ? 546 GLU A N     1 
ATOM   3992 C CA    . GLU A 1 552 ? -17.754 2.172   -24.557  1.00 70.94  ? 546 GLU A CA    1 
ATOM   3993 C C     . GLU A 1 552 ? -17.306 0.885   -25.296  1.00 73.41  ? 546 GLU A C     1 
ATOM   3994 O O     . GLU A 1 552 ? -18.071 -0.074  -25.413  1.00 73.92  ? 546 GLU A O     1 
ATOM   3995 C CB    . GLU A 1 552 ? -19.283 2.306   -24.524  1.00 72.43  ? 546 GLU A CB    1 
ATOM   3996 N N     . GLY A 1 553 ? -16.053 0.886   -25.761  1.00 68.02  ? 547 GLY A N     1 
ATOM   3997 C CA    . GLY A 1 553 ? -15.445 -0.222  -26.492  1.00 66.49  ? 547 GLY A CA    1 
ATOM   3998 C C     . GLY A 1 553 ? -15.265 -1.479  -25.673  1.00 71.12  ? 547 GLY A C     1 
ATOM   3999 O O     . GLY A 1 553 ? -14.648 -1.440  -24.598  1.00 72.83  ? 547 GLY A O     1 
ATOM   4000 N N     . ARG A 1 554 ? -15.767 -2.614  -26.201  1.00 65.36  ? 548 ARG A N     1 
ATOM   4001 C CA    . ARG A 1 554 ? -15.671 -3.920  -25.546  1.00 64.40  ? 548 ARG A CA    1 
ATOM   4002 C C     . ARG A 1 554 ? -15.317 -5.027  -26.527  1.00 66.46  ? 548 ARG A C     1 
ATOM   4003 O O     . ARG A 1 554 ? -15.642 -4.955  -27.713  1.00 64.74  ? 548 ARG A O     1 
ATOM   4004 C CB    . ARG A 1 554 ? -16.956 -4.249  -24.806  1.00 65.99  ? 548 ARG A CB    1 
ATOM   4005 N N     . VAL A 1 555 ? -14.612 -6.038  -26.023  1.00 63.02  ? 549 VAL A N     1 
ATOM   4006 C CA    . VAL A 1 555 ? -14.173 -7.197  -26.783  1.00 61.81  ? 549 VAL A CA    1 
ATOM   4007 C C     . VAL A 1 555 ? -14.720 -8.456  -26.095  1.00 65.91  ? 549 VAL A C     1 
ATOM   4008 O O     . VAL A 1 555 ? -14.634 -8.573  -24.865  1.00 66.39  ? 549 VAL A O     1 
ATOM   4009 C CB    . VAL A 1 555 ? -12.622 -7.214  -26.923  1.00 65.14  ? 549 VAL A CB    1 
ATOM   4010 C CG1   . VAL A 1 555 ? -12.104 -8.573  -27.401  1.00 64.58  ? 549 VAL A CG1   1 
ATOM   4011 C CG2   . VAL A 1 555 ? -12.134 -6.097  -27.849  1.00 63.90  ? 549 VAL A CG2   1 
ATOM   4012 N N     . ILE A 1 556 ? -15.324 -9.367  -26.892  1.00 61.21  ? 550 ILE A N     1 
ATOM   4013 C CA    . ILE A 1 556 ? -15.834 -10.653 -26.414  1.00 60.94  ? 550 ILE A CA    1 
ATOM   4014 C C     . ILE A 1 556 ? -15.063 -11.774 -27.097  1.00 64.81  ? 550 ILE A C     1 
ATOM   4015 O O     . ILE A 1 556 ? -15.066 -11.880 -28.334  1.00 62.51  ? 550 ILE A O     1 
ATOM   4016 C CB    . ILE A 1 556 ? -17.371 -10.847 -26.512  1.00 63.68  ? 550 ILE A CB    1 
ATOM   4017 C CG1   . ILE A 1 556 ? -18.128 -9.781  -25.714  1.00 64.40  ? 550 ILE A CG1   1 
ATOM   4018 C CG2   . ILE A 1 556 ? -17.760 -12.240 -26.034  1.00 64.19  ? 550 ILE A CG2   1 
ATOM   4019 C CD1   . ILE A 1 556 ? -19.595 -9.671  -26.077  1.00 71.72  ? 550 ILE A CD1   1 
ATOM   4020 N N     . MET A 1 557 ? -14.399 -12.605 -26.271  1.00 63.05  ? 551 MET A N     1 
ATOM   4021 C CA    . MET A 1 557 ? -13.629 -13.756 -26.726  1.00 62.81  ? 551 MET A CA    1 
ATOM   4022 C C     . MET A 1 557 ? -14.428 -15.010 -26.429  1.00 70.70  ? 551 MET A C     1 
ATOM   4023 O O     . MET A 1 557 ? -14.771 -15.254 -25.270  1.00 73.02  ? 551 MET A O     1 
ATOM   4024 C CB    . MET A 1 557 ? -12.260 -13.805 -26.039  1.00 64.85  ? 551 MET A CB    1 
ATOM   4025 C CG    . MET A 1 557 ? -11.348 -12.670 -26.430  1.00 67.43  ? 551 MET A CG    1 
ATOM   4026 S SD    . MET A 1 557 ? -9.616  -13.056 -26.111  1.00 71.72  ? 551 MET A SD    1 
ATOM   4027 C CE    . MET A 1 557 ? -8.865  -11.482 -26.439  1.00 67.34  ? 551 MET A CE    1 
ATOM   4028 N N     . TYR A 1 558 ? -14.780 -15.775 -27.478  1.00 67.28  ? 552 TYR A N     1 
ATOM   4029 C CA    . TYR A 1 558 ? -15.530 -17.022 -27.345  1.00 68.07  ? 552 TYR A CA    1 
ATOM   4030 C C     . TYR A 1 558 ? -14.552 -18.178 -27.411  1.00 72.30  ? 552 TYR A C     1 
ATOM   4031 O O     . TYR A 1 558 ? -13.996 -18.487 -28.468  1.00 70.76  ? 552 TYR A O     1 
ATOM   4032 C CB    . TYR A 1 558 ? -16.629 -17.128 -28.403  1.00 69.25  ? 552 TYR A CB    1 
ATOM   4033 C CG    . TYR A 1 558 ? -17.765 -16.149 -28.199  1.00 72.06  ? 552 TYR A CG    1 
ATOM   4034 C CD1   . TYR A 1 558 ? -17.969 -15.092 -29.084  1.00 73.27  ? 552 TYR A CD1   1 
ATOM   4035 C CD2   . TYR A 1 558 ? -18.636 -16.274 -27.120  1.00 74.22  ? 552 TYR A CD2   1 
ATOM   4036 C CE1   . TYR A 1 558 ? -19.014 -14.181 -28.901  1.00 74.15  ? 552 TYR A CE1   1 
ATOM   4037 C CE2   . TYR A 1 558 ? -19.678 -15.366 -26.922  1.00 75.74  ? 552 TYR A CE2   1 
ATOM   4038 C CZ    . TYR A 1 558 ? -19.871 -14.325 -27.821  1.00 80.70  ? 552 TYR A CZ    1 
ATOM   4039 O OH    . TYR A 1 558 ? -20.896 -13.427 -27.627  1.00 78.36  ? 552 TYR A OH    1 
ATOM   4040 N N     . ALA A 1 559 ? -14.290 -18.768 -26.243  1.00 71.18  ? 553 ALA A N     1 
ATOM   4041 C CA    . ALA A 1 559 ? -13.324 -19.839 -26.048  1.00 71.68  ? 553 ALA A CA    1 
ATOM   4042 C C     . ALA A 1 559 ? -13.691 -20.701 -24.839  1.00 77.86  ? 553 ALA A C     1 
ATOM   4043 O O     . ALA A 1 559 ? -14.373 -20.217 -23.927  1.00 78.73  ? 553 ALA A O     1 
ATOM   4044 C CB    . ALA A 1 559 ? -11.954 -19.217 -25.821  1.00 71.78  ? 553 ALA A CB    1 
ATOM   4045 N N     . ASP A 1 560 ? -13.196 -21.960 -24.804  1.00 74.93  ? 554 ASP A N     1 
ATOM   4046 C CA    . ASP A 1 560 ? -13.407 -22.870 -23.666  1.00 76.18  ? 554 ASP A CA    1 
ATOM   4047 C C     . ASP A 1 560 ? -12.190 -22.846 -22.726  1.00 80.13  ? 554 ASP A C     1 
ATOM   4048 O O     . ASP A 1 560 ? -12.361 -22.856 -21.506  1.00 81.29  ? 554 ASP A O     1 
ATOM   4049 C CB    . ASP A 1 560 ? -13.715 -24.287 -24.143  1.00 77.21  ? 554 ASP A CB    1 
ATOM   4050 N N     . LYS A 1 561 ? -10.979 -22.728 -23.299  1.00 74.66  ? 555 LYS A N     1 
ATOM   4051 C CA    . LYS A 1 561 ? -9.701  -22.655 -22.587  1.00 74.51  ? 555 LYS A CA    1 
ATOM   4052 C C     . LYS A 1 561 ? -9.087  -21.279 -22.745  1.00 78.73  ? 555 LYS A C     1 
ATOM   4053 O O     . LYS A 1 561 ? -9.354  -20.609 -23.743  1.00 78.23  ? 555 LYS A O     1 
ATOM   4054 C CB    . LYS A 1 561 ? -8.725  -23.716 -23.139  1.00 76.33  ? 555 LYS A CB    1 
ATOM   4055 C CG    . LYS A 1 561 ? -8.745  -23.874 -24.656  1.00 82.58  ? 555 LYS A CG    1 
ATOM   4056 C CD    . LYS A 1 561 ? -7.739  -24.871 -25.190  1.00 90.75  ? 555 LYS A CD    1 
ATOM   4057 C CE    . LYS A 1 561 ? -7.938  -25.037 -26.677  1.00 100.17 ? 555 LYS A CE    1 
ATOM   4058 N NZ    . LYS A 1 561 ? -6.721  -25.555 -27.354  1.00 107.70 ? 555 LYS A NZ    1 
ATOM   4059 N N     . ILE A 1 562 ? -8.241  -20.863 -21.796  1.00 76.25  ? 556 ILE A N     1 
ATOM   4060 C CA    . ILE A 1 562 ? -7.512  -19.593 -21.919  1.00 75.47  ? 556 ILE A CA    1 
ATOM   4061 C C     . ILE A 1 562 ? -6.106  -19.950 -22.387  1.00 79.48  ? 556 ILE A C     1 
ATOM   4062 O O     . ILE A 1 562 ? -5.348  -20.555 -21.619  1.00 82.05  ? 556 ILE A O     1 
ATOM   4063 C CB    . ILE A 1 562 ? -7.496  -18.738 -20.618  1.00 79.49  ? 556 ILE A CB    1 
ATOM   4064 C CG1   . ILE A 1 562 ? -8.905  -18.543 -20.009  1.00 81.20  ? 556 ILE A CG1   1 
ATOM   4065 C CG2   . ILE A 1 562 ? -6.759  -17.410 -20.807  1.00 78.25  ? 556 ILE A CG2   1 
ATOM   4066 C CD1   . ILE A 1 562 ? -10.017 -17.984 -20.922  1.00 87.08  ? 556 ILE A CD1   1 
ATOM   4067 N N     . THR A 1 563 ? -5.771  -19.608 -23.644  1.00 72.26  ? 557 THR A N     1 
ATOM   4068 C CA    . THR A 1 563 ? -4.464  -19.911 -24.242  1.00 71.09  ? 557 THR A CA    1 
ATOM   4069 C C     . THR A 1 563 ? -3.371  -18.954 -23.767  1.00 73.13  ? 557 THR A C     1 
ATOM   4070 O O     . THR A 1 563 ? -3.698  -17.867 -23.293  1.00 72.96  ? 557 THR A O     1 
ATOM   4071 C CB    . THR A 1 563 ? -4.576  -19.938 -25.769  1.00 80.72  ? 557 THR A CB    1 
ATOM   4072 O OG1   . THR A 1 563 ? -4.871  -18.626 -26.251  1.00 82.23  ? 557 THR A OG1   1 
ATOM   4073 C CG2   . THR A 1 563 ? -5.619  -20.927 -26.259  1.00 78.54  ? 557 THR A CG2   1 
ATOM   4074 N N     . LYS A 1 564 ? -2.071  -19.335 -23.904  1.00 68.63  ? 558 LYS A N     1 
ATOM   4075 C CA    . LYS A 1 564 ? -0.967  -18.435 -23.522  1.00 67.96  ? 558 LYS A CA    1 
ATOM   4076 C C     . LYS A 1 564 ? -1.117  -17.132 -24.319  1.00 71.30  ? 558 LYS A C     1 
ATOM   4077 O O     . LYS A 1 564 ? -1.059  -16.052 -23.731  1.00 71.71  ? 558 LYS A O     1 
ATOM   4078 C CB    . LYS A 1 564 ? 0.395   -19.075 -23.780  1.00 68.59  ? 558 LYS A CB    1 
ATOM   4079 N N     . SER A 1 565 ? -1.453  -17.253 -25.624  1.00 66.15  ? 559 SER A N     1 
ATOM   4080 C CA    . SER A 1 565 ? -1.726  -16.147 -26.537  1.00 64.30  ? 559 SER A CA    1 
ATOM   4081 C C     . SER A 1 565 ? -2.787  -15.209 -25.955  1.00 67.02  ? 559 SER A C     1 
ATOM   4082 O O     . SER A 1 565 ? -2.529  -14.010 -25.853  1.00 67.13  ? 559 SER A O     1 
ATOM   4083 C CB    . SER A 1 565 ? -2.187  -16.679 -27.891  1.00 67.45  ? 559 SER A CB    1 
ATOM   4084 O OG    . SER A 1 565 ? -1.150  -17.409 -28.519  1.00 79.78  ? 559 SER A OG    1 
ATOM   4085 N N     . MET A 1 566 ? -3.949  -15.764 -25.527  1.00 61.88  ? 560 MET A N     1 
ATOM   4086 C CA    . MET A 1 566 ? -5.062  -15.013 -24.947  1.00 61.06  ? 560 MET A CA    1 
ATOM   4087 C C     . MET A 1 566 ? -4.678  -14.316 -23.664  1.00 61.71  ? 560 MET A C     1 
ATOM   4088 O O     . MET A 1 566 ? -5.015  -13.151 -23.505  1.00 60.72  ? 560 MET A O     1 
ATOM   4089 C CB    . MET A 1 566 ? -6.254  -15.913 -24.670  1.00 64.69  ? 560 MET A CB    1 
ATOM   4090 C CG    . MET A 1 566 ? -7.162  -16.117 -25.836  1.00 68.59  ? 560 MET A CG    1 
ATOM   4091 S SD    . MET A 1 566 ? -8.199  -17.553 -25.482  1.00 75.85  ? 560 MET A SD    1 
ATOM   4092 C CE    . MET A 1 566 ? -9.422  -16.813 -24.369  1.00 73.65  ? 560 MET A CE    1 
ATOM   4093 N N     . GLU A 1 567 ? -3.978  -15.016 -22.759  1.00 57.62  ? 561 GLU A N     1 
ATOM   4094 C CA    . GLU A 1 567 ? -3.548  -14.480 -21.470  1.00 58.47  ? 561 GLU A CA    1 
ATOM   4095 C C     . GLU A 1 567 ? -2.689  -13.239 -21.641  1.00 61.87  ? 561 GLU A C     1 
ATOM   4096 O O     . GLU A 1 567 ? -2.998  -12.220 -21.028  1.00 62.89  ? 561 GLU A O     1 
ATOM   4097 C CB    . GLU A 1 567 ? -2.796  -15.533 -20.674  1.00 60.62  ? 561 GLU A CB    1 
ATOM   4098 N N     . ILE A 1 568 ? -1.660  -13.301 -22.516  1.00 55.84  ? 562 ILE A N     1 
ATOM   4099 C CA    . ILE A 1 568 ? -0.748  -12.191 -22.820  1.00 53.81  ? 562 ILE A CA    1 
ATOM   4100 C C     . ILE A 1 568 ? -1.535  -10.959 -23.292  1.00 55.64  ? 562 ILE A C     1 
ATOM   4101 O O     . ILE A 1 568 ? -1.335  -9.870  -22.745  1.00 55.21  ? 562 ILE A O     1 
ATOM   4102 C CB    . ILE A 1 568 ? 0.302   -12.641 -23.872  1.00 55.45  ? 562 ILE A CB    1 
ATOM   4103 C CG1   . ILE A 1 568 ? 1.274   -13.673 -23.281  1.00 56.00  ? 562 ILE A CG1   1 
ATOM   4104 C CG2   . ILE A 1 568 ? 1.055   -11.436 -24.458  1.00 55.41  ? 562 ILE A CG2   1 
ATOM   4105 C CD1   . ILE A 1 568 ? 1.889   -14.587 -24.291  1.00 55.28  ? 562 ILE A CD1   1 
ATOM   4106 N N     . ALA A 1 569 ? -2.432  -11.156 -24.300  1.00 50.18  ? 563 ALA A N     1 
ATOM   4107 C CA    . ALA A 1 569 ? -3.293  -10.138 -24.901  1.00 48.88  ? 563 ALA A CA    1 
ATOM   4108 C C     . ALA A 1 569 ? -4.188  -9.501  -23.839  1.00 53.63  ? 563 ALA A C     1 
ATOM   4109 O O     . ALA A 1 569 ? -4.200  -8.277  -23.693  1.00 52.44  ? 563 ALA A O     1 
ATOM   4110 C CB    . ALA A 1 569 ? -4.134  -10.757 -26.008  1.00 48.79  ? 563 ALA A CB    1 
ATOM   4111 N N     . ILE A 1 570 ? -4.881  -10.344 -23.059  1.00 52.24  ? 564 ILE A N     1 
ATOM   4112 C CA    . ILE A 1 570 ? -5.762  -9.939  -21.960  1.00 53.18  ? 564 ILE A CA    1 
ATOM   4113 C C     . ILE A 1 570 ? -4.992  -9.105  -20.927  1.00 58.24  ? 564 ILE A C     1 
ATOM   4114 O O     . ILE A 1 570 ? -5.475  -8.040  -20.524  1.00 57.88  ? 564 ILE A O     1 
ATOM   4115 C CB    . ILE A 1 570 ? -6.491  -11.191 -21.382  1.00 56.56  ? 564 ILE A CB    1 
ATOM   4116 C CG1   . ILE A 1 570 ? -7.728  -11.534 -22.258  1.00 55.89  ? 564 ILE A CG1   1 
ATOM   4117 C CG2   . ILE A 1 570 ? -6.867  -11.024 -19.919  1.00 57.96  ? 564 ILE A CG2   1 
ATOM   4118 C CD1   . ILE A 1 570 ? -8.098  -13.000 -22.409  1.00 57.86  ? 564 ILE A CD1   1 
ATOM   4119 N N     . ASN A 1 571 ? -3.768  -9.553  -20.577  1.00 56.15  ? 565 ASN A N     1 
ATOM   4120 C CA    . ASN A 1 571 ? -2.896  -8.866  -19.616  1.00 57.38  ? 565 ASN A CA    1 
ATOM   4121 C C     . ASN A 1 571 ? -2.323  -7.548  -20.130  1.00 60.57  ? 565 ASN A C     1 
ATOM   4122 O O     . ASN A 1 571 ? -2.382  -6.564  -19.395  1.00 61.81  ? 565 ASN A O     1 
ATOM   4123 C CB    . ASN A 1 571 ? -1.810  -9.787  -19.042  1.00 57.72  ? 565 ASN A CB    1 
ATOM   4124 C CG    . ASN A 1 571 ? -2.357  -10.943 -18.225  1.00 78.74  ? 565 ASN A CG    1 
ATOM   4125 O OD1   . ASN A 1 571 ? -3.481  -10.909 -17.702  1.00 71.80  ? 565 ASN A OD1   1 
ATOM   4126 N ND2   . ASN A 1 571 ? -1.577  -12.009 -18.109  1.00 70.90  ? 565 ASN A ND2   1 
ATOM   4127 N N     . GLU A 1 572 ? -1.805  -7.508  -21.380  1.00 54.36  ? 566 GLU A N     1 
ATOM   4128 C CA    . GLU A 1 572 ? -1.260  -6.280  -21.969  1.00 53.52  ? 566 GLU A CA    1 
ATOM   4129 C C     . GLU A 1 572 ? -2.327  -5.188  -22.044  1.00 56.75  ? 566 GLU A C     1 
ATOM   4130 O O     . GLU A 1 572 ? -2.034  -4.015  -21.787  1.00 56.05  ? 566 GLU A O     1 
ATOM   4131 C CB    . GLU A 1 572 ? -0.642  -6.544  -23.354  1.00 53.80  ? 566 GLU A CB    1 
ATOM   4132 C CG    . GLU A 1 572 ? 0.038   -5.345  -24.013  1.00 68.21  ? 566 GLU A CG    1 
ATOM   4133 C CD    . GLU A 1 572 ? 1.215   -4.652  -23.339  1.00 101.52 ? 566 GLU A CD    1 
ATOM   4134 O OE1   . GLU A 1 572 ? 1.537   -4.972  -22.169  1.00 103.84 ? 566 GLU A OE1   1 
ATOM   4135 O OE2   . GLU A 1 572 ? 1.813   -3.769  -23.997  1.00 98.07  ? 566 GLU A OE2   1 
ATOM   4136 N N     . THR A 1 573 ? -3.569  -5.592  -22.352  1.00 52.95  ? 567 THR A N     1 
ATOM   4137 C CA    . THR A 1 573 ? -4.708  -4.691  -22.425  1.00 52.62  ? 567 THR A CA    1 
ATOM   4138 C C     . THR A 1 573 ? -4.995  -4.147  -21.023  1.00 57.34  ? 567 THR A C     1 
ATOM   4139 O O     . THR A 1 573 ? -5.117  -2.925  -20.881  1.00 57.08  ? 567 THR A O     1 
ATOM   4140 C CB    . THR A 1 573 ? -5.891  -5.368  -23.128  1.00 62.42  ? 567 THR A CB    1 
ATOM   4141 O OG1   . THR A 1 573 ? -5.438  -5.870  -24.388  1.00 62.54  ? 567 THR A OG1   1 
ATOM   4142 C CG2   . THR A 1 573 ? -7.076  -4.421  -23.349  1.00 60.97  ? 567 THR A CG2   1 
ATOM   4143 N N     . LYS A 1 574 ? -5.021  -5.032  -19.981  1.00 53.88  ? 568 LYS A N     1 
ATOM   4144 C CA    . LYS A 1 574 ? -5.243  -4.600  -18.592  1.00 54.55  ? 568 LYS A CA    1 
ATOM   4145 C C     . LYS A 1 574 ? -4.227  -3.510  -18.226  1.00 58.42  ? 568 LYS A C     1 
ATOM   4146 O O     . LYS A 1 574 ? -4.642  -2.411  -17.845  1.00 58.39  ? 568 LYS A O     1 
ATOM   4147 C CB    . LYS A 1 574 ? -5.156  -5.777  -17.624  1.00 56.12  ? 568 LYS A CB    1 
ATOM   4148 N N     . ARG A 1 575 ? -2.911  -3.777  -18.484  1.00 54.24  ? 569 ARG A N     1 
ATOM   4149 C CA    . ARG A 1 575 ? -1.765  -2.879  -18.253  1.00 53.60  ? 569 ARG A CA    1 
ATOM   4150 C C     . ARG A 1 575 ? -2.026  -1.512  -18.855  1.00 56.28  ? 569 ARG A C     1 
ATOM   4151 O O     . ARG A 1 575 ? -2.136  -0.528  -18.116  1.00 57.15  ? 569 ARG A O     1 
ATOM   4152 C CB    . ARG A 1 575 ? -0.454  -3.483  -18.819  1.00 50.54  ? 569 ARG A CB    1 
ATOM   4153 C CG    . ARG A 1 575 ? 0.772   -2.614  -18.549  1.00 57.35  ? 569 ARG A CG    1 
ATOM   4154 C CD    . ARG A 1 575 ? 2.070   -3.166  -19.104  1.00 67.58  ? 569 ARG A CD    1 
ATOM   4155 N NE    . ARG A 1 575 ? 2.238   -2.924  -20.539  1.00 86.04  ? 569 ARG A NE    1 
ATOM   4156 C CZ    . ARG A 1 575 ? 2.635   -1.772  -21.080  1.00 105.88 ? 569 ARG A CZ    1 
ATOM   4157 N NH1   . ARG A 1 575 ? 2.882   -0.719  -20.313  1.00 97.79  ? 569 ARG A NH1   1 
ATOM   4158 N NH2   . ARG A 1 575 ? 2.756   -1.659  -22.398  1.00 90.36  ? 569 ARG A NH2   1 
ATOM   4159 N N     . ARG A 1 576 ? -2.134  -1.459  -20.183  1.00 50.28  ? 570 ARG A N     1 
ATOM   4160 C CA    . ARG A 1 576 ? -2.404  -0.229  -20.900  1.00 49.70  ? 570 ARG A CA    1 
ATOM   4161 C C     . ARG A 1 576 ? -3.681  0.491   -20.384  1.00 55.36  ? 570 ARG A C     1 
ATOM   4162 O O     . ARG A 1 576 ? -3.552  1.621   -19.898  1.00 55.63  ? 570 ARG A O     1 
ATOM   4163 C CB    . ARG A 1 576 ? -2.421  -0.481  -22.420  1.00 48.43  ? 570 ARG A CB    1 
ATOM   4164 C CG    . ARG A 1 576 ? -1.057  -0.872  -22.983  1.00 53.22  ? 570 ARG A CG    1 
ATOM   4165 C CD    . ARG A 1 576 ? -1.177  -1.888  -24.084  1.00 54.42  ? 570 ARG A CD    1 
ATOM   4166 N NE    . ARG A 1 576 ? -1.090  -1.272  -25.401  1.00 62.75  ? 570 ARG A NE    1 
ATOM   4167 C CZ    . ARG A 1 576 ? -0.327  -1.722  -26.396  1.00 78.85  ? 570 ARG A CZ    1 
ATOM   4168 N NH1   . ARG A 1 576 ? 0.418   -2.812  -26.234  1.00 50.22  ? 570 ARG A NH1   1 
ATOM   4169 N NH2   . ARG A 1 576 ? -0.313  -1.095  -27.564  1.00 79.68  ? 570 ARG A NH2   1 
ATOM   4170 N N     . ARG A 1 577 ? -4.867  -0.192  -20.374  1.00 52.54  ? 571 ARG A N     1 
ATOM   4171 C CA    . ARG A 1 577 ? -6.144  0.392   -19.920  1.00 53.82  ? 571 ARG A CA    1 
ATOM   4172 C C     . ARG A 1 577 ? -6.005  1.092   -18.569  1.00 62.99  ? 571 ARG A C     1 
ATOM   4173 O O     . ARG A 1 577 ? -6.563  2.177   -18.385  1.00 63.24  ? 571 ARG A O     1 
ATOM   4174 C CB    . ARG A 1 577 ? -7.264  -0.657  -19.870  1.00 52.69  ? 571 ARG A CB    1 
ATOM   4175 C CG    . ARG A 1 577 ? -8.643  -0.072  -19.589  1.00 59.80  ? 571 ARG A CG    1 
ATOM   4176 C CD    . ARG A 1 577 ? -9.721  -1.131  -19.615  1.00 71.82  ? 571 ARG A CD    1 
ATOM   4177 N NE    . ARG A 1 577 ? -10.983 -0.630  -19.070  1.00 82.84  ? 571 ARG A NE    1 
ATOM   4178 C CZ    . ARG A 1 577 ? -11.949 -0.066  -19.786  1.00 95.62  ? 571 ARG A CZ    1 
ATOM   4179 N NH1   . ARG A 1 577 ? -11.809 0.089   -21.095  1.00 84.67  ? 571 ARG A NH1   1 
ATOM   4180 N NH2   . ARG A 1 577 ? -13.062 0.344   -19.199  1.00 85.51  ? 571 ARG A NH2   1 
ATOM   4181 N N     . GLU A 1 578 ? -5.239  0.473   -17.642  1.00 63.32  ? 572 GLU A N     1 
ATOM   4182 C CA    . GLU A 1 578 ? -4.955  0.990   -16.299  1.00 66.00  ? 572 GLU A CA    1 
ATOM   4183 C C     . GLU A 1 578 ? -4.108  2.293   -16.368  1.00 71.02  ? 572 GLU A C     1 
ATOM   4184 O O     . GLU A 1 578 ? -4.526  3.319   -15.809  1.00 70.85  ? 572 GLU A O     1 
ATOM   4185 C CB    . GLU A 1 578 ? -4.278  -0.102  -15.441  1.00 68.52  ? 572 GLU A CB    1 
ATOM   4186 C CG    . GLU A 1 578 ? -3.896  0.314   -14.022  1.00 88.11  ? 572 GLU A CG    1 
ATOM   4187 C CD    . GLU A 1 578 ? -2.415  0.502   -13.722  1.00 124.65 ? 572 GLU A CD    1 
ATOM   4188 O OE1   . GLU A 1 578 ? -2.079  1.454   -12.978  1.00 123.12 ? 572 GLU A OE1   1 
ATOM   4189 O OE2   . GLU A 1 578 ? -1.596  -0.327  -14.185  1.00 125.72 ? 572 GLU A OE2   1 
ATOM   4190 N N     . GLN A 1 579 ? -2.952  2.260   -17.095  1.00 67.66  ? 573 GLN A N     1 
ATOM   4191 C CA    . GLN A 1 579 ? -2.054  3.418   -17.255  1.00 67.75  ? 573 GLN A CA    1 
ATOM   4192 C C     . GLN A 1 579 ? -2.822  4.633   -17.748  1.00 70.71  ? 573 GLN A C     1 
ATOM   4193 O O     . GLN A 1 579 ? -2.641  5.733   -17.215  1.00 71.45  ? 573 GLN A O     1 
ATOM   4194 C CB    . GLN A 1 579 ? -0.878  3.123   -18.219  1.00 67.90  ? 573 GLN A CB    1 
ATOM   4195 C CG    . GLN A 1 579 ? 0.079   1.995   -17.810  1.00 90.66  ? 573 GLN A CG    1 
ATOM   4196 C CD    . GLN A 1 579 ? 0.520   2.016   -16.363  1.00 122.29 ? 573 GLN A CD    1 
ATOM   4197 O OE1   . GLN A 1 579 ? 1.049   3.009   -15.845  1.00 122.00 ? 573 GLN A OE1   1 
ATOM   4198 N NE2   . GLN A 1 579 ? 0.326   0.897   -15.685  1.00 116.47 ? 573 GLN A NE2   1 
ATOM   4199 N N     . GLN A 1 580 ? -3.698  4.409   -18.747  1.00 64.95  ? 574 GLN A N     1 
ATOM   4200 C CA    . GLN A 1 580 ? -4.552  5.417   -19.364  1.00 64.37  ? 574 GLN A CA    1 
ATOM   4201 C C     . GLN A 1 580 ? -5.577  5.962   -18.373  1.00 71.14  ? 574 GLN A C     1 
ATOM   4202 O O     . GLN A 1 580 ? -5.742  7.185   -18.278  1.00 70.87  ? 574 GLN A O     1 
ATOM   4203 C CB    . GLN A 1 580 ? -5.240  4.838   -20.604  1.00 63.77  ? 574 GLN A CB    1 
ATOM   4204 C CG    . GLN A 1 580 ? -4.287  4.653   -21.773  1.00 71.29  ? 574 GLN A CG    1 
ATOM   4205 C CD    . GLN A 1 580 ? -4.441  3.341   -22.513  1.00 80.04  ? 574 GLN A CD    1 
ATOM   4206 O OE1   . GLN A 1 580 ? -5.485  2.662   -22.466  1.00 70.64  ? 574 GLN A OE1   1 
ATOM   4207 N NE2   . GLN A 1 580 ? -3.399  2.984   -23.261  1.00 68.13  ? 574 GLN A NE2   1 
ATOM   4208 N N     . GLU A 1 581 ? -6.237  5.058   -17.609  1.00 69.57  ? 575 GLU A N     1 
ATOM   4209 C CA    . GLU A 1 581 ? -7.233  5.425   -16.592  1.00 70.95  ? 575 GLU A CA    1 
ATOM   4210 C C     . GLU A 1 581 ? -6.613  6.305   -15.489  1.00 74.24  ? 575 GLU A C     1 
ATOM   4211 O O     . GLU A 1 581 ? -7.260  7.258   -15.043  1.00 73.45  ? 575 GLU A O     1 
ATOM   4212 C CB    . GLU A 1 581 ? -7.895  4.173   -16.004  1.00 73.00  ? 575 GLU A CB    1 
ATOM   4213 C CG    . GLU A 1 581 ? -9.099  3.702   -16.804  1.00 85.60  ? 575 GLU A CG    1 
ATOM   4214 C CD    . GLU A 1 581 ? -9.678  2.343   -16.457  1.00 126.56 ? 575 GLU A CD    1 
ATOM   4215 O OE1   . GLU A 1 581 ? -8.895  1.396   -16.208  1.00 132.13 ? 575 GLU A OE1   1 
ATOM   4216 O OE2   . GLU A 1 581 ? -10.924 2.208   -16.505  1.00 128.18 ? 575 GLU A OE2   1 
ATOM   4217 N N     . ARG A 1 582 ? -5.339  5.998   -15.101  1.00 70.45  ? 576 ARG A N     1 
ATOM   4218 C CA    . ARG A 1 582 ? -4.528  6.712   -14.104  1.00 71.52  ? 576 ARG A CA    1 
ATOM   4219 C C     . ARG A 1 582 ? -4.134  8.127   -14.590  1.00 75.11  ? 576 ARG A C     1 
ATOM   4220 O O     . ARG A 1 582 ? -4.075  9.061   -13.794  1.00 75.65  ? 576 ARG A O     1 
ATOM   4221 C CB    . ARG A 1 582 ? -3.285  5.900   -13.765  1.00 72.20  ? 576 ARG A CB    1 
ATOM   4222 N N     . PHE A 1 583 ? -3.877  8.279   -15.888  1.00 70.84  ? 577 PHE A N     1 
ATOM   4223 C CA    . PHE A 1 583 ? -3.536  9.551   -16.509  1.00 70.51  ? 577 PHE A CA    1 
ATOM   4224 C C     . PHE A 1 583 ? -4.802  10.413  -16.614  1.00 76.12  ? 577 PHE A C     1 
ATOM   4225 O O     . PHE A 1 583 ? -4.720  11.625  -16.424  1.00 75.95  ? 577 PHE A O     1 
ATOM   4226 C CB    . PHE A 1 583 ? -2.928  9.295   -17.893  1.00 70.24  ? 577 PHE A CB    1 
ATOM   4227 C CG    . PHE A 1 583 ? -2.507  10.520  -18.671  1.00 71.48  ? 577 PHE A CG    1 
ATOM   4228 C CD1   . PHE A 1 583 ? -1.168  10.870  -18.773  1.00 74.52  ? 577 PHE A CD1   1 
ATOM   4229 C CD2   . PHE A 1 583 ? -3.447  11.291  -19.355  1.00 73.12  ? 577 PHE A CD2   1 
ATOM   4230 C CE1   . PHE A 1 583 ? -0.776  11.974  -19.534  1.00 75.02  ? 577 PHE A CE1   1 
ATOM   4231 C CE2   . PHE A 1 583 ? -3.057  12.413  -20.087  1.00 75.39  ? 577 PHE A CE2   1 
ATOM   4232 C CZ    . PHE A 1 583 ? -1.723  12.737  -20.185  1.00 73.56  ? 577 PHE A CZ    1 
ATOM   4233 N N     . ASN A 1 584 ? -5.959  9.790   -16.933  1.00 74.56  ? 578 ASN A N     1 
ATOM   4234 C CA    . ASN A 1 584 ? -7.266  10.455  -17.042  1.00 76.19  ? 578 ASN A CA    1 
ATOM   4235 C C     . ASN A 1 584 ? -7.758  10.984  -15.676  1.00 85.56  ? 578 ASN A C     1 
ATOM   4236 O O     . ASN A 1 584 ? -8.552  11.929  -15.636  1.00 85.98  ? 578 ASN A O     1 
ATOM   4237 C CB    . ASN A 1 584 ? -8.299  9.504   -17.651  1.00 76.32  ? 578 ASN A CB    1 
ATOM   4238 C CG    . ASN A 1 584 ? -8.281  9.409   -19.159  1.00 101.04 ? 578 ASN A CG    1 
ATOM   4239 O OD1   . ASN A 1 584 ? -7.413  9.961   -19.851  1.00 102.89 ? 578 ASN A OD1   1 
ATOM   4240 N ND2   . ASN A 1 584 ? -9.258  8.702   -19.707  1.00 86.97  ? 578 ASN A ND2   1 
ATOM   4241 N N     . GLU A 1 585 ? -7.285  10.363  -14.564  1.00 84.84  ? 579 GLU A N     1 
ATOM   4242 C CA    . GLU A 1 585 ? -7.568  10.764  -13.184  1.00 87.70  ? 579 GLU A CA    1 
ATOM   4243 C C     . GLU A 1 585 ? -6.765  12.038  -12.866  1.00 94.34  ? 579 GLU A C     1 
ATOM   4244 O O     . GLU A 1 585 ? -7.339  13.041  -12.437  1.00 95.33  ? 579 GLU A O     1 
ATOM   4245 C CB    . GLU A 1 585 ? -7.155  9.655   -12.206  1.00 90.12  ? 579 GLU A CB    1 
ATOM   4246 C CG    . GLU A 1 585 ? -8.126  8.495   -12.111  1.00 107.26 ? 579 GLU A CG    1 
ATOM   4247 C CD    . GLU A 1 585 ? -7.662  7.353   -11.224  1.00 142.28 ? 579 GLU A CD    1 
ATOM   4248 O OE1   . GLU A 1 585 ? -7.539  7.569   -9.995   1.00 152.11 ? 579 GLU A OE1   1 
ATOM   4249 O OE2   . GLU A 1 585 ? -7.450  6.234   -11.751  1.00 132.71 ? 579 GLU A OE2   1 
ATOM   4250 N N     . GLU A 1 586 ? -5.436  11.991  -13.101  1.00 91.68  ? 580 GLU A N     1 
ATOM   4251 C CA    . GLU A 1 586 ? -4.470  13.074  -12.883  1.00 93.30  ? 580 GLU A CA    1 
ATOM   4252 C C     . GLU A 1 586 ? -4.726  14.349  -13.696  1.00 100.71 ? 580 GLU A C     1 
ATOM   4253 O O     . GLU A 1 586 ? -4.260  15.423  -13.297  1.00 102.48 ? 580 GLU A O     1 
ATOM   4254 C CB    . GLU A 1 586 ? -3.042  12.563  -13.116  1.00 93.76  ? 580 GLU A CB    1 
ATOM   4255 C CG    . GLU A 1 586 ? -2.438  11.961  -11.857  1.00 104.19 ? 580 GLU A CG    1 
ATOM   4256 C CD    . GLU A 1 586 ? -1.329  10.940  -12.029  1.00 115.51 ? 580 GLU A CD    1 
ATOM   4257 O OE1   . GLU A 1 586 ? -0.513  11.090  -12.968  1.00 97.49  ? 580 GLU A OE1   1 
ATOM   4258 O OE2   . GLU A 1 586 ? -1.254  10.010  -11.192  1.00 107.87 ? 580 GLU A OE2   1 
ATOM   4259 N N     . HIS A 1 587 ? -5.460  14.235  -14.828  1.00 97.23  ? 581 HIS A N     1 
ATOM   4260 C CA    . HIS A 1 587 ? -5.793  15.354  -15.722  1.00 97.08  ? 581 HIS A CA    1 
ATOM   4261 C C     . HIS A 1 587 ? -7.317  15.665  -15.803  1.00 103.22 ? 581 HIS A C     1 
ATOM   4262 O O     . HIS A 1 587 ? -7.713  16.588  -16.522  1.00 102.21 ? 581 HIS A O     1 
ATOM   4263 C CB    . HIS A 1 587 ? -5.187  15.126  -17.122  1.00 95.36  ? 581 HIS A CB    1 
ATOM   4264 C CG    . HIS A 1 587 ? -3.695  15.000  -17.150  1.00 98.19  ? 581 HIS A CG    1 
ATOM   4265 N ND1   . HIS A 1 587 ? -3.033  13.988  -16.467  1.00 99.94  ? 581 HIS A ND1   1 
ATOM   4266 C CD2   . HIS A 1 587 ? -2.785  15.733  -17.830  1.00 99.31  ? 581 HIS A CD2   1 
ATOM   4267 C CE1   . HIS A 1 587 ? -1.748  14.160  -16.724  1.00 99.05  ? 581 HIS A CE1   1 
ATOM   4268 N NE2   . HIS A 1 587 ? -1.548  15.196  -17.542  1.00 98.98  ? 581 HIS A NE2   1 
ATOM   4269 N N     . GLY A 1 588 ? -8.131  14.910  -15.053  1.00 102.59 ? 582 GLY A N     1 
ATOM   4270 C CA    . GLY A 1 588 ? -9.583  15.068  -14.974  1.00 104.47 ? 582 GLY A CA    1 
ATOM   4271 C C     . GLY A 1 588 ? -10.295 14.990  -16.309  1.00 110.30 ? 582 GLY A C     1 
ATOM   4272 O O     . GLY A 1 588 ? -11.000 15.928  -16.696  1.00 110.21 ? 582 GLY A O     1 
ATOM   4273 N N     . ILE A 1 589 ? -10.080 13.873  -17.033  1.00 107.95 ? 583 ILE A N     1 
ATOM   4274 C CA    . ILE A 1 589 ? -10.648 13.645  -18.367  1.00 107.02 ? 583 ILE A CA    1 
ATOM   4275 C C     . ILE A 1 589 ? -11.718 12.535  -18.380  1.00 114.92 ? 583 ILE A C     1 
ATOM   4276 O O     . ILE A 1 589 ? -11.566 11.508  -17.706  1.00 114.43 ? 583 ILE A O     1 
ATOM   4277 C CB    . ILE A 1 589 ? -9.556  13.405  -19.469  1.00 107.30 ? 583 ILE A CB    1 
ATOM   4278 C CG1   . ILE A 1 589 ? -8.236  14.158  -19.191  1.00 107.44 ? 583 ILE A CG1   1 
ATOM   4279 C CG2   . ILE A 1 589 ? -10.098 13.738  -20.867  1.00 106.36 ? 583 ILE A CG2   1 
ATOM   4280 C CD1   . ILE A 1 589 ? -7.012  13.555  -19.866  1.00 110.46 ? 583 ILE A CD1   1 
ATOM   4281 N N     . THR A 1 590 ? -12.807 12.777  -19.149  1.00 113.98 ? 584 THR A N     1 
ATOM   4282 C CA    . THR A 1 590 ? -13.899 11.851  -19.443  1.00 114.32 ? 584 THR A CA    1 
ATOM   4283 C C     . THR A 1 590 ? -13.827 11.636  -20.972  1.00 120.35 ? 584 THR A C     1 
ATOM   4284 O O     . THR A 1 590 ? -13.999 12.600  -21.730  1.00 119.73 ? 584 THR A O     1 
ATOM   4285 C CB    . THR A 1 590 ? -15.252 12.368  -18.929  1.00 118.47 ? 584 THR A CB    1 
ATOM   4286 O OG1   . THR A 1 590 ? -15.198 12.438  -17.504  1.00 119.29 ? 584 THR A OG1   1 
ATOM   4287 C CG2   . THR A 1 590 ? -16.417 11.475  -19.345  1.00 113.44 ? 584 THR A CG2   1 
ATOM   4288 N N     . PRO A 1 591 ? -13.489 10.405  -21.435  1.00 118.31 ? 585 PRO A N     1 
ATOM   4289 C CA    . PRO A 1 591 ? -13.354 10.182  -22.883  1.00 117.25 ? 585 PRO A CA    1 
ATOM   4290 C C     . PRO A 1 591 ? -14.686 10.225  -23.638  1.00 122.52 ? 585 PRO A C     1 
ATOM   4291 O O     . PRO A 1 591 ? -15.710 9.761   -23.130  1.00 122.22 ? 585 PRO A O     1 
ATOM   4292 C CB    . PRO A 1 591 ? -12.654 8.817   -22.969  1.00 117.89 ? 585 PRO A CB    1 
ATOM   4293 C CG    . PRO A 1 591 ? -12.258 8.462   -21.555  1.00 123.02 ? 585 PRO A CG    1 
ATOM   4294 C CD    . PRO A 1 591 ? -13.216 9.165   -20.683  1.00 120.00 ? 585 PRO A CD    1 
ATOM   4295 N N     . LYS A 1 592 ? -14.663 10.820  -24.842  1.00 119.94 ? 586 LYS A N     1 
ATOM   4296 C CA    . LYS A 1 592 ? -15.825 10.954  -25.719  1.00 120.43 ? 586 LYS A CA    1 
ATOM   4297 C C     . LYS A 1 592 ? -15.495 10.355  -27.099  1.00 124.21 ? 586 LYS A C     1 
ATOM   4298 O O     . LYS A 1 592 ? -14.461 10.685  -27.682  1.00 122.27 ? 586 LYS A O     1 
ATOM   4299 C CB    . LYS A 1 592 ? -16.229 12.416  -25.836  1.00 122.21 ? 586 LYS A CB    1 
ATOM   4300 N N     . THR A 1 593 ? -16.360 9.411   -27.555  1.00 122.15 ? 587 THR A N     1 
ATOM   4301 C CA    . THR A 1 593 ? -16.332 8.550   -28.758  1.00 121.15 ? 587 THR A CA    1 
ATOM   4302 C C     . THR A 1 593 ? -15.577 9.040   -30.040  1.00 127.52 ? 587 THR A C     1 
ATOM   4303 O O     . THR A 1 593 ? -14.355 8.868   -30.101  1.00 127.31 ? 587 THR A O     1 
ATOM   4304 C CB    . THR A 1 593 ? -17.720 7.905   -28.994  1.00 123.00 ? 587 THR A CB    1 
ATOM   4305 O OG1   . THR A 1 593 ? -18.184 7.314   -27.779  1.00 119.17 ? 587 THR A OG1   1 
ATOM   4306 C CG2   . THR A 1 593 ? -17.705 6.843   -30.075  1.00 119.56 ? 587 THR A CG2   1 
ATOM   4307 N N     . ILE A 1 594 ? -16.294 9.593   -31.067  1.00 125.29 ? 588 ILE A N     1 
ATOM   4308 C CA    . ILE A 1 594 ? -15.737 10.025  -32.371  1.00 124.28 ? 588 ILE A CA    1 
ATOM   4309 C C     . ILE A 1 594 ? -14.766 11.231  -32.346  1.00 129.40 ? 588 ILE A C     1 
ATOM   4310 O O     . ILE A 1 594 ? -14.526 11.839  -33.397  1.00 128.76 ? 588 ILE A O     1 
ATOM   4311 C CB    . ILE A 1 594 ? -16.898 10.349  -33.331  1.00 20.00  ? 588 ILE A CB    1 
ATOM   4312 N N     . ASN A 1 595 ? -14.179 11.532  -31.149  1.00 126.69 ? 589 ASN A N     1 
ATOM   4313 C CA    . ASN A 1 595 ? -13.243 12.621  -30.816  1.00 126.55 ? 589 ASN A CA    1 
ATOM   4314 C C     . ASN A 1 595 ? -13.899 14.017  -30.778  1.00 130.92 ? 589 ASN A C     1 
ATOM   4315 O O     . ASN A 1 595 ? -15.099 14.133  -31.047  1.00 130.94 ? 589 ASN A O     1 
ATOM   4316 C CB    . ASN A 1 595 ? -12.011 12.599  -31.719  1.00 126.01 ? 589 ASN A CB    1 
ATOM   4317 N N     . LYS A 1 596 ? -13.113 15.060  -30.397  1.00 127.53 ? 590 LYS A N     1 
ATOM   4318 C CA    . LYS A 1 596 ? -13.510 16.474  -30.254  1.00 141.70 ? 590 LYS A CA    1 
ATOM   4319 C C     . LYS A 1 596 ? -14.723 16.691  -29.339  1.00 136.63 ? 590 LYS A C     1 
ATOM   4320 O O     . LYS A 1 596 ? -14.924 15.947  -28.376  1.00 76.04  ? 590 LYS A O     1 
ATOM   4321 C CB    . LYS A 1 596 ? -13.737 17.122  -31.616  1.00 141.90 ? 590 LYS A CB    1 
ATOM   4322 N N     . ASP B 1 9   ? -35.657 -19.028 -73.840  1.00 106.96 ? 3   ASP B N     1 
ATOM   4323 C CA    . ASP B 1 9   ? -36.429 -19.096 -72.596  1.00 107.98 ? 3   ASP B CA    1 
ATOM   4324 C C     . ASP B 1 9   ? -36.944 -17.693 -72.170  1.00 110.15 ? 3   ASP B C     1 
ATOM   4325 O O     . ASP B 1 9   ? -36.618 -16.690 -72.822  1.00 108.61 ? 3   ASP B O     1 
ATOM   4326 C CB    . ASP B 1 9   ? -35.596 -19.771 -71.473  1.00 109.89 ? 3   ASP B CB    1 
ATOM   4327 C CG    . ASP B 1 9   ? -36.397 -20.386 -70.326  1.00 118.91 ? 3   ASP B CG    1 
ATOM   4328 O OD1   . ASP B 1 9   ? -37.187 -21.331 -70.586  1.00 119.30 ? 3   ASP B OD1   1 
ATOM   4329 O OD2   . ASP B 1 9   ? -36.197 -19.955 -69.162  1.00 124.14 ? 3   ASP B OD2   1 
ATOM   4330 N N     . ARG B 1 10  ? -37.766 -17.642 -71.090  1.00 105.56 ? 4   ARG B N     1 
ATOM   4331 C CA    . ARG B 1 10  ? -38.378 -16.432 -70.533  1.00 103.24 ? 4   ARG B CA    1 
ATOM   4332 C C     . ARG B 1 10  ? -37.579 -15.811 -69.370  1.00 102.25 ? 4   ARG B C     1 
ATOM   4333 O O     . ARG B 1 10  ? -36.850 -16.513 -68.664  1.00 101.57 ? 4   ARG B O     1 
ATOM   4334 C CB    . ARG B 1 10  ? -39.801 -16.740 -70.064  1.00 20.00  ? 4   ARG B CB    1 
ATOM   4335 N N     . PHE B 1 11  ? -37.729 -14.482 -69.186  1.00 95.35  ? 5   PHE B N     1 
ATOM   4336 C CA    . PHE B 1 11  ? -37.100 -13.689 -68.127  1.00 92.78  ? 5   PHE B CA    1 
ATOM   4337 C C     . PHE B 1 11  ? -37.866 -13.873 -66.811  1.00 97.59  ? 5   PHE B C     1 
ATOM   4338 O O     . PHE B 1 11  ? -39.075 -13.627 -66.767  1.00 98.57  ? 5   PHE B O     1 
ATOM   4339 C CB    . PHE B 1 11  ? -37.081 -12.193 -68.514  1.00 92.35  ? 5   PHE B CB    1 
ATOM   4340 C CG    . PHE B 1 11  ? -35.993 -11.760 -69.469  1.00 91.39  ? 5   PHE B CG    1 
ATOM   4341 C CD1   . PHE B 1 11  ? -36.305 -11.332 -70.751  1.00 93.87  ? 5   PHE B CD1   1 
ATOM   4342 C CD2   . PHE B 1 11  ? -34.655 -11.756 -69.075  1.00 91.30  ? 5   PHE B CD2   1 
ATOM   4343 C CE1   . PHE B 1 11  ? -35.295 -10.934 -71.635  1.00 92.98  ? 5   PHE B CE1   1 
ATOM   4344 C CE2   . PHE B 1 11  ? -33.647 -11.357 -69.956  1.00 92.04  ? 5   PHE B CE2   1 
ATOM   4345 C CZ    . PHE B 1 11  ? -33.973 -10.936 -71.225  1.00 90.15  ? 5   PHE B CZ    1 
ATOM   4346 N N     . GLU B 1 12  ? -37.170 -14.306 -65.744  1.00 93.71  ? 6   GLU B N     1 
ATOM   4347 C CA    . GLU B 1 12  ? -37.769 -14.522 -64.421  1.00 94.74  ? 6   GLU B CA    1 
ATOM   4348 C C     . GLU B 1 12  ? -37.311 -13.400 -63.486  1.00 95.60  ? 6   GLU B C     1 
ATOM   4349 O O     . GLU B 1 12  ? -36.132 -13.357 -63.112  1.00 93.86  ? 6   GLU B O     1 
ATOM   4350 C CB    . GLU B 1 12  ? -37.423 -15.926 -63.861  1.00 97.41  ? 6   GLU B CB    1 
ATOM   4351 N N     . LEU B 1 13  ? -38.237 -12.457 -63.174  1.00 90.38  ? 7   LEU B N     1 
ATOM   4352 C CA    . LEU B 1 13  ? -37.988 -11.296 -62.317  1.00 87.94  ? 7   LEU B CA    1 
ATOM   4353 C C     . LEU B 1 13  ? -38.166 -11.660 -60.847  1.00 92.40  ? 7   LEU B C     1 
ATOM   4354 O O     . LEU B 1 13  ? -39.266 -11.984 -60.393  1.00 94.07  ? 7   LEU B O     1 
ATOM   4355 C CB    . LEU B 1 13  ? -38.880 -10.120 -62.721  1.00 87.96  ? 7   LEU B CB    1 
ATOM   4356 N N     . VAL B 1 14  ? -37.054 -11.646 -60.118  1.00 88.11  ? 8   VAL B N     1 
ATOM   4357 C CA    . VAL B 1 14  ? -36.981 -11.996 -58.704  1.00 89.73  ? 8   VAL B CA    1 
ATOM   4358 C C     . VAL B 1 14  ? -36.911 -10.745 -57.819  1.00 96.51  ? 8   VAL B C     1 
ATOM   4359 O O     . VAL B 1 14  ? -35.840 -10.152 -57.631  1.00 94.57  ? 8   VAL B O     1 
ATOM   4360 C CB    . VAL B 1 14  ? -35.827 -12.990 -58.439  1.00 93.06  ? 8   VAL B CB    1 
ATOM   4361 C CG1   . VAL B 1 14  ? -35.770 -13.389 -56.969  1.00 94.31  ? 8   VAL B CG1   1 
ATOM   4362 C CG2   . VAL B 1 14  ? -35.958 -14.226 -59.324  1.00 93.61  ? 8   VAL B CG2   1 
ATOM   4363 N N     . SER B 1 15  ? -38.076 -10.352 -57.283  1.00 97.01  ? 9   SER B N     1 
ATOM   4364 C CA    . SER B 1 15  ? -38.209 -9.194  -56.406  1.00 97.49  ? 9   SER B CA    1 
ATOM   4365 C C     . SER B 1 15  ? -39.151 -9.494  -55.252  1.00 106.89 ? 9   SER B C     1 
ATOM   4366 O O     . SER B 1 15  ? -40.142 -10.211 -55.432  1.00 108.05 ? 9   SER B O     1 
ATOM   4367 C CB    . SER B 1 15  ? -38.721 -7.999  -57.196  1.00 96.78  ? 9   SER B CB    1 
ATOM   4368 N N     . LYS B 1 16  ? -38.832 -8.951  -54.062  1.00 105.91 ? 10  LYS B N     1 
ATOM   4369 C CA    . LYS B 1 16  ? -39.671 -9.086  -52.869  1.00 108.80 ? 10  LYS B CA    1 
ATOM   4370 C C     . LYS B 1 16  ? -40.738 -7.988  -52.899  1.00 113.72 ? 10  LYS B C     1 
ATOM   4371 O O     . LYS B 1 16  ? -41.812 -8.171  -52.324  1.00 115.31 ? 10  LYS B O     1 
ATOM   4372 C CB    . LYS B 1 16  ? -38.833 -8.980  -51.583  1.00 111.97 ? 10  LYS B CB    1 
ATOM   4373 N N     . TYR B 1 17  ? -40.439 -6.854  -53.593  1.00 108.61 ? 11  TYR B N     1 
ATOM   4374 C CA    . TYR B 1 17  ? -41.322 -5.689  -53.741  1.00 108.02 ? 11  TYR B CA    1 
ATOM   4375 C C     . TYR B 1 17  ? -42.286 -5.760  -54.941  1.00 111.02 ? 11  TYR B C     1 
ATOM   4376 O O     . TYR B 1 17  ? -42.016 -6.458  -55.925  1.00 110.06 ? 11  TYR B O     1 
ATOM   4377 C CB    . TYR B 1 17  ? -40.511 -4.378  -53.777  1.00 106.80 ? 11  TYR B CB    1 
ATOM   4378 N N     . GLN B 1 18  ? -43.416 -5.021  -54.834  1.00 107.01 ? 12  GLN B N     1 
ATOM   4379 C CA    . GLN B 1 18  ? -44.457 -4.889  -55.856  1.00 106.57 ? 12  GLN B CA    1 
ATOM   4380 C C     . GLN B 1 18  ? -44.539 -3.406  -56.318  1.00 108.61 ? 12  GLN B C     1 
ATOM   4381 O O     . GLN B 1 18  ? -44.217 -2.527  -55.506  1.00 107.81 ? 12  GLN B O     1 
ATOM   4382 C CB    . GLN B 1 18  ? -45.809 -5.395  -55.325  1.00 110.27 ? 12  GLN B CB    1 
ATOM   4383 N N     . PRO B 1 19  ? -44.929 -3.095  -57.597  1.00 103.38 ? 13  PRO B N     1 
ATOM   4384 C CA    . PRO B 1 19  ? -44.959 -1.687  -58.044  1.00 100.83 ? 13  PRO B CA    1 
ATOM   4385 C C     . PRO B 1 19  ? -45.891 -0.772  -57.265  1.00 102.89 ? 13  PRO B C     1 
ATOM   4386 O O     . PRO B 1 19  ? -47.086 -1.032  -57.145  1.00 103.43 ? 13  PRO B O     1 
ATOM   4387 C CB    . PRO B 1 19  ? -45.336 -1.785  -59.526  1.00 102.29 ? 13  PRO B CB    1 
ATOM   4388 C CG    . PRO B 1 19  ? -44.965 -3.164  -59.919  1.00 107.54 ? 13  PRO B CG    1 
ATOM   4389 C CD    . PRO B 1 19  ? -45.293 -3.994  -58.711  1.00 105.30 ? 13  PRO B CD    1 
ATOM   4390 N N     . GLN B 1 20  ? -45.297 0.291   -56.717  1.00 97.63  ? 14  GLN B N     1 
ATOM   4391 C CA    . GLN B 1 20  ? -45.906 1.333   -55.898  1.00 97.93  ? 14  GLN B CA    1 
ATOM   4392 C C     . GLN B 1 20  ? -45.929 2.639   -56.684  1.00 100.65 ? 14  GLN B C     1 
ATOM   4393 O O     . GLN B 1 20  ? -45.268 2.737   -57.719  1.00 99.17  ? 14  GLN B O     1 
ATOM   4394 C CB    . GLN B 1 20  ? -45.062 1.529   -54.616  1.00 98.95  ? 14  GLN B CB    1 
ATOM   4395 N N     . GLY B 1 21  ? -46.653 3.633   -56.169  1.00 97.63  ? 15  GLY B N     1 
ATOM   4396 C CA    . GLY B 1 21  ? -46.748 4.967   -56.756  1.00 96.21  ? 15  GLY B CA    1 
ATOM   4397 C C     . GLY B 1 21  ? -47.271 4.957   -58.178  1.00 99.19  ? 15  GLY B C     1 
ATOM   4398 O O     . GLY B 1 21  ? -48.330 4.371   -58.439  1.00 100.53 ? 15  GLY B O     1 
ATOM   4399 N N     . ASP B 1 22  ? -46.522 5.582   -59.119  1.00 92.74  ? 16  ASP B N     1 
ATOM   4400 C CA    . ASP B 1 22  ? -46.963 5.578   -60.518  1.00 91.67  ? 16  ASP B CA    1 
ATOM   4401 C C     . ASP B 1 22  ? -46.247 4.591   -61.454  1.00 91.45  ? 16  ASP B C     1 
ATOM   4402 O O     . ASP B 1 22  ? -46.361 4.679   -62.686  1.00 90.36  ? 16  ASP B O     1 
ATOM   4403 C CB    . ASP B 1 22  ? -47.182 6.991   -61.090  1.00 93.19  ? 16  ASP B CB    1 
ATOM   4404 C CG    . ASP B 1 22  ? -46.017 7.963   -61.047  1.00 107.33 ? 16  ASP B CG    1 
ATOM   4405 O OD1   . ASP B 1 22  ? -46.187 9.100   -61.536  1.00 107.70 ? 16  ASP B OD1   1 
ATOM   4406 O OD2   . ASP B 1 22  ? -44.923 7.581   -60.531  1.00 114.46 ? 16  ASP B OD2   1 
ATOM   4407 N N     . GLN B 1 23  ? -45.557 3.606   -60.842  1.00 85.61  ? 17  GLN B N     1 
ATOM   4408 C CA    . GLN B 1 23  ? -44.880 2.524   -61.553  1.00 83.92  ? 17  GLN B CA    1 
ATOM   4409 C C     . GLN B 1 23  ? -45.925 1.633   -62.252  1.00 88.89  ? 17  GLN B C     1 
ATOM   4410 O O     . GLN B 1 23  ? -45.720 1.361   -63.436  1.00 88.03  ? 17  GLN B O     1 
ATOM   4411 C CB    . GLN B 1 23  ? -43.970 1.686   -60.628  1.00 84.59  ? 17  GLN B CB    1 
ATOM   4412 C CG    . GLN B 1 23  ? -42.779 2.438   -60.032  1.00 86.43  ? 17  GLN B CG    1 
ATOM   4413 C CD    . GLN B 1 23  ? -41.945 1.552   -59.143  1.00 98.76  ? 17  GLN B CD    1 
ATOM   4414 O OE1   . GLN B 1 23  ? -42.451 0.822   -58.287  1.00 94.94  ? 17  GLN B OE1   1 
ATOM   4415 N NE2   . GLN B 1 23  ? -40.637 1.603   -59.315  1.00 91.59  ? 17  GLN B NE2   1 
ATOM   4416 N N     . PRO B 1 24  ? -47.072 1.219   -61.619  1.00 86.60  ? 18  PRO B N     1 
ATOM   4417 C CA    . PRO B 1 24  ? -48.028 0.355   -62.349  1.00 87.45  ? 18  PRO B CA    1 
ATOM   4418 C C     . PRO B 1 24  ? -48.585 0.957   -63.643  1.00 90.20  ? 18  PRO B C     1 
ATOM   4419 O O     . PRO B 1 24  ? -48.580 0.269   -64.672  1.00 89.69  ? 18  PRO B O     1 
ATOM   4420 C CB    . PRO B 1 24  ? -49.116 0.067   -61.311  1.00 91.38  ? 18  PRO B CB    1 
ATOM   4421 C CG    . PRO B 1 24  ? -48.452 0.275   -59.996  1.00 95.61  ? 18  PRO B CG    1 
ATOM   4422 C CD    . PRO B 1 24  ? -47.521 1.424   -60.222  1.00 89.06  ? 18  PRO B CD    1 
ATOM   4423 N N     . LYS B 1 25  ? -49.013 2.246   -63.605  1.00 85.55  ? 19  LYS B N     1 
ATOM   4424 C CA    . LYS B 1 25  ? -49.543 2.951   -64.777  1.00 84.65  ? 19  LYS B CA    1 
ATOM   4425 C C     . LYS B 1 25  ? -48.469 3.061   -65.870  1.00 87.69  ? 19  LYS B C     1 
ATOM   4426 O O     . LYS B 1 25  ? -48.765 2.812   -67.043  1.00 88.37  ? 19  LYS B O     1 
ATOM   4427 C CB    . LYS B 1 25  ? -50.065 4.328   -64.383  1.00 85.06  ? 19  LYS B CB    1 
ATOM   4428 N N     . ALA B 1 26  ? -47.210 3.359   -65.473  1.00 82.00  ? 20  ALA B N     1 
ATOM   4429 C CA    . ALA B 1 26  ? -46.068 3.458   -66.386  1.00 79.47  ? 20  ALA B CA    1 
ATOM   4430 C C     . ALA B 1 26  ? -45.821 2.138   -67.161  1.00 82.44  ? 20  ALA B C     1 
ATOM   4431 O O     . ALA B 1 26  ? -45.856 2.149   -68.400  1.00 81.19  ? 20  ALA B O     1 
ATOM   4432 C CB    . ALA B 1 26  ? -44.819 3.880   -65.622  1.00 78.55  ? 20  ALA B CB    1 
ATOM   4433 N N     . ILE B 1 27  ? -45.640 1.002   -66.426  1.00 79.03  ? 21  ILE B N     1 
ATOM   4434 C CA    . ILE B 1 27  ? -45.410 -0.334  -67.009  1.00 78.58  ? 21  ILE B CA    1 
ATOM   4435 C C     . ILE B 1 27  ? -46.528 -0.711  -67.991  1.00 82.84  ? 21  ILE B C     1 
ATOM   4436 O O     . ILE B 1 27  ? -46.220 -1.081  -69.126  1.00 81.45  ? 21  ILE B O     1 
ATOM   4437 C CB    . ILE B 1 27  ? -45.117 -1.475  -65.966  1.00 82.06  ? 21  ILE B CB    1 
ATOM   4438 C CG1   . ILE B 1 27  ? -44.084 -1.051  -64.873  1.00 80.67  ? 21  ILE B CG1   1 
ATOM   4439 C CG2   . ILE B 1 27  ? -44.659 -2.773  -66.688  1.00 82.01  ? 21  ILE B CG2   1 
ATOM   4440 C CD1   . ILE B 1 27  ? -44.329 -1.602  -63.457  1.00 79.33  ? 21  ILE B CD1   1 
ATOM   4441 N N     . GLU B 1 28  ? -47.813 -0.575  -67.571  1.00 80.84  ? 22  GLU B N     1 
ATOM   4442 C CA    . GLU B 1 28  ? -48.957 -0.900  -68.433  1.00 82.33  ? 22  GLU B CA    1 
ATOM   4443 C C     . GLU B 1 28  ? -48.899 -0.127  -69.766  1.00 84.60  ? 22  GLU B C     1 
ATOM   4444 O O     . GLU B 1 28  ? -48.981 -0.749  -70.834  1.00 83.61  ? 22  GLU B O     1 
ATOM   4445 C CB    . GLU B 1 28  ? -50.277 -0.646  -67.707  1.00 85.15  ? 22  GLU B CB    1 
ATOM   4446 N N     . LYS B 1 29  ? -48.666 1.210   -69.695  1.00 80.33  ? 23  LYS B N     1 
ATOM   4447 C CA    . LYS B 1 29  ? -48.580 2.095   -70.865  1.00 78.76  ? 23  LYS B CA    1 
ATOM   4448 C C     . LYS B 1 29  ? -47.389 1.761   -71.795  1.00 79.96  ? 23  LYS B C     1 
ATOM   4449 O O     . LYS B 1 29  ? -47.554 1.789   -73.019  1.00 78.36  ? 23  LYS B O     1 
ATOM   4450 C CB    . LYS B 1 29  ? -48.555 3.564   -70.434  1.00 78.27  ? 23  LYS B CB    1 
ATOM   4451 N N     . LEU B 1 30  ? -46.213 1.410   -71.212  1.00 75.40  ? 24  LEU B N     1 
ATOM   4452 C CA    . LEU B 1 30  ? -45.012 1.076   -71.986  1.00 73.88  ? 24  LEU B CA    1 
ATOM   4453 C C     . LEU B 1 30  ? -45.076 -0.310  -72.633  1.00 80.59  ? 24  LEU B C     1 
ATOM   4454 O O     . LEU B 1 30  ? -44.516 -0.488  -73.720  1.00 80.15  ? 24  LEU B O     1 
ATOM   4455 C CB    . LEU B 1 30  ? -43.743 1.237   -71.147  1.00 72.48  ? 24  LEU B CB    1 
ATOM   4456 N N     . VAL B 1 31  ? -45.754 -1.286  -71.986  1.00 79.44  ? 25  VAL B N     1 
ATOM   4457 C CA    . VAL B 1 31  ? -45.884 -2.648  -72.542  1.00 80.85  ? 25  VAL B CA    1 
ATOM   4458 C C     . VAL B 1 31  ? -46.905 -2.637  -73.693  1.00 86.32  ? 25  VAL B C     1 
ATOM   4459 O O     . VAL B 1 31  ? -46.644 -3.229  -74.747  1.00 86.22  ? 25  VAL B O     1 
ATOM   4460 C CB    . VAL B 1 31  ? -46.153 -3.764  -71.490  1.00 86.08  ? 25  VAL B CB    1 
ATOM   4461 C CG1   . VAL B 1 31  ? -46.166 -5.139  -72.152  1.00 87.07  ? 25  VAL B CG1   1 
ATOM   4462 C CG2   . VAL B 1 31  ? -45.110 -3.750  -70.376  1.00 84.58  ? 25  VAL B CG2   1 
ATOM   4463 N N     . LYS B 1 32  ? -48.034 -1.906  -73.500  1.00 83.63  ? 26  LYS B N     1 
ATOM   4464 C CA    . LYS B 1 32  ? -49.075 -1.717  -74.515  1.00 84.93  ? 26  LYS B CA    1 
ATOM   4465 C C     . LYS B 1 32  ? -48.471 -1.055  -75.771  1.00 89.98  ? 26  LYS B C     1 
ATOM   4466 O O     . LYS B 1 32  ? -48.806 -1.443  -76.884  1.00 90.05  ? 26  LYS B O     1 
ATOM   4467 C CB    . LYS B 1 32  ? -50.214 -0.866  -73.963  1.00 86.41  ? 26  LYS B CB    1 
ATOM   4468 N N     . GLY B 1 33  ? -47.548 -0.110  -75.568  1.00 87.28  ? 27  GLY B N     1 
ATOM   4469 C CA    . GLY B 1 33  ? -46.849 0.598   -76.639  1.00 86.74  ? 27  GLY B CA    1 
ATOM   4470 C C     . GLY B 1 33  ? -46.081 -0.335  -77.552  1.00 92.28  ? 27  GLY B C     1 
ATOM   4471 O O     . GLY B 1 33  ? -46.226 -0.260  -78.775  1.00 92.80  ? 27  GLY B O     1 
ATOM   4472 N N     . ILE B 1 34  ? -45.285 -1.252  -76.949  1.00 88.86  ? 28  ILE B N     1 
ATOM   4473 C CA    . ILE B 1 34  ? -44.505 -2.263  -77.670  1.00 88.61  ? 28  ILE B CA    1 
ATOM   4474 C C     . ILE B 1 34  ? -45.440 -3.199  -78.439  1.00 93.74  ? 28  ILE B C     1 
ATOM   4475 O O     . ILE B 1 34  ? -45.238 -3.402  -79.643  1.00 93.48  ? 28  ILE B O     1 
ATOM   4476 C CB    . ILE B 1 34  ? -43.475 -2.969  -76.738  1.00 91.09  ? 28  ILE B CB    1 
ATOM   4477 C CG1   . ILE B 1 34  ? -42.197 -2.104  -76.651  1.00 89.78  ? 28  ILE B CG1   1 
ATOM   4478 C CG2   . ILE B 1 34  ? -43.123 -4.388  -77.224  1.00 92.43  ? 28  ILE B CG2   1 
ATOM   4479 C CD1   . ILE B 1 34  ? -41.476 -2.149  -75.380  1.00 100.25 ? 28  ILE B CD1   1 
ATOM   4480 N N     . GLN B 1 35  ? -46.498 -3.698  -77.753  1.00 91.67  ? 29  GLN B N     1 
ATOM   4481 C CA    . GLN B 1 35  ? -47.535 -4.573  -78.317  1.00 93.38  ? 29  GLN B CA    1 
ATOM   4482 C C     . GLN B 1 35  ? -48.241 -3.885  -79.495  1.00 97.21  ? 29  GLN B C     1 
ATOM   4483 O O     . GLN B 1 35  ? -48.424 -4.534  -80.524  1.00 98.03  ? 29  GLN B O     1 
ATOM   4484 C CB    . GLN B 1 35  ? -48.557 -5.017  -77.241  1.00 96.22  ? 29  GLN B CB    1 
ATOM   4485 C CG    . GLN B 1 35  ? -47.988 -5.968  -76.174  1.00 111.60 ? 29  GLN B CG    1 
ATOM   4486 C CD    . GLN B 1 35  ? -48.901 -6.252  -74.989  1.00 134.72 ? 29  GLN B CD    1 
ATOM   4487 O OE1   . GLN B 1 35  ? -50.055 -5.803  -74.907  1.00 132.27 ? 29  GLN B OE1   1 
ATOM   4488 N NE2   . GLN B 1 35  ? -48.393 -7.022  -74.032  1.00 125.21 ? 29  GLN B NE2   1 
ATOM   4489 N N     . GLU B 1 36  ? -48.564 -2.556  -79.372  1.00 92.46  ? 30  GLU B N     1 
ATOM   4490 C CA    . GLU B 1 36  ? -49.232 -1.754  -80.415  1.00 92.49  ? 30  GLU B CA    1 
ATOM   4491 C C     . GLU B 1 36  ? -48.299 -1.344  -81.576  1.00 96.12  ? 30  GLU B C     1 
ATOM   4492 O O     . GLU B 1 36  ? -48.728 -0.644  -82.496  1.00 96.67  ? 30  GLU B O     1 
ATOM   4493 C CB    . GLU B 1 36  ? -49.938 -0.537  -79.812  1.00 92.81  ? 30  GLU B CB    1 
ATOM   4494 N N     . GLY B 1 37  ? -47.050 -1.813  -81.534  1.00 91.60  ? 31  GLY B N     1 
ATOM   4495 C CA    . GLY B 1 37  ? -46.052 -1.580  -82.573  1.00 90.34  ? 31  GLY B CA    1 
ATOM   4496 C C     . GLY B 1 37  ? -45.213 -0.322  -82.464  1.00 92.22  ? 31  GLY B C     1 
ATOM   4497 O O     . GLY B 1 37  ? -44.472 -0.016  -83.404  1.00 91.67  ? 31  GLY B O     1 
ATOM   4498 N N     . LYS B 1 38  ? -45.312 0.426   -81.338  1.00 86.70  ? 32  LYS B N     1 
ATOM   4499 C CA    . LYS B 1 38  ? -44.522 1.644   -81.138  1.00 83.86  ? 32  LYS B CA    1 
ATOM   4500 C C     . LYS B 1 38  ? -43.037 1.236   -80.905  1.00 86.42  ? 32  LYS B C     1 
ATOM   4501 O O     . LYS B 1 38  ? -42.803 0.381   -80.063  1.00 87.25  ? 32  LYS B O     1 
ATOM   4502 C CB    . LYS B 1 38  ? -45.068 2.439   -79.957  1.00 84.24  ? 32  LYS B CB    1 
ATOM   4503 N N     . LYS B 1 39  ? -42.035 1.610   -81.721  1.00 80.22  ? 33  LYS B N     1 
ATOM   4504 C CA    . LYS B 1 39  ? -41.773 2.634   -82.724  1.00 78.68  ? 33  LYS B CA    1 
ATOM   4505 C C     . LYS B 1 39  ? -40.556 3.277   -82.013  1.00 78.05  ? 33  LYS B C     1 
ATOM   4506 O O     . LYS B 1 39  ? -39.433 2.798   -82.174  1.00 76.50  ? 33  LYS B O     1 
ATOM   4507 C CB    . LYS B 1 39  ? -42.980 3.616   -82.921  1.00 81.61  ? 33  LYS B CB    1 
ATOM   4508 C CG    . LYS B 1 39  ? -42.755 4.778   -83.893  1.00 81.23  ? 33  LYS B CG    1 
ATOM   4509 C CD    . LYS B 1 39  ? -43.478 6.041   -83.449  1.00 80.53  ? 33  LYS B CD    1 
ATOM   4510 C CE    . LYS B 1 39  ? -42.918 7.261   -84.135  1.00 86.14  ? 33  LYS B CE    1 
ATOM   4511 N NZ    . LYS B 1 39  ? -43.690 8.489   -83.804  1.00 96.46  ? 33  LYS B NZ    1 
ATOM   4512 N N     . HIS B 1 40  ? -40.851 4.211   -81.084  1.00 71.76  ? 34  HIS B N     1 
ATOM   4513 C CA    . HIS B 1 40  ? -40.012 5.010   -80.202  1.00 68.39  ? 34  HIS B CA    1 
ATOM   4514 C C     . HIS B 1 40  ? -40.916 5.325   -78.998  1.00 72.20  ? 34  HIS B C     1 
ATOM   4515 O O     . HIS B 1 40  ? -42.084 5.676   -79.199  1.00 73.40  ? 34  HIS B O     1 
ATOM   4516 C CB    . HIS B 1 40  ? -39.661 6.351   -80.878  1.00 67.68  ? 34  HIS B CB    1 
ATOM   4517 C CG    . HIS B 1 40  ? -38.651 6.266   -81.973  1.00 69.88  ? 34  HIS B CG    1 
ATOM   4518 N ND1   . HIS B 1 40  ? -37.310 6.478   -81.729  1.00 69.68  ? 34  HIS B ND1   1 
ATOM   4519 C CD2   . HIS B 1 40  ? -38.825 6.043   -83.296  1.00 71.96  ? 34  HIS B CD2   1 
ATOM   4520 C CE1   . HIS B 1 40  ? -36.707 6.352   -82.901  1.00 68.74  ? 34  HIS B CE1   1 
ATOM   4521 N NE2   . HIS B 1 40  ? -37.577 6.091   -83.871  1.00 70.47  ? 34  HIS B NE2   1 
ATOM   4522 N N     . GLN B 1 41  ? -40.386 5.225   -77.765  1.00 67.05  ? 35  GLN B N     1 
ATOM   4523 C CA    . GLN B 1 41  ? -41.117 5.505   -76.523  1.00 67.17  ? 35  GLN B CA    1 
ATOM   4524 C C     . GLN B 1 41  ? -40.186 6.147   -75.505  1.00 70.65  ? 35  GLN B C     1 
ATOM   4525 O O     . GLN B 1 41  ? -38.985 5.874   -75.526  1.00 69.73  ? 35  GLN B O     1 
ATOM   4526 C CB    . GLN B 1 41  ? -41.711 4.223   -75.935  1.00 69.66  ? 35  GLN B CB    1 
ATOM   4527 C CG    . GLN B 1 41  ? -42.921 3.696   -76.684  1.00 82.12  ? 35  GLN B CG    1 
ATOM   4528 C CD    . GLN B 1 41  ? -43.468 2.452   -76.047  1.00 96.46  ? 35  GLN B CD    1 
ATOM   4529 O OE1   . GLN B 1 41  ? -44.422 2.503   -75.265  1.00 90.73  ? 35  GLN B OE1   1 
ATOM   4530 N NE2   . GLN B 1 41  ? -42.867 1.306   -76.367  1.00 85.79  ? 35  GLN B NE2   1 
ATOM   4531 N N     . THR B 1 42  ? -40.727 6.995   -74.612  1.00 66.99  ? 36  THR B N     1 
ATOM   4532 C CA    . THR B 1 42  ? -39.933 7.676   -73.589  1.00 64.80  ? 36  THR B CA    1 
ATOM   4533 C C     . THR B 1 42  ? -40.564 7.533   -72.217  1.00 68.03  ? 36  THR B C     1 
ATOM   4534 O O     . THR B 1 42  ? -41.780 7.755   -72.055  1.00 69.21  ? 36  THR B O     1 
ATOM   4535 C CB    . THR B 1 42  ? -39.690 9.145   -73.976  1.00 72.04  ? 36  THR B CB    1 
ATOM   4536 O OG1   . THR B 1 42  ? -38.900 9.178   -75.162  1.00 74.60  ? 36  THR B OG1   1 
ATOM   4537 C CG2   . THR B 1 42  ? -38.982 9.941   -72.889  1.00 69.73  ? 36  THR B CG2   1 
ATOM   4538 N N     . LEU B 1 43  ? -39.717 7.180   -71.229  1.00 61.79  ? 37  LEU B N     1 
ATOM   4539 C CA    . LEU B 1 43  ? -40.088 7.059   -69.832  1.00 61.62  ? 37  LEU B CA    1 
ATOM   4540 C C     . LEU B 1 43  ? -39.575 8.296   -69.078  1.00 67.78  ? 37  LEU B C     1 
ATOM   4541 O O     . LEU B 1 43  ? -38.366 8.430   -68.853  1.00 66.81  ? 37  LEU B O     1 
ATOM   4542 C CB    . LEU B 1 43  ? -39.529 5.755   -69.246  1.00 61.01  ? 37  LEU B CB    1 
ATOM   4543 C CG    . LEU B 1 43  ? -39.595 5.576   -67.722  1.00 65.58  ? 37  LEU B CG    1 
ATOM   4544 C CD1   . LEU B 1 43  ? -41.028 5.629   -67.191  1.00 67.37  ? 37  LEU B CD1   1 
ATOM   4545 C CD2   . LEU B 1 43  ? -38.908 4.298   -67.303  1.00 67.75  ? 37  LEU B CD2   1 
ATOM   4546 N N     . LEU B 1 44  ? -40.488 9.221   -68.726  1.00 66.60  ? 38  LEU B N     1 
ATOM   4547 C CA    . LEU B 1 44  ? -40.096 10.420  -67.997  1.00 66.77  ? 38  LEU B CA    1 
ATOM   4548 C C     . LEU B 1 44  ? -40.145 10.047  -66.540  1.00 72.41  ? 38  LEU B C     1 
ATOM   4549 O O     . LEU B 1 44  ? -41.198 10.139  -65.904  1.00 73.04  ? 38  LEU B O     1 
ATOM   4550 C CB    . LEU B 1 44  ? -41.019 11.609  -68.295  1.00 67.64  ? 38  LEU B CB    1 
ATOM   4551 C CG    . LEU B 1 44  ? -40.433 13.008  -68.028  1.00 71.71  ? 38  LEU B CG    1 
ATOM   4552 C CD1   . LEU B 1 44  ? -41.077 14.027  -68.934  1.00 72.28  ? 38  LEU B CD1   1 
ATOM   4553 C CD2   . LEU B 1 44  ? -40.613 13.446  -66.569  1.00 74.58  ? 38  LEU B CD2   1 
ATOM   4554 N N     . GLY B 1 45  ? -39.021 9.560   -66.047  1.00 69.75  ? 39  GLY B N     1 
ATOM   4555 C CA    . GLY B 1 45  ? -38.918 9.125   -64.666  1.00 71.34  ? 39  GLY B CA    1 
ATOM   4556 C C     . GLY B 1 45  ? -38.044 10.026  -63.842  1.00 77.41  ? 39  GLY B C     1 
ATOM   4557 O O     . GLY B 1 45  ? -36.863 10.194  -64.164  1.00 76.92  ? 39  GLY B O     1 
ATOM   4558 N N     . ALA B 1 46  ? -38.623 10.606  -62.769  1.00 75.68  ? 40  ALA B N     1 
ATOM   4559 C CA    . ALA B 1 46  ? -37.906 11.478  -61.824  1.00 75.29  ? 40  ALA B CA    1 
ATOM   4560 C C     . ALA B 1 46  ? -36.912 10.634  -61.003  1.00 80.48  ? 40  ALA B C     1 
ATOM   4561 O O     . ALA B 1 46  ? -37.108 9.423   -60.878  1.00 81.58  ? 40  ALA B O     1 
ATOM   4562 C CB    . ALA B 1 46  ? -38.891 12.182  -60.894  1.00 76.94  ? 40  ALA B CB    1 
ATOM   4563 N N     . THR B 1 47  ? -35.832 11.244  -60.485  1.00 76.43  ? 41  THR B N     1 
ATOM   4564 C CA    . THR B 1 47  ? -34.859 10.488  -59.686  1.00 76.23  ? 41  THR B CA    1 
ATOM   4565 C C     . THR B 1 47  ? -35.459 10.198  -58.316  1.00 80.47  ? 41  THR B C     1 
ATOM   4566 O O     . THR B 1 47  ? -35.848 11.129  -57.608  1.00 81.01  ? 41  THR B O     1 
ATOM   4567 C CB    . THR B 1 47  ? -33.480 11.179  -59.618  1.00 85.99  ? 41  THR B CB    1 
ATOM   4568 O OG1   . THR B 1 47  ? -33.593 12.468  -58.983  1.00 89.85  ? 41  THR B OG1   1 
ATOM   4569 C CG2   . THR B 1 47  ? -32.804 11.279  -60.988  1.00 81.97  ? 41  THR B CG2   1 
ATOM   4570 N N     . GLY B 1 48  ? -35.578 8.914   -57.987  1.00 76.33  ? 42  GLY B N     1 
ATOM   4571 C CA    . GLY B 1 48  ? -36.143 8.456   -56.722  1.00 77.02  ? 42  GLY B CA    1 
ATOM   4572 C C     . GLY B 1 48  ? -37.404 7.630   -56.867  1.00 81.00  ? 42  GLY B C     1 
ATOM   4573 O O     . GLY B 1 48  ? -37.924 7.125   -55.871  1.00 81.48  ? 42  GLY B O     1 
ATOM   4574 N N     . THR B 1 49  ? -37.888 7.463   -58.116  1.00 76.75  ? 43  THR B N     1 
ATOM   4575 C CA    . THR B 1 49  ? -39.103 6.707   -58.462  1.00 76.95  ? 43  THR B CA    1 
ATOM   4576 C C     . THR B 1 49  ? -38.892 5.208   -58.803  1.00 80.53  ? 43  THR B C     1 
ATOM   4577 O O     . THR B 1 49  ? -39.880 4.492   -58.981  1.00 82.22  ? 43  THR B O     1 
ATOM   4578 C CB    . THR B 1 49  ? -39.876 7.421   -59.579  1.00 80.59  ? 43  THR B CB    1 
ATOM   4579 O OG1   . THR B 1 49  ? -39.163 7.311   -60.812  1.00 74.10  ? 43  THR B OG1   1 
ATOM   4580 C CG2   . THR B 1 49  ? -40.177 8.889   -59.253  1.00 81.50  ? 43  THR B CG2   1 
ATOM   4581 N N     . GLY B 1 50  ? -37.637 4.764   -58.932  1.00 74.24  ? 44  GLY B N     1 
ATOM   4582 C CA    . GLY B 1 50  ? -37.304 3.379   -59.258  1.00 73.08  ? 44  GLY B CA    1 
ATOM   4583 C C     . GLY B 1 50  ? -37.532 3.040   -60.715  1.00 73.82  ? 44  GLY B C     1 
ATOM   4584 O O     . GLY B 1 50  ? -38.355 2.180   -61.047  1.00 73.04  ? 44  GLY B O     1 
ATOM   4585 N N     . LYS B 1 51  ? -36.793 3.737   -61.587  1.00 68.69  ? 45  LYS B N     1 
ATOM   4586 C CA    . LYS B 1 51  ? -36.813 3.602   -63.046  1.00 67.16  ? 45  LYS B CA    1 
ATOM   4587 C C     . LYS B 1 51  ? -36.369 2.192   -63.521  1.00 71.28  ? 45  LYS B C     1 
ATOM   4588 O O     . LYS B 1 51  ? -37.055 1.597   -64.362  1.00 70.68  ? 45  LYS B O     1 
ATOM   4589 C CB    . LYS B 1 51  ? -35.940 4.688   -63.679  1.00 65.73  ? 45  LYS B CB    1 
ATOM   4590 N N     . THR B 1 52  ? -35.253 1.651   -62.955  1.00 68.16  ? 46  THR B N     1 
ATOM   4591 C CA    . THR B 1 52  ? -34.708 0.326   -63.293  1.00 68.96  ? 46  THR B CA    1 
ATOM   4592 C C     . THR B 1 52  ? -35.732 -0.797  -63.075  1.00 76.11  ? 46  THR B C     1 
ATOM   4593 O O     . THR B 1 52  ? -35.892 -1.638  -63.956  1.00 75.92  ? 46  THR B O     1 
ATOM   4594 C CB    . THR B 1 52  ? -33.357 0.096   -62.611  1.00 81.67  ? 46  THR B CB    1 
ATOM   4595 O OG1   . THR B 1 52  ? -32.429 1.042   -63.132  1.00 82.28  ? 46  THR B OG1   1 
ATOM   4596 C CG2   . THR B 1 52  ? -32.800 -1.317  -62.832  1.00 82.25  ? 46  THR B CG2   1 
ATOM   4597 N N     . PHE B 1 53  ? -36.434 -0.812  -61.928  1.00 74.38  ? 47  PHE B N     1 
ATOM   4598 C CA    . PHE B 1 53  ? -37.465 -1.816  -61.689  1.00 75.53  ? 47  PHE B CA    1 
ATOM   4599 C C     . PHE B 1 53  ? -38.599 -1.732  -62.735  1.00 76.84  ? 47  PHE B C     1 
ATOM   4600 O O     . PHE B 1 53  ? -39.005 -2.778  -63.236  1.00 76.93  ? 47  PHE B O     1 
ATOM   4601 C CB    . PHE B 1 53  ? -37.997 -1.731  -60.256  1.00 79.35  ? 47  PHE B CB    1 
ATOM   4602 C CG    . PHE B 1 53  ? -39.059 -2.755  -59.911  1.00 83.86  ? 47  PHE B CG    1 
ATOM   4603 C CD1   . PHE B 1 53  ? -38.802 -4.117  -60.033  1.00 87.45  ? 47  PHE B CD1   1 
ATOM   4604 C CD2   . PHE B 1 53  ? -40.304 -2.356  -59.432  1.00 88.12  ? 47  PHE B CD2   1 
ATOM   4605 C CE1   . PHE B 1 53  ? -39.785 -5.058  -59.718  1.00 90.68  ? 47  PHE B CE1   1 
ATOM   4606 C CE2   . PHE B 1 53  ? -41.281 -3.300  -59.101  1.00 92.90  ? 47  PHE B CE2   1 
ATOM   4607 C CZ    . PHE B 1 53  ? -41.014 -4.644  -59.246  1.00 91.61  ? 47  PHE B CZ    1 
ATOM   4608 N N     . THR B 1 54  ? -39.061 -0.496  -63.111  1.00 71.12  ? 48  THR B N     1 
ATOM   4609 C CA    . THR B 1 54  ? -40.105 -0.273  -64.141  1.00 70.34  ? 48  THR B CA    1 
ATOM   4610 C C     . THR B 1 54  ? -39.619 -0.866  -65.435  1.00 73.63  ? 48  THR B C     1 
ATOM   4611 O O     . THR B 1 54  ? -40.382 -1.520  -66.139  1.00 74.32  ? 48  THR B O     1 
ATOM   4612 C CB    . THR B 1 54  ? -40.372 1.217   -64.371  1.00 69.53  ? 48  THR B CB    1 
ATOM   4613 O OG1   . THR B 1 54  ? -40.699 1.837   -63.133  1.00 74.40  ? 48  THR B OG1   1 
ATOM   4614 C CG2   . THR B 1 54  ? -41.471 1.468   -65.397  1.00 61.84  ? 48  THR B CG2   1 
ATOM   4615 N N     . VAL B 1 55  ? -38.335 -0.632  -65.741  1.00 68.41  ? 49  VAL B N     1 
ATOM   4616 C CA    . VAL B 1 55  ? -37.682 -1.159  -66.929  1.00 66.93  ? 49  VAL B CA    1 
ATOM   4617 C C     . VAL B 1 55  ? -37.617 -2.700  -66.837  1.00 71.61  ? 49  VAL B C     1 
ATOM   4618 O O     . VAL B 1 55  ? -37.970 -3.378  -67.808  1.00 71.63  ? 49  VAL B O     1 
ATOM   4619 C CB    . VAL B 1 55  ? -36.319 -0.456  -67.162  1.00 67.96  ? 49  VAL B CB    1 
ATOM   4620 C CG1   . VAL B 1 55  ? -35.458 -1.205  -68.180  1.00 67.13  ? 49  VAL B CG1   1 
ATOM   4621 C CG2   . VAL B 1 55  ? -36.541 0.981   -67.610  1.00 66.55  ? 49  VAL B CG2   1 
ATOM   4622 N N     . SER B 1 56  ? -37.241 -3.239  -65.647  1.00 68.19  ? 50  SER B N     1 
ATOM   4623 C CA    . SER B 1 56  ? -37.167 -4.685  -65.387  1.00 68.83  ? 50  SER B CA    1 
ATOM   4624 C C     . SER B 1 56  ? -38.534 -5.349  -65.583  1.00 73.95  ? 50  SER B C     1 
ATOM   4625 O O     . SER B 1 56  ? -38.605 -6.443  -66.151  1.00 75.19  ? 50  SER B O     1 
ATOM   4626 C CB    . SER B 1 56  ? -36.649 -4.965  -63.982  1.00 71.81  ? 50  SER B CB    1 
ATOM   4627 O OG    . SER B 1 56  ? -35.336 -4.465  -63.828  1.00 79.96  ? 50  SER B OG    1 
ATOM   4628 N N     . ASN B 1 57  ? -39.612 -4.674  -65.148  1.00 69.20  ? 51  ASN B N     1 
ATOM   4629 C CA    . ASN B 1 57  ? -40.962 -5.170  -65.326  1.00 70.67  ? 51  ASN B CA    1 
ATOM   4630 C C     . ASN B 1 57  ? -41.216 -5.276  -66.814  1.00 75.80  ? 51  ASN B C     1 
ATOM   4631 O O     . ASN B 1 57  ? -41.503 -6.359  -67.306  1.00 76.11  ? 51  ASN B O     1 
ATOM   4632 C CB    . ASN B 1 57  ? -41.965 -4.233  -64.671  1.00 70.81  ? 51  ASN B CB    1 
ATOM   4633 C CG    . ASN B 1 57  ? -42.166 -4.497  -63.211  1.00 82.47  ? 51  ASN B CG    1 
ATOM   4634 O OD1   . ASN B 1 57  ? -42.936 -5.375  -62.825  1.00 79.12  ? 51  ASN B OD1   1 
ATOM   4635 N ND2   . ASN B 1 57  ? -41.487 -3.740  -62.369  1.00 66.08  ? 51  ASN B ND2   1 
ATOM   4636 N N     . LEU B 1 58  ? -40.994 -4.176  -67.540  1.00 73.82  ? 52  LEU B N     1 
ATOM   4637 C CA    . LEU B 1 58  ? -41.146 -4.110  -68.995  1.00 74.44  ? 52  LEU B CA    1 
ATOM   4638 C C     . LEU B 1 58  ? -40.342 -5.226  -69.699  1.00 79.85  ? 52  LEU B C     1 
ATOM   4639 O O     . LEU B 1 58  ? -40.918 -5.916  -70.542  1.00 80.97  ? 52  LEU B O     1 
ATOM   4640 C CB    . LEU B 1 58  ? -40.737 -2.709  -69.511  1.00 72.82  ? 52  LEU B CB    1 
ATOM   4641 C CG    . LEU B 1 58  ? -40.505 -2.556  -71.008  1.00 76.70  ? 52  LEU B CG    1 
ATOM   4642 C CD1   . LEU B 1 58  ? -41.793 -2.313  -71.727  1.00 77.13  ? 52  LEU B CD1   1 
ATOM   4643 C CD2   . LEU B 1 58  ? -39.539 -1.435  -71.285  1.00 78.39  ? 52  LEU B CD2   1 
ATOM   4644 N N     . ILE B 1 59  ? -39.037 -5.420  -69.327  1.00 75.27  ? 53  ILE B N     1 
ATOM   4645 C CA    . ILE B 1 59  ? -38.161 -6.452  -69.909  1.00 74.73  ? 53  ILE B CA    1 
ATOM   4646 C C     . ILE B 1 59  ? -38.777 -7.849  -69.766  1.00 80.94  ? 53  ILE B C     1 
ATOM   4647 O O     . ILE B 1 59  ? -38.742 -8.626  -70.724  1.00 80.75  ? 53  ILE B O     1 
ATOM   4648 C CB    . ILE B 1 59  ? -36.752 -6.401  -69.300  1.00 73.78  ? 53  ILE B CB    1 
ATOM   4649 N N     . LYS B 1 60  ? -39.385 -8.137  -68.593  1.00 79.64  ? 54  LYS B N     1 
ATOM   4650 C CA    . LYS B 1 60  ? -40.050 -9.413  -68.293  1.00 82.05  ? 54  LYS B CA    1 
ATOM   4651 C C     . LYS B 1 60  ? -41.310 -9.600  -69.146  1.00 88.56  ? 54  LYS B C     1 
ATOM   4652 O O     . LYS B 1 60  ? -41.422 -10.626 -69.822  1.00 89.15  ? 54  LYS B O     1 
ATOM   4653 C CB    . LYS B 1 60  ? -40.393 -9.507  -66.806  1.00 83.63  ? 54  LYS B CB    1 
ATOM   4654 N N     . GLU B 1 61  ? -42.235 -8.600  -69.141  1.00 85.70  ? 55  GLU B N     1 
ATOM   4655 C CA    . GLU B 1 61  ? -43.504 -8.632  -69.886  1.00 86.78  ? 55  GLU B CA    1 
ATOM   4656 C C     . GLU B 1 61  ? -43.326 -8.784  -71.396  1.00 91.96  ? 55  GLU B C     1 
ATOM   4657 O O     . GLU B 1 61  ? -44.027 -9.595  -72.004  1.00 94.10  ? 55  GLU B O     1 
ATOM   4658 C CB    . GLU B 1 61  ? -44.364 -7.406  -69.571  1.00 87.07  ? 55  GLU B CB    1 
ATOM   4659 N N     . VAL B 1 62  ? -42.396 -8.026  -72.000  1.00 86.35  ? 56  VAL B N     1 
ATOM   4660 C CA    . VAL B 1 62  ? -42.191 -8.064  -73.451  1.00 85.66  ? 56  VAL B CA    1 
ATOM   4661 C C     . VAL B 1 62  ? -41.380 -9.257  -73.955  1.00 88.54  ? 56  VAL B C     1 
ATOM   4662 O O     . VAL B 1 62  ? -41.502 -9.606  -75.134  1.00 88.27  ? 56  VAL B O     1 
ATOM   4663 C CB    . VAL B 1 62  ? -41.733 -6.709  -74.070  1.00 88.18  ? 56  VAL B CB    1 
ATOM   4664 C CG1   . VAL B 1 62  ? -42.674 -5.559  -73.672  1.00 88.12  ? 56  VAL B CG1   1 
ATOM   4665 C CG2   . VAL B 1 62  ? -40.274 -6.386  -73.730  1.00 86.11  ? 56  VAL B CG2   1 
ATOM   4666 N N     . ASN B 1 63  ? -40.548 -9.864  -73.069  1.00 84.32  ? 57  ASN B N     1 
ATOM   4667 C CA    . ASN B 1 63  ? -39.654 -11.008 -73.342  1.00 83.95  ? 57  ASN B CA    1 
ATOM   4668 C C     . ASN B 1 63  ? -38.908 -10.932 -74.688  1.00 85.47  ? 57  ASN B C     1 
ATOM   4669 O O     . ASN B 1 63  ? -39.276 -11.604 -75.660  1.00 85.49  ? 57  ASN B O     1 
ATOM   4670 C CB    . ASN B 1 63  ? -40.365 -12.345 -73.151  1.00 88.27  ? 57  ASN B CB    1 
ATOM   4671 C CG    . ASN B 1 63  ? -39.493 -13.353 -72.464  1.00 118.23 ? 57  ASN B CG    1 
ATOM   4672 O OD1   . ASN B 1 63  ? -39.315 -13.314 -71.246  1.00 121.85 ? 57  ASN B OD1   1 
ATOM   4673 N ND2   . ASN B 1 63  ? -38.889 -14.243 -73.229  1.00 107.44 ? 57  ASN B ND2   1 
ATOM   4674 N N     . LYS B 1 64  ? -37.882 -10.071 -74.738  1.00 79.49  ? 58  LYS B N     1 
ATOM   4675 C CA    . LYS B 1 64  ? -37.084 -9.805  -75.930  1.00 77.74  ? 58  LYS B CA    1 
ATOM   4676 C C     . LYS B 1 64  ? -35.628 -9.552  -75.510  1.00 79.72  ? 58  LYS B C     1 
ATOM   4677 O O     . LYS B 1 64  ? -35.425 -8.851  -74.508  1.00 78.60  ? 58  LYS B O     1 
ATOM   4678 C CB    . LYS B 1 64  ? -37.639 -8.550  -76.627  1.00 79.11  ? 58  LYS B CB    1 
ATOM   4679 C CG    . LYS B 1 64  ? -37.836 -8.668  -78.138  1.00 90.21  ? 58  LYS B CG    1 
ATOM   4680 C CD    . LYS B 1 64  ? -38.234 -7.310  -78.775  1.00 96.09  ? 58  LYS B CD    1 
ATOM   4681 C CE    . LYS B 1 64  ? -39.704 -6.950  -78.676  1.00 96.91  ? 58  LYS B CE    1 
ATOM   4682 N NZ    . LYS B 1 64  ? -40.503 -7.630  -79.724  1.00 100.21 ? 58  LYS B NZ    1 
ATOM   4683 N N     . PRO B 1 65  ? -34.608 -10.077 -76.256  1.00 74.87  ? 59  PRO B N     1 
ATOM   4684 C CA    . PRO B 1 65  ? -33.204 -9.780  -75.911  1.00 72.80  ? 59  PRO B CA    1 
ATOM   4685 C C     . PRO B 1 65  ? -33.025 -8.270  -75.795  1.00 74.99  ? 59  PRO B C     1 
ATOM   4686 O O     . PRO B 1 65  ? -33.507 -7.526  -76.658  1.00 75.61  ? 59  PRO B O     1 
ATOM   4687 C CB    . PRO B 1 65  ? -32.415 -10.338 -77.103  1.00 74.11  ? 59  PRO B CB    1 
ATOM   4688 C CG    . PRO B 1 65  ? -33.270 -11.334 -77.687  1.00 80.19  ? 59  PRO B CG    1 
ATOM   4689 C CD    . PRO B 1 65  ? -34.681 -10.881 -77.489  1.00 77.12  ? 59  PRO B CD    1 
ATOM   4690 N N     . THR B 1 66  ? -32.436 -7.808  -74.692  1.00 68.21  ? 60  THR B N     1 
ATOM   4691 C CA    . THR B 1 66  ? -32.338 -6.376  -74.495  1.00 65.86  ? 60  THR B CA    1 
ATOM   4692 C C     . THR B 1 66  ? -30.924 -5.798  -74.380  1.00 63.99  ? 60  THR B C     1 
ATOM   4693 O O     . THR B 1 66  ? -29.988 -6.480  -73.950  1.00 62.76  ? 60  THR B O     1 
ATOM   4694 C CB    . THR B 1 66  ? -33.377 -5.904  -73.459  1.00 77.38  ? 60  THR B CB    1 
ATOM   4695 O OG1   . THR B 1 66  ? -33.915 -4.655  -73.877  1.00 78.28  ? 60  THR B OG1   1 
ATOM   4696 C CG2   . THR B 1 66  ? -32.811 -5.787  -72.055  1.00 75.88  ? 60  THR B CG2   1 
ATOM   4697 N N     . LEU B 1 67  ? -30.796 -4.514  -74.765  1.00 56.15  ? 61  LEU B N     1 
ATOM   4698 C CA    . LEU B 1 67  ? -29.555 -3.758  -74.705  1.00 52.85  ? 61  LEU B CA    1 
ATOM   4699 C C     . LEU B 1 67  ? -29.790 -2.460  -73.942  1.00 58.02  ? 61  LEU B C     1 
ATOM   4700 O O     . LEU B 1 67  ? -30.668 -1.680  -74.315  1.00 58.55  ? 61  LEU B O     1 
ATOM   4701 C CB    . LEU B 1 67  ? -29.014 -3.481  -76.122  1.00 50.86  ? 61  LEU B CB    1 
ATOM   4702 C CG    . LEU B 1 67  ? -27.744 -2.657  -76.209  1.00 51.14  ? 61  LEU B CG    1 
ATOM   4703 C CD1   . LEU B 1 67  ? -26.540 -3.443  -75.775  1.00 49.79  ? 61  LEU B CD1   1 
ATOM   4704 C CD2   . LEU B 1 67  ? -27.556 -2.151  -77.581  1.00 50.52  ? 61  LEU B CD2   1 
ATOM   4705 N N     . VAL B 1 68  ? -29.021 -2.245  -72.862  1.00 54.28  ? 62  VAL B N     1 
ATOM   4706 C CA    . VAL B 1 68  ? -29.115 -1.043  -72.037  1.00 53.46  ? 62  VAL B CA    1 
ATOM   4707 C C     . VAL B 1 68  ? -27.897 -0.170  -72.310  1.00 56.42  ? 62  VAL B C     1 
ATOM   4708 O O     . VAL B 1 68  ? -26.766 -0.619  -72.129  1.00 55.95  ? 62  VAL B O     1 
ATOM   4709 C CB    . VAL B 1 68  ? -29.288 -1.354  -70.536  1.00 57.70  ? 62  VAL B CB    1 
ATOM   4710 C CG1   . VAL B 1 68  ? -29.660 -0.098  -69.764  1.00 57.16  ? 62  VAL B CG1   1 
ATOM   4711 C CG2   . VAL B 1 68  ? -30.339 -2.435  -70.312  1.00 59.09  ? 62  VAL B CG2   1 
ATOM   4712 N N     . ILE B 1 69  ? -28.115 1.054   -72.785  1.00 51.82  ? 63  ILE B N     1 
ATOM   4713 C CA    . ILE B 1 69  ? -26.981 1.923   -73.055  1.00 50.15  ? 63  ILE B CA    1 
ATOM   4714 C C     . ILE B 1 69  ? -26.856 2.998   -71.976  1.00 56.89  ? 63  ILE B C     1 
ATOM   4715 O O     . ILE B 1 69  ? -27.847 3.669   -71.658  1.00 58.38  ? 63  ILE B O     1 
ATOM   4716 C CB    . ILE B 1 69  ? -26.952 2.483   -74.498  1.00 51.88  ? 63  ILE B CB    1 
ATOM   4717 C CG1   . ILE B 1 69  ? -27.277 1.376   -75.541  1.00 51.88  ? 63  ILE B CG1   1 
ATOM   4718 C CG2   . ILE B 1 69  ? -25.601 3.161   -74.778  1.00 51.06  ? 63  ILE B CG2   1 
ATOM   4719 C CD1   . ILE B 1 69  ? -27.252 1.797   -77.067  1.00 48.42  ? 63  ILE B CD1   1 
ATOM   4720 N N     . ALA B 1 70  ? -25.648 3.116   -71.377  1.00 52.96  ? 64  ALA B N     1 
ATOM   4721 C CA    . ALA B 1 70  ? -25.321 4.122   -70.357  1.00 52.66  ? 64  ALA B CA    1 
ATOM   4722 C C     . ALA B 1 70  ? -24.262 5.059   -70.922  1.00 55.87  ? 64  ALA B C     1 
ATOM   4723 O O     . ALA B 1 70  ? -23.390 4.631   -71.693  1.00 54.87  ? 64  ALA B O     1 
ATOM   4724 C CB    . ALA B 1 70  ? -24.818 3.465   -69.077  1.00 53.68  ? 64  ALA B CB    1 
ATOM   4725 N N     . HIS B 1 71  ? -24.353 6.349   -70.551  1.00 52.28  ? 65  HIS B N     1 
ATOM   4726 C CA    . HIS B 1 71  ? -23.434 7.378   -71.038  1.00 50.52  ? 65  HIS B CA    1 
ATOM   4727 C C     . HIS B 1 71  ? -22.074 7.402   -70.338  1.00 49.95  ? 65  HIS B C     1 
ATOM   4728 O O     . HIS B 1 71  ? -21.184 8.145   -70.773  1.00 49.03  ? 65  HIS B O     1 
ATOM   4729 C CB    . HIS B 1 71  ? -24.105 8.760   -71.106  1.00 51.26  ? 65  HIS B CB    1 
ATOM   4730 C CG    . HIS B 1 71  ? -24.318 9.390   -69.769  1.00 54.55  ? 65  HIS B CG    1 
ATOM   4731 N ND1   . HIS B 1 71  ? -23.333 10.159  -69.167  1.00 55.72  ? 65  HIS B ND1   1 
ATOM   4732 C CD2   . HIS B 1 71  ? -25.395 9.346   -68.956  1.00 56.39  ? 65  HIS B CD2   1 
ATOM   4733 C CE1   . HIS B 1 71  ? -23.850 10.567  -68.021  1.00 55.10  ? 65  HIS B CE1   1 
ATOM   4734 N NE2   . HIS B 1 71  ? -25.084 10.099  -67.847  1.00 55.93  ? 65  HIS B NE2   1 
ATOM   4735 N N     . ASN B 1 72  ? -21.926 6.600   -69.260  1.00 44.31  ? 66  ASN B N     1 
ATOM   4736 C CA    . ASN B 1 72  ? -20.674 6.417   -68.522  1.00 44.09  ? 66  ASN B CA    1 
ATOM   4737 C C     . ASN B 1 72  ? -20.616 5.050   -67.844  1.00 49.70  ? 66  ASN B C     1 
ATOM   4738 O O     . ASN B 1 72  ? -21.671 4.497   -67.489  1.00 50.27  ? 66  ASN B O     1 
ATOM   4739 C CB    . ASN B 1 72  ? -20.327 7.583   -67.566  1.00 41.66  ? 66  ASN B CB    1 
ATOM   4740 C CG    . ASN B 1 72  ? -21.092 7.620   -66.279  1.00 57.55  ? 66  ASN B CG    1 
ATOM   4741 O OD1   . ASN B 1 72  ? -21.083 6.679   -65.474  1.00 46.28  ? 66  ASN B OD1   1 
ATOM   4742 N ND2   . ASN B 1 72  ? -21.714 8.747   -66.030  1.00 51.61  ? 66  ASN B ND2   1 
ATOM   4743 N N     . LYS B 1 73  ? -19.378 4.521   -67.655  1.00 44.93  ? 67  LYS B N     1 
ATOM   4744 C CA    . LYS B 1 73  ? -19.103 3.220   -67.042  1.00 43.78  ? 67  LYS B CA    1 
ATOM   4745 C C     . LYS B 1 73  ? -19.553 3.119   -65.582  1.00 51.64  ? 67  LYS B C     1 
ATOM   4746 O O     . LYS B 1 73  ? -19.973 2.037   -65.170  1.00 52.38  ? 67  LYS B O     1 
ATOM   4747 C CB    . LYS B 1 73  ? -17.632 2.862   -67.167  1.00 42.29  ? 67  LYS B CB    1 
ATOM   4748 C CG    . LYS B 1 73  ? -17.187 2.605   -68.573  1.00 30.98  ? 67  LYS B CG    1 
ATOM   4749 C CD    . LYS B 1 73  ? -15.753 2.079   -68.612  1.00 37.44  ? 67  LYS B CD    1 
ATOM   4750 C CE    . LYS B 1 73  ? -14.685 3.085   -68.999  1.00 42.88  ? 67  LYS B CE    1 
ATOM   4751 N NZ    . LYS B 1 73  ? -13.551 2.439   -69.744  1.00 55.03  ? 67  LYS B NZ    1 
ATOM   4752 N N     . THR B 1 74  ? -19.479 4.227   -64.807  1.00 49.74  ? 68  THR B N     1 
ATOM   4753 C CA    . THR B 1 74  ? -19.898 4.236   -63.398  1.00 51.25  ? 68  THR B CA    1 
ATOM   4754 C C     . THR B 1 74  ? -21.384 3.882   -63.302  1.00 56.00  ? 68  THR B C     1 
ATOM   4755 O O     . THR B 1 74  ? -21.785 3.021   -62.508  1.00 55.14  ? 68  THR B O     1 
ATOM   4756 C CB    . THR B 1 74  ? -19.547 5.600   -62.741  1.00 64.81  ? 68  THR B CB    1 
ATOM   4757 O OG1   . THR B 1 74  ? -18.183 5.590   -62.286  1.00 68.25  ? 68  THR B OG1   1 
ATOM   4758 C CG2   . THR B 1 74  ? -20.498 5.974   -61.577  1.00 61.84  ? 68  THR B CG2   1 
ATOM   4759 N N     . LEU B 1 75  ? -22.178 4.548   -64.149  1.00 53.76  ? 69  LEU B N     1 
ATOM   4760 C CA    . LEU B 1 75  ? -23.614 4.411   -64.233  1.00 54.48  ? 69  LEU B CA    1 
ATOM   4761 C C     . LEU B 1 75  ? -23.967 3.035   -64.780  1.00 55.44  ? 69  LEU B C     1 
ATOM   4762 O O     . LEU B 1 75  ? -24.892 2.395   -64.280  1.00 54.08  ? 69  LEU B O     1 
ATOM   4763 C CB    . LEU B 1 75  ? -24.131 5.542   -65.111  1.00 55.21  ? 69  LEU B CB    1 
ATOM   4764 C CG    . LEU B 1 75  ? -25.615 5.851   -65.066  1.00 63.48  ? 69  LEU B CG    1 
ATOM   4765 C CD1   . LEU B 1 75  ? -26.340 5.224   -66.233  1.00 65.23  ? 69  LEU B CD1   1 
ATOM   4766 C CD2   . LEU B 1 75  ? -26.238 5.573   -63.663  1.00 68.13  ? 69  LEU B CD2   1 
ATOM   4767 N N     . ALA B 1 76  ? -23.165 2.564   -65.755  1.00 51.03  ? 70  ALA B N     1 
ATOM   4768 C CA    . ALA B 1 76  ? -23.268 1.249   -66.372  1.00 50.84  ? 70  ALA B CA    1 
ATOM   4769 C C     . ALA B 1 76  ? -23.067 0.163   -65.307  1.00 55.46  ? 70  ALA B C     1 
ATOM   4770 O O     . ALA B 1 76  ? -23.825 -0.817  -65.250  1.00 55.45  ? 70  ALA B O     1 
ATOM   4771 C CB    . ALA B 1 76  ? -22.216 1.114   -67.462  1.00 50.54  ? 70  ALA B CB    1 
ATOM   4772 N N     . GLY B 1 77  ? -22.061 0.375   -64.462  1.00 51.75  ? 71  GLY B N     1 
ATOM   4773 C CA    . GLY B 1 77  ? -21.712 -0.510  -63.361  1.00 52.42  ? 71  GLY B CA    1 
ATOM   4774 C C     . GLY B 1 77  ? -22.879 -0.730  -62.426  1.00 57.49  ? 71  GLY B C     1 
ATOM   4775 O O     . GLY B 1 77  ? -23.258 -1.882  -62.190  1.00 57.00  ? 71  GLY B O     1 
ATOM   4776 N N     . GLN B 1 78  ? -23.500 0.388   -61.940  1.00 54.70  ? 72  GLN B N     1 
ATOM   4777 C CA    . GLN B 1 78  ? -24.656 0.365   -61.026  1.00 55.25  ? 72  GLN B CA    1 
ATOM   4778 C C     . GLN B 1 78  ? -25.847 -0.373  -61.641  1.00 59.54  ? 72  GLN B C     1 
ATOM   4779 O O     . GLN B 1 78  ? -26.491 -1.160  -60.950  1.00 61.21  ? 72  GLN B O     1 
ATOM   4780 C CB    . GLN B 1 78  ? -25.098 1.776   -60.631  1.00 56.31  ? 72  GLN B CB    1 
ATOM   4781 C CG    . GLN B 1 78  ? -24.055 2.652   -59.958  1.00 78.89  ? 72  GLN B CG    1 
ATOM   4782 C CD    . GLN B 1 78  ? -24.605 4.044   -59.690  1.00 107.45 ? 72  GLN B CD    1 
ATOM   4783 O OE1   . GLN B 1 78  ? -25.507 4.533   -60.384  1.00 104.45 ? 72  GLN B OE1   1 
ATOM   4784 N NE2   . GLN B 1 78  ? -24.067 4.734   -58.688  1.00 102.84 ? 72  GLN B NE2   1 
ATOM   4785 N N     . LEU B 1 79  ? -26.137 -0.113  -62.932  1.00 54.27  ? 73  LEU B N     1 
ATOM   4786 C CA    . LEU B 1 79  ? -27.239 -0.738  -63.660  1.00 54.86  ? 73  LEU B CA    1 
ATOM   4787 C C     . LEU B 1 79  ? -27.073 -2.250  -63.756  1.00 60.96  ? 73  LEU B C     1 
ATOM   4788 O O     . LEU B 1 79  ? -28.050 -2.976  -63.581  1.00 60.79  ? 73  LEU B O     1 
ATOM   4789 C CB    . LEU B 1 79  ? -27.371 -0.136  -65.068  1.00 54.20  ? 73  LEU B CB    1 
ATOM   4790 C CG    . LEU B 1 79  ? -28.011 1.243   -65.193  1.00 57.75  ? 73  LEU B CG    1 
ATOM   4791 C CD1   . LEU B 1 79  ? -27.919 1.738   -66.619  1.00 56.29  ? 73  LEU B CD1   1 
ATOM   4792 C CD2   . LEU B 1 79  ? -29.468 1.215   -64.749  1.00 60.35  ? 73  LEU B CD2   1 
ATOM   4793 N N     . TYR B 1 80  ? -25.831 -2.725  -64.007  1.00 59.32  ? 74  TYR B N     1 
ATOM   4794 C CA    . TYR B 1 80  ? -25.504 -4.144  -64.084  1.00 60.69  ? 74  TYR B CA    1 
ATOM   4795 C C     . TYR B 1 80  ? -25.837 -4.819  -62.760  1.00 63.12  ? 74  TYR B C     1 
ATOM   4796 O O     . TYR B 1 80  ? -26.544 -5.820  -62.765  1.00 63.27  ? 74  TYR B O     1 
ATOM   4797 C CB    . TYR B 1 80  ? -24.035 -4.333  -64.472  1.00 63.48  ? 74  TYR B CB    1 
ATOM   4798 C CG    . TYR B 1 80  ? -23.546 -5.770  -64.417  1.00 70.14  ? 74  TYR B CG    1 
ATOM   4799 C CD1   . TYR B 1 80  ? -23.767 -6.646  -65.479  1.00 73.48  ? 74  TYR B CD1   1 
ATOM   4800 C CD2   . TYR B 1 80  ? -22.804 -6.237  -63.331  1.00 71.95  ? 74  TYR B CD2   1 
ATOM   4801 C CE1   . TYR B 1 80  ? -23.296 -7.962  -65.444  1.00 76.77  ? 74  TYR B CE1   1 
ATOM   4802 C CE2   . TYR B 1 80  ? -22.318 -7.546  -63.291  1.00 73.86  ? 74  TYR B CE2   1 
ATOM   4803 C CZ    . TYR B 1 80  ? -22.564 -8.407  -64.351  1.00 83.05  ? 74  TYR B CZ    1 
ATOM   4804 O OH    . TYR B 1 80  ? -22.092 -9.703  -64.321  1.00 83.80  ? 74  TYR B OH    1 
ATOM   4805 N N     . SER B 1 81  ? -25.385 -4.220  -61.631  1.00 58.68  ? 75  SER B N     1 
ATOM   4806 C CA    . SER B 1 81  ? -25.646 -4.685  -60.262  1.00 59.18  ? 75  SER B CA    1 
ATOM   4807 C C     . SER B 1 81  ? -27.147 -4.792  -60.054  1.00 65.58  ? 75  SER B C     1 
ATOM   4808 O O     . SER B 1 81  ? -27.634 -5.881  -59.734  1.00 68.16  ? 75  SER B O     1 
ATOM   4809 C CB    . SER B 1 81  ? -25.068 -3.716  -59.240  1.00 60.43  ? 75  SER B CB    1 
ATOM   4810 O OG    . SER B 1 81  ? -23.820 -3.197  -59.660  1.00 66.81  ? 75  SER B OG    1 
ATOM   4811 N N     . GLU B 1 82  ? -27.881 -3.682  -60.316  1.00 60.30  ? 76  GLU B N     1 
ATOM   4812 C CA    . GLU B 1 82  ? -29.335 -3.582  -60.218  1.00 60.30  ? 76  GLU B CA    1 
ATOM   4813 C C     . GLU B 1 82  ? -30.046 -4.675  -61.048  1.00 66.18  ? 76  GLU B C     1 
ATOM   4814 O O     . GLU B 1 82  ? -30.947 -5.322  -60.515  1.00 67.55  ? 76  GLU B O     1 
ATOM   4815 C CB    . GLU B 1 82  ? -29.807 -2.179  -60.628  1.00 59.61  ? 76  GLU B CB    1 
ATOM   4816 N N     . PHE B 1 83  ? -29.608 -4.921  -62.315  1.00 62.22  ? 77  PHE B N     1 
ATOM   4817 C CA    . PHE B 1 83  ? -30.230 -5.939  -63.177  1.00 62.97  ? 77  PHE B CA    1 
ATOM   4818 C C     . PHE B 1 83  ? -29.888 -7.364  -62.799  1.00 68.62  ? 77  PHE B C     1 
ATOM   4819 O O     . PHE B 1 83  ? -30.750 -8.235  -62.918  1.00 68.74  ? 77  PHE B O     1 
ATOM   4820 C CB    . PHE B 1 83  ? -29.980 -5.683  -64.667  1.00 63.62  ? 77  PHE B CB    1 
ATOM   4821 C CG    . PHE B 1 83  ? -30.810 -4.570  -65.280  1.00 64.75  ? 77  PHE B CG    1 
ATOM   4822 C CD1   . PHE B 1 83  ? -30.210 -3.412  -65.751  1.00 65.65  ? 77  PHE B CD1   1 
ATOM   4823 C CD2   . PHE B 1 83  ? -32.186 -4.692  -65.408  1.00 67.88  ? 77  PHE B CD2   1 
ATOM   4824 C CE1   . PHE B 1 83  ? -30.962 -2.410  -66.351  1.00 65.78  ? 77  PHE B CE1   1 
ATOM   4825 C CE2   . PHE B 1 83  ? -32.942 -3.665  -65.974  1.00 69.72  ? 77  PHE B CE2   1 
ATOM   4826 C CZ    . PHE B 1 83  ? -32.322 -2.538  -66.447  1.00 65.99  ? 77  PHE B CZ    1 
ATOM   4827 N N     . LYS B 1 84  ? -28.646 -7.605  -62.314  1.00 66.22  ? 78  LYS B N     1 
ATOM   4828 C CA    . LYS B 1 84  ? -28.199 -8.931  -61.867  1.00 67.00  ? 78  LYS B CA    1 
ATOM   4829 C C     . LYS B 1 84  ? -29.008 -9.375  -60.644  1.00 74.07  ? 78  LYS B C     1 
ATOM   4830 O O     . LYS B 1 84  ? -29.280 -10.570 -60.494  1.00 75.75  ? 78  LYS B O     1 
ATOM   4831 C CB    . LYS B 1 84  ? -26.709 -8.925  -61.555  1.00 66.55  ? 78  LYS B CB    1 
ATOM   4832 N N     . GLU B 1 85  ? -29.433 -8.409  -59.801  1.00 70.61  ? 79  GLU B N     1 
ATOM   4833 C CA    . GLU B 1 85  ? -30.245 -8.678  -58.619  1.00 72.56  ? 79  GLU B CA    1 
ATOM   4834 C C     . GLU B 1 85  ? -31.678 -9.099  -58.995  1.00 78.73  ? 79  GLU B C     1 
ATOM   4835 O O     . GLU B 1 85  ? -32.257 -9.963  -58.333  1.00 79.91  ? 79  GLU B O     1 
ATOM   4836 C CB    . GLU B 1 85  ? -30.260 -7.459  -57.692  1.00 73.84  ? 79  GLU B CB    1 
ATOM   4837 C CG    . GLU B 1 85  ? -30.718 -7.785  -56.279  1.00 90.54  ? 79  GLU B CG    1 
ATOM   4838 C CD    . GLU B 1 85  ? -30.762 -6.603  -55.332  1.00 121.63 ? 79  GLU B CD    1 
ATOM   4839 O OE1   . GLU B 1 85  ? -29.680 -6.067  -54.998  1.00 129.44 ? 79  GLU B OE1   1 
ATOM   4840 O OE2   . GLU B 1 85  ? -31.876 -6.235  -54.894  1.00 113.85 ? 79  GLU B OE2   1 
ATOM   4841 N N     . PHE B 1 86  ? -32.236 -8.492  -60.052  1.00 75.70  ? 80  PHE B N     1 
ATOM   4842 C CA    . PHE B 1 86  ? -33.595 -8.772  -60.520  1.00 77.40  ? 80  PHE B CA    1 
ATOM   4843 C C     . PHE B 1 86  ? -33.723 -10.023 -61.396  1.00 82.45  ? 80  PHE B C     1 
ATOM   4844 O O     . PHE B 1 86  ? -34.771 -10.661 -61.371  1.00 83.99  ? 80  PHE B O     1 
ATOM   4845 C CB    . PHE B 1 86  ? -34.170 -7.567  -61.277  1.00 78.54  ? 80  PHE B CB    1 
ATOM   4846 C CG    . PHE B 1 86  ? -34.530 -6.348  -60.463  1.00 79.99  ? 80  PHE B CG    1 
ATOM   4847 C CD1   . PHE B 1 86  ? -35.333 -6.456  -59.335  1.00 84.75  ? 80  PHE B CD1   1 
ATOM   4848 C CD2   . PHE B 1 86  ? -34.147 -5.079  -60.879  1.00 80.35  ? 80  PHE B CD2   1 
ATOM   4849 C CE1   . PHE B 1 86  ? -35.691 -5.318  -58.603  1.00 85.76  ? 80  PHE B CE1   1 
ATOM   4850 C CE2   . PHE B 1 86  ? -34.524 -3.942  -60.160  1.00 82.94  ? 80  PHE B CE2   1 
ATOM   4851 C CZ    . PHE B 1 86  ? -35.290 -4.069  -59.025  1.00 82.79  ? 80  PHE B CZ    1 
ATOM   4852 N N     . PHE B 1 87  ? -32.710 -10.341 -62.218  1.00 78.12  ? 81  PHE B N     1 
ATOM   4853 C CA    . PHE B 1 87  ? -32.736 -11.514 -63.105  1.00 78.38  ? 81  PHE B CA    1 
ATOM   4854 C C     . PHE B 1 87  ? -31.515 -12.402 -62.790  1.00 85.19  ? 81  PHE B C     1 
ATOM   4855 O O     . PHE B 1 87  ? -30.532 -12.373 -63.539  1.00 83.52  ? 81  PHE B O     1 
ATOM   4856 C CB    . PHE B 1 87  ? -32.751 -11.070 -64.573  1.00 78.09  ? 81  PHE B CB    1 
ATOM   4857 C CG    . PHE B 1 87  ? -33.941 -10.231 -64.976  1.00 79.01  ? 81  PHE B CG    1 
ATOM   4858 C CD1   . PHE B 1 87  ? -33.961 -8.865  -64.738  1.00 80.75  ? 81  PHE B CD1   1 
ATOM   4859 C CD2   . PHE B 1 87  ? -35.005 -10.792 -65.664  1.00 81.83  ? 81  PHE B CD2   1 
ATOM   4860 C CE1   . PHE B 1 87  ? -35.049 -8.087  -65.134  1.00 81.76  ? 81  PHE B CE1   1 
ATOM   4861 C CE2   . PHE B 1 87  ? -36.084 -10.008 -66.077  1.00 84.54  ? 81  PHE B CE2   1 
ATOM   4862 C CZ    . PHE B 1 87  ? -36.101 -8.663  -65.810  1.00 81.54  ? 81  PHE B CZ    1 
ATOM   4863 N N     . PRO B 1 88  ? -31.528 -13.139 -61.644  1.00 85.03  ? 82  PRO B N     1 
ATOM   4864 C CA    . PRO B 1 88  ? -30.345 -13.936 -61.256  1.00 85.80  ? 82  PRO B CA    1 
ATOM   4865 C C     . PRO B 1 88  ? -30.145 -15.204 -62.078  1.00 93.50  ? 82  PRO B C     1 
ATOM   4866 O O     . PRO B 1 88  ? -29.015 -15.695 -62.219  1.00 93.01  ? 82  PRO B O     1 
ATOM   4867 C CB    . PRO B 1 88  ? -30.607 -14.267 -59.779  1.00 88.72  ? 82  PRO B CB    1 
ATOM   4868 C CG    . PRO B 1 88  ? -31.830 -13.464 -59.382  1.00 92.91  ? 82  PRO B CG    1 
ATOM   4869 C CD    . PRO B 1 88  ? -32.593 -13.255 -60.629  1.00 87.82  ? 82  PRO B CD    1 
ATOM   4870 N N     . ASN B 1 89  ? -31.250 -15.722 -62.629  1.00 92.23  ? 83  ASN B N     1 
ATOM   4871 C CA    . ASN B 1 89  ? -31.255 -16.943 -63.420  1.00 93.10  ? 83  ASN B CA    1 
ATOM   4872 C C     . ASN B 1 89  ? -31.292 -16.699 -64.945  1.00 95.91  ? 83  ASN B C     1 
ATOM   4873 O O     . ASN B 1 89  ? -31.592 -17.621 -65.715  1.00 97.82  ? 83  ASN B O     1 
ATOM   4874 C CB    . ASN B 1 89  ? -32.381 -17.849 -62.926  1.00 96.13  ? 83  ASN B CB    1 
ATOM   4875 C CG    . ASN B 1 89  ? -32.253 -18.188 -61.459  1.00 120.06 ? 83  ASN B CG    1 
ATOM   4876 O OD1   . ASN B 1 89  ? -31.181 -18.047 -60.845  1.00 117.97 ? 83  ASN B OD1   1 
ATOM   4877 N ND2   . ASN B 1 89  ? -33.344 -18.643 -60.866  1.00 110.39 ? 83  ASN B ND2   1 
ATOM   4878 N N     . ASN B 1 90  ? -30.944 -15.465 -65.376  1.00 87.99  ? 84  ASN B N     1 
ATOM   4879 C CA    . ASN B 1 90  ? -30.914 -15.059 -66.784  1.00 84.82  ? 84  ASN B CA    1 
ATOM   4880 C C     . ASN B 1 90  ? -29.540 -14.510 -67.133  1.00 83.24  ? 84  ASN B C     1 
ATOM   4881 O O     . ASN B 1 90  ? -28.703 -14.334 -66.243  1.00 81.28  ? 84  ASN B O     1 
ATOM   4882 C CB    . ASN B 1 90  ? -32.020 -14.038 -67.084  1.00 83.84  ? 84  ASN B CB    1 
ATOM   4883 C CG    . ASN B 1 90  ? -33.414 -14.535 -66.754  1.00 105.54 ? 84  ASN B CG    1 
ATOM   4884 O OD1   . ASN B 1 90  ? -33.953 -14.323 -65.647  1.00 99.30  ? 84  ASN B OD1   1 
ATOM   4885 N ND2   . ASN B 1 90  ? -34.015 -15.234 -67.702  1.00 96.51  ? 84  ASN B ND2   1 
ATOM   4886 N N     . ALA B 1 91  ? -29.296 -14.255 -68.422  1.00 77.86  ? 85  ALA B N     1 
ATOM   4887 C CA    . ALA B 1 91  ? -28.013 -13.748 -68.890  1.00 75.53  ? 85  ALA B CA    1 
ATOM   4888 C C     . ALA B 1 91  ? -27.882 -12.221 -68.781  1.00 76.86  ? 85  ALA B C     1 
ATOM   4889 O O     . ALA B 1 91  ? -28.193 -11.500 -69.737  1.00 76.81  ? 85  ALA B O     1 
ATOM   4890 C CB    . ALA B 1 91  ? -27.766 -14.207 -70.312  1.00 76.13  ? 85  ALA B CB    1 
ATOM   4891 N N     . VAL B 1 92  ? -27.422 -11.726 -67.617  1.00 70.50  ? 86  VAL B N     1 
ATOM   4892 C CA    . VAL B 1 92  ? -27.195 -10.290 -67.409  1.00 67.78  ? 86  VAL B CA    1 
ATOM   4893 C C     . VAL B 1 92  ? -25.708 -10.064 -67.661  1.00 67.18  ? 86  VAL B C     1 
ATOM   4894 O O     . VAL B 1 92  ? -24.863 -10.577 -66.927  1.00 65.54  ? 86  VAL B O     1 
ATOM   4895 C CB    . VAL B 1 92  ? -27.689 -9.777  -66.026  1.00 72.22  ? 86  VAL B CB    1 
ATOM   4896 C CG1   . VAL B 1 92  ? -27.203 -8.356  -65.742  1.00 70.66  ? 86  VAL B CG1   1 
ATOM   4897 C CG2   . VAL B 1 92  ? -29.209 -9.850  -65.928  1.00 73.28  ? 86  VAL B CG2   1 
ATOM   4898 N N     . GLU B 1 93  ? -25.400 -9.348  -68.740  1.00 62.50  ? 87  GLU B N     1 
ATOM   4899 C CA    . GLU B 1 93  ? -24.032 -9.122  -69.198  1.00 61.35  ? 87  GLU B CA    1 
ATOM   4900 C C     . GLU B 1 93  ? -23.574 -7.664  -69.214  1.00 60.40  ? 87  GLU B C     1 
ATOM   4901 O O     . GLU B 1 93  ? -24.392 -6.746  -69.280  1.00 59.30  ? 87  GLU B O     1 
ATOM   4902 C CB    . GLU B 1 93  ? -23.836 -9.754  -70.586  1.00 63.49  ? 87  GLU B CB    1 
ATOM   4903 C CG    . GLU B 1 93  ? -24.309 -11.198 -70.716  1.00 77.74  ? 87  GLU B CG    1 
ATOM   4904 C CD    . GLU B 1 93  ? -23.499 -12.237 -69.971  1.00 104.02 ? 87  GLU B CD    1 
ATOM   4905 O OE1   . GLU B 1 93  ? -22.307 -11.983 -69.673  1.00 104.84 ? 87  GLU B OE1   1 
ATOM   4906 O OE2   . GLU B 1 93  ? -24.058 -13.326 -69.709  1.00 101.03 ? 87  GLU B OE2   1 
ATOM   4907 N N     . TYR B 1 94  ? -22.245 -7.473  -69.202  1.00 54.11  ? 88  TYR B N     1 
ATOM   4908 C CA    . TYR B 1 94  ? -21.586 -6.180  -69.157  1.00 52.32  ? 88  TYR B CA    1 
ATOM   4909 C C     . TYR B 1 94  ? -20.611 -6.043  -70.332  1.00 56.59  ? 88  TYR B C     1 
ATOM   4910 O O     . TYR B 1 94  ? -19.673 -6.833  -70.448  1.00 57.10  ? 88  TYR B O     1 
ATOM   4911 C CB    . TYR B 1 94  ? -20.864 -6.055  -67.810  1.00 52.88  ? 88  TYR B CB    1 
ATOM   4912 C CG    . TYR B 1 94  ? -20.292 -4.692  -67.486  1.00 52.96  ? 88  TYR B CG    1 
ATOM   4913 C CD1   . TYR B 1 94  ? -21.096 -3.685  -66.954  1.00 55.14  ? 88  TYR B CD1   1 
ATOM   4914 C CD2   . TYR B 1 94  ? -18.924 -4.442  -67.605  1.00 52.04  ? 88  TYR B CD2   1 
ATOM   4915 C CE1   . TYR B 1 94  ? -20.565 -2.441  -66.608  1.00 55.03  ? 88  TYR B CE1   1 
ATOM   4916 C CE2   . TYR B 1 94  ? -18.385 -3.200  -67.270  1.00 51.69  ? 88  TYR B CE2   1 
ATOM   4917 C CZ    . TYR B 1 94  ? -19.212 -2.204  -66.774  1.00 57.66  ? 88  TYR B CZ    1 
ATOM   4918 O OH    . TYR B 1 94  ? -18.700 -0.994  -66.403  1.00 57.29  ? 88  TYR B OH    1 
ATOM   4919 N N     . PHE B 1 95  ? -20.844 -5.035  -71.198  1.00 51.72  ? 89  PHE B N     1 
ATOM   4920 C CA    . PHE B 1 95  ? -20.063 -4.760  -72.392  1.00 50.52  ? 89  PHE B CA    1 
ATOM   4921 C C     . PHE B 1 95  ? -19.616 -3.313  -72.422  1.00 54.41  ? 89  PHE B C     1 
ATOM   4922 O O     . PHE B 1 95  ? -20.360 -2.432  -72.842  1.00 54.01  ? 89  PHE B O     1 
ATOM   4923 C CB    . PHE B 1 95  ? -20.897 -5.100  -73.637  1.00 52.82  ? 89  PHE B CB    1 
ATOM   4924 C CG    . PHE B 1 95  ? -20.125 -5.125  -74.937  1.00 54.22  ? 89  PHE B CG    1 
ATOM   4925 C CD1   . PHE B 1 95  ? -19.589 -6.314  -75.420  1.00 57.06  ? 89  PHE B CD1   1 
ATOM   4926 C CD2   . PHE B 1 95  ? -19.950 -3.962  -75.689  1.00 55.09  ? 89  PHE B CD2   1 
ATOM   4927 C CE1   . PHE B 1 95  ? -18.871 -6.337  -76.613  1.00 57.68  ? 89  PHE B CE1   1 
ATOM   4928 C CE2   . PHE B 1 95  ? -19.231 -3.988  -76.882  1.00 57.54  ? 89  PHE B CE2   1 
ATOM   4929 C CZ    . PHE B 1 95  ? -18.698 -5.176  -77.337  1.00 56.10  ? 89  PHE B CZ    1 
ATOM   4930 N N     . VAL B 1 96  ? -18.377 -3.078  -72.013  1.00 51.18  ? 90  VAL B N     1 
ATOM   4931 C CA    . VAL B 1 96  ? -17.742 -1.754  -71.931  1.00 49.71  ? 90  VAL B CA    1 
ATOM   4932 C C     . VAL B 1 96  ? -16.322 -1.837  -72.566  1.00 55.02  ? 90  VAL B C     1 
ATOM   4933 O O     . VAL B 1 96  ? -15.939 -2.933  -72.958  1.00 56.02  ? 90  VAL B O     1 
ATOM   4934 C CB    . VAL B 1 96  ? -17.785 -1.384  -70.431  1.00 51.91  ? 90  VAL B CB    1 
ATOM   4935 C CG1   . VAL B 1 96  ? -16.411 -1.209  -69.812  1.00 51.33  ? 90  VAL B CG1   1 
ATOM   4936 C CG2   . VAL B 1 96  ? -18.683 -0.200  -70.185  1.00 51.10  ? 90  VAL B CG2   1 
ATOM   4937 N N     . SER B 1 97  ? -15.563 -0.730  -72.714  1.00 51.82  ? 91  SER B N     1 
ATOM   4938 C CA    . SER B 1 97  ? -14.206 -0.821  -73.303  1.00 52.24  ? 91  SER B CA    1 
ATOM   4939 C C     . SER B 1 97  ? -13.208 -1.582  -72.434  1.00 57.74  ? 91  SER B C     1 
ATOM   4940 O O     . SER B 1 97  ? -13.127 -1.321  -71.228  1.00 56.69  ? 91  SER B O     1 
ATOM   4941 C CB    . SER B 1 97  ? -13.624 0.557   -73.606  1.00 56.07  ? 91  SER B CB    1 
ATOM   4942 O OG    . SER B 1 97  ? -12.266 0.456   -74.019  1.00 67.64  ? 91  SER B OG    1 
ATOM   4943 N N     . TYR B 1 98  ? -12.394 -2.473  -73.061  1.00 56.03  ? 92  TYR B N     1 
ATOM   4944 C CA    . TYR B 1 98  ? -11.381 -3.206  -72.302  1.00 55.48  ? 92  TYR B CA    1 
ATOM   4945 C C     . TYR B 1 98  ? -10.102 -2.441  -72.046  1.00 59.34  ? 92  TYR B C     1 
ATOM   4946 O O     . TYR B 1 98  ? -9.250  -2.953  -71.352  1.00 60.16  ? 92  TYR B O     1 
ATOM   4947 C CB    . TYR B 1 98  ? -11.118 -4.630  -72.810  1.00 56.71  ? 92  TYR B CB    1 
ATOM   4948 C CG    . TYR B 1 98  ? -10.627 -4.784  -74.232  1.00 58.14  ? 92  TYR B CG    1 
ATOM   4949 C CD1   . TYR B 1 98  ? -9.604  -3.988  -74.728  1.00 60.02  ? 92  TYR B CD1   1 
ATOM   4950 C CD2   . TYR B 1 98  ? -11.067 -5.832  -75.028  1.00 59.61  ? 92  TYR B CD2   1 
ATOM   4951 C CE1   . TYR B 1 98  ? -9.102  -4.174  -76.018  1.00 61.70  ? 92  TYR B CE1   1 
ATOM   4952 C CE2   . TYR B 1 98  ? -10.580 -6.023  -76.319  1.00 60.57  ? 92  TYR B CE2   1 
ATOM   4953 C CZ    . TYR B 1 98  ? -9.604  -5.187  -76.815  1.00 66.70  ? 92  TYR B CZ    1 
ATOM   4954 O OH    . TYR B 1 98  ? -9.137  -5.388  -78.088  1.00 68.01  ? 92  TYR B OH    1 
ATOM   4955 N N     . TYR B 1 99  ? -9.953  -1.228  -72.588  1.00 54.84  ? 93  TYR B N     1 
ATOM   4956 C CA    . TYR B 1 99  ? -8.750  -0.454  -72.350  1.00 54.21  ? 93  TYR B CA    1 
ATOM   4957 C C     . TYR B 1 99  ? -8.793  0.255   -71.006  1.00 58.21  ? 93  TYR B C     1 
ATOM   4958 O O     . TYR B 1 99  ? -9.748  0.985   -70.719  1.00 57.53  ? 93  TYR B O     1 
ATOM   4959 C CB    . TYR B 1 99  ? -8.525  0.567   -73.467  1.00 55.17  ? 93  TYR B CB    1 
ATOM   4960 C CG    . TYR B 1 99  ? -8.165  -0.040  -74.806  1.00 57.41  ? 93  TYR B CG    1 
ATOM   4961 C CD1   . TYR B 1 99  ? -9.040  0.040   -75.889  1.00 59.46  ? 93  TYR B CD1   1 
ATOM   4962 C CD2   . TYR B 1 99  ? -6.938  -0.669  -75.004  1.00 58.05  ? 93  TYR B CD2   1 
ATOM   4963 C CE1   . TYR B 1 99  ? -8.700  -0.491  -77.138  1.00 59.38  ? 93  TYR B CE1   1 
ATOM   4964 C CE2   . TYR B 1 99  ? -6.594  -1.214  -76.243  1.00 58.96  ? 93  TYR B CE2   1 
ATOM   4965 C CZ    . TYR B 1 99  ? -7.472  -1.118  -77.309  1.00 64.65  ? 93  TYR B CZ    1 
ATOM   4966 O OH    . TYR B 1 99  ? -7.106  -1.657  -78.524  1.00 64.19  ? 93  TYR B OH    1 
ATOM   4967 N N     . ASP B 1 100 ? -7.748  0.044   -70.184  1.00 56.30  ? 94  ASP B N     1 
ATOM   4968 C CA    . ASP B 1 100 ? -7.587  0.736   -68.901  1.00 57.70  ? 94  ASP B CA    1 
ATOM   4969 C C     . ASP B 1 100 ? -6.974  2.101   -69.246  1.00 62.00  ? 94  ASP B C     1 
ATOM   4970 O O     . ASP B 1 100 ? -7.218  3.094   -68.553  1.00 62.21  ? 94  ASP B O     1 
ATOM   4971 C CB    . ASP B 1 100 ? -6.618  0.020   -67.915  1.00 61.48  ? 94  ASP B CB    1 
ATOM   4972 C CG    . ASP B 1 100 ? -6.778  -1.449  -67.522  1.00 74.01  ? 94  ASP B CG    1 
ATOM   4973 O OD1   . ASP B 1 100 ? -6.084  -2.302  -68.124  1.00 73.13  ? 94  ASP B OD1   1 
ATOM   4974 O OD2   . ASP B 1 100 ? -7.363  -1.721  -66.447  1.00 82.13  ? 94  ASP B OD2   1 
ATOM   4975 N N     . TYR B 1 101 ? -6.148  2.129   -70.308  1.00 58.62  ? 95  TYR B N     1 
ATOM   4976 C CA    . TYR B 1 101 ? -5.532  3.345   -70.825  1.00 59.00  ? 95  TYR B CA    1 
ATOM   4977 C C     . TYR B 1 101 ? -5.520  3.272   -72.333  1.00 58.45  ? 95  TYR B C     1 
ATOM   4978 O O     . TYR B 1 101 ? -5.090  2.266   -72.892  1.00 57.40  ? 95  TYR B O     1 
ATOM   4979 C CB    . TYR B 1 101 ? -4.098  3.543   -70.275  1.00 63.23  ? 95  TYR B CB    1 
ATOM   4980 C CG    . TYR B 1 101 ? -3.375  4.749   -70.848  1.00 68.15  ? 95  TYR B CG    1 
ATOM   4981 C CD1   . TYR B 1 101 ? -3.455  5.993   -70.232  1.00 70.36  ? 95  TYR B CD1   1 
ATOM   4982 C CD2   . TYR B 1 101 ? -2.621  4.646   -72.013  1.00 70.46  ? 95  TYR B CD2   1 
ATOM   4983 C CE1   . TYR B 1 101 ? -2.800  7.107   -70.761  1.00 71.66  ? 95  TYR B CE1   1 
ATOM   4984 C CE2   . TYR B 1 101 ? -1.975  5.757   -72.558  1.00 72.29  ? 95  TYR B CE2   1 
ATOM   4985 C CZ    . TYR B 1 101 ? -2.061  6.984   -71.925  1.00 80.61  ? 95  TYR B CZ    1 
ATOM   4986 O OH    . TYR B 1 101 ? -1.411  8.066   -72.466  1.00 85.07  ? 95  TYR B OH    1 
ATOM   4987 N N     . TYR B 1 102 ? -5.986  4.341   -72.989  1.00 52.94  ? 96  TYR B N     1 
ATOM   4988 C CA    . TYR B 1 102 ? -5.950  4.446   -74.441  1.00 51.91  ? 96  TYR B CA    1 
ATOM   4989 C C     . TYR B 1 102 ? -5.657  5.838   -74.921  1.00 53.29  ? 96  TYR B C     1 
ATOM   4990 O O     . TYR B 1 102 ? -6.455  6.754   -74.727  1.00 52.12  ? 96  TYR B O     1 
ATOM   4991 C CB    . TYR B 1 102 ? -7.195  3.905   -75.125  1.00 52.94  ? 96  TYR B CB    1 
ATOM   4992 C CG    . TYR B 1 102 ? -6.994  3.641   -76.602  1.00 55.98  ? 96  TYR B CG    1 
ATOM   4993 C CD1   . TYR B 1 102 ? -6.653  2.375   -77.061  1.00 59.78  ? 96  TYR B CD1   1 
ATOM   4994 C CD2   . TYR B 1 102 ? -7.166  4.651   -77.545  1.00 56.45  ? 96  TYR B CD2   1 
ATOM   4995 C CE1   . TYR B 1 102 ? -6.522  2.105   -78.428  1.00 63.28  ? 96  TYR B CE1   1 
ATOM   4996 C CE2   . TYR B 1 102 ? -7.060  4.392   -78.915  1.00 58.00  ? 96  TYR B CE2   1 
ATOM   4997 C CZ    . TYR B 1 102 ? -6.717  3.118   -79.354  1.00 67.67  ? 96  TYR B CZ    1 
ATOM   4998 O OH    . TYR B 1 102 ? -6.552  2.832   -80.693  1.00 64.99  ? 96  TYR B OH    1 
ATOM   4999 N N     . GLN B 1 103 ? -4.483  5.986   -75.546  1.00 48.90  ? 97  GLN B N     1 
ATOM   5000 C CA    . GLN B 1 103 ? -4.024  7.206   -76.193  1.00 47.24  ? 97  GLN B CA    1 
ATOM   5001 C C     . GLN B 1 103 ? -4.098  6.878   -77.690  1.00 49.49  ? 97  GLN B C     1 
ATOM   5002 O O     . GLN B 1 103 ? -3.299  6.065   -78.165  1.00 49.38  ? 97  GLN B O     1 
ATOM   5003 C CB    . GLN B 1 103 ? -2.602  7.593   -75.757  1.00 48.35  ? 97  GLN B CB    1 
ATOM   5004 C CG    . GLN B 1 103 ? -2.032  8.809   -76.491  1.00 59.01  ? 97  GLN B CG    1 
ATOM   5005 C CD    . GLN B 1 103 ? -2.927  10.043  -76.472  1.00 72.47  ? 97  GLN B CD    1 
ATOM   5006 O OE1   . GLN B 1 103 ? -3.100  10.691  -75.429  1.00 70.26  ? 97  GLN B OE1   1 
ATOM   5007 N NE2   . GLN B 1 103 ? -3.482  10.434  -77.628  1.00 50.87  ? 97  GLN B NE2   1 
ATOM   5008 N N     . PRO B 1 104 ? -5.101  7.416   -78.427  1.00 43.83  ? 98  PRO B N     1 
ATOM   5009 C CA    . PRO B 1 104 ? -5.200  7.097   -79.853  1.00 43.93  ? 98  PRO B CA    1 
ATOM   5010 C C     . PRO B 1 104 ? -4.037  7.684   -80.651  1.00 50.88  ? 98  PRO B C     1 
ATOM   5011 O O     . PRO B 1 104 ? -3.404  8.645   -80.205  1.00 50.68  ? 98  PRO B O     1 
ATOM   5012 C CB    . PRO B 1 104 ? -6.538  7.721   -80.252  1.00 44.89  ? 98  PRO B CB    1 
ATOM   5013 C CG    . PRO B 1 104 ? -6.736  8.833   -79.305  1.00 48.09  ? 98  PRO B CG    1 
ATOM   5014 C CD    . PRO B 1 104 ? -6.146  8.381   -78.019  1.00 43.83  ? 98  PRO B CD    1 
ATOM   5015 N N     . GLU B 1 105 ? -3.740  7.093   -81.812  1.00 49.31  ? 99  GLU B N     1 
ATOM   5016 C CA    . GLU B 1 105 ? -2.683  7.590   -82.686  1.00 51.00  ? 99  GLU B CA    1 
ATOM   5017 C C     . GLU B 1 105 ? -3.238  8.865   -83.292  1.00 53.43  ? 99  GLU B C     1 
ATOM   5018 O O     . GLU B 1 105 ? -4.402  8.897   -83.707  1.00 53.05  ? 99  GLU B O     1 
ATOM   5019 C CB    . GLU B 1 105 ? -2.328  6.541   -83.754  1.00 53.89  ? 99  GLU B CB    1 
ATOM   5020 C CG    . GLU B 1 105 ? -1.458  7.004   -84.913  1.00 69.57  ? 99  GLU B CG    1 
ATOM   5021 C CD    . GLU B 1 105 ? -1.232  5.938   -85.975  1.00 102.40 ? 99  GLU B CD    1 
ATOM   5022 O OE1   . GLU B 1 105 ? -0.621  4.896   -85.646  1.00 114.79 ? 99  GLU B OE1   1 
ATOM   5023 O OE2   . GLU B 1 105 ? -1.683  6.134   -87.127  1.00 95.35  ? 99  GLU B OE2   1 
ATOM   5024 N N     . ALA B 1 106 ? -2.444  9.938   -83.227  1.00 48.60  ? 100 ALA B N     1 
ATOM   5025 C CA    . ALA B 1 106 ? -2.842  11.263  -83.680  1.00 47.29  ? 100 ALA B CA    1 
ATOM   5026 C C     . ALA B 1 106 ? -1.657  12.109  -84.140  1.00 50.72  ? 100 ALA B C     1 
ATOM   5027 O O     . ALA B 1 106 ? -0.505  11.824  -83.788  1.00 51.29  ? 100 ALA B O     1 
ATOM   5028 C CB    . ALA B 1 106 ? -3.577  11.978  -82.558  1.00 46.84  ? 100 ALA B CB    1 
ATOM   5029 N N     . TYR B 1 107 ? -1.944  13.149  -84.942  1.00 45.16  ? 101 TYR B N     1 
ATOM   5030 C CA    . TYR B 1 107 ? -0.945  14.095  -85.423  1.00 44.46  ? 101 TYR B CA    1 
ATOM   5031 C C     . TYR B 1 107 ? -1.399  15.508  -85.015  1.00 49.90  ? 101 TYR B C     1 
ATOM   5032 O O     . TYR B 1 107 ? -2.602  15.803  -85.024  1.00 49.36  ? 101 TYR B O     1 
ATOM   5033 C CB    . TYR B 1 107 ? -0.719  13.952  -86.937  1.00 44.75  ? 101 TYR B CB    1 
ATOM   5034 C CG    . TYR B 1 107 ? 0.189   15.009  -87.526  1.00 45.96  ? 101 TYR B CG    1 
ATOM   5035 C CD1   . TYR B 1 107 ? 1.550   15.020  -87.250  1.00 47.52  ? 101 TYR B CD1   1 
ATOM   5036 C CD2   . TYR B 1 107 ? -0.312  15.992  -88.370  1.00 47.47  ? 101 TYR B CD2   1 
ATOM   5037 C CE1   . TYR B 1 107 ? 2.386   16.002  -87.773  1.00 47.76  ? 101 TYR B CE1   1 
ATOM   5038 C CE2   . TYR B 1 107 ? 0.522   16.964  -88.922  1.00 49.63  ? 101 TYR B CE2   1 
ATOM   5039 C CZ    . TYR B 1 107 ? 1.865   16.985  -88.595  1.00 57.01  ? 101 TYR B CZ    1 
ATOM   5040 O OH    . TYR B 1 107 ? 2.686   17.973  -89.099  1.00 62.89  ? 101 TYR B OH    1 
ATOM   5041 N N     . VAL B 1 108 ? -0.451  16.339  -84.553  1.00 46.71  ? 102 VAL B N     1 
ATOM   5042 C CA    . VAL B 1 108 ? -0.745  17.701  -84.118  1.00 45.93  ? 102 VAL B CA    1 
ATOM   5043 C C     . VAL B 1 108 ? -0.089  18.617  -85.141  1.00 50.69  ? 102 VAL B C     1 
ATOM   5044 O O     . VAL B 1 108 ? 1.126   18.862  -85.033  1.00 49.78  ? 102 VAL B O     1 
ATOM   5045 C CB    . VAL B 1 108 ? -0.308  18.002  -82.654  1.00 48.86  ? 102 VAL B CB    1 
ATOM   5046 C CG1   . VAL B 1 108 ? -0.702  19.415  -82.243  1.00 48.65  ? 102 VAL B CG1   1 
ATOM   5047 C CG2   . VAL B 1 108 ? -0.906  16.996  -81.690  1.00 47.15  ? 102 VAL B CG2   1 
ATOM   5048 N N     . PRO B 1 109 ? -0.879  19.081  -86.167  1.00 48.27  ? 103 PRO B N     1 
ATOM   5049 C CA    . PRO B 1 109 ? -0.304  19.921  -87.238  1.00 50.00  ? 103 PRO B CA    1 
ATOM   5050 C C     . PRO B 1 109 ? 0.207   21.264  -86.765  1.00 56.57  ? 103 PRO B C     1 
ATOM   5051 O O     . PRO B 1 109 ? 1.252   21.723  -87.235  1.00 55.52  ? 103 PRO B O     1 
ATOM   5052 C CB    . PRO B 1 109 ? -1.443  20.045  -88.247  1.00 51.05  ? 103 PRO B CB    1 
ATOM   5053 C CG    . PRO B 1 109 ? -2.646  19.795  -87.481  1.00 53.66  ? 103 PRO B CG    1 
ATOM   5054 C CD    . PRO B 1 109 ? -2.303  18.813  -86.427  1.00 48.33  ? 103 PRO B CD    1 
ATOM   5055 N N     . GLN B 1 110 ? -0.504  21.842  -85.771  1.00 55.74  ? 104 GLN B N     1 
ATOM   5056 C CA    . GLN B 1 110 ? -0.180  23.107  -85.113  1.00 56.72  ? 104 GLN B CA    1 
ATOM   5057 C C     . GLN B 1 110 ? 1.291   23.121  -84.628  1.00 61.45  ? 104 GLN B C     1 
ATOM   5058 O O     . GLN B 1 110 ? 1.905   24.189  -84.593  1.00 62.26  ? 104 GLN B O     1 
ATOM   5059 C CB    . GLN B 1 110 ? -1.133  23.323  -83.939  1.00 56.15  ? 104 GLN B CB    1 
ATOM   5060 N N     . THR B 1 111 ? 1.867   21.915  -84.312  1.00 56.84  ? 105 THR B N     1 
ATOM   5061 C CA    . THR B 1 111 ? 3.240   21.743  -83.810  1.00 56.50  ? 105 THR B CA    1 
ATOM   5062 C C     . THR B 1 111 ? 4.076   20.652  -84.491  1.00 60.50  ? 105 THR B C     1 
ATOM   5063 O O     . THR B 1 111 ? 5.201   20.416  -84.035  1.00 60.64  ? 105 THR B O     1 
ATOM   5064 C CB    . THR B 1 111 ? 3.235   21.531  -82.294  1.00 56.76  ? 105 THR B CB    1 
ATOM   5065 O OG1   . THR B 1 111 ? 2.506   20.348  -81.964  1.00 56.07  ? 105 THR B OG1   1 
ATOM   5066 C CG2   . THR B 1 111 ? 2.709   22.729  -81.539  1.00 51.20  ? 105 THR B CG2   1 
ATOM   5067 N N     . ASP B 1 112 ? 3.550   20.002  -85.578  1.00 56.71  ? 106 ASP B N     1 
ATOM   5068 C CA    . ASP B 1 112 ? 4.210   18.921  -86.351  1.00 56.87  ? 106 ASP B CA    1 
ATOM   5069 C C     . ASP B 1 112 ? 4.578   17.707  -85.435  1.00 57.23  ? 106 ASP B C     1 
ATOM   5070 O O     . ASP B 1 112 ? 5.558   16.984  -85.664  1.00 58.11  ? 106 ASP B O     1 
ATOM   5071 C CB    . ASP B 1 112 ? 5.387   19.474  -87.202  1.00 61.49  ? 106 ASP B CB    1 
ATOM   5072 C CG    . ASP B 1 112 ? 6.128   18.494  -88.103  1.00 80.58  ? 106 ASP B CG    1 
ATOM   5073 O OD1   . ASP B 1 112 ? 7.366   18.288  -87.875  1.00 83.30  ? 106 ASP B OD1   1 
ATOM   5074 O OD2   . ASP B 1 112 ? 5.497   17.977  -89.074  1.00 84.66  ? 106 ASP B OD2   1 
ATOM   5075 N N     . THR B 1 113 ? 3.735   17.475  -84.409  1.00 49.06  ? 107 THR B N     1 
ATOM   5076 C CA    . THR B 1 113 ? 3.933   16.404  -83.446  1.00 46.94  ? 107 THR B CA    1 
ATOM   5077 C C     . THR B 1 113 ? 3.042   15.186  -83.719  1.00 49.27  ? 107 THR B C     1 
ATOM   5078 O O     . THR B 1 113 ? 1.819   15.318  -83.875  1.00 47.17  ? 107 THR B O     1 
ATOM   5079 C CB    . THR B 1 113 ? 3.747   16.935  -82.032  1.00 51.12  ? 107 THR B CB    1 
ATOM   5080 O OG1   . THR B 1 113 ? 4.563   18.094  -81.846  1.00 56.92  ? 107 THR B OG1   1 
ATOM   5081 C CG2   . THR B 1 113 ? 4.047   15.881  -80.969  1.00 41.64  ? 107 THR B CG2   1 
ATOM   5082 N N     . PHE B 1 114 ? 3.678   13.994  -83.756  1.00 45.09  ? 108 PHE B N     1 
ATOM   5083 C CA    . PHE B 1 114 ? 3.007   12.719  -83.948  1.00 42.57  ? 108 PHE B CA    1 
ATOM   5084 C C     . PHE B 1 114 ? 2.931   11.961  -82.621  1.00 44.73  ? 108 PHE B C     1 
ATOM   5085 O O     . PHE B 1 114 ? 3.953   11.714  -81.949  1.00 43.41  ? 108 PHE B O     1 
ATOM   5086 C CB    . PHE B 1 114 ? 3.671   11.879  -85.046  1.00 44.59  ? 108 PHE B CB    1 
ATOM   5087 C CG    . PHE B 1 114 ? 3.099   10.482  -85.140  1.00 44.86  ? 108 PHE B CG    1 
ATOM   5088 C CD1   . PHE B 1 114 ? 1.792   10.275  -85.564  1.00 46.58  ? 108 PHE B CD1   1 
ATOM   5089 C CD2   . PHE B 1 114 ? 3.858   9.373   -84.771  1.00 46.29  ? 108 PHE B CD2   1 
ATOM   5090 C CE1   . PHE B 1 114 ? 1.259   8.984   -85.633  1.00 46.81  ? 108 PHE B CE1   1 
ATOM   5091 C CE2   . PHE B 1 114 ? 3.315   8.082   -84.831  1.00 48.31  ? 108 PHE B CE2   1 
ATOM   5092 C CZ    . PHE B 1 114 ? 2.018   7.898   -85.256  1.00 45.60  ? 108 PHE B CZ    1 
ATOM   5093 N N     . ILE B 1 115 ? 1.693   11.592  -82.257  1.00 39.73  ? 109 ILE B N     1 
ATOM   5094 C CA    . ILE B 1 115 ? 1.405   10.862  -81.039  1.00 38.17  ? 109 ILE B CA    1 
ATOM   5095 C C     . ILE B 1 115 ? 1.136   9.419   -81.425  1.00 45.41  ? 109 ILE B C     1 
ATOM   5096 O O     . ILE B 1 115 ? 0.174   9.139   -82.147  1.00 45.29  ? 109 ILE B O     1 
ATOM   5097 C CB    . ILE B 1 115 ? 0.233   11.533  -80.254  1.00 39.12  ? 109 ILE B CB    1 
ATOM   5098 C CG1   . ILE B 1 115 ? 0.670   12.824  -79.570  1.00 38.64  ? 109 ILE B CG1   1 
ATOM   5099 C CG2   . ILE B 1 115 ? -0.368  10.607  -79.219  1.00 39.39  ? 109 ILE B CG2   1 
ATOM   5100 C CD1   . ILE B 1 115 ? 0.216   13.995  -80.239  1.00 42.49  ? 109 ILE B CD1   1 
ATOM   5101 N N     . GLU B 1 116 ? 2.017   8.509   -80.977  1.00 44.31  ? 110 GLU B N     1 
ATOM   5102 C CA    . GLU B 1 116 ? 1.883   7.068   -81.210  1.00 44.88  ? 110 GLU B CA    1 
ATOM   5103 C C     . GLU B 1 116 ? 0.756   6.539   -80.331  1.00 50.53  ? 110 GLU B C     1 
ATOM   5104 O O     . GLU B 1 116 ? 0.581   7.029   -79.205  1.00 50.02  ? 110 GLU B O     1 
ATOM   5105 C CB    . GLU B 1 116 ? 3.170   6.328   -80.808  1.00 46.96  ? 110 GLU B CB    1 
ATOM   5106 C CG    . GLU B 1 116 ? 4.395   6.660   -81.638  1.00 66.88  ? 110 GLU B CG    1 
ATOM   5107 C CD    . GLU B 1 116 ? 5.722   6.206   -81.057  1.00 109.22 ? 110 GLU B CD    1 
ATOM   5108 O OE1   . GLU B 1 116 ? 5.959   6.432   -79.846  1.00 100.06 ? 110 GLU B OE1   1 
ATOM   5109 O OE2   . GLU B 1 116 ? 6.554   5.690   -81.839  1.00 119.39 ? 110 GLU B OE2   1 
ATOM   5110 N N     . LYS B 1 117 ? 0.011   5.526   -80.819  1.00 48.23  ? 111 LYS B N     1 
ATOM   5111 C CA    . LYS B 1 117 ? -1.034  4.885   -80.019  1.00 47.40  ? 111 LYS B CA    1 
ATOM   5112 C C     . LYS B 1 117 ? -0.365  4.179   -78.841  1.00 53.95  ? 111 LYS B C     1 
ATOM   5113 O O     . LYS B 1 117 ? 0.660   3.514   -79.026  1.00 54.26  ? 111 LYS B O     1 
ATOM   5114 C CB    . LYS B 1 117 ? -1.835  3.884   -80.870  1.00 48.67  ? 111 LYS B CB    1 
ATOM   5115 C CG    . LYS B 1 117 ? -2.687  2.837   -80.118  1.00 47.18  ? 111 LYS B CG    1 
ATOM   5116 C CD    . LYS B 1 117 ? -2.536  1.447   -80.775  1.00 54.27  ? 111 LYS B CD    1 
ATOM   5117 C CE    . LYS B 1 117 ? -3.567  0.393   -80.416  1.00 64.70  ? 111 LYS B CE    1 
ATOM   5118 N NZ    . LYS B 1 117 ? -3.158  -0.958  -80.920  1.00 70.64  ? 111 LYS B NZ    1 
ATOM   5119 N N     . ASP B 1 118 ? -0.904  4.385   -77.635  1.00 52.31  ? 112 ASP B N     1 
ATOM   5120 C CA    . ASP B 1 118 ? -0.421  3.733   -76.425  1.00 53.72  ? 112 ASP B CA    1 
ATOM   5121 C C     . ASP B 1 118 ? -1.637  3.259   -75.662  1.00 59.64  ? 112 ASP B C     1 
ATOM   5122 O O     . ASP B 1 118 ? -2.486  4.061   -75.251  1.00 58.65  ? 112 ASP B O     1 
ATOM   5123 C CB    . ASP B 1 118 ? 0.472   4.644   -75.566  1.00 56.64  ? 112 ASP B CB    1 
ATOM   5124 C CG    . ASP B 1 118 ? 1.067   3.959   -74.336  1.00 76.62  ? 112 ASP B CG    1 
ATOM   5125 O OD1   . ASP B 1 118 ? 1.279   4.653   -73.311  1.00 78.38  ? 112 ASP B OD1   1 
ATOM   5126 O OD2   . ASP B 1 118 ? 1.321   2.725   -74.399  1.00 86.57  ? 112 ASP B OD2   1 
ATOM   5127 N N     . ALA B 1 119 ? -1.737  1.936   -75.534  1.00 57.66  ? 113 ALA B N     1 
ATOM   5128 C CA    . ALA B 1 119 ? -2.858  1.280   -74.891  1.00 57.42  ? 113 ALA B CA    1 
ATOM   5129 C C     . ALA B 1 119 ? -2.441  0.303   -73.792  1.00 62.63  ? 113 ALA B C     1 
ATOM   5130 O O     . ALA B 1 119 ? -1.256  -0.021  -73.653  1.00 63.99  ? 113 ALA B O     1 
ATOM   5131 C CB    . ALA B 1 119 ? -3.685  0.575   -75.942  1.00 58.18  ? 113 ALA B CB    1 
ATOM   5132 N N     . SER B 1 120 ? -3.417  -0.126  -72.975  1.00 58.20  ? 114 SER B N     1 
ATOM   5133 C CA    . SER B 1 120 ? -3.233  -1.054  -71.864  1.00 58.02  ? 114 SER B CA    1 
ATOM   5134 C C     . SER B 1 120 ? -4.602  -1.654  -71.574  1.00 60.68  ? 114 SER B C     1 
ATOM   5135 O O     . SER B 1 120 ? -5.476  -0.964  -71.057  1.00 60.65  ? 114 SER B O     1 
ATOM   5136 C CB    . SER B 1 120 ? -2.678  -0.322  -70.644  1.00 62.81  ? 114 SER B CB    1 
ATOM   5137 O OG    . SER B 1 120 ? -1.421  0.289   -70.901  1.00 75.07  ? 114 SER B OG    1 
ATOM   5138 N N     . ILE B 1 121 ? -4.798  -2.918  -71.990  1.00 55.96  ? 115 ILE B N     1 
ATOM   5139 C CA    . ILE B 1 121 ? -6.009  -3.742  -71.910  1.00 54.98  ? 115 ILE B CA    1 
ATOM   5140 C C     . ILE B 1 121 ? -6.262  -4.344  -70.523  1.00 60.11  ? 115 ILE B C     1 
ATOM   5141 O O     . ILE B 1 121 ? -5.352  -4.920  -69.933  1.00 62.76  ? 115 ILE B O     1 
ATOM   5142 C CB    . ILE B 1 121 ? -5.900  -4.879  -72.972  1.00 58.05  ? 115 ILE B CB    1 
ATOM   5143 C CG1   . ILE B 1 121 ? -5.745  -4.346  -74.405  1.00 58.37  ? 115 ILE B CG1   1 
ATOM   5144 C CG2   . ILE B 1 121 ? -7.033  -5.887  -72.876  1.00 58.59  ? 115 ILE B CG2   1 
ATOM   5145 C CD1   . ILE B 1 121 ? -4.238  -4.275  -74.904  1.00 69.29  ? 115 ILE B CD1   1 
ATOM   5146 N N     . ASN B 1 122 ? -7.515  -4.271  -70.042  1.00 54.50  ? 116 ASN B N     1 
ATOM   5147 C CA    . ASN B 1 122 ? -7.981  -4.876  -68.799  1.00 54.32  ? 116 ASN B CA    1 
ATOM   5148 C C     . ASN B 1 122 ? -8.554  -6.212  -69.182  1.00 62.04  ? 116 ASN B C     1 
ATOM   5149 O O     . ASN B 1 122 ? -9.619  -6.273  -69.800  1.00 60.83  ? 116 ASN B O     1 
ATOM   5150 C CB    . ASN B 1 122 ? -9.053  -4.030  -68.148  1.00 49.37  ? 116 ASN B CB    1 
ATOM   5151 C CG    . ASN B 1 122 ? -9.464  -4.483  -66.792  1.00 76.92  ? 116 ASN B CG    1 
ATOM   5152 O OD1   . ASN B 1 122 ? -9.727  -5.666  -66.551  1.00 78.02  ? 116 ASN B OD1   1 
ATOM   5153 N ND2   . ASN B 1 122 ? -9.611  -3.529  -65.888  1.00 71.48  ? 116 ASN B ND2   1 
ATOM   5154 N N     . ASP B 1 123 ? -7.843  -7.289  -68.816  1.00 63.45  ? 117 ASP B N     1 
ATOM   5155 C CA    . ASP B 1 123 ? -8.251  -8.652  -69.140  1.00 64.95  ? 117 ASP B CA    1 
ATOM   5156 C C     . ASP B 1 123 ? -9.579  -9.127  -68.566  1.00 68.74  ? 117 ASP B C     1 
ATOM   5157 O O     . ASP B 1 123 ? -10.272 -9.888  -69.247  1.00 69.43  ? 117 ASP B O     1 
ATOM   5158 C CB    . ASP B 1 123 ? -7.119  -9.655  -68.930  1.00 68.26  ? 117 ASP B CB    1 
ATOM   5159 C CG    . ASP B 1 123 ? -6.480  -10.059 -70.244  1.00 88.30  ? 117 ASP B CG    1 
ATOM   5160 O OD1   . ASP B 1 123 ? -7.192  -10.666 -71.097  1.00 89.88  ? 117 ASP B OD1   1 
ATOM   5161 O OD2   . ASP B 1 123 ? -5.289  -9.730  -70.450  1.00 99.44  ? 117 ASP B OD2   1 
ATOM   5162 N N     . GLU B 1 124 ? -9.950  -8.657  -67.346  1.00 63.43  ? 118 GLU B N     1 
ATOM   5163 C CA    . GLU B 1 124 ? -11.217 -9.004  -66.688  1.00 62.59  ? 118 GLU B CA    1 
ATOM   5164 C C     . GLU B 1 124 ? -12.422 -8.496  -67.511  1.00 62.98  ? 118 GLU B C     1 
ATOM   5165 O O     . GLU B 1 124 ? -13.414 -9.225  -67.685  1.00 61.61  ? 118 GLU B O     1 
ATOM   5166 C CB    . GLU B 1 124 ? -11.251 -8.427  -65.273  1.00 63.38  ? 118 GLU B CB    1 
ATOM   5167 N N     . ILE B 1 125 ? -12.295 -7.253  -68.043  1.00 56.95  ? 119 ILE B N     1 
ATOM   5168 C CA    . ILE B 1 125 ? -13.302 -6.593  -68.860  1.00 55.20  ? 119 ILE B CA    1 
ATOM   5169 C C     . ILE B 1 125 ? -13.418 -7.333  -70.181  1.00 59.80  ? 119 ILE B C     1 
ATOM   5170 O O     . ILE B 1 125 ? -14.541 -7.579  -70.630  1.00 61.67  ? 119 ILE B O     1 
ATOM   5171 C CB    . ILE B 1 125 ? -13.010 -5.078  -69.021  1.00 56.89  ? 119 ILE B CB    1 
ATOM   5172 C CG1   . ILE B 1 125 ? -13.028 -4.389  -67.650  1.00 56.68  ? 119 ILE B CG1   1 
ATOM   5173 C CG2   . ILE B 1 125 ? -14.019 -4.407  -69.973  1.00 57.52  ? 119 ILE B CG2   1 
ATOM   5174 C CD1   . ILE B 1 125 ? -12.586 -2.947  -67.634  1.00 62.31  ? 119 ILE B CD1   1 
ATOM   5175 N N     . ASP B 1 126 ? -12.272 -7.744  -70.765  1.00 54.17  ? 120 ASP B N     1 
ATOM   5176 C CA    . ASP B 1 126 ? -12.232 -8.519  -72.001  1.00 54.26  ? 120 ASP B CA    1 
ATOM   5177 C C     . ASP B 1 126 ? -13.023 -9.862  -71.859  1.00 55.90  ? 120 ASP B C     1 
ATOM   5178 O O     . ASP B 1 126 ? -13.818 -10.213 -72.738  1.00 54.26  ? 120 ASP B O     1 
ATOM   5179 C CB    . ASP B 1 126 ? -10.767 -8.739  -72.429  1.00 57.39  ? 120 ASP B CB    1 
ATOM   5180 C CG    . ASP B 1 126 ? -10.563 -9.437  -73.775  1.00 81.46  ? 120 ASP B CG    1 
ATOM   5181 O OD1   . ASP B 1 126 ? -9.687  -10.336 -73.853  1.00 86.15  ? 120 ASP B OD1   1 
ATOM   5182 O OD2   . ASP B 1 126 ? -11.258 -9.064  -74.757  1.00 86.34  ? 120 ASP B OD2   1 
ATOM   5183 N N     . LYS B 1 127 ? -12.847 -10.559 -70.719  1.00 52.52  ? 121 LYS B N     1 
ATOM   5184 C CA    . LYS B 1 127 ? -13.539 -11.805 -70.388  1.00 53.05  ? 121 LYS B CA    1 
ATOM   5185 C C     . LYS B 1 127 ? -15.054 -11.555 -70.340  1.00 58.92  ? 121 LYS B C     1 
ATOM   5186 O O     . LYS B 1 127 ? -15.823 -12.352 -70.894  1.00 59.28  ? 121 LYS B O     1 
ATOM   5187 C CB    . LYS B 1 127 ? -13.041 -12.345 -69.047  1.00 53.84  ? 121 LYS B CB    1 
ATOM   5188 N N     . LEU B 1 128 ? -15.465 -10.412 -69.720  1.00 55.23  ? 122 LEU B N     1 
ATOM   5189 C CA    . LEU B 1 128 ? -16.858 -9.980  -69.574  1.00 54.81  ? 122 LEU B CA    1 
ATOM   5190 C C     . LEU B 1 128 ? -17.522 -9.696  -70.915  1.00 61.18  ? 122 LEU B C     1 
ATOM   5191 O O     . LEU B 1 128 ? -18.714 -10.005 -71.091  1.00 62.11  ? 122 LEU B O     1 
ATOM   5192 C CB    . LEU B 1 128 ? -16.946 -8.729  -68.708  1.00 53.39  ? 122 LEU B CB    1 
ATOM   5193 C CG    . LEU B 1 128 ? -16.823 -8.899  -67.223  1.00 57.05  ? 122 LEU B CG    1 
ATOM   5194 C CD1   . LEU B 1 128 ? -16.568 -7.556  -66.583  1.00 56.50  ? 122 LEU B CD1   1 
ATOM   5195 C CD2   . LEU B 1 128 ? -18.080 -9.512  -66.629  1.00 58.10  ? 122 LEU B CD2   1 
ATOM   5196 N N     . ARG B 1 129 ? -16.754 -9.069  -71.838  1.00 57.57  ? 123 ARG B N     1 
ATOM   5197 C CA    . ARG B 1 129 ? -17.188 -8.719  -73.189  1.00 57.94  ? 123 ARG B CA    1 
ATOM   5198 C C     . ARG B 1 129 ? -17.452 -9.999  -73.980  1.00 66.47  ? 123 ARG B C     1 
ATOM   5199 O O     . ARG B 1 129 ? -18.433 -10.078 -74.725  1.00 66.47  ? 123 ARG B O     1 
ATOM   5200 C CB    . ARG B 1 129 ? -16.110 -7.897  -73.891  1.00 54.81  ? 123 ARG B CB    1 
ATOM   5201 C CG    . ARG B 1 129 ? -15.959 -6.470  -73.399  1.00 58.43  ? 123 ARG B CG    1 
ATOM   5202 C CD    . ARG B 1 129 ? -14.760 -5.799  -74.052  1.00 57.21  ? 123 ARG B CD    1 
ATOM   5203 N NE    . ARG B 1 129 ? -14.873 -5.810  -75.513  1.00 58.57  ? 123 ARG B NE    1 
ATOM   5204 C CZ    . ARG B 1 129 ? -15.306 -4.792  -76.240  1.00 60.71  ? 123 ARG B CZ    1 
ATOM   5205 N NH1   . ARG B 1 129 ? -15.403 -4.907  -77.554  1.00 35.28  ? 123 ARG B NH1   1 
ATOM   5206 N NH2   . ARG B 1 129 ? -15.637 -3.648  -75.662  1.00 56.48  ? 123 ARG B NH2   1 
ATOM   5207 N N     . HIS B 1 130 ? -16.566 -11.004 -73.798  1.00 65.64  ? 124 HIS B N     1 
ATOM   5208 C CA    . HIS B 1 130 ? -16.663 -12.304 -74.444  1.00 66.82  ? 124 HIS B CA    1 
ATOM   5209 C C     . HIS B 1 130 ? -17.856 -13.069 -73.932  1.00 71.31  ? 124 HIS B C     1 
ATOM   5210 O O     . HIS B 1 130 ? -18.497 -13.756 -74.721  1.00 71.72  ? 124 HIS B O     1 
ATOM   5211 C CB    . HIS B 1 130 ? -15.394 -13.120 -74.222  1.00 68.07  ? 124 HIS B CB    1 
ATOM   5212 C CG    . HIS B 1 130 ? -14.230 -12.649 -75.025  1.00 70.91  ? 124 HIS B CG    1 
ATOM   5213 N ND1   . HIS B 1 130 ? -12.938 -12.851 -74.585  1.00 72.85  ? 124 HIS B ND1   1 
ATOM   5214 C CD2   . HIS B 1 130 ? -14.196 -12.001 -76.216  1.00 72.26  ? 124 HIS B CD2   1 
ATOM   5215 C CE1   . HIS B 1 130 ? -12.157 -12.324 -75.512  1.00 71.89  ? 124 HIS B CE1   1 
ATOM   5216 N NE2   . HIS B 1 130 ? -12.872 -11.796 -76.514  1.00 72.02  ? 124 HIS B NE2   1 
ATOM   5217 N N     . SER B 1 131 ? -18.157 -12.950 -72.617  1.00 67.72  ? 125 SER B N     1 
ATOM   5218 C CA    . SER B 1 131 ? -19.316 -13.587 -71.992  1.00 68.47  ? 125 SER B CA    1 
ATOM   5219 C C     . SER B 1 131 ? -20.576 -13.016 -72.605  1.00 71.71  ? 125 SER B C     1 
ATOM   5220 O O     . SER B 1 131 ? -21.492 -13.778 -72.903  1.00 73.20  ? 125 SER B O     1 
ATOM   5221 C CB    . SER B 1 131 ? -19.326 -13.350 -70.488  1.00 72.72  ? 125 SER B CB    1 
ATOM   5222 O OG    . SER B 1 131 ? -18.427 -14.238 -69.851  1.00 85.74  ? 125 SER B OG    1 
ATOM   5223 N N     . ALA B 1 132 ? -20.582 -11.683 -72.858  1.00 65.07  ? 126 ALA B N     1 
ATOM   5224 C CA    . ALA B 1 132 ? -21.681 -10.937 -73.461  1.00 63.34  ? 126 ALA B CA    1 
ATOM   5225 C C     . ALA B 1 132 ? -21.939 -11.364 -74.904  1.00 64.48  ? 126 ALA B C     1 
ATOM   5226 O O     . ALA B 1 132 ? -23.044 -11.805 -75.181  1.00 64.05  ? 126 ALA B O     1 
ATOM   5227 C CB    . ALA B 1 132 ? -21.409 -9.441  -73.376  1.00 62.91  ? 126 ALA B CB    1 
ATOM   5228 N N     . THR B 1 133 ? -20.926 -11.271 -75.809  1.00 60.43  ? 127 THR B N     1 
ATOM   5229 C CA    . THR B 1 133 ? -21.041 -11.663 -77.226  1.00 60.59  ? 127 THR B CA    1 
ATOM   5230 C C     . THR B 1 133 ? -21.451 -13.121 -77.416  1.00 68.11  ? 127 THR B C     1 
ATOM   5231 O O     . THR B 1 133 ? -22.433 -13.385 -78.120  1.00 68.24  ? 127 THR B O     1 
ATOM   5232 C CB    . THR B 1 133 ? -19.807 -11.298 -78.057  1.00 61.43  ? 127 THR B CB    1 
ATOM   5233 O OG1   . THR B 1 133 ? -18.615 -11.527 -77.308  1.00 60.05  ? 127 THR B OG1   1 
ATOM   5234 C CG2   . THR B 1 133 ? -19.845 -9.879  -78.553  1.00 56.77  ? 127 THR B CG2   1 
ATOM   5235 N N     . SER B 1 134 ? -20.743 -14.063 -76.750  1.00 66.70  ? 128 SER B N     1 
ATOM   5236 C CA    . SER B 1 134 ? -21.097 -15.476 -76.847  1.00 68.39  ? 128 SER B CA    1 
ATOM   5237 C C     . SER B 1 134 ? -22.471 -15.817 -76.271  1.00 75.59  ? 128 SER B C     1 
ATOM   5238 O O     . SER B 1 134 ? -23.120 -16.712 -76.817  1.00 78.11  ? 128 SER B O     1 
ATOM   5239 C CB    . SER B 1 134 ? -19.987 -16.401 -76.361  1.00 71.34  ? 128 SER B CB    1 
ATOM   5240 O OG    . SER B 1 134 ? -19.523 -16.084 -75.063  1.00 79.71  ? 128 SER B OG    1 
ATOM   5241 N N     . ALA B 1 135 ? -22.970 -15.045 -75.268  1.00 71.39  ? 129 ALA B N     1 
ATOM   5242 C CA    . ALA B 1 135 ? -24.312 -15.254 -74.692  1.00 72.30  ? 129 ALA B CA    1 
ATOM   5243 C C     . ALA B 1 135 ? -25.422 -14.989 -75.694  1.00 77.92  ? 129 ALA B C     1 
ATOM   5244 O O     . ALA B 1 135 ? -26.475 -15.627 -75.605  1.00 78.79  ? 129 ALA B O     1 
ATOM   5245 C CB    . ALA B 1 135 ? -24.524 -14.374 -73.475  1.00 72.23  ? 129 ALA B CB    1 
ATOM   5246 N N     . LEU B 1 136 ? -25.194 -14.041 -76.638  1.00 74.27  ? 130 LEU B N     1 
ATOM   5247 C CA    . LEU B 1 136 ? -26.188 -13.660 -77.643  1.00 74.91  ? 130 LEU B CA    1 
ATOM   5248 C C     . LEU B 1 136 ? -26.471 -14.774 -78.679  1.00 81.22  ? 130 LEU B C     1 
ATOM   5249 O O     . LEU B 1 136 ? -27.535 -14.766 -79.317  1.00 80.91  ? 130 LEU B O     1 
ATOM   5250 C CB    . LEU B 1 136 ? -25.812 -12.336 -78.312  1.00 73.98  ? 130 LEU B CB    1 
ATOM   5251 N N     . PHE B 1 137 ? -25.532 -15.741 -78.813  1.00 78.99  ? 131 PHE B N     1 
ATOM   5252 C CA    . PHE B 1 137 ? -25.664 -16.883 -79.715  1.00 80.46  ? 131 PHE B CA    1 
ATOM   5253 C C     . PHE B 1 137 ? -26.390 -18.038 -78.998  1.00 85.85  ? 131 PHE B C     1 
ATOM   5254 O O     . PHE B 1 137 ? -27.225 -18.707 -79.602  1.00 86.52  ? 131 PHE B O     1 
ATOM   5255 C CB    . PHE B 1 137 ? -24.287 -17.332 -80.208  1.00 80.68  ? 131 PHE B CB    1 
ATOM   5256 N N     . GLU B 1 138 ? -26.105 -18.223 -77.696  1.00 82.38  ? 132 GLU B N     1 
ATOM   5257 C CA    . GLU B 1 138 ? -26.669 -19.285 -76.863  1.00 83.55  ? 132 GLU B CA    1 
ATOM   5258 C C     . GLU B 1 138 ? -28.150 -19.125 -76.489  1.00 88.39  ? 132 GLU B C     1 
ATOM   5259 O O     . GLU B 1 138 ? -28.929 -20.050 -76.719  1.00 89.36  ? 132 GLU B O     1 
ATOM   5260 C CB    . GLU B 1 138 ? -25.813 -19.501 -75.603  1.00 84.40  ? 132 GLU B CB    1 
ATOM   5261 C CG    . GLU B 1 138 ? -24.367 -19.858 -75.914  1.00 95.54  ? 132 GLU B CG    1 
ATOM   5262 C CD    . GLU B 1 138 ? -23.423 -19.904 -74.725  1.00 122.48 ? 132 GLU B CD    1 
ATOM   5263 O OE1   . GLU B 1 138 ? -23.523 -19.024 -73.838  1.00 115.93 ? 132 GLU B OE1   1 
ATOM   5264 O OE2   . GLU B 1 138 ? -22.538 -20.790 -74.712  1.00 121.87 ? 132 GLU B OE2   1 
ATOM   5265 N N     . ARG B 1 139 ? -28.538 -17.978 -75.897  1.00 83.98  ? 133 ARG B N     1 
ATOM   5266 C CA    . ARG B 1 139 ? -29.909 -17.780 -75.414  1.00 84.46  ? 133 ARG B CA    1 
ATOM   5267 C C     . ARG B 1 139 ? -30.568 -16.468 -75.794  1.00 87.26  ? 133 ARG B C     1 
ATOM   5268 O O     . ARG B 1 139 ? -29.879 -15.529 -76.189  1.00 85.66  ? 133 ARG B O     1 
ATOM   5269 C CB    . ARG B 1 139 ? -29.977 -17.996 -73.894  1.00 84.22  ? 133 ARG B CB    1 
ATOM   5270 C CG    . ARG B 1 139 ? -28.804 -17.416 -73.116  1.00 86.57  ? 133 ARG B CG    1 
ATOM   5271 C CD    . ARG B 1 139 ? -29.243 -17.136 -71.708  1.00 93.10  ? 133 ARG B CD    1 
ATOM   5272 N NE    . ARG B 1 139 ? -28.410 -17.793 -70.704  1.00 97.30  ? 133 ARG B NE    1 
ATOM   5273 C CZ    . ARG B 1 139 ? -28.817 -18.057 -69.464  1.00 110.58 ? 133 ARG B CZ    1 
ATOM   5274 N NH1   . ARG B 1 139 ? -30.052 -17.749 -69.082  1.00 88.53  ? 133 ARG B NH1   1 
ATOM   5275 N NH2   . ARG B 1 139 ? -28.000 -18.652 -68.603  1.00 101.80 ? 133 ARG B NH2   1 
ATOM   5276 N N     . ARG B 1 140 ? -31.915 -16.413 -75.681  1.00 84.11  ? 134 ARG B N     1 
ATOM   5277 C CA    . ARG B 1 140 ? -32.714 -15.227 -75.992  1.00 83.03  ? 134 ARG B CA    1 
ATOM   5278 C C     . ARG B 1 140 ? -33.009 -14.372 -74.737  1.00 86.13  ? 134 ARG B C     1 
ATOM   5279 O O     . ARG B 1 140 ? -33.395 -13.202 -74.867  1.00 85.24  ? 134 ARG B O     1 
ATOM   5280 C CB    . ARG B 1 140 ? -34.006 -15.629 -76.692  1.00 85.31  ? 134 ARG B CB    1 
ATOM   5281 N N     . ASP B 1 141 ? -32.795 -14.938 -73.529  1.00 82.46  ? 135 ASP B N     1 
ATOM   5282 C CA    . ASP B 1 141 ? -33.012 -14.227 -72.270  1.00 82.09  ? 135 ASP B CA    1 
ATOM   5283 C C     . ASP B 1 141 ? -31.734 -13.465 -71.844  1.00 85.26  ? 135 ASP B C     1 
ATOM   5284 O O     . ASP B 1 141 ? -31.135 -13.714 -70.788  1.00 86.81  ? 135 ASP B O     1 
ATOM   5285 C CB    . ASP B 1 141 ? -33.566 -15.168 -71.179  1.00 85.76  ? 135 ASP B CB    1 
ATOM   5286 C CG    . ASP B 1 141 ? -32.667 -16.342 -70.839  1.00 97.45  ? 135 ASP B CG    1 
ATOM   5287 O OD1   . ASP B 1 141 ? -32.518 -17.246 -71.694  1.00 99.25  ? 135 ASP B OD1   1 
ATOM   5288 O OD2   . ASP B 1 141 ? -32.129 -16.366 -69.712  1.00 101.81 ? 135 ASP B OD2   1 
ATOM   5289 N N     . VAL B 1 142 ? -31.330 -12.511 -72.687  1.00 77.97  ? 136 VAL B N     1 
ATOM   5290 C CA    . VAL B 1 142 ? -30.122 -11.739 -72.464  1.00 74.73  ? 136 VAL B CA    1 
ATOM   5291 C C     . VAL B 1 142 ? -30.436 -10.268 -72.270  1.00 75.50  ? 136 VAL B C     1 
ATOM   5292 O O     . VAL B 1 142 ? -31.260 -9.712  -72.998  1.00 74.94  ? 136 VAL B O     1 
ATOM   5293 C CB    . VAL B 1 142 ? -29.104 -11.946 -73.622  1.00 78.05  ? 136 VAL B CB    1 
ATOM   5294 C CG1   . VAL B 1 142 ? -27.743 -11.354 -73.274  1.00 76.54  ? 136 VAL B CG1   1 
ATOM   5295 C CG2   . VAL B 1 142 ? -28.943 -13.417 -73.968  1.00 78.96  ? 136 VAL B CG2   1 
ATOM   5296 N N     . ILE B 1 143 ? -29.754 -9.639  -71.289  1.00 69.51  ? 137 ILE B N     1 
ATOM   5297 C CA    . ILE B 1 143 ? -29.773 -8.198  -70.999  1.00 66.17  ? 137 ILE B CA    1 
ATOM   5298 C C     . ILE B 1 143 ? -28.301 -7.795  -71.013  1.00 64.87  ? 137 ILE B C     1 
ATOM   5299 O O     . ILE B 1 143 ? -27.519 -8.347  -70.234  1.00 61.99  ? 137 ILE B O     1 
ATOM   5300 C CB    . ILE B 1 143 ? -30.424 -7.820  -69.650  1.00 68.99  ? 137 ILE B CB    1 
ATOM   5301 C CG1   . ILE B 1 143 ? -31.878 -8.288  -69.557  1.00 70.75  ? 137 ILE B CG1   1 
ATOM   5302 C CG2   . ILE B 1 143 ? -30.308 -6.316  -69.421  1.00 68.45  ? 137 ILE B CG2   1 
ATOM   5303 C CD1   . ILE B 1 143 ? -32.485 -8.170  -68.142  1.00 79.74  ? 137 ILE B CD1   1 
ATOM   5304 N N     . ILE B 1 144 ? -27.917 -6.880  -71.918  1.00 60.20  ? 138 ILE B N     1 
ATOM   5305 C CA    . ILE B 1 144 ? -26.533 -6.420  -71.990  1.00 58.96  ? 138 ILE B CA    1 
ATOM   5306 C C     . ILE B 1 144 ? -26.470 -4.948  -71.623  1.00 62.62  ? 138 ILE B C     1 
ATOM   5307 O O     . ILE B 1 144 ? -27.076 -4.120  -72.310  1.00 63.76  ? 138 ILE B O     1 
ATOM   5308 C CB    . ILE B 1 144 ? -25.848 -6.732  -73.345  1.00 61.48  ? 138 ILE B CB    1 
ATOM   5309 C CG1   . ILE B 1 144 ? -25.724 -8.250  -73.551  1.00 62.41  ? 138 ILE B CG1   1 
ATOM   5310 C CG2   . ILE B 1 144 ? -24.462 -6.059  -73.423  1.00 61.10  ? 138 ILE B CG2   1 
ATOM   5311 C CD1   . ILE B 1 144 ? -25.593 -8.660  -74.949  1.00 64.42  ? 138 ILE B CD1   1 
ATOM   5312 N N     . ILE B 1 145 ? -25.756 -4.635  -70.520  1.00 55.90  ? 139 ILE B N     1 
ATOM   5313 C CA    . ILE B 1 145 ? -25.542 -3.273  -70.040  1.00 53.30  ? 139 ILE B CA    1 
ATOM   5314 C C     . ILE B 1 145 ? -24.270 -2.860  -70.714  1.00 55.94  ? 139 ILE B C     1 
ATOM   5315 O O     . ILE B 1 145 ? -23.221 -3.443  -70.444  1.00 55.36  ? 139 ILE B O     1 
ATOM   5316 C CB    . ILE B 1 145 ? -25.387 -3.199  -68.503  1.00 55.92  ? 139 ILE B CB    1 
ATOM   5317 C CG1   . ILE B 1 145 ? -26.260 -4.219  -67.723  1.00 56.60  ? 139 ILE B CG1   1 
ATOM   5318 C CG2   . ILE B 1 145 ? -25.490 -1.762  -67.990  1.00 56.03  ? 139 ILE B CG2   1 
ATOM   5319 C CD1   . ILE B 1 145 ? -27.718 -4.130  -67.870  1.00 58.41  ? 139 ILE B CD1   1 
ATOM   5320 N N     . ALA B 1 146 ? -24.365 -1.901  -71.630  1.00 52.67  ? 140 ALA B N     1 
ATOM   5321 C CA    . ALA B 1 146 ? -23.227 -1.434  -72.413  1.00 52.02  ? 140 ALA B CA    1 
ATOM   5322 C C     . ALA B 1 146 ? -23.070 0.072   -72.462  1.00 54.96  ? 140 ALA B C     1 
ATOM   5323 O O     . ALA B 1 146 ? -23.997 0.819   -72.127  1.00 54.04  ? 140 ALA B O     1 
ATOM   5324 C CB    . ALA B 1 146 ? -23.324 -1.979  -73.829  1.00 53.38  ? 140 ALA B CB    1 
ATOM   5325 N N     . SER B 1 147 ? -21.868 0.505   -72.869  1.00 51.73  ? 141 SER B N     1 
ATOM   5326 C CA    . SER B 1 147 ? -21.498 1.900   -73.104  1.00 51.79  ? 141 SER B CA    1 
ATOM   5327 C C     . SER B 1 147 ? -21.497 2.068   -74.630  1.00 57.59  ? 141 SER B C     1 
ATOM   5328 O O     . SER B 1 147 ? -21.834 1.114   -75.339  1.00 56.15  ? 141 SER B O     1 
ATOM   5329 C CB    . SER B 1 147 ? -20.101 2.176   -72.559  1.00 54.37  ? 141 SER B CB    1 
ATOM   5330 O OG    . SER B 1 147 ? -19.134 1.420   -73.270  1.00 63.78  ? 141 SER B OG    1 
ATOM   5331 N N     . VAL B 1 148 ? -21.071 3.246   -75.137  1.00 56.74  ? 142 VAL B N     1 
ATOM   5332 C CA    . VAL B 1 148 ? -20.969 3.516   -76.584  1.00 57.72  ? 142 VAL B CA    1 
ATOM   5333 C C     . VAL B 1 148 ? -20.057 2.527   -77.314  1.00 62.35  ? 142 VAL B C     1 
ATOM   5334 O O     . VAL B 1 148 ? -20.009 2.538   -78.546  1.00 62.47  ? 142 VAL B O     1 
ATOM   5335 C CB    . VAL B 1 148 ? -20.605 4.978   -76.923  1.00 61.87  ? 142 VAL B CB    1 
ATOM   5336 C CG1   . VAL B 1 148 ? -21.844 5.863   -76.920  1.00 62.14  ? 142 VAL B CG1   1 
ATOM   5337 C CG2   . VAL B 1 148 ? -19.522 5.520   -75.990  1.00 61.17  ? 142 VAL B CG2   1 
ATOM   5338 N N     . SER B 1 149 ? -19.364 1.650   -76.554  1.00 58.86  ? 143 SER B N     1 
ATOM   5339 C CA    . SER B 1 149 ? -18.501 0.593   -77.077  1.00 59.33  ? 143 SER B CA    1 
ATOM   5340 C C     . SER B 1 149 ? -19.319 -0.369  -77.994  1.00 64.31  ? 143 SER B C     1 
ATOM   5341 O O     . SER B 1 149 ? -18.748 -1.092  -78.820  1.00 65.42  ? 143 SER B O     1 
ATOM   5342 C CB    . SER B 1 149 ? -17.867 -0.174  -75.918  1.00 63.03  ? 143 SER B CB    1 
ATOM   5343 O OG    . SER B 1 149 ? -16.948 -1.129  -76.414  1.00 73.46  ? 143 SER B OG    1 
ATOM   5344 N N     . CYS B 1 150 ? -20.653 -0.340  -77.848  1.00 59.42  ? 144 CYS B N     1 
ATOM   5345 C CA    . CYS B 1 150 ? -21.605 -1.134  -78.601  1.00 60.01  ? 144 CYS B CA    1 
ATOM   5346 C C     . CYS B 1 150 ? -21.809 -0.622  -80.043  1.00 63.15  ? 144 CYS B C     1 
ATOM   5347 O O     . CYS B 1 150 ? -22.445 -1.322  -80.848  1.00 65.85  ? 144 CYS B O     1 
ATOM   5348 C CB    . CYS B 1 150 ? -22.929 -1.215  -77.844  1.00 61.10  ? 144 CYS B CB    1 
ATOM   5349 S SG    . CYS B 1 150 ? -23.810 0.367   -77.719  1.00 64.73  ? 144 CYS B SG    1 
ATOM   5350 N N     . ILE B 1 151 ? -21.328 0.608   -80.358  1.00 54.97  ? 145 ILE B N     1 
ATOM   5351 C CA    . ILE B 1 151 ? -21.447 1.187   -81.711  1.00 52.73  ? 145 ILE B CA    1 
ATOM   5352 C C     . ILE B 1 151 ? -20.115 1.185   -82.450  1.00 52.91  ? 145 ILE B C     1 
ATOM   5353 O O     . ILE B 1 151 ? -20.043 1.543   -83.620  1.00 53.08  ? 145 ILE B O     1 
ATOM   5354 C CB    . ILE B 1 151 ? -22.264 2.512   -81.828  1.00 54.45  ? 145 ILE B CB    1 
ATOM   5355 C CG1   . ILE B 1 151 ? -21.619 3.669   -81.048  1.00 53.60  ? 145 ILE B CG1   1 
ATOM   5356 C CG2   . ILE B 1 151 ? -23.719 2.298   -81.437  1.00 53.95  ? 145 ILE B CG2   1 
ATOM   5357 C CD1   . ILE B 1 151 ? -21.072 4.744   -81.876  1.00 61.62  ? 145 ILE B CD1   1 
ATOM   5358 N N     . TYR B 1 152 ? -19.079 0.706   -81.775  1.00 46.88  ? 146 TYR B N     1 
ATOM   5359 C CA    . TYR B 1 152 ? -17.736 0.573   -82.331  1.00 45.96  ? 146 TYR B CA    1 
ATOM   5360 C C     . TYR B 1 152 ? -17.538 -0.749  -83.065  1.00 52.08  ? 146 TYR B C     1 
ATOM   5361 O O     . TYR B 1 152 ? -18.314 -1.694  -82.875  1.00 52.56  ? 146 TYR B O     1 
ATOM   5362 C CB    . TYR B 1 152 ? -16.684 0.757   -81.229  1.00 44.69  ? 146 TYR B CB    1 
ATOM   5363 C CG    . TYR B 1 152 ? -16.355 2.212   -81.032  1.00 42.30  ? 146 TYR B CG    1 
ATOM   5364 C CD1   . TYR B 1 152 ? -17.161 3.030   -80.243  1.00 42.14  ? 146 TYR B CD1   1 
ATOM   5365 C CD2   . TYR B 1 152 ? -15.299 2.799   -81.715  1.00 42.78  ? 146 TYR B CD2   1 
ATOM   5366 C CE1   . TYR B 1 152 ? -16.909 4.392   -80.122  1.00 39.33  ? 146 TYR B CE1   1 
ATOM   5367 C CE2   . TYR B 1 152 ? -15.026 4.157   -81.588  1.00 43.18  ? 146 TYR B CE2   1 
ATOM   5368 C CZ    . TYR B 1 152 ? -15.831 4.948   -80.785  1.00 47.56  ? 146 TYR B CZ    1 
ATOM   5369 O OH    . TYR B 1 152 ? -15.526 6.273   -80.623  1.00 50.49  ? 146 TYR B OH    1 
ATOM   5370 N N     . GLY B 1 153 ? -16.509 -0.785  -83.902  1.00 49.60  ? 147 GLY B N     1 
ATOM   5371 C CA    . GLY B 1 153 ? -16.164 -1.942  -84.710  1.00 51.70  ? 147 GLY B CA    1 
ATOM   5372 C C     . GLY B 1 153 ? -15.878 -3.212  -83.934  1.00 59.89  ? 147 GLY B C     1 
ATOM   5373 O O     . GLY B 1 153 ? -15.235 -3.191  -82.877  1.00 60.67  ? 147 GLY B O     1 
ATOM   5374 N N     . LEU B 1 154 ? -16.376 -4.320  -84.476  1.00 58.72  ? 148 LEU B N     1 
ATOM   5375 C CA    . LEU B 1 154 ? -16.249 -5.695  -83.996  1.00 60.03  ? 148 LEU B CA    1 
ATOM   5376 C C     . LEU B 1 154 ? -16.208 -6.602  -85.241  1.00 66.67  ? 148 LEU B C     1 
ATOM   5377 O O     . LEU B 1 154 ? -16.554 -6.173  -86.357  1.00 67.62  ? 148 LEU B O     1 
ATOM   5378 C CB    . LEU B 1 154 ? -17.475 -6.095  -83.147  1.00 60.63  ? 148 LEU B CB    1 
ATOM   5379 C CG    . LEU B 1 154 ? -17.431 -5.799  -81.671  1.00 66.00  ? 148 LEU B CG    1 
ATOM   5380 C CD1   . LEU B 1 154 ? -18.294 -4.567  -81.321  1.00 66.47  ? 148 LEU B CD1   1 
ATOM   5381 C CD2   . LEU B 1 154 ? -17.984 -6.969  -80.914  1.00 70.94  ? 148 LEU B CD2   1 
ATOM   5382 N N     . GLY B 1 155 ? -15.838 -7.858  -85.024  1.00 62.95  ? 149 GLY B N     1 
ATOM   5383 C CA    . GLY B 1 155 ? -15.796 -8.837  -86.089  1.00 63.33  ? 149 GLY B CA    1 
ATOM   5384 C C     . GLY B 1 155 ? -17.181 -9.246  -86.515  1.00 67.70  ? 149 GLY B C     1 
ATOM   5385 O O     . GLY B 1 155 ? -18.152 -9.072  -85.764  1.00 68.42  ? 149 GLY B O     1 
ATOM   5386 N N     . SER B 1 156 ? -17.275 -9.767  -87.739  1.00 63.72  ? 150 SER B N     1 
ATOM   5387 C CA    . SER B 1 156 ? -18.525 -10.257 -88.291  1.00 63.98  ? 150 SER B CA    1 
ATOM   5388 C C     . SER B 1 156 ? -19.015 -11.364 -87.335  1.00 68.43  ? 150 SER B C     1 
ATOM   5389 O O     . SER B 1 156 ? -18.197 -12.219 -86.954  1.00 67.52  ? 150 SER B O     1 
ATOM   5390 C CB    . SER B 1 156 ? -18.273 -10.806 -89.692  1.00 67.99  ? 150 SER B CB    1 
ATOM   5391 O OG    . SER B 1 156 ? -19.364 -11.535 -90.226  1.00 78.93  ? 150 SER B OG    1 
ATOM   5392 N N     . PRO B 1 157 ? -20.288 -11.330 -86.847  1.00 65.42  ? 151 PRO B N     1 
ATOM   5393 C CA    . PRO B 1 157 ? -20.757 -12.421 -85.963  1.00 65.70  ? 151 PRO B CA    1 
ATOM   5394 C C     . PRO B 1 157 ? -20.497 -13.777 -86.614  1.00 71.97  ? 151 PRO B C     1 
ATOM   5395 O O     . PRO B 1 157 ? -20.227 -14.748 -85.922  1.00 72.74  ? 151 PRO B O     1 
ATOM   5396 C CB    . PRO B 1 157 ? -22.258 -12.145 -85.783  1.00 67.43  ? 151 PRO B CB    1 
ATOM   5397 C CG    . PRO B 1 157 ? -22.614 -11.211 -86.866  1.00 72.19  ? 151 PRO B CG    1 
ATOM   5398 C CD    . PRO B 1 157 ? -21.384 -10.396 -87.162  1.00 66.85  ? 151 PRO B CD    1 
ATOM   5399 N N     . GLU B 1 158 ? -20.508 -13.813 -87.953  1.00 69.50  ? 152 GLU B N     1 
ATOM   5400 C CA    . GLU B 1 158 ? -20.225 -14.989 -88.762  1.00 71.25  ? 152 GLU B CA    1 
ATOM   5401 C C     . GLU B 1 158 ? -18.761 -15.397 -88.568  1.00 74.98  ? 152 GLU B C     1 
ATOM   5402 O O     . GLU B 1 158 ? -18.488 -16.556 -88.261  1.00 75.26  ? 152 GLU B O     1 
ATOM   5403 C CB    . GLU B 1 158 ? -20.537 -14.698 -90.239  1.00 73.97  ? 152 GLU B CB    1 
ATOM   5404 C CG    . GLU B 1 158 ? -21.996 -14.318 -90.486  1.00 89.38  ? 152 GLU B CG    1 
ATOM   5405 C CD    . GLU B 1 158 ? -22.312 -12.852 -90.730  1.00 110.10 ? 152 GLU B CD    1 
ATOM   5406 O OE1   . GLU B 1 158 ? -21.705 -12.249 -91.646  1.00 103.94 ? 152 GLU B OE1   1 
ATOM   5407 O OE2   . GLU B 1 158 ? -23.229 -12.331 -90.054  1.00 101.12 ? 152 GLU B OE2   1 
ATOM   5408 N N     . GLU B 1 159 ? -17.832 -14.423 -88.663  1.00 70.89  ? 153 GLU B N     1 
ATOM   5409 C CA    . GLU B 1 159 ? -16.395 -14.640 -88.473  1.00 70.40  ? 153 GLU B CA    1 
ATOM   5410 C C     . GLU B 1 159 ? -16.084 -15.129 -87.050  1.00 74.81  ? 153 GLU B C     1 
ATOM   5411 O O     . GLU B 1 159 ? -15.140 -15.894 -86.851  1.00 74.95  ? 153 GLU B O     1 
ATOM   5412 C CB    . GLU B 1 159 ? -15.626 -13.368 -88.785  1.00 70.20  ? 153 GLU B CB    1 
ATOM   5413 N N     . TYR B 1 160 ? -16.910 -14.704 -86.075  1.00 71.14  ? 154 TYR B N     1 
ATOM   5414 C CA    . TYR B 1 160 ? -16.853 -15.075 -84.658  1.00 69.93  ? 154 TYR B CA    1 
ATOM   5415 C C     . TYR B 1 160 ? -17.167 -16.576 -84.532  1.00 72.89  ? 154 TYR B C     1 
ATOM   5416 O O     . TYR B 1 160 ? -16.339 -17.325 -84.017  1.00 71.40  ? 154 TYR B O     1 
ATOM   5417 C CB    . TYR B 1 160 ? -17.892 -14.228 -83.905  1.00 70.60  ? 154 TYR B CB    1 
ATOM   5418 C CG    . TYR B 1 160 ? -17.924 -14.361 -82.401  1.00 72.69  ? 154 TYR B CG    1 
ATOM   5419 C CD1   . TYR B 1 160 ? -17.236 -13.459 -81.588  1.00 73.99  ? 154 TYR B CD1   1 
ATOM   5420 C CD2   . TYR B 1 160 ? -18.750 -15.297 -81.781  1.00 74.29  ? 154 TYR B CD2   1 
ATOM   5421 C CE1   . TYR B 1 160 ? -17.322 -13.520 -80.196  1.00 74.66  ? 154 TYR B CE1   1 
ATOM   5422 C CE2   . TYR B 1 160 ? -18.838 -15.374 -80.388  1.00 75.31  ? 154 TYR B CE2   1 
ATOM   5423 C CZ    . TYR B 1 160 ? -18.133 -14.473 -79.598  1.00 82.21  ? 154 TYR B CZ    1 
ATOM   5424 O OH    . TYR B 1 160 ? -18.222 -14.513 -78.223  1.00 80.40  ? 154 TYR B OH    1 
ATOM   5425 N N     . ARG B 1 161 ? -18.333 -17.013 -85.078  1.00 70.58  ? 155 ARG B N     1 
ATOM   5426 C CA    . ARG B 1 161 ? -18.807 -18.400 -85.073  1.00 71.75  ? 155 ARG B CA    1 
ATOM   5427 C C     . ARG B 1 161 ? -17.709 -19.373 -85.522  1.00 77.44  ? 155 ARG B C     1 
ATOM   5428 O O     . ARG B 1 161 ? -17.558 -20.441 -84.917  1.00 78.31  ? 155 ARG B O     1 
ATOM   5429 C CB    . ARG B 1 161 ? -20.041 -18.537 -85.957  1.00 73.36  ? 155 ARG B CB    1 
ATOM   5430 N N     . GLU B 1 162 ? -16.910 -18.966 -86.541  1.00 73.62  ? 156 GLU B N     1 
ATOM   5431 C CA    . GLU B 1 162 ? -15.793 -19.731 -87.100  1.00 73.71  ? 156 GLU B CA    1 
ATOM   5432 C C     . GLU B 1 162 ? -14.528 -19.671 -86.212  1.00 76.47  ? 156 GLU B C     1 
ATOM   5433 O O     . GLU B 1 162 ? -14.002 -20.717 -85.834  1.00 77.44  ? 156 GLU B O     1 
ATOM   5434 C CB    . GLU B 1 162 ? -15.481 -19.250 -88.516  1.00 74.50  ? 156 GLU B CB    1 
ATOM   5435 N N     . MET B 1 163 ? -14.069 -18.465 -85.857  1.00 70.44  ? 157 MET B N     1 
ATOM   5436 C CA    . MET B 1 163 ? -12.851 -18.273 -85.071  1.00 68.91  ? 157 MET B CA    1 
ATOM   5437 C C     . MET B 1 163 ? -12.930 -18.474 -83.521  1.00 70.15  ? 157 MET B C     1 
ATOM   5438 O O     . MET B 1 163 ? -12.028 -18.006 -82.806  1.00 68.92  ? 157 MET B O     1 
ATOM   5439 C CB    . MET B 1 163 ? -12.205 -16.938 -85.431  1.00 68.58  ? 157 MET B CB    1 
ATOM   5440 N N     . VAL B 1 164 ? -13.973 -19.184 -83.002  1.00 64.14  ? 158 VAL B N     1 
ATOM   5441 C CA    . VAL B 1 164 ? -14.111 -19.464 -81.553  1.00 62.18  ? 158 VAL B CA    1 
ATOM   5442 C C     . VAL B 1 164 ? -14.393 -20.954 -81.347  1.00 70.02  ? 158 VAL B C     1 
ATOM   5443 O O     . VAL B 1 164 ? -15.400 -21.447 -81.862  1.00 73.13  ? 158 VAL B O     1 
ATOM   5444 C CB    . VAL B 1 164 ? -15.139 -18.568 -80.797  1.00 62.58  ? 158 VAL B CB    1 
ATOM   5445 C CG1   . VAL B 1 164 ? -15.324 -19.039 -79.358  1.00 61.76  ? 158 VAL B CG1   1 
ATOM   5446 C CG2   . VAL B 1 164 ? -14.721 -17.105 -80.803  1.00 60.77  ? 158 VAL B CG2   1 
ATOM   5447 N N     . VAL B 1 165 ? -13.516 -21.672 -80.604  1.00 65.12  ? 159 VAL B N     1 
ATOM   5448 C CA    . VAL B 1 165 ? -13.693 -23.104 -80.329  1.00 65.72  ? 159 VAL B CA    1 
ATOM   5449 C C     . VAL B 1 165 ? -14.601 -23.297 -79.100  1.00 70.87  ? 159 VAL B C     1 
ATOM   5450 O O     . VAL B 1 165 ? -14.148 -23.197 -77.953  1.00 70.98  ? 159 VAL B O     1 
ATOM   5451 C CB    . VAL B 1 165 ? -12.357 -23.897 -80.243  1.00 69.52  ? 159 VAL B CB    1 
ATOM   5452 C CG1   . VAL B 1 165 ? -12.602 -25.362 -79.906  1.00 70.64  ? 159 VAL B CG1   1 
ATOM   5453 C CG2   . VAL B 1 165 ? -11.562 -23.784 -81.536  1.00 69.46  ? 159 VAL B CG2   1 
ATOM   5454 N N     . SER B 1 166 ? -15.886 -23.557 -79.357  1.00 67.65  ? 160 SER B N     1 
ATOM   5455 C CA    . SER B 1 166 ? -16.873 -23.774 -78.312  1.00 68.09  ? 160 SER B CA    1 
ATOM   5456 C C     . SER B 1 166 ? -17.055 -25.284 -78.083  1.00 74.01  ? 160 SER B C     1 
ATOM   5457 O O     . SER B 1 166 ? -17.342 -26.034 -79.030  1.00 74.71  ? 160 SER B O     1 
ATOM   5458 C CB    . SER B 1 166 ? -18.193 -23.097 -78.670  1.00 72.12  ? 160 SER B CB    1 
ATOM   5459 O OG    . SER B 1 166 ? -19.078 -23.069 -77.561  1.00 82.34  ? 160 SER B OG    1 
ATOM   5460 N N     . LEU B 1 167 ? -16.839 -25.727 -76.825  1.00 69.74  ? 161 LEU B N     1 
ATOM   5461 C CA    . LEU B 1 167 ? -16.928 -27.131 -76.431  1.00 70.04  ? 161 LEU B CA    1 
ATOM   5462 C C     . LEU B 1 167 ? -17.972 -27.348 -75.362  1.00 74.19  ? 161 LEU B C     1 
ATOM   5463 O O     . LEU B 1 167 ? -18.049 -26.578 -74.404  1.00 72.67  ? 161 LEU B O     1 
ATOM   5464 C CB    . LEU B 1 167 ? -15.564 -27.649 -75.946  1.00 69.70  ? 161 LEU B CB    1 
ATOM   5465 C CG    . LEU B 1 167 ? -14.339 -27.377 -76.831  1.00 73.14  ? 161 LEU B CG    1 
ATOM   5466 C CD1   . LEU B 1 167 ? -13.065 -27.618 -76.069  1.00 73.43  ? 161 LEU B CD1   1 
ATOM   5467 C CD2   . LEU B 1 167 ? -14.351 -28.223 -78.083  1.00 75.33  ? 161 LEU B CD2   1 
ATOM   5468 N N     . ARG B 1 168 ? -18.783 -28.401 -75.538  1.00 73.37  ? 162 ARG B N     1 
ATOM   5469 C CA    . ARG B 1 168 ? -19.849 -28.822 -74.617  1.00 74.91  ? 162 ARG B CA    1 
ATOM   5470 C C     . ARG B 1 168 ? -19.577 -30.252 -74.117  1.00 82.45  ? 162 ARG B C     1 
ATOM   5471 O O     . ARG B 1 168 ? -18.789 -30.960 -74.736  1.00 81.92  ? 162 ARG B O     1 
ATOM   5472 C CB    . ARG B 1 168 ? -21.206 -28.750 -75.308  1.00 76.18  ? 162 ARG B CB    1 
ATOM   5473 N N     . THR B 1 169 ? -20.233 -30.667 -72.995  1.00 82.39  ? 163 THR B N     1 
ATOM   5474 C CA    . THR B 1 169 ? -20.096 -31.991 -72.345  1.00 84.69  ? 163 THR B CA    1 
ATOM   5475 C C     . THR B 1 169 ? -20.107 -33.155 -73.322  1.00 89.90  ? 163 THR B C     1 
ATOM   5476 O O     . THR B 1 169 ? -19.035 -33.471 -73.832  1.00 89.48  ? 163 THR B O     1 
ATOM   5477 C CB    . THR B 1 169 ? -21.124 -32.226 -71.223  1.00 96.41  ? 163 THR B CB    1 
ATOM   5478 O OG1   . THR B 1 169 ? -22.442 -31.951 -71.713  1.00 96.49  ? 163 THR B OG1   1 
ATOM   5479 C CG2   . THR B 1 169 ? -20.798 -31.477 -69.943  1.00 93.64  ? 163 THR B CG2   1 
ATOM   5480 N N     . GLU B 1 170 ? -21.297 -33.787 -73.594  1.00 86.79  ? 164 GLU B N     1 
ATOM   5481 C CA    . GLU B 1 170 ? -21.423 -34.937 -74.499  1.00 87.68  ? 164 GLU B CA    1 
ATOM   5482 C C     . GLU B 1 170 ? -20.736 -34.663 -75.852  1.00 90.01  ? 164 GLU B C     1 
ATOM   5483 O O     . GLU B 1 170 ? -19.929 -35.484 -76.297  1.00 91.15  ? 164 GLU B O     1 
ATOM   5484 C CB    . GLU B 1 170 ? -22.878 -35.315 -74.685  1.00 89.89  ? 164 GLU B CB    1 
ATOM   5485 N N     . MET B 1 171 ? -20.964 -33.461 -76.434  1.00 82.59  ? 165 MET B N     1 
ATOM   5486 C CA    . MET B 1 171 ? -20.327 -32.963 -77.656  1.00 80.02  ? 165 MET B CA    1 
ATOM   5487 C C     . MET B 1 171 ? -20.208 -33.923 -78.854  1.00 86.03  ? 165 MET B C     1 
ATOM   5488 O O     . MET B 1 171 ? -21.032 -33.854 -79.773  1.00 87.70  ? 165 MET B O     1 
ATOM   5489 C CB    . MET B 1 171 ? -18.958 -32.354 -77.324  1.00 79.95  ? 165 MET B CB    1 
ATOM   5490 C CG    . MET B 1 171 ? -18.290 -31.691 -78.481  1.00 81.65  ? 165 MET B CG    1 
ATOM   5491 S SD    . MET B 1 171 ? -18.573 -29.932 -78.502  1.00 83.33  ? 165 MET B SD    1 
ATOM   5492 C CE    . MET B 1 171 ? -17.465 -29.463 -79.814  1.00 79.05  ? 165 MET B CE    1 
ATOM   5493 N N     . GLU B 1 172 ? -19.153 -34.779 -78.849  1.00 81.55  ? 166 GLU B N     1 
ATOM   5494 C CA    . GLU B 1 172 ? -18.697 -35.689 -79.914  1.00 82.04  ? 166 GLU B CA    1 
ATOM   5495 C C     . GLU B 1 172 ? -17.921 -34.895 -80.990  1.00 83.48  ? 166 GLU B C     1 
ATOM   5496 O O     . GLU B 1 172 ? -18.499 -34.110 -81.751  1.00 81.72  ? 166 GLU B O     1 
ATOM   5497 C CB    . GLU B 1 172 ? -19.836 -36.504 -80.523  1.00 84.64  ? 166 GLU B CB    1 
ATOM   5498 N N     . ILE B 1 173 ? -16.584 -35.044 -80.955  1.00 79.05  ? 167 ILE B N     1 
ATOM   5499 C CA    . ILE B 1 173 ? -15.588 -34.401 -81.825  1.00 76.84  ? 167 ILE B CA    1 
ATOM   5500 C C     . ILE B 1 173 ? -14.311 -35.249 -81.818  1.00 84.08  ? 167 ILE B C     1 
ATOM   5501 O O     . ILE B 1 173 ? -13.933 -35.770 -80.763  1.00 85.26  ? 167 ILE B O     1 
ATOM   5502 C CB    . ILE B 1 173 ? -15.301 -32.928 -81.420  1.00 76.30  ? 167 ILE B CB    1 
ATOM   5503 C CG1   . ILE B 1 173 ? -14.027 -32.368 -82.117  1.00 74.96  ? 167 ILE B CG1   1 
ATOM   5504 C CG2   . ILE B 1 173 ? -15.241 -32.766 -79.916  1.00 75.82  ? 167 ILE B CG2   1 
ATOM   5505 C CD1   . ILE B 1 173 ? -13.790 -30.825 -82.034  1.00 79.64  ? 167 ILE B CD1   1 
ATOM   5506 N N     . GLU B 1 174 ? -13.637 -35.385 -82.989  1.00 80.82  ? 168 GLU B N     1 
ATOM   5507 C CA    . GLU B 1 174 ? -12.369 -36.115 -83.079  1.00 80.55  ? 168 GLU B CA    1 
ATOM   5508 C C     . GLU B 1 174 ? -11.307 -35.333 -82.275  1.00 80.47  ? 168 GLU B C     1 
ATOM   5509 O O     . GLU B 1 174 ? -11.175 -34.109 -82.442  1.00 76.51  ? 168 GLU B O     1 
ATOM   5510 C CB    . GLU B 1 174 ? -11.940 -36.277 -84.536  1.00 81.68  ? 168 GLU B CB    1 
ATOM   5511 N N     . ARG B 1 175 ? -10.622 -36.032 -81.337  1.00 77.19  ? 169 ARG B N     1 
ATOM   5512 C CA    . ARG B 1 175 ? -9.585  -35.425 -80.510  1.00 75.42  ? 169 ARG B CA    1 
ATOM   5513 C C     . ARG B 1 175 ? -8.660  -34.633 -81.449  1.00 79.45  ? 169 ARG B C     1 
ATOM   5514 O O     . ARG B 1 175 ? -8.490  -33.433 -81.253  1.00 76.14  ? 169 ARG B O     1 
ATOM   5515 C CB    . ARG B 1 175 ? -8.816  -36.500 -79.754  1.00 76.89  ? 169 ARG B CB    1 
ATOM   5516 N N     . ASN B 1 176 ? -8.202  -35.284 -82.550  1.00 79.22  ? 170 ASN B N     1 
ATOM   5517 C CA    . ASN B 1 176 ? -7.361  -34.722 -83.612  1.00 78.83  ? 170 ASN B CA    1 
ATOM   5518 C C     . ASN B 1 176 ? -7.967  -33.454 -84.298  1.00 82.04  ? 170 ASN B C     1 
ATOM   5519 O O     . ASN B 1 176 ? -7.217  -32.522 -84.612  1.00 79.59  ? 170 ASN B O     1 
ATOM   5520 C CB    . ASN B 1 176 ? -7.036  -35.801 -84.641  1.00 81.01  ? 170 ASN B CB    1 
ATOM   5521 N N     . GLU B 1 177 ? -9.311  -33.413 -84.497  1.00 79.81  ? 171 GLU B N     1 
ATOM   5522 C CA    . GLU B 1 177 ? -10.000 -32.261 -85.097  1.00 79.01  ? 171 GLU B CA    1 
ATOM   5523 C C     . GLU B 1 177 ? -9.982  -31.067 -84.152  1.00 81.40  ? 171 GLU B C     1 
ATOM   5524 O O     . GLU B 1 177 ? -9.859  -29.927 -84.613  1.00 80.86  ? 171 GLU B O     1 
ATOM   5525 C CB    . GLU B 1 177 ? -11.445 -32.593 -85.486  1.00 81.49  ? 171 GLU B CB    1 
ATOM   5526 C CG    . GLU B 1 177 ? -11.626 -32.826 -86.972  1.00 97.03  ? 171 GLU B CG    1 
ATOM   5527 C CD    . GLU B 1 177 ? -11.561 -31.562 -87.807  1.00 127.15 ? 171 GLU B CD    1 
ATOM   5528 O OE1   . GLU B 1 177 ? -10.479 -31.276 -88.370  1.00 136.33 ? 171 GLU B OE1   1 
ATOM   5529 O OE2   . GLU B 1 177 ? -12.579 -30.836 -87.862  1.00 120.83 ? 171 GLU B OE2   1 
ATOM   5530 N N     . LEU B 1 178 ? -10.095 -31.329 -82.824  1.00 75.73  ? 172 LEU B N     1 
ATOM   5531 C CA    . LEU B 1 178 ? -10.045 -30.295 -81.787  1.00 72.19  ? 172 LEU B CA    1 
ATOM   5532 C C     . LEU B 1 178 ? -8.699  -29.599 -81.908  1.00 72.69  ? 172 LEU B C     1 
ATOM   5533 O O     . LEU B 1 178 ? -8.665  -28.376 -81.982  1.00 70.79  ? 172 LEU B O     1 
ATOM   5534 C CB    . LEU B 1 178 ? -10.232 -30.917 -80.386  1.00 72.50  ? 172 LEU B CB    1 
ATOM   5535 C CG    . LEU B 1 178 ? -10.437 -30.037 -79.114  1.00 75.86  ? 172 LEU B CG    1 
ATOM   5536 C CD1   . LEU B 1 178 ? -9.299  -30.176 -78.161  1.00 75.89  ? 172 LEU B CD1   1 
ATOM   5537 C CD2   . LEU B 1 178 ? -10.719 -28.576 -79.397  1.00 76.26  ? 172 LEU B CD2   1 
ATOM   5538 N N     . LEU B 1 179 ? -7.612  -30.382 -82.036  1.00 69.24  ? 173 LEU B N     1 
ATOM   5539 C CA    . LEU B 1 179 ? -6.251  -29.872 -82.201  1.00 67.95  ? 173 LEU B CA    1 
ATOM   5540 C C     . LEU B 1 179 ? -6.166  -28.977 -83.440  1.00 71.68  ? 173 LEU B C     1 
ATOM   5541 O O     . LEU B 1 179 ? -5.685  -27.847 -83.333  1.00 68.41  ? 173 LEU B O     1 
ATOM   5542 C CB    . LEU B 1 179 ? -5.220  -31.016 -82.277  1.00 68.78  ? 173 LEU B CB    1 
ATOM   5543 C CG    . LEU B 1 179 ? -5.289  -32.135 -81.240  1.00 73.52  ? 173 LEU B CG    1 
ATOM   5544 C CD1   . LEU B 1 179 ? -4.053  -32.966 -81.293  1.00 74.83  ? 173 LEU B CD1   1 
ATOM   5545 C CD2   . LEU B 1 179 ? -5.431  -31.602 -79.832  1.00 73.82  ? 173 LEU B CD2   1 
ATOM   5546 N N     . ARG B 1 180 ? -6.710  -29.458 -84.594  1.00 70.97  ? 174 ARG B N     1 
ATOM   5547 C CA    . ARG B 1 180 ? -6.747  -28.708 -85.855  1.00 70.57  ? 174 ARG B CA    1 
ATOM   5548 C C     . ARG B 1 180 ? -7.490  -27.383 -85.653  1.00 73.91  ? 174 ARG B C     1 
ATOM   5549 O O     . ARG B 1 180 ? -6.961  -26.341 -86.030  1.00 73.04  ? 174 ARG B O     1 
ATOM   5550 C CB    . ARG B 1 180 ? -7.406  -29.535 -86.955  1.00 72.44  ? 174 ARG B CB    1 
ATOM   5551 N N     . LYS B 1 181 ? -8.670  -27.419 -84.979  1.00 70.48  ? 175 LYS B N     1 
ATOM   5552 C CA    . LYS B 1 181 ? -9.493  -26.235 -84.692  1.00 69.32  ? 175 LYS B CA    1 
ATOM   5553 C C     . LYS B 1 181 ? -8.752  -25.226 -83.785  1.00 71.84  ? 175 LYS B C     1 
ATOM   5554 O O     . LYS B 1 181 ? -8.980  -24.019 -83.896  1.00 70.72  ? 175 LYS B O     1 
ATOM   5555 C CB    . LYS B 1 181 ? -10.832 -26.645 -84.086  1.00 70.33  ? 175 LYS B CB    1 
ATOM   5556 N N     . LEU B 1 182 ? -7.833  -25.730 -82.933  1.00 67.48  ? 176 LEU B N     1 
ATOM   5557 C CA    . LEU B 1 182 ? -7.001  -24.928 -82.037  1.00 65.37  ? 176 LEU B CA    1 
ATOM   5558 C C     . LEU B 1 182 ? -5.840  -24.308 -82.801  1.00 70.25  ? 176 LEU B C     1 
ATOM   5559 O O     . LEU B 1 182 ? -5.578  -23.118 -82.636  1.00 69.21  ? 176 LEU B O     1 
ATOM   5560 C CB    . LEU B 1 182 ? -6.480  -25.755 -80.846  1.00 64.90  ? 176 LEU B CB    1 
ATOM   5561 C CG    . LEU B 1 182 ? -7.514  -26.191 -79.823  1.00 68.02  ? 176 LEU B CG    1 
ATOM   5562 C CD1   . LEU B 1 182 ? -6.976  -27.290 -78.962  1.00 68.65  ? 176 LEU B CD1   1 
ATOM   5563 C CD2   . LEU B 1 182 ? -7.970  -25.037 -78.971  1.00 67.45  ? 176 LEU B CD2   1 
ATOM   5564 N N     . VAL B 1 183 ? -5.146  -25.099 -83.648  1.00 68.14  ? 177 VAL B N     1 
ATOM   5565 C CA    . VAL B 1 183 ? -4.044  -24.581 -84.470  1.00 67.76  ? 177 VAL B CA    1 
ATOM   5566 C C     . VAL B 1 183 ? -4.612  -23.532 -85.440  1.00 72.55  ? 177 VAL B C     1 
ATOM   5567 O O     . VAL B 1 183 ? -3.980  -22.500 -85.646  1.00 71.61  ? 177 VAL B O     1 
ATOM   5568 C CB    . VAL B 1 183 ? -3.251  -25.669 -85.235  1.00 72.51  ? 177 VAL B CB    1 
ATOM   5569 C CG1   . VAL B 1 183 ? -1.952  -25.100 -85.784  1.00 72.33  ? 177 VAL B CG1   1 
ATOM   5570 C CG2   . VAL B 1 183 ? -2.965  -26.887 -84.366  1.00 72.81  ? 177 VAL B CG2   1 
ATOM   5571 N N     . ASP B 1 184 ? -5.835  -23.782 -85.987  1.00 70.55  ? 178 ASP B N     1 
ATOM   5572 C CA    . ASP B 1 184 ? -6.562  -22.888 -86.906  1.00 70.26  ? 178 ASP B CA    1 
ATOM   5573 C C     . ASP B 1 184 ? -6.754  -21.510 -86.295  1.00 73.93  ? 178 ASP B C     1 
ATOM   5574 O O     . ASP B 1 184 ? -6.758  -20.524 -87.035  1.00 72.87  ? 178 ASP B O     1 
ATOM   5575 C CB    . ASP B 1 184 ? -7.895  -23.491 -87.322  1.00 71.55  ? 178 ASP B CB    1 
ATOM   5576 N N     . ILE B 1 185 ? -6.861  -21.431 -84.943  1.00 71.38  ? 179 ILE B N     1 
ATOM   5577 C CA    . ILE B 1 185 ? -6.843  -20.161 -84.212  1.00 70.28  ? 179 ILE B CA    1 
ATOM   5578 C C     . ILE B 1 185 ? -5.334  -19.809 -84.029  1.00 76.55  ? 179 ILE B C     1 
ATOM   5579 O O     . ILE B 1 185 ? -4.613  -19.865 -85.031  1.00 77.89  ? 179 ILE B O     1 
ATOM   5580 C CB    . ILE B 1 185 ? -7.806  -19.997 -82.983  1.00 72.11  ? 179 ILE B CB    1 
ATOM   5581 C CG1   . ILE B 1 185 ? -8.049  -21.320 -82.216  1.00 72.84  ? 179 ILE B CG1   1 
ATOM   5582 C CG2   . ILE B 1 185 ? -9.137  -19.438 -83.464  1.00 72.25  ? 179 ILE B CG2   1 
ATOM   5583 C CD1   . ILE B 1 185 ? -8.786  -21.206 -80.825  1.00 73.33  ? 179 ILE B CD1   1 
ATOM   5584 N N     . GLN B 1 186 ? -4.812  -19.499 -82.850  1.00 72.67  ? 180 GLN B N     1 
ATOM   5585 C CA    . GLN B 1 186 ? -3.371  -19.219 -82.896  1.00 73.16  ? 180 GLN B CA    1 
ATOM   5586 C C     . GLN B 1 186 ? -2.555  -20.062 -81.901  1.00 79.38  ? 180 GLN B C     1 
ATOM   5587 O O     . GLN B 1 186 ? -1.477  -19.654 -81.435  1.00 79.98  ? 180 GLN B O     1 
ATOM   5588 C CB    . GLN B 1 186 ? -3.112  -17.719 -82.739  1.00 72.79  ? 180 GLN B CB    1 
ATOM   5589 N N     . TYR B 1 187 ? -3.064  -21.268 -81.603  1.00 75.51  ? 181 TYR B N     1 
ATOM   5590 C CA    . TYR B 1 187 ? -2.450  -22.164 -80.625  1.00 74.92  ? 181 TYR B CA    1 
ATOM   5591 C C     . TYR B 1 187 ? -1.365  -23.035 -81.195  1.00 78.57  ? 181 TYR B C     1 
ATOM   5592 O O     . TYR B 1 187 ? -1.548  -23.636 -82.257  1.00 79.20  ? 181 TYR B O     1 
ATOM   5593 C CB    . TYR B 1 187 ? -3.518  -23.007 -79.911  1.00 75.59  ? 181 TYR B CB    1 
ATOM   5594 C CG    . TYR B 1 187 ? -4.300  -22.206 -78.902  1.00 74.67  ? 181 TYR B CG    1 
ATOM   5595 C CD1   . TYR B 1 187 ? -5.271  -21.294 -79.306  1.00 75.09  ? 181 TYR B CD1   1 
ATOM   5596 C CD2   . TYR B 1 187 ? -4.055  -22.337 -77.542  1.00 75.55  ? 181 TYR B CD2   1 
ATOM   5597 C CE1   . TYR B 1 187 ? -5.967  -20.522 -78.382  1.00 74.59  ? 181 TYR B CE1   1 
ATOM   5598 C CE2   . TYR B 1 187 ? -4.744  -21.568 -76.607  1.00 75.74  ? 181 TYR B CE2   1 
ATOM   5599 C CZ    . TYR B 1 187 ? -5.710  -20.671 -77.031  1.00 80.99  ? 181 TYR B CZ    1 
ATOM   5600 O OH    . TYR B 1 187 ? -6.394  -19.918 -76.108  1.00 80.71  ? 181 TYR B OH    1 
ATOM   5601 N N     . ALA B 1 188 ? -0.226  -23.089 -80.500  1.00 73.50  ? 182 ALA B N     1 
ATOM   5602 C CA    . ALA B 1 188 ? 0.886   -23.941 -80.910  1.00 73.76  ? 182 ALA B CA    1 
ATOM   5603 C C     . ALA B 1 188 ? 0.783   -25.221 -80.121  1.00 77.86  ? 182 ALA B C     1 
ATOM   5604 O O     . ALA B 1 188 ? 0.085   -25.255 -79.116  1.00 76.96  ? 182 ALA B O     1 
ATOM   5605 C CB    . ALA B 1 188 ? 2.215   -23.260 -80.617  1.00 74.21  ? 182 ALA B CB    1 
ATOM   5606 N N     . ARG B 1 189 ? 1.447   -26.282 -80.567  1.00 76.11  ? 183 ARG B N     1 
ATOM   5607 C CA    . ARG B 1 189 ? 1.435   -27.515 -79.802  1.00 76.99  ? 183 ARG B CA    1 
ATOM   5608 C C     . ARG B 1 189 ? 2.782   -27.631 -79.125  1.00 83.10  ? 183 ARG B C     1 
ATOM   5609 O O     . ARG B 1 189 ? 3.824   -27.543 -79.780  1.00 83.39  ? 183 ARG B O     1 
ATOM   5610 C CB    . ARG B 1 189 ? 1.099   -28.750 -80.651  1.00 76.54  ? 183 ARG B CB    1 
ATOM   5611 C CG    . ARG B 1 189 ? 0.860   -29.958 -79.769  1.00 84.27  ? 183 ARG B CG    1 
ATOM   5612 C CD    . ARG B 1 189 ? 0.603   -31.218 -80.543  1.00 93.83  ? 183 ARG B CD    1 
ATOM   5613 N NE    . ARG B 1 189 ? 0.904   -32.380 -79.708  1.00 108.04 ? 183 ARG B NE    1 
ATOM   5614 C CZ    . ARG B 1 189 ? 0.469   -33.611 -79.953  1.00 123.63 ? 183 ARG B CZ    1 
ATOM   5615 N NH1   . ARG B 1 189 ? -0.302  -33.853 -81.007  1.00 112.52 ? 183 ARG B NH1   1 
ATOM   5616 N NH2   . ARG B 1 189 ? 0.788   -34.609 -79.136  1.00 105.96 ? 183 ARG B NH2   1 
ATOM   5617 N N     . ASN B 1 190 ? 2.757   -27.724 -77.805  1.00 80.82  ? 184 ASN B N     1 
ATOM   5618 C CA    . ASN B 1 190 ? 3.967   -27.847 -77.024  1.00 82.19  ? 184 ASN B CA    1 
ATOM   5619 C C     . ASN B 1 190 ? 3.700   -28.758 -75.844  1.00 90.45  ? 184 ASN B C     1 
ATOM   5620 O O     . ASN B 1 190 ? 2.986   -28.392 -74.904  1.00 89.45  ? 184 ASN B O     1 
ATOM   5621 C CB    . ASN B 1 190 ? 4.463   -26.477 -76.572  1.00 81.70  ? 184 ASN B CB    1 
ATOM   5622 N N     . ASP B 1 191 ? 4.207   -29.987 -75.941  1.00 91.15  ? 185 ASP B N     1 
ATOM   5623 C CA    . ASP B 1 191 ? 4.095   -30.964 -74.865  1.00 93.25  ? 185 ASP B CA    1 
ATOM   5624 C C     . ASP B 1 191 ? 5.364   -30.861 -74.002  1.00 100.49 ? 185 ASP B C     1 
ATOM   5625 O O     . ASP B 1 191 ? 5.348   -31.297 -72.845  1.00 102.46 ? 185 ASP B O     1 
ATOM   5626 C CB    . ASP B 1 191 ? 3.934   -32.368 -75.433  1.00 95.27  ? 185 ASP B CB    1 
ATOM   5627 N N     . ILE B 1 192 ? 6.452   -30.245 -74.560  1.00 96.30  ? 186 ILE B N     1 
ATOM   5628 C CA    . ILE B 1 192 ? 7.737   -30.074 -73.877  1.00 96.18  ? 186 ILE B CA    1 
ATOM   5629 C C     . ILE B 1 192 ? 7.775   -28.818 -72.998  1.00 98.48  ? 186 ILE B C     1 
ATOM   5630 O O     . ILE B 1 192 ? 8.176   -28.907 -71.831  1.00 99.02  ? 186 ILE B O     1 
ATOM   5631 C CB    . ILE B 1 192 ? 8.885   -30.074 -74.883  1.00 97.15  ? 186 ILE B CB    1 
ATOM   5632 N N     . ASP B 1 193 ? 7.347   -27.659 -73.546  1.00 92.14  ? 187 ASP B N     1 
ATOM   5633 C CA    . ASP B 1 193 ? 7.342   -26.389 -72.813  1.00 89.89  ? 187 ASP B CA    1 
ATOM   5634 C C     . ASP B 1 193 ? 5.928   -25.797 -72.791  1.00 89.88  ? 187 ASP B C     1 
ATOM   5635 O O     . ASP B 1 193 ? 5.639   -24.851 -73.532  1.00 88.98  ? 187 ASP B O     1 
ATOM   5636 C CB    . ASP B 1 193 ? 8.382   -25.414 -73.411  1.00 91.19  ? 187 ASP B CB    1 
ATOM   5637 N N     . PHE B 1 194 ? 5.042   -26.375 -71.950  1.00 83.71  ? 188 PHE B N     1 
ATOM   5638 C CA    . PHE B 1 194 ? 3.633   -25.958 -71.842  1.00 81.16  ? 188 PHE B CA    1 
ATOM   5639 C C     . PHE B 1 194 ? 3.485   -24.577 -71.174  1.00 81.35  ? 188 PHE B C     1 
ATOM   5640 O O     . PHE B 1 194 ? 3.963   -24.394 -70.054  1.00 81.72  ? 188 PHE B O     1 
ATOM   5641 C CB    . PHE B 1 194 ? 2.802   -27.054 -71.142  1.00 83.44  ? 188 PHE B CB    1 
ATOM   5642 C CG    . PHE B 1 194 ? 1.312   -26.814 -71.030  1.00 83.45  ? 188 PHE B CG    1 
ATOM   5643 C CD1   . PHE B 1 194 ? 0.539   -26.596 -72.161  1.00 85.07  ? 188 PHE B CD1   1 
ATOM   5644 C CD2   . PHE B 1 194 ? 0.673   -26.878 -69.797  1.00 85.23  ? 188 PHE B CD2   1 
ATOM   5645 C CE1   . PHE B 1 194 ? -0.838  -26.387 -72.056  1.00 85.20  ? 188 PHE B CE1   1 
ATOM   5646 C CE2   . PHE B 1 194 ? -0.706  -26.681 -69.693  1.00 87.16  ? 188 PHE B CE2   1 
ATOM   5647 C CZ    . PHE B 1 194 ? -1.452  -26.439 -70.824  1.00 84.43  ? 188 PHE B CZ    1 
ATOM   5648 N N     . GLN B 1 195 ? 2.893   -23.593 -71.892  1.00 74.14  ? 189 GLN B N     1 
ATOM   5649 C CA    . GLN B 1 195 ? 2.741   -22.201 -71.435  1.00 72.20  ? 189 GLN B CA    1 
ATOM   5650 C C     . GLN B 1 195 ? 1.634   -21.478 -72.207  1.00 72.64  ? 189 GLN B C     1 
ATOM   5651 O O     . GLN B 1 195 ? 1.166   -22.012 -73.208  1.00 71.80  ? 189 GLN B O     1 
ATOM   5652 C CB    . GLN B 1 195 ? 4.086   -21.430 -71.580  1.00 73.87  ? 189 GLN B CB    1 
ATOM   5653 C CG    . GLN B 1 195 ? 4.381   -20.869 -72.992  1.00 88.10  ? 189 GLN B CG    1 
ATOM   5654 C CD    . GLN B 1 195 ? 5.808   -21.060 -73.437  1.00 100.14 ? 189 GLN B CD    1 
ATOM   5655 O OE1   . GLN B 1 195 ? 6.745   -20.454 -72.899  1.00 96.64  ? 189 GLN B OE1   1 
ATOM   5656 N NE2   . GLN B 1 195 ? 5.996   -21.874 -74.470  1.00 84.26  ? 189 GLN B NE2   1 
ATOM   5657 N N     . ARG B 1 196 ? 1.275   -20.232 -71.783  1.00 67.16  ? 190 ARG B N     1 
ATOM   5658 C CA    . ARG B 1 196 ? 0.248   -19.363 -72.395  1.00 65.06  ? 190 ARG B CA    1 
ATOM   5659 C C     . ARG B 1 196 ? 0.262   -19.435 -73.930  1.00 68.45  ? 190 ARG B C     1 
ATOM   5660 O O     . ARG B 1 196 ? 1.326   -19.277 -74.522  1.00 68.59  ? 190 ARG B O     1 
ATOM   5661 C CB    . ARG B 1 196 ? 0.416   -17.902 -71.917  1.00 62.18  ? 190 ARG B CB    1 
ATOM   5662 N N     . GLY B 1 197 ? -0.887  -19.748 -74.536  1.00 64.78  ? 191 GLY B N     1 
ATOM   5663 C CA    . GLY B 1 197 ? -1.055  -19.849 -75.989  1.00 64.83  ? 191 GLY B CA    1 
ATOM   5664 C C     . GLY B 1 197 ? -0.756  -21.199 -76.630  1.00 70.65  ? 191 GLY B C     1 
ATOM   5665 O O     . GLY B 1 197 ? -0.747  -21.317 -77.864  1.00 71.32  ? 191 GLY B O     1 
ATOM   5666 N N     . THR B 1 198 ? -0.523  -22.233 -75.814  1.00 66.84  ? 192 THR B N     1 
ATOM   5667 C CA    . THR B 1 198 ? -0.219  -23.552 -76.339  1.00 67.75  ? 192 THR B CA    1 
ATOM   5668 C C     . THR B 1 198 ? -1.183  -24.617 -75.807  1.00 71.47  ? 192 THR B C     1 
ATOM   5669 O O     . THR B 1 198 ? -1.807  -24.417 -74.761  1.00 71.49  ? 192 THR B O     1 
ATOM   5670 C CB    . THR B 1 198 ? 1.288   -23.867 -76.118  1.00 82.36  ? 192 THR B CB    1 
ATOM   5671 O OG1   . THR B 1 198 ? 1.810   -24.608 -77.220  1.00 89.18  ? 192 THR B OG1   1 
ATOM   5672 C CG2   . THR B 1 198 ? 1.576   -24.619 -74.830  1.00 81.18  ? 192 THR B CG2   1 
ATOM   5673 N N     . PHE B 1 199 ? -1.298  -25.746 -76.532  1.00 67.07  ? 193 PHE B N     1 
ATOM   5674 C CA    . PHE B 1 199 ? -2.074  -26.904 -76.106  1.00 66.69  ? 193 PHE B CA    1 
ATOM   5675 C C     . PHE B 1 199 ? -1.115  -28.076 -75.917  1.00 71.11  ? 193 PHE B C     1 
ATOM   5676 O O     . PHE B 1 199 ? -0.025  -28.059 -76.499  1.00 70.00  ? 193 PHE B O     1 
ATOM   5677 C CB    . PHE B 1 199 ? -3.272  -27.208 -77.020  1.00 68.31  ? 193 PHE B CB    1 
ATOM   5678 C CG    . PHE B 1 199 ? -2.971  -27.568 -78.449  1.00 70.39  ? 193 PHE B CG    1 
ATOM   5679 C CD1   . PHE B 1 199 ? -2.908  -28.900 -78.849  1.00 75.15  ? 193 PHE B CD1   1 
ATOM   5680 C CD2   . PHE B 1 199 ? -2.830  -26.582 -79.416  1.00 71.92  ? 193 PHE B CD2   1 
ATOM   5681 C CE1   . PHE B 1 199 ? -2.649  -29.237 -80.181  1.00 76.52  ? 193 PHE B CE1   1 
ATOM   5682 C CE2   . PHE B 1 199 ? -2.573  -26.918 -80.746  1.00 75.58  ? 193 PHE B CE2   1 
ATOM   5683 C CZ    . PHE B 1 199 ? -2.483  -28.246 -81.120  1.00 75.01  ? 193 PHE B CZ    1 
ATOM   5684 N N     . ARG B 1 200 ? -1.491  -29.066 -75.070  1.00 69.09  ? 194 ARG B N     1 
ATOM   5685 C CA    . ARG B 1 200 ? -0.618  -30.178 -74.698  1.00 70.06  ? 194 ARG B CA    1 
ATOM   5686 C C     . ARG B 1 200 ? -0.797  -31.575 -75.342  1.00 76.78  ? 194 ARG B C     1 
ATOM   5687 O O     . ARG B 1 200 ? 0.088   -31.999 -76.100  1.00 77.39  ? 194 ARG B O     1 
ATOM   5688 C CB    . ARG B 1 200 ? -0.534  -30.275 -73.176  1.00 69.30  ? 194 ARG B CB    1 
ATOM   5689 C CG    . ARG B 1 200 ? 0.794   -30.778 -72.666  1.00 82.31  ? 194 ARG B CG    1 
ATOM   5690 C CD    . ARG B 1 200 ? 0.677   -31.109 -71.195  1.00 98.22  ? 194 ARG B CD    1 
ATOM   5691 N NE    . ARG B 1 200 ? 1.528   -30.248 -70.376  1.00 107.03 ? 194 ARG B NE    1 
ATOM   5692 C CZ    . ARG B 1 200 ? 1.497   -30.198 -69.049  1.00 120.25 ? 194 ARG B CZ    1 
ATOM   5693 N NH1   . ARG B 1 200 ? 0.640   -30.951 -68.367  1.00 104.75 ? 194 ARG B NH1   1 
ATOM   5694 N NH2   . ARG B 1 200 ? 2.312   -29.387 -68.393  1.00 110.92 ? 194 ARG B NH2   1 
ATOM   5695 N N     . VAL B 1 201 ? -1.879  -32.318 -74.972  1.00 74.09  ? 195 VAL B N     1 
ATOM   5696 C CA    . VAL B 1 201 ? -2.151  -33.729 -75.351  1.00 75.18  ? 195 VAL B CA    1 
ATOM   5697 C C     . VAL B 1 201 ? -1.369  -34.685 -74.441  1.00 80.74  ? 195 VAL B C     1 
ATOM   5698 O O     . VAL B 1 201 ? -0.174  -34.947 -74.651  1.00 79.60  ? 195 VAL B O     1 
ATOM   5699 C CB    . VAL B 1 201 ? -2.068  -34.119 -76.851  1.00 78.76  ? 195 VAL B CB    1 
ATOM   5700 C CG1   . VAL B 1 201 ? -2.266  -35.617 -77.040  1.00 80.02  ? 195 VAL B CG1   1 
ATOM   5701 C CG2   . VAL B 1 201 ? -3.091  -33.348 -77.666  1.00 77.69  ? 195 VAL B CG2   1 
ATOM   5702 N N     . ARG B 1 202 ? -2.060  -35.150 -73.390  1.00 79.29  ? 196 ARG B N     1 
ATOM   5703 C CA    . ARG B 1 202 ? -1.534  -36.063 -72.391  1.00 80.72  ? 196 ARG B CA    1 
ATOM   5704 C C     . ARG B 1 202 ? -2.024  -37.448 -72.799  1.00 88.59  ? 196 ARG B C     1 
ATOM   5705 O O     . ARG B 1 202 ? -1.565  -37.958 -73.827  1.00 90.27  ? 196 ARG B O     1 
ATOM   5706 C CB    . ARG B 1 202 ? -2.037  -35.673 -71.008  1.00 81.08  ? 196 ARG B CB    1 
ATOM   5707 N N     . GLY B 1 203 ? -2.953  -38.033 -72.048  1.00 85.55  ? 197 GLY B N     1 
ATOM   5708 C CA    . GLY B 1 203 ? -3.500  -39.340 -72.395  1.00 86.80  ? 197 GLY B CA    1 
ATOM   5709 C C     . GLY B 1 203 ? -4.662  -39.124 -73.332  1.00 89.03  ? 197 GLY B C     1 
ATOM   5710 O O     . GLY B 1 203 ? -4.491  -38.606 -74.440  1.00 87.31  ? 197 GLY B O     1 
ATOM   5711 N N     . ASP B 1 204 ? -5.867  -39.430 -72.846  1.00 85.38  ? 198 ASP B N     1 
ATOM   5712 C CA    . ASP B 1 204 ? -7.099  -39.159 -73.567  1.00 84.30  ? 198 ASP B CA    1 
ATOM   5713 C C     . ASP B 1 204 ? -7.505  -37.731 -73.119  1.00 86.77  ? 198 ASP B C     1 
ATOM   5714 O O     . ASP B 1 204 ? -8.690  -37.414 -73.000  1.00 86.32  ? 198 ASP B O     1 
ATOM   5715 C CB    . ASP B 1 204 ? -8.149  -40.186 -73.168  1.00 86.53  ? 198 ASP B CB    1 
ATOM   5716 N N     . VAL B 1 205 ? -6.481  -36.872 -72.871  1.00 82.04  ? 199 VAL B N     1 
ATOM   5717 C CA    . VAL B 1 205 ? -6.601  -35.512 -72.348  1.00 79.81  ? 199 VAL B CA    1 
ATOM   5718 C C     . VAL B 1 205 ? -5.865  -34.462 -73.182  1.00 81.48  ? 199 VAL B C     1 
ATOM   5719 O O     . VAL B 1 205 ? -4.728  -34.679 -73.602  1.00 80.67  ? 199 VAL B O     1 
ATOM   5720 C CB    . VAL B 1 205 ? -6.193  -35.476 -70.845  1.00 83.53  ? 199 VAL B CB    1 
ATOM   5721 C CG1   . VAL B 1 205 ? -5.638  -34.119 -70.415  1.00 81.66  ? 199 VAL B CG1   1 
ATOM   5722 C CG2   . VAL B 1 205 ? -7.359  -35.887 -69.955  1.00 84.21  ? 199 VAL B CG2   1 
ATOM   5723 N N     . VAL B 1 206 ? -6.544  -33.317 -73.398  1.00 76.45  ? 200 VAL B N     1 
ATOM   5724 C CA    . VAL B 1 206 ? -6.026  -32.128 -74.070  1.00 74.28  ? 200 VAL B CA    1 
ATOM   5725 C C     . VAL B 1 206 ? -6.115  -30.973 -73.049  1.00 74.78  ? 200 VAL B C     1 
ATOM   5726 O O     . VAL B 1 206 ? -7.212  -30.647 -72.575  1.00 73.35  ? 200 VAL B O     1 
ATOM   5727 C CB    . VAL B 1 206 ? -6.766  -31.786 -75.394  1.00 77.53  ? 200 VAL B CB    1 
ATOM   5728 C CG1   . VAL B 1 206 ? -6.197  -30.517 -76.027  1.00 75.84  ? 200 VAL B CG1   1 
ATOM   5729 C CG2   . VAL B 1 206 ? -6.698  -32.943 -76.379  1.00 78.61  ? 200 VAL B CG2   1 
ATOM   5730 N N     . GLU B 1 207 ? -4.949  -30.409 -72.679  1.00 68.52  ? 201 GLU B N     1 
ATOM   5731 C CA    . GLU B 1 207 ? -4.854  -29.292 -71.749  1.00 65.93  ? 201 GLU B CA    1 
ATOM   5732 C C     . GLU B 1 207 ? -4.543  -28.057 -72.591  1.00 64.82  ? 201 GLU B C     1 
ATOM   5733 O O     . GLU B 1 207 ? -3.611  -28.083 -73.396  1.00 63.10  ? 201 GLU B O     1 
ATOM   5734 C CB    . GLU B 1 207 ? -3.771  -29.541 -70.683  1.00 68.17  ? 201 GLU B CB    1 
ATOM   5735 C CG    . GLU B 1 207 ? -4.158  -30.571 -69.631  1.00 84.19  ? 201 GLU B CG    1 
ATOM   5736 C CD    . GLU B 1 207 ? -3.206  -30.750 -68.457  1.00 116.26 ? 201 GLU B CD    1 
ATOM   5737 O OE1   . GLU B 1 207 ? -2.856  -29.739 -67.803  1.00 116.17 ? 201 GLU B OE1   1 
ATOM   5738 O OE2   . GLU B 1 207 ? -2.871  -31.917 -68.146  1.00 113.76 ? 201 GLU B OE2   1 
ATOM   5739 N N     . ILE B 1 208 ? -5.373  -27.008 -72.461  1.00 59.10  ? 202 ILE B N     1 
ATOM   5740 C CA    . ILE B 1 208 ? -5.251  -25.776 -73.236  1.00 57.18  ? 202 ILE B CA    1 
ATOM   5741 C C     . ILE B 1 208 ? -4.943  -24.636 -72.292  1.00 63.59  ? 202 ILE B C     1 
ATOM   5742 O O     . ILE B 1 208 ? -5.674  -24.426 -71.318  1.00 63.61  ? 202 ILE B O     1 
ATOM   5743 C CB    . ILE B 1 208 ? -6.529  -25.471 -74.085  1.00 59.11  ? 202 ILE B CB    1 
ATOM   5744 C CG1   . ILE B 1 208 ? -7.048  -26.698 -74.853  1.00 60.54  ? 202 ILE B CG1   1 
ATOM   5745 C CG2   . ILE B 1 208 ? -6.304  -24.317 -75.037  1.00 58.16  ? 202 ILE B CG2   1 
ATOM   5746 C CD1   . ILE B 1 208 ? -8.514  -27.028 -74.583  1.00 69.28  ? 202 ILE B CD1   1 
ATOM   5747 N N     . PHE B 1 209 ? -3.865  -23.889 -72.585  1.00 61.30  ? 203 PHE B N     1 
ATOM   5748 C CA    . PHE B 1 209 ? -3.464  -22.735 -71.788  1.00 60.36  ? 203 PHE B CA    1 
ATOM   5749 C C     . PHE B 1 209 ? -3.958  -21.438 -72.468  1.00 67.86  ? 203 PHE B C     1 
ATOM   5750 O O     . PHE B 1 209 ? -3.270  -20.888 -73.335  1.00 67.19  ? 203 PHE B O     1 
ATOM   5751 C CB    . PHE B 1 209 ? -1.951  -22.718 -71.563  1.00 61.25  ? 203 PHE B CB    1 
ATOM   5752 C CG    . PHE B 1 209 ? -1.503  -22.006 -70.313  1.00 61.51  ? 203 PHE B CG    1 
ATOM   5753 C CD1   . PHE B 1 209 ? -0.431  -22.483 -69.571  1.00 65.17  ? 203 PHE B CD1   1 
ATOM   5754 C CD2   . PHE B 1 209 ? -2.147  -20.853 -69.878  1.00 61.97  ? 203 PHE B CD2   1 
ATOM   5755 C CE1   . PHE B 1 209 ? -0.009  -21.821 -68.413  1.00 65.73  ? 203 PHE B CE1   1 
ATOM   5756 C CE2   . PHE B 1 209 ? -1.741  -20.209 -68.709  1.00 64.93  ? 203 PHE B CE2   1 
ATOM   5757 C CZ    . PHE B 1 209 ? -0.675  -20.701 -67.981  1.00 63.87  ? 203 PHE B CZ    1 
ATOM   5758 N N     . PRO B 1 210 ? -5.146  -20.929 -72.058  1.00 66.85  ? 204 PRO B N     1 
ATOM   5759 C CA    . PRO B 1 210 ? -5.695  -19.721 -72.680  1.00 65.82  ? 204 PRO B CA    1 
ATOM   5760 C C     . PRO B 1 210 ? -4.907  -18.454 -72.469  1.00 71.96  ? 204 PRO B C     1 
ATOM   5761 O O     . PRO B 1 210 ? -3.976  -18.400 -71.668  1.00 70.01  ? 204 PRO B O     1 
ATOM   5762 C CB    . PRO B 1 210 ? -7.075  -19.598 -72.040  1.00 67.41  ? 204 PRO B CB    1 
ATOM   5763 C CG    . PRO B 1 210 ? -7.397  -20.982 -71.569  1.00 73.66  ? 204 PRO B CG    1 
ATOM   5764 C CD    . PRO B 1 210 ? -6.092  -21.470 -71.066  1.00 69.73  ? 204 PRO B CD    1 
ATOM   5765 N N     . ALA B 1 211 ? -5.347  -17.423 -73.217  1.00 73.37  ? 205 ALA B N     1 
ATOM   5766 C CA    . ALA B 1 211 ? -4.871  -16.036 -73.320  1.00 73.90  ? 205 ALA B CA    1 
ATOM   5767 C C     . ALA B 1 211 ? -4.208  -15.392 -72.094  1.00 78.68  ? 205 ALA B C     1 
ATOM   5768 O O     . ALA B 1 211 ? -2.991  -15.555 -71.964  1.00 79.27  ? 205 ALA B O     1 
ATOM   5769 C CB    . ALA B 1 211 ? -5.955  -15.126 -73.920  1.00 73.97  ? 205 ALA B CB    1 
ATOM   5770 N N     . SER B 1 212 ? -4.955  -14.673 -71.201  1.00 74.73  ? 206 SER B N     1 
ATOM   5771 C CA    . SER B 1 212 ? -4.240  -13.977 -70.128  1.00 74.73  ? 206 SER B CA    1 
ATOM   5772 C C     . SER B 1 212 ? -4.708  -13.948 -68.663  1.00 78.03  ? 206 SER B C     1 
ATOM   5773 O O     . SER B 1 212 ? -5.734  -14.519 -68.293  1.00 77.05  ? 206 SER B O     1 
ATOM   5774 C CB    . SER B 1 212 ? -3.866  -12.569 -70.591  1.00 74.58  ? 206 SER B CB    1 
ATOM   5775 N N     . ARG B 1 213 ? -3.857  -13.248 -67.850  1.00 74.67  ? 207 ARG B N     1 
ATOM   5776 C CA    . ARG B 1 213 ? -3.819  -12.870 -66.431  1.00 74.32  ? 207 ARG B CA    1 
ATOM   5777 C C     . ARG B 1 213 ? -4.519  -13.707 -65.368  1.00 79.88  ? 207 ARG B C     1 
ATOM   5778 O O     . ARG B 1 213 ? -3.988  -13.804 -64.251  1.00 81.13  ? 207 ARG B O     1 
ATOM   5779 C CB    . ARG B 1 213 ? -4.092  -11.388 -66.250  1.00 73.77  ? 207 ARG B CB    1 
ATOM   5780 N N     . ASP B 1 214 ? -5.677  -14.324 -65.688  1.00 75.67  ? 208 ASP B N     1 
ATOM   5781 C CA    . ASP B 1 214 ? -6.372  -15.204 -64.746  1.00 76.22  ? 208 ASP B CA    1 
ATOM   5782 C C     . ASP B 1 214 ? -5.391  -16.317 -64.326  1.00 81.81  ? 208 ASP B C     1 
ATOM   5783 O O     . ASP B 1 214 ? -5.232  -16.578 -63.124  1.00 82.78  ? 208 ASP B O     1 
ATOM   5784 C CB    . ASP B 1 214 ? -7.612  -15.805 -65.399  1.00 76.81  ? 208 ASP B CB    1 
ATOM   5785 N N     . GLU B 1 215 ? -4.640  -16.860 -65.329  1.00 77.62  ? 209 GLU B N     1 
ATOM   5786 C CA    . GLU B 1 215 ? -3.641  -17.931 -65.236  1.00 78.11  ? 209 GLU B CA    1 
ATOM   5787 C C     . GLU B 1 215 ? -4.348  -19.242 -64.930  1.00 82.75  ? 209 GLU B C     1 
ATOM   5788 O O     . GLU B 1 215 ? -4.056  -19.922 -63.937  1.00 83.78  ? 209 GLU B O     1 
ATOM   5789 C CB    . GLU B 1 215 ? -2.507  -17.601 -64.247  1.00 79.94  ? 209 GLU B CB    1 
ATOM   5790 C CG    . GLU B 1 215 ? -1.124  -17.603 -64.875  1.00 89.21  ? 209 GLU B CG    1 
ATOM   5791 C CD    . GLU B 1 215 ? -0.695  -16.342 -65.601  1.00 100.55 ? 209 GLU B CD    1 
ATOM   5792 O OE1   . GLU B 1 215 ? -0.718  -15.249 -64.986  1.00 103.70 ? 209 GLU B OE1   1 
ATOM   5793 O OE2   . GLU B 1 215 ? -0.262  -16.467 -66.771  1.00 77.62  ? 209 GLU B OE2   1 
ATOM   5794 N N     . HIS B 1 216 ? -5.331  -19.556 -65.791  1.00 78.12  ? 210 HIS B N     1 
ATOM   5795 C CA    . HIS B 1 216 ? -6.191  -20.730 -65.703  1.00 78.63  ? 210 HIS B CA    1 
ATOM   5796 C C     . HIS B 1 216 ? -5.983  -21.650 -66.903  1.00 79.10  ? 210 HIS B C     1 
ATOM   5797 O O     . HIS B 1 216 ? -5.507  -21.196 -67.945  1.00 77.98  ? 210 HIS B O     1 
ATOM   5798 C CB    . HIS B 1 216 ? -7.669  -20.290 -65.620  1.00 79.79  ? 210 HIS B CB    1 
ATOM   5799 C CG    . HIS B 1 216 ? -8.147  -19.995 -64.230  1.00 84.23  ? 210 HIS B CG    1 
ATOM   5800 N ND1   . HIS B 1 216 ? -8.946  -20.891 -63.536  1.00 87.64  ? 210 HIS B ND1   1 
ATOM   5801 C CD2   . HIS B 1 216 ? -7.925  -18.913 -63.447  1.00 85.94  ? 210 HIS B CD2   1 
ATOM   5802 C CE1   . HIS B 1 216 ? -9.180  -20.329 -62.358  1.00 87.43  ? 210 HIS B CE1   1 
ATOM   5803 N NE2   . HIS B 1 216 ? -8.587  -19.138 -62.257  1.00 86.70  ? 210 HIS B NE2   1 
ATOM   5804 N N     . CYS B 1 217 ? -6.356  -22.937 -66.762  1.00 73.76  ? 211 CYS B N     1 
ATOM   5805 C CA    . CYS B 1 217 ? -6.259  -23.941 -67.822  1.00 72.41  ? 211 CYS B CA    1 
ATOM   5806 C C     . CYS B 1 217 ? -7.540  -24.695 -68.005  1.00 71.08  ? 211 CYS B C     1 
ATOM   5807 O O     . CYS B 1 217 ? -8.212  -25.039 -67.027  1.00 70.68  ? 211 CYS B O     1 
ATOM   5808 C CB    . CYS B 1 217 ? -5.114  -24.904 -67.564  1.00 74.28  ? 211 CYS B CB    1 
ATOM   5809 S SG    . CYS B 1 217 ? -3.497  -24.119 -67.554  1.00 78.06  ? 211 CYS B SG    1 
ATOM   5810 N N     . VAL B 1 218 ? -7.842  -25.009 -69.271  1.00 62.95  ? 212 VAL B N     1 
ATOM   5811 C CA    . VAL B 1 218 ? -8.982  -25.818 -69.632  1.00 60.75  ? 212 VAL B CA    1 
ATOM   5812 C C     . VAL B 1 218 ? -8.420  -27.220 -69.870  1.00 64.77  ? 212 VAL B C     1 
ATOM   5813 O O     . VAL B 1 218 ? -7.540  -27.391 -70.715  1.00 63.95  ? 212 VAL B O     1 
ATOM   5814 C CB    . VAL B 1 218 ? -9.705  -25.259 -70.870  1.00 61.83  ? 212 VAL B CB    1 
ATOM   5815 C CG1   . VAL B 1 218 ? -10.846 -26.173 -71.280  1.00 62.91  ? 212 VAL B CG1   1 
ATOM   5816 C CG2   . VAL B 1 218 ? -10.212 -23.853 -70.617  1.00 59.61  ? 212 VAL B CG2   1 
ATOM   5817 N N     . ARG B 1 219 ? -8.873  -28.204 -69.067  1.00 62.49  ? 213 ARG B N     1 
ATOM   5818 C CA    . ARG B 1 219 ? -8.495  -29.615 -69.188  1.00 63.19  ? 213 ARG B CA    1 
ATOM   5819 C C     . ARG B 1 219 ? -9.711  -30.361 -69.776  1.00 67.95  ? 213 ARG B C     1 
ATOM   5820 O O     . ARG B 1 219 ? -10.800 -30.397 -69.181  1.00 66.30  ? 213 ARG B O     1 
ATOM   5821 C CB    . ARG B 1 219 ? -8.096  -30.190 -67.833  1.00 64.70  ? 213 ARG B CB    1 
ATOM   5822 N N     . VAL B 1 220 ? -9.531  -30.862 -71.003  1.00 66.08  ? 214 VAL B N     1 
ATOM   5823 C CA    . VAL B 1 220 ? -10.548 -31.590 -71.752  1.00 66.98  ? 214 VAL B CA    1 
ATOM   5824 C C     . VAL B 1 220 ? -10.192 -33.067 -71.722  1.00 74.47  ? 214 VAL B C     1 
ATOM   5825 O O     . VAL B 1 220 ? -9.153  -33.453 -72.252  1.00 73.45  ? 214 VAL B O     1 
ATOM   5826 C CB    . VAL B 1 220 ? -10.695 -31.049 -73.200  1.00 69.00  ? 214 VAL B CB    1 
ATOM   5827 C CG1   . VAL B 1 220 ? -11.693 -31.875 -74.008  1.00 69.52  ? 214 VAL B CG1   1 
ATOM   5828 C CG2   . VAL B 1 220 ? -11.094 -29.577 -73.193  1.00 67.00  ? 214 VAL B CG2   1 
ATOM   5829 N N     . GLU B 1 221 ? -11.046 -33.875 -71.063  1.00 74.74  ? 215 GLU B N     1 
ATOM   5830 C CA    . GLU B 1 221 ? -10.923 -35.325 -70.959  1.00 77.41  ? 215 GLU B CA    1 
ATOM   5831 C C     . GLU B 1 221 ? -11.847 -35.921 -72.018  1.00 83.62  ? 215 GLU B C     1 
ATOM   5832 O O     . GLU B 1 221 ? -13.028 -35.565 -72.068  1.00 82.26  ? 215 GLU B O     1 
ATOM   5833 C CB    . GLU B 1 221 ? -11.317 -35.789 -69.560  1.00 79.58  ? 215 GLU B CB    1 
ATOM   5834 N N     . PHE B 1 222 ? -11.282 -36.726 -72.938  1.00 83.42  ? 216 PHE B N     1 
ATOM   5835 C CA    . PHE B 1 222 ? -12.029 -37.312 -74.057  1.00 85.30  ? 216 PHE B CA    1 
ATOM   5836 C C     . PHE B 1 222 ? -12.181 -38.860 -74.027  1.00 95.10  ? 216 PHE B C     1 
ATOM   5837 O O     . PHE B 1 222 ? -11.184 -39.589 -74.029  1.00 95.89  ? 216 PHE B O     1 
ATOM   5838 C CB    . PHE B 1 222 ? -11.468 -36.824 -75.394  1.00 84.62  ? 216 PHE B CB    1 
ATOM   5839 N N     . PHE B 1 223 ? -13.448 -39.347 -73.987  1.00 94.67  ? 217 PHE B N     1 
ATOM   5840 C CA    . PHE B 1 223 ? -13.807 -40.771 -73.976  1.00 97.31  ? 217 PHE B CA    1 
ATOM   5841 C C     . PHE B 1 223 ? -13.978 -41.314 -75.418  1.00 103.38 ? 217 PHE B C     1 
ATOM   5842 O O     . PHE B 1 223 ? -15.098 -41.445 -75.928  1.00 103.58 ? 217 PHE B O     1 
ATOM   5843 C CB    . PHE B 1 223 ? -15.075 -40.986 -73.151  1.00 99.18  ? 217 PHE B CB    1 
ATOM   5844 N N     . GLY B 1 224 ? -12.843 -41.554 -76.073  1.00 100.88 ? 218 GLY B N     1 
ATOM   5845 C CA    . GLY B 1 224 ? -12.751 -42.090 -77.426  1.00 101.70 ? 218 GLY B CA    1 
ATOM   5846 C C     . GLY B 1 224 ? -12.870 -41.048 -78.521  1.00 104.10 ? 218 GLY B C     1 
ATOM   5847 O O     . GLY B 1 224 ? -11.988 -40.927 -79.378  1.00 102.67 ? 218 GLY B O     1 
ATOM   5848 N N     . ASP B 1 225 ? -13.983 -40.305 -78.503  1.00 100.67 ? 219 ASP B N     1 
ATOM   5849 C CA    . ASP B 1 225 ? -14.348 -39.274 -79.478  1.00 99.14  ? 219 ASP B CA    1 
ATOM   5850 C C     . ASP B 1 225 ? -15.407 -38.360 -78.877  1.00 98.20  ? 219 ASP B C     1 
ATOM   5851 O O     . ASP B 1 225 ? -15.943 -37.492 -79.565  1.00 96.16  ? 219 ASP B O     1 
ATOM   5852 C CB    . ASP B 1 225 ? -14.923 -39.946 -80.738  1.00 103.75 ? 219 ASP B CB    1 
ATOM   5853 C CG    . ASP B 1 225 ? -14.211 -39.527 -81.998  1.00 123.30 ? 219 ASP B CG    1 
ATOM   5854 O OD1   . ASP B 1 225 ? -14.654 -38.537 -82.627  1.00 123.70 ? 219 ASP B OD1   1 
ATOM   5855 O OD2   . ASP B 1 225 ? -13.191 -40.171 -82.345  1.00 133.72 ? 219 ASP B OD2   1 
ATOM   5856 N N     . GLU B 1 226 ? -15.757 -38.607 -77.608  1.00 93.41  ? 220 GLU B N     1 
ATOM   5857 C CA    . GLU B 1 226 ? -16.742 -37.866 -76.819  1.00 91.88  ? 220 GLU B CA    1 
ATOM   5858 C C     . GLU B 1 226 ? -15.969 -36.931 -75.874  1.00 90.82  ? 220 GLU B C     1 
ATOM   5859 O O     . GLU B 1 226 ? -14.860 -37.276 -75.466  1.00 90.71  ? 220 GLU B O     1 
ATOM   5860 C CB    . GLU B 1 226 ? -17.565 -38.878 -75.971  1.00 95.46  ? 220 GLU B CB    1 
ATOM   5861 C CG    . GLU B 1 226 ? -18.870 -38.343 -75.380  1.00 107.84 ? 220 GLU B CG    1 
ATOM   5862 C CD    . GLU B 1 226 ? -19.232 -38.698 -73.943  1.00 132.48 ? 220 GLU B CD    1 
ATOM   5863 O OE1   . GLU B 1 226 ? -18.567 -39.576 -73.341  1.00 128.64 ? 220 GLU B OE1   1 
ATOM   5864 O OE2   . GLU B 1 226 ? -20.192 -38.086 -73.416  1.00 123.20 ? 220 GLU B OE2   1 
ATOM   5865 N N     . ILE B 1 227 ? -16.535 -35.767 -75.512  1.00 82.52  ? 221 ILE B N     1 
ATOM   5866 C CA    . ILE B 1 227 ? -15.868 -34.939 -74.513  1.00 79.18  ? 221 ILE B CA    1 
ATOM   5867 C C     . ILE B 1 227 ? -16.448 -35.412 -73.183  1.00 84.42  ? 221 ILE B C     1 
ATOM   5868 O O     . ILE B 1 227 ? -17.581 -35.064 -72.851  1.00 84.24  ? 221 ILE B O     1 
ATOM   5869 C CB    . ILE B 1 227 ? -15.978 -33.408 -74.761  1.00 79.08  ? 221 ILE B CB    1 
ATOM   5870 C CG1   . ILE B 1 227 ? -15.252 -33.033 -76.071  1.00 77.69  ? 221 ILE B CG1   1 
ATOM   5871 C CG2   . ILE B 1 227 ? -15.429 -32.617 -73.558  1.00 78.65  ? 221 ILE B CG2   1 
ATOM   5872 C CD1   . ILE B 1 227 ? -15.182 -31.577 -76.422  1.00 79.68  ? 221 ILE B CD1   1 
ATOM   5873 N N     . GLU B 1 228 ? -15.709 -36.291 -72.468  1.00 82.00  ? 222 GLU B N     1 
ATOM   5874 C CA    . GLU B 1 228 ? -16.156 -36.852 -71.184  1.00 82.89  ? 222 GLU B CA    1 
ATOM   5875 C C     . GLU B 1 228 ? -16.314 -35.765 -70.087  1.00 84.72  ? 222 GLU B C     1 
ATOM   5876 O O     . GLU B 1 228 ? -17.377 -35.698 -69.464  1.00 84.75  ? 222 GLU B O     1 
ATOM   5877 C CB    . GLU B 1 228 ? -15.228 -37.977 -70.735  1.00 84.80  ? 222 GLU B CB    1 
ATOM   5878 N N     . ARG B 1 229 ? -15.297 -34.883 -69.904  1.00 79.01  ? 223 ARG B N     1 
ATOM   5879 C CA    . ARG B 1 229 ? -15.335 -33.795 -68.915  1.00 77.78  ? 223 ARG B CA    1 
ATOM   5880 C C     . ARG B 1 229 ? -14.469 -32.607 -69.330  1.00 79.47  ? 223 ARG B C     1 
ATOM   5881 O O     . ARG B 1 229 ? -13.416 -32.808 -69.937  1.00 78.77  ? 223 ARG B O     1 
ATOM   5882 C CB    . ARG B 1 229 ? -14.906 -34.304 -67.539  1.00 79.52  ? 223 ARG B CB    1 
ATOM   5883 N N     . ILE B 1 230 ? -14.944 -31.378 -69.047  1.00 74.37  ? 224 ILE B N     1 
ATOM   5884 C CA    . ILE B 1 230 ? -14.209 -30.140 -69.311  1.00 72.55  ? 224 ILE B CA    1 
ATOM   5885 C C     . ILE B 1 230 ? -14.113 -29.417 -67.954  1.00 78.69  ? 224 ILE B C     1 
ATOM   5886 O O     . ILE B 1 230 ? -15.159 -29.042 -67.412  1.00 78.86  ? 224 ILE B O     1 
ATOM   5887 C CB    . ILE B 1 230 ? -14.936 -29.283 -70.350  1.00 71.63  ? 224 ILE B CB    1 
ATOM   5888 N N     . ARG B 1 231 ? -12.868 -29.311 -67.359  1.00 75.17  ? 225 ARG B N     1 
ATOM   5889 C CA    . ARG B 1 231 ? -12.613 -28.689 -66.030  1.00 74.11  ? 225 ARG B CA    1 
ATOM   5890 C C     . ARG B 1 231 ? -11.483 -27.624 -65.974  1.00 73.82  ? 225 ARG B C     1 
ATOM   5891 O O     . ARG B 1 231 ? -10.377 -27.877 -66.456  1.00 72.79  ? 225 ARG B O     1 
ATOM   5892 C CB    . ARG B 1 231 ? -12.382 -29.768 -64.971  1.00 76.55  ? 225 ARG B CB    1 
ATOM   5893 N N     . GLU B 1 232 ? -11.772 -26.447 -65.358  1.00 67.98  ? 226 GLU B N     1 
ATOM   5894 C CA    . GLU B 1 232 ? -10.841 -25.320 -65.189  1.00 65.79  ? 226 GLU B CA    1 
ATOM   5895 C C     . GLU B 1 232 ? -9.772  -25.644 -64.136  1.00 70.79  ? 226 GLU B C     1 
ATOM   5896 O O     . GLU B 1 232 ? -10.086 -26.241 -63.105  1.00 71.20  ? 226 GLU B O     1 
ATOM   5897 C CB    . GLU B 1 232 ? -11.600 -24.062 -64.812  1.00 65.17  ? 226 GLU B CB    1 
ATOM   5898 N N     . VAL B 1 233 ? -8.504  -25.297 -64.420  1.00 67.76  ? 227 VAL B N     1 
ATOM   5899 C CA    . VAL B 1 233 ? -7.347  -25.602 -63.563  1.00 68.99  ? 227 VAL B CA    1 
ATOM   5900 C C     . VAL B 1 233 ? -6.525  -24.349 -63.266  1.00 74.40  ? 227 VAL B C     1 
ATOM   5901 O O     . VAL B 1 233 ? -6.261  -23.565 -64.174  1.00 73.60  ? 227 VAL B O     1 
ATOM   5902 C CB    . VAL B 1 233 ? -6.439  -26.714 -64.174  1.00 73.02  ? 227 VAL B CB    1 
ATOM   5903 C CG1   . VAL B 1 233 ? -5.315  -27.104 -63.223  1.00 73.56  ? 227 VAL B CG1   1 
ATOM   5904 C CG2   . VAL B 1 233 ? -7.241  -27.950 -64.561  1.00 74.09  ? 227 VAL B CG2   1 
ATOM   5905 N N     . ASP B 1 234 ? -6.081  -24.200 -62.004  1.00 72.01  ? 228 ASP B N     1 
ATOM   5906 C CA    . ASP B 1 234 ? -5.237  -23.102 -61.551  1.00 71.91  ? 228 ASP B CA    1 
ATOM   5907 C C     . ASP B 1 234 ? -3.816  -23.383 -62.047  1.00 76.50  ? 228 ASP B C     1 
ATOM   5908 O O     . ASP B 1 234 ? -3.175  -24.294 -61.516  1.00 76.86  ? 228 ASP B O     1 
ATOM   5909 C CB    . ASP B 1 234 ? -5.259  -23.058 -60.014  1.00 75.68  ? 228 ASP B CB    1 
ATOM   5910 C CG    . ASP B 1 234 ? -4.547  -21.886 -59.363  1.00 93.47  ? 228 ASP B CG    1 
ATOM   5911 O OD1   . ASP B 1 234 ? -3.921  -21.081 -60.095  1.00 94.40  ? 228 ASP B OD1   1 
ATOM   5912 O OD2   . ASP B 1 234 ? -4.639  -21.755 -58.121  1.00 102.51 ? 228 ASP B OD2   1 
ATOM   5913 N N     . ALA B 1 235 ? -3.320  -22.608 -63.060  1.00 72.54  ? 229 ALA B N     1 
ATOM   5914 C CA    . ALA B 1 235 ? -1.981  -22.815 -63.652  1.00 72.36  ? 229 ALA B CA    1 
ATOM   5915 C C     . ALA B 1 235 ? -0.836  -22.681 -62.649  1.00 75.51  ? 229 ALA B C     1 
ATOM   5916 O O     . ALA B 1 235 ? 0.108   -23.473 -62.681  1.00 75.69  ? 229 ALA B O     1 
ATOM   5917 C CB    . ALA B 1 235 ? -1.764  -21.881 -64.837  1.00 71.63  ? 229 ALA B CB    1 
ATOM   5918 N N     . LEU B 1 236 ? -0.959  -21.700 -61.739  1.00 70.98  ? 230 LEU B N     1 
ATOM   5919 C CA    . LEU B 1 236 ? 0.012   -21.360 -60.695  1.00 70.88  ? 230 LEU B CA    1 
ATOM   5920 C C     . LEU B 1 236 ? 0.070   -22.371 -59.538  1.00 76.65  ? 230 LEU B C     1 
ATOM   5921 O O     . LEU B 1 236 ? 1.068   -22.395 -58.830  1.00 77.24  ? 230 LEU B O     1 
ATOM   5922 C CB    . LEU B 1 236 ? -0.245  -19.921 -60.164  1.00 69.62  ? 230 LEU B CB    1 
ATOM   5923 C CG    . LEU B 1 236 ? -0.575  -18.819 -61.214  1.00 71.62  ? 230 LEU B CG    1 
ATOM   5924 C CD1   . LEU B 1 236 ? -1.447  -17.738 -60.636  1.00 70.66  ? 230 LEU B CD1   1 
ATOM   5925 C CD2   . LEU B 1 236 ? 0.664   -18.210 -61.791  1.00 72.94  ? 230 LEU B CD2   1 
ATOM   5926 N N     . THR B 1 237 ? -0.970  -23.207 -59.355  1.00 74.81  ? 231 THR B N     1 
ATOM   5927 C CA    . THR B 1 237 ? -1.048  -24.175 -58.246  1.00 77.06  ? 231 THR B CA    1 
ATOM   5928 C C     . THR B 1 237 ? -1.199  -25.642 -58.678  1.00 82.08  ? 231 THR B C     1 
ATOM   5929 O O     . THR B 1 237 ? -0.720  -26.530 -57.956  1.00 83.63  ? 231 THR B O     1 
ATOM   5930 C CB    . THR B 1 237 ? -2.224  -23.806 -57.293  1.00 86.95  ? 231 THR B CB    1 
ATOM   5931 O OG1   . THR B 1 237 ? -2.262  -22.395 -57.102  1.00 87.52  ? 231 THR B OG1   1 
ATOM   5932 C CG2   . THR B 1 237 ? -2.160  -24.513 -55.931  1.00 86.54  ? 231 THR B CG2   1 
ATOM   5933 N N     . GLY B 1 238 ? -1.952  -25.879 -59.758  1.00 76.21  ? 232 GLY B N     1 
ATOM   5934 C CA    . GLY B 1 238 ? -2.305  -27.221 -60.229  1.00 75.77  ? 232 GLY B CA    1 
ATOM   5935 C C     . GLY B 1 238 ? -3.671  -27.661 -59.714  1.00 76.47  ? 232 GLY B C     1 
ATOM   5936 O O     . GLY B 1 238 ? -4.164  -28.737 -60.086  1.00 74.55  ? 232 GLY B O     1 
ATOM   5937 N N     . GLU B 1 239 ? -4.281  -26.798 -58.833  1.00 72.14  ? 233 GLU B N     1 
ATOM   5938 C CA    . GLU B 1 239 ? -5.589  -26.938 -58.191  1.00 71.95  ? 233 GLU B CA    1 
ATOM   5939 C C     . GLU B 1 239 ? -6.726  -26.903 -59.250  1.00 78.49  ? 233 GLU B C     1 
ATOM   5940 O O     . GLU B 1 239 ? -6.702  -26.045 -60.147  1.00 76.76  ? 233 GLU B O     1 
ATOM   5941 C CB    . GLU B 1 239 ? -5.774  -25.833 -57.161  1.00 71.49  ? 233 GLU B CB    1 
ATOM   5942 N N     . ILE B 1 240 ? -7.694  -27.870 -59.159  1.00 77.36  ? 234 ILE B N     1 
ATOM   5943 C CA    . ILE B 1 240 ? -8.846  -28.041 -60.055  1.00 76.60  ? 234 ILE B CA    1 
ATOM   5944 C C     . ILE B 1 240 ? -10.010 -27.081 -59.701  1.00 81.12  ? 234 ILE B C     1 
ATOM   5945 O O     . ILE B 1 240 ? -11.043 -27.486 -59.180  1.00 80.54  ? 234 ILE B O     1 
ATOM   5946 C CB    . ILE B 1 240 ? -9.291  -29.495 -60.073  1.00 78.80  ? 234 ILE B CB    1 
ATOM   5947 N N     . LEU B 1 241 ? -9.801  -25.791 -60.026  1.00 79.34  ? 235 LEU B N     1 
ATOM   5948 C CA    . LEU B 1 241 ? -10.649 -24.600 -59.843  1.00 79.68  ? 235 LEU B CA    1 
ATOM   5949 C C     . LEU B 1 241 ? -12.191 -24.772 -59.999  1.00 89.90  ? 235 LEU B C     1 
ATOM   5950 O O     . LEU B 1 241 ? -12.952 -23.899 -59.545  1.00 89.18  ? 235 LEU B O     1 
ATOM   5951 C CB    . LEU B 1 241 ? -10.147 -23.481 -60.752  1.00 78.00  ? 235 LEU B CB    1 
ATOM   5952 N N     . GLY B 1 242 ? -12.626 -25.863 -60.649  1.00 90.75  ? 236 GLY B N     1 
ATOM   5953 C CA    . GLY B 1 242 ? -14.039 -26.166 -60.877  1.00 92.13  ? 236 GLY B CA    1 
ATOM   5954 C C     . GLY B 1 242 ? -14.346 -26.904 -62.170  1.00 96.84  ? 236 GLY B C     1 
ATOM   5955 O O     . GLY B 1 242 ? -13.629 -26.751 -63.165  1.00 95.74  ? 236 GLY B O     1 
ATOM   5956 N N     . ASP B 1 243 ? -15.446 -27.695 -62.163  1.00 94.10  ? 237 ASP B N     1 
ATOM   5957 C CA    . ASP B 1 243 ? -15.941 -28.471 -63.306  1.00 93.76  ? 237 ASP B CA    1 
ATOM   5958 C C     . ASP B 1 243 ? -16.946 -27.656 -64.156  1.00 94.22  ? 237 ASP B C     1 
ATOM   5959 O O     . ASP B 1 243 ? -17.857 -27.028 -63.609  1.00 92.19  ? 237 ASP B O     1 
ATOM   5960 C CB    . ASP B 1 243 ? -16.599 -29.770 -62.819  1.00 98.27  ? 237 ASP B CB    1 
ATOM   5961 C CG    . ASP B 1 243 ? -16.534 -30.930 -63.796  1.00 115.28 ? 237 ASP B CG    1 
ATOM   5962 O OD1   . ASP B 1 243 ? -16.272 -32.067 -63.349  1.00 118.04 ? 237 ASP B OD1   1 
ATOM   5963 O OD2   . ASP B 1 243 ? -16.784 -30.710 -65.008  1.00 124.13 ? 237 ASP B OD2   1 
ATOM   5964 N N     . ARG B 1 244 ? -16.770 -27.678 -65.495  1.00 90.16  ? 238 ARG B N     1 
ATOM   5965 C CA    . ARG B 1 244 ? -17.613 -26.950 -66.460  1.00 88.89  ? 238 ARG B CA    1 
ATOM   5966 C C     . ARG B 1 244 ? -18.391 -27.886 -67.412  1.00 93.55  ? 238 ARG B C     1 
ATOM   5967 O O     . ARG B 1 244 ? -18.020 -29.059 -67.572  1.00 94.13  ? 238 ARG B O     1 
ATOM   5968 C CB    . ARG B 1 244 ? -16.771 -25.954 -67.258  1.00 87.55  ? 238 ARG B CB    1 
ATOM   5969 N N     . ASP B 1 245 ? -19.490 -27.358 -68.018  1.00 89.40  ? 239 ASP B N     1 
ATOM   5970 C CA    . ASP B 1 245 ? -20.358 -28.070 -68.975  1.00 89.71  ? 239 ASP B CA    1 
ATOM   5971 C C     . ASP B 1 245 ? -20.207 -27.493 -70.386  1.00 90.66  ? 239 ASP B C     1 
ATOM   5972 O O     . ASP B 1 245 ? -20.390 -28.216 -71.367  1.00 91.55  ? 239 ASP B O     1 
ATOM   5973 C CB    . ASP B 1 245 ? -21.813 -28.011 -68.535  1.00 91.33  ? 239 ASP B CB    1 
ATOM   5974 N N     . HIS B 1 246 ? -19.863 -26.197 -70.474  1.00 82.31  ? 240 HIS B N     1 
ATOM   5975 C CA    . HIS B 1 246 ? -19.633 -25.472 -71.713  1.00 79.32  ? 240 HIS B CA    1 
ATOM   5976 C C     . HIS B 1 246 ? -18.364 -24.654 -71.545  1.00 80.54  ? 240 HIS B C     1 
ATOM   5977 O O     . HIS B 1 246 ? -18.063 -24.209 -70.435  1.00 80.71  ? 240 HIS B O     1 
ATOM   5978 C CB    . HIS B 1 246 ? -20.804 -24.543 -71.989  1.00 79.42  ? 240 HIS B CB    1 
ATOM   5979 N N     . VAL B 1 247 ? -17.616 -24.450 -72.631  1.00 74.41  ? 241 VAL B N     1 
ATOM   5980 C CA    . VAL B 1 247 ? -16.410 -23.617 -72.634  1.00 71.56  ? 241 VAL B CA    1 
ATOM   5981 C C     . VAL B 1 247 ? -16.106 -23.063 -74.023  1.00 76.88  ? 241 VAL B C     1 
ATOM   5982 O O     . VAL B 1 247 ? -16.295 -23.764 -75.027  1.00 78.74  ? 241 VAL B O     1 
ATOM   5983 C CB    . VAL B 1 247 ? -15.188 -24.215 -71.902  1.00 74.10  ? 241 VAL B CB    1 
ATOM   5984 C CG1   . VAL B 1 247 ? -14.147 -24.782 -72.859  1.00 73.26  ? 241 VAL B CG1   1 
ATOM   5985 C CG2   . VAL B 1 247 ? -14.570 -23.181 -70.993  1.00 73.00  ? 241 VAL B CG2   1 
ATOM   5986 N N     . ALA B 1 248 ? -15.686 -21.797 -74.086  1.00 71.12  ? 242 ALA B N     1 
ATOM   5987 C CA    . ALA B 1 248 ? -15.364 -21.181 -75.357  1.00 69.67  ? 242 ALA B CA    1 
ATOM   5988 C C     . ALA B 1 248 ? -13.919 -20.740 -75.340  1.00 73.23  ? 242 ALA B C     1 
ATOM   5989 O O     . ALA B 1 248 ? -13.530 -19.902 -74.517  1.00 72.79  ? 242 ALA B O     1 
ATOM   5990 C CB    . ALA B 1 248 ? -16.291 -20.013 -75.630  1.00 69.40  ? 242 ALA B CB    1 
ATOM   5991 N N     . ILE B 1 249 ? -13.108 -21.359 -76.208  1.00 69.84  ? 243 ILE B N     1 
ATOM   5992 C CA    . ILE B 1 249 ? -11.696 -21.035 -76.351  1.00 69.40  ? 243 ILE B CA    1 
ATOM   5993 C C     . ILE B 1 249 ? -11.567 -19.880 -77.358  1.00 73.41  ? 243 ILE B C     1 
ATOM   5994 O O     . ILE B 1 249 ? -12.151 -19.934 -78.446  1.00 73.33  ? 243 ILE B O     1 
ATOM   5995 C CB    . ILE B 1 249 ? -10.845 -22.269 -76.741  1.00 73.51  ? 243 ILE B CB    1 
ATOM   5996 C CG1   . ILE B 1 249 ? -11.183 -23.517 -75.885  1.00 75.33  ? 243 ILE B CG1   1 
ATOM   5997 C CG2   . ILE B 1 249 ? -9.334  -21.944 -76.734  1.00 73.77  ? 243 ILE B CG2   1 
ATOM   5998 C CD1   . ILE B 1 249 ? -10.782 -23.461 -74.381  1.00 84.77  ? 243 ILE B CD1   1 
ATOM   5999 N N     . PHE B 1 250 ? -10.829 -18.826 -76.969  1.00 69.13  ? 244 PHE B N     1 
ATOM   6000 C CA    . PHE B 1 250 ? -10.610 -17.648 -77.800  1.00 68.21  ? 244 PHE B CA    1 
ATOM   6001 C C     . PHE B 1 250 ? -9.187  -17.610 -78.352  1.00 74.84  ? 244 PHE B C     1 
ATOM   6002 O O     . PHE B 1 250 ? -8.278  -18.152 -77.724  1.00 74.35  ? 244 PHE B O     1 
ATOM   6003 C CB    . PHE B 1 250 ? -10.987 -16.357 -77.049  1.00 68.73  ? 244 PHE B CB    1 
ATOM   6004 C CG    . PHE B 1 250 ? -12.474 -16.124 -76.999  1.00 69.73  ? 244 PHE B CG    1 
ATOM   6005 C CD1   . PHE B 1 250 ? -13.263 -16.768 -76.059  1.00 73.03  ? 244 PHE B CD1   1 
ATOM   6006 C CD2   . PHE B 1 250 ? -13.084 -15.246 -77.875  1.00 70.61  ? 244 PHE B CD2   1 
ATOM   6007 C CE1   . PHE B 1 250 ? -14.641 -16.562 -76.023  1.00 73.87  ? 244 PHE B CE1   1 
ATOM   6008 C CE2   . PHE B 1 250 ? -14.461 -15.017 -77.814  1.00 73.26  ? 244 PHE B CE2   1 
ATOM   6009 C CZ    . PHE B 1 250 ? -15.232 -15.687 -76.901  1.00 71.89  ? 244 PHE B CZ    1 
ATOM   6010 N N     . PRO B 1 251 ? -8.976  -17.000 -79.542  1.00 74.61  ? 245 PRO B N     1 
ATOM   6011 C CA    . PRO B 1 251 ? -7.635  -17.012 -80.157  1.00 75.58  ? 245 PRO B CA    1 
ATOM   6012 C C     . PRO B 1 251 ? -6.482  -16.502 -79.306  1.00 81.99  ? 245 PRO B C     1 
ATOM   6013 O O     . PRO B 1 251 ? -6.654  -15.539 -78.551  1.00 81.75  ? 245 PRO B O     1 
ATOM   6014 C CB    . PRO B 1 251 ? -7.819  -16.155 -81.410  1.00 76.88  ? 245 PRO B CB    1 
ATOM   6015 C CG    . PRO B 1 251 ? -9.257  -16.267 -81.737  1.00 81.28  ? 245 PRO B CG    1 
ATOM   6016 C CD    . PRO B 1 251 ? -9.966  -16.357 -80.434  1.00 76.48  ? 245 PRO B CD    1 
ATOM   6017 N N     . ALA B 1 252 ? -5.298  -17.150 -79.452  1.00 80.13  ? 246 ALA B N     1 
ATOM   6018 C CA    . ALA B 1 252 ? -4.057  -16.785 -78.760  1.00 80.24  ? 246 ALA B CA    1 
ATOM   6019 C C     . ALA B 1 252 ? -3.536  -15.395 -79.215  1.00 87.00  ? 246 ALA B C     1 
ATOM   6020 O O     . ALA B 1 252 ? -2.817  -14.742 -78.455  1.00 87.08  ? 246 ALA B O     1 
ATOM   6021 C CB    . ALA B 1 252 ? -3.000  -17.856 -78.973  1.00 81.60  ? 246 ALA B CB    1 
ATOM   6022 N N     . SER B 1 253 ? -3.975  -14.930 -80.427  1.00 84.48  ? 247 SER B N     1 
ATOM   6023 C CA    . SER B 1 253 ? -3.672  -13.642 -81.072  1.00 114.18 ? 247 SER B CA    1 
ATOM   6024 C C     . SER B 1 253 ? -2.174  -13.369 -81.273  1.00 126.62 ? 247 SER B C     1 
ATOM   6025 O O     . SER B 1 253 ? -1.779  -12.757 -82.269  1.00 76.55  ? 247 SER B O     1 
ATOM   6026 C CB    . SER B 1 253 ? -4.342  -12.491 -80.322  1.00 113.87 ? 247 SER B CB    1 
ATOM   6027 N N     . MET B 1 262 ? -6.042  -13.763 -96.532  1.00 83.05  ? 256 MET B N     1 
ATOM   6028 C CA    . MET B 1 262 ? -5.037  -12.787 -96.070  1.00 82.43  ? 256 MET B CA    1 
ATOM   6029 C C     . MET B 1 262 ? -4.097  -12.261 -97.161  1.00 86.87  ? 256 MET B C     1 
ATOM   6030 O O     . MET B 1 262 ? -3.669  -11.102 -97.100  1.00 85.70  ? 256 MET B O     1 
ATOM   6031 C CB    . MET B 1 262 ? -4.217  -13.359 -94.918  1.00 82.62  ? 256 MET B CB    1 
ATOM   6032 N N     . GLU B 1 263 ? -3.748  -13.121 -98.134  1.00 84.27  ? 257 GLU B N     1 
ATOM   6033 C CA    . GLU B 1 263 ? -2.857  -12.760 -99.236  1.00 85.03  ? 257 GLU B CA    1 
ATOM   6034 C C     . GLU B 1 263 ? -3.486  -11.729 -100.180 1.00 88.41  ? 257 GLU B C     1 
ATOM   6035 O O     . GLU B 1 263 ? -2.785  -10.819 -100.625 1.00 88.82  ? 257 GLU B O     1 
ATOM   6036 C CB    . GLU B 1 263 ? -2.428  -14.007 -100.010 1.00 88.09  ? 257 GLU B CB    1 
ATOM   6037 N N     . LYS B 1 264 ? -4.805  -11.872 -100.477 1.00 83.66  ? 258 LYS B N     1 
ATOM   6038 C CA    . LYS B 1 264 ? -5.577  -10.964 -101.339 1.00 83.08  ? 258 LYS B CA    1 
ATOM   6039 C C     . LYS B 1 264 ? -5.687  -9.588  -100.684 1.00 83.58  ? 258 LYS B C     1 
ATOM   6040 O O     . LYS B 1 264 ? -5.644  -8.572  -101.383 1.00 83.05  ? 258 LYS B O     1 
ATOM   6041 C CB    . LYS B 1 264 ? -6.967  -11.532 -101.622 1.00 84.04  ? 258 LYS B CB    1 
ATOM   6042 N N     . ALA B 1 265 ? -5.787  -9.565  -99.335  1.00 77.03  ? 259 ALA B N     1 
ATOM   6043 C CA    . ALA B 1 265 ? -5.860  -8.355  -98.525  1.00 74.50  ? 259 ALA B CA    1 
ATOM   6044 C C     . ALA B 1 265 ? -4.562  -7.545  -98.667  1.00 76.53  ? 259 ALA B C     1 
ATOM   6045 O O     . ALA B 1 265 ? -4.627  -6.344  -98.943  1.00 75.52  ? 259 ALA B O     1 
ATOM   6046 C CB    . ALA B 1 265 ? -6.109  -8.728  -97.077  1.00 73.71  ? 259 ALA B CB    1 
ATOM   6047 N N     . ILE B 1 266 ? -3.392  -8.219  -98.543  1.00 72.47  ? 260 ILE B N     1 
ATOM   6048 C CA    . ILE B 1 266 ? -2.067  -7.597  -98.687  1.00 72.43  ? 260 ILE B CA    1 
ATOM   6049 C C     . ILE B 1 266 ? -1.889  -7.033  -100.121 1.00 77.31  ? 260 ILE B C     1 
ATOM   6050 O O     . ILE B 1 266 ? -1.364  -5.927  -100.291 1.00 77.29  ? 260 ILE B O     1 
ATOM   6051 C CB    . ILE B 1 266 ? -0.932  -8.565  -98.224  1.00 75.95  ? 260 ILE B CB    1 
ATOM   6052 C CG1   . ILE B 1 266 ? -1.067  -8.878  -96.717  1.00 75.50  ? 260 ILE B CG1   1 
ATOM   6053 C CG2   . ILE B 1 266 ? 0.458   -7.987  -98.507  1.00 77.14  ? 260 ILE B CG2   1 
ATOM   6054 C CD1   . ILE B 1 266 ? -0.440  -10.192 -96.227  1.00 88.61  ? 260 ILE B CD1   1 
ATOM   6055 N N     . GLN B 1 267 ? -2.392  -7.767  -101.137 1.00 74.33  ? 261 GLN B N     1 
ATOM   6056 C CA    . GLN B 1 267 ? -2.359  -7.343  -102.536 1.00 75.20  ? 261 GLN B CA    1 
ATOM   6057 C C     . GLN B 1 267 ? -3.222  -6.091  -102.719 1.00 77.99  ? 261 GLN B C     1 
ATOM   6058 O O     . GLN B 1 267 ? -2.783  -5.152  -103.382 1.00 78.76  ? 261 GLN B O     1 
ATOM   6059 C CB    . GLN B 1 267 ? -2.823  -8.472  -103.464 1.00 77.82  ? 261 GLN B CB    1 
ATOM   6060 N N     . ASN B 1 268 ? -4.404  -6.048  -102.066 1.00 72.55  ? 262 ASN B N     1 
ATOM   6061 C CA    . ASN B 1 268 ? -5.336  -4.919  -102.134 1.00 71.85  ? 262 ASN B CA    1 
ATOM   6062 C C     . ASN B 1 268 ? -4.847  -3.637  -101.498 1.00 72.28  ? 262 ASN B C     1 
ATOM   6063 O O     . ASN B 1 268 ? -5.144  -2.565  -102.031 1.00 71.80  ? 262 ASN B O     1 
ATOM   6064 C CB    . ASN B 1 268 ? -6.720  -5.290  -101.615 1.00 75.03  ? 262 ASN B CB    1 
ATOM   6065 C CG    . ASN B 1 268 ? -7.512  -6.173  -102.563 1.00 97.56  ? 262 ASN B CG    1 
ATOM   6066 O OD1   . ASN B 1 268 ? -7.327  -6.166  -103.792 1.00 83.04  ? 262 ASN B OD1   1 
ATOM   6067 N ND2   . ASN B 1 268 ? -8.431  -6.951  -101.999 1.00 92.31  ? 262 ASN B ND2   1 
ATOM   6068 N N     . ILE B 1 269 ? -4.114  -3.732  -100.361 1.00 66.29  ? 263 ILE B N     1 
ATOM   6069 C CA    . ILE B 1 269 ? -3.529  -2.568  -99.664  1.00 63.97  ? 263 ILE B CA    1 
ATOM   6070 C C     . ILE B 1 269 ? -2.496  -1.930  -100.600 1.00 69.50  ? 263 ILE B C     1 
ATOM   6071 O O     . ILE B 1 269 ? -2.595  -0.732  -100.882 1.00 68.86  ? 263 ILE B O     1 
ATOM   6072 C CB    . ILE B 1 269 ? -2.935  -2.936  -98.272  1.00 64.51  ? 263 ILE B CB    1 
ATOM   6073 C CG1   . ILE B 1 269 ? -4.036  -3.324  -97.295  1.00 62.86  ? 263 ILE B CG1   1 
ATOM   6074 C CG2   . ILE B 1 269 ? -2.121  -1.783  -97.698  1.00 65.12  ? 263 ILE B CG2   1 
ATOM   6075 C CD1   . ILE B 1 269 ? -3.646  -4.356  -96.289  1.00 70.48  ? 263 ILE B CD1   1 
ATOM   6076 N N     . GLU B 1 270 ? -1.548  -2.756  -101.128 1.00 67.18  ? 264 GLU B N     1 
ATOM   6077 C CA    . GLU B 1 270 ? -0.511  -2.334  -102.074 1.00 67.95  ? 264 GLU B CA    1 
ATOM   6078 C C     . GLU B 1 270 ? -1.139  -1.630  -103.287 1.00 71.96  ? 264 GLU B C     1 
ATOM   6079 O O     . GLU B 1 270 ? -0.620  -0.602  -103.717 1.00 72.88  ? 264 GLU B O     1 
ATOM   6080 C CB    . GLU B 1 270 ? 0.361   -3.523  -102.498 1.00 70.24  ? 264 GLU B CB    1 
ATOM   6081 N N     . LYS B 1 271 ? -2.299  -2.123  -103.768 1.00 67.14  ? 265 LYS B N     1 
ATOM   6082 C CA    . LYS B 1 271 ? -3.031  -1.504  -104.875 1.00 67.85  ? 265 LYS B CA    1 
ATOM   6083 C C     . LYS B 1 271 ? -3.557  -0.104  -104.498 1.00 69.50  ? 265 LYS B C     1 
ATOM   6084 O O     . LYS B 1 271 ? -3.477  0.808   -105.322 1.00 69.49  ? 265 LYS B O     1 
ATOM   6085 C CB    . LYS B 1 271 ? -4.170  -2.402  -105.334 1.00 69.17  ? 265 LYS B CB    1 
ATOM   6086 N N     . GLU B 1 272 ? -4.054  0.069   -103.246 1.00 64.63  ? 266 GLU B N     1 
ATOM   6087 C CA    . GLU B 1 272 ? -4.556  1.355   -102.724 1.00 63.46  ? 266 GLU B CA    1 
ATOM   6088 C C     . GLU B 1 272 ? -3.393  2.325   -102.500 1.00 65.82  ? 266 GLU B C     1 
ATOM   6089 O O     . GLU B 1 272 ? -3.535  3.522   -102.765 1.00 65.57  ? 266 GLU B O     1 
ATOM   6090 C CB    . GLU B 1 272 ? -5.325  1.162   -101.399 1.00 62.99  ? 266 GLU B CB    1 
ATOM   6091 C CG    . GLU B 1 272 ? -6.043  2.429   -100.940 1.00 75.28  ? 266 GLU B CG    1 
ATOM   6092 C CD    . GLU B 1 272 ? -6.534  2.494   -99.504  1.00 89.93  ? 266 GLU B CD    1 
ATOM   6093 O OE1   . GLU B 1 272 ? -7.456  3.300   -99.234  1.00 63.39  ? 266 GLU B OE1   1 
ATOM   6094 O OE2   . GLU B 1 272 ? -5.989  1.765   -98.644  1.00 86.39  ? 266 GLU B OE2   1 
ATOM   6095 N N     . LEU B 1 273 ? -2.255  1.792   -101.994 1.00 60.40  ? 267 LEU B N     1 
ATOM   6096 C CA    . LEU B 1 273 ? -1.026  2.527   -101.716 1.00 59.01  ? 267 LEU B CA    1 
ATOM   6097 C C     . LEU B 1 273 ? -0.450  3.128   -102.989 1.00 62.12  ? 267 LEU B C     1 
ATOM   6098 O O     . LEU B 1 273 ? -0.133  4.315   -103.009 1.00 60.92  ? 267 LEU B O     1 
ATOM   6099 C CB    . LEU B 1 273 ? -0.001  1.617   -101.005 1.00 58.36  ? 267 LEU B CB    1 
ATOM   6100 C CG    . LEU B 1 273 ? 1.395   2.197   -100.740 1.00 62.80  ? 267 LEU B CG    1 
ATOM   6101 C CD1   . LEU B 1 273 ? 1.353   3.344   -99.744  1.00 61.33  ? 267 LEU B CD1   1 
ATOM   6102 C CD2   . LEU B 1 273 ? 2.327   1.131   -100.235 1.00 64.85  ? 267 LEU B CD2   1 
ATOM   6103 N N     . GLU B 1 274 ? -0.350  2.324   -104.055 1.00 59.76  ? 268 GLU B N     1 
ATOM   6104 C CA    . GLU B 1 274 ? 0.177   2.800   -105.325 1.00 61.84  ? 268 GLU B CA    1 
ATOM   6105 C C     . GLU B 1 274 ? -0.700  3.913   -105.879 1.00 66.72  ? 268 GLU B C     1 
ATOM   6106 O O     . GLU B 1 274 ? -0.157  4.933   -106.295 1.00 67.79  ? 268 GLU B O     1 
ATOM   6107 C CB    . GLU B 1 274 ? 0.325   1.654   -106.323 1.00 63.93  ? 268 GLU B CB    1 
ATOM   6108 N N     . GLU B 1 275 ? -2.040  3.759   -105.806 1.00 62.59  ? 269 GLU B N     1 
ATOM   6109 C CA    . GLU B 1 275 ? -3.004  4.759   -106.286 1.00 62.59  ? 269 GLU B CA    1 
ATOM   6110 C C     . GLU B 1 275 ? -2.899  6.068   -105.492 1.00 65.21  ? 269 GLU B C     1 
ATOM   6111 O O     . GLU B 1 275 ? -2.940  7.151   -106.083 1.00 65.59  ? 269 GLU B O     1 
ATOM   6112 C CB    . GLU B 1 275 ? -4.420  4.204   -106.217 1.00 62.45  ? 269 GLU B CB    1 
ATOM   6113 N N     . GLN B 1 276 ? -2.704  5.959   -104.164 1.00 59.81  ? 270 GLN B N     1 
ATOM   6114 C CA    . GLN B 1 276 ? -2.572  7.102   -103.251 1.00 58.20  ? 270 GLN B CA    1 
ATOM   6115 C C     . GLN B 1 276 ? -1.236  7.850   -103.439 1.00 62.89  ? 270 GLN B C     1 
ATOM   6116 O O     . GLN B 1 276 ? -1.162  9.060   -103.209 1.00 62.24  ? 270 GLN B O     1 
ATOM   6117 C CB    . GLN B 1 276 ? -2.795  6.652   -101.789 1.00 56.90  ? 270 GLN B CB    1 
ATOM   6118 C CG    . GLN B 1 276 ? -2.954  7.771   -100.767 1.00 58.82  ? 270 GLN B CG    1 
ATOM   6119 C CD    . GLN B 1 276 ? -4.151  8.683   -100.940 1.00 75.18  ? 270 GLN B CD    1 
ATOM   6120 O OE1   . GLN B 1 276 ? -4.806  8.742   -101.989 1.00 71.65  ? 270 GLN B OE1   1 
ATOM   6121 N NE2   . GLN B 1 276 ? -4.412  9.491   -99.914  1.00 65.41  ? 270 GLN B NE2   1 
ATOM   6122 N N     . LEU B 1 277 ? -0.201  7.125   -103.886 1.00 60.06  ? 271 LEU B N     1 
ATOM   6123 C CA    . LEU B 1 277 ? 1.129   7.665   -104.150 1.00 61.01  ? 271 LEU B CA    1 
ATOM   6124 C C     . LEU B 1 277 ? 1.181   8.484   -105.465 1.00 67.89  ? 271 LEU B C     1 
ATOM   6125 O O     . LEU B 1 277 ? 1.939   9.458   -105.557 1.00 67.89  ? 271 LEU B O     1 
ATOM   6126 C CB    . LEU B 1 277 ? 2.138   6.508   -104.169 1.00 61.15  ? 271 LEU B CB    1 
ATOM   6127 C CG    . LEU B 1 277 ? 3.067   6.310   -102.957 1.00 63.68  ? 271 LEU B CG    1 
ATOM   6128 C CD1   . LEU B 1 277 ? 2.499   6.859   -101.689 1.00 61.56  ? 271 LEU B CD1   1 
ATOM   6129 C CD2   . LEU B 1 277 ? 3.376   4.855   -102.754 1.00 65.74  ? 271 LEU B CD2   1 
ATOM   6130 N N     . LYS B 1 278 ? 0.387   8.087   -106.477 1.00 66.24  ? 272 LYS B N     1 
ATOM   6131 C CA    . LYS B 1 278 ? 0.334   8.829   -107.727 1.00 68.41  ? 272 LYS B CA    1 
ATOM   6132 C C     . LYS B 1 278 ? -0.386  10.150  -107.445 1.00 73.64  ? 272 LYS B C     1 
ATOM   6133 O O     . LYS B 1 278 ? 0.110   11.202  -107.853 1.00 74.50  ? 272 LYS B O     1 
ATOM   6134 C CB    . LYS B 1 278 ? -0.378  8.027   -108.809 1.00 69.95  ? 272 LYS B CB    1 
ATOM   6135 N N     . VAL B 1 279 ? -1.486  10.101  -106.656 1.00 69.84  ? 273 VAL B N     1 
ATOM   6136 C CA    . VAL B 1 279 ? -2.310  11.265  -106.267 1.00 69.78  ? 273 VAL B CA    1 
ATOM   6137 C C     . VAL B 1 279 ? -1.462  12.342  -105.580 1.00 73.19  ? 273 VAL B C     1 
ATOM   6138 O O     . VAL B 1 279 ? -1.460  13.499  -106.021 1.00 73.21  ? 273 VAL B O     1 
ATOM   6139 C CB    . VAL B 1 279 ? -3.528  10.835  -105.384 1.00 72.02  ? 273 VAL B CB    1 
ATOM   6140 C CG1   . VAL B 1 279 ? -4.190  12.029  -104.698 1.00 70.75  ? 273 VAL B CG1   1 
ATOM   6141 C CG2   . VAL B 1 279 ? -4.551  10.055  -106.198 1.00 72.62  ? 273 VAL B CG2   1 
ATOM   6142 N N     . MET B 1 280 ? -0.752  11.933  -104.494 1.00 68.16  ? 274 MET B N     1 
ATOM   6143 C CA    . MET B 1 280 ? 0.105   12.767  -103.651 1.00 66.84  ? 274 MET B CA    1 
ATOM   6144 C C     . MET B 1 280 ? 1.224   13.428  -104.430 1.00 73.62  ? 274 MET B C     1 
ATOM   6145 O O     . MET B 1 280 ? 1.525   14.592  -104.170 1.00 73.20  ? 274 MET B O     1 
ATOM   6146 C CB    . MET B 1 280 ? 0.698   11.952  -102.491 1.00 66.99  ? 274 MET B CB    1 
ATOM   6147 C CG    . MET B 1 280 ? -0.258  11.707  -101.369 1.00 67.49  ? 274 MET B CG    1 
ATOM   6148 S SD    . MET B 1 280 ? 0.596   10.856  -100.034 1.00 69.55  ? 274 MET B SD    1 
ATOM   6149 C CE    . MET B 1 280 ? -0.713  10.619  -98.904  1.00 64.19  ? 274 MET B CE    1 
ATOM   6150 N N     . HIS B 1 281 ? 1.856   12.684  -105.361 1.00 72.88  ? 275 HIS B N     1 
ATOM   6151 C CA    . HIS B 1 281 ? 2.965   13.194  -106.154 1.00 75.84  ? 275 HIS B CA    1 
ATOM   6152 C C     . HIS B 1 281 ? 2.492   14.279  -107.106 1.00 81.97  ? 275 HIS B C     1 
ATOM   6153 O O     . HIS B 1 281 ? 3.124   15.336  -107.209 1.00 81.78  ? 275 HIS B O     1 
ATOM   6154 C CB    . HIS B 1 281 ? 3.677   12.060  -106.898 1.00 78.43  ? 275 HIS B CB    1 
ATOM   6155 C CG    . HIS B 1 281 ? 5.062   12.428  -107.338 1.00 84.29  ? 275 HIS B CG    1 
ATOM   6156 N ND1   . HIS B 1 281 ? 6.153   12.283  -106.491 1.00 85.82  ? 275 HIS B ND1   1 
ATOM   6157 C CD2   . HIS B 1 281 ? 5.491   12.936  -108.517 1.00 88.40  ? 275 HIS B CD2   1 
ATOM   6158 C CE1   . HIS B 1 281 ? 7.204   12.695  -107.186 1.00 87.18  ? 275 HIS B CE1   1 
ATOM   6159 N NE2   . HIS B 1 281 ? 6.855   13.091  -108.410 1.00 89.29  ? 275 HIS B NE2   1 
ATOM   6160 N N     . GLU B 1 282 ? 1.328   14.042  -107.734 1.00 80.51  ? 276 GLU B N     1 
ATOM   6161 C CA    . GLU B 1 282 ? 0.685   14.959  -108.674 1.00 82.75  ? 276 GLU B CA    1 
ATOM   6162 C C     . GLU B 1 282 ? 0.281   16.279  -108.020 1.00 85.36  ? 276 GLU B C     1 
ATOM   6163 O O     . GLU B 1 282 ? 0.181   17.288  -108.717 1.00 87.99  ? 276 GLU B O     1 
ATOM   6164 C CB    . GLU B 1 282 ? -0.512  14.285  -109.368 1.00 84.78  ? 276 GLU B CB    1 
ATOM   6165 C CG    . GLU B 1 282 ? -0.106  13.331  -110.486 1.00 102.34 ? 276 GLU B CG    1 
ATOM   6166 C CD    . GLU B 1 282 ? -1.138  12.309  -110.937 1.00 134.04 ? 276 GLU B CD    1 
ATOM   6167 O OE1   . GLU B 1 282 ? -2.117  12.059  -110.193 1.00 137.37 ? 276 GLU B OE1   1 
ATOM   6168 O OE2   . GLU B 1 282 ? -0.944  11.729  -112.031 1.00 128.68 ? 276 GLU B OE2   1 
ATOM   6169 N N     . ASN B 1 283 ? 0.092   16.276  -106.689 1.00 77.68  ? 277 ASN B N     1 
ATOM   6170 C CA    . ASN B 1 283 ? -0.266  17.454  -105.896 1.00 75.63  ? 277 ASN B CA    1 
ATOM   6171 C C     . ASN B 1 283 ? 0.959   18.092  -105.188 1.00 76.52  ? 277 ASN B C     1 
ATOM   6172 O O     . ASN B 1 283 ? 0.806   19.082  -104.464 1.00 75.25  ? 277 ASN B O     1 
ATOM   6173 C CB    . ASN B 1 283 ? -1.367  17.088  -104.885 1.00 74.91  ? 277 ASN B CB    1 
ATOM   6174 C CG    . ASN B 1 283 ? -2.722  16.756  -105.483 1.00 107.86 ? 277 ASN B CG    1 
ATOM   6175 O OD1   . ASN B 1 283 ? -3.612  16.239  -104.792 1.00 105.04 ? 277 ASN B OD1   1 
ATOM   6176 N ND2   . ASN B 1 283 ? -2.944  17.079  -106.757 1.00 102.21 ? 277 ASN B ND2   1 
ATOM   6177 N N     . GLY B 1 284 ? 2.143   17.512  -105.394 1.00 71.45  ? 278 GLY B N     1 
ATOM   6178 C CA    . GLY B 1 284 ? 3.383   17.972  -104.784 1.00 70.59  ? 278 GLY B CA    1 
ATOM   6179 C C     . GLY B 1 284 ? 3.546   17.675  -103.297 1.00 69.83  ? 278 GLY B C     1 
ATOM   6180 O O     . GLY B 1 284 ? 4.457   18.220  -102.666 1.00 70.31  ? 278 GLY B O     1 
ATOM   6181 N N     . LYS B 1 285 ? 2.700   16.793  -102.721 1.00 61.68  ? 279 LYS B N     1 
ATOM   6182 C CA    . LYS B 1 285 ? 2.766   16.396  -101.301 1.00 58.07  ? 279 LYS B CA    1 
ATOM   6183 C C     . LYS B 1 285 ? 3.806   15.259  -101.131 1.00 58.92  ? 279 LYS B C     1 
ATOM   6184 O O     . LYS B 1 285 ? 3.451   14.127  -100.778 1.00 56.75  ? 279 LYS B O     1 
ATOM   6185 C CB    . LYS B 1 285 ? 1.370   15.974  -100.773 1.00 58.15  ? 279 LYS B CB    1 
ATOM   6186 C CG    . LYS B 1 285 ? 0.332   17.113  -100.684 1.00 64.53  ? 279 LYS B CG    1 
ATOM   6187 C CD    . LYS B 1 285 ? -1.136  16.617  -100.827 1.00 69.55  ? 279 LYS B CD    1 
ATOM   6188 C CE    . LYS B 1 285 ? -1.813  16.268  -99.511  1.00 79.20  ? 279 LYS B CE    1 
ATOM   6189 N NZ    . LYS B 1 285 ? -2.878  15.230  -99.659  1.00 84.11  ? 279 LYS B NZ    1 
ATOM   6190 N N     . LEU B 1 286 ? 5.101   15.589  -101.384 1.00 54.76  ? 280 LEU B N     1 
ATOM   6191 C CA    . LEU B 1 286 ? 6.259   14.668  -101.352 1.00 53.77  ? 280 LEU B CA    1 
ATOM   6192 C C     . LEU B 1 286 ? 6.686   14.133  -99.984  1.00 54.89  ? 280 LEU B C     1 
ATOM   6193 O O     . LEU B 1 286 ? 7.133   12.993  -99.904  1.00 53.81  ? 280 LEU B O     1 
ATOM   6194 C CB    . LEU B 1 286 ? 7.486   15.258  -102.065 1.00 55.37  ? 280 LEU B CB    1 
ATOM   6195 C CG    . LEU B 1 286 ? 7.275   16.109  -103.284 1.00 60.56  ? 280 LEU B CG    1 
ATOM   6196 C CD1   . LEU B 1 286 ? 8.556   16.812  -103.636 1.00 62.48  ? 280 LEU B CD1   1 
ATOM   6197 C CD2   . LEU B 1 286 ? 6.771   15.279  -104.461 1.00 62.92  ? 280 LEU B CD2   1 
ATOM   6198 N N     . LEU B 1 287 ? 6.627   14.959  -98.929  1.00 50.06  ? 281 LEU B N     1 
ATOM   6199 C CA    . LEU B 1 287 ? 7.030   14.529  -97.592  1.00 47.98  ? 281 LEU B CA    1 
ATOM   6200 C C     . LEU B 1 287 ? 6.028   13.501  -97.100  1.00 51.56  ? 281 LEU B C     1 
ATOM   6201 O O     . LEU B 1 287 ? 6.421   12.449  -96.583  1.00 52.00  ? 281 LEU B O     1 
ATOM   6202 C CB    . LEU B 1 287 ? 7.113   15.736  -96.634  1.00 47.14  ? 281 LEU B CB    1 
ATOM   6203 C CG    . LEU B 1 287 ? 7.639   15.526  -95.205  1.00 50.10  ? 281 LEU B CG    1 
ATOM   6204 C CD1   . LEU B 1 287 ? 6.523   15.175  -94.254  1.00 47.58  ? 281 LEU B CD1   1 
ATOM   6205 C CD2   . LEU B 1 287 ? 8.848   14.574  -95.142  1.00 53.11  ? 281 LEU B CD2   1 
ATOM   6206 N N     . GLU B 1 288 ? 4.735   13.803  -97.310  1.00 46.48  ? 282 GLU B N     1 
ATOM   6207 C CA    . GLU B 1 288 ? 3.604   12.966  -96.945  1.00 44.24  ? 282 GLU B CA    1 
ATOM   6208 C C     . GLU B 1 288 ? 3.673   11.654  -97.728  1.00 48.91  ? 282 GLU B C     1 
ATOM   6209 O O     . GLU B 1 288 ? 3.336   10.601  -97.185  1.00 48.04  ? 282 GLU B O     1 
ATOM   6210 C CB    . GLU B 1 288 ? 2.284   13.702  -97.248  1.00 45.20  ? 282 GLU B CB    1 
ATOM   6211 C CG    . GLU B 1 288 ? 2.059   14.960  -96.425  1.00 60.63  ? 282 GLU B CG    1 
ATOM   6212 C CD    . GLU B 1 288 ? 2.488   16.292  -97.018  1.00 97.18  ? 282 GLU B CD    1 
ATOM   6213 O OE1   . GLU B 1 288 ? 3.506   16.336  -97.748  1.00 98.18  ? 282 GLU B OE1   1 
ATOM   6214 O OE2   . GLU B 1 288 ? 1.829   17.310  -96.699  1.00 98.33  ? 282 GLU B OE2   1 
ATOM   6215 N N     . ALA B 1 289 ? 4.124   11.717  -99.003  1.00 46.31  ? 283 ALA B N     1 
ATOM   6216 C CA    . ALA B 1 289 ? 4.215   10.533  -99.847  1.00 46.09  ? 283 ALA B CA    1 
ATOM   6217 C C     . ALA B 1 289 ? 5.348   9.609   -99.413  1.00 50.02  ? 283 ALA B C     1 
ATOM   6218 O O     . ALA B 1 289 ? 5.213   8.391   -99.489  1.00 48.86  ? 283 ALA B O     1 
ATOM   6219 C CB    . ALA B 1 289 ? 4.353   10.932  -101.299 1.00 48.53  ? 283 ALA B CB    1 
ATOM   6220 N N     . GLN B 1 290 ? 6.439   10.188  -98.911  1.00 48.11  ? 284 GLN B N     1 
ATOM   6221 C CA    . GLN B 1 290 ? 7.598   9.448   -98.416  1.00 48.77  ? 284 GLN B CA    1 
ATOM   6222 C C     . GLN B 1 290 ? 7.186   8.703   -97.136  1.00 54.06  ? 284 GLN B C     1 
ATOM   6223 O O     . GLN B 1 290 ? 7.420   7.492   -97.016  1.00 53.92  ? 284 GLN B O     1 
ATOM   6224 C CB    . GLN B 1 290 ? 8.751   10.435  -98.160  1.00 50.39  ? 284 GLN B CB    1 
ATOM   6225 C CG    . GLN B 1 290 ? 9.968   9.906   -97.443  1.00 47.79  ? 284 GLN B CG    1 
ATOM   6226 C CD    . GLN B 1 290 ? 10.892  11.059  -97.150  1.00 64.32  ? 284 GLN B CD    1 
ATOM   6227 O OE1   . GLN B 1 290 ? 11.716  11.481  -97.992  1.00 54.91  ? 284 GLN B OE1   1 
ATOM   6228 N NE2   . GLN B 1 290 ? 10.740  11.623  -95.954  1.00 58.98  ? 284 GLN B NE2   1 
ATOM   6229 N N     . ARG B 1 291 ? 6.520   9.436   -96.215  1.00 50.24  ? 285 ARG B N     1 
ATOM   6230 C CA    . ARG B 1 291 ? 6.023   8.940   -94.933  1.00 48.49  ? 285 ARG B CA    1 
ATOM   6231 C C     . ARG B 1 291 ? 5.035   7.777   -95.138  1.00 53.76  ? 285 ARG B C     1 
ATOM   6232 O O     . ARG B 1 291 ? 5.112   6.771   -94.438  1.00 52.55  ? 285 ARG B O     1 
ATOM   6233 C CB    . ARG B 1 291 ? 5.381   10.106  -94.166  1.00 46.10  ? 285 ARG B CB    1 
ATOM   6234 C CG    . ARG B 1 291 ? 4.668   9.722   -92.885  1.00 46.13  ? 285 ARG B CG    1 
ATOM   6235 C CD    . ARG B 1 291 ? 3.920   10.917  -92.338  1.00 44.91  ? 285 ARG B CD    1 
ATOM   6236 N NE    . ARG B 1 291 ? 4.808   11.856  -91.645  1.00 48.98  ? 285 ARG B NE    1 
ATOM   6237 C CZ    . ARG B 1 291 ? 4.774   13.174  -91.797  1.00 59.19  ? 285 ARG B CZ    1 
ATOM   6238 N NH1   . ARG B 1 291 ? 3.888   13.732  -92.615  1.00 53.33  ? 285 ARG B NH1   1 
ATOM   6239 N NH2   . ARG B 1 291 ? 5.625   13.948  -91.128  1.00 36.14  ? 285 ARG B NH2   1 
ATOM   6240 N N     . LEU B 1 292 ? 4.134   7.909   -96.119  1.00 52.60  ? 286 LEU B N     1 
ATOM   6241 C CA    . LEU B 1 292 ? 3.150   6.881   -96.416  1.00 51.96  ? 286 LEU B CA    1 
ATOM   6242 C C     . LEU B 1 292 ? 3.805   5.590   -96.898  1.00 55.45  ? 286 LEU B C     1 
ATOM   6243 O O     . LEU B 1 292 ? 3.524   4.543   -96.326  1.00 54.54  ? 286 LEU B O     1 
ATOM   6244 C CB    . LEU B 1 292 ? 2.075   7.386   -97.398  1.00 52.54  ? 286 LEU B CB    1 
ATOM   6245 C CG    . LEU B 1 292 ? 0.867   6.468   -97.591  1.00 56.89  ? 286 LEU B CG    1 
ATOM   6246 C CD1   . LEU B 1 292 ? -0.064  6.495   -96.376  1.00 55.33  ? 286 LEU B CD1   1 
ATOM   6247 C CD2   . LEU B 1 292 ? 0.102   6.858   -98.812  1.00 60.63  ? 286 LEU B CD2   1 
ATOM   6248 N N     . GLU B 1 293 ? 4.685   5.657   -97.913  1.00 52.39  ? 287 GLU B N     1 
ATOM   6249 C CA    . GLU B 1 293 ? 5.335   4.452   -98.421  1.00 52.57  ? 287 GLU B CA    1 
ATOM   6250 C C     . GLU B 1 293 ? 6.092   3.748   -97.282  1.00 54.60  ? 287 GLU B C     1 
ATOM   6251 O O     . GLU B 1 293 ? 5.795   2.589   -96.997  1.00 51.54  ? 287 GLU B O     1 
ATOM   6252 C CB    . GLU B 1 293 ? 6.261   4.780   -99.589  1.00 55.30  ? 287 GLU B CB    1 
ATOM   6253 N N     . GLN B 1 294 ? 6.960   4.493   -96.559  1.00 52.31  ? 288 GLN B N     1 
ATOM   6254 C CA    . GLN B 1 294 ? 7.779   3.999   -95.444  1.00 51.77  ? 288 GLN B CA    1 
ATOM   6255 C C     . GLN B 1 294 ? 6.935   3.255   -94.417  1.00 53.50  ? 288 GLN B C     1 
ATOM   6256 O O     . GLN B 1 294 ? 7.226   2.098   -94.120  1.00 52.90  ? 288 GLN B O     1 
ATOM   6257 C CB    . GLN B 1 294 ? 8.526   5.169   -94.775  1.00 53.52  ? 288 GLN B CB    1 
ATOM   6258 C CG    . GLN B 1 294 ? 10.008  4.945   -94.550  1.00 78.58  ? 288 GLN B CG    1 
ATOM   6259 C CD    . GLN B 1 294 ? 10.794  6.221   -94.758  1.00 104.42 ? 288 GLN B CD    1 
ATOM   6260 O OE1   . GLN B 1 294 ? 11.462  6.412   -95.791  1.00 100.74 ? 288 GLN B OE1   1 
ATOM   6261 N NE2   . GLN B 1 294 ? 10.726  7.126   -93.781  1.00 95.59  ? 288 GLN B NE2   1 
ATOM   6262 N N     . ARG B 1 295 ? 5.857   3.899   -93.927  1.00 48.72  ? 289 ARG B N     1 
ATOM   6263 C CA    . ARG B 1 295 ? 4.958   3.320   -92.939  1.00 47.36  ? 289 ARG B CA    1 
ATOM   6264 C C     . ARG B 1 295 ? 4.177   2.106   -93.480  1.00 53.53  ? 289 ARG B C     1 
ATOM   6265 O O     . ARG B 1 295 ? 4.201   1.047   -92.855  1.00 53.11  ? 289 ARG B O     1 
ATOM   6266 C CB    . ARG B 1 295 ? 4.067   4.399   -92.281  1.00 45.56  ? 289 ARG B CB    1 
ATOM   6267 C CG    . ARG B 1 295 ? 4.859   5.270   -91.277  1.00 63.56  ? 289 ARG B CG    1 
ATOM   6268 C CD    . ARG B 1 295 ? 4.089   6.466   -90.703  1.00 74.69  ? 289 ARG B CD    1 
ATOM   6269 N NE    . ARG B 1 295 ? 3.613   6.253   -89.330  1.00 78.78  ? 289 ARG B NE    1 
ATOM   6270 C CZ    . ARG B 1 295 ? 2.452   5.674   -89.023  1.00 88.17  ? 289 ARG B CZ    1 
ATOM   6271 N NH1   . ARG B 1 295 ? 1.660   5.207   -89.982  1.00 75.48  ? 289 ARG B NH1   1 
ATOM   6272 N NH2   . ARG B 1 295 ? 2.087   5.534   -87.754  1.00 64.84  ? 289 ARG B NH2   1 
ATOM   6273 N N     . THR B 1 296 ? 3.558   2.231   -94.669  1.00 51.42  ? 290 THR B N     1 
ATOM   6274 C CA    . THR B 1 296 ? 2.781   1.155   -95.258  1.00 51.85  ? 290 THR B CA    1 
ATOM   6275 C C     . THR B 1 296 ? 3.631   -0.045  -95.594  1.00 61.46  ? 290 THR B C     1 
ATOM   6276 O O     . THR B 1 296 ? 3.346   -1.128  -95.080  1.00 62.64  ? 290 THR B O     1 
ATOM   6277 C CB    . THR B 1 296 ? 1.940   1.632   -96.422  1.00 59.41  ? 290 THR B CB    1 
ATOM   6278 O OG1   . THR B 1 296 ? 1.460   2.944   -96.142  1.00 58.75  ? 290 THR B OG1   1 
ATOM   6279 C CG2   . THR B 1 296 ? 0.764   0.715   -96.690  1.00 58.99  ? 290 THR B CG2   1 
ATOM   6280 N N     . ARG B 1 297 ? 4.696   0.137   -96.401  1.00 60.47  ? 291 ARG B N     1 
ATOM   6281 C CA    . ARG B 1 297 ? 5.592   -0.965  -96.797  1.00 61.55  ? 291 ARG B CA    1 
ATOM   6282 C C     . ARG B 1 297 ? 6.158   -1.746  -95.612  1.00 65.58  ? 291 ARG B C     1 
ATOM   6283 O O     . ARG B 1 297 ? 6.289   -2.962  -95.710  1.00 66.17  ? 291 ARG B O     1 
ATOM   6284 C CB    . ARG B 1 297 ? 6.713   -0.501  -97.742  1.00 63.21  ? 291 ARG B CB    1 
ATOM   6285 C CG    . ARG B 1 297 ? 6.211   0.029   -99.086  1.00 72.70  ? 291 ARG B CG    1 
ATOM   6286 C CD    . ARG B 1 297 ? 6.480   -0.889  -100.255 1.00 75.64  ? 291 ARG B CD    1 
ATOM   6287 N NE    . ARG B 1 297 ? 5.879   -0.351  -101.474 1.00 86.39  ? 291 ARG B NE    1 
ATOM   6288 C CZ    . ARG B 1 297 ? 4.810   -0.863  -102.076 1.00 110.38 ? 291 ARG B CZ    1 
ATOM   6289 N NH1   . ARG B 1 297 ? 4.223   -1.954  -101.592 1.00 99.18  ? 291 ARG B NH1   1 
ATOM   6290 N NH2   . ARG B 1 297 ? 4.330   -0.302  -103.178 1.00 104.36 ? 291 ARG B NH2   1 
ATOM   6291 N N     . TYR B 1 298 ? 6.439   -1.063  -94.482  1.00 61.15  ? 292 TYR B N     1 
ATOM   6292 C CA    . TYR B 1 298 ? 6.938   -1.709  -93.271  1.00 59.86  ? 292 TYR B CA    1 
ATOM   6293 C C     . TYR B 1 298 ? 5.874   -2.660  -92.711  1.00 60.70  ? 292 TYR B C     1 
ATOM   6294 O O     . TYR B 1 298 ? 6.163   -3.834  -92.487  1.00 58.21  ? 292 TYR B O     1 
ATOM   6295 C CB    . TYR B 1 298 ? 7.361   -0.651  -92.226  1.00 60.71  ? 292 TYR B CB    1 
ATOM   6296 C CG    . TYR B 1 298 ? 7.705   -1.213  -90.859  1.00 62.05  ? 292 TYR B CG    1 
ATOM   6297 C CD1   . TYR B 1 298 ? 9.001   -1.639  -90.560  1.00 63.98  ? 292 TYR B CD1   1 
ATOM   6298 C CD2   . TYR B 1 298 ? 6.740   -1.298  -89.856  1.00 61.95  ? 292 TYR B CD2   1 
ATOM   6299 C CE1   . TYR B 1 298 ? 9.320   -2.156  -89.305  1.00 63.66  ? 292 TYR B CE1   1 
ATOM   6300 C CE2   . TYR B 1 298 ? 7.044   -1.826  -88.602  1.00 62.51  ? 292 TYR B CE2   1 
ATOM   6301 C CZ    . TYR B 1 298 ? 8.339   -2.240  -88.326  1.00 71.37  ? 292 TYR B CZ    1 
ATOM   6302 O OH    . TYR B 1 298 ? 8.633   -2.761  -87.092  1.00 72.70  ? 292 TYR B OH    1 
ATOM   6303 N N     . ASP B 1 299 ? 4.645   -2.137  -92.507  1.00 58.09  ? 293 ASP B N     1 
ATOM   6304 C CA    . ASP B 1 299 ? 3.485   -2.846  -91.966  1.00 57.58  ? 293 ASP B CA    1 
ATOM   6305 C C     . ASP B 1 299 ? 3.160   -4.098  -92.785  1.00 63.19  ? 293 ASP B C     1 
ATOM   6306 O O     . ASP B 1 299 ? 2.837   -5.141  -92.211  1.00 61.96  ? 293 ASP B O     1 
ATOM   6307 C CB    . ASP B 1 299 ? 2.265   -1.897  -91.868  1.00 59.03  ? 293 ASP B CB    1 
ATOM   6308 C CG    . ASP B 1 299 ? 2.232   -0.926  -90.672  1.00 80.96  ? 293 ASP B CG    1 
ATOM   6309 O OD1   . ASP B 1 299 ? 3.285   -0.746  -90.011  1.00 85.41  ? 293 ASP B OD1   1 
ATOM   6310 O OD2   . ASP B 1 299 ? 1.152   -0.338  -90.405  1.00 87.46  ? 293 ASP B OD2   1 
ATOM   6311 N N     . LEU B 1 300 ? 3.302   -4.004  -94.122  1.00 61.77  ? 294 LEU B N     1 
ATOM   6312 C CA    . LEU B 1 300 ? 3.046   -5.107  -95.049  1.00 62.70  ? 294 LEU B CA    1 
ATOM   6313 C C     . LEU B 1 300 ? 4.075   -6.226  -94.930  1.00 70.01  ? 294 LEU B C     1 
ATOM   6314 O O     . LEU B 1 300 ? 3.726   -7.390  -95.127  1.00 69.92  ? 294 LEU B O     1 
ATOM   6315 C CB    . LEU B 1 300 ? 2.938   -4.612  -96.494  1.00 63.62  ? 294 LEU B CB    1 
ATOM   6316 C CG    . LEU B 1 300 ? 1.759   -3.699  -96.795  1.00 67.24  ? 294 LEU B CG    1 
ATOM   6317 C CD1   . LEU B 1 300 ? 2.104   -2.722  -97.882  1.00 68.75  ? 294 LEU B CD1   1 
ATOM   6318 C CD2   . LEU B 1 300 ? 0.522   -4.491  -97.163  1.00 68.98  ? 294 LEU B CD2   1 
ATOM   6319 N N     . GLU B 1 301 ? 5.330   -5.886  -94.605  1.00 69.46  ? 295 GLU B N     1 
ATOM   6320 C CA    . GLU B 1 301 ? 6.370   -6.895  -94.433  1.00 71.51  ? 295 GLU B CA    1 
ATOM   6321 C C     . GLU B 1 301 ? 6.176   -7.594  -93.085  1.00 76.93  ? 295 GLU B C     1 
ATOM   6322 O O     . GLU B 1 301 ? 6.391   -8.804  -92.986  1.00 77.73  ? 295 GLU B O     1 
ATOM   6323 C CB    . GLU B 1 301 ? 7.770   -6.288  -94.564  1.00 74.27  ? 295 GLU B CB    1 
ATOM   6324 C CG    . GLU B 1 301 ? 8.798   -7.284  -95.080  1.00 92.83  ? 295 GLU B CG    1 
ATOM   6325 C CD    . GLU B 1 301 ? 10.148  -7.248  -94.387  1.00 130.79 ? 295 GLU B CD    1 
ATOM   6326 O OE1   . GLU B 1 301 ? 10.254  -6.605  -93.316  1.00 129.29 ? 295 GLU B OE1   1 
ATOM   6327 O OE2   . GLU B 1 301 ? 11.085  -7.914  -94.886  1.00 131.18 ? 295 GLU B OE2   1 
ATOM   6328 N N     . MET B 1 302 ? 5.713   -6.830  -92.062  1.00 72.85  ? 296 MET B N     1 
ATOM   6329 C CA    . MET B 1 302 ? 5.416   -7.314  -90.718  1.00 71.42  ? 296 MET B CA    1 
ATOM   6330 C C     . MET B 1 302 ? 4.240   -8.280  -90.801  1.00 77.76  ? 296 MET B C     1 
ATOM   6331 O O     . MET B 1 302 ? 4.218   -9.268  -90.073  1.00 77.67  ? 296 MET B O     1 
ATOM   6332 C CB    . MET B 1 302 ? 5.076   -6.147  -89.809  1.00 70.52  ? 296 MET B CB    1 
ATOM   6333 N N     . MET B 1 303 ? 3.300   -8.032  -91.733  1.00 76.69  ? 297 MET B N     1 
ATOM   6334 C CA    . MET B 1 303 ? 2.133   -8.889  -91.955  1.00 78.01  ? 297 MET B CA    1 
ATOM   6335 C C     . MET B 1 303 ? 2.480   -10.160 -92.719  1.00 84.52  ? 297 MET B C     1 
ATOM   6336 O O     . MET B 1 303 ? 1.901   -11.205 -92.442  1.00 85.05  ? 297 MET B O     1 
ATOM   6337 C CB    . MET B 1 303 ? 1.011   -8.138  -92.680  1.00 80.64  ? 297 MET B CB    1 
ATOM   6338 C CG    . MET B 1 303 ? 0.177   -7.287  -91.760  1.00 83.61  ? 297 MET B CG    1 
ATOM   6339 S SD    . MET B 1 303 ? -1.169  -6.419  -92.608  1.00 88.28  ? 297 MET B SD    1 
ATOM   6340 C CE    . MET B 1 303 ? -0.289  -5.089  -93.364  1.00 85.79  ? 297 MET B CE    1 
ATOM   6341 N N     . ARG B 1 304 ? 3.385   -10.077 -93.702  1.00 81.84  ? 298 ARG B N     1 
ATOM   6342 C CA    . ARG B 1 304 ? 3.792   -11.244 -94.480  1.00 82.68  ? 298 ARG B CA    1 
ATOM   6343 C C     . ARG B 1 304 ? 4.559   -12.251 -93.625  1.00 88.51  ? 298 ARG B C     1 
ATOM   6344 O O     . ARG B 1 304 ? 4.381   -13.458 -93.793  1.00 88.97  ? 298 ARG B O     1 
ATOM   6345 C CB    . ARG B 1 304 ? 4.614   -10.826 -95.696  1.00 81.90  ? 298 ARG B CB    1 
ATOM   6346 C CG    . ARG B 1 304 ? 3.776   -10.436 -96.898  1.00 87.78  ? 298 ARG B CG    1 
ATOM   6347 C CD    . ARG B 1 304 ? 4.636   -10.436 -98.149  1.00 94.94  ? 298 ARG B CD    1 
ATOM   6348 N NE    . ARG B 1 304 ? 3.876   -10.127 -99.362  1.00 91.40  ? 298 ARG B NE    1 
ATOM   6349 C CZ    . ARG B 1 304 ? 3.756   -8.910  -99.883  1.00 90.98  ? 298 ARG B CZ    1 
ATOM   6350 N NH1   . ARG B 1 304 ? 4.331   -7.865  -99.293  1.00 67.42  ? 298 ARG B NH1   1 
ATOM   6351 N NH2   . ARG B 1 304 ? 3.046   -8.723  -100.992 1.00 69.51  ? 298 ARG B NH2   1 
ATOM   6352 N N     . GLU B 1 305 ? 5.386   -11.754 -92.695  1.00 86.17  ? 299 GLU B N     1 
ATOM   6353 C CA    . GLU B 1 305 ? 6.193   -12.579 -91.800  1.00 86.88  ? 299 GLU B CA    1 
ATOM   6354 C C     . GLU B 1 305 ? 5.359   -13.119 -90.640  1.00 91.14  ? 299 GLU B C     1 
ATOM   6355 O O     . GLU B 1 305 ? 5.021   -14.305 -90.638  1.00 90.98  ? 299 GLU B O     1 
ATOM   6356 C CB    . GLU B 1 305 ? 7.410   -11.793 -91.287  1.00 88.46  ? 299 GLU B CB    1 
ATOM   6357 C CG    . GLU B 1 305 ? 8.435   -11.482 -92.358  1.00 103.27 ? 299 GLU B CG    1 
ATOM   6358 C CD    . GLU B 1 305 ? 9.683   -10.827 -91.809  1.00 134.97 ? 299 GLU B CD    1 
ATOM   6359 O OE1   . GLU B 1 305 ? 10.759  -11.468 -91.858  1.00 140.17 ? 299 GLU B OE1   1 
ATOM   6360 O OE2   . GLU B 1 305 ? 9.581   -9.686  -91.301  1.00 130.00 ? 299 GLU B OE2   1 
ATOM   6361 N N     . MET B 1 306 ? 5.010   -12.244 -89.672  1.00 87.97  ? 300 MET B N     1 
ATOM   6362 C CA    . MET B 1 306 ? 4.250   -12.599 -88.473  1.00 87.88  ? 300 MET B CA    1 
ATOM   6363 C C     . MET B 1 306 ? 2.795   -12.928 -88.756  1.00 90.15  ? 300 MET B C     1 
ATOM   6364 O O     . MET B 1 306 ? 2.301   -13.953 -88.289  1.00 91.25  ? 300 MET B O     1 
ATOM   6365 C CB    . MET B 1 306 ? 4.320   -11.500 -87.379  1.00 90.27  ? 300 MET B CB    1 
ATOM   6366 C CG    . MET B 1 306 ? 5.600   -10.668 -87.363  1.00 96.06  ? 300 MET B CG    1 
ATOM   6367 S SD    . MET B 1 306 ? 7.112   -11.635 -87.050  1.00 103.35 ? 300 MET B SD    1 
ATOM   6368 C CE    . MET B 1 306 ? 7.255   -11.452 -85.243  1.00 99.47  ? 300 MET B CE    1 
ATOM   6369 N N     . GLY B 1 307 ? 2.123   -12.051 -89.489  1.00 84.00  ? 301 GLY B N     1 
ATOM   6370 C CA    . GLY B 1 307 ? 0.699   -12.156 -89.771  1.00 82.69  ? 301 GLY B CA    1 
ATOM   6371 C C     . GLY B 1 307 ? -0.027  -10.999 -89.118  1.00 84.31  ? 301 GLY B C     1 
ATOM   6372 O O     . GLY B 1 307 ? -1.177  -10.712 -89.457  1.00 84.40  ? 301 GLY B O     1 
ATOM   6373 N N     . PHE B 1 308 ? 0.669   -10.321 -88.183  1.00 78.39  ? 302 PHE B N     1 
ATOM   6374 C CA    . PHE B 1 308 ? 0.199   -9.178  -87.413  1.00 76.25  ? 302 PHE B CA    1 
ATOM   6375 C C     . PHE B 1 308 ? 1.173   -8.027  -87.580  1.00 80.40  ? 302 PHE B C     1 
ATOM   6376 O O     . PHE B 1 308 ? 2.302   -8.235  -88.025  1.00 81.57  ? 302 PHE B O     1 
ATOM   6377 C CB    . PHE B 1 308 ? 0.117   -9.555  -85.942  1.00 75.82  ? 302 PHE B CB    1 
ATOM   6378 N N     . CYS B 1 309 ? 0.734   -6.813  -87.208  1.00 75.27  ? 303 CYS B N     1 
ATOM   6379 C CA    . CYS B 1 309 ? 1.512   -5.573  -87.186  1.00 74.46  ? 303 CYS B CA    1 
ATOM   6380 C C     . CYS B 1 309 ? 0.859   -4.613  -86.189  1.00 75.32  ? 303 CYS B C     1 
ATOM   6381 O O     . CYS B 1 309 ? -0.320  -4.778  -85.873  1.00 73.86  ? 303 CYS B O     1 
ATOM   6382 C CB    . CYS B 1 309 ? 1.627   -4.953  -88.580  1.00 75.80  ? 303 CYS B CB    1 
ATOM   6383 S SG    . CYS B 1 309 ? 0.073   -4.286  -89.244  1.00 79.46  ? 303 CYS B SG    1 
ATOM   6384 N N     . SER B 1 310 ? 1.606   -3.632  -85.673  1.00 71.25  ? 304 SER B N     1 
ATOM   6385 C CA    . SER B 1 310 ? 1.001   -2.647  -84.782  1.00 69.94  ? 304 SER B CA    1 
ATOM   6386 C C     . SER B 1 310 ? 0.045   -1.765  -85.629  1.00 73.77  ? 304 SER B C     1 
ATOM   6387 O O     . SER B 1 310 ? 0.392   -1.332  -86.744  1.00 75.55  ? 304 SER B O     1 
ATOM   6388 C CB    . SER B 1 310 ? 2.067   -1.795  -84.095  1.00 73.05  ? 304 SER B CB    1 
ATOM   6389 O OG    . SER B 1 310 ? 1.484   -0.746  -83.333  1.00 77.96  ? 304 SER B OG    1 
ATOM   6390 N N     . GLY B 1 311 ? -1.163  -1.576  -85.117  1.00 66.78  ? 305 GLY B N     1 
ATOM   6391 C CA    . GLY B 1 311 ? -2.188  -0.788  -85.782  1.00 64.90  ? 305 GLY B CA    1 
ATOM   6392 C C     . GLY B 1 311 ? -2.826  -1.508  -86.944  1.00 65.84  ? 305 GLY B C     1 
ATOM   6393 O O     . GLY B 1 311 ? -3.308  -0.852  -87.873  1.00 66.48  ? 305 GLY B O     1 
ATOM   6394 N N     . ILE B 1 312 ? -2.861  -2.864  -86.884  1.00 59.40  ? 306 ILE B N     1 
ATOM   6395 C CA    . ILE B 1 312 ? -3.462  -3.750  -87.904  1.00 58.24  ? 306 ILE B CA    1 
ATOM   6396 C C     . ILE B 1 312 ? -4.942  -3.417  -88.130  1.00 60.92  ? 306 ILE B C     1 
ATOM   6397 O O     . ILE B 1 312 ? -5.461  -3.599  -89.240  1.00 61.82  ? 306 ILE B O     1 
ATOM   6398 C CB    . ILE B 1 312 ? -3.213  -5.246  -87.583  1.00 60.48  ? 306 ILE B CB    1 
ATOM   6399 C CG1   . ILE B 1 312 ? -3.698  -6.164  -88.700  1.00 61.14  ? 306 ILE B CG1   1 
ATOM   6400 C CG2   . ILE B 1 312 ? -3.755  -5.659  -86.217  1.00 59.91  ? 306 ILE B CG2   1 
ATOM   6401 C CD1   . ILE B 1 312 ? -2.626  -6.882  -89.357  1.00 69.81  ? 306 ILE B CD1   1 
ATOM   6402 N N     . GLU B 1 313 ? -5.587  -2.872  -87.074  1.00 54.74  ? 307 GLU B N     1 
ATOM   6403 C CA    . GLU B 1 313 ? -6.976  -2.433  -87.048  1.00 53.80  ? 307 GLU B CA    1 
ATOM   6404 C C     . GLU B 1 313 ? -7.262  -1.413  -88.133  1.00 57.98  ? 307 GLU B C     1 
ATOM   6405 O O     . GLU B 1 313 ? -8.364  -1.395  -88.667  1.00 58.46  ? 307 GLU B O     1 
ATOM   6406 C CB    . GLU B 1 313 ? -7.376  -1.909  -85.655  1.00 54.41  ? 307 GLU B CB    1 
ATOM   6407 C CG    . GLU B 1 313 ? -6.557  -0.732  -85.127  1.00 71.00  ? 307 GLU B CG    1 
ATOM   6408 C CD    . GLU B 1 313 ? -5.353  -1.009  -84.234  1.00 97.19  ? 307 GLU B CD    1 
ATOM   6409 O OE1   . GLU B 1 313 ? -4.865  -0.042  -83.602  1.00 95.83  ? 307 GLU B OE1   1 
ATOM   6410 O OE2   . GLU B 1 313 ? -4.878  -2.169  -84.183  1.00 87.56  ? 307 GLU B OE2   1 
ATOM   6411 N N     . ASN B 1 314 ? -6.261  -0.602  -88.498  1.00 55.03  ? 308 ASN B N     1 
ATOM   6412 C CA    . ASN B 1 314 ? -6.406  0.407   -89.546  1.00 55.74  ? 308 ASN B CA    1 
ATOM   6413 C C     . ASN B 1 314 ? -6.650  -0.218  -90.910  1.00 61.73  ? 308 ASN B C     1 
ATOM   6414 O O     . ASN B 1 314 ? -7.338  0.377   -91.742  1.00 62.40  ? 308 ASN B O     1 
ATOM   6415 C CB    . ASN B 1 314 ? -5.193  1.325   -89.580  1.00 54.78  ? 308 ASN B CB    1 
ATOM   6416 C CG    . ASN B 1 314 ? -5.217  2.359   -88.490  1.00 73.80  ? 308 ASN B CG    1 
ATOM   6417 O OD1   . ASN B 1 314 ? -4.331  2.398   -87.642  1.00 58.95  ? 308 ASN B OD1   1 
ATOM   6418 N ND2   . ASN B 1 314 ? -6.250  3.211   -88.480  1.00 74.25  ? 308 ASN B ND2   1 
ATOM   6419 N N     . TYR B 1 315 ? -6.122  -1.435  -91.112  1.00 58.67  ? 309 TYR B N     1 
ATOM   6420 C CA    . TYR B 1 315 ? -6.250  -2.171  -92.357  1.00 59.99  ? 309 TYR B CA    1 
ATOM   6421 C C     . TYR B 1 315 ? -7.502  -3.019  -92.405  1.00 65.57  ? 309 TYR B C     1 
ATOM   6422 O O     . TYR B 1 315 ? -7.781  -3.570  -93.472  1.00 67.79  ? 309 TYR B O     1 
ATOM   6423 C CB    . TYR B 1 315 ? -4.993  -3.022  -92.623  1.00 62.00  ? 309 TYR B CB    1 
ATOM   6424 C CG    . TYR B 1 315 ? -3.728  -2.203  -92.698  1.00 63.39  ? 309 TYR B CG    1 
ATOM   6425 C CD1   . TYR B 1 315 ? -2.862  -2.120  -91.607  1.00 63.91  ? 309 TYR B CD1   1 
ATOM   6426 C CD2   . TYR B 1 315 ? -3.416  -1.474  -93.839  1.00 65.32  ? 309 TYR B CD2   1 
ATOM   6427 C CE1   . TYR B 1 315 ? -1.712  -1.339  -91.657  1.00 63.86  ? 309 TYR B CE1   1 
ATOM   6428 C CE2   . TYR B 1 315 ? -2.272  -0.686  -93.899  1.00 67.10  ? 309 TYR B CE2   1 
ATOM   6429 C CZ    . TYR B 1 315 ? -1.424  -0.620  -92.806  1.00 75.41  ? 309 TYR B CZ    1 
ATOM   6430 O OH    . TYR B 1 315 ? -0.305  0.169   -92.880  1.00 81.49  ? 309 TYR B OH    1 
ATOM   6431 N N     . SER B 1 316 ? -8.272  -3.102  -91.281  1.00 60.47  ? 310 SER B N     1 
ATOM   6432 C CA    . SER B 1 316 ? -9.510  -3.896  -91.120  1.00 60.08  ? 310 SER B CA    1 
ATOM   6433 C C     . SER B 1 316 ? -10.424 -4.089  -92.354  1.00 66.18  ? 310 SER B C     1 
ATOM   6434 O O     . SER B 1 316 ? -10.794 -5.227  -92.635  1.00 66.33  ? 310 SER B O     1 
ATOM   6435 C CB    . SER B 1 316 ? -10.325 -3.426  -89.924  1.00 61.39  ? 310 SER B CB    1 
ATOM   6436 O OG    . SER B 1 316 ? -11.195 -2.370  -90.288  1.00 67.33  ? 310 SER B OG    1 
ATOM   6437 N N     . ARG B 1 317 ? -10.771 -3.003  -93.092  1.00 63.54  ? 311 ARG B N     1 
ATOM   6438 C CA    . ARG B 1 317 ? -11.621 -3.096  -94.300  1.00 64.40  ? 311 ARG B CA    1 
ATOM   6439 C C     . ARG B 1 317 ? -11.023 -4.032  -95.360  1.00 70.99  ? 311 ARG B C     1 
ATOM   6440 O O     . ARG B 1 317 ? -11.754 -4.804  -95.976  1.00 72.32  ? 311 ARG B O     1 
ATOM   6441 C CB    . ARG B 1 317 ? -11.892 -1.706  -94.896  1.00 63.97  ? 311 ARG B CB    1 
ATOM   6442 C CG    . ARG B 1 317 ? -12.995 -1.661  -95.953  1.00 70.55  ? 311 ARG B CG    1 
ATOM   6443 C CD    . ARG B 1 317 ? -12.426 -1.581  -97.358  1.00 77.85  ? 311 ARG B CD    1 
ATOM   6444 N NE    . ARG B 1 317 ? -12.035 -0.221  -97.718  1.00 83.31  ? 311 ARG B NE    1 
ATOM   6445 C CZ    . ARG B 1 317 ? -11.297 0.091   -98.776  1.00 95.33  ? 311 ARG B CZ    1 
ATOM   6446 N NH1   . ARG B 1 317 ? -10.845 -0.863  -99.588  1.00 75.35  ? 311 ARG B NH1   1 
ATOM   6447 N NH2   . ARG B 1 317 ? -11.004 1.357   -99.035  1.00 84.52  ? 311 ARG B NH2   1 
ATOM   6448 N N     . HIS B 1 318 ? -9.703  -3.961  -95.565  1.00 68.48  ? 312 HIS B N     1 
ATOM   6449 C CA    . HIS B 1 318 ? -8.987  -4.798  -96.516  1.00 69.96  ? 312 HIS B CA    1 
ATOM   6450 C C     . HIS B 1 318 ? -8.892  -6.238  -96.038  1.00 73.76  ? 312 HIS B C     1 
ATOM   6451 O O     . HIS B 1 318 ? -8.959  -7.148  -96.864  1.00 75.09  ? 312 HIS B O     1 
ATOM   6452 C CB    . HIS B 1 318 ? -7.586  -4.237  -96.783  1.00 71.13  ? 312 HIS B CB    1 
ATOM   6453 C CG    . HIS B 1 318 ? -7.589  -3.005  -97.624  1.00 75.20  ? 312 HIS B CG    1 
ATOM   6454 N ND1   . HIS B 1 318 ? -7.765  -3.067  -98.998  1.00 78.69  ? 312 HIS B ND1   1 
ATOM   6455 C CD2   . HIS B 1 318 ? -7.432  -1.712  -97.259  1.00 76.25  ? 312 HIS B CD2   1 
ATOM   6456 C CE1   . HIS B 1 318 ? -7.714  -1.812  -99.419  1.00 78.34  ? 312 HIS B CE1   1 
ATOM   6457 N NE2   . HIS B 1 318 ? -7.507  -0.963  -98.408  1.00 77.27  ? 312 HIS B NE2   1 
ATOM   6458 N N     . LEU B 1 319 ? -8.734  -6.445  -94.714  1.00 68.47  ? 313 LEU B N     1 
ATOM   6459 C CA    . LEU B 1 319 ? -8.612  -7.776  -94.116  1.00 68.32  ? 313 LEU B CA    1 
ATOM   6460 C C     . LEU B 1 319 ? -9.947  -8.579  -94.175  1.00 73.71  ? 313 LEU B C     1 
ATOM   6461 O O     . LEU B 1 319 ? -9.918  -9.807  -94.268  1.00 73.55  ? 313 LEU B O     1 
ATOM   6462 C CB    . LEU B 1 319 ? -8.062  -7.681  -92.688  1.00 67.29  ? 313 LEU B CB    1 
ATOM   6463 N N     . THR B 1 320 ? -11.099 -7.882  -94.171  1.00 70.39  ? 314 THR B N     1 
ATOM   6464 C CA    . THR B 1 320 ? -12.419 -8.525  -94.252  1.00 70.44  ? 314 THR B CA    1 
ATOM   6465 C C     . THR B 1 320 ? -12.895 -8.627  -95.716  1.00 75.89  ? 314 THR B C     1 
ATOM   6466 O O     . THR B 1 320 ? -13.969 -9.175  -95.991  1.00 77.33  ? 314 THR B O     1 
ATOM   6467 C CB    . THR B 1 320 ? -13.437 -7.832  -93.333  1.00 73.20  ? 314 THR B CB    1 
ATOM   6468 O OG1   . THR B 1 320 ? -13.761 -6.542  -93.858  1.00 69.86  ? 314 THR B OG1   1 
ATOM   6469 C CG2   . THR B 1 320 ? -12.956 -7.744  -91.875  1.00 72.19  ? 314 THR B CG2   1 
ATOM   6470 N N     . LEU B 1 321 ? -12.088 -8.085  -96.649  1.00 71.09  ? 315 LEU B N     1 
ATOM   6471 C CA    . LEU B 1 321 ? -12.335 -8.072  -98.095  1.00 71.75  ? 315 LEU B CA    1 
ATOM   6472 C C     . LEU B 1 321 ? -13.652 -7.377  -98.486  1.00 73.70  ? 315 LEU B C     1 
ATOM   6473 O O     . LEU B 1 321 ? -14.113 -7.495  -99.627  1.00 74.78  ? 315 LEU B O     1 
ATOM   6474 C CB    . LEU B 1 321 ? -12.161 -9.476  -98.729  1.00 73.16  ? 315 LEU B CB    1 
ATOM   6475 C CG    . LEU B 1 321 ? -10.773 -10.113 -98.547  1.00 78.11  ? 315 LEU B CG    1 
ATOM   6476 C CD1   . LEU B 1 321 ? -10.739 -11.069 -97.344  1.00 77.52  ? 315 LEU B CD1   1 
ATOM   6477 C CD2   . LEU B 1 321 ? -10.334 -10.828 -99.804  1.00 83.02  ? 315 LEU B CD2   1 
ATOM   6478 N N     . ARG B 1 322 ? -14.206 -6.603  -97.535  1.00 67.10  ? 316 ARG B N     1 
ATOM   6479 C CA    . ARG B 1 322 ? -15.429 -5.832  -97.668  1.00 66.84  ? 316 ARG B CA    1 
ATOM   6480 C C     . ARG B 1 322 ? -15.219 -4.632  -98.637  1.00 71.59  ? 316 ARG B C     1 
ATOM   6481 O O     . ARG B 1 322 ? -14.080 -4.201  -98.813  1.00 68.92  ? 316 ARG B O     1 
ATOM   6482 C CB    . ARG B 1 322 ? -15.874 -5.350  -96.291  1.00 65.92  ? 316 ARG B CB    1 
ATOM   6483 N N     . PRO B 1 323 ? -16.282 -4.082  -99.292  1.00 71.71  ? 317 PRO B N     1 
ATOM   6484 C CA    . PRO B 1 323 ? -16.060 -2.948  -100.216 1.00 72.53  ? 317 PRO B CA    1 
ATOM   6485 C C     . PRO B 1 323 ? -15.786 -1.615  -99.500  1.00 76.99  ? 317 PRO B C     1 
ATOM   6486 O O     . PRO B 1 323 ? -16.125 -1.498  -98.315  1.00 75.86  ? 317 PRO B O     1 
ATOM   6487 C CB    . PRO B 1 323 ? -17.354 -2.903  -101.046 1.00 75.11  ? 317 PRO B CB    1 
ATOM   6488 C CG    . PRO B 1 323 ? -18.385 -3.480  -100.172 1.00 79.02  ? 317 PRO B CG    1 
ATOM   6489 C CD    . PRO B 1 323 ? -17.714 -4.460  -99.239  1.00 73.85  ? 317 PRO B CD    1 
ATOM   6490 N N     . PRO B 1 324 ? -15.191 -0.594  -100.184 1.00 74.15  ? 318 PRO B N     1 
ATOM   6491 C CA    . PRO B 1 324 ? -14.954 0.704   -99.520  1.00 72.66  ? 318 PRO B CA    1 
ATOM   6492 C C     . PRO B 1 324 ? -16.256 1.418   -99.173  1.00 76.97  ? 318 PRO B C     1 
ATOM   6493 O O     . PRO B 1 324 ? -17.243 1.272   -99.891  1.00 78.99  ? 318 PRO B O     1 
ATOM   6494 C CB    . PRO B 1 324 ? -14.173 1.504   -100.570 1.00 75.12  ? 318 PRO B CB    1 
ATOM   6495 C CG    . PRO B 1 324 ? -13.681 0.508   -101.545 1.00 80.89  ? 318 PRO B CG    1 
ATOM   6496 C CD    . PRO B 1 324 ? -14.728 -0.548  -101.584 1.00 77.23  ? 318 PRO B CD    1 
ATOM   6497 N N     . GLY B 1 325 ? -16.243 2.161   -98.075  1.00 71.55  ? 319 GLY B N     1 
ATOM   6498 C CA    . GLY B 1 325 ? -17.409 2.892   -97.599  1.00 71.46  ? 319 GLY B CA    1 
ATOM   6499 C C     . GLY B 1 325 ? -18.281 2.099   -96.640  1.00 76.02  ? 319 GLY B C     1 
ATOM   6500 O O     . GLY B 1 325 ? -18.993 2.695   -95.813  1.00 76.69  ? 319 GLY B O     1 
ATOM   6501 N N     . SER B 1 326 ? -18.204 0.742   -96.736  1.00 70.35  ? 320 SER B N     1 
ATOM   6502 C CA    . SER B 1 326 ? -18.933 -0.248  -95.939  1.00 68.27  ? 320 SER B CA    1 
ATOM   6503 C C     . SER B 1 326 ? -19.079 0.069   -94.443  1.00 67.77  ? 320 SER B C     1 
ATOM   6504 O O     . SER B 1 326 ? -18.155 0.601   -93.807  1.00 65.91  ? 320 SER B O     1 
ATOM   6505 C CB    . SER B 1 326 ? -18.325 -1.626  -96.128  1.00 69.31  ? 320 SER B CB    1 
ATOM   6506 N N     . THR B 1 327 ? -20.278 -0.245  -93.910  1.00 62.92  ? 321 THR B N     1 
ATOM   6507 C CA    . THR B 1 327 ? -20.689 -0.075  -92.514  1.00 61.42  ? 321 THR B CA    1 
ATOM   6508 C C     . THR B 1 327 ? -20.022 -1.172  -91.650  1.00 64.23  ? 321 THR B C     1 
ATOM   6509 O O     . THR B 1 327 ? -20.047 -2.343  -92.042  1.00 66.47  ? 321 THR B O     1 
ATOM   6510 C CB    . THR B 1 327 ? -22.233 -0.069  -92.433  1.00 69.74  ? 321 THR B CB    1 
ATOM   6511 O OG1   . THR B 1 327 ? -22.732 1.125   -93.048  1.00 70.58  ? 321 THR B OG1   1 
ATOM   6512 C CG2   . THR B 1 327 ? -22.760 -0.149  -91.013  1.00 67.48  ? 321 THR B CG2   1 
ATOM   6513 N N     . PRO B 1 328 ? -19.423 -0.831  -90.490  1.00 56.43  ? 322 PRO B N     1 
ATOM   6514 C CA    . PRO B 1 328 ? -18.751 -1.858  -89.687  1.00 55.52  ? 322 PRO B CA    1 
ATOM   6515 C C     . PRO B 1 328 ? -19.679 -2.804  -88.966  1.00 60.12  ? 322 PRO B C     1 
ATOM   6516 O O     . PRO B 1 328 ? -20.831 -2.444  -88.703  1.00 59.91  ? 322 PRO B O     1 
ATOM   6517 C CB    . PRO B 1 328 ? -17.962 -1.045  -88.647  1.00 56.19  ? 322 PRO B CB    1 
ATOM   6518 C CG    . PRO B 1 328 ? -18.019 0.353   -89.095  1.00 60.45  ? 322 PRO B CG    1 
ATOM   6519 C CD    . PRO B 1 328 ? -19.267 0.501   -89.880  1.00 56.75  ? 322 PRO B CD    1 
ATOM   6520 N N     . TYR B 1 329 ? -19.153 -3.993  -88.576  1.00 57.38  ? 323 TYR B N     1 
ATOM   6521 C CA    . TYR B 1 329 ? -19.918 -4.930  -87.765  1.00 57.76  ? 323 TYR B CA    1 
ATOM   6522 C C     . TYR B 1 329 ? -19.843 -4.457  -86.309  1.00 61.65  ? 323 TYR B C     1 
ATOM   6523 O O     . TYR B 1 329 ? -18.765 -4.072  -85.850  1.00 61.71  ? 323 TYR B O     1 
ATOM   6524 C CB    . TYR B 1 329 ? -19.396 -6.352  -87.919  1.00 60.25  ? 323 TYR B CB    1 
ATOM   6525 C CG    . TYR B 1 329 ? -19.850 -7.040  -89.196  1.00 65.43  ? 323 TYR B CG    1 
ATOM   6526 C CD1   . TYR B 1 329 ? -18.967 -7.237  -90.260  1.00 67.84  ? 323 TYR B CD1   1 
ATOM   6527 C CD2   . TYR B 1 329 ? -21.155 -7.523  -89.331  1.00 67.10  ? 323 TYR B CD2   1 
ATOM   6528 C CE1   . TYR B 1 329 ? -19.370 -7.889  -91.424  1.00 68.71  ? 323 TYR B CE1   1 
ATOM   6529 C CE2   . TYR B 1 329 ? -21.572 -8.165  -90.497  1.00 69.00  ? 323 TYR B CE2   1 
ATOM   6530 C CZ    . TYR B 1 329 ? -20.673 -8.351  -91.538  1.00 77.08  ? 323 TYR B CZ    1 
ATOM   6531 O OH    . TYR B 1 329 ? -21.060 -8.997  -92.691  1.00 80.70  ? 323 TYR B OH    1 
ATOM   6532 N N     . THR B 1 330 ? -20.994 -4.373  -85.616  1.00 57.45  ? 324 THR B N     1 
ATOM   6533 C CA    . THR B 1 330 ? -21.050 -3.912  -84.213  1.00 55.98  ? 324 THR B CA    1 
ATOM   6534 C C     . THR B 1 330 ? -21.761 -4.923  -83.304  1.00 59.11  ? 324 THR B C     1 
ATOM   6535 O O     . THR B 1 330 ? -22.316 -5.907  -83.800  1.00 60.28  ? 324 THR B O     1 
ATOM   6536 C CB    . THR B 1 330 ? -21.732 -2.545  -84.115  1.00 64.95  ? 324 THR B CB    1 
ATOM   6537 O OG1   . THR B 1 330 ? -23.073 -2.656  -84.599  1.00 68.02  ? 324 THR B OG1   1 
ATOM   6538 C CG2   . THR B 1 330 ? -20.968 -1.451  -84.836  1.00 61.87  ? 324 THR B CG2   1 
ATOM   6539 N N     . LEU B 1 331 ? -21.780 -4.677  -81.978  1.00 53.34  ? 325 LEU B N     1 
ATOM   6540 C CA    . LEU B 1 331 ? -22.479 -5.577  -81.065  1.00 52.73  ? 325 LEU B CA    1 
ATOM   6541 C C     . LEU B 1 331 ? -23.953 -5.698  -81.496  1.00 60.35  ? 325 LEU B C     1 
ATOM   6542 O O     . LEU B 1 331 ? -24.543 -6.784  -81.411  1.00 62.75  ? 325 LEU B O     1 
ATOM   6543 C CB    . LEU B 1 331 ? -22.360 -5.086  -79.615  1.00 51.13  ? 325 LEU B CB    1 
ATOM   6544 C CG    . LEU B 1 331 ? -23.050 -5.929  -78.544  1.00 55.83  ? 325 LEU B CG    1 
ATOM   6545 C CD1   . LEU B 1 331 ? -22.360 -7.251  -78.360  1.00 56.88  ? 325 LEU B CD1   1 
ATOM   6546 C CD2   . LEU B 1 331 ? -23.115 -5.200  -77.238  1.00 56.72  ? 325 LEU B CD2   1 
ATOM   6547 N N     . LEU B 1 332 ? -24.510 -4.600  -82.044  1.00 55.94  ? 326 LEU B N     1 
ATOM   6548 C CA    . LEU B 1 332 ? -25.889 -4.540  -82.522  1.00 56.32  ? 326 LEU B CA    1 
ATOM   6549 C C     . LEU B 1 332 ? -26.232 -5.615  -83.569  1.00 62.43  ? 326 LEU B C     1 
ATOM   6550 O O     . LEU B 1 332 ? -27.390 -6.016  -83.660  1.00 63.74  ? 326 LEU B O     1 
ATOM   6551 C CB    . LEU B 1 332 ? -26.200 -3.130  -83.049  1.00 55.56  ? 326 LEU B CB    1 
ATOM   6552 C CG    . LEU B 1 332 ? -26.093 -1.969  -82.040  1.00 57.56  ? 326 LEU B CG    1 
ATOM   6553 C CD1   . LEU B 1 332 ? -26.053 -0.644  -82.759  1.00 57.55  ? 326 LEU B CD1   1 
ATOM   6554 C CD2   . LEU B 1 332 ? -27.254 -1.963  -81.077  1.00 55.98  ? 326 LEU B CD2   1 
ATOM   6555 N N     . ASP B 1 333 ? -25.227 -6.096  -84.331  1.00 59.49  ? 327 ASP B N     1 
ATOM   6556 C CA    . ASP B 1 333 ? -25.376 -7.147  -85.355  1.00 60.42  ? 327 ASP B CA    1 
ATOM   6557 C C     . ASP B 1 333 ? -25.522 -8.554  -84.753  1.00 65.77  ? 327 ASP B C     1 
ATOM   6558 O O     . ASP B 1 333 ? -26.114 -9.437  -85.382  1.00 67.12  ? 327 ASP B O     1 
ATOM   6559 C CB    . ASP B 1 333 ? -24.214 -7.115  -86.358  1.00 61.39  ? 327 ASP B CB    1 
ATOM   6560 C CG    . ASP B 1 333 ? -24.165 -5.847  -87.173  1.00 71.13  ? 327 ASP B CG    1 
ATOM   6561 O OD1   . ASP B 1 333 ? -23.130 -5.147  -87.115  1.00 69.99  ? 327 ASP B OD1   1 
ATOM   6562 O OD2   . ASP B 1 333 ? -25.175 -5.536  -87.853  1.00 78.85  ? 327 ASP B OD2   1 
ATOM   6563 N N     . TYR B 1 334 ? -24.993 -8.753  -83.535  1.00 61.04  ? 328 TYR B N     1 
ATOM   6564 C CA    . TYR B 1 334 ? -25.055 -10.019 -82.815  1.00 61.19  ? 328 TYR B CA    1 
ATOM   6565 C C     . TYR B 1 334 ? -26.447 -10.214 -82.170  1.00 68.20  ? 328 TYR B C     1 
ATOM   6566 O O     . TYR B 1 334 ? -26.758 -11.316 -81.717  1.00 69.92  ? 328 TYR B O     1 
ATOM   6567 C CB    . TYR B 1 334 ? -23.950 -10.067 -81.749  1.00 60.55  ? 328 TYR B CB    1 
ATOM   6568 C CG    . TYR B 1 334 ? -22.530 -10.231 -82.261  1.00 61.26  ? 328 TYR B CG    1 
ATOM   6569 C CD1   . TYR B 1 334 ? -21.952 -9.279  -83.101  1.00 62.89  ? 328 TYR B CD1   1 
ATOM   6570 C CD2   . TYR B 1 334 ? -21.711 -11.248 -81.778  1.00 61.82  ? 328 TYR B CD2   1 
ATOM   6571 C CE1   . TYR B 1 334 ? -20.625 -9.394  -83.525  1.00 64.39  ? 328 TYR B CE1   1 
ATOM   6572 C CE2   . TYR B 1 334 ? -20.377 -11.359 -82.174  1.00 62.28  ? 328 TYR B CE2   1 
ATOM   6573 C CZ    . TYR B 1 334 ? -19.838 -10.431 -83.050  1.00 71.82  ? 328 TYR B CZ    1 
ATOM   6574 O OH    . TYR B 1 334 ? -18.522 -10.543 -83.439  1.00 73.76  ? 328 TYR B OH    1 
ATOM   6575 N N     . PHE B 1 335 ? -27.276 -9.148  -82.121  1.00 64.46  ? 329 PHE B N     1 
ATOM   6576 C CA    . PHE B 1 335 ? -28.638 -9.195  -81.570  1.00 64.56  ? 329 PHE B CA    1 
ATOM   6577 C C     . PHE B 1 335 ? -29.638 -9.610  -82.648  1.00 71.99  ? 329 PHE B C     1 
ATOM   6578 O O     . PHE B 1 335 ? -29.467 -9.227  -83.818  1.00 71.40  ? 329 PHE B O     1 
ATOM   6579 C CB    . PHE B 1 335 ? -29.062 -7.818  -81.041  1.00 64.69  ? 329 PHE B CB    1 
ATOM   6580 C CG    . PHE B 1 335 ? -28.654 -7.493  -79.635  1.00 64.19  ? 329 PHE B CG    1 
ATOM   6581 C CD1   . PHE B 1 335 ? -27.537 -6.698  -79.386  1.00 64.51  ? 329 PHE B CD1   1 
ATOM   6582 C CD2   . PHE B 1 335 ? -29.406 -7.946  -78.556  1.00 66.16  ? 329 PHE B CD2   1 
ATOM   6583 C CE1   . PHE B 1 335 ? -27.175 -6.370  -78.079  1.00 64.47  ? 329 PHE B CE1   1 
ATOM   6584 C CE2   . PHE B 1 335 ? -29.043 -7.622  -77.249  1.00 68.01  ? 329 PHE B CE2   1 
ATOM   6585 C CZ    . PHE B 1 335 ? -27.926 -6.839  -77.020  1.00 64.64  ? 329 PHE B CZ    1 
ATOM   6586 N N     . PRO B 1 336 ? -30.736 -10.307 -82.258  1.00 71.76  ? 330 PRO B N     1 
ATOM   6587 C CA    . PRO B 1 336 ? -31.773 -10.672 -83.243  1.00 73.82  ? 330 PRO B CA    1 
ATOM   6588 C C     . PRO B 1 336 ? -32.500 -9.451  -83.801  1.00 80.31  ? 330 PRO B C     1 
ATOM   6589 O O     . PRO B 1 336 ? -32.537 -8.420  -83.133  1.00 79.36  ? 330 PRO B O     1 
ATOM   6590 C CB    . PRO B 1 336 ? -32.761 -11.505 -82.416  1.00 76.55  ? 330 PRO B CB    1 
ATOM   6591 C CG    . PRO B 1 336 ? -32.023 -11.903 -81.203  1.00 80.01  ? 330 PRO B CG    1 
ATOM   6592 C CD    . PRO B 1 336 ? -31.099 -10.790 -80.911  1.00 73.76  ? 330 PRO B CD    1 
ATOM   6593 N N     . ASP B 1 337 ? -33.112 -9.573  -85.000  1.00 79.60  ? 331 ASP B N     1 
ATOM   6594 C CA    . ASP B 1 337 ? -33.904 -8.501  -85.628  1.00 80.21  ? 331 ASP B CA    1 
ATOM   6595 C C     . ASP B 1 337 ? -34.906 -7.924  -84.621  1.00 84.86  ? 331 ASP B C     1 
ATOM   6596 O O     . ASP B 1 337 ? -34.961 -6.704  -84.464  1.00 83.82  ? 331 ASP B O     1 
ATOM   6597 C CB    . ASP B 1 337 ? -34.642 -9.033  -86.849  1.00 82.90  ? 331 ASP B CB    1 
ATOM   6598 N N     . ASP B 1 338 ? -35.632 -8.817  -83.894  1.00 82.83  ? 332 ASP B N     1 
ATOM   6599 C CA    . ASP B 1 338 ? -36.598 -8.494  -82.842  1.00 83.05  ? 332 ASP B CA    1 
ATOM   6600 C C     . ASP B 1 338 ? -35.876 -8.385  -81.488  1.00 86.19  ? 332 ASP B C     1 
ATOM   6601 O O     . ASP B 1 338 ? -35.758 -9.380  -80.764  1.00 86.83  ? 332 ASP B O     1 
ATOM   6602 C CB    . ASP B 1 338 ? -37.682 -9.562  -82.780  1.00 85.77  ? 332 ASP B CB    1 
ATOM   6603 N N     . PHE B 1 339 ? -35.365 -7.171  -81.171  1.00 80.46  ? 333 PHE B N     1 
ATOM   6604 C CA    . PHE B 1 339 ? -34.653 -6.858  -79.926  1.00 78.34  ? 333 PHE B CA    1 
ATOM   6605 C C     . PHE B 1 339 ? -34.953 -5.433  -79.419  1.00 77.81  ? 333 PHE B C     1 
ATOM   6606 O O     . PHE B 1 339 ? -35.261 -4.534  -80.215  1.00 78.01  ? 333 PHE B O     1 
ATOM   6607 C CB    . PHE B 1 339 ? -33.141 -7.108  -80.073  1.00 79.53  ? 333 PHE B CB    1 
ATOM   6608 C CG    . PHE B 1 339 ? -32.285 -5.952  -80.544  1.00 80.53  ? 333 PHE B CG    1 
ATOM   6609 C CD1   . PHE B 1 339 ? -31.376 -5.345  -79.688  1.00 82.93  ? 333 PHE B CD1   1 
ATOM   6610 C CD2   . PHE B 1 339 ? -32.387 -5.472  -81.847  1.00 83.71  ? 333 PHE B CD2   1 
ATOM   6611 C CE1   . PHE B 1 339 ? -30.559 -4.300  -80.134  1.00 83.18  ? 333 PHE B CE1   1 
ATOM   6612 C CE2   . PHE B 1 339 ? -31.585 -4.410  -82.286  1.00 85.76  ? 333 PHE B CE2   1 
ATOM   6613 C CZ    . PHE B 1 339 ? -30.669 -3.837  -81.430  1.00 82.52  ? 333 PHE B CZ    1 
ATOM   6614 N N     . MET B 1 340 ? -34.850 -5.234  -78.095  1.00 69.51  ? 334 MET B N     1 
ATOM   6615 C CA    . MET B 1 340 ? -35.132 -3.954  -77.463  1.00 66.65  ? 334 MET B CA    1 
ATOM   6616 C C     . MET B 1 340 ? -33.865 -3.219  -76.992  1.00 67.65  ? 334 MET B C     1 
ATOM   6617 O O     . MET B 1 340 ? -32.884 -3.855  -76.607  1.00 66.66  ? 334 MET B O     1 
ATOM   6618 C CB    . MET B 1 340 ? -36.122 -4.156  -76.314  1.00 69.37  ? 334 MET B CB    1 
ATOM   6619 C CG    . MET B 1 340 ? -36.686 -2.868  -75.764  1.00 72.64  ? 334 MET B CG    1 
ATOM   6620 S SD    . MET B 1 340 ? -37.944 -3.083  -74.479  1.00 78.35  ? 334 MET B SD    1 
ATOM   6621 C CE    . MET B 1 340 ? -36.948 -3.719  -73.106  1.00 74.59  ? 334 MET B CE    1 
ATOM   6622 N N     . ILE B 1 341 ? -33.878 -1.872  -77.068  1.00 61.61  ? 335 ILE B N     1 
ATOM   6623 C CA    . ILE B 1 341 ? -32.795 -1.013  -76.598  1.00 58.92  ? 335 ILE B CA    1 
ATOM   6624 C C     . ILE B 1 341 ? -33.400 -0.048  -75.586  1.00 61.80  ? 335 ILE B C     1 
ATOM   6625 O O     . ILE B 1 341 ? -34.455 0.539   -75.847  1.00 63.61  ? 335 ILE B O     1 
ATOM   6626 C CB    . ILE B 1 341 ? -32.073 -0.247  -77.739  1.00 61.27  ? 335 ILE B CB    1 
ATOM   6627 C CG1   . ILE B 1 341 ? -31.576 -1.180  -78.844  1.00 62.00  ? 335 ILE B CG1   1 
ATOM   6628 C CG2   . ILE B 1 341 ? -30.916 0.628   -77.199  1.00 60.73  ? 335 ILE B CG2   1 
ATOM   6629 C CD1   . ILE B 1 341 ? -31.877 -0.661  -80.227  1.00 72.56  ? 335 ILE B CD1   1 
ATOM   6630 N N     . VAL B 1 342 ? -32.740 0.117   -74.442  1.00 54.98  ? 336 VAL B N     1 
ATOM   6631 C CA    . VAL B 1 342 ? -33.167 1.024   -73.387  1.00 53.55  ? 336 VAL B CA    1 
ATOM   6632 C C     . VAL B 1 342 ? -32.023 1.997   -73.149  1.00 56.92  ? 336 VAL B C     1 
ATOM   6633 O O     . VAL B 1 342 ? -30.929 1.582   -72.765  1.00 56.64  ? 336 VAL B O     1 
ATOM   6634 C CB    . VAL B 1 342 ? -33.612 0.280   -72.098  1.00 56.97  ? 336 VAL B CB    1 
ATOM   6635 C CG1   . VAL B 1 342 ? -33.941 1.267   -70.985  1.00 56.46  ? 336 VAL B CG1   1 
ATOM   6636 C CG2   . VAL B 1 342 ? -34.800 -0.640  -72.366  1.00 57.81  ? 336 VAL B CG2   1 
ATOM   6637 N N     . VAL B 1 343 ? -32.265 3.284   -73.409  1.00 53.31  ? 337 VAL B N     1 
ATOM   6638 C CA    . VAL B 1 343 ? -31.252 4.338   -73.259  1.00 52.05  ? 337 VAL B CA    1 
ATOM   6639 C C     . VAL B 1 343 ? -31.371 5.027   -71.882  1.00 56.65  ? 337 VAL B C     1 
ATOM   6640 O O     . VAL B 1 343 ? -32.341 5.749   -71.661  1.00 56.93  ? 337 VAL B O     1 
ATOM   6641 C CB    . VAL B 1 343 ? -31.330 5.375   -74.422  1.00 55.21  ? 337 VAL B CB    1 
ATOM   6642 C CG1   . VAL B 1 343 ? -30.192 6.383   -74.335  1.00 53.69  ? 337 VAL B CG1   1 
ATOM   6643 C CG2   . VAL B 1 343 ? -31.318 4.693   -75.780  1.00 55.37  ? 337 VAL B CG2   1 
ATOM   6644 N N     . ASP B 1 344 ? -30.400 4.829   -70.967  1.00 53.01  ? 338 ASP B N     1 
ATOM   6645 C CA    . ASP B 1 344 ? -30.454 5.520   -69.674  1.00 53.19  ? 338 ASP B CA    1 
ATOM   6646 C C     . ASP B 1 344 ? -29.886 6.946   -69.856  1.00 60.70  ? 338 ASP B C     1 
ATOM   6647 O O     . ASP B 1 344 ? -28.918 7.121   -70.617  1.00 61.59  ? 338 ASP B O     1 
ATOM   6648 C CB    . ASP B 1 344 ? -29.684 4.755   -68.608  1.00 53.38  ? 338 ASP B CB    1 
ATOM   6649 N N     . GLU B 1 345 ? -30.501 7.971   -69.172  1.00 56.95  ? 339 GLU B N     1 
ATOM   6650 C CA    . GLU B 1 345 ? -30.159 9.411   -69.258  1.00 54.90  ? 339 GLU B CA    1 
ATOM   6651 C C     . GLU B 1 345 ? -30.014 9.811   -70.753  1.00 58.07  ? 339 GLU B C     1 
ATOM   6652 O O     . GLU B 1 345 ? -28.982 10.317  -71.182  1.00 56.40  ? 339 GLU B O     1 
ATOM   6653 C CB    . GLU B 1 345 ? -28.905 9.739   -68.435  1.00 54.20  ? 339 GLU B CB    1 
ATOM   6654 N N     . SER B 1 346 ? -31.058 9.505   -71.546  1.00 55.55  ? 340 SER B N     1 
ATOM   6655 C CA    . SER B 1 346 ? -31.113 9.702   -73.000  1.00 55.74  ? 340 SER B CA    1 
ATOM   6656 C C     . SER B 1 346 ? -30.632 11.057  -73.503  1.00 58.31  ? 340 SER B C     1 
ATOM   6657 O O     . SER B 1 346 ? -29.927 11.128  -74.522  1.00 58.33  ? 340 SER B O     1 
ATOM   6658 C CB    . SER B 1 346 ? -32.495 9.362   -73.555  1.00 61.08  ? 340 SER B CB    1 
ATOM   6659 O OG    . SER B 1 346 ? -33.523 10.133  -72.952  1.00 73.07  ? 340 SER B OG    1 
ATOM   6660 N N     . HIS B 1 347 ? -30.964 12.125  -72.756  1.00 52.23  ? 341 HIS B N     1 
ATOM   6661 C CA    . HIS B 1 347 ? -30.577 13.509  -73.078  1.00 49.85  ? 341 HIS B CA    1 
ATOM   6662 C C     . HIS B 1 347 ? -29.050 13.709  -72.999  1.00 49.26  ? 341 HIS B C     1 
ATOM   6663 O O     . HIS B 1 347 ? -28.526 14.755  -73.398  1.00 48.18  ? 341 HIS B O     1 
ATOM   6664 C CB    . HIS B 1 347 ? -31.304 14.487  -72.154  1.00 50.24  ? 341 HIS B CB    1 
ATOM   6665 C CG    . HIS B 1 347 ? -30.805 14.443  -70.754  1.00 52.84  ? 341 HIS B CG    1 
ATOM   6666 N ND1   . HIS B 1 347 ? -31.075 13.371  -69.927  1.00 55.02  ? 341 HIS B ND1   1 
ATOM   6667 C CD2   . HIS B 1 347 ? -30.048 15.335  -70.087  1.00 54.27  ? 341 HIS B CD2   1 
ATOM   6668 C CE1   . HIS B 1 347 ? -30.489 13.651  -68.778  1.00 54.53  ? 341 HIS B CE1   1 
ATOM   6669 N NE2   . HIS B 1 347 ? -29.861 14.827  -68.825  1.00 54.46  ? 341 HIS B NE2   1 
ATOM   6670 N N     . VAL B 1 348 ? -28.349 12.695  -72.471  1.00 42.56  ? 342 VAL B N     1 
ATOM   6671 C CA    . VAL B 1 348 ? -26.897 12.702  -72.375  1.00 40.09  ? 342 VAL B CA    1 
ATOM   6672 C C     . VAL B 1 348 ? -26.311 11.697  -73.367  1.00 44.11  ? 342 VAL B C     1 
ATOM   6673 O O     . VAL B 1 348 ? -25.376 12.029  -74.101  1.00 45.50  ? 342 VAL B O     1 
ATOM   6674 C CB    . VAL B 1 348 ? -26.381 12.437  -70.946  1.00 41.55  ? 342 VAL B CB    1 
ATOM   6675 C CG1   . VAL B 1 348 ? -24.892 12.691  -70.873  1.00 40.63  ? 342 VAL B CG1   1 
ATOM   6676 C CG2   . VAL B 1 348 ? -27.110 13.286  -69.920  1.00 41.01  ? 342 VAL B CG2   1 
ATOM   6677 N N     . THR B 1 349 ? -26.861 10.482  -73.377  1.00 38.84  ? 343 THR B N     1 
ATOM   6678 C CA    . THR B 1 349 ? -26.405 9.377   -74.204  1.00 37.94  ? 343 THR B CA    1 
ATOM   6679 C C     . THR B 1 349 ? -26.625 9.634   -75.686  1.00 40.65  ? 343 THR B C     1 
ATOM   6680 O O     . THR B 1 349 ? -25.689 9.480   -76.465  1.00 39.45  ? 343 THR B O     1 
ATOM   6681 C CB    . THR B 1 349 ? -27.021 8.071   -73.701  1.00 49.63  ? 343 THR B CB    1 
ATOM   6682 O OG1   . THR B 1 349 ? -27.037 8.067   -72.264  1.00 49.65  ? 343 THR B OG1   1 
ATOM   6683 C CG2   . THR B 1 349 ? -26.290 6.853   -74.213  1.00 49.26  ? 343 THR B CG2   1 
ATOM   6684 N N     . ILE B 1 350 ? -27.849 10.025  -76.079  1.00 38.49  ? 344 ILE B N     1 
ATOM   6685 C CA    . ILE B 1 350 ? -28.161 10.292  -77.490  1.00 38.66  ? 344 ILE B CA    1 
ATOM   6686 C C     . ILE B 1 350 ? -27.151 11.263  -78.142  1.00 40.48  ? 344 ILE B C     1 
ATOM   6687 O O     . ILE B 1 350 ? -26.531 10.867  -79.131  1.00 40.00  ? 344 ILE B O     1 
ATOM   6688 C CB    . ILE B 1 350 ? -29.668 10.604  -77.757  1.00 42.85  ? 344 ILE B CB    1 
ATOM   6689 C CG1   . ILE B 1 350 ? -30.583 9.412   -77.379  1.00 43.61  ? 344 ILE B CG1   1 
ATOM   6690 C CG2   . ILE B 1 350 ? -29.927 11.084  -79.198  1.00 45.18  ? 344 ILE B CG2   1 
ATOM   6691 C CD1   . ILE B 1 350 ? -30.266 8.039   -78.048  1.00 48.54  ? 344 ILE B CD1   1 
ATOM   6692 N N     . PRO B 1 351 ? -26.866 12.461  -77.557  1.00 35.67  ? 345 PRO B N     1 
ATOM   6693 C CA    . PRO B 1 351 ? -25.840 13.337  -78.166  1.00 35.39  ? 345 PRO B CA    1 
ATOM   6694 C C     . PRO B 1 351 ? -24.441 12.701  -78.239  1.00 41.09  ? 345 PRO B C     1 
ATOM   6695 O O     . PRO B 1 351 ? -23.710 12.947  -79.217  1.00 41.84  ? 345 PRO B O     1 
ATOM   6696 C CB    . PRO B 1 351 ? -25.854 14.571  -77.262  1.00 36.13  ? 345 PRO B CB    1 
ATOM   6697 C CG    . PRO B 1 351 ? -27.172 14.531  -76.567  1.00 40.01  ? 345 PRO B CG    1 
ATOM   6698 C CD    . PRO B 1 351 ? -27.478 13.103  -76.370  1.00 36.01  ? 345 PRO B CD    1 
ATOM   6699 N N     . GLN B 1 352 ? -24.094 11.863  -77.214  1.00 36.52  ? 346 GLN B N     1 
ATOM   6700 C CA    . GLN B 1 352 ? -22.834 11.128  -77.099  1.00 35.58  ? 346 GLN B CA    1 
ATOM   6701 C C     . GLN B 1 352 ? -22.692 10.187  -78.274  1.00 42.29  ? 346 GLN B C     1 
ATOM   6702 O O     . GLN B 1 352 ? -21.699 10.271  -78.989  1.00 42.57  ? 346 GLN B O     1 
ATOM   6703 C CB    . GLN B 1 352 ? -22.759 10.337  -75.771  1.00 36.07  ? 346 GLN B CB    1 
ATOM   6704 C CG    . GLN B 1 352 ? -21.531 9.440   -75.666  1.00 41.17  ? 346 GLN B CG    1 
ATOM   6705 C CD    . GLN B 1 352 ? -21.358 8.835   -74.305  1.00 57.37  ? 346 GLN B CD    1 
ATOM   6706 O OE1   . GLN B 1 352 ? -21.813 7.723   -74.016  1.00 51.70  ? 346 GLN B OE1   1 
ATOM   6707 N NE2   . GLN B 1 352 ? -20.651 9.537   -73.446  1.00 53.55  ? 346 GLN B NE2   1 
ATOM   6708 N N     . VAL B 1 353 ? -23.685 9.287   -78.460  1.00 40.41  ? 347 VAL B N     1 
ATOM   6709 C CA    . VAL B 1 353 ? -23.756 8.285   -79.531  1.00 40.33  ? 347 VAL B CA    1 
ATOM   6710 C C     . VAL B 1 353 ? -23.600 8.983   -80.890  1.00 47.61  ? 347 VAL B C     1 
ATOM   6711 O O     . VAL B 1 353 ? -22.755 8.597   -81.706  1.00 48.56  ? 347 VAL B O     1 
ATOM   6712 C CB    . VAL B 1 353 ? -25.081 7.469   -79.455  1.00 42.41  ? 347 VAL B CB    1 
ATOM   6713 C CG1   . VAL B 1 353 ? -25.265 6.582   -80.688  1.00 42.11  ? 347 VAL B CG1   1 
ATOM   6714 C CG2   . VAL B 1 353 ? -25.153 6.644   -78.173  1.00 41.52  ? 347 VAL B CG2   1 
ATOM   6715 N N     . ARG B 1 354 ? -24.405 10.028  -81.092  1.00 45.52  ? 348 ARG B N     1 
ATOM   6716 C CA    . ARG B 1 354 ? -24.458 10.861  -82.280  1.00 47.03  ? 348 ARG B CA    1 
ATOM   6717 C C     . ARG B 1 354 ? -23.082 11.521  -82.584  1.00 53.02  ? 348 ARG B C     1 
ATOM   6718 O O     . ARG B 1 354 ? -22.707 11.693  -83.762  1.00 54.03  ? 348 ARG B O     1 
ATOM   6719 C CB    . ARG B 1 354 ? -25.553 11.918  -82.078  1.00 48.54  ? 348 ARG B CB    1 
ATOM   6720 C CG    . ARG B 1 354 ? -25.959 12.636  -83.337  1.00 70.47  ? 348 ARG B CG    1 
ATOM   6721 C CD    . ARG B 1 354 ? -26.329 14.075  -83.021  1.00 99.23  ? 348 ARG B CD    1 
ATOM   6722 N NE    . ARG B 1 354 ? -27.606 14.193  -82.304  1.00 119.58 ? 348 ARG B NE    1 
ATOM   6723 C CZ    . ARG B 1 354 ? -28.800 14.109  -82.885  1.00 135.36 ? 348 ARG B CZ    1 
ATOM   6724 N NH1   . ARG B 1 354 ? -28.896 13.895  -84.195  1.00 117.83 ? 348 ARG B NH1   1 
ATOM   6725 N NH2   . ARG B 1 354 ? -29.906 14.234  -82.162  1.00 124.31 ? 348 ARG B NH2   1 
ATOM   6726 N N     . GLY B 1 355 ? -22.338 11.845  -81.532  1.00 48.86  ? 349 GLY B N     1 
ATOM   6727 C CA    . GLY B 1 355 ? -21.043 12.508  -81.678  1.00 48.89  ? 349 GLY B CA    1 
ATOM   6728 C C     . GLY B 1 355 ? -19.796 11.674  -81.924  1.00 52.97  ? 349 GLY B C     1 
ATOM   6729 O O     . GLY B 1 355 ? -18.729 12.209  -82.291  1.00 52.51  ? 349 GLY B O     1 
ATOM   6730 N N     . MET B 1 356 ? -19.923 10.364  -81.720  1.00 49.71  ? 350 MET B N     1 
ATOM   6731 C CA    . MET B 1 356 ? -18.803 9.445   -81.836  1.00 49.59  ? 350 MET B CA    1 
ATOM   6732 C C     . MET B 1 356 ? -18.126 9.511   -83.184  1.00 50.97  ? 350 MET B C     1 
ATOM   6733 O O     . MET B 1 356 ? -16.968 9.925   -83.269  1.00 48.63  ? 350 MET B O     1 
ATOM   6734 C CB    . MET B 1 356 ? -19.186 8.007   -81.405  1.00 52.56  ? 350 MET B CB    1 
ATOM   6735 C CG    . MET B 1 356 ? -19.485 7.877   -79.920  1.00 56.85  ? 350 MET B CG    1 
ATOM   6736 S SD    . MET B 1 356 ? -18.088 8.385   -78.858  1.00 62.47  ? 350 MET B SD    1 
ATOM   6737 C CE    . MET B 1 356 ? -18.615 10.044  -78.386  1.00 59.52  ? 350 MET B CE    1 
ATOM   6738 N N     . PHE B 1 357 ? -18.890 9.212   -84.233  1.00 48.01  ? 351 PHE B N     1 
ATOM   6739 C CA    . PHE B 1 357 ? -18.431 9.165   -85.624  1.00 47.89  ? 351 PHE B CA    1 
ATOM   6740 C C     . PHE B 1 357 ? -17.660 10.412  -86.063  1.00 57.05  ? 351 PHE B C     1 
ATOM   6741 O O     . PHE B 1 357 ? -16.585 10.296  -86.664  1.00 58.65  ? 351 PHE B O     1 
ATOM   6742 C CB    . PHE B 1 357 ? -19.612 8.860   -86.569  1.00 48.53  ? 351 PHE B CB    1 
ATOM   6743 C CG    . PHE B 1 357 ? -19.301 9.005   -88.037  1.00 48.91  ? 351 PHE B CG    1 
ATOM   6744 C CD1   . PHE B 1 357 ? -18.878 7.919   -88.785  1.00 50.83  ? 351 PHE B CD1   1 
ATOM   6745 C CD2   . PHE B 1 357 ? -19.444 10.230  -88.675  1.00 49.98  ? 351 PHE B CD2   1 
ATOM   6746 C CE1   . PHE B 1 357 ? -18.607 8.056   -90.145  1.00 51.74  ? 351 PHE B CE1   1 
ATOM   6747 C CE2   . PHE B 1 357 ? -19.154 10.365  -90.034  1.00 52.76  ? 351 PHE B CE2   1 
ATOM   6748 C CZ    . PHE B 1 357 ? -18.744 9.278   -90.759  1.00 50.69  ? 351 PHE B CZ    1 
ATOM   6749 N N     . ASN B 1 358 ? -18.214 11.593  -85.769  1.00 55.09  ? 352 ASN B N     1 
ATOM   6750 C CA    . ASN B 1 358 ? -17.627 12.867  -86.179  1.00 55.62  ? 352 ASN B CA    1 
ATOM   6751 C C     . ASN B 1 358 ? -16.220 13.117  -85.665  1.00 57.48  ? 352 ASN B C     1 
ATOM   6752 O O     . ASN B 1 358 ? -15.353 13.541  -86.427  1.00 56.64  ? 352 ASN B O     1 
ATOM   6753 C CB    . ASN B 1 358 ? -18.594 14.032  -85.924  1.00 60.47  ? 352 ASN B CB    1 
ATOM   6754 C CG    . ASN B 1 358 ? -19.908 13.852  -86.671  1.00 93.56  ? 352 ASN B CG    1 
ATOM   6755 O OD1   . ASN B 1 358 ? -19.960 13.921  -87.910  1.00 86.68  ? 352 ASN B OD1   1 
ATOM   6756 N ND2   . ASN B 1 358 ? -20.978 13.507  -85.938  1.00 87.62  ? 352 ASN B ND2   1 
ATOM   6757 N N     . GLY B 1 359 ? -15.992 12.780  -84.409  1.00 53.77  ? 353 GLY B N     1 
ATOM   6758 C CA    . GLY B 1 359 ? -14.679 12.935  -83.792  1.00 53.59  ? 353 GLY B CA    1 
ATOM   6759 C C     . GLY B 1 359 ? -13.623 12.005  -84.353  1.00 57.71  ? 353 GLY B C     1 
ATOM   6760 O O     . GLY B 1 359 ? -12.489 12.421  -84.632  1.00 58.65  ? 353 GLY B O     1 
ATOM   6761 N N     . ASP B 1 360 ? -14.017 10.727  -84.522  1.00 53.39  ? 354 ASP B N     1 
ATOM   6762 C CA    . ASP B 1 360 ? -13.186 9.638   -85.055  1.00 52.17  ? 354 ASP B CA    1 
ATOM   6763 C C     . ASP B 1 360 ? -12.701 9.988   -86.450  1.00 55.01  ? 354 ASP B C     1 
ATOM   6764 O O     . ASP B 1 360 ? -11.493 9.916   -86.731  1.00 55.97  ? 354 ASP B O     1 
ATOM   6765 C CB    . ASP B 1 360 ? -13.986 8.344   -85.094  1.00 52.26  ? 354 ASP B CB    1 
ATOM   6766 N N     . GLN B 1 361 ? -13.648 10.421  -87.306  1.00 48.03  ? 355 GLN B N     1 
ATOM   6767 C CA    . GLN B 1 361 ? -13.352 10.781  -88.680  1.00 46.99  ? 355 GLN B CA    1 
ATOM   6768 C C     . GLN B 1 361 ? -12.411 11.964  -88.749  1.00 49.78  ? 355 GLN B C     1 
ATOM   6769 O O     . GLN B 1 361 ? -11.454 11.928  -89.532  1.00 48.08  ? 355 GLN B O     1 
ATOM   6770 C CB    . GLN B 1 361 ? -14.645 11.025  -89.466  1.00 47.94  ? 355 GLN B CB    1 
ATOM   6771 C CG    . GLN B 1 361 ? -15.500 9.776   -89.650  1.00 45.05  ? 355 GLN B CG    1 
ATOM   6772 C CD    . GLN B 1 361 ? -14.827 8.684   -90.447  1.00 64.97  ? 355 GLN B CD    1 
ATOM   6773 O OE1   . GLN B 1 361 ? -14.324 7.697   -89.888  1.00 60.98  ? 355 GLN B OE1   1 
ATOM   6774 N NE2   . GLN B 1 361 ? -14.798 8.834   -91.769  1.00 55.06  ? 355 GLN B NE2   1 
ATOM   6775 N N     . ALA B 1 362 ? -12.654 12.980  -87.870  1.00 46.45  ? 356 ALA B N     1 
ATOM   6776 C CA    . ALA B 1 362 ? -11.876 14.220  -87.765  1.00 45.33  ? 356 ALA B CA    1 
ATOM   6777 C C     . ALA B 1 362 ? -10.393 13.914  -87.512  1.00 49.25  ? 356 ALA B C     1 
ATOM   6778 O O     . ALA B 1 362 ? -9.552  14.333  -88.326  1.00 49.89  ? 356 ALA B O     1 
ATOM   6779 C CB    . ALA B 1 362 ? -12.448 15.095  -86.667  1.00 44.87  ? 356 ALA B CB    1 
ATOM   6780 N N     . ARG B 1 363 ? -10.093 13.113  -86.438  1.00 43.43  ? 357 ARG B N     1 
ATOM   6781 C CA    . ARG B 1 363 ? -8.743  12.674  -86.095  1.00 43.04  ? 357 ARG B CA    1 
ATOM   6782 C C     . ARG B 1 363 ? -8.133  11.830  -87.229  1.00 48.39  ? 357 ARG B C     1 
ATOM   6783 O O     . ARG B 1 363 ? -6.982  12.062  -87.620  1.00 49.78  ? 357 ARG B O     1 
ATOM   6784 C CB    . ARG B 1 363 ? -8.749  11.883  -84.782  1.00 43.75  ? 357 ARG B CB    1 
ATOM   6785 C CG    . ARG B 1 363 ? -7.434  11.108  -84.475  1.00 56.52  ? 357 ARG B CG    1 
ATOM   6786 C CD    . ARG B 1 363 ? -7.412  10.404  -83.122  1.00 66.99  ? 357 ARG B CD    1 
ATOM   6787 N NE    . ARG B 1 363 ? -8.427  9.350   -83.015  1.00 83.08  ? 357 ARG B NE    1 
ATOM   6788 C CZ    . ARG B 1 363 ? -9.612  9.487   -82.410  1.00 98.71  ? 357 ARG B CZ    1 
ATOM   6789 N NH1   . ARG B 1 363 ? -9.956  10.647  -81.853  1.00 68.76  ? 357 ARG B NH1   1 
ATOM   6790 N NH2   . ARG B 1 363 ? -10.462 8.469   -82.365  1.00 96.64  ? 357 ARG B NH2   1 
ATOM   6791 N N     . LYS B 1 364 ? -8.893  10.850  -87.750  1.00 43.94  ? 358 LYS B N     1 
ATOM   6792 C CA    . LYS B 1 364 ? -8.374  10.011  -88.830  1.00 43.83  ? 358 LYS B CA    1 
ATOM   6793 C C     . LYS B 1 364 ? -8.142  10.751  -90.132  1.00 47.23  ? 358 LYS B C     1 
ATOM   6794 O O     . LYS B 1 364 ? -7.210  10.394  -90.853  1.00 48.51  ? 358 LYS B O     1 
ATOM   6795 C CB    . LYS B 1 364 ? -9.167  8.707   -89.023  1.00 45.67  ? 358 LYS B CB    1 
ATOM   6796 C CG    . LYS B 1 364 ? -8.323  7.499   -88.610  1.00 54.52  ? 358 LYS B CG    1 
ATOM   6797 C CD    . LYS B 1 364 ? -9.031  6.165   -88.600  1.00 63.76  ? 358 LYS B CD    1 
ATOM   6798 C CE    . LYS B 1 364 ? -10.009 5.986   -87.453  1.00 68.25  ? 358 LYS B CE    1 
ATOM   6799 N NZ    . LYS B 1 364 ? -11.399 6.404   -87.831  1.00 70.78  ? 358 LYS B NZ    1 
ATOM   6800 N N     . GLN B 1 365 ? -8.945  11.797  -90.419  1.00 41.70  ? 359 GLN B N     1 
ATOM   6801 C CA    . GLN B 1 365 ? -8.752  12.582  -91.638  1.00 41.88  ? 359 GLN B CA    1 
ATOM   6802 C C     . GLN B 1 365 ? -7.428  13.336  -91.625  1.00 42.27  ? 359 GLN B C     1 
ATOM   6803 O O     . GLN B 1 365 ? -6.708  13.267  -92.619  1.00 43.18  ? 359 GLN B O     1 
ATOM   6804 C CB    . GLN B 1 365 ? -9.937  13.504  -91.962  1.00 43.61  ? 359 GLN B CB    1 
ATOM   6805 C CG    . GLN B 1 365 ? -10.676 13.115  -93.253  1.00 49.74  ? 359 GLN B CG    1 
ATOM   6806 C CD    . GLN B 1 365 ? -9.793  13.130  -94.476  1.00 60.43  ? 359 GLN B CD    1 
ATOM   6807 O OE1   . GLN B 1 365 ? -9.087  14.106  -94.745  1.00 56.05  ? 359 GLN B OE1   1 
ATOM   6808 N NE2   . GLN B 1 365 ? -9.816  12.045  -95.244  1.00 48.88  ? 359 GLN B NE2   1 
ATOM   6809 N N     . VAL B 1 366 ? -7.064  13.973  -90.486  1.00 34.78  ? 360 VAL B N     1 
ATOM   6810 C CA    . VAL B 1 366 ? -5.766  14.647  -90.390  1.00 33.65  ? 360 VAL B CA    1 
ATOM   6811 C C     . VAL B 1 366 ? -4.605  13.680  -90.636  1.00 41.85  ? 360 VAL B C     1 
ATOM   6812 O O     . VAL B 1 366 ? -3.732  13.999  -91.450  1.00 42.13  ? 360 VAL B O     1 
ATOM   6813 C CB    . VAL B 1 366 ? -5.569  15.649  -89.219  1.00 33.72  ? 360 VAL B CB    1 
ATOM   6814 C CG1   . VAL B 1 366 ? -6.636  15.504  -88.149  1.00 31.36  ? 360 VAL B CG1   1 
ATOM   6815 C CG2   . VAL B 1 366 ? -4.155  15.616  -88.638  1.00 33.07  ? 360 VAL B CG2   1 
ATOM   6816 N N     . LEU B 1 367 ? -4.662  12.456  -90.036  1.00 40.85  ? 361 LEU B N     1 
ATOM   6817 C CA    . LEU B 1 367 ? -3.643  11.406  -90.241  1.00 42.43  ? 361 LEU B CA    1 
ATOM   6818 C C     . LEU B 1 367 ? -3.538  11.021  -91.731  1.00 51.25  ? 361 LEU B C     1 
ATOM   6819 O O     . LEU B 1 367 ? -2.420  10.888  -92.253  1.00 53.08  ? 361 LEU B O     1 
ATOM   6820 C CB    . LEU B 1 367 ? -3.911  10.155  -89.392  1.00 41.14  ? 361 LEU B CB    1 
ATOM   6821 C CG    . LEU B 1 367 ? -3.692  10.282  -87.900  1.00 44.88  ? 361 LEU B CG    1 
ATOM   6822 C CD1   . LEU B 1 367 ? -4.529  9.266   -87.148  1.00 44.62  ? 361 LEU B CD1   1 
ATOM   6823 C CD2   . LEU B 1 367 ? -2.238  10.133  -87.541  1.00 47.07  ? 361 LEU B CD2   1 
ATOM   6824 N N     . VAL B 1 368 ? -4.698  10.902  -92.415  1.00 48.29  ? 362 VAL B N     1 
ATOM   6825 C CA    . VAL B 1 368 ? -4.749  10.605  -93.845  1.00 50.00  ? 362 VAL B CA    1 
ATOM   6826 C C     . VAL B 1 368 ? -4.070  11.740  -94.647  1.00 55.44  ? 362 VAL B C     1 
ATOM   6827 O O     . VAL B 1 368 ? -3.145  11.470  -95.427  1.00 56.76  ? 362 VAL B O     1 
ATOM   6828 C CB    . VAL B 1 368 ? -6.183  10.269  -94.362  1.00 53.56  ? 362 VAL B CB    1 
ATOM   6829 C CG1   . VAL B 1 368 ? -6.196  10.090  -95.884  1.00 54.81  ? 362 VAL B CG1   1 
ATOM   6830 C CG2   . VAL B 1 368 ? -6.727  9.019   -93.682  1.00 52.10  ? 362 VAL B CG2   1 
ATOM   6831 N N     . ASP B 1 369 ? -4.499  12.999  -94.400  1.00 51.76  ? 363 ASP B N     1 
ATOM   6832 C CA    . ASP B 1 369 ? -4.015  14.214  -95.056  1.00 53.80  ? 363 ASP B CA    1 
ATOM   6833 C C     . ASP B 1 369 ? -2.505  14.338  -95.046  1.00 61.17  ? 363 ASP B C     1 
ATOM   6834 O O     . ASP B 1 369 ? -1.929  14.792  -96.041  1.00 64.26  ? 363 ASP B O     1 
ATOM   6835 C CB    . ASP B 1 369 ? -4.614  15.472  -94.404  1.00 55.46  ? 363 ASP B CB    1 
ATOM   6836 C CG    . ASP B 1 369 ? -6.115  15.669  -94.560  1.00 70.09  ? 363 ASP B CG    1 
ATOM   6837 O OD1   . ASP B 1 369 ? -6.640  15.423  -95.679  1.00 70.73  ? 363 ASP B OD1   1 
ATOM   6838 O OD2   . ASP B 1 369 ? -6.758  16.138  -93.582  1.00 78.74  ? 363 ASP B OD2   1 
ATOM   6839 N N     . HIS B 1 370 ? -1.867  13.930  -93.930  1.00 55.81  ? 364 HIS B N     1 
ATOM   6840 C CA    . HIS B 1 370 ? -0.417  14.025  -93.745  1.00 55.29  ? 364 HIS B CA    1 
ATOM   6841 C C     . HIS B 1 370 ? 0.389   12.749  -94.057  1.00 55.32  ? 364 HIS B C     1 
ATOM   6842 O O     . HIS B 1 370 ? 1.592   12.700  -93.802  1.00 55.67  ? 364 HIS B O     1 
ATOM   6843 C CB    . HIS B 1 370 ? -0.094  14.629  -92.373  1.00 55.63  ? 364 HIS B CB    1 
ATOM   6844 C CG    . HIS B 1 370 ? -0.658  16.002  -92.196  1.00 59.04  ? 364 HIS B CG    1 
ATOM   6845 N ND1   . HIS B 1 370 ? 0.116   17.123  -92.401  1.00 61.83  ? 364 HIS B ND1   1 
ATOM   6846 C CD2   . HIS B 1 370 ? -1.914  16.387  -91.854  1.00 59.77  ? 364 HIS B CD2   1 
ATOM   6847 C CE1   . HIS B 1 370 ? -0.684  18.152  -92.173  1.00 60.92  ? 364 HIS B CE1   1 
ATOM   6848 N NE2   . HIS B 1 370 ? -1.918  17.757  -91.849  1.00 59.91  ? 364 HIS B NE2   1 
ATOM   6849 N N     . GLY B 1 371 ? -0.263  11.763  -94.659  1.00 48.71  ? 365 GLY B N     1 
ATOM   6850 C CA    . GLY B 1 371 ? 0.381   10.526  -95.072  1.00 48.04  ? 365 GLY B CA    1 
ATOM   6851 C C     . GLY B 1 371 ? 0.745   9.561   -93.965  1.00 49.77  ? 365 GLY B C     1 
ATOM   6852 O O     . GLY B 1 371 ? 1.650   8.734   -94.139  1.00 49.11  ? 365 GLY B O     1 
ATOM   6853 N N     . PHE B 1 372 ? 0.046   9.641   -92.818  1.00 44.88  ? 366 PHE B N     1 
ATOM   6854 C CA    . PHE B 1 372 ? 0.297   8.696   -91.735  1.00 43.91  ? 366 PHE B CA    1 
ATOM   6855 C C     . PHE B 1 372 ? -0.466  7.426   -91.995  1.00 49.22  ? 366 PHE B C     1 
ATOM   6856 O O     . PHE B 1 372 ? 0.050   6.354   -91.700  1.00 50.76  ? 366 PHE B O     1 
ATOM   6857 C CB    . PHE B 1 372 ? -0.031  9.269   -90.357  1.00 44.54  ? 366 PHE B CB    1 
ATOM   6858 C CG    . PHE B 1 372 ? 1.038   10.201  -89.838  1.00 47.22  ? 366 PHE B CG    1 
ATOM   6859 C CD1   . PHE B 1 372 ? 0.975   11.567  -90.089  1.00 51.86  ? 366 PHE B CD1   1 
ATOM   6860 C CD2   . PHE B 1 372 ? 2.127   9.712   -89.126  1.00 48.59  ? 366 PHE B CD2   1 
ATOM   6861 C CE1   . PHE B 1 372 ? 1.982   12.422  -89.629  1.00 52.96  ? 366 PHE B CE1   1 
ATOM   6862 C CE2   . PHE B 1 372 ? 3.142   10.566  -88.688  1.00 51.48  ? 366 PHE B CE2   1 
ATOM   6863 C CZ    . PHE B 1 372 ? 3.047   11.913  -88.915  1.00 50.64  ? 366 PHE B CZ    1 
ATOM   6864 N N     . ARG B 1 373 ? -1.682  7.529   -92.576  1.00 44.84  ? 367 ARG B N     1 
ATOM   6865 C CA    . ARG B 1 373 ? -2.533  6.373   -92.887  1.00 43.91  ? 367 ARG B CA    1 
ATOM   6866 C C     . ARG B 1 373 ? -3.168  6.505   -94.258  1.00 47.87  ? 367 ARG B C     1 
ATOM   6867 O O     . ARG B 1 373 ? -3.287  7.612   -94.771  1.00 49.36  ? 367 ARG B O     1 
ATOM   6868 C CB    . ARG B 1 373 ? -3.636  6.176   -91.819  1.00 41.51  ? 367 ARG B CB    1 
ATOM   6869 C CG    . ARG B 1 373 ? -3.144  5.759   -90.424  1.00 40.84  ? 367 ARG B CG    1 
ATOM   6870 C CD    . ARG B 1 373 ? -2.683  4.317   -90.342  1.00 43.59  ? 367 ARG B CD    1 
ATOM   6871 N NE    . ARG B 1 373 ? -1.968  4.071   -89.092  1.00 57.42  ? 367 ARG B NE    1 
ATOM   6872 C CZ    . ARG B 1 373 ? -1.337  2.939   -88.788  1.00 78.67  ? 367 ARG B CZ    1 
ATOM   6873 N NH1   . ARG B 1 373 ? -1.340  1.919   -89.642  1.00 62.84  ? 367 ARG B NH1   1 
ATOM   6874 N NH2   . ARG B 1 373 ? -0.705  2.815   -87.628  1.00 72.57  ? 367 ARG B NH2   1 
ATOM   6875 N N     . LEU B 1 374 ? -3.580  5.380   -94.850  1.00 42.98  ? 368 LEU B N     1 
ATOM   6876 C CA    . LEU B 1 374 ? -4.240  5.352   -96.155  1.00 43.06  ? 368 LEU B CA    1 
ATOM   6877 C C     . LEU B 1 374 ? -5.701  5.772   -95.977  1.00 49.66  ? 368 LEU B C     1 
ATOM   6878 O O     . LEU B 1 374 ? -6.217  5.624   -94.865  1.00 49.13  ? 368 LEU B O     1 
ATOM   6879 C CB    . LEU B 1 374 ? -4.204  3.923   -96.701  1.00 42.58  ? 368 LEU B CB    1 
ATOM   6880 C CG    . LEU B 1 374 ? -2.946  3.492   -97.387  1.00 46.28  ? 368 LEU B CG    1 
ATOM   6881 C CD1   . LEU B 1 374 ? -2.751  2.014   -97.231  1.00 45.06  ? 368 LEU B CD1   1 
ATOM   6882 C CD2   . LEU B 1 374 ? -2.955  3.916   -98.841  1.00 50.11  ? 368 LEU B CD2   1 
ATOM   6883 N N     . PRO B 1 375 ? -6.433  6.206   -97.033  1.00 48.20  ? 369 PRO B N     1 
ATOM   6884 C CA    . PRO B 1 375 ? -7.845  6.587   -96.828  1.00 48.43  ? 369 PRO B CA    1 
ATOM   6885 C C     . PRO B 1 375 ? -8.773  5.472   -96.322  1.00 55.18  ? 369 PRO B C     1 
ATOM   6886 O O     . PRO B 1 375 ? -9.827  5.788   -95.775  1.00 55.87  ? 369 PRO B O     1 
ATOM   6887 C CB    . PRO B 1 375 ? -8.269  7.135   -98.188  1.00 51.14  ? 369 PRO B CB    1 
ATOM   6888 C CG    . PRO B 1 375 ? -6.997  7.489   -98.860  1.00 56.05  ? 369 PRO B CG    1 
ATOM   6889 C CD    . PRO B 1 375 ? -6.022  6.454   -98.426  1.00 51.02  ? 369 PRO B CD    1 
ATOM   6890 N N     . SER B 1 376 ? -8.363  4.188   -96.445  1.00 51.71  ? 370 SER B N     1 
ATOM   6891 C CA    . SER B 1 376 ? -9.149  3.044   -95.968  1.00 50.95  ? 370 SER B CA    1 
ATOM   6892 C C     . SER B 1 376 ? -9.178  2.946   -94.438  1.00 54.29  ? 370 SER B C     1 
ATOM   6893 O O     . SER B 1 376 ? -9.922  2.116   -93.887  1.00 53.84  ? 370 SER B O     1 
ATOM   6894 C CB    . SER B 1 376 ? -8.643  1.738   -96.584  1.00 54.60  ? 370 SER B CB    1 
ATOM   6895 O OG    . SER B 1 376 ? -7.270  1.520   -96.310  1.00 61.04  ? 370 SER B OG    1 
ATOM   6896 N N     . ALA B 1 377 ? -8.364  3.779   -93.752  1.00 51.12  ? 371 ALA B N     1 
ATOM   6897 C CA    . ALA B 1 377 ? -8.288  3.801   -92.282  1.00 50.75  ? 371 ALA B CA    1 
ATOM   6898 C C     . ALA B 1 377 ? -9.593  4.338   -91.704  1.00 54.94  ? 371 ALA B C     1 
ATOM   6899 O O     . ALA B 1 377 ? -10.029 3.881   -90.643  1.00 54.04  ? 371 ALA B O     1 
ATOM   6900 C CB    . ALA B 1 377 ? -7.120  4.654   -91.812  1.00 51.30  ? 371 ALA B CB    1 
ATOM   6901 N N     . LEU B 1 378 ? -10.246 5.259   -92.454  1.00 51.30  ? 372 LEU B N     1 
ATOM   6902 C CA    . LEU B 1 378 ? -11.511 5.881   -92.090  1.00 50.40  ? 372 LEU B CA    1 
ATOM   6903 C C     . LEU B 1 378 ? -12.634 4.858   -92.068  1.00 58.59  ? 372 LEU B C     1 
ATOM   6904 O O     . LEU B 1 378 ? -13.618 5.080   -91.362  1.00 59.17  ? 372 LEU B O     1 
ATOM   6905 C CB    . LEU B 1 378 ? -11.849 7.048   -93.027  1.00 50.41  ? 372 LEU B CB    1 
ATOM   6906 C CG    . LEU B 1 378 ? -10.892 8.221   -93.009  1.00 54.37  ? 372 LEU B CG    1 
ATOM   6907 C CD1   . LEU B 1 378 ? -10.654 8.745   -94.392  1.00 55.78  ? 372 LEU B CD1   1 
ATOM   6908 C CD2   . LEU B 1 378 ? -11.382 9.320   -92.109  1.00 55.12  ? 372 LEU B CD2   1 
ATOM   6909 N N     . ASP B 1 379 ? -12.481 3.723   -92.803  1.00 57.49  ? 373 ASP B N     1 
ATOM   6910 C CA    . ASP B 1 379 ? -13.466 2.632   -92.858  1.00 58.28  ? 373 ASP B CA    1 
ATOM   6911 C C     . ASP B 1 379 ? -13.549 1.831   -91.561  1.00 59.76  ? 373 ASP B C     1 
ATOM   6912 O O     . ASP B 1 379 ? -14.544 1.156   -91.327  1.00 58.03  ? 373 ASP B O     1 
ATOM   6913 C CB    . ASP B 1 379 ? -13.272 1.732   -94.096  1.00 62.54  ? 373 ASP B CB    1 
ATOM   6914 C CG    . ASP B 1 379 ? -13.911 2.249   -95.392  1.00 81.99  ? 373 ASP B CG    1 
ATOM   6915 O OD1   . ASP B 1 379 ? -14.866 3.071   -95.307  1.00 83.81  ? 373 ASP B OD1   1 
ATOM   6916 O OD2   . ASP B 1 379 ? -13.489 1.795   -96.489  1.00 88.60  ? 373 ASP B OD2   1 
ATOM   6917 N N     . ASN B 1 380 ? -12.509 1.934   -90.717  1.00 56.16  ? 374 ASN B N     1 
ATOM   6918 C CA    . ASN B 1 380 ? -12.409 1.344   -89.379  1.00 55.17  ? 374 ASN B CA    1 
ATOM   6919 C C     . ASN B 1 380 ? -12.855 2.493   -88.492  1.00 57.58  ? 374 ASN B C     1 
ATOM   6920 O O     . ASN B 1 380 ? -12.090 3.435   -88.289  1.00 57.04  ? 374 ASN B O     1 
ATOM   6921 C CB    . ASN B 1 380 ? -10.957 0.944   -89.106  1.00 57.10  ? 374 ASN B CB    1 
ATOM   6922 C CG    . ASN B 1 380 ? -10.666 0.497   -87.709  1.00 86.93  ? 374 ASN B CG    1 
ATOM   6923 O OD1   . ASN B 1 380 ? -9.879  1.124   -86.998  1.00 83.26  ? 374 ASN B OD1   1 
ATOM   6924 N ND2   . ASN B 1 380 ? -11.222 -0.640  -87.317  1.00 82.45  ? 374 ASN B ND2   1 
ATOM   6925 N N     . ARG B 1 381 ? -14.137 2.474   -88.063  1.00 53.01  ? 375 ARG B N     1 
ATOM   6926 C CA    . ARG B 1 381 ? -14.792 3.586   -87.361  1.00 51.06  ? 375 ARG B CA    1 
ATOM   6927 C C     . ARG B 1 381 ? -16.018 3.175   -86.559  1.00 54.61  ? 375 ARG B C     1 
ATOM   6928 O O     . ARG B 1 381 ? -16.582 2.115   -86.874  1.00 55.13  ? 375 ARG B O     1 
ATOM   6929 C CB    . ARG B 1 381 ? -15.310 4.569   -88.441  1.00 48.43  ? 375 ARG B CB    1 
ATOM   6930 C CG    . ARG B 1 381 ? -16.208 3.923   -89.502  1.00 42.32  ? 375 ARG B CG    1 
ATOM   6931 C CD    . ARG B 1 381 ? -17.001 4.933   -90.282  1.00 40.79  ? 375 ARG B CD    1 
ATOM   6932 N NE    . ARG B 1 381 ? -17.872 4.291   -91.271  1.00 58.17  ? 375 ARG B NE    1 
ATOM   6933 C CZ    . ARG B 1 381 ? -19.140 3.953   -91.060  1.00 73.47  ? 375 ARG B CZ    1 
ATOM   6934 N NH1   . ARG B 1 381 ? -19.710 4.184   -89.882  1.00 69.65  ? 375 ARG B NH1   1 
ATOM   6935 N NH2   . ARG B 1 381 ? -19.845 3.376   -92.021  1.00 55.26  ? 375 ARG B NH2   1 
ATOM   6936 N N     . PRO B 1 382 ? -16.568 4.035   -85.638  1.00 48.88  ? 376 PRO B N     1 
ATOM   6937 C CA    . PRO B 1 382 ? -17.852 3.687   -85.015  1.00 47.73  ? 376 PRO B CA    1 
ATOM   6938 C C     . PRO B 1 382 ? -18.985 3.951   -86.032  1.00 52.22  ? 376 PRO B C     1 
ATOM   6939 O O     . PRO B 1 382 ? -18.754 4.426   -87.152  1.00 51.29  ? 376 PRO B O     1 
ATOM   6940 C CB    . PRO B 1 382 ? -17.919 4.621   -83.804  1.00 47.92  ? 376 PRO B CB    1 
ATOM   6941 C CG    . PRO B 1 382 ? -17.211 5.818   -84.230  1.00 51.83  ? 376 PRO B CG    1 
ATOM   6942 C CD    . PRO B 1 382 ? -16.110 5.359   -85.171  1.00 48.61  ? 376 PRO B CD    1 
ATOM   6943 N N     . LEU B 1 383 ? -20.206 3.635   -85.640  1.00 49.38  ? 377 LEU B N     1 
ATOM   6944 C CA    . LEU B 1 383 ? -21.374 3.816   -86.475  1.00 49.52  ? 377 LEU B CA    1 
ATOM   6945 C C     . LEU B 1 383 ? -21.754 5.269   -86.636  1.00 54.23  ? 377 LEU B C     1 
ATOM   6946 O O     . LEU B 1 383 ? -21.576 6.080   -85.720  1.00 53.77  ? 377 LEU B O     1 
ATOM   6947 C CB    . LEU B 1 383 ? -22.570 3.099   -85.825  1.00 49.51  ? 377 LEU B CB    1 
ATOM   6948 C CG    . LEU B 1 383 ? -22.715 1.604   -85.988  1.00 54.40  ? 377 LEU B CG    1 
ATOM   6949 C CD1   . LEU B 1 383 ? -24.115 1.192   -85.635  1.00 55.53  ? 377 LEU B CD1   1 
ATOM   6950 C CD2   . LEU B 1 383 ? -22.412 1.147   -87.405  1.00 56.01  ? 377 LEU B CD2   1 
ATOM   6951 N N     . ARG B 1 384 ? -22.373 5.575   -87.781  1.00 51.93  ? 378 ARG B N     1 
ATOM   6952 C CA    . ARG B 1 384 ? -23.000 6.863   -88.040  1.00 51.66  ? 378 ARG B CA    1 
ATOM   6953 C C     . ARG B 1 384 ? -24.320 6.795   -87.237  1.00 54.77  ? 378 ARG B C     1 
ATOM   6954 O O     . ARG B 1 384 ? -24.849 5.697   -87.020  1.00 53.39  ? 378 ARG B O     1 
ATOM   6955 C CB    . ARG B 1 384 ? -23.327 7.006   -89.536  1.00 52.16  ? 378 ARG B CB    1 
ATOM   6956 C CG    . ARG B 1 384 ? -22.321 7.827   -90.305  1.00 59.57  ? 378 ARG B CG    1 
ATOM   6957 C CD    . ARG B 1 384 ? -22.763 8.076   -91.733  1.00 72.03  ? 378 ARG B CD    1 
ATOM   6958 N NE    . ARG B 1 384 ? -21.747 8.832   -92.472  1.00 84.26  ? 378 ARG B NE    1 
ATOM   6959 C CZ    . ARG B 1 384 ? -20.834 8.295   -93.279  1.00 93.55  ? 378 ARG B CZ    1 
ATOM   6960 N NH1   . ARG B 1 384 ? -20.812 6.983   -93.492  1.00 82.34  ? 378 ARG B NH1   1 
ATOM   6961 N NH2   . ARG B 1 384 ? -19.937 9.065   -93.882  1.00 69.86  ? 378 ARG B NH2   1 
ATOM   6962 N N     . PHE B 1 385 ? -24.848 7.939   -86.784  1.00 52.00  ? 379 PHE B N     1 
ATOM   6963 C CA    . PHE B 1 385 ? -26.119 7.916   -86.057  1.00 52.01  ? 379 PHE B CA    1 
ATOM   6964 C C     . PHE B 1 385 ? -27.214 7.379   -86.952  1.00 56.32  ? 379 PHE B C     1 
ATOM   6965 O O     . PHE B 1 385 ? -28.007 6.568   -86.477  1.00 57.56  ? 379 PHE B O     1 
ATOM   6966 C CB    . PHE B 1 385 ? -26.488 9.278   -85.469  1.00 53.87  ? 379 PHE B CB    1 
ATOM   6967 C CG    . PHE B 1 385 ? -27.630 9.192   -84.484  1.00 55.95  ? 379 PHE B CG    1 
ATOM   6968 C CD1   . PHE B 1 385 ? -27.420 8.729   -83.191  1.00 59.37  ? 379 PHE B CD1   1 
ATOM   6969 C CD2   . PHE B 1 385 ? -28.920 9.572   -84.851  1.00 58.82  ? 379 PHE B CD2   1 
ATOM   6970 C CE1   . PHE B 1 385 ? -28.486 8.625   -82.291  1.00 60.71  ? 379 PHE B CE1   1 
ATOM   6971 C CE2   . PHE B 1 385 ? -29.977 9.496   -83.942  1.00 62.12  ? 379 PHE B CE2   1 
ATOM   6972 C CZ    . PHE B 1 385 ? -29.756 9.016   -82.673  1.00 60.26  ? 379 PHE B CZ    1 
ATOM   6973 N N     . GLU B 1 386 ? -27.192 7.742   -88.264  1.00 52.21  ? 380 GLU B N     1 
ATOM   6974 C CA    . GLU B 1 386 ? -28.108 7.229   -89.295  1.00 53.16  ? 380 GLU B CA    1 
ATOM   6975 C C     . GLU B 1 386 ? -28.073 5.674   -89.320  1.00 56.76  ? 380 GLU B C     1 
ATOM   6976 O O     . GLU B 1 386 ? -29.124 5.043   -89.400  1.00 56.46  ? 380 GLU B O     1 
ATOM   6977 C CB    . GLU B 1 386 ? -27.710 7.780   -90.660  1.00 54.65  ? 380 GLU B CB    1 
ATOM   6978 N N     . GLU B 1 387 ? -26.855 5.079   -89.198  1.00 52.89  ? 381 GLU B N     1 
ATOM   6979 C CA    . GLU B 1 387 ? -26.587 3.638   -89.183  1.00 52.97  ? 381 GLU B CA    1 
ATOM   6980 C C     . GLU B 1 387 ? -27.177 2.983   -87.947  1.00 59.38  ? 381 GLU B C     1 
ATOM   6981 O O     . GLU B 1 387 ? -27.751 1.893   -88.032  1.00 60.62  ? 381 GLU B O     1 
ATOM   6982 C CB    . GLU B 1 387 ? -25.075 3.383   -89.232  1.00 53.49  ? 381 GLU B CB    1 
ATOM   6983 C CG    . GLU B 1 387 ? -24.516 3.333   -90.641  1.00 65.84  ? 381 GLU B CG    1 
ATOM   6984 C CD    . GLU B 1 387 ? -23.047 3.668   -90.785  1.00 80.11  ? 381 GLU B CD    1 
ATOM   6985 O OE1   . GLU B 1 387 ? -22.226 3.102   -90.028  1.00 82.64  ? 381 GLU B OE1   1 
ATOM   6986 O OE2   . GLU B 1 387 ? -22.713 4.482   -91.674  1.00 65.62  ? 381 GLU B OE2   1 
ATOM   6987 N N     . PHE B 1 388 ? -27.015 3.647   -86.793  1.00 56.32  ? 382 PHE B N     1 
ATOM   6988 C CA    . PHE B 1 388 ? -27.519 3.208   -85.497  1.00 55.47  ? 382 PHE B CA    1 
ATOM   6989 C C     . PHE B 1 388 ? -29.049 3.252   -85.489  1.00 58.04  ? 382 PHE B C     1 
ATOM   6990 O O     . PHE B 1 388 ? -29.680 2.378   -84.907  1.00 57.85  ? 382 PHE B O     1 
ATOM   6991 C CB    . PHE B 1 388 ? -26.923 4.097   -84.399  1.00 56.33  ? 382 PHE B CB    1 
ATOM   6992 C CG    . PHE B 1 388 ? -27.585 3.987   -83.054  1.00 58.46  ? 382 PHE B CG    1 
ATOM   6993 C CD1   . PHE B 1 388 ? -27.347 2.892   -82.232  1.00 61.26  ? 382 PHE B CD1   1 
ATOM   6994 C CD2   . PHE B 1 388 ? -28.429 4.995   -82.593  1.00 62.25  ? 382 PHE B CD2   1 
ATOM   6995 C CE1   . PHE B 1 388 ? -27.948 2.796   -80.979  1.00 62.66  ? 382 PHE B CE1   1 
ATOM   6996 C CE2   . PHE B 1 388 ? -29.030 4.903   -81.333  1.00 65.31  ? 382 PHE B CE2   1 
ATOM   6997 C CZ    . PHE B 1 388 ? -28.791 3.798   -80.539  1.00 63.28  ? 382 PHE B CZ    1 
ATOM   6998 N N     . GLU B 1 389 ? -29.633 4.264   -86.148  1.00 54.15  ? 383 GLU B N     1 
ATOM   6999 C CA    . GLU B 1 389 ? -31.078 4.448   -86.262  1.00 54.98  ? 383 GLU B CA    1 
ATOM   7000 C C     . GLU B 1 389 ? -31.716 3.277   -87.030  1.00 59.90  ? 383 GLU B C     1 
ATOM   7001 O O     . GLU B 1 389 ? -32.824 2.847   -86.693  1.00 58.51  ? 383 GLU B O     1 
ATOM   7002 C CB    . GLU B 1 389 ? -31.395 5.784   -86.969  1.00 56.59  ? 383 GLU B CB    1 
ATOM   7003 C CG    . GLU B 1 389 ? -31.304 7.017   -86.085  1.00 66.03  ? 383 GLU B CG    1 
ATOM   7004 C CD    . GLU B 1 389 ? -31.791 8.316   -86.712  1.00 92.19  ? 383 GLU B CD    1 
ATOM   7005 O OE1   . GLU B 1 389 ? -32.829 8.847   -86.250  1.00 91.04  ? 383 GLU B OE1   1 
ATOM   7006 O OE2   . GLU B 1 389 ? -31.124 8.815   -87.651  1.00 85.75  ? 383 GLU B OE2   1 
ATOM   7007 N N     . LYS B 1 390 ? -30.996 2.755   -88.050  1.00 58.88  ? 384 LYS B N     1 
ATOM   7008 C CA    . LYS B 1 390 ? -31.447 1.657   -88.903  1.00 60.65  ? 384 LYS B CA    1 
ATOM   7009 C C     . LYS B 1 390 ? -31.535 0.335   -88.136  1.00 68.61  ? 384 LYS B C     1 
ATOM   7010 O O     . LYS B 1 390 ? -32.185 -0.597  -88.601  1.00 68.99  ? 384 LYS B O     1 
ATOM   7011 C CB    . LYS B 1 390 ? -30.554 1.532   -90.133  1.00 61.21  ? 384 LYS B CB    1 
ATOM   7012 N N     . HIS B 1 391 ? -30.948 0.288   -86.928  1.00 68.49  ? 385 HIS B N     1 
ATOM   7013 C CA    . HIS B 1 391 ? -30.953 -0.872  -86.028  1.00 70.54  ? 385 HIS B CA    1 
ATOM   7014 C C     . HIS B 1 391 ? -32.068 -0.843  -84.974  1.00 76.29  ? 385 HIS B C     1 
ATOM   7015 O O     . HIS B 1 391 ? -32.343 -1.876  -84.363  1.00 76.66  ? 385 HIS B O     1 
ATOM   7016 C CB    . HIS B 1 391 ? -29.601 -0.994  -85.318  1.00 70.85  ? 385 HIS B CB    1 
ATOM   7017 C CG    . HIS B 1 391 ? -28.569 -1.737  -86.102  1.00 75.17  ? 385 HIS B CG    1 
ATOM   7018 N ND1   . HIS B 1 391 ? -28.521 -3.122  -86.100  1.00 77.92  ? 385 HIS B ND1   1 
ATOM   7019 C CD2   . HIS B 1 391 ? -27.554 -1.263  -86.864  1.00 77.27  ? 385 HIS B CD2   1 
ATOM   7020 C CE1   . HIS B 1 391 ? -27.487 -3.445  -86.861  1.00 77.73  ? 385 HIS B CE1   1 
ATOM   7021 N NE2   . HIS B 1 391 ? -26.877 -2.359  -87.347  1.00 77.60  ? 385 HIS B NE2   1 
ATOM   7022 N N     . MET B 1 392 ? -32.675 0.335   -84.730  1.00 73.82  ? 386 MET B N     1 
ATOM   7023 C CA    . MET B 1 392 ? -33.739 0.517   -83.738  1.00 74.29  ? 386 MET B CA    1 
ATOM   7024 C C     . MET B 1 392 ? -34.965 -0.275  -84.138  1.00 82.12  ? 386 MET B C     1 
ATOM   7025 O O     . MET B 1 392 ? -35.587 0.047   -85.152  1.00 83.05  ? 386 MET B O     1 
ATOM   7026 C CB    . MET B 1 392 ? -34.131 1.999   -83.601  1.00 75.91  ? 386 MET B CB    1 
ATOM   7027 C CG    . MET B 1 392 ? -32.993 2.912   -83.237  1.00 77.87  ? 386 MET B CG    1 
ATOM   7028 S SD    . MET B 1 392 ? -33.571 4.608   -83.280  1.00 81.50  ? 386 MET B SD    1 
ATOM   7029 C CE    . MET B 1 392 ? -32.142 5.445   -82.702  1.00 76.85  ? 386 MET B CE    1 
ATOM   7030 N N     . HIS B 1 393 ? -35.284 -1.331  -83.375  1.00 80.47  ? 387 HIS B N     1 
ATOM   7031 C CA    . HIS B 1 393 ? -36.471 -2.147  -83.615  1.00 82.61  ? 387 HIS B CA    1 
ATOM   7032 C C     . HIS B 1 393 ? -37.599 -1.670  -82.670  1.00 83.69  ? 387 HIS B C     1 
ATOM   7033 O O     . HIS B 1 393 ? -38.691 -1.319  -83.125  1.00 84.76  ? 387 HIS B O     1 
ATOM   7034 C CB    . HIS B 1 393 ? -36.152 -3.636  -83.437  1.00 85.22  ? 387 HIS B CB    1 
ATOM   7035 C CG    . HIS B 1 393 ? -37.344 -4.521  -83.645  1.00 91.59  ? 387 HIS B CG    1 
ATOM   7036 N ND1   . HIS B 1 393 ? -37.766 -4.883  -84.920  1.00 95.07  ? 387 HIS B ND1   1 
ATOM   7037 C CD2   . HIS B 1 393 ? -38.184 -5.066  -82.733  1.00 94.85  ? 387 HIS B CD2   1 
ATOM   7038 C CE1   . HIS B 1 393 ? -38.836 -5.639  -84.739  1.00 96.40  ? 387 HIS B CE1   1 
ATOM   7039 N NE2   . HIS B 1 393 ? -39.128 -5.776  -83.441  1.00 96.66  ? 387 HIS B NE2   1 
ATOM   7040 N N     . ASN B 1 394 ? -37.296 -1.632  -81.360  1.00 76.21  ? 388 ASN B N     1 
ATOM   7041 C CA    . ASN B 1 394 ? -38.122 -1.136  -80.260  1.00 74.47  ? 388 ASN B CA    1 
ATOM   7042 C C     . ASN B 1 394 ? -37.159 -0.389  -79.336  1.00 73.54  ? 388 ASN B C     1 
ATOM   7043 O O     . ASN B 1 394 ? -36.208 -0.998  -78.828  1.00 72.17  ? 388 ASN B O     1 
ATOM   7044 C CB    . ASN B 1 394 ? -38.783 -2.284  -79.520  1.00 75.36  ? 388 ASN B CB    1 
ATOM   7045 C CG    . ASN B 1 394 ? -40.076 -2.711  -80.136  1.00 101.13 ? 388 ASN B CG    1 
ATOM   7046 O OD1   . ASN B 1 394 ? -40.969 -1.893  -80.372  1.00 97.56  ? 388 ASN B OD1   1 
ATOM   7047 N ND2   . ASN B 1 394 ? -40.221 -4.004  -80.388  1.00 94.26  ? 388 ASN B ND2   1 
ATOM   7048 N N     . ILE B 1 395 ? -37.352 0.936   -79.169  1.00 66.40  ? 389 ILE B N     1 
ATOM   7049 C CA    . ILE B 1 395 ? -36.443 1.744   -78.350  1.00 62.76  ? 389 ILE B CA    1 
ATOM   7050 C C     . ILE B 1 395 ? -37.160 2.539   -77.255  1.00 62.95  ? 389 ILE B C     1 
ATOM   7051 O O     . ILE B 1 395 ? -38.192 3.149   -77.523  1.00 64.23  ? 389 ILE B O     1 
ATOM   7052 C CB    . ILE B 1 395 ? -35.512 2.591   -79.256  1.00 64.42  ? 389 ILE B CB    1 
ATOM   7053 C CG1   . ILE B 1 395 ? -34.482 3.400   -78.441  1.00 62.72  ? 389 ILE B CG1   1 
ATOM   7054 C CG2   . ILE B 1 395 ? -36.301 3.459   -80.262  1.00 65.48  ? 389 ILE B CG2   1 
ATOM   7055 C CD1   . ILE B 1 395 ? -33.067 3.288   -78.937  1.00 63.37  ? 389 ILE B CD1   1 
ATOM   7056 N N     . VAL B 1 396 ? -36.650 2.471   -76.018  1.00 55.39  ? 390 VAL B N     1 
ATOM   7057 C CA    . VAL B 1 396 ? -37.223 3.174   -74.871  1.00 54.42  ? 390 VAL B CA    1 
ATOM   7058 C C     . VAL B 1 396 ? -36.188 4.100   -74.259  1.00 57.11  ? 390 VAL B C     1 
ATOM   7059 O O     . VAL B 1 396 ? -35.176 3.641   -73.720  1.00 56.64  ? 390 VAL B O     1 
ATOM   7060 C CB    . VAL B 1 396 ? -37.875 2.245   -73.812  1.00 58.22  ? 390 VAL B CB    1 
ATOM   7061 C CG1   . VAL B 1 396 ? -38.372 3.044   -72.605  1.00 57.50  ? 390 VAL B CG1   1 
ATOM   7062 C CG2   . VAL B 1 396 ? -39.010 1.442   -74.422  1.00 59.41  ? 390 VAL B CG2   1 
ATOM   7063 N N     . TYR B 1 397 ? -36.440 5.408   -74.362  1.00 52.52  ? 391 TYR B N     1 
ATOM   7064 C CA    . TYR B 1 397 ? -35.557 6.436   -73.819  1.00 50.68  ? 391 TYR B CA    1 
ATOM   7065 C C     . TYR B 1 397 ? -35.976 6.683   -72.388  1.00 55.12  ? 391 TYR B C     1 
ATOM   7066 O O     . TYR B 1 397 ? -37.170 6.840   -72.109  1.00 57.97  ? 391 TYR B O     1 
ATOM   7067 C CB    . TYR B 1 397 ? -35.654 7.732   -74.643  1.00 50.94  ? 391 TYR B CB    1 
ATOM   7068 C CG    . TYR B 1 397 ? -35.496 7.530   -76.137  1.00 51.62  ? 391 TYR B CG    1 
ATOM   7069 C CD1   . TYR B 1 397 ? -36.604 7.442   -76.965  1.00 54.42  ? 391 TYR B CD1   1 
ATOM   7070 C CD2   . TYR B 1 397 ? -34.233 7.438   -76.721  1.00 51.21  ? 391 TYR B CD2   1 
ATOM   7071 C CE1   . TYR B 1 397 ? -36.469 7.240   -78.337  1.00 56.09  ? 391 TYR B CE1   1 
ATOM   7072 C CE2   . TYR B 1 397 ? -34.084 7.271   -78.097  1.00 52.37  ? 391 TYR B CE2   1 
ATOM   7073 C CZ    . TYR B 1 397 ? -35.208 7.164   -78.902  1.00 62.19  ? 391 TYR B CZ    1 
ATOM   7074 O OH    . TYR B 1 397 ? -35.093 6.994   -80.263  1.00 63.86  ? 391 TYR B OH    1 
ATOM   7075 N N     . VAL B 1 398 ? -35.020 6.645   -71.469  1.00 48.13  ? 392 VAL B N     1 
ATOM   7076 C CA    . VAL B 1 398 ? -35.299 6.883   -70.055  1.00 47.19  ? 392 VAL B CA    1 
ATOM   7077 C C     . VAL B 1 398 ? -34.523 8.115   -69.633  1.00 53.68  ? 392 VAL B C     1 
ATOM   7078 O O     . VAL B 1 398 ? -33.309 8.184   -69.850  1.00 53.21  ? 392 VAL B O     1 
ATOM   7079 C CB    . VAL B 1 398 ? -35.000 5.668   -69.155  1.00 49.73  ? 392 VAL B CB    1 
ATOM   7080 C CG1   . VAL B 1 398 ? -35.519 5.911   -67.742  1.00 49.81  ? 392 VAL B CG1   1 
ATOM   7081 C CG2   . VAL B 1 398 ? -35.594 4.386   -69.730  1.00 50.36  ? 392 VAL B CG2   1 
ATOM   7082 N N     . SER B 1 399 ? -35.223 9.113   -69.085  1.00 52.68  ? 393 SER B N     1 
ATOM   7083 C CA    . SER B 1 399 ? -34.607 10.372  -68.641  1.00 52.98  ? 393 SER B CA    1 
ATOM   7084 C C     . SER B 1 399 ? -35.537 11.144  -67.723  1.00 61.96  ? 393 SER B C     1 
ATOM   7085 O O     . SER B 1 399 ? -36.756 11.083  -67.898  1.00 64.60  ? 393 SER B O     1 
ATOM   7086 C CB    . SER B 1 399 ? -34.221 11.254  -69.832  1.00 53.03  ? 393 SER B CB    1 
ATOM   7087 O OG    . SER B 1 399 ? -33.589 12.438  -69.379  1.00 56.61  ? 393 SER B OG    1 
ATOM   7088 N N     . ALA B 1 400 ? -34.976 11.894  -66.773  1.00 58.67  ? 394 ALA B N     1 
ATOM   7089 C CA    . ALA B 1 400 ? -35.808 12.734  -65.927  1.00 60.17  ? 394 ALA B CA    1 
ATOM   7090 C C     . ALA B 1 400 ? -36.164 14.009  -66.729  1.00 65.21  ? 394 ALA B C     1 
ATOM   7091 O O     . ALA B 1 400 ? -37.196 14.637  -66.485  1.00 67.22  ? 394 ALA B O     1 
ATOM   7092 C CB    . ALA B 1 400 ? -35.070 13.084  -64.644  1.00 60.87  ? 394 ALA B CB    1 
ATOM   7093 N N     . THR B 1 401 ? -35.308 14.368  -67.702  1.00 59.33  ? 395 THR B N     1 
ATOM   7094 C CA    . THR B 1 401 ? -35.458 15.542  -68.559  1.00 58.51  ? 395 THR B CA    1 
ATOM   7095 C C     . THR B 1 401 ? -35.147 15.145  -70.014  1.00 61.64  ? 395 THR B C     1 
ATOM   7096 O O     . THR B 1 401 ? -34.060 15.461  -70.509  1.00 60.78  ? 395 THR B O     1 
ATOM   7097 C CB    . THR B 1 401 ? -34.549 16.681  -68.066  1.00 66.21  ? 395 THR B CB    1 
ATOM   7098 O OG1   . THR B 1 401 ? -33.208 16.216  -67.919  1.00 67.60  ? 395 THR B OG1   1 
ATOM   7099 C CG2   . THR B 1 401 ? -35.000 17.279  -66.772  1.00 65.45  ? 395 THR B CG2   1 
ATOM   7100 N N     . PRO B 1 402 ? -36.063 14.433  -70.712  1.00 58.07  ? 396 PRO B N     1 
ATOM   7101 C CA    . PRO B 1 402 ? -35.772 13.998  -72.093  1.00 56.91  ? 396 PRO B CA    1 
ATOM   7102 C C     . PRO B 1 402 ? -35.314 15.087  -73.048  1.00 57.53  ? 396 PRO B C     1 
ATOM   7103 O O     . PRO B 1 402 ? -35.741 16.234  -72.940  1.00 57.24  ? 396 PRO B O     1 
ATOM   7104 C CB    . PRO B 1 402 ? -37.082 13.346  -72.557  1.00 59.99  ? 396 PRO B CB    1 
ATOM   7105 C CG    . PRO B 1 402 ? -38.103 13.782  -71.575  1.00 65.77  ? 396 PRO B CG    1 
ATOM   7106 C CD    . PRO B 1 402 ? -37.384 13.943  -70.280  1.00 60.99  ? 396 PRO B CD    1 
ATOM   7107 N N     . GLY B 1 403 ? -34.424 14.699  -73.952  1.00 51.51  ? 397 GLY B N     1 
ATOM   7108 C CA    . GLY B 1 403 ? -33.849 15.567  -74.970  1.00 49.85  ? 397 GLY B CA    1 
ATOM   7109 C C     . GLY B 1 403 ? -34.722 15.777  -76.193  1.00 50.76  ? 397 GLY B C     1 
ATOM   7110 O O     . GLY B 1 403 ? -35.725 15.082  -76.379  1.00 49.80  ? 397 GLY B O     1 
ATOM   7111 N N     . PRO B 1 404 ? -34.317 16.734  -77.056  1.00 46.69  ? 398 PRO B N     1 
ATOM   7112 C CA    . PRO B 1 404 ? -35.098 17.056  -78.255  1.00 47.94  ? 398 PRO B CA    1 
ATOM   7113 C C     . PRO B 1 404 ? -35.403 15.893  -79.183  1.00 52.08  ? 398 PRO B C     1 
ATOM   7114 O O     . PRO B 1 404 ? -36.514 15.848  -79.728  1.00 52.96  ? 398 PRO B O     1 
ATOM   7115 C CB    . PRO B 1 404 ? -34.221 18.091  -78.963  1.00 49.63  ? 398 PRO B CB    1 
ATOM   7116 C CG    . PRO B 1 404 ? -33.492 18.743  -77.889  1.00 53.08  ? 398 PRO B CG    1 
ATOM   7117 C CD    . PRO B 1 404 ? -33.151 17.624  -76.951  1.00 48.00  ? 398 PRO B CD    1 
ATOM   7118 N N     . TYR B 1 405 ? -34.420 14.972  -79.369  1.00 46.57  ? 399 TYR B N     1 
ATOM   7119 C CA    . TYR B 1 405 ? -34.544 13.783  -80.222  1.00 45.80  ? 399 TYR B CA    1 
ATOM   7120 C C     . TYR B 1 405 ? -35.709 12.899  -79.760  1.00 47.86  ? 399 TYR B C     1 
ATOM   7121 O O     . TYR B 1 405 ? -36.589 12.555  -80.547  1.00 46.59  ? 399 TYR B O     1 
ATOM   7122 C CB    . TYR B 1 405 ? -33.223 12.971  -80.254  1.00 45.57  ? 399 TYR B CB    1 
ATOM   7123 C CG    . TYR B 1 405 ? -33.289 11.770  -81.180  1.00 46.67  ? 399 TYR B CG    1 
ATOM   7124 C CD1   . TYR B 1 405 ? -32.997 11.893  -82.537  1.00 48.42  ? 399 TYR B CD1   1 
ATOM   7125 C CD2   . TYR B 1 405 ? -33.689 10.522  -80.708  1.00 47.40  ? 399 TYR B CD2   1 
ATOM   7126 C CE1   . TYR B 1 405 ? -33.106 10.807  -83.401  1.00 49.92  ? 399 TYR B CE1   1 
ATOM   7127 C CE2   . TYR B 1 405 ? -33.816 9.432   -81.566  1.00 48.49  ? 399 TYR B CE2   1 
ATOM   7128 C CZ    . TYR B 1 405 ? -33.517 9.578   -82.910  1.00 56.52  ? 399 TYR B CZ    1 
ATOM   7129 O OH    . TYR B 1 405 ? -33.627 8.504   -83.757  1.00 58.19  ? 399 TYR B OH    1 
ATOM   7130 N N     . GLU B 1 406 ? -35.687 12.542  -78.478  1.00 44.66  ? 400 GLU B N     1 
ATOM   7131 C CA    . GLU B 1 406 ? -36.678 11.701  -77.828  1.00 45.72  ? 400 GLU B CA    1 
ATOM   7132 C C     . GLU B 1 406 ? -38.037 12.373  -77.916  1.00 52.56  ? 400 GLU B C     1 
ATOM   7133 O O     . GLU B 1 406 ? -39.022 11.700  -78.223  1.00 53.08  ? 400 GLU B O     1 
ATOM   7134 C CB    . GLU B 1 406 ? -36.292 11.431  -76.360  1.00 46.64  ? 400 GLU B CB    1 
ATOM   7135 C CG    . GLU B 1 406 ? -34.851 10.995  -76.155  1.00 58.45  ? 400 GLU B CG    1 
ATOM   7136 C CD    . GLU B 1 406 ? -33.844 12.100  -75.887  1.00 74.01  ? 400 GLU B CD    1 
ATOM   7137 O OE1   . GLU B 1 406 ? -33.445 12.254  -74.710  1.00 55.38  ? 400 GLU B OE1   1 
ATOM   7138 O OE2   . GLU B 1 406 ? -33.451 12.808  -76.846  1.00 64.17  ? 400 GLU B OE2   1 
ATOM   7139 N N     . ILE B 1 407 ? -38.085 13.710  -77.697  1.00 50.48  ? 401 ILE B N     1 
ATOM   7140 C CA    . ILE B 1 407 ? -39.326 14.492  -77.772  1.00 51.89  ? 401 ILE B CA    1 
ATOM   7141 C C     . ILE B 1 407 ? -39.924 14.467  -79.195  1.00 55.62  ? 401 ILE B C     1 
ATOM   7142 O O     . ILE B 1 407 ? -41.128 14.250  -79.330  1.00 56.10  ? 401 ILE B O     1 
ATOM   7143 C CB    . ILE B 1 407 ? -39.153 15.913  -77.181  1.00 54.84  ? 401 ILE B CB    1 
ATOM   7144 C CG1   . ILE B 1 407 ? -38.830 15.842  -75.681  1.00 54.78  ? 401 ILE B CG1   1 
ATOM   7145 C CG2   . ILE B 1 407 ? -40.381 16.793  -77.429  1.00 56.91  ? 401 ILE B CG2   1 
ATOM   7146 C CD1   . ILE B 1 407 ? -38.055 17.075  -75.159  1.00 63.11  ? 401 ILE B CD1   1 
ATOM   7147 N N     . GLU B 1 408 ? -39.076 14.602  -80.236  1.00 50.93  ? 402 GLU B N     1 
ATOM   7148 C CA    . GLU B 1 408 ? -39.506 14.568  -81.630  1.00 51.96  ? 402 GLU B CA    1 
ATOM   7149 C C     . GLU B 1 408 ? -39.996 13.198  -82.091  1.00 62.16  ? 402 GLU B C     1 
ATOM   7150 O O     . GLU B 1 408 ? -40.827 13.131  -82.999  1.00 63.65  ? 402 GLU B O     1 
ATOM   7151 C CB    . GLU B 1 408 ? -38.385 15.047  -82.546  1.00 51.48  ? 402 GLU B CB    1 
ATOM   7152 N N     . HIS B 1 409 ? -39.481 12.111  -81.489  1.00 61.73  ? 403 HIS B N     1 
ATOM   7153 C CA    . HIS B 1 409 ? -39.781 10.732  -81.890  1.00 63.52  ? 403 HIS B CA    1 
ATOM   7154 C C     . HIS B 1 409 ? -40.855 10.007  -81.080  1.00 72.17  ? 403 HIS B C     1 
ATOM   7155 O O     . HIS B 1 409 ? -41.483 9.085   -81.603  1.00 73.93  ? 403 HIS B O     1 
ATOM   7156 C CB    . HIS B 1 409 ? -38.478 9.930   -82.013  1.00 63.25  ? 403 HIS B CB    1 
ATOM   7157 C CG    . HIS B 1 409 ? -37.599 10.428  -83.126  1.00 66.39  ? 403 HIS B CG    1 
ATOM   7158 N ND1   . HIS B 1 409 ? -37.035 11.692  -83.093  1.00 67.50  ? 403 HIS B ND1   1 
ATOM   7159 C CD2   . HIS B 1 409 ? -37.245 9.827   -84.284  1.00 68.63  ? 403 HIS B CD2   1 
ATOM   7160 C CE1   . HIS B 1 409 ? -36.361 11.814  -84.224  1.00 66.93  ? 403 HIS B CE1   1 
ATOM   7161 N NE2   . HIS B 1 409 ? -36.446 10.713  -84.966  1.00 67.89  ? 403 HIS B NE2   1 
ATOM   7162 N N     . THR B 1 410 ? -41.097 10.443  -79.828  1.00 70.30  ? 404 THR B N     1 
ATOM   7163 C CA    . THR B 1 410 ? -42.122 9.855   -78.954  1.00 71.94  ? 404 THR B CA    1 
ATOM   7164 C C     . THR B 1 410 ? -43.468 10.550  -79.213  1.00 78.84  ? 404 THR B C     1 
ATOM   7165 O O     . THR B 1 410 ? -43.533 11.789  -79.159  1.00 78.68  ? 404 THR B O     1 
ATOM   7166 C CB    . THR B 1 410 ? -41.672 9.920   -77.471  1.00 78.67  ? 404 THR B CB    1 
ATOM   7167 O OG1   . THR B 1 410 ? -40.319 9.470   -77.374  1.00 75.42  ? 404 THR B OG1   1 
ATOM   7168 C CG2   . THR B 1 410 ? -42.556 9.093   -76.537  1.00 77.48  ? 404 THR B CG2   1 
ATOM   7169 N N     . ASP B 1 411 ? -44.533 9.752   -79.509  1.00 76.85  ? 405 ASP B N     1 
ATOM   7170 C CA    . ASP B 1 411 ? -45.882 10.289  -79.756  1.00 77.79  ? 405 ASP B CA    1 
ATOM   7171 C C     . ASP B 1 411 ? -46.513 10.786  -78.443  1.00 80.76  ? 405 ASP B C     1 
ATOM   7172 O O     . ASP B 1 411 ? -46.985 11.922  -78.395  1.00 79.43  ? 405 ASP B O     1 
ATOM   7173 C CB    . ASP B 1 411 ? -46.768 9.255   -80.457  1.00 80.15  ? 405 ASP B CB    1 
ATOM   7174 N N     . GLU B 1 412 ? -46.451 9.967   -77.368  1.00 77.94  ? 406 GLU B N     1 
ATOM   7175 C CA    . GLU B 1 412 ? -46.942 10.325  -76.032  1.00 78.15  ? 406 GLU B CA    1 
ATOM   7176 C C     . GLU B 1 412 ? -45.900 9.964   -74.967  1.00 80.33  ? 406 GLU B C     1 
ATOM   7177 O O     . GLU B 1 412 ? -45.323 8.872   -74.995  1.00 79.10  ? 406 GLU B O     1 
ATOM   7178 C CB    . GLU B 1 412 ? -48.275 9.638   -75.739  1.00 80.85  ? 406 GLU B CB    1 
ATOM   7179 N N     . MET B 1 413 ? -45.656 10.902  -74.042  1.00 76.24  ? 407 MET B N     1 
ATOM   7180 C CA    . MET B 1 413 ? -44.710 10.745  -72.932  1.00 74.97  ? 407 MET B CA    1 
ATOM   7181 C C     . MET B 1 413 ? -45.292 9.859   -71.859  1.00 77.37  ? 407 MET B C     1 
ATOM   7182 O O     . MET B 1 413 ? -46.504 9.893   -71.654  1.00 78.10  ? 407 MET B O     1 
ATOM   7183 C CB    . MET B 1 413 ? -44.402 12.113  -72.321  1.00 76.88  ? 407 MET B CB    1 
ATOM   7184 C CG    . MET B 1 413 ? -43.468 12.931  -73.156  1.00 79.82  ? 407 MET B CG    1 
ATOM   7185 S SD    . MET B 1 413 ? -41.765 12.548  -72.731  1.00 82.54  ? 407 MET B SD    1 
ATOM   7186 C CE    . MET B 1 413 ? -40.955 12.879  -74.327  1.00 78.40  ? 407 MET B CE    1 
ATOM   7187 N N     . VAL B 1 414 ? -44.451 9.061   -71.181  1.00 71.99  ? 408 VAL B N     1 
ATOM   7188 C CA    . VAL B 1 414 ? -44.937 8.180   -70.104  1.00 71.89  ? 408 VAL B CA    1 
ATOM   7189 C C     . VAL B 1 414 ? -44.325 8.647   -68.757  1.00 73.05  ? 408 VAL B C     1 
ATOM   7190 O O     . VAL B 1 414 ? -43.193 8.271   -68.423  1.00 72.99  ? 408 VAL B O     1 
ATOM   7191 C CB    . VAL B 1 414 ? -44.783 6.652   -70.424  1.00 75.41  ? 408 VAL B CB    1 
ATOM   7192 C CG1   . VAL B 1 414 ? -45.248 5.786   -69.263  1.00 76.38  ? 408 VAL B CG1   1 
ATOM   7193 C CG2   . VAL B 1 414 ? -45.546 6.267   -71.692  1.00 75.87  ? 408 VAL B CG2   1 
ATOM   7194 N N     . GLU B 1 415 ? -45.046 9.538   -68.035  1.00 66.60  ? 409 GLU B N     1 
ATOM   7195 C CA    . GLU B 1 415 ? -44.567 10.114  -66.773  1.00 64.91  ? 409 GLU B CA    1 
ATOM   7196 C C     . GLU B 1 415 ? -44.616 9.163   -65.572  1.00 69.99  ? 409 GLU B C     1 
ATOM   7197 O O     . GLU B 1 415 ? -45.579 8.414   -65.414  1.00 72.20  ? 409 GLU B O     1 
ATOM   7198 C CB    . GLU B 1 415 ? -45.300 11.412  -66.454  1.00 65.73  ? 409 GLU B CB    1 
ATOM   7199 N N     . GLN B 1 416 ? -43.557 9.179   -64.757  1.00 64.71  ? 410 GLN B N     1 
ATOM   7200 C CA    . GLN B 1 416 ? -43.395 8.427   -63.511  1.00 65.00  ? 410 GLN B CA    1 
ATOM   7201 C C     . GLN B 1 416 ? -42.708 9.410   -62.543  1.00 70.86  ? 410 GLN B C     1 
ATOM   7202 O O     . GLN B 1 416 ? -41.465 9.492   -62.478  1.00 70.30  ? 410 GLN B O     1 
ATOM   7203 C CB    . GLN B 1 416 ? -42.570 7.143   -63.717  1.00 65.07  ? 410 GLN B CB    1 
ATOM   7204 C CG    . GLN B 1 416 ? -42.343 6.355   -62.430  1.00 68.16  ? 410 GLN B CG    1 
ATOM   7205 C CD    . GLN B 1 416 ? -41.496 5.140   -62.674  1.00 87.82  ? 410 GLN B CD    1 
ATOM   7206 O OE1   . GLN B 1 416 ? -41.948 4.150   -63.249  1.00 84.17  ? 410 GLN B OE1   1 
ATOM   7207 N NE2   . GLN B 1 416 ? -40.251 5.173   -62.232  1.00 81.25  ? 410 GLN B NE2   1 
ATOM   7208 N N     . ILE B 1 417 ? -43.532 10.235  -61.867  1.00 67.53  ? 411 ILE B N     1 
ATOM   7209 C CA    . ILE B 1 417 ? -43.027 11.280  -60.976  1.00 65.99  ? 411 ILE B CA    1 
ATOM   7210 C C     . ILE B 1 417 ? -43.236 11.054  -59.471  1.00 68.75  ? 411 ILE B C     1 
ATOM   7211 O O     . ILE B 1 417 ? -42.466 11.614  -58.676  1.00 67.41  ? 411 ILE B O     1 
ATOM   7212 C CB    . ILE B 1 417 ? -43.343 12.725  -61.483  1.00 68.42  ? 411 ILE B CB    1 
ATOM   7213 C CG1   . ILE B 1 417 ? -44.858 12.986  -61.541  1.00 70.77  ? 411 ILE B CG1   1 
ATOM   7214 C CG2   . ILE B 1 417 ? -42.663 12.983  -62.851  1.00 66.45  ? 411 ILE B CG2   1 
ATOM   7215 C CD1   . ILE B 1 417 ? -45.286 14.421  -61.932  1.00 81.93  ? 411 ILE B CD1   1 
ATOM   7216 N N     . ILE B 1 418 ? -44.228 10.202  -59.086  1.00 66.52  ? 412 ILE B N     1 
ATOM   7217 C CA    . ILE B 1 418 ? -44.549 9.885   -57.676  1.00 67.40  ? 412 ILE B CA    1 
ATOM   7218 C C     . ILE B 1 418 ? -43.511 8.960   -57.016  1.00 72.11  ? 412 ILE B C     1 
ATOM   7219 O O     . ILE B 1 418 ? -43.294 7.837   -57.492  1.00 71.76  ? 412 ILE B O     1 
ATOM   7220 C CB    . ILE B 1 418 ? -45.970 9.328   -57.529  1.00 69.44  ? 412 ILE B CB    1 
ATOM   7221 N N     . ARG B 1 419 ? -42.856 9.465   -55.922  1.00 68.97  ? 413 ARG B N     1 
ATOM   7222 C CA    . ARG B 1 419 ? -41.834 8.744   -55.153  1.00 69.34  ? 413 ARG B CA    1 
ATOM   7223 C C     . ARG B 1 419 ? -42.469 7.830   -54.099  1.00 79.51  ? 413 ARG B C     1 
ATOM   7224 O O     . ARG B 1 419 ? -43.460 8.236   -53.493  1.00 81.16  ? 413 ARG B O     1 
ATOM   7225 C CB    . ARG B 1 419 ? -40.842 9.716   -54.480  1.00 66.41  ? 413 ARG B CB    1 
ATOM   7226 C CG    . ARG B 1 419 ? -39.766 10.231  -55.417  1.00 68.37  ? 413 ARG B CG    1 
ATOM   7227 C CD    . ARG B 1 419 ? -38.845 11.226  -54.729  1.00 75.43  ? 413 ARG B CD    1 
ATOM   7228 N NE    . ARG B 1 419 ? -38.015 11.970  -55.680  1.00 77.99  ? 413 ARG B NE    1 
ATOM   7229 C CZ    . ARG B 1 419 ? -38.354 13.136  -56.226  1.00 89.54  ? 413 ARG B CZ    1 
ATOM   7230 N NH1   . ARG B 1 419 ? -39.515 13.707  -55.924  1.00 78.82  ? 413 ARG B NH1   1 
ATOM   7231 N NH2   . ARG B 1 419 ? -37.543 13.734  -57.084  1.00 73.78  ? 413 ARG B NH2   1 
ATOM   7232 N N     . PRO B 1 420 ? -41.909 6.613   -53.830  1.00 78.89  ? 414 PRO B N     1 
ATOM   7233 C CA    . PRO B 1 420 ? -42.491 5.749   -52.786  1.00 80.94  ? 414 PRO B CA    1 
ATOM   7234 C C     . PRO B 1 420 ? -42.322 6.352   -51.392  1.00 85.41  ? 414 PRO B C     1 
ATOM   7235 O O     . PRO B 1 420 ? -43.225 6.206   -50.564  1.00 88.06  ? 414 PRO B O     1 
ATOM   7236 C CB    . PRO B 1 420 ? -41.711 4.431   -52.926  1.00 82.65  ? 414 PRO B CB    1 
ATOM   7237 C CG    . PRO B 1 420 ? -41.013 4.507   -54.246  1.00 85.37  ? 414 PRO B CG    1 
ATOM   7238 C CD    . PRO B 1 420 ? -40.725 5.968   -54.435  1.00 79.75  ? 414 PRO B CD    1 
ATOM   7239 N N     . THR B 1 421 ? -41.195 7.068   -51.152  1.00 79.03  ? 415 THR B N     1 
ATOM   7240 C CA    . THR B 1 421 ? -40.882 7.740   -49.880  1.00 79.14  ? 415 THR B CA    1 
ATOM   7241 C C     . THR B 1 421 ? -41.756 8.964   -49.615  1.00 81.20  ? 415 THR B C     1 
ATOM   7242 O O     . THR B 1 421 ? -41.820 9.445   -48.483  1.00 80.98  ? 415 THR B O     1 
ATOM   7243 C CB    . THR B 1 421 ? -39.400 8.128   -49.807  1.00 94.99  ? 415 THR B CB    1 
ATOM   7244 O OG1   . THR B 1 421 ? -39.049 8.951   -50.932  1.00 95.50  ? 415 THR B OG1   1 
ATOM   7245 C CG2   . THR B 1 421 ? -38.479 6.919   -49.683  1.00 97.00  ? 415 THR B CG2   1 
ATOM   7246 N N     . GLY B 1 422 ? -42.388 9.472   -50.665  1.00 76.98  ? 416 GLY B N     1 
ATOM   7247 C CA    . GLY B 1 422 ? -43.252 10.642  -50.594  1.00 77.32  ? 416 GLY B CA    1 
ATOM   7248 C C     . GLY B 1 422 ? -42.496 11.952  -50.653  1.00 79.18  ? 416 GLY B C     1 
ATOM   7249 O O     . GLY B 1 422 ? -43.114 13.018  -50.648  1.00 79.60  ? 416 GLY B O     1 
ATOM   7250 N N     . LEU B 1 423 ? -41.152 11.873  -50.715  1.00 73.25  ? 417 LEU B N     1 
ATOM   7251 C CA    . LEU B 1 423 ? -40.208 12.995  -50.781  1.00 71.11  ? 417 LEU B CA    1 
ATOM   7252 C C     . LEU B 1 423 ? -40.558 13.911  -51.958  1.00 72.32  ? 417 LEU B C     1 
ATOM   7253 O O     . LEU B 1 423 ? -40.808 13.410  -53.060  1.00 71.41  ? 417 LEU B O     1 
ATOM   7254 C CB    . LEU B 1 423 ? -38.753 12.443  -50.930  1.00 69.68  ? 417 LEU B CB    1 
ATOM   7255 C CG    . LEU B 1 423 ? -37.844 12.263  -49.670  1.00 73.78  ? 417 LEU B CG    1 
ATOM   7256 C CD1   . LEU B 1 423 ? -37.338 13.582  -49.125  1.00 72.87  ? 417 LEU B CD1   1 
ATOM   7257 C CD2   . LEU B 1 423 ? -38.507 11.435  -48.581  1.00 78.92  ? 417 LEU B CD2   1 
ATOM   7258 N N     . LEU B 1 424 ? -40.619 15.241  -51.712  1.00 67.71  ? 418 LEU B N     1 
ATOM   7259 C CA    . LEU B 1 424 ? -40.992 16.233  -52.740  1.00 66.12  ? 418 LEU B CA    1 
ATOM   7260 C C     . LEU B 1 424 ? -39.810 16.932  -53.384  1.00 68.76  ? 418 LEU B C     1 
ATOM   7261 O O     . LEU B 1 424 ? -38.776 17.114  -52.732  1.00 68.21  ? 418 LEU B O     1 
ATOM   7262 C CB    . LEU B 1 424 ? -41.927 17.322  -52.173  1.00 66.67  ? 418 LEU B CB    1 
ATOM   7263 C CG    . LEU B 1 424 ? -42.984 16.924  -51.164  1.00 72.29  ? 418 LEU B CG    1 
ATOM   7264 C CD1   . LEU B 1 424 ? -43.336 18.094  -50.307  1.00 72.80  ? 418 LEU B CD1   1 
ATOM   7265 C CD2   . LEU B 1 424 ? -44.227 16.374  -51.844  1.00 74.89  ? 418 LEU B CD2   1 
ATOM   7266 N N     . ASP B 1 425 ? -40.002 17.404  -54.646  1.00 63.99  ? 419 ASP B N     1 
ATOM   7267 C CA    . ASP B 1 425 ? -39.007 18.192  -55.387  1.00 61.45  ? 419 ASP B CA    1 
ATOM   7268 C C     . ASP B 1 425 ? -38.876 19.562  -54.689  1.00 62.16  ? 419 ASP B C     1 
ATOM   7269 O O     . ASP B 1 425 ? -39.875 20.071  -54.181  1.00 62.91  ? 419 ASP B O     1 
ATOM   7270 C CB    . ASP B 1 425 ? -39.377 18.317  -56.876  1.00 63.09  ? 419 ASP B CB    1 
ATOM   7271 C CG    . ASP B 1 425 ? -38.816 17.192  -57.746  1.00 80.29  ? 419 ASP B CG    1 
ATOM   7272 O OD1   . ASP B 1 425 ? -39.625 16.459  -58.374  1.00 83.95  ? 419 ASP B OD1   1 
ATOM   7273 O OD2   . ASP B 1 425 ? -37.571 17.056  -57.816  1.00 86.71  ? 419 ASP B OD2   1 
ATOM   7274 N N     . PRO B 1 426 ? -37.656 20.113  -54.542  1.00 55.52  ? 420 PRO B N     1 
ATOM   7275 C CA    . PRO B 1 426 ? -37.479 21.342  -53.736  1.00 55.85  ? 420 PRO B CA    1 
ATOM   7276 C C     . PRO B 1 426 ? -38.240 22.642  -54.047  1.00 59.54  ? 420 PRO B C     1 
ATOM   7277 O O     . PRO B 1 426 ? -38.928 22.777  -55.057  1.00 58.46  ? 420 PRO B O     1 
ATOM   7278 C CB    . PRO B 1 426 ? -35.963 21.548  -53.729  1.00 56.39  ? 420 PRO B CB    1 
ATOM   7279 C CG    . PRO B 1 426 ? -35.471 20.777  -54.885  1.00 59.20  ? 420 PRO B CG    1 
ATOM   7280 C CD    . PRO B 1 426 ? -36.359 19.595  -55.004  1.00 55.15  ? 420 PRO B CD    1 
ATOM   7281 N N     . LEU B 1 427 ? -38.122 23.599  -53.117  1.00 56.43  ? 421 LEU B N     1 
ATOM   7282 C CA    . LEU B 1 427 ? -38.699 24.931  -53.223  1.00 56.28  ? 421 LEU B CA    1 
ATOM   7283 C C     . LEU B 1 427 ? -37.596 25.806  -53.795  1.00 59.24  ? 421 LEU B C     1 
ATOM   7284 O O     . LEU B 1 427 ? -36.472 25.806  -53.269  1.00 58.81  ? 421 LEU B O     1 
ATOM   7285 C CB    . LEU B 1 427 ? -39.080 25.450  -51.826  1.00 57.68  ? 421 LEU B CB    1 
ATOM   7286 C CG    . LEU B 1 427 ? -40.436 25.119  -51.296  1.00 63.48  ? 421 LEU B CG    1 
ATOM   7287 C CD1   . LEU B 1 427 ? -40.417 25.149  -49.809  1.00 64.72  ? 421 LEU B CD1   1 
ATOM   7288 C CD2   . LEU B 1 427 ? -41.480 26.078  -51.829  1.00 66.46  ? 421 LEU B CD2   1 
ATOM   7289 N N     . ILE B 1 428 ? -37.887 26.521  -54.883  1.00 55.12  ? 422 ILE B N     1 
ATOM   7290 C CA    . ILE B 1 428 ? -36.887 27.380  -55.513  1.00 53.65  ? 422 ILE B CA    1 
ATOM   7291 C C     . ILE B 1 428 ? -37.147 28.835  -55.204  1.00 57.78  ? 422 ILE B C     1 
ATOM   7292 O O     . ILE B 1 428 ? -38.226 29.339  -55.517  1.00 58.68  ? 422 ILE B O     1 
ATOM   7293 C CB    . ILE B 1 428 ? -36.739 27.137  -57.033  1.00 55.46  ? 422 ILE B CB    1 
ATOM   7294 C CG1   . ILE B 1 428 ? -36.596 25.640  -57.363  1.00 55.09  ? 422 ILE B CG1   1 
ATOM   7295 C CG2   . ILE B 1 428 ? -35.572 27.978  -57.608  1.00 55.77  ? 422 ILE B CG2   1 
ATOM   7296 C CD1   . ILE B 1 428 ? -36.925 25.281  -58.795  1.00 64.54  ? 422 ILE B CD1   1 
ATOM   7297 N N     . ASP B 1 429 ? -36.150 29.503  -54.604  1.00 53.27  ? 423 ASP B N     1 
ATOM   7298 C CA    . ASP B 1 429 ? -36.192 30.921  -54.288  1.00 53.65  ? 423 ASP B CA    1 
ATOM   7299 C C     . ASP B 1 429 ? -35.158 31.596  -55.170  1.00 55.08  ? 423 ASP B C     1 
ATOM   7300 O O     . ASP B 1 429 ? -34.035 31.099  -55.298  1.00 53.86  ? 423 ASP B O     1 
ATOM   7301 C CB    . ASP B 1 429 ? -35.912 31.177  -52.785  1.00 57.67  ? 423 ASP B CB    1 
ATOM   7302 C CG    . ASP B 1 429 ? -36.132 32.609  -52.255  1.00 79.42  ? 423 ASP B CG    1 
ATOM   7303 O OD1   . ASP B 1 429 ? -35.737 32.888  -51.080  1.00 78.59  ? 423 ASP B OD1   1 
ATOM   7304 O OD2   . ASP B 1 429 ? -36.720 33.441  -52.996  1.00 95.13  ? 423 ASP B OD2   1 
ATOM   7305 N N     . VAL B 1 430 ? -35.557 32.682  -55.843  1.00 51.09  ? 424 VAL B N     1 
ATOM   7306 C CA    . VAL B 1 430 ? -34.652 33.440  -56.696  1.00 49.69  ? 424 VAL B CA    1 
ATOM   7307 C C     . VAL B 1 430 ? -34.296 34.737  -55.987  1.00 55.91  ? 424 VAL B C     1 
ATOM   7308 O O     . VAL B 1 430 ? -35.181 35.511  -55.598  1.00 56.65  ? 424 VAL B O     1 
ATOM   7309 C CB    . VAL B 1 430 ? -35.152 33.640  -58.135  1.00 52.50  ? 424 VAL B CB    1 
ATOM   7310 C CG1   . VAL B 1 430 ? -34.078 34.292  -58.989  1.00 51.39  ? 424 VAL B CG1   1 
ATOM   7311 C CG2   . VAL B 1 430 ? -35.558 32.306  -58.745  1.00 52.04  ? 424 VAL B CG2   1 
ATOM   7312 N N     . ARG B 1 431 ? -32.986 34.936  -55.763  1.00 52.37  ? 425 ARG B N     1 
ATOM   7313 C CA    . ARG B 1 431 ? -32.449 36.083  -55.034  1.00 52.36  ? 425 ARG B CA    1 
ATOM   7314 C C     . ARG B 1 431 ? -31.530 36.964  -55.911  1.00 55.59  ? 425 ARG B C     1 
ATOM   7315 O O     . ARG B 1 431 ? -30.959 36.448  -56.884  1.00 53.71  ? 425 ARG B O     1 
ATOM   7316 C CB    . ARG B 1 431 ? -31.763 35.604  -53.736  1.00 50.15  ? 425 ARG B CB    1 
ATOM   7317 C CG    . ARG B 1 431 ? -32.746 34.930  -52.795  1.00 53.15  ? 425 ARG B CG    1 
ATOM   7318 C CD    . ARG B 1 431 ? -32.142 34.473  -51.503  1.00 61.27  ? 425 ARG B CD    1 
ATOM   7319 N NE    . ARG B 1 431 ? -33.101 33.669  -50.738  1.00 73.74  ? 425 ARG B NE    1 
ATOM   7320 C CZ    . ARG B 1 431 ? -32.865 33.148  -49.535  1.00 87.88  ? 425 ARG B CZ    1 
ATOM   7321 N NH1   . ARG B 1 431 ? -31.694 33.337  -48.938  1.00 70.12  ? 425 ARG B NH1   1 
ATOM   7322 N NH2   . ARG B 1 431 ? -33.798 32.432  -48.921  1.00 77.20  ? 425 ARG B NH2   1 
ATOM   7323 N N     . PRO B 1 432 ? -31.386 38.289  -55.608  1.00 52.46  ? 426 PRO B N     1 
ATOM   7324 C CA    . PRO B 1 432 ? -30.546 39.153  -56.460  1.00 52.05  ? 426 PRO B CA    1 
ATOM   7325 C C     . PRO B 1 432 ? -29.057 38.876  -56.347  1.00 59.20  ? 426 PRO B C     1 
ATOM   7326 O O     . PRO B 1 432 ? -28.597 38.339  -55.334  1.00 60.10  ? 426 PRO B O     1 
ATOM   7327 C CB    . PRO B 1 432 ? -30.860 40.567  -55.961  1.00 54.23  ? 426 PRO B CB    1 
ATOM   7328 C CG    . PRO B 1 432 ? -32.043 40.431  -55.101  1.00 59.16  ? 426 PRO B CG    1 
ATOM   7329 C CD    . PRO B 1 432 ? -31.994 39.068  -54.519  1.00 54.45  ? 426 PRO B CD    1 
ATOM   7330 N N     . ILE B 1 433 ? -28.295 39.276  -57.374  1.00 56.91  ? 427 ILE B N     1 
ATOM   7331 C CA    . ILE B 1 433 ? -26.840 39.129  -57.375  1.00 57.07  ? 427 ILE B CA    1 
ATOM   7332 C C     . ILE B 1 433 ? -26.196 40.072  -56.358  1.00 63.16  ? 427 ILE B C     1 
ATOM   7333 O O     . ILE B 1 433 ? -25.171 39.716  -55.779  1.00 62.37  ? 427 ILE B O     1 
ATOM   7334 C CB    . ILE B 1 433 ? -26.245 39.247  -58.800  1.00 59.56  ? 427 ILE B CB    1 
ATOM   7335 C CG1   . ILE B 1 433 ? -26.636 37.972  -59.626  1.00 58.97  ? 427 ILE B CG1   1 
ATOM   7336 C CG2   . ILE B 1 433 ? -24.709 39.493  -58.771  1.00 59.97  ? 427 ILE B CG2   1 
ATOM   7337 C CD1   . ILE B 1 433 ? -25.822 37.614  -60.862  1.00 65.63  ? 427 ILE B CD1   1 
ATOM   7338 N N     . GLU B 1 434 ? -26.817 41.256  -56.116  1.00 62.43  ? 428 GLU B N     1 
ATOM   7339 C CA    . GLU B 1 434 ? -26.323 42.240  -55.145  1.00 64.37  ? 428 GLU B CA    1 
ATOM   7340 C C     . GLU B 1 434 ? -26.561 41.748  -53.721  1.00 71.41  ? 428 GLU B C     1 
ATOM   7341 O O     . GLU B 1 434 ? -27.699 41.773  -53.240  1.00 71.92  ? 428 GLU B O     1 
ATOM   7342 C CB    . GLU B 1 434 ? -26.972 43.608  -55.356  1.00 66.64  ? 428 GLU B CB    1 
ATOM   7343 N N     . GLY B 1 435 ? -25.482 41.281  -53.085  1.00 68.94  ? 429 GLY B N     1 
ATOM   7344 C CA    . GLY B 1 435 ? -25.490 40.730  -51.733  1.00 69.82  ? 429 GLY B CA    1 
ATOM   7345 C C     . GLY B 1 435 ? -25.451 39.217  -51.729  1.00 74.38  ? 429 GLY B C     1 
ATOM   7346 O O     . GLY B 1 435 ? -25.663 38.601  -50.682  1.00 75.22  ? 429 GLY B O     1 
ATOM   7347 N N     . GLN B 1 436 ? -25.172 38.621  -52.921  1.00 69.37  ? 430 GLN B N     1 
ATOM   7348 C CA    . GLN B 1 436 ? -25.071 37.192  -53.232  1.00 67.48  ? 430 GLN B CA    1 
ATOM   7349 C C     . GLN B 1 436 ? -24.407 36.409  -52.101  1.00 70.36  ? 430 GLN B C     1 
ATOM   7350 O O     . GLN B 1 436 ? -25.052 35.585  -51.457  1.00 69.84  ? 430 GLN B O     1 
ATOM   7351 C CB    . GLN B 1 436 ? -24.220 37.006  -54.509  1.00 67.61  ? 430 GLN B CB    1 
ATOM   7352 C CG    . GLN B 1 436 ? -24.928 36.405  -55.714  1.00 80.59  ? 430 GLN B CG    1 
ATOM   7353 C CD    . GLN B 1 436 ? -23.978 36.031  -56.847  1.00 92.39  ? 430 GLN B CD    1 
ATOM   7354 O OE1   . GLN B 1 436 ? -22.753 36.031  -56.687  1.00 89.22  ? 430 GLN B OE1   1 
ATOM   7355 N NE2   . GLN B 1 436 ? -24.522 35.662  -58.020  1.00 70.89  ? 430 GLN B NE2   1 
ATOM   7356 N N     . ILE B 1 437 ? -23.130 36.705  -51.848  1.00 66.64  ? 431 ILE B N     1 
ATOM   7357 C CA    . ILE B 1 437 ? -22.282 36.007  -50.896  1.00 66.46  ? 431 ILE B CA    1 
ATOM   7358 C C     . ILE B 1 437 ? -22.765 36.089  -49.445  1.00 71.55  ? 431 ILE B C     1 
ATOM   7359 O O     . ILE B 1 437 ? -23.043 35.046  -48.856  1.00 69.92  ? 431 ILE B O     1 
ATOM   7360 C CB    . ILE B 1 437 ? -20.764 36.291  -51.131  1.00 69.11  ? 431 ILE B CB    1 
ATOM   7361 C CG1   . ILE B 1 437 ? -20.322 35.905  -52.575  1.00 67.77  ? 431 ILE B CG1   1 
ATOM   7362 C CG2   . ILE B 1 437 ? -19.885 35.551  -50.135  1.00 69.88  ? 431 ILE B CG2   1 
ATOM   7363 C CD1   . ILE B 1 437 ? -20.368 36.993  -53.588  1.00 74.21  ? 431 ILE B CD1   1 
ATOM   7364 N N     . ASP B 1 438 ? -22.933 37.305  -48.892  1.00 70.80  ? 432 ASP B N     1 
ATOM   7365 C CA    . ASP B 1 438 ? -23.402 37.514  -47.505  1.00 72.62  ? 432 ASP B CA    1 
ATOM   7366 C C     . ASP B 1 438 ? -24.654 36.696  -47.203  1.00 73.93  ? 432 ASP B C     1 
ATOM   7367 O O     . ASP B 1 438 ? -24.773 36.115  -46.122  1.00 74.06  ? 432 ASP B O     1 
ATOM   7368 C CB    . ASP B 1 438 ? -23.700 39.002  -47.240  1.00 76.49  ? 432 ASP B CB    1 
ATOM   7369 C CG    . ASP B 1 438 ? -22.580 39.934  -47.630  1.00 94.15  ? 432 ASP B CG    1 
ATOM   7370 O OD1   . ASP B 1 438 ? -21.881 40.433  -46.715  1.00 96.79  ? 432 ASP B OD1   1 
ATOM   7371 O OD2   . ASP B 1 438 ? -22.393 40.158  -48.858  1.00 101.59 ? 432 ASP B OD2   1 
ATOM   7372 N N     . ASP B 1 439 ? -25.575 36.655  -48.185  1.00 68.10  ? 433 ASP B N     1 
ATOM   7373 C CA    . ASP B 1 439 ? -26.843 35.942  -48.134  1.00 67.07  ? 433 ASP B CA    1 
ATOM   7374 C C     . ASP B 1 439 ? -26.600 34.440  -48.066  1.00 68.00  ? 433 ASP B C     1 
ATOM   7375 O O     . ASP B 1 439 ? -27.132 33.761  -47.180  1.00 67.46  ? 433 ASP B O     1 
ATOM   7376 C CB    . ASP B 1 439 ? -27.707 36.314  -49.354  1.00 67.70  ? 433 ASP B CB    1 
ATOM   7377 C CG    . ASP B 1 439 ? -29.108 35.777  -49.258  1.00 78.98  ? 433 ASP B CG    1 
ATOM   7378 O OD1   . ASP B 1 439 ? -29.945 36.420  -48.574  1.00 82.23  ? 433 ASP B OD1   1 
ATOM   7379 O OD2   . ASP B 1 439 ? -29.357 34.682  -49.803  1.00 81.13  ? 433 ASP B OD2   1 
ATOM   7380 N N     . LEU B 1 440 ? -25.770 33.941  -48.994  1.00 62.20  ? 434 LEU B N     1 
ATOM   7381 C CA    . LEU B 1 440 ? -25.370 32.550  -49.088  1.00 60.47  ? 434 LEU B CA    1 
ATOM   7382 C C     . LEU B 1 440 ? -24.693 32.142  -47.773  1.00 65.81  ? 434 LEU B C     1 
ATOM   7383 O O     . LEU B 1 440 ? -25.081 31.113  -47.214  1.00 67.29  ? 434 LEU B O     1 
ATOM   7384 C CB    . LEU B 1 440 ? -24.439 32.364  -50.302  1.00 58.70  ? 434 LEU B CB    1 
ATOM   7385 C CG    . LEU B 1 440 ? -23.691 31.038  -50.420  1.00 62.06  ? 434 LEU B CG    1 
ATOM   7386 C CD1   . LEU B 1 440 ? -24.649 29.883  -50.631  1.00 61.58  ? 434 LEU B CD1   1 
ATOM   7387 C CD2   . LEU B 1 440 ? -22.641 31.095  -51.516  1.00 61.99  ? 434 LEU B CD2   1 
ATOM   7388 N N     . ILE B 1 441 ? -23.749 32.988  -47.252  1.00 60.74  ? 435 ILE B N     1 
ATOM   7389 C CA    . ILE B 1 441 ? -23.003 32.804  -45.993  1.00 60.94  ? 435 ILE B CA    1 
ATOM   7390 C C     . ILE B 1 441 ? -23.959 32.560  -44.820  1.00 63.62  ? 435 ILE B C     1 
ATOM   7391 O O     . ILE B 1 441 ? -23.789 31.588  -44.087  1.00 62.11  ? 435 ILE B O     1 
ATOM   7392 C CB    . ILE B 1 441 ? -22.028 33.997  -45.730  1.00 65.20  ? 435 ILE B CB    1 
ATOM   7393 C CG1   . ILE B 1 441 ? -20.884 34.104  -46.775  1.00 64.46  ? 435 ILE B CG1   1 
ATOM   7394 C CG2   . ILE B 1 441 ? -21.506 34.052  -44.281  1.00 68.14  ? 435 ILE B CG2   1 
ATOM   7395 C CD1   . ILE B 1 441 ? -19.829 33.024  -46.804  1.00 71.08  ? 435 ILE B CD1   1 
ATOM   7396 N N     . GLY B 1 442 ? -24.968 33.421  -44.697  1.00 61.91  ? 436 GLY B N     1 
ATOM   7397 C CA    . GLY B 1 442 ? -26.006 33.331  -43.675  1.00 63.63  ? 436 GLY B CA    1 
ATOM   7398 C C     . GLY B 1 442 ? -26.799 32.038  -43.745  1.00 67.81  ? 436 GLY B C     1 
ATOM   7399 O O     . GLY B 1 442 ? -27.123 31.451  -42.706  1.00 68.61  ? 436 GLY B O     1 
ATOM   7400 N N     . GLU B 1 443 ? -27.089 31.577  -44.989  1.00 62.49  ? 437 GLU B N     1 
ATOM   7401 C CA    . GLU B 1 443 ? -27.807 30.336  -45.274  1.00 60.98  ? 437 GLU B CA    1 
ATOM   7402 C C     . GLU B 1 443 ? -26.933 29.129  -44.918  1.00 63.87  ? 437 GLU B C     1 
ATOM   7403 O O     . GLU B 1 443 ? -27.432 28.187  -44.294  1.00 63.67  ? 437 GLU B O     1 
ATOM   7404 C CB    . GLU B 1 443 ? -28.268 30.288  -46.745  1.00 60.51  ? 437 GLU B CB    1 
ATOM   7405 C CG    . GLU B 1 443 ? -29.404 31.244  -47.093  1.00 70.20  ? 437 GLU B CG    1 
ATOM   7406 C CD    . GLU B 1 443 ? -30.790 30.950  -46.542  1.00 95.43  ? 437 GLU B CD    1 
ATOM   7407 O OE1   . GLU B 1 443 ? -31.660 31.846  -46.634  1.00 94.32  ? 437 GLU B OE1   1 
ATOM   7408 O OE2   . GLU B 1 443 ? -31.016 29.830  -46.030  1.00 89.86  ? 437 GLU B OE2   1 
ATOM   7409 N N     . ILE B 1 444 ? -25.620 29.175  -45.279  1.00 60.00  ? 438 ILE B N     1 
ATOM   7410 C CA    . ILE B 1 444 ? -24.670 28.097  -44.959  1.00 59.62  ? 438 ILE B CA    1 
ATOM   7411 C C     . ILE B 1 444 ? -24.546 27.996  -43.437  1.00 65.35  ? 438 ILE B C     1 
ATOM   7412 O O     . ILE B 1 444 ? -24.753 26.913  -42.892  1.00 65.17  ? 438 ILE B O     1 
ATOM   7413 C CB    . ILE B 1 444 ? -23.295 28.314  -45.621  1.00 58.86  ? 438 ILE B CB    1 
ATOM   7414 N N     . GLN B 1 445 ? -24.303 29.135  -42.754  1.00 63.57  ? 439 GLN B N     1 
ATOM   7415 C CA    . GLN B 1 445 ? -24.172 29.204  -41.290  1.00 65.85  ? 439 GLN B CA    1 
ATOM   7416 C C     . GLN B 1 445 ? -25.375 28.579  -40.557  1.00 70.26  ? 439 GLN B C     1 
ATOM   7417 O O     . GLN B 1 445 ? -25.192 27.828  -39.587  1.00 71.36  ? 439 GLN B O     1 
ATOM   7418 C CB    . GLN B 1 445 ? -23.938 30.654  -40.823  1.00 68.41  ? 439 GLN B CB    1 
ATOM   7419 C CG    . GLN B 1 445 ? -22.517 31.175  -41.065  1.00 79.04  ? 439 GLN B CG    1 
ATOM   7420 C CD    . GLN B 1 445 ? -22.313 32.636  -40.714  1.00 97.49  ? 439 GLN B CD    1 
ATOM   7421 O OE1   . GLN B 1 445 ? -21.220 33.040  -40.313  1.00 91.70  ? 439 GLN B OE1   1 
ATOM   7422 N NE2   . GLN B 1 445 ? -23.331 33.477  -40.889  1.00 93.54  ? 439 GLN B NE2   1 
ATOM   7423 N N     . ALA B 1 446 ? -26.586 28.858  -41.067  1.00 65.40  ? 440 ALA B N     1 
ATOM   7424 C CA    . ALA B 1 446 ? -27.860 28.363  -40.557  1.00 66.46  ? 440 ALA B CA    1 
ATOM   7425 C C     . ALA B 1 446 ? -28.006 26.848  -40.710  1.00 69.95  ? 440 ALA B C     1 
ATOM   7426 O O     . ALA B 1 446 ? -28.604 26.195  -39.845  1.00 70.05  ? 440 ALA B O     1 
ATOM   7427 C CB    . ALA B 1 446 ? -29.001 29.059  -41.283  1.00 66.97  ? 440 ALA B CB    1 
ATOM   7428 N N     . ARG B 1 447 ? -27.483 26.296  -41.825  1.00 65.75  ? 441 ARG B N     1 
ATOM   7429 C CA    . ARG B 1 447 ? -27.559 24.856  -42.086  1.00 65.15  ? 441 ARG B CA    1 
ATOM   7430 C C     . ARG B 1 447 ? -26.636 24.061  -41.174  1.00 68.39  ? 441 ARG B C     1 
ATOM   7431 O O     . ARG B 1 447 ? -26.964 22.926  -40.828  1.00 68.21  ? 441 ARG B O     1 
ATOM   7432 C CB    . ARG B 1 447 ? -27.295 24.512  -43.566  1.00 62.92  ? 441 ARG B CB    1 
ATOM   7433 C CG    . ARG B 1 447 ? -28.306 25.049  -44.572  1.00 66.14  ? 441 ARG B CG    1 
ATOM   7434 C CD    . ARG B 1 447 ? -29.752 24.768  -44.204  1.00 71.95  ? 441 ARG B CD    1 
ATOM   7435 N NE    . ARG B 1 447 ? -30.690 24.984  -45.313  1.00 76.44  ? 441 ARG B NE    1 
ATOM   7436 C CZ    . ARG B 1 447 ? -30.982 26.167  -45.853  1.00 82.56  ? 441 ARG B CZ    1 
ATOM   7437 N NH1   . ARG B 1 447 ? -30.371 27.270  -45.431  1.00 56.75  ? 441 ARG B NH1   1 
ATOM   7438 N NH2   . ARG B 1 447 ? -31.868 26.251  -46.835  1.00 72.94  ? 441 ARG B NH2   1 
ATOM   7439 N N     . ILE B 1 448 ? -25.491 24.655  -40.784  1.00 64.67  ? 442 ILE B N     1 
ATOM   7440 C CA    . ILE B 1 448 ? -24.515 24.027  -39.888  1.00 65.59  ? 442 ILE B CA    1 
ATOM   7441 C C     . ILE B 1 448 ? -25.160 23.795  -38.533  1.00 70.05  ? 442 ILE B C     1 
ATOM   7442 O O     . ILE B 1 448 ? -25.046 22.697  -37.985  1.00 69.15  ? 442 ILE B O     1 
ATOM   7443 C CB    . ILE B 1 448 ? -23.188 24.831  -39.792  1.00 68.93  ? 442 ILE B CB    1 
ATOM   7444 C CG1   . ILE B 1 448 ? -22.522 24.958  -41.182  1.00 67.55  ? 442 ILE B CG1   1 
ATOM   7445 C CG2   . ILE B 1 448 ? -22.226 24.172  -38.788  1.00 70.72  ? 442 ILE B CG2   1 
ATOM   7446 C CD1   . ILE B 1 448 ? -21.707 26.203  -41.381  1.00 75.91  ? 442 ILE B CD1   1 
ATOM   7447 N N     . GLU B 1 449 ? -25.891 24.812  -38.040  1.00 68.30  ? 443 GLU B N     1 
ATOM   7448 C CA    . GLU B 1 449 ? -26.639 24.780  -36.777  1.00 70.72  ? 443 GLU B CA    1 
ATOM   7449 C C     . GLU B 1 449 ? -27.691 23.649  -36.778  1.00 73.21  ? 443 GLU B C     1 
ATOM   7450 O O     . GLU B 1 449 ? -27.886 22.993  -35.754  1.00 74.49  ? 443 GLU B O     1 
ATOM   7451 C CB    . GLU B 1 449 ? -27.298 26.149  -36.495  1.00 73.10  ? 443 GLU B CB    1 
ATOM   7452 C CG    . GLU B 1 449 ? -26.293 27.275  -36.272  1.00 86.96  ? 443 GLU B CG    1 
ATOM   7453 C CD    . GLU B 1 449 ? -26.153 27.779  -34.846  1.00 123.11 ? 443 GLU B CD    1 
ATOM   7454 O OE1   . GLU B 1 449 ? -26.162 26.950  -33.906  1.00 127.93 ? 443 GLU B OE1   1 
ATOM   7455 O OE2   . GLU B 1 449 ? -26.006 29.011  -34.670  1.00 120.20 ? 443 GLU B OE2   1 
ATOM   7456 N N     . ARG B 1 450 ? -28.325 23.401  -37.937  1.00 66.55  ? 444 ARG B N     1 
ATOM   7457 C CA    . ARG B 1 450 ? -29.338 22.363  -38.079  1.00 65.73  ? 444 ARG B CA    1 
ATOM   7458 C C     . ARG B 1 450 ? -28.744 20.976  -38.486  1.00 70.99  ? 444 ARG B C     1 
ATOM   7459 O O     . ARG B 1 450 ? -29.499 20.010  -38.630  1.00 70.91  ? 444 ARG B O     1 
ATOM   7460 C CB    . ARG B 1 450 ? -30.445 22.856  -39.034  1.00 60.66  ? 444 ARG B CB    1 
ATOM   7461 N N     . ASN B 1 451 ? -27.387 20.872  -38.608  1.00 68.01  ? 445 ASN B N     1 
ATOM   7462 C CA    . ASN B 1 451 ? -26.620 19.680  -39.038  1.00 67.39  ? 445 ASN B CA    1 
ATOM   7463 C C     . ASN B 1 451 ? -27.028 19.216  -40.439  1.00 73.04  ? 445 ASN B C     1 
ATOM   7464 O O     . ASN B 1 451 ? -27.331 18.040  -40.674  1.00 74.36  ? 445 ASN B O     1 
ATOM   7465 C CB    . ASN B 1 451 ? -26.637 18.533  -38.021  1.00 68.46  ? 445 ASN B CB    1 
ATOM   7466 C CG    . ASN B 1 451 ? -25.658 17.424  -38.349  1.00 102.66 ? 445 ASN B CG    1 
ATOM   7467 O OD1   . ASN B 1 451 ? -24.467 17.651  -38.595  1.00 97.57  ? 445 ASN B OD1   1 
ATOM   7468 N ND2   . ASN B 1 451 ? -26.156 16.200  -38.428  1.00 99.24  ? 445 ASN B ND2   1 
ATOM   7469 N N     . GLU B 1 452 ? -27.049 20.165  -41.374  1.00 68.15  ? 446 GLU B N     1 
ATOM   7470 C CA    . GLU B 1 452 ? -27.398 19.915  -42.763  1.00 65.70  ? 446 GLU B CA    1 
ATOM   7471 C C     . GLU B 1 452 ? -26.191 20.325  -43.626  1.00 67.16  ? 446 GLU B C     1 
ATOM   7472 O O     . GLU B 1 452 ? -25.301 21.037  -43.134  1.00 66.14  ? 446 GLU B O     1 
ATOM   7473 C CB    . GLU B 1 452 ? -28.674 20.693  -43.118  1.00 66.91  ? 446 GLU B CB    1 
ATOM   7474 N N     . ARG B 1 453 ? -26.112 19.825  -44.872  1.00 61.89  ? 447 ARG B N     1 
ATOM   7475 C CA    . ARG B 1 453 ? -24.988 20.191  -45.735  1.00 60.09  ? 447 ARG B CA    1 
ATOM   7476 C C     . ARG B 1 453 ? -25.454 21.075  -46.885  1.00 61.25  ? 447 ARG B C     1 
ATOM   7477 O O     . ARG B 1 453 ? -26.663 21.151  -47.132  1.00 60.96  ? 447 ARG B O     1 
ATOM   7478 C CB    . ARG B 1 453 ? -24.173 18.967  -46.232  1.00 60.46  ? 447 ARG B CB    1 
ATOM   7479 C CG    . ARG B 1 453 ? -23.901 17.842  -45.208  1.00 68.46  ? 447 ARG B CG    1 
ATOM   7480 C CD    . ARG B 1 453 ? -23.021 18.221  -44.033  1.00 69.08  ? 447 ARG B CD    1 
ATOM   7481 N NE    . ARG B 1 453 ? -22.784 17.064  -43.170  1.00 70.81  ? 447 ARG B NE    1 
ATOM   7482 C CZ    . ARG B 1 453 ? -23.467 16.788  -42.062  1.00 82.83  ? 447 ARG B CZ    1 
ATOM   7483 N NH1   . ARG B 1 453 ? -24.436 17.597  -41.650  1.00 61.41  ? 447 ARG B NH1   1 
ATOM   7484 N NH2   . ARG B 1 453 ? -23.180 15.704  -41.354  1.00 76.37  ? 447 ARG B NH2   1 
ATOM   7485 N N     . VAL B 1 454 ? -24.497 21.787  -47.545  1.00 55.44  ? 448 VAL B N     1 
ATOM   7486 C CA    . VAL B 1 454 ? -24.742 22.691  -48.684  1.00 53.37  ? 448 VAL B CA    1 
ATOM   7487 C C     . VAL B 1 454 ? -23.874 22.305  -49.902  1.00 56.01  ? 448 VAL B C     1 
ATOM   7488 O O     . VAL B 1 454 ? -22.721 21.884  -49.741  1.00 55.23  ? 448 VAL B O     1 
ATOM   7489 C CB    . VAL B 1 454 ? -24.584 24.211  -48.337  1.00 56.30  ? 448 VAL B CB    1 
ATOM   7490 C CG1   . VAL B 1 454 ? -25.074 25.092  -49.486  1.00 54.96  ? 448 VAL B CG1   1 
ATOM   7491 C CG2   . VAL B 1 454 ? -25.311 24.586  -47.047  1.00 57.26  ? 448 VAL B CG2   1 
ATOM   7492 N N     . LEU B 1 455 ? -24.441 22.466  -51.117  1.00 51.56  ? 449 LEU B N     1 
ATOM   7493 C CA    . LEU B 1 455 ? -23.746 22.259  -52.383  1.00 50.48  ? 449 LEU B CA    1 
ATOM   7494 C C     . LEU B 1 455 ? -23.868 23.545  -53.163  1.00 53.00  ? 449 LEU B C     1 
ATOM   7495 O O     . LEU B 1 455 ? -24.985 24.022  -53.377  1.00 52.95  ? 449 LEU B O     1 
ATOM   7496 C CB    . LEU B 1 455 ? -24.330 21.092  -53.205  1.00 50.35  ? 449 LEU B CB    1 
ATOM   7497 C CG    . LEU B 1 455 ? -24.376 19.691  -52.572  1.00 56.35  ? 449 LEU B CG    1 
ATOM   7498 C CD1   . LEU B 1 455 ? -25.022 18.693  -53.514  1.00 56.77  ? 449 LEU B CD1   1 
ATOM   7499 C CD2   . LEU B 1 455 ? -23.005 19.188  -52.204  1.00 58.43  ? 449 LEU B CD2   1 
ATOM   7500 N N     . VAL B 1 456 ? -22.727 24.137  -53.549  1.00 49.15  ? 450 VAL B N     1 
ATOM   7501 C CA    . VAL B 1 456 ? -22.708 25.389  -54.314  1.00 48.83  ? 450 VAL B CA    1 
ATOM   7502 C C     . VAL B 1 456 ? -22.102 25.206  -55.704  1.00 51.02  ? 450 VAL B C     1 
ATOM   7503 O O     . VAL B 1 456 ? -21.078 24.535  -55.850  1.00 50.05  ? 450 VAL B O     1 
ATOM   7504 C CB    . VAL B 1 456 ? -22.196 26.657  -53.542  1.00 53.24  ? 450 VAL B CB    1 
ATOM   7505 C CG1   . VAL B 1 456 ? -21.935 26.397  -52.070  1.00 53.72  ? 450 VAL B CG1   1 
ATOM   7506 C CG2   . VAL B 1 456 ? -21.035 27.362  -54.225  1.00 52.74  ? 450 VAL B CG2   1 
ATOM   7507 N N     . THR B 1 457 ? -22.765 25.784  -56.707  1.00 46.25  ? 451 THR B N     1 
ATOM   7508 C CA    . THR B 1 457 ? -22.324 25.730  -58.082  1.00 45.36  ? 451 THR B CA    1 
ATOM   7509 C C     . THR B 1 457 ? -21.977 27.097  -58.578  1.00 51.84  ? 451 THR B C     1 
ATOM   7510 O O     . THR B 1 457 ? -22.775 28.013  -58.418  1.00 52.46  ? 451 THR B O     1 
ATOM   7511 C CB    . THR B 1 457 ? -23.298 24.932  -58.968  1.00 55.19  ? 451 THR B CB    1 
ATOM   7512 O OG1   . THR B 1 457 ? -23.022 25.168  -60.348  1.00 59.00  ? 451 THR B OG1   1 
ATOM   7513 C CG2   . THR B 1 457 ? -24.742 25.231  -58.686  1.00 54.77  ? 451 THR B CG2   1 
ATOM   7514 N N     . THR B 1 458 ? -20.769 27.253  -59.142  1.00 51.02  ? 452 THR B N     1 
ATOM   7515 C CA    . THR B 1 458 ? -20.312 28.517  -59.748  1.00 52.89  ? 452 THR B CA    1 
ATOM   7516 C C     . THR B 1 458 ? -20.149 28.293  -61.272  1.00 59.46  ? 452 THR B C     1 
ATOM   7517 O O     . THR B 1 458 ? -20.475 27.206  -61.752  1.00 59.86  ? 452 THR B O     1 
ATOM   7518 C CB    . THR B 1 458 ? -19.037 29.079  -59.065  1.00 63.83  ? 452 THR B CB    1 
ATOM   7519 O OG1   . THR B 1 458 ? -17.880 28.498  -59.649  1.00 68.85  ? 452 THR B OG1   1 
ATOM   7520 C CG2   . THR B 1 458 ? -19.022 28.897  -57.554  1.00 60.87  ? 452 THR B CG2   1 
ATOM   7521 N N     . LEU B 1 459 ? -19.684 29.298  -62.037  1.00 57.65  ? 453 LEU B N     1 
ATOM   7522 C CA    . LEU B 1 459 ? -19.468 29.096  -63.473  1.00 57.69  ? 453 LEU B CA    1 
ATOM   7523 C C     . LEU B 1 459 ? -18.011 28.829  -63.713  1.00 65.27  ? 453 LEU B C     1 
ATOM   7524 O O     . LEU B 1 459 ? -17.672 27.874  -64.396  1.00 65.42  ? 453 LEU B O     1 
ATOM   7525 C CB    . LEU B 1 459 ? -19.834 30.319  -64.316  1.00 57.53  ? 453 LEU B CB    1 
ATOM   7526 C CG    . LEU B 1 459 ? -21.273 30.625  -64.606  1.00 61.53  ? 453 LEU B CG    1 
ATOM   7527 C CD1   . LEU B 1 459 ? -21.357 31.972  -65.238  1.00 61.72  ? 453 LEU B CD1   1 
ATOM   7528 C CD2   . LEU B 1 459 ? -21.920 29.573  -65.544  1.00 62.63  ? 453 LEU B CD2   1 
ATOM   7529 N N     . THR B 1 460 ? -17.157 29.729  -63.225  1.00 64.33  ? 454 THR B N     1 
ATOM   7530 C CA    . THR B 1 460 ? -15.726 29.689  -63.451  1.00 65.41  ? 454 THR B CA    1 
ATOM   7531 C C     . THR B 1 460 ? -15.008 29.068  -62.279  1.00 71.15  ? 454 THR B C     1 
ATOM   7532 O O     . THR B 1 460 ? -15.540 29.065  -61.165  1.00 71.61  ? 454 THR B O     1 
ATOM   7533 C CB    . THR B 1 460 ? -15.209 31.104  -63.836  1.00 79.77  ? 454 THR B CB    1 
ATOM   7534 O OG1   . THR B 1 460 ? -14.345 31.649  -62.828  1.00 85.21  ? 454 THR B OG1   1 
ATOM   7535 C CG2   . THR B 1 460 ? -16.343 32.090  -64.192  1.00 76.23  ? 454 THR B CG2   1 
ATOM   7536 N N     . LYS B 1 461 ? -13.784 28.558  -62.522  1.00 67.97  ? 455 LYS B N     1 
ATOM   7537 C CA    . LYS B 1 461 ? -12.960 27.986  -61.455  1.00 67.52  ? 455 LYS B CA    1 
ATOM   7538 C C     . LYS B 1 461 ? -12.464 29.099  -60.526  1.00 70.75  ? 455 LYS B C     1 
ATOM   7539 O O     . LYS B 1 461 ? -12.249 28.805  -59.350  1.00 72.30  ? 455 LYS B O     1 
ATOM   7540 C CB    . LYS B 1 461 ? -11.786 27.198  -62.026  1.00 67.81  ? 455 LYS B CB    1 
ATOM   7541 N N     . LYS B 1 462 ? -12.312 30.374  -61.033  1.00 63.78  ? 456 LYS B N     1 
ATOM   7542 C CA    . LYS B 1 462 ? -11.881 31.514  -60.211  1.00 63.38  ? 456 LYS B CA    1 
ATOM   7543 C C     . LYS B 1 462 ? -12.871 31.669  -59.083  1.00 66.14  ? 456 LYS B C     1 
ATOM   7544 O O     . LYS B 1 462 ? -12.529 31.350  -57.949  1.00 65.44  ? 456 LYS B O     1 
ATOM   7545 C CB    . LYS B 1 462 ? -11.816 32.788  -61.035  1.00 64.43  ? 456 LYS B CB    1 
ATOM   7546 N N     . MET B 1 463 ? -14.140 32.000  -59.425  1.00 63.10  ? 457 MET B N     1 
ATOM   7547 C CA    . MET B 1 463 ? -15.307 32.154  -58.537  1.00 62.95  ? 457 MET B CA    1 
ATOM   7548 C C     . MET B 1 463 ? -15.392 31.006  -57.501  1.00 65.22  ? 457 MET B C     1 
ATOM   7549 O O     . MET B 1 463 ? -15.601 31.255  -56.311  1.00 64.06  ? 457 MET B O     1 
ATOM   7550 C CB    . MET B 1 463 ? -16.589 32.222  -59.375  1.00 63.00  ? 457 MET B CB    1 
ATOM   7551 N N     . SER B 1 464 ? -15.145 29.763  -57.968  1.00 61.20  ? 458 SER B N     1 
ATOM   7552 C CA    . SER B 1 464 ? -15.128 28.538  -57.177  1.00 60.53  ? 458 SER B CA    1 
ATOM   7553 C C     . SER B 1 464 ? -13.952 28.518  -56.197  1.00 66.29  ? 458 SER B C     1 
ATOM   7554 O O     . SER B 1 464 ? -14.183 28.347  -55.001  1.00 66.55  ? 458 SER B O     1 
ATOM   7555 C CB    . SER B 1 464 ? -15.100 27.322  -58.093  1.00 60.83  ? 458 SER B CB    1 
ATOM   7556 O OG    . SER B 1 464 ? -16.400 26.776  -58.221  1.00 64.86  ? 458 SER B OG    1 
ATOM   7557 N N     . GLU B 1 465 ? -12.701 28.727  -56.693  1.00 63.44  ? 459 GLU B N     1 
ATOM   7558 C CA    . GLU B 1 465 ? -11.484 28.762  -55.868  1.00 63.73  ? 459 GLU B CA    1 
ATOM   7559 C C     . GLU B 1 465 ? -11.566 29.917  -54.852  1.00 67.38  ? 459 GLU B C     1 
ATOM   7560 O O     . GLU B 1 465 ? -11.250 29.723  -53.673  1.00 68.70  ? 459 GLU B O     1 
ATOM   7561 C CB    . GLU B 1 465 ? -10.250 28.915  -56.749  1.00 64.27  ? 459 GLU B CB    1 
ATOM   7562 N N     . ASP B 1 466 ? -12.074 31.083  -55.303  1.00 61.00  ? 460 ASP B N     1 
ATOM   7563 C CA    . ASP B 1 466 ? -12.223 32.301  -54.516  1.00 60.87  ? 460 ASP B CA    1 
ATOM   7564 C C     . ASP B 1 466 ? -13.221 32.157  -53.381  1.00 62.62  ? 460 ASP B C     1 
ATOM   7565 O O     . ASP B 1 466 ? -12.931 32.642  -52.282  1.00 63.61  ? 460 ASP B O     1 
ATOM   7566 C CB    . ASP B 1 466 ? -12.560 33.508  -55.414  1.00 63.06  ? 460 ASP B CB    1 
ATOM   7567 C CG    . ASP B 1 466 ? -11.522 33.843  -56.484  1.00 83.94  ? 460 ASP B CG    1 
ATOM   7568 O OD1   . ASP B 1 466 ? -10.318 33.535  -56.269  1.00 86.80  ? 460 ASP B OD1   1 
ATOM   7569 O OD2   . ASP B 1 466 ? -11.917 34.399  -57.551  1.00 94.15  ? 460 ASP B OD2   1 
ATOM   7570 N N     . LEU B 1 467 ? -14.383 31.483  -53.623  1.00 56.02  ? 461 LEU B N     1 
ATOM   7571 C CA    . LEU B 1 467 ? -15.379 31.297  -52.561  1.00 55.30  ? 461 LEU B CA    1 
ATOM   7572 C C     . LEU B 1 467 ? -14.886 30.286  -51.549  1.00 59.73  ? 461 LEU B C     1 
ATOM   7573 O O     . LEU B 1 467 ? -15.145 30.455  -50.366  1.00 60.14  ? 461 LEU B O     1 
ATOM   7574 C CB    . LEU B 1 467 ? -16.756 30.913  -53.106  1.00 54.61  ? 461 LEU B CB    1 
ATOM   7575 N N     . THR B 1 468 ? -14.133 29.275  -51.991  1.00 57.36  ? 462 THR B N     1 
ATOM   7576 C CA    . THR B 1 468 ? -13.587 28.256  -51.093  1.00 59.26  ? 462 THR B CA    1 
ATOM   7577 C C     . THR B 1 468 ? -12.594 28.905  -50.102  1.00 68.82  ? 462 THR B C     1 
ATOM   7578 O O     . THR B 1 468 ? -12.682 28.678  -48.896  1.00 68.42  ? 462 THR B O     1 
ATOM   7579 C CB    . THR B 1 468 ? -12.936 27.131  -51.911  1.00 61.21  ? 462 THR B CB    1 
ATOM   7580 O OG1   . THR B 1 468 ? -13.794 26.775  -52.981  1.00 55.65  ? 462 THR B OG1   1 
ATOM   7581 C CG2   . THR B 1 468 ? -12.623 25.909  -51.074  1.00 61.30  ? 462 THR B CG2   1 
ATOM   7582 N N     . ASP B 1 469 ? -11.683 29.733  -50.625  1.00 69.70  ? 463 ASP B N     1 
ATOM   7583 C CA    . ASP B 1 469 ? -10.663 30.423  -49.848  1.00 73.29  ? 463 ASP B CA    1 
ATOM   7584 C C     . ASP B 1 469 ? -11.277 31.397  -48.817  1.00 80.56  ? 463 ASP B C     1 
ATOM   7585 O O     . ASP B 1 469 ? -10.797 31.476  -47.678  1.00 82.59  ? 463 ASP B O     1 
ATOM   7586 C CB    . ASP B 1 469 ? -9.658  31.138  -50.795  1.00 76.10  ? 463 ASP B CB    1 
ATOM   7587 C CG    . ASP B 1 469 ? -8.792  30.233  -51.682  1.00 88.09  ? 463 ASP B CG    1 
ATOM   7588 O OD1   . ASP B 1 469 ? -8.279  29.201  -51.173  1.00 88.48  ? 463 ASP B OD1   1 
ATOM   7589 O OD2   . ASP B 1 469 ? -8.554  30.603  -52.857  1.00 94.16  ? 463 ASP B OD2   1 
ATOM   7590 N N     . TYR B 1 470 ? -12.342 32.117  -49.214  1.00 76.50  ? 464 TYR B N     1 
ATOM   7591 C CA    . TYR B 1 470 ? -13.035 33.056  -48.339  1.00 76.97  ? 464 TYR B CA    1 
ATOM   7592 C C     . TYR B 1 470 ? -13.855 32.309  -47.284  1.00 79.68  ? 464 TYR B C     1 
ATOM   7593 O O     . TYR B 1 470 ? -13.815 32.696  -46.123  1.00 80.50  ? 464 TYR B O     1 
ATOM   7594 C CB    . TYR B 1 470 ? -13.890 34.035  -49.154  1.00 77.85  ? 464 TYR B CB    1 
ATOM   7595 C CG    . TYR B 1 470 ? -14.732 34.987  -48.332  1.00 81.74  ? 464 TYR B CG    1 
ATOM   7596 C CD1   . TYR B 1 470 ? -14.174 35.730  -47.287  1.00 84.61  ? 464 TYR B CD1   1 
ATOM   7597 C CD2   . TYR B 1 470 ? -16.065 35.216  -48.650  1.00 83.05  ? 464 TYR B CD2   1 
ATOM   7598 C CE1   . TYR B 1 470 ? -14.943 36.624  -46.543  1.00 85.74  ? 464 TYR B CE1   1 
ATOM   7599 C CE2   . TYR B 1 470 ? -16.840 36.118  -47.922  1.00 85.56  ? 464 TYR B CE2   1 
ATOM   7600 C CZ    . TYR B 1 470 ? -16.280 36.806  -46.859  1.00 95.85  ? 464 TYR B CZ    1 
ATOM   7601 O OH    . TYR B 1 470 ? -17.064 37.680  -46.146  1.00 102.05 ? 464 TYR B OH    1 
ATOM   7602 N N     . LEU B 1 471 ? -14.561 31.227  -47.669  1.00 74.38  ? 465 LEU B N     1 
ATOM   7603 C CA    . LEU B 1 471 ? -15.341 30.409  -46.736  1.00 74.37  ? 465 LEU B CA    1 
ATOM   7604 C C     . LEU B 1 471 ? -14.421 29.731  -45.706  1.00 80.48  ? 465 LEU B C     1 
ATOM   7605 O O     . LEU B 1 471 ? -14.824 29.579  -44.558  1.00 81.91  ? 465 LEU B O     1 
ATOM   7606 C CB    . LEU B 1 471 ? -16.165 29.366  -47.481  1.00 73.49  ? 465 LEU B CB    1 
ATOM   7607 N N     . LYS B 1 472 ? -13.188 29.344  -46.111  1.00 76.78  ? 466 LYS B N     1 
ATOM   7608 C CA    . LYS B 1 472 ? -12.197 28.738  -45.217  1.00 77.61  ? 466 LYS B CA    1 
ATOM   7609 C C     . LYS B 1 472 ? -11.647 29.791  -44.229  1.00 84.60  ? 466 LYS B C     1 
ATOM   7610 O O     . LYS B 1 472 ? -11.356 29.448  -43.078  1.00 85.81  ? 466 LYS B O     1 
ATOM   7611 C CB    . LYS B 1 472 ? -11.071 28.051  -46.008  1.00 78.50  ? 466 LYS B CB    1 
ATOM   7612 C CG    . LYS B 1 472 ? -11.420 26.627  -46.456  1.00 85.26  ? 466 LYS B CG    1 
ATOM   7613 C CD    . LYS B 1 472 ? -10.166 25.783  -46.770  1.00 87.81  ? 466 LYS B CD    1 
ATOM   7614 C CE    . LYS B 1 472 ? -10.422 24.316  -47.069  1.00 87.65  ? 466 LYS B CE    1 
ATOM   7615 N NZ    . LYS B 1 472 ? -10.754 23.520  -45.851  1.00 90.10  ? 466 LYS B NZ    1 
ATOM   7616 N N     . GLU B 1 473 ? -11.556 31.078  -44.672  1.00 81.35  ? 467 GLU B N     1 
ATOM   7617 C CA    . GLU B 1 473 ? -11.117 32.214  -43.851  1.00 82.59  ? 467 GLU B CA    1 
ATOM   7618 C C     . GLU B 1 473 ? -12.124 32.499  -42.732  1.00 85.83  ? 467 GLU B C     1 
ATOM   7619 O O     . GLU B 1 473 ? -11.709 32.706  -41.593  1.00 88.50  ? 467 GLU B O     1 
ATOM   7620 C CB    . GLU B 1 473 ? -10.883 33.467  -44.699  1.00 84.00  ? 467 GLU B CB    1 
ATOM   7621 C CG    . GLU B 1 473 ? -9.416  33.761  -44.964  1.00 99.53  ? 467 GLU B CG    1 
ATOM   7622 C CD    . GLU B 1 473 ? -9.157  34.981  -45.832  1.00 125.55 ? 467 GLU B CD    1 
ATOM   7623 O OE1   . GLU B 1 473 ? -9.545  34.950  -47.025  1.00 136.05 ? 467 GLU B OE1   1 
ATOM   7624 O OE2   . GLU B 1 473 ? -8.548  35.956  -45.330  1.00 105.80 ? 467 GLU B OE2   1 
ATOM   7625 N N     . ILE B 1 474 ? -13.437 32.463  -43.047  1.00 78.93  ? 468 ILE B N     1 
ATOM   7626 C CA    . ILE B 1 474 ? -14.550 32.638  -42.101  1.00 78.77  ? 468 ILE B CA    1 
ATOM   7627 C C     . ILE B 1 474 ? -14.565 31.496  -41.050  1.00 82.99  ? 468 ILE B C     1 
ATOM   7628 O O     . ILE B 1 474 ? -14.820 31.763  -39.872  1.00 84.62  ? 468 ILE B O     1 
ATOM   7629 C CB    . ILE B 1 474 ? -15.921 32.801  -42.844  1.00 80.20  ? 468 ILE B CB    1 
ATOM   7630 C CG1   . ILE B 1 474 ? -15.891 33.909  -43.931  1.00 79.74  ? 468 ILE B CG1   1 
ATOM   7631 C CG2   . ILE B 1 474 ? -17.099 32.984  -41.886  1.00 81.72  ? 468 ILE B CG2   1 
ATOM   7632 C CD1   . ILE B 1 474 ? -15.506 35.317  -43.467  1.00 92.49  ? 468 ILE B CD1   1 
ATOM   7633 N N     . GLY B 1 475 ? -14.253 30.268  -41.485  1.00 77.27  ? 469 GLY B N     1 
ATOM   7634 C CA    . GLY B 1 475 ? -14.177 29.090  -40.623  1.00 77.25  ? 469 GLY B CA    1 
ATOM   7635 C C     . GLY B 1 475 ? -15.071 27.919  -40.995  1.00 78.64  ? 469 GLY B C     1 
ATOM   7636 O O     . GLY B 1 475 ? -15.181 26.953  -40.237  1.00 77.68  ? 469 GLY B O     1 
ATOM   7637 N N     . ILE B 1 476 ? -15.711 27.992  -42.162  1.00 74.36  ? 470 ILE B N     1 
ATOM   7638 C CA    . ILE B 1 476 ? -16.615 26.961  -42.672  1.00 72.90  ? 470 ILE B CA    1 
ATOM   7639 C C     . ILE B 1 476 ? -15.778 25.808  -43.243  1.00 76.75  ? 470 ILE B C     1 
ATOM   7640 O O     . ILE B 1 476 ? -14.878 26.059  -44.049  1.00 75.85  ? 470 ILE B O     1 
ATOM   7641 C CB    . ILE B 1 476 ? -17.613 27.584  -43.712  1.00 74.20  ? 470 ILE B CB    1 
ATOM   7642 C CG1   . ILE B 1 476 ? -18.446 28.706  -43.095  1.00 74.59  ? 470 ILE B CG1   1 
ATOM   7643 C CG2   . ILE B 1 476 ? -18.552 26.552  -44.285  1.00 75.10  ? 470 ILE B CG2   1 
ATOM   7644 C CD1   . ILE B 1 476 ? -18.214 29.983  -43.695  1.00 77.97  ? 470 ILE B CD1   1 
ATOM   7645 N N     . LYS B 1 477 ? -16.058 24.556  -42.807  1.00 74.00  ? 471 LYS B N     1 
ATOM   7646 C CA    . LYS B 1 477 ? -15.352 23.364  -43.291  1.00 73.51  ? 471 LYS B CA    1 
ATOM   7647 C C     . LYS B 1 477 ? -15.816 23.106  -44.748  1.00 77.77  ? 471 LYS B C     1 
ATOM   7648 O O     . LYS B 1 477 ? -16.958 22.697  -44.983  1.00 77.43  ? 471 LYS B O     1 
ATOM   7649 C CB    . LYS B 1 477 ? -15.630 22.170  -42.376  1.00 74.93  ? 471 LYS B CB    1 
ATOM   7650 N N     . VAL B 1 478 ? -14.951 23.465  -45.725  1.00 74.20  ? 472 VAL B N     1 
ATOM   7651 C CA    . VAL B 1 478 ? -15.256 23.407  -47.163  1.00 72.54  ? 472 VAL B CA    1 
ATOM   7652 C C     . VAL B 1 478 ? -14.278 22.562  -47.988  1.00 74.91  ? 472 VAL B C     1 
ATOM   7653 O O     . VAL B 1 478 ? -13.111 22.385  -47.621  1.00 74.63  ? 472 VAL B O     1 
ATOM   7654 C CB    . VAL B 1 478 ? -15.363 24.854  -47.743  1.00 76.49  ? 472 VAL B CB    1 
ATOM   7655 C CG1   . VAL B 1 478 ? -15.628 24.862  -49.246  1.00 74.69  ? 472 VAL B CG1   1 
ATOM   7656 C CG2   . VAL B 1 478 ? -16.439 25.651  -47.033  1.00 77.28  ? 472 VAL B CG2   1 
ATOM   7657 N N     . ASN B 1 479 ? -14.778 22.071  -49.133  1.00 70.21  ? 473 ASN B N     1 
ATOM   7658 C CA    . ASN B 1 479 ? -14.002 21.381  -50.139  1.00 69.54  ? 473 ASN B CA    1 
ATOM   7659 C C     . ASN B 1 479 ? -14.426 21.797  -51.535  1.00 71.42  ? 473 ASN B C     1 
ATOM   7660 O O     . ASN B 1 479 ? -15.619 21.820  -51.852  1.00 70.83  ? 473 ASN B O     1 
ATOM   7661 C CB    . ASN B 1 479 ? -14.006 19.863  -49.981  1.00 73.04  ? 473 ASN B CB    1 
ATOM   7662 C CG    . ASN B 1 479 ? -12.786 19.243  -50.635  1.00 99.65  ? 473 ASN B CG    1 
ATOM   7663 O OD1   . ASN B 1 479 ? -11.691 19.195  -50.054  1.00 92.57  ? 473 ASN B OD1   1 
ATOM   7664 N ND2   . ASN B 1 479 ? -12.921 18.843  -51.895  1.00 91.19  ? 473 ASN B ND2   1 
ATOM   7665 N N     . TYR B 1 480 ? -13.430 22.152  -52.354  1.00 66.60  ? 474 TYR B N     1 
ATOM   7666 C CA    . TYR B 1 480 ? -13.588 22.548  -53.742  1.00 64.86  ? 474 TYR B CA    1 
ATOM   7667 C C     . TYR B 1 480 ? -13.432 21.295  -54.635  1.00 70.56  ? 474 TYR B C     1 
ATOM   7668 O O     . TYR B 1 480 ? -12.464 20.544  -54.500  1.00 71.40  ? 474 TYR B O     1 
ATOM   7669 C CB    . TYR B 1 480 ? -12.583 23.670  -54.063  1.00 65.20  ? 474 TYR B CB    1 
ATOM   7670 C CG    . TYR B 1 480 ? -12.237 23.890  -55.517  1.00 65.51  ? 474 TYR B CG    1 
ATOM   7671 C CD1   . TYR B 1 480 ? -10.956 23.642  -55.993  1.00 67.92  ? 474 TYR B CD1   1 
ATOM   7672 C CD2   . TYR B 1 480 ? -13.166 24.419  -56.401  1.00 65.39  ? 474 TYR B CD2   1 
ATOM   7673 C CE1   . TYR B 1 480 ? -10.618 23.882  -57.322  1.00 68.83  ? 474 TYR B CE1   1 
ATOM   7674 C CE2   . TYR B 1 480 ? -12.846 24.640  -57.737  1.00 65.72  ? 474 TYR B CE2   1 
ATOM   7675 C CZ    . TYR B 1 480 ? -11.568 24.383  -58.191  1.00 73.79  ? 474 TYR B CZ    1 
ATOM   7676 O OH    . TYR B 1 480 ? -11.245 24.614  -59.502  1.00 75.81  ? 474 TYR B OH    1 
ATOM   7677 N N     . LEU B 1 481 ? -14.420 21.046  -55.498  1.00 66.82  ? 475 LEU B N     1 
ATOM   7678 C CA    . LEU B 1 481 ? -14.429 19.911  -56.410  1.00 65.81  ? 475 LEU B CA    1 
ATOM   7679 C C     . LEU B 1 481 ? -13.747 20.274  -57.722  1.00 71.17  ? 475 LEU B C     1 
ATOM   7680 O O     . LEU B 1 481 ? -14.191 21.200  -58.409  1.00 71.87  ? 475 LEU B O     1 
ATOM   7681 C CB    . LEU B 1 481 ? -15.879 19.492  -56.676  1.00 65.26  ? 475 LEU B CB    1 
ATOM   7682 C CG    . LEU B 1 481 ? -16.256 18.103  -56.249  1.00 70.27  ? 475 LEU B CG    1 
ATOM   7683 C CD1   . LEU B 1 481 ? -16.531 18.053  -54.773  1.00 72.12  ? 475 LEU B CD1   1 
ATOM   7684 C CD2   . LEU B 1 481 ? -17.453 17.609  -57.030  1.00 71.57  ? 475 LEU B CD2   1 
ATOM   7685 N N     . HIS B 1 482 ? -12.703 19.527  -58.095  1.00 68.40  ? 476 HIS B N     1 
ATOM   7686 C CA    . HIS B 1 482 ? -11.960 19.760  -59.341  1.00 69.15  ? 476 HIS B CA    1 
ATOM   7687 C C     . HIS B 1 482 ? -12.659 19.188  -60.538  1.00 72.66  ? 476 HIS B C     1 
ATOM   7688 O O     . HIS B 1 482 ? -13.236 18.110  -60.440  1.00 72.82  ? 476 HIS B O     1 
ATOM   7689 C CB    . HIS B 1 482 ? -10.563 19.156  -59.249  1.00 71.23  ? 476 HIS B CB    1 
ATOM   7690 C CG    . HIS B 1 482 ? -9.812  19.677  -58.079  1.00 76.21  ? 476 HIS B CG    1 
ATOM   7691 N ND1   . HIS B 1 482 ? -9.217  20.920  -58.107  1.00 78.67  ? 476 HIS B ND1   1 
ATOM   7692 C CD2   . HIS B 1 482 ? -9.681  19.152  -56.843  1.00 79.19  ? 476 HIS B CD2   1 
ATOM   7693 C CE1   . HIS B 1 482 ? -8.708  21.096  -56.904  1.00 79.41  ? 476 HIS B CE1   1 
ATOM   7694 N NE2   . HIS B 1 482 ? -8.967  20.061  -56.108  1.00 80.13  ? 476 HIS B NE2   1 
ATOM   7695 N N     . SER B 1 483 ? -12.573 19.875  -61.687  1.00 69.43  ? 477 SER B N     1 
ATOM   7696 C CA    . SER B 1 483 ? -13.182 19.425  -62.949  1.00 69.01  ? 477 SER B CA    1 
ATOM   7697 C C     . SER B 1 483 ? -12.771 17.980  -63.282  1.00 75.08  ? 477 SER B C     1 
ATOM   7698 O O     . SER B 1 483 ? -13.588 17.191  -63.767  1.00 73.66  ? 477 SER B O     1 
ATOM   7699 C CB    . SER B 1 483 ? -12.797 20.365  -64.086  1.00 71.43  ? 477 SER B CB    1 
ATOM   7700 N N     . GLU B 1 484 ? -11.507 17.644  -62.941  1.00 74.28  ? 478 GLU B N     1 
ATOM   7701 C CA    . GLU B 1 484 ? -10.839 16.352  -63.106  1.00 74.34  ? 478 GLU B CA    1 
ATOM   7702 C C     . GLU B 1 484 ? -10.694 15.635  -61.742  1.00 76.21  ? 478 GLU B C     1 
ATOM   7703 O O     . GLU B 1 484 ? -9.837  15.968  -60.928  1.00 74.58  ? 478 GLU B O     1 
ATOM   7704 C CB    . GLU B 1 484 ? -9.492  16.532  -63.849  1.00 76.18  ? 478 GLU B CB    1 
ATOM   7705 C CG    . GLU B 1 484 ? -8.432  17.420  -63.180  1.00 92.77  ? 478 GLU B CG    1 
ATOM   7706 C CD    . GLU B 1 484 ? -8.803  18.791  -62.627  1.00 121.88 ? 478 GLU B CD    1 
ATOM   7707 O OE1   . GLU B 1 484 ? -9.575  19.521  -63.291  1.00 126.87 ? 478 GLU B OE1   1 
ATOM   7708 O OE2   . GLU B 1 484 ? -8.287  19.149  -61.543  1.00 114.65 ? 478 GLU B OE2   1 
ATOM   7709 N N     . ILE B 1 485 ? -11.609 14.712  -61.473  1.00 72.58  ? 479 ILE B N     1 
ATOM   7710 C CA    . ILE B 1 485 ? -11.628 13.961  -60.223  1.00 72.53  ? 479 ILE B CA    1 
ATOM   7711 C C     . ILE B 1 485 ? -11.864 12.487  -60.539  1.00 73.59  ? 479 ILE B C     1 
ATOM   7712 O O     . ILE B 1 485 ? -12.778 12.152  -61.326  1.00 72.42  ? 479 ILE B O     1 
ATOM   7713 C CB    . ILE B 1 485 ? -12.689 14.520  -59.227  1.00 76.10  ? 479 ILE B CB    1 
ATOM   7714 N N     . LYS B 1 486 ? -11.016 11.615  -59.941  1.00 67.46  ? 480 LYS B N     1 
ATOM   7715 C CA    . LYS B 1 486 ? -11.071 10.159  -60.112  1.00 65.76  ? 480 LYS B CA    1 
ATOM   7716 C C     . LYS B 1 486 ? -12.254 9.537   -59.338  1.00 65.55  ? 480 LYS B C     1 
ATOM   7717 O O     . LYS B 1 486 ? -12.746 10.150  -58.384  1.00 64.80  ? 480 LYS B O     1 
ATOM   7718 C CB    . LYS B 1 486 ? -9.750  9.533   -59.672  1.00 67.14  ? 480 LYS B CB    1 
ATOM   7719 N N     . THR B 1 487 ? -12.698 8.321   -59.723  1.00 59.54  ? 481 THR B N     1 
ATOM   7720 C CA    . THR B 1 487 ? -13.807 7.634   -59.049  1.00 59.08  ? 481 THR B CA    1 
ATOM   7721 C C     . THR B 1 487 ? -13.595 7.474   -57.530  1.00 62.27  ? 481 THR B C     1 
ATOM   7722 O O     . THR B 1 487 ? -14.538 7.705   -56.773  1.00 63.13  ? 481 THR B O     1 
ATOM   7723 C CB    . THR B 1 487 ? -14.309 6.406   -59.853  1.00 68.76  ? 481 THR B CB    1 
ATOM   7724 O OG1   . THR B 1 487 ? -15.533 6.743   -60.526  1.00 72.55  ? 481 THR B OG1   1 
ATOM   7725 C CG2   . THR B 1 487 ? -14.518 5.153   -58.995  1.00 65.54  ? 481 THR B CG2   1 
ATOM   7726 N N     . LEU B 1 488 ? -12.356 7.159   -57.089  1.00 56.23  ? 482 LEU B N     1 
ATOM   7727 C CA    . LEU B 1 488 ? -12.045 7.021   -55.675  1.00 55.89  ? 482 LEU B CA    1 
ATOM   7728 C C     . LEU B 1 488 ? -12.134 8.367   -54.942  1.00 62.95  ? 482 LEU B C     1 
ATOM   7729 O O     . LEU B 1 488 ? -12.784 8.422   -53.909  1.00 63.75  ? 482 LEU B O     1 
ATOM   7730 C CB    . LEU B 1 488 ? -10.668 6.357   -55.491  1.00 55.58  ? 482 LEU B CB    1 
ATOM   7731 C CG    . LEU B 1 488 ? -10.352 5.564   -54.188  1.00 59.66  ? 482 LEU B CG    1 
ATOM   7732 C CD1   . LEU B 1 488 ? -9.741  6.419   -53.129  1.00 59.40  ? 482 LEU B CD1   1 
ATOM   7733 C CD2   . LEU B 1 488 ? -11.530 4.780   -53.676  1.00 62.21  ? 482 LEU B CD2   1 
ATOM   7734 N N     . GLU B 1 489 ? -11.552 9.451   -55.496  1.00 61.96  ? 483 GLU B N     1 
ATOM   7735 C CA    . GLU B 1 489 ? -11.541 10.809  -54.916  1.00 64.14  ? 483 GLU B CA    1 
ATOM   7736 C C     . GLU B 1 489 ? -12.981 11.344  -54.775  1.00 69.27  ? 483 GLU B C     1 
ATOM   7737 O O     . GLU B 1 489 ? -13.297 12.012  -53.782  1.00 69.00  ? 483 GLU B O     1 
ATOM   7738 C CB    . GLU B 1 489 ? -10.696 11.748  -55.788  1.00 65.78  ? 483 GLU B CB    1 
ATOM   7739 C CG    . GLU B 1 489 ? -10.349 13.096  -55.173  1.00 84.91  ? 483 GLU B CG    1 
ATOM   7740 C CD    . GLU B 1 489 ? -9.741  14.103  -56.142  1.00 125.53 ? 483 GLU B CD    1 
ATOM   7741 O OE1   . GLU B 1 489 ? -9.955  13.972  -57.371  1.00 126.81 ? 483 GLU B OE1   1 
ATOM   7742 O OE2   . GLU B 1 489 ? -9.056  15.038  -55.665  1.00 126.85 ? 483 GLU B OE2   1 
ATOM   7743 N N     . ARG B 1 490 ? -13.851 11.013  -55.770  1.00 65.82  ? 484 ARG B N     1 
ATOM   7744 C CA    . ARG B 1 490 ? -15.286 11.324  -55.790  1.00 65.12  ? 484 ARG B CA    1 
ATOM   7745 C C     . ARG B 1 490 ? -15.897 10.629  -54.554  1.00 69.79  ? 484 ARG B C     1 
ATOM   7746 O O     . ARG B 1 490 ? -16.229 11.333  -53.604  1.00 70.00  ? 484 ARG B O     1 
ATOM   7747 C CB    . ARG B 1 490 ? -15.930 10.846  -57.122  1.00 62.63  ? 484 ARG B CB    1 
ATOM   7748 C CG    . ARG B 1 490 ? -17.459 11.012  -57.217  1.00 64.74  ? 484 ARG B CG    1 
ATOM   7749 C CD    . ARG B 1 490 ? -18.093 10.377  -58.462  1.00 66.04  ? 484 ARG B CD    1 
ATOM   7750 N NE    . ARG B 1 490 ? -17.844 8.933   -58.593  1.00 73.85  ? 484 ARG B NE    1 
ATOM   7751 C CZ    . ARG B 1 490 ? -18.702 7.966   -58.260  1.00 91.27  ? 484 ARG B CZ    1 
ATOM   7752 N NH1   . ARG B 1 490 ? -19.898 8.266   -57.758  1.00 78.71  ? 484 ARG B NH1   1 
ATOM   7753 N NH2   . ARG B 1 490 ? -18.371 6.692   -58.425  1.00 77.88  ? 484 ARG B NH2   1 
ATOM   7754 N N     . ILE B 1 491 ? -15.908 9.264   -54.519  1.00 66.43  ? 485 ILE B N     1 
ATOM   7755 C CA    . ILE B 1 491 ? -16.433 8.417   -53.426  1.00 67.39  ? 485 ILE B CA    1 
ATOM   7756 C C     . ILE B 1 491 ? -16.019 8.882   -52.024  1.00 72.56  ? 485 ILE B C     1 
ATOM   7757 O O     . ILE B 1 491 ? -16.843 8.860   -51.101  1.00 72.16  ? 485 ILE B O     1 
ATOM   7758 C CB    . ILE B 1 491 ? -16.096 6.920   -53.674  1.00 70.63  ? 485 ILE B CB    1 
ATOM   7759 C CG1   . ILE B 1 491 ? -16.854 6.386   -54.896  1.00 70.46  ? 485 ILE B CG1   1 
ATOM   7760 C CG2   . ILE B 1 491 ? -16.394 6.058   -52.434  1.00 72.73  ? 485 ILE B CG2   1 
ATOM   7761 C CD1   . ILE B 1 491 ? -16.234 5.187   -55.560  1.00 79.80  ? 485 ILE B CD1   1 
ATOM   7762 N N     . GLU B 1 492 ? -14.743 9.310   -51.892  1.00 69.93  ? 486 GLU B N     1 
ATOM   7763 C CA    . GLU B 1 492 ? -14.127 9.796   -50.658  1.00 70.89  ? 486 GLU B CA    1 
ATOM   7764 C C     . GLU B 1 492 ? -14.655 11.162  -50.276  1.00 75.10  ? 486 GLU B C     1 
ATOM   7765 O O     . GLU B 1 492 ? -14.955 11.399  -49.099  1.00 75.51  ? 486 GLU B O     1 
ATOM   7766 C CB    . GLU B 1 492 ? -12.594 9.834   -50.792  1.00 72.15  ? 486 GLU B CB    1 
ATOM   7767 C CG    . GLU B 1 492 ? -11.948 8.467   -50.670  1.00 87.65  ? 486 GLU B CG    1 
ATOM   7768 C CD    . GLU B 1 492 ? -10.465 8.476   -50.352  1.00 126.10 ? 486 GLU B CD    1 
ATOM   7769 O OE1   . GLU B 1 492 ? -9.679  8.948   -51.206  1.00 128.48 ? 486 GLU B OE1   1 
ATOM   7770 O OE2   . GLU B 1 492 ? -10.084 7.982   -49.264  1.00 127.22 ? 486 GLU B OE2   1 
ATOM   7771 N N     . ILE B 1 493 ? -14.743 12.070  -51.271  1.00 71.06  ? 487 ILE B N     1 
ATOM   7772 C CA    . ILE B 1 493 ? -15.206 13.439  -51.054  1.00 70.80  ? 487 ILE B CA    1 
ATOM   7773 C C     . ILE B 1 493 ? -16.646 13.524  -50.536  1.00 73.27  ? 487 ILE B C     1 
ATOM   7774 O O     . ILE B 1 493 ? -16.897 14.229  -49.557  1.00 74.48  ? 487 ILE B O     1 
ATOM   7775 C CB    . ILE B 1 493 ? -14.815 14.414  -52.210  1.00 72.66  ? 487 ILE B CB    1 
ATOM   7776 C CG1   . ILE B 1 493 ? -14.269 15.731  -51.669  1.00 73.76  ? 487 ILE B CG1   1 
ATOM   7777 C CG2   . ILE B 1 493 ? -15.868 14.590  -53.310  1.00 71.66  ? 487 ILE B CG2   1 
ATOM   7778 C CD1   . ILE B 1 493 ? -12.820 15.593  -51.068  1.00 84.95  ? 487 ILE B CD1   1 
ATOM   7779 N N     . ILE B 1 494 ? -17.547 12.728  -51.147  1.00 66.40  ? 488 ILE B N     1 
ATOM   7780 C CA    . ILE B 1 494 ? -18.961 12.581  -50.823  1.00 65.51  ? 488 ILE B CA    1 
ATOM   7781 C C     . ILE B 1 494 ? -19.081 11.995  -49.410  1.00 69.98  ? 488 ILE B C     1 
ATOM   7782 O O     . ILE B 1 494 ? -19.876 12.490  -48.595  1.00 69.32  ? 488 ILE B O     1 
ATOM   7783 C CB    . ILE B 1 494 ? -19.610 11.659  -51.892  1.00 67.32  ? 488 ILE B CB    1 
ATOM   7784 C CG1   . ILE B 1 494 ? -19.695 12.378  -53.251  1.00 65.72  ? 488 ILE B CG1   1 
ATOM   7785 C CG2   . ILE B 1 494 ? -20.976 11.100  -51.431  1.00 69.35  ? 488 ILE B CG2   1 
ATOM   7786 C CD1   . ILE B 1 494 ? -20.061 11.485  -54.470  1.00 70.69  ? 488 ILE B CD1   1 
ATOM   7787 N N     . ARG B 1 495 ? -18.276 10.929  -49.142  1.00 66.99  ? 489 ARG B N     1 
ATOM   7788 C CA    . ARG B 1 495 ? -18.215 10.210  -47.861  1.00 67.98  ? 489 ARG B CA    1 
ATOM   7789 C C     . ARG B 1 495 ? -17.927 11.192  -46.721  1.00 73.75  ? 489 ARG B C     1 
ATOM   7790 O O     . ARG B 1 495 ? -18.668 11.220  -45.742  1.00 74.84  ? 489 ARG B O     1 
ATOM   7791 C CB    . ARG B 1 495 ? -17.154 9.091   -47.916  1.00 65.91  ? 489 ARG B CB    1 
ATOM   7792 C CG    . ARG B 1 495 ? -16.841 8.460   -46.564  1.00 73.78  ? 489 ARG B CG    1 
ATOM   7793 C CD    . ARG B 1 495 ? -15.509 7.744   -46.528  1.00 77.99  ? 489 ARG B CD    1 
ATOM   7794 N NE    . ARG B 1 495 ? -14.367 8.650   -46.657  1.00 79.90  ? 489 ARG B NE    1 
ATOM   7795 C CZ    . ARG B 1 495 ? -13.124 8.237   -46.893  1.00 91.56  ? 489 ARG B CZ    1 
ATOM   7796 N NH1   . ARG B 1 495 ? -12.861 6.942   -47.036  1.00 72.73  ? 489 ARG B NH1   1 
ATOM   7797 N NH2   . ARG B 1 495 ? -12.137 9.116   -47.005  1.00 81.49  ? 489 ARG B NH2   1 
ATOM   7798 N N     . ASP B 1 496 ? -16.821 11.973  -46.861  1.00 69.67  ? 490 ASP B N     1 
ATOM   7799 C CA    . ASP B 1 496 ? -16.345 13.000  -45.940  1.00 69.01  ? 490 ASP B CA    1 
ATOM   7800 C C     . ASP B 1 496 ? -17.446 14.053  -45.718  1.00 70.13  ? 490 ASP B C     1 
ATOM   7801 O O     . ASP B 1 496 ? -17.723 14.379  -44.562  1.00 71.45  ? 490 ASP B O     1 
ATOM   7802 C CB    . ASP B 1 496 ? -15.075 13.636  -46.492  1.00 68.88  ? 490 ASP B CB    1 
ATOM   7803 N N     . LEU B 1 497 ? -18.139 14.496  -46.809  1.00 62.77  ? 491 LEU B N     1 
ATOM   7804 C CA    . LEU B 1 497 ? -19.270 15.450  -46.761  1.00 61.12  ? 491 LEU B CA    1 
ATOM   7805 C C     . LEU B 1 497 ? -20.486 14.897  -45.979  1.00 62.78  ? 491 LEU B C     1 
ATOM   7806 O O     . LEU B 1 497 ? -21.081 15.647  -45.205  1.00 63.46  ? 491 LEU B O     1 
ATOM   7807 C CB    . LEU B 1 497 ? -19.680 15.920  -48.170  1.00 59.27  ? 491 LEU B CB    1 
ATOM   7808 C CG    . LEU B 1 497 ? -20.840 16.923  -48.260  1.00 63.51  ? 491 LEU B CG    1 
ATOM   7809 C CD1   . LEU B 1 497 ? -20.379 18.341  -47.991  1.00 63.55  ? 491 LEU B CD1   1 
ATOM   7810 C CD2   . LEU B 1 497 ? -21.540 16.824  -49.594  1.00 64.32  ? 491 LEU B CD2   1 
ATOM   7811 N N     . ARG B 1 498 ? -20.845 13.604  -46.189  1.00 56.24  ? 492 ARG B N     1 
ATOM   7812 C CA    . ARG B 1 498 ? -21.896 12.867  -45.472  1.00 55.93  ? 492 ARG B CA    1 
ATOM   7813 C C     . ARG B 1 498 ? -21.534 12.750  -43.965  1.00 61.62  ? 492 ARG B C     1 
ATOM   7814 O O     . ARG B 1 498 ? -22.352 13.093  -43.106  1.00 61.94  ? 492 ARG B O     1 
ATOM   7815 C CB    . ARG B 1 498 ? -22.057 11.448  -46.052  1.00 52.93  ? 492 ARG B CB    1 
ATOM   7816 C CG    . ARG B 1 498 ? -22.830 11.359  -47.355  1.00 53.60  ? 492 ARG B CG    1 
ATOM   7817 C CD    . ARG B 1 498 ? -23.552 10.029  -47.482  1.00 53.59  ? 492 ARG B CD    1 
ATOM   7818 N NE    . ARG B 1 498 ? -24.664 9.923   -46.531  1.00 69.76  ? 492 ARG B NE    1 
ATOM   7819 C CZ    . ARG B 1 498 ? -25.699 9.096   -46.665  1.00 90.11  ? 492 ARG B CZ    1 
ATOM   7820 N NH1   . ARG B 1 498 ? -25.776 8.280   -47.710  1.00 83.00  ? 492 ARG B NH1   1 
ATOM   7821 N NH2   . ARG B 1 498 ? -26.669 9.082   -45.755  1.00 71.78  ? 492 ARG B NH2   1 
ATOM   7822 N N     . LEU B 1 499 ? -20.295 12.293  -43.652  1.00 59.23  ? 493 LEU B N     1 
ATOM   7823 C CA    . LEU B 1 499 ? -19.806 12.128  -42.278  1.00 60.91  ? 493 LEU B CA    1 
ATOM   7824 C C     . LEU B 1 499 ? -19.611 13.460  -41.525  1.00 67.85  ? 493 LEU B C     1 
ATOM   7825 O O     . LEU B 1 499 ? -19.533 13.453  -40.291  1.00 68.92  ? 493 LEU B O     1 
ATOM   7826 C CB    . LEU B 1 499 ? -18.543 11.283  -42.248  1.00 61.12  ? 493 LEU B CB    1 
ATOM   7827 N N     . GLY B 1 500 ? -19.559 14.572  -42.262  1.00 65.30  ? 494 GLY B N     1 
ATOM   7828 C CA    . GLY B 1 500 ? -19.451 15.913  -41.695  1.00 67.10  ? 494 GLY B CA    1 
ATOM   7829 C C     . GLY B 1 500 ? -18.076 16.558  -41.625  1.00 73.99  ? 494 GLY B C     1 
ATOM   7830 O O     . GLY B 1 500 ? -17.949 17.644  -41.035  1.00 74.49  ? 494 GLY B O     1 
ATOM   7831 N N     . LYS B 1 501 ? -17.036 15.914  -42.234  1.00 71.07  ? 495 LYS B N     1 
ATOM   7832 C CA    . LYS B 1 501 ? -15.659 16.438  -42.297  1.00 71.55  ? 495 LYS B CA    1 
ATOM   7833 C C     . LYS B 1 501 ? -15.717 17.862  -42.894  1.00 79.20  ? 495 LYS B C     1 
ATOM   7834 O O     . LYS B 1 501 ? -15.072 18.782  -42.379  1.00 80.43  ? 495 LYS B O     1 
ATOM   7835 C CB    . LYS B 1 501 ? -14.759 15.508  -43.130  1.00 72.12  ? 495 LYS B CB    1 
ATOM   7836 C CG    . LYS B 1 501 ? -13.281 15.888  -43.114  1.00 85.86  ? 495 LYS B CG    1 
ATOM   7837 C CD    . LYS B 1 501 ? -12.425 14.986  -44.023  1.00 93.31  ? 495 LYS B CD    1 
ATOM   7838 C CE    . LYS B 1 501 ? -10.933 15.251  -43.917  1.00 100.46 ? 495 LYS B CE    1 
ATOM   7839 N NZ    . LYS B 1 501 ? -10.566 16.671  -44.211  1.00 106.70 ? 495 LYS B NZ    1 
ATOM   7840 N N     . TYR B 1 502 ? -16.561 18.033  -43.940  1.00 75.95  ? 496 TYR B N     1 
ATOM   7841 C CA    . TYR B 1 502 ? -16.867 19.300  -44.593  1.00 75.11  ? 496 TYR B CA    1 
ATOM   7842 C C     . TYR B 1 502 ? -18.360 19.471  -44.510  1.00 75.93  ? 496 TYR B C     1 
ATOM   7843 O O     . TYR B 1 502 ? -19.080 18.474  -44.562  1.00 75.49  ? 496 TYR B O     1 
ATOM   7844 C CB    . TYR B 1 502 ? -16.477 19.284  -46.071  1.00 76.00  ? 496 TYR B CB    1 
ATOM   7845 C CG    . TYR B 1 502 ? -15.171 18.604  -46.383  1.00 79.92  ? 496 TYR B CG    1 
ATOM   7846 C CD1   . TYR B 1 502 ? -15.128 17.477  -47.199  1.00 81.44  ? 496 TYR B CD1   1 
ATOM   7847 C CD2   . TYR B 1 502 ? -13.967 19.107  -45.898  1.00 82.72  ? 496 TYR B CD2   1 
ATOM   7848 C CE1   . TYR B 1 502 ? -13.917 16.875  -47.539  1.00 83.74  ? 496 TYR B CE1   1 
ATOM   7849 C CE2   . TYR B 1 502 ? -12.750 18.500  -46.211  1.00 84.42  ? 496 TYR B CE2   1 
ATOM   7850 C CZ    . TYR B 1 502 ? -12.727 17.387  -47.040  1.00 92.57  ? 496 TYR B CZ    1 
ATOM   7851 O OH    . TYR B 1 502 ? -11.522 16.797  -47.361  1.00 93.09  ? 496 TYR B OH    1 
ATOM   7852 N N     . ASP B 1 503 ? -18.827 20.719  -44.411  1.00 71.13  ? 497 ASP B N     1 
ATOM   7853 C CA    . ASP B 1 503 ? -20.246 21.059  -44.349  1.00 71.28  ? 497 ASP B CA    1 
ATOM   7854 C C     . ASP B 1 503 ? -20.741 21.611  -45.682  1.00 71.18  ? 497 ASP B C     1 
ATOM   7855 O O     . ASP B 1 503 ? -21.940 21.568  -45.956  1.00 70.62  ? 497 ASP B O     1 
ATOM   7856 C CB    . ASP B 1 503 ? -20.524 22.064  -43.212  1.00 75.75  ? 497 ASP B CB    1 
ATOM   7857 C CG    . ASP B 1 503 ? -20.214 21.547  -41.816  1.00 96.77  ? 497 ASP B CG    1 
ATOM   7858 O OD1   . ASP B 1 503 ? -20.799 20.504  -41.420  1.00 98.59  ? 497 ASP B OD1   1 
ATOM   7859 O OD2   . ASP B 1 503 ? -19.418 22.207  -41.099  1.00 106.86 ? 497 ASP B OD2   1 
ATOM   7860 N N     . VAL B 1 504 ? -19.823 22.145  -46.506  1.00 64.81  ? 498 VAL B N     1 
ATOM   7861 C CA    . VAL B 1 504 ? -20.162 22.744  -47.798  1.00 62.21  ? 498 VAL B CA    1 
ATOM   7862 C C     . VAL B 1 504 ? -19.241 22.229  -48.912  1.00 66.15  ? 498 VAL B C     1 
ATOM   7863 O O     . VAL B 1 504 ? -18.056 22.024  -48.650  1.00 66.99  ? 498 VAL B O     1 
ATOM   7864 C CB    . VAL B 1 504 ? -20.102 24.285  -47.707  1.00 64.12  ? 498 VAL B CB    1 
ATOM   7865 C CG1   . VAL B 1 504 ? -20.670 24.923  -48.960  1.00 62.23  ? 498 VAL B CG1   1 
ATOM   7866 C CG2   . VAL B 1 504 ? -20.840 24.791  -46.474  1.00 64.97  ? 498 VAL B CG2   1 
ATOM   7867 N N     . LEU B 1 505 ? -19.794 22.028  -50.147  1.00 60.11  ? 499 LEU B N     1 
ATOM   7868 C CA    . LEU B 1 505 ? -19.051 21.646  -51.361  1.00 58.03  ? 499 LEU B CA    1 
ATOM   7869 C C     . LEU B 1 505 ? -19.174 22.757  -52.394  1.00 59.47  ? 499 LEU B C     1 
ATOM   7870 O O     . LEU B 1 505 ? -20.290 23.195  -52.698  1.00 59.86  ? 499 LEU B O     1 
ATOM   7871 C CB    . LEU B 1 505 ? -19.554 20.336  -52.004  1.00 57.39  ? 499 LEU B CB    1 
ATOM   7872 C CG    . LEU B 1 505 ? -19.017 19.007  -51.494  1.00 62.82  ? 499 LEU B CG    1 
ATOM   7873 C CD1   . LEU B 1 505 ? -19.389 17.898  -52.414  1.00 61.12  ? 499 LEU B CD1   1 
ATOM   7874 C CD2   . LEU B 1 505 ? -17.510 19.021  -51.313  1.00 68.60  ? 499 LEU B CD2   1 
ATOM   7875 N N     . VAL B 1 506 ? -18.041 23.220  -52.931  1.00 53.22  ? 500 VAL B N     1 
ATOM   7876 C CA    . VAL B 1 506 ? -18.045 24.276  -53.950  1.00 52.12  ? 500 VAL B CA    1 
ATOM   7877 C C     . VAL B 1 506 ? -17.478 23.683  -55.228  1.00 55.71  ? 500 VAL B C     1 
ATOM   7878 O O     . VAL B 1 506 ? -16.622 22.805  -55.161  1.00 56.24  ? 500 VAL B O     1 
ATOM   7879 C CB    . VAL B 1 506 ? -17.289 25.568  -53.508  1.00 55.95  ? 500 VAL B CB    1 
ATOM   7880 C CG1   . VAL B 1 506 ? -17.520 26.716  -54.484  1.00 54.61  ? 500 VAL B CG1   1 
ATOM   7881 C CG2   . VAL B 1 506 ? -17.704 25.996  -52.110  1.00 57.30  ? 500 VAL B CG2   1 
ATOM   7882 N N     . GLY B 1 507 ? -17.976 24.136  -56.370  1.00 51.00  ? 501 GLY B N     1 
ATOM   7883 C CA    . GLY B 1 507 ? -17.508 23.659  -57.665  1.00 49.87  ? 501 GLY B CA    1 
ATOM   7884 C C     . GLY B 1 507 ? -18.454 23.941  -58.809  1.00 53.42  ? 501 GLY B C     1 
ATOM   7885 O O     . GLY B 1 507 ? -19.622 24.260  -58.585  1.00 53.74  ? 501 GLY B O     1 
ATOM   7886 N N     . ILE B 1 508 ? -17.945 23.791  -60.053  1.00 48.32  ? 502 ILE B N     1 
ATOM   7887 C CA    . ILE B 1 508 ? -18.672 24.025  -61.302  1.00 46.57  ? 502 ILE B CA    1 
ATOM   7888 C C     . ILE B 1 508 ? -19.769 22.969  -61.590  1.00 50.33  ? 502 ILE B C     1 
ATOM   7889 O O     . ILE B 1 508 ? -20.941 23.333  -61.790  1.00 49.17  ? 502 ILE B O     1 
ATOM   7890 C CB    . ILE B 1 508 ? -17.662 24.193  -62.475  1.00 48.49  ? 502 ILE B CB    1 
ATOM   7891 C CG1   . ILE B 1 508 ? -16.776 25.445  -62.258  1.00 49.17  ? 502 ILE B CG1   1 
ATOM   7892 C CG2   . ILE B 1 508 ? -18.387 24.262  -63.820  1.00 48.32  ? 502 ILE B CG2   1 
ATOM   7893 C CD1   . ILE B 1 508 ? -15.568 25.609  -63.218  1.00 54.99  ? 502 ILE B CD1   1 
ATOM   7894 N N     . ASN B 1 509 ? -19.365 21.668  -61.645  1.00 47.26  ? 503 ASN B N     1 
ATOM   7895 C CA    . ASN B 1 509 ? -20.240 20.533  -61.969  1.00 46.71  ? 503 ASN B CA    1 
ATOM   7896 C C     . ASN B 1 509 ? -20.740 19.701  -60.770  1.00 51.20  ? 503 ASN B C     1 
ATOM   7897 O O     . ASN B 1 509 ? -20.020 18.856  -60.211  1.00 50.26  ? 503 ASN B O     1 
ATOM   7898 C CB    . ASN B 1 509 ? -19.610 19.654  -63.057  1.00 45.11  ? 503 ASN B CB    1 
ATOM   7899 C CG    . ASN B 1 509 ? -20.576 18.713  -63.734  1.00 69.46  ? 503 ASN B CG    1 
ATOM   7900 O OD1   . ASN B 1 509 ? -21.129 17.795  -63.130  1.00 66.07  ? 503 ASN B OD1   1 
ATOM   7901 N ND2   . ASN B 1 509 ? -20.770 18.889  -65.022  1.00 63.17  ? 503 ASN B ND2   1 
ATOM   7902 N N     . LEU B 1 510 ? -22.007 19.906  -60.418  1.00 48.24  ? 504 LEU B N     1 
ATOM   7903 C CA    . LEU B 1 510 ? -22.606 19.146  -59.321  1.00 48.30  ? 504 LEU B CA    1 
ATOM   7904 C C     . LEU B 1 510 ? -23.389 17.925  -59.829  1.00 53.09  ? 504 LEU B C     1 
ATOM   7905 O O     . LEU B 1 510 ? -23.919 17.130  -59.041  1.00 53.54  ? 504 LEU B O     1 
ATOM   7906 C CB    . LEU B 1 510 ? -23.423 20.052  -58.385  1.00 48.39  ? 504 LEU B CB    1 
ATOM   7907 C CG    . LEU B 1 510 ? -22.645 21.198  -57.751  1.00 52.43  ? 504 LEU B CG    1 
ATOM   7908 C CD1   . LEU B 1 510 ? -23.499 21.941  -56.782  1.00 52.86  ? 504 LEU B CD1   1 
ATOM   7909 C CD2   . LEU B 1 510 ? -21.378 20.699  -57.059  1.00 55.30  ? 504 LEU B CD2   1 
ATOM   7910 N N     . LEU B 1 511 ? -23.373 17.742  -61.162  1.00 48.39  ? 505 LEU B N     1 
ATOM   7911 C CA    . LEU B 1 511 ? -24.036 16.651  -61.862  1.00 47.51  ? 505 LEU B CA    1 
ATOM   7912 C C     . LEU B 1 511 ? -23.198 15.360  -61.881  1.00 53.40  ? 505 LEU B C     1 
ATOM   7913 O O     . LEU B 1 511 ? -23.502 14.431  -62.622  1.00 53.54  ? 505 LEU B O     1 
ATOM   7914 C CB    . LEU B 1 511 ? -24.422 17.110  -63.271  1.00 46.80  ? 505 LEU B CB    1 
ATOM   7915 C CG    . LEU B 1 511 ? -25.151 18.461  -63.404  1.00 51.58  ? 505 LEU B CG    1 
ATOM   7916 C CD1   . LEU B 1 511 ? -25.535 18.702  -64.824  1.00 51.02  ? 505 LEU B CD1   1 
ATOM   7917 C CD2   . LEU B 1 511 ? -26.412 18.545  -62.534  1.00 54.99  ? 505 LEU B CD2   1 
ATOM   7918 N N     . ARG B 1 512 ? -22.175 15.283  -61.016  1.00 51.72  ? 506 ARG B N     1 
ATOM   7919 C CA    . ARG B 1 512 ? -21.312 14.116  -60.888  1.00 51.78  ? 506 ARG B CA    1 
ATOM   7920 C C     . ARG B 1 512 ? -22.079 13.055  -60.114  1.00 58.31  ? 506 ARG B C     1 
ATOM   7921 O O     . ARG B 1 512 ? -22.960 13.403  -59.316  1.00 59.26  ? 506 ARG B O     1 
ATOM   7922 C CB    . ARG B 1 512 ? -20.003 14.515  -60.197  1.00 52.76  ? 506 ARG B CB    1 
ATOM   7923 C CG    . ARG B 1 512 ? -19.272 15.645  -60.931  1.00 61.59  ? 506 ARG B CG    1 
ATOM   7924 C CD    . ARG B 1 512 ? -17.812 15.768  -60.568  1.00 71.79  ? 506 ARG B CD    1 
ATOM   7925 N NE    . ARG B 1 512 ? -17.378 17.159  -60.671  1.00 84.89  ? 506 ARG B NE    1 
ATOM   7926 C CZ    . ARG B 1 512 ? -16.633 17.652  -61.654  1.00 101.40 ? 506 ARG B CZ    1 
ATOM   7927 N NH1   . ARG B 1 512 ? -16.181 16.855  -62.617  1.00 91.04  ? 506 ARG B NH1   1 
ATOM   7928 N NH2   . ARG B 1 512 ? -16.316 18.943  -61.672  1.00 83.90  ? 506 ARG B NH2   1 
ATOM   7929 N N     . GLU B 1 513 ? -21.810 11.765  -60.399  1.00 55.82  ? 507 GLU B N     1 
ATOM   7930 C CA    . GLU B 1 513 ? -22.526 10.635  -59.777  1.00 56.54  ? 507 GLU B CA    1 
ATOM   7931 C C     . GLU B 1 513 ? -22.464 10.603  -58.245  1.00 61.51  ? 507 GLU B C     1 
ATOM   7932 O O     . GLU B 1 513 ? -21.444 10.967  -57.650  1.00 61.21  ? 507 GLU B O     1 
ATOM   7933 C CB    . GLU B 1 513 ? -22.072 9.304   -60.368  1.00 56.68  ? 507 GLU B CB    1 
ATOM   7934 N N     . GLY B 1 514 ? -23.591 10.234  -57.638  1.00 58.63  ? 508 GLY B N     1 
ATOM   7935 C CA    . GLY B 1 514 ? -23.741 10.095  -56.189  1.00 59.67  ? 508 GLY B CA    1 
ATOM   7936 C C     . GLY B 1 514 ? -23.744 11.336  -55.316  1.00 63.06  ? 508 GLY B C     1 
ATOM   7937 O O     . GLY B 1 514 ? -23.787 11.197  -54.087  1.00 62.83  ? 508 GLY B O     1 
ATOM   7938 N N     . LEU B 1 515 ? -23.703 12.552  -55.941  1.00 59.09  ? 509 LEU B N     1 
ATOM   7939 C CA    . LEU B 1 515 ? -23.716 13.863  -55.268  1.00 58.97  ? 509 LEU B CA    1 
ATOM   7940 C C     . LEU B 1 515 ? -25.050 14.217  -54.652  1.00 66.18  ? 509 LEU B C     1 
ATOM   7941 O O     . LEU B 1 515 ? -25.119 15.182  -53.900  1.00 67.58  ? 509 LEU B O     1 
ATOM   7942 C CB    . LEU B 1 515 ? -23.240 15.023  -56.166  1.00 57.62  ? 509 LEU B CB    1 
ATOM   7943 C CG    . LEU B 1 515 ? -21.731 15.321  -56.251  1.00 61.56  ? 509 LEU B CG    1 
ATOM   7944 C CD1   . LEU B 1 515 ? -21.492 16.666  -56.839  1.00 61.42  ? 509 LEU B CD1   1 
ATOM   7945 C CD2   . LEU B 1 515 ? -21.068 15.353  -54.915  1.00 63.86  ? 509 LEU B CD2   1 
ATOM   7946 N N     . ASP B 1 516 ? -26.114 13.463  -54.956  1.00 64.27  ? 510 ASP B N     1 
ATOM   7947 C CA    . ASP B 1 516 ? -27.407 13.713  -54.325  1.00 65.81  ? 510 ASP B CA    1 
ATOM   7948 C C     . ASP B 1 516 ? -27.453 12.898  -53.013  1.00 69.56  ? 510 ASP B C     1 
ATOM   7949 O O     . ASP B 1 516 ? -27.636 11.672  -53.009  1.00 69.87  ? 510 ASP B O     1 
ATOM   7950 C CB    . ASP B 1 516 ? -28.583 13.435  -55.287  1.00 68.47  ? 510 ASP B CB    1 
ATOM   7951 C CG    . ASP B 1 516 ? -28.740 12.001  -55.766  1.00 80.79  ? 510 ASP B CG    1 
ATOM   7952 O OD1   . ASP B 1 516 ? -27.698 11.348  -56.063  1.00 80.38  ? 510 ASP B OD1   1 
ATOM   7953 O OD2   . ASP B 1 516 ? -29.901 11.522  -55.825  1.00 86.91  ? 510 ASP B OD2   1 
ATOM   7954 N N     . ILE B 1 517 ? -27.137 13.573  -51.913  1.00 65.15  ? 511 ILE B N     1 
ATOM   7955 C CA    . ILE B 1 517 ? -27.048 12.922  -50.602  1.00 65.66  ? 511 ILE B CA    1 
ATOM   7956 C C     . ILE B 1 517 ? -28.173 13.344  -49.635  1.00 70.21  ? 511 ILE B C     1 
ATOM   7957 O O     . ILE B 1 517 ? -28.596 14.503  -49.668  1.00 70.29  ? 511 ILE B O     1 
ATOM   7958 C CB    . ILE B 1 517 ? -25.603 12.951  -49.990  1.00 67.74  ? 511 ILE B CB    1 
ATOM   7959 C CG1   . ILE B 1 517 ? -25.050 14.381  -49.845  1.00 66.52  ? 511 ILE B CG1   1 
ATOM   7960 C CG2   . ILE B 1 517 ? -24.646 12.059  -50.781  1.00 66.68  ? 511 ILE B CG2   1 
ATOM   7961 C CD1   . ILE B 1 517 ? -24.519 14.676  -48.496  1.00 65.25  ? 511 ILE B CD1   1 
ATOM   7962 N N     . PRO B 1 518 ? -28.692 12.427  -48.787  1.00 66.22  ? 512 PRO B N     1 
ATOM   7963 C CA    . PRO B 1 518 ? -29.795 12.807  -47.892  1.00 67.07  ? 512 PRO B CA    1 
ATOM   7964 C C     . PRO B 1 518 ? -29.481 13.948  -46.929  1.00 71.13  ? 512 PRO B C     1 
ATOM   7965 O O     . PRO B 1 518 ? -30.407 14.651  -46.516  1.00 72.77  ? 512 PRO B O     1 
ATOM   7966 C CB    . PRO B 1 518 ? -30.126 11.508  -47.154  1.00 70.29  ? 512 PRO B CB    1 
ATOM   7967 C CG    . PRO B 1 518 ? -29.599 10.422  -48.037  1.00 74.01  ? 512 PRO B CG    1 
ATOM   7968 C CD    . PRO B 1 518 ? -28.357 10.997  -48.638  1.00 68.13  ? 512 PRO B CD    1 
ATOM   7969 N N     . GLU B 1 519 ? -28.186 14.159  -46.602  1.00 65.14  ? 513 GLU B N     1 
ATOM   7970 C CA    . GLU B 1 519 ? -27.738 15.208  -45.682  1.00 64.37  ? 513 GLU B CA    1 
ATOM   7971 C C     . GLU B 1 519 ? -27.843 16.637  -46.272  1.00 65.91  ? 513 GLU B C     1 
ATOM   7972 O O     . GLU B 1 519 ? -27.986 17.596  -45.515  1.00 65.54  ? 513 GLU B O     1 
ATOM   7973 C CB    . GLU B 1 519 ? -26.295 14.939  -45.252  1.00 20.00  ? 513 GLU B CB    1 
ATOM   7974 N N     . VAL B 1 520 ? -27.776 16.772  -47.612  1.00 61.38  ? 514 VAL B N     1 
ATOM   7975 C CA    . VAL B 1 520 ? -27.856 18.063  -48.314  1.00 61.22  ? 514 VAL B CA    1 
ATOM   7976 C C     . VAL B 1 520 ? -29.299 18.584  -48.337  1.00 67.08  ? 514 VAL B C     1 
ATOM   7977 O O     . VAL B 1 520 ? -30.174 17.977  -48.979  1.00 67.92  ? 514 VAL B O     1 
ATOM   7978 C CB    . VAL B 1 520 ? -27.220 18.032  -49.741  1.00 64.27  ? 514 VAL B CB    1 
ATOM   7979 C CG1   . VAL B 1 520 ? -27.587 19.269  -50.552  1.00 63.21  ? 514 VAL B CG1   1 
ATOM   7980 C CG2   . VAL B 1 520 ? -25.708 17.901  -49.663  1.00 64.29  ? 514 VAL B CG2   1 
ATOM   7981 N N     . SER B 1 521 ? -29.532 19.723  -47.648  1.00 62.48  ? 515 SER B N     1 
ATOM   7982 C CA    . SER B 1 521 ? -30.838 20.386  -47.585  1.00 61.17  ? 515 SER B CA    1 
ATOM   7983 C C     . SER B 1 521 ? -30.847 21.694  -48.397  1.00 62.45  ? 515 SER B C     1 
ATOM   7984 O O     . SER B 1 521 ? -31.900 22.335  -48.499  1.00 62.98  ? 515 SER B O     1 
ATOM   7985 C CB    . SER B 1 521 ? -31.224 20.659  -46.136  1.00 64.61  ? 515 SER B CB    1 
ATOM   7986 O OG    . SER B 1 521 ? -30.439 21.697  -45.576  1.00 71.19  ? 515 SER B OG    1 
ATOM   7987 N N     . LEU B 1 522 ? -29.672 22.105  -48.949  1.00 55.56  ? 516 LEU B N     1 
ATOM   7988 C CA    . LEU B 1 522 ? -29.551 23.342  -49.720  1.00 53.07  ? 516 LEU B CA    1 
ATOM   7989 C C     . LEU B 1 522 ? -28.606 23.280  -50.896  1.00 54.82  ? 516 LEU B C     1 
ATOM   7990 O O     . LEU B 1 522 ? -27.439 22.921  -50.743  1.00 54.89  ? 516 LEU B O     1 
ATOM   7991 C CB    . LEU B 1 522 ? -29.217 24.559  -48.819  1.00 53.06  ? 516 LEU B CB    1 
ATOM   7992 C CG    . LEU B 1 522 ? -29.087 25.933  -49.527  1.00 55.78  ? 516 LEU B CG    1 
ATOM   7993 C CD1   . LEU B 1 522 ? -30.412 26.431  -50.042  1.00 55.92  ? 516 LEU B CD1   1 
ATOM   7994 C CD2   . LEU B 1 522 ? -28.512 26.966  -48.618  1.00 56.41  ? 516 LEU B CD2   1 
ATOM   7995 N N     . VAL B 1 523 ? -29.108 23.690  -52.062  1.00 49.87  ? 517 VAL B N     1 
ATOM   7996 C CA    . VAL B 1 523 ? -28.333 23.817  -53.291  1.00 48.59  ? 517 VAL B CA    1 
ATOM   7997 C C     . VAL B 1 523 ? -28.347 25.314  -53.614  1.00 55.02  ? 517 VAL B C     1 
ATOM   7998 O O     . VAL B 1 523 ? -29.429 25.928  -53.642  1.00 56.29  ? 517 VAL B O     1 
ATOM   7999 C CB    . VAL B 1 523 ? -28.856 22.942  -54.475  1.00 50.20  ? 517 VAL B CB    1 
ATOM   8000 C CG1   . VAL B 1 523 ? -28.142 23.284  -55.774  1.00 47.88  ? 517 VAL B CG1   1 
ATOM   8001 C CG2   . VAL B 1 523 ? -28.687 21.464  -54.175  1.00 50.22  ? 517 VAL B CG2   1 
ATOM   8002 N N     . ALA B 1 524 ? -27.152 25.907  -53.818  1.00 49.89  ? 518 ALA B N     1 
ATOM   8003 C CA    . ALA B 1 524 ? -27.045 27.317  -54.175  1.00 49.04  ? 518 ALA B CA    1 
ATOM   8004 C C     . ALA B 1 524 ? -26.444 27.451  -55.567  1.00 51.42  ? 518 ALA B C     1 
ATOM   8005 O O     . ALA B 1 524 ? -25.290 27.072  -55.790  1.00 50.35  ? 518 ALA B O     1 
ATOM   8006 C CB    . ALA B 1 524 ? -26.211 28.067  -53.157  1.00 50.41  ? 518 ALA B CB    1 
ATOM   8007 N N     . ILE B 1 525 ? -27.258 27.949  -56.518  1.00 46.66  ? 519 ILE B N     1 
ATOM   8008 C CA    . ILE B 1 525 ? -26.853 28.139  -57.909  1.00 44.11  ? 519 ILE B CA    1 
ATOM   8009 C C     . ILE B 1 525 ? -26.429 29.599  -58.106  1.00 48.29  ? 519 ILE B C     1 
ATOM   8010 O O     . ILE B 1 525 ? -27.285 30.449  -58.363  1.00 49.35  ? 519 ILE B O     1 
ATOM   8011 C CB    . ILE B 1 525 ? -27.957 27.635  -58.917  1.00 45.10  ? 519 ILE B CB    1 
ATOM   8012 C CG1   . ILE B 1 525 ? -28.361 26.182  -58.621  1.00 43.78  ? 519 ILE B CG1   1 
ATOM   8013 C CG2   . ILE B 1 525 ? -27.500 27.775  -60.367  1.00 43.67  ? 519 ILE B CG2   1 
ATOM   8014 C CD1   . ILE B 1 525 ? -29.664 25.733  -59.196  1.00 40.70  ? 519 ILE B CD1   1 
ATOM   8015 N N     . LEU B 1 526 ? -25.120 29.887  -57.928  1.00 44.00  ? 520 LEU B N     1 
ATOM   8016 C CA    . LEU B 1 526 ? -24.538 31.219  -58.136  1.00 44.83  ? 520 LEU B CA    1 
ATOM   8017 C C     . LEU B 1 526 ? -24.482 31.473  -59.650  1.00 51.79  ? 520 LEU B C     1 
ATOM   8018 O O     . LEU B 1 526 ? -24.125 30.555  -60.394  1.00 51.38  ? 520 LEU B O     1 
ATOM   8019 C CB    . LEU B 1 526 ? -23.102 31.284  -57.584  1.00 44.70  ? 520 LEU B CB    1 
ATOM   8020 C CG    . LEU B 1 526 ? -22.843 31.325  -56.081  1.00 49.85  ? 520 LEU B CG    1 
ATOM   8021 C CD1   . LEU B 1 526 ? -21.381 31.471  -55.828  1.00 49.46  ? 520 LEU B CD1   1 
ATOM   8022 C CD2   . LEU B 1 526 ? -23.552 32.484  -55.408  1.00 53.16  ? 520 LEU B CD2   1 
ATOM   8023 N N     . ASP B 1 527 ? -24.826 32.704  -60.110  1.00 50.53  ? 521 ASP B N     1 
ATOM   8024 C CA    . ASP B 1 527 ? -24.855 33.089  -61.541  1.00 50.71  ? 521 ASP B CA    1 
ATOM   8025 C C     . ASP B 1 527 ? -25.795 32.188  -62.369  1.00 51.99  ? 521 ASP B C     1 
ATOM   8026 O O     . ASP B 1 527 ? -25.429 31.686  -63.430  1.00 49.87  ? 521 ASP B O     1 
ATOM   8027 C CB    . ASP B 1 527 ? -23.426 33.207  -62.157  1.00 53.32  ? 521 ASP B CB    1 
ATOM   8028 C CG    . ASP B 1 527 ? -22.698 34.540  -61.921  1.00 74.03  ? 521 ASP B CG    1 
ATOM   8029 O OD1   . ASP B 1 527 ? -23.375 35.605  -61.894  1.00 76.21  ? 521 ASP B OD1   1 
ATOM   8030 O OD2   . ASP B 1 527 ? -21.451 34.529  -61.843  1.00 82.77  ? 521 ASP B OD2   1 
ATOM   8031 N N     . ALA B 1 528 ? -27.014 31.990  -61.847  1.00 49.39  ? 522 ALA B N     1 
ATOM   8032 C CA    . ALA B 1 528 ? -28.086 31.158  -62.407  1.00 49.17  ? 522 ALA B CA    1 
ATOM   8033 C C     . ALA B 1 528 ? -28.575 31.615  -63.794  1.00 55.39  ? 522 ALA B C     1 
ATOM   8034 O O     . ALA B 1 528 ? -29.016 30.788  -64.598  1.00 54.15  ? 522 ALA B O     1 
ATOM   8035 C CB    . ALA B 1 528 ? -29.254 31.109  -61.427  1.00 50.19  ? 522 ALA B CB    1 
ATOM   8036 N N     . ASP B 1 529 ? -28.498 32.938  -64.056  1.00 54.66  ? 523 ASP B N     1 
ATOM   8037 C CA    . ASP B 1 529 ? -28.922 33.617  -65.286  1.00 54.94  ? 523 ASP B CA    1 
ATOM   8038 C C     . ASP B 1 529 ? -27.787 33.788  -66.276  1.00 60.13  ? 523 ASP B C     1 
ATOM   8039 O O     . ASP B 1 529 ? -28.012 34.314  -67.369  1.00 59.84  ? 523 ASP B O     1 
ATOM   8040 C CB    . ASP B 1 529 ? -29.439 35.029  -64.928  1.00 57.88  ? 523 ASP B CB    1 
ATOM   8041 C CG    . ASP B 1 529 ? -28.413 35.961  -64.243  1.00 69.87  ? 523 ASP B CG    1 
ATOM   8042 O OD1   . ASP B 1 529 ? -28.641 37.202  -64.230  1.00 70.42  ? 523 ASP B OD1   1 
ATOM   8043 O OD2   . ASP B 1 529 ? -27.408 35.447  -63.690  1.00 74.11  ? 523 ASP B OD2   1 
ATOM   8044 N N     . LYS B 1 530 ? -26.558 33.427  -65.867  1.00 58.52  ? 524 LYS B N     1 
ATOM   8045 C CA    . LYS B 1 530 ? -25.364 33.712  -66.647  1.00 59.44  ? 524 LYS B CA    1 
ATOM   8046 C C     . LYS B 1 530 ? -25.015 32.902  -67.876  1.00 67.46  ? 524 LYS B C     1 
ATOM   8047 O O     . LYS B 1 530 ? -24.064 33.277  -68.559  1.00 69.64  ? 524 LYS B O     1 
ATOM   8048 C CB    . LYS B 1 530 ? -24.154 34.051  -65.783  1.00 61.54  ? 524 LYS B CB    1 
ATOM   8049 C CG    . LYS B 1 530 ? -24.364 35.295  -64.912  1.00 71.91  ? 524 LYS B CG    1 
ATOM   8050 C CD    . LYS B 1 530 ? -24.454 36.617  -65.641  1.00 75.07  ? 524 LYS B CD    1 
ATOM   8051 C CE    . LYS B 1 530 ? -24.486 37.723  -64.621  1.00 89.38  ? 524 LYS B CE    1 
ATOM   8052 N NZ    . LYS B 1 530 ? -25.871 38.039  -64.195  1.00 103.33 ? 524 LYS B NZ    1 
ATOM   8053 N N     . GLU B 1 531 ? -25.831 31.919  -68.256  1.00 64.31  ? 525 GLU B N     1 
ATOM   8054 C CA    . GLU B 1 531 ? -25.654 31.177  -69.512  1.00 64.66  ? 525 GLU B CA    1 
ATOM   8055 C C     . GLU B 1 531 ? -24.317 30.500  -69.851  1.00 65.73  ? 525 GLU B C     1 
ATOM   8056 O O     . GLU B 1 531 ? -23.333 31.101  -70.270  1.00 64.37  ? 525 GLU B O     1 
ATOM   8057 C CB    . GLU B 1 531 ? -26.261 31.889  -70.747  1.00 67.39  ? 525 GLU B CB    1 
ATOM   8058 C CG    . GLU B 1 531 ? -27.796 31.800  -70.870  1.00 84.09  ? 525 GLU B CG    1 
ATOM   8059 C CD    . GLU B 1 531 ? -28.543 30.463  -70.889  1.00 97.12  ? 525 GLU B CD    1 
ATOM   8060 O OE1   . GLU B 1 531 ? -27.943 29.392  -71.169  1.00 61.67  ? 525 GLU B OE1   1 
ATOM   8061 O OE2   . GLU B 1 531 ? -29.771 30.515  -70.648  1.00 89.47  ? 525 GLU B OE2   1 
ATOM   8062 N N     . GLY B 1 532 ? -24.416 29.197  -69.770  1.00 61.34  ? 526 GLY B N     1 
ATOM   8063 C CA    . GLY B 1 532 ? -23.431 28.159  -70.022  1.00 59.48  ? 526 GLY B CA    1 
ATOM   8064 C C     . GLY B 1 532 ? -24.197 26.846  -70.099  1.00 59.22  ? 526 GLY B C     1 
ATOM   8065 O O     . GLY B 1 532 ? -25.411 26.826  -69.849  1.00 57.54  ? 526 GLY B O     1 
ATOM   8066 N N     . PHE B 1 533 ? -23.509 25.735  -70.459  1.00 53.45  ? 527 PHE B N     1 
ATOM   8067 C CA    . PHE B 1 533 ? -24.131 24.416  -70.591  1.00 51.26  ? 527 PHE B CA    1 
ATOM   8068 C C     . PHE B 1 533 ? -24.835 24.021  -69.298  1.00 52.52  ? 527 PHE B C     1 
ATOM   8069 O O     . PHE B 1 533 ? -25.969 23.539  -69.340  1.00 50.25  ? 527 PHE B O     1 
ATOM   8070 C CB    . PHE B 1 533 ? -23.097 23.350  -70.980  1.00 52.39  ? 527 PHE B CB    1 
ATOM   8071 C CG    . PHE B 1 533 ? -23.671 21.948  -70.957  1.00 53.80  ? 527 PHE B CG    1 
ATOM   8072 C CD1   . PHE B 1 533 ? -24.322 21.426  -72.069  1.00 55.97  ? 527 PHE B CD1   1 
ATOM   8073 C CD2   . PHE B 1 533 ? -23.600 21.166  -69.805  1.00 55.73  ? 527 PHE B CD2   1 
ATOM   8074 C CE1   . PHE B 1 533 ? -24.876 20.146  -72.038  1.00 56.26  ? 527 PHE B CE1   1 
ATOM   8075 C CE2   . PHE B 1 533 ? -24.174 19.893  -69.770  1.00 58.01  ? 527 PHE B CE2   1 
ATOM   8076 C CZ    . PHE B 1 533 ? -24.798 19.388  -70.891  1.00 55.50  ? 527 PHE B CZ    1 
ATOM   8077 N N     . LEU B 1 534 ? -24.146 24.235  -68.154  1.00 49.05  ? 528 LEU B N     1 
ATOM   8078 C CA    . LEU B 1 534 ? -24.643 23.899  -66.833  1.00 48.86  ? 528 LEU B CA    1 
ATOM   8079 C C     . LEU B 1 534 ? -25.670 24.885  -66.290  1.00 55.41  ? 528 LEU B C     1 
ATOM   8080 O O     . LEU B 1 534 ? -26.060 24.778  -65.121  1.00 56.37  ? 528 LEU B O     1 
ATOM   8081 C CB    . LEU B 1 534 ? -23.500 23.655  -65.849  1.00 48.50  ? 528 LEU B CB    1 
ATOM   8082 C CG    . LEU B 1 534 ? -22.563 22.489  -66.163  1.00 52.74  ? 528 LEU B CG    1 
ATOM   8083 C CD1   . LEU B 1 534 ? -21.371 22.486  -65.241  1.00 52.56  ? 528 LEU B CD1   1 
ATOM   8084 C CD2   . LEU B 1 534 ? -23.259 21.156  -66.040  1.00 55.33  ? 528 LEU B CD2   1 
ATOM   8085 N N     . ARG B 1 535 ? -26.149 25.811  -67.141  1.00 52.11  ? 529 ARG B N     1 
ATOM   8086 C CA    . ARG B 1 535 ? -27.195 26.766  -66.770  1.00 52.28  ? 529 ARG B CA    1 
ATOM   8087 C C     . ARG B 1 535 ? -28.431 26.610  -67.683  1.00 55.95  ? 529 ARG B C     1 
ATOM   8088 O O     . ARG B 1 535 ? -29.377 27.408  -67.606  1.00 56.93  ? 529 ARG B O     1 
ATOM   8089 C CB    . ARG B 1 535 ? -26.653 28.213  -66.720  1.00 51.49  ? 529 ARG B CB    1 
ATOM   8090 C CG    . ARG B 1 535 ? -25.593 28.451  -65.629  1.00 55.25  ? 529 ARG B CG    1 
ATOM   8091 C CD    . ARG B 1 535 ? -26.142 28.396  -64.202  1.00 54.97  ? 529 ARG B CD    1 
ATOM   8092 N NE    . ARG B 1 535 ? -25.077 28.523  -63.204  1.00 56.58  ? 529 ARG B NE    1 
ATOM   8093 C CZ    . ARG B 1 535 ? -24.410 27.500  -62.675  1.00 63.59  ? 529 ARG B CZ    1 
ATOM   8094 N NH1   . ARG B 1 535 ? -24.708 26.254  -63.020  1.00 54.21  ? 529 ARG B NH1   1 
ATOM   8095 N NH2   . ARG B 1 535 ? -23.440 27.714  -61.798  1.00 40.89  ? 529 ARG B NH2   1 
ATOM   8096 N N     . SER B 1 536 ? -28.409 25.558  -68.538  1.00 50.20  ? 530 SER B N     1 
ATOM   8097 C CA    . SER B 1 536 ? -29.476 25.202  -69.474  1.00 49.90  ? 530 SER B CA    1 
ATOM   8098 C C     . SER B 1 536 ? -30.657 24.632  -68.721  1.00 53.55  ? 530 SER B C     1 
ATOM   8099 O O     . SER B 1 536 ? -30.481 24.134  -67.604  1.00 53.73  ? 530 SER B O     1 
ATOM   8100 C CB    . SER B 1 536 ? -28.982 24.165  -70.483  1.00 52.26  ? 530 SER B CB    1 
ATOM   8101 O OG    . SER B 1 536 ? -28.590 22.964  -69.842  1.00 53.87  ? 530 SER B OG    1 
ATOM   8102 N N     . GLU B 1 537 ? -31.853 24.649  -69.372  1.00 49.26  ? 531 GLU B N     1 
ATOM   8103 C CA    . GLU B 1 537 ? -33.091 24.123  -68.807  1.00 49.13  ? 531 GLU B CA    1 
ATOM   8104 C C     . GLU B 1 537 ? -32.831 22.767  -68.122  1.00 52.36  ? 531 GLU B C     1 
ATOM   8105 O O     . GLU B 1 537 ? -33.013 22.657  -66.903  1.00 52.71  ? 531 GLU B O     1 
ATOM   8106 C CB    . GLU B 1 537 ? -34.162 23.999  -69.882  1.00 49.99  ? 531 GLU B CB    1 
ATOM   8107 N N     . ARG B 1 538 ? -32.269 21.797  -68.870  1.00 46.36  ? 532 ARG B N     1 
ATOM   8108 C CA    . ARG B 1 538 ? -31.982 20.462  -68.361  1.00 44.74  ? 532 ARG B CA    1 
ATOM   8109 C C     . ARG B 1 538 ? -31.010 20.440  -67.187  1.00 47.36  ? 532 ARG B C     1 
ATOM   8110 O O     . ARG B 1 538 ? -31.370 19.941  -66.118  1.00 48.73  ? 532 ARG B O     1 
ATOM   8111 C CB    . ARG B 1 538 ? -31.522 19.541  -69.488  1.00 42.50  ? 532 ARG B CB    1 
ATOM   8112 C CG    . ARG B 1 538 ? -32.622 18.702  -70.075  1.00 42.29  ? 532 ARG B CG    1 
ATOM   8113 C CD    . ARG B 1 538 ? -32.193 18.084  -71.386  1.00 47.26  ? 532 ARG B CD    1 
ATOM   8114 N NE    . ARG B 1 538 ? -33.315 18.026  -72.321  1.00 55.95  ? 532 ARG B NE    1 
ATOM   8115 C CZ    . ARG B 1 538 ? -33.667 19.030  -73.115  1.00 66.51  ? 532 ARG B CZ    1 
ATOM   8116 N NH1   . ARG B 1 538 ? -32.975 20.163  -73.111  1.00 66.26  ? 532 ARG B NH1   1 
ATOM   8117 N NH2   . ARG B 1 538 ? -34.714 18.910  -73.920  1.00 38.51  ? 532 ARG B NH2   1 
ATOM   8118 N N     . SER B 1 539 ? -29.799 20.986  -67.369  1.00 41.40  ? 533 SER B N     1 
ATOM   8119 C CA    . SER B 1 539 ? -28.767 21.033  -66.332  1.00 40.60  ? 533 SER B CA    1 
ATOM   8120 C C     . SER B 1 539 ? -29.322 21.579  -65.015  1.00 46.71  ? 533 SER B C     1 
ATOM   8121 O O     . SER B 1 539 ? -29.101 20.963  -63.977  1.00 47.78  ? 533 SER B O     1 
ATOM   8122 C CB    . SER B 1 539 ? -27.578 21.866  -66.786  1.00 42.82  ? 533 SER B CB    1 
ATOM   8123 O OG    . SER B 1 539 ? -26.791 21.190  -67.752  1.00 52.95  ? 533 SER B OG    1 
ATOM   8124 N N     . LEU B 1 540 ? -30.105 22.680  -65.061  1.00 43.14  ? 534 LEU B N     1 
ATOM   8125 C CA    . LEU B 1 540 ? -30.726 23.257  -63.876  1.00 43.11  ? 534 LEU B CA    1 
ATOM   8126 C C     . LEU B 1 540 ? -31.665 22.248  -63.191  1.00 49.12  ? 534 LEU B C     1 
ATOM   8127 O O     . LEU B 1 540 ? -31.570 22.084  -61.980  1.00 51.14  ? 534 LEU B O     1 
ATOM   8128 C CB    . LEU B 1 540 ? -31.478 24.554  -64.200  1.00 43.41  ? 534 LEU B CB    1 
ATOM   8129 C CG    . LEU B 1 540 ? -30.663 25.798  -64.569  1.00 47.76  ? 534 LEU B CG    1 
ATOM   8130 C CD1   . LEU B 1 540 ? -31.586 26.955  -64.916  1.00 49.38  ? 534 LEU B CD1   1 
ATOM   8131 C CD2   . LEU B 1 540 ? -29.729 26.213  -63.460  1.00 48.29  ? 534 LEU B CD2   1 
ATOM   8132 N N     . ILE B 1 541 ? -32.514 21.532  -63.956  1.00 44.57  ? 535 ILE B N     1 
ATOM   8133 C CA    . ILE B 1 541 ? -33.422 20.526  -63.391  1.00 44.44  ? 535 ILE B CA    1 
ATOM   8134 C C     . ILE B 1 541 ? -32.648 19.417  -62.660  1.00 47.40  ? 535 ILE B C     1 
ATOM   8135 O O     . ILE B 1 541 ? -33.061 19.016  -61.562  1.00 49.07  ? 535 ILE B O     1 
ATOM   8136 C CB    . ILE B 1 541 ? -34.458 19.977  -64.417  1.00 47.66  ? 535 ILE B CB    1 
ATOM   8137 C CG1   . ILE B 1 541 ? -35.311 21.123  -64.996  1.00 48.79  ? 535 ILE B CG1   1 
ATOM   8138 C CG2   . ILE B 1 541 ? -35.365 18.920  -63.745  1.00 48.69  ? 535 ILE B CG2   1 
ATOM   8139 C CD1   . ILE B 1 541 ? -36.166 20.796  -66.180  1.00 61.70  ? 535 ILE B CD1   1 
ATOM   8140 N N     . GLN B 1 542 ? -31.512 18.950  -63.240  1.00 40.61  ? 536 GLN B N     1 
ATOM   8141 C CA    . GLN B 1 542 ? -30.695 17.917  -62.601  1.00 39.69  ? 536 GLN B CA    1 
ATOM   8142 C C     . GLN B 1 542 ? -30.022 18.487  -61.340  1.00 43.53  ? 536 GLN B C     1 
ATOM   8143 O O     . GLN B 1 542 ? -29.969 17.786  -60.326  1.00 43.84  ? 536 GLN B O     1 
ATOM   8144 C CB    . GLN B 1 542 ? -29.643 17.377  -63.572  1.00 20.00  ? 536 GLN B CB    1 
ATOM   8145 N N     . THR B 1 543 ? -29.563 19.777  -61.385  1.00 39.13  ? 537 THR B N     1 
ATOM   8146 C CA    . THR B 1 543 ? -28.928 20.460  -60.248  1.00 39.60  ? 537 THR B CA    1 
ATOM   8147 C C     . THR B 1 543 ? -29.918 20.571  -59.082  1.00 48.38  ? 537 THR B C     1 
ATOM   8148 O O     . THR B 1 543 ? -29.547 20.314  -57.931  1.00 49.70  ? 537 THR B O     1 
ATOM   8149 C CB    . THR B 1 543 ? -28.416 21.842  -60.641  1.00 44.91  ? 537 THR B CB    1 
ATOM   8150 O OG1   . THR B 1 543 ? -27.624 21.744  -61.826  1.00 47.91  ? 537 THR B OG1   1 
ATOM   8151 C CG2   . THR B 1 543 ? -27.595 22.491  -59.525  1.00 42.63  ? 537 THR B CG2   1 
ATOM   8152 N N     . ILE B 1 544 ? -31.183 20.951  -59.393  1.00 45.75  ? 538 ILE B N     1 
ATOM   8153 C CA    . ILE B 1 544 ? -32.286 21.073  -58.438  1.00 46.20  ? 538 ILE B CA    1 
ATOM   8154 C C     . ILE B 1 544 ? -32.505 19.722  -57.718  1.00 52.50  ? 538 ILE B C     1 
ATOM   8155 O O     . ILE B 1 544 ? -32.631 19.701  -56.490  1.00 52.77  ? 538 ILE B O     1 
ATOM   8156 C CB    . ILE B 1 544 ? -33.568 21.621  -59.125  1.00 48.86  ? 538 ILE B CB    1 
ATOM   8157 C CG1   . ILE B 1 544 ? -33.374 23.077  -59.588  1.00 48.55  ? 538 ILE B CG1   1 
ATOM   8158 C CG2   . ILE B 1 544 ? -34.775 21.529  -58.200  1.00 50.90  ? 538 ILE B CG2   1 
ATOM   8159 C CD1   . ILE B 1 544 ? -34.225 23.483  -60.773  1.00 51.94  ? 538 ILE B CD1   1 
ATOM   8160 N N     . GLY B 1 545 ? -32.458 18.624  -58.481  1.00 50.00  ? 539 GLY B N     1 
ATOM   8161 C CA    . GLY B 1 545 ? -32.628 17.256  -57.986  1.00 50.78  ? 539 GLY B CA    1 
ATOM   8162 C C     . GLY B 1 545 ? -31.667 16.820  -56.890  1.00 54.35  ? 539 GLY B C     1 
ATOM   8163 O O     . GLY B 1 545 ? -31.952 15.863  -56.158  1.00 54.30  ? 539 GLY B O     1 
ATOM   8164 N N     . ARG B 1 546 ? -30.533 17.532  -56.755  1.00 50.40  ? 540 ARG B N     1 
ATOM   8165 C CA    . ARG B 1 546 ? -29.521 17.247  -55.725  1.00 50.85  ? 540 ARG B CA    1 
ATOM   8166 C C     . ARG B 1 546 ? -30.012 17.626  -54.294  1.00 57.29  ? 540 ARG B C     1 
ATOM   8167 O O     . ARG B 1 546 ? -29.375 17.257  -53.309  1.00 58.19  ? 540 ARG B O     1 
ATOM   8168 C CB    . ARG B 1 546 ? -28.156 17.910  -56.065  1.00 46.65  ? 540 ARG B CB    1 
ATOM   8169 C CG    . ARG B 1 546 ? -27.623 17.584  -57.461  1.00 48.81  ? 540 ARG B CG    1 
ATOM   8170 C CD    . ARG B 1 546 ? -27.371 16.111  -57.604  1.00 52.78  ? 540 ARG B CD    1 
ATOM   8171 N NE    . ARG B 1 546 ? -26.723 15.757  -58.861  1.00 56.02  ? 540 ARG B NE    1 
ATOM   8172 C CZ    . ARG B 1 546 ? -26.387 14.512  -59.179  1.00 82.98  ? 540 ARG B CZ    1 
ATOM   8173 N NH1   . ARG B 1 546 ? -26.656 13.510  -58.351  1.00 76.34  ? 540 ARG B NH1   1 
ATOM   8174 N NH2   . ARG B 1 546 ? -25.795 14.254  -60.335  1.00 75.80  ? 540 ARG B NH2   1 
ATOM   8175 N N     . ALA B 1 547 ? -31.144 18.343  -54.193  1.00 53.45  ? 541 ALA B N     1 
ATOM   8176 C CA    . ALA B 1 547 ? -31.735 18.764  -52.928  1.00 54.58  ? 541 ALA B CA    1 
ATOM   8177 C C     . ALA B 1 547 ? -33.025 17.968  -52.597  1.00 60.70  ? 541 ALA B C     1 
ATOM   8178 O O     . ALA B 1 547 ? -33.611 18.173  -51.531  1.00 61.48  ? 541 ALA B O     1 
ATOM   8179 C CB    . ALA B 1 547 ? -32.031 20.263  -52.972  1.00 55.02  ? 541 ALA B CB    1 
ATOM   8180 N N     . ALA B 1 548 ? -33.456 17.067  -53.510  1.00 56.74  ? 542 ALA B N     1 
ATOM   8181 C CA    . ALA B 1 548 ? -34.694 16.297  -53.378  1.00 57.25  ? 542 ALA B CA    1 
ATOM   8182 C C     . ALA B 1 548 ? -34.653 15.048  -52.482  1.00 62.39  ? 542 ALA B C     1 
ATOM   8183 O O     . ALA B 1 548 ? -35.706 14.427  -52.276  1.00 62.44  ? 542 ALA B O     1 
ATOM   8184 C CB    . ALA B 1 548 ? -35.265 15.972  -54.755  1.00 57.27  ? 542 ALA B CB    1 
ATOM   8185 N N     . ARG B 1 549 ? -33.455 14.679  -51.947  1.00 60.23  ? 543 ARG B N     1 
ATOM   8186 C CA    . ARG B 1 549 ? -33.289 13.523  -51.028  1.00 61.27  ? 543 ARG B CA    1 
ATOM   8187 C C     . ARG B 1 549 ? -33.535 13.920  -49.560  1.00 66.84  ? 543 ARG B C     1 
ATOM   8188 O O     . ARG B 1 549 ? -33.543 13.074  -48.663  1.00 68.03  ? 543 ARG B O     1 
ATOM   8189 C CB    . ARG B 1 549 ? -31.935 12.806  -51.210  1.00 58.76  ? 543 ARG B CB    1 
ATOM   8190 C CG    . ARG B 1 549 ? -32.066 11.602  -52.116  1.00 70.62  ? 543 ARG B CG    1 
ATOM   8191 C CD    . ARG B 1 549 ? -30.848 10.714  -52.159  1.00 91.53  ? 543 ARG B CD    1 
ATOM   8192 N NE    . ARG B 1 549 ? -31.008 9.672   -53.178  1.00 111.67 ? 543 ARG B NE    1 
ATOM   8193 C CZ    . ARG B 1 549 ? -30.021 8.913   -53.650  1.00 136.16 ? 543 ARG B CZ    1 
ATOM   8194 N NH1   . ARG B 1 549 ? -28.778 9.070   -53.204  1.00 127.82 ? 543 ARG B NH1   1 
ATOM   8195 N NH2   . ARG B 1 549 ? -30.268 7.994   -54.577  1.00 126.37 ? 543 ARG B NH2   1 
ATOM   8196 N N     . ASN B 1 550 ? -33.812 15.206  -49.356  1.00 62.24  ? 544 ASN B N     1 
ATOM   8197 C CA    . ASN B 1 550 ? -34.045 15.833  -48.075  1.00 62.78  ? 544 ASN B CA    1 
ATOM   8198 C C     . ASN B 1 550 ? -35.477 16.355  -47.966  1.00 69.26  ? 544 ASN B C     1 
ATOM   8199 O O     . ASN B 1 550 ? -35.985 17.014  -48.883  1.00 69.05  ? 544 ASN B O     1 
ATOM   8200 C CB    . ASN B 1 550 ? -33.055 16.968  -47.929  1.00 59.33  ? 544 ASN B CB    1 
ATOM   8201 C CG    . ASN B 1 550 ? -32.898 17.446  -46.537  1.00 77.53  ? 544 ASN B CG    1 
ATOM   8202 O OD1   . ASN B 1 550 ? -33.669 18.281  -46.066  1.00 77.70  ? 544 ASN B OD1   1 
ATOM   8203 N ND2   . ASN B 1 550 ? -31.877 16.938  -45.864  1.00 64.05  ? 544 ASN B ND2   1 
ATOM   8204 N N     . ALA B 1 551 ? -36.128 16.062  -46.833  1.00 67.76  ? 545 ALA B N     1 
ATOM   8205 C CA    . ALA B 1 551 ? -37.508 16.472  -46.549  1.00 68.65  ? 545 ALA B CA    1 
ATOM   8206 C C     . ALA B 1 551 ? -37.692 18.000  -46.497  1.00 73.72  ? 545 ALA B C     1 
ATOM   8207 O O     . ALA B 1 551 ? -38.791 18.487  -46.761  1.00 74.97  ? 545 ALA B O     1 
ATOM   8208 C CB    . ALA B 1 551 ? -37.986 15.834  -45.260  1.00 71.31  ? 545 ALA B CB    1 
ATOM   8209 N N     . GLU B 1 552 ? -36.624 18.751  -46.159  1.00 69.61  ? 546 GLU B N     1 
ATOM   8210 C CA    . GLU B 1 552 ? -36.628 20.220  -46.094  1.00 68.49  ? 546 GLU B CA    1 
ATOM   8211 C C     . GLU B 1 552 ? -35.709 20.809  -47.202  1.00 68.60  ? 546 GLU B C     1 
ATOM   8212 O O     . GLU B 1 552 ? -35.079 21.853  -47.007  1.00 68.09  ? 546 GLU B O     1 
ATOM   8213 C CB    . GLU B 1 552 ? -36.222 20.695  -44.680  1.00 70.84  ? 546 GLU B CB    1 
ATOM   8214 N N     . GLY B 1 553 ? -35.664 20.128  -48.348  1.00 62.23  ? 547 GLY B N     1 
ATOM   8215 C CA    . GLY B 1 553 ? -34.851 20.508  -49.497  1.00 60.09  ? 547 GLY B CA    1 
ATOM   8216 C C     . GLY B 1 553 ? -35.243 21.836  -50.118  1.00 63.41  ? 547 GLY B C     1 
ATOM   8217 O O     . GLY B 1 553 ? -36.387 22.022  -50.536  1.00 63.18  ? 547 GLY B O     1 
ATOM   8218 N N     . ARG B 1 554 ? -34.297 22.792  -50.108  1.00 58.92  ? 548 ARG B N     1 
ATOM   8219 C CA    . ARG B 1 554 ? -34.476 24.142  -50.628  1.00 57.90  ? 548 ARG B CA    1 
ATOM   8220 C C     . ARG B 1 554 ? -33.407 24.502  -51.680  1.00 58.51  ? 548 ARG B C     1 
ATOM   8221 O O     . ARG B 1 554 ? -32.268 24.047  -51.557  1.00 57.88  ? 548 ARG B O     1 
ATOM   8222 C CB    . ARG B 1 554 ? -34.446 25.126  -49.456  1.00 60.23  ? 548 ARG B CB    1 
ATOM   8223 C CG    . ARG B 1 554 ? -35.549 26.166  -49.543  1.00 75.00  ? 548 ARG B CG    1 
ATOM   8224 C CD    . ARG B 1 554 ? -36.250 26.395  -48.226  1.00 81.05  ? 548 ARG B CD    1 
ATOM   8225 N NE    . ARG B 1 554 ? -37.259 25.374  -47.954  1.00 90.48  ? 548 ARG B NE    1 
ATOM   8226 C CZ    . ARG B 1 554 ? -38.170 25.467  -46.989  1.00 114.15 ? 548 ARG B CZ    1 
ATOM   8227 N NH1   . ARG B 1 554 ? -38.223 26.547  -46.217  1.00 103.85 ? 548 ARG B NH1   1 
ATOM   8228 N NH2   . ARG B 1 554 ? -39.045 24.490  -46.800  1.00 107.25 ? 548 ARG B NH2   1 
ATOM   8229 N N     . VAL B 1 555 ? -33.775 25.291  -52.725  1.00 52.78  ? 549 VAL B N     1 
ATOM   8230 C CA    . VAL B 1 555 ? -32.849 25.721  -53.801  1.00 50.54  ? 549 VAL B CA    1 
ATOM   8231 C C     . VAL B 1 555 ? -32.823 27.240  -53.894  1.00 55.09  ? 549 VAL B C     1 
ATOM   8232 O O     . VAL B 1 555 ? -33.885 27.866  -53.935  1.00 55.75  ? 549 VAL B O     1 
ATOM   8233 C CB    . VAL B 1 555 ? -33.150 25.090  -55.198  1.00 52.19  ? 549 VAL B CB    1 
ATOM   8234 C CG1   . VAL B 1 555 ? -32.201 25.617  -56.274  1.00 49.99  ? 549 VAL B CG1   1 
ATOM   8235 C CG2   . VAL B 1 555 ? -33.099 23.570  -55.149  1.00 51.91  ? 549 VAL B CG2   1 
ATOM   8236 N N     . ILE B 1 556 ? -31.617 27.830  -53.968  1.00 50.77  ? 550 ILE B N     1 
ATOM   8237 C CA    . ILE B 1 556 ? -31.476 29.277  -54.112  1.00 50.60  ? 550 ILE B CA    1 
ATOM   8238 C C     . ILE B 1 556 ? -30.747 29.607  -55.417  1.00 55.93  ? 550 ILE B C     1 
ATOM   8239 O O     . ILE B 1 556 ? -29.610 29.164  -55.631  1.00 54.44  ? 550 ILE B O     1 
ATOM   8240 C CB    . ILE B 1 556 ? -30.860 29.985  -52.884  1.00 53.55  ? 550 ILE B CB    1 
ATOM   8241 C CG1   . ILE B 1 556 ? -31.696 29.750  -51.625  1.00 54.96  ? 550 ILE B CG1   1 
ATOM   8242 C CG2   . ILE B 1 556 ? -30.731 31.468  -53.157  1.00 54.39  ? 550 ILE B CG2   1 
ATOM   8243 C CD1   . ILE B 1 556 ? -30.963 30.068  -50.337  1.00 64.64  ? 550 ILE B CD1   1 
ATOM   8244 N N     . MET B 1 557 ? -31.426 30.371  -56.287  1.00 53.42  ? 551 MET B N     1 
ATOM   8245 C CA    . MET B 1 557 ? -30.885 30.809  -57.561  1.00 52.84  ? 551 MET B CA    1 
ATOM   8246 C C     . MET B 1 557 ? -30.513 32.280  -57.432  1.00 56.83  ? 551 MET B C     1 
ATOM   8247 O O     . MET B 1 557 ? -31.373 33.102  -57.112  1.00 56.72  ? 551 MET B O     1 
ATOM   8248 C CB    . MET B 1 557 ? -31.903 30.604  -58.696  1.00 55.19  ? 551 MET B CB    1 
ATOM   8249 C CG    . MET B 1 557 ? -32.194 29.155  -58.998  1.00 58.67  ? 551 MET B CG    1 
ATOM   8250 S SD    . MET B 1 557 ? -32.904 28.929  -60.653  1.00 62.55  ? 551 MET B SD    1 
ATOM   8251 C CE    . MET B 1 557 ? -33.306 27.199  -60.601  1.00 58.55  ? 551 MET B CE    1 
ATOM   8252 N N     . TYR B 1 558 ? -29.225 32.602  -57.625  1.00 52.83  ? 552 TYR B N     1 
ATOM   8253 C CA    . TYR B 1 558 ? -28.723 33.965  -57.551  1.00 53.09  ? 552 TYR B CA    1 
ATOM   8254 C C     . TYR B 1 558 ? -28.592 34.490  -58.956  1.00 59.47  ? 552 TYR B C     1 
ATOM   8255 O O     . TYR B 1 558 ? -27.714 34.071  -59.714  1.00 58.70  ? 552 TYR B O     1 
ATOM   8256 C CB    . TYR B 1 558 ? -27.400 34.029  -56.771  1.00 54.25  ? 552 TYR B CB    1 
ATOM   8257 C CG    . TYR B 1 558 ? -27.547 33.764  -55.286  1.00 56.13  ? 552 TYR B CG    1 
ATOM   8258 C CD1   . TYR B 1 558 ? -27.026 32.610  -54.711  1.00 57.98  ? 552 TYR B CD1   1 
ATOM   8259 C CD2   . TYR B 1 558 ? -28.225 34.659  -54.458  1.00 57.39  ? 552 TYR B CD2   1 
ATOM   8260 C CE1   . TYR B 1 558 ? -27.172 32.351  -53.347  1.00 60.30  ? 552 TYR B CE1   1 
ATOM   8261 C CE2   . TYR B 1 558 ? -28.387 34.407  -53.097  1.00 59.02  ? 552 TYR B CE2   1 
ATOM   8262 C CZ    . TYR B 1 558 ? -27.849 33.256  -52.540  1.00 66.77  ? 552 TYR B CZ    1 
ATOM   8263 O OH    . TYR B 1 558 ? -28.004 33.003  -51.191  1.00 66.24  ? 552 TYR B OH    1 
ATOM   8264 N N     . ALA B 1 559 ? -29.528 35.367  -59.328  1.00 59.13  ? 553 ALA B N     1 
ATOM   8265 C CA    . ALA B 1 559 ? -29.657 35.947  -60.668  1.00 59.28  ? 553 ALA B CA    1 
ATOM   8266 C C     . ALA B 1 559 ? -30.359 37.301  -60.621  1.00 65.83  ? 553 ALA B C     1 
ATOM   8267 O O     . ALA B 1 559 ? -31.136 37.556  -59.695  1.00 67.19  ? 553 ALA B O     1 
ATOM   8268 C CB    . ALA B 1 559 ? -30.473 34.999  -61.536  1.00 59.40  ? 553 ALA B CB    1 
ATOM   8269 N N     . ASP B 1 560 ? -30.135 38.145  -61.645  1.00 62.56  ? 554 ASP B N     1 
ATOM   8270 C CA    . ASP B 1 560 ? -30.818 39.441  -61.760  1.00 63.01  ? 554 ASP B CA    1 
ATOM   8271 C C     . ASP B 1 560 ? -31.997 39.371  -62.732  1.00 63.93  ? 554 ASP B C     1 
ATOM   8272 O O     . ASP B 1 560 ? -33.017 40.004  -62.499  1.00 64.65  ? 554 ASP B O     1 
ATOM   8273 C CB    . ASP B 1 560 ? -29.845 40.559  -62.128  1.00 65.65  ? 554 ASP B CB    1 
ATOM   8274 C CG    . ASP B 1 560 ? -28.847 40.837  -61.015  1.00 79.86  ? 554 ASP B CG    1 
ATOM   8275 O OD1   . ASP B 1 560 ? -29.286 41.220  -59.894  1.00 80.30  ? 554 ASP B OD1   1 
ATOM   8276 O OD2   . ASP B 1 560 ? -27.636 40.673  -61.257  1.00 89.06  ? 554 ASP B OD2   1 
ATOM   8277 N N     . LYS B 1 561 ? -31.865 38.568  -63.796  1.00 57.86  ? 555 LYS B N     1 
ATOM   8278 C CA    . LYS B 1 561 ? -32.893 38.334  -64.815  1.00 56.41  ? 555 LYS B CA    1 
ATOM   8279 C C     . LYS B 1 561 ? -33.391 36.902  -64.708  1.00 57.01  ? 555 LYS B C     1 
ATOM   8280 O O     . LYS B 1 561 ? -32.637 36.029  -64.270  1.00 57.30  ? 555 LYS B O     1 
ATOM   8281 C CB    . LYS B 1 561 ? -32.311 38.561  -66.213  1.00 56.45  ? 555 LYS B CB    1 
ATOM   8282 N N     . ILE B 1 562 ? -34.634 36.643  -65.129  1.00 49.89  ? 556 ILE B N     1 
ATOM   8283 C CA    . ILE B 1 562 ? -35.145 35.277  -65.162  1.00 47.84  ? 556 ILE B CA    1 
ATOM   8284 C C     . ILE B 1 562 ? -35.024 34.814  -66.607  1.00 47.99  ? 556 ILE B C     1 
ATOM   8285 O O     . ILE B 1 562 ? -35.699 35.365  -67.475  1.00 47.65  ? 556 ILE B O     1 
ATOM   8286 C CB    . ILE B 1 562 ? -36.589 35.139  -64.610  1.00 51.78  ? 556 ILE B CB    1 
ATOM   8287 C CG1   . ILE B 1 562 ? -36.759 35.817  -63.225  1.00 53.66  ? 556 ILE B CG1   1 
ATOM   8288 C CG2   . ILE B 1 562 ? -37.097 33.661  -64.635  1.00 50.85  ? 556 ILE B CG2   1 
ATOM   8289 C CD1   . ILE B 1 562 ? -35.809 35.371  -62.083  1.00 62.56  ? 556 ILE B CD1   1 
ATOM   8290 N N     . THR B 1 563 ? -34.134 33.844  -66.871  1.00 42.40  ? 557 THR B N     1 
ATOM   8291 C CA    . THR B 1 563 ? -33.905 33.300  -68.213  1.00 41.89  ? 557 THR B CA    1 
ATOM   8292 C C     . THR B 1 563 ? -34.991 32.290  -68.630  1.00 45.63  ? 557 THR B C     1 
ATOM   8293 O O     . THR B 1 563 ? -35.682 31.733  -67.769  1.00 43.85  ? 557 THR B O     1 
ATOM   8294 C CB    . THR B 1 563 ? -32.502 32.709  -68.316  1.00 55.61  ? 557 THR B CB    1 
ATOM   8295 O OG1   . THR B 1 563 ? -32.415 31.553  -67.480  1.00 65.45  ? 557 THR B OG1   1 
ATOM   8296 C CG2   . THR B 1 563 ? -31.417 33.706  -67.941  1.00 53.49  ? 557 THR B CG2   1 
ATOM   8297 N N     . LYS B 1 564 ? -35.139 32.044  -69.949  1.00 44.16  ? 558 LYS B N     1 
ATOM   8298 C CA    . LYS B 1 564 ? -36.128 31.057  -70.415  1.00 45.36  ? 558 LYS B CA    1 
ATOM   8299 C C     . LYS B 1 564 ? -35.806 29.711  -69.752  1.00 51.47  ? 558 LYS B C     1 
ATOM   8300 O O     . LYS B 1 564 ? -36.708 29.066  -69.208  1.00 52.33  ? 558 LYS B O     1 
ATOM   8301 C CB    . LYS B 1 564 ? -36.145 30.929  -71.959  1.00 46.13  ? 558 LYS B CB    1 
ATOM   8302 C CG    . LYS B 1 564 ? -37.474 31.304  -72.616  1.00 38.02  ? 558 LYS B CG    1 
ATOM   8303 C CD    . LYS B 1 564 ? -38.614 30.478  -72.062  1.00 45.81  ? 558 LYS B CD    1 
ATOM   8304 C CE    . LYS B 1 564 ? -39.930 30.764  -72.725  1.00 61.53  ? 558 LYS B CE    1 
ATOM   8305 N NZ    . LYS B 1 564 ? -40.895 29.630  -72.552  1.00 74.05  ? 558 LYS B NZ    1 
ATOM   8306 N N     . SER B 1 565 ? -34.490 29.374  -69.696  1.00 47.00  ? 559 SER B N     1 
ATOM   8307 C CA    . SER B 1 565 ? -33.942 28.190  -69.057  1.00 46.19  ? 559 SER B CA    1 
ATOM   8308 C C     . SER B 1 565 ? -34.416 28.080  -67.608  1.00 49.54  ? 559 SER B C     1 
ATOM   8309 O O     . SER B 1 565 ? -34.963 27.039  -67.242  1.00 49.76  ? 559 SER B O     1 
ATOM   8310 C CB    . SER B 1 565 ? -32.421 28.230  -69.114  1.00 49.95  ? 559 SER B CB    1 
ATOM   8311 O OG    . SER B 1 565 ? -31.990 28.114  -70.461  1.00 58.21  ? 559 SER B OG    1 
ATOM   8312 N N     . MET B 1 566 ? -34.259 29.168  -66.809  1.00 44.58  ? 560 MET B N     1 
ATOM   8313 C CA    . MET B 1 566 ? -34.673 29.239  -65.400  1.00 43.32  ? 560 MET B CA    1 
ATOM   8314 C C     . MET B 1 566 ? -36.159 29.053  -65.230  1.00 47.48  ? 560 MET B C     1 
ATOM   8315 O O     . MET B 1 566 ? -36.556 28.289  -64.353  1.00 46.30  ? 560 MET B O     1 
ATOM   8316 C CB    . MET B 1 566 ? -34.280 30.567  -64.771  1.00 45.12  ? 560 MET B CB    1 
ATOM   8317 C CG    . MET B 1 566 ? -32.905 30.600  -64.229  1.00 47.44  ? 560 MET B CG    1 
ATOM   8318 S SD    . MET B 1 566 ? -32.476 32.345  -63.984  1.00 52.20  ? 560 MET B SD    1 
ATOM   8319 C CE    . MET B 1 566 ? -33.323 32.687  -62.432  1.00 49.69  ? 560 MET B CE    1 
ATOM   8320 N N     . GLU B 1 567 ? -36.974 29.737  -66.067  1.00 45.65  ? 561 GLU B N     1 
ATOM   8321 C CA    . GLU B 1 567 ? -38.440 29.662  -66.022  1.00 47.21  ? 561 GLU B CA    1 
ATOM   8322 C C     . GLU B 1 567 ? -38.934 28.238  -66.188  1.00 50.15  ? 561 GLU B C     1 
ATOM   8323 O O     . GLU B 1 567 ? -39.713 27.782  -65.358  1.00 50.43  ? 561 GLU B O     1 
ATOM   8324 C CB    . GLU B 1 567 ? -39.057 30.553  -67.088  1.00 48.92  ? 561 GLU B CB    1 
ATOM   8325 N N     . ILE B 1 568 ? -38.438 27.523  -67.214  1.00 46.16  ? 562 ILE B N     1 
ATOM   8326 C CA    . ILE B 1 568 ? -38.786 26.126  -67.510  1.00 46.79  ? 562 ILE B CA    1 
ATOM   8327 C C     . ILE B 1 568 ? -38.513 25.216  -66.302  1.00 50.38  ? 562 ILE B C     1 
ATOM   8328 O O     . ILE B 1 568 ? -39.397 24.468  -65.875  1.00 50.59  ? 562 ILE B O     1 
ATOM   8329 C CB    . ILE B 1 568 ? -38.044 25.653  -68.784  1.00 49.78  ? 562 ILE B CB    1 
ATOM   8330 C CG1   . ILE B 1 568 ? -38.591 26.372  -70.040  1.00 50.17  ? 562 ILE B CG1   1 
ATOM   8331 C CG2   . ILE B 1 568 ? -38.122 24.132  -68.940  1.00 52.74  ? 562 ILE B CG2   1 
ATOM   8332 C CD1   . ILE B 1 568 ? -37.618 26.504  -71.157  1.00 55.32  ? 562 ILE B CD1   1 
ATOM   8333 N N     . ALA B 1 569 ? -37.283 25.303  -65.759  1.00 46.74  ? 563 ALA B N     1 
ATOM   8334 C CA    . ALA B 1 569 ? -36.799 24.556  -64.590  1.00 45.85  ? 563 ALA B CA    1 
ATOM   8335 C C     . ALA B 1 569 ? -37.683 24.832  -63.366  1.00 50.55  ? 563 ALA B C     1 
ATOM   8336 O O     . ALA B 1 569 ? -38.203 23.892  -62.750  1.00 50.40  ? 563 ALA B O     1 
ATOM   8337 C CB    . ALA B 1 569 ? -35.352 24.930  -64.296  1.00 45.09  ? 563 ALA B CB    1 
ATOM   8338 N N     . ILE B 1 570 ? -37.898 26.128  -63.066  1.00 46.65  ? 564 ILE B N     1 
ATOM   8339 C CA    . ILE B 1 570 ? -38.745 26.600  -61.974  1.00 47.18  ? 564 ILE B CA    1 
ATOM   8340 C C     . ILE B 1 570 ? -40.180 26.054  -62.122  1.00 53.27  ? 564 ILE B C     1 
ATOM   8341 O O     . ILE B 1 570 ? -40.744 25.555  -61.139  1.00 54.17  ? 564 ILE B O     1 
ATOM   8342 C CB    . ILE B 1 570 ? -38.647 28.145  -61.871  1.00 49.99  ? 564 ILE B CB    1 
ATOM   8343 C CG1   . ILE B 1 570 ? -37.387 28.547  -61.076  1.00 49.38  ? 564 ILE B CG1   1 
ATOM   8344 C CG2   . ILE B 1 570 ? -39.905 28.779  -61.289  1.00 52.57  ? 564 ILE B CG2   1 
ATOM   8345 C CD1   . ILE B 1 570 ? -36.687 29.861  -61.478  1.00 52.55  ? 564 ILE B CD1   1 
ATOM   8346 N N     . ASN B 1 571 ? -40.727 26.083  -63.360  1.00 49.75  ? 565 ASN B N     1 
ATOM   8347 C CA    . ASN B 1 571 ? -42.073 25.595  -63.660  1.00 50.79  ? 565 ASN B CA    1 
ATOM   8348 C C     . ASN B 1 571 ? -42.219 24.084  -63.581  1.00 55.44  ? 565 ASN B C     1 
ATOM   8349 O O     . ASN B 1 571 ? -43.184 23.622  -62.971  1.00 56.77  ? 565 ASN B O     1 
ATOM   8350 C CB    . ASN B 1 571 ? -42.609 26.156  -64.981  1.00 51.42  ? 565 ASN B CB    1 
ATOM   8351 C CG    . ASN B 1 571 ? -42.825 27.655  -64.965  1.00 72.57  ? 565 ASN B CG    1 
ATOM   8352 O OD1   . ASN B 1 571 ? -42.958 28.300  -63.907  1.00 69.39  ? 565 ASN B OD1   1 
ATOM   8353 N ND2   . ASN B 1 571 ? -42.850 28.249  -66.147  1.00 59.73  ? 565 ASN B ND2   1 
ATOM   8354 N N     . GLU B 1 572 ? -41.267 23.313  -64.159  1.00 50.46  ? 566 GLU B N     1 
ATOM   8355 C CA    . GLU B 1 572 ? -41.302 21.843  -64.117  1.00 49.80  ? 566 GLU B CA    1 
ATOM   8356 C C     . GLU B 1 572 ? -41.261 21.342  -62.677  1.00 54.53  ? 566 GLU B C     1 
ATOM   8357 O O     . GLU B 1 572 ? -41.954 20.384  -62.328  1.00 54.21  ? 566 GLU B O     1 
ATOM   8358 C CB    . GLU B 1 572 ? -40.164 21.223  -64.958  1.00 49.56  ? 566 GLU B CB    1 
ATOM   8359 C CG    . GLU B 1 572 ? -40.203 19.697  -65.061  1.00 58.76  ? 566 GLU B CG    1 
ATOM   8360 C CD    . GLU B 1 572 ? -41.412 18.984  -65.671  1.00 82.98  ? 566 GLU B CD    1 
ATOM   8361 O OE1   . GLU B 1 572 ? -42.450 19.636  -65.931  1.00 69.29  ? 566 GLU B OE1   1 
ATOM   8362 O OE2   . GLU B 1 572 ? -41.317 17.754  -65.889  1.00 83.59  ? 566 GLU B OE2   1 
ATOM   8363 N N     . THR B 1 573 ? -40.468 22.026  -61.838  1.00 51.78  ? 567 THR B N     1 
ATOM   8364 C CA    . THR B 1 573 ? -40.338 21.713  -60.424  1.00 52.15  ? 567 THR B CA    1 
ATOM   8365 C C     . THR B 1 573 ? -41.672 21.979  -59.737  1.00 58.64  ? 567 THR B C     1 
ATOM   8366 O O     . THR B 1 573 ? -42.154 21.089  -59.030  1.00 59.79  ? 567 THR B O     1 
ATOM   8367 C CB    . THR B 1 573 ? -39.125 22.425  -59.818  1.00 54.16  ? 567 THR B CB    1 
ATOM   8368 O OG1   . THR B 1 573 ? -37.976 22.130  -60.623  1.00 48.91  ? 567 THR B OG1   1 
ATOM   8369 C CG2   . THR B 1 573 ? -38.865 22.019  -58.365  1.00 49.29  ? 567 THR B CG2   1 
ATOM   8370 N N     . LYS B 1 574 ? -42.308 23.159  -60.000  1.00 55.51  ? 568 LYS B N     1 
ATOM   8371 C CA    . LYS B 1 574 ? -43.626 23.495  -59.430  1.00 56.49  ? 568 LYS B CA    1 
ATOM   8372 C C     . LYS B 1 574 ? -44.618 22.369  -59.725  1.00 60.78  ? 568 LYS B C     1 
ATOM   8373 O O     . LYS B 1 574 ? -45.185 21.813  -58.784  1.00 61.11  ? 568 LYS B O     1 
ATOM   8374 C CB    . LYS B 1 574 ? -44.143 24.842  -59.952  1.00 58.64  ? 568 LYS B CB    1 
ATOM   8375 N N     . ARG B 1 575 ? -44.709 21.954  -61.018  1.00 56.83  ? 569 ARG B N     1 
ATOM   8376 C CA    . ARG B 1 575 ? -45.554 20.867  -61.532  1.00 56.90  ? 569 ARG B CA    1 
ATOM   8377 C C     . ARG B 1 575 ? -45.355 19.582  -60.721  1.00 61.93  ? 569 ARG B C     1 
ATOM   8378 O O     . ARG B 1 575 ? -46.298 19.140  -60.063  1.00 62.98  ? 569 ARG B O     1 
ATOM   8379 C CB    . ARG B 1 575 ? -45.283 20.620  -63.036  1.00 53.78  ? 569 ARG B CB    1 
ATOM   8380 C CG    . ARG B 1 575 ? -46.195 19.566  -63.645  1.00 60.91  ? 569 ARG B CG    1 
ATOM   8381 C CD    . ARG B 1 575 ? -45.938 19.317  -65.117  1.00 65.83  ? 569 ARG B CD    1 
ATOM   8382 N NE    . ARG B 1 575 ? -44.804 18.427  -65.360  1.00 74.68  ? 569 ARG B NE    1 
ATOM   8383 C CZ    . ARG B 1 575 ? -44.838 17.100  -65.254  1.00 93.84  ? 569 ARG B CZ    1 
ATOM   8384 N NH1   . ARG B 1 575 ? -45.953 16.485  -64.867  1.00 75.07  ? 569 ARG B NH1   1 
ATOM   8385 N NH2   . ARG B 1 575 ? -43.752 16.381  -65.503  1.00 90.42  ? 569 ARG B NH2   1 
ATOM   8386 N N     . ARG B 1 576 ? -44.102 19.055  -60.700  1.00 58.05  ? 570 ARG B N     1 
ATOM   8387 C CA    . ARG B 1 576 ? -43.682 17.830  -59.997  1.00 58.71  ? 570 ARG B CA    1 
ATOM   8388 C C     . ARG B 1 576 ? -43.837 17.853  -58.471  1.00 65.90  ? 570 ARG B C     1 
ATOM   8389 O O     . ARG B 1 576 ? -44.138 16.808  -57.886  1.00 68.05  ? 570 ARG B O     1 
ATOM   8390 C CB    . ARG B 1 576 ? -42.252 17.459  -60.351  1.00 56.80  ? 570 ARG B CB    1 
ATOM   8391 C CG    . ARG B 1 576 ? -42.068 17.085  -61.801  1.00 65.94  ? 570 ARG B CG    1 
ATOM   8392 C CD    . ARG B 1 576 ? -40.770 16.351  -61.970  1.00 67.26  ? 570 ARG B CD    1 
ATOM   8393 N NE    . ARG B 1 576 ? -40.214 16.554  -63.297  1.00 67.39  ? 570 ARG B NE    1 
ATOM   8394 C CZ    . ARG B 1 576 ? -38.982 16.202  -63.633  1.00 84.80  ? 570 ARG B CZ    1 
ATOM   8395 N NH1   . ARG B 1 576 ? -38.186 15.621  -62.743  1.00 80.13  ? 570 ARG B NH1   1 
ATOM   8396 N NH2   . ARG B 1 576 ? -38.531 16.431  -64.861  1.00 68.79  ? 570 ARG B NH2   1 
ATOM   8397 N N     . ARG B 1 577 ? -43.590 19.020  -57.825  1.00 60.90  ? 571 ARG B N     1 
ATOM   8398 C CA    . ARG B 1 577 ? -43.761 19.214  -56.381  1.00 60.56  ? 571 ARG B CA    1 
ATOM   8399 C C     . ARG B 1 577 ? -45.244 19.180  -55.995  1.00 65.46  ? 571 ARG B C     1 
ATOM   8400 O O     . ARG B 1 577 ? -45.584 18.596  -54.963  1.00 65.59  ? 571 ARG B O     1 
ATOM   8401 C CB    . ARG B 1 577 ? -43.124 20.530  -55.919  1.00 57.79  ? 571 ARG B CB    1 
ATOM   8402 C CG    . ARG B 1 577 ? -43.139 20.710  -54.408  1.00 63.63  ? 571 ARG B CG    1 
ATOM   8403 C CD    . ARG B 1 577 ? -42.448 21.983  -53.982  1.00 67.46  ? 571 ARG B CD    1 
ATOM   8404 N NE    . ARG B 1 577 ? -42.690 22.294  -52.571  1.00 69.08  ? 571 ARG B NE    1 
ATOM   8405 C CZ    . ARG B 1 577 ? -41.918 21.894  -51.563  1.00 78.36  ? 571 ARG B CZ    1 
ATOM   8406 N NH1   . ARG B 1 577 ? -40.842 21.148  -51.793  1.00 61.34  ? 571 ARG B NH1   1 
ATOM   8407 N NH2   . ARG B 1 577 ? -42.212 22.241  -50.319  1.00 63.54  ? 571 ARG B NH2   1 
ATOM   8408 N N     . GLU B 1 578 ? -46.116 19.805  -56.833  1.00 62.15  ? 572 GLU B N     1 
ATOM   8409 C CA    . GLU B 1 578 ? -47.565 19.873  -56.645  1.00 63.17  ? 572 GLU B CA    1 
ATOM   8410 C C     . GLU B 1 578 ? -48.206 18.460  -56.766  1.00 69.85  ? 572 GLU B C     1 
ATOM   8411 O O     . GLU B 1 578 ? -48.890 18.033  -55.829  1.00 70.08  ? 572 GLU B O     1 
ATOM   8412 C CB    . GLU B 1 578 ? -48.176 20.854  -57.641  1.00 63.20  ? 572 GLU B CB    1 
ATOM   8413 N N     . GLN B 1 579 ? -47.919 17.712  -57.879  1.00 67.02  ? 573 GLN B N     1 
ATOM   8414 C CA    . GLN B 1 579 ? -48.453 16.357  -58.122  1.00 68.10  ? 573 GLN B CA    1 
ATOM   8415 C C     . GLN B 1 579 ? -48.167 15.454  -56.939  1.00 72.46  ? 573 GLN B C     1 
ATOM   8416 O O     . GLN B 1 579 ? -49.049 14.724  -56.496  1.00 73.46  ? 573 GLN B O     1 
ATOM   8417 C CB    . GLN B 1 579 ? -47.882 15.715  -59.415  1.00 68.49  ? 573 GLN B CB    1 
ATOM   8418 C CG    . GLN B 1 579 ? -48.171 16.441  -60.732  1.00 96.84  ? 573 GLN B CG    1 
ATOM   8419 C CD    . GLN B 1 579 ? -49.600 16.897  -60.908  1.00 131.34 ? 573 GLN B CD    1 
ATOM   8420 O OE1   . GLN B 1 579 ? -50.556 16.110  -60.810  1.00 131.46 ? 573 GLN B OE1   1 
ATOM   8421 N NE2   . GLN B 1 579 ? -49.767 18.189  -61.181  1.00 124.72 ? 573 GLN B NE2   1 
ATOM   8422 N N     . GLN B 1 580 ? -46.924 15.532  -56.427  1.00 68.19  ? 574 GLN B N     1 
ATOM   8423 C CA    . GLN B 1 580 ? -46.423 14.768  -55.298  1.00 68.77  ? 574 GLN B CA    1 
ATOM   8424 C C     . GLN B 1 580 ? -47.147 15.154  -54.016  1.00 75.61  ? 574 GLN B C     1 
ATOM   8425 O O     . GLN B 1 580 ? -47.585 14.260  -53.288  1.00 78.14  ? 574 GLN B O     1 
ATOM   8426 C CB    . GLN B 1 580 ? -44.907 14.946  -55.160  1.00 68.34  ? 574 GLN B CB    1 
ATOM   8427 N N     . GLU B 1 581 ? -47.316 16.474  -53.761  1.00 70.97  ? 575 GLU B N     1 
ATOM   8428 C CA    . GLU B 1 581 ? -48.017 16.989  -52.577  1.00 72.06  ? 575 GLU B CA    1 
ATOM   8429 C C     . GLU B 1 581 ? -49.488 16.522  -52.537  1.00 78.09  ? 575 GLU B C     1 
ATOM   8430 O O     . GLU B 1 581 ? -49.986 16.166  -51.462  1.00 78.79  ? 575 GLU B O     1 
ATOM   8431 C CB    . GLU B 1 581 ? -47.928 18.514  -52.529  1.00 72.01  ? 575 GLU B CB    1 
ATOM   8432 N N     . ARG B 1 582 ? -50.150 16.484  -53.733  1.00 74.70  ? 576 ARG B N     1 
ATOM   8433 C CA    . ARG B 1 582 ? -51.538 16.051  -53.960  1.00 75.68  ? 576 ARG B CA    1 
ATOM   8434 C C     . ARG B 1 582 ? -51.702 14.550  -53.727  1.00 81.08  ? 576 ARG B C     1 
ATOM   8435 O O     . ARG B 1 582 ? -52.744 14.125  -53.234  1.00 83.19  ? 576 ARG B O     1 
ATOM   8436 C CB    . ARG B 1 582 ? -51.978 16.411  -55.371  1.00 75.40  ? 576 ARG B CB    1 
ATOM   8437 N N     . PHE B 1 583 ? -50.676 13.757  -54.080  1.00 76.90  ? 577 PHE B N     1 
ATOM   8438 C CA    . PHE B 1 583 ? -50.643 12.310  -53.884  1.00 78.35  ? 577 PHE B CA    1 
ATOM   8439 C C     . PHE B 1 583 ? -50.450 11.991  -52.395  1.00 81.96  ? 577 PHE B C     1 
ATOM   8440 O O     . PHE B 1 583 ? -51.031 11.027  -51.886  1.00 82.55  ? 577 PHE B O     1 
ATOM   8441 C CB    . PHE B 1 583 ? -49.499 11.688  -54.710  1.00 79.17  ? 577 PHE B CB    1 
ATOM   8442 C CG    . PHE B 1 583 ? -49.279 10.204  -54.482  1.00 82.03  ? 577 PHE B CG    1 
ATOM   8443 C CD1   . PHE B 1 583 ? -49.926 9.260   -55.271  1.00 86.38  ? 577 PHE B CD1   1 
ATOM   8444 C CD2   . PHE B 1 583 ? -48.423 9.755   -53.481  1.00 83.65  ? 577 PHE B CD2   1 
ATOM   8445 C CE1   . PHE B 1 583 ? -49.725 7.895   -55.060  1.00 87.82  ? 577 PHE B CE1   1 
ATOM   8446 C CE2   . PHE B 1 583 ? -48.234 8.392   -53.266  1.00 87.17  ? 577 PHE B CE2   1 
ATOM   8447 C CZ    . PHE B 1 583 ? -48.881 7.472   -54.059  1.00 86.30  ? 577 PHE B CZ    1 
ATOM   8448 N N     . ASN B 1 584 ? -49.588 12.770  -51.724  1.00 77.46  ? 578 ASN B N     1 
ATOM   8449 C CA    . ASN B 1 584 ? -49.283 12.630  -50.305  1.00 78.60  ? 578 ASN B CA    1 
ATOM   8450 C C     . ASN B 1 584 ? -50.498 12.953  -49.433  1.00 85.68  ? 578 ASN B C     1 
ATOM   8451 O O     . ASN B 1 584 ? -50.587 12.429  -48.327  1.00 86.71  ? 578 ASN B O     1 
ATOM   8452 C CB    . ASN B 1 584 ? -48.095 13.513  -49.927  1.00 79.30  ? 578 ASN B CB    1 
ATOM   8453 C CG    . ASN B 1 584 ? -46.724 12.931  -50.205  1.00 99.48  ? 578 ASN B CG    1 
ATOM   8454 O OD1   . ASN B 1 584 ? -46.563 11.858  -50.803  1.00 89.53  ? 578 ASN B OD1   1 
ATOM   8455 N ND2   . ASN B 1 584 ? -45.696 13.642  -49.757  1.00 91.33  ? 578 ASN B ND2   1 
ATOM   8456 N N     . GLU B 1 585 ? -51.420 13.819  -49.930  1.00 83.83  ? 579 GLU B N     1 
ATOM   8457 C CA    . GLU B 1 585 ? -52.680 14.199  -49.279  1.00 86.43  ? 579 GLU B CA    1 
ATOM   8458 C C     . GLU B 1 585 ? -53.664 13.021  -49.362  1.00 94.89  ? 579 GLU B C     1 
ATOM   8459 O O     . GLU B 1 585 ? -54.172 12.570  -48.327  1.00 96.78  ? 579 GLU B O     1 
ATOM   8460 C CB    . GLU B 1 585 ? -53.281 15.421  -49.968  1.00 86.60  ? 579 GLU B CB    1 
ATOM   8461 N N     . GLU B 1 586 ? -53.894 12.508  -50.603  1.00 92.38  ? 580 GLU B N     1 
ATOM   8462 C CA    . GLU B 1 586 ? -54.789 11.396  -50.940  1.00 94.41  ? 580 GLU B CA    1 
ATOM   8463 C C     . GLU B 1 586 ? -54.423 10.059  -50.282  1.00 102.32 ? 580 GLU B C     1 
ATOM   8464 O O     . GLU B 1 586 ? -55.303 9.210   -50.125  1.00 104.62 ? 580 GLU B O     1 
ATOM   8465 C CB    . GLU B 1 586 ? -54.891 11.239  -52.456  1.00 93.56  ? 580 GLU B CB    1 
ATOM   8466 N N     . HIS B 1 587 ? -53.142 9.877   -49.890  1.00 99.47  ? 581 HIS B N     1 
ATOM   8467 C CA    . HIS B 1 587 ? -52.631 8.655   -49.259  1.00 101.00 ? 581 HIS B CA    1 
ATOM   8468 C C     . HIS B 1 587 ? -52.115 8.850   -47.810  1.00 104.90 ? 581 HIS B C     1 
ATOM   8469 O O     . HIS B 1 587 ? -51.646 7.885   -47.194  1.00 105.02 ? 581 HIS B O     1 
ATOM   8470 C CB    . HIS B 1 587 ? -51.558 8.003   -50.155  1.00 100.55 ? 581 HIS B CB    1 
ATOM   8471 C CG    . HIS B 1 587 ? -52.054 7.569   -51.506  1.00 104.29 ? 581 HIS B CG    1 
ATOM   8472 N ND1   . HIS B 1 587 ? -52.532 8.488   -52.429  1.00 105.74 ? 581 HIS B ND1   1 
ATOM   8473 C CD2   . HIS B 1 587 ? -52.081 6.334   -52.064  1.00 106.73 ? 581 HIS B CD2   1 
ATOM   8474 C CE1   . HIS B 1 587 ? -52.863 7.781   -53.499  1.00 105.33 ? 581 HIS B CE1   1 
ATOM   8475 N NE2   . HIS B 1 587 ? -52.604 6.481   -53.329  1.00 106.19 ? 581 HIS B NE2   1 
ATOM   8476 N N     . GLY B 1 588 ? -52.225 10.078  -47.287  1.00 101.21 ? 582 GLY B N     1 
ATOM   8477 C CA    . GLY B 1 588 ? -51.816 10.449  -45.931  1.00 101.89 ? 582 GLY B CA    1 
ATOM   8478 C C     . GLY B 1 588 ? -50.383 10.103  -45.561  1.00 104.84 ? 582 GLY B C     1 
ATOM   8479 O O     . GLY B 1 588 ? -50.153 9.354   -44.606  1.00 104.59 ? 582 GLY B O     1 
ATOM   8480 N N     . ILE B 1 589 ? -49.406 10.653  -46.318  1.00 100.51 ? 583 ILE B N     1 
ATOM   8481 C CA    . ILE B 1 589 ? -47.958 10.423  -46.137  1.00 98.84  ? 583 ILE B CA    1 
ATOM   8482 C C     . ILE B 1 589 ? -47.241 11.706  -45.698  1.00 102.54 ? 583 ILE B C     1 
ATOM   8483 O O     . ILE B 1 589 ? -47.494 12.768  -46.265  1.00 101.64 ? 583 ILE B O     1 
ATOM   8484 C CB    . ILE B 1 589 ? -47.298 9.885   -47.442  1.00 99.53  ? 583 ILE B CB    1 
ATOM   8485 C CG1   . ILE B 1 589 ? -48.200 8.891   -48.207  1.00 100.51 ? 583 ILE B CG1   1 
ATOM   8486 C CG2   . ILE B 1 589 ? -45.903 9.312   -47.169  1.00 99.28  ? 583 ILE B CG2   1 
ATOM   8487 C CD1   . ILE B 1 589 ? -48.059 8.974   -49.696  1.00 104.47 ? 583 ILE B CD1   1 
ATOM   8488 N N     . THR B 1 590 ? -46.331 11.594  -44.713  1.00 99.46  ? 584 THR B N     1 
ATOM   8489 C CA    . THR B 1 590 ? -45.484 12.683  -44.216  1.00 98.40  ? 584 THR B CA    1 
ATOM   8490 C C     . THR B 1 590 ? -44.059 12.292  -44.605  1.00 101.96 ? 584 THR B C     1 
ATOM   8491 O O     . THR B 1 590 ? -43.580 11.255  -44.134  1.00 101.77 ? 584 THR B O     1 
ATOM   8492 C CB    . THR B 1 590 ? -45.692 12.922  -42.708  1.00 102.86 ? 584 THR B CB    1 
ATOM   8493 O OG1   . THR B 1 590 ? -47.030 13.374  -42.505  1.00 101.03 ? 584 THR B OG1   1 
ATOM   8494 C CG2   . THR B 1 590 ? -44.717 13.955  -42.134  1.00 99.61  ? 584 THR B CG2   1 
ATOM   8495 N N     . PRO B 1 591 ? -43.385 13.038  -45.515  1.00 97.93  ? 585 PRO B N     1 
ATOM   8496 C CA    . PRO B 1 591 ? -42.041 12.614  -45.941  1.00 96.56  ? 585 PRO B CA    1 
ATOM   8497 C C     . PRO B 1 591 ? -40.970 12.789  -44.870  1.00 102.20 ? 585 PRO B C     1 
ATOM   8498 O O     . PRO B 1 591 ? -40.984 13.777  -44.132  1.00 102.63 ? 585 PRO B O     1 
ATOM   8499 C CB    . PRO B 1 591 ? -41.768 13.451  -47.202  1.00 96.06  ? 585 PRO B CB    1 
ATOM   8500 C CG    . PRO B 1 591 ? -43.060 14.174  -47.503  1.00 100.90 ? 585 PRO B CG    1 
ATOM   8501 C CD    . PRO B 1 591 ? -43.795 14.273  -46.208  1.00 98.61  ? 585 PRO B CD    1 
ATOM   8502 N N     . LYS B 1 592 ? -40.076 11.788  -44.758  1.00 99.18  ? 586 LYS B N     1 
ATOM   8503 C CA    . LYS B 1 592 ? -38.973 11.777  -43.803  1.00 99.55  ? 586 LYS B CA    1 
ATOM   8504 C C     . LYS B 1 592 ? -37.678 11.510  -44.532  1.00 102.94 ? 586 LYS B C     1 
ATOM   8505 O O     . LYS B 1 592 ? -37.611 10.603  -45.378  1.00 101.52 ? 586 LYS B O     1 
ATOM   8506 C CB    . LYS B 1 592 ? -39.199 10.713  -42.734  1.00 102.28 ? 586 LYS B CB    1 
ATOM   8507 N N     . THR B 1 593 ? -36.634 12.279  -44.180  1.00 100.06 ? 587 THR B N     1 
ATOM   8508 C CA    . THR B 1 593 ? -35.311 12.095  -44.763  1.00 98.43  ? 587 THR B CA    1 
ATOM   8509 C C     . THR B 1 593 ? -34.786 10.747  -44.251  1.00 104.67 ? 587 THR B C     1 
ATOM   8510 O O     . THR B 1 593 ? -34.633 10.543  -43.035  1.00 105.57 ? 587 THR B O     1 
ATOM   8511 C CB    . THR B 1 593 ? -34.361 13.271  -44.440  1.00 102.99 ? 587 THR B CB    1 
ATOM   8512 O OG1   . THR B 1 593 ? -35.050 14.522  -44.456  1.00 101.29 ? 587 THR B OG1   1 
ATOM   8513 C CG2   . THR B 1 593 ? -33.180 13.327  -45.380  1.00 98.44  ? 587 THR B CG2   1 
ATOM   8514 N N     . ILE B 1 594 ? -34.611 9.804   -45.183  1.00 101.36 ? 588 ILE B N     1 
ATOM   8515 C CA    . ILE B 1 594 ? -34.098 8.466   -44.885  1.00 101.78 ? 588 ILE B CA    1 
ATOM   8516 C C     . ILE B 1 594 ? -32.557 8.517   -45.056  1.00 103.93 ? 588 ILE B C     1 
ATOM   8517 O O     . ILE B 1 594 ? -32.065 8.797   -46.158  1.00 101.50 ? 588 ILE B O     1 
ATOM   8518 C CB    . ILE B 1 594 ? -34.858 7.374   -45.718  1.00 104.59 ? 588 ILE B CB    1 
ATOM   8519 C CG1   . ILE B 1 594 ? -36.259 7.110   -45.108  1.00 106.96 ? 588 ILE B CG1   1 
ATOM   8520 C CG2   . ILE B 1 594 ? -34.075 6.061   -45.848  1.00 104.45 ? 588 ILE B CG2   1 
ATOM   8521 C CD1   . ILE B 1 594 ? -37.424 7.308   -46.060  1.00 112.64 ? 588 ILE B CD1   1 
ATOM   8522 N N     . ASN B 1 595 ? -31.817 8.359   -43.924  1.00 100.45 ? 589 ASN B N     1 
ATOM   8523 C CA    . ASN B 1 595 ? -30.353 8.405   -43.859  1.00 99.88  ? 589 ASN B CA    1 
ATOM   8524 C C     . ASN B 1 595 ? -29.795 7.160   -43.165  1.00 115.78 ? 589 ASN B C     1 
ATOM   8525 O O     . ASN B 1 595 ? -29.057 6.385   -43.770  1.00 69.43  ? 589 ASN B O     1 
ATOM   8526 C CB    . ASN B 1 595 ? -29.909 9.658   -43.120  1.00 100.64 ? 589 ASN B CB    1 
ATOM   8527 O "O5'" . DA  C 2 2   ? -18.041 23.399  -70.328  1.00 88.98  ? 2   DA  C "O5'" 1 
ATOM   8528 C "C5'" . DA  C 2 2   ? -18.237 23.738  -68.942  1.00 90.06  ? 2   DA  C "C5'" 1 
ATOM   8529 C "C4'" . DA  C 2 2   ? -18.651 22.553  -68.068  1.00 89.71  ? 2   DA  C "C4'" 1 
ATOM   8530 O "O4'" . DA  C 2 2   ? -19.777 21.832  -68.639  1.00 89.45  ? 2   DA  C "O4'" 1 
ATOM   8531 C "C3'" . DA  C 2 2   ? -17.580 21.501  -67.785  1.00 89.01  ? 2   DA  C "C3'" 1 
ATOM   8532 O "O3'" . DA  C 2 2   ? -17.562 21.123  -66.398  1.00 89.92  ? 2   DA  C "O3'" 1 
ATOM   8533 C "C2'" . DA  C 2 2   ? -18.050 20.333  -68.640  1.00 88.05  ? 2   DA  C "C2'" 1 
ATOM   8534 C "C1'" . DA  C 2 2   ? -19.543 20.465  -68.387  1.00 88.99  ? 2   DA  C "C1'" 1 
ATOM   8535 N N9    . DA  C 2 2   ? -20.376 19.558  -69.173  1.00 89.04  ? 2   DA  C N9    1 
ATOM   8536 C C8    . DA  C 2 2   ? -20.958 18.409  -68.715  1.00 88.89  ? 2   DA  C C8    1 
ATOM   8537 N N7    . DA  C 2 2   ? -21.601 17.724  -69.630  1.00 88.85  ? 2   DA  C N7    1 
ATOM   8538 C C5    . DA  C 2 2   ? -21.413 18.472  -70.777  1.00 89.16  ? 2   DA  C C5    1 
ATOM   8539 C C6    . DA  C 2 2   ? -21.888 18.312  -72.102  1.00 89.39  ? 2   DA  C C6    1 
ATOM   8540 N N6    . DA  C 2 2   ? -22.670 17.286  -72.479  1.00 89.13  ? 2   DA  C N6    1 
ATOM   8541 N N1    . DA  C 2 2   ? -21.569 19.278  -73.005  1.00 89.61  ? 2   DA  C N1    1 
ATOM   8542 C C2    . DA  C 2 2   ? -20.818 20.326  -72.613  1.00 89.69  ? 2   DA  C C2    1 
ATOM   8543 N N3    . DA  C 2 2   ? -20.323 20.581  -71.397  1.00 89.58  ? 2   DA  C N3    1 
ATOM   8544 C C4    . DA  C 2 2   ? -20.665 19.616  -70.516  1.00 89.24  ? 2   DA  C C4    1 
ATOM   8545 P P     . DC  C 2 3   ? -16.324 20.415  -65.667  1.00 89.95  ? 3   DC  C P     1 
ATOM   8546 O OP1   . DC  C 2 3   ? -16.564 20.518  -64.208  1.00 91.02  ? 3   DC  C OP1   1 
ATOM   8547 O OP2   . DC  C 2 3   ? -15.093 20.977  -66.269  1.00 90.18  ? 3   DC  C OP2   1 
ATOM   8548 O "O5'" . DC  C 2 3   ? -16.378 18.868  -66.075  1.00 88.93  ? 3   DC  C "O5'" 1 
ATOM   8549 C "C5'" . DC  C 2 3   ? -17.444 18.045  -65.655  1.00 89.64  ? 3   DC  C "C5'" 1 
ATOM   8550 C "C4'" . DC  C 2 3   ? -17.605 16.795  -66.507  1.00 89.30  ? 3   DC  C "C4'" 1 
ATOM   8551 O "O4'" . DC  C 2 3   ? -18.245 17.018  -67.784  1.00 88.95  ? 3   DC  C "O4'" 1 
ATOM   8552 C "C3'" . DC  C 2 3   ? -16.362 15.984  -66.786  1.00 89.32  ? 3   DC  C "C3'" 1 
ATOM   8553 O "O3'" . DC  C 2 3   ? -16.462 14.835  -65.955  1.00 91.43  ? 3   DC  C "O3'" 1 
ATOM   8554 C "C2'" . DC  C 2 3   ? -16.454 15.648  -68.274  1.00 87.87  ? 3   DC  C "C2'" 1 
ATOM   8555 C "C1'" . DC  C 2 3   ? -17.923 15.907  -68.575  1.00 88.10  ? 3   DC  C "C1'" 1 
ATOM   8556 N N1    . DC  C 2 3   ? -18.329 16.079  -70.025  1.00 88.44  ? 3   DC  C N1    1 
ATOM   8557 C C2    . DC  C 2 3   ? -17.753 17.024  -70.931  1.00 89.11  ? 3   DC  C C2    1 
ATOM   8558 O O2    . DC  C 2 3   ? -16.864 17.824  -70.584  1.00 89.71  ? 3   DC  C O2    1 
ATOM   8559 N N3    . DC  C 2 3   ? -18.198 17.043  -72.228  1.00 88.68  ? 3   DC  C N3    1 
ATOM   8560 C C4    . DC  C 2 3   ? -19.153 16.192  -72.631  1.00 88.06  ? 3   DC  C C4    1 
ATOM   8561 N N4    . DC  C 2 3   ? -19.536 16.255  -73.912  1.00 87.88  ? 3   DC  C N4    1 
ATOM   8562 C C5    . DC  C 2 3   ? -19.740 15.232  -71.741  1.00 87.78  ? 3   DC  C C5    1 
ATOM   8563 C C6    . DC  C 2 3   ? -19.309 15.221  -70.470  1.00 88.05  ? 3   DC  C C6    1 
ATOM   8564 P P     . DT  C 2 4   ? -15.282 13.783  -65.684  1.00 93.22  ? 4   DT  C P     1 
ATOM   8565 O OP1   . DT  C 2 4   ? -15.309 13.534  -64.216  1.00 94.35  ? 4   DT  C OP1   1 
ATOM   8566 O OP2   . DT  C 2 4   ? -14.028 14.255  -66.358  1.00 93.83  ? 4   DT  C OP2   1 
ATOM   8567 O "O5'" . DT  C 2 4   ? -15.738 12.460  -66.492  1.00 91.60  ? 4   DT  C "O5'" 1 
ATOM   8568 C "C5'" . DT  C 2 4   ? -16.905 11.695  -66.184  1.00 90.49  ? 4   DT  C "C5'" 1 
ATOM   8569 C "C4'" . DT  C 2 4   ? -17.461 10.985  -67.412  1.00 88.97  ? 4   DT  C "C4'" 1 
ATOM   8570 O "O4'" . DT  C 2 4   ? -17.725 11.948  -68.462  1.00 88.91  ? 4   DT  C "O4'" 1 
ATOM   8571 C "C3'" . DT  C 2 4   ? -16.568 9.911   -68.043  1.00 87.53  ? 4   DT  C "C3'" 1 
ATOM   8572 O "O3'" . DT  C 2 4   ? -17.107 8.582   -67.946  1.00 85.81  ? 4   DT  C "O3'" 1 
ATOM   8573 C "C2'" . DT  C 2 4   ? -16.512 10.291  -69.512  1.00 87.74  ? 4   DT  C "C2'" 1 
ATOM   8574 C "C1'" . DT  C 2 4   ? -17.658 11.265  -69.683  1.00 88.44  ? 4   DT  C "C1'" 1 
ATOM   8575 N N1    . DT  C 2 4   ? -17.312 12.163  -70.796  1.00 89.54  ? 4   DT  C N1    1 
ATOM   8576 C C2    . DT  C 2 4   ? -17.969 11.985  -72.004  1.00 91.03  ? 4   DT  C C2    1 
ATOM   8577 O O2    . DT  C 2 4   ? -18.911 11.223  -72.159  1.00 92.17  ? 4   DT  C O2    1 
ATOM   8578 N N3    . DT  C 2 4   ? -17.517 12.777  -73.036  1.00 90.84  ? 4   DT  C N3    1 
ATOM   8579 C C4    . DT  C 2 4   ? -16.481 13.692  -72.975  1.00 90.51  ? 4   DT  C C4    1 
ATOM   8580 O O4    . DT  C 2 4   ? -16.204 14.307  -74.000  1.00 90.91  ? 4   DT  C O4    1 
ATOM   8581 C C5    . DT  C 2 4   ? -15.810 13.799  -71.688  1.00 90.16  ? 4   DT  C C5    1 
ATOM   8582 C C7    . DT  C 2 4   ? -14.660 14.739  -71.475  1.00 90.80  ? 4   DT  C C7    1 
ATOM   8583 C C6    . DT  C 2 4   ? -16.234 13.026  -70.681  1.00 89.63  ? 4   DT  C C6    1 
ATOM   8584 P P     . DG  C 2 5   ? -16.326 7.204   -68.277  1.00 83.00  ? 5   DG  C P     1 
ATOM   8585 O OP1   . DG  C 2 5   ? -16.643 6.368   -67.089  1.00 83.32  ? 5   DG  C OP1   1 
ATOM   8586 O OP2   . DG  C 2 5   ? -14.920 7.497   -68.660  1.00 81.91  ? 5   DG  C OP2   1 
ATOM   8587 O "O5'" . DG  C 2 5   ? -17.027 6.505   -69.548  1.00 81.18  ? 5   DG  C "O5'" 1 
ATOM   8588 C "C5'" . DG  C 2 5   ? -17.683 7.335   -70.472  1.00 80.25  ? 5   DG  C "C5'" 1 
ATOM   8589 C "C4'" . DG  C 2 5   ? -17.837 6.872   -71.898  1.00 80.05  ? 5   DG  C "C4'" 1 
ATOM   8590 O "O4'" . DG  C 2 5   ? -17.914 8.135   -72.589  1.00 80.81  ? 5   DG  C "O4'" 1 
ATOM   8591 C "C3'" . DG  C 2 5   ? -16.691 6.109   -72.554  1.00 79.56  ? 5   DG  C "C3'" 1 
ATOM   8592 O "O3'" . DG  C 2 5   ? -17.011 4.715   -72.684  1.00 77.75  ? 5   DG  C "O3'" 1 
ATOM   8593 C "C2'" . DG  C 2 5   ? -16.594 6.730   -73.945  1.00 80.94  ? 5   DG  C "C2'" 1 
ATOM   8594 C "C1'" . DG  C 2 5   ? -17.391 8.025   -73.892  1.00 82.09  ? 5   DG  C "C1'" 1 
ATOM   8595 N N9    . DG  C 2 5   ? -16.610 9.222   -74.224  1.00 84.56  ? 5   DG  C N9    1 
ATOM   8596 C C8    . DG  C 2 5   ? -16.865 10.100  -75.257  1.00 85.67  ? 5   DG  C C8    1 
ATOM   8597 N N7    . DG  C 2 5   ? -16.024 11.097  -75.334  1.00 86.49  ? 5   DG  C N7    1 
ATOM   8598 C C5    . DG  C 2 5   ? -15.141 10.866  -74.281  1.00 86.59  ? 5   DG  C C5    1 
ATOM   8599 C C6    . DG  C 2 5   ? -14.007 11.613  -73.848  1.00 87.13  ? 5   DG  C C6    1 
ATOM   8600 O O6    . DG  C 2 5   ? -13.523 12.641  -74.345  1.00 87.46  ? 5   DG  C O6    1 
ATOM   8601 N N1    . DG  C 2 5   ? -13.405 11.057  -72.716  1.00 87.32  ? 5   DG  C N1    1 
ATOM   8602 C C2    . DG  C 2 5   ? -13.843 9.913   -72.073  1.00 87.35  ? 5   DG  C C2    1 
ATOM   8603 N N2    . DG  C 2 5   ? -13.115 9.490   -71.022  1.00 87.91  ? 5   DG  C N2    1 
ATOM   8604 N N3    . DG  C 2 5   ? -14.903 9.209   -72.468  1.00 86.47  ? 5   DG  C N3    1 
ATOM   8605 C C4    . DG  C 2 5   ? -15.504 9.732   -73.573  1.00 85.79  ? 5   DG  C C4    1 
ATOM   8606 P P     . DT  C 2 6   ? -15.956 3.513   -72.823  1.00 76.14  ? 6   DT  C P     1 
ATOM   8607 O OP1   . DT  C 2 6   ? -16.681 2.254   -72.542  1.00 75.86  ? 6   DT  C OP1   1 
ATOM   8608 O OP2   . DT  C 2 6   ? -14.737 3.821   -72.038  1.00 75.99  ? 6   DT  C OP2   1 
ATOM   8609 O "O5'" . DT  C 2 6   ? -15.542 3.519   -74.368  1.00 75.89  ? 6   DT  C "O5'" 1 
ATOM   8610 C "C5'" . DT  C 2 6   ? -16.371 3.341   -75.498  1.00 75.74  ? 6   DT  C "C5'" 1 
ATOM   8611 C "C4'" . DT  C 2 6   ? -15.712 3.940   -76.729  1.00 76.54  ? 6   DT  C "C4'" 1 
ATOM   8612 O "O4'" . DT  C 2 6   ? -15.730 5.382   -76.625  1.00 77.08  ? 6   DT  C "O4'" 1 
ATOM   8613 C "C3'" . DT  C 2 6   ? -14.265 3.592   -77.032  1.00 77.24  ? 6   DT  C "C3'" 1 
ATOM   8614 O "O3'" . DT  C 2 6   ? -14.182 2.452   -77.841  1.00 78.85  ? 6   DT  C "O3'" 1 
ATOM   8615 C "C2'" . DT  C 2 6   ? -13.815 4.801   -77.843  1.00 77.81  ? 6   DT  C "C2'" 1 
ATOM   8616 C "C1'" . DT  C 2 6   ? -14.623 5.952   -77.283  1.00 78.18  ? 6   DT  C "C1'" 1 
ATOM   8617 N N1    . DT  C 2 6   ? -13.839 6.963   -76.445  1.00 79.82  ? 6   DT  C N1    1 
ATOM   8618 C C2    . DT  C 2 6   ? -13.775 8.304   -76.835  1.00 81.14  ? 6   DT  C C2    1 
ATOM   8619 O O2    . DT  C 2 6   ? -14.340 8.777   -77.797  1.00 82.29  ? 6   DT  C O2    1 
ATOM   8620 N N3    . DT  C 2 6   ? -13.025 9.138   -76.049  1.00 81.39  ? 6   DT  C N3    1 
ATOM   8621 C C4    . DT  C 2 6   ? -12.311 8.774   -74.919  1.00 82.22  ? 6   DT  C C4    1 
ATOM   8622 O O4    . DT  C 2 6   ? -11.653 9.655   -74.350  1.00 82.49  ? 6   DT  C O4    1 
ATOM   8623 C C5    . DT  C 2 6   ? -12.410 7.353   -74.548  1.00 82.00  ? 6   DT  C C5    1 
ATOM   8624 C C7    . DT  C 2 6   ? -11.719 6.780   -73.336  1.00 82.50  ? 6   DT  C C7    1 
ATOM   8625 C C6    . DT  C 2 6   ? -13.161 6.545   -75.312  1.00 80.65  ? 6   DT  C C6    1 
ATOM   8626 P P     . DT  C 2 7   ? -13.574 1.065   -77.355  1.00 80.75  ? 7   DT  C P     1 
ATOM   8627 O OP1   . DT  C 2 7   ? -14.620 0.196   -76.784  1.00 80.21  ? 7   DT  C OP1   1 
ATOM   8628 O OP2   . DT  C 2 7   ? -12.377 1.391   -76.564  1.00 80.67  ? 7   DT  C OP2   1 
ATOM   8629 O "O5'" . DT  C 2 7   ? -13.189 0.395   -78.747  1.00 85.59  ? 7   DT  C "O5'" 1 
ATOM   8630 C "C5'" . DT  C 2 7   ? -11.866 0.193   -79.164  1.00 90.68  ? 7   DT  C "C5'" 1 
ATOM   8631 C "C4'" . DT  C 2 7   ? -11.627 0.775   -80.543  1.00 95.67  ? 7   DT  C "C4'" 1 
ATOM   8632 O "O4'" . DT  C 2 7   ? -12.069 2.157   -80.571  1.00 96.28  ? 7   DT  C "O4'" 1 
ATOM   8633 C "C3'" . DT  C 2 7   ? -10.156 0.742   -80.944  1.00 99.38  ? 7   DT  C "C3'" 1 
ATOM   8634 O "O3'" . DT  C 2 7   ? -9.874  -0.377  -81.815  1.00 103.21 ? 7   DT  C "O3'" 1 
ATOM   8635 C "C2'" . DT  C 2 7   ? -9.886  2.116   -81.563  1.00 99.83  ? 7   DT  C "C2'" 1 
ATOM   8636 C "C1'" . DT  C 2 7   ? -11.033 2.994   -81.049  1.00 98.61  ? 7   DT  C "C1'" 1 
ATOM   8637 N N1    . DT  C 2 7   ? -10.724 4.141   -80.072  1.00 99.44  ? 7   DT  C N1    1 
ATOM   8638 C C2    . DT  C 2 7   ? -10.558 5.437   -80.561  1.00 100.67 ? 7   DT  C C2    1 
ATOM   8639 O O2    . DT  C 2 7   ? -10.605 5.729   -81.752  1.00 102.14 ? 7   DT  C O2    1 
ATOM   8640 N N3    . DT  C 2 7   ? -10.320 6.406   -79.595  1.00 99.94  ? 7   DT  C N3    1 
ATOM   8641 C C4    . DT  C 2 7   ? -10.252 6.239   -78.213  1.00 99.02  ? 7   DT  C C4    1 
ATOM   8642 O O4    . DT  C 2 7   ? -10.036 7.221   -77.493  1.00 98.33  ? 7   DT  C O4    1 
ATOM   8643 C C5    . DT  C 2 7   ? -10.440 4.869   -77.759  1.00 98.83  ? 7   DT  C C5    1 
ATOM   8644 C C7    . DT  C 2 7   ? -10.421 4.538   -76.287  1.00 97.88  ? 7   DT  C C7    1 
ATOM   8645 C C6    . DT  C 2 7   ? -10.645 3.910   -78.699  1.00 99.27  ? 7   DT  C C6    1 
ATOM   8646 P P     . DT  C 2 8   ? -9.685  -1.920  -81.347  1.00 106.39 ? 8   DT  C P     1 
ATOM   8647 O OP1   . DT  C 2 8   ? -9.557  -2.006  -79.873  1.00 105.31 ? 8   DT  C OP1   1 
ATOM   8648 O OP2   . DT  C 2 8   ? -8.568  -2.494  -82.138  1.00 108.61 ? 8   DT  C OP2   1 
ATOM   8649 O "O5'" . DT  C 2 8   ? -11.056 -2.649  -81.833  1.00 107.31 ? 8   DT  C "O5'" 1 
ATOM   8650 C "C5'" . DT  C 2 8   ? -11.870 -3.616  -81.098  1.00 106.85 ? 8   DT  C "C5'" 1 
ATOM   8651 C "C4'" . DT  C 2 8   ? -11.562 -5.111  -81.302  1.00 108.45 ? 8   DT  C "C4'" 1 
ATOM   8652 O "O4'" . DT  C 2 8   ? -12.574 -5.846  -82.050  1.00 109.06 ? 8   DT  C "O4'" 1 
ATOM   8653 C "C3'" . DT  C 2 8   ? -10.205 -5.586  -81.826  1.00 110.22 ? 8   DT  C "C3'" 1 
ATOM   8654 O "O3'" . DT  C 2 8   ? -9.429  -6.158  -80.774  1.00 110.27 ? 8   DT  C "O3'" 1 
ATOM   8655 C "C2'" . DT  C 2 8   ? -10.557 -6.657  -82.863  1.00 112.04 ? 8   DT  C "C2'" 1 
ATOM   8656 C "C1'" . DT  C 2 8   ? -11.990 -7.046  -82.522  1.00 110.70 ? 8   DT  C "C1'" 1 
ATOM   8657 N N1    . DT  C 2 8   ? -12.748 -7.602  -83.695  1.00 111.45 ? 8   DT  C N1    1 
ATOM   8658 O "O5'" . DA  D 2 2   ? -3.903  -17.824 -42.733  1.00 78.08  ? 2   DA  D "O5'" 1 
ATOM   8659 C "C5'" . DA  D 2 2   ? -5.119  -17.173 -42.355  1.00 78.66  ? 2   DA  D "C5'" 1 
ATOM   8660 C "C4'" . DA  D 2 2   ? -5.100  -15.656 -42.547  1.00 77.79  ? 2   DA  D "C4'" 1 
ATOM   8661 O "O4'" . DA  D 2 2   ? -3.900  -15.063 -41.991  1.00 76.87  ? 2   DA  D "O4'" 1 
ATOM   8662 C "C3'" . DA  D 2 2   ? -5.183  -15.120 -43.984  1.00 77.16  ? 2   DA  D "C3'" 1 
ATOM   8663 O "O3'" . DA  D 2 2   ? -6.161  -14.068 -44.069  1.00 78.79  ? 2   DA  D "O3'" 1 
ATOM   8664 C "C2'" . DA  D 2 2   ? -3.779  -14.584 -44.257  1.00 74.88  ? 2   DA  D "C2'" 1 
ATOM   8665 C "C1'" . DA  D 2 2   ? -3.549  -14.019 -42.871  1.00 75.25  ? 2   DA  D "C1'" 1 
ATOM   8666 N N9    . DA  D 2 2   ? -2.217  -13.493 -42.636  1.00 74.13  ? 2   DA  D N9    1 
ATOM   8667 C C8    . DA  D 2 2   ? -1.903  -12.163 -42.578  1.00 73.55  ? 2   DA  D C8    1 
ATOM   8668 N N7    . DA  D 2 2   ? -0.628  -11.930 -42.401  1.00 73.04  ? 2   DA  D N7    1 
ATOM   8669 C C5    . DA  D 2 2   ? -0.066  -13.192 -42.354  1.00 73.21  ? 2   DA  D C5    1 
ATOM   8670 C C6    . DA  D 2 2   ? 1.267   -13.625 -42.139  1.00 73.36  ? 2   DA  D C6    1 
ATOM   8671 N N6    . DA  D 2 2   ? 2.294   -12.774 -41.945  1.00 72.32  ? 2   DA  D N6    1 
ATOM   8672 N N1    . DA  D 2 2   ? 1.478   -14.974 -42.100  1.00 74.08  ? 2   DA  D N1    1 
ATOM   8673 C C2    . DA  D 2 2   ? 0.430   -15.814 -42.262  1.00 73.94  ? 2   DA  D C2    1 
ATOM   8674 N N3    . DA  D 2 2   ? -0.858  -15.518 -42.461  1.00 73.56  ? 2   DA  D N3    1 
ATOM   8675 C C4    . DA  D 2 2   ? -1.038  -14.182 -42.491  1.00 73.51  ? 2   DA  D C4    1 
ATOM   8676 P P     . DC  D 2 3   ? -6.862  -13.603 -45.440  1.00 79.80  ? 3   DC  D P     1 
ATOM   8677 O OP1   . DC  D 2 3   ? -8.052  -12.798 -45.074  1.00 80.94  ? 3   DC  D OP1   1 
ATOM   8678 O OP2   . DC  D 2 3   ? -7.041  -14.808 -46.287  1.00 80.11  ? 3   DC  D OP2   1 
ATOM   8679 O "O5'" . DC  D 2 3   ? -5.805  -12.657 -46.163  1.00 79.63  ? 3   DC  D "O5'" 1 
ATOM   8680 C "C5'" . DC  D 2 3   ? -5.458  -11.425 -45.572  1.00 82.35  ? 3   DC  D "C5'" 1 
ATOM   8681 C "C4'" . DC  D 2 3   ? -4.147  -10.872 -46.090  1.00 84.16  ? 3   DC  D "C4'" 1 
ATOM   8682 O "O4'" . DC  D 2 3   ? -2.970  -11.473 -45.501  1.00 85.24  ? 3   DC  D "O4'" 1 
ATOM   8683 C "C3'" . DC  D 2 3   ? -3.960  -10.873 -47.602  1.00 84.71  ? 3   DC  D "C3'" 1 
ATOM   8684 O "O3'" . DC  D 2 3   ? -4.175  -9.532  -48.008  1.00 85.18  ? 3   DC  D "O3'" 1 
ATOM   8685 C "C2'" . DC  D 2 3   ? -2.513  -11.332 -47.794  1.00 84.36  ? 3   DC  D "C2'" 1 
ATOM   8686 C "C1'" . DC  D 2 3   ? -1.925  -11.172 -46.387  1.00 85.11  ? 3   DC  D "C1'" 1 
ATOM   8687 N N1    . DC  D 2 3   ? -0.641  -11.921 -46.081  1.00 86.27  ? 3   DC  D N1    1 
ATOM   8688 C C2    . DC  D 2 3   ? -0.464  -13.330 -46.278  1.00 87.49  ? 3   DC  D C2    1 
ATOM   8689 O O2    . DC  D 2 3   ? -1.386  -14.078 -46.670  1.00 88.32  ? 3   DC  D O2    1 
ATOM   8690 N N3    . DC  D 2 3   ? 0.765   -13.869 -46.006  1.00 87.35  ? 3   DC  D N3    1 
ATOM   8691 C C4    . DC  D 2 3   ? 1.771   -13.093 -45.566  1.00 86.94  ? 3   DC  D C4    1 
ATOM   8692 N N4    . DC  D 2 3   ? 2.948   -13.678 -45.321  1.00 87.05  ? 3   DC  D N4    1 
ATOM   8693 C C5    . DC  D 2 3   ? 1.613   -11.681 -45.367  1.00 86.37  ? 3   DC  D C5    1 
ATOM   8694 C C6    . DC  D 2 3   ? 0.404   -11.150 -45.626  1.00 86.04  ? 3   DC  D C6    1 
ATOM   8695 P P     . DT  D 2 4   ? -4.275  -9.002  -49.518  1.00 84.64  ? 4   DT  D P     1 
ATOM   8696 O OP1   . DT  D 2 4   ? -5.441  -8.074  -49.515  1.00 85.32  ? 4   DT  D OP1   1 
ATOM   8697 O OP2   . DT  D 2 4   ? -4.247  -10.168 -50.450  1.00 85.06  ? 4   DT  D OP2   1 
ATOM   8698 O "O5'" . DT  D 2 4   ? -2.892  -8.191  -49.740  1.00 80.70  ? 4   DT  D "O5'" 1 
ATOM   8699 C "C5'" . DT  D 2 4   ? -2.544  -7.022  -48.993  1.00 77.35  ? 4   DT  D "C5'" 1 
ATOM   8700 C "C4'" . DT  D 2 4   ? -1.041  -6.869  -48.838  1.00 74.37  ? 4   DT  D "C4'" 1 
ATOM   8701 O "O4'" . DT  D 2 4   ? -0.444  -8.063  -48.289  1.00 73.83  ? 4   DT  D "O4'" 1 
ATOM   8702 C "C3'" . DT  D 2 4   ? -0.273  -6.582  -50.114  1.00 72.30  ? 4   DT  D "C3'" 1 
ATOM   8703 O "O3'" . DT  D 2 4   ? 0.288   -5.264  -50.069  1.00 69.54  ? 4   DT  D "O3'" 1 
ATOM   8704 C "C2'" . DT  D 2 4   ? 0.846   -7.603  -50.093  1.00 72.57  ? 4   DT  D "C2'" 1 
ATOM   8705 C "C1'" . DT  D 2 4   ? 0.890   -8.116  -48.681  1.00 73.48  ? 4   DT  D "C1'" 1 
ATOM   8706 N N1    . DT  D 2 4   ? 1.374   -9.512  -48.744  1.00 75.95  ? 4   DT  D N1    1 
ATOM   8707 C C2    . DT  D 2 4   ? 2.675   -9.773  -48.349  1.00 78.01  ? 4   DT  D C2    1 
ATOM   8708 O O2    . DT  D 2 4   ? 3.406   -8.933  -47.845  1.00 78.93  ? 4   DT  D O2    1 
ATOM   8709 N N3    . DT  D 2 4   ? 3.092   -11.078 -48.531  1.00 78.70  ? 4   DT  D N3    1 
ATOM   8710 C C4    . DT  D 2 4   ? 2.353   -12.125 -49.063  1.00 78.82  ? 4   DT  D C4    1 
ATOM   8711 O O4    . DT  D 2 4   ? 2.891   -13.225 -49.161  1.00 79.31  ? 4   DT  D O4    1 
ATOM   8712 C C5    . DT  D 2 4   ? 1.008   -11.781 -49.487  1.00 78.49  ? 4   DT  D C5    1 
ATOM   8713 C C7    . DT  D 2 4   ? 0.090   -12.807 -50.094  1.00 79.47  ? 4   DT  D C7    1 
ATOM   8714 C C6    . DT  D 2 4   ? 0.606   -10.507 -49.337  1.00 77.16  ? 4   DT  D C6    1 
ATOM   8715 P P     . DG  D 2 5   ? 0.569   -4.304  -51.312  1.00 65.88  ? 5   DG  D P     1 
ATOM   8716 O OP1   . DG  D 2 5   ? -0.045  -2.999  -50.957  1.00 65.44  ? 5   DG  D OP1   1 
ATOM   8717 O OP2   . DG  D 2 5   ? 0.210   -4.985  -52.584  1.00 65.06  ? 5   DG  D OP2   1 
ATOM   8718 O "O5'" . DG  D 2 5   ? 2.156   -4.206  -51.179  1.00 65.15  ? 5   DG  D "O5'" 1 
ATOM   8719 C "C5'" . DG  D 2 5   ? 2.869   -5.310  -51.626  1.00 65.19  ? 5   DG  D "C5'" 1 
ATOM   8720 C "C4'" . DG  D 2 5   ? 4.305   -5.328  -51.202  1.00 66.13  ? 5   DG  D "C4'" 1 
ATOM   8721 O "O4'" . DG  D 2 5   ? 4.511   -6.564  -50.494  1.00 67.65  ? 5   DG  D "O4'" 1 
ATOM   8722 C "C3'" . DG  D 2 5   ? 5.183   -5.384  -52.441  1.00 66.75  ? 5   DG  D "C3'" 1 
ATOM   8723 O "O3'" . DG  D 2 5   ? 5.924   -4.172  -52.600  1.00 65.14  ? 5   DG  D "O3'" 1 
ATOM   8724 C "C2'" . DG  D 2 5   ? 6.052   -6.631  -52.330  1.00 68.65  ? 5   DG  D "C2'" 1 
ATOM   8725 C "C1'" . DG  D 2 5   ? 5.550   -7.335  -51.083  1.00 70.11  ? 5   DG  D "C1'" 1 
ATOM   8726 N N9    . DG  D 2 5   ? 5.114   -8.719  -51.294  1.00 73.91  ? 5   DG  D N9    1 
ATOM   8727 C C8    . DG  D 2 5   ? 5.749   -9.838  -50.822  1.00 75.71  ? 5   DG  D C8    1 
ATOM   8728 N N7    . DG  D 2 5   ? 5.126   -10.960 -51.054  1.00 76.98  ? 5   DG  D N7    1 
ATOM   8729 C C5    . DG  D 2 5   ? 3.978   -10.573 -51.724  1.00 76.99  ? 5   DG  D C5    1 
ATOM   8730 C C6    . DG  D 2 5   ? 2.909   -11.360 -52.241  1.00 77.74  ? 5   DG  D C6    1 
ATOM   8731 O O6    . DG  D 2 5   ? 2.772   -12.599 -52.191  1.00 78.30  ? 5   DG  D O6    1 
ATOM   8732 N N1    . DG  D 2 5   ? 1.907   -10.564 -52.819  1.00 77.45  ? 5   DG  D N1    1 
ATOM   8733 C C2    . DG  D 2 5   ? 1.968   -9.186  -52.928  1.00 76.82  ? 5   DG  D C2    1 
ATOM   8734 N N2    . DG  D 2 5   ? 0.941   -8.556  -53.517  1.00 76.75  ? 5   DG  D N2    1 
ATOM   8735 N N3    . DG  D 2 5   ? 2.982   -8.457  -52.472  1.00 76.52  ? 5   DG  D N3    1 
ATOM   8736 C C4    . DG  D 2 5   ? 3.950   -9.196  -51.869  1.00 75.87  ? 5   DG  D C4    1 
ATOM   8737 P P     . DT  D 2 6   ? 5.917   -3.334  -53.960  1.00 62.55  ? 6   DT  D P     1 
ATOM   8738 O OP1   . DT  D 2 6   ? 6.347   -1.963  -53.697  1.00 63.39  ? 6   DT  D OP1   1 
ATOM   8739 O OP2   . DT  D 2 6   ? 4.631   -3.530  -54.619  1.00 60.95  ? 6   DT  D OP2   1 
ATOM   8740 O "O5'" . DT  D 2 6   ? 7.078   -4.073  -54.770  1.00 64.04  ? 6   DT  D "O5'" 1 
ATOM   8741 C "C5'" . DT  D 2 6   ? 8.408   -4.299  -54.307  1.00 65.77  ? 6   DT  D "C5'" 1 
ATOM   8742 C "C4'" . DT  D 2 6   ? 9.017   -5.527  -54.967  1.00 68.10  ? 6   DT  D "C4'" 1 
ATOM   8743 O "O4'" . DT  D 2 6   ? 8.453   -6.711  -54.355  1.00 69.23  ? 6   DT  D "O4'" 1 
ATOM   8744 C "C3'" . DT  D 2 6   ? 8.825   -5.696  -56.476  1.00 69.54  ? 6   DT  D "C3'" 1 
ATOM   8745 O "O3'" . DT  D 2 6   ? 9.960   -5.253  -57.176  1.00 70.19  ? 6   DT  D "O3'" 1 
ATOM   8746 C "C2'" . DT  D 2 6   ? 8.849   -7.208  -56.646  1.00 71.20  ? 6   DT  D "C2'" 1 
ATOM   8747 C "C1'" . DT  D 2 6   ? 8.363   -7.754  -55.303  1.00 71.94  ? 6   DT  D "C1'" 1 
ATOM   8748 N N1    . DT  D 2 6   ? 6.999   -8.431  -55.361  1.00 75.76  ? 6   DT  D N1    1 
ATOM   8749 C C2    . DT  D 2 6   ? 6.887   -9.788  -55.084  1.00 78.78  ? 6   DT  D C2    1 
ATOM   8750 O O2    . DT  D 2 6   ? 7.821   -10.492 -54.736  1.00 80.65  ? 6   DT  D O2    1 
ATOM   8751 N N3    . DT  D 2 6   ? 5.617   -10.322 -55.193  1.00 79.50  ? 6   DT  D N3    1 
ATOM   8752 C C4    . DT  D 2 6   ? 4.463   -9.668  -55.613  1.00 79.59  ? 6   DT  D C4    1 
ATOM   8753 O O4    . DT  D 2 6   ? 3.413   -10.325 -55.716  1.00 79.94  ? 6   DT  D O4    1 
ATOM   8754 C C5    . DT  D 2 6   ? 4.648   -8.246  -55.902  1.00 78.50  ? 6   DT  D C5    1 
ATOM   8755 C C7    . DT  D 2 6   ? 3.502   -7.372  -56.342  1.00 78.51  ? 6   DT  D C7    1 
ATOM   8756 C C6    . DT  D 2 6   ? 5.883   -7.722  -55.783  1.00 77.03  ? 6   DT  D C6    1 
ATOM   8757 P P     . DT  D 2 7   ? 10.281  -3.824  -57.789  1.00 71.38  ? 7   DT  D P     1 
ATOM   8758 O OP1   . DT  D 2 7   ? 10.407  -2.872  -56.692  1.00 71.32  ? 7   DT  D OP1   1 
ATOM   8759 O OP2   . DT  D 2 7   ? 9.293   -3.537  -58.836  1.00 71.88  ? 7   DT  D OP2   1 
ATOM   8760 O "O5'" . DT  D 2 7   ? 11.744  -4.071  -58.403  1.00 74.63  ? 7   DT  D "O5'" 1 
ATOM   8761 C "C5'" . DT  D 2 7   ? 12.659  -3.050  -58.857  1.00 78.32  ? 7   DT  D "C5'" 1 
ATOM   8762 C "C4'" . DT  D 2 7   ? 12.639  -2.861  -60.379  1.00 82.04  ? 7   DT  D "C4'" 1 
ATOM   8763 O "O4'" . DT  D 2 7   ? 13.311  -1.631  -60.789  1.00 83.79  ? 7   DT  D "O4'" 1 
ATOM   8764 C "C3'" . DT  D 2 7   ? 13.272  -3.971  -61.211  1.00 84.76  ? 7   DT  D "C3'" 1 
ATOM   8765 O "O3'" . DT  D 2 7   ? 12.428  -4.372  -62.322  1.00 86.30  ? 7   DT  D "O3'" 1 
ATOM   8766 C "C2'" . DT  D 2 7   ? 14.568  -3.323  -61.687  1.00 86.35  ? 7   DT  D "C2'" 1 
ATOM   8767 C "C1'" . DT  D 2 7   ? 14.159  -1.868  -61.897  1.00 85.76  ? 7   DT  D "C1'" 1 
ATOM   8768 N N1    . DT  D 2 7   ? 15.342  -0.903  -61.900  1.00 86.58  ? 7   DT  D N1    1 
ATOM   8769 C C2    . DT  D 2 7   ? 15.189  0.475   -61.725  1.00 86.46  ? 7   DT  D C2    1 
ATOM   8770 O O2    . DT  D 2 7   ? 14.125  1.056   -61.543  1.00 85.23  ? 7   DT  D O2    1 
ATOM   8771 N N3    . DT  D 2 7   ? 16.382  1.178   -61.755  1.00 87.88  ? 7   DT  D N3    1 
ATOM   8772 C C4    . DT  D 2 7   ? 17.671  0.678   -61.947  1.00 89.34  ? 7   DT  D C4    1 
ATOM   8773 O O4    . DT  D 2 7   ? 18.609  1.479   -61.933  1.00 90.87  ? 7   DT  D O4    1 
ATOM   8774 C C5    . DT  D 2 7   ? 17.760  -0.769  -62.138  1.00 88.88  ? 7   DT  D C5    1 
ATOM   8775 C C7    . DT  D 2 7   ? 19.049  -1.517  -62.387  1.00 89.98  ? 7   DT  D C7    1 
ATOM   8776 C C6    . DT  D 2 7   ? 16.607  -1.450  -62.106  1.00 87.61  ? 7   DT  D C6    1 
ATOM   8777 P P     . DT  D 2 8   ? 12.878  -5.501  -63.377  1.00 87.98  ? 8   DT  D P     1 
ATOM   8778 O OP1   . DT  D 2 8   ? 11.693  -6.217  -63.907  1.00 87.39  ? 8   DT  D OP1   1 
ATOM   8779 O OP2   . DT  D 2 8   ? 13.899  -6.344  -62.675  1.00 88.34  ? 8   DT  D OP2   1 
ATOM   8780 O "O5'" . DT  D 2 8   ? 13.457  -4.594  -64.587  1.00 88.52  ? 8   DT  D "O5'" 1 
HETATM 8781 P PB    . ADP E 3 .   ? -0.830  8.066   -36.855  1.00 108.54 ? 701 ADP A PB    1 
HETATM 8782 O O1B   . ADP E 3 .   ? -0.269  9.489   -36.608  1.00 109.10 ? 701 ADP A O1B   1 
HETATM 8783 O O2B   . ADP E 3 .   ? -0.223  7.082   -35.815  1.00 110.36 ? 701 ADP A O2B   1 
HETATM 8784 O O3B   . ADP E 3 .   ? -0.461  7.619   -38.285  1.00 103.75 ? 701 ADP A O3B   1 
HETATM 8785 P PA    . ADP E 3 .   ? -3.365  7.944   -35.369  1.00 105.02 ? 701 ADP A PA    1 
HETATM 8786 O O1A   . ADP E 3 .   ? -4.646  7.285   -35.724  1.00 104.56 ? 701 ADP A O1A   1 
HETATM 8787 O O2A   . ADP E 3 .   ? -2.630  7.066   -34.326  1.00 100.71 ? 701 ADP A O2A   1 
HETATM 8788 O O3A   . ADP E 3 .   ? -2.425  8.052   -36.668  1.00 108.42 ? 701 ADP A O3A   1 
HETATM 8789 O "O5'" . ADP E 3 .   ? -3.654  9.432   -34.841  1.00 103.95 ? 701 ADP A "O5'" 1 
HETATM 8790 C "C5'" . ADP E 3 .   ? -4.741  10.263  -35.333  1.00 104.56 ? 701 ADP A "C5'" 1 
HETATM 8791 C "C4'" . ADP E 3 .   ? -4.404  11.662  -35.827  1.00 107.53 ? 701 ADP A "C4'" 1 
HETATM 8792 O "O4'" . ADP E 3 .   ? -3.941  12.531  -34.766  1.00 109.57 ? 701 ADP A "O4'" 1 
HETATM 8793 C "C3'" . ADP E 3 .   ? -3.463  11.869  -37.022  1.00 108.25 ? 701 ADP A "C3'" 1 
HETATM 8794 O "O3'" . ADP E 3 .   ? -4.119  12.588  -38.065  1.00 107.76 ? 701 ADP A "O3'" 1 
HETATM 8795 C "C2'" . ADP E 3 .   ? -2.310  12.698  -36.429  1.00 109.28 ? 701 ADP A "C2'" 1 
HETATM 8796 O "O2'" . ADP E 3 .   ? -1.656  13.527  -37.388  1.00 108.47 ? 701 ADP A "O2'" 1 
HETATM 8797 C "C1'" . ADP E 3 .   ? -3.039  13.470  -35.321  1.00 108.88 ? 701 ADP A "C1'" 1 
HETATM 8798 N N9    . ADP E 3 .   ? -2.202  14.010  -34.244  1.00 105.71 ? 701 ADP A N9    1 
HETATM 8799 C C8    . ADP E 3 .   ? -1.101  13.417  -33.682  1.00 104.74 ? 701 ADP A C8    1 
HETATM 8800 N N7    . ADP E 3 .   ? -0.632  14.043  -32.631  1.00 104.85 ? 701 ADP A N7    1 
HETATM 8801 C C5    . ADP E 3 .   ? -1.472  15.138  -32.498  1.00 104.74 ? 701 ADP A C5    1 
HETATM 8802 C C6    . ADP E 3 .   ? -1.532  16.182  -31.546  1.00 103.77 ? 701 ADP A C6    1 
HETATM 8803 N N6    . ADP E 3 .   ? -0.662  16.325  -30.541  1.00 101.55 ? 701 ADP A N6    1 
HETATM 8804 N N1    . ADP E 3 .   ? -2.528  17.089  -31.671  1.00 105.16 ? 701 ADP A N1    1 
HETATM 8805 C C2    . ADP E 3 .   ? -3.393  16.964  -32.686  1.00 105.34 ? 701 ADP A C2    1 
HETATM 8806 N N3    . ADP E 3 .   ? -3.425  16.035  -33.650  1.00 105.24 ? 701 ADP A N3    1 
HETATM 8807 C C4    . ADP E 3 .   ? -2.438  15.138  -33.492  1.00 105.03 ? 701 ADP A C4    1 
HETATM 8808 P PB    . ADP F 3 .   ? -33.095 3.625   -60.005  1.00 120.55 ? 701 ADP B PB    1 
HETATM 8809 O O1B   . ADP F 3 .   ? -33.596 4.565   -61.041  1.00 122.14 ? 701 ADP B O1B   1 
HETATM 8810 O O2B   . ADP F 3 .   ? -31.625 3.230   -60.334  1.00 117.66 ? 701 ADP B O2B   1 
HETATM 8811 O O3B   . ADP F 3 .   ? -33.990 2.356   -59.988  1.00 120.89 ? 701 ADP B O3B   1 
HETATM 8812 P PA    . ADP F 3 .   ? -33.945 5.587   -57.930  1.00 119.96 ? 701 ADP B PA    1 
HETATM 8813 O O1A   . ADP F 3 .   ? -33.305 5.970   -56.642  1.00 118.51 ? 701 ADP B O1A   1 
HETATM 8814 O O2A   . ADP F 3 .   ? -33.908 6.770   -58.909  1.00 117.44 ? 701 ADP B O2A   1 
HETATM 8815 O O3A   . ADP F 3 .   ? -33.151 4.349   -58.574  1.00 121.20 ? 701 ADP B O3A   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ASP A 9   ? 0.9803 0.8363 0.8733 -0.1501 -0.0602 -0.0870 3   ASP A N     
2    C CA    . ASP A 9   ? 0.9542 0.8164 0.8495 -0.1321 -0.0570 -0.0802 3   ASP A CA    
3    C C     . ASP A 9   ? 0.9628 0.8209 0.8424 -0.1252 -0.0603 -0.0857 3   ASP A C     
4    O O     . ASP A 9   ? 0.9418 0.8218 0.8235 -0.1242 -0.0694 -0.0859 3   ASP A O     
5    C CB    . ASP A 9   ? 0.9607 0.8557 0.8758 -0.1272 -0.0611 -0.0715 3   ASP A CB    
6    C CG    . ASP A 9   ? 1.1377 1.0347 1.0615 -0.1146 -0.0535 -0.0621 3   ASP A CG    
7    O OD1   . ASP A 9   ? 1.1703 1.0443 1.0891 -0.1121 -0.0446 -0.0602 3   ASP A OD1   
8    O OD2   . ASP A 9   ? 1.1825 1.1044 1.1185 -0.1075 -0.0563 -0.0566 3   ASP A OD2   
9    N N     . ARG A 10  ? 0.9015 0.7313 0.7658 -0.1207 -0.0524 -0.0899 4   ARG A N     
10   C CA    . ARG A 10  ? 0.8840 0.7057 0.7314 -0.1148 -0.0531 -0.0955 4   ARG A CA    
11   C C     . ARG A 10  ? 0.9121 0.7215 0.7568 -0.0989 -0.0439 -0.0917 4   ARG A C     
12   O O     . ARG A 10  ? 0.8927 0.6896 0.7432 -0.0944 -0.0354 -0.0872 4   ARG A O     
13   C CB    . ARG A 10  ? 0.9190 0.7188 0.7473 -0.1271 -0.0533 -0.1074 4   ARG A CB    
14   N N     . PHE A 11  ? 0.8835 0.6976 0.7200 -0.0907 -0.0459 -0.0929 5   PHE A N     
15   C CA    . PHE A 11  ? 0.8852 0.6906 0.7190 -0.0764 -0.0382 -0.0900 5   PHE A CA    
16   C C     . PHE A 11  ? 0.9790 0.7528 0.7962 -0.0769 -0.0289 -0.0974 5   PHE A C     
17   O O     . PHE A 11  ? 1.0161 0.7800 0.8162 -0.0845 -0.0311 -0.1066 5   PHE A O     
18   C CB    . PHE A 11  ? 0.8945 0.7167 0.7256 -0.0689 -0.0438 -0.0887 5   PHE A CB    
19   C CG    . PHE A 11  ? 0.8897 0.7396 0.7387 -0.0625 -0.0491 -0.0802 5   PHE A CG    
20   C CD1   . PHE A 11  ? 0.9265 0.7987 0.7800 -0.0668 -0.0596 -0.0796 5   PHE A CD1   
21   C CD2   . PHE A 11  ? 0.9028 0.7566 0.7641 -0.0518 -0.0435 -0.0730 5   PHE A CD2   
22   C CE1   . PHE A 11  ? 0.9114 0.8078 0.7817 -0.0603 -0.0634 -0.0723 5   PHE A CE1   
23   C CE2   . PHE A 11  ? 0.9110 0.7893 0.7877 -0.0464 -0.0477 -0.0663 5   PHE A CE2   
24   C CZ    . PHE A 11  ? 0.8758 0.7743 0.7568 -0.0504 -0.0571 -0.0663 5   PHE A CZ    
25   N N     . GLU A 12  ? 0.9195 0.6778 0.7416 -0.0689 -0.0186 -0.0935 6   GLU A N     
26   C CA    . GLU A 12  ? 0.9340 0.6615 0.7434 -0.0672 -0.0079 -0.0996 6   GLU A CA    
27   C C     . GLU A 12  ? 0.9598 0.6866 0.7679 -0.0526 -0.0022 -0.0970 6   GLU A C     
28   O O     . GLU A 12  ? 0.9644 0.6994 0.7868 -0.0419 0.0009  -0.0879 6   GLU A O     
29   C CB    . GLU A 12  ? 0.9628 0.6729 0.7803 -0.0687 -0.0002 -0.0962 6   GLU A CB    
30   C CG    . GLU A 12  ? 1.0975 0.7760 0.9073 -0.0634 0.0126  -0.0997 6   GLU A CG    
31   C CD    . GLU A 12  ? 1.3664 1.0329 1.1890 -0.0587 0.0205  -0.0913 6   GLU A CD    
32   O OE1   . GLU A 12  ? 1.0621 0.7089 0.8835 -0.0494 0.0310  -0.0906 6   GLU A OE1   
33   O OE2   . GLU A 12  ? 1.3918 1.0693 1.2260 -0.0640 0.0165  -0.0849 6   GLU A OE2   
34   N N     . LEU A 13  ? 0.8845 0.6035 0.6755 -0.0528 -0.0012 -0.1048 7   LEU A N     
35   C CA    . LEU A 13  ? 0.8586 0.5762 0.6465 -0.0404 0.0048  -0.1036 7   LEU A CA    
36   C C     . LEU A 13  ? 0.9352 0.6251 0.7184 -0.0350 0.0184  -0.1068 7   LEU A C     
37   O O     . LEU A 13  ? 0.9559 0.6233 0.7226 -0.0417 0.0232  -0.1168 7   LEU A O     
38   C CB    . LEU A 13  ? 0.8554 0.5804 0.6275 -0.0431 -0.0009 -0.1090 7   LEU A CB    
39   C CG    . LEU A 13  ? 0.9045 0.6238 0.6670 -0.0338 0.0060  -0.1106 7   LEU A CG    
40   C CD1   . LEU A 13  ? 0.8785 0.6061 0.6583 -0.0198 0.0114  -0.1015 7   LEU A CD1   
41   C CD2   . LEU A 13  ? 0.9202 0.6536 0.6708 -0.0370 -0.0026 -0.1124 7   LEU A CD2   
42   N N     . VAL A 14  ? 0.9031 0.5951 0.7013 -0.0229 0.0244  -0.0983 8   VAL A N     
43   C CA    . VAL A 14  ? 0.9228 0.5921 0.7222 -0.0149 0.0374  -0.0985 8   VAL A CA    
44   C C     . VAL A 14  ? 0.9997 0.6693 0.7962 -0.0038 0.0440  -0.0990 8   VAL A C     
45   O O     . VAL A 14  ? 0.9619 0.6480 0.7727 0.0066  0.0439  -0.0904 8   VAL A O     
46   C CB    . VAL A 14  ? 0.9593 0.6306 0.7780 -0.0093 0.0397  -0.0878 8   VAL A CB    
47   C CG1   . VAL A 14  ? 0.9825 0.6306 0.8040 -0.0002 0.0529  -0.0868 8   VAL A CG1   
48   C CG2   . VAL A 14  ? 0.9593 0.6295 0.7800 -0.0214 0.0341  -0.0875 8   VAL A CG2   
49   N N     . SER A 15  ? 1.0133 0.6648 0.7905 -0.0070 0.0498  -0.1095 9   SER A N     
50   C CA    . SER A 15  ? 1.0242 0.6728 0.7956 0.0020  0.0578  -0.1116 9   SER A CA    
51   C C     . SER A 15  ? 1.1420 0.7598 0.8984 0.0014  0.0706  -0.1218 9   SER A C     
52   O O     . SER A 15  ? 1.1674 0.7684 0.9084 -0.0102 0.0700  -0.1312 9   SER A O     
53   C CB    . SER A 15  ? 1.0564 0.7210 0.8161 -0.0017 0.0498  -0.1141 9   SER A CB    
54   O OG    . SER A 15  ? 1.1922 0.8551 0.9482 0.0073  0.0582  -0.1147 9   SER A OG    
55   N N     . LYS A 16  ? 1.1184 0.7289 0.8799 0.0136  0.0826  -0.1203 10  LYS A N     
56   C CA    . LYS A 16  ? 1.1523 0.7334 0.9006 0.0151  0.0970  -0.1302 10  LYS A CA    
57   C C     . LYS A 16  ? 1.2022 0.7807 0.9264 0.0103  0.0982  -0.1402 10  LYS A C     
58   O O     . LYS A 16  ? 1.2280 0.7820 0.9327 0.0053  0.1065  -0.1521 10  LYS A O     
59   C CB    . LYS A 16  ? 1.1838 0.7600 0.9497 0.0309  0.1096  -0.1238 10  LYS A CB    
60   N N     . TYR A 17  ? 1.1257 0.7290 0.8505 0.0113  0.0897  -0.1353 11  TYR A N     
61   C CA    . TYR A 17  ? 1.1262 0.7312 0.8291 0.0073  0.0893  -0.1420 11  TYR A CA    
62   C C     . TYR A 17  ? 1.1578 0.7672 0.8416 -0.0075 0.0764  -0.1478 11  TYR A C     
63   O O     . TYR A 17  ? 1.1331 0.7519 0.8247 -0.0142 0.0654  -0.1447 11  TYR A O     
64   C CB    . TYR A 17  ? 1.1189 0.7450 0.8316 0.0171  0.0895  -0.1337 11  TYR A CB    
65   C CG    . TYR A 17  ? 1.1029 0.7529 0.8431 0.0246  0.0828  -0.1205 11  TYR A CG    
66   C CD1   . TYR A 17  ? 1.0985 0.7717 0.8427 0.0206  0.0688  -0.1148 11  TYR A CD1   
67   C CD2   . TYR A 17  ? 1.1056 0.7563 0.8672 0.0364  0.0910  -0.1138 11  TYR A CD2   
68   C CE1   . TYR A 17  ? 1.0704 0.7651 0.8382 0.0273  0.0634  -0.1039 11  TYR A CE1   
69   C CE2   . TYR A 17  ? 1.0848 0.7585 0.8697 0.0429  0.0847  -0.1023 11  TYR A CE2   
70   C CZ    . TYR A 17  ? 1.1199 0.8148 0.9071 0.0380  0.0712  -0.0979 11  TYR A CZ    
71   O OH    . TYR A 17  ? 1.0405 0.7570 0.8496 0.0441  0.0659  -0.0878 11  TYR A OH    
72   N N     . GLN A 18  ? 1.1337 0.7369 0.7923 -0.0124 0.0782  -0.1562 12  GLN A N     
73   C CA    . GLN A 18  ? 1.1463 0.7543 0.7837 -0.0260 0.0663  -0.1620 12  GLN A CA    
74   C C     . GLN A 18  ? 1.1731 0.8009 0.8034 -0.0234 0.0608  -0.1569 12  GLN A C     
75   O O     . GLN A 18  ? 1.1694 0.7974 0.8027 -0.0133 0.0706  -0.1538 12  GLN A O     
76   C CB    . GLN A 18  ? 1.2062 0.7865 0.8157 -0.0361 0.0730  -0.1777 12  GLN A CB    
77   N N     . PRO A 19  ? 1.1063 0.7511 0.7289 -0.0320 0.0457  -0.1551 13  PRO A N     
78   C CA    . PRO A 19  ? 1.0855 0.7476 0.7020 -0.0289 0.0408  -0.1490 13  PRO A CA    
79   C C     . PRO A 19  ? 1.1361 0.7852 0.7269 -0.0284 0.0508  -0.1556 13  PRO A C     
80   O O     . PRO A 19  ? 1.1686 0.8014 0.7335 -0.0377 0.0526  -0.1670 13  PRO A O     
81   C CB    . PRO A 19  ? 1.1038 0.7826 0.7151 -0.0395 0.0231  -0.1475 13  PRO A CB    
82   C CG    . PRO A 19  ? 1.1559 0.8339 0.7822 -0.0446 0.0183  -0.1484 13  PRO A CG    
83   C CD    . PRO A 19  ? 1.1285 0.7788 0.7496 -0.0444 0.0323  -0.1574 13  PRO A CD    
84   N N     . GLN A 20  ? 1.0545 0.7111 0.6531 -0.0176 0.0577  -0.1485 14  GLN A N     
85   C CA    . GLN A 20  ? 1.0673 0.7148 0.6463 -0.0146 0.0690  -0.1519 14  GLN A CA    
86   C C     . GLN A 20  ? 1.1081 0.7744 0.6809 -0.0144 0.0607  -0.1436 14  GLN A C     
87   O O     . GLN A 20  ? 1.0762 0.7623 0.6657 -0.0136 0.0484  -0.1344 14  GLN A O     
88   C CB    . GLN A 20  ? 1.0754 0.7174 0.6729 -0.0017 0.0848  -0.1491 14  GLN A CB    
89   C CG    . GLN A 20  ? 1.3284 0.9506 0.9336 0.0004  0.0950  -0.1559 14  GLN A CG    
90   C CD    . GLN A 20  ? 1.7683 1.3651 1.3448 -0.0050 0.1060  -0.1698 14  GLN A CD    
91   O OE1   . GLN A 20  ? 1.8220 1.4099 1.3908 0.0011  0.1203  -0.1727 14  GLN A OE1   
92   N NE2   . GLN A 20  ? 1.6746 1.2602 1.2335 -0.0173 0.0994  -0.1791 14  GLN A NE2   
93   N N     . GLY A 21  ? 1.1012 0.7607 0.6508 -0.0145 0.0684  -0.1465 15  GLY A N     
94   C CA    . GLY A 21  ? 1.0972 0.7713 0.6380 -0.0138 0.0627  -0.1383 15  GLY A CA    
95   C C     . GLY A 21  ? 1.1498 0.8371 0.6804 -0.0230 0.0443  -0.1356 15  GLY A C     
96   O O     . GLY A 21  ? 1.1678 0.8462 0.6760 -0.0336 0.0395  -0.1449 15  GLY A O     
97   N N     . ASP A 22  ? 1.0805 0.7892 0.6283 -0.0191 0.0338  -0.1232 16  ASP A N     
98   C CA    . ASP A 22  ? 1.0803 0.8038 0.6221 -0.0266 0.0159  -0.1194 16  ASP A CA    
99   C C     . ASP A 22  ? 1.0559 0.7925 0.6235 -0.0277 0.0044  -0.1161 16  ASP A C     
100  O O     . ASP A 22  ? 1.0409 0.7941 0.6111 -0.0315 -0.0103 -0.1106 16  ASP A O     
101  C CB    . ASP A 22  ? 1.1167 0.8522 0.6466 -0.0254 0.0101  -0.1098 16  ASP A CB    
102  C CG    . ASP A 22  ? 1.2747 1.0213 0.8269 -0.0144 0.0136  -0.0979 16  ASP A CG    
103  O OD1   . ASP A 22  ? 1.2789 1.0335 0.8222 -0.0130 0.0099  -0.0894 16  ASP A OD1   
104  O OD2   . ASP A 22  ? 1.3613 1.1084 0.9394 -0.0074 0.0202  -0.0968 16  ASP A OD2   
105  N N     . GLN A 23  ? 0.9609 0.6897 0.5466 -0.0246 0.0114  -0.1198 17  GLN A N     
106  C CA    . GLN A 23  ? 0.9183 0.6563 0.5262 -0.0265 0.0028  -0.1182 17  GLN A CA    
107  C C     . GLN A 23  ? 0.9966 0.7318 0.5883 -0.0399 -0.0073 -0.1262 17  GLN A C     
108  O O     . GLN A 23  ? 0.9830 0.7357 0.5857 -0.0434 -0.0208 -0.1212 17  GLN A O     
109  C CB    . GLN A 23  ? 0.9105 0.6386 0.5380 -0.0205 0.0135  -0.1202 17  GLN A CB    
110  C CG    . GLN A 23  ? 0.8675 0.6023 0.5160 -0.0080 0.0214  -0.1119 17  GLN A CG    
111  C CD    . GLN A 23  ? 1.1004 0.8267 0.7677 -0.0022 0.0308  -0.1133 17  GLN A CD    
112  O OE1   . GLN A 23  ? 1.0434 0.7499 0.7014 -0.0039 0.0401  -0.1217 17  GLN A OE1   
113  N NE2   . GLN A 23  ? 0.9812 0.7218 0.6751 0.0050  0.0289  -0.1048 17  GLN A NE2   
114  N N     . PRO A 24  ? 0.9839 0.6987 0.5492 -0.0481 -0.0018 -0.1385 18  PRO A N     
115  C CA    . PRO A 24  ? 0.9918 0.7056 0.5430 -0.0621 -0.0126 -0.1462 18  PRO A CA    
116  C C     . PRO A 24  ? 1.0183 0.7526 0.5604 -0.0679 -0.0291 -0.1407 18  PRO A C     
117  O O     . PRO A 24  ? 1.0038 0.7516 0.5559 -0.0748 -0.0420 -0.1395 18  PRO A O     
118  C CB    . PRO A 24  ? 1.0526 0.7398 0.5754 -0.0682 -0.0015 -0.1604 18  PRO A CB    
119  C CG    . PRO A 24  ? 1.1077 0.7809 0.6402 -0.0566 0.0160  -0.1603 18  PRO A CG    
120  C CD    . PRO A 24  ? 1.0263 0.7180 0.5750 -0.0453 0.0150  -0.1467 18  PRO A CD    
121  N N     . LYS A 25  ? 0.9705 0.7086 0.4958 -0.0647 -0.0288 -0.1362 19  LYS A N     
122  C CA    . LYS A 25  ? 0.9724 0.7301 0.4888 -0.0688 -0.0443 -0.1291 19  LYS A CA    
123  C C     . LYS A 25  ? 0.9929 0.7746 0.5408 -0.0622 -0.0543 -0.1162 19  LYS A C     
124  O O     . LYS A 25  ? 0.9833 0.7823 0.5345 -0.0682 -0.0694 -0.1129 19  LYS A O     
125  C CB    . LYS A 25  ? 1.0009 0.7554 0.4934 -0.0656 -0.0399 -0.1259 19  LYS A CB    
126  N N     . ALA A 26  ? 0.9376 0.7205 0.5094 -0.0503 -0.0457 -0.1096 20  ALA A N     
127  C CA    . ALA A 26  ? 0.9035 0.7069 0.5058 -0.0433 -0.0528 -0.0986 20  ALA A CA    
128  C C     . ALA A 26  ? 0.9319 0.7442 0.5511 -0.0497 -0.0616 -0.1009 20  ALA A C     
129  O O     . ALA A 26  ? 0.9360 0.7680 0.5635 -0.0521 -0.0750 -0.0950 20  ALA A O     
130  C CB    . ALA A 26  ? 0.8892 0.6893 0.5111 -0.0312 -0.0406 -0.0938 20  ALA A CB    
131  N N     . ILE A 27  ? 0.8535 0.6511 0.4769 -0.0526 -0.0539 -0.1093 21  ILE A N     
132  C CA    . ILE A 27  ? 0.8299 0.6329 0.4683 -0.0595 -0.0603 -0.1120 21  ILE A CA    
133  C C     . ILE A 27  ? 0.8920 0.7043 0.5170 -0.0725 -0.0745 -0.1156 21  ILE A C     
134  O O     . ILE A 27  ? 0.8569 0.6896 0.4992 -0.0746 -0.0858 -0.1101 21  ILE A O     
135  C CB    . ILE A 27  ? 0.8692 0.6513 0.5111 -0.0608 -0.0486 -0.1203 21  ILE A CB    
136  C CG1   . ILE A 27  ? 0.8597 0.6333 0.5137 -0.0478 -0.0347 -0.1167 21  ILE A CG1   
137  C CG2   . ILE A 27  ? 0.8539 0.6439 0.5152 -0.0666 -0.0549 -0.1204 21  ILE A CG2   
138  C CD1   . ILE A 27  ? 0.9816 0.7285 0.6259 -0.0478 -0.0203 -0.1259 21  ILE A CD1   
139  N N     . GLU A 28  ? 0.8989 0.6976 0.4934 -0.0811 -0.0739 -0.1247 22  GLU A N     
140  C CA    . GLU A 28  ? 0.9258 0.7334 0.5050 -0.0947 -0.0879 -0.1290 22  GLU A CA    
141  C C     . GLU A 28  ? 0.9839 0.8201 0.5718 -0.0923 -0.1030 -0.1170 22  GLU A C     
142  O O     . GLU A 28  ? 0.9846 0.8386 0.5847 -0.0992 -0.1155 -0.1155 22  GLU A O     
143  C CB    . GLU A 28  ? 0.9710 0.7597 0.5134 -0.1027 -0.0841 -0.1399 22  GLU A CB    
144  N N     . LYS A 29  ? 0.9196 0.7602 0.5043 -0.0818 -0.1009 -0.1079 23  LYS A N     
145  C CA    . LYS A 29  ? 0.9044 0.7693 0.4967 -0.0776 -0.1135 -0.0955 23  LYS A CA    
146  C C     . LYS A 29  ? 0.9196 0.8043 0.5478 -0.0713 -0.1185 -0.0868 23  LYS A C     
147  O O     . LYS A 29  ? 0.9103 0.8173 0.5481 -0.0738 -0.1324 -0.0807 23  LYS A O     
148  C CB    . LYS A 29  ? 0.9329 0.7937 0.5120 -0.0683 -0.1080 -0.0883 23  LYS A CB    
149  N N     . LEU A 30  ? 0.8473 0.7246 0.4953 -0.0634 -0.1073 -0.0865 24  LEU A N     
150  C CA    . LEU A 30  ? 0.8059 0.7000 0.4866 -0.0572 -0.1099 -0.0793 24  LEU A CA    
151  C C     . LEU A 30  ? 0.8824 0.7850 0.5757 -0.0667 -0.1167 -0.0837 24  LEU A C     
152  O O     . LEU A 30  ? 0.8685 0.7922 0.5844 -0.0647 -0.1244 -0.0770 24  LEU A O     
153  C CB    . LEU A 30  ? 0.7738 0.6585 0.4696 -0.0462 -0.0965 -0.0772 24  LEU A CB    
154  C CG    . LEU A 30  ? 0.8180 0.7040 0.5141 -0.0350 -0.0923 -0.0689 24  LEU A CG    
155  C CD1   . LEU A 30  ? 0.8063 0.6769 0.5069 -0.0274 -0.0775 -0.0706 24  LEU A CD1   
156  C CD2   . LEU A 30  ? 0.8337 0.7417 0.5528 -0.0281 -0.1001 -0.0583 24  LEU A CD2   
157  N N     . VAL A 31  ? 0.8657 0.7520 0.5450 -0.0774 -0.1135 -0.0950 25  VAL A N     
158  C CA    . VAL A 31  ? 0.8614 0.7539 0.5515 -0.0882 -0.1194 -0.0998 25  VAL A CA    
159  C C     . VAL A 31  ? 0.9084 0.8207 0.5925 -0.0981 -0.1358 -0.0989 25  VAL A C     
160  O O     . VAL A 31  ? 0.8638 0.7969 0.5687 -0.1013 -0.1448 -0.0951 25  VAL A O     
161  C CB    . VAL A 31  ? 0.9261 0.7930 0.6058 -0.0963 -0.1097 -0.1119 25  VAL A CB    
162  C CG1   . VAL A 31  ? 0.9237 0.7980 0.6176 -0.1072 -0.1154 -0.1152 25  VAL A CG1   
163  C CG2   . VAL A 31  ? 0.9093 0.7588 0.5964 -0.0855 -0.0940 -0.1113 25  VAL A CG2   
164  N N     . LYS A 32  ? 0.9083 0.8154 0.5642 -0.1023 -0.1398 -0.1017 26  LYS A N     
165  C CA    . LYS A 32  ? 0.9218 0.8479 0.5682 -0.1112 -0.1562 -0.1002 26  LYS A CA    
166  C C     . LYS A 32  ? 0.9330 0.8880 0.6027 -0.1020 -0.1660 -0.0858 26  LYS A C     
167  O O     . LYS A 32  ? 0.9245 0.9023 0.6050 -0.1084 -0.1796 -0.0830 26  LYS A O     
168  C CB    . LYS A 32  ? 0.9601 0.8740 0.5706 -0.1149 -0.1566 -0.1044 26  LYS A CB    
169  N N     . GLY A 33  ? 0.8547 0.8080 0.5337 -0.0872 -0.1585 -0.0773 27  GLY A N     
170  C CA    . GLY A 33  ? 0.8257 0.8020 0.5273 -0.0766 -0.1650 -0.0640 27  GLY A CA    
171  C C     . GLY A 33  ? 0.8253 0.8205 0.5587 -0.0771 -0.1691 -0.0615 27  GLY A C     
172  O O     . GLY A 33  ? 0.7929 0.8131 0.5398 -0.0777 -0.1816 -0.0547 27  GLY A O     
173  N N     . ILE A 34  ? 0.7729 0.7564 0.5179 -0.0770 -0.1585 -0.0670 28  ILE A N     
174  C CA    . ILE A 34  ? 0.7447 0.7431 0.5182 -0.0783 -0.1600 -0.0657 28  ILE A CA    
175  C C     . ILE A 34  ? 0.8355 0.8482 0.6096 -0.0932 -0.1722 -0.0700 28  ILE A C     
176  O O     . ILE A 34  ? 0.8135 0.8521 0.6096 -0.0932 -0.1813 -0.0638 28  ILE A O     
177  C CB    . ILE A 34  ? 0.7500 0.7304 0.5315 -0.0751 -0.1456 -0.0701 28  ILE A CB    
178  C CG1   . ILE A 34  ? 0.7194 0.7004 0.5146 -0.0594 -0.1378 -0.0623 28  ILE A CG1   
179  C CG2   . ILE A 34  ? 0.7240 0.7128 0.5246 -0.0828 -0.1466 -0.0729 28  ILE A CG2   
180  C CD1   . ILE A 34  ? 0.7088 0.6674 0.5002 -0.0540 -0.1233 -0.0659 28  ILE A CD1   
181  N N     . GLN A 35  ? 0.8286 0.8247 0.5781 -0.1058 -0.1724 -0.0807 29  GLN A N     
182  C CA    . GLN A 35  ? 0.8448 0.8509 0.5903 -0.1221 -0.1836 -0.0868 29  GLN A CA    
183  C C     . GLN A 35  ? 0.9375 0.9709 0.6834 -0.1231 -0.2001 -0.0792 29  GLN A C     
184  O O     . GLN A 35  ? 0.9387 0.9954 0.7013 -0.1307 -0.2109 -0.0777 29  GLN A O     
185  C CB    . GLN A 35  ? 0.8859 0.8651 0.6009 -0.1343 -0.1791 -0.1004 29  GLN A CB    
186  N N     . GLU A 36  ? 0.9178 0.9496 0.6472 -0.1149 -0.2020 -0.0733 30  GLU A N     
187  C CA    . GLU A 36  ? 0.9225 0.9790 0.6504 -0.1140 -0.2175 -0.0642 30  GLU A CA    
188  C C     . GLU A 36  ? 0.9759 1.0585 0.7373 -0.1014 -0.2217 -0.0506 30  GLU A C     
189  O O     . GLU A 36  ? 0.9852 1.0898 0.7503 -0.0984 -0.2343 -0.0411 30  GLU A O     
190  C CB    . GLU A 36  ? 0.9525 0.9961 0.6485 -0.1107 -0.2173 -0.0626 30  GLU A CB    
191  N N     . GLY A 37  ? 0.9104 0.9902 0.6954 -0.0941 -0.2112 -0.0498 31  GLY A N     
192  C CA    . GLY A 37  ? 0.8761 0.9777 0.6933 -0.0826 -0.2126 -0.0391 31  GLY A CA    
193  C C     . GLY A 37  ? 0.8854 0.9820 0.7061 -0.0657 -0.2059 -0.0301 31  GLY A C     
194  O O     . GLY A 37  ? 0.8668 0.9818 0.7126 -0.0558 -0.2081 -0.0209 31  GLY A O     
195  N N     . LYS A 38  ? 0.8244 0.8959 0.6208 -0.0624 -0.1972 -0.0327 32  LYS A N     
196  C CA    . LYS A 38  ? 0.8041 0.8686 0.6025 -0.0475 -0.1900 -0.0248 32  LYS A CA    
197  C C     . LYS A 38  ? 0.8664 0.9261 0.6876 -0.0393 -0.1778 -0.0253 32  LYS A C     
198  O O     . LYS A 38  ? 0.8969 0.9415 0.7156 -0.0441 -0.1689 -0.0341 32  LYS A O     
199  C CB    . LYS A 38  ? 0.8233 0.8636 0.5899 -0.0476 -0.1838 -0.0279 32  LYS A CB    
200  N N     . LYS A 39  ? 0.7756 0.8495 0.6195 -0.0274 -0.1783 -0.0157 33  LYS A N     
201  C CA    . LYS A 39  ? 0.7276 0.8019 0.5950 -0.0179 -0.1686 -0.0142 33  LYS A CA    
202  C C     . LYS A 39  ? 0.7797 0.8318 0.6356 -0.0097 -0.1569 -0.0141 33  LYS A C     
203  O O     . LYS A 39  ? 0.7959 0.8310 0.6465 -0.0115 -0.1467 -0.0213 33  LYS A O     
204  C CB    . LYS A 39  ? 0.7143 0.8131 0.6074 -0.0092 -0.1752 -0.0042 33  LYS A CB    
205  C CG    . LYS A 39  ? 0.6025 0.7033 0.5192 0.0017  -0.1661 -0.0018 33  LYS A CG    
206  C CD    . LYS A 39  ? 0.6923 0.8174 0.6329 0.0095  -0.1733 0.0076  33  LYS A CD    
207  C CE    . LYS A 39  ? 0.9200 1.0483 0.8845 0.0197  -0.1643 0.0089  33  LYS A CE    
208  N NZ    . LYS A 39  ? 1.0280 1.1760 1.0144 0.0296  -0.1696 0.0185  33  LYS A NZ    
209  N N     . HIS A 40  ? 0.7091 0.7612 0.5607 -0.0014 -0.1586 -0.0058 34  HIS A N     
210  C CA    . HIS A 40  ? 0.6978 0.7306 0.5391 0.0059  -0.1481 -0.0046 34  HIS A CA    
211  C C     . HIS A 40  ? 0.7640 0.7782 0.5739 -0.0009 -0.1459 -0.0098 34  HIS A C     
212  O O     . HIS A 40  ? 0.7855 0.8036 0.5783 -0.0064 -0.1550 -0.0080 34  HIS A O     
213  C CB    . HIS A 40  ? 0.7025 0.7416 0.5511 0.0170  -0.1505 0.0070  34  HIS A CB    
214  C CG    . HIS A 40  ? 0.7220 0.7783 0.6010 0.0249  -0.1520 0.0122  34  HIS A CG    
215  N ND1   . HIS A 40  ? 0.7221 0.7741 0.6182 0.0309  -0.1417 0.0095  34  HIS A ND1   
216  C CD2   . HIS A 40  ? 0.7385 0.8164 0.6330 0.0279  -0.1624 0.0199  34  HIS A CD2   
217  C CE1   . HIS A 40  ? 0.7016 0.7713 0.6217 0.0370  -0.1453 0.0147  34  HIS A CE1   
218  N NE2   . HIS A 40  ? 0.7163 0.8022 0.6375 0.0359  -0.1575 0.0213  34  HIS A NE2   
219  N N     . GLN A 41  ? 0.7103 0.7048 0.5128 -0.0004 -0.1335 -0.0162 35  GLN A N     
220  C CA    . GLN A 41  ? 0.7169 0.6909 0.4915 -0.0049 -0.1276 -0.0217 35  GLN A CA    
221  C C     . GLN A 41  ? 0.7816 0.7403 0.5585 0.0030  -0.1139 -0.0219 35  GLN A C     
222  O O     . GLN A 41  ? 0.7584 0.7196 0.5562 0.0080  -0.1084 -0.0222 35  GLN A O     
223  C CB    . GLN A 41  ? 0.7307 0.6969 0.4943 -0.0164 -0.1271 -0.0328 35  GLN A CB    
224  C CG    . GLN A 41  ? 0.8305 0.8084 0.5844 -0.0268 -0.1404 -0.0343 35  GLN A CG    
225  C CD    . GLN A 41  ? 1.0361 1.0039 0.7795 -0.0387 -0.1390 -0.0460 35  GLN A CD    
226  O OE1   . GLN A 41  ? 0.8324 0.7853 0.5493 -0.0456 -0.1373 -0.0526 35  GLN A OE1   
227  N NE2   . GLN A 41  ? 1.0744 1.0499 0.8381 -0.0416 -0.1392 -0.0488 35  GLN A NE2   
228  N N     . THR A 42  ? 0.7766 0.7204 0.5321 0.0038  -0.1081 -0.0217 36  THR A N     
229  C CA    . THR A 42  ? 0.7639 0.6935 0.5207 0.0105  -0.0949 -0.0219 36  THR A CA    
230  C C     . THR A 42  ? 0.8304 0.7409 0.5642 0.0056  -0.0863 -0.0298 36  THR A C     
231  O O     . THR A 42  ? 0.8395 0.7448 0.5488 0.0001  -0.0896 -0.0310 36  THR A O     
232  C CB    . THR A 42  ? 0.8755 0.8072 0.6349 0.0189  -0.0944 -0.0114 36  THR A CB    
233  O OG1   . THR A 42  ? 0.9409 0.8887 0.7250 0.0244  -0.1003 -0.0053 36  THR A OG1   
234  C CG2   . THR A 42  ? 0.8093 0.7269 0.5692 0.0246  -0.0809 -0.0116 36  THR A CG2   
235  N N     . LEU A 43  ? 0.7909 0.6913 0.5325 0.0077  -0.0754 -0.0352 37  LEU A N     
236  C CA    . LEU A 43  ? 0.8077 0.6894 0.5315 0.0053  -0.0648 -0.0423 37  LEU A CA    
237  C C     . LEU A 43  ? 0.8794 0.7547 0.6053 0.0134  -0.0548 -0.0375 37  LEU A C     
238  O O     . LEU A 43  ? 0.8435 0.7229 0.5910 0.0198  -0.0505 -0.0349 37  LEU A O     
239  C CB    . LEU A 43  ? 0.7941 0.6686 0.5254 0.0026  -0.0590 -0.0508 37  LEU A CB    
240  C CG    . LEU A 43  ? 0.8574 0.7116 0.5725 0.0015  -0.0467 -0.0581 37  LEU A CG    
241  C CD1   . LEU A 43  ? 0.8820 0.7262 0.5695 -0.0080 -0.0493 -0.0652 37  LEU A CD1   
242  C CD2   . LEU A 43  ? 0.8700 0.7190 0.6007 0.0034  -0.0393 -0.0626 37  LEU A CD2   
243  N N     . LEU A 44  ? 0.8725 0.7389 0.5756 0.0125  -0.0519 -0.0359 38  LEU A N     
244  C CA    . LEU A 44  ? 0.8751 0.7343 0.5773 0.0187  -0.0416 -0.0315 38  LEU A CA    
245  C C     . LEU A 44  ? 0.9822 0.8263 0.6769 0.0176  -0.0291 -0.0401 38  LEU A C     
246  O O     . LEU A 44  ? 1.0173 0.8497 0.6874 0.0131  -0.0251 -0.0448 38  LEU A O     
247  C CB    . LEU A 44  ? 0.8880 0.7453 0.5691 0.0183  -0.0440 -0.0246 38  LEU A CB    
248  C CG    . LEU A 44  ? 0.9251 0.7795 0.6120 0.0254  -0.0359 -0.0166 38  LEU A CG    
249  C CD1   . LEU A 44  ? 0.9447 0.8048 0.6223 0.0267  -0.0438 -0.0058 38  LEU A CD1   
250  C CD2   . LEU A 44  ? 0.9251 0.7642 0.5976 0.0253  -0.0215 -0.0208 38  LEU A CD2   
251  N N     . GLY A 45  ? 0.9369 0.7817 0.6529 0.0215  -0.0233 -0.0425 39  GLY A N     
252  C CA    . GLY A 45  ? 0.9512 0.7834 0.6655 0.0219  -0.0115 -0.0498 39  GLY A CA    
253  C C     . GLY A 45  ? 1.0313 0.8614 0.7566 0.0289  -0.0004 -0.0464 39  GLY A C     
254  O O     . GLY A 45  ? 0.9989 0.8389 0.7470 0.0337  -0.0013 -0.0420 39  GLY A O     
255  N N     . ALA A 46  ? 1.0381 0.8556 0.7472 0.0290  0.0104  -0.0489 40  ALA A N     
256  C CA    . ALA A 46  ? 1.0422 0.8575 0.7612 0.0348  0.0224  -0.0464 40  ALA A CA    
257  C C     . ALA A 46  ? 1.0942 0.9100 0.8342 0.0385  0.0285  -0.0506 40  ALA A C     
258  O O     . ALA A 46  ? 1.0907 0.9028 0.8301 0.0359  0.0264  -0.0565 40  ALA A O     
259  C CB    . ALA A 46  ? 1.0765 0.8786 0.7715 0.0334  0.0326  -0.0486 40  ALA A CB    
260  N N     . THR A 47  ? 1.0399 0.8609 0.7989 0.0441  0.0352  -0.0470 41  THR A N     
261  C CA    . THR A 47  ? 1.0263 0.8496 0.8052 0.0479  0.0404  -0.0498 41  THR A CA    
262  C C     . THR A 47  ? 1.0781 0.8877 0.8465 0.0487  0.0526  -0.0557 41  THR A C     
263  O O     . THR A 47  ? 1.0942 0.8978 0.8531 0.0498  0.0622  -0.0552 41  THR A O     
264  C CB    . THR A 47  ? 1.1790 1.0141 0.9823 0.0528  0.0424  -0.0445 41  THR A CB    
265  O OG1   . THR A 47  ? 1.2192 1.0510 1.0186 0.0545  0.0517  -0.0416 41  THR A OG1   
266  C CG2   . THR A 47  ? 1.1468 0.9942 0.9616 0.0524  0.0310  -0.0399 41  THR A CG2   
267  N N     . GLY A 48  ? 1.0064 0.8104 0.7758 0.0479  0.0525  -0.0613 42  GLY A N     
268  C CA    . GLY A 48  ? 0.9964 0.7857 0.7568 0.0490  0.0641  -0.0677 42  GLY A CA    
269  C C     . GLY A 48  ? 1.0031 0.7783 0.7396 0.0424  0.0618  -0.0752 42  GLY A C     
270  O O     . GLY A 48  ? 1.0086 0.7693 0.7365 0.0428  0.0714  -0.0818 42  GLY A O     
271  N N     . THR A 49  ? 0.9408 0.7205 0.6677 0.0362  0.0491  -0.0744 43  THR A N     
272  C CA    . THR A 49  ? 0.9626 0.7319 0.6672 0.0282  0.0442  -0.0813 43  THR A CA    
273  C C     . THR A 49  ? 1.0078 0.7764 0.7218 0.0253  0.0383  -0.0848 43  THR A C     
274  O O     . THR A 49  ? 1.0518 0.8101 0.7489 0.0180  0.0357  -0.0917 43  THR A O     
275  C CB    . THR A 49  ? 1.1234 0.8986 0.8109 0.0226  0.0338  -0.0782 43  THR A CB    
276  O OG1   . THR A 49  ? 1.1015 0.8935 0.8063 0.0228  0.0213  -0.0719 43  THR A OG1   
277  C CG2   . THR A 49  ? 1.1266 0.9007 0.8023 0.0249  0.0402  -0.0741 43  THR A CG2   
278  N N     . GLY A 50  ? 0.9045 0.6835 0.6442 0.0302  0.0366  -0.0803 44  GLY A N     
279  C CA    . GLY A 50  ? 0.8782 0.6575 0.6282 0.0279  0.0316  -0.0821 44  GLY A CA    
280  C C     . GLY A 50  ? 0.8945 0.6852 0.6441 0.0214  0.0172  -0.0803 44  GLY A C     
281  O O     . GLY A 50  ? 0.8981 0.6823 0.6368 0.0139  0.0125  -0.0856 44  GLY A O     
282  N N     . LYS A 51  ? 0.8109 0.6188 0.5732 0.0244  0.0105  -0.0730 45  LYS A N     
283  C CA    . LYS A 51  ? 0.7923 0.6143 0.5584 0.0203  -0.0026 -0.0697 45  LYS A CA    
284  C C     . LYS A 51  ? 0.8265 0.6521 0.6040 0.0168  -0.0077 -0.0713 45  LYS A C     
285  O O     . LYS A 51  ? 0.8501 0.6770 0.6196 0.0092  -0.0159 -0.0738 45  LYS A O     
286  C CB    . LYS A 51  ? 0.8057 0.6432 0.5863 0.0258  -0.0059 -0.0618 45  LYS A CB    
287  C CG    . LYS A 51  ? 0.9867 0.8219 0.7542 0.0273  -0.0034 -0.0590 45  LYS A CG    
288  C CD    . LYS A 51  ? 1.0730 0.9122 0.8544 0.0348  0.0039  -0.0543 45  LYS A CD    
289  C CE    . LYS A 51  ? 1.1590 1.0127 0.9542 0.0375  -0.0030 -0.0474 45  LYS A CE    
290  N NZ    . LYS A 51  ? 1.2378 1.0931 1.0422 0.0430  0.0044  -0.0433 45  LYS A NZ    
291  N N     . THR A 52  ? 0.7333 0.5604 0.5287 0.0220  -0.0029 -0.0696 46  THR A N     
292  C CA    . THR A 52  ? 0.7094 0.5395 0.5163 0.0195  -0.0063 -0.0698 46  THR A CA    
293  C C     . THR A 52  ? 0.7557 0.5700 0.5484 0.0118  -0.0053 -0.0768 46  THR A C     
294  O O     . THR A 52  ? 0.7581 0.5768 0.5524 0.0051  -0.0128 -0.0777 46  THR A O     
295  C CB    . THR A 52  ? 0.7873 0.6217 0.6137 0.0271  -0.0008 -0.0658 46  THR A CB    
296  O OG1   . THR A 52  ? 0.8047 0.6552 0.6439 0.0319  -0.0038 -0.0603 46  THR A OG1   
297  C CG2   . THR A 52  ? 0.7284 0.5647 0.5655 0.0248  -0.0032 -0.0651 46  THR A CG2   
298  N N     . PHE A 53  ? 0.7055 0.5014 0.4840 0.0124  0.0041  -0.0821 47  PHE A N     
299  C CA    . PHE A 53  ? 0.7179 0.4958 0.4809 0.0049  0.0064  -0.0902 47  PHE A CA    
300  C C     . PHE A 53  ? 0.7778 0.5581 0.5234 -0.0053 -0.0035 -0.0941 47  PHE A C     
301  O O     . PHE A 53  ? 0.7948 0.5713 0.5370 -0.0138 -0.0082 -0.0982 47  PHE A O     
302  C CB    . PHE A 53  ? 0.7560 0.5137 0.5082 0.0087  0.0199  -0.0954 47  PHE A CB    
303  C CG    . PHE A 53  ? 0.8046 0.5407 0.5413 0.0014  0.0240  -0.1048 47  PHE A CG    
304  C CD1   . PHE A 53  ? 0.8434 0.5736 0.5897 -0.0014 0.0237  -0.1054 47  PHE A CD1   
305  C CD2   . PHE A 53  ? 0.8615 0.5821 0.5736 -0.0030 0.0289  -0.1131 47  PHE A CD2   
306  C CE1   . PHE A 53  ? 0.8769 0.5854 0.6093 -0.0087 0.0281  -0.1144 47  PHE A CE1   
307  C CE2   . PHE A 53  ? 0.9237 0.6226 0.6211 -0.0101 0.0335  -0.1229 47  PHE A CE2   
308  C CZ    . PHE A 53  ? 0.8974 0.5900 0.6056 -0.0130 0.0330  -0.1236 47  PHE A CZ    
309  N N     . THR A 54  ? 0.7157 0.5041 0.4521 -0.0046 -0.0074 -0.0918 48  THR A N     
310  C CA    . THR A 54  ? 0.7196 0.5137 0.4410 -0.0136 -0.0183 -0.0938 48  THR A CA    
311  C C     . THR A 54  ? 0.7472 0.5588 0.4851 -0.0174 -0.0297 -0.0899 48  THR A C     
312  O O     . THR A 54  ? 0.7445 0.5554 0.4762 -0.0272 -0.0363 -0.0944 48  THR A O     
313  C CB    . THR A 54  ? 0.7500 0.5510 0.4616 -0.0104 -0.0202 -0.0894 48  THR A CB    
314  O OG1   . THR A 54  ? 0.8347 0.6179 0.5255 -0.0103 -0.0103 -0.0951 48  THR A OG1   
315  C CG2   . THR A 54  ? 0.6461 0.4596 0.3487 -0.0173 -0.0338 -0.0877 48  THR A CG2   
316  N N     . VAL A 55  ? 0.6665 0.4935 0.4261 -0.0097 -0.0311 -0.0820 49  VAL A N     
317  C CA    . VAL A 55  ? 0.6435 0.4885 0.4210 -0.0114 -0.0401 -0.0776 49  VAL A CA    
318  C C     . VAL A 55  ? 0.6985 0.5373 0.4812 -0.0176 -0.0395 -0.0815 49  VAL A C     
319  O O     . VAL A 55  ? 0.6764 0.5241 0.4614 -0.0255 -0.0481 -0.0822 49  VAL A O     
320  C CB    . VAL A 55  ? 0.6467 0.5062 0.4444 -0.0016 -0.0394 -0.0697 49  VAL A CB    
321  C CG1   . VAL A 55  ? 0.6178 0.4941 0.4350 -0.0026 -0.0460 -0.0660 49  VAL A CG1   
322  C CG2   . VAL A 55  ? 0.6416 0.5083 0.4341 0.0022  -0.0424 -0.0655 49  VAL A CG2   
323  N N     . SER A 56  ? 0.6619 0.4849 0.4459 -0.0143 -0.0290 -0.0838 50  SER A N     
324  C CA    . SER A 56  ? 0.6692 0.4830 0.4581 -0.0189 -0.0264 -0.0865 50  SER A CA    
325  C C     . SER A 56  ? 0.7899 0.5921 0.5613 -0.0311 -0.0297 -0.0948 50  SER A C     
326  O O     . SER A 56  ? 0.8016 0.6061 0.5788 -0.0388 -0.0340 -0.0959 50  SER A O     
327  C CB    . SER A 56  ? 0.6951 0.4931 0.4872 -0.0116 -0.0141 -0.0867 50  SER A CB    
328  O OG    . SER A 56  ? 0.7450 0.5557 0.5536 -0.0014 -0.0122 -0.0793 50  SER A OG    
329  N N     . ASN A 57  ? 0.7761 0.5670 0.5259 -0.0335 -0.0278 -0.1007 51  ASN A N     
330  C CA    . ASN A 57  ? 0.8083 0.5885 0.5384 -0.0459 -0.0314 -0.1097 51  ASN A CA    
331  C C     . ASN A 57  ? 0.8500 0.6514 0.5833 -0.0537 -0.0461 -0.1074 51  ASN A C     
332  O O     . ASN A 57  ? 0.8514 0.6520 0.5850 -0.0641 -0.0508 -0.1115 51  ASN A O     
333  C CB    . ASN A 57  ? 0.8662 0.6310 0.5714 -0.0460 -0.0258 -0.1161 51  ASN A CB    
334  C CG    . ASN A 57  ? 1.0221 0.7604 0.7193 -0.0439 -0.0115 -0.1230 51  ASN A CG    
335  O OD1   . ASN A 57  ? 1.0205 0.7410 0.7047 -0.0530 -0.0092 -0.1323 51  ASN A OD1   
336  N ND2   . ASN A 57  ? 0.7535 0.4884 0.4585 -0.0320 -0.0016 -0.1189 51  ASN A ND2   
337  N N     . LEU A 58  ? 0.7901 0.6113 0.5288 -0.0482 -0.0529 -0.1001 52  LEU A N     
338  C CA    . LEU A 58  ? 0.7744 0.6186 0.5200 -0.0531 -0.0666 -0.0960 52  LEU A CA    
339  C C     . LEU A 58  ? 0.8175 0.6740 0.5860 -0.0555 -0.0700 -0.0929 52  LEU A C     
340  O O     . LEU A 58  ? 0.8190 0.6842 0.5885 -0.0658 -0.0787 -0.0951 52  LEU A O     
341  C CB    . LEU A 58  ? 0.7501 0.6102 0.5007 -0.0438 -0.0703 -0.0877 52  LEU A CB    
342  C CG    . LEU A 58  ? 0.7780 0.6638 0.5422 -0.0451 -0.0831 -0.0812 52  LEU A CG    
343  C CD1   . LEU A 58  ? 0.8045 0.6959 0.5512 -0.0535 -0.0936 -0.0833 52  LEU A CD1   
344  C CD2   . LEU A 58  ? 0.7556 0.6540 0.5342 -0.0332 -0.0824 -0.0723 52  LEU A CD2   
345  N N     . ILE A 59  ? 0.7578 0.6152 0.5439 -0.0468 -0.0630 -0.0880 53  ILE A N     
346  C CA    . ILE A 59  ? 0.7433 0.6113 0.5499 -0.0482 -0.0644 -0.0844 53  ILE A CA    
347  C C     . ILE A 59  ? 0.8442 0.6997 0.6462 -0.0600 -0.0638 -0.0908 53  ILE A C     
348  O O     . ILE A 59  ? 0.8479 0.7166 0.6612 -0.0671 -0.0702 -0.0895 53  ILE A O     
349  C CB    . ILE A 59  ? 0.7528 0.6207 0.5746 -0.0370 -0.0561 -0.0788 53  ILE A CB    
350  C CG1   . ILE A 59  ? 0.7262 0.6091 0.5564 -0.0267 -0.0577 -0.0724 53  ILE A CG1   
351  C CG2   . ILE A 59  ? 0.7509 0.6263 0.5900 -0.0396 -0.0563 -0.0757 53  ILE A CG2   
352  C CD1   . ILE A 59  ? 0.7262 0.6069 0.5678 -0.0164 -0.0491 -0.0683 53  ILE A CD1   
353  N N     . LYS A 60  ? 0.8258 0.6559 0.6119 -0.0623 -0.0556 -0.0978 54  LYS A N     
354  C CA    . LYS A 60  ? 0.8494 0.6625 0.6291 -0.0734 -0.0532 -0.1050 54  LYS A CA    
355  C C     . LYS A 60  ? 0.9355 0.7543 0.7038 -0.0875 -0.0638 -0.1112 54  LYS A C     
356  O O     . LYS A 60  ? 0.9446 0.7688 0.7211 -0.0974 -0.0683 -0.1122 54  LYS A O     
357  C CB    . LYS A 60  ? 0.8974 0.6810 0.6627 -0.0704 -0.0406 -0.1111 54  LYS A CB    
358  C CG    . LYS A 60  ? 0.9788 0.7395 0.7352 -0.0815 -0.0362 -0.1197 54  LYS A CG    
359  C CD    . LYS A 60  ? 1.0481 0.7803 0.7853 -0.0791 -0.0249 -0.1277 54  LYS A CD    
360  C CE    . LYS A 60  ? 1.1246 0.8535 0.8374 -0.0853 -0.0290 -0.1360 54  LYS A CE    
361  N NZ    . LYS A 60  ? 1.2047 0.9163 0.9032 -0.0767 -0.0180 -0.1395 54  LYS A NZ    
362  N N     . GLU A 61  ? 0.9045 0.7232 0.6542 -0.0885 -0.0679 -0.1148 55  GLU A N     
363  C CA    . GLU A 61  ? 0.9245 0.7492 0.6605 -0.1016 -0.0787 -0.1208 55  GLU A CA    
364  C C     . GLU A 61  ? 0.9534 0.8081 0.7071 -0.1058 -0.0918 -0.1146 55  GLU A C     
365  O O     . GLU A 61  ? 0.9753 0.8343 0.7288 -0.1193 -0.0988 -0.1192 55  GLU A O     
366  C CB    . GLU A 61  ? 0.9601 0.7810 0.6727 -0.1001 -0.0805 -0.1238 55  GLU A CB    
367  C CG    . GLU A 61  ? 1.1833 0.9802 0.8812 -0.0920 -0.0670 -0.1274 55  GLU A CG    
368  C CD    . GLU A 61  ? 1.6644 1.4310 1.3445 -0.0988 -0.0572 -0.1392 55  GLU A CD    
369  O OE1   . GLU A 61  ? 1.5311 1.2803 1.1958 -0.0929 -0.0473 -0.1428 55  GLU A OE1   
370  O OE2   . GLU A 61  ? 1.7591 1.5186 1.4413 -0.1097 -0.0585 -0.1447 55  GLU A OE2   
371  N N     . VAL A 62  ? 0.8556 0.7309 0.6249 -0.0947 -0.0948 -0.1046 56  VAL A N     
372  C CA    . VAL A 62  ? 0.8261 0.7310 0.6137 -0.0966 -0.1064 -0.0982 56  VAL A CA    
373  C C     . VAL A 62  ? 0.8658 0.7793 0.6759 -0.0997 -0.1053 -0.0955 56  VAL A C     
374  O O     . VAL A 62  ? 0.8569 0.7924 0.6801 -0.1059 -0.1147 -0.0930 56  VAL A O     
375  C CB    . VAL A 62  ? 0.8434 0.7672 0.6382 -0.0847 -0.1109 -0.0892 56  VAL A CB    
376  C CG1   . VAL A 62  ? 0.8511 0.7674 0.6222 -0.0833 -0.1128 -0.0911 56  VAL A CG1   
377  C CG2   . VAL A 62  ? 0.8139 0.7380 0.6246 -0.0710 -0.1020 -0.0826 56  VAL A CG2   
378  N N     . ASN A 63  ? 0.8241 0.7212 0.6391 -0.0953 -0.0938 -0.0953 57  ASN A N     
379  C CA    . ASN A 63  ? 0.8169 0.7187 0.6515 -0.0969 -0.0903 -0.0918 57  ASN A CA    
380  C C     . ASN A 63  ? 0.8572 0.7897 0.7148 -0.0939 -0.0972 -0.0838 57  ASN A C     
381  O O     . ASN A 63  ? 0.8595 0.8068 0.7265 -0.1039 -0.1042 -0.0841 57  ASN A O     
382  C CB    . ASN A 63  ? 0.8385 0.7260 0.6681 -0.1114 -0.0891 -0.0989 57  ASN A CB    
383  C CG    . ASN A 63  ? 1.2223 1.0953 1.0606 -0.1091 -0.0784 -0.0967 57  ASN A CG    
384  O OD1   . ASN A 63  ? 1.1490 0.9994 0.9785 -0.1027 -0.0684 -0.0982 57  ASN A OD1   
385  N ND2   . ASN A 63  ? 1.1883 1.0753 1.0450 -0.1137 -0.0799 -0.0922 57  ASN A ND2   
386  N N     . LYS A 64  ? 0.7812 0.7230 0.6476 -0.0803 -0.0948 -0.0771 58  LYS A N     
387  C CA    . LYS A 64  ? 0.7466 0.7156 0.6338 -0.0751 -0.0998 -0.0698 58  LYS A CA    
388  C C     . LYS A 64  ? 0.7568 0.7251 0.6541 -0.0627 -0.0912 -0.0646 58  LYS A C     
389  O O     . LYS A 64  ? 0.7449 0.6980 0.6320 -0.0549 -0.0852 -0.0652 58  LYS A O     
390  C CB    . LYS A 64  ? 0.7817 0.7648 0.6654 -0.0712 -0.1086 -0.0677 58  LYS A CB    
391  C CG    . LYS A 64  ? 0.9113 0.9226 0.8108 -0.0754 -0.1194 -0.0642 58  LYS A CG    
392  C CD    . LYS A 64  ? 0.9414 0.9659 0.8387 -0.0687 -0.1273 -0.0600 58  LYS A CD    
393  C CE    . LYS A 64  ? 0.9829 1.0024 0.8597 -0.0766 -0.1353 -0.0643 58  LYS A CE    
394  N NZ    . LYS A 64  ? 1.0891 1.1275 0.9727 -0.0885 -0.1466 -0.0652 58  LYS A NZ    
395  N N     . PRO A 65  ? 0.6820 0.6670 0.5991 -0.0608 -0.0904 -0.0596 59  PRO A N     
396  C CA    . PRO A 65  ? 0.6542 0.6400 0.5798 -0.0496 -0.0830 -0.0551 59  PRO A CA    
397  C C     . PRO A 65  ? 0.6856 0.6735 0.6077 -0.0388 -0.0838 -0.0534 59  PRO A C     
398  O O     . PRO A 65  ? 0.7058 0.7076 0.6305 -0.0380 -0.0912 -0.0521 59  PRO A O     
399  C CB    . PRO A 65  ? 0.6576 0.6663 0.6037 -0.0505 -0.0846 -0.0508 59  PRO A CB    
400  C CG    . PRO A 65  ? 0.7197 0.7335 0.6680 -0.0634 -0.0897 -0.0531 59  PRO A CG    
401  C CD    . PRO A 65  ? 0.6880 0.6937 0.6206 -0.0688 -0.0962 -0.0581 59  PRO A CD    
402  N N     . THR A 66  ? 0.6026 0.5761 0.5184 -0.0312 -0.0764 -0.0533 60  THR A N     
403  C CA    . THR A 66  ? 0.5835 0.5569 0.4951 -0.0221 -0.0764 -0.0519 60  THR A CA    
404  C C     . THR A 66  ? 0.5579 0.5370 0.4804 -0.0116 -0.0713 -0.0481 60  THR A C     
405  O O     . THR A 66  ? 0.5399 0.5172 0.4686 -0.0102 -0.0657 -0.0469 60  THR A O     
406  C CB    . THR A 66  ? 0.8211 0.7745 0.7122 -0.0236 -0.0747 -0.0563 60  THR A CB    
407  O OG1   . THR A 66  ? 0.9028 0.8614 0.7885 -0.0196 -0.0793 -0.0549 60  THR A OG1   
408  C CG2   . THR A 66  ? 0.8327 0.7681 0.7183 -0.0181 -0.0648 -0.0571 60  THR A CG2   
409  N N     . LEU A 67  ? 0.4726 0.4585 0.3969 -0.0047 -0.0734 -0.0461 61  LEU A N     
410  C CA    . LEU A 67  ? 0.4381 0.4291 0.3716 0.0047  -0.0692 -0.0434 61  LEU A CA    
411  C C     . LEU A 67  ? 0.4943 0.4740 0.4174 0.0103  -0.0668 -0.0436 61  LEU A C     
412  O O     . LEU A 67  ? 0.4995 0.4794 0.4154 0.0099  -0.0716 -0.0431 61  LEU A O     
413  C CB    . LEU A 67  ? 0.4134 0.4251 0.3628 0.0077  -0.0735 -0.0404 61  LEU A CB    
414  C CG    . LEU A 67  ? 0.4385 0.4558 0.3976 0.0167  -0.0696 -0.0387 61  LEU A CG    
415  C CD1   . LEU A 67  ? 0.4253 0.4437 0.3908 0.0176  -0.0637 -0.0390 61  LEU A CD1   
416  C CD2   . LEU A 67  ? 0.4689 0.5032 0.4410 0.0198  -0.0739 -0.0363 61  LEU A CD2   
417  N N     . VAL A 68  ? 0.4326 0.4031 0.3549 0.0152  -0.0595 -0.0438 62  VAL A N     
418  C CA    . VAL A 68  ? 0.4209 0.3811 0.3351 0.0204  -0.0557 -0.0439 62  VAL A CA    
419  C C     . VAL A 68  ? 0.4715 0.4410 0.3981 0.0279  -0.0537 -0.0414 62  VAL A C     
420  O O     . VAL A 68  ? 0.4602 0.4344 0.3963 0.0300  -0.0504 -0.0411 62  VAL A O     
421  C CB    . VAL A 68  ? 0.4665 0.4093 0.3710 0.0202  -0.0486 -0.0463 62  VAL A CB    
422  C CG1   . VAL A 68  ? 0.4659 0.3990 0.3616 0.0248  -0.0444 -0.0465 62  VAL A CG1   
423  C CG2   . VAL A 68  ? 0.4813 0.4138 0.3746 0.0122  -0.0498 -0.0497 62  VAL A CG2   
424  N N     . ILE A 69  ? 0.4354 0.4076 0.3618 0.0314  -0.0560 -0.0395 63  ILE A N     
425  C CA    . ILE A 69  ? 0.4208 0.3998 0.3588 0.0379  -0.0536 -0.0379 63  ILE A CA    
426  C C     . ILE A 69  ? 0.5257 0.4934 0.4578 0.0419  -0.0478 -0.0379 63  ILE A C     
427  O O     . ILE A 69  ? 0.5264 0.4848 0.4462 0.0413  -0.0479 -0.0372 63  ILE A O     
428  C CB    . ILE A 69  ? 0.4309 0.4226 0.3785 0.0404  -0.0589 -0.0353 63  ILE A CB    
429  C CG1   . ILE A 69  ? 0.4209 0.4249 0.3748 0.0358  -0.0644 -0.0353 63  ILE A CG1   
430  C CG2   . ILE A 69  ? 0.3988 0.3963 0.3594 0.0463  -0.0551 -0.0353 63  ILE A CG2   
431  C CD1   . ILE A 69  ? 0.4217 0.4403 0.3869 0.0383  -0.0699 -0.0324 63  ILE A CD1   
432  N N     . ALA A 70  ? 0.4982 0.4674 0.4387 0.0453  -0.0427 -0.0386 64  ALA A N     
433  C CA    . ALA A 70  ? 0.4980 0.4597 0.4372 0.0488  -0.0368 -0.0386 64  ALA A CA    
434  C C     . ALA A 70  ? 0.5783 0.5478 0.5298 0.0529  -0.0361 -0.0381 64  ALA A C     
435  O O     . ALA A 70  ? 0.5674 0.5480 0.5295 0.0533  -0.0380 -0.0390 64  ALA A O     
436  C CB    . ALA A 70  ? 0.4961 0.4535 0.4355 0.0489  -0.0318 -0.0400 64  ALA A CB    
437  N N     . HIS A 71  ? 0.5558 0.5191 0.5057 0.0555  -0.0328 -0.0369 65  HIS A N     
438  C CA    . HIS A 71  ? 0.5625 0.5304 0.5233 0.0588  -0.0314 -0.0368 65  HIS A CA    
439  C C     . HIS A 71  ? 0.5866 0.5590 0.5572 0.0597  -0.0273 -0.0396 65  HIS A C     
440  O O     . HIS A 71  ? 0.5999 0.5766 0.5802 0.0615  -0.0262 -0.0409 65  HIS A O     
441  C CB    . HIS A 71  ? 0.5962 0.5557 0.5520 0.0608  -0.0300 -0.0335 65  HIS A CB    
442  C CG    . HIS A 71  ? 0.6535 0.6034 0.6031 0.0608  -0.0238 -0.0333 65  HIS A CG    
443  N ND1   . HIS A 71  ? 0.6693 0.6197 0.6281 0.0621  -0.0186 -0.0345 65  HIS A ND1   
444  C CD2   . HIS A 71  ? 0.6994 0.6396 0.6349 0.0593  -0.0217 -0.0323 65  HIS A CD2   
445  C CE1   . HIS A 71  ? 0.6780 0.6202 0.6296 0.0618  -0.0134 -0.0337 65  HIS A CE1   
446  N NE2   . HIS A 71  ? 0.6979 0.6331 0.6349 0.0603  -0.0146 -0.0325 65  HIS A NE2   
447  N N     . ASN A 72  ? 0.4933 0.4648 0.4616 0.0584  -0.0251 -0.0406 66  ASN A N     
448  C CA    . ASN A 72  ? 0.4651 0.4430 0.4422 0.0590  -0.0225 -0.0425 66  ASN A CA    
449  C C     . ASN A 72  ? 0.5055 0.4850 0.4805 0.0578  -0.0227 -0.0422 66  ASN A C     
450  O O     . ASN A 72  ? 0.5210 0.4924 0.4866 0.0565  -0.0226 -0.0410 66  ASN A O     
451  C CB    . ASN A 72  ? 0.4303 0.4046 0.4109 0.0604  -0.0173 -0.0426 66  ASN A CB    
452  C CG    . ASN A 72  ? 0.6751 0.6402 0.6483 0.0608  -0.0129 -0.0409 66  ASN A CG    
453  O OD1   . ASN A 72  ? 0.5500 0.5149 0.5218 0.0608  -0.0119 -0.0407 66  ASN A OD1   
454  N ND2   . ASN A 72  ? 0.6239 0.5807 0.5927 0.0614  -0.0095 -0.0396 66  ASN A ND2   
455  N N     . LYS A 73  ? 0.4442 0.4337 0.4274 0.0579  -0.0227 -0.0432 67  LYS A N     
456  C CA    . LYS A 73  ? 0.4395 0.4317 0.4222 0.0573  -0.0229 -0.0417 67  LYS A CA    
457  C C     . LYS A 73  ? 0.5468 0.5307 0.5263 0.0589  -0.0188 -0.0397 67  LYS A C     
458  O O     . LYS A 73  ? 0.5604 0.5402 0.5358 0.0585  -0.0185 -0.0378 67  LYS A O     
459  C CB    . LYS A 73  ? 0.4443 0.4501 0.4355 0.0573  -0.0242 -0.0427 67  LYS A CB    
460  C CG    . LYS A 73  ? 0.4177 0.4317 0.4113 0.0557  -0.0274 -0.0449 67  LYS A CG    
461  C CD    . LYS A 73  ? 0.5604 0.5873 0.5597 0.0551  -0.0282 -0.0462 67  LYS A CD    
462  C CE    . LYS A 73  ? 0.6991 0.7326 0.7053 0.0554  -0.0276 -0.0508 67  LYS A CE    
463  N NZ    . LYS A 73  ? 0.8412 0.8874 0.8499 0.0539  -0.0289 -0.0532 67  LYS A NZ    
464  N N     . THR A 74  ? 0.5394 0.5205 0.5215 0.0609  -0.0149 -0.0400 68  THR A N     
465  C CA    . THR A 74  ? 0.5532 0.5269 0.5336 0.0631  -0.0098 -0.0382 68  THR A CA    
466  C C     . THR A 74  ? 0.6235 0.5828 0.5908 0.0622  -0.0083 -0.0381 68  THR A C     
467  O O     . THR A 74  ? 0.6256 0.5784 0.5895 0.0630  -0.0059 -0.0369 68  THR A O     
468  C CB    . THR A 74  ? 0.6089 0.5838 0.5957 0.0647  -0.0056 -0.0387 68  THR A CB    
469  O OG1   . THR A 74  ? 0.6657 0.6536 0.6648 0.0657  -0.0061 -0.0384 68  THR A OG1   
470  C CG2   . THR A 74  ? 0.5349 0.4982 0.5162 0.0666  0.0010  -0.0376 68  THR A CG2   
471  N N     . LEU A 75  ? 0.5906 0.5447 0.5504 0.0603  -0.0099 -0.0393 69  LEU A N     
472  C CA    . LEU A 75  ? 0.6052 0.5468 0.5509 0.0583  -0.0096 -0.0398 69  LEU A CA    
473  C C     . LEU A 75  ? 0.6530 0.5940 0.5945 0.0552  -0.0137 -0.0401 69  LEU A C     
474  O O     . LEU A 75  ? 0.6614 0.5913 0.5933 0.0536  -0.0117 -0.0409 69  LEU A O     
475  C CB    . LEU A 75  ? 0.6134 0.5535 0.5544 0.0575  -0.0116 -0.0398 69  LEU A CB    
476  C CG    . LEU A 75  ? 0.7179 0.6456 0.6428 0.0556  -0.0108 -0.0400 69  LEU A CG    
477  C CD1   . LEU A 75  ? 0.7405 0.6586 0.6600 0.0576  -0.0029 -0.0399 69  LEU A CD1   
478  C CD2   . LEU A 75  ? 0.7928 0.7231 0.7148 0.0546  -0.0160 -0.0386 69  LEU A CD2   
479  N N     . ALA A 76  ? 0.5998 0.5526 0.5489 0.0540  -0.0187 -0.0398 70  ALA A N     
480  C CA    . ALA A 76  ? 0.5941 0.5488 0.5416 0.0505  -0.0224 -0.0396 70  ALA A CA    
481  C C     . ALA A 76  ? 0.6717 0.6218 0.6197 0.0513  -0.0190 -0.0381 70  ALA A C     
482  O O     . ALA A 76  ? 0.7003 0.6412 0.6410 0.0483  -0.0187 -0.0383 70  ALA A O     
483  C CB    . ALA A 76  ? 0.5825 0.5521 0.5396 0.0500  -0.0267 -0.0395 70  ALA A CB    
484  N N     . GLY A 77  ? 0.5968 0.5526 0.5536 0.0553  -0.0162 -0.0364 71  GLY A N     
485  C CA    . GLY A 77  ? 0.5864 0.5396 0.5459 0.0576  -0.0129 -0.0335 71  GLY A CA    
486  C C     . GLY A 77  ? 0.6392 0.5752 0.5898 0.0582  -0.0077 -0.0342 71  GLY A C     
487  O O     . GLY A 77  ? 0.6509 0.5787 0.5977 0.0567  -0.0068 -0.0331 71  GLY A O     
488  N N     . GLN A 78  ? 0.5790 0.5084 0.5255 0.0598  -0.0039 -0.0363 72  GLN A N     
489  C CA    . GLN A 78  ? 0.5767 0.4893 0.5132 0.0605  0.0023  -0.0380 72  GLN A CA    
490  C C     . GLN A 78  ? 0.6161 0.5171 0.5389 0.0548  0.0001  -0.0409 72  GLN A C     
491  O O     . GLN A 78  ? 0.6311 0.5186 0.5479 0.0543  0.0042  -0.0419 72  GLN A O     
492  C CB    . GLN A 78  ? 0.5973 0.5066 0.5305 0.0624  0.0065  -0.0396 72  GLN A CB    
493  C CG    . GLN A 78  ? 0.9245 0.8446 0.8714 0.0670  0.0094  -0.0374 72  GLN A CG    
494  C CD    . GLN A 78  ? 1.3522 1.2683 1.2950 0.0677  0.0138  -0.0388 72  GLN A CD    
495  O OE1   . GLN A 78  ? 1.3421 1.2519 1.2730 0.0645  0.0122  -0.0407 72  GLN A OE1   
496  N NE2   . GLN A 78  ? 1.2402 1.1606 1.1931 0.0718  0.0194  -0.0373 72  GLN A NE2   
497  N N     . LEU A 79  ? 0.5465 0.4529 0.4653 0.0504  -0.0063 -0.0424 73  LEU A N     
498  C CA    . LEU A 79  ? 0.5474 0.4465 0.4544 0.0440  -0.0100 -0.0452 73  LEU A CA    
499  C C     . LEU A 79  ? 0.6179 0.5153 0.5272 0.0408  -0.0113 -0.0443 73  LEU A C     
500  O O     . LEU A 79  ? 0.6117 0.4956 0.5108 0.0365  -0.0100 -0.0471 73  LEU A O     
501  C CB    . LEU A 79  ? 0.5334 0.4429 0.4400 0.0411  -0.0173 -0.0453 73  LEU A CB    
502  C CG    . LEU A 79  ? 0.5697 0.4764 0.4685 0.0421  -0.0169 -0.0462 73  LEU A CG    
503  C CD1   . LEU A 79  ? 0.5412 0.4594 0.4427 0.0406  -0.0243 -0.0449 73  LEU A CD1   
504  C CD2   . LEU A 79  ? 0.6243 0.5148 0.5051 0.0388  -0.0142 -0.0497 73  LEU A CD2   
505  N N     . TYR A 80  ? 0.5980 0.5083 0.5199 0.0426  -0.0134 -0.0405 74  TYR A N     
506  C CA    . TYR A 80  ? 0.6136 0.5237 0.5388 0.0401  -0.0141 -0.0381 74  TYR A CA    
507  C C     . TYR A 80  ? 0.6756 0.5694 0.5976 0.0423  -0.0072 -0.0374 74  TYR A C     
508  O O     . TYR A 80  ? 0.6720 0.5537 0.5874 0.0376  -0.0063 -0.0387 74  TYR A O     
509  C CB    . TYR A 80  ? 0.6286 0.5561 0.5666 0.0426  -0.0166 -0.0339 74  TYR A CB    
510  C CG    . TYR A 80  ? 0.6838 0.6117 0.6252 0.0407  -0.0165 -0.0299 74  TYR A CG    
511  C CD1   . TYR A 80  ? 0.7259 0.6576 0.6664 0.0342  -0.0204 -0.0301 74  TYR A CD1   
512  C CD2   . TYR A 80  ? 0.7052 0.6311 0.6517 0.0456  -0.0126 -0.0252 74  TYR A CD2   
513  C CE1   . TYR A 80  ? 0.7751 0.7067 0.7184 0.0320  -0.0197 -0.0258 74  TYR A CE1   
514  C CE2   . TYR A 80  ? 0.7318 0.6575 0.6808 0.0441  -0.0124 -0.0203 74  TYR A CE2   
515  C CZ    . TYR A 80  ? 0.8509 0.7789 0.7978 0.0371  -0.0156 -0.0206 74  TYR A CZ    
516  O OH    . TYR A 80  ? 0.8355 0.7628 0.7845 0.0351  -0.0148 -0.0151 74  TYR A OH    
517  N N     . SER A 81  ? 0.6509 0.5438 0.5779 0.0494  -0.0020 -0.0355 75  SER A N     
518  C CA    . SER A 81  ? 0.6735 0.5518 0.5997 0.0536  0.0057  -0.0345 75  SER A CA    
519  C C     . SER A 81  ? 0.7313 0.5895 0.6425 0.0496  0.0094  -0.0405 75  SER A C     
520  O O     . SER A 81  ? 0.7556 0.5995 0.6625 0.0474  0.0124  -0.0410 75  SER A O     
521  C CB    . SER A 81  ? 0.7413 0.6249 0.6758 0.0615  0.0102  -0.0325 75  SER A CB    
522  O OG    . SER A 81  ? 0.9187 0.8224 0.8646 0.0634  0.0054  -0.0292 75  SER A OG    
523  N N     . GLU A 82  ? 0.6682 0.5252 0.5705 0.0481  0.0090  -0.0450 76  GLU A N     
524  C CA    . GLU A 82  ? 0.6918 0.5315 0.5771 0.0435  0.0117  -0.0515 76  GLU A CA    
525  C C     . GLU A 82  ? 0.7168 0.5500 0.5938 0.0344  0.0070  -0.0545 76  GLU A C     
526  O O     . GLU A 82  ? 0.7324 0.5469 0.5993 0.0313  0.0117  -0.0587 76  GLU A O     
527  C CB    . GLU A 82  ? 0.7199 0.5641 0.5976 0.0430  0.0101  -0.0541 76  GLU A CB    
528  C CG    . GLU A 82  ? 0.9689 0.8125 0.8499 0.0503  0.0175  -0.0532 76  GLU A CG    
529  C CD    . GLU A 82  ? 1.4310 1.2831 1.3097 0.0507  0.0155  -0.0531 76  GLU A CD    
530  O OE1   . GLU A 82  ? 1.4828 1.3506 1.3707 0.0507  0.0089  -0.0500 76  GLU A OE1   
531  O OE2   . GLU A 82  ? 1.4466 1.2891 1.3146 0.0515  0.0214  -0.0559 76  GLU A OE2   
532  N N     . PHE A 83  ? 0.6345 0.4829 0.5168 0.0301  -0.0016 -0.0525 77  PHE A N     
533  C CA    . PHE A 83  ? 0.6275 0.4729 0.5044 0.0209  -0.0066 -0.0549 77  PHE A CA    
534  C C     . PHE A 83  ? 0.6903 0.5282 0.5726 0.0195  -0.0037 -0.0522 77  PHE A C     
535  O O     . PHE A 83  ? 0.6964 0.5215 0.5707 0.0120  -0.0036 -0.0559 77  PHE A O     
536  C CB    . PHE A 83  ? 0.6249 0.4894 0.5063 0.0168  -0.0161 -0.0537 77  PHE A CB    
537  C CG    . PHE A 83  ? 0.6309 0.4985 0.5028 0.0149  -0.0203 -0.0570 77  PHE A CG    
538  C CD1   . PHE A 83  ? 0.6365 0.5188 0.5151 0.0198  -0.0232 -0.0541 77  PHE A CD1   
539  C CD2   . PHE A 83  ? 0.6595 0.5151 0.5152 0.0079  -0.0216 -0.0627 77  PHE A CD2   
540  C CE1   . PHE A 83  ? 0.6352 0.5200 0.5052 0.0184  -0.0272 -0.0557 77  PHE A CE1   
541  C CE2   . PHE A 83  ? 0.6915 0.5511 0.5376 0.0063  -0.0261 -0.0645 77  PHE A CE2   
542  C CZ    . PHE A 83  ? 0.6421 0.5161 0.4956 0.0119  -0.0289 -0.0604 77  PHE A CZ    
543  N N     . LYS A 84  ? 0.6420 0.4874 0.5376 0.0265  -0.0013 -0.0455 78  LYS A N     
544  C CA    . LYS A 84  ? 0.6531 0.4916 0.5542 0.0266  0.0018  -0.0410 78  LYS A CA    
545  C C     . LYS A 84  ? 0.7857 0.5993 0.6794 0.0280  0.0106  -0.0438 78  LYS A C     
546  O O     . LYS A 84  ? 0.8023 0.6027 0.6948 0.0242  0.0131  -0.0430 78  LYS A O     
547  C CB    . LYS A 84  ? 0.6498 0.5033 0.5652 0.0342  0.0018  -0.0330 78  LYS A CB    
548  C CG    . LYS A 84  ? 0.7927 0.6471 0.7143 0.0323  0.0015  -0.0267 78  LYS A CG    
549  C CD    . LYS A 84  ? 0.9694 0.8446 0.8971 0.0283  -0.0056 -0.0242 78  LYS A CD    
550  C CE    . LYS A 84  ? 1.1631 1.0354 1.0928 0.0230  -0.0055 -0.0196 78  LYS A CE    
551  N NZ    . LYS A 84  ? 1.1907 1.0816 1.1248 0.0173  -0.0116 -0.0187 78  LYS A NZ    
552  N N     . GLU A 85  ? 0.7751 0.5813 0.6636 0.0333  0.0159  -0.0473 79  GLU A N     
553  C CA    . GLU A 85  ? 0.8045 0.5871 0.6856 0.0356  0.0254  -0.0511 79  GLU A CA    
554  C C     . GLU A 85  ? 0.8778 0.6427 0.7416 0.0252  0.0254  -0.0601 79  GLU A C     
555  O O     . GLU A 85  ? 0.9152 0.6586 0.7739 0.0234  0.0319  -0.0629 79  GLU A O     
556  C CB    . GLU A 85  ? 0.8255 0.6083 0.7068 0.0439  0.0313  -0.0522 79  GLU A CB    
557  C CG    . GLU A 85  ? 1.1151 0.8767 0.9948 0.0497  0.0429  -0.0537 79  GLU A CG    
558  C CD    . GLU A 85  ? 1.6788 1.4417 1.5601 0.0580  0.0498  -0.0546 79  GLU A CD    
559  O OE1   . GLU A 85  ? 1.7875 1.5662 1.6845 0.0660  0.0497  -0.0476 79  GLU A OE1   
560  O OE2   . GLU A 85  ? 1.6730 1.4215 1.5398 0.0561  0.0554  -0.0624 79  GLU A OE2   
561  N N     . PHE A 86  ? 0.8059 0.5798 0.6611 0.0182  0.0179  -0.0646 80  PHE A N     
562  C CA    . PHE A 86  ? 0.8162 0.5774 0.6546 0.0074  0.0158  -0.0733 80  PHE A CA    
563  C C     . PHE A 86  ? 0.8440 0.6055 0.6844 -0.0025 0.0104  -0.0732 80  PHE A C     
564  O O     . PHE A 86  ? 0.8404 0.5850 0.6689 -0.0113 0.0115  -0.0802 80  PHE A O     
565  C CB    . PHE A 86  ? 0.8392 0.6119 0.6681 0.0045  0.0093  -0.0769 80  PHE A CB    
566  C CG    . PHE A 86  ? 0.8706 0.6374 0.6907 0.0107  0.0155  -0.0797 80  PHE A CG    
567  C CD1   . PHE A 86  ? 0.9305 0.6741 0.7381 0.0112  0.0254  -0.0862 80  PHE A CD1   
568  C CD2   . PHE A 86  ? 0.8780 0.6617 0.7016 0.0153  0.0120  -0.0764 80  PHE A CD2   
569  C CE1   . PHE A 86  ? 0.9408 0.6800 0.7403 0.0167  0.0320  -0.0887 80  PHE A CE1   
570  C CE2   . PHE A 86  ? 0.9103 0.6888 0.7259 0.0202  0.0182  -0.0785 80  PHE A CE2   
571  C CZ    . PHE A 86  ? 0.9048 0.6618 0.7082 0.0208  0.0282  -0.0846 80  PHE A CZ    
572  N N     . PHE A 87  ? 0.7808 0.5619 0.6359 -0.0018 0.0045  -0.0656 81  PHE A N     
573  C CA    . PHE A 87  ? 0.7704 0.5556 0.6294 -0.0112 -0.0007 -0.0645 81  PHE A CA    
574  C C     . PHE A 87  ? 0.8049 0.5931 0.6785 -0.0066 0.0023  -0.0554 81  PHE A C     
575  O O     . PHE A 87  ? 0.7507 0.5598 0.6357 -0.0051 -0.0028 -0.0492 81  PHE A O     
576  C CB    . PHE A 87  ? 0.7684 0.5763 0.6292 -0.0166 -0.0115 -0.0650 81  PHE A CB    
577  C CG    . PHE A 87  ? 0.7792 0.5860 0.6255 -0.0204 -0.0153 -0.0722 81  PHE A CG    
578  C CD1   . PHE A 87  ? 0.7945 0.6128 0.6407 -0.0133 -0.0171 -0.0709 81  PHE A CD1   
579  C CD2   . PHE A 87  ? 0.8205 0.6142 0.6527 -0.0313 -0.0170 -0.0802 81  PHE A CD2   
580  C CE1   . PHE A 87  ? 0.8098 0.6269 0.6416 -0.0166 -0.0205 -0.0763 81  PHE A CE1   
581  C CE2   . PHE A 87  ? 0.8600 0.6535 0.6772 -0.0348 -0.0209 -0.0863 81  PHE A CE2   
582  C CZ    . PHE A 87  ? 0.8166 0.6221 0.6336 -0.0272 -0.0228 -0.0838 81  PHE A CZ    
583  N N     . PRO A 88  ? 0.8090 0.5760 0.6820 -0.0034 0.0111  -0.0542 82  PRO A N     
584  C CA    . PRO A 88  ? 0.8040 0.5736 0.6900 0.0022  0.0140  -0.0440 82  PRO A CA    
585  C C     . PRO A 88  ? 0.8831 0.6552 0.7735 -0.0069 0.0108  -0.0405 82  PRO A C     
586  O O     . PRO A 88  ? 0.8792 0.6630 0.7805 -0.0036 0.0101  -0.0314 82  PRO A O     
587  C CB    . PRO A 88  ? 0.8391 0.5841 0.7229 0.0088  0.0246  -0.0439 82  PRO A CB    
588  C CG    . PRO A 88  ? 0.9079 0.6390 0.7773 0.0075  0.0278  -0.0547 82  PRO A CG    
589  C CD    . PRO A 88  ? 0.8542 0.5938 0.7147 -0.0040 0.0192  -0.0615 82  PRO A CD    
590  N N     . ASN A 89  ? 0.8542 0.6164 0.7358 -0.0190 0.0089  -0.0479 83  ASN A N     
591  C CA    . ASN A 89  ? 0.8505 0.6136 0.7359 -0.0295 0.0065  -0.0458 83  ASN A CA    
592  C C     . ASN A 89  ? 0.8647 0.6524 0.7534 -0.0375 -0.0036 -0.0474 83  ASN A C     
593  O O     . ASN A 89  ? 0.8809 0.6701 0.7719 -0.0484 -0.0061 -0.0477 83  ASN A O     
594  C CB    . ASN A 89  ? 0.8873 0.6211 0.7628 -0.0382 0.0120  -0.0524 83  ASN A CB    
595  C CG    . ASN A 89  ? 1.0624 0.7722 0.9376 -0.0293 0.0228  -0.0494 83  ASN A CG    
596  O OD1   . ASN A 89  ? 0.9345 0.6509 0.8192 -0.0176 0.0255  -0.0401 83  ASN A OD1   
597  N ND2   . ASN A 89  ? 0.9704 0.6522 0.8349 -0.0345 0.0290  -0.0574 83  ASN A ND2   
598  N N     . ASN A 90  ? 0.7575 0.5647 0.6477 -0.0318 -0.0088 -0.0480 84  ASN A N     
599  C CA    . ASN A 90  ? 0.7247 0.5561 0.6195 -0.0367 -0.0178 -0.0489 84  ASN A CA    
600  C C     . ASN A 90  ? 0.7776 0.6317 0.6843 -0.0276 -0.0198 -0.0416 84  ASN A C     
601  O O     . ASN A 90  ? 0.8051 0.6563 0.7149 -0.0180 -0.0149 -0.0366 84  ASN A O     
602  C CB    . ASN A 90  ? 0.6682 0.5000 0.5522 -0.0396 -0.0227 -0.0572 84  ASN A CB    
603  C CG    . ASN A 90  ? 0.9771 0.7867 0.8471 -0.0493 -0.0210 -0.0657 84  ASN A CG    
604  O OD1   . ASN A 90  ? 0.9551 0.7433 0.8144 -0.0459 -0.0144 -0.0699 84  ASN A OD1   
605  N ND2   . ASN A 90  ? 0.8404 0.6548 0.7108 -0.0618 -0.0266 -0.0688 84  ASN A ND2   
606  N N     . ALA A 91  ? 0.6930 0.5698 0.6068 -0.0306 -0.0267 -0.0411 85  ALA A N     
607  C CA    . ALA A 91  ? 0.6618 0.5597 0.5862 -0.0229 -0.0282 -0.0356 85  ALA A CA    
608  C C     . ALA A 91  ? 0.6952 0.6001 0.6177 -0.0146 -0.0303 -0.0379 85  ALA A C     
609  O O     . ALA A 91  ? 0.6892 0.6076 0.6131 -0.0161 -0.0362 -0.0406 85  ALA A O     
610  C CB    . ALA A 91  ? 0.6640 0.5824 0.5980 -0.0293 -0.0332 -0.0340 85  ALA A CB    
611  N N     . VAL A 92  ? 0.6238 0.5200 0.5443 -0.0057 -0.0252 -0.0362 86  VAL A N     
612  C CA    . VAL A 92  ? 0.5937 0.4962 0.5136 0.0020  -0.0261 -0.0377 86  VAL A CA    
613  C C     . VAL A 92  ? 0.6270 0.5475 0.5585 0.0084  -0.0266 -0.0324 86  VAL A C     
614  O O     . VAL A 92  ? 0.6471 0.5654 0.5823 0.0127  -0.0226 -0.0274 86  VAL A O     
615  C CB    . VAL A 92  ? 0.6395 0.5233 0.5509 0.0072  -0.0202 -0.0401 86  VAL A CB    
616  C CG1   . VAL A 92  ? 0.6173 0.5092 0.5306 0.0153  -0.0202 -0.0401 86  VAL A CG1   
617  C CG2   . VAL A 92  ? 0.6562 0.5231 0.5541 0.0001  -0.0201 -0.0469 86  VAL A CG2   
618  N N     . GLU A 93  ? 0.5507 0.4889 0.4877 0.0087  -0.0315 -0.0332 87  GLU A N     
619  C CA    . GLU A 93  ? 0.5245 0.4806 0.4715 0.0132  -0.0322 -0.0298 87  GLU A CA    
620  C C     . GLU A 93  ? 0.5371 0.5011 0.4867 0.0200  -0.0333 -0.0314 87  GLU A C     
621  O O     . GLU A 93  ? 0.5164 0.4762 0.4610 0.0203  -0.0349 -0.0350 87  GLU A O     
622  C CB    . GLU A 93  ? 0.5427 0.5138 0.4965 0.0074  -0.0359 -0.0291 87  GLU A CB    
623  C CG    . GLU A 93  ? 0.6900 0.6547 0.6426 -0.0008 -0.0349 -0.0274 87  GLU A CG    
624  C CD    . GLU A 93  ? 1.1161 1.0763 1.0699 0.0005  -0.0300 -0.0213 87  GLU A CD    
625  O OE1   . GLU A 93  ? 1.1224 1.0915 1.0803 0.0070  -0.0286 -0.0179 87  GLU A OE1   
626  O OE2   . GLU A 93  ? 1.0820 1.0297 1.0327 -0.0053 -0.0278 -0.0198 87  GLU A OE2   
627  N N     . TYR A 94  ? 0.4953 0.4711 0.4523 0.0247  -0.0323 -0.0288 88  TYR A N     
628  C CA    . TYR A 94  ? 0.4814 0.4649 0.4423 0.0307  -0.0326 -0.0303 88  TYR A CA    
629  C C     . TYR A 94  ? 0.5305 0.5324 0.4997 0.0308  -0.0349 -0.0306 88  TYR A C     
630  O O     . TYR A 94  ? 0.5217 0.5319 0.4946 0.0302  -0.0340 -0.0278 88  TYR A O     
631  C CB    . TYR A 94  ? 0.4873 0.4670 0.4490 0.0362  -0.0287 -0.0275 88  TYR A CB    
632  C CG    . TYR A 94  ? 0.4797 0.4643 0.4450 0.0416  -0.0283 -0.0293 88  TYR A CG    
633  C CD1   . TYR A 94  ? 0.5048 0.4795 0.4657 0.0436  -0.0268 -0.0319 88  TYR A CD1   
634  C CD2   . TYR A 94  ? 0.4681 0.4667 0.4406 0.0443  -0.0288 -0.0285 88  TYR A CD2   
635  C CE1   . TYR A 94  ? 0.4906 0.4695 0.4556 0.0479  -0.0258 -0.0332 88  TYR A CE1   
636  C CE2   . TYR A 94  ? 0.4736 0.4762 0.4500 0.0482  -0.0282 -0.0307 88  TYR A CE2   
637  C CZ    . TYR A 94  ? 0.5818 0.5745 0.5551 0.0500  -0.0266 -0.0327 88  TYR A CZ    
638  O OH    . TYR A 94  ? 0.6090 0.6055 0.5870 0.0533  -0.0255 -0.0344 88  TYR A OH    
639  N N     . PHE A 95  ? 0.4874 0.4951 0.4593 0.0319  -0.0375 -0.0339 89  PHE A N     
640  C CA    . PHE A 95  ? 0.4766 0.5003 0.4570 0.0327  -0.0391 -0.0352 89  PHE A CA    
641  C C     . PHE A 95  ? 0.5087 0.5345 0.4922 0.0379  -0.0388 -0.0379 89  PHE A C     
642  O O     . PHE A 95  ? 0.4955 0.5183 0.4783 0.0389  -0.0408 -0.0394 89  PHE A O     
643  C CB    . PHE A 95  ? 0.5074 0.5366 0.4904 0.0283  -0.0426 -0.0359 89  PHE A CB    
644  C CG    . PHE A 95  ? 0.5158 0.5621 0.5090 0.0288  -0.0432 -0.0368 89  PHE A CG    
645  C CD1   . PHE A 95  ? 0.5437 0.5994 0.5408 0.0250  -0.0419 -0.0351 89  PHE A CD1   
646  C CD2   . PHE A 95  ? 0.5337 0.5860 0.5328 0.0331  -0.0442 -0.0393 89  PHE A CD2   
647  C CE1   . PHE A 95  ? 0.5451 0.6168 0.5517 0.0257  -0.0413 -0.0364 89  PHE A CE1   
648  C CE2   . PHE A 95  ? 0.5634 0.6306 0.5724 0.0343  -0.0436 -0.0407 89  PHE A CE2   
649  C CZ    . PHE A 95  ? 0.5343 0.6115 0.5469 0.0306  -0.0420 -0.0395 89  PHE A CZ    
650  N N     . VAL A 96  ? 0.4808 0.5125 0.4678 0.0409  -0.0367 -0.0383 90  VAL A N     
651  C CA    . VAL A 96  ? 0.4745 0.5082 0.4653 0.0451  -0.0357 -0.0413 90  VAL A CA    
652  C C     . VAL A 96  ? 0.5632 0.6111 0.5605 0.0457  -0.0348 -0.0436 90  VAL A C     
653  O O     . VAL A 96  ? 0.5924 0.6476 0.5899 0.0432  -0.0346 -0.0420 90  VAL A O     
654  C CB    . VAL A 96  ? 0.5031 0.5271 0.4899 0.0473  -0.0336 -0.0400 90  VAL A CB    
655  C CG1   . VAL A 96  ? 0.4930 0.5245 0.4840 0.0493  -0.0320 -0.0403 90  VAL A CG1   
656  C CG2   . VAL A 96  ? 0.4989 0.5131 0.4830 0.0491  -0.0332 -0.0411 90  VAL A CG2   
657  N N     . SER A 97  ? 0.5176 0.5689 0.5195 0.0485  -0.0338 -0.0474 91  SER A N     
658  C CA    . SER A 97  ? 0.5292 0.5929 0.5355 0.0485  -0.0324 -0.0509 91  SER A CA    
659  C C     . SER A 97  ? 0.6126 0.6817 0.6157 0.0472  -0.0319 -0.0490 91  SER A C     
660  O O     . SER A 97  ? 0.6309 0.6948 0.6319 0.0484  -0.0320 -0.0470 91  SER A O     
661  C CB    . SER A 97  ? 0.5724 0.6363 0.5838 0.0510  -0.0311 -0.0562 91  SER A CB    
662  O OG    . SER A 97  ? 0.6388 0.7134 0.6527 0.0504  -0.0294 -0.0606 91  SER A OG    
663  N N     . TYR A 98  ? 0.5485 0.6288 0.5514 0.0452  -0.0312 -0.0493 92  TYR A N     
664  C CA    . TYR A 98  ? 0.5313 0.6182 0.5303 0.0442  -0.0313 -0.0467 92  TYR A CA    
665  C C     . TYR A 98  ? 0.5727 0.6670 0.5730 0.0449  -0.0311 -0.0515 92  TYR A C     
666  O O     . TYR A 98  ? 0.5730 0.6739 0.5699 0.0441  -0.0321 -0.0491 92  TYR A O     
667  C CB    . TYR A 98  ? 0.5353 0.6301 0.5311 0.0411  -0.0305 -0.0431 92  TYR A CB    
668  C CG    . TYR A 98  ? 0.5317 0.6373 0.5304 0.0398  -0.0283 -0.0478 92  TYR A CG    
669  C CD1   . TYR A 98  ? 0.5611 0.6738 0.5621 0.0409  -0.0269 -0.0550 92  TYR A CD1   
670  C CD2   . TYR A 98  ? 0.5373 0.6468 0.5365 0.0370  -0.0271 -0.0450 92  TYR A CD2   
671  C CE1   . TYR A 98  ? 0.5811 0.7035 0.5850 0.0402  -0.0237 -0.0598 92  TYR A CE1   
672  C CE2   . TYR A 98  ? 0.5489 0.6697 0.5519 0.0361  -0.0242 -0.0490 92  TYR A CE2   
673  C CZ    . TYR A 98  ? 0.6376 0.7646 0.6428 0.0381  -0.0222 -0.0565 92  TYR A CZ    
674  O OH    . TYR A 98  ? 0.6446 0.7823 0.6537 0.0378  -0.0182 -0.0611 92  TYR A OH    
675  N N     . TYR A 99  ? 0.5305 0.6233 0.5356 0.0461  -0.0301 -0.0581 93  TYR A N     
676  C CA    . TYR A 99  ? 0.5371 0.6359 0.5438 0.0457  -0.0299 -0.0638 93  TYR A CA    
677  C C     . TYR A 99  ? 0.6753 0.7689 0.6835 0.0468  -0.0313 -0.0619 93  TYR A C     
678  O O     . TYR A 99  ? 0.6812 0.7637 0.6919 0.0487  -0.0308 -0.0608 93  TYR A O     
679  C CB    . TYR A 99  ? 0.5351 0.6330 0.5471 0.0465  -0.0274 -0.0718 93  TYR A CB    
680  C CG    . TYR A 99  ? 0.5493 0.6550 0.5615 0.0458  -0.0250 -0.0750 93  TYR A CG    
681  C CD1   . TYR A 99  ? 0.5579 0.6601 0.5752 0.0479  -0.0236 -0.0750 93  TYR A CD1   
682  C CD2   . TYR A 99  ? 0.5655 0.6834 0.5732 0.0432  -0.0239 -0.0782 93  TYR A CD2   
683  C CE1   . TYR A 99  ? 0.5337 0.6445 0.5533 0.0477  -0.0206 -0.0780 93  TYR A CE1   
684  C CE2   . TYR A 99  ? 0.5806 0.7060 0.5886 0.0427  -0.0204 -0.0817 93  TYR A CE2   
685  C CZ    . TYR A 99  ? 0.6809 0.8029 0.6958 0.0452  -0.0185 -0.0816 93  TYR A CZ    
686  O OH    . TYR A 99  ? 0.7786 0.9095 0.7957 0.0450  -0.0145 -0.0848 93  TYR A OH    
687  N N     . ASP A 100 ? 0.6961 0.7986 0.7028 0.0455  -0.0331 -0.0613 94  ASP A N     
688  C CA    . ASP A 100 ? 0.7246 0.8253 0.7352 0.0464  -0.0343 -0.0598 94  ASP A CA    
689  C C     . ASP A 100 ? 0.8075 0.9071 0.8239 0.0453  -0.0330 -0.0679 94  ASP A C     
690  O O     . ASP A 100 ? 0.8077 0.9012 0.8290 0.0462  -0.0324 -0.0674 94  ASP A O     
691  C CB    . ASP A 100 ? 0.7587 0.8706 0.7674 0.0459  -0.0375 -0.0549 94  ASP A CB    
692  C CG    . ASP A 100 ? 0.9421 1.0483 0.9482 0.0486  -0.0378 -0.0452 94  ASP A CG    
693  O OD1   . ASP A 100 ? 0.9402 1.0328 0.9470 0.0506  -0.0357 -0.0432 94  ASP A OD1   
694  O OD2   . ASP A 100 ? 1.0587 1.1732 1.0623 0.0488  -0.0401 -0.0395 94  ASP A OD2   
695  N N     . TYR A 101 ? 0.7730 0.8777 0.7890 0.0431  -0.0318 -0.0755 95  TYR A N     
696  C CA    . TYR A 101 ? 0.7748 0.8767 0.7959 0.0416  -0.0297 -0.0841 95  TYR A CA    
697  C C     . TYR A 101 ? 0.7619 0.8629 0.7823 0.0420  -0.0267 -0.0896 95  TYR A C     
698  O O     . TYR A 101 ? 0.7611 0.8714 0.7762 0.0408  -0.0268 -0.0900 95  TYR A O     
699  C CB    . TYR A 101 ? 0.8285 0.9418 0.8504 0.0374  -0.0318 -0.0891 95  TYR A CB    
700  C CG    . TYR A 101 ? 0.9172 1.0282 0.9433 0.0344  -0.0291 -0.0999 95  TYR A CG    
701  C CD1   . TYR A 101 ? 0.9493 1.0474 0.9827 0.0355  -0.0262 -0.1018 95  TYR A CD1   
702  C CD2   . TYR A 101 ? 0.9508 1.0718 0.9729 0.0302  -0.0291 -0.1084 95  TYR A CD2   
703  C CE1   . TYR A 101 ? 0.9678 1.0617 1.0056 0.0327  -0.0231 -0.1114 95  TYR A CE1   
704  C CE2   . TYR A 101 ? 0.9804 1.0974 1.0062 0.0272  -0.0260 -0.1192 95  TYR A CE2   
705  C CZ    . TYR A 101 ? 1.1186 1.2215 1.1529 0.0285  -0.0230 -0.1206 95  TYR A CZ    
706  O OH    . TYR A 101 ? 1.2107 1.3079 1.2492 0.0253  -0.0194 -0.1310 95  TYR A OH    
707  N N     . TYR A 102 ? 0.6583 0.7484 0.6842 0.0440  -0.0236 -0.0929 96  TYR A N     
708  C CA    . TYR A 102 ? 0.6304 0.7196 0.6583 0.0455  -0.0202 -0.0980 96  TYR A CA    
709  C C     . TYR A 102 ? 0.6601 0.7410 0.6947 0.0457  -0.0166 -0.1057 96  TYR A C     
710  O O     . TYR A 102 ? 0.6813 0.7503 0.7205 0.0483  -0.0157 -0.1030 96  TYR A O     
711  C CB    . TYR A 102 ? 0.6260 0.7109 0.6544 0.0492  -0.0203 -0.0917 96  TYR A CB    
712  N N     . GLN A 103 ? 0.5688 0.6550 0.6030 0.0427  -0.0143 -0.1152 97  GLN A N     
713  C CA    . GLN A 103 ? 0.5529 0.6302 0.5934 0.0426  -0.0099 -0.1236 97  GLN A CA    
714  C C     . GLN A 103 ? 0.5710 0.6481 0.6138 0.0463  -0.0055 -0.1271 97  GLN A C     
715  O O     . GLN A 103 ? 0.5721 0.6596 0.6101 0.0444  -0.0040 -0.1323 97  GLN A O     
716  C CB    . GLN A 103 ? 0.5747 0.6577 0.6133 0.0361  -0.0098 -0.1333 97  GLN A CB    
717  C CG    . GLN A 103 ? 0.5342 0.6067 0.5790 0.0348  -0.0044 -0.1439 97  GLN A CG    
718  C CD    . GLN A 103 ? 0.8119 0.8679 0.8653 0.0382  -0.0023 -0.1400 97  GLN A CD    
719  O OE1   . GLN A 103 ? 0.5995 0.6456 0.6581 0.0437  0.0016  -0.1391 97  GLN A OE1   
720  N NE2   . GLN A 103 ? 0.8566 0.9101 0.9122 0.0350  -0.0046 -0.1372 97  GLN A NE2   
721  N N     . PRO A 104 ? 0.4946 0.5614 0.5446 0.0519  -0.0035 -0.1236 98  PRO A N     
722  C CA    . PRO A 104 ? 0.4889 0.5571 0.5435 0.0562  0.0008  -0.1263 98  PRO A CA    
723  C C     . PRO A 104 ? 0.5679 0.6330 0.6259 0.0555  0.0072  -0.1386 98  PRO A C     
724  O O     . PRO A 104 ? 0.5802 0.6374 0.6392 0.0522  0.0084  -0.1443 98  PRO A O     
725  C CB    . PRO A 104 ? 0.5066 0.5645 0.5685 0.0622  0.0002  -0.1184 98  PRO A CB    
726  C CG    . PRO A 104 ? 0.5697 0.6162 0.6318 0.0608  -0.0013 -0.1162 98  PRO A CG    
727  C CD    . PRO A 104 ? 0.5137 0.5676 0.5681 0.0546  -0.0047 -0.1169 98  PRO A CD    
728  N N     . GLU A 105 ? 0.5501 0.6211 0.6101 0.0582  0.0118  -0.1430 99  GLU A N     
729  C CA    . GLU A 105 ? 0.5685 0.6355 0.6318 0.0583  0.0193  -0.1556 99  GLU A CA    
730  C C     . GLU A 105 ? 0.6442 0.6943 0.7194 0.0640  0.0225  -0.1547 99  GLU A C     
731  O O     . GLU A 105 ? 0.6381 0.6855 0.7201 0.0702  0.0209  -0.1453 99  GLU A O     
732  C CB    . GLU A 105 ? 0.5877 0.6661 0.6511 0.0608  0.0240  -0.1591 99  GLU A CB    
733  C CG    . GLU A 105 ? 0.7193 0.7932 0.7870 0.0624  0.0333  -0.1720 99  GLU A CG    
734  C CD    . GLU A 105 ? 1.0980 1.1846 1.1661 0.0651  0.0387  -0.1748 99  GLU A CD    
735  O OE1   . GLU A 105 ? 1.0994 1.1999 1.1558 0.0598  0.0375  -0.1764 99  GLU A OE1   
736  O OE2   . GLU A 105 ? 1.0935 1.1769 1.1742 0.0727  0.0441  -0.1745 99  GLU A OE2   
737  N N     . ALA A 106 ? 0.6229 0.6615 0.6999 0.0611  0.0264  -0.1638 100 ALA A N     
738  C CA    . ALA A 106 ? 0.6297 0.6500 0.7174 0.0657  0.0300  -0.1629 100 ALA A CA    
739  C C     . ALA A 106 ? 0.7326 0.7419 0.8231 0.0632  0.0377  -0.1769 100 ALA A C     
740  O O     . ALA A 106 ? 0.7336 0.7493 0.8159 0.0558  0.0387  -0.1878 100 ALA A O     
741  C CB    . ALA A 106 ? 0.6269 0.6398 0.7136 0.0636  0.0245  -0.1542 100 ALA A CB    
742  N N     . TYR A 107 ? 0.7218 0.7140 0.8237 0.0693  0.0430  -0.1765 101 TYR A N     
743  C CA    . TYR A 107 ? 0.7459 0.7226 0.8528 0.0678  0.0512  -0.1889 101 TYR A CA    
744  C C     . TYR A 107 ? 0.8378 0.7955 0.9514 0.0682  0.0514  -0.1835 101 TYR A C     
745  O O     . TYR A 107 ? 0.8315 0.7840 0.9511 0.0752  0.0490  -0.1705 101 TYR A O     
746  C CB    . TYR A 107 ? 0.7668 0.7399 0.8827 0.0762  0.0598  -0.1940 101 TYR A CB    
747  C CG    . TYR A 107 ? 0.8087 0.7637 0.9295 0.0747  0.0695  -0.2080 101 TYR A CG    
748  C CD1   . TYR A 107 ? 0.8439 0.8021 0.9555 0.0661  0.0733  -0.2243 101 TYR A CD1   
749  C CD2   . TYR A 107 ? 0.8274 0.7616 0.9614 0.0818  0.0749  -0.2049 101 TYR A CD2   
750  C CE1   . TYR A 107 ? 0.8773 0.8177 0.9928 0.0642  0.0826  -0.2385 101 TYR A CE1   
751  C CE2   . TYR A 107 ? 0.8597 0.7753 0.9987 0.0806  0.0846  -0.2180 101 TYR A CE2   
752  C CZ    . TYR A 107 ? 0.9754 0.8937 1.1051 0.0714  0.0885  -0.2354 101 TYR A CZ    
753  O OH    . TYR A 107 ? 1.0389 0.9372 1.1731 0.0694  0.0985  -0.2494 101 TYR A OH    
754  N N     . VAL A 108 ? 0.8266 0.7747 0.9386 0.0598  0.0540  -0.1935 102 VAL A N     
755  C CA    . VAL A 108 ? 0.8385 0.7681 0.9566 0.0581  0.0553  -0.1901 102 VAL A CA    
756  C C     . VAL A 108 ? 0.9416 0.8508 1.0687 0.0601  0.0657  -0.2006 102 VAL A C     
757  O O     . VAL A 108 ? 0.9410 0.8461 1.0651 0.0515  0.0697  -0.2154 102 VAL A O     
758  C CB    . VAL A 108 ? 0.8809 0.8161 0.9919 0.0465  0.0499  -0.1922 102 VAL A CB    
759  C CG1   . VAL A 108 ? 0.8938 0.8095 1.0118 0.0431  0.0529  -0.1910 102 VAL A CG1   
760  C CG2   . VAL A 108 ? 0.8551 0.8071 0.9591 0.0467  0.0406  -0.1801 102 VAL A CG2   
761  N N     . PRO A 109 ? 0.9314 0.8285 1.0695 0.0716  0.0704  -0.1935 103 PRO A N     
762  C CA    . PRO A 109 ? 0.9519 0.8279 1.1001 0.0751  0.0813  -0.2028 103 PRO A CA    
763  C C     . PRO A 109 ? 1.0108 0.8664 1.1615 0.0673  0.0848  -0.2074 103 PRO A C     
764  O O     . PRO A 109 ? 1.0073 0.8489 1.1609 0.0633  0.0932  -0.2219 103 PRO A O     
765  C CB    . PRO A 109 ? 0.9707 0.8409 1.1306 0.0896  0.0831  -0.1898 103 PRO A CB    
766  C CG    . PRO A 109 ? 1.0048 0.8858 1.1606 0.0912  0.0729  -0.1730 103 PRO A CG    
767  C CD    . PRO A 109 ? 0.9347 0.8366 1.0770 0.0819  0.0657  -0.1765 103 PRO A CD    
768  N N     . GLN A 110 ? 0.9707 0.8256 1.1196 0.0639  0.0785  -0.1957 104 GLN A N     
769  C CA    . GLN A 110 ? 0.9840 0.8230 1.1351 0.0555  0.0805  -0.1972 104 GLN A CA    
770  C C     . GLN A 110 ? 1.0847 0.9251 1.2311 0.0419  0.0829  -0.2163 104 GLN A C     
771  O O     . GLN A 110 ? 1.1179 0.9398 1.2697 0.0354  0.0886  -0.2229 104 GLN A O     
772  C CB    . GLN A 110 ? 0.9718 0.8191 1.1184 0.0530  0.0721  -0.1829 104 GLN A CB    
773  N N     . THR A 111 ? 1.0208 0.8829 1.1571 0.0375  0.0787  -0.2249 105 THR A N     
774  C CA    . THR A 111 ? 1.0090 0.8770 1.1381 0.0244  0.0791  -0.2424 105 THR A CA    
775  C C     . THR A 111 ? 1.0292 0.9085 1.1508 0.0250  0.0817  -0.2555 105 THR A C     
776  O O     . THR A 111 ? 1.0313 0.9182 1.1444 0.0140  0.0810  -0.2698 105 THR A O     
777  C CB    . THR A 111 ? 0.9986 0.8853 1.1206 0.0149  0.0690  -0.2383 105 THR A CB    
778  N N     . ASP A 112 ? 0.9529 0.8341 1.0774 0.0374  0.0849  -0.2506 106 ASP A N     
779  C CA    . ASP A 112 ? 0.9331 0.8258 1.0513 0.0397  0.0885  -0.2610 106 ASP A CA    
780  C C     . ASP A 112 ? 0.9180 0.8385 1.0208 0.0322  0.0794  -0.2623 106 ASP A C     
781  O O     . ASP A 112 ? 0.9041 0.8347 0.9973 0.0279  0.0817  -0.2751 106 ASP A O     
782  C CB    . ASP A 112 ? 0.9913 0.8661 1.1117 0.0369  0.1003  -0.2803 106 ASP A CB    
783  C CG    . ASP A 112 ? 1.2506 1.1344 1.3650 0.0397  0.1065  -0.2924 106 ASP A CG    
784  O OD1   . ASP A 112 ? 1.2937 1.1817 1.3967 0.0292  0.1085  -0.3095 106 ASP A OD1   
785  O OD2   . ASP A 112 ? 1.3516 1.2383 1.4730 0.0522  0.1099  -0.2852 106 ASP A OD2   
786  N N     . THR A 113 ? 0.8417 0.7741 0.9423 0.0313  0.0695  -0.2482 107 THR A N     
787  C CA    . THR A 113 ? 0.8134 0.7703 0.9014 0.0252  0.0603  -0.2461 107 THR A CA    
788  C C     . THR A 113 ? 0.7979 0.7704 0.8834 0.0339  0.0562  -0.2339 107 THR A C     
789  O O     . THR A 113 ? 0.7707 0.7388 0.8637 0.0424  0.0546  -0.2200 107 THR A O     
790  C CB    . THR A 113 ? 0.9473 0.9067 1.0349 0.0173  0.0527  -0.2403 107 THR A CB    
791  O OG1   . THR A 113 ? 0.9571 0.9022 1.0483 0.0085  0.0569  -0.2523 107 THR A OG1   
792  C CG2   . THR A 113 ? 0.9299 0.9138 1.0059 0.0110  0.0432  -0.2381 107 THR A CG2   
793  N N     . PHE A 114 ? 0.7259 0.7170 0.7998 0.0308  0.0543  -0.2391 108 PHE A N     
794  C CA    . PHE A 114 ? 0.6974 0.7050 0.7674 0.0366  0.0505  -0.2290 108 PHE A CA    
795  C C     . PHE A 114 ? 0.7713 0.7967 0.8313 0.0307  0.0400  -0.2213 108 PHE A C     
796  O O     . PHE A 114 ? 0.7861 0.8216 0.8360 0.0215  0.0370  -0.2292 108 PHE A O     
797  C CB    . PHE A 114 ? 0.7147 0.7301 0.7797 0.0387  0.0572  -0.2387 108 PHE A CB    
798  C CG    . PHE A 114 ? 0.7005 0.7346 0.7608 0.0428  0.0534  -0.2288 108 PHE A CG    
799  C CD1   . PHE A 114 ? 0.6985 0.7319 0.7689 0.0524  0.0524  -0.2154 108 PHE A CD1   
800  C CD2   . PHE A 114 ? 0.7154 0.7680 0.7610 0.0366  0.0504  -0.2324 108 PHE A CD2   
801  C CE1   . PHE A 114 ? 0.6820 0.7323 0.7488 0.0551  0.0490  -0.2067 108 PHE A CE1   
802  C CE2   . PHE A 114 ? 0.7210 0.7897 0.7626 0.0398  0.0473  -0.2226 108 PHE A CE2   
803  C CZ    . PHE A 114 ? 0.6688 0.7359 0.7214 0.0488  0.0468  -0.2103 108 PHE A CZ    
804  N N     . ILE A 115 ? 0.7077 0.7370 0.7707 0.0363  0.0345  -0.2057 109 ILE A N     
805  C CA    . ILE A 115 ? 0.6836 0.7275 0.7391 0.0328  0.0254  -0.1963 109 ILE A CA    
806  C C     . ILE A 115 ? 0.7362 0.7954 0.7854 0.0363  0.0239  -0.1911 109 ILE A C     
807  O O     . ILE A 115 ? 0.7075 0.7645 0.7629 0.0441  0.0255  -0.1836 109 ILE A O     
808  C CB    . ILE A 115 ? 0.7078 0.7433 0.7701 0.0355  0.0210  -0.1836 109 ILE A CB    
809  C CG1   . ILE A 115 ? 0.7127 0.7368 0.7796 0.0294  0.0218  -0.1888 109 ILE A CG1   
810  C CG2   . ILE A 115 ? 0.7096 0.7588 0.7658 0.0349  0.0129  -0.1721 109 ILE A CG2   
811  C CD1   . ILE A 115 ? 0.7777 0.7815 0.8553 0.0341  0.0278  -0.1886 109 ILE A CD1   
812  N N     . GLU A 116 ? 0.7426 0.8176 0.7796 0.0301  0.0209  -0.1950 110 GLU A N     
813  C CA    . GLU A 116 ? 0.7606 0.8511 0.7899 0.0318  0.0196  -0.1899 110 GLU A CA    
814  C C     . GLU A 116 ? 0.8120 0.9070 0.8418 0.0343  0.0121  -0.1743 110 GLU A C     
815  O O     . GLU A 116 ? 0.7976 0.8903 0.8282 0.0315  0.0067  -0.1697 110 GLU A O     
816  C CB    . GLU A 116 ? 0.7948 0.9005 0.8094 0.0239  0.0178  -0.1975 110 GLU A CB    
817  C CG    . GLU A 116 ? 1.0380 1.1413 1.0482 0.0200  0.0251  -0.2145 110 GLU A CG    
818  C CD    . GLU A 116 ? 1.5512 1.6693 1.5452 0.0108  0.0222  -0.2225 110 GLU A CD    
819  O OE1   . GLU A 116 ? 1.6197 1.7488 1.6079 0.0064  0.0133  -0.2154 110 GLU A OE1   
820  O OE2   . GLU A 116 ? 1.5559 1.6748 1.5430 0.0079  0.0289  -0.2362 110 GLU A OE2   
821  N N     . LYS A 117 ? 0.7774 0.8790 0.8071 0.0389  0.0123  -0.1665 111 LYS A N     
822  C CA    . LYS A 117 ? 0.7709 0.8763 0.7999 0.0406  0.0058  -0.1526 111 LYS A CA    
823  C C     . LYS A 117 ? 0.8590 0.9767 0.8766 0.0345  0.0000  -0.1504 111 LYS A C     
824  O O     . LYS A 117 ? 0.8690 0.9978 0.8773 0.0304  0.0012  -0.1566 111 LYS A O     
825  C CB    . LYS A 117 ? 0.7712 0.8821 0.8024 0.0454  0.0076  -0.1464 111 LYS A CB    
826  N N     . ASP A 118 ? 0.8177 0.9334 0.8361 0.0341  -0.0060 -0.1417 112 ASP A N     
827  C CA    . ASP A 118 ? 0.8269 0.9540 0.8371 0.0297  -0.0121 -0.1373 112 ASP A CA    
828  C C     . ASP A 118 ? 0.8677 0.9924 0.8796 0.0331  -0.0163 -0.1240 112 ASP A C     
829  O O     . ASP A 118 ? 0.8561 0.9698 0.8750 0.0354  -0.0170 -0.1204 112 ASP A O     
830  C CB    . ASP A 118 ? 0.8724 1.0003 0.8828 0.0242  -0.0146 -0.1436 112 ASP A CB    
831  C CG    . ASP A 118 ? 1.1162 1.2588 1.1189 0.0199  -0.0213 -0.1392 112 ASP A CG    
832  O OD1   . ASP A 118 ? 1.1433 1.2867 1.1497 0.0171  -0.0252 -0.1390 112 ASP A OD1   
833  O OD2   . ASP A 118 ? 1.2187 1.3725 1.2121 0.0196  -0.0226 -0.1354 112 ASP A OD2   
834  N N     . ALA A 119 ? 0.8187 0.9528 0.8237 0.0330  -0.0185 -0.1168 113 ALA A N     
835  C CA    . ALA A 119 ? 0.7963 0.9270 0.8021 0.0358  -0.0219 -0.1048 113 ALA A CA    
836  C C     . ALA A 119 ? 0.8287 0.9703 0.8260 0.0338  -0.0260 -0.0974 113 ALA A C     
837  O O     . ALA A 119 ? 0.8354 0.9887 0.8248 0.0306  -0.0258 -0.1002 113 ALA A O     
838  C CB    . ALA A 119 ? 0.7986 0.9235 0.8083 0.0397  -0.0191 -0.1014 113 ALA A CB    
839  N N     . SER A 120 ? 0.7572 0.8944 0.7560 0.0357  -0.0294 -0.0877 114 SER A N     
840  C CA    . SER A 120 ? 0.7460 0.8907 0.7388 0.0351  -0.0333 -0.0788 114 SER A CA    
841  C C     . SER A 120 ? 0.7376 0.8738 0.7311 0.0381  -0.0332 -0.0691 114 SER A C     
842  O O     . SER A 120 ? 0.7283 0.8534 0.7271 0.0407  -0.0335 -0.0665 114 SER A O     
843  C CB    . SER A 120 ? 0.8249 0.9728 0.8203 0.0344  -0.0375 -0.0772 114 SER A CB    
844  O OG    . SER A 120 ? 1.0383 1.1859 1.0385 0.0321  -0.0370 -0.0867 114 SER A OG    
845  N N     . ILE A 121 ? 0.6489 0.7900 0.6364 0.0373  -0.0326 -0.0640 115 ILE A N     
846  C CA    . ILE A 121 ? 0.6207 0.7541 0.6082 0.0388  -0.0322 -0.0556 115 ILE A CA    
847  C C     . ILE A 121 ? 0.6799 0.8105 0.6653 0.0401  -0.0352 -0.0459 115 ILE A C     
848  O O     . ILE A 121 ? 0.6910 0.8314 0.6715 0.0391  -0.0375 -0.0421 115 ILE A O     
849  C CB    . ILE A 121 ? 0.6502 0.7900 0.6335 0.0366  -0.0293 -0.0546 115 ILE A CB    
850  C CG1   . ILE A 121 ? 0.6531 0.7951 0.6406 0.0365  -0.0254 -0.0639 115 ILE A CG1   
851  C CG2   . ILE A 121 ? 0.6493 0.7817 0.6324 0.0367  -0.0291 -0.0459 115 ILE A CG2   
852  C CD1   . ILE A 121 ? 0.8695 1.0240 0.8521 0.0341  -0.0234 -0.0722 115 ILE A CD1   
853  N N     . ASN A 122 ? 0.6351 0.7525 0.6239 0.0424  -0.0351 -0.0416 116 ASN A N     
854  C CA    . ASN A 122 ? 0.6318 0.7432 0.6195 0.0445  -0.0365 -0.0326 116 ASN A CA    
855  C C     . ASN A 122 ? 0.6981 0.8059 0.6815 0.0428  -0.0350 -0.0265 116 ASN A C     
856  O O     . ASN A 122 ? 0.6948 0.7937 0.6796 0.0421  -0.0333 -0.0277 116 ASN A O     
857  C CB    . ASN A 122 ? 0.6364 0.7344 0.6292 0.0473  -0.0359 -0.0328 116 ASN A CB    
858  C CG    . ASN A 122 ? 0.9175 1.0086 0.9104 0.0502  -0.0363 -0.0247 116 ASN A CG    
859  O OD1   . ASN A 122 ? 0.7775 0.8654 0.7666 0.0502  -0.0359 -0.0176 116 ASN A OD1   
860  N ND2   . ASN A 122 ? 0.8413 0.9287 0.8395 0.0530  -0.0363 -0.0255 116 ASN A ND2   
861  N N     . ASP A 123 ? 0.6595 0.7744 0.6376 0.0420  -0.0357 -0.0196 117 ASP A N     
862  C CA    . ASP A 123 ? 0.6584 0.7705 0.6322 0.0397  -0.0339 -0.0130 117 ASP A CA    
863  C C     . ASP A 123 ? 0.6667 0.7620 0.6418 0.0407  -0.0328 -0.0075 117 ASP A C     
864  O O     . ASP A 123 ? 0.6668 0.7572 0.6409 0.0374  -0.0308 -0.0063 117 ASP A O     
865  C CB    . ASP A 123 ? 0.7044 0.8282 0.6712 0.0384  -0.0347 -0.0063 117 ASP A CB    
866  C CG    . ASP A 123 ? 0.9568 1.0927 0.9192 0.0343  -0.0324 -0.0107 117 ASP A CG    
867  O OD1   . ASP A 123 ? 0.9876 1.1201 0.9508 0.0315  -0.0292 -0.0106 117 ASP A OD1   
868  O OD2   . ASP A 123 ? 1.0179 1.1672 0.9763 0.0335  -0.0337 -0.0148 117 ASP A OD2   
869  N N     . GLU A 124 ? 0.5892 0.6760 0.5671 0.0447  -0.0337 -0.0050 118 GLU A N     
870  C CA    . GLU A 124 ? 0.5798 0.6490 0.5582 0.0460  -0.0319 -0.0011 118 GLU A CA    
871  C C     . GLU A 124 ? 0.6208 0.6808 0.6004 0.0438  -0.0308 -0.0077 118 GLU A C     
872  O O     . GLU A 124 ? 0.6284 0.6773 0.6058 0.0412  -0.0293 -0.0056 118 GLU A O     
873  C CB    . GLU A 124 ? 0.5840 0.6481 0.5661 0.0515  -0.0323 0.0017  118 GLU A CB    
874  N N     . ILE A 125 ? 0.5363 0.6012 0.5193 0.0444  -0.0318 -0.0156 119 ILE A N     
875  C CA    . ILE A 125 ? 0.5127 0.5711 0.4972 0.0431  -0.0315 -0.0213 119 ILE A CA    
876  C C     . ILE A 125 ? 0.5636 0.6277 0.5477 0.0387  -0.0312 -0.0221 119 ILE A C     
877  O O     . ILE A 125 ? 0.5632 0.6196 0.5470 0.0362  -0.0312 -0.0225 119 ILE A O     
878  C CB    . ILE A 125 ? 0.5361 0.5977 0.5248 0.0455  -0.0322 -0.0280 119 ILE A CB    
879  C CG1   . ILE A 125 ? 0.5297 0.5853 0.5198 0.0493  -0.0319 -0.0266 119 ILE A CG1   
880  C CG2   . ILE A 125 ? 0.5541 0.6104 0.5443 0.0446  -0.0323 -0.0329 119 ILE A CG2   
881  C CD1   . ILE A 125 ? 0.6954 0.7546 0.6903 0.0510  -0.0321 -0.0323 119 ILE A CD1   
882  N N     . ASP A 126 ? 0.5170 0.5953 0.5010 0.0374  -0.0308 -0.0223 120 ASP A N     
883  C CA    . ASP A 126 ? 0.5210 0.6070 0.5056 0.0333  -0.0294 -0.0227 120 ASP A CA    
884  C C     . ASP A 126 ? 0.5481 0.6263 0.5298 0.0294  -0.0284 -0.0159 120 ASP A C     
885  O O     . ASP A 126 ? 0.5259 0.6036 0.5103 0.0256  -0.0280 -0.0170 120 ASP A O     
886  C CB    . ASP A 126 ? 0.5659 0.6679 0.5488 0.0327  -0.0283 -0.0240 120 ASP A CB    
887  C CG    . ASP A 126 ? 0.8465 0.9584 0.8306 0.0288  -0.0256 -0.0249 120 ASP A CG    
888  O OD1   . ASP A 126 ? 0.8993 1.0194 0.8785 0.0265  -0.0238 -0.0207 120 ASP A OD1   
889  O OD2   . ASP A 126 ? 0.9043 1.0168 0.8948 0.0283  -0.0251 -0.0294 120 ASP A OD2   
890  N N     . LYS A 127 ? 0.5025 0.5743 0.4798 0.0303  -0.0280 -0.0087 121 LYS A N     
891  C CA    . LYS A 127 ? 0.5003 0.5613 0.4748 0.0270  -0.0264 -0.0019 121 LYS A CA    
892  C C     . LYS A 127 ? 0.5271 0.5728 0.5024 0.0254  -0.0269 -0.0048 121 LYS A C     
893  O O     . LYS A 127 ? 0.5216 0.5629 0.4970 0.0199  -0.0261 -0.0038 121 LYS A O     
894  C CB    . LYS A 127 ? 0.5392 0.5951 0.5100 0.0304  -0.0260 0.0063  121 LYS A CB    
895  C CG    . LYS A 127 ? 0.8128 0.8545 0.7808 0.0279  -0.0235 0.0141  121 LYS A CG    
896  C CD    . LYS A 127 ? 1.0128 1.0554 0.9777 0.0314  -0.0230 0.0240  121 LYS A CD    
897  C CE    . LYS A 127 ? 1.1553 1.2028 1.1165 0.0267  -0.0208 0.0316  121 LYS A CE    
898  N NZ    . LYS A 127 ? 1.2316 1.2862 1.1890 0.0305  -0.0215 0.0410  121 LYS A NZ    
899  N N     . LEU A 128 ? 0.4609 0.4998 0.4367 0.0298  -0.0281 -0.0087 122 LEU A N     
900  C CA    . LEU A 128 ? 0.4531 0.4778 0.4276 0.0289  -0.0286 -0.0121 122 LEU A CA    
901  C C     . LEU A 128 ? 0.5230 0.5529 0.5004 0.0249  -0.0306 -0.0172 122 LEU A C     
902  O O     . LEU A 128 ? 0.5305 0.5507 0.5057 0.0208  -0.0313 -0.0182 122 LEU A O     
903  C CB    . LEU A 128 ? 0.4412 0.4611 0.4159 0.0347  -0.0289 -0.0150 122 LEU A CB    
904  C CG    . LEU A 128 ? 0.4895 0.4994 0.4624 0.0389  -0.0267 -0.0105 122 LEU A CG    
905  C CD1   . LEU A 128 ? 0.4776 0.4893 0.4532 0.0442  -0.0269 -0.0134 122 LEU A CD1   
906  C CD2   . LEU A 128 ? 0.5146 0.5055 0.4827 0.0370  -0.0245 -0.0096 122 LEU A CD2   
907  N N     . ARG A 129 ? 0.4786 0.5237 0.4610 0.0262  -0.0315 -0.0207 123 ARG A N     
908  C CA    . ARG A 129 ? 0.4776 0.5309 0.4653 0.0240  -0.0333 -0.0250 123 ARG A CA    
909  C C     . ARG A 129 ? 0.5806 0.6387 0.5702 0.0175  -0.0326 -0.0222 123 ARG A C     
910  O O     . ARG A 129 ? 0.5742 0.6322 0.5666 0.0136  -0.0348 -0.0240 123 ARG A O     
911  C CB    . ARG A 129 ? 0.4612 0.5288 0.4543 0.0276  -0.0329 -0.0289 123 ARG A CB    
912  C CG    . ARG A 129 ? 0.6259 0.6896 0.6192 0.0330  -0.0337 -0.0327 123 ARG A CG    
913  C CD    . ARG A 129 ? 0.7749 0.8513 0.7730 0.0356  -0.0326 -0.0371 123 ARG A CD    
914  N NE    . ARG A 129 ? 0.8297 0.9159 0.8346 0.0346  -0.0324 -0.0399 123 ARG A NE    
915  C CZ    . ARG A 129 ? 0.9824 1.0683 0.9927 0.0372  -0.0336 -0.0435 123 ARG A CZ    
916  N NH1   . ARG A 129 ? 0.8053 0.9011 0.8234 0.0368  -0.0333 -0.0453 123 ARG A NH1   
917  N NH2   . ARG A 129 ? 0.7655 0.8415 0.7741 0.0403  -0.0349 -0.0448 123 ARG A NH2   
918  N N     . HIS A 130 ? 0.5765 0.6395 0.5646 0.0159  -0.0298 -0.0175 124 HIS A N     
919  C CA    . HIS A 130 ? 0.5935 0.6612 0.5833 0.0093  -0.0280 -0.0138 124 HIS A CA    
920  C C     . HIS A 130 ? 0.6708 0.7225 0.6571 0.0043  -0.0284 -0.0112 124 HIS A C     
921  O O     . HIS A 130 ? 0.6858 0.7402 0.6758 -0.0024 -0.0288 -0.0112 124 HIS A O     
922  C CB    . HIS A 130 ? 0.6137 0.6881 0.6003 0.0094  -0.0247 -0.0083 124 HIS A CB    
923  C CG    . HIS A 130 ? 0.6542 0.7462 0.6435 0.0120  -0.0235 -0.0115 124 HIS A CG    
924  N ND1   . HIS A 130 ? 0.6847 0.7825 0.6686 0.0145  -0.0219 -0.0085 124 HIS A ND1   
925  C CD2   . HIS A 130 ? 0.6738 0.7779 0.6703 0.0125  -0.0234 -0.0175 124 HIS A CD2   
926  C CE1   . HIS A 130 ? 0.6798 0.7925 0.6668 0.0158  -0.0206 -0.0139 124 HIS A CE1   
927  N NE2   . HIS A 130 ? 0.6754 0.7917 0.6706 0.0150  -0.0210 -0.0193 124 HIS A NE2   
928  N N     . SER A 131 ? 0.6264 0.6616 0.6061 0.0072  -0.0281 -0.0094 125 SER A N     
929  C CA    . SER A 131 ? 0.6343 0.6510 0.6094 0.0029  -0.0276 -0.0081 125 SER A CA    
930  C C     . SER A 131 ? 0.6571 0.6710 0.6328 -0.0005 -0.0312 -0.0143 125 SER A C     
931  O O     . SER A 131 ? 0.6563 0.6637 0.6313 -0.0079 -0.0317 -0.0146 125 SER A O     
932  C CB    . SER A 131 ? 0.7065 0.7076 0.6757 0.0086  -0.0258 -0.0059 125 SER A CB    
933  O OG    . SER A 131 ? 0.9131 0.9134 0.8810 0.0101  -0.0227 0.0018  125 SER A OG    
934  N N     . ALA A 132 ? 0.5913 0.6112 0.5689 0.0045  -0.0339 -0.0190 126 ALA A N     
935  C CA    . ALA A 132 ? 0.5826 0.6018 0.5604 0.0028  -0.0381 -0.0241 126 ALA A CA    
936  C C     . ALA A 132 ? 0.6061 0.6401 0.5922 -0.0030 -0.0408 -0.0250 126 ALA A C     
937  O O     . ALA A 132 ? 0.5868 0.6161 0.5715 -0.0098 -0.0434 -0.0263 126 ALA A O     
938  C CB    . ALA A 132 ? 0.5842 0.6063 0.5625 0.0103  -0.0395 -0.0273 126 ALA A CB    
939  N N     . THR A 133 ? 0.5572 0.6094 0.5519 -0.0006 -0.0398 -0.0245 127 THR A N     
940  C CA    . THR A 133 ? 0.5566 0.6258 0.5618 -0.0049 -0.0414 -0.0251 127 THR A CA    
941  C C     . THR A 133 ? 0.6053 0.6740 0.6119 -0.0143 -0.0401 -0.0220 127 THR A C     
942  O O     . THR A 133 ? 0.5996 0.6724 0.6109 -0.0207 -0.0438 -0.0234 127 THR A O     
943  C CB    . THR A 133 ? 0.7054 0.7923 0.7190 0.0001  -0.0389 -0.0259 127 THR A CB    
944  O OG1   . THR A 133 ? 0.7783 0.8632 0.7865 0.0033  -0.0346 -0.0236 127 THR A OG1   
945  C CG2   . THR A 133 ? 0.6828 0.7743 0.7005 0.0068  -0.0416 -0.0300 127 THR A CG2   
946  N N     . SER A 134 ? 0.5472 0.6104 0.5495 -0.0156 -0.0353 -0.0173 128 SER A N     
947  C CA    . SER A 134 ? 0.5486 0.6090 0.5517 -0.0247 -0.0331 -0.0135 128 SER A CA    
948  C C     . SER A 134 ? 0.6101 0.6519 0.6070 -0.0312 -0.0354 -0.0150 128 SER A C     
949  O O     . SER A 134 ? 0.6202 0.6633 0.6210 -0.0406 -0.0358 -0.0144 128 SER A O     
950  C CB    . SER A 134 ? 0.6026 0.6622 0.6024 -0.0240 -0.0274 -0.0071 128 SER A CB    
951  O OG    . SER A 134 ? 0.7889 0.8332 0.7793 -0.0180 -0.0262 -0.0051 128 SER A OG    
952  N N     . ALA A 135 ? 0.5683 0.5940 0.5561 -0.0267 -0.0369 -0.0177 129 ALA A N     
953  C CA    . ALA A 135 ? 0.5759 0.5828 0.5559 -0.0324 -0.0386 -0.0207 129 ALA A CA    
954  C C     . ALA A 135 ? 0.5966 0.6116 0.5804 -0.0388 -0.0449 -0.0255 129 ALA A C     
955  O O     . ALA A 135 ? 0.5806 0.5852 0.5604 -0.0478 -0.0464 -0.0276 129 ALA A O     
956  C CB    . ALA A 135 ? 0.5895 0.5797 0.5592 -0.0252 -0.0380 -0.0228 129 ALA A CB    
957  N N     . LEU A 136 ? 0.5614 0.5946 0.5529 -0.0343 -0.0487 -0.0271 130 LEU A N     
958  C CA    . LEU A 136 ? 0.5746 0.6187 0.5713 -0.0388 -0.0556 -0.0305 130 LEU A CA    
959  C C     . LEU A 136 ? 0.6994 0.7570 0.7070 -0.0490 -0.0567 -0.0292 130 LEU A C     
960  O O     . LEU A 136 ? 0.7043 0.7683 0.7152 -0.0556 -0.0629 -0.0318 130 LEU A O     
961  C CB    . LEU A 136 ? 0.5498 0.6087 0.5529 -0.0299 -0.0587 -0.0315 130 LEU A CB    
962  C CG    . LEU A 136 ? 0.5785 0.6257 0.5714 -0.0233 -0.0609 -0.0342 130 LEU A CG    
963  C CD1   . LEU A 136 ? 0.5543 0.6160 0.5552 -0.0152 -0.0632 -0.0344 130 LEU A CD1   
964  C CD2   . LEU A 136 ? 0.5998 0.6361 0.5831 -0.0300 -0.0660 -0.0375 130 LEU A CD2   
965  N N     . PHE A 137 ? 0.6922 0.7550 0.7054 -0.0507 -0.0508 -0.0248 131 PHE A N     
966  C CA    . PHE A 137 ? 0.7079 0.7831 0.7319 -0.0608 -0.0501 -0.0227 131 PHE A CA    
967  C C     . PHE A 137 ? 0.7846 0.8403 0.8010 -0.0713 -0.0482 -0.0223 131 PHE A C     
968  O O     . PHE A 137 ? 0.7987 0.8594 0.8210 -0.0824 -0.0511 -0.0236 131 PHE A O     
969  C CB    . PHE A 137 ? 0.7306 0.8206 0.7631 -0.0578 -0.0437 -0.0179 131 PHE A CB    
970  C CG    . PHE A 137 ? 0.7467 0.8573 0.7888 -0.0489 -0.0442 -0.0190 131 PHE A CG    
971  C CD1   . PHE A 137 ? 0.7851 0.8921 0.8213 -0.0380 -0.0422 -0.0195 131 PHE A CD1   
972  C CD2   . PHE A 137 ? 0.7844 0.9182 0.8427 -0.0517 -0.0461 -0.0194 131 PHE A CD2   
973  C CE1   . PHE A 137 ? 0.7916 0.9158 0.8367 -0.0302 -0.0419 -0.0212 131 PHE A CE1   
974  C CE2   . PHE A 137 ? 0.8136 0.9650 0.8814 -0.0428 -0.0455 -0.0206 131 PHE A CE2   
975  C CZ    . PHE A 137 ? 0.7820 0.9274 0.8426 -0.0323 -0.0432 -0.0217 131 PHE A CZ    
976  N N     . GLU A 138 ? 0.7454 0.7788 0.7494 -0.0678 -0.0435 -0.0206 132 GLU A N     
977  C CA    . GLU A 138 ? 0.7551 0.7656 0.7510 -0.0759 -0.0400 -0.0197 132 GLU A CA    
978  C C     . GLU A 138 ? 0.7853 0.7799 0.7725 -0.0827 -0.0447 -0.0266 132 GLU A C     
979  O O     . GLU A 138 ? 0.7977 0.7878 0.7863 -0.0951 -0.0455 -0.0283 132 GLU A O     
980  C CB    . GLU A 138 ? 0.7767 0.7700 0.7640 -0.0684 -0.0332 -0.0147 132 GLU A CB    
981  C CG    . GLU A 138 ? 1.0204 1.0285 1.0141 -0.0637 -0.0286 -0.0075 132 GLU A CG    
982  C CD    . GLU A 138 ? 1.5840 1.5809 1.5701 -0.0545 -0.0237 -0.0021 132 GLU A CD    
983  O OE1   . GLU A 138 ? 1.6362 1.6225 1.6151 -0.0466 -0.0249 -0.0048 132 GLU A OE1   
984  O OE2   . GLU A 138 ? 1.6164 1.6170 1.6042 -0.0549 -0.0188 0.0052  132 GLU A OE2   
985  N N     . ARG A 139 ? 0.7075 0.6935 0.6850 -0.0755 -0.0474 -0.0309 133 ARG A N     
986  C CA    . ARG A 139 ? 0.7069 0.6759 0.6727 -0.0811 -0.0509 -0.0378 133 ARG A CA    
987  C C     . ARG A 139 ? 0.7483 0.7257 0.7107 -0.0774 -0.0584 -0.0427 133 ARG A C     
988  O O     . ARG A 139 ? 0.7325 0.7250 0.7006 -0.0678 -0.0599 -0.0406 133 ARG A O     
989  C CB    . ARG A 139 ? 0.6938 0.6335 0.6463 -0.0778 -0.0443 -0.0382 133 ARG A CB    
990  C CG    . ARG A 139 ? 0.6897 0.6278 0.6409 -0.0637 -0.0396 -0.0335 133 ARG A CG    
991  C CD    . ARG A 139 ? 0.7653 0.6774 0.7033 -0.0595 -0.0354 -0.0362 133 ARG A CD    
992  N NE    . ARG A 139 ? 0.9006 0.7995 0.8384 -0.0548 -0.0277 -0.0298 133 ARG A NE    
993  C CZ    . ARG A 139 ? 1.2343 1.1076 1.1630 -0.0532 -0.0222 -0.0308 133 ARG A CZ    
994  N NH1   . ARG A 139 ? 1.0076 0.8651 0.9253 -0.0568 -0.0230 -0.0390 133 ARG A NH1   
995  N NH2   . ARG A 139 ? 1.2475 1.1109 1.1778 -0.0480 -0.0156 -0.0235 133 ARG A NH2   
996  N N     . ARG A 140 ? 0.7147 0.6819 0.6672 -0.0854 -0.0631 -0.0493 134 ARG A N     
997  C CA    . ARG A 140 ? 0.7068 0.6803 0.6535 -0.0832 -0.0706 -0.0535 134 ARG A CA    
998  C C     . ARG A 140 ? 0.7867 0.7384 0.7161 -0.0760 -0.0675 -0.0569 134 ARG A C     
999  O O     . ARG A 140 ? 0.7911 0.7476 0.7152 -0.0710 -0.0722 -0.0587 134 ARG A O     
1000 C CB    . ARG A 140 ? 0.7251 0.7041 0.6709 -0.0968 -0.0786 -0.0585 134 ARG A CB    
1001 N N     . ASP A 141 ? 0.7503 0.6785 0.6720 -0.0747 -0.0591 -0.0570 135 ASP A N     
1002 C CA    . ASP A 141 ? 0.7556 0.6633 0.6629 -0.0675 -0.0546 -0.0598 135 ASP A CA    
1003 C C     . ASP A 141 ? 0.7976 0.7111 0.7107 -0.0533 -0.0503 -0.0540 135 ASP A C     
1004 O O     . ASP A 141 ? 0.7943 0.6941 0.7057 -0.0475 -0.0429 -0.0513 135 ASP A O     
1005 C CB    . ASP A 141 ? 0.7994 0.6787 0.6960 -0.0731 -0.0477 -0.0634 135 ASP A CB    
1006 C CG    . ASP A 141 ? 0.9630 0.8364 0.8683 -0.0731 -0.0408 -0.0573 135 ASP A CG    
1007 O OD1   . ASP A 141 ? 0.9791 0.8634 0.8943 -0.0814 -0.0429 -0.0549 135 ASP A OD1   
1008 O OD2   . ASP A 141 ? 1.0734 0.9318 0.9758 -0.0650 -0.0333 -0.0544 135 ASP A OD2   
1009 N N     . VAL A 142 ? 0.7316 0.6660 0.6520 -0.0478 -0.0555 -0.0521 136 VAL A N     
1010 C CA    . VAL A 142 ? 0.7013 0.6439 0.6281 -0.0359 -0.0526 -0.0476 136 VAL A CA    
1011 C C     . VAL A 142 ? 0.7433 0.6859 0.6633 -0.0289 -0.0548 -0.0498 136 VAL A C     
1012 O O     . VAL A 142 ? 0.7619 0.7119 0.6793 -0.0320 -0.0614 -0.0522 136 VAL A O     
1013 C CB    . VAL A 142 ? 0.7343 0.7010 0.6775 -0.0349 -0.0547 -0.0430 136 VAL A CB    
1014 C CG1   . VAL A 142 ? 0.7151 0.6885 0.6639 -0.0237 -0.0510 -0.0391 136 VAL A CG1   
1015 C CG2   . VAL A 142 ? 0.7439 0.7114 0.6933 -0.0431 -0.0524 -0.0404 136 VAL A CG2   
1016 N N     . ILE A 143 ? 0.6669 0.6016 0.5845 -0.0196 -0.0492 -0.0483 137 ILE A N     
1017 C CA    . ILE A 143 ? 0.6440 0.5788 0.5572 -0.0119 -0.0494 -0.0491 137 ILE A CA    
1018 C C     . ILE A 143 ? 0.6550 0.6016 0.5799 -0.0031 -0.0469 -0.0446 137 ILE A C     
1019 O O     . ILE A 143 ? 0.6624 0.6037 0.5899 -0.0002 -0.0415 -0.0419 137 ILE A O     
1020 C CB    . ILE A 143 ? 0.6930 0.6058 0.5918 -0.0098 -0.0440 -0.0525 137 ILE A CB    
1021 C CG1   . ILE A 143 ? 0.7087 0.6078 0.5937 -0.0192 -0.0458 -0.0583 137 ILE A CG1   
1022 C CG2   . ILE A 143 ? 0.7051 0.6200 0.6010 -0.0018 -0.0436 -0.0524 137 ILE A CG2   
1023 C CD1   . ILE A 143 ? 0.7904 0.6655 0.6614 -0.0177 -0.0384 -0.0623 137 ILE A CD1   
1024 N N     . ILE A 144 ? 0.5617 0.5243 0.4938 0.0007  -0.0508 -0.0435 138 ILE A N     
1025 C CA    . ILE A 144 ? 0.5228 0.4962 0.4652 0.0082  -0.0485 -0.0406 138 ILE A CA    
1026 C C     . ILE A 144 ? 0.5678 0.5390 0.5073 0.0152  -0.0477 -0.0413 138 ILE A C     
1027 O O     . ILE A 144 ? 0.5637 0.5392 0.5018 0.0154  -0.0520 -0.0422 138 ILE A O     
1028 C CB    . ILE A 144 ? 0.5419 0.5357 0.4975 0.0072  -0.0517 -0.0388 138 ILE A CB    
1029 C CG1   . ILE A 144 ? 0.5319 0.5277 0.4911 0.0005  -0.0506 -0.0371 138 ILE A CG1   
1030 C CG2   . ILE A 144 ? 0.5466 0.5505 0.5108 0.0149  -0.0492 -0.0373 138 ILE A CG2   
1031 C CD1   . ILE A 144 ? 0.5169 0.5308 0.4870 -0.0032 -0.0541 -0.0363 138 ILE A CD1   
1032 N N     . ILE A 145 ? 0.5176 0.4823 0.4567 0.0207  -0.0423 -0.0404 139 ILE A N     
1033 C CA    . ILE A 145 ? 0.5002 0.4627 0.4382 0.0271  -0.0403 -0.0408 139 ILE A CA    
1034 C C     . ILE A 145 ? 0.5336 0.5118 0.4839 0.0311  -0.0410 -0.0394 139 ILE A C     
1035 O O     . ILE A 145 ? 0.5148 0.4982 0.4712 0.0324  -0.0387 -0.0378 139 ILE A O     
1036 C CB    . ILE A 145 ? 0.5429 0.4926 0.4766 0.0308  -0.0338 -0.0405 139 ILE A CB    
1037 C CG1   . ILE A 145 ? 0.5659 0.4993 0.4899 0.0266  -0.0311 -0.0418 139 ILE A CG1   
1038 C CG2   . ILE A 145 ? 0.5451 0.4915 0.4764 0.0358  -0.0315 -0.0413 139 ILE A CG2   
1039 C CD1   . ILE A 145 ? 0.6484 0.5717 0.5597 0.0213  -0.0332 -0.0455 139 ILE A CD1   
1040 N N     . ALA A 146 ? 0.5047 0.4904 0.4583 0.0328  -0.0443 -0.0399 140 ALA A N     
1041 C CA    . ALA A 146 ? 0.4871 0.4867 0.4523 0.0364  -0.0447 -0.0397 140 ALA A CA    
1042 C C     . ALA A 146 ? 0.5314 0.5301 0.4980 0.0414  -0.0440 -0.0402 140 ALA A C     
1043 O O     . ALA A 146 ? 0.5216 0.5107 0.4800 0.0419  -0.0442 -0.0400 140 ALA A O     
1044 C CB    . ALA A 146 ? 0.4916 0.5039 0.4637 0.0334  -0.0491 -0.0394 140 ALA A CB    
1045 N N     . SER A 147 ? 0.5021 0.5102 0.4786 0.0449  -0.0427 -0.0410 141 SER A N     
1046 C CA    . SER A 147 ? 0.5072 0.5155 0.4877 0.0493  -0.0416 -0.0417 141 SER A CA    
1047 C C     . SER A 147 ? 0.5803 0.5990 0.5691 0.0503  -0.0450 -0.0416 141 SER A C     
1048 O O     . SER A 147 ? 0.5710 0.5969 0.5618 0.0472  -0.0481 -0.0410 141 SER A O     
1049 C CB    . SER A 147 ? 0.5250 0.5370 0.5117 0.0517  -0.0377 -0.0437 141 SER A CB    
1050 O OG    . SER A 147 ? 0.5786 0.6030 0.5727 0.0510  -0.0381 -0.0450 141 SER A OG    
1051 N N     . VAL A 148 ? 0.5382 0.5581 0.5332 0.0546  -0.0440 -0.0423 142 VAL A N     
1052 C CA    . VAL A 148 ? 0.5357 0.5649 0.5405 0.0572  -0.0461 -0.0420 142 VAL A CA    
1053 C C     . VAL A 148 ? 0.5826 0.6253 0.5964 0.0562  -0.0453 -0.0443 142 VAL A C     
1054 O O     . VAL A 148 ? 0.5756 0.6276 0.5987 0.0581  -0.0467 -0.0442 142 VAL A O     
1055 C CB    . VAL A 148 ? 0.5961 0.6214 0.6061 0.0623  -0.0440 -0.0422 142 VAL A CB    
1056 C CG1   . VAL A 148 ? 0.6079 0.6240 0.6107 0.0636  -0.0466 -0.0378 142 VAL A CG1   
1057 C CG2   . VAL A 148 ? 0.5952 0.6162 0.6060 0.0630  -0.0388 -0.0457 142 VAL A CG2   
1058 N N     . SER A 149 ? 0.5360 0.5801 0.5470 0.0533  -0.0430 -0.0459 143 SER A N     
1059 C CA    . SER A 149 ? 0.5255 0.5817 0.5421 0.0515  -0.0417 -0.0475 143 SER A CA    
1060 C C     . SER A 149 ? 0.5842 0.6480 0.6035 0.0482  -0.0452 -0.0451 143 SER A C     
1061 O O     . SER A 149 ? 0.5988 0.6748 0.6254 0.0472  -0.0440 -0.0461 143 SER A O     
1062 C CB    . SER A 149 ? 0.5680 0.6222 0.5787 0.0489  -0.0395 -0.0476 143 SER A CB    
1063 O OG    . SER A 149 ? 0.7311 0.7970 0.7459 0.0471  -0.0379 -0.0486 143 SER A OG    
1064 N N     . CYS A 150 ? 0.5221 0.5791 0.5353 0.0461  -0.0493 -0.0423 144 CYS A N     
1065 C CA    . CYS A 150 ? 0.5144 0.5778 0.5293 0.0419  -0.0538 -0.0402 144 CYS A CA    
1066 C C     . CYS A 150 ? 0.5355 0.6104 0.5622 0.0454  -0.0566 -0.0392 144 CYS A C     
1067 O O     . CYS A 150 ? 0.5372 0.6222 0.5692 0.0420  -0.0603 -0.0375 144 CYS A O     
1068 C CB    . CYS A 150 ? 0.5291 0.5804 0.5316 0.0379  -0.0572 -0.0386 144 CYS A CB    
1069 S SG    . CYS A 150 ? 0.5876 0.6290 0.5838 0.0422  -0.0597 -0.0371 144 CYS A SG    
1070 N N     . ILE A 151 ? 0.4592 0.5325 0.4906 0.0519  -0.0548 -0.0399 145 ILE A N     
1071 C CA    . ILE A 151 ? 0.4418 0.5249 0.4859 0.0569  -0.0566 -0.0385 145 ILE A CA    
1072 C C     . ILE A 151 ? 0.4859 0.5785 0.5423 0.0607  -0.0510 -0.0423 145 ILE A C     
1073 O O     . ILE A 151 ? 0.4812 0.5828 0.5503 0.0655  -0.0509 -0.0417 145 ILE A O     
1074 C CB    . ILE A 151 ? 0.4764 0.5516 0.5183 0.0614  -0.0599 -0.0349 145 ILE A CB    
1075 C CG1   . ILE A 151 ? 0.4687 0.5305 0.5062 0.0653  -0.0551 -0.0368 145 ILE A CG1   
1076 C CG2   . ILE A 151 ? 0.4842 0.5543 0.5144 0.0565  -0.0663 -0.0314 145 ILE A CG2   
1077 C CD1   . ILE A 151 ? 0.4188 0.4817 0.4674 0.0723  -0.0523 -0.0371 145 ILE A CD1   
1078 N N     . TYR A 152 ? 0.4515 0.5428 0.5039 0.0586  -0.0462 -0.0461 146 TYR A N     
1079 C CA    . TYR A 152 ? 0.4521 0.5520 0.5125 0.0608  -0.0404 -0.0508 146 TYR A CA    
1080 C C     . TYR A 152 ? 0.5528 0.6680 0.6196 0.0573  -0.0395 -0.0507 146 TYR A C     
1081 O O     . TYR A 152 ? 0.5548 0.6722 0.6181 0.0518  -0.0431 -0.0473 146 TYR A O     
1082 C CB    . TYR A 152 ? 0.4422 0.5344 0.4944 0.0599  -0.0364 -0.0547 146 TYR A CB    
1083 C CG    . TYR A 152 ? 0.4416 0.5241 0.4947 0.0647  -0.0345 -0.0570 146 TYR A CG    
1084 C CD1   . TYR A 152 ? 0.4436 0.5131 0.4896 0.0652  -0.0371 -0.0540 146 TYR A CD1   
1085 C CD2   . TYR A 152 ? 0.4753 0.5609 0.5365 0.0685  -0.0296 -0.0623 146 TYR A CD2   
1086 C CE1   . TYR A 152 ? 0.4458 0.5061 0.4934 0.0691  -0.0349 -0.0555 146 TYR A CE1   
1087 C CE2   . TYR A 152 ? 0.5083 0.5836 0.5711 0.0723  -0.0275 -0.0646 146 TYR A CE2   
1088 C CZ    . TYR A 152 ? 0.6527 0.7155 0.7090 0.0725  -0.0302 -0.0607 146 TYR A CZ    
1089 O OH    . TYR A 152 ? 0.7933 0.8457 0.8516 0.0756  -0.0275 -0.0625 146 TYR A OH    
1090 N N     . GLY A 153 ? 0.5267 0.6517 0.6026 0.0603  -0.0341 -0.0548 147 GLY A N     
1091 C CA    . GLY A 153 ? 0.5256 0.6664 0.6089 0.0576  -0.0314 -0.0552 147 GLY A CA    
1092 C C     . GLY A 153 ? 0.5684 0.7107 0.6422 0.0504  -0.0306 -0.0541 147 GLY A C     
1093 O O     . GLY A 153 ? 0.5759 0.7099 0.6387 0.0490  -0.0290 -0.0556 147 GLY A O     
1094 N N     . LEU A 154 ? 0.4959 0.6491 0.5749 0.0458  -0.0318 -0.0509 148 LEU A N     
1095 C CA    . LEU A 154 ? 0.4817 0.6379 0.5545 0.0385  -0.0307 -0.0485 148 LEU A CA    
1096 C C     . LEU A 154 ? 0.5034 0.6782 0.5893 0.0363  -0.0280 -0.0477 148 LEU A C     
1097 O O     . LEU A 154 ? 0.4862 0.6708 0.5860 0.0404  -0.0285 -0.0481 148 LEU A O     
1098 C CB    . LEU A 154 ? 0.4815 0.6267 0.5455 0.0330  -0.0366 -0.0440 148 LEU A CB    
1099 C CG    . LEU A 154 ? 0.5404 0.6685 0.5899 0.0328  -0.0374 -0.0438 148 LEU A CG    
1100 C CD1   . LEU A 154 ? 0.5596 0.6760 0.6060 0.0363  -0.0420 -0.0437 148 LEU A CD1   
1101 C CD2   . LEU A 154 ? 0.5516 0.6737 0.5930 0.0257  -0.0387 -0.0399 148 LEU A CD2   
1102 N N     . GLY A 155 ? 0.4479 0.6276 0.5299 0.0299  -0.0251 -0.0457 149 GLY A N     
1103 C CA    . GLY A 155 ? 0.4431 0.6406 0.5372 0.0265  -0.0219 -0.0443 149 GLY A CA    
1104 C C     . GLY A 155 ? 0.5007 0.7023 0.6024 0.0216  -0.0283 -0.0400 149 GLY A C     
1105 O O     . GLY A 155 ? 0.4758 0.6646 0.5697 0.0191  -0.0347 -0.0380 149 GLY A O     
1106 N N     . SER A 156 ? 0.4906 0.7110 0.6079 0.0197  -0.0262 -0.0390 150 SER A N     
1107 C CA    . SER A 156 ? 0.4920 0.7210 0.6190 0.0137  -0.0320 -0.0352 150 SER A CA    
1108 C C     . SER A 156 ? 0.5870 0.8051 0.7013 0.0034  -0.0337 -0.0319 150 SER A C     
1109 O O     . SER A 156 ? 0.5762 0.7909 0.6820 0.0006  -0.0277 -0.0313 150 SER A O     
1110 C CB    . SER A 156 ? 0.5039 0.7569 0.6502 0.0130  -0.0270 -0.0348 150 SER A CB    
1111 O OG    . SER A 156 ? 0.5946 0.8571 0.7494 0.0041  -0.0317 -0.0308 150 SER A OG    
1112 N N     . PRO A 157 ? 0.5773 0.7893 0.6896 -0.0023 -0.0415 -0.0298 151 PRO A N     
1113 C CA    . PRO A 157 ? 0.5795 0.7795 0.6804 -0.0123 -0.0422 -0.0272 151 PRO A CA    
1114 C C     . PRO A 157 ? 0.6103 0.8232 0.7186 -0.0198 -0.0362 -0.0246 151 PRO A C     
1115 O O     . PRO A 157 ? 0.6003 0.8029 0.6975 -0.0242 -0.0321 -0.0223 151 PRO A O     
1116 C CB    . PRO A 157 ? 0.6063 0.8013 0.7066 -0.0171 -0.0515 -0.0268 151 PRO A CB    
1117 C CG    . PRO A 157 ? 0.6603 0.8578 0.7648 -0.0076 -0.0560 -0.0285 151 PRO A CG    
1118 C CD    . PRO A 157 ? 0.5984 0.8140 0.7179 -0.0005 -0.0500 -0.0295 151 PRO A CD    
1119 N N     . GLU A 158 ? 0.5703 0.8061 0.6977 -0.0202 -0.0349 -0.0243 152 GLU A N     
1120 C CA    . GLU A 158 ? 0.5770 0.8284 0.7138 -0.0269 -0.0280 -0.0218 152 GLU A CA    
1121 C C     . GLU A 158 ? 0.6387 0.8882 0.7666 -0.0231 -0.0183 -0.0222 152 GLU A C     
1122 O O     . GLU A 158 ? 0.6326 0.8794 0.7541 -0.0301 -0.0134 -0.0186 152 GLU A O     
1123 C CB    . GLU A 158 ? 0.5794 0.8570 0.7400 -0.0257 -0.0281 -0.0220 152 GLU A CB    
1124 N N     . GLU A 159 ? 0.5955 0.8447 0.7215 -0.0124 -0.0159 -0.0264 153 GLU A N     
1125 C CA    . GLU A 159 ? 0.5931 0.8403 0.7090 -0.0084 -0.0080 -0.0280 153 GLU A CA    
1126 C C     . GLU A 159 ? 0.6644 0.8911 0.7595 -0.0117 -0.0086 -0.0251 153 GLU A C     
1127 O O     . GLU A 159 ? 0.6553 0.8831 0.7425 -0.0139 -0.0023 -0.0229 153 GLU A O     
1128 C CB    . GLU A 159 ? 0.5921 0.8398 0.7098 0.0027  -0.0070 -0.0340 153 GLU A CB    
1129 N N     . TYR A 160 ? 0.6384 0.8472 0.7252 -0.0119 -0.0160 -0.0246 154 TYR A N     
1130 C CA    . TYR A 160 ? 0.6422 0.8307 0.7116 -0.0141 -0.0171 -0.0216 154 TYR A CA    
1131 C C     . TYR A 160 ? 0.7383 0.9249 0.8052 -0.0242 -0.0143 -0.0154 154 TYR A C     
1132 O O     . TYR A 160 ? 0.7260 0.9059 0.7817 -0.0252 -0.0102 -0.0116 154 TYR A O     
1133 C CB    . TYR A 160 ? 0.6412 0.8133 0.7053 -0.0124 -0.0250 -0.0231 154 TYR A CB    
1134 C CG    . TYR A 160 ? 0.6580 0.8091 0.7058 -0.0120 -0.0257 -0.0210 154 TYR A CG    
1135 C CD1   . TYR A 160 ? 0.6833 0.8271 0.7233 -0.0041 -0.0257 -0.0235 154 TYR A CD1   
1136 C CD2   . TYR A 160 ? 0.6696 0.8077 0.7110 -0.0194 -0.0267 -0.0170 154 TYR A CD2   
1137 C CE1   . TYR A 160 ? 0.6785 0.8047 0.7057 -0.0032 -0.0265 -0.0213 154 TYR A CE1   
1138 C CE2   . TYR A 160 ? 0.6772 0.7957 0.7052 -0.0180 -0.0270 -0.0149 154 TYR A CE2   
1139 C CZ    . TYR A 160 ? 0.6861 0.7997 0.7075 -0.0096 -0.0270 -0.0169 154 TYR A CZ    
1140 O OH    . TYR A 160 ? 0.6387 0.7352 0.6491 -0.0077 -0.0271 -0.0144 154 TYR A OH    
1141 N N     . ARG A 161 ? 0.7361 0.9294 0.8139 -0.0319 -0.0166 -0.0142 155 ARG A N     
1142 C CA    . ARG A 161 ? 0.7554 0.9477 0.8339 -0.0429 -0.0139 -0.0087 155 ARG A CA    
1143 C C     . ARG A 161 ? 0.8299 1.0364 0.9104 -0.0447 -0.0046 -0.0053 155 ARG A C     
1144 O O     . ARG A 161 ? 0.8372 1.0365 0.9103 -0.0510 -0.0005 0.0007  155 ARG A O     
1145 C CB    . ARG A 161 ? 0.7621 0.9635 0.8548 -0.0505 -0.0188 -0.0095 155 ARG A CB    
1146 N N     . GLU A 162 ? 0.7831 1.0085 0.8729 -0.0387 -0.0008 -0.0090 156 GLU A N     
1147 C CA    . GLU A 162 ? 0.7857 1.0263 0.8772 -0.0392 0.0087  -0.0073 156 GLU A CA    
1148 C C     . GLU A 162 ? 0.8659 1.0982 0.9395 -0.0340 0.0126  -0.0066 156 GLU A C     
1149 O O     . GLU A 162 ? 0.8871 1.1199 0.9527 -0.0386 0.0184  -0.0009 156 GLU A O     
1150 C CB    . GLU A 162 ? 0.7862 1.0493 0.8951 -0.0343 0.0116  -0.0126 156 GLU A CB    
1151 N N     . MET A 163 ? 0.8167 1.0416 0.8838 -0.0250 0.0090  -0.0118 157 MET A N     
1152 C CA    . MET A 163 ? 0.8131 1.0321 0.8644 -0.0200 0.0114  -0.0122 157 MET A CA    
1153 C C     . MET A 163 ? 0.8630 1.0617 0.8982 -0.0214 0.0080  -0.0061 157 MET A C     
1154 O O     . MET A 163 ? 0.8798 1.0729 0.9035 -0.0160 0.0074  -0.0071 157 MET A O     
1155 C CB    . MET A 163 ? 0.8124 1.0333 0.8653 -0.0105 0.0097  -0.0207 157 MET A CB    
1156 N N     . VAL A 164 ? 0.7977 0.9858 0.8327 -0.0287 0.0062  0.0001  158 VAL A N     
1157 C CA    . VAL A 164 ? 0.7950 0.9631 0.8166 -0.0296 0.0041  0.0064  158 VAL A CA    
1158 C C     . VAL A 164 ? 0.8599 1.0257 0.8795 -0.0386 0.0088  0.0153  158 VAL A C     
1159 O O     . VAL A 164 ? 0.8541 1.0212 0.8836 -0.0462 0.0088  0.0161  158 VAL A O     
1160 C CB    . VAL A 164 ? 0.8344 0.9843 0.8553 -0.0280 -0.0033 0.0040  158 VAL A CB    
1161 C CG1   . VAL A 164 ? 0.8382 0.9676 0.8474 -0.0292 -0.0040 0.0109  158 VAL A CG1   
1162 C CG2   . VAL A 164 ? 0.8201 0.9702 0.8408 -0.0189 -0.0073 -0.0034 158 VAL A CG2   
1163 N N     . VAL A 165 ? 0.8392 1.0014 0.8462 -0.0380 0.0124  0.0225  159 VAL A N     
1164 C CA    . VAL A 165 ? 0.8594 1.0175 0.8627 -0.0460 0.0175  0.0327  159 VAL A CA    
1165 C C     . VAL A 165 ? 0.9463 1.0797 0.9448 -0.0484 0.0141  0.0381  159 VAL A C     
1166 O O     . VAL A 165 ? 0.9466 1.0672 0.9341 -0.0433 0.0126  0.0427  159 VAL A O     
1167 C CB    . VAL A 165 ? 0.9110 1.0787 0.9030 -0.0450 0.0235  0.0391  159 VAL A CB    
1168 C CG1   . VAL A 165 ? 0.9248 1.0862 0.9127 -0.0533 0.0289  0.0510  159 VAL A CG1   
1169 C CG2   . VAL A 165 ? 0.9016 1.0931 0.8987 -0.0438 0.0283  0.0327  159 VAL A CG2   
1170 N N     . SER A 166 ? 0.9188 1.0460 0.9265 -0.0561 0.0129  0.0369  160 SER A N     
1171 C CA    . SER A 166 ? 0.9268 1.0297 0.9310 -0.0598 0.0106  0.0402  160 SER A CA    
1172 C C     . SER A 166 ? 0.9707 1.0668 0.9732 -0.0690 0.0169  0.0505  160 SER A C     
1173 O O     . SER A 166 ? 0.9675 1.0758 0.9792 -0.0777 0.0206  0.0512  160 SER A O     
1174 C CB    . SER A 166 ? 0.9734 1.0725 0.9868 -0.0634 0.0050  0.0319  160 SER A CB    
1175 O OG    . SER A 166 ? 1.1250 1.1990 1.1328 -0.0656 0.0028  0.0330  160 SER A OG    
1176 N N     . LEU A 167 ? 0.9220 0.9995 0.9134 -0.0666 0.0183  0.0591  161 LEU A N     
1177 C CA    . LEU A 167 ? 0.9344 1.0018 0.9223 -0.0740 0.0246  0.0707  161 LEU A CA    
1178 C C     . LEU A 167 ? 1.0207 1.0590 1.0061 -0.0768 0.0237  0.0734  161 LEU A C     
1179 O O     . LEU A 167 ? 1.0210 1.0448 1.0005 -0.0688 0.0199  0.0718  161 LEU A O     
1180 C CB    . LEU A 167 ? 0.9361 1.0081 0.9122 -0.0682 0.0282  0.0810  161 LEU A CB    
1181 C CG    . LEU A 167 ? 0.9732 1.0718 0.9476 -0.0639 0.0295  0.0780  161 LEU A CG    
1182 C CD1   . LEU A 167 ? 0.9750 1.0744 0.9352 -0.0569 0.0304  0.0867  161 LEU A CD1   
1183 C CD2   . LEU A 167 ? 1.0004 1.1170 0.9824 -0.0730 0.0361  0.0789  161 LEU A CD2   
1184 N N     . ARG A 168 ? 0.9943 1.0239 0.9844 -0.0886 0.0279  0.0774  162 ARG A N     
1185 C CA    . ARG A 168 ? 1.0021 1.0023 0.9902 -0.0936 0.0287  0.0798  162 ARG A CA    
1186 C C     . ARG A 168 ? 1.0593 1.0481 1.0427 -0.0984 0.0366  0.0944  162 ARG A C     
1187 O O     . ARG A 168 ? 1.0352 1.0416 1.0193 -0.1016 0.0413  0.1009  162 ARG A O     
1188 C CB    . ARG A 168 ? 1.0083 1.0071 1.0069 -0.1051 0.0264  0.0704  162 ARG A CB    
1189 N N     . THR A 169 ? 1.0400 0.9992 1.0180 -0.0981 0.0385  0.1001  163 THR A N     
1190 C CA    . THR A 169 ? 1.0638 1.0090 1.0378 -0.1027 0.0462  0.1149  163 THR A CA    
1191 C C     . THR A 169 ? 1.1377 1.0834 1.1211 -0.1193 0.0507  0.1141  163 THR A C     
1192 O O     . THR A 169 ? 1.1323 1.0794 1.1242 -0.1266 0.0470  0.1021  163 THR A O     
1193 C CB    . THR A 169 ? 1.1696 1.0829 1.1363 -0.0962 0.0474  0.1214  163 THR A CB    
1194 O OG1   . THR A 169 ? 1.1862 1.1041 1.1467 -0.0812 0.0425  0.1208  163 THR A OG1   
1195 C CG2   . THR A 169 ? 1.1505 1.0492 1.1126 -0.0989 0.0553  0.1387  163 THR A CG2   
1196 N N     . GLU A 170 ? 1.1150 1.0622 1.0973 -0.1255 0.0584  0.1270  164 GLU A N     
1197 C CA    . GLU A 170 ? 1.1199 1.0694 1.1115 -0.1418 0.0642  0.1290  164 GLU A CA    
1198 C C     . GLU A 170 ? 1.1461 1.1280 1.1496 -0.1476 0.0619  0.1190  164 GLU A C     
1199 O O     . GLU A 170 ? 1.1618 1.1474 1.1766 -0.1617 0.0646  0.1167  164 GLU A O     
1200 C CB    . GLU A 170 ? 1.1549 1.0730 1.1500 -0.1521 0.0658  0.1267  164 GLU A CB    
1201 N N     . MET A 171 ? 1.0644 1.0699 1.0663 -0.1369 0.0574  0.1134  165 MET A N     
1202 C CA    . MET A 171 ? 1.0394 1.0761 1.0533 -0.1404 0.0558  0.1045  165 MET A CA    
1203 C C     . MET A 171 ? 1.0908 1.1501 1.1062 -0.1443 0.0642  0.1130  165 MET A C     
1204 O O     . MET A 171 ? 1.0855 1.1449 1.0883 -0.1379 0.0682  0.1233  165 MET A O     
1205 C CB    . MET A 171 ? 1.0423 1.0920 1.0563 -0.1286 0.0474  0.0925  165 MET A CB    
1206 C CG    . MET A 171 ? 1.0763 1.1431 1.0816 -0.1165 0.0479  0.0951  165 MET A CG    
1207 S SD    . MET A 171 ? 1.0969 1.1840 1.1065 -0.1057 0.0398  0.0804  165 MET A SD    
1208 C CE    . MET A 171 ? 1.0459 1.1663 1.0702 -0.1126 0.0445  0.0770  165 MET A CE    
1209 N N     . GLU A 172 ? 1.0514 1.1297 1.0820 -0.1554 0.0669  0.1092  166 GLU A N     
1210 C CA    . GLU A 172 ? 1.0532 1.1545 1.0874 -0.1605 0.0759  0.1159  166 GLU A CA    
1211 C C     . GLU A 172 ? 1.0763 1.2069 1.1119 -0.1504 0.0742  0.1085  166 GLU A C     
1212 O O     . GLU A 172 ? 1.0635 1.2091 1.1120 -0.1495 0.0688  0.0965  166 GLU A O     
1213 C CB    . GLU A 172 ? 1.0695 1.1783 1.1216 -0.1772 0.0800  0.1151  166 GLU A CB    
1214 N N     . ILE A 173 ? 1.0062 1.1430 1.0272 -0.1423 0.0783  0.1155  167 ILE A N     
1215 C CA    . ILE A 173 ? 0.9710 1.1329 0.9895 -0.1329 0.0786  0.1096  167 ILE A CA    
1216 C C     . ILE A 173 ? 1.0132 1.1828 1.0171 -0.1317 0.0873  0.1212  167 ILE A C     
1217 O O     . ILE A 173 ? 1.0142 1.1649 1.0034 -0.1304 0.0884  0.1328  167 ILE A O     
1218 C CB    . ILE A 173 ? 0.9855 1.1422 0.9977 -0.1193 0.0687  0.1005  167 ILE A CB    
1219 N N     . GLU A 174 ? 0.9568 1.1540 0.9647 -0.1324 0.0939  0.1183  168 GLU A N     
1220 C CA    . GLU A 174 ? 0.9577 1.1653 0.9501 -0.1315 0.1027  0.1279  168 GLU A CA    
1221 C C     . GLU A 174 ? 0.9742 1.1808 0.9485 -0.1179 0.0970  0.1255  168 GLU A C     
1222 O O     . GLU A 174 ? 0.9539 1.1699 0.9328 -0.1100 0.0914  0.1125  168 GLU A O     
1223 C CB    . GLU A 174 ? 0.9614 1.1990 0.9644 -0.1361 0.1120  0.1236  168 GLU A CB    
1224 N N     . ARG A 175 ? 0.9182 1.1126 0.8727 -0.1152 0.0980  0.1385  169 ARG A N     
1225 C CA    . ARG A 175 ? 0.8993 1.0929 0.8356 -0.1034 0.0924  0.1385  169 ARG A CA    
1226 C C     . ARG A 175 ? 0.9132 1.1320 0.8483 -0.0976 0.0932  0.1258  169 ARG A C     
1227 O O     . ARG A 175 ? 0.8916 1.1099 0.8245 -0.0882 0.0852  0.1163  169 ARG A O     
1228 C CB    . ARG A 175 ? 0.9149 1.1012 0.8308 -0.1036 0.0962  0.1561  169 ARG A CB    
1229 N N     . ASN A 176 ? 0.8523 1.0926 0.7912 -0.1035 0.1036  0.1247  170 ASN A N     
1230 C CA    . ASN A 176 ? 0.8294 1.0939 0.7686 -0.0990 0.1069  0.1124  170 ASN A CA    
1231 C C     . ASN A 176 ? 0.8215 1.0913 0.7799 -0.0942 0.1010  0.0958  170 ASN A C     
1232 O O     . ASN A 176 ? 0.8084 1.0874 0.7627 -0.0859 0.0984  0.0851  170 ASN A O     
1233 C CB    . ASN A 176 ? 0.8648 1.1493 0.8050 -0.1069 0.1205  0.1161  170 ASN A CB    
1234 N N     . GLU A 177 ? 0.7413 1.0047 0.7200 -0.0998 0.0985  0.0940  171 GLU A N     
1235 C CA    . GLU A 177 ? 0.7012 0.9684 0.6984 -0.0958 0.0919  0.0802  171 GLU A CA    
1236 C C     . GLU A 177 ? 0.7302 0.9804 0.7199 -0.0864 0.0804  0.0755  171 GLU A C     
1237 O O     . GLU A 177 ? 0.7117 0.9686 0.7074 -0.0790 0.0759  0.0636  171 GLU A O     
1238 C CB    . GLU A 177 ? 0.7121 0.9762 0.7304 -0.1053 0.0912  0.0806  171 GLU A CB    
1239 N N     . LEU A 178 ? 0.6818 0.9099 0.6590 -0.0863 0.0761  0.0854  172 LEU A N     
1240 C CA    . LEU A 178 ? 0.6598 0.8713 0.6295 -0.0775 0.0660  0.0827  172 LEU A CA    
1241 C C     . LEU A 178 ? 0.6906 0.9142 0.6481 -0.0684 0.0650  0.0766  172 LEU A C     
1242 O O     . LEU A 178 ? 0.6788 0.9024 0.6404 -0.0612 0.0586  0.0658  172 LEU A O     
1243 C CB    . LEU A 178 ? 0.6693 0.8572 0.6278 -0.0789 0.0638  0.0962  172 LEU A CB    
1244 C CG    . LEU A 178 ? 0.7122 0.8799 0.6645 -0.0705 0.0541  0.0957  172 LEU A CG    
1245 C CD1   . LEU A 178 ? 0.7255 0.8922 0.6589 -0.0639 0.0529  0.1037  172 LEU A CD1   
1246 C CD2   . LEU A 178 ? 0.6966 0.8657 0.6584 -0.0642 0.0467  0.0810  172 LEU A CD2   
1247 N N     . LEU A 179 ? 0.6272 0.8621 0.5703 -0.0697 0.0720  0.0829  173 LEU A N     
1248 C CA    . LEU A 179 ? 0.6132 0.8610 0.5427 -0.0629 0.0720  0.0770  173 LEU A CA    
1249 C C     . LEU A 179 ? 0.6740 0.9377 0.6162 -0.0595 0.0736  0.0610  173 LEU A C     
1250 O O     . LEU A 179 ? 0.6644 0.9281 0.6041 -0.0517 0.0679  0.0513  173 LEU A O     
1251 C CB    . LEU A 179 ? 0.6259 0.8846 0.5375 -0.0666 0.0804  0.0865  173 LEU A CB    
1252 C CG    . LEU A 179 ? 0.7021 0.9473 0.6020 -0.0710 0.0814  0.1047  173 LEU A CG    
1253 C CD1   . LEU A 179 ? 0.7195 0.9776 0.5990 -0.0728 0.0882  0.1126  173 LEU A CD1   
1254 C CD2   . LEU A 179 ? 0.7549 0.9799 0.6490 -0.0648 0.0709  0.1100  173 LEU A CD2   
1255 N N     . ARG A 180 ? 0.6287 0.9052 0.5863 -0.0654 0.0813  0.0585  174 ARG A N     
1256 C CA    . ARG A 180 ? 0.6107 0.9030 0.5836 -0.0620 0.0838  0.0447  174 ARG A CA    
1257 C C     . ARG A 180 ? 0.6376 0.9192 0.6224 -0.0560 0.0733  0.0361  174 ARG A C     
1258 O O     . ARG A 180 ? 0.6034 0.8899 0.5888 -0.0484 0.0711  0.0251  174 ARG A O     
1259 C CB    . ARG A 180 ? 0.6211 0.9279 0.6113 -0.0698 0.0927  0.0460  174 ARG A CB    
1260 N N     . LYS A 181 ? 0.6055 0.8707 0.5974 -0.0594 0.0669  0.0414  175 LYS A N     
1261 C CA    . LYS A 181 ? 0.5925 0.8459 0.5939 -0.0548 0.0571  0.0347  175 LYS A CA    
1262 C C     . LYS A 181 ? 0.6641 0.9074 0.6519 -0.0458 0.0502  0.0311  175 LYS A C     
1263 O O     . LYS A 181 ? 0.6454 0.8861 0.6402 -0.0398 0.0444  0.0220  175 LYS A O     
1264 C CB    . LYS A 181 ? 0.5987 0.8357 0.6065 -0.0615 0.0530  0.0416  175 LYS A CB    
1265 N N     . LEU A 182 ? 0.6491 0.8883 0.6178 -0.0451 0.0510  0.0386  176 LEU A N     
1266 C CA    . LEU A 182 ? 0.6513 0.8835 0.6067 -0.0375 0.0447  0.0366  176 LEU A CA    
1267 C C     . LEU A 182 ? 0.7306 0.9785 0.6815 -0.0326 0.0474  0.0258  176 LEU A C     
1268 O O     . LEU A 182 ? 0.7052 0.9495 0.6568 -0.0261 0.0416  0.0173  176 LEU A O     
1269 C CB    . LEU A 182 ? 0.6656 0.8890 0.6037 -0.0387 0.0439  0.0497  176 LEU A CB    
1270 C CG    . LEU A 182 ? 0.7309 0.9337 0.6713 -0.0414 0.0402  0.0598  176 LEU A CG    
1271 C CD1   . LEU A 182 ? 0.7562 0.9541 0.6814 -0.0435 0.0424  0.0745  176 LEU A CD1   
1272 C CD2   . LEU A 182 ? 0.7511 0.9386 0.6946 -0.0348 0.0310  0.0553  176 LEU A CD2   
1273 N N     . VAL A 183 ? 0.7224 0.9871 0.6688 -0.0361 0.0568  0.0257  177 VAL A N     
1274 C CA    . VAL A 183 ? 0.7232 1.0026 0.6653 -0.0320 0.0610  0.0141  177 VAL A CA    
1275 C C     . VAL A 183 ? 0.7645 1.0467 0.7261 -0.0277 0.0601  0.0017  177 VAL A C     
1276 O O     . VAL A 183 ? 0.7353 1.0177 0.6953 -0.0215 0.0574  -0.0086 177 VAL A O     
1277 C CB    . VAL A 183 ? 0.7844 1.0812 0.7182 -0.0367 0.0726  0.0158  177 VAL A CB    
1278 C CG1   . VAL A 183 ? 0.7843 1.0926 0.7082 -0.0323 0.0761  0.0037  177 VAL A CG1   
1279 C CG2   . VAL A 183 ? 0.8016 1.0949 0.7182 -0.0420 0.0739  0.0310  177 VAL A CG2   
1280 N N     . ASP A 184 ? 0.7397 1.0230 0.7200 -0.0312 0.0614  0.0035  178 ASP A N     
1281 C CA    . ASP A 184 ? 0.7310 1.0174 0.7319 -0.0275 0.0596  -0.0056 178 ASP A CA    
1282 C C     . ASP A 184 ? 0.7567 1.0282 0.7578 -0.0207 0.0493  -0.0109 178 ASP A C     
1283 O O     . ASP A 184 ? 0.7462 1.0209 0.7582 -0.0151 0.0483  -0.0205 178 ASP A O     
1284 C CB    . ASP A 184 ? 0.7387 1.0272 0.7571 -0.0339 0.0603  -0.0002 178 ASP A CB    
1285 N N     . ILE A 185 ? 0.6966 0.9522 0.6855 -0.0208 0.0423  -0.0043 179 ILE A N     
1286 C CA    . ILE A 185 ? 0.6805 0.9220 0.6683 -0.0148 0.0334  -0.0084 179 ILE A CA    
1287 C C     . ILE A 185 ? 0.7404 0.9805 0.7118 -0.0105 0.0313  -0.0112 179 ILE A C     
1288 O O     . ILE A 185 ? 0.7163 0.9434 0.6821 -0.0077 0.0240  -0.0091 179 ILE A O     
1289 C CB    . ILE A 185 ? 0.7060 0.9301 0.6985 -0.0165 0.0260  -0.0022 179 ILE A CB    
1290 C CG1   . ILE A 185 ? 0.7186 0.9328 0.6994 -0.0212 0.0257  0.0101  179 ILE A CG1   
1291 C CG2   . ILE A 185 ? 0.7023 0.9294 0.7131 -0.0196 0.0260  -0.0039 179 ILE A CG2   
1292 C CD1   . ILE A 185 ? 0.7829 0.9766 0.7620 -0.0195 0.0179  0.0140  179 ILE A CD1   
1293 N N     . GLN A 186 ? 0.7180 0.9723 0.6817 -0.0103 0.0380  -0.0163 180 GLN A N     
1294 C CA    . GLN A 186 ? 0.7257 0.9823 0.6733 -0.0075 0.0367  -0.0207 180 GLN A CA    
1295 C C     . GLN A 186 ? 0.7536 1.0067 0.6820 -0.0097 0.0332  -0.0099 180 GLN A C     
1296 O O     . GLN A 186 ? 0.7402 0.9941 0.6567 -0.0072 0.0294  -0.0131 180 GLN A O     
1297 C CB    . GLN A 186 ? 0.7247 0.9744 0.6779 -0.0012 0.0311  -0.0312 180 GLN A CB    
1298 N N     . TYR A 187 ? 0.6885 0.9387 0.6144 -0.0146 0.0347  0.0030  181 TYR A N     
1299 C CA    . TYR A 187 ? 0.6857 0.9329 0.5949 -0.0161 0.0320  0.0147  181 TYR A CA    
1300 C C     . TYR A 187 ? 0.7506 1.0135 0.6453 -0.0203 0.0399  0.0172  181 TYR A C     
1301 O O     . TYR A 187 ? 0.7687 1.0396 0.6685 -0.0247 0.0484  0.0179  181 TYR A O     
1310 N N     . ALA A 188 ? 0.6811 0.9497 0.5577 -0.0191 0.0372  0.0180  182 ALA A N     
1311 C CA    . ALA A 188 ? 0.6782 0.9617 0.5370 -0.0231 0.0439  0.0204  182 ALA A CA    
1312 C C     . ALA A 188 ? 0.7009 0.9807 0.5485 -0.0265 0.0433  0.0386  182 ALA A C     
1313 O O     . ALA A 188 ? 0.7052 0.9708 0.5569 -0.0245 0.0364  0.0477  182 ALA A O     
1314 C CB    . ALA A 188 ? 0.6941 0.9858 0.5383 -0.0207 0.0402  0.0114  182 ALA A CB    
1315 N N     . ARG A 189 ? 0.6467 0.9384 0.4801 -0.0315 0.0510  0.0445  183 ARG A N     
1316 C CA    . ARG A 189 ? 0.6478 0.9353 0.4692 -0.0345 0.0504  0.0633  183 ARG A CA    
1317 C C     . ARG A 189 ? 0.6996 0.9963 0.4972 -0.0333 0.0457  0.0673  183 ARG A C     
1318 O O     . ARG A 189 ? 0.7050 1.0170 0.4898 -0.0349 0.0497  0.0580  183 ARG A O     
1319 C CB    . ARG A 189 ? 0.6195 0.9115 0.4416 -0.0416 0.0616  0.0713  183 ARG A CB    
1320 C CG    . ARG A 189 ? 0.6724 0.9541 0.4873 -0.0443 0.0606  0.0917  183 ARG A CG    
1321 C CD    . ARG A 189 ? 0.7787 1.0660 0.5923 -0.0522 0.0723  0.1000  183 ARG A CD    
1322 N NE    . ARG A 189 ? 0.8525 1.1343 0.6511 -0.0547 0.0723  0.1199  183 ARG A NE    
1323 C CZ    . ARG A 189 ? 1.0540 1.3353 0.8514 -0.0620 0.0815  0.1320  183 ARG A CZ    
1324 N NH1   . ARG A 189 ? 0.8562 1.1438 0.6679 -0.0677 0.0911  0.1257  183 ARG A NH1   
1325 N NH2   . ARG A 189 ? 0.9384 1.2131 0.7216 -0.0635 0.0810  0.1509  183 ARG A NH2   
1326 N N     . ASN A 190 ? 0.6498 0.9376 0.4417 -0.0305 0.0371  0.0808  184 ASN A N     
1327 C CA    . ASN A 190 ? 0.6677 0.9646 0.4390 -0.0288 0.0303  0.0860  184 ASN A CA    
1328 C C     . ASN A 190 ? 0.7568 1.0444 0.5226 -0.0276 0.0259  0.1074  184 ASN A C     
1329 O O     . ASN A 190 ? 0.7393 1.0138 0.5150 -0.0222 0.0178  0.1122  184 ASN A O     
1330 C CB    . ASN A 190 ? 0.6770 0.9736 0.4532 -0.0232 0.0205  0.0738  184 ASN A CB    
1331 C CG    . ASN A 190 ? 0.8491 1.1631 0.6082 -0.0242 0.0185  0.0627  184 ASN A CG    
1332 O OD1   . ASN A 190 ? 0.6820 1.0091 0.4193 -0.0276 0.0199  0.0692  184 ASN A OD1   
1333 N ND2   . ASN A 190 ? 0.6661 0.9798 0.4345 -0.0213 0.0147  0.0459  184 ASN A ND2   
1334 N N     . ASP A 191 ? 0.7688 1.0625 0.5188 -0.0324 0.0319  0.1208  185 ASP A N     
1335 C CA    . ASP A 191 ? 0.7883 1.0731 0.5312 -0.0314 0.0290  0.1432  185 ASP A CA    
1336 C C     . ASP A 191 ? 0.8491 1.1452 0.5735 -0.0276 0.0191  0.1494  185 ASP A C     
1337 O O     . ASP A 191 ? 0.8676 1.1557 0.5903 -0.0235 0.0126  0.1663  185 ASP A O     
1338 C CB    . ASP A 191 ? 0.8365 1.1230 0.5703 -0.0386 0.0402  0.1559  185 ASP A CB    
1339 C CG    . ASP A 191 ? 0.9364 1.2159 0.6872 -0.0442 0.0510  0.1511  185 ASP A CG    
1340 O OD1   . ASP A 191 ? 0.9244 1.1958 0.6960 -0.0422 0.0496  0.1382  185 ASP A OD1   
1341 O OD2   . ASP A 191 ? 0.9658 1.2486 0.7096 -0.0508 0.0608  0.1606  185 ASP A OD2   
1342 N N     . ILE A 192 ? 0.7973 1.1120 0.5087 -0.0290 0.0177  0.1354  186 ILE A N     
1343 C CA    . ILE A 192 ? 0.8041 1.1334 0.4965 -0.0270 0.0078  0.1383  186 ILE A CA    
1344 C C     . ILE A 192 ? 0.8484 1.1745 0.5535 -0.0204 -0.0042 0.1306  186 ILE A C     
1345 O O     . ILE A 192 ? 0.8728 1.2007 0.5735 -0.0159 -0.0142 0.1429  186 ILE A O     
1346 C CB    . ILE A 192 ? 0.8479 1.1986 0.5180 -0.0330 0.0127  0.1269  186 ILE A CB    
1347 C CG1   . ILE A 192 ? 0.8722 1.2271 0.5295 -0.0398 0.0259  0.1347  186 ILE A CG1   
1348 C CG2   . ILE A 192 ? 0.8629 1.2300 0.5122 -0.0321 0.0017  0.1294  186 ILE A CG2   
1349 C CD1   . ILE A 192 ? 0.9611 1.3099 0.6093 -0.0403 0.0264  0.1618  186 ILE A CD1   
1350 N N     . ASP A 193 ? 0.7527 1.0751 0.4736 -0.0197 -0.0029 0.1108  187 ASP A N     
1351 C CA    . ASP A 193 ? 0.7219 1.0412 0.4556 -0.0142 -0.0127 0.1015  187 ASP A CA    
1352 C C     . ASP A 193 ? 0.7188 1.0179 0.4785 -0.0107 -0.0109 0.0970  187 ASP A C     
1353 O O     . ASP A 193 ? 0.6967 0.9939 0.4676 -0.0111 -0.0082 0.0796  187 ASP A O     
1354 C CB    . ASP A 193 ? 0.7450 1.0797 0.4704 -0.0169 -0.0141 0.0813  187 ASP A CB    
1355 C CG    . ASP A 193 ? 0.8943 1.2495 0.5939 -0.0201 -0.0192 0.0837  187 ASP A CG    
1356 O OD1   . ASP A 193 ? 0.8925 1.2525 0.5768 -0.0213 -0.0194 0.1014  187 ASP A OD1   
1357 O OD2   . ASP A 193 ? 1.0342 1.4004 0.7281 -0.0219 -0.0228 0.0677  187 ASP A OD2   
1358 N N     . PHE A 194 ? 0.6533 0.9368 0.4219 -0.0072 -0.0123 0.1128  188 PHE A N     
1359 C CA    . PHE A 194 ? 0.6169 0.8800 0.4079 -0.0044 -0.0107 0.1108  188 PHE A CA    
1360 C C     . PHE A 194 ? 0.6430 0.9016 0.4473 0.0014  -0.0188 0.1013  188 PHE A C     
1361 O O     . PHE A 194 ? 0.6606 0.9222 0.4630 0.0062  -0.0275 0.1083  188 PHE A O     
1362 C CB    . PHE A 194 ? 0.6399 0.8871 0.4338 -0.0032 -0.0090 0.1307  188 PHE A CB    
1363 C CG    . PHE A 194 ? 0.6281 0.8534 0.4420 -0.0019 -0.0062 0.1296  188 PHE A CG    
1364 C CD1   . PHE A 194 ? 0.6578 0.8794 0.4815 -0.0066 0.0012  0.1180  188 PHE A CD1   
1365 C CD2   . PHE A 194 ? 0.6433 0.8520 0.4660 0.0040  -0.0106 0.1407  188 PHE A CD2   
1366 C CE1   . PHE A 194 ? 0.6611 0.8632 0.5018 -0.0062 0.0030  0.1169  188 PHE A CE1   
1367 C CE2   . PHE A 194 ? 0.6751 0.8629 0.5142 0.0044  -0.0077 0.1390  188 PHE A CE2   
1368 C CZ    . PHE A 194 ? 0.6473 0.8322 0.4947 -0.0011 -0.0013 0.1271  188 PHE A CZ    
1369 N N     . GLN A 195 ? 0.5667 0.8189 0.3851 0.0011  -0.0159 0.0857  189 GLN A N     
1370 C CA    . GLN A 195 ? 0.5435 0.7909 0.3751 0.0058  -0.0220 0.0748  189 GLN A CA    
1371 C C     . GLN A 195 ? 0.5751 0.8096 0.4235 0.0054  -0.0170 0.0639  189 GLN A C     
1372 O O     . GLN A 195 ? 0.5501 0.7825 0.4000 0.0011  -0.0092 0.0631  189 GLN A O     
1373 C CB    . GLN A 195 ? 0.5637 0.8287 0.3866 0.0045  -0.0256 0.0614  189 GLN A CB    
1374 C CG    . GLN A 195 ? 0.6137 0.8863 0.4334 -0.0006 -0.0175 0.0460  189 GLN A CG    
1375 C CD    . GLN A 195 ? 0.7972 1.0890 0.5994 -0.0043 -0.0181 0.0377  189 GLN A CD    
1376 O OE1   . GLN A 195 ? 0.6178 0.9202 0.4078 -0.0040 -0.0255 0.0432  189 GLN A OE1   
1377 N NE2   . GLN A 195 ? 0.8982 1.1951 0.6987 -0.0078 -0.0103 0.0239  189 GLN A NE2   
1378 N N     . ARG A 196 ? 0.5413 0.7694 0.4020 0.0096  -0.0217 0.0549  190 ARG A N     
1379 C CA    . ARG A 196 ? 0.5219 0.7390 0.3979 0.0101  -0.0189 0.0436  190 ARG A CA    
1380 C C     . ARG A 196 ? 0.5686 0.7945 0.4429 0.0053  -0.0116 0.0327  190 ARG A C     
1381 O O     . ARG A 196 ? 0.5781 0.8191 0.4412 0.0031  -0.0106 0.0268  190 ARG A O     
1382 C CB    . ARG A 196 ? 0.5164 0.7318 0.4005 0.0145  -0.0250 0.0342  190 ARG A CB    
1383 N N     . GLY A 197 ? 0.5142 0.7314 0.3995 0.0036  -0.0064 0.0306  191 GLY A N     
1384 C CA    . GLY A 197 ? 0.5107 0.7361 0.3984 -0.0001 0.0012  0.0213  191 GLY A CA    
1385 C C     . GLY A 197 ? 0.5844 0.8183 0.4628 -0.0056 0.0083  0.0290  191 GLY A C     
1386 O O     . GLY A 197 ? 0.5926 0.8341 0.4742 -0.0087 0.0156  0.0221  191 GLY A O     
1387 N N     . THR A 198 ? 0.5433 0.7765 0.4102 -0.0066 0.0068  0.0437  192 THR A N     
1388 C CA    . THR A 198 ? 0.5553 0.7958 0.4119 -0.0120 0.0138  0.0530  192 THR A CA    
1389 C C     . THR A 198 ? 0.6109 0.8371 0.4711 -0.0139 0.0150  0.0685  192 THR A C     
1390 O O     . THR A 198 ? 0.5915 0.8022 0.4595 -0.0102 0.0096  0.0732  192 THR A O     
1391 C CB    . THR A 198 ? 0.6595 0.9160 0.4948 -0.0131 0.0130  0.0560  192 THR A CB    
1392 O OG1   . THR A 198 ? 0.6557 0.9079 0.4831 -0.0102 0.0058  0.0701  192 THR A OG1   
1393 C CG2   . THR A 198 ? 0.6578 0.9263 0.4888 -0.0119 0.0113  0.0398  192 THR A CG2   
1394 N N     . PHE A 199 ? 0.5781 0.8094 0.4324 -0.0199 0.0229  0.0764  193 PHE A N     
1395 C CA    . PHE A 199 ? 0.5820 0.8007 0.4376 -0.0233 0.0258  0.0918  193 PHE A CA    
1396 C C     . PHE A 199 ? 0.6200 0.8491 0.4576 -0.0272 0.0304  0.1038  193 PHE A C     
1397 O O     . PHE A 199 ? 0.6378 0.8844 0.4659 -0.0297 0.0350  0.0972  193 PHE A O     
1398 C CB    . PHE A 199 ? 0.6065 0.8185 0.4785 -0.0284 0.0318  0.0883  193 PHE A CB    
1399 C CG    . PHE A 199 ? 0.6446 0.8731 0.5176 -0.0341 0.0410  0.0816  193 PHE A CG    
1400 C CD1   . PHE A 199 ? 0.7106 0.9441 0.5774 -0.0410 0.0493  0.0922  193 PHE A CD1   
1401 C CD2   . PHE A 199 ? 0.6694 0.9079 0.5514 -0.0324 0.0420  0.0651  193 PHE A CD2   
1402 C CE1   . PHE A 199 ? 0.7255 0.9750 0.5949 -0.0461 0.0588  0.0859  193 PHE A CE1   
1403 C CE2   . PHE A 199 ? 0.7066 0.9603 0.5918 -0.0368 0.0513  0.0590  193 PHE A CE2   
1404 C CZ    . PHE A 199 ? 0.7020 0.9618 0.5811 -0.0436 0.0597  0.0692  193 PHE A CZ    
1405 N N     . ARG A 200 ? 0.5583 0.7762 0.3908 -0.0276 0.0299  0.1214  194 ARG A N     
1406 C CA    . ARG A 200 ? 0.5738 0.7996 0.3883 -0.0311 0.0341  0.1359  194 ARG A CA    
1407 C C     . ARG A 200 ? 0.6429 0.8555 0.4624 -0.0372 0.0413  0.1492  194 ARG A C     
1408 O O     . ARG A 200 ? 0.6313 0.8248 0.4653 -0.0367 0.0400  0.1507  194 ARG A O     
1409 C CB    . ARG A 200 ? 0.5835 0.8103 0.3842 -0.0248 0.0252  0.1467  194 ARG A CB    
1410 C CG    . ARG A 200 ? 0.6687 0.8759 0.4717 -0.0219 0.0225  0.1655  194 ARG A CG    
1411 C CD    . ARG A 200 ? 0.7461 0.9458 0.5547 -0.0127 0.0118  0.1661  194 ARG A CD    
1412 N NE    . ARG A 200 ? 0.8573 1.0719 0.6497 -0.0085 0.0047  0.1732  194 ARG A NE    
1413 C CZ    . ARG A 200 ? 0.9483 1.1568 0.7402 -0.0012 -0.0030 0.1856  194 ARG A CZ    
1414 N NH1   . ARG A 200 ? 0.3218 0.5080 0.1285 0.0031  -0.0037 0.1918  194 ARG A NH1   
1415 N NH2   . ARG A 200 ? 0.9239 1.1492 0.7010 0.0019  -0.0099 0.1920  194 ARG A NH2   
1416 N N     . VAL A 201 ? 0.6296 0.8516 0.4363 -0.0433 0.0493  0.1586  195 VAL A N     
1417 C CA    . VAL A 201 ? 0.6447 0.8544 0.4549 -0.0501 0.0569  0.1727  195 VAL A CA    
1418 C C     . VAL A 201 ? 0.7666 0.9730 0.5587 -0.0488 0.0560  0.1934  195 VAL A C     
1419 O O     . VAL A 201 ? 0.8005 1.0239 0.5740 -0.0510 0.0593  0.1982  195 VAL A O     
1420 C CB    . VAL A 201 ? 0.6814 0.9025 0.4961 -0.0595 0.0688  0.1678  195 VAL A CB    
1421 C CG1   . VAL A 201 ? 0.6881 0.8949 0.5076 -0.0672 0.0762  0.1829  195 VAL A CG1   
1422 C CG2   . VAL A 201 ? 0.6557 0.8807 0.4897 -0.0596 0.0688  0.1481  195 VAL A CG2   
1423 N N     . ARG A 202 ? 0.7431 0.9281 0.5403 -0.0448 0.0515  0.2058  196 ARG A N     
1424 C CA    . ARG A 202 ? 0.7762 0.9562 0.5582 -0.0426 0.0504  0.2275  196 ARG A CA    
1425 C C     . ARG A 202 ? 0.8891 1.0623 0.6685 -0.0521 0.0620  0.2415  196 ARG A C     
1426 O O     . ARG A 202 ? 0.9086 1.0991 0.6733 -0.0576 0.0686  0.2448  196 ARG A O     
1427 C CB    . ARG A 202 ? 0.7802 0.9402 0.5696 -0.0336 0.0419  0.2353  196 ARG A CB    
1428 N N     . GLY A 203 ? 0.8565 1.0051 0.6498 -0.0547 0.0650  0.2483  197 GLY A N     
1429 C CA    . GLY A 203 ? 0.8784 1.0181 0.6716 -0.0645 0.0760  0.2611  197 GLY A CA    
1430 C C     . GLY A 203 ? 0.9165 1.0513 0.7300 -0.0728 0.0817  0.2475  197 GLY A C     
1431 O O     . GLY A 203 ? 0.9002 1.0542 0.7176 -0.0759 0.0839  0.2317  197 GLY A O     
1432 N N     . ASP A 204 ? 0.8738 0.9824 0.7008 -0.0758 0.0833  0.2525  198 ASP A N     
1433 C CA    . ASP A 204 ? 0.8545 0.9566 0.7019 -0.0835 0.0865  0.2392  198 ASP A CA    
1434 C C     . ASP A 204 ? 0.8805 0.9754 0.7384 -0.0748 0.0761  0.2242  198 ASP A C     
1435 O O     . ASP A 204 ? 0.8713 0.9491 0.7446 -0.0774 0.0752  0.2172  198 ASP A O     
1436 C CB    . ASP A 204 ? 0.8855 0.9619 0.7402 -0.0916 0.0931  0.2517  198 ASP A CB    
1437 N N     . VAL A 205 ? 0.8167 0.9256 0.6652 -0.0649 0.0684  0.2192  199 VAL A N     
1438 C CA    . VAL A 205 ? 0.7822 0.8871 0.6375 -0.0556 0.0586  0.2072  199 VAL A CA    
1439 C C     . VAL A 205 ? 0.8315 0.9611 0.6858 -0.0527 0.0549  0.1899  199 VAL A C     
1440 O O     . VAL A 205 ? 0.8497 0.9997 0.6899 -0.0523 0.0563  0.1912  199 VAL A O     
1441 C CB    . VAL A 205 ? 0.8212 0.9134 0.6684 -0.0454 0.0520  0.2206  199 VAL A CB    
1442 C CG1   . VAL A 205 ? 0.7940 0.8945 0.6415 -0.0350 0.0418  0.2098  199 VAL A CG1   
1443 C CG2   . VAL A 205 ? 0.8284 0.8894 0.6851 -0.0458 0.0537  0.2294  199 VAL A CG2   
1444 N N     . VAL A 206 ? 0.7466 0.8729 0.6152 -0.0506 0.0505  0.1737  200 VAL A N     
1445 C CA    . VAL A 206 ? 0.7121 0.8567 0.5826 -0.0467 0.0464  0.1567  200 VAL A CA    
1446 C C     . VAL A 206 ? 0.7470 0.8811 0.6212 -0.0369 0.0366  0.1518  200 VAL A C     
1447 O O     . VAL A 206 ? 0.7526 0.8675 0.6384 -0.0364 0.0347  0.1495  200 VAL A O     
1448 C CB    . VAL A 206 ? 0.7357 0.8887 0.6209 -0.0533 0.0507  0.1422  200 VAL A CB    
1449 C CG1   . VAL A 206 ? 0.7115 0.8818 0.5984 -0.0482 0.0468  0.1254  200 VAL A CG1   
1450 C CG2   . VAL A 206 ? 0.7428 0.9065 0.6264 -0.0632 0.0612  0.1478  200 VAL A CG2   
1451 N N     . GLU A 207 ? 0.6730 0.8194 0.5367 -0.0297 0.0307  0.1506  201 GLU A N     
1452 C CA    . GLU A 207 ? 0.6419 0.7824 0.5089 -0.0205 0.0217  0.1459  201 GLU A CA    
1453 C C     . GLU A 207 ? 0.6373 0.7925 0.5090 -0.0189 0.0189  0.1270  201 GLU A C     
1454 O O     . GLU A 207 ? 0.6237 0.7987 0.4868 -0.0207 0.0209  0.1220  201 GLU A O     
1455 C CB    . GLU A 207 ? 0.6728 0.8177 0.5261 -0.0138 0.0164  0.1587  201 GLU A CB    
1456 C CG    . GLU A 207 ? 0.8337 0.9615 0.6838 -0.0132 0.0184  0.1787  201 GLU A CG    
1457 C CD    . GLU A 207 ? 1.1074 1.2392 0.9463 -0.0055 0.0123  0.1930  201 GLU A CD    
1458 O OE1   . GLU A 207 ? 1.2503 1.3865 1.0916 0.0023  0.0042  0.1880  201 GLU A OE1   
1459 O OE2   . GLU A 207 ? 0.8750 1.0042 0.7039 -0.0071 0.0156  0.2104  201 GLU A OE2   
1460 N N     . ILE A 208 ? 0.5698 0.7146 0.4549 -0.0161 0.0153  0.1164  202 ILE A N     
1461 C CA    . ILE A 208 ? 0.5530 0.7085 0.4444 -0.0144 0.0128  0.0990  202 ILE A CA    
1462 C C     . ILE A 208 ? 0.6071 0.7598 0.4996 -0.0060 0.0046  0.0948  202 ILE A C     
1463 O O     . ILE A 208 ? 0.6038 0.7392 0.5022 -0.0023 0.0016  0.0988  202 ILE A O     
1464 C CB    . ILE A 208 ? 0.5808 0.7297 0.4874 -0.0189 0.0157  0.0893  202 ILE A CB    
1465 C CG1   . ILE A 208 ? 0.5993 0.7484 0.5082 -0.0281 0.0238  0.0953  202 ILE A CG1   
1466 C CG2   . ILE A 208 ? 0.5626 0.7248 0.4751 -0.0172 0.0144  0.0729  202 ILE A CG2   
1467 C CD1   . ILE A 208 ? 0.6366 0.7648 0.5552 -0.0320 0.0246  0.0991  202 ILE A CD1   
1468 N N     . PHE A 209 ? 0.5665 0.7357 0.4540 -0.0033 0.0016  0.0856  203 PHE A N     
1469 C CA    . PHE A 209 ? 0.5578 0.7281 0.4460 0.0036  -0.0060 0.0808  203 PHE A CA    
1470 C C     . PHE A 209 ? 0.6105 0.7837 0.5085 0.0049  -0.0074 0.0634  203 PHE A C     
1471 O O     . PHE A 209 ? 0.5963 0.7848 0.4895 0.0045  -0.0073 0.0543  203 PHE A O     
1472 C CB    . PHE A 209 ? 0.5927 0.7803 0.4659 0.0049  -0.0089 0.0851  203 PHE A CB    
1473 C CG    . PHE A 209 ? 0.6200 0.8084 0.4920 0.0118  -0.0173 0.0885  203 PHE A CG    
1474 C CD1   . PHE A 209 ? 0.6764 0.8731 0.5362 0.0136  -0.0208 0.1015  203 PHE A CD1   
1475 C CD2   . PHE A 209 ? 0.6385 0.8212 0.5217 0.0163  -0.0219 0.0789  203 PHE A CD2   
1476 C CE1   . PHE A 209 ? 0.6930 0.8934 0.5534 0.0199  -0.0291 0.1046  203 PHE A CE1   
1477 C CE2   . PHE A 209 ? 0.6736 0.8592 0.5573 0.0223  -0.0293 0.0819  203 PHE A CE2   
1478 C CZ    . PHE A 209 ? 0.6631 0.8579 0.5362 0.0241  -0.0331 0.0947  203 PHE A CZ    
1479 N N     . PRO A 210 ? 0.5762 0.7343 0.4866 0.0068  -0.0088 0.0587  204 PRO A N     
1480 C CA    . PRO A 210 ? 0.5902 0.7511 0.5091 0.0084  -0.0103 0.0435  204 PRO A CA    
1481 C C     . PRO A 210 ? 0.9589 1.1242 0.8770 0.0140  -0.0163 0.0379  204 PRO A C     
1482 O O     . PRO A 210 ? 0.5070 0.6804 0.4276 0.0146  -0.0168 0.0257  204 PRO A O     
1483 C CB    . PRO A 210 ? 0.5973 0.7409 0.5276 0.0077  -0.0097 0.0422  204 PRO A CB    
1484 C CG    . PRO A 210 ? 0.6511 0.7798 0.5793 0.0088  -0.0103 0.0551  204 PRO A CG    
1485 C CD    . PRO A 210 ? 0.6081 0.7458 0.5248 0.0072  -0.0085 0.0665  204 PRO A CD    
1486 N N     . ARG A 213 ? 0.9683 1.1210 0.9100 0.0327  -0.0346 0.0163  207 ARG A N     
1487 C CA    . ARG A 213 ? 0.9729 1.1249 0.9152 0.0373  -0.0390 0.0247  207 ARG A CA    
1488 C C     . ARG A 213 ? 1.0443 1.1834 0.9865 0.0391  -0.0375 0.0377  207 ARG A C     
1489 O O     . ARG A 213 ? 1.0511 1.1839 0.9908 0.0353  -0.0332 0.0401  207 ARG A O     
1490 C CB    . ARG A 213 ? 0.9510 1.0994 0.9026 0.0412  -0.0419 0.0182  207 ARG A CB    
1491 C CG    . ARG A 213 ? 1.0280 1.1931 0.9781 0.0415  -0.0467 0.0143  207 ARG A CG    
1492 C CD    . ARG A 213 ? 1.0370 1.2010 0.9947 0.0415  -0.0471 0.0017  207 ARG A CD    
1493 N NE    . ARG A 213 ? 1.1126 1.2931 1.0668 0.0388  -0.0502 -0.0058 207 ARG A NE    
1494 C CZ    . ARG A 213 ? 1.3299 1.5114 1.2898 0.0380  -0.0505 -0.0171 207 ARG A CZ    
1495 N NH1   . ARG A 213 ? 1.2466 1.4142 1.2154 0.0401  -0.0481 -0.0212 207 ARG A NH1   
1496 N NH2   . ARG A 213 ? 1.0855 1.2813 1.0414 0.0346  -0.0532 -0.0243 207 ARG A NH2   
1497 N N     . ASP A 214 ? 1.0079 1.1433 0.9535 0.0446  -0.0405 0.0462  208 ASP A N     
1498 C CA    . ASP A 214 ? 1.0244 1.1470 0.9703 0.0477  -0.0391 0.0597  208 ASP A CA    
1499 C C     . ASP A 214 ? 1.0898 1.2177 1.0255 0.0443  -0.0375 0.0699  208 ASP A C     
1500 O O     . ASP A 214 ? 1.0912 1.2134 1.0238 0.0390  -0.0328 0.0691  208 ASP A O     
1502 N N     . GLU A 215 ? 1.0473 1.1884 0.9775 0.0470  -0.0417 0.0795  209 GLU A N     
1503 C CA    . GLU A 215 ? 1.0498 1.1985 0.9684 0.0442  -0.0409 0.0906  209 GLU A CA    
1504 C C     . GLU A 215 ? 1.1092 1.2388 1.0277 0.0436  -0.0354 0.1020  209 GLU A C     
1505 O O     . GLU A 215 ? 1.1166 1.2412 1.0344 0.0480  -0.0363 0.1165  209 GLU A O     
1506 C CB    . GLU A 215 ? 1.0639 1.2292 0.9779 0.0482  -0.0477 0.0995  209 GLU A CB    
1507 N N     . HIS A 216 ? 1.0586 1.1776 0.9789 0.0378  -0.0297 0.0949  210 HIS A N     
1508 C CA    . HIS A 216 ? 1.0621 1.1621 0.9835 0.0346  -0.0238 0.1013  210 HIS A CA    
1509 C C     . HIS A 216 ? 1.0739 1.1811 0.9885 0.0262  -0.0192 0.1001  210 HIS A C     
1510 O O     . HIS A 216 ? 1.0766 1.1972 0.9902 0.0228  -0.0192 0.0884  210 HIS A O     
1511 C CB    . HIS A 216 ? 1.0678 1.1495 0.9994 0.0346  -0.0216 0.0922  210 HIS A CB    
1512 C CG    . HIS A 216 ? 1.1186 1.1875 1.0572 0.0424  -0.0235 0.0955  210 HIS A CG    
1513 N ND1   . HIS A 216 ? 1.1578 1.2054 1.0991 0.0444  -0.0198 0.1044  210 HIS A ND1   
1514 C CD2   . HIS A 216 ? 1.1380 1.2133 1.0818 0.0486  -0.0279 0.0911  210 HIS A CD2   
1515 C CE1   . HIS A 216 ? 1.1533 1.1951 1.1015 0.0523  -0.0218 0.1051  210 HIS A CE1   
1516 N NE2   . HIS A 216 ? 1.1434 1.2023 1.0937 0.0550  -0.0268 0.0975  210 HIS A NE2   
1517 N N     . CYS A 217 ? 0.9832 1.0808 0.8942 0.0229  -0.0146 0.1118  211 CYS A N     
1518 C CA    . CYS A 217 ? 0.9593 1.0633 0.8650 0.0144  -0.0092 0.1119  211 CYS A CA    
1519 C C     . CYS A 217 ? 0.9232 1.0088 0.8304 0.0095  -0.0031 0.1213  211 CYS A C     
1520 O O     . CYS A 217 ? 0.9231 0.9945 0.8297 0.0128  -0.0026 0.1341  211 CYS A O     
1521 C CB    . CYS A 217 ? 0.9836 1.1096 0.8764 0.0133  -0.0101 0.1162  211 CYS A CB    
1522 S SG    . CYS A 217 ? 1.0666 1.1918 0.9490 0.0172  -0.0116 0.1380  211 CYS A SG    
1523 N N     . VAL A 218 ? 0.8110 0.8976 0.7214 0.0013  0.0017  0.1146  212 VAL A N     
1524 C CA    . VAL A 218 ? 0.7869 0.8586 0.7012 -0.0062 0.0077  0.1189  212 VAL A CA    
1525 C C     . VAL A 218 ? 0.8417 0.9193 0.7467 -0.0113 0.0129  0.1320  212 VAL A C     
1526 O O     . VAL A 218 ? 0.8422 0.9404 0.7411 -0.0142 0.0145  0.1296  212 VAL A O     
1527 C CB    . VAL A 218 ? 0.7991 0.8749 0.7223 -0.0124 0.0092  0.1043  212 VAL A CB    
1528 C CG1   . VAL A 218 ? 0.8038 0.8670 0.7322 -0.0217 0.0149  0.1073  212 VAL A CG1   
1529 C CG2   . VAL A 218 ? 0.7737 0.8437 0.7045 -0.0073 0.0041  0.0921  212 VAL A CG2   
1530 N N     . ARG A 219 ? 0.8002 0.8591 0.7043 -0.0125 0.0164  0.1459  213 ARG A N     
1531 C CA    . ARG A 219 ? 0.8012 0.8622 0.6965 -0.0177 0.0221  0.1605  213 ARG A CA    
1532 C C     . ARG A 219 ? 0.8563 0.9031 0.7585 -0.0280 0.0292  0.1615  213 ARG A C     
1533 O O     . ARG A 219 ? 0.8534 0.8756 0.7612 -0.0286 0.0308  0.1657  213 ARG A O     
1534 C CB    . ARG A 219 ? 0.7814 0.8343 0.6689 -0.0105 0.0203  0.1780  213 ARG A CB    
1535 C CG    . ARG A 219 ? 0.9080 0.9618 0.7855 -0.0159 0.0264  0.1945  213 ARG A CG    
1536 C CD    . ARG A 219 ? 1.0169 1.0577 0.8891 -0.0087 0.0252  0.2136  213 ARG A CD    
1537 N NE    . ARG A 219 ? 1.0515 1.1064 0.9188 0.0018  0.0166  0.2147  213 ARG A NE    
1538 C CZ    . ARG A 219 ? 1.1507 1.1971 1.0171 0.0111  0.0130  0.2285  213 ARG A CZ    
1539 N NH1   . ARG A 219 ? 0.9236 0.9454 0.7930 0.0118  0.0178  0.2426  213 ARG A NH1   
1540 N NH2   . ARG A 219 ? 0.9266 0.9891 0.7899 0.0197  0.0046  0.2284  213 ARG A NH2   
1541 N N     . VAL A 220 ? 0.8135 0.8764 0.7156 -0.0365 0.0339  0.1572  214 VAL A N     
1542 C CA    . VAL A 220 ? 0.8141 0.8702 0.7241 -0.0479 0.0406  0.1566  214 VAL A CA    
1543 C C     . VAL A 220 ? 0.9180 0.9730 0.8197 -0.0537 0.0480  0.1732  214 VAL A C     
1544 O O     . VAL A 220 ? 0.9149 0.9905 0.8073 -0.0549 0.0506  0.1766  214 VAL A O     
1545 C CB    . VAL A 220 ? 0.8284 0.9043 0.7466 -0.0531 0.0413  0.1410  214 VAL A CB    
1546 C CG1   . VAL A 220 ? 0.8320 0.9042 0.7598 -0.0655 0.0480  0.1409  214 VAL A CG1   
1547 C CG2   . VAL A 220 ? 0.7974 0.8725 0.7233 -0.0472 0.0341  0.1258  214 VAL A CG2   
1548 N N     . GLU A 221 ? 0.9193 0.9492 0.8238 -0.0575 0.0517  0.1835  215 GLU A N     
1549 C CA    . GLU A 221 ? 0.9550 0.9786 0.8532 -0.0640 0.0595  0.2005  215 GLU A CA    
1550 C C     . GLU A 221 ? 1.0325 1.0559 0.9410 -0.0781 0.0667  0.1961  215 GLU A C     
1551 O O     . GLU A 221 ? 1.0260 1.0360 0.9468 -0.0825 0.0657  0.1863  215 GLU A O     
1552 C CB    . GLU A 221 ? 0.9836 0.9782 0.8800 -0.0594 0.0598  0.2144  215 GLU A CB    
1553 N N     . PHE A 222 ? 1.0045 1.0439 0.9079 -0.0854 0.0739  0.2030  216 PHE A N     
1554 C CA    . PHE A 222 ? 1.0089 1.0524 0.9228 -0.0994 0.0814  0.2002  216 PHE A CA    
1555 C C     . PHE A 222 ? 1.1492 1.1754 1.0600 -0.1078 0.0901  0.2179  216 PHE A C     
1556 O O     . PHE A 222 ? 1.1636 1.1903 1.0601 -0.1044 0.0929  0.2337  216 PHE A O     
1557 C CB    . PHE A 222 ? 1.0078 1.0841 0.9207 -0.1022 0.0847  0.1933  216 PHE A CB    
1558 C CG    . PHE A 222 ? 0.9878 1.0810 0.9092 -0.0978 0.0785  0.1739  216 PHE A CG    
1559 C CD1   . PHE A 222 ? 1.0061 1.0980 0.9450 -0.1040 0.0773  0.1613  216 PHE A CD1   
1560 C CD2   . PHE A 222 ? 0.9977 1.1092 0.9096 -0.0883 0.0742  0.1685  216 PHE A CD2   
1561 C CE1   . PHE A 222 ? 0.9867 1.0945 0.9335 -0.0996 0.0718  0.1447  216 PHE A CE1   
1562 C CE2   . PHE A 222 ? 1.0043 1.1301 0.9244 -0.0843 0.0693  0.1511  216 PHE A CE2   
1563 C CZ    . PHE A 222 ? 0.9618 1.0853 0.8994 -0.0895 0.0681  0.1399  216 PHE A CZ    
1564 N N     . PHE A 223 ? 1.1540 1.1655 1.0782 -0.1195 0.0944  0.2154  217 PHE A N     
1565 C CA    . PHE A 223 ? 1.1913 1.1838 1.1156 -0.1298 0.1035  0.2307  217 PHE A CA    
1566 C C     . PHE A 223 ? 1.2409 1.2548 1.1657 -0.1411 0.1130  0.2356  217 PHE A C     
1567 O O     . PHE A 223 ? 1.2660 1.2706 1.1848 -0.1472 0.1213  0.2524  217 PHE A O     
1568 C CB    . PHE A 223 ? 1.2084 1.1747 1.1467 -0.1380 0.1035  0.2242  217 PHE A CB    
1569 N N     . GLY A 224 ? 1.1671 1.2091 1.0997 -0.1433 0.1122  0.2214  218 GLY A N     
1570 C CA    . GLY A 224 ? 1.1714 1.2388 1.1075 -0.1530 0.1211  0.2221  218 GLY A CA    
1571 C C     . GLY A 224 ? 1.2086 1.3029 1.1572 -0.1527 0.1178  0.2031  218 GLY A C     
1572 O O     . GLY A 224 ? 1.2106 1.3317 1.1542 -0.1502 0.1209  0.2004  218 GLY A O     
1573 N N     . ASP A 225 ? 1.1391 1.2258 1.1036 -0.1551 0.1116  0.1898  219 ASP A N     
1574 C CA    . ASP A 225 ? 1.1015 1.2100 1.0803 -0.1544 0.1071  0.1718  219 ASP A CA    
1575 C C     . ASP A 225 ? 1.1071 1.1971 1.0939 -0.1518 0.0972  0.1610  219 ASP A C     
1576 O O     . ASP A 225 ? 1.0827 1.1851 1.0825 -0.1519 0.0919  0.1466  219 ASP A O     
1577 C CB    . ASP A 225 ? 1.1331 1.2602 1.1288 -0.1684 0.1150  0.1697  219 ASP A CB    
1578 C CG    . ASP A 225 ? 1.3232 1.4845 1.3211 -0.1650 0.1185  0.1628  219 ASP A CG    
1579 O OD1   . ASP A 225 ? 1.3219 1.4984 1.3334 -0.1622 0.1131  0.1480  219 ASP A OD1   
1580 O OD2   . ASP A 225 ? 1.4321 1.6049 1.4177 -0.1646 0.1266  0.1722  219 ASP A OD2   
1581 N N     . GLU A 226 ? 1.0562 1.1165 1.0342 -0.1487 0.0949  0.1687  220 GLU A N     
1582 C CA    . GLU A 226 ? 1.0452 1.0823 1.0269 -0.1460 0.0871  0.1611  220 GLU A CA    
1583 C C     . GLU A 226 ? 1.0743 1.1020 1.0414 -0.1302 0.0812  0.1637  220 GLU A C     
1584 O O     . GLU A 226 ? 1.0952 1.1185 1.0490 -0.1254 0.0845  0.1778  220 GLU A O     
1585 C CB    . GLU A 226 ? 1.0909 1.0987 1.0755 -0.1568 0.0920  0.1695  220 GLU A CB    
1586 C CG    . GLU A 226 ? 1.2451 1.2313 1.2378 -0.1599 0.0859  0.1585  220 GLU A CG    
1587 C CD    . GLU A 226 ? 1.5979 1.5482 1.5876 -0.1657 0.0904  0.1681  220 GLU A CD    
1588 O OE1   . GLU A 226 ? 1.7113 1.6375 1.6960 -0.1582 0.0859  0.1655  220 GLU A OE1   
1589 O OE2   . GLU A 226 ? 1.4280 1.3736 1.4200 -0.1771 0.0991  0.1787  220 GLU A OE2   
1590 N N     . ILE A 227 ? 0.9730 0.9987 0.9430 -0.1223 0.0723  0.1508  221 ILE A N     
1591 C CA    . ILE A 227 ? 0.9431 0.9607 0.9018 -0.1078 0.0663  0.1520  221 ILE A CA    
1592 C C     . ILE A 227 ? 0.9966 0.9799 0.9514 -0.1073 0.0674  0.1613  221 ILE A C     
1593 O O     . ILE A 227 ? 0.9796 0.9439 0.9412 -0.1105 0.0649  0.1537  221 ILE A O     
1594 C CB    . ILE A 227 ? 0.9443 0.9716 0.9076 -0.1000 0.0574  0.1355  221 ILE A CB    
1595 C CG1   . ILE A 227 ? 0.9160 0.9766 0.8826 -0.0993 0.0575  0.1278  221 ILE A CG1   
1596 C CG2   . ILE A 227 ? 0.9507 0.9664 0.9042 -0.0861 0.0516  0.1371  221 ILE A CG2   
1597 C CD1   . ILE A 227 ? 0.8695 0.9419 0.8404 -0.0913 0.0498  0.1129  221 ILE A CD1   
1598 N N     . GLU A 228 ? 0.9727 0.9483 0.9165 -0.1041 0.0719  0.1783  222 GLU A N     
1599 C CA    . GLU A 228 ? 0.9885 0.9316 0.9285 -0.1025 0.0743  0.1899  222 GLU A CA    
1600 C C     . GLU A 228 ? 1.0169 0.9441 0.9554 -0.0900 0.0671  0.1846  222 GLU A C     
1601 O O     . GLU A 228 ? 1.0248 0.9252 0.9681 -0.0923 0.0677  0.1817  222 GLU A O     
1602 C CB    . GLU A 228 ? 1.0164 0.9587 0.9447 -0.1005 0.0800  0.2102  222 GLU A CB    
1603 N N     . ARG A 229 ? 0.9336 0.8776 0.8658 -0.0775 0.0607  0.1822  223 ARG A N     
1604 C CA    . ARG A 229 ? 0.9124 0.8456 0.8439 -0.0652 0.0541  0.1772  223 ARG A CA    
1605 C C     . ARG A 229 ? 0.9365 0.8957 0.8658 -0.0566 0.0468  0.1673  223 ARG A C     
1606 O O     . ARG A 229 ? 0.9316 0.9151 0.8553 -0.0563 0.0470  0.1699  223 ARG A O     
1607 C CB    . ARG A 229 ? 0.9395 0.8537 0.8641 -0.0563 0.0556  0.1940  223 ARG A CB    
1608 N N     . ILE A 230 ? 0.8774 0.8303 0.8106 -0.0496 0.0409  0.1561  224 ILE A N     
1609 C CA    . ILE A 230 ? 0.8475 0.8201 0.7803 -0.0412 0.0337  0.1453  224 ILE A CA    
1610 C C     . ILE A 230 ? 0.9096 0.8697 0.8400 -0.0285 0.0295  0.1484  224 ILE A C     
1611 O O     . ILE A 230 ? 0.9106 0.8478 0.8457 -0.0273 0.0298  0.1451  224 ILE A O     
1612 C CB    . ILE A 230 ? 0.8573 0.8347 0.7993 -0.0462 0.0308  0.1273  224 ILE A CB    
1613 C CG1   . ILE A 230 ? 0.8576 0.8478 0.8051 -0.0587 0.0349  0.1242  224 ILE A CG1   
1614 C CG2   . ILE A 230 ? 0.8317 0.8263 0.7737 -0.0374 0.0240  0.1164  224 ILE A CG2   
1615 C CD1   . ILE A 230 ? 0.9677 0.9534 0.9254 -0.0661 0.0331  0.1108  224 ILE A CD1   
1616 N N     . ARG A 231 ? 0.8622 0.8382 0.7861 -0.0194 0.0257  0.1539  225 ARG A N     
1617 C CA    . ARG A 231 ? 0.8570 0.8242 0.7808 -0.0073 0.0215  0.1571  225 ARG A CA    
1618 C C     . ARG A 231 ? 0.8850 0.8752 0.8059 0.0012  0.0145  0.1525  225 ARG A C     
1619 O O     . ARG A 231 ? 0.8684 0.8803 0.7820 0.0005  0.0133  0.1559  225 ARG A O     
1620 C CB    . ARG A 231 ? 0.8700 0.8172 0.7912 -0.0030 0.0250  0.1751  225 ARG A CB    
1621 C CG    . ARG A 231 ? 0.9216 0.8739 0.8348 -0.0079 0.0295  0.1907  225 ARG A CG    
1622 C CD    . ARG A 231 ? 1.0115 0.9574 0.9199 0.0021  0.0287  0.2090  225 ARG A CD    
1623 N NE    . ARG A 231 ? 1.1181 1.0315 1.0320 0.0042  0.0335  0.2168  225 ARG A NE    
1624 C CZ    . ARG A 231 ? 1.2845 1.1808 1.1960 -0.0002 0.0403  0.2314  225 ARG A CZ    
1625 N NH1   . ARG A 231 ? 1.1476 1.0573 1.0509 -0.0072 0.0431  0.2405  225 ARG A NH1   
1626 N NH2   . ARG A 231 ? 1.0513 0.9162 0.9685 0.0023  0.0450  0.2371  225 ARG A NH2   
1627 N N     . GLU A 232 ? 0.8428 0.8276 0.7693 0.0086  0.0102  0.1443  226 GLU A N     
1628 C CA    . GLU A 232 ? 0.8295 0.8329 0.7555 0.0166  0.0035  0.1389  226 GLU A CA    
1629 C C     . GLU A 232 ? 0.8997 0.9083 0.8210 0.0255  0.0006  0.1536  226 GLU A C     
1630 O O     . GLU A 232 ? 0.8957 0.8858 0.8188 0.0299  0.0030  0.1653  226 GLU A O     
1631 C CB    . GLU A 232 ? 0.8336 0.8272 0.7676 0.0210  0.0010  0.1265  226 GLU A CB    
1632 C CG    . GLU A 232 ? 0.9979 0.9973 0.9354 0.0146  0.0004  0.1103  226 GLU A CG    
1633 C CD    . GLU A 232 ? 1.4022 1.3953 1.3456 0.0197  -0.0026 0.0991  226 GLU A CD    
1634 O OE1   . GLU A 232 ? 1.3549 1.3276 1.3018 0.0176  -0.0001 0.0949  226 GLU A OE1   
1635 O OE2   . GLU A 232 ? 1.4218 1.4300 1.3657 0.0255  -0.0073 0.0947  226 GLU A OE2   
1636 N N     . VAL A 233 ? 0.8781 0.9120 0.7935 0.0279  -0.0045 0.1531  227 VAL A N     
1637 C CA    . VAL A 233 ? 0.9016 0.9459 0.8117 0.0356  -0.0088 0.1667  227 VAL A CA    
1638 C C     . VAL A 233 ? 0.9880 1.0506 0.9003 0.0419  -0.0164 0.1581  227 VAL A C     
1639 O O     . VAL A 233 ? 0.9537 1.0307 0.8648 0.0378  -0.0181 0.1442  227 VAL A O     
1640 C CB    . VAL A 233 ? 0.9611 1.0203 0.8579 0.0307  -0.0074 0.1773  227 VAL A CB    
1641 C CG1   . VAL A 233 ? 0.9736 1.0425 0.8643 0.0386  -0.0125 0.1935  227 VAL A CG1   
1642 C CG2   . VAL A 233 ? 0.9713 1.0149 0.8664 0.0224  0.0009  0.1841  227 VAL A CG2   
1643 N N     . ASP A 234 ? 1.0075 1.0705 0.9236 0.0516  -0.0209 0.1667  228 ASP A N     
1644 C CA    . ASP A 234 ? 1.0156 1.0981 0.9343 0.0566  -0.0284 0.1595  228 ASP A CA    
1645 C C     . ASP A 234 ? 1.0986 1.2069 1.0046 0.0543  -0.0330 0.1642  228 ASP A C     
1646 O O     . ASP A 234 ? 1.1161 1.2272 1.0148 0.0562  -0.0336 0.1806  228 ASP A O     
1647 C CB    . ASP A 234 ? 1.0458 1.1222 0.9751 0.0676  -0.0316 0.1663  228 ASP A CB    
1648 N N     . ALA A 235 ? 1.0474 1.1732 0.9496 0.0497  -0.0354 0.1497  229 ALA A N     
1649 C CA    . ALA A 235 ? 1.0577 1.2078 0.9460 0.0459  -0.0387 0.1506  229 ALA A CA    
1650 C C     . ALA A 235 ? 1.1329 1.2998 1.0179 0.0522  -0.0471 0.1604  229 ALA A C     
1651 O O     . ALA A 235 ? 1.1496 1.3297 1.0210 0.0505  -0.0490 0.1711  229 ALA A O     
1652 C CB    . ALA A 235 ? 1.0499 1.2121 0.9368 0.0402  -0.0385 0.1315  229 ALA A CB    
1653 N N     . LEU A 236 ? 1.0787 1.2456 0.9761 0.0593  -0.0522 0.1577  230 LEU A N     
1654 C CA    . LEU A 236 ? 1.0752 1.2597 0.9737 0.0657  -0.0612 0.1660  230 LEU A CA    
1655 C C     . LEU A 236 ? 1.1240 1.3020 1.0238 0.0734  -0.0623 0.1882  230 LEU A C     
1656 O O     . LEU A 236 ? 1.1180 1.3145 1.0148 0.0776  -0.0702 0.1983  230 LEU A O     
1657 C CB    . LEU A 236 ? 1.0584 1.2456 0.9717 0.0702  -0.0652 0.1547  230 LEU A CB    
1658 C CG    . LEU A 236 ? 1.1063 1.2949 1.0216 0.0641  -0.0633 0.1333  230 LEU A CG    
1659 C CD1   . LEU A 236 ? 1.0960 1.2744 1.0281 0.0691  -0.0631 0.1254  230 LEU A CD1   
1660 C CD2   . LEU A 236 ? 1.1495 1.3634 1.0551 0.0590  -0.0691 0.1246  230 LEU A CD2   
1661 N N     . THR A 237 ? 1.0956 1.2477 0.9998 0.0750  -0.0547 0.1959  231 THR A N     
1662 C CA    . THR A 237 ? 1.1197 1.2609 1.0267 0.0827  -0.0542 0.2170  231 THR A CA    
1663 C C     . THR A 237 ? 1.1776 1.3048 1.0742 0.0781  -0.0471 0.2290  231 THR A C     
1664 O O     . THR A 237 ? 1.1789 1.3053 1.0715 0.0830  -0.0483 0.2486  231 THR A O     
1665 C CB    . THR A 237 ? 1.2758 1.3977 1.2018 0.0921  -0.0521 0.2179  231 THR A CB    
1666 O OG1   . THR A 237 ? 1.3433 1.4537 1.2724 0.1001  -0.0509 0.2388  231 THR A OG1   
1667 C CG2   . THR A 237 ? 1.2199 1.3171 1.1523 0.0879  -0.0436 0.2042  231 THR A CG2   
1668 N N     . GLY A 238 ? 1.1367 1.2529 1.0300 0.0690  -0.0398 0.2178  232 GLY A N     
1669 C CA    . GLY A 238 ? 1.1562 1.2585 1.0412 0.0629  -0.0320 0.2269  232 GLY A CA    
1670 C C     . GLY A 238 ? 1.2140 1.2849 1.1092 0.0664  -0.0253 0.2351  232 GLY A C     
1671 O O     . GLY A 238 ? 1.2172 1.2753 1.1069 0.0642  -0.0199 0.2491  232 GLY A O     
1672 N N     . GLU A 239 ? 1.1642 1.2219 1.0741 0.0718  -0.0250 0.2261  233 GLU A N     
1673 C CA    . GLU A 239 ? 1.1689 1.1953 1.0891 0.0755  -0.0183 0.2304  233 GLU A CA    
1674 C C     . GLU A 239 ? 1.1775 1.1879 1.0974 0.0649  -0.0110 0.2171  233 GLU A C     
1675 O O     . GLU A 239 ? 1.1409 1.1614 1.0612 0.0597  -0.0125 0.1998  233 GLU A O     
1676 C CB    . GLU A 239 ? 1.1690 1.1907 1.1038 0.0856  -0.0209 0.2255  233 GLU A CB    
1677 N N     . ILE A 240 ? 1.1325 1.1189 1.0519 0.0612  -0.0032 0.2257  234 ILE A N     
1678 C CA    . ILE A 240 ? 1.1223 1.0935 1.0423 0.0503  0.0034  0.2141  234 ILE A CA    
1679 C C     . ILE A 240 ? 1.1638 1.1167 1.0951 0.0526  0.0051  0.2002  234 ILE A C     
1680 O O     . ILE A 240 ? 1.1746 1.0996 1.1110 0.0529  0.0112  0.2028  234 ILE A O     
1681 C CB    . ILE A 240 ? 1.1552 1.1067 1.0713 0.0448  0.0111  0.2276  234 ILE A CB    
1682 N N     . LEU A 241 ? 1.0924 1.0611 1.0265 0.0539  -0.0002 0.1853  235 LEU A N     
1683 C CA    . LEU A 241 ? 1.0701 1.0292 1.0129 0.0562  -0.0002 0.1704  235 LEU A CA    
1684 C C     . LEU A 241 ? 1.1173 1.0483 1.0633 0.0499  0.0068  0.1628  235 LEU A C     
1685 O O     . LEU A 241 ? 1.1189 1.0368 1.0713 0.0537  0.0078  0.1541  235 LEU A O     
1686 C CB    . LEU A 241 ? 1.0462 1.0291 0.9878 0.0533  -0.0057 0.1553  235 LEU A CB    
1687 C CG    . LEU A 241 ? 1.0973 1.0831 1.0468 0.0600  -0.0092 0.1449  235 LEU A CG    
1688 C CD1   . LEU A 241 ? 1.0900 1.1033 1.0385 0.0649  -0.0168 0.1461  235 LEU A CD1   
1689 C CD2   . LEU A 241 ? 1.1203 1.1028 1.0713 0.0533  -0.0082 0.1271  235 LEU A CD2   
1690 N N     . GLY A 242 ? 1.0648 0.9876 1.0061 0.0400  0.0115  0.1659  236 GLY A N     
1691 C CA    . GLY A 242 ? 1.0649 0.9625 1.0085 0.0321  0.0177  0.1589  236 GLY A CA    
1692 C C     . GLY A 242 ? 1.1103 1.0124 1.0499 0.0185  0.0202  0.1556  236 GLY A C     
1693 O O     . GLY A 242 ? 1.0979 1.0248 1.0342 0.0148  0.0167  0.1510  236 GLY A O     
1694 N N     . ASP A 243 ? 1.0748 0.9525 1.0153 0.0109  0.0268  0.1574  237 ASP A N     
1695 C CA    . ASP A 243 ? 1.0682 0.9470 1.0071 -0.0031 0.0303  0.1550  237 ASP A CA    
1696 C C     . ASP A 243 ? 1.0635 0.9428 1.0063 -0.0111 0.0288  0.1365  237 ASP A C     
1697 O O     . ASP A 243 ? 1.0644 0.9259 1.0102 -0.0091 0.0291  0.1282  237 ASP A O     
1698 C CB    . ASP A 243 ? 1.1285 0.9802 1.0673 -0.0080 0.0380  0.1668  237 ASP A CB    
1699 C CG    . ASP A 243 ? 1.3116 1.1700 1.2473 -0.0199 0.0420  0.1732  237 ASP A CG    
1700 O OD1   . ASP A 243 ? 1.3385 1.1904 1.2705 -0.0189 0.0461  0.1901  237 ASP A OD1   
1701 O OD2   . ASP A 243 ? 1.4131 1.2834 1.3510 -0.0301 0.0414  0.1618  237 ASP A OD2   
1702 N N     . ARG A 244 ? 0.9768 0.8768 0.9195 -0.0198 0.0274  0.1306  238 ARG A N     
1703 C CA    . ARG A 244 ? 0.9443 0.8498 0.8914 -0.0273 0.0250  0.1142  238 ARG A CA    
1704 C C     . ARG A 244 ? 0.9759 0.8777 0.9261 -0.0420 0.0292  0.1128  238 ARG A C     
1705 O O     . ARG A 244 ? 0.9728 0.8747 0.9212 -0.0470 0.0339  0.1243  238 ARG A O     
1706 C CB    . ARG A 244 ? 0.8960 0.8313 0.8433 -0.0236 0.0191  0.1062  238 ARG A CB    
1707 C CG    . ARG A 244 ? 0.9896 0.9330 0.9344 -0.0105 0.0147  0.1079  238 ARG A CG    
1708 C CD    . ARG A 244 ? 1.1567 1.0906 1.1047 -0.0047 0.0115  0.0974  238 ARG A CD    
1709 N NE    . ARG A 244 ? 1.3705 1.3114 1.3218 -0.0108 0.0090  0.0829  238 ARG A NE    
1710 C CZ    . ARG A 244 ? 1.4681 1.4300 1.4208 -0.0084 0.0043  0.0745  238 ARG A CZ    
1711 N NH1   . ARG A 244 ? 1.2757 1.2538 1.2262 -0.0008 0.0017  0.0779  238 ARG A NH1   
1712 N NH2   . ARG A 244 ? 1.2005 1.1672 1.1571 -0.0136 0.0021  0.0628  238 ARG A NH2   
1713 N N     . ASP A 245 ? 0.9181 0.8167 0.8730 -0.0491 0.0272  0.0991  239 ASP A N     
1714 C CA    . ASP A 245 ? 0.9247 0.8221 0.8846 -0.0639 0.0297  0.0952  239 ASP A CA    
1715 C C     . ASP A 245 ? 0.9736 0.9002 0.9389 -0.0679 0.0253  0.0856  239 ASP A C     
1716 O O     . ASP A 245 ? 0.9733 0.9107 0.9439 -0.0785 0.0276  0.0859  239 ASP A O     
1717 C CB    . ASP A 245 ? 0.9427 0.8133 0.9036 -0.0697 0.0305  0.0872  239 ASP A CB    
1718 N N     . HIS A 246 ? 0.9093 0.8483 0.8741 -0.0591 0.0195  0.0774  240 HIS A N     
1719 C CA    . HIS A 246 ? 0.8795 0.8448 0.8498 -0.0601 0.0152  0.0682  240 HIS A CA    
1720 C C     . HIS A 246 ? 0.8884 0.8691 0.8549 -0.0479 0.0120  0.0681  240 HIS A C     
1721 O O     . HIS A 246 ? 0.8919 0.8612 0.8532 -0.0388 0.0109  0.0709  240 HIS A O     
1722 C CB    . HIS A 246 ? 0.8834 0.8435 0.8578 -0.0638 0.0105  0.0551  240 HIS A CB    
1723 N N     . VAL A 247 ? 0.8033 0.8099 0.7729 -0.0478 0.0107  0.0648  241 VAL A N     
1724 C CA    . VAL A 247 ? 0.7727 0.7955 0.7391 -0.0378 0.0077  0.0628  241 VAL A CA    
1725 C C     . VAL A 247 ? 0.7820 0.8291 0.7547 -0.0391 0.0060  0.0540  241 VAL A C     
1726 O O     . VAL A 247 ? 0.7623 0.8208 0.7404 -0.0469 0.0093  0.0545  241 VAL A O     
1727 C CB    . VAL A 247 ? 0.8192 0.8442 0.7770 -0.0321 0.0099  0.0746  241 VAL A CB    
1728 C CG1   . VAL A 247 ? 0.8041 0.8542 0.7598 -0.0329 0.0118  0.0761  241 VAL A CG1   
1729 C CG2   . VAL A 247 ? 0.8119 0.8304 0.7655 -0.0210 0.0059  0.0744  241 VAL A CG2   
1730 N N     . ALA A 248 ? 0.7246 0.7790 0.6978 -0.0314 0.0014  0.0459  242 ALA A N     
1731 C CA    . ALA A 248 ? 0.7112 0.7869 0.6909 -0.0310 0.0000  0.0374  242 ALA A CA    
1732 C C     . ALA A 248 ? 0.7759 0.8653 0.7502 -0.0232 -0.0003 0.0370  242 ALA A C     
1733 O O     . ALA A 248 ? 0.7722 0.8558 0.7423 -0.0157 -0.0038 0.0355  242 ALA A O     
1734 C CB    . ALA A 248 ? 0.7079 0.7799 0.6937 -0.0299 -0.0050 0.0274  242 ALA A CB    
1735 N N     . ILE A 249 ? 0.7328 0.8405 0.7071 -0.0256 0.0038  0.0384  243 ILE A N     
1736 C CA    . ILE A 249 ? 0.7202 0.8426 0.6883 -0.0199 0.0041  0.0370  243 ILE A CA    
1737 C C     . ILE A 249 ? 0.7732 0.9082 0.7489 -0.0167 0.0022  0.0249  243 ILE A C     
1738 O O     . ILE A 249 ? 0.7496 0.8927 0.7354 -0.0209 0.0039  0.0205  243 ILE A O     
1739 C CB    . ILE A 249 ? 0.7611 0.8960 0.7230 -0.0241 0.0103  0.0447  243 ILE A CB    
1740 C CG1   . ILE A 249 ? 0.7757 0.8966 0.7316 -0.0283 0.0129  0.0580  243 ILE A CG1   
1741 C CG2   . ILE A 249 ? 0.7654 0.9152 0.7181 -0.0188 0.0105  0.0428  243 ILE A CG2   
1742 C CD1   . ILE A 249 ? 0.8698 0.9779 0.8159 -0.0218 0.0097  0.0659  243 ILE A CD1   
1743 N N     . PHE A 250 ? 0.7490 0.8854 0.7209 -0.0094 -0.0012 0.0200  244 PHE A N     
1744 C CA    . PHE A 250 ? 0.7443 0.8907 0.7228 -0.0056 -0.0026 0.0090  244 PHE A CA    
1745 C C     . PHE A 250 ? 0.8474 1.0108 0.8208 -0.0034 0.0006  0.0054  244 PHE A C     
1746 O O     . PHE A 250 ? 0.8517 1.0170 0.8139 -0.0028 0.0012  0.0111  244 PHE A O     
1747 C CB    . PHE A 250 ? 0.7473 0.8817 0.7266 0.0002  -0.0083 0.0045  244 PHE A CB    
1748 C CG    . PHE A 250 ? 0.7467 0.8685 0.7329 -0.0020 -0.0110 0.0032  244 PHE A CG    
1749 C CD1   . PHE A 250 ? 0.7834 0.8882 0.7660 -0.0045 -0.0119 0.0096  244 PHE A CD1   
1750 C CD2   . PHE A 250 ? 0.7466 0.8732 0.7423 -0.0015 -0.0127 -0.0045 244 PHE A CD2   
1751 C CE1   . PHE A 250 ? 0.7835 0.8763 0.7706 -0.0071 -0.0145 0.0072  244 PHE A CE1   
1752 C CE2   . PHE A 250 ? 0.7778 0.8936 0.7780 -0.0038 -0.0161 -0.0058 244 PHE A CE2   
1753 C CZ    . PHE A 250 ? 0.7613 0.8602 0.7564 -0.0069 -0.0169 -0.0005 244 PHE A CZ    
1754 N N     . PRO A 251 ? 0.8321 1.0078 0.8131 -0.0022 0.0027  -0.0038 245 PRO A N     
1755 C CA    . PRO A 251 ? 0.8518 1.0427 0.8273 -0.0006 0.0068  -0.0085 245 PRO A CA    
1756 C C     . PRO A 251 ? 0.9669 1.1567 0.9309 0.0037  0.0036  -0.0100 245 PRO A C     
1757 O O     . PRO A 251 ? 0.9581 1.1381 0.9237 0.0079  -0.0018 -0.0126 245 PRO A O     
1758 C CB    . PRO A 251 ? 0.8594 1.0584 0.8475 0.0017  0.0087  -0.0188 245 PRO A CB    
1759 C CG    . PRO A 251 ? 0.8996 1.0941 0.8998 -0.0015 0.0074  -0.0163 245 PRO A CG    
1760 C CD    . PRO A 251 ? 0.8408 1.0174 0.8359 -0.0021 0.0018  -0.0100 245 PRO A CD    
1761 N N     . ALA A 252 ? 0.9743 1.1756 0.9269 0.0022  0.0071  -0.0085 246 ALA A N     
1762 C CA    . ALA A 252 ? 0.9913 1.1958 0.9319 0.0049  0.0040  -0.0098 246 ALA A CA    
1763 C C     . ALA A 252 ? 1.0817 1.2889 1.0260 0.0090  0.0027  -0.0229 246 ALA A C     
1764 O O     . ALA A 252 ? 1.0857 1.2908 1.0246 0.0116  -0.0022 -0.0247 246 ALA A O     
1765 C CB    . ALA A 252 ? 1.0166 1.2342 0.9435 0.0013  0.0085  -0.0056 246 ALA A CB    
1766 N N     . SER A 253 ? 1.0596 1.2719 1.0138 0.0096  0.0072  -0.0319 247 SER A N     
1767 C CA    . SER A 253 ? 1.0574 1.2701 1.0169 0.0137  0.0069  -0.0442 247 SER A CA    
1768 C C     . SER A 253 ? 1.1319 1.3304 1.1027 0.0174  0.0014  -0.0449 247 SER A C     
1769 O O     . SER A 253 ? 1.1208 1.3103 1.0949 0.0163  -0.0015 -0.0370 247 SER A O     
1770 C CB    . SER A 253 ? 1.0643 1.2879 1.0304 0.0136  0.0147  -0.0524 247 SER A CB    
1771 N N     . HIS A 254 ? 1.1082 1.3039 1.0838 0.0213  0.0003  -0.0545 248 HIS A N     
1772 C CA    . HIS A 254 ? 1.1017 1.2847 1.0868 0.0249  -0.0042 -0.0559 248 HIS A CA    
1773 C C     . HIS A 254 ? 1.1639 1.3479 1.1631 0.0272  -0.0013 -0.0608 248 HIS A C     
1774 O O     . HIS A 254 ? 1.1525 1.3268 1.1596 0.0299  -0.0049 -0.0608 248 HIS A O     
1775 C CB    . HIS A 254 ? 1.1081 1.2866 1.0901 0.0276  -0.0074 -0.0618 248 HIS A CB    
1776 N N     . PHE A 255 ? 1.1351 1.3315 1.1374 0.0263  0.0053  -0.0645 249 PHE A N     
1777 C CA    . PHE A 255 ? 1.1294 1.3303 1.1465 0.0289  0.0088  -0.0685 249 PHE A CA    
1778 C C     . PHE A 255 ? 1.2124 1.4258 1.2332 0.0249  0.0140  -0.0641 249 PHE A C     
1779 O O     . PHE A 255 ? 1.2032 1.4169 1.2348 0.0240  0.0125  -0.0598 249 PHE A O     
1780 C CB    . PHE A 255 ? 1.1436 1.3473 1.1644 0.0333  0.0134  -0.0800 249 PHE A CB    
1781 C CG    . PHE A 255 ? 1.1413 1.3439 1.1790 0.0385  0.0145  -0.0834 249 PHE A CG    
1782 C CD1   . PHE A 255 ? 1.1621 1.3758 1.2119 0.0387  0.0186  -0.0817 249 PHE A CD1   
1783 C CD2   . PHE A 255 ? 1.1541 1.3454 1.1964 0.0433  0.0114  -0.0875 249 PHE A CD2   
1784 C CE1   . PHE A 255 ? 1.1597 1.3739 1.2264 0.0441  0.0188  -0.0836 249 PHE A CE1   
1785 C CE2   . PHE A 255 ? 1.1791 1.3693 1.2369 0.0486  0.0119  -0.0891 249 PHE A CE2   
1786 C CZ    . PHE A 255 ? 1.1461 1.3481 1.2161 0.0493  0.0153  -0.0870 249 PHE A CZ    
1787 N N     . VAL A 256 ? 1.1951 1.4191 1.2063 0.0220  0.0200  -0.0653 250 VAL A N     
1788 C CA    . VAL A 256 ? 1.2087 1.4459 1.2213 0.0177  0.0265  -0.0614 250 VAL A CA    
1789 C C     . VAL A 256 ? 1.2656 1.5113 1.2973 0.0192  0.0304  -0.0631 250 VAL A C     
1790 O O     . VAL A 256 ? 1.2531 1.4959 1.2948 0.0177  0.0261  -0.0573 250 VAL A O     
1791 C CB    . VAL A 256 ? 1.2617 1.4964 1.2647 0.0115  0.0241  -0.0497 250 VAL A CB    
1792 N N     . THR A 257 ? 1.2268 1.4835 1.2640 0.0223  0.0385  -0.0716 251 THR A N     
1793 C CA    . THR A 257 ? 1.2212 1.4888 1.2782 0.0251  0.0434  -0.0739 251 THR A CA    
1794 C C     . THR A 257 ? 1.2830 1.5655 1.3435 0.0192  0.0496  -0.0680 251 THR A C     
1795 O O     . THR A 257 ? 1.2933 1.5805 1.3393 0.0146  0.0543  -0.0661 251 THR A O     
1796 C CB    . THR A 257 ? 1.3044 1.5760 1.3660 0.0316  0.0505  -0.0857 251 THR A CB    
1797 N N     . ARG A 258 ? 1.2263 1.5171 1.3065 0.0192  0.0496  -0.0648 252 ARG A N     
1798 C CA    . ARG A 258 ? 1.2251 1.5317 1.3134 0.0133  0.0557  -0.0593 252 ARG A CA    
1799 C C     . ARG A 258 ? 1.3055 1.6275 1.3954 0.0157  0.0685  -0.0667 252 ARG A C     
1800 O O     . ARG A 258 ? 1.3045 1.6329 1.4094 0.0227  0.0726  -0.0739 252 ARG A O     
1801 C CB    . ARG A 258 ? 1.1915 1.5039 1.3021 0.0130  0.0512  -0.0553 252 ARG A CB    
1802 N N     . ALA A 259 ? 1.2792 1.6056 1.3518 0.0102  0.0748  -0.0649 253 ALA A N     
1803 C CA    . ALA A 259 ? 1.2900 1.6297 1.3571 0.0108  0.0876  -0.0716 253 ALA A CA    
1804 C C     . ALA A 259 ? 1.3401 1.6986 1.4294 0.0137  0.0979  -0.0754 253 ALA A C     
1805 O O     . ALA A 259 ? 1.3381 1.7033 1.4273 0.0186  0.1076  -0.0855 253 ALA A O     
1806 C CB    . ALA A 259 ? 1.3109 1.6535 1.3575 0.0026  0.0912  -0.0648 253 ALA A CB    
1807 N N     . GLU A 260 ? 1.2874 1.6547 1.3957 0.0104  0.0960  -0.0677 254 GLU A N     
1808 C CA    . GLU A 260 ? 1.2807 1.6684 1.4137 0.0123  0.1045  -0.0689 254 GLU A CA    
1809 C C     . GLU A 260 ? 1.3166 1.7061 1.4682 0.0236  0.1053  -0.0777 254 GLU A C     
1810 O O     . GLU A 260 ? 1.3299 1.7300 1.4875 0.0289  0.1171  -0.0859 254 GLU A O     
1811 C CB    . GLU A 260 ? 1.2812 1.6762 1.4297 0.0052  0.0994  -0.0582 254 GLU A CB    
1812 N N     . LYS A 261 ? 1.2330 1.6109 1.3926 0.0274  0.0933  -0.0760 255 LYS A N     
1813 C CA    . LYS A 261 ? 1.2076 1.5850 1.3857 0.0381  0.0920  -0.0818 255 LYS A CA    
1814 C C     . LYS A 261 ? 1.2107 1.5722 1.3760 0.0455  0.0932  -0.0922 255 LYS A C     
1815 O O     . LYS A 261 ? 1.2097 1.5633 1.3857 0.0535  0.0884  -0.0951 255 LYS A O     
1816 C CB    . LYS A 261 ? 1.2025 1.5753 1.3931 0.0379  0.0785  -0.0744 255 LYS A CB    
1817 N N     . MET A 262 ? 1.1157 1.4732 1.2585 0.0426  0.0997  -0.0979 256 MET A N     
1818 C CA    . MET A 262 ? 1.0876 1.4301 1.2160 0.0473  0.1004  -0.1081 256 MET A CA    
1819 C C     . MET A 262 ? 1.0964 1.4446 1.2320 0.0549  0.1133  -0.1204 256 MET A C     
1820 O O     . MET A 262 ? 1.0881 1.4232 1.2229 0.0614  0.1126  -0.1287 256 MET A O     
1821 C CB    . MET A 262 ? 1.0998 1.4340 1.1990 0.0398  0.0982  -0.1075 256 MET A CB    
1822 N N     . GLU A 263 ? 1.0203 1.3871 1.1626 0.0540  0.1259  -0.1221 257 GLU A N     
1823 C CA    . GLU A 263 ? 1.0015 1.3746 1.1505 0.0611  0.1403  -0.1344 257 GLU A CA    
1824 C C     . GLU A 263 ? 0.9666 1.3408 1.1448 0.0726  0.1410  -0.1367 257 GLU A C     
1825 O O     . GLU A 263 ? 0.9530 1.3194 1.1333 0.0804  0.1479  -0.1480 257 GLU A O     
1826 C CB    . GLU A 263 ? 1.0224 1.4161 1.1713 0.0567  0.1538  -0.1344 257 GLU A CB    
1827 N N     . LYS A 264 ? 0.8681 1.2514 1.0685 0.0734  0.1336  -0.1258 258 LYS A N     
1828 C CA    . LYS A 264 ? 0.8437 1.2300 1.0730 0.0842  0.1321  -0.1251 258 LYS A CA    
1829 C C     . LYS A 264 ? 0.8536 1.2166 1.0778 0.0897  0.1226  -0.1276 258 LYS A C     
1830 O O     . LYS A 264 ? 0.8546 1.2132 1.0942 0.1004  0.1262  -0.1329 258 LYS A O     
1831 C CB    . LYS A 264 ? 0.8389 1.2412 1.0893 0.0815  0.1244  -0.1123 258 LYS A CB    
1832 N N     . ALA A 265 ? 0.7742 1.1221 0.9769 0.0825  0.1113  -0.1238 259 ALA A N     
1833 C CA    . ALA A 265 ? 0.7548 1.0804 0.9494 0.0857  0.1022  -0.1256 259 ALA A CA    
1834 C C     . ALA A 265 ? 0.7597 1.0727 0.9442 0.0903  0.1111  -0.1397 259 ALA A C     
1835 O O     . ALA A 265 ? 0.7514 1.0524 0.9455 0.0987  0.1105  -0.1437 259 ALA A O     
1836 C CB    . ALA A 265 ? 0.7602 1.0752 0.9334 0.0762  0.0905  -0.1190 259 ALA A CB    
1837 N N     . ILE A 266 ? 0.6926 1.0088 0.8580 0.0847  0.1198  -0.1473 260 ILE A N     
1838 C CA    . ILE A 266 ? 0.6949 1.0009 0.8483 0.0872  0.1291  -0.1621 260 ILE A CA    
1839 C C     . ILE A 266 ? 0.7083 1.0188 0.8844 0.0984  0.1416  -0.1701 260 ILE A C     
1840 O O     . ILE A 266 ? 0.6929 0.9880 0.8697 0.1045  0.1452  -0.1800 260 ILE A O     
1841 C CB    . ILE A 266 ? 0.7498 1.0610 0.8765 0.0778  0.1349  -0.1672 260 ILE A CB    
1842 C CG1   . ILE A 266 ? 0.7600 1.0632 0.8652 0.0686  0.1218  -0.1595 260 ILE A CG1   
1843 C CG2   . ILE A 266 ? 0.7671 1.0704 0.8815 0.0796  0.1457  -0.1840 260 ILE A CG2   
1844 C CD1   . ILE A 266 ? 0.9144 1.2286 0.9987 0.0587  0.1244  -0.1564 260 ILE A CD1   
1845 N N     . GLN A 267 ? 0.6453 0.9767 0.8418 0.1012  0.1481  -0.1651 261 GLN A N     
1846 C CA    . GLN A 267 ? 0.6364 0.9753 0.8586 0.1128  0.1600  -0.1707 261 GLN A CA    
1847 C C     . GLN A 267 ? 0.6486 0.9764 0.8913 0.1229  0.1521  -0.1663 261 GLN A C     
1848 O O     . GLN A 267 ? 0.6464 0.9647 0.8993 0.1326  0.1601  -0.1750 261 GLN A O     
1849 C CB    . GLN A 267 ? 0.6421 1.0081 0.8824 0.1125  0.1670  -0.1644 261 GLN A CB    
1850 N N     . ASN A 268 ? 0.5811 0.9080 0.8275 0.1201  0.1366  -0.1530 262 ASN A N     
1851 C CA    . ASN A 268 ? 0.5719 0.8891 0.8352 0.1285  0.1273  -0.1468 262 ASN A CA    
1852 C C     . ASN A 268 ? 0.6278 0.9180 0.8785 0.1311  0.1244  -0.1535 262 ASN A C     
1853 O O     . ASN A 268 ? 0.6287 0.9099 0.8959 0.1415  0.1248  -0.1536 262 ASN A O     
1854 C CB    . ASN A 268 ? 0.5945 0.9189 0.8629 0.1237  0.1122  -0.1318 262 ASN A CB    
1855 C CG    . ASN A 268 ? 1.0633 1.4146 1.3552 0.1245  0.1139  -0.1238 262 ASN A CG    
1856 O OD1   . ASN A 268 ? 0.9513 1.3162 1.2658 0.1332  0.1246  -0.1267 262 ASN A OD1   
1857 N ND2   . ASN A 268 ? 1.0085 1.3680 1.2969 0.1153  0.1033  -0.1134 262 ASN A ND2   
1858 N N     . ILE A 269 ? 0.5914 0.8691 0.8138 0.1217  0.1214  -0.1585 263 ILE A N     
1859 C CA    . ILE A 269 ? 0.5893 0.8423 0.7979 0.1221  0.1189  -0.1659 263 ILE A CA    
1860 C C     . ILE A 269 ? 0.6366 0.8823 0.8509 0.1298  0.1338  -0.1805 263 ILE A C     
1861 O O     . ILE A 269 ? 0.6291 0.8592 0.8542 0.1379  0.1342  -0.1827 263 ILE A O     
1862 C CB    . ILE A 269 ? 0.6210 0.8664 0.7995 0.1100  0.1127  -0.1679 263 ILE A CB    
1863 C CG1   . ILE A 269 ? 0.6115 0.8591 0.7860 0.1041  0.0980  -0.1537 263 ILE A CG1   
1864 C CG2   . ILE A 269 ? 0.6114 0.8339 0.7768 0.1098  0.1127  -0.1781 263 ILE A CG2   
1865 C CD1   . ILE A 269 ? 0.7685 1.0199 0.9196 0.0926  0.0944  -0.1522 263 ILE A CD1   
1866 N N     . GLU A 270 ? 0.5892 0.8464 0.7971 0.1273  0.1466  -0.1900 264 GLU A N     
1867 C CA    . GLU A 270 ? 0.6009 0.8526 0.8127 0.1337  0.1627  -0.2053 264 GLU A CA    
1868 C C     . GLU A 270 ? 0.6284 0.8808 0.8727 0.1484  0.1681  -0.2028 264 GLU A C     
1869 O O     . GLU A 270 ? 0.6338 0.8690 0.8834 0.1558  0.1755  -0.2124 264 GLU A O     
1870 C CB    . GLU A 270 ? 0.6217 0.8900 0.8229 0.1286  0.1750  -0.2131 264 GLU A CB    
1871 N N     . LYS A 271 ? 0.5606 0.8317 0.8265 0.1523  0.1631  -0.1890 265 LYS A N     
1872 C CA    . LYS A 271 ? 0.5597 0.8351 0.8582 0.1664  0.1659  -0.1836 265 LYS A CA    
1873 C C     . LYS A 271 ? 0.6341 0.8869 0.9372 0.1723  0.1564  -0.1792 265 LYS A C     
1874 O O     . LYS A 271 ? 0.6347 0.8780 0.9561 0.1845  0.1636  -0.1825 265 LYS A O     
1875 C CB    . LYS A 271 ? 0.5466 0.8491 0.8649 0.1669  0.1605  -0.1694 265 LYS A CB    
1876 N N     . GLU A 272 ? 0.5989 0.8423 0.8850 0.1639  0.1412  -0.1718 266 GLU A N     
1877 C CA    . GLU A 272 ? 0.5963 0.8183 0.8831 0.1675  0.1316  -0.1668 266 GLU A CA    
1878 C C     . GLU A 272 ? 0.6571 0.8536 0.9310 0.1679  0.1394  -0.1814 266 GLU A C     
1879 O O     . GLU A 272 ? 0.6618 0.8406 0.9464 0.1764  0.1400  -0.1812 266 GLU A O     
1880 C CB    . GLU A 272 ? 0.5952 0.8153 0.8660 0.1576  0.1148  -0.1561 266 GLU A CB    
1881 C CG    . GLU A 272 ? 0.7354 0.9366 1.0090 0.1618  0.1048  -0.1487 266 GLU A CG    
1882 C CD    . GLU A 272 ? 1.0245 1.2171 1.2779 0.1519  0.0907  -0.1421 266 GLU A CD    
1883 O OE1   . GLU A 272 ? 1.0588 1.2422 1.3174 0.1554  0.0814  -0.1326 266 GLU A OE1   
1884 O OE2   . GLU A 272 ? 0.8662 1.0606 1.0986 0.1410  0.0895  -0.1464 266 GLU A OE2   
1885 N N     . LEU A 273 ? 0.6061 0.8011 0.8565 0.1581  0.1449  -0.1936 267 LEU A N     
1886 C CA    . LEU A 273 ? 0.6166 0.7902 0.8513 0.1554  0.1521  -0.2093 267 LEU A CA    
1887 C C     . LEU A 273 ? 0.7079 0.8742 0.9598 0.1669  0.1682  -0.2202 267 LEU A C     
1888 O O     . LEU A 273 ? 0.7258 0.8688 0.9799 0.1712  0.1709  -0.2263 267 LEU A O     
1889 C CB    . LEU A 273 ? 0.6155 0.7950 0.8220 0.1422  0.1539  -0.2186 267 LEU A CB    
1890 C CG    . LEU A 273 ? 0.6910 0.8527 0.8791 0.1375  0.1621  -0.2369 267 LEU A CG    
1891 C CD1   . LEU A 273 ? 0.6957 0.8343 0.8752 0.1341  0.1528  -0.2368 267 LEU A CD1   
1892 C CD2   . LEU A 273 ? 0.7068 0.8803 0.8700 0.1261  0.1649  -0.2446 267 LEU A CD2   
1893 N N     . GLU A 274 ? 0.6756 0.8611 0.9408 0.1721  0.1791  -0.2224 268 GLU A N     
1894 C CA    . GLU A 274 ? 0.7014 0.8817 0.9848 0.1840  0.1957  -0.2326 268 GLU A CA    
1895 C C     . GLU A 274 ? 0.7637 0.9332 1.0739 0.1977  0.1927  -0.2229 268 GLU A C     
1896 O O     . GLU A 274 ? 0.7974 0.9452 1.1137 0.2049  0.2015  -0.2320 268 GLU A O     
1897 C CB    . GLU A 274 ? 0.7263 0.9326 1.0207 0.1869  0.2075  -0.2346 268 GLU A CB    
1898 C CG    . GLU A 274 ? 0.9476 1.1577 1.2161 0.1766  0.2176  -0.2501 268 GLU A CG    
1899 C CD    . GLU A 274 ? 1.4035 1.6360 1.6830 0.1806  0.2331  -0.2548 268 GLU A CD    
1900 O OE1   . GLU A 274 ? 1.4079 1.6653 1.6980 0.1797  0.2288  -0.2423 268 GLU A OE1   
1901 O OE2   . GLU A 274 ? 1.3658 1.5908 1.6428 0.1841  0.2499  -0.2715 268 GLU A OE2   
1902 N N     . GLU A 275 ? 0.6932 0.8761 1.0174 0.2004  0.1795  -0.2045 269 GLU A N     
1903 C CA    . GLU A 275 ? 0.6854 0.8611 1.0340 0.2130  0.1743  -0.1925 269 GLU A CA    
1904 C C     . GLU A 275 ? 0.7114 0.8564 1.0486 0.2116  0.1684  -0.1935 269 GLU A C     
1905 O O     . GLU A 275 ? 0.7222 0.8503 1.0755 0.2230  0.1735  -0.1935 269 GLU A O     
1906 C CB    . GLU A 275 ? 0.6736 0.8717 1.0343 0.2131  0.1600  -0.1734 269 GLU A CB    
1907 N N     . GLN A 276 ? 0.6347 0.7724 0.9449 0.1979  0.1586  -0.1947 270 GLN A N     
1908 C CA    . GLN A 276 ? 0.6262 0.7369 0.9238 0.1943  0.1527  -0.1959 270 GLN A CA    
1909 C C     . GLN A 276 ? 0.6820 0.7692 0.9726 0.1944  0.1662  -0.2145 270 GLN A C     
1910 O O     . GLN A 276 ? 0.6881 0.7506 0.9794 0.1968  0.1658  -0.2155 270 GLN A O     
1911 C CB    . GLN A 276 ? 0.6210 0.7341 0.8937 0.1798  0.1386  -0.1913 270 GLN A CB    
1912 C CG    . GLN A 276 ? 0.7968 0.8862 1.0594 0.1763  0.1299  -0.1881 270 GLN A CG    
1913 C CD    . GLN A 276 ? 0.9842 1.0663 1.2639 0.1857  0.1222  -0.1727 270 GLN A CD    
1914 O OE1   . GLN A 276 ? 0.8705 0.9616 1.1738 0.1977  0.1243  -0.1646 270 GLN A OE1   
1915 N NE2   . GLN A 276 ? 0.9172 0.9826 1.1854 0.1806  0.1135  -0.1684 270 GLN A NE2   
1916 N N     . LEU A 277 ? 0.6381 0.7329 0.9221 0.1917  0.1788  -0.2292 271 LEU A N     
1917 C CA    . LEU A 277 ? 0.6506 0.7244 0.9269 0.1911  0.1927  -0.2487 271 LEU A CA    
1918 C C     . LEU A 277 ? 0.7136 0.7745 1.0169 0.2074  0.2052  -0.2508 271 LEU A C     
1919 O O     . LEU A 277 ? 0.7117 0.7452 1.0142 0.2091  0.2106  -0.2593 271 LEU A O     
1920 C CB