data_3V56
# 
_entry.id   3V56 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V56         
RCSB  RCSB069608   
WWPDB D_1000069608 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1OSG 
_pdbx_database_related.details        'THIS ENTRY 3V56 REFLECTS AN ALTERNATIVE MODELING OF X-RAY DATA R1OSGSF' 
_pdbx_database_related.content_type   re-refinement 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3V56 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Smart, O.S.'   1 
'Womack, T.O.'  2 
'Flensburg, C.' 3 
'Keller, P.'    4 
'Sharff, A.'    5 
'Paciorek, W.'  6 
'Vonrhein, C.'  7 
'Bricogne, G.'  8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary         'Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.' 
'Acta Crystallogr.,Sect.D' 68 368  380  2012 ABCRE6 DK 0907-4449 0766 ? 22505257 10.1107/S0907444911056058 
original_data_1 
'BAFF/BLyS Receptor 3 Comprises a Minimal TNF Receptor-like Module That Encodes a Highly Focused Ligand-Binding Site' Biochemistry 
42 5977 5983 2003 BICHAW US 0006-2960 0033 ? 12755599 10.1021/bi034017g         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary         'Smart, O.S.'       1  
primary         'Womack, T.O.'      2  
primary         'Flensburg, C.'     3  
primary         'Keller, P.'        4  
primary         'Paciorek, W.'      5  
primary         'Sharff, A.'        6  
primary         'Vonrhein, C.'      7  
primary         'Bricogne, G.'      8  
original_data_1 'Gordon, N.C.'      9  
original_data_1 'Pan, B.'           10 
original_data_1 'Hymowitz, S.G.'    11 
original_data_1 'Yin, J.P.'         12 
original_data_1 'F Kelley, R.'      13 
original_data_1 'Cochran, A.G.'     14 
original_data_1 'Yan, M.'           15 
original_data_1 'Dixit, V.M.'       16 
original_data_1 'Fairbrother, W.J.' 17 
original_data_1 'Starovasnik, M.A.' 18 
# 
_cell.entry_id           3V56 
_cell.length_a           121.633 
_cell.length_b           121.633 
_cell.length_c           157.214 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              42 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V56 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor ligand superfamily member 13B' 22746.762 6  ? ? ? ? 
2 polymer     syn 'BR3 derived peptive'                                 1593.918  7  ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                         96.063    2  ? ? ? ? 
4 water       nat water                                                 18.015    18 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;B lymphocyte stimulator, BLyS, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, Tumor necrosis factor ligand superfamily member 13b, membrane form, Tumor necrosis factor ligand superfamily member 13b, soluble form
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSHMELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPT
IQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMP
ETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
;
;GSHMELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPT
IQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMP
ETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
;
A,B,C,D,E,F   ? 
2 'polypeptide(L)' no yes '(ACE)CHWDLLVRHWVC(NH2)' XCHWDLLVRHWVCX G,H,I,J,K,L,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLU n 
1 6   LEU n 
1 7   GLN n 
1 8   GLY n 
1 9   HIS n 
1 10  HIS n 
1 11  ALA n 
1 12  GLU n 
1 13  LYS n 
1 14  LEU n 
1 15  PRO n 
1 16  ALA n 
1 17  GLY n 
1 18  ALA n 
1 19  GLY n 
1 20  ALA n 
1 21  PRO n 
1 22  LYS n 
1 23  ALA n 
1 24  GLY n 
1 25  LEU n 
1 26  GLU n 
1 27  GLU n 
1 28  ALA n 
1 29  PRO n 
1 30  ALA n 
1 31  VAL n 
1 32  THR n 
1 33  ALA n 
1 34  GLY n 
1 35  LEU n 
1 36  LYS n 
1 37  ILE n 
1 38  PHE n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  ALA n 
1 43  PRO n 
1 44  GLY n 
1 45  GLU n 
1 46  GLY n 
1 47  ASN n 
1 48  SER n 
1 49  SER n 
1 50  GLN n 
1 51  ASN n 
1 52  SER n 
1 53  ARG n 
1 54  ASN n 
1 55  LYS n 
1 56  ARG n 
1 57  ALA n 
1 58  VAL n 
1 59  GLN n 
1 60  GLY n 
1 61  PRO n 
1 62  GLU n 
1 63  GLU n 
1 64  THR n 
1 65  VAL n 
1 66  THR n 
1 67  GLN n 
1 68  ASP n 
1 69  CYS n 
1 70  LEU n 
1 71  GLN n 
1 72  LEU n 
1 73  ILE n 
1 74  ALA n 
1 75  ASP n 
1 76  SER n 
1 77  GLU n 
1 78  THR n 
1 79  PRO n 
1 80  THR n 
1 81  ILE n 
1 82  GLN n 
1 83  LYS n 
1 84  GLY n 
1 85  SER n 
1 86  TYR n 
1 87  THR n 
1 88  PHE n 
1 89  VAL n 
1 90  PRO n 
1 91  TRP n 
1 92  LEU n 
1 93  LEU n 
1 94  SER n 
1 95  PHE n 
1 96  LYS n 
1 97  ARG n 
1 98  GLY n 
1 99  SER n 
1 100 ALA n 
1 101 LEU n 
1 102 GLU n 
1 103 GLU n 
1 104 LYS n 
1 105 GLU n 
1 106 ASN n 
1 107 LYS n 
1 108 ILE n 
1 109 LEU n 
1 110 VAL n 
1 111 LYS n 
1 112 GLU n 
1 113 THR n 
1 114 GLY n 
1 115 TYR n 
1 116 PHE n 
1 117 PHE n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLN n 
1 122 VAL n 
1 123 LEU n 
1 124 TYR n 
1 125 THR n 
1 126 ASP n 
1 127 LYS n 
1 128 THR n 
1 129 TYR n 
1 130 ALA n 
1 131 MET n 
1 132 GLY n 
1 133 HIS n 
1 134 LEU n 
1 135 ILE n 
1 136 GLN n 
1 137 ARG n 
1 138 LYS n 
1 139 LYS n 
1 140 VAL n 
1 141 HIS n 
1 142 VAL n 
1 143 PHE n 
1 144 GLY n 
1 145 ASP n 
1 146 GLU n 
1 147 LEU n 
1 148 SER n 
1 149 LEU n 
1 150 VAL n 
1 151 THR n 
1 152 LEU n 
1 153 PHE n 
1 154 ARG n 
1 155 CYS n 
1 156 ILE n 
1 157 GLN n 
1 158 ASN n 
1 159 MET n 
1 160 PRO n 
1 161 GLU n 
1 162 THR n 
1 163 LEU n 
1 164 PRO n 
1 165 ASN n 
1 166 ASN n 
1 167 SER n 
1 168 CYS n 
1 169 TYR n 
1 170 SER n 
1 171 ALA n 
1 172 GLY n 
1 173 ILE n 
1 174 ALA n 
1 175 LYS n 
1 176 LEU n 
1 177 GLU n 
1 178 GLU n 
1 179 GLY n 
1 180 ASP n 
1 181 GLU n 
1 182 LEU n 
1 183 GLN n 
1 184 LEU n 
1 185 ALA n 
1 186 ILE n 
1 187 PRO n 
1 188 ARG n 
1 189 GLU n 
1 190 ASN n 
1 191 ALA n 
1 192 GLN n 
1 193 ILE n 
1 194 SER n 
1 195 LEU n 
1 196 ASP n 
1 197 GLY n 
1 198 ASP n 
1 199 VAL n 
1 200 THR n 
1 201 PHE n 
1 202 PHE n 
1 203 GLY n 
1 204 ALA n 
1 205 LEU n 
1 206 LYS n 
1 207 LEU n 
1 208 LEU n 
2 1   ACE n 
2 2   CYS n 
2 3   HIS n 
2 4   TRP n 
2 5   ASP n 
2 6   LEU n 
2 7   LEU n 
2 8   VAL n 
2 9   ARG n 
2 10  HIS n 
2 11  TRP n 
2 12  VAL n 
2 13  CYS n 
2 14  NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TNFSF13B, BAFF, BLYS, TALL1, TNFSF20, ZTNF4, UNQ401/PRO738' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TN13B_HUMAN 1 
;ELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKG
SYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLP
NNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
;
82 Q9Y275 ? 
2 PDB 3V56        2 CHWDLLVRHWVC ?  3V56   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3V56 A 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
2  1 3V56 B 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
3  1 3V56 C 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
4  1 3V56 D 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
5  1 3V56 E 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
6  1 3V56 F 5 ? 208 ? Q9Y275 82 ? 285 ? 82 285 
7  2 3V56 G 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
8  2 3V56 H 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
9  2 3V56 I 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
10 2 3V56 J 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
11 2 3V56 K 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
12 2 3V56 L 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
13 2 3V56 Z 1 ? 14  ? 3V56   22 ? 35  ? 22 35  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V56 GLY A 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 1  
1 3V56 SER A 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 2  
1 3V56 HIS A 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 3  
1 3V56 MET A 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 4  
2 3V56 GLY B 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 5  
2 3V56 SER B 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 6  
2 3V56 HIS B 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 7  
2 3V56 MET B 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 8  
3 3V56 GLY C 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 9  
3 3V56 SER C 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 10 
3 3V56 HIS C 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 11 
3 3V56 MET C 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 12 
4 3V56 GLY D 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 13 
4 3V56 SER D 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 14 
4 3V56 HIS D 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 15 
4 3V56 MET D 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 16 
5 3V56 GLY E 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 17 
5 3V56 SER E 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 18 
5 3V56 HIS E 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 19 
5 3V56 MET E 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 20 
6 3V56 GLY F 1 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 78 21 
6 3V56 SER F 2 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 79 22 
6 3V56 HIS F 3 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 80 23 
6 3V56 MET F 4 ? UNP Q9Y275 ? ? 'EXPRESSION TAG' 81 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3V56 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.91 
_exptl_crystal.description           'AUTHOR USED THE SF DATA FROM THE ENTRY 1OSG.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 3V56 
_refine.ls_number_reflns_obs                     26306 
_refine.ls_number_reflns_all                     26393 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.85 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    99.67 
_refine.ls_R_factor_obs                          0.1654 
_refine.ls_R_factor_all                          0.1654 
_refine.ls_R_factor_R_work                       0.1617 
_refine.ls_R_factor_R_free                       0.1999 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.64 
_refine.ls_number_reflns_R_free                  2536 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9445 
_refine.correlation_coeff_Fo_to_Fc_free          0.9201 
_refine.B_iso_mean                               50.54 
_refine.aniso_B[1][1]                            1.4780 
_refine.aniso_B[2][2]                            1.4780 
_refine.aniso_B[3][3]                            -2.9561 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;1. X-ray weight: 14.83. 2. Void correction : ON. 3. Similarity, NCS representation : RESTRAINT LSSR, Target restraints: NONE, Target structure : NULL. 4. Molecules SO4 A 499, SO4 D 499, HOH A 500, HOH D 500 are modeled into density on NCS 3 fold axes where map interpretation is difficult, and so should be treated with caution. 5. Due to radiation damage or only partial oxidation residues CYS 232 and CYS 245 in the A, B, C, D, E and F chains form only a partial disulfide bond. The disulfide bond is modeled as the A alternate whereas the B alternate represents the reduced CYS residues.
;
_refine.pdbx_starting_model                      '1OSG with water molecules and ions removed.' 
_refine.pdbx_method_to_determine_struct          RE-REFINEMENT 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber EH99' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3V56 
_refine_analyze.Luzzati_coordinate_error_obs    0.339 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7406 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             18 
_refine_hist.number_atoms_total               7434 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        29.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  7595  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.20  ? 2.00  10339 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  2520  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  189   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  1088  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 7595  HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_omega_torsion           3.15  ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_other_torsion           19.75 ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  1002  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? 1.00  12    HARMONIC     'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? 1.00  12    HARMONIC     'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  8381  SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   13 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.12 
_refine_ls_shell.number_reflns_R_work             2665 
_refine_ls_shell.R_factor_R_work                  0.2090 
_refine_ls_shell.percent_reflns_obs               99.67 
_refine_ls_shell.R_factor_R_free                  0.2849 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10.36 
_refine_ls_shell.number_reflns_R_free             308 
_refine_ls_shell.number_reflns_all                2973 
_refine_ls_shell.R_factor_all                     0.2165 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3V56 
_struct.title                     
;Re-refinement of PDB entry 1OSG - Complex between BAFF and a BR3 derived peptide presented in a beta-hairpin scaffold - reveals an additonal copy of the peptide.
;
_struct.pdbx_descriptor           'Tumor necrosis factor ligand superfamily member 13B, BR3 derived PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V56 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'JELLY-ROLL, BETA HAIRPIN, PROTEIN-PEPTIDE COMPLEX, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 3 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The biologically relevant assembly of BAFF is a trimer. The crystallographic asymmetric unit contains two trimers. Each individual BAFF trimer binds 3 copies of BR3 peptide. An additional copy of the BR3 peptide was located in this re-refinement at a crystal contact (modeled as the Z chain). The additional BR3 peptide is not biologically relevant.
;
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 155 SG A ? ? 1_555 A CYS 168 SG A ? A CYS 232 A CYS 245 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2  disulf ? ? B CYS 155 SG A ? ? 1_555 B CYS 168 SG A ? B CYS 232 B CYS 245 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3  disulf ? ? C CYS 155 SG A ? ? 1_555 C CYS 168 SG A ? C CYS 232 C CYS 245 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4  disulf ? ? D CYS 155 SG A ? ? 1_555 D CYS 168 SG A ? D CYS 232 D CYS 245 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5  disulf ? ? E CYS 155 SG A ? ? 1_555 E CYS 168 SG A ? E CYS 232 E CYS 245 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf6  disulf ? ? F CYS 155 SG A ? ? 1_555 F CYS 168 SG A ? F CYS 232 F CYS 245 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? G CYS 2   SG ? ? ? 1_555 G CYS 13  SG ? ? G CYS 23  G CYS 34  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf8  disulf ? ? H CYS 2   SG ? ? ? 1_555 H CYS 13  SG ? ? H CYS 23  H CYS 34  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf9  disulf ? ? I CYS 2   SG ? ? ? 1_555 I CYS 13  SG ? ? I CYS 23  I CYS 34  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf10 disulf ? ? J CYS 2   SG ? ? ? 1_555 J CYS 13  SG ? ? J CYS 23  J CYS 34  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf11 disulf ? ? K CYS 2   SG ? ? ? 1_555 K CYS 13  SG ? ? K CYS 23  K CYS 34  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf12 disulf ? ? L CYS 2   SG ? ? ? 1_555 L CYS 13  SG ? ? L CYS 23  L CYS 34  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf13 disulf ? ? M CYS 2   SG ? ? ? 1_555 M CYS 13  SG ? ? Z CYS 23  Z CYS 34  1_555 ? ? ? ? ? ? ? 2.034 ? 
covale1  covale ? ? G ACE 1   C  ? ? ? 1_555 G CYS 2   N  ? ? G ACE 22  G CYS 23  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale2  covale ? ? G CYS 13  C  ? ? ? 1_555 G NH2 14  N  ? ? G CYS 34  G NH2 35  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale3  covale ? ? H CYS 13  C  ? ? ? 1_555 H NH2 14  N  ? ? H CYS 34  H NH2 35  1_555 ? ? ? ? ? ? ? 1.340 ? 
covale4  covale ? ? I CYS 13  C  ? ? ? 1_555 I NH2 14  N  ? ? I CYS 34  I NH2 35  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale5  covale ? ? J CYS 13  C  ? ? ? 1_555 J NH2 14  N  ? ? J CYS 34  J NH2 35  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale6  covale ? ? K CYS 13  C  ? ? ? 1_555 K NH2 14  N  ? ? K CYS 34  K NH2 35  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale7  covale ? ? L CYS 13  C  ? ? ? 1_555 L NH2 14  N  ? ? L CYS 34  L NH2 35  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale8  covale ? ? M CYS 13  C  ? ? ? 1_555 M NH2 14  N  ? ? Z CYS 34  Z NH2 35  1_555 ? ? ? ? ? ? ? 1.335 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 5 ? 
C  ? 4 ? 
D  ? 4 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 5 ? 
H  ? 5 ? 
I  ? 5 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 5 ? 
M  ? 5 ? 
N  ? 5 ? 
O  ? 2 ? 
P  ? 5 ? 
Q  ? 5 ? 
R  ? 4 ? 
S  ? 4 ? 
T  ? 2 ? 
U  ? 5 ? 
V  ? 5 ? 
W  ? 5 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 5 ? 
AB ? 5 ? 
AC ? 5 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 4 ? 
AJ ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? parallel      
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 TRP A 91  ? ARG A 97  ? TRP A 168 ARG A 174 
A  2 CYS A 69  ? ALA A 74  ? CYS A 146 ALA A 151 
A  3 PHE A 201 ? LYS A 206 ? PHE A 278 LYS A 283 
A  4 GLY A 114 ? TYR A 124 ? GLY A 191 TYR A 201 
A  5 ASN A 166 ? LEU A 176 ? ASN A 243 LEU A 253 
B  1 TRP A 91  ? ARG A 97  ? TRP A 168 ARG A 174 
B  2 CYS A 69  ? ALA A 74  ? CYS A 146 ALA A 151 
B  3 PHE A 201 ? LYS A 206 ? PHE A 278 LYS A 283 
B  4 GLY A 114 ? TYR A 124 ? GLY A 191 TYR A 201 
B  5 ILE A 193 ? SER A 194 ? ILE A 270 SER A 271 
C  1 THR A 87  ? PHE A 88  ? THR A 164 PHE A 165 
C  2 GLU A 181 ? ILE A 186 ? GLU A 258 ILE A 263 
C  3 LYS A 107 ? VAL A 110 ? LYS A 184 VAL A 187 
C  4 LEU A 101 ? LYS A 104 ? LEU A 178 LYS A 181 
D  1 THR A 87  ? PHE A 88  ? THR A 164 PHE A 165 
D  2 GLU A 181 ? ILE A 186 ? GLU A 258 ILE A 263 
D  3 LEU A 134 ? LYS A 138 ? LEU A 211 LYS A 215 
D  4 LEU A 149 ? ARG A 154 ? LEU A 226 ARG A 231 
E  1 ALA A 130 ? MET A 131 ? ALA A 207 MET A 208 
E  2 GLN A 157 ? ASN A 158 ? GLN A 234 ASN A 235 
F  1 TRP B 91  ? ARG B 97  ? TRP B 168 ARG B 174 
F  2 CYS B 69  ? ALA B 74  ? CYS B 146 ALA B 151 
F  3 PHE B 201 ? LYS B 206 ? PHE B 278 LYS B 283 
F  4 GLY B 114 ? TYR B 124 ? GLY B 191 TYR B 201 
F  5 ASN B 166 ? LEU B 176 ? ASN B 243 LEU B 253 
G  1 TRP B 91  ? ARG B 97  ? TRP B 168 ARG B 174 
G  2 CYS B 69  ? ALA B 74  ? CYS B 146 ALA B 151 
G  3 PHE B 201 ? LYS B 206 ? PHE B 278 LYS B 283 
G  4 GLY B 114 ? TYR B 124 ? GLY B 191 TYR B 201 
G  5 ILE B 193 ? SER B 194 ? ILE B 270 SER B 271 
H  1 ILE B 81  ? LYS B 83  ? ILE B 158 LYS B 160 
H  2 TYR B 86  ? PHE B 88  ? TYR B 163 PHE B 165 
H  3 GLU B 181 ? ILE B 186 ? GLU B 258 ILE B 263 
H  4 LYS B 107 ? VAL B 110 ? LYS B 184 VAL B 187 
H  5 LEU B 101 ? LYS B 104 ? LEU B 178 LYS B 181 
I  1 ILE B 81  ? LYS B 83  ? ILE B 158 LYS B 160 
I  2 TYR B 86  ? PHE B 88  ? TYR B 163 PHE B 165 
I  3 GLU B 181 ? ILE B 186 ? GLU B 258 ILE B 263 
I  4 LEU B 134 ? LYS B 138 ? LEU B 211 LYS B 215 
I  5 LEU B 149 ? ARG B 154 ? LEU B 226 ARG B 231 
J  1 ALA B 130 ? MET B 131 ? ALA B 207 MET B 208 
J  2 GLN B 157 ? ASN B 158 ? GLN B 234 ASN B 235 
K  1 TRP C 91  ? ARG C 97  ? TRP C 168 ARG C 174 
K  2 CYS C 69  ? ALA C 74  ? CYS C 146 ALA C 151 
K  3 PHE C 201 ? LYS C 206 ? PHE C 278 LYS C 283 
K  4 GLY C 114 ? TYR C 124 ? GLY C 191 TYR C 201 
K  5 ASN C 166 ? LEU C 176 ? ASN C 243 LEU C 253 
L  1 TRP C 91  ? ARG C 97  ? TRP C 168 ARG C 174 
L  2 CYS C 69  ? ALA C 74  ? CYS C 146 ALA C 151 
L  3 PHE C 201 ? LYS C 206 ? PHE C 278 LYS C 283 
L  4 GLY C 114 ? TYR C 124 ? GLY C 191 TYR C 201 
L  5 ILE C 193 ? SER C 194 ? ILE C 270 SER C 271 
M  1 ILE C 81  ? LYS C 83  ? ILE C 158 LYS C 160 
M  2 TYR C 86  ? PHE C 88  ? TYR C 163 PHE C 165 
M  3 GLU C 181 ? ILE C 186 ? GLU C 258 ILE C 263 
M  4 LYS C 107 ? VAL C 110 ? LYS C 184 VAL C 187 
M  5 LEU C 101 ? LYS C 104 ? LEU C 178 LYS C 181 
N  1 ILE C 81  ? LYS C 83  ? ILE C 158 LYS C 160 
N  2 TYR C 86  ? PHE C 88  ? TYR C 163 PHE C 165 
N  3 GLU C 181 ? ILE C 186 ? GLU C 258 ILE C 263 
N  4 LEU C 134 ? LYS C 138 ? LEU C 211 LYS C 215 
N  5 LEU C 149 ? ARG C 154 ? LEU C 226 ARG C 231 
O  1 ALA C 130 ? MET C 131 ? ALA C 207 MET C 208 
O  2 GLN C 157 ? ASN C 158 ? GLN C 234 ASN C 235 
P  1 TRP D 91  ? ARG D 97  ? TRP D 168 ARG D 174 
P  2 CYS D 69  ? ALA D 74  ? CYS D 146 ALA D 151 
P  3 PHE D 201 ? LYS D 206 ? PHE D 278 LYS D 283 
P  4 GLY D 114 ? TYR D 124 ? GLY D 191 TYR D 201 
P  5 ASN D 166 ? LEU D 176 ? ASN D 243 LEU D 253 
Q  1 TRP D 91  ? ARG D 97  ? TRP D 168 ARG D 174 
Q  2 CYS D 69  ? ALA D 74  ? CYS D 146 ALA D 151 
Q  3 PHE D 201 ? LYS D 206 ? PHE D 278 LYS D 283 
Q  4 GLY D 114 ? TYR D 124 ? GLY D 191 TYR D 201 
Q  5 ILE D 193 ? SER D 194 ? ILE D 270 SER D 271 
R  1 THR D 87  ? PHE D 88  ? THR D 164 PHE D 165 
R  2 GLU D 181 ? ILE D 186 ? GLU D 258 ILE D 263 
R  3 LYS D 107 ? VAL D 110 ? LYS D 184 VAL D 187 
R  4 LEU D 101 ? LYS D 104 ? LEU D 178 LYS D 181 
S  1 THR D 87  ? PHE D 88  ? THR D 164 PHE D 165 
S  2 GLU D 181 ? ILE D 186 ? GLU D 258 ILE D 263 
S  3 LEU D 134 ? LYS D 138 ? LEU D 211 LYS D 215 
S  4 LEU D 149 ? ARG D 154 ? LEU D 226 ARG D 231 
T  1 ALA D 130 ? MET D 131 ? ALA D 207 MET D 208 
T  2 GLN D 157 ? ASN D 158 ? GLN D 234 ASN D 235 
U  1 TRP E 91  ? ARG E 97  ? TRP E 168 ARG E 174 
U  2 CYS E 69  ? ALA E 74  ? CYS E 146 ALA E 151 
U  3 PHE E 201 ? LYS E 206 ? PHE E 278 LYS E 283 
U  4 GLY E 114 ? TYR E 124 ? GLY E 191 TYR E 201 
U  5 ASN E 166 ? LEU E 176 ? ASN E 243 LEU E 253 
V  1 TRP E 91  ? ARG E 97  ? TRP E 168 ARG E 174 
V  2 CYS E 69  ? ALA E 74  ? CYS E 146 ALA E 151 
V  3 PHE E 201 ? LYS E 206 ? PHE E 278 LYS E 283 
V  4 GLY E 114 ? TYR E 124 ? GLY E 191 TYR E 201 
V  5 ILE E 193 ? SER E 194 ? ILE E 270 SER E 271 
W  1 ILE E 81  ? LYS E 83  ? ILE E 158 LYS E 160 
W  2 TYR E 86  ? PHE E 88  ? TYR E 163 PHE E 165 
W  3 GLU E 181 ? ILE E 186 ? GLU E 258 ILE E 263 
W  4 LYS E 107 ? VAL E 110 ? LYS E 184 VAL E 187 
W  5 LEU E 101 ? LYS E 104 ? LEU E 178 LYS E 181 
X  1 ILE E 81  ? LYS E 83  ? ILE E 158 LYS E 160 
X  2 TYR E 86  ? PHE E 88  ? TYR E 163 PHE E 165 
X  3 GLU E 181 ? ILE E 186 ? GLU E 258 ILE E 263 
X  4 LEU E 134 ? LYS E 138 ? LEU E 211 LYS E 215 
X  5 LEU E 149 ? ARG E 154 ? LEU E 226 ARG E 231 
Y  1 ALA E 130 ? MET E 131 ? ALA E 207 MET E 208 
Y  2 GLN E 157 ? ASN E 158 ? GLN E 234 ASN E 235 
Z  1 TRP F 91  ? ARG F 97  ? TRP F 168 ARG F 174 
Z  2 CYS F 69  ? ALA F 74  ? CYS F 146 ALA F 151 
Z  3 PHE F 201 ? LYS F 206 ? PHE F 278 LYS F 283 
Z  4 GLY F 114 ? TYR F 124 ? GLY F 191 TYR F 201 
Z  5 ASN F 166 ? LEU F 176 ? ASN F 243 LEU F 253 
AA 1 TRP F 91  ? ARG F 97  ? TRP F 168 ARG F 174 
AA 2 CYS F 69  ? ALA F 74  ? CYS F 146 ALA F 151 
AA 3 PHE F 201 ? LYS F 206 ? PHE F 278 LYS F 283 
AA 4 GLY F 114 ? TYR F 124 ? GLY F 191 TYR F 201 
AA 5 ILE F 193 ? SER F 194 ? ILE F 270 SER F 271 
AB 1 ILE F 81  ? LYS F 83  ? ILE F 158 LYS F 160 
AB 2 TYR F 86  ? PHE F 88  ? TYR F 163 PHE F 165 
AB 3 GLU F 181 ? ILE F 186 ? GLU F 258 ILE F 263 
AB 4 LYS F 107 ? VAL F 110 ? LYS F 184 VAL F 187 
AB 5 LEU F 101 ? LYS F 104 ? LEU F 178 LYS F 181 
AC 1 ILE F 81  ? LYS F 83  ? ILE F 158 LYS F 160 
AC 2 TYR F 86  ? PHE F 88  ? TYR F 163 PHE F 165 
AC 3 GLU F 181 ? ILE F 186 ? GLU F 258 ILE F 263 
AC 4 LEU F 134 ? LYS F 138 ? LEU F 211 LYS F 215 
AC 5 LEU F 149 ? ARG F 154 ? LEU F 226 ARG F 231 
AD 1 ALA F 130 ? MET F 131 ? ALA F 207 MET F 208 
AD 2 GLN F 157 ? ASN F 158 ? GLN F 234 ASN F 235 
AE 1 HIS G 3   ? ASP G 5   ? HIS G 24  ASP G 26  
AE 2 HIS G 10  ? VAL G 12  ? HIS G 31  VAL G 33  
AF 1 HIS H 3   ? ASP H 5   ? HIS H 24  ASP H 26  
AF 2 HIS H 10  ? VAL H 12  ? HIS H 31  VAL H 33  
AG 1 HIS I 3   ? ASP I 5   ? HIS I 24  ASP I 26  
AG 2 HIS I 10  ? VAL I 12  ? HIS I 31  VAL I 33  
AH 1 HIS J 3   ? ASP J 5   ? HIS J 24  ASP J 26  
AH 2 HIS J 10  ? VAL J 12  ? HIS J 31  VAL J 33  
AI 1 HIS K 10  ? VAL K 12  ? HIS K 31  VAL K 33  
AI 2 HIS K 3   ? ASP K 5   ? HIS K 24  ASP K 26  
AI 3 HIS M 10  ? CYS M 13  ? HIS Z 31  CYS Z 34  
AI 4 HIS M 3   ? ASP M 5   ? HIS Z 24  ASP Z 26  
AJ 1 HIS L 3   ? ASP L 5   ? HIS L 24  ASP L 26  
AJ 2 HIS L 10  ? VAL L 12  ? HIS L 31  VAL L 33  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ARG A 97  ? O ARG A 174 N CYS A 69  ? N CYS A 146 
A  2 3 N LEU A 72  ? N LEU A 149 O PHE A 202 ? O PHE A 279 
A  3 4 O LEU A 205 ? O LEU A 282 N PHE A 117 ? N PHE A 194 
A  4 5 N TYR A 124 ? N TYR A 201 O ASN A 166 ? O ASN A 243 
B  1 2 O ARG A 97  ? O ARG A 174 N CYS A 69  ? N CYS A 146 
B  2 3 N LEU A 72  ? N LEU A 149 O PHE A 202 ? O PHE A 279 
B  3 4 O LEU A 205 ? O LEU A 282 N PHE A 117 ? N PHE A 194 
B  4 5 N LEU A 123 ? N LEU A 200 O SER A 194 ? O SER A 271 
C  1 2 N THR A 87  ? N THR A 164 O ILE A 186 ? O ILE A 263 
C  2 3 O LEU A 182 ? O LEU A 259 N ILE A 108 ? N ILE A 185 
C  3 4 O LEU A 109 ? O LEU A 186 N GLU A 102 ? N GLU A 179 
D  1 2 N THR A 87  ? N THR A 164 O ILE A 186 ? O ILE A 263 
D  2 3 O GLU A 181 ? O GLU A 258 N LYS A 138 ? N LYS A 215 
D  3 4 N ILE A 135 ? N ILE A 212 O PHE A 153 ? O PHE A 230 
E  1 2 N MET A 131 ? N MET A 208 O GLN A 157 ? O GLN A 234 
F  1 2 O LEU B 92  ? O LEU B 169 N ILE B 73  ? N ILE B 150 
F  2 3 N LEU B 72  ? N LEU B 149 O PHE B 202 ? O PHE B 279 
F  3 4 O PHE B 201 ? O PHE B 278 N GLN B 121 ? N GLN B 198 
F  4 5 N TYR B 124 ? N TYR B 201 O ASN B 166 ? O ASN B 243 
G  1 2 O LEU B 92  ? O LEU B 169 N ILE B 73  ? N ILE B 150 
G  2 3 N LEU B 72  ? N LEU B 149 O PHE B 202 ? O PHE B 279 
G  3 4 O PHE B 201 ? O PHE B 278 N GLN B 121 ? N GLN B 198 
G  4 5 N LEU B 123 ? N LEU B 200 O SER B 194 ? O SER B 271 
H  1 2 N ILE B 81  ? N ILE B 158 O PHE B 88  ? O PHE B 165 
H  2 3 N THR B 87  ? N THR B 164 O ILE B 186 ? O ILE B 263 
H  3 4 O LEU B 182 ? O LEU B 259 N ILE B 108 ? N ILE B 185 
H  4 5 O LEU B 109 ? O LEU B 186 N GLU B 102 ? N GLU B 179 
I  1 2 N ILE B 81  ? N ILE B 158 O PHE B 88  ? O PHE B 165 
I  2 3 N THR B 87  ? N THR B 164 O ILE B 186 ? O ILE B 263 
I  3 4 O GLU B 181 ? O GLU B 258 N LYS B 138 ? N LYS B 215 
I  4 5 N ILE B 135 ? N ILE B 212 O PHE B 153 ? O PHE B 230 
J  1 2 N MET B 131 ? N MET B 208 O GLN B 157 ? O GLN B 234 
K  1 2 O ARG C 97  ? O ARG C 174 N CYS C 69  ? N CYS C 146 
K  2 3 N LEU C 72  ? N LEU C 149 O PHE C 202 ? O PHE C 279 
K  3 4 O LEU C 205 ? O LEU C 282 N PHE C 117 ? N PHE C 194 
K  4 5 N TYR C 124 ? N TYR C 201 O ASN C 166 ? O ASN C 243 
L  1 2 O ARG C 97  ? O ARG C 174 N CYS C 69  ? N CYS C 146 
L  2 3 N LEU C 72  ? N LEU C 149 O PHE C 202 ? O PHE C 279 
L  3 4 O LEU C 205 ? O LEU C 282 N PHE C 117 ? N PHE C 194 
L  4 5 N LEU C 123 ? N LEU C 200 O SER C 194 ? O SER C 271 
M  1 2 N ILE C 81  ? N ILE C 158 O PHE C 88  ? O PHE C 165 
M  2 3 N THR C 87  ? N THR C 164 O ILE C 186 ? O ILE C 263 
M  3 4 O LEU C 182 ? O LEU C 259 N ILE C 108 ? N ILE C 185 
M  4 5 O LEU C 109 ? O LEU C 186 N GLU C 102 ? N GLU C 179 
N  1 2 N ILE C 81  ? N ILE C 158 O PHE C 88  ? O PHE C 165 
N  2 3 N THR C 87  ? N THR C 164 O ILE C 186 ? O ILE C 263 
N  3 4 O GLU C 181 ? O GLU C 258 N LYS C 138 ? N LYS C 215 
N  4 5 N ILE C 135 ? N ILE C 212 O LEU C 152 ? O LEU C 229 
O  1 2 N MET C 131 ? N MET C 208 O GLN C 157 ? O GLN C 234 
P  1 2 O LEU D 92  ? O LEU D 169 N ILE D 73  ? N ILE D 150 
P  2 3 N LEU D 72  ? N LEU D 149 O PHE D 202 ? O PHE D 279 
P  3 4 O LEU D 205 ? O LEU D 282 N PHE D 117 ? N PHE D 194 
P  4 5 N TYR D 124 ? N TYR D 201 O ASN D 166 ? O ASN D 243 
Q  1 2 O LEU D 92  ? O LEU D 169 N ILE D 73  ? N ILE D 150 
Q  2 3 N LEU D 72  ? N LEU D 149 O PHE D 202 ? O PHE D 279 
Q  3 4 O LEU D 205 ? O LEU D 282 N PHE D 117 ? N PHE D 194 
Q  4 5 N LEU D 123 ? N LEU D 200 O SER D 194 ? O SER D 271 
R  1 2 N THR D 87  ? N THR D 164 O ILE D 186 ? O ILE D 263 
R  2 3 O LEU D 182 ? O LEU D 259 N ILE D 108 ? N ILE D 185 
R  3 4 O LEU D 109 ? O LEU D 186 N GLU D 102 ? N GLU D 179 
S  1 2 N THR D 87  ? N THR D 164 O ILE D 186 ? O ILE D 263 
S  2 3 O GLU D 181 ? O GLU D 258 N LYS D 138 ? N LYS D 215 
S  3 4 N ILE D 135 ? N ILE D 212 O LEU D 152 ? O LEU D 229 
T  1 2 N MET D 131 ? N MET D 208 O GLN D 157 ? O GLN D 234 
U  1 2 O ARG E 97  ? O ARG E 174 N CYS E 69  ? N CYS E 146 
U  2 3 N LEU E 72  ? N LEU E 149 O PHE E 202 ? O PHE E 279 
U  3 4 O LEU E 205 ? O LEU E 282 N PHE E 117 ? N PHE E 194 
U  4 5 N GLY E 114 ? N GLY E 191 O LEU E 176 ? O LEU E 253 
V  1 2 O ARG E 97  ? O ARG E 174 N CYS E 69  ? N CYS E 146 
V  2 3 N LEU E 72  ? N LEU E 149 O PHE E 202 ? O PHE E 279 
V  3 4 O LEU E 205 ? O LEU E 282 N PHE E 117 ? N PHE E 194 
V  4 5 N LEU E 123 ? N LEU E 200 O SER E 194 ? O SER E 271 
W  1 2 N ILE E 81  ? N ILE E 158 O PHE E 88  ? O PHE E 165 
W  2 3 N THR E 87  ? N THR E 164 O ILE E 186 ? O ILE E 263 
W  3 4 O LEU E 182 ? O LEU E 259 N ILE E 108 ? N ILE E 185 
W  4 5 O LEU E 109 ? O LEU E 186 N GLU E 102 ? N GLU E 179 
X  1 2 N ILE E 81  ? N ILE E 158 O PHE E 88  ? O PHE E 165 
X  2 3 N THR E 87  ? N THR E 164 O ILE E 186 ? O ILE E 263 
X  3 4 O GLU E 181 ? O GLU E 258 N LYS E 138 ? N LYS E 215 
X  4 5 N ILE E 135 ? N ILE E 212 O PHE E 153 ? O PHE E 230 
Y  1 2 N MET E 131 ? N MET E 208 O GLN E 157 ? O GLN E 234 
Z  1 2 O ARG F 97  ? O ARG F 174 N CYS F 69  ? N CYS F 146 
Z  2 3 N LEU F 72  ? N LEU F 149 O PHE F 202 ? O PHE F 279 
Z  3 4 O LEU F 205 ? O LEU F 282 N PHE F 117 ? N PHE F 194 
Z  4 5 N TYR F 124 ? N TYR F 201 O ASN F 166 ? O ASN F 243 
AA 1 2 O ARG F 97  ? O ARG F 174 N CYS F 69  ? N CYS F 146 
AA 2 3 N LEU F 72  ? N LEU F 149 O PHE F 202 ? O PHE F 279 
AA 3 4 O LEU F 205 ? O LEU F 282 N PHE F 117 ? N PHE F 194 
AA 4 5 N LEU F 123 ? N LEU F 200 O SER F 194 ? O SER F 271 
AB 1 2 N ILE F 81  ? N ILE F 158 O PHE F 88  ? O PHE F 165 
AB 2 3 N THR F 87  ? N THR F 164 O ILE F 186 ? O ILE F 263 
AB 3 4 O LEU F 182 ? O LEU F 259 N ILE F 108 ? N ILE F 185 
AB 4 5 O LEU F 109 ? O LEU F 186 N GLU F 102 ? N GLU F 179 
AC 1 2 N ILE F 81  ? N ILE F 158 O PHE F 88  ? O PHE F 165 
AC 2 3 N THR F 87  ? N THR F 164 O ILE F 186 ? O ILE F 263 
AC 3 4 O GLU F 181 ? O GLU F 258 N LYS F 138 ? N LYS F 215 
AC 4 5 N ILE F 135 ? N ILE F 212 O LEU F 152 ? O LEU F 229 
AD 1 2 N MET F 131 ? N MET F 208 O GLN F 157 ? O GLN F 234 
AE 1 2 N HIS G 3   ? N HIS G 24  O VAL G 12  ? O VAL G 33  
AF 1 2 N ASP H 5   ? N ASP H 26  O HIS H 10  ? O HIS H 31  
AG 1 2 N ASP I 5   ? N ASP I 26  O HIS I 10  ? O HIS I 31  
AH 1 2 N HIS J 3   ? N HIS J 24  O VAL J 12  ? O VAL J 33  
AI 1 2 O HIS K 10  ? O HIS K 31  N ASP K 5   ? N ASP K 26  
AI 2 3 N TRP K 4   ? N TRP K 25  O TRP M 11  ? O TRP Z 32  
AI 3 4 O VAL M 12  ? O VAL Z 33  N HIS M 3   ? N HIS Z 24  
AJ 1 2 N ASP L 5   ? N ASP L 26  O HIS L 10  ? O HIS L 31  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 499' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 D 499' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 GLN A 157 ? GLN A 234 . ? 1_555 ? 
2  AC1 9 ASN A 158 ? ASN A 235 . ? 1_555 ? 
3  AC1 9 ASN A 166 ? ASN A 243 . ? 1_555 ? 
4  AC1 9 GLN B 157 ? GLN B 234 . ? 1_555 ? 
5  AC1 9 ASN B 158 ? ASN B 235 . ? 1_555 ? 
6  AC1 9 ASN B 166 ? ASN B 243 . ? 1_555 ? 
7  AC1 9 GLN C 157 ? GLN C 234 . ? 1_555 ? 
8  AC1 9 ASN C 158 ? ASN C 235 . ? 1_555 ? 
9  AC1 9 ASN C 166 ? ASN C 243 . ? 1_555 ? 
10 AC2 9 GLN D 157 ? GLN D 234 . ? 1_555 ? 
11 AC2 9 ASN D 158 ? ASN D 235 . ? 1_555 ? 
12 AC2 9 ASN D 166 ? ASN D 243 . ? 1_555 ? 
13 AC2 9 GLN E 157 ? GLN E 234 . ? 1_555 ? 
14 AC2 9 ASN E 158 ? ASN E 235 . ? 1_555 ? 
15 AC2 9 ASN E 166 ? ASN E 243 . ? 1_555 ? 
16 AC2 9 GLN F 157 ? GLN F 234 . ? 1_555 ? 
17 AC2 9 ASN F 158 ? ASN F 235 . ? 1_555 ? 
18 AC2 9 ASN F 166 ? ASN F 243 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3V56 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3V56 
_atom_sites.fract_transf_matrix[1][1]   0.008221 
_atom_sites.fract_transf_matrix[1][2]   0.004747 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006361 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 65  ? 50.256  14.674  -10.679 1.00 70.12  ? 142 VAL A N   1 
ATOM   2    C CA  . VAL A 1 65  ? 51.458  14.509  -9.844  1.00 68.41  ? 142 VAL A CA  1 
ATOM   3    C C   . VAL A 1 65  ? 52.659  15.278  -10.437 1.00 69.66  ? 142 VAL A C   1 
ATOM   4    O O   . VAL A 1 65  ? 52.810  15.313  -11.656 1.00 70.97  ? 142 VAL A O   1 
ATOM   5    C CB  . VAL A 1 65  ? 51.815  13.026  -9.510  1.00 71.90  ? 142 VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 65  ? 52.717  12.934  -8.267  1.00 69.98  ? 142 VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 65  ? 50.557  12.189  -9.306  1.00 74.51  ? 142 VAL A CG2 1 
ATOM   8    N N   . THR A 1 66  ? 53.503  15.891  -9.571  1.00 60.99  ? 143 THR A N   1 
ATOM   9    C CA  . THR A 1 66  ? 54.651  16.686  -9.989  1.00 56.64  ? 143 THR A CA  1 
ATOM   10   C C   . THR A 1 66  ? 55.994  16.096  -9.587  1.00 56.06  ? 143 THR A C   1 
ATOM   11   O O   . THR A 1 66  ? 56.065  15.260  -8.672  1.00 56.20  ? 143 THR A O   1 
ATOM   12   C CB  . THR A 1 66  ? 54.533  18.155  -9.504  1.00 60.50  ? 143 THR A CB  1 
ATOM   13   O OG1 . THR A 1 66  ? 54.779  18.235  -8.102  1.00 59.89  ? 143 THR A OG1 1 
ATOM   14   C CG2 . THR A 1 66  ? 53.207  18.821  -9.877  1.00 60.13  ? 143 THR A CG2 1 
ATOM   15   N N   . GLN A 1 67  ? 57.071  16.581  -10.263 1.00 47.38  ? 144 GLN A N   1 
ATOM   16   C CA  . GLN A 1 67  ? 58.458  16.216  -10.002 1.00 43.15  ? 144 GLN A CA  1 
ATOM   17   C C   . GLN A 1 67  ? 59.083  17.249  -9.075  1.00 45.36  ? 144 GLN A C   1 
ATOM   18   O O   . GLN A 1 67  ? 59.417  18.345  -9.524  1.00 44.27  ? 144 GLN A O   1 
ATOM   19   C CB  . GLN A 1 67  ? 59.242  16.126  -11.300 1.00 41.87  ? 144 GLN A CB  1 
ATOM   20   C CG  . GLN A 1 67  ? 59.092  14.805  -11.995 1.00 53.06  ? 144 GLN A CG  1 
ATOM   21   C CD  . GLN A 1 67  ? 59.636  14.882  -13.394 1.00 71.76  ? 144 GLN A CD  1 
ATOM   22   O OE1 . GLN A 1 67  ? 59.050  15.483  -14.304 1.00 60.85  ? 144 GLN A OE1 1 
ATOM   23   N NE2 . GLN A 1 67  ? 60.795  14.300  -13.587 1.00 74.77  ? 144 GLN A NE2 1 
ATOM   24   N N   . ASP A 1 68  ? 59.201  16.919  -7.770  1.00 41.31  ? 145 ASP A N   1 
ATOM   25   C CA  . ASP A 1 68  ? 59.828  17.796  -6.790  1.00 40.19  ? 145 ASP A CA  1 
ATOM   26   C C   . ASP A 1 68  ? 61.282  18.048  -7.190  1.00 42.10  ? 145 ASP A C   1 
ATOM   27   O O   . ASP A 1 68  ? 61.952  17.163  -7.707  1.00 39.84  ? 145 ASP A O   1 
ATOM   28   C CB  . ASP A 1 68  ? 59.761  17.209  -5.363  1.00 42.87  ? 145 ASP A CB  1 
ATOM   29   C CG  . ASP A 1 68  ? 58.371  17.137  -4.762  1.00 56.37  ? 145 ASP A CG  1 
ATOM   30   O OD1 . ASP A 1 68  ? 57.397  17.542  -5.459  1.00 60.57  ? 145 ASP A OD1 1 
ATOM   31   O OD2 . ASP A 1 68  ? 58.259  16.756  -3.562  1.00 53.31  ? 145 ASP A OD2 1 
ATOM   32   N N   . CYS A 1 69  ? 61.745  19.270  -7.014  1.00 39.91  ? 146 CYS A N   1 
ATOM   33   C CA  . CYS A 1 69  ? 63.117  19.628  -7.339  1.00 39.32  ? 146 CYS A CA  1 
ATOM   34   C C   . CYS A 1 69  ? 63.585  20.813  -6.520  1.00 43.57  ? 146 CYS A C   1 
ATOM   35   O O   . CYS A 1 69  ? 62.780  21.615  -6.028  1.00 44.63  ? 146 CYS A O   1 
ATOM   36   C CB  . CYS A 1 69  ? 63.324  19.852  -8.838  1.00 39.76  ? 146 CYS A CB  1 
ATOM   37   S SG  . CYS A 1 69  ? 61.972  20.727  -9.670  1.00 45.40  ? 146 CYS A SG  1 
ATOM   38   N N   . LEU A 1 70  ? 64.891  20.887  -6.321  1.00 38.74  ? 147 LEU A N   1 
ATOM   39   C CA  . LEU A 1 70  ? 65.508  21.981  -5.597  1.00 38.20  ? 147 LEU A CA  1 
ATOM   40   C C   . LEU A 1 70  ? 66.782  22.314  -6.333  1.00 39.13  ? 147 LEU A C   1 
ATOM   41   O O   . LEU A 1 70  ? 67.547  21.407  -6.691  1.00 37.90  ? 147 LEU A O   1 
ATOM   42   C CB  . LEU A 1 70  ? 65.812  21.579  -4.149  1.00 38.90  ? 147 LEU A CB  1 
ATOM   43   C CG  . LEU A 1 70  ? 66.366  22.682  -3.261  1.00 45.09  ? 147 LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 70  ? 65.696  22.679  -1.918  1.00 46.71  ? 147 LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 70  ? 67.870  22.570  -3.123  1.00 47.22  ? 147 LEU A CD2 1 
ATOM   46   N N   . GLN A 1 71  ? 66.995  23.602  -6.580  1.00 33.76  ? 148 GLN A N   1 
ATOM   47   C CA  . GLN A 1 71  ? 68.208  24.058  -7.215  1.00 32.68  ? 148 GLN A CA  1 
ATOM   48   C C   . GLN A 1 71  ? 68.848  25.145  -6.369  1.00 37.71  ? 148 GLN A C   1 
ATOM   49   O O   . GLN A 1 71  ? 68.153  26.012  -5.819  1.00 37.19  ? 148 GLN A O   1 
ATOM   50   C CB  . GLN A 1 71  ? 67.934  24.554  -8.633  1.00 33.56  ? 148 GLN A CB  1 
ATOM   51   C CG  . GLN A 1 71  ? 69.180  24.980  -9.393  1.00 35.63  ? 148 GLN A CG  1 
ATOM   52   C CD  . GLN A 1 71  ? 68.822  25.320  -10.787 1.00 37.92  ? 148 GLN A CD  1 
ATOM   53   O OE1 . GLN A 1 71  ? 68.814  24.443  -11.656 1.00 24.51  ? 148 GLN A OE1 1 
ATOM   54   N NE2 . GLN A 1 71  ? 68.493  26.595  -11.014 1.00 30.66  ? 148 GLN A NE2 1 
ATOM   55   N N   . LEU A 1 72  ? 70.184  25.079  -6.279  1.00 34.70  ? 149 LEU A N   1 
ATOM   56   C CA  . LEU A 1 72  ? 71.025  26.035  -5.577  1.00 36.01  ? 149 LEU A CA  1 
ATOM   57   C C   . LEU A 1 72  ? 71.960  26.713  -6.571  1.00 38.16  ? 149 LEU A C   1 
ATOM   58   O O   . LEU A 1 72  ? 72.443  26.064  -7.489  1.00 38.27  ? 149 LEU A O   1 
ATOM   59   C CB  . LEU A 1 72  ? 71.863  25.321  -4.487  1.00 36.40  ? 149 LEU A CB  1 
ATOM   60   C CG  . LEU A 1 72  ? 71.127  24.555  -3.390  1.00 39.91  ? 149 LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 72  ? 72.072  23.726  -2.631  1.00 37.93  ? 149 LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 72  ? 70.369  25.501  -2.453  1.00 45.46  ? 149 LEU A CD2 1 
ATOM   63   N N   . ILE A 1 73  ? 72.203  28.011  -6.387  1.00 33.72  ? 150 ILE A N   1 
ATOM   64   C CA  . ILE A 1 73  ? 73.124  28.798  -7.207  1.00 33.09  ? 150 ILE A CA  1 
ATOM   65   C C   . ILE A 1 73  ? 74.135  29.486  -6.272  1.00 39.70  ? 150 ILE A C   1 
ATOM   66   O O   . ILE A 1 73  ? 73.781  29.835  -5.144  1.00 41.44  ? 150 ILE A O   1 
ATOM   67   C CB  . ILE A 1 73  ? 72.409  29.777  -8.160  1.00 35.09  ? 150 ILE A CB  1 
ATOM   68   C CG1 . ILE A 1 73  ? 71.533  30.785  -7.395  1.00 35.72  ? 150 ILE A CG1 1 
ATOM   69   C CG2 . ILE A 1 73  ? 71.624  29.017  -9.241  1.00 33.18  ? 150 ILE A CG2 1 
ATOM   70   C CD1 . ILE A 1 73  ? 71.051  31.929  -8.224  1.00 29.80  ? 150 ILE A CD1 1 
ATOM   71   N N   . ALA A 1 74  ? 75.386  29.624  -6.717  1.00 35.42  ? 151 ALA A N   1 
ATOM   72   C CA  . ALA A 1 74  ? 76.449  30.224  -5.930  1.00 37.45  ? 151 ALA A CA  1 
ATOM   73   C C   . ALA A 1 74  ? 76.110  31.649  -5.410  1.00 48.17  ? 151 ALA A C   1 
ATOM   74   O O   . ALA A 1 74  ? 75.544  32.491  -6.139  1.00 49.76  ? 151 ALA A O   1 
ATOM   75   C CB  . ALA A 1 74  ? 77.744  30.233  -6.718  1.00 37.87  ? 151 ALA A CB  1 
ATOM   76   N N   . ASP A 1 75  ? 76.423  31.893  -4.135  1.00 47.04  ? 152 ASP A N   1 
ATOM   77   C CA  . ASP A 1 75  ? 76.200  33.193  -3.525  1.00 50.82  ? 152 ASP A CA  1 
ATOM   78   C C   . ASP A 1 75  ? 77.475  34.036  -3.666  1.00 58.67  ? 152 ASP A C   1 
ATOM   79   O O   . ASP A 1 75  ? 78.411  33.895  -2.862  1.00 59.73  ? 152 ASP A O   1 
ATOM   80   C CB  . ASP A 1 75  ? 75.760  33.043  -2.056  1.00 54.17  ? 152 ASP A CB  1 
ATOM   81   C CG  . ASP A 1 75  ? 75.621  34.322  -1.269  1.00 67.01  ? 152 ASP A CG  1 
ATOM   82   O OD1 . ASP A 1 75  ? 75.575  35.422  -1.902  1.00 67.53  ? 152 ASP A OD1 1 
ATOM   83   O OD2 . ASP A 1 75  ? 75.540  34.236  -0.033  1.00 76.65  ? 152 ASP A OD2 1 
ATOM   84   N N   . SER A 1 76  ? 77.496  34.915  -4.693  1.00 56.10  ? 153 SER A N   1 
ATOM   85   C CA  . SER A 1 76  ? 78.620  35.808  -4.986  1.00 57.89  ? 153 SER A CA  1 
ATOM   86   C C   . SER A 1 76  ? 78.986  36.791  -3.835  1.00 62.72  ? 153 SER A C   1 
ATOM   87   O O   . SER A 1 76  ? 80.094  37.329  -3.830  1.00 63.79  ? 153 SER A O   1 
ATOM   88   C CB  . SER A 1 76  ? 78.380  36.569  -6.281  1.00 63.67  ? 153 SER A CB  1 
ATOM   89   O OG  . SER A 1 76  ? 77.363  37.539  -6.089  1.00 80.22  ? 153 SER A OG  1 
ATOM   90   N N   . GLU A 1 77  ? 78.092  36.990  -2.857  1.00 58.54  ? 154 GLU A N   1 
ATOM   91   C CA  . GLU A 1 77  ? 78.366  37.888  -1.732  1.00 60.08  ? 154 GLU A CA  1 
ATOM   92   C C   . GLU A 1 77  ? 78.972  37.190  -0.496  1.00 64.30  ? 154 GLU A C   1 
ATOM   93   O O   . GLU A 1 77  ? 79.148  37.835  0.547   1.00 66.02  ? 154 GLU A O   1 
ATOM   94   C CB  . GLU A 1 77  ? 77.096  38.606  -1.300  1.00 62.42  ? 154 GLU A CB  1 
ATOM   95   C CG  . GLU A 1 77  ? 76.422  39.488  -2.331  1.00 76.33  ? 154 GLU A CG  1 
ATOM   96   C CD  . GLU A 1 77  ? 75.061  39.844  -1.768  1.00 100.53 ? 154 GLU A CD  1 
ATOM   97   O OE1 . GLU A 1 77  ? 74.988  40.758  -0.906  1.00 61.46  ? 154 GLU A OE1 1 
ATOM   98   O OE2 . GLU A 1 77  ? 74.107  39.076  -2.043  1.00 105.38 ? 154 GLU A OE2 1 
ATOM   99   N N   . THR A 1 78  ? 79.283  35.885  -0.590  1.00 58.36  ? 155 THR A N   1 
ATOM   100  C CA  . THR A 1 78  ? 79.843  35.155  0.549   1.00 57.85  ? 155 THR A CA  1 
ATOM   101  C C   . THR A 1 78  ? 81.158  34.482  0.166   1.00 62.64  ? 155 THR A C   1 
ATOM   102  O O   . THR A 1 78  ? 81.230  33.882  -0.919  1.00 63.72  ? 155 THR A O   1 
ATOM   103  C CB  . THR A 1 78  ? 78.806  34.175  1.107   1.00 56.92  ? 155 THR A CB  1 
ATOM   104  O OG1 . THR A 1 78  ? 77.693  34.928  1.572   1.00 58.63  ? 155 THR A OG1 1 
ATOM   105  C CG2 . THR A 1 78  ? 79.342  33.309  2.249   1.00 51.01  ? 155 THR A CG2 1 
ATOM   106  N N   . PRO A 1 79  ? 82.209  34.546  1.021   1.00 56.82  ? 156 PRO A N   1 
ATOM   107  C CA  . PRO A 1 79  ? 83.460  33.858  0.664   1.00 55.88  ? 156 PRO A CA  1 
ATOM   108  C C   . PRO A 1 79  ? 83.309  32.337  0.722   1.00 58.86  ? 156 PRO A C   1 
ATOM   109  O O   . PRO A 1 79  ? 82.557  31.832  1.574   1.00 57.81  ? 156 PRO A O   1 
ATOM   110  C CB  . PRO A 1 79  ? 84.448  34.367  1.709   1.00 59.43  ? 156 PRO A CB  1 
ATOM   111  C CG  . PRO A 1 79  ? 83.614  34.762  2.857   1.00 64.10  ? 156 PRO A CG  1 
ATOM   112  C CD  . PRO A 1 79  ? 82.308  35.215  2.333   1.00 58.84  ? 156 PRO A CD  1 
ATOM   113  N N   . THR A 1 80  ? 84.027  31.614  -0.180  1.00 55.01  ? 157 THR A N   1 
ATOM   114  C CA  . THR A 1 80  ? 84.045  30.144  -0.220  1.00 53.92  ? 157 THR A CA  1 
ATOM   115  C C   . THR A 1 80  ? 84.411  29.585  1.155   1.00 59.77  ? 157 THR A C   1 
ATOM   116  O O   . THR A 1 80  ? 85.209  30.194  1.877   1.00 62.06  ? 157 THR A O   1 
ATOM   117  C CB  . THR A 1 80  ? 85.023  29.595  -1.266  1.00 62.05  ? 157 THR A CB  1 
ATOM   118  O OG1 . THR A 1 80  ? 86.334  30.120  -1.066  1.00 58.65  ? 157 THR A OG1 1 
ATOM   119  C CG2 . THR A 1 80  ? 84.574  29.848  -2.662  1.00 62.96  ? 157 THR A CG2 1 
ATOM   120  N N   . ILE A 1 81  ? 83.797  28.450  1.516   1.00 54.12  ? 158 ILE A N   1 
ATOM   121  C CA  . ILE A 1 81  ? 83.988  27.771  2.791   1.00 54.10  ? 158 ILE A CA  1 
ATOM   122  C C   . ILE A 1 81  ? 85.217  26.854  2.673   1.00 61.52  ? 158 ILE A C   1 
ATOM   123  O O   . ILE A 1 81  ? 85.217  25.936  1.851   1.00 59.62  ? 158 ILE A O   1 
ATOM   124  C CB  . ILE A 1 81  ? 82.688  27.014  3.184   1.00 55.05  ? 158 ILE A CB  1 
ATOM   125  C CG1 . ILE A 1 81  ? 81.512  27.971  3.308   1.00 55.37  ? 158 ILE A CG1 1 
ATOM   126  C CG2 . ILE A 1 81  ? 82.865  26.233  4.476   1.00 57.21  ? 158 ILE A CG2 1 
ATOM   127  C CD1 . ILE A 1 81  ? 80.385  27.624  2.463   1.00 61.86  ? 158 ILE A CD1 1 
ATOM   128  N N   . GLN A 1 82  ? 86.265  27.085  3.490   1.00 61.76  ? 159 GLN A N   1 
ATOM   129  C CA  . GLN A 1 82  ? 87.489  26.284  3.392   1.00 61.63  ? 159 GLN A CA  1 
ATOM   130  C C   . GLN A 1 82  ? 87.659  25.337  4.552   1.00 64.41  ? 159 GLN A C   1 
ATOM   131  O O   . GLN A 1 82  ? 88.343  25.683  5.488   1.00 67.45  ? 159 GLN A O   1 
ATOM   132  C CB  . GLN A 1 82  ? 88.710  27.200  3.213   1.00 64.89  ? 159 GLN A CB  1 
ATOM   133  C CG  . GLN A 1 82  ? 88.750  27.932  1.850   1.00 68.73  ? 159 GLN A CG  1 
ATOM   134  C CD  . GLN A 1 82  ? 89.800  29.029  1.810   1.00 74.78  ? 159 GLN A CD  1 
ATOM   135  O OE1 . GLN A 1 82  ? 89.491  30.194  1.540   1.00 70.56  ? 159 GLN A OE1 1 
ATOM   136  N NE2 . GLN A 1 82  ? 91.064  28.695  2.109   1.00 57.20  ? 159 GLN A NE2 1 
ATOM   137  N N   . LYS A 1 83  ? 87.040  24.145  4.496   1.00 57.48  ? 160 LYS A N   1 
ATOM   138  C CA  . LYS A 1 83  ? 87.069  23.126  5.544   1.00 56.14  ? 160 LYS A CA  1 
ATOM   139  C C   . LYS A 1 83  ? 88.132  22.076  5.243   1.00 61.90  ? 160 LYS A C   1 
ATOM   140  O O   . LYS A 1 83  ? 87.843  21.038  4.619   1.00 60.86  ? 160 LYS A O   1 
ATOM   141  C CB  . LYS A 1 83  ? 85.674  22.495  5.775   1.00 54.94  ? 160 LYS A CB  1 
ATOM   142  N N   . GLY A 1 84  ? 89.366  22.390  5.665   1.00 60.77  ? 161 GLY A N   1 
ATOM   143  C CA  . GLY A 1 84  ? 90.541  21.523  5.552   1.00 60.56  ? 161 GLY A CA  1 
ATOM   144  C C   . GLY A 1 84  ? 91.097  21.409  4.154   1.00 61.39  ? 161 GLY A C   1 
ATOM   145  O O   . GLY A 1 84  ? 91.393  22.429  3.520   1.00 60.66  ? 161 GLY A O   1 
ATOM   146  N N   . SER A 1 85  ? 91.227  20.161  3.658   1.00 55.68  ? 162 SER A N   1 
ATOM   147  C CA  . SER A 1 85  ? 91.733  19.895  2.306   1.00 54.16  ? 162 SER A CA  1 
ATOM   148  C C   . SER A 1 85  ? 90.693  20.202  1.211   1.00 51.76  ? 162 SER A C   1 
ATOM   149  O O   . SER A 1 85  ? 91.020  20.118  0.019   1.00 49.44  ? 162 SER A O   1 
ATOM   150  C CB  . SER A 1 85  ? 92.202  18.447  2.197   1.00 57.67  ? 162 SER A CB  1 
ATOM   151  O OG  . SER A 1 85  ? 93.359  18.212  2.977   1.00 63.49  ? 162 SER A OG  1 
ATOM   152  N N   . TYR A 1 86  ? 89.459  20.583  1.627   1.00 45.57  ? 163 TYR A N   1 
ATOM   153  C CA  . TYR A 1 86  ? 88.327  20.873  0.751   1.00 43.27  ? 163 TYR A CA  1 
ATOM   154  C C   . TYR A 1 86  ? 87.866  22.304  0.754   1.00 45.45  ? 163 TYR A C   1 
ATOM   155  O O   . TYR A 1 86  ? 88.088  23.041  1.728   1.00 47.32  ? 163 TYR A O   1 
ATOM   156  C CB  . TYR A 1 86  ? 87.126  19.971  1.091   1.00 43.69  ? 163 TYR A CB  1 
ATOM   157  C CG  . TYR A 1 86  ? 87.402  18.499  0.884   1.00 45.02  ? 163 TYR A CG  1 
ATOM   158  C CD1 . TYR A 1 86  ? 88.089  17.754  1.845   1.00 46.73  ? 163 TYR A CD1 1 
ATOM   159  C CD2 . TYR A 1 86  ? 86.962  17.842  -0.262  1.00 44.50  ? 163 TYR A CD2 1 
ATOM   160  C CE1 . TYR A 1 86  ? 88.333  16.400  1.668   1.00 44.93  ? 163 TYR A CE1 1 
ATOM   161  C CE2 . TYR A 1 86  ? 87.197  16.480  -0.447  1.00 45.11  ? 163 TYR A CE2 1 
ATOM   162  C CZ  . TYR A 1 86  ? 87.885  15.766  0.521   1.00 52.85  ? 163 TYR A CZ  1 
ATOM   163  O OH  . TYR A 1 86  ? 88.135  14.430  0.352   1.00 57.17  ? 163 TYR A OH  1 
ATOM   164  N N   . THR A 1 87  ? 87.194  22.687  -0.356  1.00 38.35  ? 164 THR A N   1 
ATOM   165  C CA  . THR A 1 87  ? 86.558  23.983  -0.560  1.00 37.53  ? 164 THR A CA  1 
ATOM   166  C C   . THR A 1 87  ? 85.082  23.741  -0.864  1.00 40.88  ? 164 THR A C   1 
ATOM   167  O O   . THR A 1 87  ? 84.731  22.885  -1.681  1.00 38.87  ? 164 THR A O   1 
ATOM   168  C CB  . THR A 1 87  ? 87.279  24.796  -1.640  1.00 42.93  ? 164 THR A CB  1 
ATOM   169  O OG1 . THR A 1 87  ? 88.637  25.033  -1.252  1.00 51.47  ? 164 THR A OG1 1 
ATOM   170  C CG2 . THR A 1 87  ? 86.593  26.127  -1.931  1.00 38.01  ? 164 THR A CG2 1 
ATOM   171  N N   . PHE A 1 88  ? 84.220  24.504  -0.203  1.00 39.51  ? 165 PHE A N   1 
ATOM   172  C CA  . PHE A 1 88  ? 82.782  24.417  -0.383  1.00 38.09  ? 165 PHE A CA  1 
ATOM   173  C C   . PHE A 1 88  ? 82.216  25.725  -0.922  1.00 44.23  ? 165 PHE A C   1 
ATOM   174  O O   . PHE A 1 88  ? 82.658  26.838  -0.556  1.00 45.24  ? 165 PHE A O   1 
ATOM   175  C CB  . PHE A 1 88  ? 82.112  23.998  0.926   1.00 39.62  ? 165 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 88  ? 82.463  22.577  1.311   1.00 40.23  ? 165 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 88  ? 81.744  21.498  0.788   1.00 40.81  ? 165 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 88  ? 83.535  22.312  2.177   1.00 42.68  ? 165 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 88  ? 82.089  20.180  1.116   1.00 41.27  ? 165 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 88  ? 83.896  20.998  2.492   1.00 44.60  ? 165 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 88  ? 83.174  19.939  1.958   1.00 41.61  ? 165 PHE A CZ  1 
ATOM   182  N N   . VAL A 1 89  ? 81.251  25.588  -1.822  1.00 39.43  ? 166 VAL A N   1 
ATOM   183  C CA  . VAL A 1 89  ? 80.623  26.759  -2.418  1.00 39.69  ? 166 VAL A CA  1 
ATOM   184  C C   . VAL A 1 89  ? 79.514  27.285  -1.491  1.00 46.89  ? 166 VAL A C   1 
ATOM   185  O O   . VAL A 1 89  ? 78.670  26.478  -1.094  1.00 47.69  ? 166 VAL A O   1 
ATOM   186  C CB  . VAL A 1 89  ? 80.053  26.396  -3.807  1.00 40.73  ? 166 VAL A CB  1 
ATOM   187  C CG1 . VAL A 1 89  ? 79.296  27.572  -4.430  1.00 40.89  ? 166 VAL A CG1 1 
ATOM   188  C CG2 . VAL A 1 89  ? 81.145  25.874  -4.729  1.00 39.18  ? 166 VAL A CG2 1 
ATOM   189  N N   . PRO A 1 90  ? 79.463  28.600  -1.141  1.00 44.47  ? 167 PRO A N   1 
ATOM   190  C CA  . PRO A 1 90  ? 78.311  29.098  -0.380  1.00 44.00  ? 167 PRO A CA  1 
ATOM   191  C C   . PRO A 1 90  ? 77.099  29.159  -1.323  1.00 48.52  ? 167 PRO A C   1 
ATOM   192  O O   . PRO A 1 90  ? 77.167  29.790  -2.375  1.00 50.01  ? 167 PRO A O   1 
ATOM   193  C CB  . PRO A 1 90  ? 78.757  30.467  0.110   1.00 47.08  ? 167 PRO A CB  1 
ATOM   194  C CG  . PRO A 1 90  ? 79.878  30.862  -0.727  1.00 52.40  ? 167 PRO A CG  1 
ATOM   195  C CD  . PRO A 1 90  ? 80.358  29.703  -1.537  1.00 47.65  ? 167 PRO A CD  1 
ATOM   196  N N   . TRP A 1 91  ? 76.023  28.435  -0.994  1.00 43.28  ? 168 TRP A N   1 
ATOM   197  C CA  . TRP A 1 91  ? 74.835  28.370  -1.843  1.00 41.48  ? 168 TRP A CA  1 
ATOM   198  C C   . TRP A 1 91  ? 73.761  29.346  -1.457  1.00 46.28  ? 168 TRP A C   1 
ATOM   199  O O   . TRP A 1 91  ? 73.678  29.766  -0.312  1.00 49.22  ? 168 TRP A O   1 
ATOM   200  C CB  . TRP A 1 91  ? 74.238  26.945  -1.878  1.00 38.78  ? 168 TRP A CB  1 
ATOM   201  C CG  . TRP A 1 91  ? 75.167  25.889  -2.406  1.00 37.83  ? 168 TRP A CG  1 
ATOM   202  C CD1 . TRP A 1 91  ? 75.737  24.870  -1.704  1.00 40.11  ? 168 TRP A CD1 1 
ATOM   203  C CD2 . TRP A 1 91  ? 75.687  25.804  -3.729  1.00 36.87  ? 168 TRP A CD2 1 
ATOM   204  N NE1 . TRP A 1 91  ? 76.574  24.148  -2.514  1.00 38.41  ? 168 TRP A NE1 1 
ATOM   205  C CE2 . TRP A 1 91  ? 76.569  24.701  -3.764  1.00 39.12  ? 168 TRP A CE2 1 
ATOM   206  C CE3 . TRP A 1 91  ? 75.498  26.564  -4.898  1.00 38.27  ? 168 TRP A CE3 1 
ATOM   207  C CZ2 . TRP A 1 91  ? 77.257  24.326  -4.921  1.00 37.31  ? 168 TRP A CZ2 1 
ATOM   208  C CZ3 . TRP A 1 91  ? 76.173  26.185  -6.050  1.00 38.79  ? 168 TRP A CZ3 1 
ATOM   209  C CH2 . TRP A 1 91  ? 77.042  25.078  -6.052  1.00 38.50  ? 168 TRP A CH2 1 
ATOM   210  N N   . LEU A 1 92  ? 72.924  29.682  -2.428  1.00 41.61  ? 169 LEU A N   1 
ATOM   211  C CA  . LEU A 1 92  ? 71.737  30.536  -2.335  1.00 41.94  ? 169 LEU A CA  1 
ATOM   212  C C   . LEU A 1 92  ? 70.622  29.710  -3.014  1.00 43.34  ? 169 LEU A C   1 
ATOM   213  O O   . LEU A 1 92  ? 70.888  29.046  -4.031  1.00 43.43  ? 169 LEU A O   1 
ATOM   214  C CB  . LEU A 1 92  ? 71.968  31.829  -3.115  1.00 42.45  ? 169 LEU A CB  1 
ATOM   215  N N   . LEU A 1 93  ? 69.405  29.697  -2.442  1.00 34.21  ? 170 LEU A N   1 
ATOM   216  C CA  . LEU A 1 93  ? 68.349  28.903  -3.054  1.00 30.49  ? 170 LEU A CA  1 
ATOM   217  C C   . LEU A 1 93  ? 67.867  29.532  -4.348  1.00 38.39  ? 170 LEU A C   1 
ATOM   218  O O   . LEU A 1 93  ? 67.463  30.687  -4.353  1.00 39.23  ? 170 LEU A O   1 
ATOM   219  C CB  . LEU A 1 93  ? 67.181  28.689  -2.099  1.00 29.17  ? 170 LEU A CB  1 
ATOM   220  C CG  . LEU A 1 93  ? 65.967  28.019  -2.674  1.00 29.05  ? 170 LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 93  ? 66.102  26.485  -2.656  1.00 27.64  ? 170 LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 93  ? 64.804  28.395  -1.911  1.00 27.75  ? 170 LEU A CD2 1 
ATOM   223  N N   . SER A 1 94  ? 67.933  28.756  -5.458  1.00 36.79  ? 171 SER A N   1 
ATOM   224  C CA  . SER A 1 94  ? 67.469  29.185  -6.785  1.00 37.20  ? 171 SER A CA  1 
ATOM   225  C C   . SER A 1 94  ? 65.949  29.005  -6.882  1.00 42.41  ? 171 SER A C   1 
ATOM   226  O O   . SER A 1 94  ? 65.263  29.885  -7.403  1.00 43.93  ? 171 SER A O   1 
ATOM   227  C CB  . SER A 1 94  ? 68.158  28.409  -7.890  1.00 40.04  ? 171 SER A CB  1 
ATOM   228  O OG  . SER A 1 94  ? 67.570  28.762  -9.125  1.00 53.40  ? 171 SER A OG  1 
ATOM   229  N N   . PHE A 1 95  ? 65.432  27.880  -6.354  1.00 36.68  ? 172 PHE A N   1 
ATOM   230  C CA  . PHE A 1 95  ? 64.011  27.570  -6.233  1.00 36.78  ? 172 PHE A CA  1 
ATOM   231  C C   . PHE A 1 95  ? 63.886  26.244  -5.523  1.00 40.12  ? 172 PHE A C   1 
ATOM   232  O O   . PHE A 1 95  ? 64.824  25.433  -5.540  1.00 40.24  ? 172 PHE A O   1 
ATOM   233  C CB  . PHE A 1 95  ? 63.279  27.552  -7.596  1.00 38.72  ? 172 PHE A CB  1 
ATOM   234  C CG  . PHE A 1 95  ? 63.542  26.315  -8.411  1.00 40.14  ? 172 PHE A CG  1 
ATOM   235  C CD1 . PHE A 1 95  ? 62.740  25.187  -8.269  1.00 43.13  ? 172 PHE A CD1 1 
ATOM   236  C CD2 . PHE A 1 95  ? 64.630  26.251  -9.278  1.00 41.69  ? 172 PHE A CD2 1 
ATOM   237  C CE1 . PHE A 1 95  ? 63.031  24.018  -8.960  1.00 42.49  ? 172 PHE A CE1 1 
ATOM   238  C CE2 . PHE A 1 95  ? 64.874  25.103  -10.019 1.00 43.45  ? 172 PHE A CE2 1 
ATOM   239  C CZ  . PHE A 1 95  ? 64.100  23.978  -9.812  1.00 41.48  ? 172 PHE A CZ  1 
ATOM   240  N N   . LYS A 1 96  ? 62.730  26.017  -4.917  1.00 36.49  ? 173 LYS A N   1 
ATOM   241  C CA  . LYS A 1 96  ? 62.355  24.779  -4.226  1.00 36.58  ? 173 LYS A CA  1 
ATOM   242  C C   . LYS A 1 96  ? 60.928  24.481  -4.671  1.00 45.66  ? 173 LYS A C   1 
ATOM   243  O O   . LYS A 1 96  ? 60.049  25.352  -4.618  1.00 49.25  ? 173 LYS A O   1 
ATOM   244  C CB  . LYS A 1 96  ? 62.440  24.943  -2.697  1.00 37.14  ? 173 LYS A CB  1 
ATOM   245  C CG  . LYS A 1 96  ? 61.887  23.776  -1.909  1.00 37.04  ? 173 LYS A CG  1 
ATOM   246  C CD  . LYS A 1 96  ? 61.856  24.005  -0.386  1.00 41.01  ? 173 LYS A CD  1 
ATOM   247  C CE  . LYS A 1 96  ? 61.020  22.966  0.321   1.00 38.38  ? 173 LYS A CE  1 
ATOM   248  N NZ  . LYS A 1 96  ? 59.582  23.178  0.048   1.00 57.47  ? 173 LYS A NZ  1 
ATOM   249  N N   . ARG A 1 97  ? 60.705  23.267  -5.144  1.00 40.70  ? 174 ARG A N   1 
ATOM   250  C CA  . ARG A 1 97  ? 59.408  22.842  -5.641  1.00 40.03  ? 174 ARG A CA  1 
ATOM   251  C C   . ARG A 1 97  ? 59.095  21.521  -4.982  1.00 46.13  ? 174 ARG A C   1 
ATOM   252  O O   . ARG A 1 97  ? 59.902  20.584  -5.053  1.00 46.73  ? 174 ARG A O   1 
ATOM   253  C CB  . ARG A 1 97  ? 59.484  22.703  -7.149  1.00 33.95  ? 174 ARG A CB  1 
ATOM   254  C CG  . ARG A 1 97  ? 58.172  22.460  -7.819  1.00 33.96  ? 174 ARG A CG  1 
ATOM   255  C CD  . ARG A 1 97  ? 58.415  22.084  -9.248  1.00 41.18  ? 174 ARG A CD  1 
ATOM   256  N NE  . ARG A 1 97  ? 57.156  21.952  -9.975  1.00 51.38  ? 174 ARG A NE  1 
ATOM   257  C CZ  . ARG A 1 97  ? 56.890  20.964  -10.824 1.00 70.20  ? 174 ARG A CZ  1 
ATOM   258  N NH1 . ARG A 1 97  ? 57.795  20.021  -11.065 1.00 59.29  ? 174 ARG A NH1 1 
ATOM   259  N NH2 . ARG A 1 97  ? 55.712  20.901  -11.428 1.00 59.43  ? 174 ARG A NH2 1 
ATOM   260  N N   . GLY A 1 98  ? 57.974  21.486  -4.273  1.00 43.43  ? 175 GLY A N   1 
ATOM   261  C CA  . GLY A 1 98  ? 57.527  20.298  -3.567  1.00 44.27  ? 175 GLY A CA  1 
ATOM   262  C C   . GLY A 1 98  ? 58.130  20.106  -2.190  1.00 49.97  ? 175 GLY A C   1 
ATOM   263  O O   . GLY A 1 98  ? 58.778  21.006  -1.641  1.00 48.89  ? 175 GLY A O   1 
ATOM   264  N N   . SER A 1 99  ? 57.924  18.897  -1.645  1.00 48.22  ? 176 SER A N   1 
ATOM   265  C CA  . SER A 1 99  ? 58.316  18.494  -0.296  1.00 49.63  ? 176 SER A CA  1 
ATOM   266  C C   . SER A 1 99  ? 59.583  17.631  -0.160  1.00 54.92  ? 176 SER A C   1 
ATOM   267  O O   . SER A 1 99  ? 60.227  17.687  0.894   1.00 56.28  ? 176 SER A O   1 
ATOM   268  C CB  . SER A 1 99  ? 57.146  17.784  0.380   1.00 54.51  ? 176 SER A CB  1 
ATOM   269  O OG  . SER A 1 99  ? 56.509  16.843  -0.475  1.00 61.94  ? 176 SER A OG  1 
ATOM   270  N N   . ALA A 1 100 ? 59.899  16.796  -1.182  1.00 49.26  ? 177 ALA A N   1 
ATOM   271  C CA  . ALA A 1 100 ? 61.016  15.837  -1.171  1.00 46.67  ? 177 ALA A CA  1 
ATOM   272  C C   . ALA A 1 100 ? 62.400  16.405  -0.902  1.00 49.03  ? 177 ALA A C   1 
ATOM   273  O O   . ALA A 1 100 ? 63.246  15.695  -0.355  1.00 49.10  ? 177 ALA A O   1 
ATOM   274  C CB  . ALA A 1 100 ? 61.026  15.024  -2.453  1.00 45.97  ? 177 ALA A CB  1 
ATOM   275  N N   . LEU A 1 101 ? 62.650  17.655  -1.301  1.00 44.26  ? 178 LEU A N   1 
ATOM   276  C CA  . LEU A 1 101 ? 63.967  18.251  -1.105  1.00 42.71  ? 178 LEU A CA  1 
ATOM   277  C C   . LEU A 1 101 ? 63.900  19.598  -0.373  1.00 49.13  ? 178 LEU A C   1 
ATOM   278  O O   . LEU A 1 101 ? 62.974  20.401  -0.592  1.00 48.68  ? 178 LEU A O   1 
ATOM   279  C CB  . LEU A 1 101 ? 64.728  18.387  -2.442  1.00 40.35  ? 178 LEU A CB  1 
ATOM   280  C CG  . LEU A 1 101 ? 65.000  17.089  -3.221  1.00 41.39  ? 178 LEU A CG  1 
ATOM   281  C CD1 . LEU A 1 101 ? 65.165  17.361  -4.702  1.00 38.67  ? 178 LEU A CD1 1 
ATOM   282  C CD2 . LEU A 1 101 ? 66.168  16.327  -2.635  1.00 40.38  ? 178 LEU A CD2 1 
ATOM   283  N N   . GLU A 1 102 ? 64.914  19.824  0.502   1.00 44.64  ? 179 GLU A N   1 
ATOM   284  C CA  . GLU A 1 102 ? 65.081  21.004  1.348   1.00 43.62  ? 179 GLU A CA  1 
ATOM   285  C C   . GLU A 1 102 ? 66.525  21.453  1.375   1.00 50.29  ? 179 GLU A C   1 
ATOM   286  O O   . GLU A 1 102 ? 67.428  20.641  1.166   1.00 50.32  ? 179 GLU A O   1 
ATOM   287  C CB  . GLU A 1 102 ? 64.692  20.665  2.777   1.00 45.27  ? 179 GLU A CB  1 
ATOM   288  C CG  . GLU A 1 102 ? 63.208  20.664  3.047   1.00 49.56  ? 179 GLU A CG  1 
ATOM   289  C CD  . GLU A 1 102 ? 62.852  20.366  4.493   1.00 63.20  ? 179 GLU A CD  1 
ATOM   290  O OE1 . GLU A 1 102 ? 63.680  20.626  5.408   1.00 46.43  ? 179 GLU A OE1 1 
ATOM   291  O OE2 . GLU A 1 102 ? 61.713  19.889  4.708   1.00 42.55  ? 179 GLU A OE2 1 
ATOM   292  N N   . GLU A 1 103 ? 66.748  22.741  1.661   1.00 49.57  ? 180 GLU A N   1 
ATOM   293  C CA  . GLU A 1 103 ? 68.081  23.327  1.816   1.00 50.20  ? 180 GLU A CA  1 
ATOM   294  C C   . GLU A 1 103 ? 68.367  23.231  3.320   1.00 54.21  ? 180 GLU A C   1 
ATOM   295  O O   . GLU A 1 103 ? 67.544  23.645  4.136   1.00 54.40  ? 180 GLU A O   1 
ATOM   296  C CB  . GLU A 1 103 ? 68.074  24.818  1.362   1.00 52.82  ? 180 GLU A CB  1 
ATOM   297  C CG  . GLU A 1 103 ? 69.448  25.463  1.192   1.00 69.37  ? 180 GLU A CG  1 
ATOM   298  C CD  . GLU A 1 103 ? 70.205  25.962  2.414   1.00 107.61 ? 180 GLU A CD  1 
ATOM   299  O OE1 . GLU A 1 103 ? 69.577  26.168  3.480   1.00 118.32 ? 180 GLU A OE1 1 
ATOM   300  O OE2 . GLU A 1 103 ? 71.429  26.198  2.286   1.00 101.47 ? 180 GLU A OE2 1 
ATOM   301  N N   . LYS A 1 104 ? 69.501  22.670  3.689   1.00 51.09  ? 181 LYS A N   1 
ATOM   302  C CA  . LYS A 1 104 ? 69.893  22.587  5.099   1.00 52.53  ? 181 LYS A CA  1 
ATOM   303  C C   . LYS A 1 104 ? 71.401  22.775  5.207   1.00 53.43  ? 181 LYS A C   1 
ATOM   304  O O   . LYS A 1 104 ? 72.164  21.942  4.696   1.00 51.20  ? 181 LYS A O   1 
ATOM   305  C CB  . LYS A 1 104 ? 69.436  21.263  5.794   1.00 56.14  ? 181 LYS A CB  1 
ATOM   306  N N   . GLU A 1 105 ? 71.817  23.905  5.822   1.00 49.29  ? 182 GLU A N   1 
ATOM   307  C CA  . GLU A 1 105 ? 73.208  24.251  6.095   1.00 48.93  ? 182 GLU A CA  1 
ATOM   308  C C   . GLU A 1 105 ? 74.111  24.021  4.898   1.00 50.99  ? 182 GLU A C   1 
ATOM   309  O O   . GLU A 1 105 ? 75.112  23.300  5.004   1.00 51.91  ? 182 GLU A O   1 
ATOM   310  C CB  . GLU A 1 105 ? 73.724  23.450  7.317   1.00 51.36  ? 182 GLU A CB  1 
ATOM   311  C CG  . GLU A 1 105 ? 73.064  23.810  8.638   1.00 65.26  ? 182 GLU A CG  1 
ATOM   312  C CD  . GLU A 1 105 ? 73.735  23.147  9.818   1.00 91.54  ? 182 GLU A CD  1 
ATOM   313  O OE1 . GLU A 1 105 ? 74.068  21.945  9.699   1.00 86.36  ? 182 GLU A OE1 1 
ATOM   314  O OE2 . GLU A 1 105 ? 73.970  23.837  10.840  1.00 92.21  ? 182 GLU A OE2 1 
ATOM   315  N N   . ASN A 1 106 ? 73.719  24.574  3.734   1.00 44.86  ? 183 ASN A N   1 
ATOM   316  C CA  . ASN A 1 106 ? 74.477  24.487  2.484   1.00 41.48  ? 183 ASN A CA  1 
ATOM   317  C C   . ASN A 1 106 ? 74.540  23.106  1.844   1.00 42.23  ? 183 ASN A C   1 
ATOM   318  O O   . ASN A 1 106 ? 75.447  22.824  1.056   1.00 40.83  ? 183 ASN A O   1 
ATOM   319  C CB  . ASN A 1 106 ? 75.867  25.072  2.681   1.00 39.61  ? 183 ASN A CB  1 
ATOM   320  C CG  . ASN A 1 106 ? 76.121  26.242  1.810   1.00 67.72  ? 183 ASN A CG  1 
ATOM   321  O OD1 . ASN A 1 106 ? 75.288  27.178  1.672   1.00 55.05  ? 183 ASN A OD1 1 
ATOM   322  N ND2 . ASN A 1 106 ? 77.292  26.187  1.198   1.00 65.14  ? 183 ASN A ND2 1 
ATOM   323  N N   . LYS A 1 107 ? 73.575  22.246  2.173   1.00 38.41  ? 184 LYS A N   1 
ATOM   324  C CA  . LYS A 1 107 ? 73.463  20.888  1.639   1.00 36.29  ? 184 LYS A CA  1 
ATOM   325  C C   . LYS A 1 107 ? 72.005  20.691  1.213   1.00 42.33  ? 184 LYS A C   1 
ATOM   326  O O   . LYS A 1 107 ? 71.103  21.404  1.682   1.00 42.86  ? 184 LYS A O   1 
ATOM   327  C CB  . LYS A 1 107 ? 73.828  19.824  2.693   1.00 37.41  ? 184 LYS A CB  1 
ATOM   328  C CG  . LYS A 1 107 ? 75.258  19.858  3.265   1.00 38.71  ? 184 LYS A CG  1 
ATOM   329  C CD  . LYS A 1 107 ? 75.293  19.346  4.720   1.00 40.14  ? 184 LYS A CD  1 
ATOM   330  N N   . ILE A 1 108 ? 71.773  19.735  0.310   1.00 38.74  ? 185 ILE A N   1 
ATOM   331  C CA  . ILE A 1 108 ? 70.412  19.388  -0.097  1.00 37.45  ? 185 ILE A CA  1 
ATOM   332  C C   . ILE A 1 108 ? 70.001  18.208  0.809   1.00 40.84  ? 185 ILE A C   1 
ATOM   333  O O   . ILE A 1 108 ? 70.700  17.196  0.858   1.00 39.89  ? 185 ILE A O   1 
ATOM   334  C CB  . ILE A 1 108 ? 70.281  19.065  -1.600  1.00 38.34  ? 185 ILE A CB  1 
ATOM   335  C CG1 . ILE A 1 108 ? 70.773  20.263  -2.485  1.00 36.73  ? 185 ILE A CG1 1 
ATOM   336  C CG2 . ILE A 1 108 ? 68.844  18.647  -1.911  1.00 37.79  ? 185 ILE A CG2 1 
ATOM   337  C CD1 . ILE A 1 108 ? 70.887  19.995  -4.021  1.00 29.11  ? 185 ILE A CD1 1 
ATOM   338  N N   . LEU A 1 109 ? 68.917  18.382  1.578   1.00 37.03  ? 186 LEU A N   1 
ATOM   339  C CA  . LEU A 1 109 ? 68.424  17.369  2.488   1.00 37.10  ? 186 LEU A CA  1 
ATOM   340  C C   . LEU A 1 109 ? 67.266  16.623  1.852   1.00 41.08  ? 186 LEU A C   1 
ATOM   341  O O   . LEU A 1 109 ? 66.304  17.238  1.385   1.00 41.52  ? 186 LEU A O   1 
ATOM   342  C CB  . LEU A 1 109 ? 68.014  18.011  3.822   1.00 39.15  ? 186 LEU A CB  1 
ATOM   343  C CG  . LEU A 1 109 ? 67.199  17.130  4.812   1.00 45.18  ? 186 LEU A CG  1 
ATOM   344  C CD1 . LEU A 1 109 ? 68.008  15.902  5.324   1.00 45.03  ? 186 LEU A CD1 1 
ATOM   345  C CD2 . LEU A 1 109 ? 66.700  17.950  5.959   1.00 47.87  ? 186 LEU A CD2 1 
ATOM   346  N N   . VAL A 1 110 ? 67.380  15.289  1.826   1.00 37.58  ? 187 VAL A N   1 
ATOM   347  C CA  . VAL A 1 110 ? 66.394  14.391  1.244   1.00 37.42  ? 187 VAL A CA  1 
ATOM   348  C C   . VAL A 1 110 ? 65.308  14.117  2.287   1.00 44.72  ? 187 VAL A C   1 
ATOM   349  O O   . VAL A 1 110 ? 65.605  13.634  3.393   1.00 46.48  ? 187 VAL A O   1 
ATOM   350  C CB  . VAL A 1 110 ? 67.065  13.106  0.705   1.00 39.63  ? 187 VAL A CB  1 
ATOM   351  C CG1 . VAL A 1 110 ? 66.034  12.165  0.080   1.00 40.03  ? 187 VAL A CG1 1 
ATOM   352  C CG2 . VAL A 1 110 ? 68.157  13.450  -0.307  1.00 37.24  ? 187 VAL A CG2 1 
ATOM   353  N N   . LYS A 1 111 ? 64.048  14.454  1.938   1.00 39.94  ? 188 LYS A N   1 
ATOM   354  C CA  . LYS A 1 111 ? 62.893  14.284  2.824   1.00 39.48  ? 188 LYS A CA  1 
ATOM   355  C C   . LYS A 1 111 ? 62.010  13.079  2.446   1.00 44.89  ? 188 LYS A C   1 
ATOM   356  O O   . LYS A 1 111 ? 61.304  12.558  3.293   1.00 47.16  ? 188 LYS A O   1 
ATOM   357  C CB  . LYS A 1 111 ? 62.084  15.593  2.943   1.00 39.56  ? 188 LYS A CB  1 
ATOM   358  C CG  . LYS A 1 111 ? 62.827  16.752  3.615   1.00 37.10  ? 188 LYS A CG  1 
ATOM   359  C CD  . LYS A 1 111 ? 63.136  16.552  5.119   1.00 46.82  ? 188 LYS A CD  1 
ATOM   360  C CE  . LYS A 1 111 ? 62.024  16.855  6.099   1.00 47.58  ? 188 LYS A CE  1 
ATOM   361  N NZ  . LYS A 1 111 ? 62.392  17.970  7.020   1.00 69.65  ? 188 LYS A NZ  1 
ATOM   362  N N   . GLU A 1 112 ? 62.052  12.639  1.192   1.00 40.37  ? 189 GLU A N   1 
ATOM   363  C CA  . GLU A 1 112 ? 61.319  11.468  0.704   1.00 40.25  ? 189 GLU A CA  1 
ATOM   364  C C   . GLU A 1 112 ? 62.301  10.545  -0.027  1.00 45.23  ? 189 GLU A C   1 
ATOM   365  O O   . GLU A 1 112 ? 63.168  11.016  -0.792  1.00 43.88  ? 189 GLU A O   1 
ATOM   366  C CB  . GLU A 1 112 ? 60.218  11.871  -0.277  1.00 41.58  ? 189 GLU A CB  1 
ATOM   367  C CG  . GLU A 1 112 ? 58.995  12.469  0.377   1.00 54.88  ? 189 GLU A CG  1 
ATOM   368  C CD  . GLU A 1 112 ? 58.207  13.437  -0.484  1.00 77.53  ? 189 GLU A CD  1 
ATOM   369  O OE1 . GLU A 1 112 ? 58.030  13.153  -1.692  1.00 82.65  ? 189 GLU A OE1 1 
ATOM   370  O OE2 . GLU A 1 112 ? 57.750  14.471  0.057   1.00 61.12  ? 189 GLU A OE2 1 
ATOM   371  N N   . THR A 1 113 ? 62.167  9.234   0.201   1.00 41.96  ? 190 THR A N   1 
ATOM   372  C CA  . THR A 1 113 ? 63.019  8.260   -0.464  1.00 39.58  ? 190 THR A CA  1 
ATOM   373  C C   . THR A 1 113 ? 62.593  8.170   -1.933  1.00 43.75  ? 190 THR A C   1 
ATOM   374  O O   . THR A 1 113 ? 61.402  8.249   -2.250  1.00 45.02  ? 190 THR A O   1 
ATOM   375  C CB  . THR A 1 113 ? 62.939  6.926   0.270   1.00 40.92  ? 190 THR A CB  1 
ATOM   376  O OG1 . THR A 1 113 ? 63.460  7.112   1.589   1.00 43.81  ? 190 THR A OG1 1 
ATOM   377  C CG2 . THR A 1 113 ? 63.715  5.822   -0.421  1.00 38.64  ? 190 THR A CG2 1 
ATOM   378  N N   . GLY A 1 114 ? 63.574  8.020   -2.806  1.00 38.95  ? 191 GLY A N   1 
ATOM   379  C CA  . GLY A 1 114 ? 63.341  7.828   -4.223  1.00 38.48  ? 191 GLY A CA  1 
ATOM   380  C C   . GLY A 1 114 ? 64.590  7.815   -5.066  1.00 41.07  ? 191 GLY A C   1 
ATOM   381  O O   . GLY A 1 114 ? 65.719  7.716   -4.550  1.00 37.54  ? 191 GLY A O   1 
ATOM   382  N N   . TYR A 1 115 ? 64.356  7.935   -6.392  1.00 39.28  ? 192 TYR A N   1 
ATOM   383  C CA  . TYR A 1 115 ? 65.405  8.048   -7.406  1.00 38.28  ? 192 TYR A CA  1 
ATOM   384  C C   . TYR A 1 115 ? 65.480  9.509   -7.788  1.00 39.03  ? 192 TYR A C   1 
ATOM   385  O O   . TYR A 1 115 ? 64.441  10.114  -8.017  1.00 38.03  ? 192 TYR A O   1 
ATOM   386  C CB  . TYR A 1 115 ? 65.120  7.139   -8.622  1.00 39.86  ? 192 TYR A CB  1 
ATOM   387  C CG  . TYR A 1 115 ? 65.419  5.680   -8.340  1.00 42.76  ? 192 TYR A CG  1 
ATOM   388  C CD1 . TYR A 1 115 ? 64.492  4.871   -7.693  1.00 44.85  ? 192 TYR A CD1 1 
ATOM   389  C CD2 . TYR A 1 115 ? 66.637  5.110   -8.710  1.00 44.94  ? 192 TYR A CD2 1 
ATOM   390  C CE1 . TYR A 1 115 ? 64.759  3.523   -7.433  1.00 45.93  ? 192 TYR A CE1 1 
ATOM   391  C CE2 . TYR A 1 115 ? 66.919  3.760   -8.452  1.00 47.68  ? 192 TYR A CE2 1 
ATOM   392  C CZ  . TYR A 1 115 ? 65.975  2.966   -7.816  1.00 54.99  ? 192 TYR A CZ  1 
ATOM   393  O OH  . TYR A 1 115 ? 66.292  1.647   -7.558  1.00 54.14  ? 192 TYR A OH  1 
ATOM   394  N N   . PHE A 1 116 ? 66.690  10.089  -7.802  1.00 35.25  ? 193 PHE A N   1 
ATOM   395  C CA  . PHE A 1 116 ? 66.899  11.518  -8.087  1.00 34.42  ? 193 PHE A CA  1 
ATOM   396  C C   . PHE A 1 116 ? 67.913  11.789  -9.173  1.00 38.17  ? 193 PHE A C   1 
ATOM   397  O O   . PHE A 1 116 ? 69.037  11.257  -9.124  1.00 38.37  ? 193 PHE A O   1 
ATOM   398  C CB  . PHE A 1 116 ? 67.370  12.257  -6.825  1.00 35.85  ? 193 PHE A CB  1 
ATOM   399  C CG  . PHE A 1 116 ? 66.361  12.293  -5.712  1.00 39.48  ? 193 PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 116 ? 66.220  11.219  -4.843  1.00 43.70  ? 193 PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 116 ? 65.564  13.416  -5.509  1.00 43.07  ? 193 PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 116 ? 65.272  11.260  -3.813  1.00 46.79  ? 193 PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 116 ? 64.635  13.464  -4.463  1.00 46.63  ? 193 PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 116 ? 64.481  12.379  -3.636  1.00 45.89  ? 193 PHE A CZ  1 
ATOM   405  N N   . PHE A 1 117 ? 67.550  12.682  -10.112 1.00 32.45  ? 194 PHE A N   1 
ATOM   406  C CA  . PHE A 1 117 ? 68.495  13.156  -11.111 1.00 30.68  ? 194 PHE A CA  1 
ATOM   407  C C   . PHE A 1 117 ? 69.239  14.288  -10.407 1.00 37.09  ? 194 PHE A C   1 
ATOM   408  O O   . PHE A 1 117 ? 68.609  15.282  -10.019 1.00 38.06  ? 194 PHE A O   1 
ATOM   409  C CB  . PHE A 1 117 ? 67.790  13.673  -12.362 1.00 31.91  ? 194 PHE A CB  1 
ATOM   410  C CG  . PHE A 1 117 ? 68.748  14.263  -13.371 1.00 32.22  ? 194 PHE A CG  1 
ATOM   411  C CD1 . PHE A 1 117 ? 69.584  13.444  -14.127 1.00 34.13  ? 194 PHE A CD1 1 
ATOM   412  C CD2 . PHE A 1 117 ? 68.819  15.640  -13.562 1.00 34.46  ? 194 PHE A CD2 1 
ATOM   413  C CE1 . PHE A 1 117 ? 70.478  13.994  -15.050 1.00 34.60  ? 194 PHE A CE1 1 
ATOM   414  C CE2 . PHE A 1 117 ? 69.715  16.191  -14.482 1.00 36.81  ? 194 PHE A CE2 1 
ATOM   415  C CZ  . PHE A 1 117 ? 70.538  15.365  -15.222 1.00 34.52  ? 194 PHE A CZ  1 
ATOM   416  N N   . ILE A 1 118 ? 70.547  14.105  -10.168 1.00 33.06  ? 195 ILE A N   1 
ATOM   417  C CA  . ILE A 1 118 ? 71.378  15.072  -9.437  1.00 32.70  ? 195 ILE A CA  1 
ATOM   418  C C   . ILE A 1 118 ? 72.395  15.663  -10.398 1.00 37.58  ? 195 ILE A C   1 
ATOM   419  O O   . ILE A 1 118 ? 73.014  14.914  -11.148 1.00 39.41  ? 195 ILE A O   1 
ATOM   420  C CB  . ILE A 1 118 ? 72.060  14.418  -8.207  1.00 35.09  ? 195 ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 118 ? 71.023  13.747  -7.292  1.00 35.05  ? 195 ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 118 ? 72.889  15.446  -7.437  1.00 35.03  ? 195 ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 118 ? 71.359  12.444  -6.906  1.00 38.49  ? 195 ILE A CD1 1 
ATOM   424  N N   . TYR A 1 119 ? 72.568  16.995  -10.372 1.00 30.63  ? 196 TYR A N   1 
ATOM   425  C CA  . TYR A 1 119 ? 73.455  17.744  -11.268 1.00 28.00  ? 196 TYR A CA  1 
ATOM   426  C C   . TYR A 1 119 ? 74.231  18.820  -10.535 1.00 34.59  ? 196 TYR A C   1 
ATOM   427  O O   . TYR A 1 119 ? 73.785  19.320  -9.492  1.00 36.34  ? 196 TYR A O   1 
ATOM   428  C CB  . TYR A 1 119 ? 72.649  18.369  -12.430 1.00 27.17  ? 196 TYR A CB  1 
ATOM   429  C CG  . TYR A 1 119 ? 71.544  19.319  -12.008 1.00 27.98  ? 196 TYR A CG  1 
ATOM   430  C CD1 . TYR A 1 119 ? 70.270  18.840  -11.661 1.00 29.19  ? 196 TYR A CD1 1 
ATOM   431  C CD2 . TYR A 1 119 ? 71.758  20.696  -11.968 1.00 28.31  ? 196 TYR A CD2 1 
ATOM   432  C CE1 . TYR A 1 119 ? 69.254  19.709  -11.260 1.00 27.11  ? 196 TYR A CE1 1 
ATOM   433  C CE2 . TYR A 1 119 ? 70.743  21.575  -11.589 1.00 29.16  ? 196 TYR A CE2 1 
ATOM   434  C CZ  . TYR A 1 119 ? 69.492  21.076  -11.249 1.00 37.30  ? 196 TYR A CZ  1 
ATOM   435  O OH  . TYR A 1 119 ? 68.506  21.947  -10.859 1.00 41.92  ? 196 TYR A OH  1 
ATOM   436  N N   . GLY A 1 120 ? 75.375  19.188  -11.098 1.00 30.80  ? 197 GLY A N   1 
ATOM   437  C CA  . GLY A 1 120 ? 76.232  20.224  -10.541 1.00 30.99  ? 197 GLY A CA  1 
ATOM   438  C C   . GLY A 1 120 ? 77.272  20.734  -11.515 1.00 35.30  ? 197 GLY A C   1 
ATOM   439  O O   . GLY A 1 120 ? 77.848  19.956  -12.281 1.00 37.30  ? 197 GLY A O   1 
ATOM   440  N N   . GLN A 1 121 ? 77.516  22.047  -11.484 1.00 29.95  ? 198 GLN A N   1 
ATOM   441  C CA  . GLN A 1 121 ? 78.526  22.715  -12.282 1.00 29.46  ? 198 GLN A CA  1 
ATOM   442  C C   . GLN A 1 121 ? 79.263  23.733  -11.428 1.00 34.85  ? 198 GLN A C   1 
ATOM   443  O O   . GLN A 1 121 ? 78.657  24.369  -10.547 1.00 35.17  ? 198 GLN A O   1 
ATOM   444  C CB  . GLN A 1 121 ? 77.924  23.394  -13.521 1.00 29.84  ? 198 GLN A CB  1 
ATOM   445  C CG  . GLN A 1 121 ? 78.972  24.090  -14.394 1.00 28.62  ? 198 GLN A CG  1 
ATOM   446  C CD  . GLN A 1 121 ? 78.414  24.652  -15.672 1.00 43.97  ? 198 GLN A CD  1 
ATOM   447  O OE1 . GLN A 1 121 ? 78.100  23.920  -16.620 1.00 37.69  ? 198 GLN A OE1 1 
ATOM   448  N NE2 . GLN A 1 121 ? 78.321  25.973  -15.748 1.00 32.39  ? 198 GLN A NE2 1 
ATOM   449  N N   . VAL A 1 122 ? 80.575  23.876  -11.690 1.00 30.39  ? 199 VAL A N   1 
ATOM   450  C CA  . VAL A 1 122 ? 81.454  24.845  -11.032 1.00 30.59  ? 199 VAL A CA  1 
ATOM   451  C C   . VAL A 1 122 ? 82.352  25.396  -12.136 1.00 39.71  ? 199 VAL A C   1 
ATOM   452  O O   . VAL A 1 122 ? 82.781  24.631  -13.005 1.00 41.56  ? 199 VAL A O   1 
ATOM   453  C CB  . VAL A 1 122 ? 82.320  24.202  -9.899  1.00 32.46  ? 199 VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 122 ? 83.224  25.220  -9.248  1.00 32.91  ? 199 VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 122 ? 81.463  23.530  -8.835  1.00 31.73  ? 199 VAL A CG2 1 
ATOM   456  N N   . LEU A 1 123 ? 82.637  26.710  -12.108 1.00 37.26  ? 200 LEU A N   1 
ATOM   457  C CA  . LEU A 1 123 ? 83.593  27.329  -13.026 1.00 37.60  ? 200 LEU A CA  1 
ATOM   458  C C   . LEU A 1 123 ? 84.877  27.514  -12.247 1.00 41.94  ? 200 LEU A C   1 
ATOM   459  O O   . LEU A 1 123 ? 84.880  28.171  -11.210 1.00 43.22  ? 200 LEU A O   1 
ATOM   460  C CB  . LEU A 1 123 ? 83.091  28.674  -13.588 1.00 38.15  ? 200 LEU A CB  1 
ATOM   461  C CG  . LEU A 1 123 ? 84.126  29.583  -14.290 1.00 42.94  ? 200 LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 123 ? 84.767  28.893  -15.484 1.00 43.21  ? 200 LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 123 ? 83.492  30.844  -14.743 1.00 41.52  ? 200 LEU A CD2 1 
ATOM   464  N N   . TYR A 1 124 ? 85.950  26.918  -12.741 1.00 37.97  ? 201 TYR A N   1 
ATOM   465  C CA  . TYR A 1 124 ? 87.265  26.952  -12.110 1.00 38.80  ? 201 TYR A CA  1 
ATOM   466  C C   . TYR A 1 124 ? 88.129  28.001  -12.733 1.00 45.97  ? 201 TYR A C   1 
ATOM   467  O O   . TYR A 1 124 ? 88.220  28.093  -13.967 1.00 48.55  ? 201 TYR A O   1 
ATOM   468  C CB  . TYR A 1 124 ? 87.949  25.574  -12.185 1.00 38.69  ? 201 TYR A CB  1 
ATOM   469  C CG  . TYR A 1 124 ? 87.156  24.523  -11.457 1.00 38.82  ? 201 TYR A CG  1 
ATOM   470  C CD1 . TYR A 1 124 ? 87.197  24.432  -10.068 1.00 40.99  ? 201 TYR A CD1 1 
ATOM   471  C CD2 . TYR A 1 124 ? 86.280  23.683  -12.143 1.00 38.01  ? 201 TYR A CD2 1 
ATOM   472  C CE1 . TYR A 1 124 ? 86.414  23.508  -9.382  1.00 40.93  ? 201 TYR A CE1 1 
ATOM   473  C CE2 . TYR A 1 124 ? 85.490  22.756  -11.468 1.00 37.39  ? 201 TYR A CE2 1 
ATOM   474  C CZ  . TYR A 1 124 ? 85.569  22.670  -10.089 1.00 42.91  ? 201 TYR A CZ  1 
ATOM   475  O OH  . TYR A 1 124 ? 84.797  21.784  -9.413  1.00 40.30  ? 201 TYR A OH  1 
ATOM   476  N N   . THR A 1 125 ? 88.727  28.828  -11.884 1.00 41.21  ? 202 THR A N   1 
ATOM   477  C CA  . THR A 1 125 ? 89.635  29.895  -12.301 1.00 42.51  ? 202 THR A CA  1 
ATOM   478  C C   . THR A 1 125 ? 90.967  29.717  -11.555 1.00 48.18  ? 202 THR A C   1 
ATOM   479  O O   . THR A 1 125 ? 91.651  30.701  -11.221 1.00 49.47  ? 202 THR A O   1 
ATOM   480  C CB  . THR A 1 125 ? 88.979  31.269  -12.144 1.00 46.79  ? 202 THR A CB  1 
ATOM   481  O OG1 . THR A 1 125 ? 88.570  31.459  -10.791 1.00 51.83  ? 202 THR A OG1 1 
ATOM   482  C CG2 . THR A 1 125 ? 87.813  31.467  -13.085 1.00 43.50  ? 202 THR A CG2 1 
ATOM   483  N N   . ASP A 1 126 ? 91.321  28.427  -11.313 1.00 43.16  ? 203 ASP A N   1 
ATOM   484  C CA  . ASP A 1 126 ? 92.490  27.984  -10.574 1.00 44.20  ? 203 ASP A CA  1 
ATOM   485  C C   . ASP A 1 126 ? 93.593  27.453  -11.484 1.00 47.81  ? 203 ASP A C   1 
ATOM   486  O O   . ASP A 1 126 ? 93.308  26.680  -12.386 1.00 43.86  ? 203 ASP A O   1 
ATOM   487  C CB  . ASP A 1 126 ? 92.053  26.927  -9.558  1.00 44.83  ? 203 ASP A CB  1 
ATOM   488  C CG  . ASP A 1 126 ? 92.957  26.766  -8.353  1.00 59.70  ? 203 ASP A CG  1 
ATOM   489  O OD1 . ASP A 1 126 ? 94.165  26.503  -8.548  1.00 62.22  ? 203 ASP A OD1 1 
ATOM   490  O OD2 . ASP A 1 126 ? 92.443  26.837  -7.209  1.00 65.18  ? 203 ASP A OD2 1 
ATOM   491  N N   . LYS A 1 127 ? 94.866  27.854  -11.222 1.00 48.91  ? 204 LYS A N   1 
ATOM   492  C CA  . LYS A 1 127 ? 96.029  27.425  -12.011 1.00 49.53  ? 204 LYS A CA  1 
ATOM   493  C C   . LYS A 1 127 ? 96.480  25.952  -11.759 1.00 51.23  ? 204 LYS A C   1 
ATOM   494  O O   . LYS A 1 127 ? 97.217  25.398  -12.588 1.00 53.16  ? 204 LYS A O   1 
ATOM   495  C CB  . LYS A 1 127 ? 97.176  28.454  -11.964 1.00 53.51  ? 204 LYS A CB  1 
ATOM   496  N N   . THR A 1 128 ? 95.978  25.303  -10.674 1.00 42.96  ? 205 THR A N   1 
ATOM   497  C CA  . THR A 1 128 ? 96.252  23.888  -10.340 1.00 41.89  ? 205 THR A CA  1 
ATOM   498  C C   . THR A 1 128 ? 96.019  22.982  -11.565 1.00 45.90  ? 205 THR A C   1 
ATOM   499  O O   . THR A 1 128 ? 94.971  23.088  -12.194 1.00 43.79  ? 205 THR A O   1 
ATOM   500  C CB  . THR A 1 128 ? 95.384  23.431  -9.149  1.00 50.85  ? 205 THR A CB  1 
ATOM   501  O OG1 . THR A 1 128 ? 95.573  24.311  -8.035  1.00 53.04  ? 205 THR A OG1 1 
ATOM   502  C CG2 . THR A 1 128 ? 95.661  21.994  -8.729  1.00 48.08  ? 205 THR A CG2 1 
ATOM   503  N N   . TYR A 1 129 ? 96.997  22.103  -11.898 1.00 45.55  ? 206 TYR A N   1 
ATOM   504  C CA  . TYR A 1 129 ? 97.007  21.203  -13.075 1.00 45.05  ? 206 TYR A CA  1 
ATOM   505  C C   . TYR A 1 129 ? 95.652  20.573  -13.410 1.00 47.58  ? 206 TYR A C   1 
ATOM   506  O O   . TYR A 1 129 ? 95.331  20.395  -14.584 1.00 47.00  ? 206 TYR A O   1 
ATOM   507  C CB  . TYR A 1 129 ? 98.117  20.136  -12.992 1.00 47.11  ? 206 TYR A CB  1 
ATOM   508  C CG  . TYR A 1 129 ? 97.722  18.935  -12.167 1.00 48.74  ? 206 TYR A CG  1 
ATOM   509  C CD1 . TYR A 1 129 ? 97.709  18.993  -10.777 1.00 50.56  ? 206 TYR A CD1 1 
ATOM   510  C CD2 . TYR A 1 129 ? 97.289  17.761  -12.774 1.00 49.23  ? 206 TYR A CD2 1 
ATOM   511  C CE1 . TYR A 1 129 ? 97.325  17.894  -10.010 1.00 51.29  ? 206 TYR A CE1 1 
ATOM   512  C CE2 . TYR A 1 129 ? 96.881  16.663  -12.019 1.00 49.56  ? 206 TYR A CE2 1 
ATOM   513  C CZ  . TYR A 1 129 ? 96.896  16.735  -10.635 1.00 58.97  ? 206 TYR A CZ  1 
ATOM   514  O OH  . TYR A 1 129 ? 96.485  15.655  -9.885  1.00 59.74  ? 206 TYR A OH  1 
ATOM   515  N N   . ALA A 1 130 ? 94.881  20.222  -12.376 1.00 42.51  ? 207 ALA A N   1 
ATOM   516  C CA  . ALA A 1 130 ? 93.548  19.667  -12.511 1.00 40.41  ? 207 ALA A CA  1 
ATOM   517  C C   . ALA A 1 130 ? 92.668  20.163  -11.366 1.00 43.84  ? 207 ALA A C   1 
ATOM   518  O O   . ALA A 1 130 ? 93.121  20.285  -10.213 1.00 43.37  ? 207 ALA A O   1 
ATOM   519  C CB  . ALA A 1 130 ? 93.596  18.155  -12.527 1.00 40.76  ? 207 ALA A CB  1 
ATOM   520  N N   . MET A 1 131 ? 91.419  20.503  -11.718 1.00 38.69  ? 208 MET A N   1 
ATOM   521  C CA  . MET A 1 131 ? 90.376  21.014  -10.826 1.00 36.71  ? 208 MET A CA  1 
ATOM   522  C C   . MET A 1 131 ? 89.127  20.217  -11.093 1.00 39.80  ? 208 MET A C   1 
ATOM   523  O O   . MET A 1 131 ? 89.007  19.617  -12.163 1.00 39.35  ? 208 MET A O   1 
ATOM   524  C CB  . MET A 1 131 ? 90.113  22.504  -11.065 1.00 38.93  ? 208 MET A CB  1 
ATOM   525  C CG  . MET A 1 131 ? 91.220  23.416  -10.570 1.00 44.14  ? 208 MET A CG  1 
ATOM   526  S SD  . MET A 1 131 ? 91.602  23.324  -8.801  1.00 49.30  ? 208 MET A SD  1 
ATOM   527  C CE  . MET A 1 131 ? 90.161  24.062  -8.069  1.00 43.81  ? 208 MET A CE  1 
ATOM   528  N N   . GLY A 1 132 ? 88.248  20.138  -10.097 1.00 35.15  ? 209 GLY A N   1 
ATOM   529  C CA  . GLY A 1 132 ? 87.026  19.365  -10.208 1.00 32.89  ? 209 GLY A CA  1 
ATOM   530  C C   . GLY A 1 132 ? 86.289  19.257  -8.914  1.00 37.55  ? 209 GLY A C   1 
ATOM   531  O O   . GLY A 1 132 ? 86.760  19.757  -7.884  1.00 39.81  ? 209 GLY A O   1 
ATOM   532  N N   . HIS A 1 133 ? 85.098  18.661  -8.967  1.00 32.43  ? 210 HIS A N   1 
ATOM   533  C CA  . HIS A 1 133 ? 84.303  18.529  -7.751  1.00 32.89  ? 210 HIS A CA  1 
ATOM   534  C C   . HIS A 1 133 ? 83.683  17.141  -7.603  1.00 37.98  ? 210 HIS A C   1 
ATOM   535  O O   . HIS A 1 133 ? 83.665  16.343  -8.554  1.00 37.29  ? 210 HIS A O   1 
ATOM   536  C CB  . HIS A 1 133 ? 83.224  19.623  -7.658  1.00 32.98  ? 210 HIS A CB  1 
ATOM   537  C CG  . HIS A 1 133 ? 82.331  19.693  -8.847  1.00 35.35  ? 210 HIS A CG  1 
ATOM   538  N ND1 . HIS A 1 133 ? 82.664  20.439  -9.944  1.00 38.02  ? 210 HIS A ND1 1 
ATOM   539  C CD2 . HIS A 1 133 ? 81.147  19.084  -9.077  1.00 37.08  ? 210 HIS A CD2 1 
ATOM   540  C CE1 . HIS A 1 133 ? 81.668  20.292  -10.803 1.00 36.97  ? 210 HIS A CE1 1 
ATOM   541  N NE2 . HIS A 1 133 ? 80.740  19.465  -10.330 1.00 36.56  ? 210 HIS A NE2 1 
ATOM   542  N N   . LEU A 1 134 ? 83.158  16.872  -6.403  1.00 33.04  ? 211 LEU A N   1 
ATOM   543  C CA  . LEU A 1 134 ? 82.506  15.620  -6.108  1.00 31.30  ? 211 LEU A CA  1 
ATOM   544  C C   . LEU A 1 134 ? 81.084  15.894  -5.661  1.00 37.22  ? 211 LEU A C   1 
ATOM   545  O O   . LEU A 1 134 ? 80.878  16.754  -4.802  1.00 37.92  ? 211 LEU A O   1 
ATOM   546  C CB  . LEU A 1 134 ? 83.248  14.871  -4.974  1.00 31.15  ? 211 LEU A CB  1 
ATOM   547  C CG  . LEU A 1 134 ? 84.779  14.922  -4.901  1.00 34.87  ? 211 LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 134 ? 85.268  14.342  -3.616  1.00 34.22  ? 211 LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 134 ? 85.404  14.193  -6.039  1.00 38.70  ? 211 LEU A CD2 1 
ATOM   550  N N   . ILE A 1 135 ? 80.104  15.166  -6.242  1.00 33.93  ? 212 ILE A N   1 
ATOM   551  C CA  . ILE A 1 135 ? 78.710  15.210  -5.809  1.00 33.69  ? 212 ILE A CA  1 
ATOM   552  C C   . ILE A 1 135 ? 78.628  14.023  -4.856  1.00 37.92  ? 212 ILE A C   1 
ATOM   553  O O   . ILE A 1 135 ? 78.723  12.863  -5.276  1.00 38.64  ? 212 ILE A O   1 
ATOM   554  C CB  . ILE A 1 135 ? 77.637  15.193  -6.947  1.00 35.27  ? 212 ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 135 ? 77.603  16.558  -7.655  1.00 35.62  ? 212 ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 135 ? 76.236  14.842  -6.372  1.00 33.01  ? 212 ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 135 ? 76.890  16.539  -9.009  1.00 41.38  ? 212 ILE A CD1 1 
ATOM   558  N N   . GLN A 1 136 ? 78.544  14.338  -3.572  1.00 32.85  ? 213 GLN A N   1 
ATOM   559  C CA  . GLN A 1 136 ? 78.577  13.358  -2.525  1.00 33.20  ? 213 GLN A CA  1 
ATOM   560  C C   . GLN A 1 136 ? 77.268  13.163  -1.814  1.00 39.16  ? 213 GLN A C   1 
ATOM   561  O O   . GLN A 1 136 ? 76.472  14.086  -1.668  1.00 41.92  ? 213 GLN A O   1 
ATOM   562  C CB  . GLN A 1 136 ? 79.654  13.736  -1.514  1.00 35.81  ? 213 GLN A CB  1 
ATOM   563  C CG  . GLN A 1 136 ? 81.026  13.889  -2.139  1.00 40.32  ? 213 GLN A CG  1 
ATOM   564  C CD  . GLN A 1 136 ? 82.053  14.117  -1.086  1.00 47.71  ? 213 GLN A CD  1 
ATOM   565  O OE1 . GLN A 1 136 ? 82.000  15.100  -0.318  1.00 44.72  ? 213 GLN A OE1 1 
ATOM   566  N NE2 . GLN A 1 136 ? 82.998  13.197  -1.024  1.00 20.99  ? 213 GLN A NE2 1 
ATOM   567  N N   . ARG A 1 137 ? 77.074  11.961  -1.313  1.00 34.25  ? 214 ARG A N   1 
ATOM   568  C CA  . ARG A 1 137 ? 75.911  11.557  -0.552  1.00 32.91  ? 214 ARG A CA  1 
ATOM   569  C C   . ARG A 1 137 ? 76.331  11.245  0.859   1.00 36.10  ? 214 ARG A C   1 
ATOM   570  O O   . ARG A 1 137 ? 77.169  10.362  1.049   1.00 35.82  ? 214 ARG A O   1 
ATOM   571  C CB  . ARG A 1 137 ? 75.347  10.295  -1.190  1.00 32.53  ? 214 ARG A CB  1 
ATOM   572  C CG  . ARG A 1 137 ? 74.112  9.796   -0.500  1.00 38.31  ? 214 ARG A CG  1 
ATOM   573  C CD  . ARG A 1 137 ? 73.759  8.472   -1.078  1.00 36.93  ? 214 ARG A CD  1 
ATOM   574  N NE  . ARG A 1 137 ? 72.669  7.846   -0.346  1.00 38.78  ? 214 ARG A NE  1 
ATOM   575  C CZ  . ARG A 1 137 ? 72.443  6.546   -0.322  1.00 44.99  ? 214 ARG A CZ  1 
ATOM   576  N NH1 . ARG A 1 137 ? 73.276  5.710   -0.931  1.00 45.82  ? 214 ARG A NH1 1 
ATOM   577  N NH2 . ARG A 1 137 ? 71.385  6.067   0.309   1.00 29.69  ? 214 ARG A NH2 1 
ATOM   578  N N   . LYS A 1 138 ? 75.778  11.964  1.856   1.00 32.71  ? 215 LYS A N   1 
ATOM   579  C CA  . LYS A 1 138 ? 76.083  11.676  3.260   1.00 32.46  ? 215 LYS A CA  1 
ATOM   580  C C   . LYS A 1 138 ? 74.940  10.804  3.703   1.00 35.79  ? 215 LYS A C   1 
ATOM   581  O O   . LYS A 1 138 ? 73.817  11.289  3.898   1.00 37.41  ? 215 LYS A O   1 
ATOM   582  C CB  . LYS A 1 138 ? 76.246  12.946  4.118   1.00 34.90  ? 215 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 138 ? 76.613  12.712  5.606   1.00 45.89  ? 215 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 138 ? 77.638  11.594  5.961   1.00 47.20  ? 215 LYS A CD  1 
ATOM   585  N N   . LYS A 1 139 ? 75.212  9.492   3.744   1.00 29.18  ? 216 LYS A N   1 
ATOM   586  C CA  . LYS A 1 139 ? 74.261  8.452   4.079   1.00 29.41  ? 216 LYS A CA  1 
ATOM   587  C C   . LYS A 1 139 ? 73.764  8.612   5.507   1.00 37.25  ? 216 LYS A C   1 
ATOM   588  O O   . LYS A 1 139 ? 74.587  8.768   6.422   1.00 38.35  ? 216 LYS A O   1 
ATOM   589  C CB  . LYS A 1 139 ? 74.906  7.055   3.909   1.00 31.62  ? 216 LYS A CB  1 
ATOM   590  C CG  . LYS A 1 139 ? 75.108  6.604   2.472   1.00 41.54  ? 216 LYS A CG  1 
ATOM   591  C CD  . LYS A 1 139 ? 76.238  5.595   2.367   1.00 45.54  ? 216 LYS A CD  1 
ATOM   592  C CE  . LYS A 1 139 ? 75.857  4.140   2.366   1.00 36.39  ? 216 LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 139 ? 76.083  3.565   3.695   1.00 66.13  ? 216 LYS A NZ  1 
ATOM   594  N N   . VAL A 1 140 ? 72.431  8.558   5.714   1.00 35.28  ? 217 VAL A N   1 
ATOM   595  C CA  . VAL A 1 140 ? 71.896  8.634   7.080   1.00 37.38  ? 217 VAL A CA  1 
ATOM   596  C C   . VAL A 1 140 ? 72.210  7.295   7.828   1.00 44.03  ? 217 VAL A C   1 
ATOM   597  O O   . VAL A 1 140 ? 72.488  7.299   9.027   1.00 47.02  ? 217 VAL A O   1 
ATOM   598  C CB  . VAL A 1 140 ? 70.407  9.114   7.169   1.00 40.67  ? 217 VAL A CB  1 
ATOM   599  C CG1 . VAL A 1 140 ? 69.424  8.144   6.484   1.00 41.01  ? 217 VAL A CG1 1 
ATOM   600  C CG2 . VAL A 1 140 ? 70.013  9.398   8.606   1.00 40.91  ? 217 VAL A CG2 1 
ATOM   601  N N   . HIS A 1 141 ? 72.248  6.189   7.077   1.00 38.68  ? 218 HIS A N   1 
ATOM   602  C CA  . HIS A 1 141 ? 72.514  4.845   7.584   1.00 39.91  ? 218 HIS A CA  1 
ATOM   603  C C   . HIS A 1 141 ? 73.751  4.214   6.924   1.00 39.71  ? 218 HIS A C   1 
ATOM   604  O O   . HIS A 1 141 ? 73.909  4.319   5.713   1.00 38.90  ? 218 HIS A O   1 
ATOM   605  C CB  . HIS A 1 141 ? 71.284  3.943   7.360   1.00 42.04  ? 218 HIS A CB  1 
ATOM   606  C CG  . HIS A 1 141 ? 70.061  4.379   8.107   1.00 46.68  ? 218 HIS A CG  1 
ATOM   607  N ND1 . HIS A 1 141 ? 68.814  3.960   7.721   1.00 48.84  ? 218 HIS A ND1 1 
ATOM   608  C CD2 . HIS A 1 141 ? 69.939  5.158   9.213   1.00 49.31  ? 218 HIS A CD2 1 
ATOM   609  C CE1 . HIS A 1 141 ? 67.971  4.471   8.610   1.00 49.77  ? 218 HIS A CE1 1 
ATOM   610  N NE2 . HIS A 1 141 ? 68.606  5.200   9.529   1.00 50.32  ? 218 HIS A NE2 1 
ATOM   611  N N   . VAL A 1 142 ? 74.645  3.613   7.723   1.00 33.13  ? 219 VAL A N   1 
ATOM   612  C CA  . VAL A 1 142 ? 75.866  2.988   7.227   1.00 30.89  ? 219 VAL A CA  1 
ATOM   613  C C   . VAL A 1 142 ? 75.862  1.576   7.764   1.00 35.31  ? 219 VAL A C   1 
ATOM   614  O O   . VAL A 1 142 ? 75.454  1.369   8.915   1.00 35.72  ? 219 VAL A O   1 
ATOM   615  C CB  . VAL A 1 142 ? 77.156  3.739   7.631   1.00 33.82  ? 219 VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 142 ? 78.364  3.199   6.901   1.00 32.93  ? 219 VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 142 ? 77.038  5.196   7.303   1.00 33.72  ? 219 VAL A CG2 1 
ATOM   618  N N   . PHE A 1 143 ? 76.315  0.600   6.941   1.00 27.70  ? 220 PHE A N   1 
ATOM   619  C CA  . PHE A 1 143 ? 76.374  -0.779  7.373   1.00 27.66  ? 220 PHE A CA  1 
ATOM   620  C C   . PHE A 1 143 ? 77.760  -1.333  7.119   1.00 31.16  ? 220 PHE A C   1 
ATOM   621  O O   . PHE A 1 143 ? 78.381  -0.968  6.131   1.00 27.23  ? 220 PHE A O   1 
ATOM   622  C CB  . PHE A 1 143 ? 75.302  -1.598  6.653   1.00 29.07  ? 220 PHE A CB  1 
ATOM   623  C CG  . PHE A 1 143 ? 73.890  -1.127  6.906   1.00 30.47  ? 220 PHE A CG  1 
ATOM   624  C CD1 . PHE A 1 143 ? 73.132  -1.676  7.935   1.00 36.57  ? 220 PHE A CD1 1 
ATOM   625  C CD2 . PHE A 1 143 ? 73.311  -0.140  6.107   1.00 27.72  ? 220 PHE A CD2 1 
ATOM   626  C CE1 . PHE A 1 143 ? 71.809  -1.261  8.147   1.00 37.27  ? 220 PHE A CE1 1 
ATOM   627  C CE2 . PHE A 1 143 ? 72.010  0.292   6.339   1.00 30.62  ? 220 PHE A CE2 1 
ATOM   628  C CZ  . PHE A 1 143 ? 71.254  -0.292  7.331   1.00 31.82  ? 220 PHE A CZ  1 
ATOM   629  N N   . GLY A 1 144 ? 78.242  -2.200  8.016   1.00 31.17  ? 221 GLY A N   1 
ATOM   630  C CA  . GLY A 1 144 ? 79.543  -2.863  7.906   1.00 32.16  ? 221 GLY A CA  1 
ATOM   631  C C   . GLY A 1 144 ? 80.677  -2.005  7.397   1.00 39.96  ? 221 GLY A C   1 
ATOM   632  O O   . GLY A 1 144 ? 80.859  -0.875  7.858   1.00 43.76  ? 221 GLY A O   1 
ATOM   633  N N   . ASP A 1 145 ? 81.381  -2.490  6.372   1.00 35.20  ? 222 ASP A N   1 
ATOM   634  C CA  . ASP A 1 145 ? 82.527  -1.775  5.791   1.00 33.77  ? 222 ASP A CA  1 
ATOM   635  C C   . ASP A 1 145 ? 82.210  -0.601  4.840   1.00 36.73  ? 222 ASP A C   1 
ATOM   636  O O   . ASP A 1 145 ? 83.134  -0.038  4.233   1.00 34.89  ? 222 ASP A O   1 
ATOM   637  C CB  . ASP A 1 145 ? 83.601  -2.733  5.233   1.00 35.52  ? 222 ASP A CB  1 
ATOM   638  C CG  . ASP A 1 145 ? 83.283  -3.432  3.916   1.00 48.65  ? 222 ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 145 ? 82.174  -3.214  3.375   1.00 49.85  ? 222 ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 145 ? 84.159  -4.182  3.411   1.00 58.10  ? 222 ASP A OD2 1 
ATOM   641  N N   . GLU A 1 146 ? 80.916  -0.219  4.715   1.00 33.14  ? 223 GLU A N   1 
ATOM   642  C CA  . GLU A 1 146 ? 80.500  0.902   3.860   1.00 30.79  ? 223 GLU A CA  1 
ATOM   643  C C   . GLU A 1 146 ? 81.084  2.224   4.388   1.00 36.99  ? 223 GLU A C   1 
ATOM   644  O O   . GLU A 1 146 ? 81.376  2.333   5.569   1.00 38.95  ? 223 GLU A O   1 
ATOM   645  C CB  . GLU A 1 146 ? 78.970  1.060   3.866   1.00 30.82  ? 223 GLU A CB  1 
ATOM   646  C CG  . GLU A 1 146 ? 78.159  0.102   3.022   1.00 35.69  ? 223 GLU A CG  1 
ATOM   647  C CD  . GLU A 1 146 ? 76.659  0.356   3.136   1.00 55.80  ? 223 GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 146 ? 76.204  0.840   4.204   1.00 40.20  ? 223 GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 146 ? 75.941  0.112   2.138   1.00 43.32  ? 223 GLU A OE2 1 
ATOM   650  N N   . LEU A 1 147 ? 81.186  3.219   3.522   1.00 34.01  ? 224 LEU A N   1 
ATOM   651  C CA  . LEU A 1 147 ? 81.587  4.568   3.873   1.00 35.29  ? 224 LEU A CA  1 
ATOM   652  C C   . LEU A 1 147 ? 80.296  5.379   4.078   1.00 43.06  ? 224 LEU A C   1 
ATOM   653  O O   . LEU A 1 147 ? 79.314  5.156   3.355   1.00 43.00  ? 224 LEU A O   1 
ATOM   654  C CB  . LEU A 1 147 ? 82.336  5.214   2.687   1.00 34.36  ? 224 LEU A CB  1 
ATOM   655  C CG  . LEU A 1 147 ? 83.617  4.571   2.173   1.00 37.19  ? 224 LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 147 ? 83.926  5.067   0.773   1.00 36.49  ? 224 LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 147 ? 84.742  4.805   3.114   1.00 34.86  ? 224 LEU A CD2 1 
ATOM   658  N N   . SER A 1 148 ? 80.318  6.367   5.006   1.00 42.15  ? 225 SER A N   1 
ATOM   659  C CA  . SER A 1 148 ? 79.162  7.271   5.260   1.00 41.32  ? 225 SER A CA  1 
ATOM   660  C C   . SER A 1 148 ? 78.980  8.237   4.097   1.00 43.73  ? 225 SER A C   1 
ATOM   661  O O   . SER A 1 148 ? 77.854  8.602   3.735   1.00 41.21  ? 225 SER A O   1 
ATOM   662  C CB  . SER A 1 148 ? 79.343  8.089   6.534   1.00 43.35  ? 225 SER A CB  1 
ATOM   663  O OG  . SER A 1 148 ? 80.131  7.431   7.502   1.00 59.05  ? 225 SER A OG  1 
ATOM   664  N N   . LEU A 1 149 ? 80.106  8.648   3.510   1.00 40.77  ? 226 LEU A N   1 
ATOM   665  C CA  . LEU A 1 149 ? 80.132  9.607   2.417   1.00 38.85  ? 226 LEU A CA  1 
ATOM   666  C C   . LEU A 1 149 ? 80.469  8.915   1.108   1.00 38.55  ? 226 LEU A C   1 
ATOM   667  O O   . LEU A 1 149 ? 81.470  8.215   1.004   1.00 38.37  ? 226 LEU A O   1 
ATOM   668  C CB  . LEU A 1 149 ? 81.134  10.712  2.775   1.00 39.24  ? 226 LEU A CB  1 
ATOM   669  C CG  . LEU A 1 149 ? 80.941  12.064  2.133   1.00 41.98  ? 226 LEU A CG  1 
ATOM   670  C CD1 . LEU A 1 149 ? 79.673  12.767  2.598   1.00 41.05  ? 226 LEU A CD1 1 
ATOM   671  C CD2 . LEU A 1 149 ? 82.125  12.914  2.407   1.00 44.64  ? 226 LEU A CD2 1 
ATOM   672  N N   . VAL A 1 150 ? 79.569  9.040   0.134   1.00 32.93  ? 227 VAL A N   1 
ATOM   673  C CA  . VAL A 1 150 ? 79.718  8.400   -1.186  1.00 31.18  ? 227 VAL A CA  1 
ATOM   674  C C   . VAL A 1 150 ? 79.945  9.440   -2.279  1.00 34.66  ? 227 VAL A C   1 
ATOM   675  O O   . VAL A 1 150 ? 79.100  10.318  -2.466  1.00 33.05  ? 227 VAL A O   1 
ATOM   676  C CB  . VAL A 1 150 ? 78.485  7.553   -1.588  1.00 32.58  ? 227 VAL A CB  1 
ATOM   677  C CG1 . VAL A 1 150 ? 78.626  7.018   -3.014  1.00 31.59  ? 227 VAL A CG1 1 
ATOM   678  C CG2 . VAL A 1 150 ? 78.214  6.443   -0.607  1.00 32.38  ? 227 VAL A CG2 1 
ATOM   679  N N   . THR A 1 151 ? 81.023  9.294   -3.061  1.00 31.12  ? 228 THR A N   1 
ATOM   680  C CA  . THR A 1 151 ? 81.128  10.162  -4.210  1.00 30.02  ? 228 THR A CA  1 
ATOM   681  C C   . THR A 1 151 ? 80.272  9.500   -5.292  1.00 32.14  ? 228 THR A C   1 
ATOM   682  O O   . THR A 1 151 ? 80.592  8.397   -5.783  1.00 30.95  ? 228 THR A O   1 
ATOM   683  C CB  . THR A 1 151 ? 82.546  10.390  -4.642  1.00 36.17  ? 228 THR A CB  1 
ATOM   684  O OG1 . THR A 1 151 ? 83.251  10.969  -3.553  1.00 41.36  ? 228 THR A OG1 1 
ATOM   685  C CG2 . THR A 1 151 ? 82.618  11.295  -5.845  1.00 34.08  ? 228 THR A CG2 1 
ATOM   686  N N   . LEU A 1 152 ? 79.148  10.161  -5.615  1.00 27.20  ? 229 LEU A N   1 
ATOM   687  C CA  . LEU A 1 152 ? 78.226  9.667   -6.627  1.00 26.00  ? 229 LEU A CA  1 
ATOM   688  C C   . LEU A 1 152 ? 78.805  9.975   -8.020  1.00 32.79  ? 229 LEU A C   1 
ATOM   689  O O   . LEU A 1 152 ? 78.953  9.067   -8.851  1.00 32.32  ? 229 LEU A O   1 
ATOM   690  C CB  . LEU A 1 152 ? 76.832  10.285  -6.443  1.00 24.68  ? 229 LEU A CB  1 
ATOM   691  C CG  . LEU A 1 152 ? 76.044  9.837   -5.227  1.00 28.38  ? 229 LEU A CG  1 
ATOM   692  C CD1 . LEU A 1 152 ? 74.818  10.720  -4.990  1.00 27.64  ? 229 LEU A CD1 1 
ATOM   693  C CD2 . LEU A 1 152 ? 75.666  8.407   -5.358  1.00 31.61  ? 229 LEU A CD2 1 
ATOM   694  N N   . PHE A 1 153 ? 79.141  11.262  -8.264  1.00 29.98  ? 230 PHE A N   1 
ATOM   695  C CA  . PHE A 1 153 ? 79.698  11.732  -9.524  1.00 29.28  ? 230 PHE A CA  1 
ATOM   696  C C   . PHE A 1 153 ? 80.861  12.649  -9.257  1.00 34.27  ? 230 PHE A C   1 
ATOM   697  O O   . PHE A 1 153 ? 80.827  13.410  -8.296  1.00 35.75  ? 230 PHE A O   1 
ATOM   698  C CB  . PHE A 1 153 ? 78.628  12.422  -10.386 1.00 30.68  ? 230 PHE A CB  1 
ATOM   699  C CG  . PHE A 1 153 ? 77.295  11.729  -10.319 1.00 31.78  ? 230 PHE A CG  1 
ATOM   700  C CD1 . PHE A 1 153 ? 77.095  10.520  -10.964 1.00 35.25  ? 230 PHE A CD1 1 
ATOM   701  C CD2 . PHE A 1 153 ? 76.262  12.244  -9.530  1.00 32.86  ? 230 PHE A CD2 1 
ATOM   702  C CE1 . PHE A 1 153 ? 75.881  9.840   -10.836 1.00 36.57  ? 230 PHE A CE1 1 
ATOM   703  C CE2 . PHE A 1 153 ? 75.046  11.571  -9.409  1.00 35.48  ? 230 PHE A CE2 1 
ATOM   704  C CZ  . PHE A 1 153 ? 74.868  10.366  -10.052 1.00 34.39  ? 230 PHE A CZ  1 
ATOM   705  N N   . ARG A 1 154 ? 81.892  12.566  -10.099 1.00 31.24  ? 231 ARG A N   1 
ATOM   706  C CA  . ARG A 1 154 ? 83.118  13.351  -10.012 1.00 32.07  ? 231 ARG A CA  1 
ATOM   707  C C   . ARG A 1 154 ? 83.508  13.878  -11.415 1.00 38.97  ? 231 ARG A C   1 
ATOM   708  O O   . ARG A 1 154 ? 83.381  13.139  -12.393 1.00 39.56  ? 231 ARG A O   1 
ATOM   709  C CB  . ARG A 1 154 ? 84.204  12.482  -9.353  1.00 32.33  ? 231 ARG A CB  1 
ATOM   710  C CG  . ARG A 1 154 ? 85.655  12.875  -9.565  1.00 44.13  ? 231 ARG A CG  1 
ATOM   711  C CD  . ARG A 1 154 ? 86.610  12.104  -8.643  1.00 46.61  ? 231 ARG A CD  1 
ATOM   712  N NE  . ARG A 1 154 ? 86.570  10.657  -8.867  1.00 40.62  ? 231 ARG A NE  1 
ATOM   713  C CZ  . ARG A 1 154 ? 87.575  9.948   -9.362  1.00 50.43  ? 231 ARG A CZ  1 
ATOM   714  N NH1 . ARG A 1 154 ? 88.731  10.535  -9.660  1.00 35.85  ? 231 ARG A NH1 1 
ATOM   715  N NH2 . ARG A 1 154 ? 87.448  8.638   -9.531  1.00 42.24  ? 231 ARG A NH2 1 
ATOM   716  N N   . CYS A 1 155 ? 83.868  15.194  -11.498 1.00 36.17  ? 232 CYS A N   1 
ATOM   717  C CA  . CYS A 1 155 ? 84.342  15.961  -12.660 1.00 35.73  ? 232 CYS A CA  1 
ATOM   718  C C   . CYS A 1 155 ? 85.818  16.109  -12.468 1.00 41.24  ? 232 CYS A C   1 
ATOM   719  O O   . CYS A 1 155 ? 86.255  16.324  -11.329 1.00 43.70  ? 232 CYS A O   1 
ATOM   720  C CB  . CYS A 1 155 ? 83.766  17.374  -12.674 1.00 35.92  ? 232 CYS A CB  1 
ATOM   721  S SG  A CYS A 1 155 ? 82.768  17.768  -14.126 0.30 39.56  ? 232 CYS A SG  1 
ATOM   722  S SG  B CYS A 1 155 ? 82.047  17.497  -12.253 0.58 39.15  ? 232 CYS A SG  1 
ATOM   723  N N   . ILE A 1 156 ? 86.540  16.311  -13.568 1.00 34.19  ? 233 ILE A N   1 
ATOM   724  C CA  . ILE A 1 156 ? 87.935  16.718  -13.538 1.00 32.73  ? 233 ILE A CA  1 
ATOM   725  C C   . ILE A 1 156 ? 88.143  17.501  -14.835 1.00 37.54  ? 233 ILE A C   1 
ATOM   726  O O   . ILE A 1 156 ? 87.637  17.117  -15.904 1.00 37.62  ? 233 ILE A O   1 
ATOM   727  C CB  . ILE A 1 156 ? 89.004  15.582  -13.307 1.00 34.93  ? 233 ILE A CB  1 
ATOM   728  C CG1 . ILE A 1 156 ? 88.663  14.666  -12.096 1.00 32.77  ? 233 ILE A CG1 1 
ATOM   729  C CG2 . ILE A 1 156 ? 90.418  16.187  -13.160 1.00 37.19  ? 233 ILE A CG2 1 
ATOM   730  C CD1 . ILE A 1 156 ? 89.558  13.503  -11.808 1.00 37.93  ? 233 ILE A CD1 1 
ATOM   731  N N   . GLN A 1 157 ? 88.841  18.627  -14.716 1.00 32.94  ? 234 GLN A N   1 
ATOM   732  C CA  . GLN A 1 157 ? 89.245  19.493  -15.816 1.00 31.59  ? 234 GLN A CA  1 
ATOM   733  C C   . GLN A 1 157 ? 90.711  19.848  -15.583 1.00 38.95  ? 234 GLN A C   1 
ATOM   734  O O   . GLN A 1 157 ? 91.073  20.303  -14.489 1.00 39.77  ? 234 GLN A O   1 
ATOM   735  C CB  . GLN A 1 157 ? 88.426  20.795  -15.861 1.00 31.14  ? 234 GLN A CB  1 
ATOM   736  C CG  . GLN A 1 157 ? 87.073  20.710  -16.551 1.00 36.89  ? 234 GLN A CG  1 
ATOM   737  C CD  . GLN A 1 157 ? 87.109  20.218  -17.974 1.00 50.68  ? 234 GLN A CD  1 
ATOM   738  O OE1 . GLN A 1 157 ? 86.940  19.016  -18.240 1.00 47.17  ? 234 GLN A OE1 1 
ATOM   739  N NE2 . GLN A 1 157 ? 87.269  21.139  -18.922 1.00 34.27  ? 234 GLN A NE2 1 
ATOM   740  N N   . ASN A 1 158 ? 91.557  19.668  -16.609 1.00 35.41  ? 235 ASN A N   1 
ATOM   741  C CA  . ASN A 1 158 ? 92.937  20.109  -16.521 1.00 35.88  ? 235 ASN A CA  1 
ATOM   742  C C   . ASN A 1 158 ? 92.855  21.616  -16.700 1.00 45.77  ? 235 ASN A C   1 
ATOM   743  O O   . ASN A 1 158 ? 91.907  22.109  -17.340 1.00 47.45  ? 235 ASN A O   1 
ATOM   744  C CB  . ASN A 1 158 ? 93.799  19.491  -17.610 1.00 28.57  ? 235 ASN A CB  1 
ATOM   745  C CG  . ASN A 1 158 ? 94.236  18.074  -17.354 1.00 54.62  ? 235 ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 158 ? 94.011  17.180  -18.176 1.00 41.20  ? 235 ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 158 ? 94.933  17.845  -16.237 1.00 52.53  ? 235 ASN A ND2 1 
ATOM   748  N N   . MET A 1 159 ? 93.804  22.364  -16.114 1.00 43.97  ? 236 MET A N   1 
ATOM   749  C CA  . MET A 1 159 ? 93.777  23.827  -16.210 1.00 44.03  ? 236 MET A CA  1 
ATOM   750  C C   . MET A 1 159 ? 95.072  24.342  -16.815 1.00 50.48  ? 236 MET A C   1 
ATOM   751  O O   . MET A 1 159 ? 96.131  23.749  -16.565 1.00 52.17  ? 236 MET A O   1 
ATOM   752  C CB  . MET A 1 159 ? 93.576  24.465  -14.819 1.00 46.29  ? 236 MET A CB  1 
ATOM   753  C CG  . MET A 1 159 ? 92.417  23.886  -14.005 1.00 47.62  ? 236 MET A CG  1 
ATOM   754  S SD  . MET A 1 159 ? 90.755  24.212  -14.658 1.00 49.85  ? 236 MET A SD  1 
ATOM   755  C CE  . MET A 1 159 ? 90.703  25.956  -14.589 1.00 46.89  ? 236 MET A CE  1 
ATOM   756  N N   . PRO A 1 160 ? 95.035  25.465  -17.568 1.00 46.92  ? 237 PRO A N   1 
ATOM   757  C CA  . PRO A 1 160 ? 96.287  26.032  -18.088 1.00 49.60  ? 237 PRO A CA  1 
ATOM   758  C C   . PRO A 1 160 ? 96.942  26.993  -17.075 1.00 56.59  ? 237 PRO A C   1 
ATOM   759  O O   . PRO A 1 160 ? 96.267  27.516  -16.177 1.00 56.19  ? 237 PRO A O   1 
ATOM   760  C CB  . PRO A 1 160 ? 95.827  26.772  -19.341 1.00 51.72  ? 237 PRO A CB  1 
ATOM   761  C CG  . PRO A 1 160 ? 94.428  27.203  -19.025 1.00 54.21  ? 237 PRO A CG  1 
ATOM   762  C CD  . PRO A 1 160 ? 93.873  26.286  -17.967 1.00 47.51  ? 237 PRO A CD  1 
ATOM   763  N N   . GLU A 1 161 ? 98.253  27.246  -17.229 1.00 55.14  ? 238 GLU A N   1 
ATOM   764  C CA  . GLU A 1 161 ? 98.967  28.159  -16.350 1.00 57.66  ? 238 GLU A CA  1 
ATOM   765  C C   . GLU A 1 161 ? 98.418  29.592  -16.538 1.00 65.50  ? 238 GLU A C   1 
ATOM   766  O O   . GLU A 1 161 ? 98.351  30.357  -15.577 1.00 67.42  ? 238 GLU A O   1 
ATOM   767  C CB  . GLU A 1 161 ? 100.488 28.114  -16.645 1.00 61.85  ? 238 GLU A CB  1 
ATOM   768  C CG  . GLU A 1 161 ? 101.366 27.453  -15.587 1.00 66.41  ? 238 GLU A CG  1 
ATOM   769  N N   . THR A 1 162 ? 97.981  29.923  -17.762 1.00 62.44  ? 239 THR A N   1 
ATOM   770  C CA  . THR A 1 162 ? 97.484  31.249  -18.146 1.00 62.80  ? 239 THR A CA  1 
ATOM   771  C C   . THR A 1 162 ? 95.978  31.307  -18.357 1.00 62.36  ? 239 THR A C   1 
ATOM   772  O O   . THR A 1 162 ? 95.426  30.483  -19.081 1.00 60.09  ? 239 THR A O   1 
ATOM   773  C CB  . THR A 1 162 ? 98.309  31.831  -19.329 1.00 73.09  ? 239 THR A CB  1 
ATOM   774  O OG1 . THR A 1 162 ? 97.566  32.863  -19.968 1.00 70.93  ? 239 THR A OG1 1 
ATOM   775  C CG2 . THR A 1 162 ? 98.665  30.784  -20.381 1.00 73.27  ? 239 THR A CG2 1 
ATOM   776  N N   . LEU A 1 163 ? 95.340  32.326  -17.760 1.00 58.66  ? 240 LEU A N   1 
ATOM   777  C CA  . LEU A 1 163 ? 93.902  32.612  -17.820 1.00 57.24  ? 240 LEU A CA  1 
ATOM   778  C C   . LEU A 1 163 ? 93.015  31.374  -17.624 1.00 60.23  ? 240 LEU A C   1 
ATOM   779  O O   . LEU A 1 163 ? 92.207  31.072  -18.510 1.00 59.24  ? 240 LEU A O   1 
ATOM   780  C CB  . LEU A 1 163 ? 93.537  33.351  -19.114 1.00 58.25  ? 240 LEU A CB  1 
ATOM   781  C CG  . LEU A 1 163 ? 94.149  34.748  -19.295 1.00 67.01  ? 240 LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 163 ? 94.155  35.162  -20.760 1.00 68.34  ? 240 LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 163 ? 93.420  35.795  -18.445 1.00 69.16  ? 240 LEU A CD2 1 
ATOM   784  N N   . PRO A 1 164 ? 93.159  30.609  -16.501 1.00 55.65  ? 241 PRO A N   1 
ATOM   785  C CA  . PRO A 1 164 ? 92.339  29.404  -16.345 1.00 51.94  ? 241 PRO A CA  1 
ATOM   786  C C   . PRO A 1 164 ? 90.875  29.751  -16.175 1.00 53.00  ? 241 PRO A C   1 
ATOM   787  O O   . PRO A 1 164 ? 90.534  30.596  -15.350 1.00 53.61  ? 241 PRO A O   1 
ATOM   788  C CB  . PRO A 1 164 ? 92.942  28.729  -15.109 1.00 54.06  ? 241 PRO A CB  1 
ATOM   789  C CG  . PRO A 1 164 ? 93.565  29.811  -14.332 1.00 60.58  ? 241 PRO A CG  1 
ATOM   790  C CD  . PRO A 1 164 ? 94.077  30.779  -15.350 1.00 58.43  ? 241 PRO A CD  1 
ATOM   791  N N   . ASN A 1 165 ? 90.033  29.173  -17.031 1.00 47.56  ? 242 ASN A N   1 
ATOM   792  C CA  . ASN A 1 165 ? 88.574  29.364  -17.052 1.00 45.52  ? 242 ASN A CA  1 
ATOM   793  C C   . ASN A 1 165 ? 87.941  28.126  -17.664 1.00 44.46  ? 242 ASN A C   1 
ATOM   794  O O   . ASN A 1 165 ? 87.801  28.047  -18.889 1.00 42.34  ? 242 ASN A O   1 
ATOM   795  C CB  . ASN A 1 165 ? 88.165  30.617  -17.871 1.00 48.71  ? 242 ASN A CB  1 
ATOM   796  C CG  . ASN A 1 165 ? 88.488  31.942  -17.245 1.00 65.54  ? 242 ASN A CG  1 
ATOM   797  O OD1 . ASN A 1 165 ? 89.549  32.505  -17.483 1.00 66.19  ? 242 ASN A OD1 1 
ATOM   798  N ND2 . ASN A 1 165 ? 87.578  32.471  -16.443 1.00 51.31  ? 242 ASN A ND2 1 
ATOM   799  N N   . ASN A 1 166 ? 87.608  27.135  -16.821 1.00 40.30  ? 243 ASN A N   1 
ATOM   800  C CA  . ASN A 1 166 ? 86.969  25.881  -17.265 1.00 38.00  ? 243 ASN A CA  1 
ATOM   801  C C   . ASN A 1 166 ? 85.823  25.562  -16.367 1.00 41.43  ? 243 ASN A C   1 
ATOM   802  O O   . ASN A 1 166 ? 85.998  25.478  -15.149 1.00 42.15  ? 243 ASN A O   1 
ATOM   803  C CB  . ASN A 1 166 ? 87.950  24.689  -17.275 1.00 34.62  ? 243 ASN A CB  1 
ATOM   804  C CG  . ASN A 1 166 ? 88.927  24.654  -18.427 1.00 48.57  ? 243 ASN A CG  1 
ATOM   805  O OD1 . ASN A 1 166 ? 88.577  24.841  -19.608 1.00 43.19  ? 243 ASN A OD1 1 
ATOM   806  N ND2 . ASN A 1 166 ? 90.171  24.335  -18.112 1.00 36.73  ? 243 ASN A ND2 1 
ATOM   807  N N   . SER A 1 167 ? 84.636  25.438  -16.945 1.00 37.07  ? 244 SER A N   1 
ATOM   808  C CA  . SER A 1 167 ? 83.461  25.045  -16.172 1.00 35.22  ? 244 SER A CA  1 
ATOM   809  C C   . SER A 1 167 ? 83.356  23.544  -16.337 1.00 38.67  ? 244 SER A C   1 
ATOM   810  O O   . SER A 1 167 ? 83.726  23.014  -17.389 1.00 38.71  ? 244 SER A O   1 
ATOM   811  C CB  . SER A 1 167 ? 82.196  25.735  -16.678 1.00 37.26  ? 244 SER A CB  1 
ATOM   812  O OG  . SER A 1 167 ? 81.842  25.380  -18.010 1.00 42.39  ? 244 SER A OG  1 
ATOM   813  N N   . CYS A 1 168 ? 82.908  22.848  -15.301 1.00 34.78  ? 245 CYS A N   1 
ATOM   814  C CA  . CYS A 1 168 ? 82.735  21.408  -15.399 1.00 33.15  ? 245 CYS A CA  1 
ATOM   815  C C   . CYS A 1 168 ? 81.391  21.027  -14.877 1.00 37.17  ? 245 CYS A C   1 
ATOM   816  O O   . CYS A 1 168 ? 81.024  21.382  -13.748 1.00 37.92  ? 245 CYS A O   1 
ATOM   817  C CB  . CYS A 1 168 ? 83.844  20.647  -14.691 1.00 33.55  ? 245 CYS A CB  1 
ATOM   818  S SG  A CYS A 1 168 ? 84.007  18.933  -15.238 0.30 36.72  ? 245 CYS A SG  1 
ATOM   819  S SG  B CYS A 1 168 ? 84.084  18.974  -15.316 0.33 36.80  ? 245 CYS A SG  1 
ATOM   820  N N   . TYR A 1 169 ? 80.651  20.323  -15.710 1.00 32.89  ? 246 TYR A N   1 
ATOM   821  C CA  . TYR A 1 169 ? 79.321  19.838  -15.396 1.00 31.33  ? 246 TYR A CA  1 
ATOM   822  C C   . TYR A 1 169 ? 79.360  18.308  -15.299 1.00 36.82  ? 246 TYR A C   1 
ATOM   823  O O   . TYR A 1 169 ? 79.979  17.642  -16.141 1.00 40.16  ? 246 TYR A O   1 
ATOM   824  C CB  . TYR A 1 169 ? 78.351  20.257  -16.528 1.00 30.82  ? 246 TYR A CB  1 
ATOM   825  C CG  . TYR A 1 169 ? 76.920  19.791  -16.330 1.00 31.47  ? 246 TYR A CG  1 
ATOM   826  C CD1 . TYR A 1 169 ? 76.513  18.522  -16.739 1.00 33.12  ? 246 TYR A CD1 1 
ATOM   827  C CD2 . TYR A 1 169 ? 75.977  20.608  -15.715 1.00 31.96  ? 246 TYR A CD2 1 
ATOM   828  C CE1 . TYR A 1 169 ? 75.211  18.068  -16.513 1.00 33.55  ? 246 TYR A CE1 1 
ATOM   829  C CE2 . TYR A 1 169 ? 74.663  20.179  -15.519 1.00 32.85  ? 246 TYR A CE2 1 
ATOM   830  C CZ  . TYR A 1 169 ? 74.279  18.912  -15.934 1.00 42.21  ? 246 TYR A CZ  1 
ATOM   831  O OH  . TYR A 1 169 ? 72.975  18.483  -15.780 1.00 44.10  ? 246 TYR A OH  1 
ATOM   832  N N   . SER A 1 170 ? 78.652  17.756  -14.316 1.00 29.56  ? 247 SER A N   1 
ATOM   833  C CA  . SER A 1 170 ? 78.419  16.323  -14.202 1.00 28.39  ? 247 SER A CA  1 
ATOM   834  C C   . SER A 1 170 ? 77.051  16.100  -13.595 1.00 31.84  ? 247 SER A C   1 
ATOM   835  O O   . SER A 1 170 ? 76.589  16.925  -12.799 1.00 34.31  ? 247 SER A O   1 
ATOM   836  C CB  . SER A 1 170 ? 79.486  15.646  -13.367 1.00 31.06  ? 247 SER A CB  1 
ATOM   837  O OG  . SER A 1 170 ? 79.502  14.262  -13.653 1.00 36.04  ? 247 SER A OG  1 
ATOM   838  N N   . ALA A 1 171 ? 76.393  15.018  -13.978 1.00 25.30  ? 248 ALA A N   1 
ATOM   839  C CA  . ALA A 1 171 ? 75.072  14.665  -13.470 1.00 25.92  ? 248 ALA A CA  1 
ATOM   840  C C   . ALA A 1 171 ? 74.799  13.177  -13.678 1.00 32.73  ? 248 ALA A C   1 
ATOM   841  O O   . ALA A 1 171 ? 75.384  12.544  -14.568 1.00 33.78  ? 248 ALA A O   1 
ATOM   842  C CB  . ALA A 1 171 ? 73.996  15.466  -14.187 1.00 27.41  ? 248 ALA A CB  1 
ATOM   843  N N   . GLY A 1 172 ? 73.871  12.647  -12.887 1.00 29.02  ? 249 GLY A N   1 
ATOM   844  C CA  . GLY A 1 172 ? 73.458  11.254  -12.956 1.00 28.95  ? 249 GLY A CA  1 
ATOM   845  C C   . GLY A 1 172 ? 72.250  10.955  -12.111 1.00 32.07  ? 249 GLY A C   1 
ATOM   846  O O   . GLY A 1 172 ? 71.664  11.868  -11.518 1.00 34.03  ? 249 GLY A O   1 
ATOM   847  N N   . ILE A 1 173 ? 71.874  9.690   -12.053 1.00 26.49  ? 250 ILE A N   1 
ATOM   848  C CA  . ILE A 1 173 ? 70.735  9.274   -11.231 1.00 26.83  ? 250 ILE A CA  1 
ATOM   849  C C   . ILE A 1 173 ? 71.258  8.494   -10.006 1.00 31.55  ? 250 ILE A C   1 
ATOM   850  O O   . ILE A 1 173 ? 72.248  7.769   -10.107 1.00 33.67  ? 250 ILE A O   1 
ATOM   851  C CB  . ILE A 1 173 ? 69.694  8.464   -12.051 1.00 29.77  ? 250 ILE A CB  1 
ATOM   852  C CG1 . ILE A 1 173 ? 69.264  9.244   -13.329 1.00 29.78  ? 250 ILE A CG1 1 
ATOM   853  C CG2 . ILE A 1 173 ? 68.489  8.134   -11.171 1.00 30.74  ? 250 ILE A CG2 1 
ATOM   854  C CD1 . ILE A 1 173 ? 68.530  8.452   -14.363 1.00 29.53  ? 250 ILE A CD1 1 
ATOM   855  N N   . ALA A 1 174 ? 70.630  8.664   -8.852  1.00 25.16  ? 251 ALA A N   1 
ATOM   856  C CA  . ALA A 1 174 ? 70.990  7.868   -7.689  1.00 24.27  ? 251 ALA A CA  1 
ATOM   857  C C   . ALA A 1 174 ? 69.750  7.588   -6.800  1.00 30.50  ? 251 ALA A C   1 
ATOM   858  O O   . ALA A 1 174 ? 68.780  8.373   -6.762  1.00 28.78  ? 251 ALA A O   1 
ATOM   859  C CB  . ALA A 1 174 ? 72.123  8.515   -6.880  1.00 23.75  ? 251 ALA A CB  1 
ATOM   860  N N   . LYS A 1 175 ? 69.774  6.443   -6.109  1.00 28.37  ? 252 LYS A N   1 
ATOM   861  C CA  . LYS A 1 175 ? 68.713  6.183   -5.171  1.00 29.95  ? 252 LYS A CA  1 
ATOM   862  C C   . LYS A 1 175 ? 69.140  6.802   -3.874  1.00 34.81  ? 252 LYS A C   1 
ATOM   863  O O   . LYS A 1 175 ? 70.249  6.519   -3.411  1.00 34.22  ? 252 LYS A O   1 
ATOM   864  C CB  . LYS A 1 175 ? 68.447  4.678   -5.031  1.00 33.32  ? 252 LYS A CB  1 
ATOM   865  C CG  . LYS A 1 175 ? 67.639  4.228   -3.790  1.00 34.87  ? 252 LYS A CG  1 
ATOM   866  C CD  . LYS A 1 175 ? 66.161  4.144   -4.022  1.00 42.54  ? 252 LYS A CD  1 
ATOM   867  C CE  . LYS A 1 175 ? 65.477  3.392   -2.898  1.00 52.17  ? 252 LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 175 ? 65.382  1.921   -3.175  1.00 62.05  ? 252 LYS A NZ  1 
ATOM   869  N N   . LEU A 1 176 ? 68.302  7.696   -3.320  1.00 31.90  ? 253 LEU A N   1 
ATOM   870  C CA  . LEU A 1 176 ? 68.543  8.370   -2.030  1.00 31.53  ? 253 LEU A CA  1 
ATOM   871  C C   . LEU A 1 176 ? 67.397  8.067   -1.087  1.00 38.90  ? 253 LEU A C   1 
ATOM   872  O O   . LEU A 1 176 ? 66.248  7.925   -1.516  1.00 38.97  ? 253 LEU A O   1 
ATOM   873  C CB  . LEU A 1 176 ? 68.745  9.901   -2.154  1.00 29.75  ? 253 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 176 ? 69.637  10.395  -3.313  1.00 30.88  ? 253 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 176 ? 69.671  11.880  -3.360  1.00 29.29  ? 253 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 176 ? 71.044  9.835   -3.232  1.00 32.51  ? 253 LEU A CD2 1 
ATOM   877  N N   . GLU A 1 177 ? 67.738  7.895   0.185   1.00 37.12  ? 254 GLU A N   1 
ATOM   878  C CA  . GLU A 1 177 ? 66.824  7.587   1.278   1.00 38.36  ? 254 GLU A CA  1 
ATOM   879  C C   . GLU A 1 177 ? 66.533  8.817   2.120   1.00 41.36  ? 254 GLU A C   1 
ATOM   880  O O   . GLU A 1 177 ? 67.400  9.664   2.317   1.00 40.56  ? 254 GLU A O   1 
ATOM   881  C CB  . GLU A 1 177 ? 67.463  6.545   2.172   1.00 40.76  ? 254 GLU A CB  1 
ATOM   882  C CG  . GLU A 1 177 ? 67.177  5.122   1.756   1.00 57.48  ? 254 GLU A CG  1 
ATOM   883  C CD  . GLU A 1 177 ? 68.079  4.159   2.505   1.00 112.26 ? 254 GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 177 ? 69.191  3.897   1.989   1.00 129.86 ? 254 GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 177 ? 67.722  3.737   3.634   1.00 113.03 ? 254 GLU A OE2 1 
ATOM   886  N N   . GLU A 1 178 ? 65.319  8.902   2.641   1.00 39.40  ? 255 GLU A N   1 
ATOM   887  C CA  . GLU A 1 178 ? 64.887  9.986   3.525   1.00 40.17  ? 255 GLU A CA  1 
ATOM   888  C C   . GLU A 1 178 ? 65.918  10.126  4.694   1.00 44.39  ? 255 GLU A C   1 
ATOM   889  O O   . GLU A 1 178 ? 66.182  9.155   5.410   1.00 45.93  ? 255 GLU A O   1 
ATOM   890  C CB  . GLU A 1 178 ? 63.464  9.680   4.037   1.00 43.12  ? 255 GLU A CB  1 
ATOM   891  C CG  . GLU A 1 178 ? 63.068  10.459  5.273   1.00 55.15  ? 255 GLU A CG  1 
ATOM   892  C CD  . GLU A 1 178 ? 61.688  10.169  5.807   1.00 77.60  ? 255 GLU A CD  1 
ATOM   893  O OE1 . GLU A 1 178 ? 61.227  9.014   5.656   1.00 57.60  ? 255 GLU A OE1 1 
ATOM   894  O OE2 . GLU A 1 178 ? 61.096  11.077  6.437   1.00 77.64  ? 255 GLU A OE2 1 
ATOM   895  N N   . GLY A 1 179 ? 66.533  11.293  4.800   1.00 39.17  ? 256 GLY A N   1 
ATOM   896  C CA  . GLY A 1 179 ? 67.546  11.551  5.813   1.00 39.95  ? 256 GLY A CA  1 
ATOM   897  C C   . GLY A 1 179 ? 68.931  11.783  5.239   1.00 45.81  ? 256 GLY A C   1 
ATOM   898  O O   . GLY A 1 179 ? 69.788  12.383  5.904   1.00 46.55  ? 256 GLY A O   1 
ATOM   899  N N   . ASP A 1 180 ? 69.173  11.296  3.999   1.00 41.49  ? 257 ASP A N   1 
ATOM   900  C CA  . ASP A 1 180 ? 70.447  11.507  3.303   1.00 39.21  ? 257 ASP A CA  1 
ATOM   901  C C   . ASP A 1 180 ? 70.604  12.986  2.969   1.00 44.39  ? 257 ASP A C   1 
ATOM   902  O O   . ASP A 1 180 ? 69.610  13.724  2.883   1.00 46.05  ? 257 ASP A O   1 
ATOM   903  C CB  . ASP A 1 180 ? 70.532  10.687  1.999   1.00 38.61  ? 257 ASP A CB  1 
ATOM   904  C CG  . ASP A 1 180 ? 70.570  9.181   2.164   1.00 49.70  ? 257 ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 180 ? 70.883  8.704   3.289   1.00 54.35  ? 257 ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 180 ? 70.290  8.473   1.177   1.00 49.59  ? 257 ASP A OD2 1 
ATOM   907  N N   . GLU A 1 181 ? 71.859  13.416  2.785   1.00 38.70  ? 258 GLU A N   1 
ATOM   908  C CA  . GLU A 1 181 ? 72.191  14.789  2.417   1.00 36.51  ? 258 GLU A CA  1 
ATOM   909  C C   . GLU A 1 181 ? 73.136  14.765  1.251   1.00 40.57  ? 258 GLU A C   1 
ATOM   910  O O   . GLU A 1 181 ? 73.973  13.867  1.150   1.00 43.10  ? 258 GLU A O   1 
ATOM   911  C CB  . GLU A 1 181 ? 72.810  15.547  3.589   1.00 38.24  ? 258 GLU A CB  1 
ATOM   912  C CG  . GLU A 1 181 ? 71.793  15.948  4.638   1.00 44.15  ? 258 GLU A CG  1 
ATOM   913  C CD  . GLU A 1 181 ? 72.386  16.342  5.973   1.00 76.03  ? 258 GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 181 ? 73.598  16.663  6.013   1.00 78.99  ? 258 GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 181 ? 71.633  16.347  6.978   1.00 74.29  ? 258 GLU A OE2 1 
ATOM   916  N N   . LEU A 1 182 ? 72.983  15.723  0.345   1.00 35.14  ? 259 LEU A N   1 
ATOM   917  C CA  . LEU A 1 182 ? 73.845  15.852  -0.832  1.00 32.40  ? 259 LEU A CA  1 
ATOM   918  C C   . LEU A 1 182 ? 74.718  17.090  -0.681  1.00 34.82  ? 259 LEU A C   1 
ATOM   919  O O   . LEU A 1 182 ? 74.244  18.124  -0.190  1.00 35.82  ? 259 LEU A O   1 
ATOM   920  C CB  . LEU A 1 182 ? 73.027  15.959  -2.128  1.00 30.87  ? 259 LEU A CB  1 
ATOM   921  C CG  . LEU A 1 182 ? 72.170  14.784  -2.508  1.00 33.82  ? 259 LEU A CG  1 
ATOM   922  C CD1 . LEU A 1 182 ? 71.322  15.136  -3.710  1.00 32.77  ? 259 LEU A CD1 1 
ATOM   923  C CD2 . LEU A 1 182 ? 73.022  13.535  -2.767  1.00 33.51  ? 259 LEU A CD2 1 
ATOM   924  N N   . GLN A 1 183 ? 75.978  16.982  -1.107  1.00 28.55  ? 260 GLN A N   1 
ATOM   925  C CA  . GLN A 1 183 ? 76.935  18.071  -1.056  1.00 29.74  ? 260 GLN A CA  1 
ATOM   926  C C   . GLN A 1 183 ? 77.906  18.068  -2.246  1.00 39.21  ? 260 GLN A C   1 
ATOM   927  O O   . GLN A 1 183 ? 78.246  17.010  -2.787  1.00 40.91  ? 260 GLN A O   1 
ATOM   928  C CB  . GLN A 1 183 ? 77.702  18.079  0.262   1.00 31.46  ? 260 GLN A CB  1 
ATOM   929  C CG  . GLN A 1 183 ? 78.664  16.909  0.444   1.00 40.20  ? 260 GLN A CG  1 
ATOM   930  C CD  . GLN A 1 183 ? 79.527  17.084  1.661   1.00 56.81  ? 260 GLN A CD  1 
ATOM   931  O OE1 . GLN A 1 183 ? 79.112  17.652  2.681   1.00 56.57  ? 260 GLN A OE1 1 
ATOM   932  N NE2 . GLN A 1 183 ? 80.739  16.567  1.590   1.00 44.21  ? 260 GLN A NE2 1 
ATOM   933  N N   . LEU A 1 184 ? 78.351  19.262  -2.635  1.00 35.96  ? 261 LEU A N   1 
ATOM   934  C CA  . LEU A 1 184 ? 79.308  19.446  -3.707  1.00 35.00  ? 261 LEU A CA  1 
ATOM   935  C C   . LEU A 1 184 ? 80.591  19.892  -3.015  1.00 41.40  ? 261 LEU A C   1 
ATOM   936  O O   . LEU A 1 184 ? 80.607  20.955  -2.380  1.00 43.04  ? 261 LEU A O   1 
ATOM   937  C CB  . LEU A 1 184 ? 78.797  20.505  -4.704  1.00 34.23  ? 261 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 184 ? 79.546  20.631  -6.008  1.00 37.36  ? 261 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 184 ? 78.613  21.026  -7.102  1.00 36.07  ? 261 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 184 ? 80.690  21.622  -5.886  1.00 41.41  ? 261 LEU A CD2 1 
ATOM   941  N N   . ALA A 1 185 ? 81.652  19.060  -3.105  1.00 36.62  ? 262 ALA A N   1 
ATOM   942  C CA  . ALA A 1 185 ? 82.940  19.314  -2.467  1.00 35.89  ? 262 ALA A CA  1 
ATOM   943  C C   . ALA A 1 185 ? 84.063  19.444  -3.485  1.00 41.95  ? 262 ALA A C   1 
ATOM   944  O O   . ALA A 1 185 ? 84.142  18.634  -4.417  1.00 43.53  ? 262 ALA A O   1 
ATOM   945  C CB  . ALA A 1 185 ? 83.251  18.195  -1.514  1.00 36.02  ? 262 ALA A CB  1 
ATOM   946  N N   . ILE A 1 186 ? 84.935  20.461  -3.319  1.00 37.61  ? 263 ILE A N   1 
ATOM   947  C CA  . ILE A 1 186 ? 86.088  20.649  -4.199  1.00 37.63  ? 263 ILE A CA  1 
ATOM   948  C C   . ILE A 1 186 ? 87.328  20.154  -3.461  1.00 44.89  ? 263 ILE A C   1 
ATOM   949  O O   . ILE A 1 186 ? 87.728  20.801  -2.493  1.00 46.93  ? 263 ILE A O   1 
ATOM   950  C CB  . ILE A 1 186 ? 86.237  22.082  -4.718  1.00 40.55  ? 263 ILE A CB  1 
ATOM   951  C CG1 . ILE A 1 186 ? 84.984  22.500  -5.548  1.00 38.26  ? 263 ILE A CG1 1 
ATOM   952  C CG2 . ILE A 1 186 ? 87.531  22.185  -5.547  1.00 42.50  ? 263 ILE A CG2 1 
ATOM   953  C CD1 . ILE A 1 186 ? 84.707  23.967  -5.580  1.00 29.18  ? 263 ILE A CD1 1 
ATOM   954  N N   . PRO A 1 187 ? 87.938  19.002  -3.870  1.00 41.25  ? 264 PRO A N   1 
ATOM   955  C CA  . PRO A 1 187 ? 89.087  18.472  -3.104  1.00 41.96  ? 264 PRO A CA  1 
ATOM   956  C C   . PRO A 1 187 ? 90.382  19.230  -3.344  1.00 46.35  ? 264 PRO A C   1 
ATOM   957  O O   . PRO A 1 187 ? 91.377  18.647  -3.777  1.00 47.17  ? 264 PRO A O   1 
ATOM   958  C CB  . PRO A 1 187 ? 89.171  16.997  -3.523  1.00 43.06  ? 264 PRO A CB  1 
ATOM   959  C CG  . PRO A 1 187 ? 88.094  16.788  -4.579  1.00 45.86  ? 264 PRO A CG  1 
ATOM   960  C CD  . PRO A 1 187 ? 87.582  18.117  -5.003  1.00 41.05  ? 264 PRO A CD  1 
ATOM   961  N N   . ARG A 1 188 ? 90.354  20.552  -3.096  1.00 41.32  ? 265 ARG A N   1 
ATOM   962  C CA  . ARG A 1 188 ? 91.489  21.462  -3.257  1.00 41.26  ? 265 ARG A CA  1 
ATOM   963  C C   . ARG A 1 188 ? 91.356  22.566  -2.202  1.00 47.69  ? 265 ARG A C   1 
ATOM   964  O O   . ARG A 1 188 ? 90.263  23.090  -2.005  1.00 46.69  ? 265 ARG A O   1 
ATOM   965  C CB  . ARG A 1 188 ? 91.521  22.074  -4.667  1.00 34.67  ? 265 ARG A CB  1 
ATOM   966  C CG  . ARG A 1 188 ? 91.411  21.084  -5.823  1.00 37.84  ? 265 ARG A CG  1 
ATOM   967  C CD  . ARG A 1 188 ? 92.750  20.914  -6.445  1.00 47.18  ? 265 ARG A CD  1 
ATOM   968  N NE  . ARG A 1 188 ? 92.846  19.911  -7.509  1.00 48.55  ? 265 ARG A NE  1 
ATOM   969  C CZ  . ARG A 1 188 ? 93.081  18.616  -7.312  1.00 53.68  ? 265 ARG A CZ  1 
ATOM   970  N NH1 . ARG A 1 188 ? 93.046  18.104  -6.087  1.00 30.47  ? 265 ARG A NH1 1 
ATOM   971  N NH2 . ARG A 1 188 ? 93.303  17.814  -8.340  1.00 36.37  ? 265 ARG A NH2 1 
ATOM   972  N N   . GLU A 1 189 ? 92.442  22.883  -1.494  1.00 47.45  ? 266 GLU A N   1 
ATOM   973  C CA  . GLU A 1 189 ? 92.447  23.940  -0.481  1.00 49.93  ? 266 GLU A CA  1 
ATOM   974  C C   . GLU A 1 189 ? 92.419  25.283  -1.193  1.00 56.11  ? 266 GLU A C   1 
ATOM   975  O O   . GLU A 1 189 ? 93.102  25.434  -2.207  1.00 56.90  ? 266 GLU A O   1 
ATOM   976  C CB  . GLU A 1 189 ? 93.733  23.884  0.347   1.00 53.91  ? 266 GLU A CB  1 
ATOM   977  C CG  . GLU A 1 189 ? 93.760  22.792  1.385   1.00 67.26  ? 266 GLU A CG  1 
ATOM   978  C CD  . GLU A 1 189 ? 95.118  22.617  2.026   1.00 90.29  ? 266 GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 189 ? 95.676  23.611  2.553   1.00 73.37  ? 266 GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 189 ? 95.611  21.467  2.016   1.00 89.24  ? 266 GLU A OE2 1 
ATOM   981  N N   . ASN A 1 190 ? 91.667  26.274  -0.651  1.00 52.38  ? 267 ASN A N   1 
ATOM   982  C CA  . ASN A 1 190 ? 91.551  27.635  -1.214  1.00 52.05  ? 267 ASN A CA  1 
ATOM   983  C C   . ASN A 1 190 ? 91.287  27.631  -2.748  1.00 53.22  ? 267 ASN A C   1 
ATOM   984  O O   . ASN A 1 190 ? 91.955  28.371  -3.479  1.00 53.06  ? 267 ASN A O   1 
ATOM   985  C CB  . ASN A 1 190 ? 92.781  28.485  -0.820  1.00 52.91  ? 267 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 190 ? 92.699  29.960  -1.178  1.00 80.54  ? 267 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 190 ? 91.793  30.701  -0.766  1.00 73.54  ? 267 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 190 ? 93.667  30.426  -1.954  1.00 76.30  ? 267 ASN A ND2 1 
ATOM   989  N N   . ALA A 1 191 ? 90.331  26.752  -3.230  1.00 46.61  ? 268 ALA A N   1 
ATOM   990  C CA  . ALA A 1 191 ? 89.999  26.598  -4.654  1.00 43.65  ? 268 ALA A CA  1 
ATOM   991  C C   . ALA A 1 191 ? 89.558  27.919  -5.242  1.00 49.65  ? 268 ALA A C   1 
ATOM   992  O O   . ALA A 1 191 ? 88.815  28.663  -4.587  1.00 50.45  ? 268 ALA A O   1 
ATOM   993  C CB  . ALA A 1 191 ? 88.924  25.556  -4.848  1.00 40.96  ? 268 ALA A CB  1 
ATOM   994  N N   . GLN A 1 192 ? 90.086  28.245  -6.437  1.00 46.06  ? 269 GLN A N   1 
ATOM   995  C CA  . GLN A 1 192 ? 89.781  29.487  -7.134  1.00 46.27  ? 269 GLN A CA  1 
ATOM   996  C C   . GLN A 1 192 ? 88.675  29.201  -8.104  1.00 51.30  ? 269 GLN A C   1 
ATOM   997  O O   . GLN A 1 192 ? 88.889  28.521  -9.103  1.00 51.97  ? 269 GLN A O   1 
ATOM   998  C CB  . GLN A 1 192 ? 91.016  30.032  -7.847  1.00 48.57  ? 269 GLN A CB  1 
ATOM   999  C CG  . GLN A 1 192 ? 92.168  30.353  -6.921  1.00 53.44  ? 269 GLN A CG  1 
ATOM   1000 C CD  . GLN A 1 192 ? 91.773  31.319  -5.828  1.00 67.26  ? 269 GLN A CD  1 
ATOM   1001 O OE1 . GLN A 1 192 ? 91.569  32.515  -6.053  1.00 64.34  ? 269 GLN A OE1 1 
ATOM   1002 N NE2 . GLN A 1 192 ? 91.637  30.814  -4.615  1.00 60.31  ? 269 GLN A NE2 1 
ATOM   1003 N N   . ILE A 1 193 ? 87.468  29.652  -7.773  1.00 47.21  ? 270 ILE A N   1 
ATOM   1004 C CA  . ILE A 1 193 ? 86.262  29.386  -8.552  1.00 44.78  ? 270 ILE A CA  1 
ATOM   1005 C C   . ILE A 1 193 ? 85.432  30.638  -8.745  1.00 48.92  ? 270 ILE A C   1 
ATOM   1006 O O   . ILE A 1 193 ? 85.633  31.608  -8.037  1.00 50.80  ? 270 ILE A O   1 
ATOM   1007 C CB  . ILE A 1 193 ? 85.425  28.253  -7.852  1.00 46.25  ? 270 ILE A CB  1 
ATOM   1008 C CG1 . ILE A 1 193 ? 84.920  28.695  -6.440  1.00 46.44  ? 270 ILE A CG1 1 
ATOM   1009 C CG2 . ILE A 1 193 ? 86.215  26.926  -7.780  1.00 46.30  ? 270 ILE A CG2 1 
ATOM   1010 C CD1 . ILE A 1 193 ? 83.775  27.980  -5.946  1.00 43.67  ? 270 ILE A CD1 1 
ATOM   1011 N N   . SER A 1 194 ? 84.477  30.613  -9.679  1.00 45.33  ? 271 SER A N   1 
ATOM   1012 C CA  . SER A 1 194 ? 83.560  31.736  -9.886  1.00 44.99  ? 271 SER A CA  1 
ATOM   1013 C C   . SER A 1 194 ? 82.277  31.488  -9.086  1.00 46.70  ? 271 SER A C   1 
ATOM   1014 O O   . SER A 1 194 ? 81.742  30.391  -9.109  1.00 42.82  ? 271 SER A O   1 
ATOM   1015 C CB  . SER A 1 194 ? 83.239  31.918  -11.357 1.00 46.76  ? 271 SER A CB  1 
ATOM   1016 O OG  . SER A 1 194 ? 82.203  32.868  -11.527 1.00 54.64  ? 271 SER A OG  1 
ATOM   1017 N N   . LEU A 1 195 ? 81.819  32.498  -8.352  1.00 45.18  ? 272 LEU A N   1 
ATOM   1018 C CA  . LEU A 1 195 ? 80.616  32.395  -7.535  1.00 42.73  ? 272 LEU A CA  1 
ATOM   1019 C C   . LEU A 1 195 ? 79.391  33.041  -8.216  1.00 45.31  ? 272 LEU A C   1 
ATOM   1020 O O   . LEU A 1 195 ? 78.463  33.489  -7.530  1.00 44.04  ? 272 LEU A O   1 
ATOM   1021 C CB  . LEU A 1 195 ? 80.855  32.932  -6.109  1.00 43.12  ? 272 LEU A CB  1 
ATOM   1022 C CG  . LEU A 1 195 ? 81.855  32.167  -5.250  1.00 46.04  ? 272 LEU A CG  1 
ATOM   1023 C CD1 . LEU A 1 195 ? 81.910  32.760  -3.889  1.00 46.60  ? 272 LEU A CD1 1 
ATOM   1024 C CD2 . LEU A 1 195 ? 81.459  30.706  -5.095  1.00 47.86  ? 272 LEU A CD2 1 
ATOM   1025 N N   . ASP A 1 196 ? 79.386  33.049  -9.568  1.00 41.84  ? 273 ASP A N   1 
ATOM   1026 C CA  . ASP A 1 196 ? 78.263  33.550  -10.362 1.00 42.71  ? 273 ASP A CA  1 
ATOM   1027 C C   . ASP A 1 196 ? 77.211  32.423  -10.525 1.00 46.91  ? 273 ASP A C   1 
ATOM   1028 O O   . ASP A 1 196 ? 77.556  31.311  -10.936 1.00 45.64  ? 273 ASP A O   1 
ATOM   1029 C CB  . ASP A 1 196 ? 78.728  34.103  -11.731 1.00 44.34  ? 273 ASP A CB  1 
ATOM   1030 C CG  . ASP A 1 196 ? 79.658  35.301  -11.660 1.00 52.42  ? 273 ASP A CG  1 
ATOM   1031 O OD1 . ASP A 1 196 ? 79.530  36.100  -10.697 1.00 57.09  ? 273 ASP A OD1 1 
ATOM   1032 O OD2 . ASP A 1 196 ? 80.513  35.454  -12.580 1.00 48.49  ? 273 ASP A OD2 1 
ATOM   1033 N N   . GLY A 1 197 ? 75.954  32.735  -10.199 1.00 43.58  ? 274 GLY A N   1 
ATOM   1034 C CA  . GLY A 1 197 ? 74.824  31.804  -10.250 1.00 42.00  ? 274 GLY A CA  1 
ATOM   1035 C C   . GLY A 1 197 ? 74.573  31.072  -11.555 1.00 42.25  ? 274 GLY A C   1 
ATOM   1036 O O   . GLY A 1 197 ? 74.039  29.958  -11.545 1.00 39.95  ? 274 GLY A O   1 
ATOM   1037 N N   . ASP A 1 198 ? 74.966  31.681  -12.678 1.00 38.88  ? 275 ASP A N   1 
ATOM   1038 C CA  . ASP A 1 198 ? 74.775  31.096  -14.012 1.00 38.70  ? 275 ASP A CA  1 
ATOM   1039 C C   . ASP A 1 198 ? 75.887  30.088  -14.383 1.00 41.72  ? 275 ASP A C   1 
ATOM   1040 O O   . ASP A 1 198 ? 75.808  29.404  -15.418 1.00 39.83  ? 275 ASP A O   1 
ATOM   1041 C CB  . ASP A 1 198 ? 74.706  32.220  -15.075 1.00 40.50  ? 275 ASP A CB  1 
ATOM   1042 C CG  . ASP A 1 198 ? 75.970  33.049  -15.210 1.00 47.43  ? 275 ASP A CG  1 
ATOM   1043 O OD1 . ASP A 1 198 ? 76.698  33.197  -14.201 1.00 46.62  ? 275 ASP A OD1 1 
ATOM   1044 O OD2 . ASP A 1 198 ? 76.207  33.592  -16.311 1.00 59.28  ? 275 ASP A OD2 1 
ATOM   1045 N N   . VAL A 1 199 ? 76.922  30.027  -13.542 1.00 37.02  ? 276 VAL A N   1 
ATOM   1046 C CA  . VAL A 1 199 ? 78.113  29.265  -13.813 1.00 35.67  ? 276 VAL A CA  1 
ATOM   1047 C C   . VAL A 1 199 ? 78.435  28.207  -12.751 1.00 39.29  ? 276 VAL A C   1 
ATOM   1048 O O   . VAL A 1 199 ? 79.006  27.179  -13.079 1.00 40.39  ? 276 VAL A O   1 
ATOM   1049 C CB  . VAL A 1 199 ? 79.213  30.324  -14.105 1.00 40.42  ? 276 VAL A CB  1 
ATOM   1050 C CG1 . VAL A 1 199 ? 80.128  30.599  -12.941 1.00 40.04  ? 276 VAL A CG1 1 
ATOM   1051 C CG2 . VAL A 1 199 ? 79.978  30.009  -15.365 1.00 40.97  ? 276 VAL A CG2 1 
ATOM   1052 N N   . THR A 1 200 ? 78.038  28.442  -11.500 1.00 35.32  ? 277 THR A N   1 
ATOM   1053 C CA  . THR A 1 200 ? 78.252  27.546  -10.367 1.00 34.65  ? 277 THR A CA  1 
ATOM   1054 C C   . THR A 1 200 ? 76.894  27.285  -9.718  1.00 39.18  ? 277 THR A C   1 
ATOM   1055 O O   . THR A 1 200 ? 76.284  28.185  -9.131  1.00 41.01  ? 277 THR A O   1 
ATOM   1056 C CB  . THR A 1 200 ? 79.314  28.108  -9.426  1.00 38.52  ? 277 THR A CB  1 
ATOM   1057 O OG1 . THR A 1 200 ? 80.531  28.253  -10.163 1.00 43.96  ? 277 THR A OG1 1 
ATOM   1058 C CG2 . THR A 1 200 ? 79.559  27.224  -8.208  1.00 28.72  ? 277 THR A CG2 1 
ATOM   1059 N N   . PHE A 1 201 ? 76.399  26.069  -9.891  1.00 32.66  ? 278 PHE A N   1 
ATOM   1060 C CA  . PHE A 1 201 ? 75.078  25.688  -9.424  1.00 31.25  ? 278 PHE A CA  1 
ATOM   1061 C C   . PHE A 1 201 ? 75.038  24.201  -9.101  1.00 35.47  ? 278 PHE A C   1 
ATOM   1062 O O   . PHE A 1 201 ? 75.933  23.457  -9.514  1.00 35.59  ? 278 PHE A O   1 
ATOM   1063 C CB  . PHE A 1 201 ? 73.975  26.087  -10.443 1.00 31.94  ? 278 PHE A CB  1 
ATOM   1064 C CG  . PHE A 1 201 ? 74.208  25.607  -11.848 1.00 31.75  ? 278 PHE A CG  1 
ATOM   1065 C CD1 . PHE A 1 201 ? 74.844  26.420  -12.783 1.00 34.59  ? 278 PHE A CD1 1 
ATOM   1066 C CD2 . PHE A 1 201 ? 73.830  24.329  -12.232 1.00 32.95  ? 278 PHE A CD2 1 
ATOM   1067 C CE1 . PHE A 1 201 ? 75.084  25.966  -14.088 1.00 34.99  ? 278 PHE A CE1 1 
ATOM   1068 C CE2 . PHE A 1 201 ? 74.078  23.873  -13.528 1.00 35.53  ? 278 PHE A CE2 1 
ATOM   1069 C CZ  . PHE A 1 201 ? 74.683  24.709  -14.458 1.00 33.92  ? 278 PHE A CZ  1 
ATOM   1070 N N   . PHE A 1 202 ? 74.005  23.778  -8.343  1.00 30.25  ? 279 PHE A N   1 
ATOM   1071 C CA  . PHE A 1 202 ? 73.837  22.425  -7.832  1.00 28.54  ? 279 PHE A CA  1 
ATOM   1072 C C   . PHE A 1 202 ? 72.351  22.187  -7.601  1.00 34.08  ? 279 PHE A C   1 
ATOM   1073 O O   . PHE A 1 202 ? 71.666  23.027  -6.994  1.00 35.12  ? 279 PHE A O   1 
ATOM   1074 C CB  . PHE A 1 202 ? 74.625  22.319  -6.502  1.00 29.88  ? 279 PHE A CB  1 
ATOM   1075 C CG  . PHE A 1 202 ? 74.600  21.044  -5.698  1.00 30.08  ? 279 PHE A CG  1 
ATOM   1076 C CD1 . PHE A 1 202 ? 74.682  19.799  -6.328  1.00 31.30  ? 279 PHE A CD1 1 
ATOM   1077 C CD2 . PHE A 1 202 ? 74.624  21.083  -4.308  1.00 31.46  ? 279 PHE A CD2 1 
ATOM   1078 C CE1 . PHE A 1 202 ? 74.724  18.622  -5.582  1.00 31.22  ? 279 PHE A CE1 1 
ATOM   1079 C CE2 . PHE A 1 202 ? 74.651  19.901  -3.560  1.00 33.37  ? 279 PHE A CE2 1 
ATOM   1080 C CZ  . PHE A 1 202 ? 74.706  18.682  -4.201  1.00 30.64  ? 279 PHE A CZ  1 
ATOM   1081 N N   . GLY A 1 203 ? 71.852  21.068  -8.116  1.00 29.23  ? 280 GLY A N   1 
ATOM   1082 C CA  . GLY A 1 203 ? 70.453  20.728  -7.955  1.00 29.75  ? 280 GLY A CA  1 
ATOM   1083 C C   . GLY A 1 203 ? 70.157  19.251  -7.991  1.00 38.22  ? 280 GLY A C   1 
ATOM   1084 O O   . GLY A 1 203 ? 71.020  18.432  -8.334  1.00 36.90  ? 280 GLY A O   1 
ATOM   1085 N N   . ALA A 1 204 ? 68.910  18.908  -7.619  1.00 38.39  ? 281 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 204 ? 68.384  17.541  -7.622  1.00 37.90  ? 281 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 204 ? 66.930  17.581  -8.037  1.00 42.20  ? 281 ALA A C   1 
ATOM   1088 O O   . ALA A 1 204 ? 66.239  18.572  -7.771  1.00 42.40  ? 281 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 204 ? 68.529  16.913  -6.252  1.00 38.89  ? 281 ALA A CB  1 
ATOM   1090 N N   . LEU A 1 205 ? 66.482  16.522  -8.721  1.00 38.40  ? 282 LEU A N   1 
ATOM   1091 C CA  . LEU A 1 205 ? 65.128  16.385  -9.239  1.00 38.85  ? 282 LEU A CA  1 
ATOM   1092 C C   . LEU A 1 205 ? 64.587  14.982  -8.963  1.00 40.51  ? 282 LEU A C   1 
ATOM   1093 O O   . LEU A 1 205 ? 65.224  14.000  -9.326  1.00 40.10  ? 282 LEU A O   1 
ATOM   1094 C CB  . LEU A 1 205 ? 65.210  16.676  -10.738 1.00 38.99  ? 282 LEU A CB  1 
ATOM   1095 C CG  . LEU A 1 205 ? 64.087  16.241  -11.670 1.00 45.12  ? 282 LEU A CG  1 
ATOM   1096 C CD1 . LEU A 1 205 ? 62.816  16.983  -11.382 1.00 46.42  ? 282 LEU A CD1 1 
ATOM   1097 C CD2 . LEU A 1 205 ? 64.484  16.537  -13.101 1.00 47.15  ? 282 LEU A CD2 1 
ATOM   1098 N N   . LYS A 1 206 ? 63.437  14.890  -8.291  1.00 36.35  ? 283 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 206 ? 62.832  13.598  -7.948  1.00 36.07  ? 283 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 206 ? 62.153  12.983  -9.154  1.00 44.35  ? 283 LYS A C   1 
ATOM   1101 O O   . LYS A 1 206 ? 61.327  13.627  -9.792  1.00 46.45  ? 283 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 206 ? 61.853  13.682  -6.761  1.00 36.50  ? 283 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 206 ? 61.660  12.316  -6.134  1.00 36.00  ? 283 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 206 ? 60.906  12.294  -4.837  1.00 40.16  ? 283 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 206 ? 60.755  10.887  -4.346  1.00 50.81  ? 283 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 206 ? 59.397  10.639  -3.791  1.00 72.67  ? 283 LYS A NZ  1 
ATOM   1107 N N   . LEU A 1 207 ? 62.519  11.745  -9.478  1.00 41.59  ? 284 LEU A N   1 
ATOM   1108 C CA  . LEU A 1 207 ? 61.925  11.029  -10.597 1.00 42.23  ? 284 LEU A CA  1 
ATOM   1109 C C   . LEU A 1 207 ? 60.625  10.402  -10.156 1.00 49.72  ? 284 LEU A C   1 
ATOM   1110 O O   . LEU A 1 207 ? 60.534  9.913   -9.027  1.00 49.90  ? 284 LEU A O   1 
ATOM   1111 C CB  . LEU A 1 207 ? 62.876  9.947   -11.137 1.00 41.09  ? 284 LEU A CB  1 
ATOM   1112 C CG  . LEU A 1 207 ? 64.253  10.441  -11.608 1.00 43.81  ? 284 LEU A CG  1 
ATOM   1113 C CD1 . LEU A 1 207 ? 65.051  9.296   -12.146 1.00 44.36  ? 284 LEU A CD1 1 
ATOM   1114 C CD2 . LEU A 1 207 ? 64.139  11.530  -12.668 1.00 44.12  ? 284 LEU A CD2 1 
ATOM   1115 N N   . LEU A 1 208 ? 59.617  10.409  -11.036 1.00 48.54  ? 285 LEU A N   1 
ATOM   1116 C CA  . LEU A 1 208 ? 58.331  9.798   -10.709 1.00 52.09  ? 285 LEU A CA  1 
ATOM   1117 C C   . LEU A 1 208 ? 58.455  8.294   -10.848 1.00 52.76  ? 285 LEU A C   1 
ATOM   1118 O O   . LEU A 1 208 ? 57.826  7.570   -10.046 1.00 61.45  ? 285 LEU A O   1 
ATOM   1119 C CB  . LEU A 1 208 ? 57.209  10.312  -11.617 1.00 53.13  ? 285 LEU A CB  1 
ATOM   1120 C CG  . LEU A 1 208 ? 56.693  11.674  -11.306 1.00 57.44  ? 285 LEU A CG  1 
ATOM   1121 C CD1 . LEU A 1 208 ? 56.322  12.399  -12.582 1.00 58.08  ? 285 LEU A CD1 1 
ATOM   1122 C CD2 . LEU A 1 208 ? 55.534  11.595  -10.379 1.00 61.95  ? 285 LEU A CD2 1 
ATOM   1123 O OXT . LEU A 1 208 ? 59.214  7.851   -11.732 1.00 54.13  ? 285 LEU A OXT 1 
ATOM   1124 N N   . VAL B 1 65  ? 52.145  6.421   -12.703 1.00 78.48  ? 142 VAL B N   1 
ATOM   1125 C CA  . VAL B 1 65  ? 53.106  5.963   -13.716 1.00 76.41  ? 142 VAL B CA  1 
ATOM   1126 C C   . VAL B 1 65  ? 54.519  6.474   -13.353 1.00 76.03  ? 142 VAL B C   1 
ATOM   1127 O O   . VAL B 1 65  ? 54.654  7.571   -12.802 1.00 75.91  ? 142 VAL B O   1 
ATOM   1128 C CB  . VAL B 1 65  ? 52.690  6.316   -15.185 1.00 81.16  ? 142 VAL B CB  1 
ATOM   1129 C CG1 . VAL B 1 65  ? 53.470  5.480   -16.214 1.00 79.79  ? 142 VAL B CG1 1 
ATOM   1130 C CG2 . VAL B 1 65  ? 51.191  6.133   -15.406 1.00 83.47  ? 142 VAL B CG2 1 
ATOM   1131 N N   . THR B 1 66  ? 55.564  5.667   -13.643 1.00 68.00  ? 143 THR B N   1 
ATOM   1132 C CA  . THR B 1 66  ? 56.939  6.015   -13.319 1.00 64.61  ? 143 THR B CA  1 
ATOM   1133 C C   . THR B 1 66  ? 57.815  6.251   -14.558 1.00 64.28  ? 143 THR B C   1 
ATOM   1134 O O   . THR B 1 66  ? 57.483  5.829   -15.668 1.00 64.58  ? 143 THR B O   1 
ATOM   1135 C CB  . THR B 1 66  ? 57.580  4.961   -12.374 1.00 74.66  ? 143 THR B CB  1 
ATOM   1136 O OG1 . THR B 1 66  ? 57.853  3.760   -13.083 1.00 73.15  ? 143 THR B OG1 1 
ATOM   1137 C CG2 . THR B 1 66  ? 56.744  4.660   -11.132 1.00 76.57  ? 143 THR B CG2 1 
ATOM   1138 N N   . GLN B 1 67  ? 58.964  6.905   -14.340 1.00 56.00  ? 144 GLN B N   1 
ATOM   1139 C CA  . GLN B 1 67  ? 59.967  7.178   -15.357 1.00 51.43  ? 144 GLN B CA  1 
ATOM   1140 C C   . GLN B 1 67  ? 61.021  6.101   -15.266 1.00 50.58  ? 144 GLN B C   1 
ATOM   1141 O O   . GLN B 1 67  ? 61.878  6.111   -14.373 1.00 48.54  ? 144 GLN B O   1 
ATOM   1142 C CB  . GLN B 1 67  ? 60.590  8.553   -15.141 1.00 51.35  ? 144 GLN B CB  1 
ATOM   1143 C CG  . GLN B 1 67  ? 59.786  9.668   -15.738 1.00 53.08  ? 144 GLN B CG  1 
ATOM   1144 C CD  . GLN B 1 67  ? 60.294  10.973  -15.243 1.00 72.26  ? 144 GLN B CD  1 
ATOM   1145 O OE1 . GLN B 1 67  ? 60.057  11.373  -14.084 1.00 66.86  ? 144 GLN B OE1 1 
ATOM   1146 N NE2 . GLN B 1 67  ? 61.019  11.651  -16.107 1.00 70.52  ? 144 GLN B NE2 1 
ATOM   1147 N N   . ASP B 1 68  ? 60.910  5.132   -16.174 1.00 47.10  ? 145 ASP B N   1 
ATOM   1148 C CA  . ASP B 1 68  ? 61.829  4.001   -16.285 1.00 45.66  ? 145 ASP B CA  1 
ATOM   1149 C C   . ASP B 1 68  ? 63.206  4.532   -16.608 1.00 46.73  ? 145 ASP B C   1 
ATOM   1150 O O   . ASP B 1 68  ? 63.353  5.436   -17.440 1.00 46.51  ? 145 ASP B O   1 
ATOM   1151 C CB  . ASP B 1 68  ? 61.396  3.016   -17.387 1.00 47.55  ? 145 ASP B CB  1 
ATOM   1152 C CG  . ASP B 1 68  ? 60.023  2.421   -17.241 1.00 61.64  ? 145 ASP B CG  1 
ATOM   1153 O OD1 . ASP B 1 68  ? 59.122  3.133   -16.785 1.00 67.28  ? 145 ASP B OD1 1 
ATOM   1154 O OD2 . ASP B 1 68  ? 59.804  1.318   -17.754 1.00 67.32  ? 145 ASP B OD2 1 
ATOM   1155 N N   . CYS B 1 69  ? 64.210  4.000   -15.933 1.00 40.53  ? 146 CYS B N   1 
ATOM   1156 C CA  . CYS B 1 69  ? 65.575  4.417   -16.194 1.00 38.36  ? 146 CYS B CA  1 
ATOM   1157 C C   . CYS B 1 69  ? 66.553  3.290   -15.913 1.00 39.33  ? 146 CYS B C   1 
ATOM   1158 O O   . CYS B 1 69  ? 66.259  2.346   -15.177 1.00 37.49  ? 146 CYS B O   1 
ATOM   1159 C CB  . CYS B 1 69  ? 65.929  5.694   -15.441 1.00 38.30  ? 146 CYS B CB  1 
ATOM   1160 S SG  . CYS B 1 69  ? 65.240  5.770   -13.768 1.00 43.70  ? 146 CYS B SG  1 
ATOM   1161 N N   . LEU B 1 70  ? 67.692  3.357   -16.580 1.00 35.18  ? 147 LEU B N   1 
ATOM   1162 C CA  . LEU B 1 70  ? 68.756  2.407   -16.397 1.00 34.97  ? 147 LEU B CA  1 
ATOM   1163 C C   . LEU B 1 70  ? 70.047  3.185   -16.411 1.00 36.19  ? 147 LEU B C   1 
ATOM   1164 O O   . LEU B 1 70  ? 70.236  4.039   -17.281 1.00 36.40  ? 147 LEU B O   1 
ATOM   1165 C CB  . LEU B 1 70  ? 68.751  1.370   -17.510 1.00 36.24  ? 147 LEU B CB  1 
ATOM   1166 C CG  . LEU B 1 70  ? 69.769  0.233   -17.367 1.00 42.98  ? 147 LEU B CG  1 
ATOM   1167 C CD1 . LEU B 1 70  ? 69.138  -1.090  -17.664 1.00 45.34  ? 147 LEU B CD1 1 
ATOM   1168 C CD2 . LEU B 1 70  ? 70.975  0.454   -18.255 1.00 43.76  ? 147 LEU B CD2 1 
ATOM   1169 N N   . GLN B 1 71  ? 70.925  2.897   -15.444 1.00 29.96  ? 148 GLN B N   1 
ATOM   1170 C CA  . GLN B 1 71  ? 72.242  3.486   -15.400 1.00 29.14  ? 148 GLN B CA  1 
ATOM   1171 C C   . GLN B 1 71  ? 73.308  2.389   -15.308 1.00 34.47  ? 148 GLN B C   1 
ATOM   1172 O O   . GLN B 1 71  ? 73.132  1.386   -14.596 1.00 36.55  ? 148 GLN B O   1 
ATOM   1173 C CB  . GLN B 1 71  ? 72.353  4.470   -14.252 1.00 29.65  ? 148 GLN B CB  1 
ATOM   1174 C CG  . GLN B 1 71  ? 73.671  5.227   -14.224 1.00 20.64  ? 148 GLN B CG  1 
ATOM   1175 C CD  . GLN B 1 71  ? 73.606  6.259   -13.142 1.00 37.29  ? 148 GLN B CD  1 
ATOM   1176 O OE1 . GLN B 1 71  ? 73.206  7.405   -13.395 1.00 35.87  ? 148 GLN B OE1 1 
ATOM   1177 N NE2 . GLN B 1 71  ? 73.951  5.868   -11.899 1.00 22.13  ? 148 GLN B NE2 1 
ATOM   1178 N N   . LEU B 1 72  ? 74.403  2.592   -16.041 1.00 27.96  ? 149 LEU B N   1 
ATOM   1179 C CA  . LEU B 1 72  ? 75.576  1.722   -16.062 1.00 27.16  ? 149 LEU B CA  1 
ATOM   1180 C C   . LEU B 1 72  ? 76.785  2.528   -15.552 1.00 32.81  ? 149 LEU B C   1 
ATOM   1181 O O   . LEU B 1 72  ? 76.914  3.720   -15.831 1.00 30.22  ? 149 LEU B O   1 
ATOM   1182 C CB  . LEU B 1 72  ? 75.874  1.214   -17.489 1.00 26.39  ? 149 LEU B CB  1 
ATOM   1183 C CG  . LEU B 1 72  ? 74.779  0.441   -18.214 1.00 28.80  ? 149 LEU B CG  1 
ATOM   1184 C CD1 . LEU B 1 72  ? 75.121  0.298   -19.623 1.00 27.72  ? 149 LEU B CD1 1 
ATOM   1185 C CD2 . LEU B 1 72  ? 74.553  -0.912  -17.601 1.00 31.54  ? 149 LEU B CD2 1 
ATOM   1186 N N   . ILE B 1 73  ? 77.658  1.867   -14.794 1.00 32.74  ? 150 ILE B N   1 
ATOM   1187 C CA  . ILE B 1 73  ? 78.880  2.456   -14.260 1.00 33.42  ? 150 ILE B CA  1 
ATOM   1188 C C   . ILE B 1 73  ? 80.040  1.553   -14.653 1.00 37.69  ? 150 ILE B C   1 
ATOM   1189 O O   . ILE B 1 73  ? 79.868  0.329   -14.741 1.00 36.92  ? 150 ILE B O   1 
ATOM   1190 C CB  . ILE B 1 73  ? 78.818  2.736   -12.727 1.00 37.51  ? 150 ILE B CB  1 
ATOM   1191 C CG1 . ILE B 1 73  ? 78.564  1.454   -11.915 1.00 38.69  ? 150 ILE B CG1 1 
ATOM   1192 C CG2 . ILE B 1 73  ? 77.805  3.848   -12.391 1.00 38.61  ? 150 ILE B CG2 1 
ATOM   1193 C CD1 . ILE B 1 73  ? 78.875  1.563   -10.426 1.00 42.55  ? 150 ILE B CD1 1 
ATOM   1194 N N   . ALA B 1 74  ? 81.208  2.158   -14.922 1.00 34.87  ? 151 ALA B N   1 
ATOM   1195 C CA  . ALA B 1 74  ? 82.406  1.440   -15.344 1.00 35.96  ? 151 ALA B CA  1 
ATOM   1196 C C   . ALA B 1 74  ? 82.814  0.340   -14.381 1.00 41.59  ? 151 ALA B C   1 
ATOM   1197 O O   . ALA B 1 74  ? 82.773  0.531   -13.159 1.00 40.84  ? 151 ALA B O   1 
ATOM   1198 C CB  . ALA B 1 74  ? 83.545  2.407   -15.538 1.00 36.95  ? 151 ALA B CB  1 
ATOM   1199 N N   . ASP B 1 75  ? 83.164  -0.831  -14.931 1.00 40.18  ? 152 ASP B N   1 
ATOM   1200 C CA  . ASP B 1 75  ? 83.588  -1.948  -14.099 1.00 42.11  ? 152 ASP B CA  1 
ATOM   1201 C C   . ASP B 1 75  ? 85.110  -1.887  -13.952 1.00 46.98  ? 152 ASP B C   1 
ATOM   1202 O O   . ASP B 1 75  ? 85.826  -2.343  -14.854 1.00 48.36  ? 152 ASP B O   1 
ATOM   1203 C CB  . ASP B 1 75  ? 83.092  -3.292  -14.675 1.00 44.92  ? 152 ASP B CB  1 
ATOM   1204 C CG  . ASP B 1 75  ? 83.594  -4.538  -13.964 1.00 54.48  ? 152 ASP B CG  1 
ATOM   1205 O OD1 . ASP B 1 75  ? 84.120  -4.409  -12.832 1.00 58.07  ? 152 ASP B OD1 1 
ATOM   1206 O OD2 . ASP B 1 75  ? 83.453  -5.641  -14.533 1.00 53.91  ? 152 ASP B OD2 1 
ATOM   1207 N N   . SER B 1 76  ? 85.599  -1.306  -12.815 1.00 40.90  ? 153 SER B N   1 
ATOM   1208 C CA  . SER B 1 76  ? 87.026  -1.168  -12.502 1.00 41.20  ? 153 SER B CA  1 
ATOM   1209 C C   . SER B 1 76  ? 87.798  -2.505  -12.423 1.00 47.80  ? 153 SER B C   1 
ATOM   1210 O O   . SER B 1 76  ? 89.027  -2.490  -12.457 1.00 48.99  ? 153 SER B O   1 
ATOM   1211 C CB  . SER B 1 76  ? 87.211  -0.401  -11.206 1.00 45.85  ? 153 SER B CB  1 
ATOM   1212 O OG  . SER B 1 76  ? 86.802  -1.163  -10.079 1.00 61.22  ? 153 SER B OG  1 
ATOM   1213 N N   . GLU B 1 77  ? 87.097  -3.651  -12.325 1.00 44.51  ? 154 GLU B N   1 
ATOM   1214 C CA  . GLU B 1 77  ? 87.754  -4.943  -12.256 1.00 46.07  ? 154 GLU B CA  1 
ATOM   1215 C C   . GLU B 1 77  ? 87.910  -5.624  -13.634 1.00 52.83  ? 154 GLU B C   1 
ATOM   1216 O O   . GLU B 1 77  ? 88.386  -6.767  -13.686 1.00 57.89  ? 154 GLU B O   1 
ATOM   1217 C CB  . GLU B 1 77  ? 87.005  -5.874  -11.311 1.00 47.91  ? 154 GLU B CB  1 
ATOM   1218 C CG  . GLU B 1 77  ? 86.860  -5.416  -9.876  1.00 59.12  ? 154 GLU B CG  1 
ATOM   1219 C CD  . GLU B 1 77  ? 85.833  -6.318  -9.224  1.00 87.26  ? 154 GLU B CD  1 
ATOM   1220 O OE1 . GLU B 1 77  ? 86.218  -7.423  -8.776  1.00 67.13  ? 154 GLU B OE1 1 
ATOM   1221 O OE2 . GLU B 1 77  ? 84.627  -5.984  -9.289  1.00 90.85  ? 154 GLU B OE2 1 
ATOM   1222 N N   . THR B 1 78  ? 87.521  -4.952  -14.745 1.00 44.40  ? 155 THR B N   1 
ATOM   1223 C CA  . THR B 1 78  ? 87.614  -5.542  -16.085 1.00 42.97  ? 155 THR B CA  1 
ATOM   1224 C C   . THR B 1 78  ? 88.421  -4.662  -17.032 1.00 44.82  ? 155 THR B C   1 
ATOM   1225 O O   . THR B 1 78  ? 88.229  -3.452  -17.037 1.00 43.70  ? 155 THR B O   1 
ATOM   1226 C CB  . THR B 1 78  ? 86.212  -5.864  -16.614 1.00 44.88  ? 155 THR B CB  1 
ATOM   1227 O OG1 . THR B 1 78  ? 85.621  -6.817  -15.738 1.00 49.47  ? 155 THR B OG1 1 
ATOM   1228 C CG2 . THR B 1 78  ? 86.207  -6.425  -18.037 1.00 41.52  ? 155 THR B CG2 1 
ATOM   1229 N N   . PRO B 1 79  ? 89.324  -5.233  -17.864 1.00 39.66  ? 156 PRO B N   1 
ATOM   1230 C CA  . PRO B 1 79  ? 90.058  -4.386  -18.817 1.00 39.17  ? 156 PRO B CA  1 
ATOM   1231 C C   . PRO B 1 79  ? 89.153  -3.853  -19.933 1.00 44.05  ? 156 PRO B C   1 
ATOM   1232 O O   . PRO B 1 79  ? 88.228  -4.556  -20.354 1.00 46.63  ? 156 PRO B O   1 
ATOM   1233 C CB  . PRO B 1 79  ? 91.130  -5.333  -19.366 1.00 41.32  ? 156 PRO B CB  1 
ATOM   1234 C CG  . PRO B 1 79  ? 90.623  -6.630  -19.147 1.00 44.74  ? 156 PRO B CG  1 
ATOM   1235 C CD  . PRO B 1 79  ? 89.718  -6.646  -17.993 1.00 39.55  ? 156 PRO B CD  1 
ATOM   1236 N N   . THR B 1 80  ? 89.435  -2.631  -20.432 1.00 38.35  ? 157 THR B N   1 
ATOM   1237 C CA  . THR B 1 80  ? 88.697  -2.018  -21.547 1.00 36.98  ? 157 THR B CA  1 
ATOM   1238 C C   . THR B 1 80  ? 88.659  -2.930  -22.743 1.00 44.48  ? 157 THR B C   1 
ATOM   1239 O O   . THR B 1 80  ? 89.616  -3.665  -22.973 1.00 48.13  ? 157 THR B O   1 
ATOM   1240 C CB  . THR B 1 80  ? 89.302  -0.676  -21.961 1.00 41.70  ? 157 THR B CB  1 
ATOM   1241 O OG1 . THR B 1 80  ? 90.700  -0.824  -22.234 1.00 43.21  ? 157 THR B OG1 1 
ATOM   1242 C CG2 . THR B 1 80  ? 89.060  0.410   -20.942 1.00 39.78  ? 157 THR B CG2 1 
ATOM   1243 N N   . ILE B 1 81  ? 87.553  -2.912  -23.478 1.00 41.48  ? 158 ILE B N   1 
ATOM   1244 C CA  . ILE B 1 81  ? 87.340  -3.735  -24.659 1.00 43.41  ? 158 ILE B CA  1 
ATOM   1245 C C   . ILE B 1 81  ? 87.923  -3.023  -25.864 1.00 49.31  ? 158 ILE B C   1 
ATOM   1246 O O   . ILE B 1 81  ? 87.476  -1.922  -26.217 1.00 49.37  ? 158 ILE B O   1 
ATOM   1247 C CB  . ILE B 1 81  ? 85.839  -4.069  -24.829 1.00 45.98  ? 158 ILE B CB  1 
ATOM   1248 C CG1 . ILE B 1 81  ? 85.297  -4.814  -23.590 1.00 45.16  ? 158 ILE B CG1 1 
ATOM   1249 C CG2 . ILE B 1 81  ? 85.601  -4.861  -26.118 1.00 48.71  ? 158 ILE B CG2 1 
ATOM   1250 C CD1 . ILE B 1 81  ? 84.150  -4.144  -22.961 1.00 45.16  ? 158 ILE B CD1 1 
ATOM   1251 N N   . GLN B 1 82  ? 88.951  -3.634  -26.469 1.00 46.71  ? 159 GLN B N   1 
ATOM   1252 C CA  . GLN B 1 82  ? 89.628  -3.050  -27.616 1.00 46.80  ? 159 GLN B CA  1 
ATOM   1253 C C   . GLN B 1 82  ? 89.197  -3.746  -28.907 1.00 54.94  ? 159 GLN B C   1 
ATOM   1254 O O   . GLN B 1 82  ? 89.667  -4.847  -29.198 1.00 56.53  ? 159 GLN B O   1 
ATOM   1255 C CB  . GLN B 1 82  ? 91.142  -3.003  -27.389 1.00 48.34  ? 159 GLN B CB  1 
ATOM   1256 C CG  . GLN B 1 82  ? 91.555  -1.976  -26.325 1.00 52.37  ? 159 GLN B CG  1 
ATOM   1257 C CD  . GLN B 1 82  ? 92.771  -2.418  -25.529 1.00 80.57  ? 159 GLN B CD  1 
ATOM   1258 O OE1 . GLN B 1 82  ? 92.670  -2.838  -24.350 1.00 77.87  ? 159 GLN B OE1 1 
ATOM   1259 N NE2 . GLN B 1 82  ? 93.952  -2.343  -26.156 1.00 65.34  ? 159 GLN B NE2 1 
ATOM   1260 N N   . LYS B 1 83  ? 88.218  -3.130  -29.630 1.00 52.04  ? 160 LYS B N   1 
ATOM   1261 C CA  . LYS B 1 83  ? 87.643  -3.647  -30.877 1.00 52.17  ? 160 LYS B CA  1 
ATOM   1262 C C   . LYS B 1 83  ? 88.010  -2.724  -32.053 1.00 56.14  ? 160 LYS B C   1 
ATOM   1263 O O   . LYS B 1 83  ? 87.247  -1.807  -32.423 1.00 54.28  ? 160 LYS B O   1 
ATOM   1264 C CB  . LYS B 1 83  ? 86.108  -3.877  -30.754 1.00 52.60  ? 160 LYS B CB  1 
ATOM   1265 N N   . GLY B 1 84  ? 89.194  -2.984  -32.604 1.00 54.78  ? 161 GLY B N   1 
ATOM   1266 C CA  . GLY B 1 84  ? 89.733  -2.292  -33.768 1.00 57.05  ? 161 GLY B CA  1 
ATOM   1267 C C   . GLY B 1 84  ? 90.185  -0.879  -33.486 1.00 63.01  ? 161 GLY B C   1 
ATOM   1268 O O   . GLY B 1 84  ? 90.994  -0.656  -32.582 1.00 63.54  ? 161 GLY B O   1 
ATOM   1269 N N   . SER B 1 85  ? 89.670  0.083   -34.260 1.00 59.29  ? 162 SER B N   1 
ATOM   1270 C CA  . SER B 1 85  ? 89.966  1.508   -34.082 1.00 58.48  ? 162 SER B CA  1 
ATOM   1271 C C   . SER B 1 85  ? 89.203  2.143   -32.867 1.00 57.91  ? 162 SER B C   1 
ATOM   1272 O O   . SER B 1 85  ? 89.407  3.323   -32.548 1.00 57.85  ? 162 SER B O   1 
ATOM   1273 C CB  . SER B 1 85  ? 89.662  2.269   -35.368 1.00 63.95  ? 162 SER B CB  1 
ATOM   1274 O OG  . SER B 1 85  ? 88.411  1.878   -35.908 1.00 77.21  ? 162 SER B OG  1 
ATOM   1275 N N   . TYR B 1 86  ? 88.358  1.344   -32.181 1.00 50.11  ? 163 TYR B N   1 
ATOM   1276 C CA  . TYR B 1 86  ? 87.550  1.788   -31.045 1.00 46.94  ? 163 TYR B CA  1 
ATOM   1277 C C   . TYR B 1 86  ? 87.909  1.131   -29.731 1.00 49.40  ? 163 TYR B C   1 
ATOM   1278 O O   . TYR B 1 86  ? 88.486  0.030   -29.710 1.00 52.25  ? 163 TYR B O   1 
ATOM   1279 C CB  . TYR B 1 86  ? 86.041  1.567   -31.322 1.00 46.48  ? 163 TYR B CB  1 
ATOM   1280 C CG  . TYR B 1 86  ? 85.497  2.406   -32.460 1.00 47.09  ? 163 TYR B CG  1 
ATOM   1281 C CD1 . TYR B 1 86  ? 85.702  2.032   -33.791 1.00 50.21  ? 163 TYR B CD1 1 
ATOM   1282 C CD2 . TYR B 1 86  ? 84.802  3.586   -32.211 1.00 46.30  ? 163 TYR B CD2 1 
ATOM   1283 C CE1 . TYR B 1 86  ? 85.253  2.825   -34.846 1.00 49.76  ? 163 TYR B CE1 1 
ATOM   1284 C CE2 . TYR B 1 86  ? 84.334  4.382   -33.258 1.00 48.23  ? 163 TYR B CE2 1 
ATOM   1285 C CZ  . TYR B 1 86  ? 84.555  3.992   -34.576 1.00 60.31  ? 163 TYR B CZ  1 
ATOM   1286 O OH  . TYR B 1 86  ? 84.085  4.771   -35.610 1.00 65.88  ? 163 TYR B OH  1 
ATOM   1287 N N   . THR B 1 87  ? 87.544  1.811   -28.631 1.00 41.03  ? 164 THR B N   1 
ATOM   1288 C CA  . THR B 1 87  ? 87.684  1.322   -27.262 1.00 39.98  ? 164 THR B CA  1 
ATOM   1289 C C   . THR B 1 87  ? 86.293  1.373   -26.588 1.00 39.77  ? 164 THR B C   1 
ATOM   1290 O O   . THR B 1 87  ? 85.567  2.372   -26.706 1.00 37.88  ? 164 THR B O   1 
ATOM   1291 C CB  . THR B 1 87  ? 88.766  2.090   -26.494 1.00 48.34  ? 164 THR B CB  1 
ATOM   1292 O OG1 . THR B 1 87  ? 90.037  1.917   -27.146 1.00 47.72  ? 164 THR B OG1 1 
ATOM   1293 C CG2 . THR B 1 87  ? 88.856  1.667   -25.016 1.00 44.62  ? 164 THR B CG2 1 
ATOM   1294 N N   . PHE B 1 88  ? 85.940  0.294   -25.900 1.00 33.71  ? 165 PHE B N   1 
ATOM   1295 C CA  . PHE B 1 88  ? 84.670  0.173   -25.219 1.00 31.71  ? 165 PHE B CA  1 
ATOM   1296 C C   . PHE B 1 88  ? 84.849  -0.001  -23.716 1.00 35.91  ? 165 PHE B C   1 
ATOM   1297 O O   . PHE B 1 88  ? 85.769  -0.681  -23.255 1.00 36.28  ? 165 PHE B O   1 
ATOM   1298 C CB  . PHE B 1 88  ? 83.854  -0.961  -25.833 1.00 33.61  ? 165 PHE B CB  1 
ATOM   1299 C CG  . PHE B 1 88  ? 83.415  -0.646  -27.247 1.00 34.53  ? 165 PHE B CG  1 
ATOM   1300 C CD1 . PHE B 1 88  ? 82.230  0.052   -27.485 1.00 36.68  ? 165 PHE B CD1 1 
ATOM   1301 C CD2 . PHE B 1 88  ? 84.194  -1.041  -28.345 1.00 36.27  ? 165 PHE B CD2 1 
ATOM   1302 C CE1 . PHE B 1 88  ? 81.828  0.351   -28.795 1.00 38.19  ? 165 PHE B CE1 1 
ATOM   1303 C CE2 . PHE B 1 88  ? 83.800  -0.739  -29.647 1.00 37.77  ? 165 PHE B CE2 1 
ATOM   1304 C CZ  . PHE B 1 88  ? 82.618  -0.047  -29.867 1.00 35.12  ? 165 PHE B CZ  1 
ATOM   1305 N N   . VAL B 1 89  ? 83.989  0.651   -22.952 1.00 32.70  ? 166 VAL B N   1 
ATOM   1306 C CA  . VAL B 1 89  ? 84.063  0.586   -21.500 1.00 33.57  ? 166 VAL B CA  1 
ATOM   1307 C C   . VAL B 1 89  ? 83.326  -0.673  -21.019 1.00 40.21  ? 166 VAL B C   1 
ATOM   1308 O O   . VAL B 1 89  ? 82.171  -0.878  -21.419 1.00 40.00  ? 166 VAL B O   1 
ATOM   1309 C CB  . VAL B 1 89  ? 83.422  1.848   -20.882 1.00 36.80  ? 166 VAL B CB  1 
ATOM   1310 C CG1 . VAL B 1 89  ? 83.391  1.774   -19.360 1.00 36.05  ? 166 VAL B CG1 1 
ATOM   1311 C CG2 . VAL B 1 89  ? 84.126  3.113   -21.365 1.00 36.73  ? 166 VAL B CG2 1 
ATOM   1312 N N   . PRO B 1 90  ? 83.951  -1.529  -20.166 1.00 36.20  ? 167 PRO B N   1 
ATOM   1313 C CA  . PRO B 1 90  ? 83.192  -2.659  -19.613 1.00 34.73  ? 167 PRO B CA  1 
ATOM   1314 C C   . PRO B 1 90  ? 82.211  -2.113  -18.571 1.00 37.91  ? 167 PRO B C   1 
ATOM   1315 O O   . PRO B 1 90  ? 82.628  -1.429  -17.627 1.00 37.88  ? 167 PRO B O   1 
ATOM   1316 C CB  . PRO B 1 90  ? 84.278  -3.553  -19.000 1.00 37.21  ? 167 PRO B CB  1 
ATOM   1317 C CG  . PRO B 1 90  ? 85.491  -2.725  -18.850 1.00 40.92  ? 167 PRO B CG  1 
ATOM   1318 C CD  . PRO B 1 90  ? 85.315  -1.436  -19.584 1.00 36.85  ? 167 PRO B CD  1 
ATOM   1319 N N   . TRP B 1 91  ? 80.908  -2.322  -18.788 1.00 35.92  ? 168 TRP B N   1 
ATOM   1320 C CA  . TRP B 1 91  ? 79.883  -1.788  -17.882 1.00 36.96  ? 168 TRP B CA  1 
ATOM   1321 C C   . TRP B 1 91  ? 79.451  -2.763  -16.812 1.00 43.04  ? 168 TRP B C   1 
ATOM   1322 O O   . TRP B 1 91  ? 79.566  -3.978  -16.974 1.00 44.09  ? 168 TRP B O   1 
ATOM   1323 C CB  . TRP B 1 91  ? 78.637  -1.284  -18.641 1.00 35.60  ? 168 TRP B CB  1 
ATOM   1324 C CG  . TRP B 1 91  ? 78.904  -0.187  -19.615 1.00 36.00  ? 168 TRP B CG  1 
ATOM   1325 C CD1 . TRP B 1 91  ? 78.823  -0.263  -20.972 1.00 38.90  ? 168 TRP B CD1 1 
ATOM   1326 C CD2 . TRP B 1 91  ? 79.374  1.133   -19.310 1.00 35.47  ? 168 TRP B CD2 1 
ATOM   1327 N NE1 . TRP B 1 91  ? 79.221  0.926   -21.535 1.00 37.92  ? 168 TRP B NE1 1 
ATOM   1328 C CE2 . TRP B 1 91  ? 79.562  1.804   -20.535 1.00 38.38  ? 168 TRP B CE2 1 
ATOM   1329 C CE3 . TRP B 1 91  ? 79.661  1.814   -18.116 1.00 36.98  ? 168 TRP B CE3 1 
ATOM   1330 C CZ2 . TRP B 1 91  ? 79.990  3.133   -20.603 1.00 36.69  ? 168 TRP B CZ2 1 
ATOM   1331 C CZ3 . TRP B 1 91  ? 80.085  3.132   -18.188 1.00 38.18  ? 168 TRP B CZ3 1 
ATOM   1332 C CH2 . TRP B 1 91  ? 80.237  3.778   -19.423 1.00 38.27  ? 168 TRP B CH2 1 
ATOM   1333 N N   . LEU B 1 92  ? 78.924  -2.203  -15.735 1.00 38.53  ? 169 LEU B N   1 
ATOM   1334 C CA  . LEU B 1 92  ? 78.354  -2.888  -14.601 1.00 38.61  ? 169 LEU B CA  1 
ATOM   1335 C C   . LEU B 1 92  ? 77.011  -2.179  -14.372 1.00 40.05  ? 169 LEU B C   1 
ATOM   1336 O O   . LEU B 1 92  ? 76.932  -0.944  -14.497 1.00 39.72  ? 169 LEU B O   1 
ATOM   1337 C CB  . LEU B 1 92  ? 79.256  -2.624  -13.414 1.00 39.40  ? 169 LEU B CB  1 
ATOM   1338 C CG  . LEU B 1 92  ? 79.638  -3.760  -12.542 1.00 46.02  ? 169 LEU B CG  1 
ATOM   1339 C CD1 . LEU B 1 92  ? 80.786  -3.331  -11.699 1.00 48.62  ? 169 LEU B CD1 1 
ATOM   1340 C CD2 . LEU B 1 92  ? 78.509  -4.133  -11.626 1.00 45.49  ? 169 LEU B CD2 1 
ATOM   1341 N N   . LEU B 1 93  ? 75.947  -2.936  -14.073 1.00 33.96  ? 170 LEU B N   1 
ATOM   1342 C CA  . LEU B 1 93  ? 74.658  -2.288  -13.855 1.00 30.97  ? 170 LEU B CA  1 
ATOM   1343 C C   . LEU B 1 93  ? 74.686  -1.524  -12.540 1.00 35.61  ? 170 LEU B C   1 
ATOM   1344 O O   . LEU B 1 93  ? 74.972  -2.110  -11.467 1.00 36.75  ? 170 LEU B O   1 
ATOM   1345 C CB  . LEU B 1 93  ? 73.486  -3.283  -13.865 1.00 30.05  ? 170 LEU B CB  1 
ATOM   1346 C CG  . LEU B 1 93  ? 72.139  -2.677  -13.485 1.00 32.24  ? 170 LEU B CG  1 
ATOM   1347 C CD1 . LEU B 1 93  ? 71.437  -2.013  -14.682 1.00 31.83  ? 170 LEU B CD1 1 
ATOM   1348 C CD2 . LEU B 1 93  ? 71.301  -3.637  -12.707 1.00 31.93  ? 170 LEU B CD2 1 
ATOM   1349 N N   . SER B 1 94  ? 74.407  -0.214  -12.647 1.00 28.96  ? 171 SER B N   1 
ATOM   1350 C CA  . SER B 1 94  ? 74.312  0.626   -11.475 1.00 27.92  ? 171 SER B CA  1 
ATOM   1351 C C   . SER B 1 94  ? 72.934  0.360   -10.853 1.00 30.80  ? 171 SER B C   1 
ATOM   1352 O O   . SER B 1 94  ? 72.865  -0.046  -9.700  1.00 27.30  ? 171 SER B O   1 
ATOM   1353 C CB  . SER B 1 94  ? 74.527  2.092   -11.829 1.00 29.09  ? 171 SER B CB  1 
ATOM   1354 O OG  . SER B 1 94  ? 74.343  2.886   -10.673 1.00 40.18  ? 171 SER B OG  1 
ATOM   1355 N N   . PHE B 1 95  ? 71.864  0.474   -11.664 1.00 29.26  ? 172 PHE B N   1 
ATOM   1356 C CA  . PHE B 1 95  ? 70.482  0.210   -11.279 1.00 31.28  ? 172 PHE B CA  1 
ATOM   1357 C C   . PHE B 1 95  ? 69.606  0.185   -12.517 1.00 38.76  ? 172 PHE B C   1 
ATOM   1358 O O   . PHE B 1 95  ? 69.970  0.734   -13.554 1.00 40.45  ? 172 PHE B O   1 
ATOM   1359 C CB  . PHE B 1 95  ? 69.961  1.254   -10.280 1.00 34.09  ? 172 PHE B CB  1 
ATOM   1360 C CG  . PHE B 1 95  ? 69.514  2.550   -10.918 1.00 35.90  ? 172 PHE B CG  1 
ATOM   1361 C CD1 . PHE B 1 95  ? 68.199  2.711   -11.358 1.00 39.34  ? 172 PHE B CD1 1 
ATOM   1362 C CD2 . PHE B 1 95  ? 70.417  3.585   -11.130 1.00 36.38  ? 172 PHE B CD2 1 
ATOM   1363 C CE1 . PHE B 1 95  ? 67.793  3.884   -11.980 1.00 38.72  ? 172 PHE B CE1 1 
ATOM   1364 C CE2 . PHE B 1 95  ? 70.002  4.763   -11.731 1.00 38.74  ? 172 PHE B CE2 1 
ATOM   1365 C CZ  . PHE B 1 95  ? 68.700  4.885   -12.183 1.00 37.32  ? 172 PHE B CZ  1 
ATOM   1366 N N   . LYS B 1 96  ? 68.442  -0.424  -12.397 1.00 36.49  ? 173 LYS B N   1 
ATOM   1367 C CA  . LYS B 1 96  ? 67.435  -0.582  -13.452 1.00 36.39  ? 173 LYS B CA  1 
ATOM   1368 C C   . LYS B 1 96  ? 66.095  -0.370  -12.752 1.00 41.43  ? 173 LYS B C   1 
ATOM   1369 O O   . LYS B 1 96  ? 65.870  -0.871  -11.647 1.00 42.41  ? 173 LYS B O   1 
ATOM   1370 C CB  . LYS B 1 96  ? 67.538  -1.985  -14.103 1.00 38.31  ? 173 LYS B CB  1 
ATOM   1371 C CG  . LYS B 1 96  ? 66.407  -2.335  -15.049 1.00 51.42  ? 173 LYS B CG  1 
ATOM   1372 C CD  . LYS B 1 96  ? 66.441  -3.813  -15.487 1.00 55.41  ? 173 LYS B CD  1 
ATOM   1373 N N   . ARG B 1 97  ? 65.246  0.445   -13.345 1.00 37.06  ? 174 ARG B N   1 
ATOM   1374 C CA  . ARG B 1 97  ? 63.955  0.816   -12.776 1.00 36.11  ? 174 ARG B CA  1 
ATOM   1375 C C   . ARG B 1 97  ? 62.949  0.749   -13.914 1.00 43.07  ? 174 ARG B C   1 
ATOM   1376 O O   . ARG B 1 97  ? 63.149  1.382   -14.961 1.00 44.68  ? 174 ARG B O   1 
ATOM   1377 C CB  . ARG B 1 97  ? 64.088  2.232   -12.234 1.00 31.31  ? 174 ARG B CB  1 
ATOM   1378 C CG  . ARG B 1 97  ? 62.938  2.679   -11.441 1.00 40.48  ? 174 ARG B CG  1 
ATOM   1379 C CD  . ARG B 1 97  ? 63.021  4.164   -11.151 1.00 40.91  ? 174 ARG B CD  1 
ATOM   1380 N NE  . ARG B 1 97  ? 61.853  4.544   -10.360 1.00 48.29  ? 174 ARG B NE  1 
ATOM   1381 C CZ  . ARG B 1 97  ? 61.038  5.542   -10.652 1.00 69.64  ? 174 ARG B CZ  1 
ATOM   1382 N NH1 . ARG B 1 97  ? 61.313  6.358   -11.662 1.00 56.94  ? 174 ARG B NH1 1 
ATOM   1383 N NH2 . ARG B 1 97  ? 59.970  5.773   -9.900  1.00 65.07  ? 174 ARG B NH2 1 
ATOM   1384 N N   . GLY B 1 98  ? 61.936  -0.081  -13.754 1.00 39.42  ? 175 GLY B N   1 
ATOM   1385 C CA  . GLY B 1 98  ? 60.918  -0.266  -14.784 1.00 39.92  ? 175 GLY B CA  1 
ATOM   1386 C C   . GLY B 1 98  ? 61.257  -1.291  -15.854 1.00 46.20  ? 175 GLY B C   1 
ATOM   1387 O O   . GLY B 1 98  ? 62.249  -2.028  -15.744 1.00 47.49  ? 175 GLY B O   1 
ATOM   1388 N N   . SER B 1 99  ? 60.438  -1.297  -16.926 1.00 42.85  ? 176 SER B N   1 
ATOM   1389 C CA  . SER B 1 99  ? 60.493  -2.211  -18.068 1.00 42.90  ? 176 SER B CA  1 
ATOM   1390 C C   . SER B 1 99  ? 61.137  -1.707  -19.375 1.00 49.24  ? 176 SER B C   1 
ATOM   1391 O O   . SER B 1 99  ? 61.680  -2.535  -20.119 1.00 51.43  ? 176 SER B O   1 
ATOM   1392 C CB  . SER B 1 99  ? 59.095  -2.724  -18.375 1.00 46.58  ? 176 SER B CB  1 
ATOM   1393 O OG  . SER B 1 99  ? 58.156  -1.664  -18.445 1.00 54.20  ? 176 SER B OG  1 
ATOM   1394 N N   . ALA B 1 100 ? 61.044  -0.395  -19.688 1.00 44.38  ? 177 ALA B N   1 
ATOM   1395 C CA  . ALA B 1 100 ? 61.546  0.201   -20.941 1.00 42.74  ? 177 ALA B CA  1 
ATOM   1396 C C   . ALA B 1 100 ? 63.018  -0.014  -21.251 1.00 45.01  ? 177 ALA B C   1 
ATOM   1397 O O   . ALA B 1 100 ? 63.378  -0.102  -22.413 1.00 44.15  ? 177 ALA B O   1 
ATOM   1398 C CB  . ALA B 1 100 ? 61.206  1.683   -21.017 1.00 42.76  ? 177 ALA B CB  1 
ATOM   1399 N N   . LEU B 1 101 ? 63.875  -0.119  -20.235 1.00 41.63  ? 178 LEU B N   1 
ATOM   1400 C CA  . LEU B 1 101 ? 65.302  -0.306  -20.488 1.00 39.59  ? 178 LEU B CA  1 
ATOM   1401 C C   . LEU B 1 101 ? 65.888  -1.518  -19.791 1.00 45.42  ? 178 LEU B C   1 
ATOM   1402 O O   . LEU B 1 101 ? 65.494  -1.855  -18.669 1.00 44.41  ? 178 LEU B O   1 
ATOM   1403 C CB  . LEU B 1 101 ? 66.094  0.968   -20.153 1.00 37.55  ? 178 LEU B CB  1 
ATOM   1404 C CG  . LEU B 1 101 ? 65.682  2.253   -20.897 1.00 40.81  ? 178 LEU B CG  1 
ATOM   1405 C CD1 . LEU B 1 101 ? 66.047  3.474   -20.117 1.00 39.59  ? 178 LEU B CD1 1 
ATOM   1406 C CD2 . LEU B 1 101 ? 66.281  2.316   -22.280 1.00 42.02  ? 178 LEU B CD2 1 
ATOM   1407 N N   . GLU B 1 102 ? 66.832  -2.172  -20.484 1.00 45.12  ? 179 GLU B N   1 
ATOM   1408 C CA  . GLU B 1 102 ? 67.562  -3.375  -20.062 1.00 46.37  ? 179 GLU B CA  1 
ATOM   1409 C C   . GLU B 1 102 ? 69.033  -3.301  -20.447 1.00 52.09  ? 179 GLU B C   1 
ATOM   1410 O O   . GLU B 1 102 ? 69.386  -2.605  -21.391 1.00 51.49  ? 179 GLU B O   1 
ATOM   1411 C CB  . GLU B 1 102 ? 66.981  -4.608  -20.753 1.00 48.99  ? 179 GLU B CB  1 
ATOM   1412 C CG  . GLU B 1 102 ? 65.713  -5.141  -20.132 1.00 60.64  ? 179 GLU B CG  1 
ATOM   1413 C CD  . GLU B 1 102 ? 65.285  -6.482  -20.688 1.00 81.35  ? 179 GLU B CD  1 
ATOM   1414 O OE1 . GLU B 1 102 ? 66.124  -7.192  -21.294 1.00 57.23  ? 179 GLU B OE1 1 
ATOM   1415 O OE2 . GLU B 1 102 ? 64.102  -6.835  -20.486 1.00 83.11  ? 179 GLU B OE2 1 
ATOM   1416 N N   . GLU B 1 103 ? 69.878  -4.059  -19.738 1.00 51.10  ? 180 GLU B N   1 
ATOM   1417 C CA  . GLU B 1 103 ? 71.301  -4.208  -20.024 1.00 51.47  ? 180 GLU B CA  1 
ATOM   1418 C C   . GLU B 1 103 ? 71.384  -5.424  -20.936 1.00 55.95  ? 180 GLU B C   1 
ATOM   1419 O O   . GLU B 1 103 ? 70.841  -6.469  -20.594 1.00 56.56  ? 180 GLU B O   1 
ATOM   1420 C CB  . GLU B 1 103 ? 72.089  -4.472  -18.707 1.00 53.38  ? 180 GLU B CB  1 
ATOM   1421 C CG  . GLU B 1 103 ? 73.609  -4.338  -18.828 1.00 73.87  ? 180 GLU B CG  1 
ATOM   1422 C CD  . GLU B 1 103 ? 74.443  -5.486  -19.392 1.00 121.05 ? 180 GLU B CD  1 
ATOM   1423 O OE1 . GLU B 1 103 ? 73.948  -6.638  -19.425 1.00 133.92 ? 180 GLU B OE1 1 
ATOM   1424 O OE2 . GLU B 1 103 ? 75.619  -5.236  -19.754 1.00 118.86 ? 180 GLU B OE2 1 
ATOM   1425 N N   . LYS B 1 104 ? 72.037  -5.304  -22.086 1.00 52.99  ? 181 LYS B N   1 
ATOM   1426 C CA  . LYS B 1 104 ? 72.229  -6.450  -22.987 1.00 54.04  ? 181 LYS B CA  1 
ATOM   1427 C C   . LYS B 1 104 ? 73.602  -6.349  -23.627 1.00 59.26  ? 181 LYS B C   1 
ATOM   1428 O O   . LYS B 1 104 ? 73.872  -5.387  -24.353 1.00 59.78  ? 181 LYS B O   1 
ATOM   1429 C CB  . LYS B 1 104 ? 71.104  -6.584  -24.044 1.00 55.87  ? 181 LYS B CB  1 
ATOM   1430 N N   . GLU B 1 105 ? 74.487  -7.303  -23.307 1.00 55.35  ? 182 GLU B N   1 
ATOM   1431 C CA  . GLU B 1 105 ? 75.848  -7.417  -23.845 1.00 54.67  ? 182 GLU B CA  1 
ATOM   1432 C C   . GLU B 1 105 ? 76.596  -6.092  -23.882 1.00 53.12  ? 182 GLU B C   1 
ATOM   1433 O O   . GLU B 1 105 ? 77.095  -5.691  -24.938 1.00 51.78  ? 182 GLU B O   1 
ATOM   1434 C CB  . GLU B 1 105 ? 75.828  -8.058  -25.249 1.00 57.88  ? 182 GLU B CB  1 
ATOM   1435 C CG  . GLU B 1 105 ? 75.290  -9.481  -25.340 1.00 73.44  ? 182 GLU B CG  1 
ATOM   1436 C CD  . GLU B 1 105 ? 75.366  -10.055 -26.747 1.00 93.14  ? 182 GLU B CD  1 
ATOM   1437 O OE1 . GLU B 1 105 ? 75.044  -9.316  -27.710 1.00 71.31  ? 182 GLU B OE1 1 
ATOM   1438 O OE2 . GLU B 1 105 ? 75.790  -11.227 -26.888 1.00 85.56  ? 182 GLU B OE2 1 
ATOM   1439 N N   . ASN B 1 106 ? 76.642  -5.397  -22.736 1.00 48.15  ? 183 ASN B N   1 
ATOM   1440 C CA  . ASN B 1 106 ? 77.330  -4.099  -22.591 1.00 46.59  ? 183 ASN B CA  1 
ATOM   1441 C C   . ASN B 1 106 ? 76.692  -2.922  -23.364 1.00 47.68  ? 183 ASN B C   1 
ATOM   1442 O O   . ASN B 1 106 ? 77.362  -1.921  -23.628 1.00 48.15  ? 183 ASN B O   1 
ATOM   1443 C CB  . ASN B 1 106 ? 78.825  -4.229  -22.900 1.00 44.98  ? 183 ASN B CB  1 
ATOM   1444 C CG  . ASN B 1 106 ? 79.698  -3.844  -21.766 1.00 65.51  ? 183 ASN B CG  1 
ATOM   1445 O OD1 . ASN B 1 106 ? 79.482  -4.256  -20.619 1.00 62.94  ? 183 ASN B OD1 1 
ATOM   1446 N ND2 . ASN B 1 106 ? 80.717  -3.056  -22.080 1.00 59.95  ? 183 ASN B ND2 1 
ATOM   1447 N N   . LYS B 1 107 ? 75.408  -3.040  -23.698 1.00 41.05  ? 184 LYS B N   1 
ATOM   1448 C CA  . LYS B 1 107 ? 74.643  -2.013  -24.387 1.00 40.31  ? 184 LYS B CA  1 
ATOM   1449 C C   . LYS B 1 107 ? 73.327  -1.807  -23.609 1.00 46.61  ? 184 LYS B C   1 
ATOM   1450 O O   . LYS B 1 107 ? 72.911  -2.690  -22.838 1.00 48.31  ? 184 LYS B O   1 
ATOM   1451 C CB  . LYS B 1 107 ? 74.309  -2.443  -25.847 1.00 42.72  ? 184 LYS B CB  1 
ATOM   1452 C CG  . LYS B 1 107 ? 75.484  -2.712  -26.785 1.00 36.43  ? 184 LYS B CG  1 
ATOM   1453 C CD  . LYS B 1 107 ? 75.154  -3.779  -27.857 1.00 32.62  ? 184 LYS B CD  1 
ATOM   1454 N N   . ILE B 1 108 ? 72.673  -0.649  -23.814 1.00 41.11  ? 185 ILE B N   1 
ATOM   1455 C CA  . ILE B 1 108 ? 71.356  -0.393  -23.236 1.00 40.18  ? 185 ILE B CA  1 
ATOM   1456 C C   . ILE B 1 108 ? 70.335  -0.812  -24.329 1.00 47.14  ? 185 ILE B C   1 
ATOM   1457 O O   . ILE B 1 108 ? 70.403  -0.324  -25.459 1.00 46.52  ? 185 ILE B O   1 
ATOM   1458 C CB  . ILE B 1 108 ? 71.148  1.070   -22.756 1.00 41.05  ? 185 ILE B CB  1 
ATOM   1459 C CG1 . ILE B 1 108 ? 72.197  1.459   -21.707 1.00 40.28  ? 185 ILE B CG1 1 
ATOM   1460 C CG2 . ILE B 1 108 ? 69.736  1.228   -22.217 1.00 41.23  ? 185 ILE B CG2 1 
ATOM   1461 C CD1 . ILE B 1 108 ? 72.229  2.918   -21.263 1.00 39.62  ? 185 ILE B CD1 1 
ATOM   1462 N N   . LEU B 1 109 ? 69.436  -1.744  -23.999 1.00 45.16  ? 186 LEU B N   1 
ATOM   1463 C CA  . LEU B 1 109 ? 68.419  -2.223  -24.916 1.00 45.63  ? 186 LEU B CA  1 
ATOM   1464 C C   . LEU B 1 109 ? 67.095  -1.539  -24.623 1.00 47.96  ? 186 LEU B C   1 
ATOM   1465 O O   . LEU B 1 109 ? 66.634  -1.565  -23.481 1.00 49.45  ? 186 LEU B O   1 
ATOM   1466 C CB  . LEU B 1 109 ? 68.294  -3.745  -24.818 1.00 47.28  ? 186 LEU B CB  1 
ATOM   1467 C CG  . LEU B 1 109 ? 67.072  -4.396  -25.493 1.00 55.34  ? 186 LEU B CG  1 
ATOM   1468 C CD1 . LEU B 1 109 ? 67.078  -4.186  -27.054 1.00 57.14  ? 186 LEU B CD1 1 
ATOM   1469 C CD2 . LEU B 1 109 ? 66.966  -5.872  -25.128 1.00 60.56  ? 186 LEU B CD2 1 
ATOM   1470 N N   . VAL B 1 110 ? 66.491  -0.914  -25.659 1.00 40.55  ? 187 VAL B N   1 
ATOM   1471 C CA  . VAL B 1 110 ? 65.196  -0.212  -25.586 1.00 37.65  ? 187 VAL B CA  1 
ATOM   1472 C C   . VAL B 1 110 ? 64.075  -1.235  -25.749 1.00 41.84  ? 187 VAL B C   1 
ATOM   1473 O O   . VAL B 1 110 ? 64.037  -1.966  -26.737 1.00 43.34  ? 187 VAL B O   1 
ATOM   1474 C CB  . VAL B 1 110 ? 65.121  0.915   -26.637 1.00 39.33  ? 187 VAL B CB  1 
ATOM   1475 C CG1 . VAL B 1 110 ? 63.798  1.648   -26.582 1.00 39.06  ? 187 VAL B CG1 1 
ATOM   1476 C CG2 . VAL B 1 110 ? 66.270  1.876   -26.452 1.00 37.85  ? 187 VAL B CG2 1 
ATOM   1477 N N   . LYS B 1 111 ? 63.192  -1.313  -24.770 1.00 38.02  ? 188 LYS B N   1 
ATOM   1478 C CA  . LYS B 1 111 ? 62.076  -2.261  -24.771 1.00 38.62  ? 188 LYS B CA  1 
ATOM   1479 C C   . LYS B 1 111 ? 60.715  -1.580  -25.030 1.00 44.24  ? 188 LYS B C   1 
ATOM   1480 O O   . LYS B 1 111 ? 59.748  -2.273  -25.337 1.00 46.07  ? 188 LYS B O   1 
ATOM   1481 C CB  . LYS B 1 111 ? 62.053  -3.063  -23.480 1.00 39.92  ? 188 LYS B CB  1 
ATOM   1482 C CG  . LYS B 1 111 ? 63.196  -4.019  -23.262 1.00 44.99  ? 188 LYS B CG  1 
ATOM   1483 C CD  . LYS B 1 111 ? 62.677  -4.920  -22.177 1.00 57.21  ? 188 LYS B CD  1 
ATOM   1484 N N   . GLU B 1 112 ? 60.644  -0.244  -24.914 1.00 40.87  ? 189 GLU B N   1 
ATOM   1485 C CA  . GLU B 1 112 ? 59.432  0.526   -25.205 1.00 43.76  ? 189 GLU B CA  1 
ATOM   1486 C C   . GLU B 1 112 ? 59.772  1.704   -26.088 1.00 49.53  ? 189 GLU B C   1 
ATOM   1487 O O   . GLU B 1 112 ? 60.771  2.365   -25.830 1.00 50.59  ? 189 GLU B O   1 
ATOM   1488 C CB  . GLU B 1 112 ? 58.729  1.026   -23.926 1.00 45.53  ? 189 GLU B CB  1 
ATOM   1489 C CG  . GLU B 1 112 ? 57.916  -0.042  -23.210 1.00 60.51  ? 189 GLU B CG  1 
ATOM   1490 C CD  . GLU B 1 112 ? 57.835  0.147   -21.708 1.00 89.30  ? 189 GLU B CD  1 
ATOM   1491 O OE1 . GLU B 1 112 ? 57.639  1.303   -21.261 1.00 93.07  ? 189 GLU B OE1 1 
ATOM   1492 O OE2 . GLU B 1 112 ? 57.942  -0.867  -20.978 1.00 76.71  ? 189 GLU B OE2 1 
ATOM   1493 N N   . THR B 1 113 ? 58.940  1.996   -27.105 1.00 45.04  ? 190 THR B N   1 
ATOM   1494 C CA  . THR B 1 113 ? 59.152  3.165   -27.962 1.00 43.63  ? 190 THR B CA  1 
ATOM   1495 C C   . THR B 1 113 ? 58.787  4.414   -27.167 1.00 46.09  ? 190 THR B C   1 
ATOM   1496 O O   . THR B 1 113 ? 57.853  4.391   -26.376 1.00 46.92  ? 190 THR B O   1 
ATOM   1497 C CB  . THR B 1 113 ? 58.356  3.046   -29.270 1.00 46.20  ? 190 THR B CB  1 
ATOM   1498 O OG1 . THR B 1 113 ? 58.815  1.910   -29.995 1.00 49.81  ? 190 THR B OG1 1 
ATOM   1499 C CG2 . THR B 1 113 ? 58.511  4.248   -30.158 1.00 40.06  ? 190 THR B CG2 1 
ATOM   1500 N N   . GLY B 1 114 ? 59.555  5.470   -27.349 1.00 41.40  ? 191 GLY B N   1 
ATOM   1501 C CA  . GLY B 1 114 ? 59.333  6.730   -26.660 1.00 40.74  ? 191 GLY B CA  1 
ATOM   1502 C C   . GLY B 1 114 ? 60.464  7.714   -26.819 1.00 43.22  ? 191 GLY B C   1 
ATOM   1503 O O   . GLY B 1 114 ? 61.285  7.591   -27.740 1.00 40.57  ? 191 GLY B O   1 
ATOM   1504 N N   . TYR B 1 115 ? 60.482  8.711   -25.911 1.00 41.65  ? 192 TYR B N   1 
ATOM   1505 C CA  . TYR B 1 115 ? 61.496  9.775   -25.868 1.00 41.47  ? 192 TYR B CA  1 
ATOM   1506 C C   . TYR B 1 115 ? 62.375  9.515   -24.679 1.00 45.47  ? 192 TYR B C   1 
ATOM   1507 O O   . TYR B 1 115 ? 61.867  9.211   -23.589 1.00 46.92  ? 192 TYR B O   1 
ATOM   1508 C CB  . TYR B 1 115 ? 60.861  11.177  -25.790 1.00 42.75  ? 192 TYR B CB  1 
ATOM   1509 C CG  . TYR B 1 115 ? 60.182  11.619  -27.079 1.00 45.23  ? 192 TYR B CG  1 
ATOM   1510 C CD1 . TYR B 1 115 ? 58.931  11.123  -27.438 1.00 47.51  ? 192 TYR B CD1 1 
ATOM   1511 C CD2 . TYR B 1 115 ? 60.788  12.535  -27.930 1.00 46.55  ? 192 TYR B CD2 1 
ATOM   1512 C CE1 . TYR B 1 115 ? 58.300  11.529  -28.610 1.00 50.09  ? 192 TYR B CE1 1 
ATOM   1513 C CE2 . TYR B 1 115 ? 60.162  12.957  -29.102 1.00 49.09  ? 192 TYR B CE2 1 
ATOM   1514 C CZ  . TYR B 1 115 ? 58.903  12.465  -29.429 1.00 59.37  ? 192 TYR B CZ  1 
ATOM   1515 O OH  . TYR B 1 115 ? 58.226  12.858  -30.569 1.00 59.99  ? 192 TYR B OH  1 
ATOM   1516 N N   . PHE B 1 116 ? 63.695  9.573   -24.892 1.00 39.08  ? 193 PHE B N   1 
ATOM   1517 C CA  . PHE B 1 116 ? 64.628  9.288   -23.812 1.00 37.23  ? 193 PHE B CA  1 
ATOM   1518 C C   . PHE B 1 116 ? 65.691  10.350  -23.583 1.00 39.44  ? 193 PHE B C   1 
ATOM   1519 O O   . PHE B 1 116 ? 66.267  10.888  -24.530 1.00 38.82  ? 193 PHE B O   1 
ATOM   1520 C CB  . PHE B 1 116 ? 65.306  7.919   -23.996 1.00 38.28  ? 193 PHE B CB  1 
ATOM   1521 C CG  . PHE B 1 116 ? 64.391  6.723   -24.056 1.00 40.76  ? 193 PHE B CG  1 
ATOM   1522 C CD1 . PHE B 1 116 ? 63.682  6.420   -25.225 1.00 44.60  ? 193 PHE B CD1 1 
ATOM   1523 C CD2 . PHE B 1 116 ? 64.311  5.835   -22.986 1.00 42.73  ? 193 PHE B CD2 1 
ATOM   1524 C CE1 . PHE B 1 116 ? 62.854  5.288   -25.292 1.00 46.35  ? 193 PHE B CE1 1 
ATOM   1525 C CE2 . PHE B 1 116 ? 63.498  4.687   -23.061 1.00 46.23  ? 193 PHE B CE2 1 
ATOM   1526 C CZ  . PHE B 1 116 ? 62.754  4.438   -24.201 1.00 45.15  ? 193 PHE B CZ  1 
ATOM   1527 N N   . PHE B 1 117 ? 65.953  10.632  -22.312 1.00 34.51  ? 194 PHE B N   1 
ATOM   1528 C CA  . PHE B 1 117 ? 67.038  11.495  -21.942 1.00 33.97  ? 194 PHE B CA  1 
ATOM   1529 C C   . PHE B 1 117 ? 68.228  10.544  -21.789 1.00 41.03  ? 194 PHE B C   1 
ATOM   1530 O O   . PHE B 1 117 ? 68.200  9.668   -20.929 1.00 42.76  ? 194 PHE B O   1 
ATOM   1531 C CB  . PHE B 1 117 ? 66.764  12.252  -20.636 1.00 34.80  ? 194 PHE B CB  1 
ATOM   1532 C CG  . PHE B 1 117 ? 67.946  13.096  -20.213 1.00 35.15  ? 194 PHE B CG  1 
ATOM   1533 C CD1 . PHE B 1 117 ? 68.279  14.259  -20.905 1.00 38.57  ? 194 PHE B CD1 1 
ATOM   1534 C CD2 . PHE B 1 117 ? 68.741  12.719  -19.138 1.00 36.63  ? 194 PHE B CD2 1 
ATOM   1535 C CE1 . PHE B 1 117 ? 69.389  15.040  -20.516 1.00 39.82  ? 194 PHE B CE1 1 
ATOM   1536 C CE2 . PHE B 1 117 ? 69.835  13.513  -18.735 1.00 39.35  ? 194 PHE B CE2 1 
ATOM   1537 C CZ  . PHE B 1 117 ? 70.152  14.670  -19.424 1.00 37.62  ? 194 PHE B CZ  1 
ATOM   1538 N N   . ILE B 1 118 ? 69.240  10.673  -22.660 1.00 36.70  ? 195 ILE B N   1 
ATOM   1539 C CA  . ILE B 1 118 ? 70.418  9.798   -22.665 1.00 34.43  ? 195 ILE B CA  1 
ATOM   1540 C C   . ILE B 1 118 ? 71.614  10.613  -22.265 1.00 38.07  ? 195 ILE B C   1 
ATOM   1541 O O   . ILE B 1 118 ? 71.807  11.704  -22.804 1.00 39.24  ? 195 ILE B O   1 
ATOM   1542 C CB  . ILE B 1 118 ? 70.613  9.126   -24.067 1.00 36.19  ? 195 ILE B CB  1 
ATOM   1543 C CG1 . ILE B 1 118 ? 69.349  8.366   -24.502 1.00 34.41  ? 195 ILE B CG1 1 
ATOM   1544 C CG2 . ILE B 1 118 ? 71.804  8.182   -24.026 1.00 36.98  ? 195 ILE B CG2 1 
ATOM   1545 C CD1 . ILE B 1 118 ? 68.966  8.602   -25.775 1.00 24.20  ? 195 ILE B CD1 1 
ATOM   1546 N N   . TYR B 1 119 ? 72.432  10.081  -21.352 1.00 32.60  ? 196 TYR B N   1 
ATOM   1547 C CA  . TYR B 1 119 ? 73.628  10.743  -20.799 1.00 30.58  ? 196 TYR B CA  1 
ATOM   1548 C C   . TYR B 1 119 ? 74.822  9.799   -20.701 1.00 33.99  ? 196 TYR B C   1 
ATOM   1549 O O   . TYR B 1 119 ? 74.658  8.583   -20.621 1.00 34.50  ? 196 TYR B O   1 
ATOM   1550 C CB  . TYR B 1 119 ? 73.319  11.365  -19.417 1.00 30.12  ? 196 TYR B CB  1 
ATOM   1551 C CG  . TYR B 1 119 ? 72.850  10.383  -18.361 1.00 31.17  ? 196 TYR B CG  1 
ATOM   1552 C CD1 . TYR B 1 119 ? 71.505  10.045  -18.242 1.00 33.93  ? 196 TYR B CD1 1 
ATOM   1553 C CD2 . TYR B 1 119 ? 73.746  9.814   -17.462 1.00 31.89  ? 196 TYR B CD2 1 
ATOM   1554 C CE1 . TYR B 1 119 ? 71.068  9.129   -17.282 1.00 35.71  ? 196 TYR B CE1 1 
ATOM   1555 C CE2 . TYR B 1 119 ? 73.319  8.912   -16.485 1.00 33.14  ? 196 TYR B CE2 1 
ATOM   1556 C CZ  . TYR B 1 119 ? 71.978  8.580   -16.394 1.00 41.50  ? 196 TYR B CZ  1 
ATOM   1557 O OH  . TYR B 1 119 ? 71.558  7.672   -15.463 1.00 41.09  ? 196 TYR B OH  1 
ATOM   1558 N N   . GLY B 1 120 ? 76.008  10.374  -20.688 1.00 29.83  ? 197 GLY B N   1 
ATOM   1559 C CA  . GLY B 1 120 ? 77.237  9.617   -20.583 1.00 30.08  ? 197 GLY B CA  1 
ATOM   1560 C C   . GLY B 1 120 ? 78.436  10.475  -20.249 1.00 35.94  ? 197 GLY B C   1 
ATOM   1561 O O   . GLY B 1 120 ? 78.568  11.597  -20.755 1.00 38.77  ? 197 GLY B O   1 
ATOM   1562 N N   . GLN B 1 121 ? 79.325  9.939   -19.394 1.00 29.00  ? 198 GLN B N   1 
ATOM   1563 C CA  . GLN B 1 121 ? 80.567  10.588  -19.010 1.00 27.42  ? 198 GLN B CA  1 
ATOM   1564 C C   . GLN B 1 121 ? 81.676  9.569   -18.978 1.00 30.78  ? 198 GLN B C   1 
ATOM   1565 O O   . GLN B 1 121 ? 81.451  8.426   -18.594 1.00 31.00  ? 198 GLN B O   1 
ATOM   1566 C CB  . GLN B 1 121 ? 80.450  11.305  -17.655 1.00 28.08  ? 198 GLN B CB  1 
ATOM   1567 C CG  . GLN B 1 121 ? 81.734  12.001  -17.230 1.00 34.24  ? 198 GLN B CG  1 
ATOM   1568 C CD  . GLN B 1 121 ? 81.593  12.772  -15.959 1.00 42.91  ? 198 GLN B CD  1 
ATOM   1569 O OE1 . GLN B 1 121 ? 80.962  13.821  -15.927 1.00 40.29  ? 198 GLN B OE1 1 
ATOM   1570 N NE2 . GLN B 1 121 ? 82.215  12.283  -14.885 1.00 29.63  ? 198 GLN B NE2 1 
ATOM   1571 N N   . VAL B 1 122 ? 82.870  9.986   -19.392 1.00 27.39  ? 199 VAL B N   1 
ATOM   1572 C CA  . VAL B 1 122 ? 84.092  9.182   -19.370 1.00 27.95  ? 199 VAL B CA  1 
ATOM   1573 C C   . VAL B 1 122 ? 85.191  10.119  -18.888 1.00 32.41  ? 199 VAL B C   1 
ATOM   1574 O O   . VAL B 1 122 ? 85.198  11.290  -19.277 1.00 32.00  ? 199 VAL B O   1 
ATOM   1575 C CB  . VAL B 1 122 ? 84.450  8.610   -20.784 1.00 32.46  ? 199 VAL B CB  1 
ATOM   1576 C CG1 . VAL B 1 122 ? 85.727  7.786   -20.749 1.00 32.73  ? 199 VAL B CG1 1 
ATOM   1577 C CG2 . VAL B 1 122 ? 83.314  7.788   -21.374 1.00 31.67  ? 199 VAL B CG2 1 
ATOM   1578 N N   . LEU B 1 123 ? 86.104  9.619   -18.031 1.00 30.04  ? 200 LEU B N   1 
ATOM   1579 C CA  . LEU B 1 123 ? 87.278  10.382  -17.588 1.00 30.07  ? 200 LEU B CA  1 
ATOM   1580 C C   . LEU B 1 123 ? 88.449  9.866   -18.412 1.00 36.23  ? 200 LEU B C   1 
ATOM   1581 O O   . LEU B 1 123 ? 88.745  8.669   -18.396 1.00 34.25  ? 200 LEU B O   1 
ATOM   1582 C CB  . LEU B 1 123 ? 87.557  10.249  -16.088 1.00 29.58  ? 200 LEU B CB  1 
ATOM   1583 C CG  . LEU B 1 123 ? 88.934  10.705  -15.573 1.00 34.78  ? 200 LEU B CG  1 
ATOM   1584 C CD1 . LEU B 1 123 ? 89.175  12.179  -15.834 1.00 36.18  ? 200 LEU B CD1 1 
ATOM   1585 C CD2 . LEU B 1 123 ? 89.042  10.506  -14.118 1.00 34.91  ? 200 LEU B CD2 1 
ATOM   1586 N N   . TYR B 1 124 ? 89.082  10.778  -19.153 1.00 35.94  ? 201 TYR B N   1 
ATOM   1587 C CA  . TYR B 1 124 ? 90.201  10.481  -20.035 1.00 37.42  ? 201 TYR B CA  1 
ATOM   1588 C C   . TYR B 1 124 ? 91.507  10.783  -19.352 1.00 43.40  ? 201 TYR B C   1 
ATOM   1589 O O   . TYR B 1 124 ? 91.674  11.848  -18.754 1.00 43.30  ? 201 TYR B O   1 
ATOM   1590 C CB  . TYR B 1 124 ? 90.078  11.248  -21.368 1.00 37.88  ? 201 TYR B CB  1 
ATOM   1591 C CG  . TYR B 1 124 ? 88.831  10.864  -22.120 1.00 37.91  ? 201 TYR B CG  1 
ATOM   1592 C CD1 . TYR B 1 124 ? 88.772  9.680   -22.856 1.00 38.66  ? 201 TYR B CD1 1 
ATOM   1593 C CD2 . TYR B 1 124 ? 87.669  11.627  -22.015 1.00 38.96  ? 201 TYR B CD2 1 
ATOM   1594 C CE1 . TYR B 1 124 ? 87.604  9.290   -23.505 1.00 35.92  ? 201 TYR B CE1 1 
ATOM   1595 C CE2 . TYR B 1 124 ? 86.488  11.239  -22.651 1.00 39.15  ? 201 TYR B CE2 1 
ATOM   1596 C CZ  . TYR B 1 124 ? 86.468  10.081  -23.406 1.00 41.26  ? 201 TYR B CZ  1 
ATOM   1597 O OH  . TYR B 1 124 ? 85.308  9.732   -24.017 1.00 37.74  ? 201 TYR B OH  1 
ATOM   1598 N N   . THR B 1 125 ? 92.413  9.808   -19.396 1.00 40.50  ? 202 THR B N   1 
ATOM   1599 C CA  . THR B 1 125 ? 93.747  9.919   -18.813 1.00 41.00  ? 202 THR B CA  1 
ATOM   1600 C C   . THR B 1 125 ? 94.755  9.601   -19.899 1.00 45.31  ? 202 THR B C   1 
ATOM   1601 O O   . THR B 1 125 ? 95.815  9.044   -19.616 1.00 46.22  ? 202 THR B O   1 
ATOM   1602 C CB  . THR B 1 125 ? 93.871  9.077   -17.527 1.00 41.68  ? 202 THR B CB  1 
ATOM   1603 O OG1 . THR B 1 125 ? 93.576  7.698   -17.814 1.00 41.56  ? 202 THR B OG1 1 
ATOM   1604 C CG2 . THR B 1 125 ? 92.982  9.609   -16.400 1.00 33.44  ? 202 THR B CG2 1 
ATOM   1605 N N   . ASP B 1 126 ? 94.405  9.983   -21.154 1.00 41.07  ? 203 ASP B N   1 
ATOM   1606 C CA  . ASP B 1 126 ? 95.173  9.755   -22.378 1.00 40.99  ? 203 ASP B CA  1 
ATOM   1607 C C   . ASP B 1 126 ? 95.860  11.035  -22.876 1.00 42.46  ? 203 ASP B C   1 
ATOM   1608 O O   . ASP B 1 126 ? 95.224  12.093  -22.923 1.00 40.16  ? 203 ASP B O   1 
ATOM   1609 C CB  . ASP B 1 126 ? 94.223  9.206   -23.438 1.00 41.70  ? 203 ASP B CB  1 
ATOM   1610 C CG  . ASP B 1 126 ? 94.876  8.411   -24.534 1.00 49.89  ? 203 ASP B CG  1 
ATOM   1611 O OD1 . ASP B 1 126 ? 95.765  8.958   -25.211 1.00 49.45  ? 203 ASP B OD1 1 
ATOM   1612 O OD2 . ASP B 1 126 ? 94.432  7.265   -24.778 1.00 59.69  ? 203 ASP B OD2 1 
ATOM   1613 N N   . LYS B 1 127 ? 97.153  10.930  -23.266 1.00 39.51  ? 204 LYS B N   1 
ATOM   1614 C CA  . LYS B 1 127 ? 97.936  12.072  -23.778 1.00 39.72  ? 204 LYS B CA  1 
ATOM   1615 C C   . LYS B 1 127 ? 97.553  12.551  -25.224 1.00 44.04  ? 204 LYS B C   1 
ATOM   1616 O O   . LYS B 1 127 ? 97.940  13.659  -25.620 1.00 44.02  ? 204 LYS B O   1 
ATOM   1617 C CB  . LYS B 1 127 ? 99.450  11.857  -23.593 1.00 42.55  ? 204 LYS B CB  1 
ATOM   1618 N N   . THR B 1 128 ? 96.768  11.738  -25.984 1.00 40.98  ? 205 THR B N   1 
ATOM   1619 C CA  . THR B 1 128 ? 96.281  12.055  -27.352 1.00 41.76  ? 205 THR B CA  1 
ATOM   1620 C C   . THR B 1 128 ? 95.637  13.456  -27.358 1.00 45.14  ? 205 THR B C   1 
ATOM   1621 O O   . THR B 1 128 ? 94.804  13.746  -26.487 1.00 41.03  ? 205 THR B O   1 
ATOM   1622 C CB  . THR B 1 128 ? 95.265  11.005  -27.833 1.00 46.54  ? 205 THR B CB  1 
ATOM   1623 O OG1 . THR B 1 128 ? 95.845  9.707   -27.751 1.00 47.22  ? 205 THR B OG1 1 
ATOM   1624 C CG2 . THR B 1 128 ? 94.747  11.275  -29.237 1.00 38.46  ? 205 THR B CG2 1 
ATOM   1625 N N   . TYR B 1 129 ? 96.048  14.320  -28.343 1.00 42.58  ? 206 TYR B N   1 
ATOM   1626 C CA  . TYR B 1 129 ? 95.635  15.729  -28.476 1.00 40.06  ? 206 TYR B CA  1 
ATOM   1627 C C   . TYR B 1 129 ? 94.162  15.994  -28.157 1.00 43.45  ? 206 TYR B C   1 
ATOM   1628 O O   . TYR B 1 129 ? 93.836  17.028  -27.588 1.00 42.73  ? 206 TYR B O   1 
ATOM   1629 C CB  . TYR B 1 129 ? 96.050  16.309  -29.827 1.00 40.60  ? 206 TYR B CB  1 
ATOM   1630 C CG  . TYR B 1 129 ? 95.074  16.001  -30.930 1.00 40.80  ? 206 TYR B CG  1 
ATOM   1631 C CD1 . TYR B 1 129 ? 95.048  14.749  -31.530 1.00 42.29  ? 206 TYR B CD1 1 
ATOM   1632 C CD2 . TYR B 1 129 ? 94.127  16.940  -31.333 1.00 41.00  ? 206 TYR B CD2 1 
ATOM   1633 C CE1 . TYR B 1 129 ? 94.124  14.442  -32.520 1.00 42.30  ? 206 TYR B CE1 1 
ATOM   1634 C CE2 . TYR B 1 129 ? 93.211  16.652  -32.338 1.00 41.92  ? 206 TYR B CE2 1 
ATOM   1635 C CZ  . TYR B 1 129 ? 93.199  15.389  -32.912 1.00 51.52  ? 206 TYR B CZ  1 
ATOM   1636 O OH  . TYR B 1 129 ? 92.317  15.064  -33.911 1.00 56.33  ? 206 TYR B OH  1 
ATOM   1637 N N   . ALA B 1 130 ? 93.288  15.060  -28.533 1.00 40.62  ? 207 ALA B N   1 
ATOM   1638 C CA  . ALA B 1 130 ? 91.855  15.127  -28.281 1.00 39.78  ? 207 ALA B CA  1 
ATOM   1639 C C   . ALA B 1 130 ? 91.311  13.730  -28.026 1.00 43.53  ? 207 ALA B C   1 
ATOM   1640 O O   . ALA B 1 130 ? 91.718  12.769  -28.673 1.00 45.18  ? 207 ALA B O   1 
ATOM   1641 C CB  . ALA B 1 130 ? 91.126  15.775  -29.444 1.00 41.16  ? 207 ALA B CB  1 
ATOM   1642 N N   . MET B 1 131 ? 90.435  13.628  -27.030 1.00 38.20  ? 208 MET B N   1 
ATOM   1643 C CA  . MET B 1 131 ? 89.767  12.411  -26.575 1.00 36.70  ? 208 MET B CA  1 
ATOM   1644 C C   . MET B 1 131 ? 88.278  12.714  -26.454 1.00 39.07  ? 208 MET B C   1 
ATOM   1645 O O   . MET B 1 131 ? 87.893  13.880  -26.302 1.00 38.94  ? 208 MET B O   1 
ATOM   1646 C CB  . MET B 1 131 ? 90.316  11.951  -25.207 1.00 38.43  ? 208 MET B CB  1 
ATOM   1647 C CG  . MET B 1 131 ? 91.727  11.381  -25.259 1.00 43.15  ? 208 MET B CG  1 
ATOM   1648 S SD  . MET B 1 131 ? 91.971  9.957   -26.338 1.00 47.95  ? 208 MET B SD  1 
ATOM   1649 C CE  . MET B 1 131 ? 91.078  8.672   -25.433 1.00 42.30  ? 208 MET B CE  1 
ATOM   1650 N N   . GLY B 1 132 ? 87.459  11.679  -26.555 1.00 33.41  ? 209 GLY B N   1 
ATOM   1651 C CA  . GLY B 1 132 ? 86.019  11.835  -26.497 1.00 32.15  ? 209 GLY B CA  1 
ATOM   1652 C C   . GLY B 1 132 ? 85.282  10.574  -26.872 1.00 37.08  ? 209 GLY B C   1 
ATOM   1653 O O   . GLY B 1 132 ? 85.904  9.577   -27.245 1.00 37.62  ? 209 GLY B O   1 
ATOM   1654 N N   . HIS B 1 133 ? 83.954  10.593  -26.736 1.00 32.86  ? 210 HIS B N   1 
ATOM   1655 C CA  . HIS B 1 133 ? 83.147  9.416   -27.015 1.00 32.46  ? 210 HIS B CA  1 
ATOM   1656 C C   . HIS B 1 133 ? 81.901  9.714   -27.828 1.00 36.53  ? 210 HIS B C   1 
ATOM   1657 O O   . HIS B 1 133 ? 81.539  10.878  -28.018 1.00 37.46  ? 210 HIS B O   1 
ATOM   1658 C CB  . HIS B 1 133 ? 82.790  8.673   -25.717 1.00 32.57  ? 210 HIS B CB  1 
ATOM   1659 C CG  . HIS B 1 133 ? 82.104  9.522   -24.697 1.00 35.89  ? 210 HIS B CG  1 
ATOM   1660 N ND1 . HIS B 1 133 ? 82.822  10.270  -23.783 1.00 38.82  ? 210 HIS B ND1 1 
ATOM   1661 C CD2 . HIS B 1 133 ? 80.786  9.722   -24.480 1.00 37.63  ? 210 HIS B CD2 1 
ATOM   1662 C CE1 . HIS B 1 133 ? 81.927  10.883  -23.028 1.00 37.61  ? 210 HIS B CE1 1 
ATOM   1663 N NE2 . HIS B 1 133 ? 80.687  10.598  -23.418 1.00 37.35  ? 210 HIS B NE2 1 
ATOM   1664 N N   . LEU B 1 134 ? 81.253  8.646   -28.321 1.00 31.99  ? 211 LEU B N   1 
ATOM   1665 C CA  . LEU B 1 134 ? 80.035  8.745   -29.109 1.00 31.66  ? 211 LEU B CA  1 
ATOM   1666 C C   . LEU B 1 134 ? 78.940  7.954   -28.427 1.00 37.14  ? 211 LEU B C   1 
ATOM   1667 O O   . LEU B 1 134 ? 79.176  6.800   -28.057 1.00 38.16  ? 211 LEU B O   1 
ATOM   1668 C CB  . LEU B 1 134 ? 80.225  8.192   -30.551 1.00 32.04  ? 211 LEU B CB  1 
ATOM   1669 C CG  . LEU B 1 134 ? 81.536  8.426   -31.284 1.00 35.14  ? 211 LEU B CG  1 
ATOM   1670 C CD1 . LEU B 1 134 ? 81.591  7.659   -32.540 1.00 34.52  ? 211 LEU B CD1 1 
ATOM   1671 C CD2 . LEU B 1 134 ? 81.733  9.864   -31.588 1.00 37.56  ? 211 LEU B CD2 1 
ATOM   1672 N N   . ILE B 1 135 ? 77.753  8.572   -28.249 1.00 33.27  ? 212 ILE B N   1 
ATOM   1673 C CA  . ILE B 1 135 ? 76.559  7.887   -27.755 1.00 33.89  ? 212 ILE B CA  1 
ATOM   1674 C C   . ILE B 1 135 ? 75.830  7.505   -29.042 1.00 41.76  ? 212 ILE B C   1 
ATOM   1675 O O   . ILE B 1 135 ? 75.337  8.367   -29.774 1.00 41.85  ? 212 ILE B O   1 
ATOM   1676 C CB  . ILE B 1 135 ? 75.700  8.704   -26.747 1.00 35.99  ? 212 ILE B CB  1 
ATOM   1677 C CG1 . ILE B 1 135 ? 76.412  8.781   -25.366 1.00 35.43  ? 212 ILE B CG1 1 
ATOM   1678 C CG2 . ILE B 1 135 ? 74.311  8.071   -26.601 1.00 35.29  ? 212 ILE B CG2 1 
ATOM   1679 C CD1 . ILE B 1 135 ? 75.870  9.896   -24.403 1.00 42.06  ? 212 ILE B CD1 1 
ATOM   1680 N N   . GLN B 1 136 ? 75.872  6.221   -29.361 1.00 40.96  ? 213 GLN B N   1 
ATOM   1681 C CA  . GLN B 1 136 ? 75.350  5.686   -30.613 1.00 42.07  ? 213 GLN B CA  1 
ATOM   1682 C C   . GLN B 1 136 ? 74.090  4.886   -30.460 1.00 45.68  ? 213 GLN B C   1 
ATOM   1683 O O   . GLN B 1 136 ? 73.901  4.190   -29.461 1.00 44.56  ? 213 GLN B O   1 
ATOM   1684 C CB  . GLN B 1 136 ? 76.411  4.830   -31.326 1.00 44.41  ? 213 GLN B CB  1 
ATOM   1685 C CG  . GLN B 1 136 ? 77.701  5.573   -31.551 1.00 52.91  ? 213 GLN B CG  1 
ATOM   1686 C CD  . GLN B 1 136 ? 78.632  4.746   -32.367 1.00 67.13  ? 213 GLN B CD  1 
ATOM   1687 O OE1 . GLN B 1 136 ? 79.050  3.650   -31.967 1.00 67.38  ? 213 GLN B OE1 1 
ATOM   1688 N NE2 . GLN B 1 136 ? 78.978  5.256   -33.540 1.00 45.52  ? 213 GLN B NE2 1 
ATOM   1689 N N   . ARG B 1 137 ? 73.268  4.921   -31.507 1.00 42.93  ? 214 ARG B N   1 
ATOM   1690 C CA  . ARG B 1 137 ? 72.012  4.210   -31.583 1.00 42.56  ? 214 ARG B CA  1 
ATOM   1691 C C   . ARG B 1 137 ? 72.091  3.156   -32.667 1.00 48.56  ? 214 ARG B C   1 
ATOM   1692 O O   . ARG B 1 137 ? 72.346  3.500   -33.832 1.00 50.19  ? 214 ARG B O   1 
ATOM   1693 C CB  . ARG B 1 137 ? 70.913  5.202   -31.905 1.00 41.30  ? 214 ARG B CB  1 
ATOM   1694 C CG  . ARG B 1 137 ? 69.541  4.579   -31.997 1.00 52.97  ? 214 ARG B CG  1 
ATOM   1695 C CD  . ARG B 1 137 ? 68.595  5.600   -32.565 1.00 52.54  ? 214 ARG B CD  1 
ATOM   1696 N NE  . ARG B 1 137 ? 67.276  5.046   -32.803 1.00 45.06  ? 214 ARG B NE  1 
ATOM   1697 C CZ  . ARG B 1 137 ? 66.387  5.615   -33.596 1.00 58.70  ? 214 ARG B CZ  1 
ATOM   1698 N NH1 . ARG B 1 137 ? 66.684  6.733   -34.235 1.00 48.16  ? 214 ARG B NH1 1 
ATOM   1699 N NH2 . ARG B 1 137 ? 65.200  5.055   -33.783 1.00 54.20  ? 214 ARG B NH2 1 
ATOM   1700 N N   . LYS B 1 138 ? 71.886  1.876   -32.290 1.00 43.88  ? 215 LYS B N   1 
ATOM   1701 C CA  . LYS B 1 138 ? 71.866  0.801   -33.275 1.00 45.27  ? 215 LYS B CA  1 
ATOM   1702 C C   . LYS B 1 138 ? 70.398  0.600   -33.574 1.00 48.98  ? 215 LYS B C   1 
ATOM   1703 O O   . LYS B 1 138 ? 69.669  0.006   -32.762 1.00 49.49  ? 215 LYS B O   1 
ATOM   1704 C CB  . LYS B 1 138 ? 72.562  -0.486  -32.772 1.00 47.62  ? 215 LYS B CB  1 
ATOM   1705 C CG  . LYS B 1 138 ? 72.651  -1.600  -33.829 1.00 59.95  ? 215 LYS B CG  1 
ATOM   1706 N N   . LYS B 1 139 ? 69.950  1.184   -34.698 1.00 43.85  ? 216 LYS B N   1 
ATOM   1707 C CA  . LYS B 1 139 ? 68.551  1.154   -35.145 1.00 43.66  ? 216 LYS B CA  1 
ATOM   1708 C C   . LYS B 1 139 ? 68.071  -0.258  -35.425 1.00 46.71  ? 216 LYS B C   1 
ATOM   1709 O O   . LYS B 1 139 ? 68.753  -0.991  -36.142 1.00 46.97  ? 216 LYS B O   1 
ATOM   1710 C CB  . LYS B 1 139 ? 68.361  2.024   -36.404 1.00 46.83  ? 216 LYS B CB  1 
ATOM   1711 C CG  . LYS B 1 139 ? 68.502  3.547   -36.188 1.00 55.30  ? 216 LYS B CG  1 
ATOM   1712 C CD  . LYS B 1 139 ? 67.467  4.358   -36.980 1.00 66.49  ? 216 LYS B CD  1 
ATOM   1713 C CE  . LYS B 1 139 ? 67.944  4.868   -38.320 1.00 86.53  ? 216 LYS B CE  1 
ATOM   1714 N NZ  . LYS B 1 139 ? 67.501  4.003   -39.444 1.00 101.87 ? 216 LYS B NZ  1 
ATOM   1715 N N   . VAL B 1 140 ? 66.909  -0.650  -34.872 1.00 42.94  ? 217 VAL B N   1 
ATOM   1716 C CA  . VAL B 1 140 ? 66.355  -1.996  -35.155 1.00 43.55  ? 217 VAL B CA  1 
ATOM   1717 C C   . VAL B 1 140 ? 65.750  -2.006  -36.587 1.00 54.79  ? 217 VAL B C   1 
ATOM   1718 O O   . VAL B 1 140 ? 65.826  -3.016  -37.304 1.00 56.33  ? 217 VAL B O   1 
ATOM   1719 C CB  . VAL B 1 140 ? 65.389  -2.547  -34.072 1.00 42.77  ? 217 VAL B CB  1 
ATOM   1720 C CG1 . VAL B 1 140 ? 64.106  -1.731  -33.992 1.00 41.56  ? 217 VAL B CG1 1 
ATOM   1721 C CG2 . VAL B 1 140 ? 65.100  -4.024  -34.291 1.00 43.08  ? 217 VAL B CG2 1 
ATOM   1722 N N   . HIS B 1 141 ? 65.197  -0.831  -36.981 1.00 53.58  ? 218 HIS B N   1 
ATOM   1723 C CA  . HIS B 1 141 ? 64.548  -0.550  -38.245 1.00 54.74  ? 218 HIS B CA  1 
ATOM   1724 C C   . HIS B 1 141 ? 65.244  0.587   -39.006 1.00 55.90  ? 218 HIS B C   1 
ATOM   1725 O O   . HIS B 1 141 ? 65.435  1.685   -38.485 1.00 53.84  ? 218 HIS B O   1 
ATOM   1726 C CB  . HIS B 1 141 ? 63.084  -0.212  -37.986 1.00 56.66  ? 218 HIS B CB  1 
ATOM   1727 C CG  . HIS B 1 141 ? 62.401  0.312   -39.193 1.00 62.87  ? 218 HIS B CG  1 
ATOM   1728 N ND1 . HIS B 1 141 ? 61.967  1.627   -39.255 1.00 64.95  ? 218 HIS B ND1 1 
ATOM   1729 C CD2 . HIS B 1 141 ? 62.180  -0.294  -40.388 1.00 66.99  ? 218 HIS B CD2 1 
ATOM   1730 C CE1 . HIS B 1 141 ? 61.461  1.767   -40.471 1.00 66.54  ? 218 HIS B CE1 1 
ATOM   1731 N NE2 . HIS B 1 141 ? 61.560  0.631   -41.182 1.00 68.10  ? 218 HIS B NE2 1 
ATOM   1732 N N   . VAL B 1 142 ? 65.600  0.309   -40.253 1.00 52.86  ? 219 VAL B N   1 
ATOM   1733 C CA  . VAL B 1 142 ? 66.274  1.247   -41.152 1.00 51.84  ? 219 VAL B CA  1 
ATOM   1734 C C   . VAL B 1 142 ? 65.436  1.327   -42.435 1.00 56.33  ? 219 VAL B C   1 
ATOM   1735 O O   . VAL B 1 142 ? 64.837  0.320   -42.855 1.00 57.21  ? 219 VAL B O   1 
ATOM   1736 C CB  . VAL B 1 142 ? 67.730  0.770   -41.413 1.00 55.15  ? 219 VAL B CB  1 
ATOM   1737 C CG1 . VAL B 1 142 ? 68.423  1.628   -42.439 1.00 55.43  ? 219 VAL B CG1 1 
ATOM   1738 C CG2 . VAL B 1 142 ? 68.539  0.760   -40.122 1.00 53.33  ? 219 VAL B CG2 1 
ATOM   1739 N N   . PHE B 1 143 ? 65.360  2.531   -43.030 1.00 51.06  ? 220 PHE B N   1 
ATOM   1740 C CA  . PHE B 1 143 ? 64.652  2.724   -44.294 1.00 51.56  ? 220 PHE B CA  1 
ATOM   1741 C C   . PHE B 1 143 ? 65.691  2.956   -45.415 1.00 55.45  ? 220 PHE B C   1 
ATOM   1742 O O   . PHE B 1 143 ? 66.501  3.883   -45.327 1.00 52.95  ? 220 PHE B O   1 
ATOM   1743 C CB  . PHE B 1 143 ? 63.632  3.861   -44.178 1.00 52.97  ? 220 PHE B CB  1 
ATOM   1744 C CG  . PHE B 1 143 ? 62.870  4.167   -45.440 1.00 57.00  ? 220 PHE B CG  1 
ATOM   1745 C CD1 . PHE B 1 143 ? 61.627  3.582   -45.682 1.00 61.08  ? 220 PHE B CD1 1 
ATOM   1746 C CD2 . PHE B 1 143 ? 63.402  5.020   -46.409 1.00 59.88  ? 220 PHE B CD2 1 
ATOM   1747 C CE1 . PHE B 1 143 ? 60.946  3.812   -46.892 1.00 63.88  ? 220 PHE B CE1 1 
ATOM   1748 C CE2 . PHE B 1 143 ? 62.723  5.240   -47.621 1.00 64.69  ? 220 PHE B CE2 1 
ATOM   1749 C CZ  . PHE B 1 143 ? 61.492  4.646   -47.847 1.00 63.81  ? 220 PHE B CZ  1 
ATOM   1750 N N   . GLY B 1 144 ? 65.699  2.049   -46.396 1.00 55.66  ? 221 GLY B N   1 
ATOM   1751 C CA  . GLY B 1 144 ? 66.609  2.060   -47.536 1.00 59.11  ? 221 GLY B CA  1 
ATOM   1752 C C   . GLY B 1 144 ? 68.038  2.421   -47.173 1.00 66.91  ? 221 GLY B C   1 
ATOM   1753 O O   . GLY B 1 144 ? 68.583  1.875   -46.210 1.00 64.70  ? 221 GLY B O   1 
ATOM   1754 N N   . ASP B 1 145 ? 68.610  3.421   -47.879 1.00 67.59  ? 222 ASP B N   1 
ATOM   1755 C CA  . ASP B 1 145 ? 69.963  3.946   -47.752 1.00 68.03  ? 222 ASP B CA  1 
ATOM   1756 C C   . ASP B 1 145 ? 70.431  4.358   -46.379 1.00 73.17  ? 222 ASP B C   1 
ATOM   1757 O O   . ASP B 1 145 ? 71.650  4.476   -46.199 1.00 72.21  ? 222 ASP B O   1 
ATOM   1758 C CB  . ASP B 1 145 ? 70.120  5.146   -48.687 1.00 72.00  ? 222 ASP B CB  1 
ATOM   1759 C CG  . ASP B 1 145 ? 71.052  4.904   -49.857 1.00 93.31  ? 222 ASP B CG  1 
ATOM   1760 O OD1 . ASP B 1 145 ? 71.099  3.753   -50.356 1.00 97.64  ? 222 ASP B OD1 1 
ATOM   1761 O OD2 . ASP B 1 145 ? 71.681  5.885   -50.331 1.00 100.02 ? 222 ASP B OD2 1 
ATOM   1762 N N   . GLU B 1 146 ? 69.484  4.636   -45.429 1.00 71.66  ? 223 GLU B N   1 
ATOM   1763 C CA  . GLU B 1 146 ? 69.747  5.125   -44.052 1.00 70.59  ? 223 GLU B CA  1 
ATOM   1764 C C   . GLU B 1 146 ? 70.737  4.289   -43.259 1.00 73.06  ? 223 GLU B C   1 
ATOM   1765 O O   . GLU B 1 146 ? 70.859  3.088   -43.517 1.00 74.75  ? 223 GLU B O   1 
ATOM   1766 C CB  . GLU B 1 146 ? 68.442  5.347   -43.271 1.00 71.84  ? 223 GLU B CB  1 
ATOM   1767 C CG  . GLU B 1 146 ? 67.680  6.585   -43.749 1.00 89.39  ? 223 GLU B CG  1 
ATOM   1768 C CD  . GLU B 1 146 ? 66.274  6.830   -43.230 1.00 121.64 ? 223 GLU B CD  1 
ATOM   1769 O OE1 . GLU B 1 146 ? 65.373  7.007   -44.085 1.00 109.67 ? 223 GLU B OE1 1 
ATOM   1770 O OE2 . GLU B 1 146 ? 66.082  6.921   -41.990 1.00 117.17 ? 223 GLU B OE2 1 
ATOM   1771 N N   . LEU B 1 147 ? 71.456  4.906   -42.320 1.00 66.10  ? 224 LEU B N   1 
ATOM   1772 C CA  . LEU B 1 147 ? 72.473  4.194   -41.548 1.00 65.21  ? 224 LEU B CA  1 
ATOM   1773 C C   . LEU B 1 147 ? 71.872  3.439   -40.400 1.00 65.98  ? 224 LEU B C   1 
ATOM   1774 O O   . LEU B 1 147 ? 70.974  3.967   -39.745 1.00 63.81  ? 224 LEU B O   1 
ATOM   1775 C CB  . LEU B 1 147 ? 73.542  5.145   -40.988 1.00 64.87  ? 224 LEU B CB  1 
ATOM   1776 C CG  . LEU B 1 147 ? 74.317  6.041   -41.939 1.00 70.67  ? 224 LEU B CG  1 
ATOM   1777 C CD1 . LEU B 1 147 ? 75.178  6.987   -41.132 1.00 68.49  ? 224 LEU B CD1 1 
ATOM   1778 C CD2 . LEU B 1 147 ? 75.185  5.224   -42.937 1.00 76.27  ? 224 LEU B CD2 1 
ATOM   1779 N N   . SER B 1 148 ? 72.403  2.226   -40.114 1.00 61.50  ? 225 SER B N   1 
ATOM   1780 C CA  . SER B 1 148 ? 71.943  1.388   -39.006 1.00 58.42  ? 225 SER B CA  1 
ATOM   1781 C C   . SER B 1 148 ? 72.468  1.944   -37.674 1.00 56.63  ? 225 SER B C   1 
ATOM   1782 O O   . SER B 1 148 ? 71.751  1.929   -36.660 1.00 55.61  ? 225 SER B O   1 
ATOM   1783 C CB  . SER B 1 148 ? 72.405  -0.049  -39.203 1.00 63.03  ? 225 SER B CB  1 
ATOM   1784 O OG  . SER B 1 148 ? 71.612  -0.965  -38.466 1.00 75.41  ? 225 SER B OG  1 
ATOM   1785 N N   . LEU B 1 149 ? 73.718  2.441   -37.691 1.00 48.61  ? 226 LEU B N   1 
ATOM   1786 C CA  . LEU B 1 149 ? 74.381  2.974   -36.509 1.00 45.08  ? 226 LEU B CA  1 
ATOM   1787 C C   . LEU B 1 149 ? 74.539  4.458   -36.671 1.00 49.34  ? 226 LEU B C   1 
ATOM   1788 O O   . LEU B 1 149 ? 75.066  4.926   -37.687 1.00 49.88  ? 226 LEU B O   1 
ATOM   1789 C CB  . LEU B 1 149 ? 75.737  2.276   -36.258 1.00 44.15  ? 226 LEU B CB  1 
ATOM   1790 C CG  . LEU B 1 149 ? 76.331  2.391   -34.881 1.00 47.06  ? 226 LEU B CG  1 
ATOM   1791 C CD1 . LEU B 1 149 ? 75.599  1.510   -33.873 1.00 46.88  ? 226 LEU B CD1 1 
ATOM   1792 C CD2 . LEU B 1 149 ? 77.772  2.066   -34.920 1.00 49.84  ? 226 LEU B CD2 1 
ATOM   1793 N N   . VAL B 1 150 ? 74.025  5.203   -35.688 1.00 45.18  ? 227 VAL B N   1 
ATOM   1794 C CA  . VAL B 1 150 ? 74.045  6.652   -35.733 1.00 45.21  ? 227 VAL B CA  1 
ATOM   1795 C C   . VAL B 1 150 ? 74.591  7.238   -34.480 1.00 47.88  ? 227 VAL B C   1 
ATOM   1796 O O   . VAL B 1 150 ? 74.269  6.763   -33.399 1.00 48.76  ? 227 VAL B O   1 
ATOM   1797 C CB  . VAL B 1 150 ? 72.683  7.289   -36.155 1.00 50.17  ? 227 VAL B CB  1 
ATOM   1798 C CG1 . VAL B 1 150 ? 72.294  6.857   -37.567 1.00 52.63  ? 227 VAL B CG1 1 
ATOM   1799 C CG2 . VAL B 1 150 ? 71.571  6.945   -35.192 1.00 49.33  ? 227 VAL B CG2 1 
ATOM   1800 N N   . THR B 1 151 ? 75.413  8.278   -34.616 1.00 42.77  ? 228 THR B N   1 
ATOM   1801 C CA  . THR B 1 151 ? 75.948  8.967   -33.462 1.00 41.16  ? 228 THR B CA  1 
ATOM   1802 C C   . THR B 1 151 ? 74.924  10.010  -33.065 1.00 46.33  ? 228 THR B C   1 
ATOM   1803 O O   . THR B 1 151 ? 74.634  10.923  -33.851 1.00 48.39  ? 228 THR B O   1 
ATOM   1804 C CB  . THR B 1 151 ? 77.308  9.558   -33.762 1.00 47.18  ? 228 THR B CB  1 
ATOM   1805 O OG1 . THR B 1 151 ? 78.177  8.504   -34.171 1.00 52.67  ? 228 THR B OG1 1 
ATOM   1806 C CG2 . THR B 1 151 ? 77.891  10.304  -32.564 1.00 42.46  ? 228 THR B CG2 1 
ATOM   1807 N N   . LEU B 1 152 ? 74.348  9.856   -31.867 1.00 40.54  ? 229 LEU B N   1 
ATOM   1808 C CA  . LEU B 1 152 ? 73.359  10.786  -31.339 1.00 39.28  ? 229 LEU B CA  1 
ATOM   1809 C C   . LEU B 1 152 ? 74.047  11.990  -30.778 1.00 40.24  ? 229 LEU B C   1 
ATOM   1810 O O   . LEU B 1 152 ? 73.722  13.110  -31.177 1.00 38.66  ? 229 LEU B O   1 
ATOM   1811 C CB  . LEU B 1 152 ? 72.467  10.121  -30.278 1.00 38.96  ? 229 LEU B CB  1 
ATOM   1812 C CG  . LEU B 1 152 ? 71.497  9.046   -30.788 1.00 44.51  ? 229 LEU B CG  1 
ATOM   1813 C CD1 . LEU B 1 152 ? 70.885  8.277   -29.623 1.00 44.02  ? 229 LEU B CD1 1 
ATOM   1814 C CD2 . LEU B 1 152 ? 70.431  9.641   -31.685 1.00 47.35  ? 229 LEU B CD2 1 
ATOM   1815 N N   . PHE B 1 153 ? 75.011  11.762  -29.856 1.00 37.35  ? 230 PHE B N   1 
ATOM   1816 C CA  . PHE B 1 153 ? 75.787  12.819  -29.184 1.00 36.47  ? 230 PHE B CA  1 
ATOM   1817 C C   . PHE B 1 153 ? 77.247  12.440  -29.191 1.00 40.54  ? 230 PHE B C   1 
ATOM   1818 O O   . PHE B 1 153 ? 77.567  11.261  -29.063 1.00 40.88  ? 230 PHE B O   1 
ATOM   1819 C CB  . PHE B 1 153 ? 75.276  13.106  -27.745 1.00 36.59  ? 230 PHE B CB  1 
ATOM   1820 C CG  . PHE B 1 153 ? 73.767  13.089  -27.655 1.00 38.68  ? 230 PHE B CG  1 
ATOM   1821 C CD1 . PHE B 1 153 ? 73.004  14.117  -28.215 1.00 41.50  ? 230 PHE B CD1 1 
ATOM   1822 C CD2 . PHE B 1 153 ? 73.098  11.981  -27.133 1.00 40.64  ? 230 PHE B CD2 1 
ATOM   1823 C CE1 . PHE B 1 153 ? 71.601  14.049  -28.217 1.00 42.08  ? 230 PHE B CE1 1 
ATOM   1824 C CE2 . PHE B 1 153 ? 71.692  11.923  -27.122 1.00 42.12  ? 230 PHE B CE2 1 
ATOM   1825 C CZ  . PHE B 1 153 ? 70.959  12.953  -27.662 1.00 40.44  ? 230 PHE B CZ  1 
ATOM   1826 N N   . ARG B 1 154 ? 78.127  13.438  -29.345 1.00 36.21  ? 231 ARG B N   1 
ATOM   1827 C CA  . ARG B 1 154 ? 79.578  13.285  -29.347 1.00 35.36  ? 231 ARG B CA  1 
ATOM   1828 C C   . ARG B 1 154 ? 80.249  14.410  -28.475 1.00 40.84  ? 231 ARG B C   1 
ATOM   1829 O O   . ARG B 1 154 ? 79.800  15.560  -28.514 1.00 39.76  ? 231 ARG B O   1 
ATOM   1830 C CB  . ARG B 1 154 ? 80.045  13.253  -30.807 1.00 32.41  ? 231 ARG B CB  1 
ATOM   1831 C CG  . ARG B 1 154 ? 81.508  13.565  -31.090 1.00 39.39  ? 231 ARG B CG  1 
ATOM   1832 C CD  . ARG B 1 154 ? 81.897  13.301  -32.545 1.00 29.67  ? 231 ARG B CD  1 
ATOM   1833 N NE  . ARG B 1 154 ? 81.099  14.078  -33.501 1.00 32.76  ? 231 ARG B NE  1 
ATOM   1834 C CZ  . ARG B 1 154 ? 81.546  15.104  -34.222 1.00 53.16  ? 231 ARG B CZ  1 
ATOM   1835 N NH1 . ARG B 1 154 ? 82.810  15.496  -34.122 1.00 45.81  ? 231 ARG B NH1 1 
ATOM   1836 N NH2 . ARG B 1 154 ? 80.743  15.719  -35.080 1.00 41.13  ? 231 ARG B NH2 1 
ATOM   1837 N N   . CYS B 1 155 ? 81.240  14.020  -27.615 1.00 37.83  ? 232 CYS B N   1 
ATOM   1838 C CA  . CYS B 1 155 ? 82.087  14.847  -26.727 1.00 36.87  ? 232 CYS B CA  1 
ATOM   1839 C C   . CYS B 1 155 ? 83.421  14.931  -27.389 1.00 43.96  ? 232 CYS B C   1 
ATOM   1840 O O   . CYS B 1 155 ? 83.870  13.924  -27.948 1.00 45.92  ? 232 CYS B O   1 
ATOM   1841 C CB  . CYS B 1 155 ? 82.322  14.175  -25.382 1.00 35.61  ? 232 CYS B CB  1 
ATOM   1842 S SG  A CYS B 1 155 ? 81.722  15.120  -23.967 0.30 38.67  ? 232 CYS B SG  1 
ATOM   1843 S SG  B CYS B 1 155 ? 80.903  13.396  -24.664 0.58 38.66  ? 232 CYS B SG  1 
ATOM   1844 N N   . ILE B 1 156 ? 84.178  15.993  -27.086 1.00 37.83  ? 233 ILE B N   1 
ATOM   1845 C CA  . ILE B 1 156 ? 85.577  16.104  -27.437 1.00 37.86  ? 233 ILE B CA  1 
ATOM   1846 C C   . ILE B 1 156 ? 86.218  16.978  -26.353 1.00 41.53  ? 233 ILE B C   1 
ATOM   1847 O O   . ILE B 1 156 ? 85.655  18.001  -25.945 1.00 43.01  ? 233 ILE B O   1 
ATOM   1848 C CB  . ILE B 1 156 ? 85.914  16.557  -28.902 1.00 43.10  ? 233 ILE B CB  1 
ATOM   1849 C CG1 . ILE B 1 156 ? 85.155  15.711  -29.985 1.00 43.88  ? 233 ILE B CG1 1 
ATOM   1850 C CG2 . ILE B 1 156 ? 87.437  16.491  -29.150 1.00 45.83  ? 233 ILE B CG2 1 
ATOM   1851 C CD1 . ILE B 1 156 ? 85.251  16.163  -31.444 1.00 52.58  ? 233 ILE B CD1 1 
ATOM   1852 N N   . GLN B 1 157 ? 87.368  16.540  -25.861 1.00 34.86  ? 234 GLN B N   1 
ATOM   1853 C CA  . GLN B 1 157 ? 88.182  17.244  -24.900 1.00 33.71  ? 234 GLN B CA  1 
ATOM   1854 C C   . GLN B 1 157 ? 89.612  17.195  -25.405 1.00 40.69  ? 234 GLN B C   1 
ATOM   1855 O O   . GLN B 1 157 ? 90.124  16.102  -25.703 1.00 41.56  ? 234 GLN B O   1 
ATOM   1856 C CB  . GLN B 1 157 ? 88.140  16.573  -23.508 1.00 32.94  ? 234 GLN B CB  1 
ATOM   1857 C CG  . GLN B 1 157 ? 86.966  16.954  -22.611 1.00 30.41  ? 234 GLN B CG  1 
ATOM   1858 C CD  . GLN B 1 157 ? 86.788  18.429  -22.351 1.00 49.84  ? 234 GLN B CD  1 
ATOM   1859 O OE1 . GLN B 1 157 ? 86.022  19.116  -23.043 1.00 45.54  ? 234 GLN B OE1 1 
ATOM   1860 N NE2 . GLN B 1 157 ? 87.440  18.937  -21.314 1.00 38.78  ? 234 GLN B NE2 1 
ATOM   1861 N N   . ASN B 1 158 ? 90.286  18.359  -25.451 1.00 36.46  ? 235 ASN B N   1 
ATOM   1862 C CA  . ASN B 1 158 ? 91.696  18.376  -25.801 1.00 37.44  ? 235 ASN B CA  1 
ATOM   1863 C C   . ASN B 1 158 ? 92.392  17.909  -24.544 1.00 45.07  ? 235 ASN B C   1 
ATOM   1864 O O   . ASN B 1 158 ? 91.852  18.092  -23.438 1.00 46.30  ? 235 ASN B O   1 
ATOM   1865 C CB  . ASN B 1 158 ? 92.184  19.781  -26.182 1.00 37.40  ? 235 ASN B CB  1 
ATOM   1866 C CG  . ASN B 1 158 ? 91.810  20.235  -27.564 1.00 51.01  ? 235 ASN B CG  1 
ATOM   1867 O OD1 . ASN B 1 158 ? 91.157  21.264  -27.718 1.00 43.72  ? 235 ASN B OD1 1 
ATOM   1868 N ND2 . ASN B 1 158 ? 92.219  19.488  -28.601 1.00 40.92  ? 235 ASN B ND2 1 
ATOM   1869 N N   . MET B 1 159 ? 93.561  17.280  -24.683 1.00 42.57  ? 236 MET B N   1 
ATOM   1870 C CA  . MET B 1 159 ? 94.284  16.759  -23.521 1.00 41.66  ? 236 MET B CA  1 
ATOM   1871 C C   . MET B 1 159 ? 95.688  17.356  -23.465 1.00 50.03  ? 236 MET B C   1 
ATOM   1872 O O   . MET B 1 159 ? 96.298  17.601  -24.517 1.00 51.92  ? 236 MET B O   1 
ATOM   1873 C CB  . MET B 1 159 ? 94.397  15.223  -23.590 1.00 43.50  ? 236 MET B CB  1 
ATOM   1874 C CG  . MET B 1 159 ? 93.096  14.488  -23.882 1.00 45.06  ? 236 MET B CG  1 
ATOM   1875 S SD  . MET B 1 159 ? 91.865  14.601  -22.605 1.00 47.76  ? 236 MET B SD  1 
ATOM   1876 C CE  . MET B 1 159 ? 92.726  13.802  -21.251 1.00 45.30  ? 236 MET B CE  1 
ATOM   1877 N N   . PRO B 1 160 ? 96.248  17.564  -22.257 1.00 47.57  ? 237 PRO B N   1 
ATOM   1878 C CA  . PRO B 1 160 ? 97.612  18.088  -22.181 1.00 49.36  ? 237 PRO B CA  1 
ATOM   1879 C C   . PRO B 1 160 ? 98.637  16.946  -22.238 1.00 57.75  ? 237 PRO B C   1 
ATOM   1880 O O   . PRO B 1 160 ? 98.292  15.790  -21.933 1.00 57.50  ? 237 PRO B O   1 
ATOM   1881 C CB  . PRO B 1 160 ? 97.625  18.790  -20.825 1.00 50.38  ? 237 PRO B CB  1 
ATOM   1882 C CG  . PRO B 1 160 ? 96.657  18.029  -19.984 1.00 52.63  ? 237 PRO B CG  1 
ATOM   1883 C CD  . PRO B 1 160 ? 95.682  17.342  -20.904 1.00 47.61  ? 237 PRO B CD  1 
ATOM   1884 N N   . GLU B 1 161 ? 99.901  17.258  -22.610 1.00 56.87  ? 238 GLU B N   1 
ATOM   1885 C CA  . GLU B 1 161 ? 100.930 16.228  -22.662 1.00 58.84  ? 238 GLU B CA  1 
ATOM   1886 C C   . GLU B 1 161 ? 101.228 15.701  -21.251 1.00 63.41  ? 238 GLU B C   1 
ATOM   1887 O O   . GLU B 1 161 ? 101.536 14.519  -21.079 1.00 63.90  ? 238 GLU B O   1 
ATOM   1888 C CB  . GLU B 1 161 ? 102.200 16.758  -23.334 1.00 63.43  ? 238 GLU B CB  1 
ATOM   1889 N N   . THR B 1 162 ? 101.069 16.565  -20.248 1.00 59.21  ? 239 THR B N   1 
ATOM   1890 C CA  . THR B 1 162 ? 101.358 16.267  -18.851 1.00 58.77  ? 239 THR B CA  1 
ATOM   1891 C C   . THR B 1 162 ? 100.100 16.104  -17.982 1.00 58.51  ? 239 THR B C   1 
ATOM   1892 O O   . THR B 1 162 ? 99.214  16.957  -17.998 1.00 56.24  ? 239 THR B O   1 
ATOM   1893 C CB  . THR B 1 162 ? 102.387 17.280  -18.299 1.00 68.10  ? 239 THR B CB  1 
ATOM   1894 O OG1 . THR B 1 162 ? 102.429 17.153  -16.882 1.00 73.95  ? 239 THR B OG1 1 
ATOM   1895 C CG2 . THR B 1 162 ? 102.067 18.744  -18.699 1.00 62.45  ? 239 THR B CG2 1 
ATOM   1896 N N   . LEU B 1 163 ? 100.075 15.028  -17.187 1.00 53.82  ? 240 LEU B N   1 
ATOM   1897 C CA  . LEU B 1 163 ? 99.003  14.665  -16.262 1.00 51.71  ? 240 LEU B CA  1 
ATOM   1898 C C   . LEU B 1 163 ? 97.596  14.778  -16.868 1.00 55.21  ? 240 LEU B C   1 
ATOM   1899 O O   . LEU B 1 163 ? 96.766  15.488  -16.297 1.00 56.25  ? 240 LEU B O   1 
ATOM   1900 C CB  . LEU B 1 163 ? 99.124  15.459  -14.949 1.00 51.60  ? 240 LEU B CB  1 
ATOM   1901 C CG  . LEU B 1 163 ? 100.382 15.210  -14.112 1.00 57.68  ? 240 LEU B CG  1 
ATOM   1902 C CD1 . LEU B 1 163 ? 100.624 16.349  -13.147 1.00 58.52  ? 240 LEU B CD1 1 
ATOM   1903 C CD2 . LEU B 1 163 ? 100.281 13.918  -13.343 1.00 57.72  ? 240 LEU B CD2 1 
ATOM   1904 N N   . PRO B 1 164 ? 97.289  14.122  -18.020 1.00 49.21  ? 241 PRO B N   1 
ATOM   1905 C CA  . PRO B 1 164 ? 95.955  14.284  -18.605 1.00 47.06  ? 241 PRO B CA  1 
ATOM   1906 C C   . PRO B 1 164 ? 94.869  13.688  -17.732 1.00 50.86  ? 241 PRO B C   1 
ATOM   1907 O O   . PRO B 1 164 ? 94.975  12.539  -17.307 1.00 52.41  ? 241 PRO B O   1 
ATOM   1908 C CB  . PRO B 1 164 ? 96.073  13.582  -19.959 1.00 49.11  ? 241 PRO B CB  1 
ATOM   1909 C CG  . PRO B 1 164 ? 97.137  12.594  -19.784 1.00 54.49  ? 241 PRO B CG  1 
ATOM   1910 C CD  . PRO B 1 164 ? 98.120  13.228  -18.852 1.00 51.43  ? 241 PRO B CD  1 
ATOM   1911 N N   . ASN B 1 165 ? 93.880  14.516  -17.387 1.00 44.97  ? 242 ASN B N   1 
ATOM   1912 C CA  . ASN B 1 165 ? 92.734  14.149  -16.555 1.00 42.24  ? 242 ASN B CA  1 
ATOM   1913 C C   . ASN B 1 165 ? 91.594  15.093  -16.933 1.00 41.10  ? 242 ASN B C   1 
ATOM   1914 O O   . ASN B 1 165 ? 91.526  16.218  -16.419 1.00 39.12  ? 242 ASN B O   1 
ATOM   1915 C CB  . ASN B 1 165 ? 93.052  14.285  -15.053 1.00 44.25  ? 242 ASN B CB  1 
ATOM   1916 C CG  . ASN B 1 165 ? 93.992  13.285  -14.477 1.00 56.55  ? 242 ASN B CG  1 
ATOM   1917 O OD1 . ASN B 1 165 ? 95.216  13.508  -14.430 1.00 47.84  ? 242 ASN B OD1 1 
ATOM   1918 N ND2 . ASN B 1 165 ? 93.422  12.207  -13.956 1.00 44.09  ? 242 ASN B ND2 1 
ATOM   1919 N N   . ASN B 1 166 ? 90.748  14.662  -17.886 1.00 35.83  ? 243 ASN B N   1 
ATOM   1920 C CA  . ASN B 1 166 ? 89.588  15.427  -18.345 1.00 33.91  ? 243 ASN B CA  1 
ATOM   1921 C C   . ASN B 1 166 ? 88.414  14.511  -18.453 1.00 35.17  ? 243 ASN B C   1 
ATOM   1922 O O   . ASN B 1 166 ? 88.484  13.500  -19.150 1.00 34.95  ? 243 ASN B O   1 
ATOM   1923 C CB  . ASN B 1 166 ? 89.819  16.123  -19.701 1.00 32.55  ? 243 ASN B CB  1 
ATOM   1924 C CG  . ASN B 1 166 ? 90.626  17.389  -19.649 1.00 62.61  ? 243 ASN B CG  1 
ATOM   1925 O OD1 . ASN B 1 166 ? 90.422  18.273  -18.802 1.00 49.32  ? 243 ASN B OD1 1 
ATOM   1926 N ND2 . ASN B 1 166 ? 91.516  17.537  -20.618 1.00 65.17  ? 243 ASN B ND2 1 
ATOM   1927 N N   . SER B 1 167 ? 87.344  14.839  -17.744 1.00 29.30  ? 244 SER B N   1 
ATOM   1928 C CA  . SER B 1 167 ? 86.110  14.085  -17.839 1.00 27.54  ? 244 SER B CA  1 
ATOM   1929 C C   . SER B 1 167 ? 85.254  14.825  -18.842 1.00 32.52  ? 244 SER B C   1 
ATOM   1930 O O   . SER B 1 167 ? 85.347  16.054  -18.952 1.00 33.76  ? 244 SER B O   1 
ATOM   1931 C CB  . SER B 1 167 ? 85.398  14.009  -16.490 1.00 30.75  ? 244 SER B CB  1 
ATOM   1932 O OG  . SER B 1 167 ? 85.016  15.268  -15.956 1.00 34.16  ? 244 SER B OG  1 
ATOM   1933 N N   . CYS B 1 168 ? 84.468  14.096  -19.622 1.00 28.17  ? 245 CYS B N   1 
ATOM   1934 C CA  . CYS B 1 168 ? 83.596  14.730  -20.596 1.00 26.41  ? 245 CYS B CA  1 
ATOM   1935 C C   . CYS B 1 168 ? 82.253  14.157  -20.490 1.00 32.39  ? 245 CYS B C   1 
ATOM   1936 O O   . CYS B 1 168 ? 82.072  12.940  -20.563 1.00 34.61  ? 245 CYS B O   1 
ATOM   1937 C CB  . CYS B 1 168 ? 84.133  14.640  -22.022 1.00 26.85  ? 245 CYS B CB  1 
ATOM   1938 S SG  A CYS B 1 168 ? 83.423  15.871  -23.152 0.30 31.00  ? 245 CYS B SG  1 
ATOM   1939 S SG  B CYS B 1 168 ? 83.511  15.936  -23.124 0.33 31.01  ? 245 CYS B SG  1 
ATOM   1940 N N   . TYR B 1 169 ? 81.295  15.035  -20.293 1.00 29.29  ? 246 TYR B N   1 
ATOM   1941 C CA  . TYR B 1 169 ? 79.886  14.698  -20.164 1.00 28.22  ? 246 TYR B CA  1 
ATOM   1942 C C   . TYR B 1 169 ? 79.131  15.262  -21.375 1.00 33.55  ? 246 TYR B C   1 
ATOM   1943 O O   . TYR B 1 169 ? 79.362  16.410  -21.791 1.00 35.86  ? 246 TYR B O   1 
ATOM   1944 C CB  . TYR B 1 169 ? 79.333  15.344  -18.882 1.00 28.36  ? 246 TYR B CB  1 
ATOM   1945 C CG  . TYR B 1 169 ? 77.866  15.081  -18.649 1.00 29.99  ? 246 TYR B CG  1 
ATOM   1946 C CD1 . TYR B 1 169 ? 76.892  15.889  -19.225 1.00 31.43  ? 246 TYR B CD1 1 
ATOM   1947 C CD2 . TYR B 1 169 ? 77.447  14.024  -17.841 1.00 30.27  ? 246 TYR B CD2 1 
ATOM   1948 C CE1 . TYR B 1 169 ? 75.536  15.636  -19.022 1.00 32.53  ? 246 TYR B CE1 1 
ATOM   1949 C CE2 . TYR B 1 169 ? 76.094  13.780  -17.611 1.00 29.93  ? 246 TYR B CE2 1 
ATOM   1950 C CZ  . TYR B 1 169 ? 75.142  14.596  -18.192 1.00 34.32  ? 246 TYR B CZ  1 
ATOM   1951 O OH  . TYR B 1 169 ? 73.811  14.345  -17.956 1.00 29.88  ? 246 TYR B OH  1 
ATOM   1952 N N   . SER B 1 170 ? 78.204  14.473  -21.899 1.00 28.33  ? 247 SER B N   1 
ATOM   1953 C CA  . SER B 1 170 ? 77.280  14.884  -22.941 1.00 28.20  ? 247 SER B CA  1 
ATOM   1954 C C   . SER B 1 170 ? 75.958  14.168  -22.727 1.00 34.24  ? 247 SER B C   1 
ATOM   1955 O O   . SER B 1 170 ? 75.942  13.018  -22.268 1.00 34.36  ? 247 SER B O   1 
ATOM   1956 C CB  . SER B 1 170 ? 77.824  14.609  -24.331 1.00 30.05  ? 247 SER B CB  1 
ATOM   1957 O OG  . SER B 1 170 ? 77.166  15.455  -25.260 1.00 40.00  ? 247 SER B OG  1 
ATOM   1958 N N   . ALA B 1 171 ? 74.854  14.851  -23.045 1.00 31.34  ? 248 ALA B N   1 
ATOM   1959 C CA  . ALA B 1 171 ? 73.525  14.287  -22.918 1.00 32.68  ? 248 ALA B CA  1 
ATOM   1960 C C   . ALA B 1 171 ? 72.554  15.010  -23.837 1.00 39.23  ? 248 ALA B C   1 
ATOM   1961 O O   . ALA B 1 171 ? 72.837  16.119  -24.275 1.00 41.22  ? 248 ALA B O   1 
ATOM   1962 C CB  . ALA B 1 171 ? 73.049  14.408  -21.478 1.00 33.75  ? 248 ALA B CB  1 
ATOM   1963 N N   . GLY B 1 172 ? 71.394  14.409  -24.069 1.00 34.56  ? 249 GLY B N   1 
ATOM   1964 C CA  . GLY B 1 172 ? 70.346  14.977  -24.907 1.00 34.01  ? 249 GLY B CA  1 
ATOM   1965 C C   . GLY B 1 172 ? 69.136  14.074  -24.950 1.00 37.57  ? 249 GLY B C   1 
ATOM   1966 O O   . GLY B 1 172 ? 69.109  13.013  -24.319 1.00 37.99  ? 249 GLY B O   1 
ATOM   1967 N N   . ILE B 1 173 ? 68.122  14.487  -25.680 1.00 32.69  ? 250 ILE B N   1 
ATOM   1968 C CA  . ILE B 1 173 ? 66.893  13.702  -25.809 1.00 30.60  ? 250 ILE B CA  1 
ATOM   1969 C C   . ILE B 1 173 ? 66.893  13.051  -27.191 1.00 36.85  ? 250 ILE B C   1 
ATOM   1970 O O   . ILE B 1 173 ? 67.374  13.667  -28.143 1.00 38.08  ? 250 ILE B O   1 
ATOM   1971 C CB  . ILE B 1 173 ? 65.630  14.573  -25.555 1.00 31.59  ? 250 ILE B CB  1 
ATOM   1972 C CG1 . ILE B 1 173 ? 65.700  15.232  -24.185 1.00 28.94  ? 250 ILE B CG1 1 
ATOM   1973 C CG2 . ILE B 1 173 ? 64.330  13.747  -25.714 1.00 33.02  ? 250 ILE B CG2 1 
ATOM   1974 C CD1 . ILE B 1 173 ? 64.692  16.295  -23.944 1.00 28.25  ? 250 ILE B CD1 1 
ATOM   1975 N N   . ALA B 1 174 ? 66.390  11.813  -27.305 1.00 32.46  ? 251 ALA B N   1 
ATOM   1976 C CA  . ALA B 1 174 ? 66.325  11.149  -28.604 1.00 33.02  ? 251 ALA B CA  1 
ATOM   1977 C C   . ALA B 1 174 ? 65.070  10.276  -28.654 1.00 39.94  ? 251 ALA B C   1 
ATOM   1978 O O   . ALA B 1 174 ? 64.782  9.604   -27.672 1.00 39.62  ? 251 ALA B O   1 
ATOM   1979 C CB  . ALA B 1 174 ? 67.580  10.308  -28.834 1.00 32.60  ? 251 ALA B CB  1 
ATOM   1980 N N   . LYS B 1 175 ? 64.280  10.339  -29.749 1.00 38.64  ? 252 LYS B N   1 
ATOM   1981 C CA  . LYS B 1 175 ? 63.114  9.472   -29.897 1.00 39.99  ? 252 LYS B CA  1 
ATOM   1982 C C   . LYS B 1 175 ? 63.663  8.114   -30.354 1.00 42.93  ? 252 LYS B C   1 
ATOM   1983 O O   . LYS B 1 175 ? 64.298  8.036   -31.404 1.00 40.42  ? 252 LYS B O   1 
ATOM   1984 C CB  . LYS B 1 175 ? 62.042  10.026  -30.873 1.00 45.07  ? 252 LYS B CB  1 
ATOM   1985 C CG  . LYS B 1 175 ? 62.502  11.153  -31.772 1.00 67.39  ? 252 LYS B CG  1 
ATOM   1986 N N   . LEU B 1 176 ? 63.533  7.084   -29.495 1.00 40.91  ? 253 LEU B N   1 
ATOM   1987 C CA  . LEU B 1 176 ? 63.997  5.708   -29.756 1.00 40.27  ? 253 LEU B CA  1 
ATOM   1988 C C   . LEU B 1 176 ? 62.782  4.768   -29.925 1.00 46.95  ? 253 LEU B C   1 
ATOM   1989 O O   . LEU B 1 176 ? 61.686  5.062   -29.415 1.00 46.63  ? 253 LEU B O   1 
ATOM   1990 C CB  . LEU B 1 176 ? 64.936  5.197   -28.644 1.00 38.23  ? 253 LEU B CB  1 
ATOM   1991 C CG  . LEU B 1 176 ? 66.061  6.148   -28.161 1.00 40.58  ? 253 LEU B CG  1 
ATOM   1992 C CD1 . LEU B 1 176 ? 66.807  5.566   -26.956 1.00 38.44  ? 253 LEU B CD1 1 
ATOM   1993 C CD2 . LEU B 1 176 ? 67.063  6.450   -29.271 1.00 43.31  ? 253 LEU B CD2 1 
ATOM   1994 N N   . GLU B 1 177 ? 62.981  3.681   -30.705 1.00 43.91  ? 254 GLU B N   1 
ATOM   1995 C CA  . GLU B 1 177 ? 62.003  2.641   -31.025 1.00 44.72  ? 254 GLU B CA  1 
ATOM   1996 C C   . GLU B 1 177 ? 62.342  1.343   -30.302 1.00 49.21  ? 254 GLU B C   1 
ATOM   1997 O O   . GLU B 1 177 ? 63.518  1.010   -30.106 1.00 47.51  ? 254 GLU B O   1 
ATOM   1998 C CB  . GLU B 1 177 ? 62.024  2.356   -32.512 1.00 47.76  ? 254 GLU B CB  1 
ATOM   1999 C CG  . GLU B 1 177 ? 61.100  3.219   -33.331 1.00 64.11  ? 254 GLU B CG  1 
ATOM   2000 C CD  . GLU B 1 177 ? 61.425  3.093   -34.805 1.00 84.96  ? 254 GLU B CD  1 
ATOM   2001 O OE1 . GLU B 1 177 ? 62.330  3.813   -35.279 1.00 75.85  ? 254 GLU B OE1 1 
ATOM   2002 O OE2 . GLU B 1 177 ? 60.822  2.226   -35.473 1.00 83.59  ? 254 GLU B OE2 1 
ATOM   2003 N N   . GLU B 1 178 ? 61.305  0.588   -29.936 1.00 47.98  ? 255 GLU B N   1 
ATOM   2004 C CA  . GLU B 1 178 ? 61.422  -0.709  -29.255 1.00 48.17  ? 255 GLU B CA  1 
ATOM   2005 C C   . GLU B 1 178 ? 62.299  -1.621  -30.098 1.00 51.57  ? 255 GLU B C   1 
ATOM   2006 O O   . GLU B 1 178 ? 61.994  -1.840  -31.276 1.00 53.33  ? 255 GLU B O   1 
ATOM   2007 C CB  . GLU B 1 178 ? 60.008  -1.263  -29.055 1.00 51.15  ? 255 GLU B CB  1 
ATOM   2008 C CG  . GLU B 1 178 ? 59.844  -2.740  -28.835 1.00 63.66  ? 255 GLU B CG  1 
ATOM   2009 C CD  . GLU B 1 178 ? 58.388  -3.181  -28.884 1.00 92.58  ? 255 GLU B CD  1 
ATOM   2010 O OE1 . GLU B 1 178 ? 57.618  -2.695  -29.750 1.00 79.38  ? 255 GLU B OE1 1 
ATOM   2011 O OE2 . GLU B 1 178 ? 58.032  -4.068  -28.081 1.00 94.75  ? 255 GLU B OE2 1 
ATOM   2012 N N   . GLY B 1 179 ? 63.419  -2.057  -29.527 1.00 45.25  ? 256 GLY B N   1 
ATOM   2013 C CA  . GLY B 1 179 ? 64.375  -2.902  -30.230 1.00 45.49  ? 256 GLY B CA  1 
ATOM   2014 C C   . GLY B 1 179 ? 65.701  -2.234  -30.509 1.00 49.43  ? 256 GLY B C   1 
ATOM   2015 O O   . GLY B 1 179 ? 66.684  -2.928  -30.790 1.00 50.62  ? 256 GLY B O   1 
ATOM   2016 N N   . ASP B 1 180 ? 65.738  -0.879  -30.454 1.00 44.83  ? 257 ASP B N   1 
ATOM   2017 C CA  . ASP B 1 180 ? 66.984  -0.117  -30.615 1.00 43.79  ? 257 ASP B CA  1 
ATOM   2018 C C   . ASP B 1 180 ? 67.932  -0.412  -29.441 1.00 46.18  ? 257 ASP B C   1 
ATOM   2019 O O   . ASP B 1 180 ? 67.489  -0.808  -28.350 1.00 45.60  ? 257 ASP B O   1 
ATOM   2020 C CB  . ASP B 1 180 ? 66.729  1.405   -30.666 1.00 44.37  ? 257 ASP B CB  1 
ATOM   2021 C CG  . ASP B 1 180 ? 66.004  1.910   -31.885 1.00 50.83  ? 257 ASP B CG  1 
ATOM   2022 O OD1 . ASP B 1 180 ? 65.944  1.166   -32.891 1.00 56.21  ? 257 ASP B OD1 1 
ATOM   2023 O OD2 . ASP B 1 180 ? 65.484  3.051   -31.833 1.00 47.31  ? 257 ASP B OD2 1 
ATOM   2024 N N   . GLU B 1 181 ? 69.234  -0.239  -29.683 1.00 40.73  ? 258 GLU B N   1 
ATOM   2025 C CA  . GLU B 1 181 ? 70.258  -0.422  -28.668 1.00 38.99  ? 258 GLU B CA  1 
ATOM   2026 C C   . GLU B 1 181 ? 71.127  0.812   -28.616 1.00 41.71  ? 258 GLU B C   1 
ATOM   2027 O O   . GLU B 1 181 ? 71.365  1.433   -29.662 1.00 43.11  ? 258 GLU B O   1 
ATOM   2028 C CB  . GLU B 1 181 ? 71.093  -1.671  -28.943 1.00 40.61  ? 258 GLU B CB  1 
ATOM   2029 C CG  . GLU B 1 181 ? 70.359  -2.952  -28.598 1.00 43.49  ? 258 GLU B CG  1 
ATOM   2030 C CD  . GLU B 1 181 ? 70.979  -4.206  -29.175 1.00 64.60  ? 258 GLU B CD  1 
ATOM   2031 O OE1 . GLU B 1 181 ? 72.181  -4.167  -29.529 1.00 41.63  ? 258 GLU B OE1 1 
ATOM   2032 O OE2 . GLU B 1 181 ? 70.259  -5.228  -29.282 1.00 70.03  ? 258 GLU B OE2 1 
ATOM   2033 N N   . LEU B 1 182 ? 71.571  1.189   -27.408 1.00 35.41  ? 259 LEU B N   1 
ATOM   2034 C CA  . LEU B 1 182 ? 72.461  2.331   -27.211 1.00 34.77  ? 259 LEU B CA  1 
ATOM   2035 C C   . LEU B 1 182 ? 73.843  1.854   -26.757 1.00 40.68  ? 259 LEU B C   1 
ATOM   2036 O O   . LEU B 1 182 ? 73.943  0.903   -25.977 1.00 38.77  ? 259 LEU B O   1 
ATOM   2037 C CB  . LEU B 1 182 ? 71.900  3.295   -26.176 1.00 33.75  ? 259 LEU B CB  1 
ATOM   2038 C CG  . LEU B 1 182 ? 70.561  3.936   -26.473 1.00 38.12  ? 259 LEU B CG  1 
ATOM   2039 C CD1 . LEU B 1 182 ? 70.073  4.706   -25.251 1.00 37.75  ? 259 LEU B CD1 1 
ATOM   2040 C CD2 . LEU B 1 182 ? 70.643  4.832   -27.687 1.00 38.46  ? 259 LEU B CD2 1 
ATOM   2041 N N   . GLN B 1 183 ? 74.903  2.506   -27.256 1.00 39.60  ? 260 GLN B N   1 
ATOM   2042 C CA  . GLN B 1 183 ? 76.283  2.181   -26.898 1.00 39.99  ? 260 GLN B CA  1 
ATOM   2043 C C   . GLN B 1 183 ? 77.174  3.412   -26.834 1.00 42.72  ? 260 GLN B C   1 
ATOM   2044 O O   . GLN B 1 183 ? 76.958  4.381   -27.576 1.00 43.38  ? 260 GLN B O   1 
ATOM   2045 C CB  . GLN B 1 183 ? 76.887  1.141   -27.862 1.00 43.28  ? 260 GLN B CB  1 
ATOM   2046 C CG  . GLN B 1 183 ? 77.093  1.620   -29.305 1.00 61.26  ? 260 GLN B CG  1 
ATOM   2047 C CD  . GLN B 1 183 ? 77.895  0.632   -30.126 1.00 78.38  ? 260 GLN B CD  1 
ATOM   2048 O OE1 . GLN B 1 183 ? 77.824  -0.583  -29.929 1.00 68.23  ? 260 GLN B OE1 1 
ATOM   2049 N NE2 . GLN B 1 183 ? 78.677  1.132   -31.072 1.00 75.22  ? 260 GLN B NE2 1 
ATOM   2050 N N   . LEU B 1 184 ? 78.184  3.355   -25.960 1.00 36.16  ? 261 LEU B N   1 
ATOM   2051 C CA  . LEU B 1 184 ? 79.170  4.409   -25.801 1.00 34.82  ? 261 LEU B CA  1 
ATOM   2052 C C   . LEU B 1 184 ? 80.481  3.854   -26.402 1.00 40.04  ? 261 LEU B C   1 
ATOM   2053 O O   . LEU B 1 184 ? 81.008  2.836   -25.942 1.00 40.28  ? 261 LEU B O   1 
ATOM   2054 C CB  . LEU B 1 184 ? 79.311  4.779   -24.308 1.00 33.20  ? 261 LEU B CB  1 
ATOM   2055 C CG  . LEU B 1 184 ? 80.111  6.033   -23.969 1.00 35.06  ? 261 LEU B CG  1 
ATOM   2056 C CD1 . LEU B 1 184 ? 79.565  6.700   -22.723 1.00 33.96  ? 261 LEU B CD1 1 
ATOM   2057 C CD2 . LEU B 1 184 ? 81.595  5.724   -23.814 1.00 31.01  ? 261 LEU B CD2 1 
ATOM   2058 N N   . ALA B 1 185 ? 80.969  4.503   -27.447 1.00 36.76  ? 262 ALA B N   1 
ATOM   2059 C CA  . ALA B 1 185 ? 82.177  4.097   -28.160 1.00 36.95  ? 262 ALA B CA  1 
ATOM   2060 C C   . ALA B 1 185 ? 83.245  5.204   -28.128 1.00 36.98  ? 262 ALA B C   1 
ATOM   2061 O O   . ALA B 1 185 ? 82.930  6.368   -28.390 1.00 33.31  ? 262 ALA B O   1 
ATOM   2062 C CB  . ALA B 1 185 ? 81.818  3.759   -29.615 1.00 38.83  ? 262 ALA B CB  1 
ATOM   2063 N N   . ILE B 1 186 ? 84.503  4.834   -27.846 1.00 35.22  ? 263 ILE B N   1 
ATOM   2064 C CA  . ILE B 1 186 ? 85.615  5.794   -27.860 1.00 36.52  ? 263 ILE B CA  1 
ATOM   2065 C C   . ILE B 1 186 ? 86.403  5.600   -29.170 1.00 45.05  ? 263 ILE B C   1 
ATOM   2066 O O   . ILE B 1 186 ? 87.054  4.553   -29.318 1.00 48.22  ? 263 ILE B O   1 
ATOM   2067 C CB  . ILE B 1 186 ? 86.524  5.712   -26.605 1.00 38.40  ? 263 ILE B CB  1 
ATOM   2068 C CG1 . ILE B 1 186 ? 85.718  6.029   -25.340 1.00 35.61  ? 263 ILE B CG1 1 
ATOM   2069 C CG2 . ILE B 1 186 ? 87.729  6.675   -26.761 1.00 39.36  ? 263 ILE B CG2 1 
ATOM   2070 C CD1 . ILE B 1 186 ? 86.228  5.382   -24.086 1.00 35.70  ? 263 ILE B CD1 1 
ATOM   2071 N N   . PRO B 1 187 ? 86.335  6.552   -30.137 1.00 40.02  ? 264 PRO B N   1 
ATOM   2072 C CA  . PRO B 1 187 ? 87.032  6.344   -31.421 1.00 41.82  ? 264 PRO B CA  1 
ATOM   2073 C C   . PRO B 1 187 ? 88.536  6.533   -31.339 1.00 47.11  ? 264 PRO B C   1 
ATOM   2074 O O   . PRO B 1 187 ? 89.106  7.366   -32.045 1.00 48.97  ? 264 PRO B O   1 
ATOM   2075 C CB  . PRO B 1 187 ? 86.352  7.339   -32.382 1.00 43.62  ? 264 PRO B CB  1 
ATOM   2076 C CG  . PRO B 1 187 ? 85.317  8.074   -31.575 1.00 45.25  ? 264 PRO B CG  1 
ATOM   2077 C CD  . PRO B 1 187 ? 85.587  7.819   -30.132 1.00 39.85  ? 264 PRO B CD  1 
ATOM   2078 N N   . ARG B 1 188 ? 89.178  5.768   -30.451 1.00 42.46  ? 265 ARG B N   1 
ATOM   2079 C CA  . ARG B 1 188 ? 90.624  5.797   -30.233 1.00 43.09  ? 265 ARG B CA  1 
ATOM   2080 C C   . ARG B 1 188 ? 91.071  4.401   -29.840 1.00 49.24  ? 265 ARG B C   1 
ATOM   2081 O O   . ARG B 1 188 ? 90.422  3.769   -29.008 1.00 46.21  ? 265 ARG B O   1 
ATOM   2082 C CB  . ARG B 1 188 ? 91.006  6.794   -29.126 1.00 38.50  ? 265 ARG B CB  1 
ATOM   2083 C CG  . ARG B 1 188 ? 90.474  8.214   -29.295 1.00 42.45  ? 265 ARG B CG  1 
ATOM   2084 C CD  . ARG B 1 188 ? 91.589  9.092   -29.747 1.00 49.63  ? 265 ARG B CD  1 
ATOM   2085 N NE  . ARG B 1 188 ? 91.221  10.463  -30.085 1.00 53.46  ? 265 ARG B NE  1 
ATOM   2086 C CZ  . ARG B 1 188 ? 90.774  10.861  -31.276 1.00 75.94  ? 265 ARG B CZ  1 
ATOM   2087 N NH1 . ARG B 1 188 ? 90.465  9.972   -32.212 1.00 60.25  ? 265 ARG B NH1 1 
ATOM   2088 N NH2 . ARG B 1 188 ? 90.566  12.150  -31.516 1.00 73.40  ? 265 ARG B NH2 1 
ATOM   2089 N N   . GLU B 1 189 ? 92.152  3.898   -30.477 1.00 50.86  ? 266 GLU B N   1 
ATOM   2090 C CA  . GLU B 1 189 ? 92.710  2.593   -30.151 1.00 52.26  ? 266 GLU B CA  1 
ATOM   2091 C C   . GLU B 1 189 ? 93.352  2.685   -28.798 1.00 56.16  ? 266 GLU B C   1 
ATOM   2092 O O   . GLU B 1 189 ? 94.035  3.670   -28.512 1.00 55.16  ? 266 GLU B O   1 
ATOM   2093 C CB  . GLU B 1 189 ? 93.772  2.181   -31.159 1.00 56.44  ? 266 GLU B CB  1 
ATOM   2094 C CG  . GLU B 1 189 ? 93.220  1.626   -32.452 1.00 73.12  ? 266 GLU B CG  1 
ATOM   2095 C CD  . GLU B 1 189 ? 94.283  1.403   -33.509 1.00 108.81 ? 266 GLU B CD  1 
ATOM   2096 O OE1 . GLU B 1 189 ? 95.300  0.737   -33.203 1.00 106.19 ? 266 GLU B OE1 1 
ATOM   2097 O OE2 . GLU B 1 189 ? 94.100  1.905   -34.642 1.00 105.28 ? 266 GLU B OE2 1 
ATOM   2098 N N   . ASN B 1 190 ? 93.099  1.669   -27.963 1.00 53.57  ? 267 ASN B N   1 
ATOM   2099 C CA  . ASN B 1 190 ? 93.625  1.519   -26.602 1.00 53.20  ? 267 ASN B CA  1 
ATOM   2100 C C   . ASN B 1 190 ? 93.583  2.809   -25.808 1.00 55.10  ? 267 ASN B C   1 
ATOM   2101 O O   . ASN B 1 190 ? 94.609  3.290   -25.308 1.00 56.36  ? 267 ASN B O   1 
ATOM   2102 C CB  . ASN B 1 190 ? 94.997  0.809   -26.567 1.00 54.11  ? 267 ASN B CB  1 
ATOM   2103 C CG  . ASN B 1 190 ? 95.526  0.544   -25.176 1.00 88.61  ? 267 ASN B CG  1 
ATOM   2104 O OD1 . ASN B 1 190 ? 96.731  0.653   -24.935 1.00 90.38  ? 267 ASN B OD1 1 
ATOM   2105 N ND2 . ASN B 1 190 ? 94.635  0.298   -24.204 1.00 81.00  ? 267 ASN B ND2 1 
ATOM   2106 N N   . ALA B 1 191 ? 92.373  3.375   -25.726 1.00 47.70  ? 268 ALA B N   1 
ATOM   2107 C CA  . ALA B 1 191 ? 92.103  4.606   -25.009 1.00 45.07  ? 268 ALA B CA  1 
ATOM   2108 C C   . ALA B 1 191 ? 92.446  4.450   -23.527 1.00 46.73  ? 268 ALA B C   1 
ATOM   2109 O O   . ALA B 1 191 ? 92.192  3.390   -22.936 1.00 47.04  ? 268 ALA B O   1 
ATOM   2110 C CB  . ALA B 1 191 ? 90.648  4.987   -25.180 1.00 43.85  ? 268 ALA B CB  1 
ATOM   2111 N N   . GLN B 1 192 ? 93.099  5.470   -22.965 1.00 40.36  ? 269 GLN B N   1 
ATOM   2112 C CA  . GLN B 1 192 ? 93.495  5.511   -21.561 1.00 38.60  ? 269 GLN B CA  1 
ATOM   2113 C C   . GLN B 1 192 ? 92.429  6.267   -20.812 1.00 41.65  ? 269 GLN B C   1 
ATOM   2114 O O   . GLN B 1 192 ? 92.295  7.493   -20.952 1.00 41.37  ? 269 GLN B O   1 
ATOM   2115 C CB  . GLN B 1 192 ? 94.857  6.183   -21.398 1.00 40.76  ? 269 GLN B CB  1 
ATOM   2116 C CG  . GLN B 1 192 ? 95.957  5.505   -22.183 1.00 46.59  ? 269 GLN B CG  1 
ATOM   2117 C CD  . GLN B 1 192 ? 96.144  4.069   -21.785 1.00 44.63  ? 269 GLN B CD  1 
ATOM   2118 O OE1 . GLN B 1 192 ? 96.680  3.768   -20.714 1.00 31.34  ? 269 GLN B OE1 1 
ATOM   2119 N NE2 . GLN B 1 192 ? 95.727  3.165   -22.658 1.00 30.96  ? 269 GLN B NE2 1 
ATOM   2120 N N   . ILE B 1 193 ? 91.613  5.525   -20.076 1.00 37.64  ? 270 ILE B N   1 
ATOM   2121 C CA  . ILE B 1 193 ? 90.469  6.092   -19.354 1.00 36.32  ? 270 ILE B CA  1 
ATOM   2122 C C   . ILE B 1 193 ? 90.403  5.597   -17.910 1.00 39.73  ? 270 ILE B C   1 
ATOM   2123 O O   . ILE B 1 193 ? 91.045  4.622   -17.594 1.00 41.12  ? 270 ILE B O   1 
ATOM   2124 C CB  . ILE B 1 193 ? 89.136  5.779   -20.135 1.00 38.34  ? 270 ILE B CB  1 
ATOM   2125 C CG1 . ILE B 1 193 ? 88.875  4.255   -20.206 1.00 37.79  ? 270 ILE B CG1 1 
ATOM   2126 C CG2 . ILE B 1 193 ? 89.136  6.422   -21.555 1.00 39.48  ? 270 ILE B CG2 1 
ATOM   2127 C CD1 . ILE B 1 193 ? 87.527  3.879   -20.439 1.00 37.50  ? 270 ILE B CD1 1 
ATOM   2128 N N   . SER B 1 194 ? 89.608  6.245   -17.045 1.00 35.17  ? 271 SER B N   1 
ATOM   2129 C CA  . SER B 1 194 ? 89.410  5.798   -15.672 1.00 33.82  ? 271 SER B CA  1 
ATOM   2130 C C   . SER B 1 194 ? 88.177  4.924   -15.624 1.00 39.63  ? 271 SER B C   1 
ATOM   2131 O O   . SER B 1 194 ? 87.131  5.286   -16.182 1.00 38.37  ? 271 SER B O   1 
ATOM   2132 C CB  . SER B 1 194 ? 89.255  6.969   -14.718 1.00 34.20  ? 271 SER B CB  1 
ATOM   2133 O OG  . SER B 1 194 ? 88.925  6.517   -13.411 1.00 43.59  ? 271 SER B OG  1 
ATOM   2134 N N   . LEU B 1 195 ? 88.298  3.757   -14.966 1.00 37.34  ? 272 LEU B N   1 
ATOM   2135 C CA  . LEU B 1 195 ? 87.168  2.841   -14.868 1.00 35.24  ? 272 LEU B CA  1 
ATOM   2136 C C   . LEU B 1 195 ? 86.450  2.939   -13.528 1.00 39.67  ? 272 LEU B C   1 
ATOM   2137 O O   . LEU B 1 195 ? 85.835  1.971   -13.097 1.00 40.61  ? 272 LEU B O   1 
ATOM   2138 C CB  . LEU B 1 195 ? 87.583  1.403   -15.232 1.00 35.09  ? 272 LEU B CB  1 
ATOM   2139 C CG  . LEU B 1 195 ? 87.999  1.151   -16.695 1.00 37.72  ? 272 LEU B CG  1 
ATOM   2140 C CD1 . LEU B 1 195 ? 88.291  -0.248  -16.886 1.00 37.09  ? 272 LEU B CD1 1 
ATOM   2141 C CD2 . LEU B 1 195 ? 86.912  1.536   -17.691 1.00 39.18  ? 272 LEU B CD2 1 
ATOM   2142 N N   . ASP B 1 196 ? 86.500  4.123   -12.882 1.00 35.63  ? 273 ASP B N   1 
ATOM   2143 C CA  . ASP B 1 196 ? 85.814  4.364   -11.618 1.00 35.33  ? 273 ASP B CA  1 
ATOM   2144 C C   . ASP B 1 196 ? 84.349  4.755   -11.882 1.00 37.87  ? 273 ASP B C   1 
ATOM   2145 O O   . ASP B 1 196 ? 84.080  5.652   -12.683 1.00 37.26  ? 273 ASP B O   1 
ATOM   2146 C CB  . ASP B 1 196 ? 86.556  5.439   -10.804 1.00 37.95  ? 273 ASP B CB  1 
ATOM   2147 C CG  . ASP B 1 196 ? 87.959  5.042   -10.338 1.00 48.12  ? 273 ASP B CG  1 
ATOM   2148 O OD1 . ASP B 1 196 ? 88.194  3.811   -10.099 1.00 45.85  ? 273 ASP B OD1 1 
ATOM   2149 O OD2 . ASP B 1 196 ? 88.802  5.960   -10.150 1.00 50.14  ? 273 ASP B OD2 1 
ATOM   2150 N N   . GLY B 1 197 ? 83.426  4.069   -11.224 1.00 34.18  ? 274 GLY B N   1 
ATOM   2151 C CA  . GLY B 1 197 ? 81.990  4.283   -11.384 1.00 34.21  ? 274 GLY B CA  1 
ATOM   2152 C C   . GLY B 1 197 ? 81.432  5.685   -11.191 1.00 39.81  ? 274 GLY B C   1 
ATOM   2153 O O   . GLY B 1 197 ? 80.379  6.008   -11.754 1.00 40.79  ? 274 GLY B O   1 
ATOM   2154 N N   . ASP B 1 198 ? 82.119  6.532   -10.402 1.00 36.59  ? 275 ASP B N   1 
ATOM   2155 C CA  . ASP B 1 198 ? 81.728  7.930   -10.131 1.00 35.80  ? 275 ASP B CA  1 
ATOM   2156 C C   . ASP B 1 198 ? 82.196  8.878   -11.215 1.00 38.87  ? 275 ASP B C   1 
ATOM   2157 O O   . ASP B 1 198 ? 81.833  10.047  -11.222 1.00 40.31  ? 275 ASP B O   1 
ATOM   2158 C CB  . ASP B 1 198 ? 82.313  8.402   -8.775  1.00 38.17  ? 275 ASP B CB  1 
ATOM   2159 C CG  . ASP B 1 198 ? 83.832  8.383   -8.651  1.00 44.18  ? 275 ASP B CG  1 
ATOM   2160 O OD1 . ASP B 1 198 ? 84.474  7.557   -9.326  1.00 44.91  ? 275 ASP B OD1 1 
ATOM   2161 O OD2 . ASP B 1 198 ? 84.370  9.138   -7.815  1.00 48.14  ? 275 ASP B OD2 1 
ATOM   2162 N N   . VAL B 1 199 ? 83.007  8.381   -12.132 1.00 34.09  ? 276 VAL B N   1 
ATOM   2163 C CA  . VAL B 1 199 ? 83.647  9.185   -13.147 1.00 32.73  ? 276 VAL B CA  1 
ATOM   2164 C C   . VAL B 1 199 ? 83.347  8.743   -14.592 1.00 34.38  ? 276 VAL B C   1 
ATOM   2165 O O   . VAL B 1 199 ? 83.334  9.588   -15.482 1.00 34.17  ? 276 VAL B O   1 
ATOM   2166 C CB  . VAL B 1 199 ? 85.140  9.228   -12.727 1.00 36.74  ? 276 VAL B CB  1 
ATOM   2167 C CG1 . VAL B 1 199 ? 86.017  8.282   -13.510 1.00 36.87  ? 276 VAL B CG1 1 
ATOM   2168 C CG2 . VAL B 1 199 ? 85.685  10.633  -12.679 1.00 36.99  ? 276 VAL B CG2 1 
ATOM   2169 N N   . THR B 1 200 ? 83.065  7.439   -14.806 1.00 29.92  ? 277 THR B N   1 
ATOM   2170 C CA  . THR B 1 200 ? 82.736  6.843   -16.106 1.00 29.61  ? 277 THR B CA  1 
ATOM   2171 C C   . THR B 1 200 ? 81.420  6.100   -15.970 1.00 34.59  ? 277 THR B C   1 
ATOM   2172 O O   . THR B 1 200 ? 81.341  5.084   -15.290 1.00 36.00  ? 277 THR B O   1 
ATOM   2173 C CB  . THR B 1 200 ? 83.890  6.001   -16.623 1.00 31.35  ? 277 THR B CB  1 
ATOM   2174 O OG1 . THR B 1 200 ? 85.045  6.836   -16.743 1.00 29.50  ? 277 THR B OG1 1 
ATOM   2175 C CG2 . THR B 1 200 ? 83.579  5.337   -17.970 1.00 27.32  ? 277 THR B CG2 1 
ATOM   2176 N N   . PHE B 1 201 ? 80.374  6.650   -16.561 1.00 30.99  ? 278 PHE B N   1 
ATOM   2177 C CA  . PHE B 1 201 ? 79.015  6.125   -16.451 1.00 30.79  ? 278 PHE B CA  1 
ATOM   2178 C C   . PHE B 1 201 ? 78.194  6.454   -17.690 1.00 35.03  ? 278 PHE B C   1 
ATOM   2179 O O   . PHE B 1 201 ? 78.596  7.317   -18.482 1.00 36.10  ? 278 PHE B O   1 
ATOM   2180 C CB  . PHE B 1 201 ? 78.334  6.638   -15.164 1.00 32.22  ? 278 PHE B CB  1 
ATOM   2181 C CG  . PHE B 1 201 ? 78.344  8.141   -14.978 1.00 32.77  ? 278 PHE B CG  1 
ATOM   2182 C CD1 . PHE B 1 201 ? 79.341  8.762   -14.232 1.00 34.93  ? 278 PHE B CD1 1 
ATOM   2183 C CD2 . PHE B 1 201 ? 77.381  8.938   -15.581 1.00 33.52  ? 278 PHE B CD2 1 
ATOM   2184 C CE1 . PHE B 1 201 ? 79.359  10.155  -14.083 1.00 34.95  ? 278 PHE B CE1 1 
ATOM   2185 C CE2 . PHE B 1 201 ? 77.406  10.331  -15.427 1.00 34.54  ? 278 PHE B CE2 1 
ATOM   2186 C CZ  . PHE B 1 201 ? 78.389  10.925  -14.676 1.00 32.24  ? 278 PHE B CZ  1 
ATOM   2187 N N   . PHE B 1 202 ? 77.073  5.737   -17.877 1.00 29.10  ? 279 PHE B N   1 
ATOM   2188 C CA  . PHE B 1 202 ? 76.218  5.806   -19.061 1.00 28.03  ? 279 PHE B CA  1 
ATOM   2189 C C   . PHE B 1 202 ? 74.806  5.414   -18.653 1.00 35.21  ? 279 PHE B C   1 
ATOM   2190 O O   . PHE B 1 202 ? 74.615  4.395   -17.976 1.00 37.62  ? 279 PHE B O   1 
ATOM   2191 C CB  . PHE B 1 202 ? 76.787  4.845   -20.116 1.00 29.89  ? 279 PHE B CB  1 
ATOM   2192 C CG  . PHE B 1 202 ? 76.072  4.658   -21.435 1.00 32.88  ? 279 PHE B CG  1 
ATOM   2193 C CD1 . PHE B 1 202 ? 75.539  5.749   -22.123 1.00 36.70  ? 279 PHE B CD1 1 
ATOM   2194 C CD2 . PHE B 1 202 ? 76.021  3.406   -22.048 1.00 35.58  ? 279 PHE B CD2 1 
ATOM   2195 C CE1 . PHE B 1 202 ? 74.912  5.581   -23.378 1.00 37.33  ? 279 PHE B CE1 1 
ATOM   2196 C CE2 . PHE B 1 202 ? 75.396  3.242   -23.292 1.00 39.33  ? 279 PHE B CE2 1 
ATOM   2197 C CZ  . PHE B 1 202 ? 74.840  4.331   -23.948 1.00 36.98  ? 279 PHE B CZ  1 
ATOM   2198 N N   . GLY B 1 203 ? 73.828  6.242   -19.013 1.00 29.88  ? 280 GLY B N   1 
ATOM   2199 C CA  . GLY B 1 203 ? 72.445  5.976   -18.659 1.00 29.26  ? 280 GLY B CA  1 
ATOM   2200 C C   . GLY B 1 203 ? 71.422  6.558   -19.594 1.00 34.94  ? 280 GLY B C   1 
ATOM   2201 O O   . GLY B 1 203 ? 71.745  7.355   -20.480 1.00 35.95  ? 280 GLY B O   1 
ATOM   2202 N N   . ALA B 1 204 ? 70.173  6.148   -19.401 1.00 32.67  ? 281 ALA B N   1 
ATOM   2203 C CA  . ALA B 1 204 ? 69.024  6.612   -20.180 1.00 33.12  ? 281 ALA B CA  1 
ATOM   2204 C C   . ALA B 1 204 ? 67.811  6.659   -19.267 1.00 40.27  ? 281 ALA B C   1 
ATOM   2205 O O   . ALA B 1 204 ? 67.702  5.853   -18.338 1.00 41.28  ? 281 ALA B O   1 
ATOM   2206 C CB  . ALA B 1 204 ? 68.757  5.687   -21.360 1.00 33.98  ? 281 ALA B CB  1 
ATOM   2207 N N   . LEU B 1 205 ? 66.883  7.575   -19.552 1.00 37.74  ? 282 LEU B N   1 
ATOM   2208 C CA  . LEU B 1 205 ? 65.683  7.803   -18.745 1.00 38.88  ? 282 LEU B CA  1 
ATOM   2209 C C   . LEU B 1 205 ? 64.488  8.027   -19.658 1.00 40.40  ? 282 LEU B C   1 
ATOM   2210 O O   . LEU B 1 205 ? 64.570  8.841   -20.568 1.00 40.19  ? 282 LEU B O   1 
ATOM   2211 C CB  . LEU B 1 205 ? 65.971  9.038   -17.845 1.00 39.58  ? 282 LEU B CB  1 
ATOM   2212 C CG  . LEU B 1 205 ? 64.838  9.828   -17.213 1.00 44.92  ? 282 LEU B CG  1 
ATOM   2213 C CD1 . LEU B 1 205 ? 64.167  9.033   -16.121 1.00 45.03  ? 282 LEU B CD1 1 
ATOM   2214 C CD2 . LEU B 1 205 ? 65.391  11.111  -16.640 1.00 48.56  ? 282 LEU B CD2 1 
ATOM   2215 N N   . LYS B 1 206 ? 63.393  7.289   -19.450 1.00 36.32  ? 283 LYS B N   1 
ATOM   2216 C CA  . LYS B 1 206 ? 62.248  7.438   -20.342 1.00 35.87  ? 283 LYS B CA  1 
ATOM   2217 C C   . LYS B 1 206 ? 61.418  8.573   -19.904 1.00 43.69  ? 283 LYS B C   1 
ATOM   2218 O O   . LYS B 1 206 ? 61.026  8.621   -18.746 1.00 45.26  ? 283 LYS B O   1 
ATOM   2219 C CB  . LYS B 1 206 ? 61.397  6.178   -20.454 1.00 35.33  ? 283 LYS B CB  1 
ATOM   2220 C CG  . LYS B 1 206 ? 60.579  6.181   -21.733 1.00 30.15  ? 283 LYS B CG  1 
ATOM   2221 C CD  . LYS B 1 206 ? 59.520  5.097   -21.778 1.00 42.54  ? 283 LYS B CD  1 
ATOM   2222 C CE  . LYS B 1 206 ? 58.177  5.614   -22.236 1.00 60.74  ? 283 LYS B CE  1 
ATOM   2223 N NZ  . LYS B 1 206 ? 57.386  4.557   -22.941 1.00 85.79  ? 283 LYS B NZ  1 
ATOM   2224 N N   . LEU B 1 207 ? 61.149  9.490   -20.814 1.00 41.01  ? 284 LEU B N   1 
ATOM   2225 C CA  . LEU B 1 207 ? 60.308  10.623  -20.511 1.00 42.89  ? 284 LEU B CA  1 
ATOM   2226 C C   . LEU B 1 207 ? 58.872  10.180  -20.564 1.00 49.16  ? 284 LEU B C   1 
ATOM   2227 O O   . LEU B 1 207 ? 58.555  9.303   -21.351 1.00 48.95  ? 284 LEU B O   1 
ATOM   2228 C CB  . LEU B 1 207 ? 60.556  11.742  -21.524 1.00 43.82  ? 284 LEU B CB  1 
ATOM   2229 C CG  . LEU B 1 207 ? 62.006  12.225  -21.610 1.00 48.63  ? 284 LEU B CG  1 
ATOM   2230 C CD1 . LEU B 1 207 ? 62.112  13.333  -22.593 1.00 49.54  ? 284 LEU B CD1 1 
ATOM   2231 C CD2 . LEU B 1 207 ? 62.535  12.673  -20.229 1.00 51.22  ? 284 LEU B CD2 1 
ATOM   2232 N N   . LEU B 1 208 ? 58.007  10.750  -19.720 1.00 48.58  ? 285 LEU B N   1 
ATOM   2233 C CA  . LEU B 1 208 ? 56.582  10.427  -19.747 1.00 57.81  ? 285 LEU B CA  1 
ATOM   2234 C C   . LEU B 1 208 ? 55.902  11.123  -20.912 1.00 60.19  ? 285 LEU B C   1 
ATOM   2235 O O   . LEU B 1 208 ? 54.963  10.534  -21.502 1.00 54.15  ? 285 LEU B O   1 
ATOM   2236 C CB  . LEU B 1 208 ? 55.903  10.804  -18.448 1.00 59.71  ? 285 LEU B CB  1 
ATOM   2237 C CG  . LEU B 1 208 ? 56.134  9.811   -17.334 1.00 66.86  ? 285 LEU B CG  1 
ATOM   2238 C CD1 . LEU B 1 208 ? 56.199  10.518  -15.992 1.00 68.33  ? 285 LEU B CD1 1 
ATOM   2239 C CD2 . LEU B 1 208 ? 55.061  8.710   -17.342 1.00 72.75  ? 285 LEU B CD2 1 
ATOM   2240 O OXT . LEU B 1 208 ? 56.365  12.225  -21.275 1.00 78.82  ? 285 LEU B OXT 1 
ATOM   2241 N N   . VAL C 1 65  ? 49.121  12.048  -19.090 1.00 78.17  ? 142 VAL C N   1 
ATOM   2242 C CA  . VAL C 1 65  ? 49.938  13.261  -19.204 1.00 76.44  ? 142 VAL C CA  1 
ATOM   2243 C C   . VAL C 1 65  ? 51.391  12.962  -19.620 1.00 75.55  ? 142 VAL C C   1 
ATOM   2244 O O   . VAL C 1 65  ? 52.007  12.035  -19.076 1.00 75.35  ? 142 VAL C O   1 
ATOM   2245 C CB  . VAL C 1 65  ? 49.897  14.206  -17.963 1.00 81.35  ? 142 VAL C CB  1 
ATOM   2246 C CG1 . VAL C 1 65  ? 50.233  15.649  -18.368 1.00 80.20  ? 142 VAL C CG1 1 
ATOM   2247 C CG2 . VAL C 1 65  ? 48.541  14.155  -17.249 1.00 83.77  ? 142 VAL C CG2 1 
ATOM   2248 N N   . THR C 1 66  ? 51.929  13.767  -20.581 1.00 67.05  ? 143 THR C N   1 
ATOM   2249 C CA  . THR C 1 66  ? 53.282  13.609  -21.125 1.00 63.07  ? 143 THR C CA  1 
ATOM   2250 C C   . THR C 1 66  ? 54.181  14.809  -20.844 1.00 62.65  ? 143 THR C C   1 
ATOM   2251 O O   . THR C 1 66  ? 53.690  15.886  -20.480 1.00 63.74  ? 143 THR C O   1 
ATOM   2252 C CB  . THR C 1 66  ? 53.265  13.289  -22.634 1.00 66.50  ? 143 THR C CB  1 
ATOM   2253 O OG1 . THR C 1 66  ? 52.850  14.441  -23.372 1.00 70.13  ? 143 THR C OG1 1 
ATOM   2254 C CG2 . THR C 1 66  ? 52.444  12.064  -22.983 1.00 62.16  ? 143 THR C CG2 1 
ATOM   2255 N N   . GLN C 1 67  ? 55.505  14.624  -21.044 1.00 53.11  ? 144 GLN C N   1 
ATOM   2256 C CA  . GLN C 1 67  ? 56.506  15.665  -20.898 1.00 49.59  ? 144 GLN C CA  1 
ATOM   2257 C C   . GLN C 1 67  ? 56.822  16.260  -22.273 1.00 50.82  ? 144 GLN C C   1 
ATOM   2258 O O   . GLN C 1 67  ? 57.500  15.643  -23.093 1.00 49.46  ? 144 GLN C O   1 
ATOM   2259 C CB  . GLN C 1 67  ? 57.777  15.103  -20.279 1.00 49.23  ? 144 GLN C CB  1 
ATOM   2260 C CG  . GLN C 1 67  ? 57.751  14.972  -18.789 1.00 45.51  ? 144 GLN C CG  1 
ATOM   2261 C CD  . GLN C 1 67  ? 58.954  14.192  -18.338 1.00 57.51  ? 144 GLN C CD  1 
ATOM   2262 O OE1 . GLN C 1 67  ? 58.993  12.954  -18.361 1.00 56.25  ? 144 GLN C OE1 1 
ATOM   2263 N NE2 . GLN C 1 67  ? 59.959  14.906  -17.907 1.00 40.35  ? 144 GLN C NE2 1 
ATOM   2264 N N   . ASP C 1 68  ? 56.317  17.460  -22.538 1.00 46.68  ? 145 ASP C N   1 
ATOM   2265 C CA  . ASP C 1 68  ? 56.599  18.146  -23.796 1.00 44.29  ? 145 ASP C CA  1 
ATOM   2266 C C   . ASP C 1 68  ? 58.114  18.436  -23.895 1.00 43.55  ? 145 ASP C C   1 
ATOM   2267 O O   . ASP C 1 68  ? 58.779  18.588  -22.876 1.00 40.89  ? 145 ASP C O   1 
ATOM   2268 C CB  . ASP C 1 68  ? 55.748  19.427  -23.903 1.00 45.96  ? 145 ASP C CB  1 
ATOM   2269 C CG  . ASP C 1 68  ? 54.253  19.179  -24.085 1.00 56.89  ? 145 ASP C CG  1 
ATOM   2270 O OD1 . ASP C 1 68  ? 53.850  18.001  -24.160 1.00 59.02  ? 145 ASP C OD1 1 
ATOM   2271 O OD2 . ASP C 1 68  ? 53.486  20.169  -24.178 1.00 63.69  ? 145 ASP C OD2 1 
ATOM   2272 N N   . CYS C 1 69  ? 58.668  18.404  -25.099 1.00 40.01  ? 146 CYS C N   1 
ATOM   2273 C CA  . CYS C 1 69  ? 60.083  18.678  -25.302 1.00 39.84  ? 146 CYS C CA  1 
ATOM   2274 C C   . CYS C 1 69  ? 60.359  19.102  -26.717 1.00 42.86  ? 146 CYS C C   1 
ATOM   2275 O O   . CYS C 1 69  ? 59.620  18.726  -27.623 1.00 44.41  ? 146 CYS C O   1 
ATOM   2276 C CB  . CYS C 1 69  ? 60.955  17.488  -24.892 1.00 40.96  ? 146 CYS C CB  1 
ATOM   2277 S SG  . CYS C 1 69  ? 60.528  15.913  -25.709 1.00 46.05  ? 146 CYS C SG  1 
ATOM   2278 N N   . LEU C 1 70  ? 61.431  19.880  -26.913 1.00 37.33  ? 147 LEU C N   1 
ATOM   2279 C CA  . LEU C 1 70  ? 61.862  20.361  -28.225 1.00 36.68  ? 147 LEU C CA  1 
ATOM   2280 C C   . LEU C 1 70  ? 63.358  20.337  -28.232 1.00 41.19  ? 147 LEU C C   1 
ATOM   2281 O O   . LEU C 1 70  ? 63.980  20.809  -27.288 1.00 41.94  ? 147 LEU C O   1 
ATOM   2282 C CB  . LEU C 1 70  ? 61.362  21.798  -28.477 1.00 37.07  ? 147 LEU C CB  1 
ATOM   2283 C CG  . LEU C 1 70  ? 61.656  22.379  -29.848 1.00 42.10  ? 147 LEU C CG  1 
ATOM   2284 C CD1 . LEU C 1 70  ? 60.431  23.071  -30.434 1.00 43.89  ? 147 LEU C CD1 1 
ATOM   2285 C CD2 . LEU C 1 70  ? 62.836  23.305  -29.800 1.00 41.80  ? 147 LEU C CD2 1 
ATOM   2286 N N   . GLN C 1 71  ? 63.941  19.791  -29.286 1.00 37.31  ? 148 GLN C N   1 
ATOM   2287 C CA  . GLN C 1 71  ? 65.384  19.775  -29.471 1.00 35.00  ? 148 GLN C CA  1 
ATOM   2288 C C   . GLN C 1 71  ? 65.732  20.328  -30.840 1.00 39.29  ? 148 GLN C C   1 
ATOM   2289 O O   . GLN C 1 71  ? 65.062  20.025  -31.846 1.00 40.16  ? 148 GLN C O   1 
ATOM   2290 C CB  . GLN C 1 71  ? 65.949  18.374  -29.316 1.00 35.57  ? 148 GLN C CB  1 
ATOM   2291 C CG  . GLN C 1 71  ? 67.471  18.335  -29.311 1.00 32.18  ? 148 GLN C CG  1 
ATOM   2292 C CD  . GLN C 1 71  ? 67.949  16.961  -28.990 1.00 45.98  ? 148 GLN C CD  1 
ATOM   2293 O OE1 . GLN C 1 71  ? 68.056  16.565  -27.836 1.00 45.09  ? 148 GLN C OE1 1 
ATOM   2294 N NE2 . GLN C 1 71  ? 68.243  16.204  -30.007 1.00 45.02  ? 148 GLN C NE2 1 
ATOM   2295 N N   . LEU C 1 72  ? 66.784  21.160  -30.850 1.00 34.58  ? 149 LEU C N   1 
ATOM   2296 C CA  . LEU C 1 72  ? 67.370  21.795  -32.021 1.00 34.65  ? 149 LEU C CA  1 
ATOM   2297 C C   . LEU C 1 72  ? 68.787  21.281  -32.202 1.00 38.46  ? 149 LEU C C   1 
ATOM   2298 O O   . LEU C 1 72  ? 69.511  21.083  -31.229 1.00 36.05  ? 149 LEU C O   1 
ATOM   2299 C CB  . LEU C 1 72  ? 67.417  23.324  -31.858 1.00 34.85  ? 149 LEU C CB  1 
ATOM   2300 C CG  . LEU C 1 72  ? 66.085  24.055  -31.608 1.00 40.09  ? 149 LEU C CG  1 
ATOM   2301 C CD1 . LEU C 1 72  ? 66.338  25.471  -31.193 1.00 39.80  ? 149 LEU C CD1 1 
ATOM   2302 C CD2 . LEU C 1 72  ? 65.193  24.027  -32.847 1.00 45.43  ? 149 LEU C CD2 1 
ATOM   2303 N N   . ILE C 1 73  ? 69.177  21.051  -33.450 1.00 37.67  ? 150 ILE C N   1 
ATOM   2304 C CA  . ILE C 1 73  ? 70.522  20.600  -33.819 1.00 37.20  ? 150 ILE C CA  1 
ATOM   2305 C C   . ILE C 1 73  ? 71.088  21.572  -34.863 1.00 41.74  ? 150 ILE C C   1 
ATOM   2306 O O   . ILE C 1 73  ? 70.334  22.126  -35.678 1.00 39.67  ? 150 ILE C O   1 
ATOM   2307 C CB  . ILE C 1 73  ? 70.567  19.121  -34.291 1.00 39.67  ? 150 ILE C CB  1 
ATOM   2308 C CG1 . ILE C 1 73  ? 69.662  18.878  -35.517 1.00 39.80  ? 150 ILE C CG1 1 
ATOM   2309 C CG2 . ILE C 1 73  ? 70.239  18.162  -33.128 1.00 39.58  ? 150 ILE C CG2 1 
ATOM   2310 C CD1 . ILE C 1 73  ? 69.890  17.609  -36.214 1.00 36.42  ? 150 ILE C CD1 1 
ATOM   2311 N N   . ALA C 1 74  ? 72.412  21.810  -34.800 1.00 38.36  ? 151 ALA C N   1 
ATOM   2312 C CA  . ALA C 1 74  ? 73.095  22.731  -35.692 1.00 37.89  ? 151 ALA C CA  1 
ATOM   2313 C C   . ALA C 1 74  ? 72.874  22.399  -37.177 1.00 45.46  ? 151 ALA C C   1 
ATOM   2314 O O   . ALA C 1 74  ? 72.913  21.229  -37.589 1.00 46.39  ? 151 ALA C O   1 
ATOM   2315 C CB  . ALA C 1 74  ? 74.576  22.766  -35.362 1.00 37.67  ? 151 ALA C CB  1 
ATOM   2316 N N   . ASP C 1 75  ? 72.606  23.435  -37.972 1.00 43.82  ? 152 ASP C N   1 
ATOM   2317 C CA  . ASP C 1 75  ? 72.420  23.272  -39.402 1.00 45.16  ? 152 ASP C CA  1 
ATOM   2318 C C   . ASP C 1 75  ? 73.783  23.460  -40.091 1.00 50.80  ? 152 ASP C C   1 
ATOM   2319 O O   . ASP C 1 75  ? 74.203  24.600  -40.337 1.00 52.91  ? 152 ASP C O   1 
ATOM   2320 C CB  . ASP C 1 75  ? 71.341  24.244  -39.927 1.00 47.56  ? 152 ASP C CB  1 
ATOM   2321 C CG  . ASP C 1 75  ? 71.165  24.265  -41.436 1.00 62.55  ? 152 ASP C CG  1 
ATOM   2322 O OD1 . ASP C 1 75  ? 71.680  23.340  -42.118 1.00 63.43  ? 152 ASP C OD1 1 
ATOM   2323 O OD2 . ASP C 1 75  ? 70.504  25.188  -41.937 1.00 71.87  ? 152 ASP C OD2 1 
ATOM   2324 N N   . SER C 1 76  ? 74.464  22.335  -40.395 1.00 46.58  ? 153 SER C N   1 
ATOM   2325 C CA  . SER C 1 76  ? 75.772  22.322  -41.083 1.00 48.31  ? 153 SER C CA  1 
ATOM   2326 C C   . SER C 1 76  ? 75.774  22.978  -42.507 1.00 54.55  ? 153 SER C C   1 
ATOM   2327 O O   . SER C 1 76  ? 76.846  23.262  -43.051 1.00 53.99  ? 153 SER C O   1 
ATOM   2328 C CB  . SER C 1 76  ? 76.323  20.905  -41.179 1.00 50.78  ? 153 SER C CB  1 
ATOM   2329 O OG  . SER C 1 76  ? 75.603  20.160  -42.146 1.00 60.75  ? 153 SER C OG  1 
ATOM   2330 N N   . GLU C 1 77  ? 74.586  23.221  -43.093 1.00 52.24  ? 154 GLU C N   1 
ATOM   2331 C CA  . GLU C 1 77  ? 74.501  23.823  -44.421 1.00 54.68  ? 154 GLU C CA  1 
ATOM   2332 C C   . GLU C 1 77  ? 74.338  25.360  -44.385 1.00 61.18  ? 154 GLU C C   1 
ATOM   2333 O O   . GLU C 1 77  ? 74.215  25.981  -45.450 1.00 63.94  ? 154 GLU C O   1 
ATOM   2334 C CB  . GLU C 1 77  ? 73.379  23.167  -45.272 1.00 56.70  ? 154 GLU C CB  1 
ATOM   2335 C CG  . GLU C 1 77  ? 73.352  21.643  -45.404 1.00 64.09  ? 154 GLU C CG  1 
ATOM   2336 C CD  . GLU C 1 77  ? 74.517  20.962  -46.094 1.00 102.51 ? 154 GLU C CD  1 
ATOM   2337 O OE1 . GLU C 1 77  ? 75.493  20.628  -45.387 1.00 98.92  ? 154 GLU C OE1 1 
ATOM   2338 O OE2 . GLU C 1 77  ? 74.483  20.815  -47.337 1.00 118.01 ? 154 GLU C OE2 1 
ATOM   2339 N N   . THR C 1 78  ? 74.355  25.970  -43.189 1.00 55.22  ? 155 THR C N   1 
ATOM   2340 C CA  . THR C 1 78  ? 74.189  27.419  -43.058 1.00 54.51  ? 155 THR C CA  1 
ATOM   2341 C C   . THR C 1 78  ? 75.354  28.058  -42.283 1.00 54.05  ? 155 THR C C   1 
ATOM   2342 O O   . THR C 1 78  ? 75.751  27.535  -41.245 1.00 49.01  ? 155 THR C O   1 
ATOM   2343 C CB  . THR C 1 78  ? 72.810  27.715  -42.423 1.00 60.70  ? 155 THR C CB  1 
ATOM   2344 O OG1 . THR C 1 78  ? 71.809  27.174  -43.283 1.00 65.51  ? 155 THR C OG1 1 
ATOM   2345 C CG2 . THR C 1 78  ? 72.540  29.219  -42.191 1.00 54.95  ? 155 THR C CG2 1 
ATOM   2346 N N   . PRO C 1 79  ? 75.876  29.225  -42.740 1.00 50.65  ? 156 PRO C N   1 
ATOM   2347 C CA  . PRO C 1 79  ? 76.917  29.909  -41.959 1.00 48.75  ? 156 PRO C CA  1 
ATOM   2348 C C   . PRO C 1 79  ? 76.368  30.474  -40.648 1.00 49.98  ? 156 PRO C C   1 
ATOM   2349 O O   . PRO C 1 79  ? 75.207  30.898  -40.582 1.00 48.39  ? 156 PRO C O   1 
ATOM   2350 C CB  . PRO C 1 79  ? 77.363  31.037  -42.886 1.00 52.31  ? 156 PRO C CB  1 
ATOM   2351 C CG  . PRO C 1 79  ? 76.222  31.293  -43.744 1.00 57.54  ? 156 PRO C CG  1 
ATOM   2352 C CD  . PRO C 1 79  ? 75.510  30.003  -43.940 1.00 52.55  ? 156 PRO C CD  1 
ATOM   2353 N N   . THR C 1 80  ? 77.222  30.488  -39.609 1.00 46.66  ? 157 THR C N   1 
ATOM   2354 C CA  . THR C 1 80  ? 76.906  31.038  -38.290 1.00 44.82  ? 157 THR C CA  1 
ATOM   2355 C C   . THR C 1 80  ? 76.441  32.489  -38.421 1.00 50.82  ? 157 THR C C   1 
ATOM   2356 O O   . THR C 1 80  ? 76.936  33.223  -39.278 1.00 54.55  ? 157 THR C O   1 
ATOM   2357 C CB  . THR C 1 80  ? 78.115  30.971  -37.359 1.00 48.28  ? 157 THR C CB  1 
ATOM   2358 O OG1 . THR C 1 80  ? 79.261  31.631  -37.932 1.00 44.35  ? 157 THR C OG1 1 
ATOM   2359 C CG2 . THR C 1 80  ? 78.429  29.565  -36.915 1.00 45.86  ? 157 THR C CG2 1 
ATOM   2360 N N   . ILE C 1 81  ? 75.469  32.876  -37.601 1.00 44.22  ? 158 ILE C N   1 
ATOM   2361 C CA  . ILE C 1 81  ? 74.908  34.217  -37.565 1.00 44.73  ? 158 ILE C CA  1 
ATOM   2362 C C   . ILE C 1 81  ? 75.814  35.141  -36.711 1.00 51.72  ? 158 ILE C C   1 
ATOM   2363 O O   . ILE C 1 81  ? 76.005  34.907  -35.509 1.00 50.11  ? 158 ILE C O   1 
ATOM   2364 C CB  . ILE C 1 81  ? 73.454  34.156  -37.040 1.00 45.64  ? 158 ILE C CB  1 
ATOM   2365 C CG1 . ILE C 1 81  ? 72.600  33.237  -37.929 1.00 44.45  ? 158 ILE C CG1 1 
ATOM   2366 C CG2 . ILE C 1 81  ? 72.848  35.568  -36.892 1.00 47.64  ? 158 ILE C CG2 1 
ATOM   2367 C CD1 . ILE C 1 81  ? 71.954  32.152  -37.254 1.00 36.98  ? 158 ILE C CD1 1 
ATOM   2368 N N   . GLN C 1 82  ? 76.363  36.180  -37.355 1.00 50.59  ? 159 GLN C N   1 
ATOM   2369 C CA  . GLN C 1 82  ? 77.237  37.159  -36.723 1.00 50.66  ? 159 GLN C CA  1 
ATOM   2370 C C   . GLN C 1 82  ? 76.411  38.400  -36.356 1.00 55.00  ? 159 GLN C C   1 
ATOM   2371 O O   . GLN C 1 82  ? 76.039  39.160  -37.241 1.00 55.63  ? 159 GLN C O   1 
ATOM   2372 C CB  . GLN C 1 82  ? 78.381  37.556  -37.667 1.00 54.09  ? 159 GLN C CB  1 
ATOM   2373 C CG  . GLN C 1 82  ? 78.899  36.444  -38.553 1.00 74.39  ? 159 GLN C CG  1 
ATOM   2374 C CD  . GLN C 1 82  ? 80.095  35.804  -37.931 1.00 97.06  ? 159 GLN C CD  1 
ATOM   2375 O OE1 . GLN C 1 82  ? 79.985  34.990  -36.987 1.00 96.19  ? 159 GLN C OE1 1 
ATOM   2376 N NE2 . GLN C 1 82  ? 81.257  36.173  -38.460 1.00 78.42  ? 159 GLN C NE2 1 
ATOM   2377 N N   . LYS C 1 83  ? 76.073  38.573  -35.068 1.00 50.81  ? 160 LYS C N   1 
ATOM   2378 C CA  . LYS C 1 83  ? 75.333  39.745  -34.627 1.00 51.34  ? 160 LYS C CA  1 
ATOM   2379 C C   . LYS C 1 83  ? 76.147  40.470  -33.551 1.00 59.57  ? 160 LYS C C   1 
ATOM   2380 O O   . LYS C 1 83  ? 75.970  40.228  -32.353 1.00 59.42  ? 160 LYS C O   1 
ATOM   2381 C CB  . LYS C 1 83  ? 73.896  39.409  -34.178 1.00 50.75  ? 160 LYS C CB  1 
ATOM   2382 N N   . GLY C 1 84  ? 77.049  41.340  -34.001 1.00 58.85  ? 161 GLY C N   1 
ATOM   2383 C CA  . GLY C 1 84  ? 77.865  42.179  -33.131 1.00 59.95  ? 161 GLY C CA  1 
ATOM   2384 C C   . GLY C 1 84  ? 78.975  41.451  -32.426 1.00 65.88  ? 161 GLY C C   1 
ATOM   2385 O O   . GLY C 1 84  ? 79.776  40.785  -33.080 1.00 66.97  ? 161 GLY C O   1 
ATOM   2386 N N   . SER C 1 85  ? 79.027  41.568  -31.084 1.00 61.85  ? 162 SER C N   1 
ATOM   2387 C CA  . SER C 1 85  ? 80.021  40.907  -30.236 1.00 60.19  ? 162 SER C CA  1 
ATOM   2388 C C   . SER C 1 85  ? 79.704  39.409  -30.066 1.00 64.15  ? 162 SER C C   1 
ATOM   2389 O O   . SER C 1 85  ? 80.516  38.676  -29.492 1.00 64.10  ? 162 SER C O   1 
ATOM   2390 C CB  . SER C 1 85  ? 80.073  41.581  -28.865 1.00 61.00  ? 162 SER C CB  1 
ATOM   2391 O OG  . SER C 1 85  ? 80.748  42.824  -28.896 1.00 65.74  ? 162 SER C OG  1 
ATOM   2392 N N   . TYR C 1 86  ? 78.537  38.959  -30.574 1.00 59.83  ? 163 TYR C N   1 
ATOM   2393 C CA  . TYR C 1 86  ? 78.053  37.580  -30.457 1.00 57.59  ? 163 TYR C CA  1 
ATOM   2394 C C   . TYR C 1 86  ? 77.990  36.797  -31.770 1.00 60.58  ? 163 TYR C C   1 
ATOM   2395 O O   . TYR C 1 86  ? 77.899  37.386  -32.869 1.00 62.32  ? 163 TYR C O   1 
ATOM   2396 C CB  . TYR C 1 86  ? 76.662  37.565  -29.806 1.00 57.92  ? 163 TYR C CB  1 
ATOM   2397 C CG  . TYR C 1 86  ? 76.655  38.108  -28.395 1.00 60.23  ? 163 TYR C CG  1 
ATOM   2398 C CD1 . TYR C 1 86  ? 76.622  39.478  -28.154 1.00 63.20  ? 163 TYR C CD1 1 
ATOM   2399 C CD2 . TYR C 1 86  ? 76.662  37.251  -27.295 1.00 59.53  ? 163 TYR C CD2 1 
ATOM   2400 C CE1 . TYR C 1 86  ? 76.616  39.985  -26.857 1.00 62.31  ? 163 TYR C CE1 1 
ATOM   2401 C CE2 . TYR C 1 86  ? 76.670  37.750  -25.992 1.00 60.01  ? 163 TYR C CE2 1 
ATOM   2402 C CZ  . TYR C 1 86  ? 76.630  39.120  -25.783 1.00 67.34  ? 163 TYR C CZ  1 
ATOM   2403 O OH  . TYR C 1 86  ? 76.622  39.651  -24.523 1.00 69.86  ? 163 TYR C OH  1 
ATOM   2404 N N   . THR C 1 87  ? 78.004  35.451  -31.625 1.00 51.70  ? 164 THR C N   1 
ATOM   2405 C CA  . THR C 1 87  ? 77.857  34.471  -32.701 1.00 49.86  ? 164 THR C CA  1 
ATOM   2406 C C   . THR C 1 87  ? 76.694  33.559  -32.344 1.00 52.69  ? 164 THR C C   1 
ATOM   2407 O O   . THR C 1 87  ? 76.601  33.076  -31.212 1.00 52.07  ? 164 THR C O   1 
ATOM   2408 C CB  . THR C 1 87  ? 79.155  33.694  -32.950 1.00 42.59  ? 164 THR C CB  1 
ATOM   2409 O OG1 . THR C 1 87  ? 80.169  34.607  -33.338 1.00 41.35  ? 164 THR C OG1 1 
ATOM   2410 C CG2 . THR C 1 87  ? 79.002  32.612  -34.006 1.00 34.98  ? 164 THR C CG2 1 
ATOM   2411 N N   . PHE C 1 88  ? 75.819  33.322  -33.313 1.00 48.52  ? 165 PHE C N   1 
ATOM   2412 C CA  . PHE C 1 88  ? 74.658  32.488  -33.122 1.00 47.06  ? 165 PHE C CA  1 
ATOM   2413 C C   . PHE C 1 88  ? 74.687  31.288  -34.033 1.00 52.31  ? 165 PHE C C   1 
ATOM   2414 O O   . PHE C 1 88  ? 75.122  31.375  -35.189 1.00 51.89  ? 165 PHE C O   1 
ATOM   2415 C CB  . PHE C 1 88  ? 73.382  33.301  -33.306 1.00 49.74  ? 165 PHE C CB  1 
ATOM   2416 C CG  . PHE C 1 88  ? 73.196  34.318  -32.212 1.00 50.88  ? 165 PHE C CG  1 
ATOM   2417 C CD1 . PHE C 1 88  ? 72.604  33.964  -31.006 1.00 50.17  ? 165 PHE C CD1 1 
ATOM   2418 C CD2 . PHE C 1 88  ? 73.632  35.634  -32.379 1.00 55.86  ? 165 PHE C CD2 1 
ATOM   2419 C CE1 . PHE C 1 88  ? 72.441  34.902  -29.988 1.00 50.81  ? 165 PHE C CE1 1 
ATOM   2420 C CE2 . PHE C 1 88  ? 73.490  36.567  -31.348 1.00 58.06  ? 165 PHE C CE2 1 
ATOM   2421 C CZ  . PHE C 1 88  ? 72.893  36.189  -30.158 1.00 53.09  ? 165 PHE C CZ  1 
ATOM   2422 N N   . VAL C 1 89  ? 74.254  30.145  -33.490 1.00 48.36  ? 166 VAL C N   1 
ATOM   2423 C CA  . VAL C 1 89  ? 74.237  28.907  -34.243 1.00 47.25  ? 166 VAL C CA  1 
ATOM   2424 C C   . VAL C 1 89  ? 72.963  28.849  -35.095 1.00 54.27  ? 166 VAL C C   1 
ATOM   2425 O O   . VAL C 1 89  ? 71.876  29.036  -34.543 1.00 53.10  ? 166 VAL C O   1 
ATOM   2426 C CB  . VAL C 1 89  ? 74.330  27.705  -33.278 1.00 47.70  ? 166 VAL C CB  1 
ATOM   2427 C CG1 . VAL C 1 89  ? 74.244  26.374  -34.025 1.00 47.43  ? 166 VAL C CG1 1 
ATOM   2428 C CG2 . VAL C 1 89  ? 75.593  27.778  -32.444 1.00 46.10  ? 166 VAL C CG2 1 
ATOM   2429 N N   . PRO C 1 90  ? 73.055  28.565  -36.421 1.00 54.63  ? 167 PRO C N   1 
ATOM   2430 C CA  . PRO C 1 90  ? 71.828  28.365  -37.195 1.00 54.72  ? 167 PRO C CA  1 
ATOM   2431 C C   . PRO C 1 90  ? 71.243  27.002  -36.801 1.00 55.51  ? 167 PRO C C   1 
ATOM   2432 O O   . PRO C 1 90  ? 71.936  25.982  -36.898 1.00 54.83  ? 167 PRO C O   1 
ATOM   2433 C CB  . PRO C 1 90  ? 72.301  28.427  -38.656 1.00 58.86  ? 167 PRO C CB  1 
ATOM   2434 C CG  . PRO C 1 90  ? 73.752  28.205  -38.645 1.00 64.45  ? 167 PRO C CG  1 
ATOM   2435 C CD  . PRO C 1 90  ? 74.265  28.282  -37.234 1.00 58.66  ? 167 PRO C CD  1 
ATOM   2436 N N   . TRP C 1 91  ? 70.007  26.994  -36.274 1.00 50.62  ? 168 TRP C N   1 
ATOM   2437 C CA  . TRP C 1 91  ? 69.364  25.755  -35.819 1.00 49.58  ? 168 TRP C CA  1 
ATOM   2438 C C   . TRP C 1 91  ? 68.497  25.116  -36.858 1.00 52.61  ? 168 TRP C C   1 
ATOM   2439 O O   . TRP C 1 91  ? 68.009  25.774  -37.779 1.00 56.12  ? 168 TRP C O   1 
ATOM   2440 C CB  . TRP C 1 91  ? 68.540  25.971  -34.517 1.00 47.87  ? 168 TRP C CB  1 
ATOM   2441 C CG  . TRP C 1 91  ? 69.353  26.444  -33.355 1.00 48.12  ? 168 TRP C CG  1 
ATOM   2442 C CD1 . TRP C 1 91  ? 69.295  27.670  -32.761 1.00 51.41  ? 168 TRP C CD1 1 
ATOM   2443 C CD2 . TRP C 1 91  ? 70.416  25.729  -32.703 1.00 46.76  ? 168 TRP C CD2 1 
ATOM   2444 N NE1 . TRP C 1 91  ? 70.254  27.765  -31.775 1.00 50.13  ? 168 TRP C NE1 1 
ATOM   2445 C CE2 . TRP C 1 91  ? 70.957  26.588  -31.722 1.00 50.69  ? 168 TRP C CE2 1 
ATOM   2446 C CE3 . TRP C 1 91  ? 70.974  24.445  -32.865 1.00 47.44  ? 168 TRP C CE3 1 
ATOM   2447 C CZ2 . TRP C 1 91  ? 72.010  26.196  -30.887 1.00 49.33  ? 168 TRP C CZ2 1 
ATOM   2448 C CZ3 . TRP C 1 91  ? 72.024  24.059  -32.043 1.00 48.24  ? 168 TRP C CZ3 1 
ATOM   2449 C CH2 . TRP C 1 91  ? 72.525  24.922  -31.060 1.00 48.64  ? 168 TRP C CH2 1 
ATOM   2450 N N   . LEU C 1 92  ? 68.270  23.830  -36.667 1.00 44.74  ? 169 LEU C N   1 
ATOM   2451 C CA  . LEU C 1 92  ? 67.390  22.974  -37.450 1.00 43.81  ? 169 LEU C CA  1 
ATOM   2452 C C   . LEU C 1 92  ? 66.577  22.198  -36.411 1.00 45.52  ? 169 LEU C C   1 
ATOM   2453 O O   . LEU C 1 92  ? 67.127  21.782  -35.387 1.00 43.34  ? 169 LEU C O   1 
ATOM   2454 C CB  . LEU C 1 92  ? 68.253  22.002  -38.250 1.00 43.74  ? 169 LEU C CB  1 
ATOM   2455 C CG  . LEU C 1 92  ? 68.024  21.927  -39.707 1.00 48.85  ? 169 LEU C CG  1 
ATOM   2456 C CD1 . LEU C 1 92  ? 67.837  23.326  -40.306 1.00 49.85  ? 169 LEU C CD1 1 
ATOM   2457 C CD2 . LEU C 1 92  ? 69.183  21.245  -40.353 1.00 50.38  ? 169 LEU C CD2 1 
ATOM   2458 N N   . LEU C 1 93  ? 65.276  22.032  -36.628 1.00 42.74  ? 170 LEU C N   1 
ATOM   2459 C CA  . LEU C 1 93  ? 64.479  21.301  -35.646 1.00 41.77  ? 170 LEU C CA  1 
ATOM   2460 C C   . LEU C 1 93  ? 64.759  19.807  -35.770 1.00 48.30  ? 170 LEU C C   1 
ATOM   2461 O O   . LEU C 1 93  ? 64.539  19.258  -36.860 1.00 49.60  ? 170 LEU C O   1 
ATOM   2462 C CB  . LEU C 1 93  ? 62.982  21.564  -35.829 1.00 42.33  ? 170 LEU C CB  1 
ATOM   2463 C CG  . LEU C 1 93  ? 62.053  20.737  -34.964 1.00 46.15  ? 170 LEU C CG  1 
ATOM   2464 C CD1 . LEU C 1 93  ? 61.892  21.350  -33.563 1.00 46.01  ? 170 LEU C CD1 1 
ATOM   2465 C CD2 . LEU C 1 93  ? 60.731  20.609  -35.616 1.00 46.70  ? 170 LEU C CD2 1 
ATOM   2466 N N   . SER C 1 94  ? 65.261  19.145  -34.691 1.00 42.77  ? 171 SER C N   1 
ATOM   2467 C CA  . SER C 1 94  ? 65.482  17.706  -34.719 1.00 40.96  ? 171 SER C CA  1 
ATOM   2468 C C   . SER C 1 94  ? 64.145  17.060  -34.511 1.00 46.17  ? 171 SER C C   1 
ATOM   2469 O O   . SER C 1 94  ? 63.807  16.140  -35.242 1.00 47.57  ? 171 SER C O   1 
ATOM   2470 C CB  . SER C 1 94  ? 66.437  17.273  -33.628 1.00 43.27  ? 171 SER C CB  1 
ATOM   2471 O OG  . SER C 1 94  ? 66.706  15.895  -33.811 1.00 55.44  ? 171 SER C OG  1 
ATOM   2472 N N   . PHE C 1 95  ? 63.378  17.558  -33.513 1.00 43.04  ? 172 PHE C N   1 
ATOM   2473 C CA  . PHE C 1 95  ? 62.032  17.114  -33.147 1.00 43.62  ? 172 PHE C CA  1 
ATOM   2474 C C   . PHE C 1 95  ? 61.361  18.048  -32.144 1.00 44.88  ? 172 PHE C C   1 
ATOM   2475 O O   . PHE C 1 95  ? 62.050  18.736  -31.393 1.00 44.09  ? 172 PHE C O   1 
ATOM   2476 C CB  . PHE C 1 95  ? 62.023  15.676  -32.619 1.00 45.76  ? 172 PHE C CB  1 
ATOM   2477 C CG  . PHE C 1 95  ? 62.817  15.458  -31.366 1.00 47.80  ? 172 PHE C CG  1 
ATOM   2478 C CD1 . PHE C 1 95  ? 62.269  15.753  -30.111 1.00 51.22  ? 172 PHE C CD1 1 
ATOM   2479 C CD2 . PHE C 1 95  ? 64.096  14.907  -31.423 1.00 50.90  ? 172 PHE C CD2 1 
ATOM   2480 C CE1 . PHE C 1 95  ? 62.996  15.533  -28.939 1.00 50.78  ? 172 PHE C CE1 1 
ATOM   2481 C CE2 . PHE C 1 95  ? 64.824  14.677  -30.252 1.00 53.13  ? 172 PHE C CE2 1 
ATOM   2482 C CZ  . PHE C 1 95  ? 64.266  14.994  -29.017 1.00 50.74  ? 172 PHE C CZ  1 
ATOM   2483 N N   . LYS C 1 96  ? 60.015  18.033  -32.130 1.00 39.79  ? 173 LYS C N   1 
ATOM   2484 C CA  . LYS C 1 96  ? 59.116  18.786  -31.260 1.00 38.85  ? 173 LYS C CA  1 
ATOM   2485 C C   . LYS C 1 96  ? 58.032  17.801  -30.754 1.00 43.74  ? 173 LYS C C   1 
ATOM   2486 O O   . LYS C 1 96  ? 57.472  17.023  -31.532 1.00 46.55  ? 173 LYS C O   1 
ATOM   2487 C CB  . LYS C 1 96  ? 58.503  19.969  -32.045 1.00 41.39  ? 173 LYS C CB  1 
ATOM   2488 C CG  . LYS C 1 96  ? 57.394  20.727  -31.323 1.00 44.37  ? 173 LYS C CG  1 
ATOM   2489 C CD  . LYS C 1 96  ? 56.690  21.748  -32.227 1.00 50.20  ? 173 LYS C CD  1 
ATOM   2490 C CE  . LYS C 1 96  ? 55.431  22.283  -31.602 1.00 63.85  ? 173 LYS C CE  1 
ATOM   2491 N NZ  . LYS C 1 96  ? 54.374  21.244  -31.574 1.00 83.46  ? 173 LYS C NZ  1 
ATOM   2492 N N   . ARG C 1 97  ? 57.787  17.793  -29.464 1.00 37.64  ? 174 ARG C N   1 
ATOM   2493 C CA  . ARG C 1 97  ? 56.794  16.917  -28.870 1.00 37.71  ? 174 ARG C CA  1 
ATOM   2494 C C   . ARG C 1 97  ? 55.907  17.758  -27.969 1.00 43.03  ? 174 ARG C C   1 
ATOM   2495 O O   . ARG C 1 97  ? 56.407  18.478  -27.091 1.00 41.62  ? 174 ARG C O   1 
ATOM   2496 C CB  . ARG C 1 97  ? 57.482  15.800  -28.099 1.00 35.31  ? 174 ARG C CB  1 
ATOM   2497 C CG  . ARG C 1 97  ? 56.540  14.762  -27.526 1.00 44.05  ? 174 ARG C CG  1 
ATOM   2498 C CD  . ARG C 1 97  ? 57.250  13.970  -26.454 1.00 46.46  ? 174 ARG C CD  1 
ATOM   2499 N NE  . ARG C 1 97  ? 56.447  12.838  -26.010 1.00 42.44  ? 174 ARG C NE  1 
ATOM   2500 C CZ  . ARG C 1 97  ? 56.442  12.393  -24.764 1.00 50.71  ? 174 ARG C CZ  1 
ATOM   2501 N NH1 . ARG C 1 97  ? 57.192  12.980  -23.839 1.00 48.48  ? 174 ARG C NH1 1 
ATOM   2502 N NH2 . ARG C 1 97  ? 55.668  11.371  -24.423 1.00 31.07  ? 174 ARG C NH2 1 
ATOM   2503 N N   . GLY C 1 98  ? 54.617  17.745  -28.282 1.00 41.83  ? 175 GLY C N   1 
ATOM   2504 C CA  . GLY C 1 98  ? 53.620  18.486  -27.531 1.00 43.33  ? 175 GLY C CA  1 
ATOM   2505 C C   . GLY C 1 98  ? 53.476  19.936  -27.912 1.00 50.07  ? 175 GLY C C   1 
ATOM   2506 O O   . GLY C 1 98  ? 53.987  20.370  -28.951 1.00 51.04  ? 175 GLY C O   1 
ATOM   2507 N N   . SER C 1 99  ? 52.777  20.688  -27.045 1.00 47.68  ? 176 SER C N   1 
ATOM   2508 C CA  . SER C 1 99  ? 52.396  22.089  -27.224 1.00 48.25  ? 176 SER C CA  1 
ATOM   2509 C C   . SER C 1 99  ? 53.263  23.153  -26.529 1.00 52.86  ? 176 SER C C   1 
ATOM   2510 O O   . SER C 1 99  ? 53.343  24.269  -27.045 1.00 55.54  ? 176 SER C O   1 
ATOM   2511 C CB  . SER C 1 99  ? 50.931  22.275  -26.829 1.00 50.54  ? 176 SER C CB  1 
ATOM   2512 O OG  . SER C 1 99  ? 50.600  21.623  -25.609 1.00 51.43  ? 176 SER C OG  1 
ATOM   2513 N N   . ALA C 1 100 ? 53.850  22.838  -25.360 1.00 46.07  ? 177 ALA C N   1 
ATOM   2514 C CA  . ALA C 1 100 ? 54.603  23.775  -24.527 1.00 45.28  ? 177 ALA C CA  1 
ATOM   2515 C C   . ALA C 1 100 ? 55.777  24.499  -25.164 1.00 49.68  ? 177 ALA C C   1 
ATOM   2516 O O   . ALA C 1 100 ? 56.103  25.612  -24.745 1.00 48.84  ? 177 ALA C O   1 
ATOM   2517 C CB  . ALA C 1 100 ? 55.044  23.098  -23.246 1.00 44.95  ? 177 ALA C CB  1 
ATOM   2518 N N   . LEU C 1 101 ? 56.432  23.869  -26.148 1.00 46.39  ? 178 LEU C N   1 
ATOM   2519 C CA  . LEU C 1 101 ? 57.601  24.470  -26.794 1.00 44.39  ? 178 LEU C CA  1 
ATOM   2520 C C   . LEU C 1 101 ? 57.479  24.508  -28.294 1.00 51.04  ? 178 LEU C C   1 
ATOM   2521 O O   . LEU C 1 101 ? 56.942  23.580  -28.893 1.00 52.26  ? 178 LEU C O   1 
ATOM   2522 C CB  . LEU C 1 101 ? 58.903  23.759  -26.366 1.00 41.44  ? 178 LEU C CB  1 
ATOM   2523 C CG  . LEU C 1 101 ? 59.215  23.783  -24.875 1.00 43.11  ? 178 LEU C CG  1 
ATOM   2524 C CD1 . LEU C 1 101 ? 60.132  22.662  -24.522 1.00 40.79  ? 178 LEU C CD1 1 
ATOM   2525 C CD2 . LEU C 1 101 ? 59.764  25.154  -24.429 1.00 45.45  ? 178 LEU C CD2 1 
ATOM   2526 N N   . GLU C 1 102 ? 57.994  25.592  -28.894 1.00 49.22  ? 179 GLU C N   1 
ATOM   2527 C CA  . GLU C 1 102 ? 57.990  25.871  -30.333 1.00 50.77  ? 179 GLU C CA  1 
ATOM   2528 C C   . GLU C 1 102 ? 59.301  26.452  -30.792 1.00 55.61  ? 179 GLU C C   1 
ATOM   2529 O O   . GLU C 1 102 ? 60.003  27.064  -29.993 1.00 55.02  ? 179 GLU C O   1 
ATOM   2530 C CB  . GLU C 1 102 ? 56.902  26.891  -30.665 1.00 54.23  ? 179 GLU C CB  1 
ATOM   2531 C CG  . GLU C 1 102 ? 55.496  26.342  -30.737 1.00 66.39  ? 179 GLU C CG  1 
ATOM   2532 C CD  . GLU C 1 102 ? 54.457  27.374  -31.137 1.00 84.64  ? 179 GLU C CD  1 
ATOM   2533 O OE1 . GLU C 1 102 ? 54.813  28.352  -31.837 1.00 58.92  ? 179 GLU C OE1 1 
ATOM   2534 O OE2 . GLU C 1 102 ? 53.274  27.185  -30.771 1.00 81.00  ? 179 GLU C OE2 1 
ATOM   2535 N N   . GLU C 1 103 ? 59.608  26.301  -32.090 1.00 55.13  ? 180 GLU C N   1 
ATOM   2536 C CA  . GLU C 1 103 ? 60.781  26.898  -32.738 1.00 56.10  ? 180 GLU C CA  1 
ATOM   2537 C C   . GLU C 1 103 ? 60.278  28.221  -33.316 1.00 61.94  ? 180 GLU C C   1 
ATOM   2538 O O   . GLU C 1 103 ? 59.270  28.234  -34.024 1.00 62.74  ? 180 GLU C O   1 
ATOM   2539 C CB  . GLU C 1 103 ? 61.318  25.994  -33.874 1.00 57.92  ? 180 GLU C CB  1 
ATOM   2540 C CG  . GLU C 1 103 ? 62.704  26.364  -34.408 1.00 72.36  ? 180 GLU C CG  1 
ATOM   2541 C CD  . GLU C 1 103 ? 62.854  27.492  -35.424 1.00 108.53 ? 180 GLU C CD  1 
ATOM   2542 O OE1 . GLU C 1 103 ? 61.844  27.882  -36.057 1.00 116.11 ? 180 GLU C OE1 1 
ATOM   2543 O OE2 . GLU C 1 103 ? 64.003  27.954  -35.621 1.00 101.63 ? 180 GLU C OE2 1 
ATOM   2544 N N   . LYS C 1 104 ? 60.944  29.324  -32.994 1.00 59.67  ? 181 LYS C N   1 
ATOM   2545 C CA  . LYS C 1 104 ? 60.561  30.628  -33.540 1.00 62.26  ? 181 LYS C CA  1 
ATOM   2546 C C   . LYS C 1 104 ? 61.807  31.446  -33.780 1.00 65.93  ? 181 LYS C C   1 
ATOM   2547 O O   . LYS C 1 104 ? 62.535  31.775  -32.828 1.00 63.91  ? 181 LYS C O   1 
ATOM   2548 C CB  . LYS C 1 104 ? 59.548  31.391  -32.652 1.00 65.54  ? 181 LYS C CB  1 
ATOM   2549 N N   . GLU C 1 105 ? 62.078  31.721  -35.071 1.00 62.65  ? 182 GLU C N   1 
ATOM   2550 C CA  . GLU C 1 105 ? 63.201  32.539  -35.542 1.00 62.09  ? 182 GLU C CA  1 
ATOM   2551 C C   . GLU C 1 105 ? 64.529  32.191  -34.852 1.00 60.62  ? 182 GLU C C   1 
ATOM   2552 O O   . GLU C 1 105 ? 65.182  33.080  -34.275 1.00 59.16  ? 182 GLU C O   1 
ATOM   2553 C CB  . GLU C 1 105 ? 62.878  34.038  -35.394 1.00 65.22  ? 182 GLU C CB  1 
ATOM   2554 C CG  . GLU C 1 105 ? 61.713  34.519  -36.243 1.00 80.97  ? 182 GLU C CG  1 
ATOM   2555 C CD  . GLU C 1 105 ? 61.331  35.978  -36.078 1.00 105.07 ? 182 GLU C CD  1 
ATOM   2556 O OE1 . GLU C 1 105 ? 61.645  36.574  -35.017 1.00 82.04  ? 182 GLU C OE1 1 
ATOM   2557 O OE2 . GLU C 1 105 ? 60.686  36.513  -37.011 1.00 105.24 ? 182 GLU C OE2 1 
ATOM   2558 N N   . ASN C 1 106 ? 64.888  30.880  -34.863 1.00 52.64  ? 183 ASN C N   1 
ATOM   2559 C CA  . ASN C 1 106 ? 66.130  30.378  -34.278 1.00 49.35  ? 183 ASN C CA  1 
ATOM   2560 C C   . ASN C 1 106 ? 66.205  30.450  -32.740 1.00 52.51  ? 183 ASN C C   1 
ATOM   2561 O O   . ASN C 1 106 ? 67.298  30.407  -32.163 1.00 52.90  ? 183 ASN C O   1 
ATOM   2562 C CB  . ASN C 1 106 ? 67.346  31.029  -34.948 1.00 44.01  ? 183 ASN C CB  1 
ATOM   2563 C CG  . ASN C 1 106 ? 68.266  30.033  -35.553 1.00 75.37  ? 183 ASN C CG  1 
ATOM   2564 O OD1 . ASN C 1 106 ? 67.847  29.117  -36.283 1.00 67.88  ? 183 ASN C OD1 1 
ATOM   2565 N ND2 . ASN C 1 106 ? 69.544  30.188  -35.242 1.00 75.99  ? 183 ASN C ND2 1 
ATOM   2566 N N   . LYS C 1 107 ? 65.047  30.521  -32.080 1.00 47.06  ? 184 LYS C N   1 
ATOM   2567 C CA  . LYS C 1 107 ? 64.932  30.552  -30.625 1.00 44.47  ? 184 LYS C CA  1 
ATOM   2568 C C   . LYS C 1 107 ? 63.862  29.532  -30.210 1.00 46.02  ? 184 LYS C C   1 
ATOM   2569 O O   . LYS C 1 107 ? 63.010  29.147  -31.019 1.00 43.54  ? 184 LYS C O   1 
ATOM   2570 C CB  . LYS C 1 107 ? 64.514  31.961  -30.130 1.00 47.73  ? 184 LYS C CB  1 
ATOM   2571 C CG  . LYS C 1 107 ? 65.446  33.133  -30.465 1.00 52.27  ? 184 LYS C CG  1 
ATOM   2572 C CD  . LYS C 1 107 ? 64.660  34.464  -30.639 1.00 61.58  ? 184 LYS C CD  1 
ATOM   2573 N N   . ILE C 1 108 ? 63.904  29.104  -28.942 1.00 44.29  ? 185 ILE C N   1 
ATOM   2574 C CA  . ILE C 1 108 ? 62.881  28.211  -28.385 1.00 44.27  ? 185 ILE C CA  1 
ATOM   2575 C C   . ILE C 1 108 ? 61.840  29.136  -27.736 1.00 48.84  ? 185 ILE C C   1 
ATOM   2576 O O   . ILE C 1 108 ? 62.189  29.956  -26.889 1.00 47.33  ? 185 ILE C O   1 
ATOM   2577 C CB  . ILE C 1 108 ? 63.424  27.136  -27.391 1.00 44.77  ? 185 ILE C CB  1 
ATOM   2578 C CG1 . ILE C 1 108 ? 64.487  26.247  -28.073 1.00 42.75  ? 185 ILE C CG1 1 
ATOM   2579 C CG2 . ILE C 1 108 ? 62.251  26.290  -26.870 1.00 46.30  ? 185 ILE C CG2 1 
ATOM   2580 C CD1 . ILE C 1 108 ? 65.218  25.265  -27.196 1.00 36.68  ? 185 ILE C CD1 1 
ATOM   2581 N N   . LEU C 1 109 ? 60.587  29.043  -28.184 1.00 46.15  ? 186 LEU C N   1 
ATOM   2582 C CA  . LEU C 1 109 ? 59.509  29.866  -27.666 1.00 46.24  ? 186 LEU C CA  1 
ATOM   2583 C C   . LEU C 1 109 ? 58.686  29.052  -26.678 1.00 48.06  ? 186 LEU C C   1 
ATOM   2584 O O   . LEU C 1 109 ? 58.253  27.937  -26.991 1.00 47.40  ? 186 LEU C O   1 
ATOM   2585 C CB  . LEU C 1 109 ? 58.656  30.431  -28.820 1.00 48.03  ? 186 LEU C CB  1 
ATOM   2586 C CG  . LEU C 1 109 ? 57.329  31.081  -28.455 1.00 54.07  ? 186 LEU C CG  1 
ATOM   2587 C CD1 . LEU C 1 109 ? 57.502  32.341  -27.619 1.00 53.53  ? 186 LEU C CD1 1 
ATOM   2588 C CD2 . LEU C 1 109 ? 56.567  31.401  -29.688 1.00 60.71  ? 186 LEU C CD2 1 
ATOM   2589 N N   . VAL C 1 110 ? 58.514  29.605  -25.465 1.00 42.22  ? 187 VAL C N   1 
ATOM   2590 C CA  . VAL C 1 110 ? 57.743  28.985  -24.396 1.00 40.24  ? 187 VAL C CA  1 
ATOM   2591 C C   . VAL C 1 110 ? 56.248  29.317  -24.606 1.00 49.21  ? 187 VAL C C   1 
ATOM   2592 O O   . VAL C 1 110 ? 55.874  30.494  -24.676 1.00 51.62  ? 187 VAL C O   1 
ATOM   2593 C CB  . VAL C 1 110 ? 58.265  29.435  -23.032 1.00 40.55  ? 187 VAL C CB  1 
ATOM   2594 C CG1 . VAL C 1 110 ? 57.460  28.814  -21.910 1.00 39.97  ? 187 VAL C CG1 1 
ATOM   2595 C CG2 . VAL C 1 110 ? 59.737  29.101  -22.893 1.00 38.22  ? 187 VAL C CG2 1 
ATOM   2596 N N   . LYS C 1 111 ? 55.411  28.268  -24.757 1.00 44.86  ? 188 LYS C N   1 
ATOM   2597 C CA  . LYS C 1 111 ? 53.976  28.404  -24.977 1.00 45.15  ? 188 LYS C CA  1 
ATOM   2598 C C   . LYS C 1 111 ? 53.133  28.124  -23.724 1.00 50.52  ? 188 LYS C C   1 
ATOM   2599 O O   . LYS C 1 111 ? 51.990  28.563  -23.649 1.00 51.82  ? 188 LYS C O   1 
ATOM   2600 C CB  . LYS C 1 111 ? 53.525  27.590  -26.187 1.00 45.96  ? 188 LYS C CB  1 
ATOM   2601 C CG  . LYS C 1 111 ? 54.108  28.087  -27.517 1.00 50.52  ? 188 LYS C CG  1 
ATOM   2602 C CD  . LYS C 1 111 ? 53.522  29.423  -28.024 1.00 54.07  ? 188 LYS C CD  1 
ATOM   2603 N N   . GLU C 1 112 ? 53.699  27.422  -22.740 1.00 46.50  ? 189 GLU C N   1 
ATOM   2604 C CA  . GLU C 1 112 ? 53.007  27.140  -21.484 1.00 47.55  ? 189 GLU C CA  1 
ATOM   2605 C C   . GLU C 1 112 ? 53.943  27.496  -20.359 1.00 52.04  ? 189 GLU C C   1 
ATOM   2606 O O   . GLU C 1 112 ? 55.126  27.186  -20.459 1.00 52.26  ? 189 GLU C O   1 
ATOM   2607 C CB  . GLU C 1 112 ? 52.645  25.648  -21.372 1.00 48.73  ? 189 GLU C CB  1 
ATOM   2608 C CG  . GLU C 1 112 ? 51.427  25.244  -22.164 1.00 60.64  ? 189 GLU C CG  1 
ATOM   2609 C CD  . GLU C 1 112 ? 51.408  23.791  -22.576 1.00 84.86  ? 189 GLU C CD  1 
ATOM   2610 O OE1 . GLU C 1 112 ? 51.827  22.921  -21.775 1.00 73.58  ? 189 GLU C OE1 1 
ATOM   2611 O OE2 . GLU C 1 112 ? 50.948  23.528  -23.711 1.00 86.30  ? 189 GLU C OE2 1 
ATOM   2612 N N   . THR C 1 113 ? 53.439  28.104  -19.284 1.00 48.47  ? 190 THR C N   1 
ATOM   2613 C CA  . THR C 1 113 ? 54.274  28.416  -18.126 1.00 47.69  ? 190 THR C CA  1 
ATOM   2614 C C   . THR C 1 113 ? 54.541  27.098  -17.381 1.00 54.14  ? 190 THR C C   1 
ATOM   2615 O O   . THR C 1 113 ? 53.645  26.235  -17.339 1.00 56.68  ? 190 THR C O   1 
ATOM   2616 C CB  . THR C 1 113 ? 53.590  29.472  -17.240 1.00 52.49  ? 190 THR C CB  1 
ATOM   2617 O OG1 . THR C 1 113 ? 53.424  30.668  -18.011 1.00 61.13  ? 190 THR C OG1 1 
ATOM   2618 C CG2 . THR C 1 113 ? 54.359  29.771  -15.951 1.00 40.05  ? 190 THR C CG2 1 
ATOM   2619 N N   . GLY C 1 114 ? 55.752  26.937  -16.827 1.00 47.04  ? 191 GLY C N   1 
ATOM   2620 C CA  . GLY C 1 114 ? 56.090  25.737  -16.071 1.00 44.61  ? 191 GLY C CA  1 
ATOM   2621 C C   . GLY C 1 114 ? 57.547  25.634  -15.725 1.00 45.44  ? 191 GLY C C   1 
ATOM   2622 O O   . GLY C 1 114 ? 58.299  26.597  -15.924 1.00 44.64  ? 191 GLY C O   1 
ATOM   2623 N N   . TYR C 1 115 ? 57.953  24.463  -15.188 1.00 40.70  ? 192 TYR C N   1 
ATOM   2624 C CA  . TYR C 1 115 ? 59.364  24.212  -14.883 1.00 38.79  ? 192 TYR C CA  1 
ATOM   2625 C C   . TYR C 1 115 ? 59.929  23.444  -16.048 1.00 42.54  ? 192 TYR C C   1 
ATOM   2626 O O   . TYR C 1 115 ? 59.313  22.480  -16.520 1.00 42.45  ? 192 TYR C O   1 
ATOM   2627 C CB  . TYR C 1 115 ? 59.570  23.458  -13.560 1.00 39.41  ? 192 TYR C CB  1 
ATOM   2628 C CG  . TYR C 1 115 ? 59.336  24.306  -12.333 1.00 41.93  ? 192 TYR C CG  1 
ATOM   2629 C CD1 . TYR C 1 115 ? 58.046  24.560  -11.874 1.00 45.48  ? 192 TYR C CD1 1 
ATOM   2630 C CD2 . TYR C 1 115 ? 60.405  24.861  -11.629 1.00 41.91  ? 192 TYR C CD2 1 
ATOM   2631 C CE1 . TYR C 1 115 ? 57.821  25.352  -10.752 1.00 48.19  ? 192 TYR C CE1 1 
ATOM   2632 C CE2 . TYR C 1 115 ? 60.191  25.651  -10.498 1.00 43.91  ? 192 TYR C CE2 1 
ATOM   2633 C CZ  . TYR C 1 115 ? 58.895  25.894  -10.065 1.00 54.81  ? 192 TYR C CZ  1 
ATOM   2634 O OH  . TYR C 1 115 ? 58.637  26.644  -8.943  1.00 54.78  ? 192 TYR C OH  1 
ATOM   2635 N N   . PHE C 1 116 ? 61.059  23.908  -16.559 1.00 38.47  ? 193 PHE C N   1 
ATOM   2636 C CA  . PHE C 1 116 ? 61.704  23.284  -17.707 1.00 37.62  ? 193 PHE C CA  1 
ATOM   2637 C C   . PHE C 1 116 ? 63.117  22.908  -17.360 1.00 41.38  ? 193 PHE C C   1 
ATOM   2638 O O   . PHE C 1 116 ? 63.789  23.669  -16.626 1.00 40.82  ? 193 PHE C O   1 
ATOM   2639 C CB  . PHE C 1 116 ? 61.730  24.258  -18.932 1.00 38.90  ? 193 PHE C CB  1 
ATOM   2640 C CG  . PHE C 1 116 ? 60.358  24.633  -19.423 1.00 40.36  ? 193 PHE C CG  1 
ATOM   2641 C CD1 . PHE C 1 116 ? 59.644  25.662  -18.818 1.00 42.95  ? 193 PHE C CD1 1 
ATOM   2642 C CD2 . PHE C 1 116 ? 59.732  23.888  -20.418 1.00 40.49  ? 193 PHE C CD2 1 
ATOM   2643 C CE1 . PHE C 1 116 ? 58.347  25.963  -19.234 1.00 44.53  ? 193 PHE C CE1 1 
ATOM   2644 C CE2 . PHE C 1 116 ? 58.434  24.181  -20.818 1.00 43.40  ? 193 PHE C CE2 1 
ATOM   2645 C CZ  . PHE C 1 116 ? 57.753  25.217  -20.230 1.00 42.70  ? 193 PHE C CZ  1 
ATOM   2646 N N   . PHE C 1 117 ? 63.586  21.764  -17.945 1.00 35.04  ? 194 PHE C N   1 
ATOM   2647 C CA  . PHE C 1 117 ? 64.971  21.301  -17.889 1.00 32.18  ? 194 PHE C CA  1 
ATOM   2648 C C   . PHE C 1 117 ? 65.515  21.758  -19.227 1.00 38.25  ? 194 PHE C C   1 
ATOM   2649 O O   . PHE C 1 117 ? 64.992  21.338  -20.266 1.00 40.72  ? 194 PHE C O   1 
ATOM   2650 C CB  . PHE C 1 117 ? 65.062  19.768  -17.753 1.00 32.16  ? 194 PHE C CB  1 
ATOM   2651 C CG  . PHE C 1 117 ? 66.478  19.241  -17.836 1.00 30.76  ? 194 PHE C CG  1 
ATOM   2652 C CD1 . PHE C 1 117 ? 67.376  19.435  -16.787 1.00 30.16  ? 194 PHE C CD1 1 
ATOM   2653 C CD2 . PHE C 1 117 ? 66.925  18.571  -18.981 1.00 30.96  ? 194 PHE C CD2 1 
ATOM   2654 C CE1 . PHE C 1 117 ? 68.689  18.974  -16.881 1.00 29.96  ? 194 PHE C CE1 1 
ATOM   2655 C CE2 . PHE C 1 117 ? 68.243  18.104  -19.073 1.00 31.80  ? 194 PHE C CE2 1 
ATOM   2656 C CZ  . PHE C 1 117 ? 69.112  18.308  -18.024 1.00 29.65  ? 194 PHE C CZ  1 
ATOM   2657 N N   . ILE C 1 118 ? 66.499  22.670  -19.215 1.00 33.68  ? 195 ILE C N   1 
ATOM   2658 C CA  . ILE C 1 118 ? 67.082  23.263  -20.436 1.00 33.12  ? 195 ILE C CA  1 
ATOM   2659 C C   . ILE C 1 118 ? 68.522  22.823  -20.544 1.00 36.38  ? 195 ILE C C   1 
ATOM   2660 O O   . ILE C 1 118 ? 69.244  22.892  -19.545 1.00 34.62  ? 195 ILE C O   1 
ATOM   2661 C CB  . ILE C 1 118 ? 66.945  24.824  -20.438 1.00 35.41  ? 195 ILE C CB  1 
ATOM   2662 C CG1 . ILE C 1 118 ? 65.491  25.261  -20.245 1.00 34.69  ? 195 ILE C CG1 1 
ATOM   2663 C CG2 . ILE C 1 118 ? 67.533  25.433  -21.692 1.00 36.74  ? 195 ILE C CG2 1 
ATOM   2664 C CD1 . ILE C 1 118 ? 65.317  26.244  -19.240 1.00 36.56  ? 195 ILE C CD1 1 
ATOM   2665 N N   . TYR C 1 119 ? 68.932  22.395  -21.755 1.00 32.83  ? 196 TYR C N   1 
ATOM   2666 C CA  . TYR C 1 119 ? 70.280  21.888  -22.052 1.00 31.80  ? 196 TYR C CA  1 
ATOM   2667 C C   . TYR C 1 119 ? 70.843  22.431  -23.370 1.00 36.13  ? 196 TYR C C   1 
ATOM   2668 O O   . TYR C 1 119 ? 70.082  22.790  -24.275 1.00 34.53  ? 196 TYR C O   1 
ATOM   2669 C CB  . TYR C 1 119 ? 70.290  20.341  -22.060 1.00 31.30  ? 196 TYR C CB  1 
ATOM   2670 C CG  . TYR C 1 119 ? 69.370  19.721  -23.081 1.00 31.63  ? 196 TYR C CG  1 
ATOM   2671 C CD1 . TYR C 1 119 ? 68.031  19.474  -22.785 1.00 34.39  ? 196 TYR C CD1 1 
ATOM   2672 C CD2 . TYR C 1 119 ? 69.837  19.357  -24.341 1.00 32.11  ? 196 TYR C CD2 1 
ATOM   2673 C CE1 . TYR C 1 119 ? 67.171  18.907  -23.734 1.00 34.59  ? 196 TYR C CE1 1 
ATOM   2674 C CE2 . TYR C 1 119 ? 68.990  18.776  -25.291 1.00 32.80  ? 196 TYR C CE2 1 
ATOM   2675 C CZ  . TYR C 1 119 ? 67.660  18.550  -24.981 1.00 36.66  ? 196 TYR C CZ  1 
ATOM   2676 O OH  . TYR C 1 119 ? 66.822  18.008  -25.919 1.00 36.03  ? 196 TYR C OH  1 
ATOM   2677 N N   . GLY C 1 120 ? 72.169  22.443  -23.470 1.00 33.72  ? 197 GLY C N   1 
ATOM   2678 C CA  . GLY C 1 120 ? 72.853  22.915  -24.664 1.00 34.95  ? 197 GLY C CA  1 
ATOM   2679 C C   . GLY C 1 120 ? 74.311  22.533  -24.703 1.00 42.49  ? 197 GLY C C   1 
ATOM   2680 O O   . GLY C 1 120 ? 74.988  22.555  -23.669 1.00 44.67  ? 197 GLY C O   1 
ATOM   2681 N N   . GLN C 1 121 ? 74.797  22.183  -25.909 1.00 38.07  ? 198 GLN C N   1 
ATOM   2682 C CA  . GLN C 1 121 ? 76.189  21.837  -26.174 1.00 36.91  ? 198 GLN C CA  1 
ATOM   2683 C C   . GLN C 1 121 ? 76.647  22.468  -27.482 1.00 41.05  ? 198 GLN C C   1 
ATOM   2684 O O   . GLN C 1 121 ? 75.867  22.574  -28.439 1.00 41.46  ? 198 GLN C O   1 
ATOM   2685 C CB  . GLN C 1 121 ? 76.408  20.322  -26.204 1.00 37.32  ? 198 GLN C CB  1 
ATOM   2686 C CG  . GLN C 1 121 ? 77.873  19.932  -26.465 1.00 27.41  ? 198 GLN C CG  1 
ATOM   2687 C CD  . GLN C 1 121 ? 78.097  18.464  -26.377 1.00 47.41  ? 198 GLN C CD  1 
ATOM   2688 O OE1 . GLN C 1 121 ? 78.083  17.875  -25.293 1.00 52.03  ? 198 GLN C OE1 1 
ATOM   2689 N NE2 . GLN C 1 121 ? 78.315  17.837  -27.511 1.00 30.62  ? 198 GLN C NE2 1 
ATOM   2690 N N   . VAL C 1 122 ? 77.921  22.894  -27.511 1.00 35.62  ? 199 VAL C N   1 
ATOM   2691 C CA  . VAL C 1 122 ? 78.578  23.462  -28.687 1.00 34.86  ? 199 VAL C CA  1 
ATOM   2692 C C   . VAL C 1 122 ? 79.986  22.870  -28.702 1.00 38.41  ? 199 VAL C C   1 
ATOM   2693 O O   . VAL C 1 122 ? 80.594  22.719  -27.634 1.00 37.40  ? 199 VAL C O   1 
ATOM   2694 C CB  . VAL C 1 122 ? 78.641  25.017  -28.637 1.00 38.05  ? 199 VAL C CB  1 
ATOM   2695 C CG1 . VAL C 1 122 ? 79.336  25.585  -29.866 1.00 38.85  ? 199 VAL C CG1 1 
ATOM   2696 C CG2 . VAL C 1 122 ? 77.255  25.631  -28.483 1.00 37.63  ? 199 VAL C CG2 1 
ATOM   2697 N N   . LEU C 1 123 ? 80.499  22.530  -29.890 1.00 35.37  ? 200 LEU C N   1 
ATOM   2698 C CA  . LEU C 1 123 ? 81.877  22.071  -30.041 1.00 36.01  ? 200 LEU C CA  1 
ATOM   2699 C C   . LEU C 1 123 ? 82.643  23.250  -30.600 1.00 41.77  ? 200 LEU C C   1 
ATOM   2700 O O   . LEU C 1 123 ? 82.303  23.779  -31.678 1.00 41.38  ? 200 LEU C O   1 
ATOM   2701 C CB  . LEU C 1 123 ? 82.007  20.852  -30.973 1.00 36.57  ? 200 LEU C CB  1 
ATOM   2702 C CG  . LEU C 1 123 ? 83.406  20.498  -31.494 1.00 42.05  ? 200 LEU C CG  1 
ATOM   2703 C CD1 . LEU C 1 123 ? 84.363  20.180  -30.372 1.00 42.52  ? 200 LEU C CD1 1 
ATOM   2704 C CD2 . LEU C 1 123 ? 83.352  19.307  -32.383 1.00 44.14  ? 200 LEU C CD2 1 
ATOM   2705 N N   . TYR C 1 124 ? 83.678  23.666  -29.851 1.00 38.94  ? 201 TYR C N   1 
ATOM   2706 C CA  . TYR C 1 124 ? 84.527  24.810  -30.192 1.00 38.87  ? 201 TYR C CA  1 
ATOM   2707 C C   . TYR C 1 124 ? 85.763  24.370  -30.873 1.00 43.11  ? 201 TYR C C   1 
ATOM   2708 O O   . TYR C 1 124 ? 86.424  23.436  -30.399 1.00 44.71  ? 201 TYR C O   1 
ATOM   2709 C CB  . TYR C 1 124 ? 84.846  25.638  -28.946 1.00 38.35  ? 201 TYR C CB  1 
ATOM   2710 C CG  . TYR C 1 124 ? 83.590  26.192  -28.325 1.00 39.46  ? 201 TYR C CG  1 
ATOM   2711 C CD1 . TYR C 1 124 ? 82.955  27.307  -28.867 1.00 43.05  ? 201 TYR C CD1 1 
ATOM   2712 C CD2 . TYR C 1 124 ? 82.983  25.551  -27.247 1.00 38.67  ? 201 TYR C CD2 1 
ATOM   2713 C CE1 . TYR C 1 124 ? 81.763  27.788  -28.336 1.00 45.32  ? 201 TYR C CE1 1 
ATOM   2714 C CE2 . TYR C 1 124 ? 81.798  26.026  -26.699 1.00 38.99  ? 201 TYR C CE2 1 
ATOM   2715 C CZ  . TYR C 1 124 ? 81.191  27.145  -27.249 1.00 53.37  ? 201 TYR C CZ  1 
ATOM   2716 O OH  . TYR C 1 124 ? 80.008  27.601  -26.736 1.00 59.86  ? 201 TYR C OH  1 
ATOM   2717 N N   . THR C 1 125 ? 86.043  24.987  -32.021 1.00 37.96  ? 202 THR C N   1 
ATOM   2718 C CA  . THR C 1 125 ? 87.243  24.729  -32.812 1.00 39.66  ? 202 THR C CA  1 
ATOM   2719 C C   . THR C 1 125 ? 87.991  26.056  -33.007 1.00 45.78  ? 202 THR C C   1 
ATOM   2720 O O   . THR C 1 125 ? 88.614  26.283  -34.037 1.00 47.18  ? 202 THR C O   1 
ATOM   2721 C CB  . THR C 1 125 ? 86.900  23.973  -34.091 1.00 52.54  ? 202 THR C CB  1 
ATOM   2722 O OG1 . THR C 1 125 ? 85.959  24.730  -34.858 1.00 52.43  ? 202 THR C OG1 1 
ATOM   2723 C CG2 . THR C 1 125 ? 86.377  22.565  -33.817 1.00 53.01  ? 202 THR C CG2 1 
ATOM   2724 N N   . ASP C 1 126 ? 87.919  26.927  -31.977 1.00 42.25  ? 203 ASP C N   1 
ATOM   2725 C CA  . ASP C 1 126 ? 88.470  28.266  -31.938 1.00 43.23  ? 203 ASP C CA  1 
ATOM   2726 C C   . ASP C 1 126 ? 89.727  28.330  -31.078 1.00 50.11  ? 203 ASP C C   1 
ATOM   2727 O O   . ASP C 1 126 ? 89.738  27.793  -29.974 1.00 49.11  ? 203 ASP C O   1 
ATOM   2728 C CB  . ASP C 1 126 ? 87.386  29.228  -31.425 1.00 43.53  ? 203 ASP C CB  1 
ATOM   2729 C CG  . ASP C 1 126 ? 87.570  30.682  -31.832 1.00 60.21  ? 203 ASP C CG  1 
ATOM   2730 O OD1 . ASP C 1 126 ? 88.667  31.247  -31.563 1.00 63.37  ? 203 ASP C OD1 1 
ATOM   2731 O OD2 . ASP C 1 126 ? 86.607  31.273  -32.382 1.00 63.35  ? 203 ASP C OD2 1 
ATOM   2732 N N   . LYS C 1 127 ? 90.783  29.012  -31.579 1.00 48.97  ? 204 LYS C N   1 
ATOM   2733 C CA  . LYS C 1 127 ? 92.056  29.147  -30.863 1.00 48.70  ? 204 LYS C CA  1 
ATOM   2734 C C   . LYS C 1 127 ? 92.003  30.144  -29.663 1.00 52.91  ? 204 LYS C C   1 
ATOM   2735 O O   . LYS C 1 127 ? 92.910  30.112  -28.814 1.00 53.59  ? 204 LYS C O   1 
ATOM   2736 C CB  . LYS C 1 127 ? 93.244  29.380  -31.828 1.00 50.68  ? 204 LYS C CB  1 
ATOM   2737 N N   . THR C 1 128 ? 90.921  30.977  -29.564 1.00 47.88  ? 205 THR C N   1 
ATOM   2738 C CA  . THR C 1 128 ? 90.713  31.950  -28.469 1.00 47.99  ? 205 THR C CA  1 
ATOM   2739 C C   . THR C 1 128 ? 90.910  31.258  -27.109 1.00 53.70  ? 205 THR C C   1 
ATOM   2740 O O   . THR C 1 128 ? 90.328  30.191  -26.892 1.00 52.46  ? 205 THR C O   1 
ATOM   2741 C CB  . THR C 1 128 ? 89.305  32.600  -28.568 1.00 48.59  ? 205 THR C CB  1 
ATOM   2742 O OG1 . THR C 1 128 ? 89.145  33.200  -29.848 1.00 45.94  ? 205 THR C OG1 1 
ATOM   2743 C CG2 . THR C 1 128 ? 89.047  33.646  -27.491 1.00 42.78  ? 205 THR C CG2 1 
ATOM   2744 N N   . TYR C 1 129 ? 91.718  31.870  -26.203 1.00 51.89  ? 206 TYR C N   1 
ATOM   2745 C CA  . TYR C 1 129 ? 92.080  31.340  -24.872 1.00 50.61  ? 206 TYR C CA  1 
ATOM   2746 C C   . TYR C 1 129 ? 90.954  30.643  -24.119 1.00 52.75  ? 206 TYR C C   1 
ATOM   2747 O O   . TYR C 1 129 ? 91.204  29.657  -23.431 1.00 53.05  ? 206 TYR C O   1 
ATOM   2748 C CB  . TYR C 1 129 ? 92.764  32.409  -24.000 1.00 52.10  ? 206 TYR C CB  1 
ATOM   2749 C CG  . TYR C 1 129 ? 91.788  33.323  -23.298 1.00 52.15  ? 206 TYR C CG  1 
ATOM   2750 C CD1 . TYR C 1 129 ? 91.140  34.340  -23.988 1.00 54.14  ? 206 TYR C CD1 1 
ATOM   2751 C CD2 . TYR C 1 129 ? 91.457  33.125  -21.961 1.00 51.79  ? 206 TYR C CD2 1 
ATOM   2752 C CE1 . TYR C 1 129 ? 90.215  35.166  -23.357 1.00 54.01  ? 206 TYR C CE1 1 
ATOM   2753 C CE2 . TYR C 1 129 ? 90.534  33.944  -21.317 1.00 52.15  ? 206 TYR C CE2 1 
ATOM   2754 C CZ  . TYR C 1 129 ? 89.912  34.966  -22.024 1.00 61.07  ? 206 TYR C CZ  1 
ATOM   2755 O OH  . TYR C 1 129 ? 89.011  35.821  -21.430 1.00 61.99  ? 206 TYR C OH  1 
ATOM   2756 N N   . ALA C 1 130 ? 89.730  31.169  -24.243 1.00 48.52  ? 207 ALA C N   1 
ATOM   2757 C CA  . ALA C 1 130 ? 88.522  30.609  -23.654 1.00 46.59  ? 207 ALA C CA  1 
ATOM   2758 C C   . ALA C 1 130 ? 87.345  30.823  -24.597 1.00 49.52  ? 207 ALA C C   1 
ATOM   2759 O O   . ALA C 1 130 ? 87.228  31.886  -25.226 1.00 51.49  ? 207 ALA C O   1 
ATOM   2760 C CB  . ALA C 1 130 ? 88.243  31.242  -22.303 1.00 46.98  ? 207 ALA C CB  1 
ATOM   2761 N N   . MET C 1 131 ? 86.506  29.782  -24.728 1.00 42.42  ? 208 MET C N   1 
ATOM   2762 C CA  . MET C 1 131 ? 85.293  29.728  -25.560 1.00 39.85  ? 208 MET C CA  1 
ATOM   2763 C C   . MET C 1 131 ? 84.190  29.171  -24.708 1.00 42.16  ? 208 MET C C   1 
ATOM   2764 O O   . MET C 1 131 ? 84.476  28.526  -23.696 1.00 42.27  ? 208 MET C O   1 
ATOM   2765 C CB  . MET C 1 131 ? 85.493  28.833  -26.786 1.00 41.59  ? 208 MET C CB  1 
ATOM   2766 C CG  . MET C 1 131 ? 86.400  29.424  -27.828 1.00 46.57  ? 208 MET C CG  1 
ATOM   2767 S SD  . MET C 1 131 ? 85.865  31.030  -28.472 1.00 51.93  ? 208 MET C SD  1 
ATOM   2768 C CE  . MET C 1 131 ? 84.466  30.541  -29.505 1.00 48.32  ? 208 MET C CE  1 
ATOM   2769 N N   . GLY C 1 132 ? 82.947  29.462  -25.077 1.00 37.56  ? 209 GLY C N   1 
ATOM   2770 C CA  . GLY C 1 132 ? 81.778  29.035  -24.317 1.00 36.46  ? 209 GLY C CA  1 
ATOM   2771 C C   . GLY C 1 132 ? 80.520  29.733  -24.769 1.00 42.71  ? 209 GLY C C   1 
ATOM   2772 O O   . GLY C 1 132 ? 80.567  30.604  -25.652 1.00 45.30  ? 209 GLY C O   1 
ATOM   2773 N N   . HIS C 1 133 ? 79.378  29.320  -24.203 1.00 36.59  ? 210 HIS C N   1 
ATOM   2774 C CA  . HIS C 1 133 ? 78.108  29.904  -24.599 1.00 35.95  ? 210 HIS C CA  1 
ATOM   2775 C C   . HIS C 1 133 ? 77.215  30.245  -23.408 1.00 38.97  ? 210 HIS C C   1 
ATOM   2776 O O   . HIS C 1 133 ? 77.498  29.831  -22.263 1.00 37.23  ? 210 HIS C O   1 
ATOM   2777 C CB  . HIS C 1 133 ? 77.382  28.992  -25.589 1.00 36.70  ? 210 HIS C CB  1 
ATOM   2778 C CG  . HIS C 1 133 ? 77.180  27.592  -25.092 1.00 39.48  ? 210 HIS C CG  1 
ATOM   2779 N ND1 . HIS C 1 133 ? 78.141  26.621  -25.279 1.00 41.12  ? 210 HIS C ND1 1 
ATOM   2780 C CD2 . HIS C 1 133 ? 76.138  27.051  -24.408 1.00 41.13  ? 210 HIS C CD2 1 
ATOM   2781 C CE1 . HIS C 1 133 ? 77.653  25.518  -24.732 1.00 39.95  ? 210 HIS C CE1 1 
ATOM   2782 N NE2 . HIS C 1 133 ? 76.453  25.729  -24.180 1.00 39.95  ? 210 HIS C NE2 1 
ATOM   2783 N N   . LEU C 1 134 ? 76.131  31.006  -23.697 1.00 33.30  ? 211 LEU C N   1 
ATOM   2784 C CA  . LEU C 1 134 ? 75.153  31.402  -22.707 1.00 31.57  ? 211 LEU C CA  1 
ATOM   2785 C C   . LEU C 1 134 ? 73.793  30.904  -23.131 1.00 37.60  ? 211 LEU C C   1 
ATOM   2786 O O   . LEU C 1 134 ? 73.403  31.118  -24.281 1.00 37.86  ? 211 LEU C O   1 
ATOM   2787 C CB  . LEU C 1 134 ? 75.090  32.932  -22.560 1.00 31.99  ? 211 LEU C CB  1 
ATOM   2788 C CG  . LEU C 1 134 ? 76.374  33.745  -22.642 1.00 36.52  ? 211 LEU C CG  1 
ATOM   2789 C CD1 . LEU C 1 134 ? 76.064  35.204  -22.679 1.00 37.12  ? 211 LEU C CD1 1 
ATOM   2790 C CD2 . LEU C 1 134 ? 77.294  33.461  -21.491 1.00 38.15  ? 211 LEU C CD2 1 
ATOM   2791 N N   . ILE C 1 135 ? 73.061  30.239  -22.210 1.00 34.42  ? 212 ILE C N   1 
ATOM   2792 C CA  . ILE C 1 135 ? 71.668  29.842  -22.427 1.00 33.61  ? 212 ILE C CA  1 
ATOM   2793 C C   . ILE C 1 135 ? 70.904  31.009  -21.791 1.00 37.07  ? 212 ILE C C   1 
ATOM   2794 O O   . ILE C 1 135 ? 70.923  31.196  -20.567 1.00 36.64  ? 212 ILE C O   1 
ATOM   2795 C CB  . ILE C 1 135 ? 71.288  28.444  -21.865 1.00 36.23  ? 212 ILE C CB  1 
ATOM   2796 C CG1 . ILE C 1 135 ? 71.893  27.327  -22.741 1.00 37.45  ? 212 ILE C CG1 1 
ATOM   2797 C CG2 . ILE C 1 135 ? 69.762  28.276  -21.783 1.00 36.84  ? 212 ILE C CG2 1 
ATOM   2798 C CD1 . ILE C 1 135 ? 71.919  25.899  -22.058 1.00 47.51  ? 212 ILE C CD1 1 
ATOM   2799 N N   . GLN C 1 136 ? 70.325  31.851  -22.651 1.00 33.62  ? 213 GLN C N   1 
ATOM   2800 C CA  . GLN C 1 136 ? 69.653  33.082  -22.264 1.00 33.18  ? 213 GLN C CA  1 
ATOM   2801 C C   . GLN C 1 136 ? 68.175  33.020  -22.363 1.00 39.82  ? 213 GLN C C   1 
ATOM   2802 O O   . GLN C 1 136 ? 67.632  32.313  -23.213 1.00 41.18  ? 213 GLN C O   1 
ATOM   2803 C CB  . GLN C 1 136 ? 70.169  34.245  -23.080 1.00 34.78  ? 213 GLN C CB  1 
ATOM   2804 C CG  . GLN C 1 136 ? 71.664  34.395  -22.977 1.00 52.40  ? 213 GLN C CG  1 
ATOM   2805 C CD  . GLN C 1 136 ? 72.107  35.640  -23.669 1.00 68.06  ? 213 GLN C CD  1 
ATOM   2806 O OE1 . GLN C 1 136 ? 71.890  35.817  -24.878 1.00 57.56  ? 213 GLN C OE1 1 
ATOM   2807 N NE2 . GLN C 1 136 ? 72.711  36.541  -22.896 1.00 59.23  ? 213 GLN C NE2 1 
ATOM   2808 N N   . ARG C 1 137 ? 67.519  33.801  -21.505 1.00 36.69  ? 214 ARG C N   1 
ATOM   2809 C CA  . ARG C 1 137 ? 66.083  33.902  -21.438 1.00 36.31  ? 214 ARG C CA  1 
ATOM   2810 C C   . ARG C 1 137 ? 65.683  35.339  -21.815 1.00 43.72  ? 214 ARG C C   1 
ATOM   2811 O O   . ARG C 1 137 ? 66.106  36.296  -21.160 1.00 44.68  ? 214 ARG C O   1 
ATOM   2812 C CB  . ARG C 1 137 ? 65.633  33.581  -20.026 1.00 32.05  ? 214 ARG C CB  1 
ATOM   2813 C CG  . ARG C 1 137 ? 64.145  33.640  -19.848 1.00 44.63  ? 214 ARG C CG  1 
ATOM   2814 C CD  . ARG C 1 137 ? 63.841  33.511  -18.399 1.00 53.23  ? 214 ARG C CD  1 
ATOM   2815 N NE  . ARG C 1 137 ? 62.429  33.674  -18.115 1.00 52.56  ? 214 ARG C NE  1 
ATOM   2816 C CZ  . ARG C 1 137 ? 61.963  33.930  -16.906 1.00 60.82  ? 214 ARG C CZ  1 
ATOM   2817 N NH1 . ARG C 1 137 ? 62.797  34.062  -15.880 1.00 39.13  ? 214 ARG C NH1 1 
ATOM   2818 N NH2 . ARG C 1 137 ? 60.662  34.069  -16.709 1.00 51.20  ? 214 ARG C NH2 1 
ATOM   2819 N N   . LYS C 1 138 ? 64.877  35.490  -22.882 1.00 39.67  ? 215 LYS C N   1 
ATOM   2820 C CA  . LYS C 1 138 ? 64.351  36.793  -23.261 1.00 39.22  ? 215 LYS C CA  1 
ATOM   2821 C C   . LYS C 1 138 ? 62.988  36.828  -22.588 1.00 43.04  ? 215 LYS C C   1 
ATOM   2822 O O   . LYS C 1 138 ? 62.055  36.158  -23.036 1.00 43.63  ? 215 LYS C O   1 
ATOM   2823 C CB  . LYS C 1 138 ? 64.283  36.980  -24.792 1.00 39.80  ? 215 LYS C CB  1 
ATOM   2824 C CG  . LYS C 1 138 ? 63.881  38.382  -25.236 1.00 40.64  ? 215 LYS C CG  1 
ATOM   2825 N N   . LYS C 1 139 ? 62.926  37.508  -21.437 1.00 39.12  ? 216 LYS C N   1 
ATOM   2826 C CA  . LYS C 1 139 ? 61.724  37.642  -20.614 1.00 40.56  ? 216 LYS C CA  1 
ATOM   2827 C C   . LYS C 1 139 ? 60.603  38.374  -21.373 1.00 50.55  ? 216 LYS C C   1 
ATOM   2828 O O   . LYS C 1 139 ? 60.845  39.436  -21.979 1.00 53.37  ? 216 LYS C O   1 
ATOM   2829 C CB  . LYS C 1 139 ? 62.062  38.408  -19.321 1.00 43.10  ? 216 LYS C CB  1 
ATOM   2830 C CG  . LYS C 1 139 ? 62.930  37.634  -18.322 1.00 52.86  ? 216 LYS C CG  1 
ATOM   2831 C CD  . LYS C 1 139 ? 62.536  37.905  -16.876 1.00 64.16  ? 216 LYS C CD  1 
ATOM   2832 C CE  . LYS C 1 139 ? 63.090  39.149  -16.213 1.00 62.82  ? 216 LYS C CE  1 
ATOM   2833 N NZ  . LYS C 1 139 ? 64.418  38.914  -15.578 1.00 72.39  ? 216 LYS C NZ  1 
ATOM   2834 N N   . VAL C 1 140 ? 59.377  37.823  -21.340 1.00 47.51  ? 217 VAL C N   1 
ATOM   2835 C CA  . VAL C 1 140 ? 58.235  38.511  -21.966 1.00 49.45  ? 217 VAL C CA  1 
ATOM   2836 C C   . VAL C 1 140 ? 57.812  39.732  -21.107 1.00 56.97  ? 217 VAL C C   1 
ATOM   2837 O O   . VAL C 1 140 ? 57.368  40.749  -21.638 1.00 59.47  ? 217 VAL C O   1 
ATOM   2838 C CB  . VAL C 1 140 ? 57.049  37.574  -22.372 1.00 52.52  ? 217 VAL C CB  1 
ATOM   2839 C CG1 . VAL C 1 140 ? 56.374  36.930  -21.176 1.00 50.65  ? 217 VAL C CG1 1 
ATOM   2840 C CG2 . VAL C 1 140 ? 56.027  38.303  -23.238 1.00 54.94  ? 217 VAL C CG2 1 
ATOM   2841 N N   . HIS C 1 141 ? 58.020  39.633  -19.787 1.00 53.55  ? 218 HIS C N   1 
ATOM   2842 C CA  . HIS C 1 141 ? 57.714  40.670  -18.809 1.00 54.51  ? 218 HIS C CA  1 
ATOM   2843 C C   . HIS C 1 141 ? 58.975  41.133  -18.101 1.00 52.08  ? 218 HIS C C   1 
ATOM   2844 O O   . HIS C 1 141 ? 59.779  40.303  -17.676 1.00 50.96  ? 218 HIS C O   1 
ATOM   2845 C CB  . HIS C 1 141 ? 56.726  40.129  -17.774 1.00 57.16  ? 218 HIS C CB  1 
ATOM   2846 C CG  . HIS C 1 141 ? 55.416  39.686  -18.347 1.00 63.32  ? 218 HIS C CG  1 
ATOM   2847 N ND1 . HIS C 1 141 ? 54.673  38.674  -17.750 1.00 65.38  ? 218 HIS C ND1 1 
ATOM   2848 C CD2 . HIS C 1 141 ? 54.745  40.153  -19.434 1.00 68.07  ? 218 HIS C CD2 1 
ATOM   2849 C CE1 . HIS C 1 141 ? 53.575  38.574  -18.481 1.00 67.48  ? 218 HIS C CE1 1 
ATOM   2850 N NE2 . HIS C 1 141 ? 53.574  39.447  -19.508 1.00 69.08  ? 218 HIS C NE2 1 
ATOM   2851 N N   . VAL C 1 142 ? 59.157  42.454  -17.991 1.00 44.54  ? 219 VAL C N   1 
ATOM   2852 C CA  . VAL C 1 142 ? 60.298  43.088  -17.329 1.00 41.03  ? 219 VAL C CA  1 
ATOM   2853 C C   . VAL C 1 142 ? 59.719  44.068  -16.364 1.00 41.33  ? 219 VAL C C   1 
ATOM   2854 O O   . VAL C 1 142 ? 58.854  44.861  -16.754 1.00 42.48  ? 219 VAL C O   1 
ATOM   2855 C CB  . VAL C 1 142 ? 61.283  43.819  -18.305 1.00 44.97  ? 219 VAL C CB  1 
ATOM   2856 C CG1 . VAL C 1 142 ? 62.558  44.256  -17.591 1.00 43.97  ? 219 VAL C CG1 1 
ATOM   2857 C CG2 . VAL C 1 142 ? 61.631  42.947  -19.484 1.00 43.91  ? 219 VAL C CG2 1 
ATOM   2858 N N   . PHE C 1 143 ? 60.235  44.084  -15.129 1.00 34.59  ? 220 PHE C N   1 
ATOM   2859 C CA  . PHE C 1 143 ? 59.788  45.048  -14.117 1.00 35.09  ? 220 PHE C CA  1 
ATOM   2860 C C   . PHE C 1 143 ? 60.952  45.816  -13.550 1.00 39.39  ? 220 PHE C C   1 
ATOM   2861 O O   . PHE C 1 143 ? 62.015  45.246  -13.348 1.00 37.99  ? 220 PHE C O   1 
ATOM   2862 C CB  . PHE C 1 143 ? 58.968  44.346  -13.020 1.00 35.81  ? 220 PHE C CB  1 
ATOM   2863 C CG  . PHE C 1 143 ? 57.732  43.657  -13.572 1.00 36.93  ? 220 PHE C CG  1 
ATOM   2864 C CD1 . PHE C 1 143 ? 56.536  44.364  -13.752 1.00 42.15  ? 220 PHE C CD1 1 
ATOM   2865 C CD2 . PHE C 1 143 ? 57.784  42.332  -13.998 1.00 35.38  ? 220 PHE C CD2 1 
ATOM   2866 C CE1 . PHE C 1 143 ? 55.413  43.745  -14.331 1.00 42.68  ? 220 PHE C CE1 1 
ATOM   2867 C CE2 . PHE C 1 143 ? 56.647  41.709  -14.554 1.00 37.99  ? 220 PHE C CE2 1 
ATOM   2868 C CZ  . PHE C 1 143 ? 55.470  42.414  -14.700 1.00 38.35  ? 220 PHE C CZ  1 
ATOM   2869 N N   . GLY C 1 144 ? 60.758  47.107  -13.339 1.00 39.33  ? 221 GLY C N   1 
ATOM   2870 C CA  . GLY C 1 144 ? 61.748  48.021  -12.767 1.00 40.22  ? 221 GLY C CA  1 
ATOM   2871 C C   . GLY C 1 144 ? 63.158  47.823  -13.269 1.00 44.13  ? 221 GLY C C   1 
ATOM   2872 O O   . GLY C 1 144 ? 63.369  47.800  -14.479 1.00 43.20  ? 221 GLY C O   1 
ATOM   2873 N N   . ASP C 1 145 ? 64.117  47.585  -12.346 1.00 41.34  ? 222 ASP C N   1 
ATOM   2874 C CA  . ASP C 1 145 ? 65.530  47.447  -12.681 1.00 40.71  ? 222 ASP C CA  1 
ATOM   2875 C C   . ASP C 1 145 ? 65.995  46.091  -13.231 1.00 45.01  ? 222 ASP C C   1 
ATOM   2876 O O   . ASP C 1 145 ? 67.189  45.889  -13.430 1.00 44.79  ? 222 ASP C O   1 
ATOM   2877 C CB  . ASP C 1 145 ? 66.420  48.019  -11.570 1.00 43.56  ? 222 ASP C CB  1 
ATOM   2878 C CG  . ASP C 1 145 ? 66.527  47.215  -10.282 1.00 58.44  ? 222 ASP C CG  1 
ATOM   2879 O OD1 . ASP C 1 145 ? 67.466  47.493  -9.481  1.00 59.66  ? 222 ASP C OD1 1 
ATOM   2880 O OD2 . ASP C 1 145 ? 65.693  46.297  -10.078 1.00 65.08  ? 222 ASP C OD2 1 
ATOM   2881 N N   . GLU C 1 146 ? 65.059  45.184  -13.554 1.00 42.32  ? 223 GLU C N   1 
ATOM   2882 C CA  . GLU C 1 146 ? 65.374  43.886  -14.163 1.00 40.44  ? 223 GLU C CA  1 
ATOM   2883 C C   . GLU C 1 146 ? 65.872  44.091  -15.586 1.00 46.38  ? 223 GLU C C   1 
ATOM   2884 O O   . GLU C 1 146 ? 65.510  45.073  -16.227 1.00 46.62  ? 223 GLU C O   1 
ATOM   2885 C CB  . GLU C 1 146 ? 64.104  43.041  -14.281 1.00 41.92  ? 223 GLU C CB  1 
ATOM   2886 C CG  . GLU C 1 146 ? 63.611  42.370  -13.011 1.00 57.95  ? 223 GLU C CG  1 
ATOM   2887 C CD  . GLU C 1 146 ? 62.323  41.575  -13.186 1.00 86.00  ? 223 GLU C CD  1 
ATOM   2888 O OE1 . GLU C 1 146 ? 61.514  41.887  -14.093 1.00 59.44  ? 223 GLU C OE1 1 
ATOM   2889 O OE2 . GLU C 1 146 ? 62.137  40.613  -12.410 1.00 92.61  ? 223 GLU C OE2 1 
ATOM   2890 N N   . LEU C 1 147 ? 66.637  43.141  -16.107 1.00 45.87  ? 224 LEU C N   1 
ATOM   2891 C CA  . LEU C 1 147 ? 67.049  43.138  -17.517 1.00 47.75  ? 224 LEU C CA  1 
ATOM   2892 C C   . LEU C 1 147 ? 66.059  42.232  -18.291 1.00 51.56  ? 224 LEU C C   1 
ATOM   2893 O O   . LEU C 1 147 ? 65.585  41.248  -17.727 1.00 50.38  ? 224 LEU C O   1 
ATOM   2894 C CB  . LEU C 1 147 ? 68.446  42.529  -17.691 1.00 47.06  ? 224 LEU C CB  1 
ATOM   2895 C CG  . LEU C 1 147 ? 69.620  43.180  -16.993 1.00 51.55  ? 224 LEU C CG  1 
ATOM   2896 C CD1 . LEU C 1 147 ? 70.772  42.189  -16.890 1.00 51.24  ? 224 LEU C CD1 1 
ATOM   2897 C CD2 . LEU C 1 147 ? 70.016  44.440  -17.665 1.00 50.44  ? 224 LEU C CD2 1 
ATOM   2898 N N   . SER C 1 148 ? 65.798  42.533  -19.584 1.00 48.38  ? 225 SER C N   1 
ATOM   2899 C CA  . SER C 1 148 ? 64.935  41.745  -20.469 1.00 46.93  ? 225 SER C CA  1 
ATOM   2900 C C   . SER C 1 148 ? 65.601  40.413  -20.819 1.00 46.49  ? 225 SER C C   1 
ATOM   2901 O O   . SER C 1 148 ? 64.919  39.388  -20.912 1.00 44.50  ? 225 SER C O   1 
ATOM   2902 C CB  . SER C 1 148 ? 64.657  42.528  -21.748 1.00 53.78  ? 225 SER C CB  1 
ATOM   2903 O OG  . SER C 1 148 ? 63.509  42.044  -22.432 1.00 70.26  ? 225 SER C OG  1 
ATOM   2904 N N   . LEU C 1 149 ? 66.933  40.438  -21.031 1.00 41.72  ? 226 LEU C N   1 
ATOM   2905 C CA  . LEU C 1 149 ? 67.721  39.264  -21.379 1.00 40.01  ? 226 LEU C CA  1 
ATOM   2906 C C   . LEU C 1 149 ? 68.591  38.872  -20.224 1.00 46.34  ? 226 LEU C C   1 
ATOM   2907 O O   . LEU C 1 149 ? 69.342  39.706  -19.697 1.00 48.04  ? 226 LEU C O   1 
ATOM   2908 C CB  . LEU C 1 149 ? 68.569  39.554  -22.618 1.00 40.11  ? 226 LEU C CB  1 
ATOM   2909 C CG  . LEU C 1 149 ? 69.070  38.368  -23.398 1.00 41.48  ? 226 LEU C CG  1 
ATOM   2910 C CD1 . LEU C 1 149 ? 67.952  37.725  -24.187 1.00 40.81  ? 226 LEU C CD1 1 
ATOM   2911 C CD2 . LEU C 1 149 ? 70.187  38.769  -24.283 1.00 42.98  ? 226 LEU C CD2 1 
ATOM   2912 N N   . VAL C 1 150 ? 68.487  37.609  -19.818 1.00 42.64  ? 227 VAL C N   1 
ATOM   2913 C CA  . VAL C 1 150 ? 69.223  37.079  -18.680 1.00 41.44  ? 227 VAL C CA  1 
ATOM   2914 C C   . VAL C 1 150 ? 69.897  35.770  -19.006 1.00 43.30  ? 227 VAL C C   1 
ATOM   2915 O O   . VAL C 1 150 ? 69.332  34.927  -19.709 1.00 41.39  ? 227 VAL C O   1 
ATOM   2916 C CB  . VAL C 1 150 ? 68.347  36.992  -17.400 1.00 46.78  ? 227 VAL C CB  1 
ATOM   2917 C CG1 . VAL C 1 150 ? 67.864  38.383  -16.974 1.00 49.29  ? 227 VAL C CG1 1 
ATOM   2918 C CG2 . VAL C 1 150 ? 67.161  36.041  -17.566 1.00 46.33  ? 227 VAL C CG2 1 
ATOM   2919 N N   . THR C 1 151 ? 71.111  35.599  -18.491 1.00 39.76  ? 228 THR C N   1 
ATOM   2920 C CA  . THR C 1 151 ? 71.850  34.365  -18.697 1.00 37.94  ? 228 THR C CA  1 
ATOM   2921 C C   . THR C 1 151 ? 71.408  33.391  -17.633 1.00 39.47  ? 228 THR C C   1 
ATOM   2922 O O   . THR C 1 151 ? 71.573  33.673  -16.449 1.00 39.39  ? 228 THR C O   1 
ATOM   2923 C CB  . THR C 1 151 ? 73.346  34.636  -18.707 1.00 49.18  ? 228 THR C CB  1 
ATOM   2924 O OG1 . THR C 1 151 ? 73.617  35.619  -19.710 1.00 55.70  ? 228 THR C OG1 1 
ATOM   2925 C CG2 . THR C 1 151 ? 74.174  33.373  -18.948 1.00 46.05  ? 228 THR C CG2 1 
ATOM   2926 N N   . LEU C 1 152 ? 70.800  32.274  -18.045 1.00 34.29  ? 229 LEU C N   1 
ATOM   2927 C CA  . LEU C 1 152 ? 70.386  31.215  -17.125 1.00 33.39  ? 229 LEU C CA  1 
ATOM   2928 C C   . LEU C 1 152 ? 71.600  30.345  -16.757 1.00 36.29  ? 229 LEU C C   1 
ATOM   2929 O O   . LEU C 1 152 ? 71.923  30.193  -15.567 1.00 32.80  ? 229 LEU C O   1 
ATOM   2930 C CB  . LEU C 1 152 ? 69.281  30.357  -17.747 1.00 33.39  ? 229 LEU C CB  1 
ATOM   2931 C CG  . LEU C 1 152 ? 67.920  31.035  -17.905 1.00 38.58  ? 229 LEU C CG  1 
ATOM   2932 C CD1 . LEU C 1 152 ? 66.985  30.221  -18.777 1.00 37.52  ? 229 LEU C CD1 1 
ATOM   2933 C CD2 . LEU C 1 152 ? 67.270  31.210  -16.576 1.00 41.78  ? 229 LEU C CD2 1 
ATOM   2934 N N   . PHE C 1 153 ? 72.296  29.795  -17.800 1.00 34.14  ? 230 PHE C N   1 
ATOM   2935 C CA  . PHE C 1 153 ? 73.471  28.926  -17.644 1.00 33.28  ? 230 PHE C CA  1 
ATOM   2936 C C   . PHE C 1 153 ? 74.553  29.366  -18.587 1.00 39.54  ? 230 PHE C C   1 
ATOM   2937 O O   . PHE C 1 153 ? 74.239  29.812  -19.689 1.00 41.03  ? 230 PHE C O   1 
ATOM   2938 C CB  . PHE C 1 153 ? 73.117  27.439  -17.867 1.00 33.98  ? 230 PHE C CB  1 
ATOM   2939 C CG  . PHE C 1 153 ? 71.801  27.077  -17.238 1.00 36.48  ? 230 PHE C CG  1 
ATOM   2940 C CD1 . PHE C 1 153 ? 71.672  26.998  -15.846 1.00 42.11  ? 230 PHE C CD1 1 
ATOM   2941 C CD2 . PHE C 1 153 ? 70.660  26.937  -18.016 1.00 39.06  ? 230 PHE C CD2 1 
ATOM   2942 C CE1 . PHE C 1 153 ? 70.422  26.759  -15.249 1.00 43.90  ? 230 PHE C CE1 1 
ATOM   2943 C CE2 . PHE C 1 153 ? 69.414  26.675  -17.428 1.00 43.84  ? 230 PHE C CE2 1 
ATOM   2944 C CZ  . PHE C 1 153 ? 69.299  26.603  -16.050 1.00 43.69  ? 230 PHE C CZ  1 
ATOM   2945 N N   . ARG C 1 154 ? 75.826  29.240  -18.161 1.00 35.61  ? 231 ARG C N   1 
ATOM   2946 C CA  . ARG C 1 154 ? 77.006  29.623  -18.925 1.00 36.13  ? 231 ARG C CA  1 
ATOM   2947 C C   . ARG C 1 154 ? 78.107  28.544  -18.785 1.00 41.25  ? 231 ARG C C   1 
ATOM   2948 O O   . ARG C 1 154 ? 78.295  28.025  -17.688 1.00 41.41  ? 231 ARG C O   1 
ATOM   2949 C CB  . ARG C 1 154 ? 77.443  31.045  -18.471 1.00 39.15  ? 231 ARG C CB  1 
ATOM   2950 C CG  . ARG C 1 154 ? 78.889  31.467  -18.736 1.00 48.74  ? 231 ARG C CG  1 
ATOM   2951 C CD  . ARG C 1 154 ? 79.143  32.946  -18.504 1.00 34.85  ? 231 ARG C CD  1 
ATOM   2952 N NE  . ARG C 1 154 ? 78.882  33.359  -17.127 1.00 42.97  ? 231 ARG C NE  1 
ATOM   2953 C CZ  . ARG C 1 154 ? 79.801  33.804  -16.271 1.00 54.51  ? 231 ARG C CZ  1 
ATOM   2954 N NH1 . ARG C 1 154 ? 81.080  33.854  -16.624 1.00 36.48  ? 231 ARG C NH1 1 
ATOM   2955 N NH2 . ARG C 1 154 ? 79.449  34.192  -15.051 1.00 37.96  ? 231 ARG C NH2 1 
ATOM   2956 N N   . CYS C 1 155 ? 78.751  28.149  -19.927 1.00 38.80  ? 232 CYS C N   1 
ATOM   2957 C CA  . CYS C 1 155 ? 79.881  27.200  -20.091 1.00 37.53  ? 232 CYS C CA  1 
ATOM   2958 C C   . CYS C 1 155 ? 81.099  28.044  -20.362 1.00 43.29  ? 232 CYS C C   1 
ATOM   2959 O O   . CYS C 1 155 ? 80.995  29.027  -21.112 1.00 44.76  ? 232 CYS C O   1 
ATOM   2960 C CB  . CYS C 1 155 ? 79.699  26.326  -21.324 1.00 36.80  ? 232 CYS C CB  1 
ATOM   2961 S SG  A CYS C 1 155 ? 79.619  24.559  -20.989 0.30 39.76  ? 232 CYS C SG  1 
ATOM   2962 S SG  B CYS C 1 155 ? 78.055  25.714  -21.593 0.58 39.76  ? 232 CYS C SG  1 
ATOM   2963 N N   . ILE C 1 156 ? 82.271  27.513  -20.030 1.00 37.11  ? 233 ILE C N   1 
ATOM   2964 C CA  . ILE C 1 156 ? 83.538  28.085  -20.436 1.00 36.54  ? 233 ILE C CA  1 
ATOM   2965 C C   . ILE C 1 156 ? 84.503  26.901  -20.561 1.00 42.02  ? 233 ILE C C   1 
ATOM   2966 O O   . ILE C 1 156 ? 84.527  25.997  -19.708 1.00 40.58  ? 233 ILE C O   1 
ATOM   2967 C CB  . ILE C 1 156 ? 84.101  29.276  -19.571 1.00 39.55  ? 233 ILE C CB  1 
ATOM   2968 C CG1 . ILE C 1 156 ? 83.026  30.383  -19.298 1.00 39.67  ? 233 ILE C CG1 1 
ATOM   2969 C CG2 . ILE C 1 156 ? 85.356  29.888  -20.242 1.00 39.85  ? 233 ILE C CG2 1 
ATOM   2970 C CD1 . ILE C 1 156 ? 83.414  31.593  -18.466 1.00 41.56  ? 233 ILE C CD1 1 
ATOM   2971 N N   . GLN C 1 157 ? 85.270  26.898  -21.660 1.00 39.44  ? 234 GLN C N   1 
ATOM   2972 C CA  . GLN C 1 157 ? 86.323  25.946  -21.923 1.00 39.32  ? 234 GLN C CA  1 
ATOM   2973 C C   . GLN C 1 157 ? 87.544  26.731  -22.380 1.00 47.15  ? 234 GLN C C   1 
ATOM   2974 O O   . GLN C 1 157 ? 87.439  27.551  -23.304 1.00 48.65  ? 234 GLN C O   1 
ATOM   2975 C CB  . GLN C 1 157 ? 85.923  24.968  -23.031 1.00 39.66  ? 234 GLN C CB  1 
ATOM   2976 C CG  . GLN C 1 157 ? 85.067  23.781  -22.606 1.00 32.79  ? 234 GLN C CG  1 
ATOM   2977 C CD  . GLN C 1 157 ? 85.670  22.920  -21.548 1.00 39.88  ? 234 GLN C CD  1 
ATOM   2978 O OE1 . GLN C 1 157 ? 85.443  23.139  -20.359 1.00 39.75  ? 234 GLN C OE1 1 
ATOM   2979 N NE2 . GLN C 1 157 ? 86.398  21.886  -21.950 1.00 25.91  ? 234 GLN C NE2 1 
ATOM   2980 N N   . ASN C 1 158 ? 88.708  26.462  -21.769 1.00 43.66  ? 235 ASN C N   1 
ATOM   2981 C CA  . ASN C 1 158 ? 89.947  27.052  -22.258 1.00 44.39  ? 235 ASN C CA  1 
ATOM   2982 C C   . ASN C 1 158 ? 90.271  26.260  -23.523 1.00 47.60  ? 235 ASN C C   1 
ATOM   2983 O O   . ASN C 1 158 ? 89.872  25.093  -23.644 1.00 47.31  ? 235 ASN C O   1 
ATOM   2984 C CB  . ASN C 1 158 ? 91.100  26.908  -21.248 1.00 45.48  ? 235 ASN C CB  1 
ATOM   2985 C CG  . ASN C 1 158 ? 91.068  27.895  -20.111 1.00 57.89  ? 235 ASN C CG  1 
ATOM   2986 O OD1 . ASN C 1 158 ? 91.068  27.502  -18.945 1.00 44.45  ? 235 ASN C OD1 1 
ATOM   2987 N ND2 . ASN C 1 158 ? 91.073  29.202  -20.415 1.00 45.85  ? 235 ASN C ND2 1 
ATOM   2988 N N   . MET C 1 159 ? 90.958  26.886  -24.475 1.00 43.80  ? 236 MET C N   1 
ATOM   2989 C CA  . MET C 1 159 ? 91.317  26.230  -25.733 1.00 42.24  ? 236 MET C CA  1 
ATOM   2990 C C   . MET C 1 159 ? 92.837  26.212  -25.951 1.00 45.92  ? 236 MET C C   1 
ATOM   2991 O O   . MET C 1 159 ? 93.508  27.176  -25.569 1.00 47.89  ? 236 MET C O   1 
ATOM   2992 C CB  . MET C 1 159 ? 90.644  26.942  -26.916 1.00 44.18  ? 236 MET C CB  1 
ATOM   2993 C CG  . MET C 1 159 ? 89.142  27.204  -26.729 1.00 44.92  ? 236 MET C CG  1 
ATOM   2994 S SD  . MET C 1 159 ? 88.086  25.749  -26.687 1.00 45.09  ? 236 MET C SD  1 
ATOM   2995 C CE  . MET C 1 159 ? 88.410  25.080  -28.287 1.00 42.31  ? 236 MET C CE  1 
ATOM   2996 N N   . PRO C 1 160 ? 93.393  25.151  -26.588 1.00 41.40  ? 237 PRO C N   1 
ATOM   2997 C CA  . PRO C 1 160 ? 94.817  25.165  -26.908 1.00 43.90  ? 237 PRO C CA  1 
ATOM   2998 C C   . PRO C 1 160 ? 95.106  25.904  -28.262 1.00 53.80  ? 237 PRO C C   1 
ATOM   2999 O O   . PRO C 1 160 ? 94.219  26.038  -29.121 1.00 50.86  ? 237 PRO C O   1 
ATOM   3000 C CB  . PRO C 1 160 ? 95.140  23.679  -27.000 1.00 44.79  ? 237 PRO C CB  1 
ATOM   3001 C CG  . PRO C 1 160 ? 93.902  23.050  -27.524 1.00 46.99  ? 237 PRO C CG  1 
ATOM   3002 C CD  . PRO C 1 160 ? 92.747  23.939  -27.150 1.00 41.62  ? 237 PRO C CD  1 
ATOM   3003 N N   . GLU C 1 161 ? 96.359  26.368  -28.459 1.00 55.59  ? 238 GLU C N   1 
ATOM   3004 C CA  . GLU C 1 161 ? 96.737  27.036  -29.698 1.00 58.04  ? 238 GLU C CA  1 
ATOM   3005 C C   . GLU C 1 161 ? 96.679  26.045  -30.862 1.00 63.77  ? 238 GLU C C   1 
ATOM   3006 O O   . GLU C 1 161 ? 96.329  26.427  -31.987 1.00 65.08  ? 238 GLU C O   1 
ATOM   3007 C CB  . GLU C 1 161 ? 98.139  27.661  -29.583 1.00 61.87  ? 238 GLU C CB  1 
ATOM   3008 N N   . THR C 1 162 ? 96.962  24.765  -30.573 1.00 58.93  ? 239 THR C N   1 
ATOM   3009 C CA  . THR C 1 162 ? 97.006  23.698  -31.572 1.00 58.53  ? 239 THR C CA  1 
ATOM   3010 C C   . THR C 1 162 ? 95.832  22.726  -31.492 1.00 58.42  ? 239 THR C C   1 
ATOM   3011 O O   . THR C 1 162 ? 95.522  22.198  -30.409 1.00 57.61  ? 239 THR C O   1 
ATOM   3012 C CB  . THR C 1 162 ? 98.412  23.029  -31.625 1.00 59.00  ? 239 THR C CB  1 
ATOM   3013 O OG1 . THR C 1 162 ? 98.303  21.749  -32.264 1.00 53.30  ? 239 THR C OG1 1 
ATOM   3014 C CG2 . THR C 1 162 ? 99.052  22.876  -30.242 1.00 53.73  ? 239 THR C CG2 1 
ATOM   3015 N N   . LEU C 1 163 ? 95.228  22.463  -32.670 1.00 51.35  ? 240 LEU C N   1 
ATOM   3016 C CA  . LEU C 1 163 ? 94.078  21.573  -32.873 1.00 48.95  ? 240 LEU C CA  1 
ATOM   3017 C C   . LEU C 1 163 ? 92.938  21.783  -31.861 1.00 48.97  ? 240 LEU C C   1 
ATOM   3018 O O   . LEU C 1 163 ? 92.579  20.830  -31.178 1.00 45.76  ? 240 LEU C O   1 
ATOM   3019 C CB  . LEU C 1 163 ? 94.537  20.099  -32.924 1.00 49.43  ? 240 LEU C CB  1 
ATOM   3020 C CG  . LEU C 1 163 ? 95.480  19.721  -34.088 1.00 56.18  ? 240 LEU C CG  1 
ATOM   3021 C CD1 . LEU C 1 163 ? 96.200  18.423  -33.813 1.00 56.45  ? 240 LEU C CD1 1 
ATOM   3022 C CD2 . LEU C 1 163 ? 94.725  19.632  -35.432 1.00 58.54  ? 240 LEU C CD2 1 
ATOM   3023 N N   . PRO C 1 164 ? 92.382  23.014  -31.690 1.00 46.77  ? 241 PRO C N   1 
ATOM   3024 C CA  . PRO C 1 164 ? 91.356  23.200  -30.659 1.00 45.32  ? 241 PRO C CA  1 
ATOM   3025 C C   . PRO C 1 164 ? 90.084  22.448  -31.004 1.00 51.53  ? 241 PRO C C   1 
ATOM   3026 O O   . PRO C 1 164 ? 89.572  22.584  -32.121 1.00 52.47  ? 241 PRO C O   1 
ATOM   3027 C CB  . PRO C 1 164 ? 91.163  24.722  -30.607 1.00 46.88  ? 241 PRO C CB  1 
ATOM   3028 C CG  . PRO C 1 164 ? 91.550  25.201  -31.938 1.00 52.24  ? 241 PRO C CG  1 
ATOM   3029 C CD  . PRO C 1 164 ? 92.665  24.294  -32.377 1.00 49.58  ? 241 PRO C CD  1 
ATOM   3030 N N   . ASN C 1 165 ? 89.638  21.588  -30.068 1.00 47.49  ? 242 ASN C N   1 
ATOM   3031 C CA  . ASN C 1 165 ? 88.445  20.760  -30.182 1.00 46.22  ? 242 ASN C CA  1 
ATOM   3032 C C   . ASN C 1 165 ? 87.948  20.475  -28.772 1.00 49.34  ? 242 ASN C C   1 
ATOM   3033 O O   . ASN C 1 165 ? 88.402  19.506  -28.138 1.00 49.40  ? 242 ASN C O   1 
ATOM   3034 C CB  . ASN C 1 165 ? 88.735  19.433  -30.921 1.00 44.64  ? 242 ASN C CB  1 
ATOM   3035 C CG  . ASN C 1 165 ? 89.001  19.543  -32.389 1.00 59.06  ? 242 ASN C CG  1 
ATOM   3036 O OD1 . ASN C 1 165 ? 90.148  19.657  -32.829 1.00 69.25  ? 242 ASN C OD1 1 
ATOM   3037 N ND2 . ASN C 1 165 ? 87.963  19.499  -33.183 1.00 44.87  ? 242 ASN C ND2 1 
ATOM   3038 N N   . ASN C 1 166 ? 87.046  21.342  -28.260 1.00 43.19  ? 243 ASN C N   1 
ATOM   3039 C CA  . ASN C 1 166 ? 86.443  21.158  -26.929 1.00 40.39  ? 243 ASN C CA  1 
ATOM   3040 C C   . ASN C 1 166 ? 84.972  21.377  -27.014 1.00 41.53  ? 243 ASN C C   1 
ATOM   3041 O O   . ASN C 1 166 ? 84.537  22.438  -27.480 1.00 41.60  ? 243 ASN C O   1 
ATOM   3042 C CB  . ASN C 1 166 ? 87.028  22.111  -25.874 1.00 38.96  ? 243 ASN C CB  1 
ATOM   3043 C CG  . ASN C 1 166 ? 88.376  21.743  -25.338 1.00 56.33  ? 243 ASN C CG  1 
ATOM   3044 O OD1 . ASN C 1 166 ? 88.655  20.587  -24.982 1.00 46.78  ? 243 ASN C OD1 1 
ATOM   3045 N ND2 . ASN C 1 166 ? 89.221  22.749  -25.201 1.00 52.91  ? 243 ASN C ND2 1 
ATOM   3046 N N   . SER C 1 167 ? 84.194  20.367  -26.609 1.00 36.61  ? 244 SER C N   1 
ATOM   3047 C CA  . SER C 1 167 ? 82.743  20.500  -26.585 1.00 35.66  ? 244 SER C CA  1 
ATOM   3048 C C   . SER C 1 167 ? 82.391  20.902  -25.179 1.00 41.50  ? 244 SER C C   1 
ATOM   3049 O O   . SER C 1 167 ? 83.076  20.502  -24.243 1.00 42.21  ? 244 SER C O   1 
ATOM   3050 C CB  . SER C 1 167 ? 82.046  19.202  -26.983 1.00 37.43  ? 244 SER C CB  1 
ATOM   3051 O OG  . SER C 1 167 ? 82.289  18.121  -26.104 1.00 43.86  ? 244 SER C OG  1 
ATOM   3052 N N   . CYS C 1 168 ? 81.389  21.745  -25.016 1.00 39.53  ? 245 CYS C N   1 
ATOM   3053 C CA  . CYS C 1 168 ? 80.976  22.144  -23.680 1.00 39.37  ? 245 CYS C CA  1 
ATOM   3054 C C   . CYS C 1 168 ? 79.489  22.006  -23.547 1.00 43.75  ? 245 CYS C C   1 
ATOM   3055 O O   . CYS C 1 168 ? 78.721  22.527  -24.371 1.00 45.35  ? 245 CYS C O   1 
ATOM   3056 C CB  . CYS C 1 168 ? 81.432  23.552  -23.328 1.00 40.66  ? 245 CYS C CB  1 
ATOM   3057 S SG  A CYS C 1 168 ? 81.452  23.883  -21.547 0.30 44.24  ? 245 CYS C SG  1 
ATOM   3058 S SG  B CYS C 1 168 ? 81.564  23.847  -21.550 0.33 44.31  ? 245 CYS C SG  1 
ATOM   3059 N N   . TYR C 1 169 ? 79.084  21.288  -22.510 1.00 37.38  ? 246 TYR C N   1 
ATOM   3060 C CA  . TYR C 1 169 ? 77.693  21.025  -22.195 1.00 34.82  ? 246 TYR C CA  1 
ATOM   3061 C C   . TYR C 1 169 ? 77.355  21.715  -20.887 1.00 37.74  ? 246 TYR C C   1 
ATOM   3062 O O   . TYR C 1 169 ? 78.145  21.689  -19.947 1.00 38.95  ? 246 TYR C O   1 
ATOM   3063 C CB  . TYR C 1 169 ? 77.500  19.503  -22.038 1.00 34.68  ? 246 TYR C CB  1 
ATOM   3064 C CG  . TYR C 1 169 ? 76.093  19.094  -21.673 1.00 34.19  ? 246 TYR C CG  1 
ATOM   3065 C CD1 . TYR C 1 169 ? 75.678  19.056  -20.342 1.00 34.86  ? 246 TYR C CD1 1 
ATOM   3066 C CD2 . TYR C 1 169 ? 75.176  18.724  -22.654 1.00 34.69  ? 246 TYR C CD2 1 
ATOM   3067 C CE1 . TYR C 1 169 ? 74.373  18.704  -19.998 1.00 35.22  ? 246 TYR C CE1 1 
ATOM   3068 C CE2 . TYR C 1 169 ? 73.874  18.337  -22.319 1.00 35.47  ? 246 TYR C CE2 1 
ATOM   3069 C CZ  . TYR C 1 169 ? 73.477  18.318  -20.985 1.00 39.97  ? 246 TYR C CZ  1 
ATOM   3070 O OH  . TYR C 1 169 ? 72.186  17.964  -20.623 1.00 34.73  ? 246 TYR C OH  1 
ATOM   3071 N N   . SER C 1 170 ? 76.172  22.296  -20.812 1.00 33.22  ? 247 SER C N   1 
ATOM   3072 C CA  . SER C 1 170 ? 75.621  22.840  -19.582 1.00 33.57  ? 247 SER C CA  1 
ATOM   3073 C C   . SER C 1 170 ? 74.096  22.670  -19.617 1.00 38.83  ? 247 SER C C   1 
ATOM   3074 O O   . SER C 1 170 ? 73.482  22.686  -20.710 1.00 38.66  ? 247 SER C O   1 
ATOM   3075 C CB  . SER C 1 170 ? 76.003  24.294  -19.375 1.00 36.89  ? 247 SER C CB  1 
ATOM   3076 O OG  . SER C 1 170 ? 75.880  24.613  -17.998 1.00 50.12  ? 247 SER C OG  1 
ATOM   3077 N N   . ALA C 1 171 ? 73.496  22.462  -18.431 1.00 33.74  ? 248 ALA C N   1 
ATOM   3078 C CA  . ALA C 1 171 ? 72.054  22.302  -18.332 1.00 34.45  ? 248 ALA C CA  1 
ATOM   3079 C C   . ALA C 1 171 ? 71.585  22.666  -16.923 1.00 38.96  ? 248 ALA C C   1 
ATOM   3080 O O   . ALA C 1 171 ? 72.383  22.610  -15.986 1.00 38.85  ? 248 ALA C O   1 
ATOM   3081 C CB  . ALA C 1 171 ? 71.643  20.863  -18.679 1.00 35.22  ? 248 ALA C CB  1 
ATOM   3082 N N   . GLY C 1 172 ? 70.301  23.020  -16.802 1.00 33.41  ? 249 GLY C N   1 
ATOM   3083 C CA  . GLY C 1 172 ? 69.673  23.342  -15.534 1.00 32.41  ? 249 GLY C CA  1 
ATOM   3084 C C   . GLY C 1 172 ? 68.161  23.397  -15.608 1.00 35.13  ? 249 GLY C C   1 
ATOM   3085 O O   . GLY C 1 172 ? 67.562  23.050  -16.630 1.00 35.82  ? 249 GLY C O   1 
ATOM   3086 N N   . ILE C 1 173 ? 67.539  23.795  -14.515 1.00 29.66  ? 250 ILE C N   1 
ATOM   3087 C CA  . ILE C 1 173 ? 66.101  23.906  -14.428 1.00 30.45  ? 250 ILE C CA  1 
ATOM   3088 C C   . ILE C 1 173 ? 65.791  25.378  -14.275 1.00 39.28  ? 250 ILE C C   1 
ATOM   3089 O O   . ILE C 1 173 ? 66.552  26.108  -13.650 1.00 42.53  ? 250 ILE C O   1 
ATOM   3090 C CB  . ILE C 1 173 ? 65.497  23.036  -13.272 1.00 33.17  ? 250 ILE C CB  1 
ATOM   3091 C CG1 . ILE C 1 173 ? 65.943  21.560  -13.425 1.00 31.97  ? 250 ILE C CG1 1 
ATOM   3092 C CG2 . ILE C 1 173 ? 63.939  23.148  -13.236 1.00 34.37  ? 250 ILE C CG2 1 
ATOM   3093 C CD1 . ILE C 1 173 ? 65.720  20.667  -12.278 1.00 31.09  ? 250 ILE C CD1 1 
ATOM   3094 N N   . ALA C 1 174 ? 64.696  25.824  -14.859 1.00 35.68  ? 251 ALA C N   1 
ATOM   3095 C CA  . ALA C 1 174 ? 64.279  27.210  -14.765 1.00 36.08  ? 251 ALA C CA  1 
ATOM   3096 C C   . ALA C 1 174 ? 62.779  27.245  -14.935 1.00 43.00  ? 251 ALA C C   1 
ATOM   3097 O O   . ALA C 1 174 ? 62.243  26.465  -15.729 1.00 46.51  ? 251 ALA C O   1 
ATOM   3098 C CB  . ALA C 1 174 ? 64.955  28.045  -15.849 1.00 36.45  ? 251 ALA C CB  1 
ATOM   3099 N N   . LYS C 1 175 ? 62.091  28.079  -14.138 1.00 37.07  ? 252 LYS C N   1 
ATOM   3100 C CA  . LYS C 1 175 ? 60.657  28.298  -14.226 1.00 36.74  ? 252 LYS C CA  1 
ATOM   3101 C C   . LYS C 1 175 ? 60.498  29.334  -15.358 1.00 40.91  ? 252 LYS C C   1 
ATOM   3102 O O   . LYS C 1 175 ? 61.125  30.399  -15.348 1.00 42.65  ? 252 LYS C O   1 
ATOM   3103 C CB  . LYS C 1 175 ? 60.105  28.764  -12.870 1.00 39.48  ? 252 LYS C CB  1 
ATOM   3104 C CG  . LYS C 1 175 ? 58.759  29.458  -12.913 1.00 55.00  ? 252 LYS C CG  1 
ATOM   3105 C CD  . LYS C 1 175 ? 57.590  28.517  -12.701 1.00 58.27  ? 252 LYS C CD  1 
ATOM   3106 C CE  . LYS C 1 175 ? 56.307  29.282  -12.504 1.00 58.98  ? 252 LYS C CE  1 
ATOM   3107 N NZ  . LYS C 1 175 ? 56.163  29.690  -11.081 1.00 74.43  ? 252 LYS C NZ  1 
ATOM   3108 N N   . LEU C 1 176 ? 59.796  28.942  -16.403 1.00 36.05  ? 253 LEU C N   1 
ATOM   3109 C CA  . LEU C 1 176 ? 59.646  29.841  -17.535 1.00 36.80  ? 253 LEU C CA  1 
ATOM   3110 C C   . LEU C 1 176 ? 58.176  30.165  -17.762 1.00 43.43  ? 253 LEU C C   1 
ATOM   3111 O O   . LEU C 1 176 ? 57.303  29.296  -17.582 1.00 42.24  ? 253 LEU C O   1 
ATOM   3112 C CB  . LEU C 1 176 ? 60.306  29.281  -18.825 1.00 35.84  ? 253 LEU C CB  1 
ATOM   3113 C CG  . LEU C 1 176 ? 61.789  28.854  -18.798 1.00 37.19  ? 253 LEU C CG  1 
ATOM   3114 C CD1 . LEU C 1 176 ? 62.117  28.048  -20.023 1.00 36.23  ? 253 LEU C CD1 1 
ATOM   3115 C CD2 . LEU C 1 176 ? 62.713  30.052  -18.725 1.00 37.33  ? 253 LEU C CD2 1 
ATOM   3116 N N   . GLU C 1 177 ? 57.911  31.437  -18.135 1.00 41.96  ? 254 GLU C N   1 
ATOM   3117 C CA  . GLU C 1 177 ? 56.572  31.961  -18.368 1.00 42.70  ? 254 GLU C CA  1 
ATOM   3118 C C   . GLU C 1 177 ? 56.210  31.927  -19.849 1.00 47.32  ? 254 GLU C C   1 
ATOM   3119 O O   . GLU C 1 177 ? 57.072  32.138  -20.706 1.00 46.47  ? 254 GLU C O   1 
ATOM   3120 C CB  . GLU C 1 177 ? 56.507  33.405  -17.882 1.00 44.41  ? 254 GLU C CB  1 
ATOM   3121 C CG  . GLU C 1 177 ? 56.023  33.578  -16.472 1.00 54.76  ? 254 GLU C CG  1 
ATOM   3122 C CD  . GLU C 1 177 ? 54.979  34.681  -16.425 1.00 92.93  ? 254 GLU C CD  1 
ATOM   3123 O OE1 . GLU C 1 177 ? 53.804  34.415  -16.785 1.00 80.81  ? 254 GLU C OE1 1 
ATOM   3124 O OE2 . GLU C 1 177 ? 55.376  35.844  -16.179 1.00 94.51  ? 254 GLU C OE2 1 
ATOM   3125 N N   . GLU C 1 178 ? 54.918  31.702  -20.142 1.00 44.76  ? 255 GLU C N   1 
ATOM   3126 C CA  . GLU C 1 178 ? 54.384  31.690  -21.505 1.00 45.08  ? 255 GLU C CA  1 
ATOM   3127 C C   . GLU C 1 178 ? 54.737  33.022  -22.163 1.00 48.51  ? 255 GLU C C   1 
ATOM   3128 O O   . GLU C 1 178 ? 54.384  34.079  -21.638 1.00 49.96  ? 255 GLU C O   1 
ATOM   3129 C CB  . GLU C 1 178 ? 52.860  31.478  -21.454 1.00 47.92  ? 255 GLU C CB  1 
ATOM   3130 C CG  . GLU C 1 178 ? 52.105  31.807  -22.732 1.00 51.11  ? 255 GLU C CG  1 
ATOM   3131 C CD  . GLU C 1 178 ? 50.619  31.545  -22.621 1.00 79.57  ? 255 GLU C CD  1 
ATOM   3132 O OE1 . GLU C 1 178 ? 50.247  30.604  -21.883 1.00 91.54  ? 255 GLU C OE1 1 
ATOM   3133 O OE2 . GLU C 1 178 ? 49.830  32.219  -23.322 1.00 81.30  ? 255 GLU C OE2 1 
ATOM   3134 N N   . GLY C 1 179 ? 55.484  32.957  -23.252 1.00 42.77  ? 256 GLY C N   1 
ATOM   3135 C CA  . GLY C 1 179 ? 55.919  34.150  -23.962 1.00 43.06  ? 256 GLY C CA  1 
ATOM   3136 C C   . GLY C 1 179 ? 57.416  34.360  -23.926 1.00 44.33  ? 256 GLY C C   1 
ATOM   3137 O O   . GLY C 1 179 ? 57.958  35.084  -24.766 1.00 44.72  ? 256 GLY C O   1 
ATOM   3138 N N   . ASP C 1 180 ? 58.098  33.745  -22.947 1.00 38.48  ? 257 ASP C N   1 
ATOM   3139 C CA  . ASP C 1 180 ? 59.563  33.803  -22.854 1.00 36.87  ? 257 ASP C CA  1 
ATOM   3140 C C   . ASP C 1 180 ? 60.199  33.053  -24.025 1.00 39.72  ? 257 ASP C C   1 
ATOM   3141 O O   . ASP C 1 180 ? 59.594  32.136  -24.595 1.00 37.44  ? 257 ASP C O   1 
ATOM   3142 C CB  . ASP C 1 180 ? 60.089  33.191  -21.552 1.00 36.80  ? 257 ASP C CB  1 
ATOM   3143 C CG  . ASP C 1 180 ? 59.711  33.916  -20.278 1.00 52.51  ? 257 ASP C CG  1 
ATOM   3144 O OD1 . ASP C 1 180 ? 59.321  35.119  -20.356 1.00 57.27  ? 257 ASP C OD1 1 
ATOM   3145 O OD2 . ASP C 1 180 ? 59.808  33.292  -19.199 1.00 54.37  ? 257 ASP C OD2 1 
ATOM   3146 N N   . GLU C 1 181 ? 61.410  33.473  -24.394 1.00 37.27  ? 258 GLU C N   1 
ATOM   3147 C CA  . GLU C 1 181 ? 62.161  32.852  -25.473 1.00 37.16  ? 258 GLU C CA  1 
ATOM   3148 C C   . GLU C 1 181 ? 63.533  32.471  -24.958 1.00 42.74  ? 258 GLU C C   1 
ATOM   3149 O O   . GLU C 1 181 ? 64.101  33.190  -24.135 1.00 43.02  ? 258 GLU C O   1 
ATOM   3150 C CB  . GLU C 1 181 ? 62.278  33.778  -26.682 1.00 39.44  ? 258 GLU C CB  1 
ATOM   3151 C CG  . GLU C 1 181 ? 60.993  33.856  -27.472 1.00 51.30  ? 258 GLU C CG  1 
ATOM   3152 C CD  . GLU C 1 181 ? 60.917  35.013  -28.447 1.00 71.86  ? 258 GLU C CD  1 
ATOM   3153 O OE1 . GLU C 1 181 ? 61.988  35.537  -28.831 1.00 69.30  ? 258 GLU C OE1 1 
ATOM   3154 O OE2 . GLU C 1 181 ? 59.786  35.401  -28.823 1.00 62.77  ? 258 GLU C OE2 1 
ATOM   3155 N N   . LEU C 1 182 ? 64.042  31.328  -25.402 1.00 39.34  ? 259 LEU C N   1 
ATOM   3156 C CA  . LEU C 1 182 ? 65.356  30.857  -25.025 1.00 39.20  ? 259 LEU C CA  1 
ATOM   3157 C C   . LEU C 1 182 ? 66.290  30.936  -26.230 1.00 46.03  ? 259 LEU C C   1 
ATOM   3158 O O   . LEU C 1 182 ? 65.871  30.644  -27.358 1.00 46.54  ? 259 LEU C O   1 
ATOM   3159 C CB  . LEU C 1 182 ? 65.300  29.409  -24.500 1.00 37.94  ? 259 LEU C CB  1 
ATOM   3160 C CG  . LEU C 1 182 ? 64.475  29.150  -23.271 1.00 41.94  ? 259 LEU C CG  1 
ATOM   3161 C CD1 . LEU C 1 182 ? 64.370  27.667  -23.006 1.00 41.13  ? 259 LEU C CD1 1 
ATOM   3162 C CD2 . LEU C 1 182 ? 65.049  29.863  -22.095 1.00 46.44  ? 259 LEU C CD2 1 
ATOM   3163 N N   . GLN C 1 183 ? 67.556  31.309  -25.985 1.00 42.62  ? 260 GLN C N   1 
ATOM   3164 C CA  . GLN C 1 183 ? 68.571  31.380  -27.031 1.00 43.43  ? 260 GLN C CA  1 
ATOM   3165 C C   . GLN C 1 183 ? 69.955  30.981  -26.521 1.00 46.18  ? 260 GLN C C   1 
ATOM   3166 O O   . GLN C 1 183 ? 70.275  31.193  -25.345 1.00 46.86  ? 260 GLN C O   1 
ATOM   3167 C CB  . GLN C 1 183 ? 68.615  32.769  -27.686 1.00 46.55  ? 260 GLN C CB  1 
ATOM   3168 C CG  . GLN C 1 183 ? 69.086  33.888  -26.758 1.00 64.14  ? 260 GLN C CG  1 
ATOM   3169 C CD  . GLN C 1 183 ? 69.274  35.189  -27.483 1.00 69.83  ? 260 GLN C CD  1 
ATOM   3170 O OE1 . GLN C 1 183 ? 68.577  35.496  -28.445 1.00 54.83  ? 260 GLN C OE1 1 
ATOM   3171 N NE2 . GLN C 1 183 ? 70.215  35.992  -27.009 1.00 67.43  ? 260 GLN C NE2 1 
ATOM   3172 N N   . LEU C 1 184 ? 70.779  30.423  -27.416 1.00 38.30  ? 261 LEU C N   1 
ATOM   3173 C CA  . LEU C 1 184 ? 72.151  30.039  -27.135 1.00 34.55  ? 261 LEU C CA  1 
ATOM   3174 C C   . LEU C 1 184 ? 73.026  31.056  -27.867 1.00 41.62  ? 261 LEU C C   1 
ATOM   3175 O O   . LEU C 1 184 ? 72.955  31.161  -29.079 1.00 45.46  ? 261 LEU C O   1 
ATOM   3176 C CB  . LEU C 1 184 ? 72.404  28.613  -27.627 1.00 32.52  ? 261 LEU C CB  1 
ATOM   3177 C CG  . LEU C 1 184 ? 73.686  27.963  -27.181 1.00 35.37  ? 261 LEU C CG  1 
ATOM   3178 C CD1 . LEU C 1 184 ? 73.490  26.492  -26.990 1.00 34.28  ? 261 LEU C CD1 1 
ATOM   3179 C CD2 . LEU C 1 184 ? 74.810  28.252  -28.133 1.00 36.53  ? 261 LEU C CD2 1 
ATOM   3180 N N   . ALA C 1 185 ? 73.788  31.850  -27.128 1.00 37.68  ? 262 ALA C N   1 
ATOM   3181 C CA  . ALA C 1 185 ? 74.645  32.896  -27.664 1.00 38.11  ? 262 ALA C CA  1 
ATOM   3182 C C   . ALA C 1 185 ? 76.118  32.645  -27.328 1.00 43.38  ? 262 ALA C C   1 
ATOM   3183 O O   . ALA C 1 185 ? 76.452  32.319  -26.180 1.00 44.07  ? 262 ALA C O   1 
ATOM   3184 C CB  . ALA C 1 185 ? 74.212  34.238  -27.096 1.00 39.62  ? 262 ALA C CB  1 
ATOM   3185 N N   . ILE C 1 186 ? 77.001  32.818  -28.316 1.00 40.60  ? 263 ILE C N   1 
ATOM   3186 C CA  . ILE C 1 186 ? 78.433  32.685  -28.101 1.00 41.75  ? 263 ILE C CA  1 
ATOM   3187 C C   . ILE C 1 186 ? 79.034  34.097  -27.992 1.00 51.41  ? 263 ILE C C   1 
ATOM   3188 O O   . ILE C 1 186 ? 79.048  34.816  -29.002 1.00 54.44  ? 263 ILE C O   1 
ATOM   3189 C CB  . ILE C 1 186 ? 79.124  31.817  -29.167 1.00 45.11  ? 263 ILE C CB  1 
ATOM   3190 C CG1 . ILE C 1 186 ? 78.545  30.381  -29.149 1.00 43.67  ? 263 ILE C CG1 1 
ATOM   3191 C CG2 . ILE C 1 186 ? 80.650  31.819  -28.900 1.00 47.12  ? 263 ILE C CG2 1 
ATOM   3192 C CD1 . ILE C 1 186 ? 78.643  29.667  -30.431 1.00 48.41  ? 263 ILE C CD1 1 
ATOM   3193 N N   . PRO C 1 187 ? 79.491  34.544  -26.787 1.00 46.98  ? 264 PRO C N   1 
ATOM   3194 C CA  . PRO C 1 187 ? 80.002  35.921  -26.669 1.00 47.74  ? 264 PRO C CA  1 
ATOM   3195 C C   . PRO C 1 187 ? 81.381  36.124  -27.277 1.00 52.04  ? 264 PRO C C   1 
ATOM   3196 O O   . PRO C 1 187 ? 82.309  36.559  -26.594 1.00 53.27  ? 264 PRO C O   1 
ATOM   3197 C CB  . PRO C 1 187 ? 79.947  36.213  -25.170 1.00 48.98  ? 264 PRO C CB  1 
ATOM   3198 C CG  . PRO C 1 187 ? 79.482  34.943  -24.510 1.00 51.81  ? 264 PRO C CG  1 
ATOM   3199 C CD  . PRO C 1 187 ? 79.534  33.841  -25.492 1.00 46.74  ? 264 PRO C CD  1 
ATOM   3200 N N   . ARG C 1 188 ? 81.518  35.787  -28.566 1.00 47.98  ? 265 ARG C N   1 
ATOM   3201 C CA  . ARG C 1 188 ? 82.759  35.917  -29.331 1.00 49.44  ? 265 ARG C CA  1 
ATOM   3202 C C   . ARG C 1 188 ? 82.389  36.236  -30.780 1.00 55.88  ? 265 ARG C C   1 
ATOM   3203 O O   . ARG C 1 188 ? 81.481  35.608  -31.325 1.00 55.26  ? 265 ARG C O   1 
ATOM   3204 C CB  . ARG C 1 188 ? 83.589  34.622  -29.272 1.00 46.47  ? 265 ARG C CB  1 
ATOM   3205 C CG  . ARG C 1 188 ? 83.835  34.050  -27.865 1.00 49.50  ? 265 ARG C CG  1 
ATOM   3206 C CD  . ARG C 1 188 ? 85.229  34.327  -27.470 1.00 48.89  ? 265 ARG C CD  1 
ATOM   3207 N NE  . ARG C 1 188 ? 85.595  33.959  -26.106 1.00 49.48  ? 265 ARG C NE  1 
ATOM   3208 C CZ  . ARG C 1 188 ? 85.459  34.758  -25.053 1.00 61.10  ? 265 ARG C CZ  1 
ATOM   3209 N NH1 . ARG C 1 188 ? 84.781  35.892  -25.157 1.00 40.20  ? 265 ARG C NH1 1 
ATOM   3210 N NH2 . ARG C 1 188 ? 85.946  34.399  -23.874 1.00 58.24  ? 265 ARG C NH2 1 
ATOM   3211 N N   . GLU C 1 189 ? 83.045  37.241  -31.386 1.00 53.68  ? 266 GLU C N   1 
ATOM   3212 C CA  . GLU C 1 189 ? 82.784  37.624  -32.777 1.00 54.47  ? 266 GLU C CA  1 
ATOM   3213 C C   . GLU C 1 189 ? 83.343  36.549  -33.679 1.00 59.16  ? 266 GLU C C   1 
ATOM   3214 O O   . GLU C 1 189 ? 84.444  36.058  -33.405 1.00 60.82  ? 266 GLU C O   1 
ATOM   3215 C CB  . GLU C 1 189 ? 83.445  38.974  -33.107 1.00 58.11  ? 266 GLU C CB  1 
ATOM   3216 N N   . ASN C 1 190 ? 82.586  36.146  -34.730 1.00 54.24  ? 267 ASN C N   1 
ATOM   3217 C CA  . ASN C 1 190 ? 83.021  35.123  -35.694 1.00 53.61  ? 267 ASN C CA  1 
ATOM   3218 C C   . ASN C 1 190 ? 83.628  33.877  -34.999 1.00 54.16  ? 267 ASN C C   1 
ATOM   3219 O O   . ASN C 1 190 ? 84.795  33.550  -35.179 1.00 54.63  ? 267 ASN C O   1 
ATOM   3220 C CB  . ASN C 1 190 ? 83.970  35.765  -36.736 1.00 57.72  ? 267 ASN C CB  1 
ATOM   3221 C CG  . ASN C 1 190 ? 84.595  34.808  -37.720 1.00 96.57  ? 267 ASN C CG  1 
ATOM   3222 O OD1 . ASN C 1 190 ? 83.927  33.921  -38.273 1.00 99.98  ? 267 ASN C OD1 1 
ATOM   3223 N ND2 . ASN C 1 190 ? 85.914  34.915  -37.887 1.00 87.58  ? 267 ASN C ND2 1 
ATOM   3224 N N   . ALA C 1 191 ? 82.861  33.266  -34.112 1.00 48.71  ? 268 ALA C N   1 
ATOM   3225 C CA  . ALA C 1 191 ? 83.284  32.100  -33.339 1.00 47.05  ? 268 ALA C CA  1 
ATOM   3226 C C   . ALA C 1 191 ? 83.489  30.897  -34.257 1.00 52.12  ? 268 ALA C C   1 
ATOM   3227 O O   . ALA C 1 191 ? 82.719  30.717  -35.206 1.00 53.63  ? 268 ALA C O   1 
ATOM   3228 C CB  . ALA C 1 191 ? 82.254  31.782  -32.266 1.00 45.30  ? 268 ALA C CB  1 
ATOM   3229 N N   . GLN C 1 192 ? 84.563  30.119  -34.008 1.00 47.25  ? 269 GLN C N   1 
ATOM   3230 C CA  . GLN C 1 192 ? 84.896  28.921  -34.773 1.00 46.72  ? 269 GLN C CA  1 
ATOM   3231 C C   . GLN C 1 192 ? 84.339  27.733  -34.069 1.00 49.20  ? 269 GLN C C   1 
ATOM   3232 O O   . GLN C 1 192 ? 84.826  27.339  -33.014 1.00 48.52  ? 269 GLN C O   1 
ATOM   3233 C CB  . GLN C 1 192 ? 86.399  28.793  -34.952 1.00 49.34  ? 269 GLN C CB  1 
ATOM   3234 C CG  . GLN C 1 192 ? 87.054  30.020  -35.607 1.00 55.87  ? 269 GLN C CG  1 
ATOM   3235 C CD  . GLN C 1 192 ? 86.504  30.284  -36.966 1.00 62.60  ? 269 GLN C CD  1 
ATOM   3236 O OE1 . GLN C 1 192 ? 86.748  29.540  -37.915 1.00 62.32  ? 269 GLN C OE1 1 
ATOM   3237 N NE2 . GLN C 1 192 ? 85.712  31.322  -37.070 1.00 50.34  ? 269 GLN C NE2 1 
ATOM   3238 N N   . ILE C 1 193 ? 83.241  27.212  -34.594 1.00 46.76  ? 270 ILE C N   1 
ATOM   3239 C CA  . ILE C 1 193 ? 82.513  26.091  -33.968 1.00 44.77  ? 270 ILE C CA  1 
ATOM   3240 C C   . ILE C 1 193 ? 82.176  24.998  -34.993 1.00 47.14  ? 270 ILE C C   1 
ATOM   3241 O O   . ILE C 1 193 ? 82.250  25.251  -36.187 1.00 45.91  ? 270 ILE C O   1 
ATOM   3242 C CB  . ILE C 1 193 ? 81.235  26.619  -33.238 1.00 46.48  ? 270 ILE C CB  1 
ATOM   3243 C CG1 . ILE C 1 193 ? 80.229  27.245  -34.261 1.00 47.90  ? 270 ILE C CG1 1 
ATOM   3244 C CG2 . ILE C 1 193 ? 81.606  27.607  -32.106 1.00 44.77  ? 270 ILE C CG2 1 
ATOM   3245 C CD1 . ILE C 1 193 ? 78.883  27.326  -33.830 1.00 51.66  ? 270 ILE C CD1 1 
ATOM   3246 N N   . SER C 1 194 ? 81.811  23.791  -34.530 1.00 44.20  ? 271 SER C N   1 
ATOM   3247 C CA  . SER C 1 194 ? 81.391  22.714  -35.429 1.00 44.05  ? 271 SER C CA  1 
ATOM   3248 C C   . SER C 1 194 ? 79.865  22.774  -35.542 1.00 50.12  ? 271 SER C C   1 
ATOM   3249 O O   . SER C 1 194 ? 79.167  22.919  -34.528 1.00 51.46  ? 271 SER C O   1 
ATOM   3250 C CB  . SER C 1 194 ? 81.826  21.357  -34.900 1.00 44.13  ? 271 SER C CB  1 
ATOM   3251 O OG  . SER C 1 194 ? 81.255  20.305  -35.658 1.00 50.58  ? 271 SER C OG  1 
ATOM   3252 N N   . LEU C 1 195 ? 79.350  22.690  -36.765 1.00 45.55  ? 272 LEU C N   1 
ATOM   3253 C CA  . LEU C 1 195 ? 77.919  22.747  -36.985 1.00 44.27  ? 272 LEU C CA  1 
ATOM   3254 C C   . LEU C 1 195 ? 77.314  21.360  -37.219 1.00 50.21  ? 272 LEU C C   1 
ATOM   3255 O O   . LEU C 1 195 ? 76.292  21.232  -37.898 1.00 51.74  ? 272 LEU C O   1 
ATOM   3256 C CB  . LEU C 1 195 ? 77.572  23.753  -38.101 1.00 45.71  ? 272 LEU C CB  1 
ATOM   3257 C CG  . LEU C 1 195 ? 77.856  25.246  -37.813 1.00 49.06  ? 272 LEU C CG  1 
ATOM   3258 C CD1 . LEU C 1 195 ? 77.500  26.081  -38.985 1.00 48.78  ? 272 LEU C CD1 1 
ATOM   3259 C CD2 . LEU C 1 195 ? 77.102  25.744  -36.566 1.00 49.42  ? 272 LEU C CD2 1 
ATOM   3260 N N   . ASP C 1 196 ? 77.928  20.321  -36.624 1.00 47.13  ? 273 ASP C N   1 
ATOM   3261 C CA  . ASP C 1 196 ? 77.423  18.955  -36.702 1.00 47.86  ? 273 ASP C CA  1 
ATOM   3262 C C   . ASP C 1 196 ? 76.362  18.727  -35.602 1.00 50.68  ? 273 ASP C C   1 
ATOM   3263 O O   . ASP C 1 196 ? 76.607  19.019  -34.436 1.00 48.09  ? 273 ASP C O   1 
ATOM   3264 C CB  . ASP C 1 196 ? 78.568  17.933  -36.605 1.00 50.60  ? 273 ASP C CB  1 
ATOM   3265 C CG  . ASP C 1 196 ? 79.595  17.984  -37.725 1.00 68.22  ? 273 ASP C CG  1 
ATOM   3266 O OD1 . ASP C 1 196 ? 79.214  18.333  -38.876 1.00 68.77  ? 273 ASP C OD1 1 
ATOM   3267 O OD2 . ASP C 1 196 ? 80.776  17.635  -37.463 1.00 81.12  ? 273 ASP C OD2 1 
ATOM   3268 N N   . GLY C 1 197 ? 75.197  18.227  -35.997 1.00 48.70  ? 274 GLY C N   1 
ATOM   3269 C CA  . GLY C 1 197 ? 74.049  17.988  -35.126 1.00 47.30  ? 274 GLY C CA  1 
ATOM   3270 C C   . GLY C 1 197 ? 74.269  17.128  -33.894 1.00 49.63  ? 274 GLY C C   1 
ATOM   3271 O O   . GLY C 1 197 ? 73.526  17.256  -32.909 1.00 48.02  ? 274 GLY C O   1 
ATOM   3272 N N   . ASP C 1 198 ? 75.285  16.239  -33.929 1.00 45.17  ? 275 ASP C N   1 
ATOM   3273 C CA  . ASP C 1 198 ? 75.600  15.329  -32.817 1.00 43.18  ? 275 ASP C CA  1 
ATOM   3274 C C   . ASP C 1 198 ? 76.480  15.993  -31.769 1.00 44.11  ? 275 ASP C C   1 
ATOM   3275 O O   . ASP C 1 198 ? 76.705  15.432  -30.703 1.00 42.43  ? 275 ASP C O   1 
ATOM   3276 C CB  . ASP C 1 198 ? 76.304  14.056  -33.359 1.00 45.69  ? 275 ASP C CB  1 
ATOM   3277 C CG  . ASP C 1 198 ? 77.630  14.283  -34.072 1.00 53.13  ? 275 ASP C CG  1 
ATOM   3278 O OD1 . ASP C 1 198 ? 77.806  15.369  -34.663 1.00 53.27  ? 275 ASP C OD1 1 
ATOM   3279 O OD2 . ASP C 1 198 ? 78.470  13.342  -34.093 1.00 58.88  ? 275 ASP C OD2 1 
ATOM   3280 N N   . VAL C 1 199 ? 76.989  17.176  -32.088 1.00 40.21  ? 276 VAL C N   1 
ATOM   3281 C CA  . VAL C 1 199 ? 77.974  17.889  -31.306 1.00 38.26  ? 276 VAL C CA  1 
ATOM   3282 C C   . VAL C 1 199 ? 77.530  19.289  -30.852 1.00 42.30  ? 276 VAL C C   1 
ATOM   3283 O O   . VAL C 1 199 ? 77.975  19.737  -29.804 1.00 43.29  ? 276 VAL C O   1 
ATOM   3284 C CB  . VAL C 1 199 ? 79.277  17.822  -32.138 1.00 42.21  ? 276 VAL C CB  1 
ATOM   3285 C CG1 . VAL C 1 199 ? 79.580  19.092  -32.920 1.00 42.49  ? 276 VAL C CG1 1 
ATOM   3286 C CG2 . VAL C 1 199 ? 80.439  17.346  -31.310 1.00 42.14  ? 276 VAL C CG2 1 
ATOM   3287 N N   . THR C 1 200 ? 76.634  19.958  -31.619 1.00 36.52  ? 277 THR C N   1 
ATOM   3288 C CA  . THR C 1 200 ? 76.108  21.289  -31.345 1.00 34.42  ? 277 THR C CA  1 
ATOM   3289 C C   . THR C 1 200 ? 74.604  21.189  -31.386 1.00 38.21  ? 277 THR C C   1 
ATOM   3290 O O   . THR C 1 200 ? 74.003  20.980  -32.449 1.00 38.41  ? 277 THR C O   1 
ATOM   3291 C CB  . THR C 1 200 ? 76.719  22.334  -32.301 1.00 35.16  ? 277 THR C CB  1 
ATOM   3292 O OG1 . THR C 1 200 ? 78.138  22.340  -32.136 1.00 38.98  ? 277 THR C OG1 1 
ATOM   3293 C CG2 . THR C 1 200 ? 76.180  23.744  -32.074 1.00 24.85  ? 277 THR C CG2 1 
ATOM   3294 N N   . PHE C 1 201 ? 73.999  21.273  -30.209 1.00 34.19  ? 278 PHE C N   1 
ATOM   3295 C CA  . PHE C 1 201 ? 72.559  21.105  -30.051 1.00 34.04  ? 278 PHE C CA  1 
ATOM   3296 C C   . PHE C 1 201 ? 72.047  21.911  -28.868 1.00 37.22  ? 278 PHE C C   1 
ATOM   3297 O O   . PHE C 1 201 ? 72.839  22.348  -28.035 1.00 35.97  ? 278 PHE C O   1 
ATOM   3298 C CB  . PHE C 1 201 ? 72.177  19.609  -29.944 1.00 35.11  ? 278 PHE C CB  1 
ATOM   3299 C CG  . PHE C 1 201 ? 72.919  18.835  -28.883 1.00 35.85  ? 278 PHE C CG  1 
ATOM   3300 C CD1 . PHE C 1 201 ? 74.059  18.109  -29.199 1.00 40.48  ? 278 PHE C CD1 1 
ATOM   3301 C CD2 . PHE C 1 201 ? 72.496  18.852  -27.558 1.00 37.41  ? 278 PHE C CD2 1 
ATOM   3302 C CE1 . PHE C 1 201 ? 74.758  17.404  -28.209 1.00 40.84  ? 278 PHE C CE1 1 
ATOM   3303 C CE2 . PHE C 1 201 ? 73.196  18.146  -26.568 1.00 39.55  ? 278 PHE C CE2 1 
ATOM   3304 C CZ  . PHE C 1 201 ? 74.316  17.418  -26.904 1.00 38.02  ? 278 PHE C CZ  1 
ATOM   3305 N N   . PHE C 1 202 ? 70.720  22.114  -28.811 1.00 33.79  ? 279 PHE C N   1 
ATOM   3306 C CA  . PHE C 1 202 ? 70.037  22.937  -27.826 1.00 33.68  ? 279 PHE C CA  1 
ATOM   3307 C C   . PHE C 1 202 ? 68.593  22.443  -27.666 1.00 39.60  ? 279 PHE C C   1 
ATOM   3308 O O   . PHE C 1 202 ? 67.905  22.224  -28.663 1.00 39.90  ? 279 PHE C O   1 
ATOM   3309 C CB  . PHE C 1 202 ? 70.080  24.397  -28.331 1.00 36.02  ? 279 PHE C CB  1 
ATOM   3310 C CG  . PHE C 1 202 ? 69.417  25.496  -27.534 1.00 37.40  ? 279 PHE C CG  1 
ATOM   3311 C CD1 . PHE C 1 202 ? 69.512  25.532  -26.137 1.00 38.83  ? 279 PHE C CD1 1 
ATOM   3312 C CD2 . PHE C 1 202 ? 68.795  26.553  -28.178 1.00 40.13  ? 279 PHE C CD2 1 
ATOM   3313 C CE1 . PHE C 1 202 ? 68.926  26.567  -25.408 1.00 39.34  ? 279 PHE C CE1 1 
ATOM   3314 C CE2 . PHE C 1 202 ? 68.208  27.592  -27.447 1.00 42.88  ? 279 PHE C CE2 1 
ATOM   3315 C CZ  . PHE C 1 202 ? 68.277  27.592  -26.072 1.00 40.14  ? 279 PHE C CZ  1 
ATOM   3316 N N   . GLY C 1 203 ? 68.169  22.216  -26.425 1.00 35.81  ? 280 GLY C N   1 
ATOM   3317 C CA  . GLY C 1 203 ? 66.830  21.720  -26.157 1.00 35.26  ? 280 GLY C CA  1 
ATOM   3318 C C   . GLY C 1 203 ? 66.269  22.095  -24.804 1.00 40.31  ? 280 GLY C C   1 
ATOM   3319 O O   . GLY C 1 203 ? 66.967  22.632  -23.928 1.00 39.52  ? 280 GLY C O   1 
ATOM   3320 N N   . ALA C 1 204 ? 64.988  21.808  -24.634 1.00 38.50  ? 281 ALA C N   1 
ATOM   3321 C CA  . ALA C 1 204 ? 64.258  22.064  -23.411 1.00 39.62  ? 281 ALA C CA  1 
ATOM   3322 C C   . ALA C 1 204 ? 63.218  20.958  -23.221 1.00 47.36  ? 281 ALA C C   1 
ATOM   3323 O O   . ALA C 1 204 ? 62.706  20.390  -24.205 1.00 48.96  ? 281 ALA C O   1 
ATOM   3324 C CB  . ALA C 1 204 ? 63.587  23.436  -23.469 1.00 41.00  ? 281 ALA C CB  1 
ATOM   3325 N N   . LEU C 1 205 ? 62.880  20.690  -21.951 1.00 43.32  ? 282 LEU C N   1 
ATOM   3326 C CA  . LEU C 1 205 ? 61.921  19.674  -21.557 1.00 43.84  ? 282 LEU C CA  1 
ATOM   3327 C C   . LEU C 1 205 ? 61.031  20.183  -20.402 1.00 47.74  ? 282 LEU C C   1 
ATOM   3328 O O   . LEU C 1 205 ? 61.570  20.652  -19.398 1.00 48.75  ? 282 LEU C O   1 
ATOM   3329 C CB  . LEU C 1 205 ? 62.772  18.489  -21.124 1.00 43.90  ? 282 LEU C CB  1 
ATOM   3330 C CG  . LEU C 1 205 ? 62.215  17.397  -20.272 1.00 49.99  ? 282 LEU C CG  1 
ATOM   3331 C CD1 . LEU C 1 205 ? 61.133  16.636  -21.022 1.00 53.13  ? 282 LEU C CD1 1 
ATOM   3332 C CD2 . LEU C 1 205 ? 63.327  16.451  -19.944 1.00 49.94  ? 282 LEU C CD2 1 
ATOM   3333 N N   . LYS C 1 206 ? 59.678  20.124  -20.553 1.00 41.93  ? 283 LYS C N   1 
ATOM   3334 C CA  . LYS C 1 206 ? 58.733  20.542  -19.513 1.00 41.00  ? 283 LYS C CA  1 
ATOM   3335 C C   . LYS C 1 206 ? 58.663  19.446  -18.437 1.00 46.49  ? 283 LYS C C   1 
ATOM   3336 O O   . LYS C 1 206 ? 58.417  18.284  -18.762 1.00 49.72  ? 283 LYS C O   1 
ATOM   3337 C CB  . LYS C 1 206 ? 57.329  20.843  -20.091 1.00 42.69  ? 283 LYS C CB  1 
ATOM   3338 C CG  . LYS C 1 206 ? 56.367  21.386  -19.027 1.00 45.90  ? 283 LYS C CG  1 
ATOM   3339 C CD  . LYS C 1 206 ? 55.242  22.259  -19.529 1.00 50.39  ? 283 LYS C CD  1 
ATOM   3340 C CE  . LYS C 1 206 ? 54.425  22.752  -18.350 1.00 70.17  ? 283 LYS C CE  1 
ATOM   3341 N NZ  . LYS C 1 206 ? 53.150  23.417  -18.759 1.00 90.01  ? 283 LYS C NZ  1 
ATOM   3342 N N   . LEU C 1 207 ? 58.882  19.803  -17.174 1.00 39.96  ? 284 LEU C N   1 
ATOM   3343 C CA  . LEU C 1 207 ? 58.829  18.859  -16.056 1.00 39.55  ? 284 LEU C CA  1 
ATOM   3344 C C   . LEU C 1 207 ? 57.402  18.685  -15.595 1.00 49.05  ? 284 LEU C C   1 
ATOM   3345 O O   . LEU C 1 207 ? 56.639  19.645  -15.655 1.00 51.59  ? 284 LEU C O   1 
ATOM   3346 C CB  . LEU C 1 207 ? 59.693  19.356  -14.878 1.00 37.79  ? 284 LEU C CB  1 
ATOM   3347 C CG  . LEU C 1 207 ? 61.166  19.600  -15.155 1.00 38.54  ? 284 LEU C CG  1 
ATOM   3348 C CD1 . LEU C 1 207 ? 61.832  20.072  -13.939 1.00 38.43  ? 284 LEU C CD1 1 
ATOM   3349 C CD2 . LEU C 1 207 ? 61.842  18.368  -15.687 1.00 35.48  ? 284 LEU C CD2 1 
ATOM   3350 N N   . LEU C 1 208 ? 57.032  17.484  -15.128 1.00 47.26  ? 285 LEU C N   1 
ATOM   3351 C CA  . LEU C 1 208 ? 55.674  17.253  -14.650 1.00 54.78  ? 285 LEU C CA  1 
ATOM   3352 C C   . LEU C 1 208 ? 55.454  17.893  -13.309 1.00 58.42  ? 285 LEU C C   1 
ATOM   3353 O O   . LEU C 1 208 ? 54.345  18.427  -13.082 1.00 63.90  ? 285 LEU C O   1 
ATOM   3354 C CB  . LEU C 1 208 ? 55.313  15.766  -14.649 1.00 56.34  ? 285 LEU C CB  1 
ATOM   3355 C CG  . LEU C 1 208 ? 54.898  15.258  -16.049 1.00 63.14  ? 285 LEU C CG  1 
ATOM   3356 C CD1 . LEU C 1 208 ? 55.308  13.851  -16.258 1.00 63.00  ? 285 LEU C CD1 1 
ATOM   3357 C CD2 . LEU C 1 208 ? 53.404  15.411  -16.301 1.00 70.57  ? 285 LEU C CD2 1 
ATOM   3358 O OXT . LEU C 1 208 ? 56.432  17.975  -12.541 1.00 70.45  ? 285 LEU C OXT 1 
ATOM   3359 N N   . VAL D 1 65  ? 52.472  -4.911  12.157  1.00 84.63  ? 142 VAL D N   1 
ATOM   3360 C CA  . VAL D 1 65  ? 53.286  -4.197  13.150  1.00 82.53  ? 142 VAL D CA  1 
ATOM   3361 C C   . VAL D 1 65  ? 54.780  -4.518  12.922  1.00 79.26  ? 142 VAL D C   1 
ATOM   3362 O O   . VAL D 1 65  ? 55.093  -5.593  12.407  1.00 77.94  ? 142 VAL D O   1 
ATOM   3363 C CB  . VAL D 1 65  ? 52.804  -4.473  14.611  1.00 88.33  ? 142 VAL D CB  1 
ATOM   3364 C CG1 . VAL D 1 65  ? 53.415  -3.487  15.614  1.00 86.96  ? 142 VAL D CG1 1 
ATOM   3365 C CG2 . VAL D 1 65  ? 51.279  -4.433  14.707  1.00 92.08  ? 142 VAL D CG2 1 
ATOM   3366 N N   . THR D 1 66  ? 55.689  -3.576  13.274  1.00 71.10  ? 143 THR D N   1 
ATOM   3367 C CA  . THR D 1 66  ? 57.122  -3.741  13.063  1.00 67.00  ? 143 THR D CA  1 
ATOM   3368 C C   . THR D 1 66  ? 57.952  -3.935  14.341  1.00 66.62  ? 143 THR D C   1 
ATOM   3369 O O   . THR D 1 66  ? 57.517  -3.567  15.434  1.00 66.23  ? 143 THR D O   1 
ATOM   3370 C CB  . THR D 1 66  ? 57.696  -2.639  12.159  1.00 72.79  ? 143 THR D CB  1 
ATOM   3371 O OG1 . THR D 1 66  ? 57.799  -1.443  12.908  1.00 74.71  ? 143 THR D OG1 1 
ATOM   3372 C CG2 . THR D 1 66  ? 56.881  -2.408  10.885  1.00 72.12  ? 143 THR D CG2 1 
ATOM   3373 N N   . GLN D 1 67  ? 59.155  -4.527  14.172  1.00 58.89  ? 144 GLN D N   1 
ATOM   3374 C CA  . GLN D 1 67  ? 60.133  -4.769  15.225  1.00 55.97  ? 144 GLN D CA  1 
ATOM   3375 C C   . GLN D 1 67  ? 61.131  -3.622  15.249  1.00 59.38  ? 144 GLN D C   1 
ATOM   3376 O O   . GLN D 1 67  ? 62.056  -3.582  14.423  1.00 58.20  ? 144 GLN D O   1 
ATOM   3377 C CB  . GLN D 1 67  ? 60.853  -6.105  15.001  1.00 54.84  ? 144 GLN D CB  1 
ATOM   3378 C CG  . GLN D 1 67  ? 60.145  -7.244  15.665  1.00 65.61  ? 144 GLN D CG  1 
ATOM   3379 C CD  . GLN D 1 67  ? 60.666  -8.573  15.230  1.00 81.50  ? 144 GLN D CD  1 
ATOM   3380 O OE1 . GLN D 1 67  ? 60.432  -9.021  14.097  1.00 74.81  ? 144 GLN D OE1 1 
ATOM   3381 N NE2 . GLN D 1 67  ? 61.314  -9.267  16.158  1.00 74.57  ? 144 GLN D NE2 1 
ATOM   3382 N N   . ASP D 1 68  ? 60.939  -2.672  16.178  1.00 56.02  ? 145 ASP D N   1 
ATOM   3383 C CA  . ASP D 1 68  ? 61.840  -1.519  16.294  1.00 54.90  ? 145 ASP D CA  1 
ATOM   3384 C C   . ASP D 1 68  ? 63.246  -1.968  16.603  1.00 55.17  ? 145 ASP D C   1 
ATOM   3385 O O   . ASP D 1 68  ? 63.420  -2.927  17.358  1.00 56.16  ? 145 ASP D O   1 
ATOM   3386 C CB  . ASP D 1 68  ? 61.340  -0.541  17.375  1.00 58.54  ? 145 ASP D CB  1 
ATOM   3387 C CG  . ASP D 1 68  ? 60.050  0.188   17.036  1.00 75.39  ? 145 ASP D CG  1 
ATOM   3388 O OD1 . ASP D 1 68  ? 59.460  -0.110  15.981  1.00 79.51  ? 145 ASP D OD1 1 
ATOM   3389 O OD2 . ASP D 1 68  ? 59.662  1.093   17.797  1.00 80.31  ? 145 ASP D OD2 1 
ATOM   3390 N N   . CYS D 1 69  ? 64.244  -1.328  15.997  1.00 48.32  ? 146 CYS D N   1 
ATOM   3391 C CA  . CYS D 1 69  ? 65.650  -1.691  16.240  1.00 45.47  ? 146 CYS D CA  1 
ATOM   3392 C C   . CYS D 1 69  ? 66.598  -0.552  15.920  1.00 45.79  ? 146 CYS D C   1 
ATOM   3393 O O   . CYS D 1 69  ? 66.286  0.344   15.118  1.00 44.03  ? 146 CYS D O   1 
ATOM   3394 C CB  . CYS D 1 69  ? 66.052  -2.984  15.528  1.00 44.41  ? 146 CYS D CB  1 
ATOM   3395 S SG  . CYS D 1 69  ? 65.417  -3.124  13.843  1.00 49.22  ? 146 CYS D SG  1 
ATOM   3396 N N   . LEU D 1 70  ? 67.748  -0.573  16.595  1.00 40.13  ? 147 LEU D N   1 
ATOM   3397 C CA  . LEU D 1 70  ? 68.789  0.421   16.403  1.00 39.36  ? 147 LEU D CA  1 
ATOM   3398 C C   . LEU D 1 70  ? 70.112  -0.296  16.443  1.00 41.87  ? 147 LEU D C   1 
ATOM   3399 O O   . LEU D 1 70  ? 70.347  -1.105  17.348  1.00 40.71  ? 147 LEU D O   1 
ATOM   3400 C CB  . LEU D 1 70  ? 68.749  1.493   17.498  1.00 40.14  ? 147 LEU D CB  1 
ATOM   3401 C CG  . LEU D 1 70  ? 69.724  2.655   17.324  1.00 44.16  ? 147 LEU D CG  1 
ATOM   3402 C CD1 . LEU D 1 70  ? 69.059  3.936   17.610  1.00 45.44  ? 147 LEU D CD1 1 
ATOM   3403 C CD2 . LEU D 1 70  ? 70.934  2.491   18.198  1.00 45.34  ? 147 LEU D CD2 1 
ATOM   3404 N N   . GLN D 1 71  ? 70.978  0.016   15.462  1.00 36.51  ? 148 GLN D N   1 
ATOM   3405 C CA  . GLN D 1 71  ? 72.319  -0.523  15.413  1.00 33.97  ? 148 GLN D CA  1 
ATOM   3406 C C   . GLN D 1 71  ? 73.352  0.607   15.303  1.00 38.52  ? 148 GLN D C   1 
ATOM   3407 O O   . GLN D 1 71  ? 73.154  1.589   14.575  1.00 39.37  ? 148 GLN D O   1 
ATOM   3408 C CB  . GLN D 1 71  ? 72.458  -1.508  14.279  1.00 33.36  ? 148 GLN D CB  1 
ATOM   3409 C CG  . GLN D 1 71  ? 73.775  -2.243  14.252  1.00 28.63  ? 148 GLN D CG  1 
ATOM   3410 C CD  . GLN D 1 71  ? 73.712  -3.270  13.163  1.00 34.96  ? 148 GLN D CD  1 
ATOM   3411 O OE1 . GLN D 1 71  ? 73.237  -4.406  13.360  1.00 29.65  ? 148 GLN D OE1 1 
ATOM   3412 N NE2 . GLN D 1 71  ? 74.160  -2.889  11.982  1.00 32.25  ? 148 GLN D NE2 1 
ATOM   3413 N N   . LEU D 1 72  ? 74.449  0.448   16.051  1.00 33.71  ? 149 LEU D N   1 
ATOM   3414 C CA  . LEU D 1 72  ? 75.602  1.333   16.080  1.00 33.71  ? 149 LEU D CA  1 
ATOM   3415 C C   . LEU D 1 72  ? 76.830  0.568   15.591  1.00 36.77  ? 149 LEU D C   1 
ATOM   3416 O O   . LEU D 1 72  ? 76.988  -0.621  15.872  1.00 33.66  ? 149 LEU D O   1 
ATOM   3417 C CB  . LEU D 1 72  ? 75.874  1.845   17.502  1.00 34.96  ? 149 LEU D CB  1 
ATOM   3418 C CG  . LEU D 1 72  ? 74.747  2.593   18.211  1.00 40.41  ? 149 LEU D CG  1 
ATOM   3419 C CD1 . LEU D 1 72  ? 75.078  2.748   19.649  1.00 40.34  ? 149 LEU D CD1 1 
ATOM   3420 C CD2 . LEU D 1 72  ? 74.483  3.948   17.555  1.00 42.88  ? 149 LEU D CD2 1 
ATOM   3421 N N   . ILE D 1 73  ? 77.689  1.255   14.835  1.00 35.32  ? 150 ILE D N   1 
ATOM   3422 C CA  . ILE D 1 73  ? 78.936  0.705   14.297  1.00 33.82  ? 150 ILE D CA  1 
ATOM   3423 C C   . ILE D 1 73  ? 80.073  1.648   14.690  1.00 39.60  ? 150 ILE D C   1 
ATOM   3424 O O   . ILE D 1 73  ? 79.869  2.867   14.785  1.00 40.85  ? 150 ILE D O   1 
ATOM   3425 C CB  . ILE D 1 73  ? 78.871  0.426   12.762  1.00 35.22  ? 150 ILE D CB  1 
ATOM   3426 C CG1 . ILE D 1 73  ? 78.574  1.712   11.950  1.00 34.60  ? 150 ILE D CG1 1 
ATOM   3427 C CG2 . ILE D 1 73  ? 77.887  -0.725  12.447  1.00 34.59  ? 150 ILE D CG2 1 
ATOM   3428 C CD1 . ILE D 1 73  ? 78.839  1.615   10.499  1.00 34.21  ? 150 ILE D CD1 1 
ATOM   3429 N N   . ALA D 1 74  ? 81.252  1.078   14.961  1.00 35.18  ? 151 ALA D N   1 
ATOM   3430 C CA  . ALA D 1 74  ? 82.411  1.844   15.364  1.00 36.42  ? 151 ALA D CA  1 
ATOM   3431 C C   . ALA D 1 74  ? 82.791  2.974   14.393  1.00 43.54  ? 151 ALA D C   1 
ATOM   3432 O O   . ALA D 1 74  ? 82.793  2.789   13.170  1.00 42.67  ? 151 ALA D O   1 
ATOM   3433 C CB  . ALA D 1 74  ? 83.579  0.917   15.574  1.00 36.41  ? 151 ALA D CB  1 
ATOM   3434 N N   . ASP D 1 75  ? 83.083  4.156   14.948  1.00 42.71  ? 152 ASP D N   1 
ATOM   3435 C CA  . ASP D 1 75  ? 83.503  5.292   14.137  1.00 44.48  ? 152 ASP D CA  1 
ATOM   3436 C C   . ASP D 1 75  ? 85.039  5.294   14.055  1.00 49.96  ? 152 ASP D C   1 
ATOM   3437 O O   . ASP D 1 75  ? 85.711  5.782   14.969  1.00 51.71  ? 152 ASP D O   1 
ATOM   3438 C CB  . ASP D 1 75  ? 82.948  6.609   14.710  1.00 48.12  ? 152 ASP D CB  1 
ATOM   3439 C CG  . ASP D 1 75  ? 83.428  7.877   14.036  1.00 59.59  ? 152 ASP D CG  1 
ATOM   3440 O OD1 . ASP D 1 75  ? 84.016  7.781   12.926  1.00 60.64  ? 152 ASP D OD1 1 
ATOM   3441 O OD2 . ASP D 1 75  ? 83.222  8.963   14.613  1.00 64.19  ? 152 ASP D OD2 1 
ATOM   3442 N N   . SER D 1 76  ? 85.588  4.738   12.957  1.00 45.31  ? 153 SER D N   1 
ATOM   3443 C CA  . SER D 1 76  ? 87.027  4.667   12.709  1.00 45.63  ? 153 SER D CA  1 
ATOM   3444 C C   . SER D 1 76  ? 87.750  6.045   12.698  1.00 52.72  ? 153 SER D C   1 
ATOM   3445 O O   . SER D 1 76  ? 88.970  6.079   12.831  1.00 54.91  ? 153 SER D O   1 
ATOM   3446 C CB  . SER D 1 76  ? 87.301  3.905   11.417  1.00 47.66  ? 153 SER D CB  1 
ATOM   3447 O OG  . SER D 1 76  ? 86.940  4.665   10.276  1.00 52.78  ? 153 SER D OG  1 
ATOM   3448 N N   . GLU D 1 77  ? 87.008  7.173   12.570  1.00 48.01  ? 154 GLU D N   1 
ATOM   3449 C CA  . GLU D 1 77  ? 87.627  8.500   12.524  1.00 48.64  ? 154 GLU D CA  1 
ATOM   3450 C C   . GLU D 1 77  ? 87.687  9.194   13.882  1.00 52.54  ? 154 GLU D C   1 
ATOM   3451 O O   . GLU D 1 77  ? 88.097  10.362  13.964  1.00 52.83  ? 154 GLU D O   1 
ATOM   3452 C CB  . GLU D 1 77  ? 86.910  9.401   11.542  1.00 50.69  ? 154 GLU D CB  1 
ATOM   3453 C CG  . GLU D 1 77  ? 86.857  8.944   10.107  1.00 60.79  ? 154 GLU D CG  1 
ATOM   3454 C CD  . GLU D 1 77  ? 85.808  9.780   9.404   1.00 92.02  ? 154 GLU D CD  1 
ATOM   3455 O OE1 . GLU D 1 77  ? 86.155  10.896  8.951   1.00 78.98  ? 154 GLU D OE1 1 
ATOM   3456 O OE2 . GLU D 1 77  ? 84.620  9.376   9.410   1.00 96.51  ? 154 GLU D OE2 1 
ATOM   3457 N N   . THR D 1 78  ? 87.296  8.488   14.956  1.00 48.78  ? 155 THR D N   1 
ATOM   3458 C CA  . THR D 1 78  ? 87.325  9.059   16.307  1.00 49.65  ? 155 THR D CA  1 
ATOM   3459 C C   . THR D 1 78  ? 88.156  8.196   17.241  1.00 52.79  ? 155 THR D C   1 
ATOM   3460 O O   . THR D 1 78  ? 88.030  6.975   17.194  1.00 49.64  ? 155 THR D O   1 
ATOM   3461 C CB  . THR D 1 78  ? 85.897  9.333   16.820  1.00 55.99  ? 155 THR D CB  1 
ATOM   3462 O OG1 . THR D 1 78  ? 85.263  10.273  15.950  1.00 61.37  ? 155 THR D OG1 1 
ATOM   3463 C CG2 . THR D 1 78  ? 85.864  9.878   18.247  1.00 51.75  ? 155 THR D CG2 1 
ATOM   3464 N N   . PRO D 1 79  ? 89.043  8.789   18.074  1.00 52.22  ? 156 PRO D N   1 
ATOM   3465 C CA  . PRO D 1 79  ? 89.816  7.946   19.008  1.00 51.99  ? 156 PRO D CA  1 
ATOM   3466 C C   . PRO D 1 79  ? 88.915  7.402   20.120  1.00 54.93  ? 156 PRO D C   1 
ATOM   3467 O O   . PRO D 1 79  ? 87.960  8.085   20.525  1.00 55.09  ? 156 PRO D O   1 
ATOM   3468 C CB  . PRO D 1 79  ? 90.875  8.907   19.564  1.00 56.13  ? 156 PRO D CB  1 
ATOM   3469 C CG  . PRO D 1 79  ? 90.262  10.254  19.433  1.00 61.46  ? 156 PRO D CG  1 
ATOM   3470 C CD  . PRO D 1 79  ? 89.361  10.226  18.241  1.00 55.18  ? 156 PRO D CD  1 
ATOM   3471 N N   . THR D 1 80  ? 89.226  6.177   20.619  1.00 49.74  ? 157 THR D N   1 
ATOM   3472 C CA  . THR D 1 80  ? 88.499  5.533   21.730  1.00 47.41  ? 157 THR D CA  1 
ATOM   3473 C C   . THR D 1 80  ? 88.447  6.464   22.941  1.00 52.74  ? 157 THR D C   1 
ATOM   3474 O O   . THR D 1 80  ? 89.402  7.205   23.195  1.00 54.36  ? 157 THR D O   1 
ATOM   3475 C CB  . THR D 1 80  ? 89.120  4.203   22.146  1.00 43.04  ? 157 THR D CB  1 
ATOM   3476 O OG1 . THR D 1 80  ? 90.487  4.383   22.457  1.00 47.16  ? 157 THR D OG1 1 
ATOM   3477 C CG2 . THR D 1 80  ? 88.986  3.148   21.103  1.00 36.21  ? 157 THR D CG2 1 
ATOM   3478 N N   . ILE D 1 81  ? 87.309  6.440   23.645  1.00 48.05  ? 158 ILE D N   1 
ATOM   3479 C CA  . ILE D 1 81  ? 87.023  7.251   24.812  1.00 49.82  ? 158 ILE D CA  1 
ATOM   3480 C C   . ILE D 1 81  ? 87.590  6.581   26.064  1.00 56.11  ? 158 ILE D C   1 
ATOM   3481 O O   . ILE D 1 81  ? 87.194  5.464   26.395  1.00 55.11  ? 158 ILE D O   1 
ATOM   3482 C CB  . ILE D 1 81  ? 85.501  7.517   24.899  1.00 51.96  ? 158 ILE D CB  1 
ATOM   3483 C CG1 . ILE D 1 81  ? 84.992  8.243   23.636  1.00 49.99  ? 158 ILE D CG1 1 
ATOM   3484 C CG2 . ILE D 1 81  ? 85.154  8.310   26.176  1.00 56.48  ? 158 ILE D CG2 1 
ATOM   3485 C CD1 . ILE D 1 81  ? 83.912  7.559   22.977  1.00 42.93  ? 158 ILE D CD1 1 
ATOM   3486 N N   . GLN D 1 82  ? 88.472  7.288   26.788  1.00 56.07  ? 159 GLN D N   1 
ATOM   3487 C CA  . GLN D 1 82  ? 89.145  6.738   27.960  1.00 58.07  ? 159 GLN D CA  1 
ATOM   3488 C C   . GLN D 1 82  ? 88.657  7.280   29.313  1.00 71.14  ? 159 GLN D C   1 
ATOM   3489 O O   . GLN D 1 82  ? 89.278  8.161   29.909  1.00 75.70  ? 159 GLN D O   1 
ATOM   3490 C CB  . GLN D 1 82  ? 90.667  6.813   27.792  1.00 59.40  ? 159 GLN D CB  1 
ATOM   3491 C CG  . GLN D 1 82  ? 91.279  5.510   27.355  1.00 51.98  ? 159 GLN D CG  1 
ATOM   3492 C CD  . GLN D 1 82  ? 91.918  5.597   25.996  1.00 74.08  ? 159 GLN D CD  1 
ATOM   3493 O OE1 . GLN D 1 82  ? 92.845  6.373   25.759  1.00 64.26  ? 159 GLN D OE1 1 
ATOM   3494 N NE2 . GLN D 1 82  ? 91.510  4.718   25.090  1.00 80.54  ? 159 GLN D NE2 1 
ATOM   3495 N N   . LYS D 1 83  ? 87.572  6.710   29.828  1.00 69.36  ? 160 LYS D N   1 
ATOM   3496 C CA  . LYS D 1 83  ? 87.002  7.177   31.076  1.00 72.37  ? 160 LYS D CA  1 
ATOM   3497 C C   . LYS D 1 83  ? 87.430  6.285   32.241  1.00 79.10  ? 160 LYS D C   1 
ATOM   3498 O O   . LYS D 1 83  ? 86.738  5.322   32.572  1.00 78.17  ? 160 LYS D O   1 
ATOM   3499 C CB  . LYS D 1 83  ? 85.469  7.329   30.953  1.00 73.55  ? 160 LYS D CB  1 
ATOM   3500 N N   . GLY D 1 84  ? 88.585  6.611   32.822  1.00 78.20  ? 161 GLY D N   1 
ATOM   3501 C CA  . GLY D 1 84  ? 89.147  5.926   33.977  1.00 80.02  ? 161 GLY D CA  1 
ATOM   3502 C C   . GLY D 1 84  ? 89.704  4.551   33.690  1.00 83.19  ? 161 GLY D C   1 
ATOM   3503 O O   . GLY D 1 84  ? 90.551  4.392   32.808  1.00 82.70  ? 161 GLY D O   1 
ATOM   3504 N N   . SER D 1 85  ? 89.231  3.545   34.448  1.00 79.31  ? 162 SER D N   1 
ATOM   3505 C CA  . SER D 1 85  ? 89.639  2.145   34.294  1.00 77.42  ? 162 SER D CA  1 
ATOM   3506 C C   . SER D 1 85  ? 88.989  1.479   33.054  1.00 75.44  ? 162 SER D C   1 
ATOM   3507 O O   . SER D 1 85  ? 89.306  0.327   32.728  1.00 74.51  ? 162 SER D O   1 
ATOM   3508 C CB  . SER D 1 85  ? 89.309  1.362   35.568  1.00 82.30  ? 162 SER D CB  1 
ATOM   3509 O OG  . SER D 1 85  ? 90.000  1.847   36.710  1.00 90.06  ? 162 SER D OG  1 
ATOM   3510 N N   . TYR D 1 86  ? 88.101  2.224   32.358  1.00 67.79  ? 163 TYR D N   1 
ATOM   3511 C CA  . TYR D 1 86  ? 87.353  1.752   31.199  1.00 63.42  ? 163 TYR D CA  1 
ATOM   3512 C C   . TYR D 1 86  ? 87.697  2.441   29.891  1.00 64.80  ? 163 TYR D C   1 
ATOM   3513 O O   . TYR D 1 86  ? 88.181  3.579   29.887  1.00 67.33  ? 163 TYR D O   1 
ATOM   3514 C CB  . TYR D 1 86  ? 85.839  1.882   31.452  1.00 63.20  ? 163 TYR D CB  1 
ATOM   3515 C CG  . TYR D 1 86  ? 85.334  1.035   32.594  1.00 63.99  ? 163 TYR D CG  1 
ATOM   3516 C CD1 . TYR D 1 86  ? 85.460  1.463   33.914  1.00 67.63  ? 163 TYR D CD1 1 
ATOM   3517 C CD2 . TYR D 1 86  ? 84.706  -0.179  32.359  1.00 62.80  ? 163 TYR D CD2 1 
ATOM   3518 C CE1 . TYR D 1 86  ? 85.006  0.685   34.972  1.00 67.51  ? 163 TYR D CE1 1 
ATOM   3519 C CE2 . TYR D 1 86  ? 84.238  -0.964  33.410  1.00 64.99  ? 163 TYR D CE2 1 
ATOM   3520 C CZ  . TYR D 1 86  ? 84.395  -0.528  34.717  1.00 74.47  ? 163 TYR D CZ  1 
ATOM   3521 O OH  . TYR D 1 86  ? 83.923  -1.285  35.756  1.00 77.16  ? 163 TYR D OH  1 
ATOM   3522 N N   . THR D 1 87  ? 87.404  1.738   28.777  1.00 55.55  ? 164 THR D N   1 
ATOM   3523 C CA  . THR D 1 87  ? 87.546  2.218   27.410  1.00 52.91  ? 164 THR D CA  1 
ATOM   3524 C C   . THR D 1 87  ? 86.176  2.102   26.728  1.00 53.37  ? 164 THR D C   1 
ATOM   3525 O O   . THR D 1 87  ? 85.498  1.073   26.842  1.00 50.41  ? 164 THR D O   1 
ATOM   3526 C CB  . THR D 1 87  ? 88.648  1.458   26.656  1.00 54.94  ? 164 THR D CB  1 
ATOM   3527 O OG1 . THR D 1 87  ? 89.898  1.665   27.309  1.00 53.27  ? 164 THR D OG1 1 
ATOM   3528 C CG2 . THR D 1 87  ? 88.766  1.884   25.187  1.00 49.70  ? 164 THR D CG2 1 
ATOM   3529 N N   . PHE D 1 88  ? 85.786  3.164   26.027  1.00 49.23  ? 165 PHE D N   1 
ATOM   3530 C CA  . PHE D 1 88  ? 84.530  3.236   25.318  1.00 46.82  ? 165 PHE D CA  1 
ATOM   3531 C C   . PHE D 1 88  ? 84.739  3.399   23.815  1.00 49.55  ? 165 PHE D C   1 
ATOM   3532 O O   . PHE D 1 88  ? 85.643  4.106   23.369  1.00 49.10  ? 165 PHE D O   1 
ATOM   3533 C CB  . PHE D 1 88  ? 83.652  4.344   25.902  1.00 49.35  ? 165 PHE D CB  1 
ATOM   3534 C CG  . PHE D 1 88  ? 83.196  4.008   27.295  1.00 51.84  ? 165 PHE D CG  1 
ATOM   3535 C CD1 . PHE D 1 88  ? 82.050  3.244   27.508  1.00 54.20  ? 165 PHE D CD1 1 
ATOM   3536 C CD2 . PHE D 1 88  ? 83.923  4.435   28.405  1.00 56.39  ? 165 PHE D CD2 1 
ATOM   3537 C CE1 . PHE D 1 88  ? 81.632  2.927   28.815  1.00 56.89  ? 165 PHE D CE1 1 
ATOM   3538 C CE2 . PHE D 1 88  ? 83.515  4.106   29.707  1.00 60.08  ? 165 PHE D CE2 1 
ATOM   3539 C CZ  . PHE D 1 88  ? 82.379  3.349   29.906  1.00 57.23  ? 165 PHE D CZ  1 
ATOM   3540 N N   . VAL D 1 89  ? 83.903  2.718   23.037  1.00 44.53  ? 166 VAL D N   1 
ATOM   3541 C CA  . VAL D 1 89  ? 83.984  2.780   21.599  1.00 43.62  ? 166 VAL D CA  1 
ATOM   3542 C C   . VAL D 1 89  ? 83.231  4.003   21.097  1.00 49.35  ? 166 VAL D C   1 
ATOM   3543 O O   . VAL D 1 89  ? 82.070  4.171   21.465  1.00 49.01  ? 166 VAL D O   1 
ATOM   3544 C CB  . VAL D 1 89  ? 83.397  1.498   20.989  1.00 46.61  ? 166 VAL D CB  1 
ATOM   3545 C CG1 . VAL D 1 89  ? 83.383  1.557   19.451  1.00 45.96  ? 166 VAL D CG1 1 
ATOM   3546 C CG2 . VAL D 1 89  ? 84.142  0.270   21.499  1.00 46.10  ? 166 VAL D CG2 1 
ATOM   3547 N N   . PRO D 1 90  ? 83.835  4.861   20.232  1.00 47.22  ? 167 PRO D N   1 
ATOM   3548 C CA  . PRO D 1 90  ? 83.044  5.953   19.647  1.00 46.78  ? 167 PRO D CA  1 
ATOM   3549 C C   . PRO D 1 90  ? 82.085  5.368   18.600  1.00 49.11  ? 167 PRO D C   1 
ATOM   3550 O O   . PRO D 1 90  ? 82.523  4.683   17.673  1.00 47.97  ? 167 PRO D O   1 
ATOM   3551 C CB  . PRO D 1 90  ? 84.093  6.891   19.061  1.00 49.21  ? 167 PRO D CB  1 
ATOM   3552 C CG  . PRO D 1 90  ? 85.324  6.109   18.936  1.00 53.40  ? 167 PRO D CG  1 
ATOM   3553 C CD  . PRO D 1 90  ? 85.203  4.820   19.670  1.00 48.37  ? 167 PRO D CD  1 
ATOM   3554 N N   . TRP D 1 91  ? 80.776  5.553   18.802  1.00 46.48  ? 168 TRP D N   1 
ATOM   3555 C CA  . TRP D 1 91  ? 79.775  4.989   17.895  1.00 46.56  ? 168 TRP D CA  1 
ATOM   3556 C C   . TRP D 1 91  ? 79.326  5.943   16.824  1.00 49.17  ? 168 TRP D C   1 
ATOM   3557 O O   . TRP D 1 91  ? 79.396  7.160   16.991  1.00 50.07  ? 168 TRP D O   1 
ATOM   3558 C CB  . TRP D 1 91  ? 78.532  4.450   18.655  1.00 45.76  ? 168 TRP D CB  1 
ATOM   3559 C CG  . TRP D 1 91  ? 78.832  3.373   19.643  1.00 46.12  ? 168 TRP D CG  1 
ATOM   3560 C CD1 . TRP D 1 91  ? 78.738  3.460   20.999  1.00 49.71  ? 168 TRP D CD1 1 
ATOM   3561 C CD2 . TRP D 1 91  ? 79.356  2.076   19.356  1.00 44.92  ? 168 TRP D CD2 1 
ATOM   3562 N NE1 . TRP D 1 91  ? 79.160  2.293   21.578  1.00 48.49  ? 168 TRP D NE1 1 
ATOM   3563 C CE2 . TRP D 1 91  ? 79.552  1.423   20.593  1.00 48.68  ? 168 TRP D CE2 1 
ATOM   3564 C CE3 . TRP D 1 91  ? 79.677  1.397   18.165  1.00 45.56  ? 168 TRP D CE3 1 
ATOM   3565 C CZ2 . TRP D 1 91  ? 80.036  0.113   20.678  1.00 47.10  ? 168 TRP D CZ2 1 
ATOM   3566 C CZ3 . TRP D 1 91  ? 80.151  0.100   18.247  1.00 46.50  ? 168 TRP D CZ3 1 
ATOM   3567 C CH2 . TRP D 1 91  ? 80.323  -0.531  19.492  1.00 47.28  ? 168 TRP D CH2 1 
ATOM   3568 N N   . LEU D 1 92  ? 78.823  5.365   15.744  1.00 43.69  ? 169 LEU D N   1 
ATOM   3569 C CA  . LEU D 1 92  ? 78.234  6.034   14.610  1.00 44.84  ? 169 LEU D CA  1 
ATOM   3570 C C   . LEU D 1 92  ? 76.924  5.286   14.363  1.00 46.53  ? 169 LEU D C   1 
ATOM   3571 O O   . LEU D 1 92  ? 76.896  4.060   14.498  1.00 46.50  ? 169 LEU D O   1 
ATOM   3572 C CB  . LEU D 1 92  ? 79.148  5.814   13.436  1.00 45.99  ? 169 LEU D CB  1 
ATOM   3573 C CG  . LEU D 1 92  ? 79.523  6.977   12.586  1.00 54.83  ? 169 LEU D CG  1 
ATOM   3574 C CD1 . LEU D 1 92  ? 80.692  6.565   11.715  1.00 56.05  ? 169 LEU D CD1 1 
ATOM   3575 C CD2 . LEU D 1 92  ? 78.380  7.367   11.670  1.00 59.70  ? 169 LEU D CD2 1 
ATOM   3576 N N   . LEU D 1 93  ? 75.831  5.998   14.047  1.00 41.40  ? 170 LEU D N   1 
ATOM   3577 C CA  . LEU D 1 93  ? 74.563  5.310   13.819  1.00 39.05  ? 170 LEU D CA  1 
ATOM   3578 C C   . LEU D 1 93  ? 74.617  4.557   12.519  1.00 42.48  ? 170 LEU D C   1 
ATOM   3579 O O   . LEU D 1 93  ? 74.861  5.165   11.441  1.00 40.93  ? 170 LEU D O   1 
ATOM   3580 C CB  . LEU D 1 93  ? 73.354  6.254   13.796  1.00 39.26  ? 170 LEU D CB  1 
ATOM   3581 C CG  . LEU D 1 93  ? 72.031  5.590   13.426  1.00 41.78  ? 170 LEU D CG  1 
ATOM   3582 C CD1 . LEU D 1 93  ? 71.345  4.948   14.641  1.00 42.34  ? 170 LEU D CD1 1 
ATOM   3583 C CD2 . LEU D 1 93  ? 71.145  6.528   12.708  1.00 42.31  ? 170 LEU D CD2 1 
ATOM   3584 N N   . SER D 1 94  ? 74.359  3.219   12.646  1.00 37.25  ? 171 SER D N   1 
ATOM   3585 C CA  . SER D 1 94  ? 74.267  2.322   11.503  1.00 35.42  ? 171 SER D CA  1 
ATOM   3586 C C   . SER D 1 94  ? 72.868  2.521   10.898  1.00 37.06  ? 171 SER D C   1 
ATOM   3587 O O   . SER D 1 94  ? 72.761  2.890   9.735   1.00 36.05  ? 171 SER D O   1 
ATOM   3588 C CB  . SER D 1 94  ? 74.503  0.871   11.902  1.00 35.57  ? 171 SER D CB  1 
ATOM   3589 O OG  . SER D 1 94  ? 74.133  0.033   10.822  1.00 43.93  ? 171 SER D OG  1 
ATOM   3590 N N   . PHE D 1 95  ? 71.820  2.358   11.711  1.00 31.06  ? 172 PHE D N   1 
ATOM   3591 C CA  . PHE D 1 95  ? 70.448  2.529   11.290  1.00 31.68  ? 172 PHE D CA  1 
ATOM   3592 C C   . PHE D 1 95  ? 69.579  2.575   12.517  1.00 37.61  ? 172 PHE D C   1 
ATOM   3593 O O   . PHE D 1 95  ? 69.917  2.028   13.584  1.00 35.83  ? 172 PHE D O   1 
ATOM   3594 C CB  . PHE D 1 95  ? 69.979  1.399   10.344  1.00 33.44  ? 172 PHE D CB  1 
ATOM   3595 C CG  . PHE D 1 95  ? 69.477  0.167   11.074  1.00 34.87  ? 172 PHE D CG  1 
ATOM   3596 C CD1 . PHE D 1 95  ? 68.148  0.061   11.465  1.00 38.68  ? 172 PHE D CD1 1 
ATOM   3597 C CD2 . PHE D 1 95  ? 70.338  -0.867  11.401  1.00 35.32  ? 172 PHE D CD2 1 
ATOM   3598 C CE1 . PHE D 1 95  ? 67.701  -1.053  12.167  1.00 38.22  ? 172 PHE D CE1 1 
ATOM   3599 C CE2 . PHE D 1 95  ? 69.875  -1.983  12.100  1.00 36.48  ? 172 PHE D CE2 1 
ATOM   3600 C CZ  . PHE D 1 95  ? 68.575  -2.052  12.497  1.00 34.40  ? 172 PHE D CZ  1 
ATOM   3601 N N   . LYS D 1 96  ? 68.426  3.200   12.339  1.00 37.50  ? 173 LYS D N   1 
ATOM   3602 C CA  . LYS D 1 96  ? 67.393  3.342   13.360  1.00 38.55  ? 173 LYS D CA  1 
ATOM   3603 C C   . LYS D 1 96  ? 66.065  3.049   12.644  1.00 44.49  ? 173 LYS D C   1 
ATOM   3604 O O   . LYS D 1 96  ? 65.860  3.495   11.520  1.00 45.32  ? 173 LYS D O   1 
ATOM   3605 C CB  . LYS D 1 96  ? 67.436  4.759   13.977  1.00 40.09  ? 173 LYS D CB  1 
ATOM   3606 C CG  . LYS D 1 96  ? 66.309  5.030   14.940  1.00 37.88  ? 173 LYS D CG  1 
ATOM   3607 C CD  . LYS D 1 96  ? 66.245  6.477   15.386  1.00 52.67  ? 173 LYS D CD  1 
ATOM   3608 C CE  . LYS D 1 96  ? 64.919  6.777   16.049  1.00 66.19  ? 173 LYS D CE  1 
ATOM   3609 N NZ  . LYS D 1 96  ? 63.818  6.815   15.046  1.00 78.50  ? 173 LYS D NZ  1 
ATOM   3610 N N   . ARG D 1 97  ? 65.207  2.254   13.263  1.00 41.92  ? 174 ARG D N   1 
ATOM   3611 C CA  . ARG D 1 97  ? 63.926  1.819   12.707  1.00 42.68  ? 174 ARG D CA  1 
ATOM   3612 C C   . ARG D 1 97  ? 62.938  1.807   13.875  1.00 50.23  ? 174 ARG D C   1 
ATOM   3613 O O   . ARG D 1 97  ? 63.197  1.224   14.947  1.00 50.95  ? 174 ARG D O   1 
ATOM   3614 C CB  . ARG D 1 97  ? 64.117  0.408   12.124  1.00 39.62  ? 174 ARG D CB  1 
ATOM   3615 C CG  . ARG D 1 97  ? 62.932  -0.178  11.439  1.00 37.64  ? 174 ARG D CG  1 
ATOM   3616 C CD  . ARG D 1 97  ? 63.213  -1.630  11.166  1.00 35.99  ? 174 ARG D CD  1 
ATOM   3617 N NE  . ARG D 1 97  ? 62.218  -2.185  10.256  1.00 43.80  ? 174 ARG D NE  1 
ATOM   3618 C CZ  . ARG D 1 97  ? 61.473  -3.248  10.522  1.00 67.68  ? 174 ARG D CZ  1 
ATOM   3619 N NH1 . ARG D 1 97  ? 61.636  -3.914  11.655  1.00 55.21  ? 174 ARG D NH1 1 
ATOM   3620 N NH2 . ARG D 1 97  ? 60.588  -3.679  9.638   1.00 68.46  ? 174 ARG D NH2 1 
ATOM   3621 N N   . GLY D 1 98  ? 61.844  2.503   13.683  1.00 48.14  ? 175 GLY D N   1 
ATOM   3622 C CA  . GLY D 1 98  ? 60.836  2.620   14.715  1.00 50.11  ? 175 GLY D CA  1 
ATOM   3623 C C   . GLY D 1 98  ? 61.172  3.684   15.739  1.00 57.61  ? 175 GLY D C   1 
ATOM   3624 O O   . GLY D 1 98  ? 62.165  4.421   15.592  1.00 57.99  ? 175 GLY D O   1 
ATOM   3625 N N   . SER D 1 99  ? 60.339  3.733   16.805  1.00 54.48  ? 176 SER D N   1 
ATOM   3626 C CA  . SER D 1 99  ? 60.363  4.722   17.877  1.00 54.60  ? 176 SER D CA  1 
ATOM   3627 C C   . SER D 1 99  ? 60.999  4.274   19.197  1.00 57.86  ? 176 SER D C   1 
ATOM   3628 O O   . SER D 1 99  ? 61.453  5.135   19.966  1.00 58.91  ? 176 SER D O   1 
ATOM   3629 C CB  . SER D 1 99  ? 58.945  5.217   18.136  1.00 59.84  ? 176 SER D CB  1 
ATOM   3630 O OG  . SER D 1 99  ? 58.019  4.141   18.113  1.00 67.81  ? 176 SER D OG  1 
ATOM   3631 N N   . ALA D 1 100 ? 61.026  2.950   19.468  1.00 51.23  ? 177 ALA D N   1 
ATOM   3632 C CA  . ALA D 1 100 ? 61.503  2.389   20.729  1.00 48.80  ? 177 ALA D CA  1 
ATOM   3633 C C   . ALA D 1 100 ? 62.936  2.665   21.079  1.00 51.54  ? 177 ALA D C   1 
ATOM   3634 O O   . ALA D 1 100 ? 63.257  2.738   22.265  1.00 52.03  ? 177 ALA D O   1 
ATOM   3635 C CB  . ALA D 1 100 ? 61.213  0.909   20.800  1.00 48.30  ? 177 ALA D CB  1 
ATOM   3636 N N   . LEU D 1 101 ? 63.809  2.831   20.084  1.00 47.62  ? 178 LEU D N   1 
ATOM   3637 C CA  . LEU D 1 101 ? 65.224  3.069   20.381  1.00 47.09  ? 178 LEU D CA  1 
ATOM   3638 C C   . LEU D 1 101 ? 65.804  4.288   19.695  1.00 52.26  ? 178 LEU D C   1 
ATOM   3639 O O   . LEU D 1 101 ? 65.426  4.588   18.565  1.00 53.33  ? 178 LEU D O   1 
ATOM   3640 C CB  . LEU D 1 101 ? 66.073  1.821   20.115  1.00 44.98  ? 178 LEU D CB  1 
ATOM   3641 C CG  . LEU D 1 101 ? 65.680  0.547   20.876  1.00 49.11  ? 178 LEU D CG  1 
ATOM   3642 C CD1 . LEU D 1 101 ? 66.060  -0.710  20.087  1.00 46.72  ? 178 LEU D CD1 1 
ATOM   3643 C CD2 . LEU D 1 101 ? 66.285  0.538   22.241  1.00 53.11  ? 178 LEU D CD2 1 
ATOM   3644 N N   . GLU D 1 102 ? 66.720  4.983   20.395  1.00 49.06  ? 179 GLU D N   1 
ATOM   3645 C CA  . GLU D 1 102 ? 67.397  6.210   19.960  1.00 50.43  ? 179 GLU D CA  1 
ATOM   3646 C C   . GLU D 1 102 ? 68.867  6.206   20.348  1.00 52.46  ? 179 GLU D C   1 
ATOM   3647 O O   . GLU D 1 102 ? 69.253  5.526   21.301  1.00 51.62  ? 179 GLU D O   1 
ATOM   3648 C CB  . GLU D 1 102 ? 66.757  7.431   20.632  1.00 54.67  ? 179 GLU D CB  1 
ATOM   3649 C CG  . GLU D 1 102 ? 65.459  7.895   20.010  1.00 64.00  ? 179 GLU D CG  1 
ATOM   3650 C CD  . GLU D 1 102 ? 64.890  9.120   20.691  1.00 84.72  ? 179 GLU D CD  1 
ATOM   3651 O OE1 . GLU D 1 102 ? 65.688  9.927   21.228  1.00 59.59  ? 179 GLU D OE1 1 
ATOM   3652 O OE2 . GLU D 1 102 ? 63.647  9.278   20.674  1.00 88.04  ? 179 GLU D OE2 1 
ATOM   3653 N N   . GLU D 1 103 ? 69.675  7.006   19.631  1.00 47.44  ? 180 GLU D N   1 
ATOM   3654 C CA  . GLU D 1 103 ? 71.100  7.174   19.915  1.00 45.95  ? 180 GLU D CA  1 
ATOM   3655 C C   . GLU D 1 103 ? 71.152  8.400   20.791  1.00 49.78  ? 180 GLU D C   1 
ATOM   3656 O O   . GLU D 1 103 ? 70.580  9.428   20.421  1.00 51.62  ? 180 GLU D O   1 
ATOM   3657 C CB  . GLU D 1 103 ? 71.910  7.430   18.606  1.00 46.46  ? 180 GLU D CB  1 
ATOM   3658 C CG  . GLU D 1 103 ? 73.430  7.322   18.741  1.00 55.96  ? 180 GLU D CG  1 
ATOM   3659 C CD  . GLU D 1 103 ? 74.246  8.501   19.246  1.00 90.65  ? 180 GLU D CD  1 
ATOM   3660 O OE1 . GLU D 1 103 ? 73.714  9.635   19.242  1.00 124.81 ? 180 GLU D OE1 1 
ATOM   3661 O OE2 . GLU D 1 103 ? 75.427  8.299   19.621  1.00 66.79  ? 180 GLU D OE2 1 
ATOM   3662 N N   . LYS D 1 104 ? 71.817  8.311   21.939  1.00 44.44  ? 181 LYS D N   1 
ATOM   3663 C CA  . LYS D 1 104 ? 71.982  9.471   22.800  1.00 46.70  ? 181 LYS D CA  1 
ATOM   3664 C C   . LYS D 1 104 ? 73.363  9.421   23.431  1.00 50.57  ? 181 LYS D C   1 
ATOM   3665 O O   . LYS D 1 104 ? 73.655  8.485   24.186  1.00 48.39  ? 181 LYS D O   1 
ATOM   3666 C CB  . LYS D 1 104 ? 70.849  9.626   23.852  1.00 49.88  ? 181 LYS D CB  1 
ATOM   3667 N N   . GLU D 1 105 ? 74.227  10.406  23.066  1.00 47.81  ? 182 GLU D N   1 
ATOM   3668 C CA  . GLU D 1 105 ? 75.569  10.617  23.610  1.00 47.89  ? 182 GLU D CA  1 
ATOM   3669 C C   . GLU D 1 105 ? 76.345  9.300   23.738  1.00 50.60  ? 182 GLU D C   1 
ATOM   3670 O O   . GLU D 1 105 ? 76.842  8.960   24.823  1.00 48.72  ? 182 GLU D O   1 
ATOM   3671 C CB  . GLU D 1 105 ? 75.508  11.337  24.979  1.00 51.50  ? 182 GLU D CB  1 
ATOM   3672 C CG  . GLU D 1 105 ? 74.822  12.690  25.004  1.00 59.07  ? 182 GLU D CG  1 
ATOM   3673 C CD  . GLU D 1 105 ? 74.627  13.301  26.379  1.00 85.55  ? 182 GLU D CD  1 
ATOM   3674 O OE1 . GLU D 1 105 ? 74.827  12.588  27.390  1.00 57.10  ? 182 GLU D OE1 1 
ATOM   3675 O OE2 . GLU D 1 105 ? 74.227  14.487  26.444  1.00 100.09 ? 182 GLU D OE2 1 
ATOM   3676 N N   . ASN D 1 106 ? 76.418  8.554   22.626  1.00 47.81  ? 183 ASN D N   1 
ATOM   3677 C CA  . ASN D 1 106 ? 77.151  7.287   22.542  1.00 46.68  ? 183 ASN D CA  1 
ATOM   3678 C C   . ASN D 1 106 ? 76.560  6.134   23.333  1.00 51.17  ? 183 ASN D C   1 
ATOM   3679 O O   . ASN D 1 106 ? 77.271  5.181   23.641  1.00 51.99  ? 183 ASN D O   1 
ATOM   3680 C CB  . ASN D 1 106 ? 78.629  7.478   22.875  1.00 48.14  ? 183 ASN D CB  1 
ATOM   3681 C CG  . ASN D 1 106 ? 79.529  7.102   21.746  1.00 70.11  ? 183 ASN D CG  1 
ATOM   3682 O OD1 . ASN D 1 106 ? 79.317  7.495   20.581  1.00 53.03  ? 183 ASN D OD1 1 
ATOM   3683 N ND2 . ASN D 1 106 ? 80.550  6.317   22.087  1.00 66.37  ? 183 ASN D ND2 1 
ATOM   3684 N N   . LYS D 1 107 ? 75.258  6.202   23.630  1.00 47.55  ? 184 LYS D N   1 
ATOM   3685 C CA  . LYS D 1 107 ? 74.514  5.160   24.341  1.00 46.24  ? 184 LYS D CA  1 
ATOM   3686 C C   . LYS D 1 107 ? 73.214  4.894   23.556  1.00 49.51  ? 184 LYS D C   1 
ATOM   3687 O O   . LYS D 1 107 ? 72.769  5.748   22.773  1.00 50.99  ? 184 LYS D O   1 
ATOM   3688 C CB  . LYS D 1 107 ? 74.155  5.623   25.786  1.00 49.63  ? 184 LYS D CB  1 
ATOM   3689 C CG  . LYS D 1 107 ? 75.321  5.933   26.733  1.00 45.38  ? 184 LYS D CG  1 
ATOM   3690 C CD  . LYS D 1 107 ? 74.957  7.066   27.746  1.00 41.62  ? 184 LYS D CD  1 
ATOM   3691 N N   . ILE D 1 108 ? 72.603  3.720   23.765  1.00 43.11  ? 185 ILE D N   1 
ATOM   3692 C CA  . ILE D 1 108 ? 71.293  3.420   23.184  1.00 41.65  ? 185 ILE D CA  1 
ATOM   3693 C C   . ILE D 1 108 ? 70.260  3.820   24.266  1.00 50.85  ? 185 ILE D C   1 
ATOM   3694 O O   . ILE D 1 108 ? 70.337  3.358   25.407  1.00 51.49  ? 185 ILE D O   1 
ATOM   3695 C CB  . ILE D 1 108 ? 71.133  1.948   22.728  1.00 41.42  ? 185 ILE D CB  1 
ATOM   3696 C CG1 . ILE D 1 108 ? 72.213  1.569   21.698  1.00 38.88  ? 185 ILE D CG1 1 
ATOM   3697 C CG2 . ILE D 1 108 ? 69.722  1.718   22.172  1.00 41.16  ? 185 ILE D CG2 1 
ATOM   3698 C CD1 . ILE D 1 108 ? 72.278  0.111   21.288  1.00 39.72  ? 185 ILE D CD1 1 
ATOM   3699 N N   . LEU D 1 109 ? 69.343  4.725   23.919  1.00 49.30  ? 186 LEU D N   1 
ATOM   3700 C CA  . LEU D 1 109 ? 68.315  5.198   24.831  1.00 50.63  ? 186 LEU D CA  1 
ATOM   3701 C C   . LEU D 1 109 ? 67.000  4.477   24.534  1.00 53.05  ? 186 LEU D C   1 
ATOM   3702 O O   . LEU D 1 109 ? 66.539  4.465   23.391  1.00 53.11  ? 186 LEU D O   1 
ATOM   3703 C CB  . LEU D 1 109 ? 68.167  6.729   24.723  1.00 52.46  ? 186 LEU D CB  1 
ATOM   3704 C CG  . LEU D 1 109 ? 66.952  7.364   25.385  1.00 60.10  ? 186 LEU D CG  1 
ATOM   3705 C CD1 . LEU D 1 109 ? 66.951  7.176   26.930  1.00 62.01  ? 186 LEU D CD1 1 
ATOM   3706 C CD2 . LEU D 1 109 ? 66.860  8.810   25.020  1.00 64.11  ? 186 LEU D CD2 1 
ATOM   3707 N N   . VAL D 1 110 ? 66.421  3.868   25.561  1.00 48.12  ? 187 VAL D N   1 
ATOM   3708 C CA  . VAL D 1 110 ? 65.169  3.134   25.456  1.00 48.33  ? 187 VAL D CA  1 
ATOM   3709 C C   . VAL D 1 110 ? 64.003  4.130   25.586  1.00 54.18  ? 187 VAL D C   1 
ATOM   3710 O O   . VAL D 1 110 ? 63.919  4.869   26.579  1.00 55.57  ? 187 VAL D O   1 
ATOM   3711 C CB  . VAL D 1 110 ? 65.113  1.995   26.508  1.00 52.71  ? 187 VAL D CB  1 
ATOM   3712 C CG1 . VAL D 1 110 ? 63.798  1.221   26.433  1.00 53.65  ? 187 VAL D CG1 1 
ATOM   3713 C CG2 . VAL D 1 110 ? 66.313  1.056   26.369  1.00 49.74  ? 187 VAL D CG2 1 
ATOM   3714 N N   . LYS D 1 111 ? 63.124  4.158   24.563  1.00 49.02  ? 188 LYS D N   1 
ATOM   3715 C CA  . LYS D 1 111 ? 61.956  5.048   24.513  1.00 49.66  ? 188 LYS D CA  1 
ATOM   3716 C C   . LYS D 1 111 ? 60.598  4.346   24.788  1.00 55.28  ? 188 LYS D C   1 
ATOM   3717 O O   . LYS D 1 111 ? 59.650  5.023   25.157  1.00 56.88  ? 188 LYS D O   1 
ATOM   3718 C CB  . LYS D 1 111 ? 61.933  5.887   23.226  1.00 49.62  ? 188 LYS D CB  1 
ATOM   3719 C CG  . LYS D 1 111 ? 63.118  6.848   23.052  1.00 39.51  ? 188 LYS D CG  1 
ATOM   3720 C CD  . LYS D 1 111 ? 63.089  8.069   23.999  1.00 40.55  ? 188 LYS D CD  1 
ATOM   3721 N N   . GLU D 1 112 ? 60.498  3.004   24.601  1.00 51.86  ? 189 GLU D N   1 
ATOM   3722 C CA  . GLU D 1 112 ? 59.312  2.168   24.891  1.00 52.47  ? 189 GLU D CA  1 
ATOM   3723 C C   . GLU D 1 112 ? 59.754  1.009   25.731  1.00 56.64  ? 189 GLU D C   1 
ATOM   3724 O O   . GLU D 1 112 ? 60.776  0.372   25.416  1.00 54.44  ? 189 GLU D O   1 
ATOM   3725 C CB  . GLU D 1 112 ? 58.665  1.592   23.636  1.00 52.93  ? 189 GLU D CB  1 
ATOM   3726 C CG  . GLU D 1 112 ? 57.730  2.559   22.960  1.00 68.29  ? 189 GLU D CG  1 
ATOM   3727 C CD  . GLU D 1 112 ? 57.588  2.378   21.464  1.00 86.28  ? 189 GLU D CD  1 
ATOM   3728 O OE1 . GLU D 1 112 ? 57.266  1.244   21.038  1.00 74.87  ? 189 GLU D OE1 1 
ATOM   3729 O OE2 . GLU D 1 112 ? 57.737  3.384   20.727  1.00 70.36  ? 189 GLU D OE2 1 
ATOM   3730 N N   . THR D 1 113 ? 58.984  0.721   26.794  1.00 54.55  ? 190 THR D N   1 
ATOM   3731 C CA  . THR D 1 113 ? 59.259  -0.399  27.680  1.00 53.63  ? 190 THR D CA  1 
ATOM   3732 C C   . THR D 1 113 ? 58.956  -1.685  26.924  1.00 55.59  ? 190 THR D C   1 
ATOM   3733 O O   . THR D 1 113 ? 57.950  -1.759  26.228  1.00 56.59  ? 190 THR D O   1 
ATOM   3734 C CB  . THR D 1 113 ? 58.445  -0.261  28.956  1.00 67.50  ? 190 THR D CB  1 
ATOM   3735 O OG1 . THR D 1 113 ? 58.857  0.922   29.626  1.00 72.39  ? 190 THR D OG1 1 
ATOM   3736 C CG2 . THR D 1 113 ? 58.593  -1.452  29.892  1.00 66.24  ? 190 THR D CG2 1 
ATOM   3737 N N   . GLY D 1 114 ? 59.845  -2.658  27.037  1.00 49.28  ? 191 GLY D N   1 
ATOM   3738 C CA  . GLY D 1 114 ? 59.654  -3.937  26.390  1.00 48.09  ? 191 GLY D CA  1 
ATOM   3739 C C   . GLY D 1 114 ? 60.732  -4.938  26.719  1.00 49.87  ? 191 GLY D C   1 
ATOM   3740 O O   . GLY D 1 114 ? 61.525  -4.739  27.652  1.00 47.54  ? 191 GLY D O   1 
ATOM   3741 N N   . TYR D 1 115 ? 60.716  -6.041  25.940  1.00 45.99  ? 192 TYR D N   1 
ATOM   3742 C CA  . TYR D 1 115 ? 61.694  -7.123  25.989  1.00 44.22  ? 192 TYR D CA  1 
ATOM   3743 C C   . TYR D 1 115 ? 62.569  -6.873  24.799  1.00 44.67  ? 192 TYR D C   1 
ATOM   3744 O O   . TYR D 1 115 ? 62.041  -6.627  23.702  1.00 44.31  ? 192 TYR D O   1 
ATOM   3745 C CB  . TYR D 1 115 ? 61.022  -8.507  25.919  1.00 45.78  ? 192 TYR D CB  1 
ATOM   3746 C CG  . TYR D 1 115 ? 60.272  -8.895  27.185  1.00 49.72  ? 192 TYR D CG  1 
ATOM   3747 C CD1 . TYR D 1 115 ? 59.038  -8.329  27.493  1.00 53.13  ? 192 TYR D CD1 1 
ATOM   3748 C CD2 . TYR D 1 115 ? 60.774  -9.862  28.047  1.00 50.71  ? 192 TYR D CD2 1 
ATOM   3749 C CE1 . TYR D 1 115 ? 58.329  -8.718  28.630  1.00 56.42  ? 192 TYR D CE1 1 
ATOM   3750 C CE2 . TYR D 1 115 ? 60.061  -10.278 29.169  1.00 53.61  ? 192 TYR D CE2 1 
ATOM   3751 C CZ  . TYR D 1 115 ? 58.845  -9.691  29.469  1.00 62.58  ? 192 TYR D CZ  1 
ATOM   3752 O OH  . TYR D 1 115 ? 58.147  -10.088 30.594  1.00 66.89  ? 192 TYR D OH  1 
ATOM   3753 N N   . PHE D 1 116 ? 63.893  -6.836  25.015  1.00 38.31  ? 193 PHE D N   1 
ATOM   3754 C CA  . PHE D 1 116 ? 64.801  -6.511  23.921  1.00 36.52  ? 193 PHE D CA  1 
ATOM   3755 C C   . PHE D 1 116 ? 65.886  -7.514  23.740  1.00 41.68  ? 193 PHE D C   1 
ATOM   3756 O O   . PHE D 1 116 ? 66.514  -7.911  24.741  1.00 41.14  ? 193 PHE D O   1 
ATOM   3757 C CB  . PHE D 1 116 ? 65.467  -5.138  24.135  1.00 37.60  ? 193 PHE D CB  1 
ATOM   3758 C CG  . PHE D 1 116 ? 64.569  -3.920  24.130  1.00 40.15  ? 193 PHE D CG  1 
ATOM   3759 C CD1 . PHE D 1 116 ? 63.870  -3.543  25.276  1.00 44.81  ? 193 PHE D CD1 1 
ATOM   3760 C CD2 . PHE D 1 116 ? 64.462  -3.121  22.997  1.00 40.62  ? 193 PHE D CD2 1 
ATOM   3761 C CE1 . PHE D 1 116 ? 63.056  -2.403  25.277  1.00 46.96  ? 193 PHE D CE1 1 
ATOM   3762 C CE2 . PHE D 1 116 ? 63.659  -1.975  23.004  1.00 44.93  ? 193 PHE D CE2 1 
ATOM   3763 C CZ  . PHE D 1 116 ? 62.963  -1.622  24.146  1.00 45.14  ? 193 PHE D CZ  1 
ATOM   3764 N N   . PHE D 1 117 ? 66.175  -7.859  22.439  1.00 37.16  ? 194 PHE D N   1 
ATOM   3765 C CA  . PHE D 1 117 ? 67.313  -8.703  22.080  1.00 34.41  ? 194 PHE D CA  1 
ATOM   3766 C C   . PHE D 1 117 ? 68.471  -7.716  21.885  1.00 36.05  ? 194 PHE D C   1 
ATOM   3767 O O   . PHE D 1 117 ? 68.395  -6.849  21.017  1.00 34.03  ? 194 PHE D O   1 
ATOM   3768 C CB  . PHE D 1 117 ? 67.058  -9.521  20.810  1.00 35.32  ? 194 PHE D CB  1 
ATOM   3769 C CG  . PHE D 1 117 ? 68.278  -10.303 20.375  1.00 35.04  ? 194 PHE D CG  1 
ATOM   3770 C CD1 . PHE D 1 117 ? 68.676  -11.441 21.063  1.00 38.66  ? 194 PHE D CD1 1 
ATOM   3771 C CD2 . PHE D 1 117 ? 69.034  -9.898  19.277  1.00 34.25  ? 194 PHE D CD2 1 
ATOM   3772 C CE1 . PHE D 1 117 ? 69.816  -12.152 20.667  1.00 38.00  ? 194 PHE D CE1 1 
ATOM   3773 C CE2 . PHE D 1 117 ? 70.157  -10.621 18.875  1.00 35.20  ? 194 PHE D CE2 1 
ATOM   3774 C CZ  . PHE D 1 117 ? 70.545  -11.736 19.576  1.00 33.83  ? 194 PHE D CZ  1 
ATOM   3775 N N   . ILE D 1 118 ? 69.489  -7.795  22.752  1.00 33.95  ? 195 ILE D N   1 
ATOM   3776 C CA  . ILE D 1 118 ? 70.628  -6.868  22.746  1.00 33.84  ? 195 ILE D CA  1 
ATOM   3777 C C   . ILE D 1 118 ? 71.867  -7.623  22.359  1.00 37.37  ? 195 ILE D C   1 
ATOM   3778 O O   . ILE D 1 118 ? 72.096  -8.706  22.897  1.00 40.93  ? 195 ILE D O   1 
ATOM   3779 C CB  . ILE D 1 118 ? 70.782  -6.170  24.133  1.00 38.69  ? 195 ILE D CB  1 
ATOM   3780 C CG1 . ILE D 1 118 ? 69.481  -5.443  24.542  1.00 40.15  ? 195 ILE D CG1 1 
ATOM   3781 C CG2 . ILE D 1 118 ? 71.953  -5.177  24.105  1.00 41.58  ? 195 ILE D CG2 1 
ATOM   3782 C CD1 . ILE D 1 118 ? 69.084  -5.689  25.828  1.00 49.66  ? 195 ILE D CD1 1 
ATOM   3783 N N   . TYR D 1 119 ? 72.662  -7.068  21.439  1.00 30.09  ? 196 TYR D N   1 
ATOM   3784 C CA  . TYR D 1 119 ? 73.880  -7.695  20.906  1.00 28.97  ? 196 TYR D CA  1 
ATOM   3785 C C   . TYR D 1 119 ? 75.053  -6.700  20.795  1.00 37.87  ? 196 TYR D C   1 
ATOM   3786 O O   . TYR D 1 119 ? 74.848  -5.485  20.699  1.00 39.45  ? 196 TYR D O   1 
ATOM   3787 C CB  . TYR D 1 119 ? 73.604  -8.331  19.532  1.00 27.89  ? 196 TYR D CB  1 
ATOM   3788 C CG  . TYR D 1 119 ? 73.105  -7.371  18.473  1.00 28.20  ? 196 TYR D CG  1 
ATOM   3789 C CD1 . TYR D 1 119 ? 71.750  -7.071  18.359  1.00 31.03  ? 196 TYR D CD1 1 
ATOM   3790 C CD2 . TYR D 1 119 ? 73.985  -6.786  17.558  1.00 28.75  ? 196 TYR D CD2 1 
ATOM   3791 C CE1 . TYR D 1 119 ? 71.282  -6.185  17.385  1.00 34.87  ? 196 TYR D CE1 1 
ATOM   3792 C CE2 . TYR D 1 119 ? 73.528  -5.914  16.562  1.00 30.22  ? 196 TYR D CE2 1 
ATOM   3793 C CZ  . TYR D 1 119 ? 72.173  -5.617  16.479  1.00 38.57  ? 196 TYR D CZ  1 
ATOM   3794 O OH  . TYR D 1 119 ? 71.707  -4.729  15.544  1.00 33.01  ? 196 TYR D OH  1 
ATOM   3795 N N   . GLY D 1 120 ? 76.263  -7.234  20.787  1.00 34.02  ? 197 GLY D N   1 
ATOM   3796 C CA  . GLY D 1 120 ? 77.463  -6.432  20.683  1.00 33.62  ? 197 GLY D CA  1 
ATOM   3797 C C   . GLY D 1 120 ? 78.679  -7.268  20.348  1.00 40.59  ? 197 GLY D C   1 
ATOM   3798 O O   . GLY D 1 120 ? 78.838  -8.389  20.855  1.00 43.26  ? 197 GLY D O   1 
ATOM   3799 N N   . GLN D 1 121 ? 79.555  -6.709  19.508  1.00 35.03  ? 198 GLN D N   1 
ATOM   3800 C CA  . GLN D 1 121 ? 80.821  -7.303  19.135  1.00 34.91  ? 198 GLN D CA  1 
ATOM   3801 C C   . GLN D 1 121 ? 81.913  -6.239  19.117  1.00 41.78  ? 198 GLN D C   1 
ATOM   3802 O O   . GLN D 1 121 ? 81.665  -5.088  18.740  1.00 44.00  ? 198 GLN D O   1 
ATOM   3803 C CB  . GLN D 1 121 ? 80.743  -8.010  17.778  1.00 35.18  ? 198 GLN D CB  1 
ATOM   3804 C CG  . GLN D 1 121 ? 82.064  -8.669  17.378  1.00 40.71  ? 198 GLN D CG  1 
ATOM   3805 C CD  . GLN D 1 121 ? 81.949  -9.460  16.118  1.00 46.79  ? 198 GLN D CD  1 
ATOM   3806 O OE1 . GLN D 1 121 ? 81.345  -10.548 16.085  1.00 40.34  ? 198 GLN D OE1 1 
ATOM   3807 N NE2 . GLN D 1 121 ? 82.550  -8.935  15.056  1.00 34.33  ? 198 GLN D NE2 1 
ATOM   3808 N N   . VAL D 1 122 ? 83.116  -6.631  19.547  1.00 36.55  ? 199 VAL D N   1 
ATOM   3809 C CA  . VAL D 1 122 ? 84.307  -5.788  19.543  1.00 35.34  ? 199 VAL D CA  1 
ATOM   3810 C C   . VAL D 1 122 ? 85.448  -6.689  19.059  1.00 37.79  ? 199 VAL D C   1 
ATOM   3811 O O   . VAL D 1 122 ? 85.486  -7.858  19.450  1.00 36.24  ? 199 VAL D O   1 
ATOM   3812 C CB  . VAL D 1 122 ? 84.632  -5.207  20.954  1.00 38.11  ? 199 VAL D CB  1 
ATOM   3813 C CG1 . VAL D 1 122 ? 85.883  -4.341  20.923  1.00 38.15  ? 199 VAL D CG1 1 
ATOM   3814 C CG2 . VAL D 1 122 ? 83.465  -4.425  21.522  1.00 37.64  ? 199 VAL D CG2 1 
ATOM   3815 N N   . LEU D 1 123 ? 86.352  -6.155  18.200  1.00 33.87  ? 200 LEU D N   1 
ATOM   3816 C CA  . LEU D 1 123 ? 87.540  -6.871  17.772  1.00 34.43  ? 200 LEU D CA  1 
ATOM   3817 C C   . LEU D 1 123 ? 88.677  -6.318  18.597  1.00 38.79  ? 200 LEU D C   1 
ATOM   3818 O O   . LEU D 1 123 ? 88.933  -5.109  18.565  1.00 38.57  ? 200 LEU D O   1 
ATOM   3819 C CB  . LEU D 1 123 ? 87.830  -6.718  16.264  1.00 34.76  ? 200 LEU D CB  1 
ATOM   3820 C CG  . LEU D 1 123 ? 89.227  -7.138  15.743  1.00 39.79  ? 200 LEU D CG  1 
ATOM   3821 C CD1 . LEU D 1 123 ? 89.524  -8.610  16.024  1.00 40.00  ? 200 LEU D CD1 1 
ATOM   3822 C CD2 . LEU D 1 123 ? 89.321  -6.931  14.282  1.00 38.49  ? 200 LEU D CD2 1 
ATOM   3823 N N   . TYR D 1 124 ? 89.340  -7.212  19.346  1.00 34.58  ? 201 TYR D N   1 
ATOM   3824 C CA  . TYR D 1 124 ? 90.439  -6.863  20.224  1.00 35.87  ? 201 TYR D CA  1 
ATOM   3825 C C   . TYR D 1 124 ? 91.755  -7.135  19.552  1.00 43.76  ? 201 TYR D C   1 
ATOM   3826 O O   . TYR D 1 124 ? 91.966  -8.193  18.946  1.00 45.33  ? 201 TYR D O   1 
ATOM   3827 C CB  . TYR D 1 124 ? 90.324  -7.624  21.548  1.00 37.67  ? 201 TYR D CB  1 
ATOM   3828 C CG  . TYR D 1 124 ? 89.060  -7.288  22.298  1.00 38.79  ? 201 TYR D CG  1 
ATOM   3829 C CD1 . TYR D 1 124 ? 88.955  -6.108  23.032  1.00 40.60  ? 201 TYR D CD1 1 
ATOM   3830 C CD2 . TYR D 1 124 ? 87.936  -8.102  22.204  1.00 39.59  ? 201 TYR D CD2 1 
ATOM   3831 C CE1 . TYR D 1 124 ? 87.771  -5.758  23.678  1.00 39.84  ? 201 TYR D CE1 1 
ATOM   3832 C CE2 . TYR D 1 124 ? 86.739  -7.760  22.841  1.00 41.02  ? 201 TYR D CE2 1 
ATOM   3833 C CZ  . TYR D 1 124 ? 86.664  -6.589  23.587  1.00 47.30  ? 201 TYR D CZ  1 
ATOM   3834 O OH  . TYR D 1 124 ? 85.488  -6.243  24.211  1.00 42.04  ? 201 TYR D OH  1 
ATOM   3835 N N   . THR D 1 125 ? 92.628  -6.151  19.607  1.00 42.17  ? 202 THR D N   1 
ATOM   3836 C CA  . THR D 1 125 ? 93.976  -6.237  19.038  1.00 42.99  ? 202 THR D CA  1 
ATOM   3837 C C   . THR D 1 125 ? 94.991  -5.901  20.144  1.00 45.68  ? 202 THR D C   1 
ATOM   3838 O O   . THR D 1 125 ? 96.039  -5.305  19.884  1.00 47.15  ? 202 THR D O   1 
ATOM   3839 C CB  . THR D 1 125 ? 94.087  -5.385  17.757  1.00 50.30  ? 202 THR D CB  1 
ATOM   3840 O OG1 . THR D 1 125 ? 93.746  -4.027  18.049  1.00 55.70  ? 202 THR D OG1 1 
ATOM   3841 C CG2 . THR D 1 125 ? 93.232  -5.929  16.622  1.00 42.73  ? 202 THR D CG2 1 
ATOM   3842 N N   . ASP D 1 126 ? 94.646  -6.301  21.379  1.00 39.25  ? 203 ASP D N   1 
ATOM   3843 C CA  . ASP D 1 126 ? 95.373  -6.039  22.598  1.00 40.88  ? 203 ASP D CA  1 
ATOM   3844 C C   . ASP D 1 126 ? 96.094  -7.289  23.101  1.00 46.72  ? 203 ASP D C   1 
ATOM   3845 O O   . ASP D 1 126 ? 95.493  -8.363  23.160  1.00 45.76  ? 203 ASP D O   1 
ATOM   3846 C CB  . ASP D 1 126 ? 94.385  -5.494  23.653  1.00 42.27  ? 203 ASP D CB  1 
ATOM   3847 C CG  . ASP D 1 126 ? 95.009  -4.668  24.768  1.00 50.18  ? 203 ASP D CG  1 
ATOM   3848 O OD1 . ASP D 1 126 ? 95.929  -5.182  25.447  1.00 50.28  ? 203 ASP D OD1 1 
ATOM   3849 O OD2 . ASP D 1 126 ? 94.522  -3.536  25.013  1.00 56.06  ? 203 ASP D OD2 1 
ATOM   3850 N N   . LYS D 1 127 ? 97.375  -7.140  23.504  1.00 45.57  ? 204 LYS D N   1 
ATOM   3851 C CA  . LYS D 1 127 ? 98.193  -8.238  24.022  1.00 46.67  ? 204 LYS D CA  1 
ATOM   3852 C C   . LYS D 1 127 ? 97.812  -8.707  25.461  1.00 54.71  ? 204 LYS D C   1 
ATOM   3853 O O   . LYS D 1 127 ? 98.217  -9.812  25.849  1.00 56.70  ? 204 LYS D O   1 
ATOM   3854 C CB  . LYS D 1 127 ? 99.697  -7.969  23.843  1.00 49.78  ? 204 LYS D CB  1 
ATOM   3855 N N   . THR D 1 128 ? 96.989  -7.911  26.221  1.00 50.79  ? 205 THR D N   1 
ATOM   3856 C CA  . THR D 1 128 ? 96.504  -8.256  27.580  1.00 51.61  ? 205 THR D CA  1 
ATOM   3857 C C   . THR D 1 128 ? 95.931  -9.697  27.588  1.00 56.28  ? 205 THR D C   1 
ATOM   3858 O O   . THR D 1 128 ? 95.103  -10.022 26.722  1.00 53.17  ? 205 THR D O   1 
ATOM   3859 C CB  . THR D 1 128 ? 95.421  -7.249  28.046  1.00 50.34  ? 205 THR D CB  1 
ATOM   3860 O OG1 . THR D 1 128 ? 95.935  -5.939  27.969  1.00 51.36  ? 205 THR D OG1 1 
ATOM   3861 C CG2 . THR D 1 128 ? 94.928  -7.514  29.470  1.00 45.75  ? 205 THR D CG2 1 
ATOM   3862 N N   . TYR D 1 129 ? 96.367  -10.538 28.569  1.00 54.45  ? 206 TYR D N   1 
ATOM   3863 C CA  . TYR D 1 129 ? 95.991  -11.957 28.712  1.00 53.41  ? 206 TYR D CA  1 
ATOM   3864 C C   . TYR D 1 129 ? 94.525  -12.280 28.386  1.00 52.83  ? 206 TYR D C   1 
ATOM   3865 O O   . TYR D 1 129 ? 94.241  -13.340 27.836  1.00 51.00  ? 206 TYR D O   1 
ATOM   3866 C CB  . TYR D 1 129 ? 96.412  -12.502 30.091  1.00 57.67  ? 206 TYR D CB  1 
ATOM   3867 C CG  . TYR D 1 129 ? 95.406  -12.228 31.188  1.00 60.63  ? 206 TYR D CG  1 
ATOM   3868 C CD1 . TYR D 1 129 ? 95.304  -10.966 31.769  1.00 62.72  ? 206 TYR D CD1 1 
ATOM   3869 C CD2 . TYR D 1 129 ? 94.490  -13.206 31.583  1.00 61.43  ? 206 TYR D CD2 1 
ATOM   3870 C CE1 . TYR D 1 129 ? 94.346  -10.695 32.745  1.00 63.64  ? 206 TYR D CE1 1 
ATOM   3871 C CE2 . TYR D 1 129 ? 93.516  -12.941 32.545  1.00 62.48  ? 206 TYR D CE2 1 
ATOM   3872 C CZ  . TYR D 1 129 ? 93.451  -11.687 33.128  1.00 71.19  ? 206 TYR D CZ  1 
ATOM   3873 O OH  . TYR D 1 129 ? 92.504  -11.445 34.095  1.00 73.95  ? 206 TYR D OH  1 
ATOM   3874 N N   . ALA D 1 130 ? 93.612  -11.367 28.752  1.00 49.09  ? 207 ALA D N   1 
ATOM   3875 C CA  . ALA D 1 130 ? 92.179  -11.466 28.488  1.00 47.29  ? 207 ALA D CA  1 
ATOM   3876 C C   . ALA D 1 130 ? 91.600  -10.084 28.225  1.00 48.42  ? 207 ALA D C   1 
ATOM   3877 O O   . ALA D 1 130 ? 91.986  -9.104  28.871  1.00 46.74  ? 207 ALA D O   1 
ATOM   3878 C CB  . ALA D 1 130 ? 91.456  -12.127 29.638  1.00 49.00  ? 207 ALA D CB  1 
ATOM   3879 N N   . MET D 1 131 ? 90.721  -10.017 27.210  1.00 42.30  ? 208 MET D N   1 
ATOM   3880 C CA  . MET D 1 131 ? 90.019  -8.820  26.751  1.00 39.65  ? 208 MET D CA  1 
ATOM   3881 C C   . MET D 1 131 ? 88.537  -9.177  26.641  1.00 43.21  ? 208 MET D C   1 
ATOM   3882 O O   . MET D 1 131 ? 88.187  -10.358 26.522  1.00 44.01  ? 208 MET D O   1 
ATOM   3883 C CB  . MET D 1 131 ? 90.560  -8.353  25.392  1.00 40.35  ? 208 MET D CB  1 
ATOM   3884 C CG  . MET D 1 131 ? 91.939  -7.735  25.452  1.00 45.73  ? 208 MET D CG  1 
ATOM   3885 S SD  . MET D 1 131 ? 92.097  -6.313  26.564  1.00 52.41  ? 208 MET D SD  1 
ATOM   3886 C CE  . MET D 1 131 ? 91.203  -5.028  25.634  1.00 47.20  ? 208 MET D CE  1 
ATOM   3887 N N   . GLY D 1 132 ? 87.680  -8.174  26.742  1.00 37.57  ? 209 GLY D N   1 
ATOM   3888 C CA  . GLY D 1 132 ? 86.244  -8.375  26.685  1.00 35.68  ? 209 GLY D CA  1 
ATOM   3889 C C   . GLY D 1 132 ? 85.473  -7.133  27.044  1.00 40.46  ? 209 GLY D C   1 
ATOM   3890 O O   . GLY D 1 132 ? 86.061  -6.118  27.414  1.00 40.80  ? 209 GLY D O   1 
ATOM   3891 N N   . HIS D 1 133 ? 84.146  -7.192  26.908  1.00 37.12  ? 210 HIS D N   1 
ATOM   3892 C CA  . HIS D 1 133 ? 83.289  -6.036  27.179  1.00 36.93  ? 210 HIS D CA  1 
ATOM   3893 C C   . HIS D 1 133 ? 82.051  -6.368  27.987  1.00 43.87  ? 210 HIS D C   1 
ATOM   3894 O O   . HIS D 1 133 ? 81.716  -7.542  28.156  1.00 44.10  ? 210 HIS D O   1 
ATOM   3895 C CB  . HIS D 1 133 ? 82.916  -5.307  25.885  1.00 35.24  ? 210 HIS D CB  1 
ATOM   3896 C CG  . HIS D 1 133 ? 82.265  -6.174  24.857  1.00 36.48  ? 210 HIS D CG  1 
ATOM   3897 N ND1 . HIS D 1 133 ? 83.018  -6.879  23.935  1.00 38.03  ? 210 HIS D ND1 1 
ATOM   3898 C CD2 . HIS D 1 133 ? 80.953  -6.432  24.639  1.00 36.61  ? 210 HIS D CD2 1 
ATOM   3899 C CE1 . HIS D 1 133 ? 82.147  -7.543  23.186  1.00 35.84  ? 210 HIS D CE1 1 
ATOM   3900 N NE2 . HIS D 1 133 ? 80.888  -7.314  23.583  1.00 35.43  ? 210 HIS D NE2 1 
ATOM   3901 N N   . LEU D 1 134 ? 81.373  -5.323  28.488  1.00 41.68  ? 211 LEU D N   1 
ATOM   3902 C CA  . LEU D 1 134 ? 80.146  -5.437  29.283  1.00 42.18  ? 211 LEU D CA  1 
ATOM   3903 C C   . LEU D 1 134 ? 79.040  -4.676  28.581  1.00 48.34  ? 211 LEU D C   1 
ATOM   3904 O O   . LEU D 1 134 ? 79.252  -3.524  28.190  1.00 50.72  ? 211 LEU D O   1 
ATOM   3905 C CB  . LEU D 1 134 ? 80.313  -4.846  30.711  1.00 43.89  ? 211 LEU D CB  1 
ATOM   3906 C CG  . LEU D 1 134 ? 81.626  -5.029  31.448  1.00 48.77  ? 211 LEU D CG  1 
ATOM   3907 C CD1 . LEU D 1 134 ? 81.644  -4.217  32.695  1.00 49.72  ? 211 LEU D CD1 1 
ATOM   3908 C CD2 . LEU D 1 134 ? 81.869  -6.461  31.777  1.00 53.61  ? 211 LEU D CD2 1 
ATOM   3909 N N   . ILE D 1 135 ? 77.875  -5.307  28.402  1.00 43.71  ? 212 ILE D N   1 
ATOM   3910 C CA  . ILE D 1 135 ? 76.675  -4.641  27.880  1.00 43.11  ? 212 ILE D CA  1 
ATOM   3911 C C   . ILE D 1 135 ? 75.937  -4.251  29.167  1.00 49.63  ? 212 ILE D C   1 
ATOM   3912 O O   . ILE D 1 135 ? 75.473  -5.117  29.915  1.00 50.88  ? 212 ILE D O   1 
ATOM   3913 C CB  . ILE D 1 135 ? 75.839  -5.490  26.877  1.00 44.45  ? 212 ILE D CB  1 
ATOM   3914 C CG1 . ILE D 1 135 ? 76.548  -5.575  25.495  1.00 42.40  ? 212 ILE D CG1 1 
ATOM   3915 C CG2 . ILE D 1 135 ? 74.437  -4.894  26.731  1.00 45.87  ? 212 ILE D CG2 1 
ATOM   3916 C CD1 . ILE D 1 135 ? 76.036  -6.703  24.526  1.00 48.65  ? 212 ILE D CD1 1 
ATOM   3917 N N   . GLN D 1 136 ? 75.948  -2.955  29.476  1.00 47.02  ? 213 GLN D N   1 
ATOM   3918 C CA  . GLN D 1 136 ? 75.405  -2.412  30.726  1.00 47.95  ? 213 GLN D CA  1 
ATOM   3919 C C   . GLN D 1 136 ? 74.135  -1.625  30.556  1.00 52.01  ? 213 GLN D C   1 
ATOM   3920 O O   . GLN D 1 136 ? 73.929  -0.958  29.531  1.00 49.78  ? 213 GLN D O   1 
ATOM   3921 C CB  . GLN D 1 136 ? 76.437  -1.535  31.420  1.00 49.85  ? 213 GLN D CB  1 
ATOM   3922 C CG  . GLN D 1 136 ? 77.732  -2.254  31.664  1.00 57.15  ? 213 GLN D CG  1 
ATOM   3923 C CD  . GLN D 1 136 ? 78.635  -1.404  32.483  1.00 80.38  ? 213 GLN D CD  1 
ATOM   3924 O OE1 . GLN D 1 136 ? 79.015  -0.303  32.086  1.00 74.16  ? 213 GLN D OE1 1 
ATOM   3925 N NE2 . GLN D 1 136 ? 78.974  -1.889  33.667  1.00 79.74  ? 213 GLN D NE2 1 
ATOM   3926 N N   . ARG D 1 137 ? 73.314  -1.660  31.599  1.00 49.84  ? 214 ARG D N   1 
ATOM   3927 C CA  . ARG D 1 137 ? 72.041  -0.971  31.646  1.00 50.92  ? 214 ARG D CA  1 
ATOM   3928 C C   . ARG D 1 137 ? 72.076  0.094   32.718  1.00 58.96  ? 214 ARG D C   1 
ATOM   3929 O O   . ARG D 1 137 ? 72.306  -0.230  33.891  1.00 60.66  ? 214 ARG D O   1 
ATOM   3930 C CB  . ARG D 1 137 ? 70.942  -1.989  31.961  1.00 52.00  ? 214 ARG D CB  1 
ATOM   3931 C CG  . ARG D 1 137 ? 69.555  -1.399  32.051  1.00 60.72  ? 214 ARG D CG  1 
ATOM   3932 C CD  . ARG D 1 137 ? 68.635  -2.423  32.624  1.00 64.94  ? 214 ARG D CD  1 
ATOM   3933 N NE  . ARG D 1 137 ? 67.291  -1.899  32.815  1.00 71.13  ? 214 ARG D NE  1 
ATOM   3934 C CZ  . ARG D 1 137 ? 66.377  -2.496  33.572  1.00 92.50  ? 214 ARG D CZ  1 
ATOM   3935 N NH1 . ARG D 1 137 ? 66.664  -3.630  34.202  1.00 77.55  ? 214 ARG D NH1 1 
ATOM   3936 N NH2 . ARG D 1 137 ? 65.168  -1.965  33.708  1.00 81.11  ? 214 ARG D NH2 1 
ATOM   3937 N N   . LYS D 1 138 ? 71.852  1.364   32.329  1.00 56.95  ? 215 LYS D N   1 
ATOM   3938 C CA  . LYS D 1 138 ? 71.776  2.463   33.295  1.00 59.78  ? 215 LYS D CA  1 
ATOM   3939 C C   . LYS D 1 138 ? 70.289  2.643   33.552  1.00 67.54  ? 215 LYS D C   1 
ATOM   3940 O O   . LYS D 1 138 ? 69.563  3.192   32.720  1.00 65.52  ? 215 LYS D O   1 
ATOM   3941 C CB  . LYS D 1 138 ? 72.452  3.751   32.777  1.00 61.77  ? 215 LYS D CB  1 
ATOM   3942 C CG  . LYS D 1 138 ? 72.513  4.891   33.799  1.00 76.00  ? 215 LYS D CG  1 
ATOM   3943 N N   . LYS D 1 139 ? 69.825  2.068   34.663  1.00 70.18  ? 216 LYS D N   1 
ATOM   3944 C CA  . LYS D 1 139 ? 68.420  2.083   35.086  1.00 73.81  ? 216 LYS D CA  1 
ATOM   3945 C C   . LYS D 1 139 ? 67.918  3.508   35.345  1.00 85.25  ? 216 LYS D C   1 
ATOM   3946 O O   . LYS D 1 139 ? 68.600  4.294   36.018  1.00 86.23  ? 216 LYS D O   1 
ATOM   3947 C CB  . LYS D 1 139 ? 68.213  1.219   36.340  1.00 77.04  ? 216 LYS D CB  1 
ATOM   3948 N N   . VAL D 1 140 ? 66.729  3.842   34.808  1.00 85.50  ? 217 VAL D N   1 
ATOM   3949 C CA  . VAL D 1 140 ? 66.132  5.164   35.036  1.00 89.13  ? 217 VAL D CA  1 
ATOM   3950 C C   . VAL D 1 140 ? 65.633  5.293   36.482  1.00 101.52 ? 217 VAL D C   1 
ATOM   3951 O O   . VAL D 1 140 ? 65.783  6.366   37.109  1.00 104.68 ? 217 VAL D O   1 
ATOM   3952 C CB  . VAL D 1 140 ? 65.107  5.614   33.958  1.00 92.15  ? 217 VAL D CB  1 
ATOM   3953 C CG1 . VAL D 1 140 ? 63.880  4.705   33.891  1.00 91.86  ? 217 VAL D CG1 1 
ATOM   3954 C CG2 . VAL D 1 140 ? 64.706  7.076   34.145  1.00 94.61  ? 217 VAL D CG2 1 
ATOM   3955 N N   . HIS D 1 141 ? 65.060  4.193   37.022  1.00 99.71  ? 218 HIS D N   1 
ATOM   3956 C CA  . HIS D 1 141 ? 64.677  4.191   38.416  1.00 103.41 ? 218 HIS D CA  1 
ATOM   3957 C C   . HIS D 1 141 ? 65.006  2.940   39.176  1.00 106.21 ? 218 HIS D C   1 
ATOM   3958 O O   . HIS D 1 141 ? 64.643  1.832   38.776  1.00 102.67 ? 218 HIS D O   1 
ATOM   3959 C CB  . HIS D 1 141 ? 63.316  4.802   38.733  1.00 107.77 ? 218 HIS D CB  1 
ATOM   3960 C CG  . HIS D 1 141 ? 63.351  5.635   39.984  1.00 115.54 ? 218 HIS D CG  1 
ATOM   3961 N ND1 . HIS D 1 141 ? 62.187  6.085   40.586  1.00 121.06 ? 218 HIS D ND1 1 
ATOM   3962 C CD2 . HIS D 1 141 ? 64.410  6.061   40.715  1.00 118.60 ? 218 HIS D CD2 1 
ATOM   3963 C CE1 . HIS D 1 141 ? 62.572  6.778   41.644  1.00 123.62 ? 218 HIS D CE1 1 
ATOM   3964 N NE2 . HIS D 1 141 ? 63.900  6.784   41.769  1.00 122.73 ? 218 HIS D NE2 1 
ATOM   3965 N N   . VAL D 1 142 ? 65.716  3.156   40.297  1.00 106.06 ? 219 VAL D N   1 
ATOM   3966 C CA  . VAL D 1 142 ? 66.262  2.178   41.217  1.00 106.79 ? 219 VAL D CA  1 
ATOM   3967 C C   . VAL D 1 142 ? 65.388  2.064   42.466  1.00 115.13 ? 219 VAL D C   1 
ATOM   3968 O O   . VAL D 1 142 ? 64.849  3.064   42.951  1.00 116.96 ? 219 VAL D O   1 
ATOM   3969 C CB  . VAL D 1 142 ? 67.708  2.588   41.578  1.00 110.57 ? 219 VAL D CB  1 
ATOM   3970 N N   . PHE D 1 143 ? 65.251  0.835   42.977  1.00 112.08 ? 220 PHE D N   1 
ATOM   3971 C CA  . PHE D 1 143 ? 64.467  0.552   44.168  1.00 115.21 ? 220 PHE D CA  1 
ATOM   3972 C C   . PHE D 1 143 ? 65.313  -0.201  45.180  1.00 119.64 ? 220 PHE D C   1 
ATOM   3973 O O   . PHE D 1 143 ? 66.091  -1.077  44.799  1.00 116.52 ? 220 PHE D O   1 
ATOM   3974 C CB  . PHE D 1 143 ? 63.222  -0.251  43.797  1.00 116.75 ? 220 PHE D CB  1 
ATOM   3975 N N   . GLY D 1 144 ? 65.160  0.157   46.455  1.00 119.96 ? 221 GLY D N   1 
ATOM   3976 C CA  . GLY D 1 144 ? 65.878  -0.451  47.571  1.00 121.83 ? 221 GLY D CA  1 
ATOM   3977 C C   . GLY D 1 144 ? 67.351  -0.716  47.313  1.00 122.95 ? 221 GLY D C   1 
ATOM   3978 O O   . GLY D 1 144 ? 68.070  0.168   46.834  1.00 122.00 ? 221 GLY D O   1 
ATOM   3979 N N   . ASP D 1 145 ? 67.786  -1.966  47.557  1.00 117.15 ? 222 ASP D N   1 
ATOM   3980 C CA  . ASP D 1 145 ? 69.173  -2.413  47.410  1.00 114.13 ? 222 ASP D CA  1 
ATOM   3981 C C   . ASP D 1 145 ? 69.733  -2.538  45.978  1.00 110.57 ? 222 ASP D C   1 
ATOM   3982 O O   . ASP D 1 145 ? 70.921  -2.833  45.839  1.00 107.87 ? 222 ASP D O   1 
ATOM   3983 C CB  . ASP D 1 145 ? 69.416  -3.694  48.232  1.00 117.47 ? 222 ASP D CB  1 
ATOM   3984 N N   . GLU D 1 146 ? 68.903  -2.303  44.929  1.00 103.85 ? 223 GLU D N   1 
ATOM   3985 C CA  . GLU D 1 146 ? 69.313  -2.405  43.519  1.00 98.75  ? 223 GLU D CA  1 
ATOM   3986 C C   . GLU D 1 146 ? 70.436  -1.434  43.160  1.00 96.76  ? 223 GLU D C   1 
ATOM   3987 O O   . GLU D 1 146 ? 70.538  -0.370  43.767  1.00 98.73  ? 223 GLU D O   1 
ATOM   3988 C CB  . GLU D 1 146 ? 68.143  -2.078  42.584  1.00 99.20  ? 223 GLU D CB  1 
ATOM   3989 C CG  . GLU D 1 146 ? 67.056  -3.116  42.418  1.00 112.55 ? 223 GLU D CG  1 
ATOM   3990 C CD  . GLU D 1 146 ? 65.935  -2.653  41.499  1.00 137.43 ? 223 GLU D CD  1 
ATOM   3991 O OE1 . GLU D 1 146 ? 65.678  -1.428  41.415  1.00 122.50 ? 223 GLU D OE1 1 
ATOM   3992 O OE2 . GLU D 1 146 ? 65.307  -3.526  40.861  1.00 138.43 ? 223 GLU D OE2 1 
ATOM   3993 N N   . LEU D 1 147 ? 71.219  -1.771  42.119  1.00 85.86  ? 224 LEU D N   1 
ATOM   3994 C CA  . LEU D 1 147 ? 72.270  -0.901  41.584  1.00 82.33  ? 224 LEU D CA  1 
ATOM   3995 C C   . LEU D 1 147 ? 71.690  -0.141  40.394  1.00 79.16  ? 224 LEU D C   1 
ATOM   3996 O O   . LEU D 1 147 ? 70.842  -0.690  39.697  1.00 76.84  ? 224 LEU D O   1 
ATOM   3997 C CB  . LEU D 1 147 ? 73.471  -1.717  41.086  1.00 79.80  ? 224 LEU D CB  1 
ATOM   3998 C CG  . LEU D 1 147 ? 74.252  -2.552  42.088  1.00 85.43  ? 224 LEU D CG  1 
ATOM   3999 C CD1 . LEU D 1 147 ? 75.163  -3.513  41.362  1.00 83.41  ? 224 LEU D CD1 1 
ATOM   4000 C CD2 . LEU D 1 147 ? 75.034  -1.681  43.058  1.00 87.41  ? 224 LEU D CD2 1 
ATOM   4001 N N   . SER D 1 148 ? 72.165  1.093   40.140  1.00 72.14  ? 225 SER D N   1 
ATOM   4002 C CA  . SER D 1 148 ? 71.720  1.911   39.008  1.00 68.61  ? 225 SER D CA  1 
ATOM   4003 C C   . SER D 1 148 ? 72.301  1.365   37.698  1.00 68.96  ? 225 SER D C   1 
ATOM   4004 O O   . SER D 1 148 ? 71.617  1.365   36.672  1.00 69.36  ? 225 SER D O   1 
ATOM   4005 C CB  . SER D 1 148 ? 72.155  3.365   39.164  1.00 71.65  ? 225 SER D CB  1 
ATOM   4006 O OG  . SER D 1 148 ? 72.481  3.722   40.495  1.00 82.41  ? 225 SER D OG  1 
ATOM   4007 N N   . LEU D 1 149 ? 73.565  0.904   37.733  1.00 60.94  ? 226 LEU D N   1 
ATOM   4008 C CA  . LEU D 1 149 ? 74.254  0.365   36.566  1.00 55.74  ? 226 LEU D CA  1 
ATOM   4009 C C   . LEU D 1 149 ? 74.443  -1.115  36.759  1.00 59.22  ? 226 LEU D C   1 
ATOM   4010 O O   . LEU D 1 149 ? 74.965  -1.554  37.802  1.00 61.66  ? 226 LEU D O   1 
ATOM   4011 C CB  . LEU D 1 149 ? 75.609  1.069   36.332  1.00 54.78  ? 226 LEU D CB  1 
ATOM   4012 C CG  . LEU D 1 149 ? 76.234  0.939   34.962  1.00 56.31  ? 226 LEU D CG  1 
ATOM   4013 C CD1 . LEU D 1 149 ? 75.525  1.819   33.949  1.00 55.00  ? 226 LEU D CD1 1 
ATOM   4014 C CD2 . LEU D 1 149 ? 77.695  1.250   35.021  1.00 60.45  ? 226 LEU D CD2 1 
ATOM   4015 N N   . VAL D 1 150 ? 73.979  -1.892  35.774  1.00 51.55  ? 227 VAL D N   1 
ATOM   4016 C CA  . VAL D 1 150 ? 74.050  -3.347  35.855  1.00 49.86  ? 227 VAL D CA  1 
ATOM   4017 C C   . VAL D 1 150 ? 74.623  -3.931  34.589  1.00 56.13  ? 227 VAL D C   1 
ATOM   4018 O O   . VAL D 1 150 ? 74.303  -3.465  33.482  1.00 57.18  ? 227 VAL D O   1 
ATOM   4019 C CB  . VAL D 1 150 ? 72.700  -4.015  36.247  1.00 51.93  ? 227 VAL D CB  1 
ATOM   4020 C CG1 . VAL D 1 150 ? 72.251  -3.587  37.621  1.00 54.14  ? 227 VAL D CG1 1 
ATOM   4021 C CG2 . VAL D 1 150 ? 71.608  -3.721  35.240  1.00 50.46  ? 227 VAL D CG2 1 
ATOM   4022 N N   . THR D 1 151 ? 75.467  -4.963  34.743  1.00 50.90  ? 228 THR D N   1 
ATOM   4023 C CA  . THR D 1 151 ? 76.036  -5.671  33.607  1.00 46.73  ? 228 THR D CA  1 
ATOM   4024 C C   . THR D 1 151 ? 75.030  -6.719  33.204  1.00 49.91  ? 228 THR D C   1 
ATOM   4025 O O   . THR D 1 151 ? 74.727  -7.606  33.998  1.00 51.70  ? 228 THR D O   1 
ATOM   4026 C CB  . THR D 1 151 ? 77.395  -6.248  33.946  1.00 50.26  ? 228 THR D CB  1 
ATOM   4027 O OG1 . THR D 1 151 ? 78.232  -5.174  34.373  1.00 53.11  ? 228 THR D OG1 1 
ATOM   4028 C CG2 . THR D 1 151 ? 78.023  -7.000  32.766  1.00 51.21  ? 228 THR D CG2 1 
ATOM   4029 N N   . LEU D 1 152 ? 74.467  -6.586  31.993  1.00 44.44  ? 229 LEU D N   1 
ATOM   4030 C CA  . LEU D 1 152 ? 73.514  -7.544  31.459  1.00 43.11  ? 229 LEU D CA  1 
ATOM   4031 C C   . LEU D 1 152 ? 74.263  -8.754  30.917  1.00 46.55  ? 229 LEU D C   1 
ATOM   4032 O O   . LEU D 1 152 ? 73.976  -9.880  31.336  1.00 46.09  ? 229 LEU D O   1 
ATOM   4033 C CB  . LEU D 1 152 ? 72.632  -6.907  30.379  1.00 41.75  ? 229 LEU D CB  1 
ATOM   4034 C CG  . LEU D 1 152 ? 71.632  -5.854  30.854  1.00 46.70  ? 229 LEU D CG  1 
ATOM   4035 C CD1 . LEU D 1 152 ? 71.027  -5.120  29.680  1.00 46.27  ? 229 LEU D CD1 1 
ATOM   4036 C CD2 . LEU D 1 152 ? 70.531  -6.475  31.627  1.00 47.85  ? 229 LEU D CD2 1 
ATOM   4037 N N   . PHE D 1 153 ? 75.234  -8.518  30.006  1.00 42.89  ? 230 PHE D N   1 
ATOM   4038 C CA  . PHE D 1 153 ? 76.044  -9.563  29.375  1.00 43.02  ? 230 PHE D CA  1 
ATOM   4039 C C   . PHE D 1 153 ? 77.493  -9.166  29.384  1.00 49.66  ? 230 PHE D C   1 
ATOM   4040 O O   . PHE D 1 153 ? 77.790  -7.988  29.247  1.00 50.37  ? 230 PHE D O   1 
ATOM   4041 C CB  . PHE D 1 153 ? 75.564  -9.872  27.927  1.00 43.07  ? 230 PHE D CB  1 
ATOM   4042 C CG  . PHE D 1 153 ? 74.062  -9.913  27.826  1.00 44.73  ? 230 PHE D CG  1 
ATOM   4043 C CD1 . PHE D 1 153 ? 73.340  -10.978 28.370  1.00 47.08  ? 230 PHE D CD1 1 
ATOM   4044 C CD2 . PHE D 1 153 ? 73.360  -8.839  27.291  1.00 46.74  ? 230 PHE D CD2 1 
ATOM   4045 C CE1 . PHE D 1 153 ? 71.950  -10.979 28.357  1.00 48.40  ? 230 PHE D CE1 1 
ATOM   4046 C CE2 . PHE D 1 153 ? 71.963  -8.842  27.270  1.00 49.90  ? 230 PHE D CE2 1 
ATOM   4047 C CZ  . PHE D 1 153 ? 71.268  -9.907  27.815  1.00 48.35  ? 230 PHE D CZ  1 
ATOM   4048 N N   . ARG D 1 154 ? 78.394  -10.153 29.519  1.00 47.17  ? 231 ARG D N   1 
ATOM   4049 C CA  . ARG D 1 154 ? 79.845  -9.972  29.529  1.00 46.57  ? 231 ARG D CA  1 
ATOM   4050 C C   . ARG D 1 154 ? 80.555  -11.081 28.666  1.00 49.07  ? 231 ARG D C   1 
ATOM   4051 O O   . ARG D 1 154 ? 80.132  -12.227 28.718  1.00 47.39  ? 231 ARG D O   1 
ATOM   4052 C CB  . ARG D 1 154 ? 80.308  -9.925  30.998  1.00 47.23  ? 231 ARG D CB  1 
ATOM   4053 C CG  . ARG D 1 154 ? 81.787  -10.203 31.278  1.00 49.69  ? 231 ARG D CG  1 
ATOM   4054 C CD  . ARG D 1 154 ? 82.156  -9.909  32.725  1.00 40.00  ? 231 ARG D CD  1 
ATOM   4055 N NE  . ARG D 1 154 ? 81.391  -10.712 33.684  1.00 47.52  ? 231 ARG D NE  1 
ATOM   4056 C CZ  . ARG D 1 154 ? 81.914  -11.654 34.462  1.00 59.75  ? 231 ARG D CZ  1 
ATOM   4057 N NH1 . ARG D 1 154 ? 83.216  -11.917 34.415  1.00 49.00  ? 231 ARG D NH1 1 
ATOM   4058 N NH2 . ARG D 1 154 ? 81.141  -12.336 35.303  1.00 32.77  ? 231 ARG D NH2 1 
ATOM   4059 N N   . CYS D 1 155 ? 81.549  -10.683 27.801  1.00 45.95  ? 232 CYS D N   1 
ATOM   4060 C CA  . CYS D 1 155 ? 82.426  -11.485 26.911  1.00 44.27  ? 232 CYS D CA  1 
ATOM   4061 C C   . CYS D 1 155 ? 83.740  -11.545 27.578  1.00 48.75  ? 232 CYS D C   1 
ATOM   4062 O O   . CYS D 1 155 ? 84.154  -10.542 28.155  1.00 52.26  ? 232 CYS D O   1 
ATOM   4063 C CB  . CYS D 1 155 ? 82.652  -10.796 25.567  1.00 43.02  ? 232 CYS D CB  1 
ATOM   4064 S SG  A CYS D 1 155 ? 82.099  -11.742 24.127  0.30 45.74  ? 232 CYS D SG  1 
ATOM   4065 S SG  B CYS D 1 155 ? 81.201  -10.085 24.835  0.58 46.10  ? 232 CYS D SG  1 
ATOM   4066 N N   . ILE D 1 156 ? 84.527  -12.566 27.256  1.00 41.73  ? 233 ILE D N   1 
ATOM   4067 C CA  . ILE D 1 156 ? 85.941  -12.650 27.619  1.00 41.05  ? 233 ILE D CA  1 
ATOM   4068 C C   . ILE D 1 156 ? 86.618  -13.500 26.518  1.00 43.96  ? 233 ILE D C   1 
ATOM   4069 O O   . ILE D 1 156 ? 86.088  -14.547 26.088  1.00 42.99  ? 233 ILE D O   1 
ATOM   4070 C CB  . ILE D 1 156 ? 86.288  -13.123 29.090  1.00 44.81  ? 233 ILE D CB  1 
ATOM   4071 C CG1 . ILE D 1 156 ? 85.438  -12.387 30.172  1.00 45.06  ? 233 ILE D CG1 1 
ATOM   4072 C CG2 . ILE D 1 156 ? 87.803  -12.968 29.366  1.00 44.44  ? 233 ILE D CG2 1 
ATOM   4073 C CD1 . ILE D 1 156 ? 85.506  -12.870 31.609  1.00 47.59  ? 233 ILE D CD1 1 
ATOM   4074 N N   . GLN D 1 157 ? 87.756  -13.005 26.034  1.00 38.27  ? 234 GLN D N   1 
ATOM   4075 C CA  . GLN D 1 157 ? 88.605  -13.681 25.069  1.00 37.24  ? 234 GLN D CA  1 
ATOM   4076 C C   . GLN D 1 157 ? 90.009  -13.593 25.586  1.00 47.05  ? 234 GLN D C   1 
ATOM   4077 O O   . GLN D 1 157 ? 90.483  -12.482 25.912  1.00 49.27  ? 234 GLN D O   1 
ATOM   4078 C CB  . GLN D 1 157 ? 88.562  -13.019 23.677  1.00 35.85  ? 234 GLN D CB  1 
ATOM   4079 C CG  . GLN D 1 157 ? 87.406  -13.440 22.770  1.00 37.82  ? 234 GLN D CG  1 
ATOM   4080 C CD  . GLN D 1 157 ? 87.272  -14.932 22.512  1.00 49.80  ? 234 GLN D CD  1 
ATOM   4081 O OE1 . GLN D 1 157 ? 86.533  -15.643 23.215  1.00 42.84  ? 234 GLN D OE1 1 
ATOM   4082 N NE2 . GLN D 1 157 ? 87.931  -15.436 21.474  1.00 33.14  ? 234 GLN D NE2 1 
ATOM   4083 N N   . ASN D 1 158 ? 90.699  -14.749 25.661  1.00 43.54  ? 235 ASN D N   1 
ATOM   4084 C CA  . ASN D 1 158 ? 92.101  -14.733 26.021  1.00 44.76  ? 235 ASN D CA  1 
ATOM   4085 C C   . ASN D 1 158 ? 92.818  -14.237 24.745  1.00 48.00  ? 235 ASN D C   1 
ATOM   4086 O O   . ASN D 1 158 ? 92.298  -14.423 23.622  1.00 46.50  ? 235 ASN D O   1 
ATOM   4087 C CB  . ASN D 1 158 ? 92.585  -16.115 26.411  1.00 47.47  ? 235 ASN D CB  1 
ATOM   4088 C CG  . ASN D 1 158 ? 92.208  -16.541 27.816  1.00 69.63  ? 235 ASN D CG  1 
ATOM   4089 O OD1 . ASN D 1 158 ? 91.583  -17.587 28.031  1.00 52.09  ? 235 ASN D OD1 1 
ATOM   4090 N ND2 . ASN D 1 158 ? 92.629  -15.773 28.815  1.00 66.05  ? 235 ASN D ND2 1 
ATOM   4091 N N   . MET D 1 159 ? 93.959  -13.558 24.910  1.00 42.68  ? 236 MET D N   1 
ATOM   4092 C CA  . MET D 1 159 ? 94.695  -13.041 23.766  1.00 40.63  ? 236 MET D CA  1 
ATOM   4093 C C   . MET D 1 159 ? 96.119  -13.605 23.720  1.00 45.68  ? 236 MET D C   1 
ATOM   4094 O O   . MET D 1 159 ? 96.715  -13.800 24.779  1.00 47.35  ? 236 MET D O   1 
ATOM   4095 C CB  . MET D 1 159 ? 94.765  -11.501 23.815  1.00 42.43  ? 236 MET D CB  1 
ATOM   4096 C CG  . MET D 1 159 ? 93.421  -10.808 24.077  1.00 42.59  ? 236 MET D CG  1 
ATOM   4097 S SD  . MET D 1 159 ? 92.219  -10.941 22.738  1.00 40.70  ? 236 MET D SD  1 
ATOM   4098 C CE  . MET D 1 159 ? 93.058  -10.145 21.450  1.00 36.02  ? 236 MET D CE  1 
ATOM   4099 N N   . PRO D 1 160 ? 96.707  -13.816 22.513  1.00 40.67  ? 237 PRO D N   1 
ATOM   4100 C CA  . PRO D 1 160 ? 98.099  -14.262 22.452  1.00 42.02  ? 237 PRO D CA  1 
ATOM   4101 C C   . PRO D 1 160 ? 99.093  -13.072 22.507  1.00 51.02  ? 237 PRO D C   1 
ATOM   4102 O O   . PRO D 1 160 ? 98.728  -11.932 22.196  1.00 51.00  ? 237 PRO D O   1 
ATOM   4103 C CB  . PRO D 1 160 ? 98.149  -14.971 21.113  1.00 42.04  ? 237 PRO D CB  1 
ATOM   4104 C CG  . PRO D 1 160 ? 97.159  -14.255 20.261  1.00 44.27  ? 237 PRO D CG  1 
ATOM   4105 C CD  . PRO D 1 160 ? 96.156  -13.608 21.153  1.00 39.81  ? 237 PRO D CD  1 
ATOM   4106 N N   . GLU D 1 161 ? 100.354 -13.331 22.871  1.00 50.28  ? 238 GLU D N   1 
ATOM   4107 C CA  . GLU D 1 161 ? 101.355 -12.275 22.911  1.00 52.50  ? 238 GLU D CA  1 
ATOM   4108 C C   . GLU D 1 161 ? 101.616 -11.741 21.497  1.00 59.40  ? 238 GLU D C   1 
ATOM   4109 O O   . GLU D 1 161 ? 101.880 -10.548 21.323  1.00 60.46  ? 238 GLU D O   1 
ATOM   4110 C CB  . GLU D 1 161 ? 102.667 -12.770 23.568  1.00 56.95  ? 238 GLU D CB  1 
ATOM   4111 N N   . THR D 1 162 ? 101.513 -12.633 20.488  1.00 56.09  ? 239 THR D N   1 
ATOM   4112 C CA  . THR D 1 162 ? 101.787 -12.345 19.080  1.00 55.28  ? 239 THR D CA  1 
ATOM   4113 C C   . THR D 1 162 ? 100.528 -12.249 18.228  1.00 57.45  ? 239 THR D C   1 
ATOM   4114 O O   . THR D 1 162 ? 99.661  -13.130 18.259  1.00 57.16  ? 239 THR D O   1 
ATOM   4115 C CB  . THR D 1 162 ? 102.821 -13.331 18.503  1.00 62.69  ? 239 THR D CB  1 
ATOM   4116 O OG1 . THR D 1 162 ? 102.532 -14.653 18.968  1.00 66.34  ? 239 THR D OG1 1 
ATOM   4117 C CG2 . THR D 1 162 ? 104.227 -12.977 18.880  1.00 64.98  ? 239 THR D CG2 1 
ATOM   4118 N N   . LEU D 1 163 ? 100.454 -11.171 17.441  1.00 51.96  ? 240 LEU D N   1 
ATOM   4119 C CA  . LEU D 1 163 ? 99.389  -10.825 16.514  1.00 48.58  ? 240 LEU D CA  1 
ATOM   4120 C C   . LEU D 1 163 ? 97.991  -10.989 17.103  1.00 53.23  ? 240 LEU D C   1 
ATOM   4121 O O   . LEU D 1 163 ? 97.189  -11.735 16.530  1.00 54.65  ? 240 LEU D O   1 
ATOM   4122 C CB  . LEU D 1 163 ? 99.565  -11.592 15.196  1.00 48.04  ? 240 LEU D CB  1 
ATOM   4123 C CG  . LEU D 1 163 ? 100.825 -11.267 14.387  1.00 53.70  ? 240 LEU D CG  1 
ATOM   4124 C CD1 . LEU D 1 163 ? 101.132 -12.369 13.409  1.00 54.33  ? 240 LEU D CD1 1 
ATOM   4125 C CD2 . LEU D 1 163 ? 100.706 -9.912  13.676  1.00 52.95  ? 240 LEU D CD2 1 
ATOM   4126 N N   . PRO D 1 164 ? 97.660  -10.344 18.255  1.00 48.51  ? 241 PRO D N   1 
ATOM   4127 C CA  . PRO D 1 164 ? 96.327  -10.539 18.826  1.00 46.91  ? 241 PRO D CA  1 
ATOM   4128 C C   . PRO D 1 164 ? 95.237  -9.948  17.929  1.00 51.31  ? 241 PRO D C   1 
ATOM   4129 O O   . PRO D 1 164 ? 95.313  -8.782  17.521  1.00 52.24  ? 241 PRO D O   1 
ATOM   4130 C CB  . PRO D 1 164 ? 96.419  -9.844  20.186  1.00 49.41  ? 241 PRO D CB  1 
ATOM   4131 C CG  . PRO D 1 164 ? 97.439  -8.817  20.018  1.00 54.47  ? 241 PRO D CG  1 
ATOM   4132 C CD  . PRO D 1 164 ? 98.454  -9.426  19.093  1.00 51.09  ? 241 PRO D CD  1 
ATOM   4133 N N   . ASN D 1 165 ? 94.273  -10.795 17.554  1.00 45.63  ? 242 ASN D N   1 
ATOM   4134 C CA  . ASN D 1 165 ? 93.128  -10.447 16.729  1.00 43.37  ? 242 ASN D CA  1 
ATOM   4135 C C   . ASN D 1 165 ? 92.007  -11.422 17.096  1.00 48.33  ? 242 ASN D C   1 
ATOM   4136 O O   . ASN D 1 165 ? 91.919  -12.529 16.522  1.00 47.98  ? 242 ASN D O   1 
ATOM   4137 C CB  . ASN D 1 165 ? 93.464  -10.567 15.241  1.00 42.19  ? 242 ASN D CB  1 
ATOM   4138 C CG  . ASN D 1 165 ? 94.379  -9.525  14.683  1.00 64.07  ? 242 ASN D CG  1 
ATOM   4139 O OD1 . ASN D 1 165 ? 95.603  -9.696  14.656  1.00 72.64  ? 242 ASN D OD1 1 
ATOM   4140 N ND2 . ASN D 1 165 ? 93.810  -8.445  14.185  1.00 48.21  ? 242 ASN D ND2 1 
ATOM   4141 N N   . ASN D 1 166 ? 91.176  -11.035 18.092  1.00 44.53  ? 243 ASN D N   1 
ATOM   4142 C CA  . ASN D 1 166 ? 90.021  -11.839 18.528  1.00 42.32  ? 243 ASN D CA  1 
ATOM   4143 C C   . ASN D 1 166 ? 88.801  -10.961 18.629  1.00 42.37  ? 243 ASN D C   1 
ATOM   4144 O O   . ASN D 1 166 ? 88.828  -9.945  19.332  1.00 42.08  ? 243 ASN D O   1 
ATOM   4145 C CB  . ASN D 1 166 ? 90.260  -12.534 19.866  1.00 36.94  ? 243 ASN D CB  1 
ATOM   4146 C CG  . ASN D 1 166 ? 91.122  -13.749 19.810  1.00 52.72  ? 243 ASN D CG  1 
ATOM   4147 O OD1 . ASN D 1 166 ? 90.961  -14.624 18.962  1.00 41.14  ? 243 ASN D OD1 1 
ATOM   4148 N ND2 . ASN D 1 166 ? 91.992  -13.883 20.798  1.00 56.56  ? 243 ASN D ND2 1 
ATOM   4149 N N   . SER D 1 167 ? 87.753  -11.323 17.901  1.00 35.55  ? 244 SER D N   1 
ATOM   4150 C CA  . SER D 1 167 ? 86.496  -10.605 17.999  1.00 34.03  ? 244 SER D CA  1 
ATOM   4151 C C   . SER D 1 167 ? 85.659  -11.376 19.010  1.00 40.05  ? 244 SER D C   1 
ATOM   4152 O O   . SER D 1 167 ? 85.767  -12.611 19.090  1.00 41.80  ? 244 SER D O   1 
ATOM   4153 C CB  . SER D 1 167 ? 85.781  -10.524 16.653  1.00 33.46  ? 244 SER D CB  1 
ATOM   4154 O OG  . SER D 1 167 ? 85.421  -11.792 16.129  1.00 36.48  ? 244 SER D OG  1 
ATOM   4155 N N   . CYS D 1 168 ? 84.863  -10.664 19.812  1.00 34.89  ? 245 CYS D N   1 
ATOM   4156 C CA  . CYS D 1 168 ? 83.998  -11.327 20.772  1.00 33.71  ? 245 CYS D CA  1 
ATOM   4157 C C   . CYS D 1 168 ? 82.620  -10.802 20.646  1.00 41.77  ? 245 CYS D C   1 
ATOM   4158 O O   . CYS D 1 168 ? 82.384  -9.589  20.707  1.00 43.24  ? 245 CYS D O   1 
ATOM   4159 C CB  . CYS D 1 168 ? 84.506  -11.204 22.198  1.00 33.82  ? 245 CYS D CB  1 
ATOM   4160 S SG  A CYS D 1 168 ? 83.825  -12.448 23.320  0.30 38.23  ? 245 CYS D SG  1 
ATOM   4161 S SG  B CYS D 1 168 ? 83.916  -12.511 23.291  0.33 38.20  ? 245 CYS D SG  1 
ATOM   4162 N N   . TYR D 1 169 ? 81.701  -11.724 20.449  1.00 38.54  ? 246 TYR D N   1 
ATOM   4163 C CA  . TYR D 1 169 ? 80.291  -11.446 20.304  1.00 36.80  ? 246 TYR D CA  1 
ATOM   4164 C C   . TYR D 1 169 ? 79.553  -12.017 21.532  1.00 42.32  ? 246 TYR D C   1 
ATOM   4165 O O   . TYR D 1 169 ? 79.837  -13.137 21.979  1.00 43.82  ? 246 TYR D O   1 
ATOM   4166 C CB  . TYR D 1 169 ? 79.773  -12.124 19.015  1.00 35.14  ? 246 TYR D CB  1 
ATOM   4167 C CG  . TYR D 1 169 ? 78.298  -11.919 18.763  1.00 35.34  ? 246 TYR D CG  1 
ATOM   4168 C CD1 . TYR D 1 169 ? 77.346  -12.749 19.348  1.00 37.15  ? 246 TYR D CD1 1 
ATOM   4169 C CD2 . TYR D 1 169 ? 77.848  -10.885 17.946  1.00 35.98  ? 246 TYR D CD2 1 
ATOM   4170 C CE1 . TYR D 1 169 ? 75.981  -12.529 19.154  1.00 39.42  ? 246 TYR D CE1 1 
ATOM   4171 C CE2 . TYR D 1 169 ? 76.487  -10.676 17.718  1.00 36.46  ? 246 TYR D CE2 1 
ATOM   4172 C CZ  . TYR D 1 169 ? 75.558  -11.507 18.311  1.00 42.22  ? 246 TYR D CZ  1 
ATOM   4173 O OH  . TYR D 1 169 ? 74.230  -11.283 18.058  1.00 40.01  ? 246 TYR D OH  1 
ATOM   4174 N N   . SER D 1 170 ? 78.583  -11.261 22.033  1.00 37.31  ? 247 SER D N   1 
ATOM   4175 C CA  . SER D 1 170 ? 77.672  -11.691 23.080  1.00 37.03  ? 247 SER D CA  1 
ATOM   4176 C C   . SER D 1 170 ? 76.347  -11.021 22.843  1.00 37.69  ? 247 SER D C   1 
ATOM   4177 O O   . SER D 1 170 ? 76.297  -9.872  22.352  1.00 35.63  ? 247 SER D O   1 
ATOM   4178 C CB  . SER D 1 170 ? 78.194  -11.363 24.477  1.00 42.20  ? 247 SER D CB  1 
ATOM   4179 O OG  . SER D 1 170 ? 77.517  -12.138 25.447  1.00 55.07  ? 247 SER D OG  1 
ATOM   4180 N N   . ALA D 1 171 ? 75.270  -11.737 23.189  1.00 33.44  ? 248 ALA D N   1 
ATOM   4181 C CA  . ALA D 1 171 ? 73.929  -11.210 23.056  1.00 34.15  ? 248 ALA D CA  1 
ATOM   4182 C C   . ALA D 1 171 ? 72.999  -11.942 24.006  1.00 42.07  ? 248 ALA D C   1 
ATOM   4183 O O   . ALA D 1 171 ? 73.325  -13.047 24.449  1.00 43.51  ? 248 ALA D O   1 
ATOM   4184 C CB  . ALA D 1 171 ? 73.456  -11.358 21.612  1.00 33.95  ? 248 ALA D CB  1 
ATOM   4185 N N   . GLY D 1 172 ? 71.845  -11.344 24.288  1.00 39.42  ? 249 GLY D N   1 
ATOM   4186 C CA  . GLY D 1 172 ? 70.812  -11.946 25.128  1.00 40.48  ? 249 GLY D CA  1 
ATOM   4187 C C   . GLY D 1 172 ? 69.528  -11.153 25.111  1.00 44.08  ? 249 GLY D C   1 
ATOM   4188 O O   . GLY D 1 172 ? 69.412  -10.148 24.392  1.00 46.30  ? 249 GLY D O   1 
ATOM   4189 N N   . ILE D 1 173 ? 68.554  -11.604 25.887  1.00 37.61  ? 250 ILE D N   1 
ATOM   4190 C CA  . ILE D 1 173 ? 67.269  -10.912 25.976  1.00 36.85  ? 250 ILE D CA  1 
ATOM   4191 C C   . ILE D 1 173 ? 67.216  -10.090 27.278  1.00 41.86  ? 250 ILE D C   1 
ATOM   4192 O O   . ILE D 1 173 ? 67.707  -10.543 28.312  1.00 43.64  ? 250 ILE D O   1 
ATOM   4193 C CB  . ILE D 1 173 ? 66.049  -11.851 25.767  1.00 39.71  ? 250 ILE D CB  1 
ATOM   4194 C CG1 . ILE D 1 173 ? 66.195  -12.629 24.463  1.00 38.16  ? 250 ILE D CG1 1 
ATOM   4195 C CG2 . ILE D 1 173 ? 64.735  -11.064 25.757  1.00 41.75  ? 250 ILE D CG2 1 
ATOM   4196 C CD1 . ILE D 1 173 ? 65.078  -13.615 24.178  1.00 40.07  ? 250 ILE D CD1 1 
ATOM   4197 N N   . ALA D 1 174 ? 66.681  -8.866  27.219  1.00 35.91  ? 251 ALA D N   1 
ATOM   4198 C CA  . ALA D 1 174 ? 66.594  -8.071  28.425  1.00 36.55  ? 251 ALA D CA  1 
ATOM   4199 C C   . ALA D 1 174 ? 65.280  -7.335  28.555  1.00 44.07  ? 251 ALA D C   1 
ATOM   4200 O O   . ALA D 1 174 ? 64.798  -6.760  27.579  1.00 44.93  ? 251 ALA D O   1 
ATOM   4201 C CB  . ALA D 1 174 ? 67.746  -7.095  28.493  1.00 35.84  ? 251 ALA D CB  1 
ATOM   4202 N N   . LYS D 1 175 ? 64.691  -7.356  29.764  1.00 42.57  ? 252 LYS D N   1 
ATOM   4203 C CA  . LYS D 1 175 ? 63.492  -6.581  30.062  1.00 44.05  ? 252 LYS D CA  1 
ATOM   4204 C C   . LYS D 1 175 ? 64.059  -5.149  30.291  1.00 50.42  ? 252 LYS D C   1 
ATOM   4205 O O   . LYS D 1 175 ? 64.953  -4.977  31.139  1.00 50.64  ? 252 LYS D O   1 
ATOM   4206 C CB  . LYS D 1 175 ? 62.827  -7.062  31.368  1.00 47.25  ? 252 LYS D CB  1 
ATOM   4207 C CG  . LYS D 1 175 ? 62.118  -8.424  31.388  1.00 45.78  ? 252 LYS D CG  1 
ATOM   4208 C CD  . LYS D 1 175 ? 61.383  -8.494  32.753  1.00 52.91  ? 252 LYS D CD  1 
ATOM   4209 C CE  . LYS D 1 175 ? 60.128  -9.311  32.864  1.00 58.08  ? 252 LYS D CE  1 
ATOM   4210 N NZ  . LYS D 1 175 ? 59.343  -8.939  34.084  1.00 70.75  ? 252 LYS D NZ  1 
ATOM   4211 N N   . LEU D 1 176 ? 63.613  -4.152  29.496  1.00 47.21  ? 253 LEU D N   1 
ATOM   4212 C CA  . LEU D 1 176 ? 64.071  -2.770  29.649  1.00 47.09  ? 253 LEU D CA  1 
ATOM   4213 C C   . LEU D 1 176 ? 62.875  -1.862  29.752  1.00 56.19  ? 253 LEU D C   1 
ATOM   4214 O O   . LEU D 1 176 ? 61.831  -2.147  29.155  1.00 56.69  ? 253 LEU D O   1 
ATOM   4215 C CB  . LEU D 1 176 ? 65.004  -2.316  28.502  1.00 44.28  ? 253 LEU D CB  1 
ATOM   4216 C CG  . LEU D 1 176 ? 66.216  -3.216  28.144  1.00 46.38  ? 253 LEU D CG  1 
ATOM   4217 C CD1 . LEU D 1 176 ? 66.909  -2.716  26.924  1.00 44.36  ? 253 LEU D CD1 1 
ATOM   4218 C CD2 . LEU D 1 176 ? 67.248  -3.277  29.269  1.00 47.59  ? 253 LEU D CD2 1 
ATOM   4219 N N   . GLU D 1 177 ? 63.027  -0.771  30.521  1.00 55.89  ? 254 GLU D N   1 
ATOM   4220 C CA  . GLU D 1 177 ? 62.011  0.249   30.776  1.00 58.06  ? 254 GLU D CA  1 
ATOM   4221 C C   . GLU D 1 177 ? 62.331  1.556   30.047  1.00 63.39  ? 254 GLU D C   1 
ATOM   4222 O O   . GLU D 1 177 ? 63.503  1.912   29.881  1.00 61.93  ? 254 GLU D O   1 
ATOM   4223 C CB  . GLU D 1 177 ? 61.964  0.540   32.266  1.00 61.74  ? 254 GLU D CB  1 
ATOM   4224 C CG  . GLU D 1 177 ? 61.020  -0.341  33.037  1.00 73.29  ? 254 GLU D CG  1 
ATOM   4225 C CD  . GLU D 1 177 ? 61.249  -0.202  34.522  1.00 95.52  ? 254 GLU D CD  1 
ATOM   4226 O OE1 . GLU D 1 177 ? 62.139  -0.907  35.048  1.00 87.69  ? 254 GLU D OE1 1 
ATOM   4227 O OE2 . GLU D 1 177 ? 60.580  0.652   35.148  1.00 98.43  ? 254 GLU D OE2 1 
ATOM   4228 N N   . GLU D 1 178 ? 61.282  2.289   29.650  1.00 61.36  ? 255 GLU D N   1 
ATOM   4229 C CA  . GLU D 1 178 ? 61.384  3.592   28.996  1.00 60.36  ? 255 GLU D CA  1 
ATOM   4230 C C   . GLU D 1 178 ? 62.200  4.518   29.895  1.00 63.66  ? 255 GLU D C   1 
ATOM   4231 O O   . GLU D 1 178 ? 61.848  4.704   31.058  1.00 67.22  ? 255 GLU D O   1 
ATOM   4232 C CB  . GLU D 1 178 ? 59.973  4.139   28.747  1.00 64.03  ? 255 GLU D CB  1 
ATOM   4233 C CG  . GLU D 1 178 ? 59.881  5.631   28.462  1.00 76.36  ? 255 GLU D CG  1 
ATOM   4234 C CD  . GLU D 1 178 ? 58.472  6.097   28.150  1.00 95.78  ? 255 GLU D CD  1 
ATOM   4235 O OE1 . GLU D 1 178 ? 57.694  5.292   27.587  1.00 93.21  ? 255 GLU D OE1 1 
ATOM   4236 O OE2 . GLU D 1 178 ? 58.166  7.282   28.408  1.00 86.48  ? 255 GLU D OE2 1 
ATOM   4237 N N   . GLY D 1 179 ? 63.321  5.012   29.379  1.00 56.03  ? 256 GLY D N   1 
ATOM   4238 C CA  . GLY D 1 179 ? 64.218  5.880   30.133  1.00 55.85  ? 256 GLY D CA  1 
ATOM   4239 C C   . GLY D 1 179 ? 65.567  5.258   30.414  1.00 57.92  ? 256 GLY D C   1 
ATOM   4240 O O   . GLY D 1 179 ? 66.531  5.975   30.705  1.00 56.68  ? 256 GLY D O   1 
ATOM   4241 N N   . ASP D 1 180 ? 65.649  3.906   30.348  1.00 54.87  ? 257 ASP D N   1 
ATOM   4242 C CA  . ASP D 1 180 ? 66.910  3.175   30.532  1.00 52.63  ? 257 ASP D CA  1 
ATOM   4243 C C   . ASP D 1 180 ? 67.857  3.456   29.373  1.00 52.48  ? 257 ASP D C   1 
ATOM   4244 O O   . ASP D 1 180 ? 67.409  3.807   28.278  1.00 52.34  ? 257 ASP D O   1 
ATOM   4245 C CB  . ASP D 1 180 ? 66.686  1.661   30.607  1.00 52.94  ? 257 ASP D CB  1 
ATOM   4246 C CG  . ASP D 1 180 ? 65.940  1.161   31.806  1.00 66.83  ? 257 ASP D CG  1 
ATOM   4247 O OD1 . ASP D 1 180 ? 65.833  1.922   32.807  1.00 71.18  ? 257 ASP D OD1 1 
ATOM   4248 O OD2 . ASP D 1 180 ? 65.458  0.010   31.753  1.00 73.93  ? 257 ASP D OD2 1 
ATOM   4249 N N   . GLU D 1 181 ? 69.164  3.322   29.624  1.00 46.76  ? 258 GLU D N   1 
ATOM   4250 C CA  . GLU D 1 181 ? 70.207  3.529   28.624  1.00 44.86  ? 258 GLU D CA  1 
ATOM   4251 C C   . GLU D 1 181 ? 71.113  2.348   28.616  1.00 49.44  ? 258 GLU D C   1 
ATOM   4252 O O   . GLU D 1 181 ? 71.348  1.762   29.680  1.00 51.58  ? 258 GLU D O   1 
ATOM   4253 C CB  . GLU D 1 181 ? 71.010  4.796   28.881  1.00 47.41  ? 258 GLU D CB  1 
ATOM   4254 C CG  . GLU D 1 181 ? 70.236  6.052   28.517  1.00 63.06  ? 258 GLU D CG  1 
ATOM   4255 C CD  . GLU D 1 181 ? 70.800  7.334   29.086  1.00 85.92  ? 258 GLU D CD  1 
ATOM   4256 O OE1 . GLU D 1 181 ? 71.997  7.345   29.452  1.00 78.69  ? 258 GLU D OE1 1 
ATOM   4257 O OE2 . GLU D 1 181 ? 70.050  8.336   29.148  1.00 87.60  ? 258 GLU D OE2 1 
ATOM   4258 N N   . LEU D 1 182 ? 71.584  1.956   27.414  1.00 42.79  ? 259 LEU D N   1 
ATOM   4259 C CA  . LEU D 1 182 ? 72.485  0.826   27.240  1.00 40.54  ? 259 LEU D CA  1 
ATOM   4260 C C   . LEU D 1 182 ? 73.837  1.333   26.798  1.00 43.12  ? 259 LEU D C   1 
ATOM   4261 O O   . LEU D 1 182 ? 73.917  2.278   26.008  1.00 41.04  ? 259 LEU D O   1 
ATOM   4262 C CB  . LEU D 1 182 ? 71.943  -0.163  26.202  1.00 39.37  ? 259 LEU D CB  1 
ATOM   4263 C CG  . LEU D 1 182 ? 70.630  -0.870  26.488  1.00 45.40  ? 259 LEU D CG  1 
ATOM   4264 C CD1 . LEU D 1 182 ? 70.212  -1.709  25.287  1.00 43.61  ? 259 LEU D CD1 1 
ATOM   4265 C CD2 . LEU D 1 182 ? 70.718  -1.732  27.741  1.00 50.10  ? 259 LEU D CD2 1 
ATOM   4266 N N   . GLN D 1 183 ? 74.904  0.711   27.317  1.00 40.87  ? 260 GLN D N   1 
ATOM   4267 C CA  . GLN D 1 183 ? 76.280  1.062   26.955  1.00 40.77  ? 260 GLN D CA  1 
ATOM   4268 C C   . GLN D 1 183 ? 77.191  -0.175  26.912  1.00 47.26  ? 260 GLN D C   1 
ATOM   4269 O O   . GLN D 1 183 ? 76.974  -1.147  27.658  1.00 48.88  ? 260 GLN D O   1 
ATOM   4270 C CB  . GLN D 1 183 ? 76.858  2.131   27.888  1.00 43.39  ? 260 GLN D CB  1 
ATOM   4271 C CG  . GLN D 1 183 ? 77.065  1.673   29.328  1.00 67.44  ? 260 GLN D CG  1 
ATOM   4272 C CD  . GLN D 1 183 ? 77.797  2.687   30.173  1.00 88.08  ? 260 GLN D CD  1 
ATOM   4273 O OE1 . GLN D 1 183 ? 77.677  3.899   29.973  1.00 85.24  ? 260 GLN D OE1 1 
ATOM   4274 N NE2 . GLN D 1 183 ? 78.568  2.216   31.145  1.00 77.52  ? 260 GLN D NE2 1 
ATOM   4275 N N   . LEU D 1 184 ? 78.205  -0.132  26.038  1.00 40.58  ? 261 LEU D N   1 
ATOM   4276 C CA  . LEU D 1 184 ? 79.199  -1.182  25.900  1.00 38.02  ? 261 LEU D CA  1 
ATOM   4277 C C   . LEU D 1 184 ? 80.476  -0.605  26.501  1.00 46.31  ? 261 LEU D C   1 
ATOM   4278 O O   . LEU D 1 184 ? 80.990  0.410   26.017  1.00 48.78  ? 261 LEU D O   1 
ATOM   4279 C CB  . LEU D 1 184 ? 79.366  -1.539  24.409  1.00 35.74  ? 261 LEU D CB  1 
ATOM   4280 C CG  . LEU D 1 184 ? 80.191  -2.771  24.079  1.00 37.80  ? 261 LEU D CG  1 
ATOM   4281 C CD1 . LEU D 1 184 ? 79.675  -3.444  22.834  1.00 35.30  ? 261 LEU D CD1 1 
ATOM   4282 C CD2 . LEU D 1 184 ? 81.671  -2.427  23.937  1.00 38.10  ? 261 LEU D CD2 1 
ATOM   4283 N N   . ALA D 1 185 ? 80.962  -1.215  27.582  1.00 44.53  ? 262 ALA D N   1 
ATOM   4284 C CA  . ALA D 1 185 ? 82.158  -0.771  28.308  1.00 45.48  ? 262 ALA D CA  1 
ATOM   4285 C C   . ALA D 1 185 ? 83.262  -1.835  28.302  1.00 48.53  ? 262 ALA D C   1 
ATOM   4286 O O   . ALA D 1 185 ? 82.976  -3.004  28.537  1.00 46.84  ? 262 ALA D O   1 
ATOM   4287 C CB  . ALA D 1 185 ? 81.787  -0.422  29.733  1.00 48.27  ? 262 ALA D CB  1 
ATOM   4288 N N   . ILE D 1 186 ? 84.521  -1.430  28.032  1.00 45.68  ? 263 ILE D N   1 
ATOM   4289 C CA  . ILE D 1 186 ? 85.665  -2.348  28.041  1.00 43.76  ? 263 ILE D CA  1 
ATOM   4290 C C   . ILE D 1 186 ? 86.427  -2.114  29.345  1.00 50.26  ? 263 ILE D C   1 
ATOM   4291 O O   . ILE D 1 186 ? 87.021  -1.038  29.505  1.00 52.56  ? 263 ILE D O   1 
ATOM   4292 C CB  . ILE D 1 186 ? 86.558  -2.217  26.788  1.00 43.99  ? 263 ILE D CB  1 
ATOM   4293 C CG1 . ILE D 1 186 ? 85.749  -2.554  25.512  1.00 39.71  ? 263 ILE D CG1 1 
ATOM   4294 C CG2 . ILE D 1 186 ? 87.803  -3.124  26.947  1.00 45.18  ? 263 ILE D CG2 1 
ATOM   4295 C CD1 . ILE D 1 186 ? 86.241  -1.916  24.265  1.00 38.63  ? 263 ILE D CD1 1 
ATOM   4296 N N   . PRO D 1 187 ? 86.393  -3.072  30.308  1.00 45.54  ? 264 PRO D N   1 
ATOM   4297 C CA  . PRO D 1 187 ? 87.066  -2.827  31.609  1.00 48.25  ? 264 PRO D CA  1 
ATOM   4298 C C   . PRO D 1 187 ? 88.586  -2.922  31.566  1.00 48.37  ? 264 PRO D C   1 
ATOM   4299 O O   . PRO D 1 187 ? 89.186  -3.708  32.293  1.00 46.96  ? 264 PRO D O   1 
ATOM   4300 C CB  . PRO D 1 187 ? 86.418  -3.859  32.558  1.00 50.66  ? 264 PRO D CB  1 
ATOM   4301 C CG  . PRO D 1 187 ? 85.437  -4.635  31.734  1.00 51.00  ? 264 PRO D CG  1 
ATOM   4302 C CD  . PRO D 1 187 ? 85.706  -4.375  30.298  1.00 44.07  ? 264 PRO D CD  1 
ATOM   4303 N N   . ARG D 1 188 ? 89.200  -2.148  30.667  1.00 43.81  ? 265 ARG D N   1 
ATOM   4304 C CA  . ARG D 1 188 ? 90.649  -2.113  30.449  1.00 44.43  ? 265 ARG D CA  1 
ATOM   4305 C C   . ARG D 1 188 ? 91.026  -0.695  30.040  1.00 48.92  ? 265 ARG D C   1 
ATOM   4306 O O   . ARG D 1 188 ? 90.351  -0.117  29.194  1.00 46.77  ? 265 ARG D O   1 
ATOM   4307 C CB  . ARG D 1 188 ? 91.074  -3.105  29.339  1.00 42.11  ? 265 ARG D CB  1 
ATOM   4308 C CG  . ARG D 1 188 ? 90.567  -4.552  29.466  1.00 42.03  ? 265 ARG D CG  1 
ATOM   4309 C CD  . ARG D 1 188 ? 91.680  -5.406  29.945  1.00 40.26  ? 265 ARG D CD  1 
ATOM   4310 N NE  . ARG D 1 188 ? 91.326  -6.788  30.269  1.00 49.77  ? 265 ARG D NE  1 
ATOM   4311 C CZ  . ARG D 1 188 ? 90.897  -7.207  31.456  1.00 56.26  ? 265 ARG D CZ  1 
ATOM   4312 N NH1 . ARG D 1 188 ? 90.580  -6.335  32.396  1.00 44.73  ? 265 ARG D NH1 1 
ATOM   4313 N NH2 . ARG D 1 188 ? 90.723  -8.500  31.688  1.00 45.48  ? 265 ARG D NH2 1 
ATOM   4314 N N   . GLU D 1 189 ? 92.054  -0.110  30.680  1.00 49.63  ? 266 GLU D N   1 
ATOM   4315 C CA  . GLU D 1 189 ? 92.520  1.241   30.365  1.00 51.38  ? 266 GLU D CA  1 
ATOM   4316 C C   . GLU D 1 189 ? 93.210  1.182   28.999  1.00 57.31  ? 266 GLU D C   1 
ATOM   4317 O O   . GLU D 1 189 ? 93.941  0.219   28.754  1.00 58.61  ? 266 GLU D O   1 
ATOM   4318 C CB  . GLU D 1 189 ? 93.498  1.750   31.437  1.00 55.94  ? 266 GLU D CB  1 
ATOM   4319 N N   . ASN D 1 190 ? 92.955  2.180   28.103  1.00 52.20  ? 267 ASN D N   1 
ATOM   4320 C CA  . ASN D 1 190 ? 93.572  2.268   26.765  1.00 51.06  ? 267 ASN D CA  1 
ATOM   4321 C C   . ASN D 1 190 ? 93.543  0.965   25.971  1.00 55.40  ? 267 ASN D C   1 
ATOM   4322 O O   . ASN D 1 190 ? 94.576  0.520   25.447  1.00 54.14  ? 267 ASN D O   1 
ATOM   4323 C CB  . ASN D 1 190 ? 94.998  2.826   26.833  1.00 49.98  ? 267 ASN D CB  1 
ATOM   4324 C CG  . ASN D 1 190 ? 95.293  3.767   25.700  1.00 81.61  ? 267 ASN D CG  1 
ATOM   4325 O OD1 . ASN D 1 190 ? 95.249  4.988   25.876  1.00 89.33  ? 267 ASN D OD1 1 
ATOM   4326 N ND2 . ASN D 1 190 ? 95.557  3.240   24.498  1.00 65.90  ? 267 ASN D ND2 1 
ATOM   4327 N N   . ALA D 1 191 ? 92.352  0.333   25.917  1.00 52.85  ? 268 ALA D N   1 
ATOM   4328 C CA  . ALA D 1 191 ? 92.125  -0.928  25.213  1.00 50.72  ? 268 ALA D CA  1 
ATOM   4329 C C   . ALA D 1 191 ? 92.478  -0.786  23.720  1.00 54.35  ? 268 ALA D C   1 
ATOM   4330 O O   . ALA D 1 191 ? 92.199  0.256   23.105  1.00 54.75  ? 268 ALA D O   1 
ATOM   4331 C CB  . ALA D 1 191 ? 90.681  -1.357  25.379  1.00 49.39  ? 268 ALA D CB  1 
ATOM   4332 N N   . GLN D 1 192 ? 93.161  -1.805  23.176  1.00 48.90  ? 269 GLN D N   1 
ATOM   4333 C CA  . GLN D 1 192 ? 93.573  -1.843  21.781  1.00 47.33  ? 269 GLN D CA  1 
ATOM   4334 C C   . GLN D 1 192 ? 92.539  -2.613  21.025  1.00 50.12  ? 269 GLN D C   1 
ATOM   4335 O O   . GLN D 1 192 ? 92.435  -3.834  21.175  1.00 50.94  ? 269 GLN D O   1 
ATOM   4336 C CB  . GLN D 1 192 ? 94.959  -2.481  21.621  1.00 49.46  ? 269 GLN D CB  1 
ATOM   4337 C CG  . GLN D 1 192 ? 96.051  -1.780  22.391  1.00 54.16  ? 269 GLN D CG  1 
ATOM   4338 C CD  . GLN D 1 192 ? 96.177  -0.353  21.989  1.00 66.41  ? 269 GLN D CD  1 
ATOM   4339 O OE1 . GLN D 1 192 ? 96.666  -0.046  20.903  1.00 56.59  ? 269 GLN D OE1 1 
ATOM   4340 N NE2 . GLN D 1 192 ? 95.707  0.539   22.851  1.00 67.34  ? 269 GLN D NE2 1 
ATOM   4341 N N   . ILE D 1 193 ? 91.703  -1.888  20.281  1.00 44.51  ? 270 ILE D N   1 
ATOM   4342 C CA  . ILE D 1 193 ? 90.575  -2.478  19.550  1.00 41.56  ? 270 ILE D CA  1 
ATOM   4343 C C   . ILE D 1 193 ? 90.525  -1.975  18.106  1.00 43.22  ? 270 ILE D C   1 
ATOM   4344 O O   . ILE D 1 193 ? 91.154  -0.976  17.805  1.00 44.96  ? 270 ILE D O   1 
ATOM   4345 C CB  . ILE D 1 193 ? 89.229  -2.211  20.315  1.00 43.31  ? 270 ILE D CB  1 
ATOM   4346 C CG1 . ILE D 1 193 ? 88.926  -0.701  20.390  1.00 43.46  ? 270 ILE D CG1 1 
ATOM   4347 C CG2 . ILE D 1 193 ? 89.236  -2.850  21.723  1.00 44.17  ? 270 ILE D CG2 1 
ATOM   4348 C CD1 . ILE D 1 193 ? 87.560  -0.354  20.598  1.00 43.34  ? 270 ILE D CD1 1 
ATOM   4349 N N   . SER D 1 194 ? 89.769  -2.648  17.227  1.00 36.79  ? 271 SER D N   1 
ATOM   4350 C CA  . SER D 1 194 ? 89.589  -2.210  15.845  1.00 34.38  ? 271 SER D CA  1 
ATOM   4351 C C   . SER D 1 194 ? 88.313  -1.384  15.775  1.00 36.00  ? 271 SER D C   1 
ATOM   4352 O O   . SER D 1 194 ? 87.278  -1.782  16.320  1.00 35.23  ? 271 SER D O   1 
ATOM   4353 C CB  . SER D 1 194 ? 89.494  -3.399  14.898  1.00 35.05  ? 271 SER D CB  1 
ATOM   4354 O OG  . SER D 1 194 ? 89.139  -2.992  13.588  1.00 41.72  ? 271 SER D OG  1 
ATOM   4355 N N   . LEU D 1 195 ? 88.390  -0.228  15.123  1.00 31.88  ? 272 LEU D N   1 
ATOM   4356 C CA  . LEU D 1 195 ? 87.235  0.639   14.994  1.00 31.18  ? 272 LEU D CA  1 
ATOM   4357 C C   . LEU D 1 195 ? 86.557  0.526   13.628  1.00 38.18  ? 272 LEU D C   1 
ATOM   4358 O O   . LEU D 1 195 ? 85.919  1.479   13.189  1.00 40.08  ? 272 LEU D O   1 
ATOM   4359 C CB  . LEU D 1 195 ? 87.557  2.088   15.385  1.00 32.39  ? 272 LEU D CB  1 
ATOM   4360 C CG  . LEU D 1 195 ? 87.960  2.349   16.835  1.00 37.51  ? 272 LEU D CG  1 
ATOM   4361 C CD1 . LEU D 1 195 ? 88.290  3.777   17.036  1.00 38.25  ? 272 LEU D CD1 1 
ATOM   4362 C CD2 . LEU D 1 195 ? 86.872  1.936   17.809  1.00 40.81  ? 272 LEU D CD2 1 
ATOM   4363 N N   . ASP D 1 196 ? 86.647  -0.661  12.984  1.00 35.10  ? 273 ASP D N   1 
ATOM   4364 C CA  . ASP D 1 196 ? 85.979  -0.948  11.711  1.00 35.04  ? 273 ASP D CA  1 
ATOM   4365 C C   . ASP D 1 196 ? 84.517  -1.390  11.962  1.00 37.45  ? 273 ASP D C   1 
ATOM   4366 O O   . ASP D 1 196 ? 84.273  -2.293  12.768  1.00 38.78  ? 273 ASP D O   1 
ATOM   4367 C CB  . ASP D 1 196 ? 86.760  -2.015  10.932  1.00 37.96  ? 273 ASP D CB  1 
ATOM   4368 C CG  . ASP D 1 196 ? 88.179  -1.627  10.521  1.00 53.64  ? 273 ASP D CG  1 
ATOM   4369 O OD1 . ASP D 1 196 ? 88.432  -0.410  10.305  1.00 55.06  ? 273 ASP D OD1 1 
ATOM   4370 O OD2 . ASP D 1 196 ? 89.022  -2.544  10.368  1.00 61.09  ? 273 ASP D OD2 1 
ATOM   4371 N N   . GLY D 1 197 ? 83.572  -0.744  11.280  1.00 32.95  ? 274 GLY D N   1 
ATOM   4372 C CA  . GLY D 1 197 ? 82.123  -0.975  11.403  1.00 32.92  ? 274 GLY D CA  1 
ATOM   4373 C C   . GLY D 1 197 ? 81.613  -2.400  11.245  1.00 39.63  ? 274 GLY D C   1 
ATOM   4374 O O   . GLY D 1 197 ? 80.571  -2.755  11.814  1.00 41.44  ? 274 GLY D O   1 
ATOM   4375 N N   . ASP D 1 198 ? 82.346  -3.234  10.482  1.00 34.40  ? 275 ASP D N   1 
ATOM   4376 C CA  . ASP D 1 198 ? 81.991  -4.632  10.236  1.00 33.04  ? 275 ASP D CA  1 
ATOM   4377 C C   . ASP D 1 198 ? 82.468  -5.569  11.348  1.00 35.13  ? 275 ASP D C   1 
ATOM   4378 O O   . ASP D 1 198 ? 82.107  -6.745  11.387  1.00 33.49  ? 275 ASP D O   1 
ATOM   4379 C CB  . ASP D 1 198 ? 82.578  -5.086  8.878   1.00 35.30  ? 275 ASP D CB  1 
ATOM   4380 C CG  . ASP D 1 198 ? 84.101  -5.049  8.772   1.00 43.33  ? 275 ASP D CG  1 
ATOM   4381 O OD1 . ASP D 1 198 ? 84.736  -4.239  9.488   1.00 43.30  ? 275 ASP D OD1 1 
ATOM   4382 O OD2 . ASP D 1 198 ? 84.645  -5.748  7.907   1.00 47.90  ? 275 ASP D OD2 1 
ATOM   4383 N N   . VAL D 1 199 ? 83.274  -5.042  12.255  1.00 32.20  ? 276 VAL D N   1 
ATOM   4384 C CA  . VAL D 1 199 ? 83.927  -5.832  13.284  1.00 31.65  ? 276 VAL D CA  1 
ATOM   4385 C C   . VAL D 1 199 ? 83.605  -5.391  14.733  1.00 38.33  ? 276 VAL D C   1 
ATOM   4386 O O   . VAL D 1 199 ? 83.620  -6.219  15.642  1.00 37.39  ? 276 VAL D O   1 
ATOM   4387 C CB  . VAL D 1 199 ? 85.417  -5.825  12.885  1.00 34.87  ? 276 VAL D CB  1 
ATOM   4388 C CG1 . VAL D 1 199 ? 86.254  -4.831  13.665  1.00 35.21  ? 276 VAL D CG1 1 
ATOM   4389 C CG2 . VAL D 1 199 ? 86.010  -7.199  12.870  1.00 34.72  ? 276 VAL D CG2 1 
ATOM   4390 N N   . THR D 1 200 ? 83.269  -4.098  14.924  1.00 37.13  ? 277 THR D N   1 
ATOM   4391 C CA  . THR D 1 200 ? 82.925  -3.522  16.220  1.00 37.85  ? 277 THR D CA  1 
ATOM   4392 C C   . THR D 1 200 ? 81.586  -2.833  16.061  1.00 42.53  ? 277 THR D C   1 
ATOM   4393 O O   . THR D 1 200 ? 81.477  -1.805  15.380  1.00 44.28  ? 277 THR D O   1 
ATOM   4394 C CB  . THR D 1 200 ? 84.060  -2.621  16.739  1.00 40.92  ? 277 THR D CB  1 
ATOM   4395 O OG1 . THR D 1 200 ? 85.234  -3.405  16.863  1.00 37.52  ? 277 THR D OG1 1 
ATOM   4396 C CG2 . THR D 1 200 ? 83.735  -1.966  18.095  1.00 37.77  ? 277 THR D CG2 1 
ATOM   4397 N N   . PHE D 1 201 ? 80.562  -3.428  16.662  1.00 36.57  ? 278 PHE D N   1 
ATOM   4398 C CA  . PHE D 1 201 ? 79.194  -2.945  16.552  1.00 35.82  ? 278 PHE D CA  1 
ATOM   4399 C C   . PHE D 1 201 ? 78.380  -3.268  17.805  1.00 37.83  ? 278 PHE D C   1 
ATOM   4400 O O   . PHE D 1 201 ? 78.806  -4.095  18.595  1.00 36.73  ? 278 PHE D O   1 
ATOM   4401 C CB  . PHE D 1 201 ? 78.524  -3.469  15.260  1.00 36.04  ? 278 PHE D CB  1 
ATOM   4402 C CG  . PHE D 1 201 ? 78.582  -4.958  15.093  1.00 34.86  ? 278 PHE D CG  1 
ATOM   4403 C CD1 . PHE D 1 201 ? 79.608  -5.550  14.358  1.00 34.77  ? 278 PHE D CD1 1 
ATOM   4404 C CD2 . PHE D 1 201 ? 77.616  -5.779  15.684  1.00 36.06  ? 278 PHE D CD2 1 
ATOM   4405 C CE1 . PHE D 1 201 ? 79.665  -6.939  14.207  1.00 34.61  ? 278 PHE D CE1 1 
ATOM   4406 C CE2 . PHE D 1 201 ? 77.679  -7.170  15.545  1.00 37.29  ? 278 PHE D CE2 1 
ATOM   4407 C CZ  . PHE D 1 201 ? 78.694  -7.737  14.795  1.00 34.39  ? 278 PHE D CZ  1 
ATOM   4408 N N   . PHE D 1 202 ? 77.225  -2.590  17.984  1.00 33.23  ? 279 PHE D N   1 
ATOM   4409 C CA  . PHE D 1 202 ? 76.347  -2.685  19.140  1.00 31.58  ? 279 PHE D CA  1 
ATOM   4410 C C   . PHE D 1 202 ? 74.919  -2.351  18.704  1.00 34.02  ? 279 PHE D C   1 
ATOM   4411 O O   . PHE D 1 202 ? 74.700  -1.370  18.001  1.00 35.08  ? 279 PHE D O   1 
ATOM   4412 C CB  . PHE D 1 202 ? 76.878  -1.702  20.193  1.00 34.35  ? 279 PHE D CB  1 
ATOM   4413 C CG  . PHE D 1 202 ? 76.155  -1.522  21.513  1.00 37.44  ? 279 PHE D CG  1 
ATOM   4414 C CD1 . PHE D 1 202 ? 75.635  -2.615  22.200  1.00 41.11  ? 279 PHE D CD1 1 
ATOM   4415 C CD2 . PHE D 1 202 ? 76.086  -0.270  22.119  1.00 41.31  ? 279 PHE D CD2 1 
ATOM   4416 C CE1 . PHE D 1 202 ? 75.013  -2.450  23.447  1.00 43.43  ? 279 PHE D CE1 1 
ATOM   4417 C CE2 . PHE D 1 202 ? 75.450  -0.103  23.353  1.00 46.16  ? 279 PHE D CE2 1 
ATOM   4418 C CZ  . PHE D 1 202 ? 74.922  -1.194  24.013  1.00 44.34  ? 279 PHE D CZ  1 
ATOM   4419 N N   . GLY D 1 203 ? 73.973  -3.194  19.072  1.00 29.43  ? 280 GLY D N   1 
ATOM   4420 C CA  . GLY D 1 203 ? 72.582  -2.990  18.706  1.00 30.45  ? 280 GLY D CA  1 
ATOM   4421 C C   . GLY D 1 203 ? 71.571  -3.596  19.659  1.00 37.41  ? 280 GLY D C   1 
ATOM   4422 O O   . GLY D 1 203 ? 71.919  -4.368  20.559  1.00 37.27  ? 280 GLY D O   1 
ATOM   4423 N N   . ALA D 1 204 ? 70.302  -3.234  19.460  1.00 36.70  ? 281 ALA D N   1 
ATOM   4424 C CA  . ALA D 1 204 ? 69.165  -3.726  20.232  1.00 38.42  ? 281 ALA D CA  1 
ATOM   4425 C C   . ALA D 1 204 ? 67.967  -3.843  19.306  1.00 46.47  ? 281 ALA D C   1 
ATOM   4426 O O   . ALA D 1 204 ? 67.820  -3.036  18.382  1.00 47.93  ? 281 ALA D O   1 
ATOM   4427 C CB  . ALA D 1 204 ? 68.853  -2.787  21.379  1.00 40.31  ? 281 ALA D CB  1 
ATOM   4428 N N   . LEU D 1 205 ? 67.140  -4.870  19.530  1.00 43.98  ? 282 LEU D N   1 
ATOM   4429 C CA  . LEU D 1 205 ? 65.951  -5.194  18.745  1.00 44.09  ? 282 LEU D CA  1 
ATOM   4430 C C   . LEU D 1 205 ? 64.757  -5.442  19.677  1.00 47.43  ? 282 LEU D C   1 
ATOM   4431 O O   . LEU D 1 205 ? 64.827  -6.291  20.584  1.00 45.30  ? 282 LEU D O   1 
ATOM   4432 C CB  . LEU D 1 205 ? 66.281  -6.433  17.898  1.00 43.54  ? 282 LEU D CB  1 
ATOM   4433 C CG  . LEU D 1 205 ? 65.156  -7.248  17.260  1.00 49.73  ? 282 LEU D CG  1 
ATOM   4434 C CD1 . LEU D 1 205 ? 64.373  -6.427  16.240  1.00 51.39  ? 282 LEU D CD1 1 
ATOM   4435 C CD2 . LEU D 1 205 ? 65.728  -8.477  16.588  1.00 50.62  ? 282 LEU D CD2 1 
ATOM   4436 N N   . LYS D 1 206 ? 63.678  -4.662  19.479  1.00 46.14  ? 283 LYS D N   1 
ATOM   4437 C CA  . LYS D 1 206 ? 62.501  -4.814  20.330  1.00 48.53  ? 283 LYS D CA  1 
ATOM   4438 C C   . LYS D 1 206 ? 61.663  -5.979  19.879  1.00 57.28  ? 283 LYS D C   1 
ATOM   4439 O O   . LYS D 1 206 ? 61.273  -6.048  18.709  1.00 58.81  ? 283 LYS D O   1 
ATOM   4440 C CB  . LYS D 1 206 ? 61.666  -3.534  20.488  1.00 49.80  ? 283 LYS D CB  1 
ATOM   4441 C CG  . LYS D 1 206 ? 60.698  -3.649  21.659  1.00 40.92  ? 283 LYS D CG  1 
ATOM   4442 C CD  . LYS D 1 206 ? 59.885  -2.404  21.927  1.00 47.89  ? 283 LYS D CD  1 
ATOM   4443 C CE  . LYS D 1 206 ? 58.528  -2.764  22.495  1.00 67.59  ? 283 LYS D CE  1 
ATOM   4444 N NZ  . LYS D 1 206 ? 57.590  -1.604  22.503  1.00 87.07  ? 283 LYS D NZ  1 
ATOM   4445 N N   . LEU D 1 207 ? 61.426  -6.918  20.798  1.00 54.63  ? 284 LEU D N   1 
ATOM   4446 C CA  . LEU D 1 207 ? 60.610  -8.090  20.519  1.00 55.90  ? 284 LEU D CA  1 
ATOM   4447 C C   . LEU D 1 207 ? 59.162  -7.647  20.496  1.00 61.82  ? 284 LEU D C   1 
ATOM   4448 O O   . LEU D 1 207 ? 58.842  -6.689  21.193  1.00 63.12  ? 284 LEU D O   1 
ATOM   4449 C CB  . LEU D 1 207 ? 60.828  -9.164  21.611  1.00 56.25  ? 284 LEU D CB  1 
ATOM   4450 C CG  . LEU D 1 207 ? 62.266  -9.659  21.824  1.00 58.61  ? 284 LEU D CG  1 
ATOM   4451 C CD1 . LEU D 1 207 ? 62.308  -10.727 22.886  1.00 60.20  ? 284 LEU D CD1 1 
ATOM   4452 C CD2 . LEU D 1 207 ? 62.868  -10.192 20.545  1.00 57.66  ? 284 LEU D CD2 1 
ATOM   4453 N N   . LEU D 1 208 ? 58.305  -8.282  19.680  1.00 59.18  ? 285 LEU D N   1 
ATOM   4454 C CA  . LEU D 1 208 ? 56.885  -7.939  19.664  1.00 69.06  ? 285 LEU D CA  1 
ATOM   4455 C C   . LEU D 1 208 ? 56.202  -8.534  20.886  1.00 77.48  ? 285 LEU D C   1 
ATOM   4456 O O   . LEU D 1 208 ? 55.299  -7.873  21.443  1.00 77.82  ? 285 LEU D O   1 
ATOM   4457 C CB  . LEU D 1 208 ? 56.196  -8.404  18.385  1.00 70.86  ? 285 LEU D CB  1 
ATOM   4458 C CG  . LEU D 1 208 ? 56.394  -7.462  17.218  1.00 77.14  ? 285 LEU D CG  1 
ATOM   4459 C CD1 . LEU D 1 208 ? 56.617  -8.211  15.936  1.00 77.57  ? 285 LEU D CD1 1 
ATOM   4460 C CD2 . LEU D 1 208 ? 55.232  -6.507  17.080  1.00 83.75  ? 285 LEU D CD2 1 
ATOM   4461 O OXT . LEU D 1 208 ? 56.636  -9.619  21.333  1.00 95.24  ? 285 LEU D OXT 1 
ATOM   4462 N N   . VAL E 1 65  ? 49.637  -9.821  19.117  1.00 73.64  ? 142 VAL E N   1 
ATOM   4463 C CA  . VAL E 1 65  ? 50.535  -10.988 19.081  1.00 71.46  ? 142 VAL E CA  1 
ATOM   4464 C C   . VAL E 1 65  ? 51.984  -10.694 19.495  1.00 74.27  ? 142 VAL E C   1 
ATOM   4465 O O   . VAL E 1 65  ? 52.629  -9.795  18.942  1.00 73.34  ? 142 VAL E O   1 
ATOM   4466 C CB  . VAL E 1 65  ? 50.478  -11.898 17.829  1.00 73.17  ? 142 VAL E CB  1 
ATOM   4467 C CG1 . VAL E 1 65  ? 50.794  -13.347 18.210  1.00 71.52  ? 142 VAL E CG1 1 
ATOM   4468 C CG2 . VAL E 1 65  ? 49.116  -11.814 17.143  1.00 75.26  ? 142 VAL E CG2 1 
ATOM   4469 N N   . THR E 1 66  ? 52.491  -11.494 20.464  1.00 69.17  ? 143 THR E N   1 
ATOM   4470 C CA  . THR E 1 66  ? 53.830  -11.349 21.034  1.00 65.76  ? 143 THR E CA  1 
ATOM   4471 C C   . THR E 1 66  ? 54.762  -12.531 20.759  1.00 65.77  ? 143 THR E C   1 
ATOM   4472 O O   . THR E 1 66  ? 54.320  -13.623 20.378  1.00 66.14  ? 143 THR E O   1 
ATOM   4473 C CB  . THR E 1 66  ? 53.763  -11.043 22.540  1.00 66.64  ? 143 THR E CB  1 
ATOM   4474 O OG1 . THR E 1 66  ? 53.371  -12.218 23.261  1.00 68.12  ? 143 THR E OG1 1 
ATOM   4475 C CG2 . THR E 1 66  ? 52.887  -9.843  22.871  1.00 61.34  ? 143 THR E CG2 1 
ATOM   4476 N N   . GLN E 1 67  ? 56.062  -12.301 20.997  1.00 57.60  ? 144 GLN E N   1 
ATOM   4477 C CA  . GLN E 1 67  ? 57.114  -13.297 20.858  1.00 54.82  ? 144 GLN E CA  1 
ATOM   4478 C C   . GLN E 1 67  ? 57.429  -13.853 22.250  1.00 57.46  ? 144 GLN E C   1 
ATOM   4479 O O   . GLN E 1 67  ? 58.101  -13.192 23.040  1.00 56.41  ? 144 GLN E O   1 
ATOM   4480 C CB  . GLN E 1 67  ? 58.369  -12.673 20.230  1.00 53.88  ? 144 GLN E CB  1 
ATOM   4481 C CG  . GLN E 1 67  ? 58.289  -12.489 18.738  1.00 51.41  ? 144 GLN E CG  1 
ATOM   4482 C CD  . GLN E 1 67  ? 59.416  -11.643 18.263  1.00 77.91  ? 144 GLN E CD  1 
ATOM   4483 O OE1 . GLN E 1 67  ? 59.365  -10.414 18.352  1.00 75.31  ? 144 GLN E OE1 1 
ATOM   4484 N NE2 . GLN E 1 67  ? 60.455  -12.281 17.737  1.00 77.44  ? 144 GLN E NE2 1 
ATOM   4485 N N   . ASP E 1 68  ? 56.898  -15.044 22.574  1.00 54.36  ? 145 ASP E N   1 
ATOM   4486 C CA  . ASP E 1 68  ? 57.139  -15.681 23.871  1.00 53.81  ? 145 ASP E CA  1 
ATOM   4487 C C   . ASP E 1 68  ? 58.626  -15.963 24.008  1.00 56.21  ? 145 ASP E C   1 
ATOM   4488 O O   . ASP E 1 68  ? 59.282  -16.266 23.018  1.00 56.40  ? 145 ASP E O   1 
ATOM   4489 C CB  . ASP E 1 68  ? 56.327  -16.982 23.986  1.00 56.26  ? 145 ASP E CB  1 
ATOM   4490 C CG  . ASP E 1 68  ? 54.823  -16.794 24.140  1.00 68.04  ? 145 ASP E CG  1 
ATOM   4491 O OD1 . ASP E 1 68  ? 54.368  -15.624 24.185  1.00 68.58  ? 145 ASP E OD1 1 
ATOM   4492 O OD2 . ASP E 1 68  ? 54.102  -17.820 24.270  1.00 74.09  ? 145 ASP E OD2 1 
ATOM   4493 N N   . CYS E 1 69  ? 59.185  -15.792 25.196  1.00 52.10  ? 146 CYS E N   1 
ATOM   4494 C CA  . CYS E 1 69  ? 60.621  -16.041 25.415  1.00 49.92  ? 146 CYS E CA  1 
ATOM   4495 C C   . CYS E 1 69  ? 60.886  -16.481 26.850  1.00 51.97  ? 146 CYS E C   1 
ATOM   4496 O O   . CYS E 1 69  ? 60.102  -16.195 27.766  1.00 51.15  ? 146 CYS E O   1 
ATOM   4497 C CB  . CYS E 1 69  ? 61.446  -14.809 25.068  1.00 49.23  ? 146 CYS E CB  1 
ATOM   4498 S SG  . CYS E 1 69  ? 60.999  -13.343 26.046  1.00 54.22  ? 146 CYS E SG  1 
ATOM   4499 N N   . LEU E 1 70  ? 61.996  -17.194 27.036  1.00 46.76  ? 147 LEU E N   1 
ATOM   4500 C CA  . LEU E 1 70  ? 62.431  -17.669 28.339  1.00 45.81  ? 147 LEU E CA  1 
ATOM   4501 C C   . LEU E 1 70  ? 63.925  -17.590 28.345  1.00 47.16  ? 147 LEU E C   1 
ATOM   4502 O O   . LEU E 1 70  ? 64.574  -18.042 27.388  1.00 45.39  ? 147 LEU E O   1 
ATOM   4503 C CB  . LEU E 1 70  ? 61.986  -19.123 28.584  1.00 46.78  ? 147 LEU E CB  1 
ATOM   4504 C CG  . LEU E 1 70  ? 62.290  -19.668 29.965  1.00 53.00  ? 147 LEU E CG  1 
ATOM   4505 C CD1 . LEU E 1 70  ? 61.097  -20.365 30.542  1.00 55.71  ? 147 LEU E CD1 1 
ATOM   4506 C CD2 . LEU E 1 70  ? 63.504  -20.560 29.947  1.00 51.70  ? 147 LEU E CD2 1 
ATOM   4507 N N   . GLN E 1 71  ? 64.471  -17.007 29.412  1.00 43.27  ? 148 GLN E N   1 
ATOM   4508 C CA  . GLN E 1 71  ? 65.906  -16.934 29.601  1.00 41.53  ? 148 GLN E CA  1 
ATOM   4509 C C   . GLN E 1 71  ? 66.266  -17.475 30.965  1.00 48.19  ? 148 GLN E C   1 
ATOM   4510 O O   . GLN E 1 71  ? 65.581  -17.183 31.971  1.00 49.24  ? 148 GLN E O   1 
ATOM   4511 C CB  . GLN E 1 71  ? 66.415  -15.520 29.439  1.00 41.41  ? 148 GLN E CB  1 
ATOM   4512 C CG  . GLN E 1 71  ? 67.933  -15.441 29.424  1.00 52.48  ? 148 GLN E CG  1 
ATOM   4513 C CD  . GLN E 1 71  ? 68.355  -14.051 29.087  1.00 62.88  ? 148 GLN E CD  1 
ATOM   4514 O OE1 . GLN E 1 71  ? 68.506  -13.704 27.917  1.00 38.12  ? 148 GLN E OE1 1 
ATOM   4515 N NE2 . GLN E 1 71  ? 68.512  -13.213 30.111  1.00 72.83  ? 148 GLN E NE2 1 
ATOM   4516 N N   . LEU E 1 72  ? 67.356  -18.280 30.980  1.00 43.05  ? 149 LEU E N   1 
ATOM   4517 C CA  . LEU E 1 72  ? 67.951  -18.893 32.168  1.00 41.75  ? 149 LEU E CA  1 
ATOM   4518 C C   . LEU E 1 72  ? 69.350  -18.334 32.355  1.00 46.60  ? 149 LEU E C   1 
ATOM   4519 O O   . LEU E 1 72  ? 70.075  -18.118 31.375  1.00 47.81  ? 149 LEU E O   1 
ATOM   4520 C CB  . LEU E 1 72  ? 68.047  -20.414 32.013  1.00 40.62  ? 149 LEU E CB  1 
ATOM   4521 C CG  . LEU E 1 72  ? 66.761  -21.189 31.762  1.00 43.36  ? 149 LEU E CG  1 
ATOM   4522 C CD1 . LEU E 1 72  ? 67.085  -22.597 31.352  1.00 42.84  ? 149 LEU E CD1 1 
ATOM   4523 C CD2 . LEU E 1 72  ? 65.865  -21.182 32.973  1.00 41.79  ? 149 LEU E CD2 1 
ATOM   4524 N N   . ILE E 1 73  ? 69.724  -18.085 33.604  1.00 41.54  ? 150 ILE E N   1 
ATOM   4525 C CA  . ILE E 1 73  ? 71.058  -17.596 33.970  1.00 40.64  ? 150 ILE E CA  1 
ATOM   4526 C C   . ILE E 1 73  ? 71.659  -18.551 35.006  1.00 47.97  ? 150 ILE E C   1 
ATOM   4527 O O   . ILE E 1 73  ? 70.923  -19.141 35.805  1.00 48.17  ? 150 ILE E O   1 
ATOM   4528 C CB  . ILE E 1 73  ? 71.046  -16.113 34.449  1.00 43.04  ? 150 ILE E CB  1 
ATOM   4529 C CG1 . ILE E 1 73  ? 70.123  -15.905 35.681  1.00 43.48  ? 150 ILE E CG1 1 
ATOM   4530 C CG2 . ILE E 1 73  ? 70.680  -15.170 33.287  1.00 43.02  ? 150 ILE E CG2 1 
ATOM   4531 C CD1 . ILE E 1 73  ? 70.292  -14.673 36.395  1.00 42.43  ? 150 ILE E CD1 1 
ATOM   4532 N N   . ALA E 1 74  ? 72.981  -18.732 34.968  1.00 46.45  ? 151 ALA E N   1 
ATOM   4533 C CA  . ALA E 1 74  ? 73.694  -19.626 35.883  1.00 48.28  ? 151 ALA E CA  1 
ATOM   4534 C C   . ALA E 1 74  ? 73.442  -19.314 37.366  1.00 56.99  ? 151 ALA E C   1 
ATOM   4535 O O   . ALA E 1 74  ? 73.436  -18.150 37.785  1.00 57.46  ? 151 ALA E O   1 
ATOM   4536 C CB  . ALA E 1 74  ? 75.181  -19.600 35.584  1.00 48.26  ? 151 ALA E CB  1 
ATOM   4537 N N   . ASP E 1 75  ? 73.195  -20.367 38.153  1.00 57.00  ? 152 ASP E N   1 
ATOM   4538 C CA  . ASP E 1 75  ? 72.964  -20.235 39.592  1.00 58.35  ? 152 ASP E CA  1 
ATOM   4539 C C   . ASP E 1 75  ? 74.312  -20.386 40.313  1.00 65.19  ? 152 ASP E C   1 
ATOM   4540 O O   . ASP E 1 75  ? 74.754  -21.505 40.558  1.00 65.00  ? 152 ASP E O   1 
ATOM   4541 C CB  . ASP E 1 75  ? 71.906  -21.237 40.085  1.00 59.62  ? 152 ASP E CB  1 
ATOM   4542 C CG  . ASP E 1 75  ? 71.682  -21.245 41.577  1.00 72.63  ? 152 ASP E CG  1 
ATOM   4543 O OD1 . ASP E 1 75  ? 72.151  -20.301 42.261  1.00 74.31  ? 152 ASP E OD1 1 
ATOM   4544 O OD2 . ASP E 1 75  ? 71.041  -22.190 42.071  1.00 81.59  ? 152 ASP E OD2 1 
ATOM   4545 N N   . SER E 1 76  ? 74.958  -19.246 40.643  1.00 63.88  ? 153 SER E N   1 
ATOM   4546 C CA  . SER E 1 76  ? 76.250  -19.180 41.346  1.00 64.97  ? 153 SER E CA  1 
ATOM   4547 C C   . SER E 1 76  ? 76.241  -19.843 42.740  1.00 72.25  ? 153 SER E C   1 
ATOM   4548 O O   . SER E 1 76  ? 77.317  -20.117 43.280  1.00 73.64  ? 153 SER E O   1 
ATOM   4549 C CB  . SER E 1 76  ? 76.734  -17.736 41.457  1.00 66.65  ? 153 SER E CB  1 
ATOM   4550 O OG  . SER E 1 76  ? 75.956  -17.025 42.404  1.00 72.10  ? 153 SER E OG  1 
ATOM   4551 N N   . GLU E 1 77  ? 75.046  -20.120 43.309  1.00 68.25  ? 154 GLU E N   1 
ATOM   4552 C CA  . GLU E 1 77  ? 74.942  -20.744 44.636  1.00 69.12  ? 154 GLU E CA  1 
ATOM   4553 C C   . GLU E 1 77  ? 74.811  -22.283 44.585  1.00 70.11  ? 154 GLU E C   1 
ATOM   4554 O O   . GLU E 1 77  ? 74.630  -22.919 45.636  1.00 71.40  ? 154 GLU E O   1 
ATOM   4555 C CB  . GLU E 1 77  ? 73.798  -20.120 45.472  1.00 71.42  ? 154 GLU E CB  1 
ATOM   4556 C CG  . GLU E 1 77  ? 73.776  -18.606 45.629  1.00 76.99  ? 154 GLU E CG  1 
ATOM   4557 C CD  . GLU E 1 77  ? 74.778  -17.935 46.551  1.00 103.12 ? 154 GLU E CD  1 
ATOM   4558 O OE1 . GLU E 1 77  ? 74.696  -18.138 47.787  1.00 97.64  ? 154 GLU E OE1 1 
ATOM   4559 O OE2 . GLU E 1 77  ? 75.568  -17.108 46.040  1.00 100.65 ? 154 GLU E OE2 1 
ATOM   4560 N N   . THR E 1 78  ? 74.910  -22.876 43.387  1.00 62.73  ? 155 THR E N   1 
ATOM   4561 C CA  . THR E 1 78  ? 74.771  -24.319 43.242  1.00 63.21  ? 155 THR E CA  1 
ATOM   4562 C C   . THR E 1 78  ? 75.962  -24.938 42.521  1.00 67.84  ? 155 THR E C   1 
ATOM   4563 O O   . THR E 1 78  ? 76.402  -24.397 41.513  1.00 64.15  ? 155 THR E O   1 
ATOM   4564 C CB  . THR E 1 78  ? 73.413  -24.648 42.594  1.00 69.96  ? 155 THR E CB  1 
ATOM   4565 O OG1 . THR E 1 78  ? 72.378  -24.159 43.453  1.00 74.74  ? 155 THR E OG1 1 
ATOM   4566 C CG2 . THR E 1 78  ? 73.205  -26.149 42.324  1.00 67.03  ? 155 THR E CG2 1 
ATOM   4567 N N   . PRO E 1 79  ? 76.482  -26.102 42.985  1.00 68.62  ? 156 PRO E N   1 
ATOM   4568 C CA  . PRO E 1 79  ? 77.586  -26.741 42.244  1.00 68.10  ? 156 PRO E CA  1 
ATOM   4569 C C   . PRO E 1 79  ? 77.110  -27.301 40.897  1.00 68.66  ? 156 PRO E C   1 
ATOM   4570 O O   . PRO E 1 79  ? 75.965  -27.786 40.806  1.00 67.34  ? 156 PRO E O   1 
ATOM   4571 C CB  . PRO E 1 79  ? 78.043  -27.871 43.196  1.00 71.42  ? 156 PRO E CB  1 
ATOM   4572 C CG  . PRO E 1 79  ? 76.888  -28.166 44.020  1.00 75.88  ? 156 PRO E CG  1 
ATOM   4573 C CD  . PRO E 1 79  ? 76.102  -26.903 44.173  1.00 71.10  ? 156 PRO E CD  1 
ATOM   4574 N N   . THR E 1 80  ? 77.999  -27.260 39.872  1.00 62.90  ? 157 THR E N   1 
ATOM   4575 C CA  . THR E 1 80  ? 77.724  -27.821 38.537  1.00 60.60  ? 157 THR E CA  1 
ATOM   4576 C C   . THR E 1 80  ? 77.300  -29.285 38.659  1.00 63.53  ? 157 THR E C   1 
ATOM   4577 O O   . THR E 1 80  ? 77.782  -30.006 39.538  1.00 65.77  ? 157 THR E O   1 
ATOM   4578 C CB  . THR E 1 80  ? 78.938  -27.709 37.601  1.00 67.07  ? 157 THR E CB  1 
ATOM   4579 O OG1 . THR E 1 80  ? 80.087  -28.338 38.191  1.00 68.58  ? 157 THR E OG1 1 
ATOM   4580 C CG2 . THR E 1 80  ? 79.231  -26.285 37.193  1.00 65.34  ? 157 THR E CG2 1 
ATOM   4581 N N   . ILE E 1 81  ? 76.376  -29.701 37.806  1.00 56.50  ? 158 ILE E N   1 
ATOM   4582 C CA  . ILE E 1 81  ? 75.864  -31.074 37.769  1.00 56.34  ? 158 ILE E CA  1 
ATOM   4583 C C   . ILE E 1 81  ? 76.806  -31.955 36.917  1.00 59.40  ? 158 ILE E C   1 
ATOM   4584 O O   . ILE E 1 81  ? 76.991  -31.701 35.722  1.00 56.84  ? 158 ILE E O   1 
ATOM   4585 C CB  . ILE E 1 81  ? 74.408  -31.068 37.232  1.00 57.87  ? 158 ILE E CB  1 
ATOM   4586 C CG1 . ILE E 1 81  ? 73.508  -30.173 38.105  1.00 59.46  ? 158 ILE E CG1 1 
ATOM   4587 C CG2 . ILE E 1 81  ? 73.854  -32.468 37.099  1.00 56.66  ? 158 ILE E CG2 1 
ATOM   4588 C CD1 . ILE E 1 81  ? 72.856  -29.076 37.402  1.00 67.28  ? 158 ILE E CD1 1 
ATOM   4589 N N   . GLN E 1 82  ? 77.409  -32.977 37.537  1.00 57.49  ? 159 GLN E N   1 
ATOM   4590 C CA  . GLN E 1 82  ? 78.320  -33.859 36.811  1.00 56.76  ? 159 GLN E CA  1 
ATOM   4591 C C   . GLN E 1 82  ? 77.639  -35.183 36.499  1.00 61.15  ? 159 GLN E C   1 
ATOM   4592 O O   . GLN E 1 82  ? 77.460  -35.988 37.381  1.00 62.61  ? 159 GLN E O   1 
ATOM   4593 C CB  . GLN E 1 82  ? 79.671  -34.022 37.536  1.00 59.03  ? 159 GLN E CB  1 
ATOM   4594 C CG  . GLN E 1 82  ? 80.530  -32.751 37.549  1.00 69.26  ? 159 GLN E CG  1 
ATOM   4595 C CD  . GLN E 1 82  ? 81.322  -32.612 38.840  1.00 97.09  ? 159 GLN E CD  1 
ATOM   4596 O OE1 . GLN E 1 82  ? 82.167  -33.463 39.180  1.00 91.39  ? 159 GLN E OE1 1 
ATOM   4597 N NE2 . GLN E 1 82  ? 81.083  -31.519 39.586  1.00 91.00  ? 159 GLN E NE2 1 
ATOM   4598 N N   . LYS E 1 83  ? 77.151  -35.349 35.273  1.00 57.87  ? 160 LYS E N   1 
ATOM   4599 C CA  . LYS E 1 83  ? 76.474  -36.559 34.833  1.00 58.55  ? 160 LYS E CA  1 
ATOM   4600 C C   . LYS E 1 83  ? 77.321  -37.241 33.777  1.00 65.35  ? 160 LYS E C   1 
ATOM   4601 O O   . LYS E 1 83  ? 77.166  -36.998 32.574  1.00 64.17  ? 160 LYS E O   1 
ATOM   4602 C CB  . LYS E 1 83  ? 75.045  -36.262 34.336  1.00 59.36  ? 160 LYS E CB  1 
ATOM   4603 N N   . GLY E 1 84  ? 78.252  -38.059 34.251  1.00 65.40  ? 161 GLY E N   1 
ATOM   4604 C CA  . GLY E 1 84  ? 79.135  -38.860 33.403  1.00 66.00  ? 161 GLY E CA  1 
ATOM   4605 C C   . GLY E 1 84  ? 80.256  -38.089 32.753  1.00 68.54  ? 161 GLY E C   1 
ATOM   4606 O O   . GLY E 1 84  ? 81.010  -37.386 33.439  1.00 67.90  ? 161 GLY E O   1 
ATOM   4607 N N   . SER E 1 85  ? 80.380  -38.223 31.420  1.00 63.94  ? 162 SER E N   1 
ATOM   4608 C CA  . SER E 1 85  ? 81.413  -37.469 30.695  1.00 62.30  ? 162 SER E CA  1 
ATOM   4609 C C   . SER E 1 85  ? 80.982  -36.009 30.454  1.00 61.13  ? 162 SER E C   1 
ATOM   4610 O O   . SER E 1 85  ? 81.755  -35.228 29.905  1.00 59.90  ? 162 SER E O   1 
ATOM   4611 C CB  . SER E 1 85  ? 81.809  -38.161 29.393  1.00 65.71  ? 162 SER E CB  1 
ATOM   4612 O OG  . SER E 1 85  ? 82.979  -38.943 29.591  1.00 74.13  ? 162 SER E OG  1 
ATOM   4613 N N   . TYR E 1 86  ? 79.780  -35.632 30.919  1.00 54.86  ? 163 TYR E N   1 
ATOM   4614 C CA  . TYR E 1 86  ? 79.254  -34.284 30.758  1.00 52.70  ? 163 TYR E CA  1 
ATOM   4615 C C   . TYR E 1 86  ? 79.132  -33.480 32.048  1.00 56.47  ? 163 TYR E C   1 
ATOM   4616 O O   . TYR E 1 86  ? 79.045  -34.046 33.150  1.00 57.98  ? 163 TYR E O   1 
ATOM   4617 C CB  . TYR E 1 86  ? 77.895  -34.318 30.056  1.00 52.10  ? 163 TYR E CB  1 
ATOM   4618 C CG  . TYR E 1 86  ? 77.960  -34.860 28.654  1.00 51.65  ? 163 TYR E CG  1 
ATOM   4619 C CD1 . TYR E 1 86  ? 78.030  -36.229 28.419  1.00 53.93  ? 163 TYR E CD1 1 
ATOM   4620 C CD2 . TYR E 1 86  ? 77.925  -34.010 27.559  1.00 50.87  ? 163 TYR E CD2 1 
ATOM   4621 C CE1 . TYR E 1 86  ? 78.103  -36.738 27.128  1.00 53.22  ? 163 TYR E CE1 1 
ATOM   4622 C CE2 . TYR E 1 86  ? 77.982  -34.508 26.261  1.00 51.95  ? 163 TYR E CE2 1 
ATOM   4623 C CZ  . TYR E 1 86  ? 78.050  -35.878 26.049  1.00 61.95  ? 163 TYR E CZ  1 
ATOM   4624 O OH  . TYR E 1 86  ? 78.098  -36.387 24.771  1.00 65.42  ? 163 TYR E OH  1 
ATOM   4625 N N   . THR E 1 87  ? 79.104  -32.145 31.879  1.00 48.97  ? 164 THR E N   1 
ATOM   4626 C CA  . THR E 1 87  ? 78.900  -31.178 32.937  1.00 48.47  ? 164 THR E CA  1 
ATOM   4627 C C   . THR E 1 87  ? 77.697  -30.319 32.561  1.00 52.02  ? 164 THR E C   1 
ATOM   4628 O O   . THR E 1 87  ? 77.591  -29.842 31.428  1.00 50.73  ? 164 THR E O   1 
ATOM   4629 C CB  . THR E 1 87  ? 80.160  -30.359 33.190  1.00 49.77  ? 164 THR E CB  1 
ATOM   4630 O OG1 . THR E 1 87  ? 81.205  -31.237 33.606  1.00 52.98  ? 164 THR E OG1 1 
ATOM   4631 C CG2 . THR E 1 87  ? 79.948  -29.255 34.235  1.00 44.71  ? 164 THR E CG2 1 
ATOM   4632 N N   . PHE E 1 88  ? 76.793  -30.123 33.522  1.00 49.11  ? 165 PHE E N   1 
ATOM   4633 C CA  . PHE E 1 88  ? 75.591  -29.330 33.334  1.00 47.36  ? 165 PHE E CA  1 
ATOM   4634 C C   . PHE E 1 88  ? 75.568  -28.128 34.249  1.00 53.25  ? 165 PHE E C   1 
ATOM   4635 O O   . PHE E 1 88  ? 75.985  -28.204 35.417  1.00 53.70  ? 165 PHE E O   1 
ATOM   4636 C CB  . PHE E 1 88  ? 74.347  -30.199 33.512  1.00 48.68  ? 165 PHE E CB  1 
ATOM   4637 C CG  . PHE E 1 88  ? 74.211  -31.215 32.416  1.00 48.13  ? 165 PHE E CG  1 
ATOM   4638 C CD1 . PHE E 1 88  ? 73.625  -30.877 31.208  1.00 48.58  ? 165 PHE E CD1 1 
ATOM   4639 C CD2 . PHE E 1 88  ? 74.729  -32.498 32.566  1.00 51.04  ? 165 PHE E CD2 1 
ATOM   4640 C CE1 . PHE E 1 88  ? 73.527  -31.817 30.177  1.00 49.03  ? 165 PHE E CE1 1 
ATOM   4641 C CE2 . PHE E 1 88  ? 74.650  -33.433 31.529  1.00 52.65  ? 165 PHE E CE2 1 
ATOM   4642 C CZ  . PHE E 1 88  ? 74.055  -33.086 30.338  1.00 48.75  ? 165 PHE E CZ  1 
ATOM   4643 N N   . VAL E 1 89  ? 75.115  -26.999 33.698  1.00 49.14  ? 166 VAL E N   1 
ATOM   4644 C CA  . VAL E 1 89  ? 75.058  -25.743 34.445  1.00 49.01  ? 166 VAL E CA  1 
ATOM   4645 C C   . VAL E 1 89  ? 73.783  -25.722 35.269  1.00 55.95  ? 166 VAL E C   1 
ATOM   4646 O O   . VAL E 1 89  ? 72.708  -25.952 34.686  1.00 56.41  ? 166 VAL E O   1 
ATOM   4647 C CB  . VAL E 1 89  ? 75.109  -24.533 33.486  1.00 50.12  ? 166 VAL E CB  1 
ATOM   4648 C CG1 . VAL E 1 89  ? 74.950  -23.214 34.231  1.00 48.96  ? 166 VAL E CG1 1 
ATOM   4649 C CG2 . VAL E 1 89  ? 76.382  -24.552 32.652  1.00 49.39  ? 166 VAL E CG2 1 
ATOM   4650 N N   . PRO E 1 90  ? 73.849  -25.450 36.605  1.00 52.88  ? 167 PRO E N   1 
ATOM   4651 C CA  . PRO E 1 90  ? 72.599  -25.293 37.358  1.00 53.21  ? 167 PRO E CA  1 
ATOM   4652 C C   . PRO E 1 90  ? 71.965  -23.946 36.958  1.00 55.74  ? 167 PRO E C   1 
ATOM   4653 O O   . PRO E 1 90  ? 72.612  -22.903 37.060  1.00 53.69  ? 167 PRO E O   1 
ATOM   4654 C CB  . PRO E 1 90  ? 73.040  -25.356 38.815  1.00 57.00  ? 167 PRO E CB  1 
ATOM   4655 C CG  . PRO E 1 90  ? 74.500  -25.070 38.818  1.00 61.32  ? 167 PRO E CG  1 
ATOM   4656 C CD  . PRO E 1 90  ? 75.035  -25.145 37.438  1.00 55.00  ? 167 PRO E CD  1 
ATOM   4657 N N   . TRP E 1 91  ? 70.734  -23.981 36.413  1.00 52.94  ? 168 TRP E N   1 
ATOM   4658 C CA  . TRP E 1 91  ? 70.051  -22.770 35.950  1.00 52.25  ? 168 TRP E CA  1 
ATOM   4659 C C   . TRP E 1 91  ? 69.139  -22.176 36.967  1.00 56.96  ? 168 TRP E C   1 
ATOM   4660 O O   . TRP E 1 91  ? 68.647  -22.859 37.862  1.00 60.31  ? 168 TRP E O   1 
ATOM   4661 C CB  . TRP E 1 91  ? 69.257  -23.015 34.647  1.00 50.50  ? 168 TRP E CB  1 
ATOM   4662 C CG  . TRP E 1 91  ? 70.096  -23.456 33.490  1.00 50.36  ? 168 TRP E CG  1 
ATOM   4663 C CD1 . TRP E 1 91  ? 70.077  -24.676 32.892  1.00 53.46  ? 168 TRP E CD1 1 
ATOM   4664 C CD2 . TRP E 1 91  ? 71.141  -22.707 32.849  1.00 48.75  ? 168 TRP E CD2 1 
ATOM   4665 N NE1 . TRP E 1 91  ? 71.042  -24.738 31.913  1.00 51.98  ? 168 TRP E NE1 1 
ATOM   4666 C CE2 . TRP E 1 91  ? 71.714  -23.543 31.868  1.00 51.87  ? 168 TRP E CE2 1 
ATOM   4667 C CE3 . TRP E 1 91  ? 71.654  -21.407 33.013  1.00 49.56  ? 168 TRP E CE3 1 
ATOM   4668 C CZ2 . TRP E 1 91  ? 72.770  -23.123 31.049  1.00 49.41  ? 168 TRP E CZ2 1 
ATOM   4669 C CZ3 . TRP E 1 91  ? 72.695  -20.991 32.202  1.00 49.59  ? 168 TRP E CZ3 1 
ATOM   4670 C CH2 . TRP E 1 91  ? 73.238  -21.842 31.229  1.00 49.44  ? 168 TRP E CH2 1 
ATOM   4671 N N   . LEU E 1 92  ? 68.881  -20.900 36.793  1.00 51.70  ? 169 LEU E N   1 
ATOM   4672 C CA  . LEU E 1 92  ? 67.974  -20.089 37.585  1.00 52.92  ? 169 LEU E CA  1 
ATOM   4673 C C   . LEU E 1 92  ? 67.147  -19.319 36.552  1.00 53.66  ? 169 LEU E C   1 
ATOM   4674 O O   . LEU E 1 92  ? 67.701  -18.883 35.542  1.00 52.39  ? 169 LEU E O   1 
ATOM   4675 C CB  . LEU E 1 92  ? 68.811  -19.101 38.383  1.00 54.03  ? 169 LEU E CB  1 
ATOM   4676 C CG  . LEU E 1 92  ? 68.551  -18.978 39.833  1.00 61.86  ? 169 LEU E CG  1 
ATOM   4677 C CD1 . LEU E 1 92  ? 69.702  -18.238 40.453  1.00 62.92  ? 169 LEU E CD1 1 
ATOM   4678 C CD2 . LEU E 1 92  ? 67.256  -18.223 40.088  1.00 68.00  ? 169 LEU E CD2 1 
ATOM   4679 N N   . LEU E 1 93  ? 65.838  -19.195 36.746  1.00 49.93  ? 170 LEU E N   1 
ATOM   4680 C CA  . LEU E 1 93  ? 65.028  -18.492 35.761  1.00 48.94  ? 170 LEU E CA  1 
ATOM   4681 C C   . LEU E 1 93  ? 65.263  -17.013 35.879  1.00 55.17  ? 170 LEU E C   1 
ATOM   4682 O O   . LEU E 1 93  ? 65.103  -16.471 36.971  1.00 57.01  ? 170 LEU E O   1 
ATOM   4683 C CB  . LEU E 1 93  ? 63.533  -18.793 35.911  1.00 50.53  ? 170 LEU E CB  1 
ATOM   4684 C CG  . LEU E 1 93  ? 62.605  -17.961 35.034  1.00 55.83  ? 170 LEU E CG  1 
ATOM   4685 C CD1 . LEU E 1 93  ? 62.416  -18.600 33.676  1.00 55.48  ? 170 LEU E CD1 1 
ATOM   4686 C CD2 . LEU E 1 93  ? 61.283  -17.759 35.688  1.00 60.52  ? 170 LEU E CD2 1 
ATOM   4687 N N   . SER E 1 94  ? 65.594  -16.337 34.770  1.00 51.16  ? 171 SER E N   1 
ATOM   4688 C CA  . SER E 1 94  ? 65.774  -14.891 34.831  1.00 50.44  ? 171 SER E CA  1 
ATOM   4689 C C   . SER E 1 94  ? 64.411  -14.254 34.595  1.00 54.61  ? 171 SER E C   1 
ATOM   4690 O O   . SER E 1 94  ? 63.959  -13.468 35.430  1.00 55.47  ? 171 SER E O   1 
ATOM   4691 C CB  . SER E 1 94  ? 66.800  -14.416 33.813  1.00 51.10  ? 171 SER E CB  1 
ATOM   4692 O OG  . SER E 1 94  ? 66.816  -13.002 33.811  1.00 57.38  ? 171 SER E OG  1 
ATOM   4693 N N   . PHE E 1 95  ? 63.734  -14.663 33.488  1.00 49.32  ? 172 PHE E N   1 
ATOM   4694 C CA  . PHE E 1 95  ? 62.396  -14.218 33.079  1.00 48.18  ? 172 PHE E CA  1 
ATOM   4695 C C   . PHE E 1 95  ? 61.814  -15.139 32.051  1.00 49.97  ? 172 PHE E C   1 
ATOM   4696 O O   . PHE E 1 95  ? 62.540  -15.689 31.220  1.00 49.11  ? 172 PHE E O   1 
ATOM   4697 C CB  . PHE E 1 95  ? 62.358  -12.758 32.585  1.00 48.83  ? 172 PHE E CB  1 
ATOM   4698 C CG  . PHE E 1 95  ? 63.236  -12.458 31.401  1.00 48.04  ? 172 PHE E CG  1 
ATOM   4699 C CD1 . PHE E 1 95  ? 62.800  -12.722 30.105  1.00 49.40  ? 172 PHE E CD1 1 
ATOM   4700 C CD2 . PHE E 1 95  ? 64.498  -11.904 31.576  1.00 49.15  ? 172 PHE E CD2 1 
ATOM   4701 C CE1 . PHE E 1 95  ? 63.623  -12.462 29.016  1.00 48.48  ? 172 PHE E CE1 1 
ATOM   4702 C CE2 . PHE E 1 95  ? 65.316  -11.623 30.480  1.00 49.74  ? 172 PHE E CE2 1 
ATOM   4703 C CZ  . PHE E 1 95  ? 64.871  -11.897 29.211  1.00 46.80  ? 172 PHE E CZ  1 
ATOM   4704 N N   . LYS E 1 96  ? 60.494  -15.305 32.138  1.00 47.06  ? 173 LYS E N   1 
ATOM   4705 C CA  . LYS E 1 96  ? 59.609  -16.118 31.307  1.00 46.40  ? 173 LYS E CA  1 
ATOM   4706 C C   . LYS E 1 96  ? 58.517  -15.160 30.800  1.00 54.36  ? 173 LYS E C   1 
ATOM   4707 O O   . LYS E 1 96  ? 57.985  -14.344 31.559  1.00 59.02  ? 173 LYS E O   1 
ATOM   4708 C CB  . LYS E 1 96  ? 59.021  -17.294 32.136  1.00 47.53  ? 173 LYS E CB  1 
ATOM   4709 C CG  . LYS E 1 96  ? 57.965  -18.119 31.410  1.00 50.54  ? 173 LYS E CG  1 
ATOM   4710 C CD  . LYS E 1 96  ? 57.226  -19.130 32.291  1.00 50.83  ? 173 LYS E CD  1 
ATOM   4711 N N   . ARG E 1 97  ? 58.231  -15.213 29.526  1.00 48.59  ? 174 ARG E N   1 
ATOM   4712 C CA  . ARG E 1 97  ? 57.207  -14.369 28.937  1.00 49.32  ? 174 ARG E CA  1 
ATOM   4713 C C   . ARG E 1 97  ? 56.354  -15.254 28.051  1.00 55.66  ? 174 ARG E C   1 
ATOM   4714 O O   . ARG E 1 97  ? 56.877  -15.919 27.148  1.00 57.38  ? 174 ARG E O   1 
ATOM   4715 C CB  . ARG E 1 97  ? 57.867  -13.244 28.139  1.00 47.73  ? 174 ARG E CB  1 
ATOM   4716 C CG  . ARG E 1 97  ? 56.922  -12.250 27.519  1.00 51.18  ? 174 ARG E CG  1 
ATOM   4717 C CD  . ARG E 1 97  ? 57.670  -11.462 26.479  1.00 50.74  ? 174 ARG E CD  1 
ATOM   4718 N NE  . ARG E 1 97  ? 56.825  -10.397 25.974  1.00 50.63  ? 174 ARG E NE  1 
ATOM   4719 C CZ  . ARG E 1 97  ? 56.789  -10.009 24.712  1.00 60.09  ? 174 ARG E CZ  1 
ATOM   4720 N NH1 . ARG E 1 97  ? 57.577  -10.583 23.810  1.00 37.77  ? 174 ARG E NH1 1 
ATOM   4721 N NH2 . ARG E 1 97  ? 55.982  -9.028  24.341  1.00 57.69  ? 174 ARG E NH2 1 
ATOM   4722 N N   . GLY E 1 98  ? 55.073  -15.312 28.362  1.00 52.25  ? 175 GLY E N   1 
ATOM   4723 C CA  . GLY E 1 98  ? 54.131  -16.111 27.602  1.00 53.19  ? 175 GLY E CA  1 
ATOM   4724 C C   . GLY E 1 98  ? 54.046  -17.564 28.010  1.00 58.59  ? 175 GLY E C   1 
ATOM   4725 O O   . GLY E 1 98  ? 54.545  -17.957 29.071  1.00 58.33  ? 175 GLY E O   1 
ATOM   4726 N N   . SER E 1 99  ? 53.401  -18.360 27.143  1.00 55.89  ? 176 SER E N   1 
ATOM   4727 C CA  . SER E 1 99  ? 53.101  -19.770 27.328  1.00 56.82  ? 176 SER E CA  1 
ATOM   4728 C C   . SER E 1 99  ? 53.999  -20.756 26.609  1.00 61.27  ? 176 SER E C   1 
ATOM   4729 O O   . SER E 1 99  ? 54.147  -21.863 27.119  1.00 63.90  ? 176 SER E O   1 
ATOM   4730 C CB  . SER E 1 99  ? 51.654  -20.048 26.934  1.00 63.13  ? 176 SER E CB  1 
ATOM   4731 O OG  . SER E 1 99  ? 51.311  -19.459 25.688  1.00 76.50  ? 176 SER E OG  1 
ATOM   4732 N N   . ALA E 1 100 ? 54.541  -20.414 25.420  1.00 54.60  ? 177 ALA E N   1 
ATOM   4733 C CA  . ALA E 1 100 ? 55.324  -21.344 24.604  1.00 52.71  ? 177 ALA E CA  1 
ATOM   4734 C C   . ALA E 1 100 ? 56.528  -22.007 25.275  1.00 55.97  ? 177 ALA E C   1 
ATOM   4735 O O   . ALA E 1 100 ? 56.872  -23.141 24.910  1.00 55.26  ? 177 ALA E O   1 
ATOM   4736 C CB  . ALA E 1 100 ? 55.728  -20.697 23.290  1.00 51.69  ? 177 ALA E CB  1 
ATOM   4737 N N   . LEU E 1 101 ? 57.169  -21.319 26.238  1.00 52.02  ? 178 LEU E N   1 
ATOM   4738 C CA  . LEU E 1 101 ? 58.352  -21.885 26.889  1.00 51.35  ? 178 LEU E CA  1 
ATOM   4739 C C   . LEU E 1 101 ? 58.251  -21.907 28.392  1.00 58.08  ? 178 LEU E C   1 
ATOM   4740 O O   . LEU E 1 101 ? 57.707  -20.975 28.984  1.00 59.21  ? 178 LEU E O   1 
ATOM   4741 C CB  . LEU E 1 101 ? 59.652  -21.187 26.436  1.00 48.62  ? 178 LEU E CB  1 
ATOM   4742 C CG  . LEU E 1 101 ? 59.970  -21.223 24.942  1.00 49.28  ? 178 LEU E CG  1 
ATOM   4743 C CD1 . LEU E 1 101 ? 60.831  -20.031 24.554  1.00 47.68  ? 178 LEU E CD1 1 
ATOM   4744 C CD2 . LEU E 1 101 ? 60.590  -22.538 24.541  1.00 47.72  ? 178 LEU E CD2 1 
ATOM   4745 N N   . GLU E 1 102 ? 58.798  -22.979 29.001  1.00 55.67  ? 179 GLU E N   1 
ATOM   4746 C CA  . GLU E 1 102 ? 58.798  -23.247 30.444  1.00 57.40  ? 179 GLU E CA  1 
ATOM   4747 C C   . GLU E 1 102 ? 60.127  -23.819 30.901  1.00 59.88  ? 179 GLU E C   1 
ATOM   4748 O O   . GLU E 1 102 ? 60.845  -24.424 30.112  1.00 58.02  ? 179 GLU E O   1 
ATOM   4749 C CB  . GLU E 1 102 ? 57.728  -24.295 30.778  1.00 61.06  ? 179 GLU E CB  1 
ATOM   4750 C CG  . GLU E 1 102 ? 56.313  -23.768 30.869  1.00 69.50  ? 179 GLU E CG  1 
ATOM   4751 C CD  . GLU E 1 102 ? 55.306  -24.844 31.206  1.00 88.14  ? 179 GLU E CD  1 
ATOM   4752 O OE1 . GLU E 1 102 ? 55.660  -25.806 31.927  1.00 78.57  ? 179 GLU E OE1 1 
ATOM   4753 O OE2 . GLU E 1 102 ? 54.149  -24.711 30.754  1.00 90.46  ? 179 GLU E OE2 1 
ATOM   4754 N N   . GLU E 1 103 ? 60.434  -23.658 32.182  1.00 58.18  ? 180 GLU E N   1 
ATOM   4755 C CA  . GLU E 1 103 ? 61.616  -24.229 32.811  1.00 58.97  ? 180 GLU E CA  1 
ATOM   4756 C C   . GLU E 1 103 ? 61.131  -25.550 33.397  1.00 65.20  ? 180 GLU E C   1 
ATOM   4757 O O   . GLU E 1 103 ? 60.114  -25.589 34.099  1.00 68.47  ? 180 GLU E O   1 
ATOM   4758 C CB  . GLU E 1 103 ? 62.122  -23.305 33.944  1.00 61.76  ? 180 GLU E CB  1 
ATOM   4759 C CG  . GLU E 1 103 ? 63.493  -23.636 34.533  1.00 78.87  ? 180 GLU E CG  1 
ATOM   4760 C CD  . GLU E 1 103 ? 63.640  -24.746 35.570  1.00 119.04 ? 180 GLU E CD  1 
ATOM   4761 O OE1 . GLU E 1 103 ? 62.629  -25.152 36.189  1.00 128.79 ? 180 GLU E OE1 1 
ATOM   4762 O OE2 . GLU E 1 103 ? 64.792  -25.184 35.792  1.00 117.61 ? 180 GLU E OE2 1 
ATOM   4763 N N   . LYS E 1 104 ? 61.827  -26.627 33.108  1.00 60.48  ? 181 LYS E N   1 
ATOM   4764 C CA  . LYS E 1 104 ? 61.474  -27.925 33.669  1.00 62.55  ? 181 LYS E CA  1 
ATOM   4765 C C   . LYS E 1 104 ? 62.741  -28.711 33.907  1.00 68.07  ? 181 LYS E C   1 
ATOM   4766 O O   . LYS E 1 104 ? 63.495  -29.001 32.963  1.00 66.82  ? 181 LYS E O   1 
ATOM   4767 C CB  . LYS E 1 104 ? 60.472  -28.708 32.792  1.00 65.29  ? 181 LYS E CB  1 
ATOM   4768 N N   . GLU E 1 105 ? 63.005  -28.999 35.189  1.00 65.97  ? 182 GLU E N   1 
ATOM   4769 C CA  . GLU E 1 105 ? 64.139  -29.802 35.658  1.00 65.30  ? 182 GLU E CA  1 
ATOM   4770 C C   . GLU E 1 105 ? 65.472  -29.375 35.021  1.00 63.31  ? 182 GLU E C   1 
ATOM   4771 O O   . GLU E 1 105 ? 66.178  -30.229 34.483  1.00 63.83  ? 182 GLU E O   1 
ATOM   4772 C CB  . GLU E 1 105 ? 63.867  -31.321 35.429  1.00 67.56  ? 182 GLU E CB  1 
ATOM   4773 C CG  . GLU E 1 105 ? 62.665  -31.880 36.175  1.00 81.55  ? 182 GLU E CG  1 
ATOM   4774 C CD  . GLU E 1 105 ? 62.314  -33.328 35.890  1.00 108.18 ? 182 GLU E CD  1 
ATOM   4775 O OE1 . GLU E 1 105 ? 62.784  -33.871 34.864  1.00 103.00 ? 182 GLU E OE1 1 
ATOM   4776 O OE2 . GLU E 1 105 ? 61.534  -33.909 36.679  1.00 105.88 ? 182 GLU E OE2 1 
ATOM   4777 N N   . ASN E 1 106 ? 65.787  -28.064 35.035  1.00 54.18  ? 183 ASN E N   1 
ATOM   4778 C CA  . ASN E 1 106 ? 67.013  -27.513 34.450  1.00 51.23  ? 183 ASN E CA  1 
ATOM   4779 C C   . ASN E 1 106 ? 67.110  -27.584 32.914  1.00 53.69  ? 183 ASN E C   1 
ATOM   4780 O O   . ASN E 1 106 ? 68.209  -27.521 32.351  1.00 52.78  ? 183 ASN E O   1 
ATOM   4781 C CB  . ASN E 1 106 ? 68.242  -28.105 35.102  1.00 50.95  ? 183 ASN E CB  1 
ATOM   4782 C CG  . ASN E 1 106 ? 69.126  -27.069 35.703  1.00 85.26  ? 183 ASN E CG  1 
ATOM   4783 O OD1 . ASN E 1 106 ? 68.671  -26.174 36.446  1.00 74.58  ? 183 ASN E OD1 1 
ATOM   4784 N ND2 . ASN E 1 106 ? 70.413  -27.179 35.387  1.00 81.48  ? 183 ASN E ND2 1 
ATOM   4785 N N   . LYS E 1 107 ? 65.965  -27.694 32.240  1.00 49.29  ? 184 LYS E N   1 
ATOM   4786 C CA  . LYS E 1 107 ? 65.873  -27.741 30.786  1.00 46.86  ? 184 LYS E CA  1 
ATOM   4787 C C   . LYS E 1 107 ? 64.780  -26.747 30.350  1.00 50.49  ? 184 LYS E C   1 
ATOM   4788 O O   . LYS E 1 107 ? 63.923  -26.371 31.158  1.00 50.32  ? 184 LYS E O   1 
ATOM   4789 C CB  . LYS E 1 107 ? 65.488  -29.171 30.316  1.00 48.54  ? 184 LYS E CB  1 
ATOM   4790 C CG  . LYS E 1 107 ? 66.460  -30.305 30.666  1.00 42.58  ? 184 LYS E CG  1 
ATOM   4791 C CD  . LYS E 1 107 ? 65.739  -31.657 30.808  1.00 46.47  ? 184 LYS E CD  1 
ATOM   4792 N N   . ILE E 1 108 ? 64.802  -26.331 29.075  1.00 46.72  ? 185 ILE E N   1 
ATOM   4793 C CA  . ILE E 1 108 ? 63.745  -25.482 28.522  1.00 46.78  ? 185 ILE E CA  1 
ATOM   4794 C C   . ILE E 1 108 ? 62.751  -26.435 27.871  1.00 50.62  ? 185 ILE E C   1 
ATOM   4795 O O   . ILE E 1 108 ? 63.133  -27.234 27.026  1.00 48.65  ? 185 ILE E O   1 
ATOM   4796 C CB  . ILE E 1 108 ? 64.246  -24.378 27.542  1.00 48.52  ? 185 ILE E CB  1 
ATOM   4797 C CG1 . ILE E 1 108 ? 65.279  -23.441 28.221  1.00 47.60  ? 185 ILE E CG1 1 
ATOM   4798 C CG2 . ILE E 1 108 ? 63.051  -23.568 27.017  1.00 51.13  ? 185 ILE E CG2 1 
ATOM   4799 C CD1 . ILE E 1 108 ? 65.991  -22.428 27.309  1.00 44.13  ? 185 ILE E CD1 1 
ATOM   4800 N N   . LEU E 1 109 ? 61.500  -26.396 28.315  1.00 49.91  ? 186 LEU E N   1 
ATOM   4801 C CA  . LEU E 1 109 ? 60.448  -27.259 27.804  1.00 50.45  ? 186 LEU E CA  1 
ATOM   4802 C C   . LEU E 1 109 ? 59.601  -26.477 26.810  1.00 54.01  ? 186 LEU E C   1 
ATOM   4803 O O   . LEU E 1 109 ? 59.091  -25.390 27.126  1.00 55.15  ? 186 LEU E O   1 
ATOM   4804 C CB  . LEU E 1 109 ? 59.601  -27.816 28.961  1.00 52.72  ? 186 LEU E CB  1 
ATOM   4805 C CG  . LEU E 1 109 ? 58.290  -28.519 28.593  1.00 58.75  ? 186 LEU E CG  1 
ATOM   4806 C CD1 . LEU E 1 109 ? 58.518  -29.786 27.762  1.00 58.09  ? 186 LEU E CD1 1 
ATOM   4807 C CD2 . LEU E 1 109 ? 57.514  -28.836 29.815  1.00 61.99  ? 186 LEU E CD2 1 
ATOM   4808 N N   . VAL E 1 110 ? 59.472  -27.041 25.605  1.00 47.84  ? 187 VAL E N   1 
ATOM   4809 C CA  . VAL E 1 110 ? 58.707  -26.454 24.508  1.00 46.27  ? 187 VAL E CA  1 
ATOM   4810 C C   . VAL E 1 110 ? 57.223  -26.826 24.702  1.00 52.38  ? 187 VAL E C   1 
ATOM   4811 O O   . VAL E 1 110 ? 56.887  -28.014 24.752  1.00 53.50  ? 187 VAL E O   1 
ATOM   4812 C CB  . VAL E 1 110 ? 59.284  -26.887 23.127  1.00 46.84  ? 187 VAL E CB  1 
ATOM   4813 C CG1 . VAL E 1 110 ? 58.494  -26.285 21.978  1.00 46.65  ? 187 VAL E CG1 1 
ATOM   4814 C CG2 . VAL E 1 110 ? 60.739  -26.500 23.005  1.00 43.66  ? 187 VAL E CG2 1 
ATOM   4815 N N   . LYS E 1 111 ? 56.353  -25.805 24.840  1.00 47.73  ? 188 LYS E N   1 
ATOM   4816 C CA  . LYS E 1 111 ? 54.915  -26.004 25.057  1.00 48.20  ? 188 LYS E CA  1 
ATOM   4817 C C   . LYS E 1 111 ? 54.065  -25.768 23.798  1.00 55.08  ? 188 LYS E C   1 
ATOM   4818 O O   . LYS E 1 111 ? 52.936  -26.253 23.713  1.00 55.60  ? 188 LYS E O   1 
ATOM   4819 C CB  . LYS E 1 111 ? 54.402  -25.194 26.260  1.00 47.90  ? 188 LYS E CB  1 
ATOM   4820 C CG  . LYS E 1 111 ? 54.994  -25.596 27.605  1.00 35.10  ? 188 LYS E CG  1 
ATOM   4821 C CD  . LYS E 1 111 ? 54.610  -26.999 28.079  1.00 51.22  ? 188 LYS E CD  1 
ATOM   4822 C CE  . LYS E 1 111 ? 53.306  -27.154 28.826  1.00 63.73  ? 188 LYS E CE  1 
ATOM   4823 N N   . GLU E 1 112 ? 54.605  -25.030 22.820  1.00 52.59  ? 189 GLU E N   1 
ATOM   4824 C CA  . GLU E 1 112 ? 53.917  -24.777 21.546  1.00 52.59  ? 189 GLU E CA  1 
ATOM   4825 C C   . GLU E 1 112 ? 54.861  -25.133 20.436  1.00 53.59  ? 189 GLU E C   1 
ATOM   4826 O O   . GLU E 1 112 ? 56.044  -24.799 20.540  1.00 53.23  ? 189 GLU E O   1 
ATOM   4827 C CB  . GLU E 1 112 ? 53.506  -23.296 21.416  1.00 53.98  ? 189 GLU E CB  1 
ATOM   4828 C CG  . GLU E 1 112 ? 52.253  -22.944 22.187  1.00 65.94  ? 189 GLU E CG  1 
ATOM   4829 C CD  . GLU E 1 112 ? 52.158  -21.506 22.651  1.00 93.32  ? 189 GLU E CD  1 
ATOM   4830 O OE1 . GLU E 1 112 ? 52.514  -20.599 21.865  1.00 83.47  ? 189 GLU E OE1 1 
ATOM   4831 O OE2 . GLU E 1 112 ? 51.670  -21.285 23.785  1.00 93.14  ? 189 GLU E OE2 1 
ATOM   4832 N N   . THR E 1 113 ? 54.371  -25.792 19.377  1.00 48.38  ? 190 THR E N   1 
ATOM   4833 C CA  . THR E 1 113 ? 55.217  -26.111 18.224  1.00 46.05  ? 190 THR E CA  1 
ATOM   4834 C C   . THR E 1 113 ? 55.439  -24.822 17.442  1.00 48.63  ? 190 THR E C   1 
ATOM   4835 O O   . THR E 1 113 ? 54.501  -24.021 17.322  1.00 50.57  ? 190 THR E O   1 
ATOM   4836 C CB  . THR E 1 113 ? 54.578  -27.191 17.367  1.00 54.83  ? 190 THR E CB  1 
ATOM   4837 O OG1 . THR E 1 113 ? 54.459  -28.366 18.169  1.00 60.50  ? 190 THR E OG1 1 
ATOM   4838 C CG2 . THR E 1 113 ? 55.379  -27.493 16.084  1.00 51.72  ? 190 THR E CG2 1 
ATOM   4839 N N   . GLY E 1 114 ? 56.668  -24.611 16.972  1.00 41.44  ? 191 GLY E N   1 
ATOM   4840 C CA  . GLY E 1 114 ? 56.996  -23.435 16.184  1.00 40.87  ? 191 GLY E CA  1 
ATOM   4841 C C   . GLY E 1 114 ? 58.462  -23.311 15.861  1.00 45.47  ? 191 GLY E C   1 
ATOM   4842 O O   . GLY E 1 114 ? 59.214  -24.270 16.039  1.00 44.25  ? 191 GLY E O   1 
ATOM   4843 N N   . TYR E 1 115 ? 58.869  -22.114 15.376  1.00 43.41  ? 192 TYR E N   1 
ATOM   4844 C CA  . TYR E 1 115 ? 60.265  -21.789 15.067  1.00 42.07  ? 192 TYR E CA  1 
ATOM   4845 C C   . TYR E 1 115 ? 60.811  -20.952 16.207  1.00 43.98  ? 192 TYR E C   1 
ATOM   4846 O O   . TYR E 1 115 ? 60.172  -19.996 16.662  1.00 44.56  ? 192 TYR E O   1 
ATOM   4847 C CB  . TYR E 1 115 ? 60.388  -21.041 13.730  1.00 43.68  ? 192 TYR E CB  1 
ATOM   4848 C CG  . TYR E 1 115 ? 60.170  -21.914 12.515  1.00 46.82  ? 192 TYR E CG  1 
ATOM   4849 C CD1 . TYR E 1 115 ? 58.887  -22.209 12.068  1.00 50.65  ? 192 TYR E CD1 1 
ATOM   4850 C CD2 . TYR E 1 115 ? 61.249  -22.442 11.803  1.00 46.35  ? 192 TYR E CD2 1 
ATOM   4851 C CE1 . TYR E 1 115 ? 58.680  -22.996 10.938  1.00 53.09  ? 192 TYR E CE1 1 
ATOM   4852 C CE2 . TYR E 1 115 ? 61.053  -23.210 10.658  1.00 47.23  ? 192 TYR E CE2 1 
ATOM   4853 C CZ  . TYR E 1 115 ? 59.765  -23.487 10.233  1.00 59.81  ? 192 TYR E CZ  1 
ATOM   4854 O OH  . TYR E 1 115 ? 59.525  -24.245 9.114   1.00 66.59  ? 192 TYR E OH  1 
ATOM   4855 N N   . PHE E 1 116 ? 61.952  -21.348 16.715  1.00 37.67  ? 193 PHE E N   1 
ATOM   4856 C CA  . PHE E 1 116 ? 62.499  -20.651 17.861  1.00 36.62  ? 193 PHE E CA  1 
ATOM   4857 C C   . PHE E 1 116 ? 63.928  -20.224 17.580  1.00 40.83  ? 193 PHE E C   1 
ATOM   4858 O O   . PHE E 1 116 ? 64.685  -20.967 16.937  1.00 40.93  ? 193 PHE E O   1 
ATOM   4859 C CB  . PHE E 1 116 ? 62.440  -21.566 19.130  1.00 38.43  ? 193 PHE E CB  1 
ATOM   4860 C CG  . PHE E 1 116 ? 61.058  -21.999 19.587  1.00 40.56  ? 193 PHE E CG  1 
ATOM   4861 C CD1 . PHE E 1 116 ? 60.391  -23.043 18.958  1.00 43.51  ? 193 PHE E CD1 1 
ATOM   4862 C CD2 . PHE E 1 116 ? 60.422  -21.358 20.641  1.00 43.56  ? 193 PHE E CD2 1 
ATOM   4863 C CE1 . PHE E 1 116 ? 59.093  -23.406 19.344  1.00 45.72  ? 193 PHE E CE1 1 
ATOM   4864 C CE2 . PHE E 1 116 ? 59.135  -21.742 21.045  1.00 47.17  ? 193 PHE E CE2 1 
ATOM   4865 C CZ  . PHE E 1 116 ? 58.477  -22.758 20.389  1.00 45.09  ? 193 PHE E CZ  1 
ATOM   4866 N N   . PHE E 1 117 ? 64.299  -19.027 18.068  1.00 36.15  ? 194 PHE E N   1 
ATOM   4867 C CA  . PHE E 1 117 ? 65.671  -18.542 18.033  1.00 34.28  ? 194 PHE E CA  1 
ATOM   4868 C C   . PHE E 1 117 ? 66.245  -18.961 19.375  1.00 41.35  ? 194 PHE E C   1 
ATOM   4869 O O   . PHE E 1 117 ? 65.734  -18.510 20.419  1.00 43.62  ? 194 PHE E O   1 
ATOM   4870 C CB  . PHE E 1 117 ? 65.747  -17.023 17.874  1.00 34.27  ? 194 PHE E CB  1 
ATOM   4871 C CG  . PHE E 1 117 ? 67.167  -16.500 17.979  1.00 32.75  ? 194 PHE E CG  1 
ATOM   4872 C CD1 . PHE E 1 117 ? 68.058  -16.650 16.931  1.00 32.21  ? 194 PHE E CD1 1 
ATOM   4873 C CD2 . PHE E 1 117 ? 67.592  -15.816 19.113  1.00 34.22  ? 194 PHE E CD2 1 
ATOM   4874 C CE1 . PHE E 1 117 ? 69.351  -16.135 17.015  1.00 32.80  ? 194 PHE E CE1 1 
ATOM   4875 C CE2 . PHE E 1 117 ? 68.882  -15.301 19.193  1.00 36.05  ? 194 PHE E CE2 1 
ATOM   4876 C CZ  . PHE E 1 117 ? 69.754  -15.463 18.139  1.00 32.97  ? 194 PHE E CZ  1 
ATOM   4877 N N   . ILE E 1 118 ? 67.253  -19.864 19.359  1.00 36.69  ? 195 ILE E N   1 
ATOM   4878 C CA  . ILE E 1 118 ? 67.846  -20.415 20.577  1.00 37.31  ? 195 ILE E CA  1 
ATOM   4879 C C   . ILE E 1 118 ? 69.254  -19.929 20.693  1.00 40.67  ? 195 ILE E C   1 
ATOM   4880 O O   . ILE E 1 118 ? 69.977  -19.974 19.706  1.00 40.50  ? 195 ILE E O   1 
ATOM   4881 C CB  . ILE E 1 118 ? 67.759  -21.974 20.585  1.00 41.49  ? 195 ILE E CB  1 
ATOM   4882 C CG1 . ILE E 1 118 ? 66.300  -22.462 20.374  1.00 42.22  ? 195 ILE E CG1 1 
ATOM   4883 C CG2 . ILE E 1 118 ? 68.361  -22.563 21.875  1.00 42.20  ? 195 ILE E CG2 1 
ATOM   4884 C CD1 . ILE E 1 118 ? 66.178  -23.451 19.349  1.00 46.06  ? 195 ILE E CD1 1 
ATOM   4885 N N   . TYR E 1 119 ? 69.658  -19.489 21.898  1.00 37.82  ? 196 TYR E N   1 
ATOM   4886 C CA  . TYR E 1 119 ? 70.987  -18.925 22.195  1.00 35.81  ? 196 TYR E CA  1 
ATOM   4887 C C   . TYR E 1 119 ? 71.539  -19.452 23.514  1.00 41.50  ? 196 TYR E C   1 
ATOM   4888 O O   . TYR E 1 119 ? 70.775  -19.858 24.401  1.00 40.90  ? 196 TYR E O   1 
ATOM   4889 C CB  . TYR E 1 119 ? 70.944  -17.376 22.195  1.00 34.47  ? 196 TYR E CB  1 
ATOM   4890 C CG  . TYR E 1 119 ? 69.996  -16.774 23.212  1.00 36.17  ? 196 TYR E CG  1 
ATOM   4891 C CD1 . TYR E 1 119 ? 68.648  -16.582 22.913  1.00 38.14  ? 196 TYR E CD1 1 
ATOM   4892 C CD2 . TYR E 1 119 ? 70.447  -16.378 24.469  1.00 37.79  ? 196 TYR E CD2 1 
ATOM   4893 C CE1 . TYR E 1 119 ? 67.764  -16.046 23.857  1.00 37.55  ? 196 TYR E CE1 1 
ATOM   4894 C CE2 . TYR E 1 119 ? 69.573  -15.833 25.417  1.00 39.39  ? 196 TYR E CE2 1 
ATOM   4895 C CZ  . TYR E 1 119 ? 68.237  -15.660 25.102  1.00 43.78  ? 196 TYR E CZ  1 
ATOM   4896 O OH  . TYR E 1 119 ? 67.388  -15.148 26.043  1.00 45.40  ? 196 TYR E OH  1 
ATOM   4897 N N   . GLY E 1 120 ? 72.862  -19.416 23.631  1.00 38.88  ? 197 GLY E N   1 
ATOM   4898 C CA  . GLY E 1 120 ? 73.554  -19.868 24.824  1.00 39.05  ? 197 GLY E CA  1 
ATOM   4899 C C   . GLY E 1 120 ? 74.986  -19.397 24.872  1.00 42.68  ? 197 GLY E C   1 
ATOM   4900 O O   . GLY E 1 120 ? 75.670  -19.362 23.837  1.00 43.03  ? 197 GLY E O   1 
ATOM   4901 N N   . GLN E 1 121 ? 75.441  -19.026 26.091  1.00 36.27  ? 198 GLN E N   1 
ATOM   4902 C CA  . GLN E 1 121 ? 76.808  -18.631 26.367  1.00 34.18  ? 198 GLN E CA  1 
ATOM   4903 C C   . GLN E 1 121 ? 77.272  -19.246 27.677  1.00 42.13  ? 198 GLN E C   1 
ATOM   4904 O O   . GLN E 1 121 ? 76.481  -19.377 28.627  1.00 43.92  ? 198 GLN E O   1 
ATOM   4905 C CB  . GLN E 1 121 ? 76.965  -17.120 26.397  1.00 33.91  ? 198 GLN E CB  1 
ATOM   4906 C CG  . GLN E 1 121 ? 78.412  -16.689 26.642  1.00 35.43  ? 198 GLN E CG  1 
ATOM   4907 C CD  . GLN E 1 121 ? 78.595  -15.218 26.566  1.00 43.23  ? 198 GLN E CD  1 
ATOM   4908 O OE1 . GLN E 1 121 ? 78.547  -14.641 25.475  1.00 31.32  ? 198 GLN E OE1 1 
ATOM   4909 N NE2 . GLN E 1 121 ? 78.832  -14.599 27.726  1.00 38.77  ? 198 GLN E NE2 1 
ATOM   4910 N N   . VAL E 1 122 ? 78.566  -19.641 27.717  1.00 37.69  ? 199 VAL E N   1 
ATOM   4911 C CA  . VAL E 1 122 ? 79.235  -20.187 28.898  1.00 37.01  ? 199 VAL E CA  1 
ATOM   4912 C C   . VAL E 1 122 ? 80.612  -19.555 28.933  1.00 41.45  ? 199 VAL E C   1 
ATOM   4913 O O   . VAL E 1 122 ? 81.219  -19.399 27.868  1.00 41.50  ? 199 VAL E O   1 
ATOM   4914 C CB  . VAL E 1 122 ? 79.348  -21.741 28.861  1.00 39.27  ? 199 VAL E CB  1 
ATOM   4915 C CG1 . VAL E 1 122 ? 80.050  -22.282 30.101  1.00 40.95  ? 199 VAL E CG1 1 
ATOM   4916 C CG2 . VAL E 1 122 ? 77.995  -22.407 28.699  1.00 37.70  ? 199 VAL E CG2 1 
ATOM   4917 N N   . LEU E 1 123 ? 81.098  -19.175 30.133  1.00 38.27  ? 200 LEU E N   1 
ATOM   4918 C CA  . LEU E 1 123 ? 82.462  -18.674 30.303  1.00 38.44  ? 200 LEU E CA  1 
ATOM   4919 C C   . LEU E 1 123 ? 83.264  -19.840 30.873  1.00 47.11  ? 200 LEU E C   1 
ATOM   4920 O O   . LEU E 1 123 ? 82.928  -20.384 31.937  1.00 47.18  ? 200 LEU E O   1 
ATOM   4921 C CB  . LEU E 1 123 ? 82.539  -17.463 31.237  1.00 38.23  ? 200 LEU E CB  1 
ATOM   4922 C CG  . LEU E 1 123 ? 83.922  -17.050 31.772  1.00 41.17  ? 200 LEU E CG  1 
ATOM   4923 C CD1 . LEU E 1 123 ? 84.878  -16.711 30.655  1.00 41.04  ? 200 LEU E CD1 1 
ATOM   4924 C CD2 . LEU E 1 123 ? 83.803  -15.864 32.670  1.00 38.25  ? 200 LEU E CD2 1 
ATOM   4925 N N   . TYR E 1 124 ? 84.321  -20.219 30.144  1.00 44.62  ? 201 TYR E N   1 
ATOM   4926 C CA  . TYR E 1 124 ? 85.202  -21.324 30.493  1.00 44.61  ? 201 TYR E CA  1 
ATOM   4927 C C   . TYR E 1 124 ? 86.419  -20.834 31.170  1.00 46.69  ? 201 TYR E C   1 
ATOM   4928 O O   . TYR E 1 124 ? 87.043  -19.884 30.703  1.00 45.11  ? 201 TYR E O   1 
ATOM   4929 C CB  . TYR E 1 124 ? 85.559  -22.153 29.248  1.00 45.48  ? 201 TYR E CB  1 
ATOM   4930 C CG  . TYR E 1 124 ? 84.335  -22.751 28.608  1.00 45.71  ? 201 TYR E CG  1 
ATOM   4931 C CD1 . TYR E 1 124 ? 83.737  -23.889 29.137  1.00 47.94  ? 201 TYR E CD1 1 
ATOM   4932 C CD2 . TYR E 1 124 ? 83.717  -22.128 27.528  1.00 45.40  ? 201 TYR E CD2 1 
ATOM   4933 C CE1 . TYR E 1 124 ? 82.569  -24.409 28.592  1.00 47.65  ? 201 TYR E CE1 1 
ATOM   4934 C CE2 . TYR E 1 124 ? 82.554  -22.643 26.965  1.00 45.66  ? 201 TYR E CE2 1 
ATOM   4935 C CZ  . TYR E 1 124 ? 81.991  -23.789 27.495  1.00 51.56  ? 201 TYR E CZ  1 
ATOM   4936 O OH  . TYR E 1 124 ? 80.839  -24.273 26.951  1.00 47.41  ? 201 TYR E OH  1 
ATOM   4937 N N   . THR E 1 125 ? 86.736  -21.450 32.310  1.00 45.92  ? 202 THR E N   1 
ATOM   4938 C CA  . THR E 1 125 ? 87.930  -21.144 33.119  1.00 47.50  ? 202 THR E CA  1 
ATOM   4939 C C   . THR E 1 125 ? 88.725  -22.427 33.315  1.00 52.91  ? 202 THR E C   1 
ATOM   4940 O O   . THR E 1 125 ? 89.344  -22.621 34.347  1.00 55.58  ? 202 THR E O   1 
ATOM   4941 C CB  . THR E 1 125 ? 87.551  -20.383 34.411  1.00 51.51  ? 202 THR E CB  1 
ATOM   4942 O OG1 . THR E 1 125 ? 86.619  -21.155 35.166  1.00 58.20  ? 202 THR E OG1 1 
ATOM   4943 C CG2 . THR E 1 125 ? 86.965  -19.010 34.131  1.00 42.69  ? 202 THR E CG2 1 
ATOM   4944 N N   . ASP E 1 126 ? 88.689  -23.303 32.305  1.00 49.84  ? 203 ASP E N   1 
ATOM   4945 C CA  . ASP E 1 126 ? 89.303  -24.627 32.283  1.00 51.41  ? 203 ASP E CA  1 
ATOM   4946 C C   . ASP E 1 126 ? 90.561  -24.654 31.404  1.00 58.70  ? 203 ASP E C   1 
ATOM   4947 O O   . ASP E 1 126 ? 90.542  -24.134 30.283  1.00 59.71  ? 203 ASP E O   1 
ATOM   4948 C CB  . ASP E 1 126 ? 88.262  -25.631 31.767  1.00 51.91  ? 203 ASP E CB  1 
ATOM   4949 C CG  . ASP E 1 126 ? 88.494  -27.073 32.172  1.00 64.69  ? 203 ASP E CG  1 
ATOM   4950 O OD1 . ASP E 1 126 ? 89.579  -27.608 31.868  1.00 67.71  ? 203 ASP E OD1 1 
ATOM   4951 O OD2 . ASP E 1 126 ? 87.560  -27.691 32.725  1.00 69.08  ? 203 ASP E OD2 1 
ATOM   4952 N N   . LYS E 1 127 ? 91.646  -25.274 31.902  1.00 55.57  ? 204 LYS E N   1 
ATOM   4953 C CA  . LYS E 1 127 ? 92.920  -25.376 31.181  1.00 55.01  ? 204 LYS E CA  1 
ATOM   4954 C C   . LYS E 1 127 ? 92.915  -26.389 29.985  1.00 55.30  ? 204 LYS E C   1 
ATOM   4955 O O   . LYS E 1 127 ? 93.821  -26.317 29.139  1.00 54.97  ? 204 LYS E O   1 
ATOM   4956 C CB  . LYS E 1 127 ? 94.105  -25.562 32.158  1.00 59.32  ? 204 LYS E CB  1 
ATOM   4957 N N   . THR E 1 128 ? 91.867  -27.263 29.878  1.00 48.76  ? 205 THR E N   1 
ATOM   4958 C CA  . THR E 1 128 ? 91.694  -28.256 28.790  1.00 48.06  ? 205 THR E CA  1 
ATOM   4959 C C   . THR E 1 128 ? 91.855  -27.573 27.429  1.00 50.37  ? 205 THR E C   1 
ATOM   4960 O O   . THR E 1 128 ? 91.231  -26.533 27.217  1.00 50.45  ? 205 THR E O   1 
ATOM   4961 C CB  . THR E 1 128 ? 90.323  -28.956 28.891  1.00 56.07  ? 205 THR E CB  1 
ATOM   4962 O OG1 . THR E 1 128 ? 90.168  -29.547 30.179  1.00 58.02  ? 205 THR E OG1 1 
ATOM   4963 C CG2 . THR E 1 128 ? 90.129  -30.018 27.832  1.00 53.72  ? 205 THR E CG2 1 
ATOM   4964 N N   . TYR E 1 129 ? 92.696  -28.146 26.524  1.00 45.26  ? 206 TYR E N   1 
ATOM   4965 C CA  . TYR E 1 129 ? 93.054  -27.599 25.202  1.00 43.50  ? 206 TYR E CA  1 
ATOM   4966 C C   . TYR E 1 129 ? 91.891  -26.937 24.444  1.00 48.95  ? 206 TYR E C   1 
ATOM   4967 O O   . TYR E 1 129 ? 92.094  -25.925 23.760  1.00 47.64  ? 206 TYR E O   1 
ATOM   4968 C CB  . TYR E 1 129 ? 93.786  -28.636 24.331  1.00 44.25  ? 206 TYR E CB  1 
ATOM   4969 C CG  . TYR E 1 129 ? 92.855  -29.578 23.600  1.00 44.51  ? 206 TYR E CG  1 
ATOM   4970 C CD1 . TYR E 1 129 ? 92.232  -30.625 24.266  1.00 46.67  ? 206 TYR E CD1 1 
ATOM   4971 C CD2 . TYR E 1 129 ? 92.529  -29.371 22.263  1.00 43.97  ? 206 TYR E CD2 1 
ATOM   4972 C CE1 . TYR E 1 129 ? 91.343  -31.470 23.612  1.00 46.86  ? 206 TYR E CE1 1 
ATOM   4973 C CE2 . TYR E 1 129 ? 91.622  -30.195 21.605  1.00 44.09  ? 206 TYR E CE2 1 
ATOM   4974 C CZ  . TYR E 1 129 ? 91.032  -31.248 22.284  1.00 52.95  ? 206 TYR E CZ  1 
ATOM   4975 O OH  . TYR E 1 129 ? 90.142  -32.087 21.656  1.00 51.95  ? 206 TYR E OH  1 
ATOM   4976 N N   . ALA E 1 130 ? 90.681  -27.522 24.568  1.00 45.81  ? 207 ALA E N   1 
ATOM   4977 C CA  . ALA E 1 130 ? 89.457  -27.007 23.966  1.00 43.56  ? 207 ALA E CA  1 
ATOM   4978 C C   . ALA E 1 130 ? 88.282  -27.275 24.896  1.00 47.28  ? 207 ALA E C   1 
ATOM   4979 O O   . ALA E 1 130 ? 88.198  -28.337 25.514  1.00 46.89  ? 207 ALA E O   1 
ATOM   4980 C CB  . ALA E 1 130 ? 89.219  -27.637 22.607  1.00 43.26  ? 207 ALA E CB  1 
ATOM   4981 N N   . MET E 1 131 ? 87.416  -26.272 25.019  1.00 43.77  ? 208 MET E N   1 
ATOM   4982 C CA  . MET E 1 131 ? 86.194  -26.244 25.834  1.00 42.50  ? 208 MET E CA  1 
ATOM   4983 C C   . MET E 1 131 ? 85.058  -25.729 24.958  1.00 42.80  ? 208 MET E C   1 
ATOM   4984 O O   . MET E 1 131 ? 85.291  -25.097 23.935  1.00 41.45  ? 208 MET E O   1 
ATOM   4985 C CB  . MET E 1 131 ? 86.366  -25.318 27.054  1.00 45.09  ? 208 MET E CB  1 
ATOM   4986 C CG  . MET E 1 131 ? 87.288  -25.872 28.135  1.00 49.31  ? 208 MET E CG  1 
ATOM   4987 S SD  . MET E 1 131 ? 86.798  -27.476 28.823  1.00 52.81  ? 208 MET E SD  1 
ATOM   4988 C CE  . MET E 1 131 ? 85.396  -27.032 29.769  1.00 48.39  ? 208 MET E CE  1 
ATOM   4989 N N   . GLY E 1 132 ? 83.848  -26.053 25.330  1.00 39.02  ? 209 GLY E N   1 
ATOM   4990 C CA  . GLY E 1 132 ? 82.681  -25.675 24.553  1.00 38.30  ? 209 GLY E CA  1 
ATOM   4991 C C   . GLY E 1 132 ? 81.442  -26.418 25.003  1.00 42.83  ? 209 GLY E C   1 
ATOM   4992 O O   . GLY E 1 132 ? 81.512  -27.298 25.878  1.00 41.49  ? 209 GLY E O   1 
ATOM   4993 N N   . HIS E 1 133 ? 80.289  -26.039 24.427  1.00 39.19  ? 210 HIS E N   1 
ATOM   4994 C CA  . HIS E 1 133 ? 79.030  -26.655 24.814  1.00 38.73  ? 210 HIS E CA  1 
ATOM   4995 C C   . HIS E 1 133 ? 78.169  -27.025 23.635  1.00 41.57  ? 210 HIS E C   1 
ATOM   4996 O O   . HIS E 1 133 ? 78.421  -26.573 22.502  1.00 39.74  ? 210 HIS E O   1 
ATOM   4997 C CB  . HIS E 1 133 ? 78.265  -25.766 25.798  1.00 39.18  ? 210 HIS E CB  1 
ATOM   4998 C CG  . HIS E 1 133 ? 78.027  -24.374 25.302  1.00 41.58  ? 210 HIS E CG  1 
ATOM   4999 N ND1 . HIS E 1 133 ? 78.959  -23.364 25.493  1.00 43.11  ? 210 HIS E ND1 1 
ATOM   5000 C CD2 . HIS E 1 133 ? 76.969  -23.865 24.628  1.00 43.06  ? 210 HIS E CD2 1 
ATOM   5001 C CE1 . HIS E 1 133 ? 78.434  -22.277 24.951  1.00 41.66  ? 210 HIS E CE1 1 
ATOM   5002 N NE2 . HIS E 1 133 ? 77.248  -22.529 24.396  1.00 41.84  ? 210 HIS E NE2 1 
ATOM   5003 N N   . LEU E 1 134 ? 77.138  -27.845 23.915  1.00 38.61  ? 211 LEU E N   1 
ATOM   5004 C CA  . LEU E 1 134 ? 76.175  -28.288 22.922  1.00 38.40  ? 211 LEU E CA  1 
ATOM   5005 C C   . LEU E 1 134 ? 74.788  -27.843 23.337  1.00 44.24  ? 211 LEU E C   1 
ATOM   5006 O O   . LEU E 1 134 ? 74.411  -28.066 24.490  1.00 45.39  ? 211 LEU E O   1 
ATOM   5007 C CB  . LEU E 1 134 ? 76.179  -29.820 22.787  1.00 39.34  ? 211 LEU E CB  1 
ATOM   5008 C CG  . LEU E 1 134 ? 77.513  -30.577 22.889  1.00 45.02  ? 211 LEU E CG  1 
ATOM   5009 C CD1 . LEU E 1 134 ? 77.293  -32.050 22.926  1.00 45.44  ? 211 LEU E CD1 1 
ATOM   5010 C CD2 . LEU E 1 134 ? 78.411  -30.269 21.743  1.00 47.56  ? 211 LEU E CD2 1 
ATOM   5011 N N   . ILE E 1 135 ? 74.040  -27.191 22.417  1.00 39.59  ? 212 ILE E N   1 
ATOM   5012 C CA  . ILE E 1 135 ? 72.637  -26.844 22.634  1.00 39.18  ? 212 ILE E CA  1 
ATOM   5013 C C   . ILE E 1 135 ? 71.924  -28.046 22.009  1.00 42.81  ? 212 ILE E C   1 
ATOM   5014 O O   . ILE E 1 135 ? 71.946  -28.228 20.789  1.00 41.33  ? 212 ILE E O   1 
ATOM   5015 C CB  . ILE E 1 135 ? 72.195  -25.462 22.076  1.00 41.07  ? 212 ILE E CB  1 
ATOM   5016 C CG1 . ILE E 1 135 ? 72.738  -24.327 22.943  1.00 41.12  ? 212 ILE E CG1 1 
ATOM   5017 C CG2 . ILE E 1 135 ? 70.671  -25.359 21.996  1.00 41.98  ? 212 ILE E CG2 1 
ATOM   5018 C CD1 . ILE E 1 135 ? 72.727  -22.888 22.258  1.00 47.63  ? 212 ILE E CD1 1 
ATOM   5019 N N   . GLN E 1 136 ? 71.382  -28.913 22.876  1.00 39.86  ? 213 GLN E N   1 
ATOM   5020 C CA  . GLN E 1 136 ? 70.741  -30.161 22.489  1.00 39.40  ? 213 GLN E CA  1 
ATOM   5021 C C   . GLN E 1 136 ? 69.242  -30.161 22.570  1.00 40.46  ? 213 GLN E C   1 
ATOM   5022 O O   . GLN E 1 136 ? 68.659  -29.501 23.419  1.00 39.47  ? 213 GLN E O   1 
ATOM   5023 C CB  . GLN E 1 136 ? 71.300  -31.307 23.307  1.00 41.85  ? 213 GLN E CB  1 
ATOM   5024 C CG  . GLN E 1 136 ? 72.807  -31.403 23.198  1.00 53.18  ? 213 GLN E CG  1 
ATOM   5025 C CD  . GLN E 1 136 ? 73.298  -32.630 23.901  1.00 61.04  ? 213 GLN E CD  1 
ATOM   5026 O OE1 . GLN E 1 136 ? 73.100  -32.809 25.115  1.00 43.71  ? 213 GLN E OE1 1 
ATOM   5027 N NE2 . GLN E 1 136 ? 73.946  -33.501 23.141  1.00 49.50  ? 213 GLN E NE2 1 
ATOM   5028 N N   . ARG E 1 137 ? 68.632  -30.957 21.701  1.00 36.47  ? 214 ARG E N   1 
ATOM   5029 C CA  . ARG E 1 137 ? 67.202  -31.131 21.613  1.00 36.56  ? 214 ARG E CA  1 
ATOM   5030 C C   . ARG E 1 137 ? 66.842  -32.560 22.004  1.00 41.54  ? 214 ARG E C   1 
ATOM   5031 O O   . ARG E 1 137 ? 67.305  -33.500 21.353  1.00 40.64  ? 214 ARG E O   1 
ATOM   5032 C CB  . ARG E 1 137 ? 66.739  -30.849 20.180  1.00 31.92  ? 214 ARG E CB  1 
ATOM   5033 C CG  . ARG E 1 137 ? 65.248  -30.940 20.007  1.00 35.23  ? 214 ARG E CG  1 
ATOM   5034 C CD  . ARG E 1 137 ? 64.940  -30.858 18.560  1.00 46.60  ? 214 ARG E CD  1 
ATOM   5035 N NE  . ARG E 1 137 ? 63.531  -31.112 18.278  1.00 51.39  ? 214 ARG E NE  1 
ATOM   5036 C CZ  . ARG E 1 137 ? 63.073  -31.398 17.067  1.00 62.34  ? 214 ARG E CZ  1 
ATOM   5037 N NH1 . ARG E 1 137 ? 63.902  -31.471 16.041  1.00 46.16  ? 214 ARG E NH1 1 
ATOM   5038 N NH2 . ARG E 1 137 ? 61.783  -31.618 16.875  1.00 56.24  ? 214 ARG E NH2 1 
ATOM   5039 N N   . LYS E 1 138 ? 66.019  -32.724 23.066  1.00 39.58  ? 215 LYS E N   1 
ATOM   5040 C CA  . LYS E 1 138 ? 65.548  -34.050 23.457  1.00 41.48  ? 215 LYS E CA  1 
ATOM   5041 C C   . LYS E 1 138 ? 64.197  -34.162 22.789  1.00 47.28  ? 215 LYS E C   1 
ATOM   5042 O O   . LYS E 1 138 ? 63.222  -33.549 23.242  1.00 49.61  ? 215 LYS E O   1 
ATOM   5043 C CB  . LYS E 1 138 ? 65.488  -34.253 24.989  1.00 44.48  ? 215 LYS E CB  1 
ATOM   5044 C CG  . LYS E 1 138 ? 65.111  -35.676 25.432  1.00 46.94  ? 215 LYS E CG  1 
ATOM   5045 N N   . LYS E 1 139 ? 64.177  -34.855 21.640  1.00 41.72  ? 216 LYS E N   1 
ATOM   5046 C CA  . LYS E 1 139 ? 62.996  -35.052 20.801  1.00 41.52  ? 216 LYS E CA  1 
ATOM   5047 C C   . LYS E 1 139 ? 61.900  -35.818 21.557  1.00 50.18  ? 216 LYS E C   1 
ATOM   5048 O O   . LYS E 1 139 ? 62.182  -36.869 22.152  1.00 51.85  ? 216 LYS E O   1 
ATOM   5049 C CB  . LYS E 1 139 ? 63.382  -35.809 19.507  1.00 41.12  ? 216 LYS E CB  1 
ATOM   5050 C CG  . LYS E 1 139 ? 64.156  -34.979 18.484  1.00 31.28  ? 216 LYS E CG  1 
ATOM   5051 C CD  . LYS E 1 139 ? 65.152  -35.798 17.638  1.00 39.07  ? 216 LYS E CD  1 
ATOM   5052 C CE  . LYS E 1 139 ? 64.658  -36.332 16.311  1.00 56.61  ? 216 LYS E CE  1 
ATOM   5053 N NZ  . LYS E 1 139 ? 63.981  -37.666 16.411  1.00 76.84  ? 216 LYS E NZ  1 
ATOM   5054 N N   . VAL E 1 140 ? 60.651  -35.302 21.541  1.00 47.53  ? 217 VAL E N   1 
ATOM   5055 C CA  . VAL E 1 140 ? 59.540  -36.023 22.171  1.00 49.20  ? 217 VAL E CA  1 
ATOM   5056 C C   . VAL E 1 140 ? 59.191  -37.311 21.365  1.00 58.02  ? 217 VAL E C   1 
ATOM   5057 O O   . VAL E 1 140 ? 58.782  -38.321 21.962  1.00 62.72  ? 217 VAL E O   1 
ATOM   5058 C CB  . VAL E 1 140 ? 58.322  -35.130 22.551  1.00 52.00  ? 217 VAL E CB  1 
ATOM   5059 C CG1 . VAL E 1 140 ? 57.641  -34.511 21.344  1.00 50.12  ? 217 VAL E CG1 1 
ATOM   5060 C CG2 . VAL E 1 140 ? 57.329  -35.894 23.415  1.00 54.51  ? 217 VAL E CG2 1 
ATOM   5061 N N   . HIS E 1 141 ? 59.472  -37.294 20.039  1.00 50.66  ? 218 HIS E N   1 
ATOM   5062 C CA  . HIS E 1 141 ? 59.247  -38.384 19.102  1.00 50.83  ? 218 HIS E CA  1 
ATOM   5063 C C   . HIS E 1 141 ? 60.518  -38.758 18.362  1.00 51.34  ? 218 HIS E C   1 
ATOM   5064 O O   . HIS E 1 141 ? 61.235  -37.887 17.862  1.00 52.71  ? 218 HIS E O   1 
ATOM   5065 C CB  . HIS E 1 141 ? 58.236  -37.944 18.042  1.00 53.20  ? 218 HIS E CB  1 
ATOM   5066 C CG  . HIS E 1 141 ? 56.899  -37.573 18.579  1.00 59.76  ? 218 HIS E CG  1 
ATOM   5067 N ND1 . HIS E 1 141 ? 56.084  -36.675 17.903  1.00 61.86  ? 218 HIS E ND1 1 
ATOM   5068 C CD2 . HIS E 1 141 ? 56.265  -38.002 19.705  1.00 64.41  ? 218 HIS E CD2 1 
ATOM   5069 C CE1 . HIS E 1 141 ? 54.977  -36.609 18.625  1.00 63.96  ? 218 HIS E CE1 1 
ATOM   5070 N NE2 . HIS E 1 141 ? 55.036  -37.402 19.715  1.00 65.53  ? 218 HIS E NE2 1 
ATOM   5071 N N   . VAL E 1 142 ? 60.781  -40.049 18.232  1.00 42.92  ? 219 VAL E N   1 
ATOM   5072 C CA  . VAL E 1 142 ? 61.944  -40.542 17.492  1.00 38.64  ? 219 VAL E CA  1 
ATOM   5073 C C   . VAL E 1 142 ? 61.430  -41.566 16.508  1.00 38.30  ? 219 VAL E C   1 
ATOM   5074 O O   . VAL E 1 142 ? 60.541  -42.359 16.840  1.00 37.23  ? 219 VAL E O   1 
ATOM   5075 C CB  . VAL E 1 142 ? 63.002  -41.170 18.430  1.00 42.79  ? 219 VAL E CB  1 
ATOM   5076 C CG1 . VAL E 1 142 ? 64.335  -41.369 17.723  1.00 40.80  ? 219 VAL E CG1 1 
ATOM   5077 C CG2 . VAL E 1 142 ? 63.193  -40.322 19.667  1.00 43.07  ? 219 VAL E CG2 1 
ATOM   5078 N N   . PHE E 1 143 ? 62.004  -41.584 15.307  1.00 33.29  ? 220 PHE E N   1 
ATOM   5079 C CA  . PHE E 1 143 ? 61.591  -42.539 14.289  1.00 33.36  ? 220 PHE E CA  1 
ATOM   5080 C C   . PHE E 1 143 ? 62.769  -43.280 13.717  1.00 36.98  ? 220 PHE E C   1 
ATOM   5081 O O   . PHE E 1 143 ? 63.832  -42.693 13.540  1.00 36.54  ? 220 PHE E O   1 
ATOM   5082 C CB  . PHE E 1 143 ? 60.760  -41.827 13.219  1.00 34.55  ? 220 PHE E CB  1 
ATOM   5083 C CG  . PHE E 1 143 ? 59.445  -41.303 13.762  1.00 35.99  ? 220 PHE E CG  1 
ATOM   5084 C CD1 . PHE E 1 143 ? 58.361  -42.165 13.976  1.00 40.47  ? 220 PHE E CD1 1 
ATOM   5085 C CD2 . PHE E 1 143 ? 59.303  -39.966 14.114  1.00 34.70  ? 220 PHE E CD2 1 
ATOM   5086 C CE1 . PHE E 1 143 ? 57.165  -41.688 14.530  1.00 41.07  ? 220 PHE E CE1 1 
ATOM   5087 C CE2 . PHE E 1 143 ? 58.108  -39.498 14.684  1.00 37.65  ? 220 PHE E CE2 1 
ATOM   5088 C CZ  . PHE E 1 143 ? 57.045  -40.356 14.872  1.00 37.39  ? 220 PHE E CZ  1 
ATOM   5089 N N   . GLY E 1 144 ? 62.588  -44.572 13.491  1.00 34.97  ? 221 GLY E N   1 
ATOM   5090 C CA  . GLY E 1 144 ? 63.615  -45.465 12.971  1.00 36.94  ? 221 GLY E CA  1 
ATOM   5091 C C   . GLY E 1 144 ? 65.003  -45.245 13.534  1.00 46.82  ? 221 GLY E C   1 
ATOM   5092 O O   . GLY E 1 144 ? 65.172  -45.199 14.754  1.00 49.10  ? 221 GLY E O   1 
ATOM   5093 N N   . ASP E 1 145 ? 65.997  -45.036 12.649  1.00 44.77  ? 222 ASP E N   1 
ATOM   5094 C CA  . ASP E 1 145 ? 67.404  -44.877 13.042  1.00 44.97  ? 222 ASP E CA  1 
ATOM   5095 C C   . ASP E 1 145 ? 67.829  -43.530 13.658  1.00 50.42  ? 222 ASP E C   1 
ATOM   5096 O O   . ASP E 1 145 ? 68.981  -43.405 14.086  1.00 50.49  ? 222 ASP E O   1 
ATOM   5097 C CB  . ASP E 1 145 ? 68.384  -45.400 11.968  1.00 46.49  ? 222 ASP E CB  1 
ATOM   5098 C CG  . ASP E 1 145 ? 68.317  -44.711 10.602  1.00 60.08  ? 222 ASP E CG  1 
ATOM   5099 O OD1 . ASP E 1 145 ? 67.871  -43.541 10.540  1.00 60.57  ? 222 ASP E OD1 1 
ATOM   5100 O OD2 . ASP E 1 145 ? 68.741  -45.333 9.602   1.00 66.85  ? 222 ASP E OD2 1 
ATOM   5101 N N   . GLU E 1 146 ? 66.904  -42.556 13.774  1.00 46.98  ? 223 GLU E N   1 
ATOM   5102 C CA  . GLU E 1 146 ? 67.189  -41.251 14.401  1.00 45.85  ? 223 GLU E CA  1 
ATOM   5103 C C   . GLU E 1 146 ? 67.621  -41.404 15.872  1.00 51.95  ? 223 GLU E C   1 
ATOM   5104 O O   . GLU E 1 146 ? 67.253  -42.384 16.512  1.00 53.30  ? 223 GLU E O   1 
ATOM   5105 C CB  . GLU E 1 146 ? 65.909  -40.401 14.457  1.00 46.85  ? 223 GLU E CB  1 
ATOM   5106 C CG  . GLU E 1 146 ? 65.413  -39.768 13.181  1.00 57.22  ? 223 GLU E CG  1 
ATOM   5107 C CD  . GLU E 1 146 ? 64.151  -38.956 13.429  1.00 83.37  ? 223 GLU E CD  1 
ATOM   5108 O OE1 . GLU E 1 146 ? 63.317  -39.368 14.274  1.00 45.00  ? 223 GLU E OE1 1 
ATOM   5109 O OE2 . GLU E 1 146 ? 64.034  -37.864 12.824  1.00 87.65  ? 223 GLU E OE2 1 
ATOM   5110 N N   . LEU E 1 147 ? 68.291  -40.390 16.423  1.00 50.02  ? 224 LEU E N   1 
ATOM   5111 C CA  . LEU E 1 147 ? 68.616  -40.327 17.843  1.00 52.15  ? 224 LEU E CA  1 
ATOM   5112 C C   . LEU E 1 147 ? 67.580  -39.456 18.557  1.00 56.07  ? 224 LEU E C   1 
ATOM   5113 O O   . LEU E 1 147 ? 67.092  -38.500 17.967  1.00 55.70  ? 224 LEU E O   1 
ATOM   5114 C CB  . LEU E 1 147 ? 69.998  -39.702 18.069  1.00 52.20  ? 224 LEU E CB  1 
ATOM   5115 C CG  . LEU E 1 147 ? 71.240  -40.514 17.670  1.00 58.31  ? 224 LEU E CG  1 
ATOM   5116 C CD1 . LEU E 1 147 ? 72.467  -39.700 17.914  1.00 57.55  ? 224 LEU E CD1 1 
ATOM   5117 C CD2 . LEU E 1 147 ? 71.377  -41.821 18.471  1.00 63.60  ? 224 LEU E CD2 1 
ATOM   5118 N N   . SER E 1 148 ? 67.297  -39.750 19.838  1.00 52.95  ? 225 SER E N   1 
ATOM   5119 C CA  . SER E 1 148 ? 66.380  -38.984 20.685  1.00 52.72  ? 225 SER E CA  1 
ATOM   5120 C C   . SER E 1 148 ? 66.984  -37.620 21.046  1.00 53.48  ? 225 SER E C   1 
ATOM   5121 O O   . SER E 1 148 ? 66.258  -36.627 21.139  1.00 52.45  ? 225 SER E O   1 
ATOM   5122 C CB  . SER E 1 148 ? 66.095  -39.764 21.965  1.00 58.39  ? 225 SER E CB  1 
ATOM   5123 O OG  . SER E 1 148 ? 64.886  -39.345 22.572  1.00 69.92  ? 225 SER E OG  1 
ATOM   5124 N N   . LEU E 1 149 ? 68.316  -37.590 21.289  1.00 46.97  ? 226 LEU E N   1 
ATOM   5125 C CA  . LEU E 1 149 ? 69.057  -36.393 21.643  1.00 44.11  ? 226 LEU E CA  1 
ATOM   5126 C C   . LEU E 1 149 ? 69.922  -35.980 20.492  1.00 48.83  ? 226 LEU E C   1 
ATOM   5127 O O   . LEU E 1 149 ? 70.723  -36.793 20.010  1.00 50.48  ? 226 LEU E O   1 
ATOM   5128 C CB  . LEU E 1 149 ? 69.909  -36.660 22.867  1.00 44.04  ? 226 LEU E CB  1 
ATOM   5129 C CG  . LEU E 1 149 ? 70.356  -35.458 23.657  1.00 46.23  ? 226 LEU E CG  1 
ATOM   5130 C CD1 . LEU E 1 149 ? 69.189  -34.843 24.433  1.00 45.89  ? 226 LEU E CD1 1 
ATOM   5131 C CD2 . LEU E 1 149 ? 71.467  -35.849 24.589  1.00 46.06  ? 226 LEU E CD2 1 
ATOM   5132 N N   . VAL E 1 150 ? 69.750  -34.725 20.036  1.00 42.89  ? 227 VAL E N   1 
ATOM   5133 C CA  . VAL E 1 150 ? 70.488  -34.181 18.913  1.00 41.01  ? 227 VAL E CA  1 
ATOM   5134 C C   . VAL E 1 150 ? 71.103  -32.838 19.231  1.00 45.27  ? 227 VAL E C   1 
ATOM   5135 O O   . VAL E 1 150 ? 70.494  -32.009 19.908  1.00 45.46  ? 227 VAL E O   1 
ATOM   5136 C CB  . VAL E 1 150 ? 69.650  -34.149 17.637  1.00 45.42  ? 227 VAL E CB  1 
ATOM   5137 C CG1 . VAL E 1 150 ? 69.285  -35.570 17.209  1.00 47.21  ? 227 VAL E CG1 1 
ATOM   5138 C CG2 . VAL E 1 150 ? 68.402  -33.263 17.796  1.00 45.28  ? 227 VAL E CG2 1 
ATOM   5139 N N   . THR E 1 151 ? 72.314  -32.617 18.735  1.00 41.16  ? 228 THR E N   1 
ATOM   5140 C CA  . THR E 1 151 ? 73.014  -31.365 18.940  1.00 39.96  ? 228 THR E CA  1 
ATOM   5141 C C   . THR E 1 151 ? 72.571  -30.412 17.865  1.00 44.95  ? 228 THR E C   1 
ATOM   5142 O O   . THR E 1 151 ? 72.780  -30.685 16.685  1.00 47.11  ? 228 THR E O   1 
ATOM   5143 C CB  . THR E 1 151 ? 74.522  -31.601 18.956  1.00 49.91  ? 228 THR E CB  1 
ATOM   5144 O OG1 . THR E 1 151 ? 74.842  -32.603 19.948  1.00 50.75  ? 228 THR E OG1 1 
ATOM   5145 C CG2 . THR E 1 151 ? 75.301  -30.313 19.197  1.00 47.21  ? 228 THR E CG2 1 
ATOM   5146 N N   . LEU E 1 152 ? 71.912  -29.323 18.258  1.00 39.84  ? 229 LEU E N   1 
ATOM   5147 C CA  . LEU E 1 152 ? 71.455  -28.274 17.338  1.00 36.67  ? 229 LEU E CA  1 
ATOM   5148 C C   . LEU E 1 152 ? 72.613  -27.375 16.980  1.00 38.93  ? 229 LEU E C   1 
ATOM   5149 O O   . LEU E 1 152 ? 72.906  -27.228 15.792  1.00 38.87  ? 229 LEU E O   1 
ATOM   5150 C CB  . LEU E 1 152 ? 70.301  -27.454 17.938  1.00 36.06  ? 229 LEU E CB  1 
ATOM   5151 C CG  . LEU E 1 152 ? 68.964  -28.191 18.097  1.00 40.01  ? 229 LEU E CG  1 
ATOM   5152 C CD1 . LEU E 1 152 ? 67.991  -27.393 18.919  1.00 38.90  ? 229 LEU E CD1 1 
ATOM   5153 C CD2 . LEU E 1 152 ? 68.335  -28.450 16.773  1.00 42.16  ? 229 LEU E CD2 1 
ATOM   5154 N N   . PHE E 1 153 ? 73.294  -26.794 18.009  1.00 34.38  ? 230 PHE E N   1 
ATOM   5155 C CA  . PHE E 1 153 ? 74.439  -25.890 17.854  1.00 33.44  ? 230 PHE E CA  1 
ATOM   5156 C C   . PHE E 1 153 ? 75.525  -26.278 18.812  1.00 39.96  ? 230 PHE E C   1 
ATOM   5157 O O   . PHE E 1 153 ? 75.225  -26.693 19.930  1.00 43.07  ? 230 PHE E O   1 
ATOM   5158 C CB  . PHE E 1 153 ? 74.038  -24.415 18.065  1.00 35.04  ? 230 PHE E CB  1 
ATOM   5159 C CG  . PHE E 1 153 ? 72.712  -24.096 17.426  1.00 37.94  ? 230 PHE E CG  1 
ATOM   5160 C CD1 . PHE E 1 153 ? 72.591  -24.025 16.036  1.00 41.81  ? 230 PHE E CD1 1 
ATOM   5161 C CD2 . PHE E 1 153 ? 71.556  -23.989 18.202  1.00 41.55  ? 230 PHE E CD2 1 
ATOM   5162 C CE1 . PHE E 1 153 ? 71.344  -23.816 15.435  1.00 43.73  ? 230 PHE E CE1 1 
ATOM   5163 C CE2 . PHE E 1 153 ? 70.315  -23.752 17.606  1.00 45.51  ? 230 PHE E CE2 1 
ATOM   5164 C CZ  . PHE E 1 153 ? 70.215  -23.680 16.224  1.00 44.16  ? 230 PHE E CZ  1 
ATOM   5165 N N   . ARG E 1 154 ? 76.789  -26.136 18.391  1.00 35.20  ? 231 ARG E N   1 
ATOM   5166 C CA  . ARG E 1 154 ? 77.979  -26.461 19.167  1.00 35.25  ? 231 ARG E CA  1 
ATOM   5167 C C   . ARG E 1 154 ? 79.043  -25.345 19.024  1.00 41.74  ? 231 ARG E C   1 
ATOM   5168 O O   . ARG E 1 154 ? 79.233  -24.835 17.916  1.00 42.70  ? 231 ARG E O   1 
ATOM   5169 C CB  . ARG E 1 154 ? 78.470  -27.853 18.697  1.00 35.07  ? 231 ARG E CB  1 
ATOM   5170 C CG  . ARG E 1 154 ? 79.915  -28.236 18.986  1.00 47.04  ? 231 ARG E CG  1 
ATOM   5171 C CD  . ARG E 1 154 ? 80.179  -29.722 18.760  1.00 44.00  ? 231 ARG E CD  1 
ATOM   5172 N NE  . ARG E 1 154 ? 79.966  -30.142 17.374  1.00 44.69  ? 231 ARG E NE  1 
ATOM   5173 C CZ  . ARG E 1 154 ? 80.935  -30.522 16.539  1.00 58.38  ? 231 ARG E CZ  1 
ATOM   5174 N NH1 . ARG E 1 154 ? 82.203  -30.551 16.946  1.00 38.88  ? 231 ARG E NH1 1 
ATOM   5175 N NH2 . ARG E 1 154 ? 80.644  -30.879 15.291  1.00 42.54  ? 231 ARG E NH2 1 
ATOM   5176 N N   . CYS E 1 155 ? 79.657  -24.914 20.161  1.00 39.04  ? 232 CYS E N   1 
ATOM   5177 C CA  . CYS E 1 155 ? 80.748  -23.908 20.310  1.00 38.32  ? 232 CYS E CA  1 
ATOM   5178 C C   . CYS E 1 155 ? 81.991  -24.701 20.574  1.00 43.83  ? 232 CYS E C   1 
ATOM   5179 O O   . CYS E 1 155 ? 81.924  -25.693 21.320  1.00 45.74  ? 232 CYS E O   1 
ATOM   5180 C CB  . CYS E 1 155 ? 80.536  -23.030 21.545  1.00 38.22  ? 232 CYS E CB  1 
ATOM   5181 S SG  A CYS E 1 155 ? 80.379  -21.267 21.205  0.30 41.11  ? 232 CYS E SG  1 
ATOM   5182 S SG  B CYS E 1 155 ? 78.877  -22.441 21.793  0.58 41.33  ? 232 CYS E SG  1 
ATOM   5183 N N   . ILE E 1 156 ? 83.136  -24.125 20.241  1.00 38.19  ? 233 ILE E N   1 
ATOM   5184 C CA  . ILE E 1 156 ? 84.421  -24.648 20.658  1.00 39.32  ? 233 ILE E CA  1 
ATOM   5185 C C   . ILE E 1 156 ? 85.342  -23.433 20.805  1.00 43.72  ? 233 ILE E C   1 
ATOM   5186 O O   . ILE E 1 156 ? 85.318  -22.516 19.976  1.00 41.02  ? 233 ILE E O   1 
ATOM   5187 C CB  . ILE E 1 156 ? 85.044  -25.818 19.803  1.00 43.20  ? 233 ILE E CB  1 
ATOM   5188 C CG1 . ILE E 1 156 ? 84.028  -26.975 19.531  1.00 44.04  ? 233 ILE E CG1 1 
ATOM   5189 C CG2 . ILE E 1 156 ? 86.319  -26.375 20.473  1.00 44.39  ? 233 ILE E CG2 1 
ATOM   5190 C CD1 . ILE E 1 156 ? 84.435  -28.052 18.521  1.00 50.49  ? 233 ILE E CD1 1 
ATOM   5191 N N   . GLN E 1 157 ? 86.104  -23.416 21.905  1.00 42.07  ? 234 GLN E N   1 
ATOM   5192 C CA  . GLN E 1 157 ? 87.105  -22.425 22.207  1.00 41.76  ? 234 GLN E CA  1 
ATOM   5193 C C   . GLN E 1 157 ? 88.339  -23.163 22.672  1.00 47.29  ? 234 GLN E C   1 
ATOM   5194 O O   . GLN E 1 157 ? 88.251  -23.987 23.596  1.00 49.53  ? 234 GLN E O   1 
ATOM   5195 C CB  . GLN E 1 157 ? 86.638  -21.471 23.323  1.00 42.67  ? 234 GLN E CB  1 
ATOM   5196 C CG  . GLN E 1 157 ? 85.767  -20.294 22.888  1.00 42.92  ? 234 GLN E CG  1 
ATOM   5197 C CD  . GLN E 1 157 ? 86.357  -19.408 21.823  1.00 51.51  ? 234 GLN E CD  1 
ATOM   5198 O OE1 . GLN E 1 157 ? 86.152  -19.613 20.623  1.00 51.60  ? 234 GLN E OE1 1 
ATOM   5199 N NE2 . GLN E 1 157 ? 87.048  -18.371 22.226  1.00 41.59  ? 234 GLN E NE2 1 
ATOM   5200 N N   . ASN E 1 158 ? 89.502  -22.853 22.072  1.00 41.48  ? 235 ASN E N   1 
ATOM   5201 C CA  . ASN E 1 158 ? 90.748  -23.413 22.566  1.00 41.31  ? 235 ASN E CA  1 
ATOM   5202 C C   . ASN E 1 158 ? 91.042  -22.607 23.839  1.00 48.68  ? 235 ASN E C   1 
ATOM   5203 O O   . ASN E 1 158 ? 90.581  -21.458 23.973  1.00 48.42  ? 235 ASN E O   1 
ATOM   5204 C CB  . ASN E 1 158 ? 91.858  -23.228 21.565  1.00 37.16  ? 235 ASN E CB  1 
ATOM   5205 C CG  . ASN E 1 158 ? 91.891  -24.204 20.430  1.00 54.27  ? 235 ASN E CG  1 
ATOM   5206 O OD1 . ASN E 1 158 ? 91.909  -23.805 19.264  1.00 45.71  ? 235 ASN E OD1 1 
ATOM   5207 N ND2 . ASN E 1 158 ? 92.011  -25.494 20.740  1.00 46.88  ? 235 ASN E ND2 1 
ATOM   5208 N N   . MET E 1 159 ? 91.749  -23.213 24.797  1.00 47.26  ? 236 MET E N   1 
ATOM   5209 C CA  . MET E 1 159 ? 92.073  -22.534 26.054  1.00 46.61  ? 236 MET E CA  1 
ATOM   5210 C C   . MET E 1 159 ? 93.595  -22.467 26.280  1.00 51.86  ? 236 MET E C   1 
ATOM   5211 O O   . MET E 1 159 ? 94.302  -23.416 25.906  1.00 52.48  ? 236 MET E O   1 
ATOM   5212 C CB  . MET E 1 159 ? 91.425  -23.269 27.232  1.00 48.64  ? 236 MET E CB  1 
ATOM   5213 C CG  . MET E 1 159 ? 89.937  -23.584 27.036  1.00 49.72  ? 236 MET E CG  1 
ATOM   5214 S SD  . MET E 1 159 ? 88.834  -22.153 26.975  1.00 50.25  ? 236 MET E SD  1 
ATOM   5215 C CE  . MET E 1 159 ? 89.105  -21.469 28.588  1.00 47.68  ? 236 MET E CE  1 
ATOM   5216 N N   . PRO E 1 160 ? 94.116  -21.390 26.921  1.00 47.80  ? 237 PRO E N   1 
ATOM   5217 C CA  . PRO E 1 160 ? 95.550  -21.346 27.219  1.00 49.89  ? 237 PRO E CA  1 
ATOM   5218 C C   . PRO E 1 160 ? 95.875  -22.052 28.555  1.00 59.54  ? 237 PRO E C   1 
ATOM   5219 O O   . PRO E 1 160 ? 94.989  -22.223 29.409  1.00 58.93  ? 237 PRO E O   1 
ATOM   5220 C CB  . PRO E 1 160 ? 95.828  -19.854 27.295  1.00 51.09  ? 237 PRO E CB  1 
ATOM   5221 C CG  . PRO E 1 160 ? 94.559  -19.258 27.804  1.00 53.87  ? 237 PRO E CG  1 
ATOM   5222 C CD  . PRO E 1 160 ? 93.432  -20.185 27.437  1.00 48.36  ? 237 PRO E CD  1 
ATOM   5223 N N   . GLU E 1 161 ? 97.152  -22.446 28.752  1.00 59.59  ? 238 GLU E N   1 
ATOM   5224 C CA  . GLU E 1 161 ? 97.554  -23.110 29.990  1.00 61.61  ? 238 GLU E CA  1 
ATOM   5225 C C   . GLU E 1 161 ? 97.440  -22.138 31.162  1.00 67.99  ? 238 GLU E C   1 
ATOM   5226 O O   . GLU E 1 161 ? 97.094  -22.555 32.276  1.00 69.56  ? 238 GLU E O   1 
ATOM   5227 C CB  . GLU E 1 161 ? 98.968  -23.707 29.873  1.00 65.20  ? 238 GLU E CB  1 
ATOM   5228 N N   . THR E 1 162 ? 97.689  -20.834 30.893  1.00 64.08  ? 239 THR E N   1 
ATOM   5229 C CA  . THR E 1 162 ? 97.655  -19.770 31.895  1.00 64.63  ? 239 THR E CA  1 
ATOM   5230 C C   . THR E 1 162 ? 96.433  -18.854 31.807  1.00 66.94  ? 239 THR E C   1 
ATOM   5231 O O   . THR E 1 162 ? 96.082  -18.344 30.725  1.00 64.09  ? 239 THR E O   1 
ATOM   5232 C CB  . THR E 1 162 ? 98.987  -19.031 31.965  1.00 74.77  ? 239 THR E CB  1 
ATOM   5233 O OG1 . THR E 1 162 ? 99.397  -18.666 30.646  1.00 75.14  ? 239 THR E OG1 1 
ATOM   5234 C CG2 . THR E 1 162 ? 100.072 -19.880 32.609  1.00 80.51  ? 239 THR E CG2 1 
ATOM   5235 N N   . LEU E 1 163 ? 95.799  -18.647 32.982  1.00 63.22  ? 240 LEU E N   1 
ATOM   5236 C CA  . LEU E 1 163 ? 94.604  -17.832 33.207  1.00 61.21  ? 240 LEU E CA  1 
ATOM   5237 C C   . LEU E 1 163 ? 93.517  -18.032 32.151  1.00 63.67  ? 240 LEU E C   1 
ATOM   5238 O O   . LEU E 1 163 ? 93.136  -17.066 31.480  1.00 62.13  ? 240 LEU E O   1 
ATOM   5239 C CB  . LEU E 1 163 ? 94.967  -16.354 33.375  1.00 61.48  ? 240 LEU E CB  1 
ATOM   5240 C CG  . LEU E 1 163 ? 95.861  -16.013 34.580  1.00 68.01  ? 240 LEU E CG  1 
ATOM   5241 C CD1 . LEU E 1 163 ? 96.560  -14.670 34.369  1.00 68.35  ? 240 LEU E CD1 1 
ATOM   5242 C CD2 . LEU E 1 163 ? 95.075  -16.061 35.899  1.00 68.33  ? 240 LEU E CD2 1 
ATOM   5243 N N   . PRO E 1 164 ? 93.016  -19.277 31.957  1.00 60.48  ? 241 PRO E N   1 
ATOM   5244 C CA  . PRO E 1 164 ? 91.981  -19.484 30.929  1.00 58.62  ? 241 PRO E CA  1 
ATOM   5245 C C   . PRO E 1 164 ? 90.681  -18.777 31.284  1.00 62.28  ? 241 PRO E C   1 
ATOM   5246 O O   . PRO E 1 164 ? 90.172  -18.924 32.393  1.00 62.74  ? 241 PRO E O   1 
ATOM   5247 C CB  . PRO E 1 164 ? 91.822  -21.006 30.885  1.00 60.62  ? 241 PRO E CB  1 
ATOM   5248 C CG  . PRO E 1 164 ? 92.261  -21.479 32.222  1.00 66.45  ? 241 PRO E CG  1 
ATOM   5249 C CD  . PRO E 1 164 ? 93.353  -20.542 32.644  1.00 62.89  ? 241 PRO E CD  1 
ATOM   5250 N N   . ASN E 1 165 ? 90.209  -17.938 30.369  1.00 58.04  ? 242 ASN E N   1 
ATOM   5251 C CA  . ASN E 1 165 ? 88.975  -17.155 30.496  1.00 56.23  ? 242 ASN E CA  1 
ATOM   5252 C C   . ASN E 1 165 ? 88.450  -16.872 29.071  1.00 54.53  ? 242 ASN E C   1 
ATOM   5253 O O   . ASN E 1 165 ? 88.843  -15.879 28.453  1.00 54.48  ? 242 ASN E O   1 
ATOM   5254 C CB  . ASN E 1 165 ? 89.228  -15.824 31.242  1.00 58.70  ? 242 ASN E CB  1 
ATOM   5255 C CG  . ASN E 1 165 ? 89.487  -15.935 32.711  1.00 83.38  ? 242 ASN E CG  1 
ATOM   5256 O OD1 . ASN E 1 165 ? 90.630  -16.034 33.156  1.00 80.87  ? 242 ASN E OD1 1 
ATOM   5257 N ND2 . ASN E 1 165 ? 88.434  -15.879 33.502  1.00 77.96  ? 242 ASN E ND2 1 
ATOM   5258 N N   . ASN E 1 166 ? 87.615  -17.777 28.539  1.00 45.30  ? 243 ASN E N   1 
ATOM   5259 C CA  . ASN E 1 166 ? 87.017  -17.631 27.216  1.00 41.80  ? 243 ASN E CA  1 
ATOM   5260 C C   . ASN E 1 166 ? 85.540  -17.908 27.291  1.00 45.41  ? 243 ASN E C   1 
ATOM   5261 O O   . ASN E 1 166 ? 85.131  -18.977 27.746  1.00 45.06  ? 243 ASN E O   1 
ATOM   5262 C CB  . ASN E 1 166 ? 87.647  -18.573 26.181  1.00 34.85  ? 243 ASN E CB  1 
ATOM   5263 C CG  . ASN E 1 166 ? 88.984  -18.154 25.645  1.00 45.50  ? 243 ASN E CG  1 
ATOM   5264 O OD1 . ASN E 1 166 ? 89.229  -16.990 25.287  1.00 33.60  ? 243 ASN E OD1 1 
ATOM   5265 N ND2 . ASN E 1 166 ? 89.865  -19.122 25.503  1.00 46.28  ? 243 ASN E ND2 1 
ATOM   5266 N N   . SER E 1 167 ? 84.731  -16.935 26.874  1.00 41.61  ? 244 SER E N   1 
ATOM   5267 C CA  . SER E 1 167 ? 83.288  -17.114 26.842  1.00 40.05  ? 244 SER E CA  1 
ATOM   5268 C C   . SER E 1 167 ? 82.986  -17.516 25.430  1.00 44.35  ? 244 SER E C   1 
ATOM   5269 O O   . SER E 1 167 ? 83.677  -17.075 24.499  1.00 43.88  ? 244 SER E O   1 
ATOM   5270 C CB  . SER E 1 167 ? 82.548  -15.823 27.199  1.00 41.76  ? 244 SER E CB  1 
ATOM   5271 O OG  . SER E 1 167 ? 82.769  -14.771 26.268  1.00 43.75  ? 244 SER E OG  1 
ATOM   5272 N N   . CYS E 1 168 ? 81.996  -18.386 25.254  1.00 41.64  ? 245 CYS E N   1 
ATOM   5273 C CA  . CYS E 1 168 ? 81.614  -18.801 23.908  1.00 40.05  ? 245 CYS E CA  1 
ATOM   5274 C C   . CYS E 1 168 ? 80.136  -18.707 23.754  1.00 41.09  ? 245 CYS E C   1 
ATOM   5275 O O   . CYS E 1 168 ? 79.377  -19.238 24.570  1.00 41.89  ? 245 CYS E O   1 
ATOM   5276 C CB  . CYS E 1 168 ? 82.126  -20.192 23.555  1.00 41.04  ? 245 CYS E CB  1 
ATOM   5277 S SG  A CYS E 1 168 ? 82.183  -20.515 21.774  0.30 44.10  ? 245 CYS E SG  1 
ATOM   5278 S SG  B CYS E 1 168 ? 82.308  -20.466 21.779  0.33 44.07  ? 245 CYS E SG  1 
ATOM   5279 N N   . TYR E 1 169 ? 79.730  -18.008 22.712  1.00 34.80  ? 246 TYR E N   1 
ATOM   5280 C CA  . TYR E 1 169 ? 78.337  -17.785 22.368  1.00 32.41  ? 246 TYR E CA  1 
ATOM   5281 C C   . TYR E 1 169 ? 78.052  -18.469 21.047  1.00 36.05  ? 246 TYR E C   1 
ATOM   5282 O O   . TYR E 1 169 ? 78.855  -18.394 20.106  1.00 35.81  ? 246 TYR E O   1 
ATOM   5283 C CB  . TYR E 1 169 ? 78.084  -16.269 22.224  1.00 31.55  ? 246 TYR E CB  1 
ATOM   5284 C CG  . TYR E 1 169 ? 76.665  -15.918 21.844  1.00 30.64  ? 246 TYR E CG  1 
ATOM   5285 C CD1 . TYR E 1 169 ? 76.266  -15.889 20.508  1.00 30.13  ? 246 TYR E CD1 1 
ATOM   5286 C CD2 . TYR E 1 169 ? 75.720  -15.591 22.818  1.00 32.16  ? 246 TYR E CD2 1 
ATOM   5287 C CE1 . TYR E 1 169 ? 74.958  -15.586 20.150  1.00 29.33  ? 246 TYR E CE1 1 
ATOM   5288 C CE2 . TYR E 1 169 ? 74.413  -15.241 22.466  1.00 32.33  ? 246 TYR E CE2 1 
ATOM   5289 C CZ  . TYR E 1 169 ? 74.043  -15.226 21.125  1.00 36.45  ? 246 TYR E CZ  1 
ATOM   5290 O OH  . TYR E 1 169 ? 72.768  -14.897 20.727  1.00 35.52  ? 246 TYR E OH  1 
ATOM   5291 N N   . SER E 1 170 ? 76.883  -19.095 20.961  1.00 32.10  ? 247 SER E N   1 
ATOM   5292 C CA  . SER E 1 170 ? 76.357  -19.685 19.736  1.00 30.15  ? 247 SER E CA  1 
ATOM   5293 C C   . SER E 1 170 ? 74.830  -19.579 19.789  1.00 36.00  ? 247 SER E C   1 
ATOM   5294 O O   . SER E 1 170 ? 74.222  -19.608 20.875  1.00 37.80  ? 247 SER E O   1 
ATOM   5295 C CB  . SER E 1 170 ? 76.787  -21.130 19.573  1.00 31.25  ? 247 SER E CB  1 
ATOM   5296 O OG  . SER E 1 170 ? 76.675  -21.507 18.215  1.00 41.73  ? 247 SER E OG  1 
ATOM   5297 N N   . ALA E 1 171 ? 74.213  -19.422 18.623  1.00 30.47  ? 248 ALA E N   1 
ATOM   5298 C CA  . ALA E 1 171 ? 72.773  -19.320 18.505  1.00 29.68  ? 248 ALA E CA  1 
ATOM   5299 C C   . ALA E 1 171 ? 72.362  -19.703 17.093  1.00 36.12  ? 248 ALA E C   1 
ATOM   5300 O O   . ALA E 1 171 ? 73.186  -19.652 16.158  1.00 36.61  ? 248 ALA E O   1 
ATOM   5301 C CB  . ALA E 1 171 ? 72.328  -17.891 18.808  1.00 30.04  ? 248 ALA E CB  1 
ATOM   5302 N N   . GLY E 1 172 ? 71.092  -20.066 16.950  1.00 32.27  ? 249 GLY E N   1 
ATOM   5303 C CA  . GLY E 1 172 ? 70.488  -20.387 15.667  1.00 31.42  ? 249 GLY E CA  1 
ATOM   5304 C C   . GLY E 1 172 ? 68.982  -20.530 15.717  1.00 34.84  ? 249 GLY E C   1 
ATOM   5305 O O   . GLY E 1 172 ? 68.352  -20.330 16.759  1.00 36.82  ? 249 GLY E O   1 
ATOM   5306 N N   . ILE E 1 173 ? 68.394  -20.876 14.586  1.00 28.99  ? 250 ILE E N   1 
ATOM   5307 C CA  . ILE E 1 173 ? 66.961  -21.072 14.525  1.00 28.91  ? 250 ILE E CA  1 
ATOM   5308 C C   . ILE E 1 173 ? 66.692  -22.575 14.392  1.00 35.95  ? 250 ILE E C   1 
ATOM   5309 O O   . ILE E 1 173 ? 67.492  -23.299 13.805  1.00 36.90  ? 250 ILE E O   1 
ATOM   5310 C CB  . ILE E 1 173 ? 66.279  -20.230 13.424  1.00 30.60  ? 250 ILE E CB  1 
ATOM   5311 C CG1 . ILE E 1 173 ? 66.645  -18.736 13.584  1.00 30.29  ? 250 ILE E CG1 1 
ATOM   5312 C CG2 . ILE E 1 173 ? 64.731  -20.443 13.436  1.00 30.27  ? 250 ILE E CG2 1 
ATOM   5313 C CD1 . ILE E 1 173 ? 66.439  -17.851 12.359  1.00 31.62  ? 250 ILE E CD1 1 
ATOM   5314 N N   . ALA E 1 174 ? 65.592  -23.039 14.982  1.00 32.03  ? 251 ALA E N   1 
ATOM   5315 C CA  . ALA E 1 174 ? 65.190  -24.424 14.922  1.00 32.04  ? 251 ALA E CA  1 
ATOM   5316 C C   . ALA E 1 174 ? 63.690  -24.514 15.051  1.00 35.92  ? 251 ALA E C   1 
ATOM   5317 O O   . ALA E 1 174 ? 63.076  -23.674 15.732  1.00 34.77  ? 251 ALA E O   1 
ATOM   5318 C CB  . ALA E 1 174 ? 65.872  -25.237 16.016  1.00 32.77  ? 251 ALA E CB  1 
ATOM   5319 N N   . LYS E 1 175 ? 63.101  -25.489 14.318  1.00 31.81  ? 252 LYS E N   1 
ATOM   5320 C CA  . LYS E 1 175 ? 61.684  -25.806 14.386  1.00 32.88  ? 252 LYS E CA  1 
ATOM   5321 C C   . LYS E 1 175 ? 61.551  -26.832 15.536  1.00 40.59  ? 252 LYS E C   1 
ATOM   5322 O O   . LYS E 1 175 ? 62.244  -27.861 15.555  1.00 43.51  ? 252 LYS E O   1 
ATOM   5323 C CB  . LYS E 1 175 ? 61.154  -26.309 13.039  1.00 34.80  ? 252 LYS E CB  1 
ATOM   5324 C CG  . LYS E 1 175 ? 59.830  -27.057 13.106  1.00 43.08  ? 252 LYS E CG  1 
ATOM   5325 C CD  . LYS E 1 175 ? 58.636  -26.180 12.826  1.00 47.56  ? 252 LYS E CD  1 
ATOM   5326 C CE  . LYS E 1 175 ? 57.376  -26.988 12.634  1.00 59.98  ? 252 LYS E CE  1 
ATOM   5327 N NZ  . LYS E 1 175 ? 57.197  -27.383 11.211  1.00 66.05  ? 252 LYS E NZ  1 
ATOM   5328 N N   . LEU E 1 176 ? 60.778  -26.466 16.561  1.00 36.01  ? 253 LEU E N   1 
ATOM   5329 C CA  . LEU E 1 176 ? 60.641  -27.312 17.743  1.00 36.54  ? 253 LEU E CA  1 
ATOM   5330 C C   . LEU E 1 176 ? 59.220  -27.768 17.897  1.00 44.04  ? 253 LEU E C   1 
ATOM   5331 O O   . LEU E 1 176 ? 58.313  -27.007 17.565  1.00 46.00  ? 253 LEU E O   1 
ATOM   5332 C CB  . LEU E 1 176 ? 61.154  -26.592 19.011  1.00 35.58  ? 253 LEU E CB  1 
ATOM   5333 C CG  . LEU E 1 176 ? 62.631  -26.149 18.982  1.00 37.21  ? 253 LEU E CG  1 
ATOM   5334 C CD1 . LEU E 1 176 ? 62.995  -25.363 20.210  1.00 36.68  ? 253 LEU E CD1 1 
ATOM   5335 C CD2 . LEU E 1 176 ? 63.564  -27.333 18.837  1.00 37.66  ? 253 LEU E CD2 1 
ATOM   5336 N N   . GLU E 1 177 ? 59.014  -29.016 18.335  1.00 40.68  ? 254 GLU E N   1 
ATOM   5337 C CA  . GLU E 1 177 ? 57.674  -29.563 18.541  1.00 42.46  ? 254 GLU E CA  1 
ATOM   5338 C C   . GLU E 1 177 ? 57.287  -29.528 20.016  1.00 48.17  ? 254 GLU E C   1 
ATOM   5339 O O   . GLU E 1 177 ? 58.136  -29.738 20.873  1.00 46.62  ? 254 GLU E O   1 
ATOM   5340 C CB  . GLU E 1 177 ? 57.603  -31.000 18.057  1.00 43.96  ? 254 GLU E CB  1 
ATOM   5341 C CG  . GLU E 1 177 ? 57.238  -31.128 16.603  1.00 56.33  ? 254 GLU E CG  1 
ATOM   5342 C CD  . GLU E 1 177 ? 57.515  -32.525 16.097  1.00 93.18  ? 254 GLU E CD  1 
ATOM   5343 O OE1 . GLU E 1 177 ? 58.674  -32.797 15.710  1.00 103.02 ? 254 GLU E OE1 1 
ATOM   5344 O OE2 . GLU E 1 177 ? 56.585  -33.361 16.132  1.00 94.71  ? 254 GLU E OE2 1 
ATOM   5345 N N   . GLU E 1 178 ? 55.999  -29.296 20.306  1.00 47.18  ? 255 GLU E N   1 
ATOM   5346 C CA  . GLU E 1 178 ? 55.445  -29.297 21.660  1.00 49.24  ? 255 GLU E CA  1 
ATOM   5347 C C   . GLU E 1 178 ? 55.833  -30.622 22.328  1.00 55.09  ? 255 GLU E C   1 
ATOM   5348 O O   . GLU E 1 178 ? 55.544  -31.687 21.791  1.00 56.56  ? 255 GLU E O   1 
ATOM   5349 C CB  . GLU E 1 178 ? 53.913  -29.136 21.578  1.00 52.57  ? 255 GLU E CB  1 
ATOM   5350 C CG  . GLU E 1 178 ? 53.164  -29.510 22.845  1.00 63.42  ? 255 GLU E CG  1 
ATOM   5351 C CD  . GLU E 1 178 ? 51.664  -29.336 22.775  1.00 81.30  ? 255 GLU E CD  1 
ATOM   5352 O OE1 . GLU E 1 178 ? 51.093  -29.501 21.675  1.00 82.03  ? 255 GLU E OE1 1 
ATOM   5353 O OE2 . GLU E 1 178 ? 51.051  -29.068 23.834  1.00 74.62  ? 255 GLU E OE2 1 
ATOM   5354 N N   . GLY E 1 179 ? 56.553  -30.544 23.433  1.00 51.40  ? 256 GLY E N   1 
ATOM   5355 C CA  . GLY E 1 179 ? 57.019  -31.731 24.142  1.00 51.22  ? 256 GLY E CA  1 
ATOM   5356 C C   . GLY E 1 179 ? 58.521  -31.897 24.127  1.00 52.69  ? 256 GLY E C   1 
ATOM   5357 O O   . GLY E 1 179 ? 59.072  -32.588 24.985  1.00 52.59  ? 256 GLY E O   1 
ATOM   5358 N N   . ASP E 1 180 ? 59.204  -31.263 23.149  1.00 47.72  ? 257 ASP E N   1 
ATOM   5359 C CA  . ASP E 1 180 ? 60.668  -31.282 23.060  1.00 44.79  ? 257 ASP E CA  1 
ATOM   5360 C C   . ASP E 1 180 ? 61.253  -30.489 24.209  1.00 47.83  ? 257 ASP E C   1 
ATOM   5361 O O   . ASP E 1 180 ? 60.598  -29.596 24.760  1.00 48.41  ? 257 ASP E O   1 
ATOM   5362 C CB  . ASP E 1 180 ? 61.174  -30.664 21.746  1.00 44.05  ? 257 ASP E CB  1 
ATOM   5363 C CG  . ASP E 1 180 ? 60.847  -31.406 20.473  1.00 47.46  ? 257 ASP E CG  1 
ATOM   5364 O OD1 . ASP E 1 180 ? 60.507  -32.624 20.555  1.00 46.52  ? 257 ASP E OD1 1 
ATOM   5365 O OD2 . ASP E 1 180 ? 60.925  -30.776 19.394  1.00 50.60  ? 257 ASP E OD2 1 
ATOM   5366 N N   . GLU E 1 181 ? 62.486  -30.832 24.582  1.00 44.16  ? 258 GLU E N   1 
ATOM   5367 C CA  . GLU E 1 181 ? 63.222  -30.165 25.648  1.00 43.45  ? 258 GLU E CA  1 
ATOM   5368 C C   . GLU E 1 181 ? 64.574  -29.751 25.131  1.00 49.59  ? 258 GLU E C   1 
ATOM   5369 O O   . GLU E 1 181 ? 65.176  -30.483 24.341  1.00 50.03  ? 258 GLU E O   1 
ATOM   5370 C CB  . GLU E 1 181 ? 63.366  -31.062 26.872  1.00 45.17  ? 258 GLU E CB  1 
ATOM   5371 C CG  . GLU E 1 181 ? 62.077  -31.169 27.667  1.00 49.62  ? 258 GLU E CG  1 
ATOM   5372 C CD  . GLU E 1 181 ? 62.034  -32.329 28.635  1.00 68.69  ? 258 GLU E CD  1 
ATOM   5373 O OE1 . GLU E 1 181 ? 63.113  -32.846 29.004  1.00 67.74  ? 258 GLU E OE1 1 
ATOM   5374 O OE2 . GLU E 1 181 ? 60.912  -32.723 29.027  1.00 75.08  ? 258 GLU E OE2 1 
ATOM   5375 N N   . LEU E 1 182 ? 65.040  -28.569 25.555  1.00 45.57  ? 259 LEU E N   1 
ATOM   5376 C CA  . LEU E 1 182 ? 66.349  -28.048 25.193  1.00 43.52  ? 259 LEU E CA  1 
ATOM   5377 C C   . LEU E 1 182 ? 67.267  -28.090 26.405  1.00 48.29  ? 259 LEU E C   1 
ATOM   5378 O O   . LEU E 1 182 ? 66.830  -27.805 27.526  1.00 50.78  ? 259 LEU E O   1 
ATOM   5379 C CB  . LEU E 1 182 ? 66.245  -26.610 24.680  1.00 42.18  ? 259 LEU E CB  1 
ATOM   5380 C CG  . LEU E 1 182 ? 65.435  -26.384 23.421  1.00 46.47  ? 259 LEU E CG  1 
ATOM   5381 C CD1 . LEU E 1 182 ? 65.264  -24.893 23.147  1.00 45.15  ? 259 LEU E CD1 1 
ATOM   5382 C CD2 . LEU E 1 182 ? 66.035  -27.115 22.232  1.00 49.17  ? 259 LEU E CD2 1 
ATOM   5383 N N   . GLN E 1 183 ? 68.534  -28.433 26.185  1.00 41.98  ? 260 GLN E N   1 
ATOM   5384 C CA  . GLN E 1 183 ? 69.544  -28.470 27.240  1.00 41.36  ? 260 GLN E CA  1 
ATOM   5385 C C   . GLN E 1 183 ? 70.917  -28.029 26.737  1.00 45.23  ? 260 GLN E C   1 
ATOM   5386 O O   . GLN E 1 183 ? 71.254  -28.236 25.564  1.00 45.20  ? 260 GLN E O   1 
ATOM   5387 C CB  . GLN E 1 183 ? 69.622  -29.853 27.882  1.00 43.18  ? 260 GLN E CB  1 
ATOM   5388 C CG  . GLN E 1 183 ? 70.144  -30.964 26.964  1.00 57.08  ? 260 GLN E CG  1 
ATOM   5389 C CD  . GLN E 1 183 ? 70.393  -32.257 27.695  1.00 65.87  ? 260 GLN E CD  1 
ATOM   5390 O OE1 . GLN E 1 183 ? 69.723  -32.611 28.675  1.00 51.47  ? 260 GLN E OE1 1 
ATOM   5391 N NE2 . GLN E 1 183 ? 71.359  -33.009 27.217  1.00 65.23  ? 260 GLN E NE2 1 
ATOM   5392 N N   . LEU E 1 184 ? 71.700  -27.432 27.619  1.00 41.75  ? 261 LEU E N   1 
ATOM   5393 C CA  . LEU E 1 184 ? 73.062  -27.008 27.328  1.00 41.43  ? 261 LEU E CA  1 
ATOM   5394 C C   . LEU E 1 184 ? 73.992  -27.985 28.061  1.00 49.51  ? 261 LEU E C   1 
ATOM   5395 O O   . LEU E 1 184 ? 73.943  -28.075 29.287  1.00 53.05  ? 261 LEU E O   1 
ATOM   5396 C CB  . LEU E 1 184 ? 73.267  -25.558 27.793  1.00 40.81  ? 261 LEU E CB  1 
ATOM   5397 C CG  . LEU E 1 184 ? 74.538  -24.864 27.351  1.00 43.82  ? 261 LEU E CG  1 
ATOM   5398 C CD1 . LEU E 1 184 ? 74.288  -23.393 27.152  1.00 42.89  ? 261 LEU E CD1 1 
ATOM   5399 C CD2 . LEU E 1 184 ? 75.673  -25.117 28.344  1.00 45.95  ? 261 LEU E CD2 1 
ATOM   5400 N N   . ALA E 1 185 ? 74.788  -28.749 27.309  1.00 44.91  ? 262 ALA E N   1 
ATOM   5401 C CA  . ALA E 1 185 ? 75.689  -29.763 27.853  1.00 45.35  ? 262 ALA E CA  1 
ATOM   5402 C C   . ALA E 1 185 ? 77.150  -29.474 27.524  1.00 46.02  ? 262 ALA E C   1 
ATOM   5403 O O   . ALA E 1 185 ? 77.467  -29.139 26.383  1.00 45.18  ? 262 ALA E O   1 
ATOM   5404 C CB  . ALA E 1 185 ? 75.305  -31.123 27.295  1.00 46.70  ? 262 ALA E CB  1 
ATOM   5405 N N   . ILE E 1 186 ? 78.036  -29.623 28.507  1.00 41.01  ? 263 ILE E N   1 
ATOM   5406 C CA  . ILE E 1 186 ? 79.470  -29.421 28.307  1.00 40.04  ? 263 ILE E CA  1 
ATOM   5407 C C   . ILE E 1 186 ? 80.133  -30.801 28.232  1.00 46.02  ? 263 ILE E C   1 
ATOM   5408 O O   . ILE E 1 186 ? 80.168  -31.488 29.251  1.00 47.47  ? 263 ILE E O   1 
ATOM   5409 C CB  . ILE E 1 186 ? 80.107  -28.504 29.379  1.00 42.78  ? 263 ILE E CB  1 
ATOM   5410 C CG1 . ILE E 1 186 ? 79.456  -27.098 29.359  1.00 40.31  ? 263 ILE E CG1 1 
ATOM   5411 C CG2 . ILE E 1 186 ? 81.626  -28.434 29.152  1.00 43.99  ? 263 ILE E CG2 1 
ATOM   5412 C CD1 . ILE E 1 186 ? 79.502  -26.368 30.651  1.00 35.98  ? 263 ILE E CD1 1 
ATOM   5413 N N   . PRO E 1 187 ? 80.636  -31.240 27.047  1.00 42.86  ? 264 PRO E N   1 
ATOM   5414 C CA  . PRO E 1 187 ? 81.201  -32.604 26.940  1.00 43.20  ? 264 PRO E CA  1 
ATOM   5415 C C   . PRO E 1 187 ? 82.571  -32.779 27.566  1.00 47.50  ? 264 PRO E C   1 
ATOM   5416 O O   . PRO E 1 187 ? 83.508  -33.266 26.920  1.00 47.75  ? 264 PRO E O   1 
ATOM   5417 C CB  . PRO E 1 187 ? 81.179  -32.910 25.440  1.00 44.41  ? 264 PRO E CB  1 
ATOM   5418 C CG  . PRO E 1 187 ? 80.677  -31.660 24.758  1.00 48.55  ? 264 PRO E CG  1 
ATOM   5419 C CD  . PRO E 1 187 ? 80.658  -30.540 25.745  1.00 43.87  ? 264 PRO E CD  1 
ATOM   5420 N N   . ARG E 1 188 ? 82.684  -32.392 28.852  1.00 43.73  ? 265 ARG E N   1 
ATOM   5421 C CA  . ARG E 1 188 ? 83.909  -32.480 29.638  1.00 43.85  ? 265 ARG E CA  1 
ATOM   5422 C C   . ARG E 1 188 ? 83.535  -32.788 31.062  1.00 52.11  ? 265 ARG E C   1 
ATOM   5423 O O   . ARG E 1 188 ? 82.602  -32.170 31.584  1.00 51.22  ? 265 ARG E O   1 
ATOM   5424 C CB  . ARG E 1 188 ? 84.693  -31.163 29.581  1.00 38.30  ? 265 ARG E CB  1 
ATOM   5425 C CG  . ARG E 1 188 ? 84.931  -30.593 28.177  1.00 46.80  ? 265 ARG E CG  1 
ATOM   5426 C CD  . ARG E 1 188 ? 86.352  -30.828 27.806  1.00 51.34  ? 265 ARG E CD  1 
ATOM   5427 N NE  . ARG E 1 188 ? 86.699  -30.467 26.433  1.00 47.39  ? 265 ARG E NE  1 
ATOM   5428 C CZ  . ARG E 1 188 ? 86.619  -31.292 25.400  1.00 59.71  ? 265 ARG E CZ  1 
ATOM   5429 N NH1 . ARG E 1 188 ? 86.022  -32.475 25.528  1.00 36.90  ? 265 ARG E NH1 1 
ATOM   5430 N NH2 . ARG E 1 188 ? 87.079  -30.923 24.218  1.00 68.82  ? 265 ARG E NH2 1 
ATOM   5431 N N   . GLU E 1 189 ? 84.226  -33.772 31.687  1.00 53.65  ? 266 GLU E N   1 
ATOM   5432 C CA  . GLU E 1 189 ? 83.981  -34.137 33.095  1.00 56.58  ? 266 GLU E CA  1 
ATOM   5433 C C   . GLU E 1 189 ? 84.482  -33.017 33.966  1.00 61.40  ? 266 GLU E C   1 
ATOM   5434 O O   . GLU E 1 189 ? 85.546  -32.453 33.657  1.00 61.37  ? 266 GLU E O   1 
ATOM   5435 C CB  . GLU E 1 189 ? 84.688  -35.449 33.486  1.00 60.42  ? 266 GLU E CB  1 
ATOM   5436 N N   . ASN E 1 190 ? 83.701  -32.656 35.013  1.00 58.51  ? 267 ASN E N   1 
ATOM   5437 C CA  . ASN E 1 190 ? 84.046  -31.575 35.950  1.00 59.70  ? 267 ASN E CA  1 
ATOM   5438 C C   . ASN E 1 190 ? 84.692  -30.350 35.233  1.00 61.29  ? 267 ASN E C   1 
ATOM   5439 O O   . ASN E 1 190 ? 85.877  -30.011 35.427  1.00 62.03  ? 267 ASN E O   1 
ATOM   5440 C CB  . ASN E 1 190 ? 84.889  -32.118 37.125  1.00 66.17  ? 267 ASN E CB  1 
ATOM   5441 C CG  . ASN E 1 190 ? 85.301  -31.096 38.148  1.00 103.06 ? 267 ASN E CG  1 
ATOM   5442 O OD1 . ASN E 1 190 ? 84.472  -30.459 38.817  1.00 103.75 ? 267 ASN E OD1 1 
ATOM   5443 N ND2 . ASN E 1 190 ? 86.605  -30.937 38.288  1.00 98.78  ? 267 ASN E ND2 1 
ATOM   5444 N N   . ALA E 1 191 ? 83.902  -29.773 34.318  1.00 53.38  ? 268 ALA E N   1 
ATOM   5445 C CA  . ALA E 1 191 ? 84.256  -28.593 33.557  1.00 50.25  ? 268 ALA E CA  1 
ATOM   5446 C C   . ALA E 1 191 ? 84.383  -27.399 34.506  1.00 56.36  ? 268 ALA E C   1 
ATOM   5447 O O   . ALA E 1 191 ? 83.591  -27.252 35.453  1.00 57.91  ? 268 ALA E O   1 
ATOM   5448 C CB  . ALA E 1 191 ? 83.196  -28.318 32.517  1.00 48.12  ? 268 ALA E CB  1 
ATOM   5449 N N   . GLN E 1 192 ? 85.427  -26.592 34.284  1.00 52.90  ? 269 GLN E N   1 
ATOM   5450 C CA  . GLN E 1 192 ? 85.711  -25.399 35.069  1.00 53.74  ? 269 GLN E CA  1 
ATOM   5451 C C   . GLN E 1 192 ? 85.110  -24.222 34.354  1.00 58.36  ? 269 GLN E C   1 
ATOM   5452 O O   . GLN E 1 192 ? 85.600  -23.819 33.302  1.00 57.40  ? 269 GLN E O   1 
ATOM   5453 C CB  . GLN E 1 192 ? 87.222  -25.223 35.265  1.00 56.21  ? 269 GLN E CB  1 
ATOM   5454 C CG  . GLN E 1 192 ? 87.907  -26.383 35.976  1.00 51.59  ? 269 GLN E CG  1 
ATOM   5455 C CD  . GLN E 1 192 ? 87.293  -26.646 37.322  1.00 66.68  ? 269 GLN E CD  1 
ATOM   5456 O OE1 . GLN E 1 192 ? 87.457  -25.865 38.269  1.00 59.01  ? 269 GLN E OE1 1 
ATOM   5457 N NE2 . GLN E 1 192 ? 86.535  -27.731 37.421  1.00 63.58  ? 269 GLN E NE2 1 
ATOM   5458 N N   . ILE E 1 193 ? 83.989  -23.728 34.876  1.00 56.61  ? 270 ILE E N   1 
ATOM   5459 C CA  . ILE E 1 193 ? 83.222  -22.643 34.247  1.00 54.92  ? 270 ILE E CA  1 
ATOM   5460 C C   . ILE E 1 193 ? 82.833  -21.562 35.263  1.00 58.94  ? 270 ILE E C   1 
ATOM   5461 O O   . ILE E 1 193 ? 82.888  -21.828 36.458  1.00 61.29  ? 270 ILE E O   1 
ATOM   5462 C CB  . ILE E 1 193 ? 81.966  -23.229 33.512  1.00 55.99  ? 270 ILE E CB  1 
ATOM   5463 C CG1 . ILE E 1 193 ? 80.990  -23.890 34.514  1.00 57.48  ? 270 ILE E CG1 1 
ATOM   5464 C CG2 . ILE E 1 193 ? 82.372  -24.198 32.395  1.00 54.20  ? 270 ILE E CG2 1 
ATOM   5465 C CD1 . ILE E 1 193 ? 79.615  -24.000 34.052  1.00 61.27  ? 270 ILE E CD1 1 
ATOM   5466 N N   . SER E 1 194 ? 82.419  -20.368 34.796  1.00 52.76  ? 271 SER E N   1 
ATOM   5467 C CA  . SER E 1 194 ? 81.941  -19.310 35.687  1.00 52.33  ? 271 SER E CA  1 
ATOM   5468 C C   . SER E 1 194 ? 80.441  -19.417 35.811  1.00 55.79  ? 271 SER E C   1 
ATOM   5469 O O   . SER E 1 194 ? 79.756  -19.579 34.798  1.00 54.21  ? 271 SER E O   1 
ATOM   5470 C CB  . SER E 1 194 ? 82.318  -17.931 35.167  1.00 54.44  ? 271 SER E CB  1 
ATOM   5471 O OG  . SER E 1 194 ? 81.714  -16.888 35.926  1.00 58.98  ? 271 SER E OG  1 
ATOM   5472 N N   . LEU E 1 195 ? 79.932  -19.342 37.040  1.00 55.09  ? 272 LEU E N   1 
ATOM   5473 C CA  . LEU E 1 195 ? 78.500  -19.443 37.278  1.00 56.37  ? 272 LEU E CA  1 
ATOM   5474 C C   . LEU E 1 195 ? 77.828  -18.080 37.503  1.00 61.81  ? 272 LEU E C   1 
ATOM   5475 O O   . LEU E 1 195 ? 76.788  -17.993 38.168  1.00 64.53  ? 272 LEU E O   1 
ATOM   5476 C CB  . LEU E 1 195 ? 78.155  -20.484 38.370  1.00 58.55  ? 272 LEU E CB  1 
ATOM   5477 C CG  . LEU E 1 195 ? 78.479  -21.959 38.063  1.00 63.11  ? 272 LEU E CG  1 
ATOM   5478 C CD1 . LEU E 1 195 ? 78.117  -22.827 39.229  1.00 65.38  ? 272 LEU E CD1 1 
ATOM   5479 C CD2 . LEU E 1 195 ? 77.770  -22.465 36.797  1.00 59.81  ? 272 LEU E CD2 1 
ATOM   5480 N N   . ASP E 1 196 ? 78.399  -17.021 36.899  1.00 55.59  ? 273 ASP E N   1 
ATOM   5481 C CA  . ASP E 1 196 ? 77.835  -15.677 36.950  1.00 54.92  ? 273 ASP E CA  1 
ATOM   5482 C C   . ASP E 1 196 ? 76.785  -15.506 35.839  1.00 54.75  ? 273 ASP E C   1 
ATOM   5483 O O   . ASP E 1 196 ? 77.061  -15.789 34.668  1.00 52.64  ? 273 ASP E O   1 
ATOM   5484 C CB  . ASP E 1 196 ? 78.944  -14.611 36.839  1.00 57.73  ? 273 ASP E CB  1 
ATOM   5485 C CG  . ASP E 1 196 ? 79.964  -14.606 37.961  1.00 72.27  ? 273 ASP E CG  1 
ATOM   5486 O OD1 . ASP E 1 196 ? 79.582  -14.934 39.117  1.00 75.28  ? 273 ASP E OD1 1 
ATOM   5487 O OD2 . ASP E 1 196 ? 81.141  -14.247 37.692  1.00 78.98  ? 273 ASP E OD2 1 
ATOM   5488 N N   . GLY E 1 197 ? 75.597  -15.051 36.228  1.00 50.77  ? 274 GLY E N   1 
ATOM   5489 C CA  . GLY E 1 197 ? 74.449  -14.852 35.337  1.00 48.78  ? 274 GLY E CA  1 
ATOM   5490 C C   . GLY E 1 197 ? 74.641  -13.974 34.106  1.00 48.73  ? 274 GLY E C   1 
ATOM   5491 O O   . GLY E 1 197 ? 73.912  -14.133 33.126  1.00 46.02  ? 274 GLY E O   1 
ATOM   5492 N N   . ASP E 1 198 ? 75.613  -13.038 34.143  1.00 44.70  ? 275 ASP E N   1 
ATOM   5493 C CA  . ASP E 1 198 ? 75.909  -12.136 33.022  1.00 43.42  ? 275 ASP E CA  1 
ATOM   5494 C C   . ASP E 1 198 ? 76.839  -12.777 31.979  1.00 48.46  ? 275 ASP E C   1 
ATOM   5495 O O   . ASP E 1 198 ? 77.070  -12.209 30.907  1.00 47.59  ? 275 ASP E O   1 
ATOM   5496 C CB  . ASP E 1 198 ? 76.556  -10.840 33.555  1.00 45.30  ? 275 ASP E CB  1 
ATOM   5497 C CG  . ASP E 1 198 ? 77.885  -11.013 34.278  1.00 50.60  ? 275 ASP E CG  1 
ATOM   5498 O OD1 . ASP E 1 198 ? 78.123  -12.106 34.838  1.00 50.68  ? 275 ASP E OD1 1 
ATOM   5499 O OD2 . ASP E 1 198 ? 78.646  -10.029 34.358  1.00 54.36  ? 275 ASP E OD2 1 
ATOM   5500 N N   . VAL E 1 199 ? 77.387  -13.950 32.315  1.00 45.08  ? 276 VAL E N   1 
ATOM   5501 C CA  . VAL E 1 199 ? 78.404  -14.616 31.535  1.00 43.02  ? 276 VAL E CA  1 
ATOM   5502 C C   . VAL E 1 199 ? 78.023  -16.029 31.071  1.00 47.66  ? 276 VAL E C   1 
ATOM   5503 O O   . VAL E 1 199 ? 78.478  -16.466 30.020  1.00 46.35  ? 276 VAL E O   1 
ATOM   5504 C CB  . VAL E 1 199 ? 79.696  -14.500 32.383  1.00 46.24  ? 276 VAL E CB  1 
ATOM   5505 C CG1 . VAL E 1 199 ? 80.027  -15.762 33.164  1.00 46.57  ? 276 VAL E CG1 1 
ATOM   5506 C CG2 . VAL E 1 199 ? 80.860  -13.994 31.569  1.00 44.98  ? 276 VAL E CG2 1 
ATOM   5507 N N   . THR E 1 200 ? 77.161  -16.719 31.837  1.00 45.63  ? 277 THR E N   1 
ATOM   5508 C CA  . THR E 1 200 ? 76.683  -18.074 31.549  1.00 44.51  ? 277 THR E CA  1 
ATOM   5509 C C   . THR E 1 200 ? 75.170  -18.024 31.580  1.00 46.59  ? 277 THR E C   1 
ATOM   5510 O O   . THR E 1 200 ? 74.557  -17.835 32.635  1.00 48.31  ? 277 THR E O   1 
ATOM   5511 C CB  . THR E 1 200 ? 77.320  -19.095 32.518  1.00 53.11  ? 277 THR E CB  1 
ATOM   5512 O OG1 . THR E 1 200 ? 78.740  -19.036 32.368  1.00 53.45  ? 277 THR E OG1 1 
ATOM   5513 C CG2 . THR E 1 200 ? 76.836  -20.514 32.279  1.00 50.34  ? 277 THR E CG2 1 
ATOM   5514 N N   . PHE E 1 201 ? 74.577  -18.128 30.407  1.00 40.08  ? 278 PHE E N   1 
ATOM   5515 C CA  . PHE E 1 201 ? 73.134  -18.010 30.233  1.00 39.07  ? 278 PHE E CA  1 
ATOM   5516 C C   . PHE E 1 201 ? 72.661  -18.847 29.033  1.00 44.03  ? 278 PHE E C   1 
ATOM   5517 O O   . PHE E 1 201 ? 73.482  -19.279 28.210  1.00 43.70  ? 278 PHE E O   1 
ATOM   5518 C CB  . PHE E 1 201 ? 72.701  -16.536 30.124  1.00 39.14  ? 278 PHE E CB  1 
ATOM   5519 C CG  . PHE E 1 201 ? 73.435  -15.754 29.066  1.00 39.16  ? 278 PHE E CG  1 
ATOM   5520 C CD1 . PHE E 1 201 ? 74.545  -14.989 29.392  1.00 43.51  ? 278 PHE E CD1 1 
ATOM   5521 C CD2 . PHE E 1 201 ? 73.023  -15.788 27.733  1.00 39.49  ? 278 PHE E CD2 1 
ATOM   5522 C CE1 . PHE E 1 201 ? 75.229  -14.259 28.402  1.00 44.03  ? 278 PHE E CE1 1 
ATOM   5523 C CE2 . PHE E 1 201 ? 73.696  -15.047 26.751  1.00 41.48  ? 278 PHE E CE2 1 
ATOM   5524 C CZ  . PHE E 1 201 ? 74.795  -14.287 27.090  1.00 40.37  ? 278 PHE E CZ  1 
ATOM   5525 N N   . PHE E 1 202 ? 71.343  -19.099 28.967  1.00 39.92  ? 279 PHE E N   1 
ATOM   5526 C CA  . PHE E 1 202 ? 70.711  -19.944 27.976  1.00 39.45  ? 279 PHE E CA  1 
ATOM   5527 C C   . PHE E 1 202 ? 69.255  -19.495 27.809  1.00 46.59  ? 279 PHE E C   1 
ATOM   5528 O O   . PHE E 1 202 ? 68.546  -19.291 28.809  1.00 47.81  ? 279 PHE E O   1 
ATOM   5529 C CB  . PHE E 1 202 ? 70.807  -21.398 28.475  1.00 42.02  ? 279 PHE E CB  1 
ATOM   5530 C CG  . PHE E 1 202 ? 70.179  -22.525 27.688  1.00 43.59  ? 279 PHE E CG  1 
ATOM   5531 C CD1 . PHE E 1 202 ? 70.274  -22.567 26.302  1.00 45.61  ? 279 PHE E CD1 1 
ATOM   5532 C CD2 . PHE E 1 202 ? 69.585  -23.599 28.344  1.00 46.51  ? 279 PHE E CD2 1 
ATOM   5533 C CE1 . PHE E 1 202 ? 69.730  -23.629 25.590  1.00 46.91  ? 279 PHE E CE1 1 
ATOM   5534 C CE2 . PHE E 1 202 ? 69.050  -24.667 27.631  1.00 49.41  ? 279 PHE E CE2 1 
ATOM   5535 C CZ  . PHE E 1 202 ? 69.126  -24.678 26.266  1.00 47.34  ? 279 PHE E CZ  1 
ATOM   5536 N N   . GLY E 1 203 ? 68.843  -19.294 26.557  1.00 41.90  ? 280 GLY E N   1 
ATOM   5537 C CA  . GLY E 1 203 ? 67.495  -18.849 26.285  1.00 42.44  ? 280 GLY E CA  1 
ATOM   5538 C C   . GLY E 1 203 ? 66.960  -19.230 24.932  1.00 48.76  ? 280 GLY E C   1 
ATOM   5539 O O   . GLY E 1 203 ? 67.690  -19.726 24.067  1.00 48.23  ? 280 GLY E O   1 
ATOM   5540 N N   . ALA E 1 204 ? 65.660  -18.984 24.753  1.00 47.46  ? 281 ALA E N   1 
ATOM   5541 C CA  . ALA E 1 204 ? 64.942  -19.268 23.522  1.00 47.39  ? 281 ALA E CA  1 
ATOM   5542 C C   . ALA E 1 204 ? 63.869  -18.215 23.353  1.00 50.59  ? 281 ALA E C   1 
ATOM   5543 O O   . ALA E 1 204 ? 63.326  -17.689 24.349  1.00 51.72  ? 281 ALA E O   1 
ATOM   5544 C CB  . ALA E 1 204 ? 64.319  -20.663 23.575  1.00 49.23  ? 281 ALA E CB  1 
ATOM   5545 N N   . LEU E 1 205 ? 63.566  -17.906 22.087  1.00 43.23  ? 282 LEU E N   1 
ATOM   5546 C CA  . LEU E 1 205 ? 62.583  -16.899 21.735  1.00 42.16  ? 282 LEU E CA  1 
ATOM   5547 C C   . LEU E 1 205 ? 61.687  -17.425 20.578  1.00 42.09  ? 282 LEU E C   1 
ATOM   5548 O O   . LEU E 1 205 ? 62.199  -17.886 19.567  1.00 41.42  ? 282 LEU E O   1 
ATOM   5549 C CB  . LEU E 1 205 ? 63.403  -15.652 21.368  1.00 42.02  ? 282 LEU E CB  1 
ATOM   5550 C CG  . LEU E 1 205 ? 62.839  -14.633 20.406  1.00 48.46  ? 282 LEU E CG  1 
ATOM   5551 C CD1 . LEU E 1 205 ? 61.750  -13.813 21.097  1.00 53.02  ? 282 LEU E CD1 1 
ATOM   5552 C CD2 . LEU E 1 205 ? 63.942  -13.762 19.860  1.00 44.12  ? 282 LEU E CD2 1 
ATOM   5553 N N   . LYS E 1 206 ? 60.369  -17.418 20.744  1.00 37.53  ? 283 LYS E N   1 
ATOM   5554 C CA  . LYS E 1 206 ? 59.495  -17.902 19.678  1.00 37.36  ? 283 LYS E CA  1 
ATOM   5555 C C   . LYS E 1 206 ? 59.339  -16.870 18.568  1.00 42.17  ? 283 LYS E C   1 
ATOM   5556 O O   . LYS E 1 206 ? 58.911  -15.757 18.849  1.00 43.65  ? 283 LYS E O   1 
ATOM   5557 C CB  . LYS E 1 206 ? 58.119  -18.341 20.205  1.00 39.85  ? 283 LYS E CB  1 
ATOM   5558 C CG  . LYS E 1 206 ? 57.207  -18.898 19.100  1.00 43.19  ? 283 LYS E CG  1 
ATOM   5559 C CD  . LYS E 1 206 ? 56.393  -20.072 19.580  1.00 54.02  ? 283 LYS E CD  1 
ATOM   5560 C CE  . LYS E 1 206 ? 55.179  -20.333 18.747  1.00 58.69  ? 283 LYS E CE  1 
ATOM   5561 N NZ  . LYS E 1 206 ? 53.958  -20.403 19.600  1.00 71.48  ? 283 LYS E NZ  1 
ATOM   5562 N N   . LEU E 1 207 ? 59.620  -17.259 17.307  1.00 37.24  ? 284 LEU E N   1 
ATOM   5563 C CA  . LEU E 1 207 ? 59.474  -16.389 16.136  1.00 35.95  ? 284 LEU E CA  1 
ATOM   5564 C C   . LEU E 1 207 ? 58.025  -16.331 15.744  1.00 44.92  ? 284 LEU E C   1 
ATOM   5565 O O   . LEU E 1 207 ? 57.312  -17.324 15.878  1.00 45.90  ? 284 LEU E O   1 
ATOM   5566 C CB  . LEU E 1 207 ? 60.292  -16.916 14.923  1.00 33.56  ? 284 LEU E CB  1 
ATOM   5567 C CG  . LEU E 1 207 ? 61.775  -17.070 15.102  1.00 36.18  ? 284 LEU E CG  1 
ATOM   5568 C CD1 . LEU E 1 207 ? 62.391  -17.533 13.864  1.00 35.35  ? 284 LEU E CD1 1 
ATOM   5569 C CD2 . LEU E 1 207 ? 62.419  -15.763 15.490  1.00 39.01  ? 284 LEU E CD2 1 
ATOM   5570 N N   . LEU E 1 208 ? 57.590  -15.188 15.220  1.00 45.33  ? 285 LEU E N   1 
ATOM   5571 C CA  . LEU E 1 208 ? 56.230  -15.044 14.698  1.00 56.06  ? 285 LEU E CA  1 
ATOM   5572 C C   . LEU E 1 208 ? 56.096  -15.725 13.345  1.00 60.13  ? 285 LEU E C   1 
ATOM   5573 O O   . LEU E 1 208 ? 55.049  -16.376 13.107  1.00 66.36  ? 285 LEU E O   1 
ATOM   5574 C CB  . LEU E 1 208 ? 55.813  -13.578 14.627  1.00 57.60  ? 285 LEU E CB  1 
ATOM   5575 C CG  . LEU E 1 208 ? 55.407  -13.035 15.986  1.00 65.66  ? 285 LEU E CG  1 
ATOM   5576 C CD1 . LEU E 1 208 ? 55.810  -11.620 16.135  1.00 67.73  ? 285 LEU E CD1 1 
ATOM   5577 C CD2 . LEU E 1 208 ? 53.933  -13.217 16.239  1.00 68.22  ? 285 LEU E CD2 1 
ATOM   5578 O OXT . LEU E 1 208 ? 57.089  -15.700 12.582  1.00 63.36  ? 285 LEU E OXT 1 
ATOM   5579 N N   . VAL F 1 65  ? 50.765  -12.422 10.790  1.00 76.00  ? 142 VAL F N   1 
ATOM   5580 C CA  . VAL F 1 65  ? 51.913  -12.265 9.892   1.00 73.33  ? 142 VAL F CA  1 
ATOM   5581 C C   . VAL F 1 65  ? 53.132  -13.003 10.478  1.00 75.55  ? 142 VAL F C   1 
ATOM   5582 O O   . VAL F 1 65  ? 53.286  -13.032 11.706  1.00 77.36  ? 142 VAL F O   1 
ATOM   5583 C CB  . VAL F 1 65  ? 52.250  -10.778 9.591   1.00 77.40  ? 142 VAL F CB  1 
ATOM   5584 C CG1 . VAL F 1 65  ? 53.101  -10.643 8.318   1.00 74.51  ? 142 VAL F CG1 1 
ATOM   5585 C CG2 . VAL F 1 65  ? 50.994  -9.907  9.514   1.00 81.00  ? 142 VAL F CG2 1 
ATOM   5586 N N   . THR F 1 66  ? 53.997  -13.595 9.602   1.00 66.40  ? 143 THR F N   1 
ATOM   5587 C CA  . THR F 1 66  ? 55.164  -14.361 10.034  1.00 61.70  ? 143 THR F CA  1 
ATOM   5588 C C   . THR F 1 66  ? 56.491  -13.736 9.646   1.00 60.58  ? 143 THR F C   1 
ATOM   5589 O O   . THR F 1 66  ? 56.542  -12.909 8.747   1.00 61.26  ? 143 THR F O   1 
ATOM   5590 C CB  . THR F 1 66  ? 55.083  -15.835 9.574   1.00 65.82  ? 143 THR F CB  1 
ATOM   5591 O OG1 . THR F 1 66  ? 55.351  -15.933 8.177   1.00 68.47  ? 143 THR F OG1 1 
ATOM   5592 C CG2 . THR F 1 66  ? 53.768  -16.529 9.947   1.00 61.25  ? 143 THR F CG2 1 
ATOM   5593 N N   . GLN F 1 67  ? 57.576  -14.177 10.306  1.00 52.72  ? 144 GLN F N   1 
ATOM   5594 C CA  . GLN F 1 67  ? 58.951  -13.750 10.052  1.00 48.29  ? 144 GLN F CA  1 
ATOM   5595 C C   . GLN F 1 67  ? 59.604  -14.786 9.158   1.00 49.83  ? 144 GLN F C   1 
ATOM   5596 O O   . GLN F 1 67  ? 59.935  -15.882 9.621   1.00 48.14  ? 144 GLN F O   1 
ATOM   5597 C CB  . GLN F 1 67  ? 59.730  -13.649 11.369  1.00 47.87  ? 144 GLN F CB  1 
ATOM   5598 C CG  . GLN F 1 67  ? 59.533  -12.353 12.090  1.00 53.43  ? 144 GLN F CG  1 
ATOM   5599 C CD  . GLN F 1 67  ? 60.107  -12.442 13.465  1.00 72.52  ? 144 GLN F CD  1 
ATOM   5600 O OE1 . GLN F 1 67  ? 59.532  -13.027 14.375  1.00 76.07  ? 144 GLN F OE1 1 
ATOM   5601 N NE2 . GLN F 1 67  ? 61.267  -11.881 13.644  1.00 66.56  ? 144 GLN F NE2 1 
ATOM   5602 N N   . ASP F 1 68  ? 59.770  -14.452 7.868   1.00 45.37  ? 145 ASP F N   1 
ATOM   5603 C CA  . ASP F 1 68  ? 60.417  -15.322 6.877   1.00 42.39  ? 145 ASP F CA  1 
ATOM   5604 C C   . ASP F 1 68  ? 61.855  -15.506 7.266   1.00 42.59  ? 145 ASP F C   1 
ATOM   5605 O O   . ASP F 1 68  ? 62.471  -14.581 7.766   1.00 42.06  ? 145 ASP F O   1 
ATOM   5606 C CB  . ASP F 1 68  ? 60.336  -14.707 5.458   1.00 44.09  ? 145 ASP F CB  1 
ATOM   5607 C CG  . ASP F 1 68  ? 58.955  -14.716 4.812   1.00 53.20  ? 145 ASP F CG  1 
ATOM   5608 O OD1 . ASP F 1 68  ? 57.977  -15.133 5.490   1.00 57.12  ? 145 ASP F OD1 1 
ATOM   5609 O OD2 . ASP F 1 68  ? 58.852  -14.335 3.623   1.00 52.06  ? 145 ASP F OD2 1 
ATOM   5610 N N   . CYS F 1 69  ? 62.379  -16.698 7.111   1.00 39.47  ? 146 CYS F N   1 
ATOM   5611 C CA  . CYS F 1 69  ? 63.765  -16.989 7.454   1.00 38.78  ? 146 CYS F CA  1 
ATOM   5612 C C   . CYS F 1 69  ? 64.284  -18.174 6.699   1.00 40.77  ? 146 CYS F C   1 
ATOM   5613 O O   . CYS F 1 69  ? 63.512  -19.027 6.267   1.00 41.88  ? 146 CYS F O   1 
ATOM   5614 C CB  . CYS F 1 69  ? 63.991  -17.128 8.959   1.00 40.82  ? 146 CYS F CB  1 
ATOM   5615 S SG  . CYS F 1 69  ? 62.676  -18.003 9.859   1.00 48.28  ? 146 CYS F SG  1 
ATOM   5616 N N   . LEU F 1 70  ? 65.592  -18.201 6.485   1.00 34.25  ? 147 LEU F N   1 
ATOM   5617 C CA  . LEU F 1 70  ? 66.259  -19.279 5.775   1.00 32.66  ? 147 LEU F CA  1 
ATOM   5618 C C   . LEU F 1 70  ? 67.538  -19.563 6.509   1.00 36.03  ? 147 LEU F C   1 
ATOM   5619 O O   . LEU F 1 70  ? 68.302  -18.638 6.805   1.00 33.73  ? 147 LEU F O   1 
ATOM   5620 C CB  . LEU F 1 70  ? 66.560  -18.887 4.322   1.00 31.80  ? 147 LEU F CB  1 
ATOM   5621 C CG  . LEU F 1 70  ? 67.143  -19.960 3.446   1.00 35.68  ? 147 LEU F CG  1 
ATOM   5622 C CD1 . LEU F 1 70  ? 66.488  -19.966 2.095   1.00 36.60  ? 147 LEU F CD1 1 
ATOM   5623 C CD2 . LEU F 1 70  ? 68.632  -19.803 3.325   1.00 36.39  ? 147 LEU F CD2 1 
ATOM   5624 N N   . GLN F 1 71  ? 67.766  -20.851 6.808   1.00 33.05  ? 148 GLN F N   1 
ATOM   5625 C CA  . GLN F 1 71  ? 68.999  -21.296 7.436   1.00 30.50  ? 148 GLN F CA  1 
ATOM   5626 C C   . GLN F 1 71  ? 69.665  -22.362 6.587   1.00 32.31  ? 148 GLN F C   1 
ATOM   5627 O O   . GLN F 1 71  ? 68.985  -23.248 6.045   1.00 31.84  ? 148 GLN F O   1 
ATOM   5628 C CB  . GLN F 1 71  ? 68.751  -21.805 8.839   1.00 31.63  ? 148 GLN F CB  1 
ATOM   5629 C CG  . GLN F 1 71  ? 70.018  -22.133 9.604   1.00 27.46  ? 148 GLN F CG  1 
ATOM   5630 C CD  . GLN F 1 71  ? 69.680  -22.466 11.014  1.00 34.24  ? 148 GLN F CD  1 
ATOM   5631 O OE1 . GLN F 1 71  ? 69.653  -21.590 11.889  1.00 22.86  ? 148 GLN F OE1 1 
ATOM   5632 N NE2 . GLN F 1 71  ? 69.402  -23.743 11.252  1.00 32.44  ? 148 GLN F NE2 1 
ATOM   5633 N N   . LEU F 1 72  ? 70.999  -22.243 6.476   1.00 26.87  ? 149 LEU F N   1 
ATOM   5634 C CA  . LEU F 1 72  ? 71.875  -23.156 5.769   1.00 27.61  ? 149 LEU F CA  1 
ATOM   5635 C C   . LEU F 1 72  ? 72.848  -23.799 6.782   1.00 32.11  ? 149 LEU F C   1 
ATOM   5636 O O   . LEU F 1 72  ? 73.305  -23.135 7.721   1.00 31.65  ? 149 LEU F O   1 
ATOM   5637 C CB  . LEU F 1 72  ? 72.681  -22.423 4.683   1.00 27.22  ? 149 LEU F CB  1 
ATOM   5638 C CG  . LEU F 1 72  ? 71.910  -21.695 3.592   1.00 31.10  ? 149 LEU F CG  1 
ATOM   5639 C CD1 . LEU F 1 72  ? 72.838  -20.824 2.813   1.00 30.28  ? 149 LEU F CD1 1 
ATOM   5640 C CD2 . LEU F 1 72  ? 71.195  -22.655 2.679   1.00 33.12  ? 149 LEU F CD2 1 
ATOM   5641 N N   . ILE F 1 73  ? 73.148  -25.092 6.584   1.00 26.48  ? 150 ILE F N   1 
ATOM   5642 C CA  . ILE F 1 73  ? 74.092  -25.834 7.403   1.00 25.82  ? 150 ILE F CA  1 
ATOM   5643 C C   . ILE F 1 73  ? 75.133  -26.465 6.486   1.00 31.98  ? 150 ILE F C   1 
ATOM   5644 O O   . ILE F 1 73  ? 74.803  -26.817 5.354   1.00 33.83  ? 150 ILE F O   1 
ATOM   5645 C CB  . ILE F 1 73  ? 73.407  -26.862 8.362   1.00 28.24  ? 150 ILE F CB  1 
ATOM   5646 C CG1 . ILE F 1 73  ? 72.592  -27.912 7.579   1.00 27.01  ? 150 ILE F CG1 1 
ATOM   5647 C CG2 . ILE F 1 73  ? 72.589  -26.129 9.468   1.00 27.09  ? 150 ILE F CG2 1 
ATOM   5648 C CD1 . ILE F 1 73  ? 72.181  -29.052 8.342   1.00 23.20  ? 150 ILE F CD1 1 
ATOM   5649 N N   . ALA F 1 74  ? 76.386  -26.571 6.954   1.00 27.67  ? 151 ALA F N   1 
ATOM   5650 C CA  . ALA F 1 74  ? 77.471  -27.123 6.166   1.00 28.88  ? 151 ALA F CA  1 
ATOM   5651 C C   . ALA F 1 74  ? 77.189  -28.540 5.630   1.00 38.66  ? 151 ALA F C   1 
ATOM   5652 O O   . ALA F 1 74  ? 76.647  -29.390 6.347   1.00 39.66  ? 151 ALA F O   1 
ATOM   5653 C CB  . ALA F 1 74  ? 78.749  -27.102 6.962   1.00 29.46  ? 151 ALA F CB  1 
ATOM   5654 N N   . ASP F 1 75  ? 77.520  -28.770 4.342   1.00 36.59  ? 152 ASP F N   1 
ATOM   5655 C CA  . ASP F 1 75  ? 77.347  -30.077 3.730   1.00 37.68  ? 152 ASP F CA  1 
ATOM   5656 C C   . ASP F 1 75  ? 78.652  -30.867 3.889   1.00 43.19  ? 152 ASP F C   1 
ATOM   5657 O O   . ASP F 1 75  ? 79.586  -30.702 3.096   1.00 41.83  ? 152 ASP F O   1 
ATOM   5658 C CB  . ASP F 1 75  ? 76.887  -29.964 2.264   1.00 39.88  ? 152 ASP F CB  1 
ATOM   5659 C CG  . ASP F 1 75  ? 76.808  -31.270 1.482   1.00 50.38  ? 152 ASP F CG  1 
ATOM   5660 O OD1 . ASP F 1 75  ? 76.848  -32.374 2.120   1.00 51.00  ? 152 ASP F OD1 1 
ATOM   5661 O OD2 . ASP F 1 75  ? 76.711  -31.203 0.249   1.00 54.26  ? 152 ASP F OD2 1 
ATOM   5662 N N   . SER F 1 76  ? 78.699  -31.726 4.941   1.00 41.39  ? 153 SER F N   1 
ATOM   5663 C CA  . SER F 1 76  ? 79.832  -32.580 5.270   1.00 41.79  ? 153 SER F CA  1 
ATOM   5664 C C   . SER F 1 76  ? 80.239  -33.544 4.138   1.00 46.99  ? 153 SER F C   1 
ATOM   5665 O O   . SER F 1 76  ? 81.353  -34.065 4.187   1.00 48.64  ? 153 SER F O   1 
ATOM   5666 C CB  . SER F 1 76  ? 79.558  -33.341 6.564   1.00 45.99  ? 153 SER F CB  1 
ATOM   5667 O OG  . SER F 1 76  ? 78.614  -34.383 6.388   1.00 57.73  ? 153 SER F OG  1 
ATOM   5668 N N   . GLU F 1 77  ? 79.372  -33.775 3.132   1.00 43.66  ? 154 GLU F N   1 
ATOM   5669 C CA  . GLU F 1 77  ? 79.722  -34.692 2.040   1.00 46.47  ? 154 GLU F CA  1 
ATOM   5670 C C   . GLU F 1 77  ? 80.313  -33.988 0.792   1.00 51.49  ? 154 GLU F C   1 
ATOM   5671 O O   . GLU F 1 77  ? 80.522  -34.648 -0.238  1.00 53.86  ? 154 GLU F O   1 
ATOM   5672 C CB  . GLU F 1 77  ? 78.527  -35.531 1.610   1.00 49.03  ? 154 GLU F CB  1 
ATOM   5673 C CG  . GLU F 1 77  ? 77.886  -36.416 2.654   1.00 61.29  ? 154 GLU F CG  1 
ATOM   5674 C CD  . GLU F 1 77  ? 76.534  -36.839 2.110   1.00 101.28 ? 154 GLU F CD  1 
ATOM   5675 O OE1 . GLU F 1 77  ? 76.494  -37.849 1.372   1.00 96.74  ? 154 GLU F OE1 1 
ATOM   5676 O OE2 . GLU F 1 77  ? 75.550  -36.080 2.288   1.00 110.67 ? 154 GLU F OE2 1 
ATOM   5677 N N   . THR F 1 78  ? 80.576  -32.672 0.866   1.00 43.82  ? 155 THR F N   1 
ATOM   5678 C CA  . THR F 1 78  ? 81.113  -31.951 -0.285  1.00 42.72  ? 155 THR F CA  1 
ATOM   5679 C C   . THR F 1 78  ? 82.402  -31.219 0.097   1.00 46.34  ? 155 THR F C   1 
ATOM   5680 O O   . THR F 1 78  ? 82.456  -30.604 1.177   1.00 46.28  ? 155 THR F O   1 
ATOM   5681 C CB  . THR F 1 78  ? 80.038  -31.006 -0.846  1.00 47.80  ? 155 THR F CB  1 
ATOM   5682 O OG1 . THR F 1 78  ? 78.951  -31.789 -1.294  1.00 53.72  ? 155 THR F OG1 1 
ATOM   5683 C CG2 . THR F 1 78  ? 80.528  -30.155 -2.003  1.00 44.17  ? 155 THR F CG2 1 
ATOM   5684 N N   . PRO F 1 79  ? 83.436  -31.208 -0.785  1.00 40.93  ? 156 PRO F N   1 
ATOM   5685 C CA  . PRO F 1 79  ? 84.656  -30.455 -0.454  1.00 39.97  ? 156 PRO F CA  1 
ATOM   5686 C C   . PRO F 1 79  ? 84.425  -28.944 -0.508  1.00 44.27  ? 156 PRO F C   1 
ATOM   5687 O O   . PRO F 1 79  ? 83.628  -28.480 -1.337  1.00 42.59  ? 156 PRO F O   1 
ATOM   5688 C CB  . PRO F 1 79  ? 85.652  -30.905 -1.528  1.00 42.53  ? 156 PRO F CB  1 
ATOM   5689 C CG  . PRO F 1 79  ? 84.853  -31.370 -2.619  1.00 46.62  ? 156 PRO F CG  1 
ATOM   5690 C CD  . PRO F 1 79  ? 83.554  -31.861 -2.102  1.00 42.08  ? 156 PRO F CD  1 
ATOM   5691 N N   . THR F 1 80  ? 85.134  -28.177 0.369   1.00 41.86  ? 157 THR F N   1 
ATOM   5692 C CA  . THR F 1 80  ? 85.076  -26.701 0.391   1.00 39.86  ? 157 THR F CA  1 
ATOM   5693 C C   . THR F 1 80  ? 85.400  -26.135 -0.982  1.00 44.45  ? 157 THR F C   1 
ATOM   5694 O O   . THR F 1 80  ? 86.212  -26.716 -1.716  1.00 48.82  ? 157 THR F O   1 
ATOM   5695 C CB  . THR F 1 80  ? 86.018  -26.102 1.424   1.00 41.82  ? 157 THR F CB  1 
ATOM   5696 O OG1 . THR F 1 80  ? 87.355  -26.550 1.186   1.00 40.64  ? 157 THR F OG1 1 
ATOM   5697 C CG2 . THR F 1 80  ? 85.570  -26.376 2.850   1.00 40.67  ? 157 THR F CG2 1 
ATOM   5698 N N   . ILE F 1 81  ? 84.733  -25.042 -1.337  1.00 36.48  ? 158 ILE F N   1 
ATOM   5699 C CA  . ILE F 1 81  ? 84.881  -24.365 -2.618  1.00 35.94  ? 158 ILE F CA  1 
ATOM   5700 C C   . ILE F 1 81  ? 86.028  -23.367 -2.565  1.00 40.28  ? 158 ILE F C   1 
ATOM   5701 O O   . ILE F 1 81  ? 86.015  -22.454 -1.740  1.00 40.35  ? 158 ILE F O   1 
ATOM   5702 C CB  . ILE F 1 81  ? 83.546  -23.692 -3.033  1.00 37.12  ? 158 ILE F CB  1 
ATOM   5703 C CG1 . ILE F 1 81  ? 82.416  -24.722 -3.148  1.00 37.29  ? 158 ILE F CG1 1 
ATOM   5704 C CG2 . ILE F 1 81  ? 83.685  -22.888 -4.321  1.00 36.77  ? 158 ILE F CG2 1 
ATOM   5705 C CD1 . ILE F 1 81  ? 81.288  -24.455 -2.265  1.00 38.65  ? 158 ILE F CD1 1 
ATOM   5706 N N   . GLN F 1 82  ? 86.990  -23.520 -3.472  1.00 37.41  ? 159 GLN F N   1 
ATOM   5707 C CA  . GLN F 1 82  ? 88.099  -22.589 -3.556  1.00 36.72  ? 159 GLN F CA  1 
ATOM   5708 C C   . GLN F 1 82  ? 87.841  -21.652 -4.723  1.00 43.13  ? 159 GLN F C   1 
ATOM   5709 O O   . GLN F 1 82  ? 87.647  -22.075 -5.866  1.00 43.65  ? 159 GLN F O   1 
ATOM   5710 C CB  . GLN F 1 82  ? 89.457  -23.300 -3.685  1.00 38.80  ? 159 GLN F CB  1 
ATOM   5711 C CG  . GLN F 1 82  ? 89.783  -24.293 -2.579  1.00 39.15  ? 159 GLN F CG  1 
ATOM   5712 C CD  . GLN F 1 82  ? 89.924  -23.647 -1.245  1.00 65.22  ? 159 GLN F CD  1 
ATOM   5713 O OE1 . GLN F 1 82  ? 90.463  -22.536 -1.137  1.00 67.33  ? 159 GLN F OE1 1 
ATOM   5714 N NE2 . GLN F 1 82  ? 89.424  -24.324 -0.201  1.00 54.29  ? 159 GLN F NE2 1 
ATOM   5715 N N   . LYS F 1 83  ? 87.738  -20.384 -4.410  1.00 40.68  ? 160 LYS F N   1 
ATOM   5716 C CA  . LYS F 1 83  ? 87.608  -19.362 -5.436  1.00 41.28  ? 160 LYS F CA  1 
ATOM   5717 C C   . LYS F 1 83  ? 88.594  -18.227 -5.115  1.00 50.41  ? 160 LYS F C   1 
ATOM   5718 O O   . LYS F 1 83  ? 88.273  -17.298 -4.381  1.00 49.41  ? 160 LYS F O   1 
ATOM   5719 C CB  . LYS F 1 83  ? 86.158  -18.895 -5.640  1.00 39.97  ? 160 LYS F CB  1 
ATOM   5720 N N   . GLY F 1 84  ? 89.815  -18.360 -5.620  1.00 51.40  ? 161 GLY F N   1 
ATOM   5721 C CA  . GLY F 1 84  ? 90.876  -17.370 -5.444  1.00 52.12  ? 161 GLY F CA  1 
ATOM   5722 C C   . GLY F 1 84  ? 91.530  -17.382 -4.087  1.00 56.02  ? 161 GLY F C   1 
ATOM   5723 O O   . GLY F 1 84  ? 91.930  -18.439 -3.572  1.00 58.61  ? 161 GLY F O   1 
ATOM   5724 N N   . SER F 1 85  ? 91.622  -16.190 -3.501  1.00 50.19  ? 162 SER F N   1 
ATOM   5725 C CA  . SER F 1 85  ? 92.198  -16.008 -2.157  1.00 49.18  ? 162 SER F CA  1 
ATOM   5726 C C   . SER F 1 85  ? 91.228  -16.447 -1.030  1.00 47.67  ? 162 SER F C   1 
ATOM   5727 O O   . SER F 1 85  ? 91.597  -16.412 0.145   1.00 46.36  ? 162 SER F O   1 
ATOM   5728 C CB  . SER F 1 85  ? 92.627  -14.554 -1.960  1.00 52.61  ? 162 SER F CB  1 
ATOM   5729 O OG  . SER F 1 85  ? 93.636  -14.190 -2.886  1.00 64.54  ? 162 SER F OG  1 
ATOM   5730 N N   . TYR F 1 86  ? 90.008  -16.876 -1.412  1.00 42.03  ? 163 TYR F N   1 
ATOM   5731 C CA  . TYR F 1 86  ? 88.915  -17.248 -0.520  1.00 39.83  ? 163 TYR F CA  1 
ATOM   5732 C C   . TYR F 1 86  ? 88.504  -18.717 -0.577  1.00 43.30  ? 163 TYR F C   1 
ATOM   5733 O O   . TYR F 1 86  ? 88.715  -19.409 -1.595  1.00 45.63  ? 163 TYR F O   1 
ATOM   5734 C CB  . TYR F 1 86  ? 87.680  -16.372 -0.816  1.00 38.88  ? 163 TYR F CB  1 
ATOM   5735 C CG  . TYR F 1 86  ? 87.920  -14.892 -0.609  1.00 39.71  ? 163 TYR F CG  1 
ATOM   5736 C CD1 . TYR F 1 86  ? 88.496  -14.113 -1.603  1.00 42.08  ? 163 TYR F CD1 1 
ATOM   5737 C CD2 . TYR F 1 86  ? 87.512  -14.257 0.554   1.00 39.46  ? 163 TYR F CD2 1 
ATOM   5738 C CE1 . TYR F 1 86  ? 88.697  -12.748 -1.425  1.00 41.64  ? 163 TYR F CE1 1 
ATOM   5739 C CE2 . TYR F 1 86  ? 87.711  -12.892 0.742   1.00 39.30  ? 163 TYR F CE2 1 
ATOM   5740 C CZ  . TYR F 1 86  ? 88.302  -12.142 -0.252  1.00 44.09  ? 163 TYR F CZ  1 
ATOM   5741 O OH  . TYR F 1 86  ? 88.512  -10.797 -0.086  1.00 45.91  ? 163 TYR F OH  1 
ATOM   5742 N N   . THR F 1 87  ? 87.877  -19.160 0.532   1.00 34.68  ? 164 THR F N   1 
ATOM   5743 C CA  . THR F 1 87  ? 87.313  -20.488 0.732   1.00 33.58  ? 164 THR F CA  1 
ATOM   5744 C C   . THR F 1 87  ? 85.827  -20.315 1.073   1.00 38.37  ? 164 THR F C   1 
ATOM   5745 O O   . THR F 1 87  ? 85.448  -19.506 1.952   1.00 35.56  ? 164 THR F O   1 
ATOM   5746 C CB  . THR F 1 87  ? 88.048  -21.264 1.837   1.00 33.91  ? 164 THR F CB  1 
ATOM   5747 O OG1 . THR F 1 87  ? 89.397  -21.477 1.445   1.00 35.80  ? 164 THR F OG1 1 
ATOM   5748 C CG2 . THR F 1 87  ? 87.418  -22.604 2.144   1.00 26.33  ? 164 THR F CG2 1 
ATOM   5749 N N   . PHE F 1 88  ? 84.986  -21.108 0.380   1.00 35.37  ? 165 PHE F N   1 
ATOM   5750 C CA  . PHE F 1 88  ? 83.546  -21.083 0.558   1.00 33.01  ? 165 PHE F CA  1 
ATOM   5751 C C   . PHE F 1 88  ? 83.035  -22.398 1.090   1.00 39.99  ? 165 PHE F C   1 
ATOM   5752 O O   . PHE F 1 88  ? 83.518  -23.478 0.706   1.00 41.61  ? 165 PHE F O   1 
ATOM   5753 C CB  . PHE F 1 88  ? 82.868  -20.688 -0.743  1.00 33.65  ? 165 PHE F CB  1 
ATOM   5754 C CG  . PHE F 1 88  ? 83.154  -19.256 -1.117  1.00 34.07  ? 165 PHE F CG  1 
ATOM   5755 C CD1 . PHE F 1 88  ? 82.394  -18.218 -0.593  1.00 36.41  ? 165 PHE F CD1 1 
ATOM   5756 C CD2 . PHE F 1 88  ? 84.210  -18.935 -1.954  1.00 35.47  ? 165 PHE F CD2 1 
ATOM   5757 C CE1 . PHE F 1 88  ? 82.681  -16.889 -0.914  1.00 36.32  ? 165 PHE F CE1 1 
ATOM   5758 C CE2 . PHE F 1 88  ? 84.503  -17.604 -2.254  1.00 37.74  ? 165 PHE F CE2 1 
ATOM   5759 C CZ  . PHE F 1 88  ? 83.746  -16.592 -1.726  1.00 34.92  ? 165 PHE F CZ  1 
ATOM   5760 N N   . VAL F 1 89  ? 82.081  -22.306 2.016   1.00 34.43  ? 166 VAL F N   1 
ATOM   5761 C CA  . VAL F 1 89  ? 81.511  -23.493 2.623   1.00 33.51  ? 166 VAL F CA  1 
ATOM   5762 C C   . VAL F 1 89  ? 80.433  -24.067 1.702   1.00 41.01  ? 166 VAL F C   1 
ATOM   5763 O O   . VAL F 1 89  ? 79.552  -23.314 1.306   1.00 41.19  ? 166 VAL F O   1 
ATOM   5764 C CB  . VAL F 1 89  ? 80.932  -23.146 4.016   1.00 33.74  ? 166 VAL F CB  1 
ATOM   5765 C CG1 . VAL F 1 89  ? 80.228  -24.345 4.660   1.00 33.31  ? 166 VAL F CG1 1 
ATOM   5766 C CG2 . VAL F 1 89  ? 82.007  -22.577 4.920   1.00 32.60  ? 166 VAL F CG2 1 
ATOM   5767 N N   . PRO F 1 90  ? 80.442  -25.373 1.362   1.00 40.16  ? 167 PRO F N   1 
ATOM   5768 C CA  . PRO F 1 90  ? 79.306  -25.920 0.609   1.00 40.61  ? 167 PRO F CA  1 
ATOM   5769 C C   . PRO F 1 90  ? 78.097  -26.024 1.553   1.00 44.83  ? 167 PRO F C   1 
ATOM   5770 O O   . PRO F 1 90  ? 78.188  -26.656 2.614   1.00 45.70  ? 167 PRO F O   1 
ATOM   5771 C CB  . PRO F 1 90  ? 79.800  -27.288 0.134   1.00 44.05  ? 167 PRO F CB  1 
ATOM   5772 C CG  . PRO F 1 90  ? 80.956  -27.630 0.972   1.00 48.83  ? 167 PRO F CG  1 
ATOM   5773 C CD  . PRO F 1 90  ? 81.396  -26.430 1.757   1.00 43.37  ? 167 PRO F CD  1 
ATOM   5774 N N   . TRP F 1 91  ? 76.989  -25.335 1.210   1.00 39.33  ? 168 TRP F N   1 
ATOM   5775 C CA  . TRP F 1 91  ? 75.793  -25.331 2.046   1.00 38.05  ? 168 TRP F CA  1 
ATOM   5776 C C   . TRP F 1 91  ? 74.759  -26.357 1.649   1.00 40.40  ? 168 TRP F C   1 
ATOM   5777 O O   . TRP F 1 91  ? 74.692  -26.779 0.498   1.00 42.64  ? 168 TRP F O   1 
ATOM   5778 C CB  . TRP F 1 91  ? 75.138  -23.941 2.072   1.00 36.82  ? 168 TRP F CB  1 
ATOM   5779 C CG  . TRP F 1 91  ? 76.018  -22.859 2.606   1.00 37.31  ? 168 TRP F CG  1 
ATOM   5780 C CD1 . TRP F 1 91  ? 76.541  -21.809 1.905   1.00 40.26  ? 168 TRP F CD1 1 
ATOM   5781 C CD2 . TRP F 1 91  ? 76.540  -22.757 3.938   1.00 36.43  ? 168 TRP F CD2 1 
ATOM   5782 N NE1 . TRP F 1 91  ? 77.363  -21.062 2.716   1.00 39.43  ? 168 TRP F NE1 1 
ATOM   5783 C CE2 . TRP F 1 91  ? 77.387  -21.626 3.972   1.00 39.98  ? 168 TRP F CE2 1 
ATOM   5784 C CE3 . TRP F 1 91  ? 76.376  -23.513 5.111   1.00 37.39  ? 168 TRP F CE3 1 
ATOM   5785 C CZ2 . TRP F 1 91  ? 78.045  -21.216 5.141   1.00 37.88  ? 168 TRP F CZ2 1 
ATOM   5786 C CZ3 . TRP F 1 91  ? 77.045  -23.118 6.261   1.00 37.90  ? 168 TRP F CZ3 1 
ATOM   5787 C CH2 . TRP F 1 91  ? 77.856  -21.975 6.272   1.00 37.79  ? 168 TRP F CH2 1 
ATOM   5788 N N   . LEU F 1 92  ? 73.920  -26.714 2.609   1.00 33.85  ? 169 LEU F N   1 
ATOM   5789 C CA  . LEU F 1 92  ? 72.775  -27.605 2.504   1.00 33.46  ? 169 LEU F CA  1 
ATOM   5790 C C   . LEU F 1 92  ? 71.643  -26.843 3.181   1.00 38.56  ? 169 LEU F C   1 
ATOM   5791 O O   . LEU F 1 92  ? 71.876  -26.161 4.197   1.00 40.22  ? 169 LEU F O   1 
ATOM   5792 C CB  . LEU F 1 92  ? 73.088  -28.823 3.315   1.00 34.43  ? 169 LEU F CB  1 
ATOM   5793 C CG  . LEU F 1 92  ? 72.816  -30.154 2.745   1.00 42.97  ? 169 LEU F CG  1 
ATOM   5794 C CD1 . LEU F 1 92  ? 73.586  -31.186 3.522   1.00 44.48  ? 169 LEU F CD1 1 
ATOM   5795 C CD2 . LEU F 1 92  ? 71.314  -30.495 2.897   1.00 49.90  ? 169 LEU F CD2 1 
ATOM   5796 N N   . LEU F 1 93  ? 70.427  -26.898 2.626   1.00 33.52  ? 170 LEU F N   1 
ATOM   5797 C CA  . LEU F 1 93  ? 69.332  -26.139 3.248   1.00 31.31  ? 170 LEU F CA  1 
ATOM   5798 C C   . LEU F 1 93  ? 68.868  -26.778 4.575   1.00 36.26  ? 170 LEU F C   1 
ATOM   5799 O O   . LEU F 1 93  ? 68.479  -27.951 4.594   1.00 38.15  ? 170 LEU F O   1 
ATOM   5800 C CB  . LEU F 1 93  ? 68.161  -25.957 2.281   1.00 30.99  ? 170 LEU F CB  1 
ATOM   5801 C CG  . LEU F 1 93  ? 66.933  -25.305 2.826   1.00 34.66  ? 170 LEU F CG  1 
ATOM   5802 C CD1 . LEU F 1 93  ? 67.025  -23.774 2.747   1.00 35.07  ? 170 LEU F CD1 1 
ATOM   5803 C CD2 . LEU F 1 93  ? 65.776  -25.742 2.078   1.00 35.06  ? 170 LEU F CD2 1 
ATOM   5804 N N   . SER F 1 94  ? 68.950  -25.997 5.685   1.00 30.36  ? 171 SER F N   1 
ATOM   5805 C CA  . SER F 1 94  ? 68.432  -26.413 6.986   1.00 30.69  ? 171 SER F CA  1 
ATOM   5806 C C   . SER F 1 94  ? 66.899  -26.279 6.943   1.00 35.29  ? 171 SER F C   1 
ATOM   5807 O O   . SER F 1 94  ? 66.179  -27.256 7.162   1.00 35.65  ? 171 SER F O   1 
ATOM   5808 C CB  . SER F 1 94  ? 68.984  -25.563 8.116   1.00 31.86  ? 171 SER F CB  1 
ATOM   5809 O OG  . SER F 1 94  ? 68.252  -25.887 9.285   1.00 40.50  ? 171 SER F OG  1 
ATOM   5810 N N   . PHE F 1 95  ? 66.419  -25.084 6.602   1.00 30.70  ? 172 PHE F N   1 
ATOM   5811 C CA  . PHE F 1 95  ? 64.998  -24.814 6.437   1.00 32.04  ? 172 PHE F CA  1 
ATOM   5812 C C   . PHE F 1 95  ? 64.835  -23.512 5.692   1.00 33.48  ? 172 PHE F C   1 
ATOM   5813 O O   . PHE F 1 95  ? 65.738  -22.662 5.715   1.00 31.44  ? 172 PHE F O   1 
ATOM   5814 C CB  . PHE F 1 95  ? 64.238  -24.766 7.795   1.00 35.12  ? 172 PHE F CB  1 
ATOM   5815 C CG  . PHE F 1 95  ? 64.565  -23.557 8.624   1.00 36.19  ? 172 PHE F CG  1 
ATOM   5816 C CD1 . PHE F 1 95  ? 63.899  -22.355 8.420   1.00 40.02  ? 172 PHE F CD1 1 
ATOM   5817 C CD2 . PHE F 1 95  ? 65.595  -23.594 9.552   1.00 37.88  ? 172 PHE F CD2 1 
ATOM   5818 C CE1 . PHE F 1 95  ? 64.281  -21.202 9.103   1.00 40.31  ? 172 PHE F CE1 1 
ATOM   5819 C CE2 . PHE F 1 95  ? 65.947  -22.450 10.270  1.00 40.12  ? 172 PHE F CE2 1 
ATOM   5820 C CZ  . PHE F 1 95  ? 65.302  -21.257 10.018  1.00 38.73  ? 172 PHE F CZ  1 
ATOM   5821 N N   . LYS F 1 96  ? 63.661  -23.351 5.077   1.00 30.48  ? 173 LYS F N   1 
ATOM   5822 C CA  . LYS F 1 96  ? 63.223  -22.152 4.356   1.00 29.98  ? 173 LYS F CA  1 
ATOM   5823 C C   . LYS F 1 96  ? 61.789  -21.916 4.801   1.00 36.42  ? 173 LYS F C   1 
ATOM   5824 O O   . LYS F 1 96  ? 60.946  -22.814 4.744   1.00 38.51  ? 173 LYS F O   1 
ATOM   5825 C CB  . LYS F 1 96  ? 63.329  -22.326 2.824   1.00 31.30  ? 173 LYS F CB  1 
ATOM   5826 C CG  . LYS F 1 96  ? 62.742  -21.164 2.035   1.00 29.18  ? 173 LYS F CG  1 
ATOM   5827 C CD  . LYS F 1 96  ? 62.650  -21.395 0.517   1.00 29.01  ? 173 LYS F CD  1 
ATOM   5828 C CE  . LYS F 1 96  ? 61.745  -20.320 -0.077  1.00 34.56  ? 173 LYS F CE  1 
ATOM   5829 N NZ  . LYS F 1 96  ? 61.213  -20.613 -1.448  1.00 45.47  ? 173 LYS F NZ  1 
ATOM   5830 N N   . ARG F 1 97  ? 61.530  -20.718 5.294   1.00 33.09  ? 174 ARG F N   1 
ATOM   5831 C CA  . ARG F 1 97  ? 60.228  -20.315 5.820   1.00 33.43  ? 174 ARG F CA  1 
ATOM   5832 C C   . ARG F 1 97  ? 59.842  -19.011 5.153   1.00 39.12  ? 174 ARG F C   1 
ATOM   5833 O O   . ARG F 1 97  ? 60.587  -18.041 5.243   1.00 37.78  ? 174 ARG F O   1 
ATOM   5834 C CB  . ARG F 1 97  ? 60.350  -20.151 7.327   1.00 27.14  ? 174 ARG F CB  1 
ATOM   5835 C CG  . ARG F 1 97  ? 59.041  -20.064 8.010   1.00 32.38  ? 174 ARG F CG  1 
ATOM   5836 C CD  . ARG F 1 97  ? 59.223  -19.640 9.449   1.00 34.87  ? 174 ARG F CD  1 
ATOM   5837 N NE  . ARG F 1 97  ? 57.931  -19.555 10.138  1.00 40.02  ? 174 ARG F NE  1 
ATOM   5838 C CZ  . ARG F 1 97  ? 57.583  -18.550 10.929  1.00 55.07  ? 174 ARG F CZ  1 
ATOM   5839 N NH1 . ARG F 1 97  ? 58.425  -17.552 11.154  1.00 54.30  ? 174 ARG F NH1 1 
ATOM   5840 N NH2 . ARG F 1 97  ? 56.391  -18.535 11.505  1.00 38.91  ? 174 ARG F NH2 1 
ATOM   5841 N N   . GLY F 1 98  ? 58.752  -19.030 4.397   1.00 39.29  ? 175 GLY F N   1 
ATOM   5842 C CA  . GLY F 1 98  ? 58.272  -17.857 3.682   1.00 40.47  ? 175 GLY F CA  1 
ATOM   5843 C C   . GLY F 1 98  ? 58.900  -17.639 2.323   1.00 47.67  ? 175 GLY F C   1 
ATOM   5844 O O   . GLY F 1 98  ? 59.633  -18.494 1.807   1.00 47.42  ? 175 GLY F O   1 
ATOM   5845 N N   . SER F 1 99  ? 58.617  -16.462 1.740   1.00 45.68  ? 176 SER F N   1 
ATOM   5846 C CA  . SER F 1 99  ? 59.002  -16.072 0.375   1.00 44.98  ? 176 SER F CA  1 
ATOM   5847 C C   . SER F 1 99  ? 60.213  -15.176 0.219   1.00 46.51  ? 176 SER F C   1 
ATOM   5848 O O   . SER F 1 99  ? 60.861  -15.247 -0.812  1.00 44.60  ? 176 SER F O   1 
ATOM   5849 C CB  . SER F 1 99  ? 57.809  -15.440 -0.340  1.00 50.60  ? 176 SER F CB  1 
ATOM   5850 O OG  . SER F 1 99  ? 57.114  -14.503 0.473   1.00 61.35  ? 176 SER F OG  1 
ATOM   5851 N N   . ALA F 1 100 ? 60.489  -14.307 1.208   1.00 44.25  ? 177 ALA F N   1 
ATOM   5852 C CA  . ALA F 1 100 ? 61.569  -13.308 1.224   1.00 43.30  ? 177 ALA F CA  1 
ATOM   5853 C C   . ALA F 1 100 ? 62.965  -13.819 0.982   1.00 47.32  ? 177 ALA F C   1 
ATOM   5854 O O   . ALA F 1 100 ? 63.775  -13.080 0.437   1.00 48.38  ? 177 ALA F O   1 
ATOM   5855 C CB  . ALA F 1 100 ? 61.539  -12.523 2.520   1.00 43.91  ? 177 ALA F CB  1 
ATOM   5856 N N   . LEU F 1 101 ? 63.274  -15.038 1.418   1.00 43.02  ? 178 LEU F N   1 
ATOM   5857 C CA  . LEU F 1 101 ? 64.607  -15.599 1.233   1.00 41.28  ? 178 LEU F CA  1 
ATOM   5858 C C   . LEU F 1 101 ? 64.590  -16.942 0.503   1.00 50.32  ? 178 LEU F C   1 
ATOM   5859 O O   . LEU F 1 101 ? 63.699  -17.768 0.728   1.00 52.51  ? 178 LEU F O   1 
ATOM   5860 C CB  . LEU F 1 101 ? 65.378  -15.709 2.571   1.00 38.86  ? 178 LEU F CB  1 
ATOM   5861 C CG  . LEU F 1 101 ? 65.609  -14.422 3.342   1.00 40.36  ? 178 LEU F CG  1 
ATOM   5862 C CD1 . LEU F 1 101 ? 65.796  -14.702 4.809   1.00 39.47  ? 178 LEU F CD1 1 
ATOM   5863 C CD2 . LEU F 1 101 ? 66.741  -13.622 2.774   1.00 38.30  ? 178 LEU F CD2 1 
ATOM   5864 N N   . GLU F 1 102 ? 65.604  -17.154 -0.351  1.00 46.78  ? 179 GLU F N   1 
ATOM   5865 C CA  . GLU F 1 102 ? 65.811  -18.347 -1.173  1.00 46.49  ? 179 GLU F CA  1 
ATOM   5866 C C   . GLU F 1 102 ? 67.283  -18.768 -1.181  1.00 50.04  ? 179 GLU F C   1 
ATOM   5867 O O   . GLU F 1 102 ? 68.154  -17.931 -0.962  1.00 50.60  ? 179 GLU F O   1 
ATOM   5868 C CB  . GLU F 1 102 ? 65.417  -18.042 -2.619  1.00 47.99  ? 179 GLU F CB  1 
ATOM   5869 C CG  . GLU F 1 102 ? 63.937  -18.094 -2.892  1.00 51.51  ? 179 GLU F CG  1 
ATOM   5870 C CD  . GLU F 1 102 ? 63.568  -17.859 -4.341  1.00 66.24  ? 179 GLU F CD  1 
ATOM   5871 O OE1 . GLU F 1 102 ? 64.406  -18.145 -5.231  1.00 52.87  ? 179 GLU F OE1 1 
ATOM   5872 O OE2 . GLU F 1 102 ? 62.422  -17.414 -4.585  1.00 57.77  ? 179 GLU F OE2 1 
ATOM   5873 N N   . GLU F 1 103 ? 67.553  -20.043 -1.476  1.00 44.85  ? 180 GLU F N   1 
ATOM   5874 C CA  . GLU F 1 103 ? 68.899  -20.576 -1.640  1.00 43.87  ? 180 GLU F CA  1 
ATOM   5875 C C   . GLU F 1 103 ? 69.164  -20.461 -3.150  1.00 46.25  ? 180 GLU F C   1 
ATOM   5876 O O   . GLU F 1 103 ? 68.337  -20.902 -3.952  1.00 45.74  ? 180 GLU F O   1 
ATOM   5877 C CB  . GLU F 1 103 ? 68.949  -22.076 -1.210  1.00 46.61  ? 180 GLU F CB  1 
ATOM   5878 C CG  . GLU F 1 103 ? 70.342  -22.683 -1.056  1.00 60.71  ? 180 GLU F CG  1 
ATOM   5879 C CD  . GLU F 1 103 ? 71.118  -23.126 -2.288  1.00 102.93 ? 180 GLU F CD  1 
ATOM   5880 O OE1 . GLU F 1 103 ? 70.499  -23.349 -3.356  1.00 111.61 ? 180 GLU F OE1 1 
ATOM   5881 O OE2 . GLU F 1 103 ? 72.351  -23.317 -2.162  1.00 101.31 ? 180 GLU F OE2 1 
ATOM   5882 N N   . LYS F 1 104 ? 70.294  -19.858 -3.543  1.00 41.44  ? 181 LYS F N   1 
ATOM   5883 C CA  . LYS F 1 104 ? 70.678  -19.763 -4.959  1.00 40.45  ? 181 LYS F CA  1 
ATOM   5884 C C   . LYS F 1 104 ? 72.183  -19.876 -5.064  1.00 43.31  ? 181 LYS F C   1 
ATOM   5885 O O   . LYS F 1 104 ? 72.910  -19.026 -4.524  1.00 42.46  ? 181 LYS F O   1 
ATOM   5886 C CB  . LYS F 1 104 ? 70.154  -18.490 -5.646  1.00 41.33  ? 181 LYS F CB  1 
ATOM   5887 N N   . GLU F 1 105 ? 72.652  -20.977 -5.698  1.00 39.49  ? 182 GLU F N   1 
ATOM   5888 C CA  . GLU F 1 105 ? 74.065  -21.281 -5.981  1.00 38.21  ? 182 GLU F CA  1 
ATOM   5889 C C   . GLU F 1 105 ? 74.968  -21.034 -4.760  1.00 36.56  ? 182 GLU F C   1 
ATOM   5890 O O   . GLU F 1 105 ? 75.933  -20.281 -4.844  1.00 34.46  ? 182 GLU F O   1 
ATOM   5891 C CB  . GLU F 1 105 ? 74.559  -20.431 -7.190  1.00 40.49  ? 182 GLU F CB  1 
ATOM   5892 C CG  . GLU F 1 105 ? 73.937  -20.797 -8.523  1.00 56.41  ? 182 GLU F CG  1 
ATOM   5893 C CD  . GLU F 1 105 ? 74.343  -19.925 -9.702  1.00 88.15  ? 182 GLU F CD  1 
ATOM   5894 O OE1 . GLU F 1 105 ? 74.587  -18.711 -9.508  1.00 71.49  ? 182 GLU F OE1 1 
ATOM   5895 O OE2 . GLU F 1 105 ? 74.369  -20.453 -10.838 1.00 93.43  ? 182 GLU F OE2 1 
ATOM   5896 N N   . ASN F 1 106 ? 74.602  -21.605 -3.615  1.00 31.29  ? 183 ASN F N   1 
ATOM   5897 C CA  . ASN F 1 106 ? 75.337  -21.494 -2.360  1.00 28.80  ? 183 ASN F CA  1 
ATOM   5898 C C   . ASN F 1 106 ? 75.331  -20.119 -1.700  1.00 33.66  ? 183 ASN F C   1 
ATOM   5899 O O   . ASN F 1 106 ? 76.189  -19.829 -0.864  1.00 35.62  ? 183 ASN F O   1 
ATOM   5900 C CB  . ASN F 1 106 ? 76.729  -22.032 -2.523  1.00 25.16  ? 183 ASN F CB  1 
ATOM   5901 C CG  . ASN F 1 106 ? 77.014  -23.164 -1.602  1.00 62.93  ? 183 ASN F CG  1 
ATOM   5902 O OD1 . ASN F 1 106 ? 76.228  -24.129 -1.453  1.00 54.69  ? 183 ASN F OD1 1 
ATOM   5903 N ND2 . ASN F 1 106 ? 78.169  -23.056 -0.975  1.00 60.66  ? 183 ASN F ND2 1 
ATOM   5904 N N   . LYS F 1 107 ? 74.356  -19.280 -2.049  1.00 29.04  ? 184 LYS F N   1 
ATOM   5905 C CA  . LYS F 1 107 ? 74.185  -17.944 -1.483  1.00 27.26  ? 184 LYS F CA  1 
ATOM   5906 C C   . LYS F 1 107 ? 72.708  -17.802 -1.047  1.00 31.40  ? 184 LYS F C   1 
ATOM   5907 O O   . LYS F 1 107 ? 71.827  -18.527 -1.537  1.00 31.06  ? 184 LYS F O   1 
ATOM   5908 C CB  . LYS F 1 107 ? 74.514  -16.867 -2.540  1.00 29.43  ? 184 LYS F CB  1 
ATOM   5909 C CG  . LYS F 1 107 ? 75.946  -16.851 -3.101  1.00 36.61  ? 184 LYS F CG  1 
ATOM   5910 C CD  . LYS F 1 107 ? 75.984  -16.346 -4.555  1.00 40.96  ? 184 LYS F CD  1 
ATOM   5911 N N   . ILE F 1 108 ? 72.438  -16.871 -0.138  1.00 28.04  ? 185 ILE F N   1 
ATOM   5912 C CA  . ILE F 1 108 ? 71.066  -16.558 0.271   1.00 28.42  ? 185 ILE F CA  1 
ATOM   5913 C C   . ILE F 1 108 ? 70.616  -15.396 -0.645  1.00 36.99  ? 185 ILE F C   1 
ATOM   5914 O O   . ILE F 1 108 ? 71.285  -14.362 -0.728  1.00 38.21  ? 185 ILE F O   1 
ATOM   5915 C CB  . ILE F 1 108 ? 70.927  -16.220 1.779   1.00 29.68  ? 185 ILE F CB  1 
ATOM   5916 C CG1 . ILE F 1 108 ? 71.449  -17.371 2.666   1.00 28.51  ? 185 ILE F CG1 1 
ATOM   5917 C CG2 . ILE F 1 108 ? 69.494  -15.879 2.089   1.00 30.51  ? 185 ILE F CG2 1 
ATOM   5918 C CD1 . ILE F 1 108 ? 71.557  -17.092 4.167   1.00 29.10  ? 185 ILE F CD1 1 
ATOM   5919 N N   . LEU F 1 109 ? 69.534  -15.601 -1.379  1.00 35.46  ? 186 LEU F N   1 
ATOM   5920 C CA  . LEU F 1 109 ? 69.015  -14.616 -2.322  1.00 35.77  ? 186 LEU F CA  1 
ATOM   5921 C C   . LEU F 1 109 ? 67.843  -13.893 -1.696  1.00 39.52  ? 186 LEU F C   1 
ATOM   5922 O O   . LEU F 1 109 ? 66.899  -14.526 -1.220  1.00 40.54  ? 186 LEU F O   1 
ATOM   5923 C CB  . LEU F 1 109 ? 68.624  -15.294 -3.657  1.00 36.82  ? 186 LEU F CB  1 
ATOM   5924 C CG  . LEU F 1 109 ? 67.810  -14.471 -4.656  1.00 42.60  ? 186 LEU F CG  1 
ATOM   5925 C CD1 . LEU F 1 109 ? 68.593  -13.254 -5.198  1.00 41.87  ? 186 LEU F CD1 1 
ATOM   5926 C CD2 . LEU F 1 109 ? 67.334  -15.343 -5.788  1.00 47.79  ? 186 LEU F CD2 1 
ATOM   5927 N N   . VAL F 1 110 ? 67.914  -12.567 -1.699  1.00 33.89  ? 187 VAL F N   1 
ATOM   5928 C CA  . VAL F 1 110 ? 66.883  -11.714 -1.142  1.00 34.15  ? 187 VAL F CA  1 
ATOM   5929 C C   . VAL F 1 110 ? 65.804  -11.481 -2.209  1.00 38.34  ? 187 VAL F C   1 
ATOM   5930 O O   . VAL F 1 110 ? 66.101  -10.985 -3.304  1.00 38.21  ? 187 VAL F O   1 
ATOM   5931 C CB  . VAL F 1 110 ? 67.506  -10.394 -0.614  1.00 37.48  ? 187 VAL F CB  1 
ATOM   5932 C CG1 . VAL F 1 110 ? 66.443  -9.461  -0.002  1.00 37.84  ? 187 VAL F CG1 1 
ATOM   5933 C CG2 . VAL F 1 110 ? 68.638  -10.683 0.374   1.00 35.27  ? 187 VAL F CG2 1 
ATOM   5934 N N   . LYS F 1 111 ? 64.554  -11.861 -1.882  1.00 34.29  ? 188 LYS F N   1 
ATOM   5935 C CA  . LYS F 1 111 ? 63.395  -11.740 -2.778  1.00 34.35  ? 188 LYS F CA  1 
ATOM   5936 C C   . LYS F 1 111 ? 62.491  -10.557 -2.441  1.00 40.10  ? 188 LYS F C   1 
ATOM   5937 O O   . LYS F 1 111 ? 61.793  -10.044 -3.316  1.00 40.36  ? 188 LYS F O   1 
ATOM   5938 C CB  . LYS F 1 111 ? 62.614  -13.072 -2.890  1.00 34.33  ? 188 LYS F CB  1 
ATOM   5939 C CG  . LYS F 1 111 ? 63.406  -14.226 -3.546  1.00 36.11  ? 188 LYS F CG  1 
ATOM   5940 C CD  . LYS F 1 111 ? 63.798  -14.025 -5.049  1.00 46.87  ? 188 LYS F CD  1 
ATOM   5941 C CE  . LYS F 1 111 ? 62.746  -14.310 -6.100  1.00 56.14  ? 188 LYS F CE  1 
ATOM   5942 N NZ  . LYS F 1 111 ? 63.189  -15.405 -7.006  1.00 63.93  ? 188 LYS F NZ  1 
ATOM   5943 N N   . GLU F 1 112 ? 62.517  -10.120 -1.181  1.00 37.30  ? 189 GLU F N   1 
ATOM   5944 C CA  . GLU F 1 112 ? 61.743  -8.974  -0.709  1.00 38.13  ? 189 GLU F CA  1 
ATOM   5945 C C   . GLU F 1 112 ? 62.679  -7.999  -0.007  1.00 41.07  ? 189 GLU F C   1 
ATOM   5946 O O   . GLU F 1 112 ? 63.542  -8.430  0.773   1.00 40.51  ? 189 GLU F O   1 
ATOM   5947 C CB  . GLU F 1 112 ? 60.670  -9.434  0.277   1.00 40.26  ? 189 GLU F CB  1 
ATOM   5948 C CG  . GLU F 1 112 ? 59.487  -10.082 -0.402  1.00 53.54  ? 189 GLU F CG  1 
ATOM   5949 C CD  . GLU F 1 112 ? 58.703  -11.060 0.452   1.00 74.24  ? 189 GLU F CD  1 
ATOM   5950 O OE1 . GLU F 1 112 ? 58.497  -10.778 1.661   1.00 75.86  ? 189 GLU F OE1 1 
ATOM   5951 O OE2 . GLU F 1 112 ? 58.267  -12.097 -0.108  1.00 45.57  ? 189 GLU F OE2 1 
ATOM   5952 N N   . THR F 1 113 ? 62.498  -6.699  -0.242  1.00 36.21  ? 190 THR F N   1 
ATOM   5953 C CA  . THR F 1 113 ? 63.308  -5.695  0.437   1.00 35.15  ? 190 THR F CA  1 
ATOM   5954 C C   . THR F 1 113 ? 62.903  -5.624  1.909   1.00 42.02  ? 190 THR F C   1 
ATOM   5955 O O   . THR F 1 113 ? 61.721  -5.754  2.213   1.00 46.01  ? 190 THR F O   1 
ATOM   5956 C CB  . THR F 1 113 ? 63.176  -4.354  -0.284  1.00 44.40  ? 190 THR F CB  1 
ATOM   5957 O OG1 . THR F 1 113 ? 63.686  -4.508  -1.617  1.00 50.59  ? 190 THR F OG1 1 
ATOM   5958 C CG2 . THR F 1 113 ? 63.907  -3.207  0.440   1.00 38.32  ? 190 THR F CG2 1 
ATOM   5959 N N   . GLY F 1 114 ? 63.870  -5.427  2.800   1.00 36.54  ? 191 GLY F N   1 
ATOM   5960 C CA  . GLY F 1 114 ? 63.593  -5.292  4.222   1.00 36.64  ? 191 GLY F CA  1 
ATOM   5961 C C   . GLY F 1 114 ? 64.817  -5.212  5.099   1.00 41.11  ? 191 GLY F C   1 
ATOM   5962 O O   . GLY F 1 114 ? 65.923  -4.998  4.606   1.00 39.99  ? 191 GLY F O   1 
ATOM   5963 N N   . TYR F 1 115 ? 64.604  -5.365  6.416   1.00 40.08  ? 192 TYR F N   1 
ATOM   5964 C CA  . TYR F 1 115 ? 65.636  -5.417  7.453   1.00 39.26  ? 192 TYR F CA  1 
ATOM   5965 C C   . TYR F 1 115 ? 65.764  -6.879  7.839   1.00 41.86  ? 192 TYR F C   1 
ATOM   5966 O O   . TYR F 1 115 ? 64.755  -7.560  8.049   1.00 44.72  ? 192 TYR F O   1 
ATOM   5967 C CB  . TYR F 1 115 ? 65.280  -4.531  8.673   1.00 42.31  ? 192 TYR F CB  1 
ATOM   5968 C CG  . TYR F 1 115 ? 65.473  -3.050  8.411   1.00 46.74  ? 192 TYR F CG  1 
ATOM   5969 C CD1 . TYR F 1 115 ? 64.493  -2.304  7.770   1.00 50.64  ? 192 TYR F CD1 1 
ATOM   5970 C CD2 . TYR F 1 115 ? 66.649  -2.401  8.780   1.00 47.74  ? 192 TYR F CD2 1 
ATOM   5971 C CE1 . TYR F 1 115 ? 64.671  -0.946  7.503   1.00 53.75  ? 192 TYR F CE1 1 
ATOM   5972 C CE2 . TYR F 1 115 ? 66.835  -1.038  8.529   1.00 50.29  ? 192 TYR F CE2 1 
ATOM   5973 C CZ  . TYR F 1 115 ? 65.841  -0.312  7.890   1.00 63.30  ? 192 TYR F CZ  1 
ATOM   5974 O OH  . TYR F 1 115 ? 66.017  1.035   7.627   1.00 68.79  ? 192 TYR F OH  1 
ATOM   5975 N N   . PHE F 1 116 ? 66.985  -7.386  7.857   1.00 33.75  ? 193 PHE F N   1 
ATOM   5976 C CA  . PHE F 1 116 ? 67.191  -8.796  8.134   1.00 31.59  ? 193 PHE F CA  1 
ATOM   5977 C C   . PHE F 1 116 ? 68.208  -9.004  9.215   1.00 33.97  ? 193 PHE F C   1 
ATOM   5978 O O   . PHE F 1 116 ? 69.265  -8.366  9.200   1.00 32.67  ? 193 PHE F O   1 
ATOM   5979 C CB  . PHE F 1 116 ? 67.658  -9.521  6.856   1.00 32.08  ? 193 PHE F CB  1 
ATOM   5980 C CG  . PHE F 1 116 ? 66.645  -9.584  5.736   1.00 34.20  ? 193 PHE F CG  1 
ATOM   5981 C CD1 . PHE F 1 116 ? 66.437  -8.490  4.899   1.00 37.46  ? 193 PHE F CD1 1 
ATOM   5982 C CD2 . PHE F 1 116 ? 65.938  -10.755 5.483   1.00 36.08  ? 193 PHE F CD2 1 
ATOM   5983 C CE1 . PHE F 1 116 ? 65.506  -8.550  3.861   1.00 39.05  ? 193 PHE F CE1 1 
ATOM   5984 C CE2 . PHE F 1 116 ? 65.028  -10.828 4.430   1.00 39.40  ? 193 PHE F CE2 1 
ATOM   5985 C CZ  . PHE F 1 116 ? 64.810  -9.720  3.632   1.00 38.85  ? 193 PHE F CZ  1 
ATOM   5986 N N   . PHE F 1 117 ? 67.907  -9.919  10.148  1.00 30.35  ? 194 PHE F N   1 
ATOM   5987 C CA  . PHE F 1 117 ? 68.876  -10.325 11.151  1.00 29.59  ? 194 PHE F CA  1 
ATOM   5988 C C   . PHE F 1 117 ? 69.683  -11.419 10.460  1.00 29.65  ? 194 PHE F C   1 
ATOM   5989 O O   . PHE F 1 117 ? 69.095  -12.438 10.084  1.00 27.45  ? 194 PHE F O   1 
ATOM   5990 C CB  . PHE F 1 117 ? 68.196  -10.872 12.411  1.00 32.67  ? 194 PHE F CB  1 
ATOM   5991 C CG  . PHE F 1 117 ? 69.180  -11.448 13.405  1.00 32.94  ? 194 PHE F CG  1 
ATOM   5992 C CD1 . PHE F 1 117 ? 69.999  -10.618 14.154  1.00 35.92  ? 194 PHE F CD1 1 
ATOM   5993 C CD2 . PHE F 1 117 ? 69.252  -12.815 13.618  1.00 34.20  ? 194 PHE F CD2 1 
ATOM   5994 C CE1 . PHE F 1 117 ? 70.878  -11.141 15.090  1.00 37.45  ? 194 PHE F CE1 1 
ATOM   5995 C CE2 . PHE F 1 117 ? 70.146  -13.344 14.537  1.00 37.76  ? 194 PHE F CE2 1 
ATOM   5996 C CZ  . PHE F 1 117 ? 70.955  -12.503 15.271  1.00 36.80  ? 194 PHE F CZ  1 
ATOM   5997 N N   . ILE F 1 118 ? 71.000  -11.187 10.239  1.00 26.00  ? 195 ILE F N   1 
ATOM   5998 C CA  . ILE F 1 118 ? 71.885  -12.130 9.534   1.00 25.94  ? 195 ILE F CA  1 
ATOM   5999 C C   . ILE F 1 118 ? 72.905  -12.686 10.489  1.00 34.51  ? 195 ILE F C   1 
ATOM   6000 O O   . ILE F 1 118 ? 73.493  -11.920 11.240  1.00 35.27  ? 195 ILE F O   1 
ATOM   6001 C CB  . ILE F 1 118 ? 72.541  -11.457 8.329   1.00 28.43  ? 195 ILE F CB  1 
ATOM   6002 C CG1 . ILE F 1 118 ? 71.468  -10.824 7.394   1.00 29.08  ? 195 ILE F CG1 1 
ATOM   6003 C CG2 . ILE F 1 118 ? 73.404  -12.451 7.586   1.00 28.54  ? 195 ILE F CG2 1 
ATOM   6004 C CD1 . ILE F 1 118 ? 71.758  -9.526  6.973   1.00 28.23  ? 195 ILE F CD1 1 
ATOM   6005 N N   . TYR F 1 119 ? 73.090  -14.017 10.494  1.00 33.23  ? 196 TYR F N   1 
ATOM   6006 C CA  . TYR F 1 119 ? 73.999  -14.736 11.406  1.00 32.45  ? 196 TYR F CA  1 
ATOM   6007 C C   . TYR F 1 119 ? 74.822  -15.801 10.687  1.00 34.21  ? 196 TYR F C   1 
ATOM   6008 O O   . TYR F 1 119 ? 74.413  -16.288 9.628   1.00 34.20  ? 196 TYR F O   1 
ATOM   6009 C CB  . TYR F 1 119 ? 73.211  -15.372 12.573  1.00 33.88  ? 196 TYR F CB  1 
ATOM   6010 C CG  . TYR F 1 119 ? 72.148  -16.358 12.153  1.00 36.41  ? 196 TYR F CG  1 
ATOM   6011 C CD1 . TYR F 1 119 ? 70.870  -15.929 11.806  1.00 37.87  ? 196 TYR F CD1 1 
ATOM   6012 C CD2 . TYR F 1 119 ? 72.406  -17.734 12.140  1.00 38.34  ? 196 TYR F CD2 1 
ATOM   6013 C CE1 . TYR F 1 119 ? 69.880  -16.839 11.425  1.00 40.12  ? 196 TYR F CE1 1 
ATOM   6014 C CE2 . TYR F 1 119 ? 71.419  -18.656 11.768  1.00 39.22  ? 196 TYR F CE2 1 
ATOM   6015 C CZ  . TYR F 1 119 ? 70.156  -18.200 11.418  1.00 42.60  ? 196 TYR F CZ  1 
ATOM   6016 O OH  . TYR F 1 119 ? 69.181  -19.073 11.024  1.00 37.98  ? 196 TYR F OH  1 
ATOM   6017 N N   . GLY F 1 120 ? 75.960  -16.154 11.278  1.00 28.31  ? 197 GLY F N   1 
ATOM   6018 C CA  . GLY F 1 120 ? 76.847  -17.168 10.739  1.00 27.43  ? 197 GLY F CA  1 
ATOM   6019 C C   . GLY F 1 120 ? 77.912  -17.623 11.716  1.00 31.99  ? 197 GLY F C   1 
ATOM   6020 O O   . GLY F 1 120 ? 78.469  -16.816 12.470  1.00 34.29  ? 197 GLY F O   1 
ATOM   6021 N N   . GLN F 1 121 ? 78.208  -18.921 11.690  1.00 25.57  ? 198 GLN F N   1 
ATOM   6022 C CA  . GLN F 1 121 ? 79.243  -19.526 12.496  1.00 25.22  ? 198 GLN F CA  1 
ATOM   6023 C C   . GLN F 1 121 ? 80.019  -20.521 11.653  1.00 32.17  ? 198 GLN F C   1 
ATOM   6024 O O   . GLN F 1 121 ? 79.438  -21.199 10.781  1.00 33.72  ? 198 GLN F O   1 
ATOM   6025 C CB  . GLN F 1 121 ? 78.665  -20.227 13.729  1.00 26.81  ? 198 GLN F CB  1 
ATOM   6026 C CG  . GLN F 1 121 ? 79.737  -20.889 14.621  1.00 36.18  ? 198 GLN F CG  1 
ATOM   6027 C CD  . GLN F 1 121 ? 79.199  -21.457 15.900  1.00 38.76  ? 198 GLN F CD  1 
ATOM   6028 O OE1 . GLN F 1 121 ? 78.828  -20.732 16.827  1.00 32.33  ? 198 GLN F OE1 1 
ATOM   6029 N NE2 . GLN F 1 121 ? 79.168  -22.768 15.984  1.00 30.94  ? 198 GLN F NE2 1 
ATOM   6030 N N   . VAL F 1 122 ? 81.342  -20.611 11.920  1.00 27.10  ? 199 VAL F N   1 
ATOM   6031 C CA  . VAL F 1 122 ? 82.256  -21.549 11.267  1.00 26.96  ? 199 VAL F CA  1 
ATOM   6032 C C   . VAL F 1 122 ? 83.180  -22.067 12.371  1.00 33.68  ? 199 VAL F C   1 
ATOM   6033 O O   . VAL F 1 122 ? 83.575  -21.289 13.237  1.00 32.77  ? 199 VAL F O   1 
ATOM   6034 C CB  . VAL F 1 122 ? 83.093  -20.883 10.126  1.00 29.12  ? 199 VAL F CB  1 
ATOM   6035 C CG1 . VAL F 1 122 ? 84.034  -21.881 9.462   1.00 28.48  ? 199 VAL F CG1 1 
ATOM   6036 C CG2 . VAL F 1 122 ? 82.202  -20.238 9.074   1.00 28.28  ? 199 VAL F CG2 1 
ATOM   6037 N N   . LEU F 1 123 ? 83.512  -23.372 12.345  1.00 32.03  ? 200 LEU F N   1 
ATOM   6038 C CA  . LEU F 1 123 ? 84.481  -23.947 13.256  1.00 33.27  ? 200 LEU F CA  1 
ATOM   6039 C C   . LEU F 1 123 ? 85.768  -24.088 12.469  1.00 39.31  ? 200 LEU F C   1 
ATOM   6040 O O   . LEU F 1 123 ? 85.794  -24.749 11.426  1.00 39.20  ? 200 LEU F O   1 
ATOM   6041 C CB  . LEU F 1 123 ? 84.025  -25.306 13.819  1.00 34.18  ? 200 LEU F CB  1 
ATOM   6042 C CG  . LEU F 1 123 ? 85.095  -26.184 14.528  1.00 39.11  ? 200 LEU F CG  1 
ATOM   6043 C CD1 . LEU F 1 123 ? 85.732  -25.471 15.715  1.00 39.64  ? 200 LEU F CD1 1 
ATOM   6044 C CD2 . LEU F 1 123 ? 84.489  -27.425 15.010  1.00 37.80  ? 200 LEU F CD2 1 
ATOM   6045 N N   . TYR F 1 124 ? 86.833  -23.451 12.972  1.00 37.36  ? 201 TYR F N   1 
ATOM   6046 C CA  . TYR F 1 124 ? 88.155  -23.437 12.342  1.00 37.34  ? 201 TYR F CA  1 
ATOM   6047 C C   . TYR F 1 124 ? 89.052  -24.452 12.966  1.00 40.01  ? 201 TYR F C   1 
ATOM   6048 O O   . TYR F 1 124 ? 89.126  -24.553 14.190  1.00 40.97  ? 201 TYR F O   1 
ATOM   6049 C CB  . TYR F 1 124 ? 88.784  -22.034 12.408  1.00 38.57  ? 201 TYR F CB  1 
ATOM   6050 C CG  . TYR F 1 124 ? 87.947  -21.013 11.677  1.00 40.19  ? 201 TYR F CG  1 
ATOM   6051 C CD1 . TYR F 1 124 ? 87.988  -20.915 10.289  1.00 41.78  ? 201 TYR F CD1 1 
ATOM   6052 C CD2 . TYR F 1 124 ? 87.041  -20.209 12.360  1.00 40.78  ? 201 TYR F CD2 1 
ATOM   6053 C CE1 . TYR F 1 124 ? 87.167  -20.029 9.597   1.00 39.55  ? 201 TYR F CE1 1 
ATOM   6054 C CE2 . TYR F 1 124 ? 86.213  -19.320 11.682  1.00 41.00  ? 201 TYR F CE2 1 
ATOM   6055 C CZ  . TYR F 1 124 ? 86.283  -19.231 10.299  1.00 46.37  ? 201 TYR F CZ  1 
ATOM   6056 O OH  . TYR F 1 124 ? 85.466  -18.362 9.626   1.00 41.59  ? 201 TYR F OH  1 
ATOM   6057 N N   . THR F 1 125 ? 89.680  -25.256 12.126  1.00 35.29  ? 202 THR F N   1 
ATOM   6058 C CA  . THR F 1 125 ? 90.625  -26.298 12.547  1.00 36.29  ? 202 THR F CA  1 
ATOM   6059 C C   . THR F 1 125 ? 91.960  -26.079 11.797  1.00 42.18  ? 202 THR F C   1 
ATOM   6060 O O   . THR F 1 125 ? 92.675  -27.030 11.461  1.00 43.48  ? 202 THR F O   1 
ATOM   6061 C CB  . THR F 1 125 ? 90.001  -27.699 12.389  1.00 35.34  ? 202 THR F CB  1 
ATOM   6062 O OG1 . THR F 1 125 ? 89.583  -27.894 11.035  1.00 38.36  ? 202 THR F OG1 1 
ATOM   6063 C CG2 . THR F 1 125 ? 88.832  -27.920 13.327  1.00 27.47  ? 202 THR F CG2 1 
ATOM   6064 N N   . ASP F 1 126 ? 92.269  -24.797 11.546  1.00 37.56  ? 203 ASP F N   1 
ATOM   6065 C CA  . ASP F 1 126 ? 93.413  -24.308 10.799  1.00 37.74  ? 203 ASP F CA  1 
ATOM   6066 C C   . ASP F 1 126 ? 94.484  -23.716 11.727  1.00 42.54  ? 203 ASP F C   1 
ATOM   6067 O O   . ASP F 1 126 ? 94.163  -22.934 12.618  1.00 41.27  ? 203 ASP F O   1 
ATOM   6068 C CB  . ASP F 1 126 ? 92.918  -23.266 9.777   1.00 37.27  ? 203 ASP F CB  1 
ATOM   6069 C CG  . ASP F 1 126 ? 93.831  -23.057 8.584   1.00 46.29  ? 203 ASP F CG  1 
ATOM   6070 O OD1 . ASP F 1 126 ? 95.034  -22.753 8.803   1.00 48.21  ? 203 ASP F OD1 1 
ATOM   6071 O OD2 . ASP F 1 126 ? 93.333  -23.148 7.420   1.00 44.86  ? 203 ASP F OD2 1 
ATOM   6072 N N   . LYS F 1 127 ? 95.758  -24.070 11.498  1.00 41.15  ? 204 LYS F N   1 
ATOM   6073 C CA  . LYS F 1 127 ? 96.883  -23.589 12.321  1.00 41.85  ? 204 LYS F CA  1 
ATOM   6074 C C   . LYS F 1 127 ? 97.258  -22.097 12.050  1.00 47.08  ? 204 LYS F C   1 
ATOM   6075 O O   . LYS F 1 127 ? 97.991  -21.514 12.868  1.00 49.90  ? 204 LYS F O   1 
ATOM   6076 C CB  . LYS F 1 127 ? 98.102  -24.566 12.283  1.00 44.13  ? 204 LYS F CB  1 
ATOM   6077 N N   . THR F 1 128 ? 96.735  -21.473 10.936  1.00 39.69  ? 205 THR F N   1 
ATOM   6078 C CA  . THR F 1 128 ? 96.993  -20.059 10.576  1.00 38.67  ? 205 THR F CA  1 
ATOM   6079 C C   . THR F 1 128 ? 96.735  -19.152 11.793  1.00 43.04  ? 205 THR F C   1 
ATOM   6080 O O   . THR F 1 128 ? 95.675  -19.287 12.413  1.00 40.80  ? 205 THR F O   1 
ATOM   6081 C CB  . THR F 1 128 ? 96.115  -19.632 9.385   1.00 38.31  ? 205 THR F CB  1 
ATOM   6082 O OG1 . THR F 1 128 ? 96.322  -20.519 8.297   1.00 37.92  ? 205 THR F OG1 1 
ATOM   6083 C CG2 . THR F 1 128 ? 96.366  -18.192 8.942   1.00 30.33  ? 205 THR F CG2 1 
ATOM   6084 N N   . TYR F 1 129 ? 97.700  -18.242 12.126  1.00 41.23  ? 206 TYR F N   1 
ATOM   6085 C CA  . TYR F 1 129 ? 97.659  -17.351 13.302  1.00 40.72  ? 206 TYR F CA  1 
ATOM   6086 C C   . TYR F 1 129 ? 96.279  -16.773 13.633  1.00 43.45  ? 206 TYR F C   1 
ATOM   6087 O O   . TYR F 1 129 ? 95.943  -16.634 14.807  1.00 43.35  ? 206 TYR F O   1 
ATOM   6088 C CB  . TYR F 1 129 ? 98.726  -16.249 13.209  1.00 43.36  ? 206 TYR F CB  1 
ATOM   6089 C CG  . TYR F 1 129 ? 98.298  -15.043 12.402  1.00 43.88  ? 206 TYR F CG  1 
ATOM   6090 C CD1 . TYR F 1 129 ? 98.273  -15.084 11.011  1.00 45.28  ? 206 TYR F CD1 1 
ATOM   6091 C CD2 . TYR F 1 129 ? 97.849  -13.884 13.030  1.00 43.74  ? 206 TYR F CD2 1 
ATOM   6092 C CE1 . TYR F 1 129 ? 97.833  -13.998 10.267  1.00 44.16  ? 206 TYR F CE1 1 
ATOM   6093 C CE2 . TYR F 1 129 ? 97.400  -12.792 12.293  1.00 43.37  ? 206 TYR F CE2 1 
ATOM   6094 C CZ  . TYR F 1 129 ? 97.388  -12.856 10.911  1.00 49.87  ? 206 TYR F CZ  1 
ATOM   6095 O OH  . TYR F 1 129 ? 96.970  -11.778 10.172  1.00 51.07  ? 206 TYR F OH  1 
ATOM   6096 N N   . ALA F 1 130 ? 95.493  -16.444 12.595  1.00 38.46  ? 207 ALA F N   1 
ATOM   6097 C CA  . ALA F 1 130 ? 94.146  -15.934 12.728  1.00 37.01  ? 207 ALA F CA  1 
ATOM   6098 C C   . ALA F 1 130 ? 93.295  -16.472 11.579  1.00 43.60  ? 207 ALA F C   1 
ATOM   6099 O O   . ALA F 1 130 ? 93.769  -16.583 10.431  1.00 44.86  ? 207 ALA F O   1 
ATOM   6100 C CB  . ALA F 1 130 ? 94.140  -14.419 12.730  1.00 37.47  ? 207 ALA F CB  1 
ATOM   6101 N N   . MET F 1 131 ? 92.045  -16.850 11.921  1.00 37.73  ? 208 MET F N   1 
ATOM   6102 C CA  . MET F 1 131 ? 91.022  -17.394 11.032  1.00 34.17  ? 208 MET F CA  1 
ATOM   6103 C C   . MET F 1 131 ? 89.744  -16.651 11.315  1.00 33.59  ? 208 MET F C   1 
ATOM   6104 O O   . MET F 1 131 ? 89.591  -16.067 12.383  1.00 31.34  ? 208 MET F O   1 
ATOM   6105 C CB  . MET F 1 131 ? 90.819  -18.899 11.272  1.00 36.46  ? 208 MET F CB  1 
ATOM   6106 C CG  . MET F 1 131 ? 91.952  -19.763 10.779  1.00 41.81  ? 208 MET F CG  1 
ATOM   6107 S SD  . MET F 1 131 ? 92.343  -19.594 9.023   1.00 46.98  ? 208 MET F SD  1 
ATOM   6108 C CE  . MET F 1 131 ? 90.926  -20.423 8.255   1.00 41.81  ? 208 MET F CE  1 
ATOM   6109 N N   . GLY F 1 132 ? 88.863  -16.622 10.332  1.00 30.77  ? 209 GLY F N   1 
ATOM   6110 C CA  . GLY F 1 132 ? 87.602  -15.914 10.451  1.00 31.21  ? 209 GLY F CA  1 
ATOM   6111 C C   . GLY F 1 132 ? 86.876  -15.814 9.138   1.00 38.18  ? 209 GLY F C   1 
ATOM   6112 O O   . GLY F 1 132 ? 87.416  -16.218 8.100   1.00 40.59  ? 209 GLY F O   1 
ATOM   6113 N N   . HIS F 1 133 ? 85.640  -15.293 9.176   1.00 33.16  ? 210 HIS F N   1 
ATOM   6114 C CA  . HIS F 1 133 ? 84.858  -15.166 7.948   1.00 31.94  ? 210 HIS F CA  1 
ATOM   6115 C C   . HIS F 1 133 ? 84.197  -13.806 7.801   1.00 33.21  ? 210 HIS F C   1 
ATOM   6116 O O   . HIS F 1 133 ? 84.136  -13.013 8.761   1.00 32.47  ? 210 HIS F O   1 
ATOM   6117 C CB  . HIS F 1 133 ? 83.825  -16.296 7.851   1.00 32.59  ? 210 HIS F CB  1 
ATOM   6118 C CG  . HIS F 1 133 ? 82.929  -16.403 9.045   1.00 36.12  ? 210 HIS F CG  1 
ATOM   6119 N ND1 . HIS F 1 133 ? 83.291  -17.138 10.150  1.00 38.94  ? 210 HIS F ND1 1 
ATOM   6120 C CD2 . HIS F 1 133 ? 81.718  -15.844 9.271   1.00 37.16  ? 210 HIS F CD2 1 
ATOM   6121 C CE1 . HIS F 1 133 ? 82.289  -17.010 11.010  1.00 37.90  ? 210 HIS F CE1 1 
ATOM   6122 N NE2 . HIS F 1 133 ? 81.328  -16.225 10.529  1.00 37.05  ? 210 HIS F NE2 1 
ATOM   6123 N N   . LEU F 1 134 ? 83.684  -13.556 6.598   1.00 26.79  ? 211 LEU F N   1 
ATOM   6124 C CA  . LEU F 1 134 ? 82.973  -12.335 6.290   1.00 26.44  ? 211 LEU F CA  1 
ATOM   6125 C C   . LEU F 1 134 ? 81.557  -12.665 5.833   1.00 33.99  ? 211 LEU F C   1 
ATOM   6126 O O   . LEU F 1 134 ? 81.387  -13.520 4.954   1.00 33.94  ? 211 LEU F O   1 
ATOM   6127 C CB  . LEU F 1 134 ? 83.679  -11.556 5.163   1.00 26.56  ? 211 LEU F CB  1 
ATOM   6128 C CG  . LEU F 1 134 ? 85.222  -11.546 5.095   1.00 30.93  ? 211 LEU F CG  1 
ATOM   6129 C CD1 . LEU F 1 134 ? 85.694  -10.930 3.834   1.00 30.40  ? 211 LEU F CD1 1 
ATOM   6130 C CD2 . LEU F 1 134 ? 85.816  -10.802 6.215   1.00 34.42  ? 211 LEU F CD2 1 
ATOM   6131 N N   . ILE F 1 135 ? 80.544  -12.002 6.431   1.00 31.74  ? 212 ILE F N   1 
ATOM   6132 C CA  . ILE F 1 135 ? 79.156  -12.084 5.976   1.00 31.36  ? 212 ILE F CA  1 
ATOM   6133 C C   . ILE F 1 135 ? 79.045  -10.881 5.019   1.00 35.54  ? 212 ILE F C   1 
ATOM   6134 O O   . ILE F 1 135 ? 79.101  -9.710  5.437   1.00 34.67  ? 212 ILE F O   1 
ATOM   6135 C CB  . ILE F 1 135 ? 78.090  -12.104 7.096   1.00 33.85  ? 212 ILE F CB  1 
ATOM   6136 C CG1 . ILE F 1 135 ? 78.112  -13.471 7.797   1.00 34.98  ? 212 ILE F CG1 1 
ATOM   6137 C CG2 . ILE F 1 135 ? 76.686  -11.817 6.517   1.00 31.34  ? 212 ILE F CG2 1 
ATOM   6138 C CD1 . ILE F 1 135 ? 77.412  -13.476 9.166   1.00 50.93  ? 212 ILE F CD1 1 
ATOM   6139 N N   . GLN F 1 136 ? 78.980  -11.203 3.726   1.00 30.50  ? 213 GLN F N   1 
ATOM   6140 C CA  . GLN F 1 136 ? 78.983  -10.218 2.670   1.00 29.95  ? 213 GLN F CA  1 
ATOM   6141 C C   . GLN F 1 136 ? 77.679  -10.072 1.952   1.00 35.26  ? 213 GLN F C   1 
ATOM   6142 O O   . GLN F 1 136 ? 76.922  -11.028 1.803   1.00 37.15  ? 213 GLN F O   1 
ATOM   6143 C CB  . GLN F 1 136 ? 80.082  -10.548 1.662   1.00 31.54  ? 213 GLN F CB  1 
ATOM   6144 C CG  . GLN F 1 136 ? 81.441  -10.677 2.302   1.00 38.45  ? 213 GLN F CG  1 
ATOM   6145 C CD  . GLN F 1 136 ? 82.478  -10.854 1.269   1.00 53.71  ? 213 GLN F CD  1 
ATOM   6146 O OE1 . GLN F 1 136 ? 82.455  -11.820 0.487   1.00 56.91  ? 213 GLN F OE1 1 
ATOM   6147 N NE2 . GLN F 1 136 ? 83.413  -9.924  1.270   1.00 36.81  ? 213 GLN F NE2 1 
ATOM   6148 N N   . ARG F 1 137 ? 77.455  -8.873  1.444   1.00 31.20  ? 214 ARG F N   1 
ATOM   6149 C CA  . ARG F 1 137 ? 76.286  -8.527  0.669   1.00 30.95  ? 214 ARG F CA  1 
ATOM   6150 C C   . ARG F 1 137 ? 76.706  -8.215  -0.779  1.00 36.71  ? 214 ARG F C   1 
ATOM   6151 O O   . ARG F 1 137 ? 77.505  -7.302  -0.992  1.00 37.26  ? 214 ARG F O   1 
ATOM   6152 C CB  . ARG F 1 137 ? 75.638  -7.303  1.309   1.00 27.74  ? 214 ARG F CB  1 
ATOM   6153 C CG  . ARG F 1 137 ? 74.412  -6.848  0.582   1.00 25.21  ? 214 ARG F CG  1 
ATOM   6154 C CD  . ARG F 1 137 ? 73.980  -5.563  1.165   1.00 23.29  ? 214 ARG F CD  1 
ATOM   6155 N NE  . ARG F 1 137 ? 72.870  -4.986  0.420   1.00 33.87  ? 214 ARG F NE  1 
ATOM   6156 C CZ  . ARG F 1 137 ? 72.627  -3.686  0.378   1.00 44.75  ? 214 ARG F CZ  1 
ATOM   6157 N NH1 . ARG F 1 137 ? 73.442  -2.833  0.982   1.00 35.72  ? 214 ARG F NH1 1 
ATOM   6158 N NH2 . ARG F 1 137 ? 71.576  -3.226  -0.280  1.00 33.47  ? 214 ARG F NH2 1 
ATOM   6159 N N   . LYS F 1 138 ? 76.184  -8.973  -1.762  1.00 33.10  ? 215 LYS F N   1 
ATOM   6160 C CA  . LYS F 1 138 ? 76.476  -8.679  -3.157  1.00 33.50  ? 215 LYS F CA  1 
ATOM   6161 C C   . LYS F 1 138 ? 75.295  -7.825  -3.612  1.00 38.60  ? 215 LYS F C   1 
ATOM   6162 O O   . LYS F 1 138 ? 74.184  -8.336  -3.810  1.00 40.53  ? 215 LYS F O   1 
ATOM   6163 C CB  . LYS F 1 138 ? 76.685  -9.954  -4.014  1.00 34.78  ? 215 LYS F CB  1 
ATOM   6164 C CG  . LYS F 1 138 ? 77.036  -9.704  -5.516  1.00 43.14  ? 215 LYS F CG  1 
ATOM   6165 C CD  . LYS F 1 138 ? 78.030  -8.560  -5.921  1.00 40.98  ? 215 LYS F CD  1 
ATOM   6166 N N   . LYS F 1 139 ? 75.525  -6.507  -3.651  1.00 32.12  ? 216 LYS F N   1 
ATOM   6167 C CA  . LYS F 1 139 ? 74.531  -5.516  -4.010  1.00 31.98  ? 216 LYS F CA  1 
ATOM   6168 C C   . LYS F 1 139 ? 74.032  -5.709  -5.442  1.00 40.59  ? 216 LYS F C   1 
ATOM   6169 O O   . LYS F 1 139 ? 74.862  -5.846  -6.359  1.00 42.36  ? 216 LYS F O   1 
ATOM   6170 C CB  . LYS F 1 139 ? 75.128  -4.107  -3.857  1.00 32.46  ? 216 LYS F CB  1 
ATOM   6171 C CG  . LYS F 1 139 ? 75.297  -3.640  -2.428  1.00 31.06  ? 216 LYS F CG  1 
ATOM   6172 C CD  . LYS F 1 139 ? 76.373  -2.589  -2.312  1.00 35.30  ? 216 LYS F CD  1 
ATOM   6173 C CE  . LYS F 1 139 ? 75.924  -1.158  -2.348  1.00 30.01  ? 216 LYS F CE  1 
ATOM   6174 N NZ  . LYS F 1 139 ? 76.136  -0.560  -3.666  1.00 53.30  ? 216 LYS F NZ  1 
ATOM   6175 N N   . VAL F 1 140 ? 72.688  -5.696  -5.648  1.00 37.19  ? 217 VAL F N   1 
ATOM   6176 C CA  . VAL F 1 140 ? 72.143  -5.791  -7.013  1.00 38.04  ? 217 VAL F CA  1 
ATOM   6177 C C   . VAL F 1 140 ? 72.384  -4.426  -7.753  1.00 41.37  ? 217 VAL F C   1 
ATOM   6178 O O   . VAL F 1 140 ? 72.629  -4.386  -8.970  1.00 42.19  ? 217 VAL F O   1 
ATOM   6179 C CB  . VAL F 1 140 ? 70.671  -6.332  -7.094  1.00 41.98  ? 217 VAL F CB  1 
ATOM   6180 C CG1 . VAL F 1 140 ? 69.662  -5.405  -6.416  1.00 42.80  ? 217 VAL F CG1 1 
ATOM   6181 C CG2 . VAL F 1 140 ? 70.260  -6.606  -8.527  1.00 42.31  ? 217 VAL F CG2 1 
ATOM   6182 N N   . HIS F 1 141 ? 72.363  -3.330  -6.984  1.00 35.61  ? 218 HIS F N   1 
ATOM   6183 C CA  . HIS F 1 141 ? 72.584  -1.995  -7.527  1.00 36.32  ? 218 HIS F CA  1 
ATOM   6184 C C   . HIS F 1 141 ? 73.815  -1.329  -6.879  1.00 36.45  ? 218 HIS F C   1 
ATOM   6185 O O   . HIS F 1 141 ? 74.009  -1.454  -5.679  1.00 36.73  ? 218 HIS F O   1 
ATOM   6186 C CB  . HIS F 1 141 ? 71.301  -1.112  -7.398  1.00 38.46  ? 218 HIS F CB  1 
ATOM   6187 C CG  . HIS F 1 141 ? 70.100  -1.617  -8.171  1.00 43.46  ? 218 HIS F CG  1 
ATOM   6188 N ND1 . HIS F 1 141 ? 68.809  -1.201  -7.854  1.00 45.71  ? 218 HIS F ND1 1 
ATOM   6189 C CD2 . HIS F 1 141 ? 70.029  -2.467  -9.235  1.00 45.52  ? 218 HIS F CD2 1 
ATOM   6190 C CE1 . HIS F 1 141 ? 68.009  -1.809  -8.724  1.00 45.67  ? 218 HIS F CE1 1 
ATOM   6191 N NE2 . HIS F 1 141 ? 68.694  -2.576  -9.577  1.00 45.92  ? 218 HIS F NE2 1 
ATOM   6192 N N   . VAL F 1 142 ? 74.664  -0.668  -7.663  1.00 30.14  ? 219 VAL F N   1 
ATOM   6193 C CA  . VAL F 1 142 ? 75.841  0.018   -7.133  1.00 28.54  ? 219 VAL F CA  1 
ATOM   6194 C C   . VAL F 1 142 ? 75.784  1.424   -7.668  1.00 32.70  ? 219 VAL F C   1 
ATOM   6195 O O   . VAL F 1 142 ? 75.357  1.615   -8.804  1.00 32.72  ? 219 VAL F O   1 
ATOM   6196 C CB  . VAL F 1 142 ? 77.183  -0.661  -7.504  1.00 32.18  ? 219 VAL F CB  1 
ATOM   6197 C CG1 . VAL F 1 142 ? 78.334  -0.066  -6.716  1.00 31.26  ? 219 VAL F CG1 1 
ATOM   6198 C CG2 . VAL F 1 142 ? 77.124  -2.145  -7.220  1.00 32.05  ? 219 VAL F CG2 1 
ATOM   6199 N N   . PHE F 1 143 ? 76.220  2.409   -6.859  1.00 26.94  ? 220 PHE F N   1 
ATOM   6200 C CA  . PHE F 1 143 ? 76.236  3.802   -7.263  1.00 26.70  ? 220 PHE F CA  1 
ATOM   6201 C C   . PHE F 1 143 ? 77.592  4.402   -7.023  1.00 30.04  ? 220 PHE F C   1 
ATOM   6202 O O   . PHE F 1 143 ? 78.234  4.046   -6.039  1.00 26.14  ? 220 PHE F O   1 
ATOM   6203 C CB  . PHE F 1 143 ? 75.144  4.587   -6.511  1.00 27.87  ? 220 PHE F CB  1 
ATOM   6204 C CG  . PHE F 1 143 ? 73.740  4.088   -6.766  1.00 28.79  ? 220 PHE F CG  1 
ATOM   6205 C CD1 . PHE F 1 143 ? 72.929  4.699   -7.712  1.00 35.87  ? 220 PHE F CD1 1 
ATOM   6206 C CD2 . PHE F 1 143 ? 73.233  3.002   -6.072  1.00 26.63  ? 220 PHE F CD2 1 
ATOM   6207 C CE1 . PHE F 1 143 ? 71.619  4.254   -7.925  1.00 37.06  ? 220 PHE F CE1 1 
ATOM   6208 C CE2 . PHE F 1 143 ? 71.932  2.559   -6.290  1.00 30.42  ? 220 PHE F CE2 1 
ATOM   6209 C CZ  . PHE F 1 143 ? 71.124  3.200   -7.193  1.00 31.79  ? 220 PHE F CZ  1 
ATOM   6210 N N   . GLY F 1 144 ? 78.012  5.305   -7.922  1.00 30.37  ? 221 GLY F N   1 
ATOM   6211 C CA  . GLY F 1 144 ? 79.280  6.029   -7.839  1.00 31.29  ? 221 GLY F CA  1 
ATOM   6212 C C   . GLY F 1 144 ? 80.453  5.207   -7.353  1.00 36.65  ? 221 GLY F C   1 
ATOM   6213 O O   . GLY F 1 144 ? 80.681  4.101   -7.850  1.00 36.30  ? 221 GLY F O   1 
ATOM   6214 N N   . ASP F 1 145 ? 81.144  5.695   -6.305  1.00 33.12  ? 222 ASP F N   1 
ATOM   6215 C CA  . ASP F 1 145 ? 82.321  5.006   -5.783  1.00 31.76  ? 222 ASP F CA  1 
ATOM   6216 C C   . ASP F 1 145 ? 82.089  3.807   -4.884  1.00 36.65  ? 222 ASP F C   1 
ATOM   6217 O O   . ASP F 1 145 ? 83.072  3.219   -4.417  1.00 37.97  ? 222 ASP F O   1 
ATOM   6218 C CB  . ASP F 1 145 ? 83.385  5.986   -5.246  1.00 33.68  ? 222 ASP F CB  1 
ATOM   6219 C CG  . ASP F 1 145 ? 83.110  6.680   -3.931  1.00 40.95  ? 222 ASP F CG  1 
ATOM   6220 O OD1 . ASP F 1 145 ? 82.036  6.425   -3.330  1.00 42.58  ? 222 ASP F OD1 1 
ATOM   6221 O OD2 . ASP F 1 145 ? 83.972  7.474   -3.491  1.00 45.78  ? 222 ASP F OD2 1 
ATOM   6222 N N   . GLU F 1 146 ? 80.807  3.425   -4.639  1.00 31.85  ? 223 GLU F N   1 
ATOM   6223 C CA  . GLU F 1 146 ? 80.450  2.279   -3.773  1.00 28.70  ? 223 GLU F CA  1 
ATOM   6224 C C   . GLU F 1 146 ? 81.075  0.973   -4.270  1.00 33.40  ? 223 GLU F C   1 
ATOM   6225 O O   . GLU F 1 146 ? 81.314  0.823   -5.464  1.00 32.99  ? 223 GLU F O   1 
ATOM   6226 C CB  . GLU F 1 146 ? 78.924  2.052   -3.777  1.00 28.46  ? 223 GLU F CB  1 
ATOM   6227 C CG  . GLU F 1 146 ? 78.065  2.983   -2.947  1.00 28.33  ? 223 GLU F CG  1 
ATOM   6228 C CD  . GLU F 1 146 ? 76.565  2.724   -3.062  1.00 48.21  ? 223 GLU F CD  1 
ATOM   6229 O OE1 . GLU F 1 146 ? 76.119  2.162   -4.091  1.00 33.28  ? 223 GLU F OE1 1 
ATOM   6230 O OE2 . GLU F 1 146 ? 75.824  3.128   -2.136  1.00 51.80  ? 223 GLU F OE2 1 
ATOM   6231 N N   . LEU F 1 147 ? 81.237  -0.003  -3.379  1.00 31.81  ? 224 LEU F N   1 
ATOM   6232 C CA  . LEU F 1 147 ? 81.665  -1.337  -3.791  1.00 31.96  ? 224 LEU F CA  1 
ATOM   6233 C C   . LEU F 1 147 ? 80.418  -2.206  -3.975  1.00 36.14  ? 224 LEU F C   1 
ATOM   6234 O O   . LEU F 1 147 ? 79.443  -2.041  -3.221  1.00 34.33  ? 224 LEU F O   1 
ATOM   6235 C CB  . LEU F 1 147 ? 82.537  -2.007  -2.722  1.00 31.32  ? 224 LEU F CB  1 
ATOM   6236 C CG  . LEU F 1 147 ? 83.891  -1.380  -2.337  1.00 35.18  ? 224 LEU F CG  1 
ATOM   6237 C CD1 . LEU F 1 147 ? 84.540  -2.232  -1.286  1.00 33.76  ? 224 LEU F CD1 1 
ATOM   6238 C CD2 . LEU F 1 147 ? 84.855  -1.268  -3.526  1.00 35.20  ? 224 LEU F CD2 1 
ATOM   6239 N N   . SER F 1 148 ? 80.482  -3.175  -4.935  1.00 33.77  ? 225 SER F N   1 
ATOM   6240 C CA  . SER F 1 148 ? 79.410  -4.130  -5.230  1.00 32.88  ? 225 SER F CA  1 
ATOM   6241 C C   . SER F 1 148 ? 79.255  -5.146  -4.097  1.00 35.64  ? 225 SER F C   1 
ATOM   6242 O O   . SER F 1 148 ? 78.145  -5.558  -3.754  1.00 34.07  ? 225 SER F O   1 
ATOM   6243 C CB  . SER F 1 148 ? 79.695  -4.841  -6.543  1.00 37.79  ? 225 SER F CB  1 
ATOM   6244 O OG  . SER F 1 148 ? 78.477  -5.197  -7.183  1.00 53.23  ? 225 SER F OG  1 
ATOM   6245 N N   . LEU F 1 149 ? 80.384  -5.522  -3.492  1.00 33.24  ? 226 LEU F N   1 
ATOM   6246 C CA  . LEU F 1 149 ? 80.454  -6.470  -2.375  1.00 31.16  ? 226 LEU F CA  1 
ATOM   6247 C C   . LEU F 1 149 ? 80.808  -5.738  -1.080  1.00 38.22  ? 226 LEU F C   1 
ATOM   6248 O O   . LEU F 1 149 ? 81.798  -5.016  -1.010  1.00 41.46  ? 226 LEU F O   1 
ATOM   6249 C CB  . LEU F 1 149 ? 81.494  -7.531  -2.703  1.00 30.05  ? 226 LEU F CB  1 
ATOM   6250 C CG  . LEU F 1 149 ? 81.346  -8.845  -2.012  1.00 31.31  ? 226 LEU F CG  1 
ATOM   6251 C CD1 . LEU F 1 149 ? 80.095  -9.612  -2.468  1.00 30.14  ? 226 LEU F CD1 1 
ATOM   6252 C CD2 . LEU F 1 149 ? 82.534  -9.661  -2.270  1.00 30.98  ? 226 LEU F CD2 1 
ATOM   6253 N N   . VAL F 1 150 ? 79.957  -5.853  -0.083  1.00 33.97  ? 227 VAL F N   1 
ATOM   6254 C CA  . VAL F 1 150 ? 80.105  -5.170  1.196   1.00 33.53  ? 227 VAL F CA  1 
ATOM   6255 C C   . VAL F 1 150 ? 80.268  -6.227  2.299   1.00 39.02  ? 227 VAL F C   1 
ATOM   6256 O O   . VAL F 1 150 ? 79.432  -7.141  2.371   1.00 38.25  ? 227 VAL F O   1 
ATOM   6257 C CB  . VAL F 1 150 ? 78.817  -4.335  1.455   1.00 36.39  ? 227 VAL F CB  1 
ATOM   6258 C CG1 . VAL F 1 150 ? 78.491  -4.193  2.936   1.00 36.52  ? 227 VAL F CG1 1 
ATOM   6259 C CG2 . VAL F 1 150 ? 78.878  -2.981  0.839   1.00 36.95  ? 227 VAL F CG2 1 
ATOM   6260 N N   . THR F 1 151 ? 81.274  -6.060  3.190   1.00 34.68  ? 228 THR F N   1 
ATOM   6261 C CA  . THR F 1 151 ? 81.387  -6.918  4.340   1.00 34.34  ? 228 THR F CA  1 
ATOM   6262 C C   . THR F 1 151 ? 80.506  -6.297  5.407   1.00 39.14  ? 228 THR F C   1 
ATOM   6263 O O   . THR F 1 151 ? 80.771  -5.173  5.850   1.00 40.14  ? 228 THR F O   1 
ATOM   6264 C CB  . THR F 1 151 ? 82.821  -7.092  4.791   1.00 43.39  ? 228 THR F CB  1 
ATOM   6265 O OG1 . THR F 1 151 ? 83.573  -7.617  3.687   1.00 49.71  ? 228 THR F OG1 1 
ATOM   6266 C CG2 . THR F 1 151 ? 82.932  -8.005  6.028   1.00 37.11  ? 228 THR F CG2 1 
ATOM   6267 N N   . LEU F 1 152 ? 79.422  -7.009  5.774   1.00 32.47  ? 229 LEU F N   1 
ATOM   6268 C CA  . LEU F 1 152 ? 78.490  -6.532  6.778   1.00 30.46  ? 229 LEU F CA  1 
ATOM   6269 C C   . LEU F 1 152 ? 79.085  -6.817  8.156   1.00 35.19  ? 229 LEU F C   1 
ATOM   6270 O O   . LEU F 1 152 ? 79.186  -5.910  8.980   1.00 35.77  ? 229 LEU F O   1 
ATOM   6271 C CB  . LEU F 1 152 ? 77.109  -7.220  6.601   1.00 29.51  ? 229 LEU F CB  1 
ATOM   6272 C CG  . LEU F 1 152 ? 76.288  -6.803  5.375   1.00 32.47  ? 229 LEU F CG  1 
ATOM   6273 C CD1 . LEU F 1 152 ? 75.110  -7.727  5.159   1.00 32.25  ? 229 LEU F CD1 1 
ATOM   6274 C CD2 . LEU F 1 152 ? 75.869  -5.388  5.474   1.00 29.08  ? 229 LEU F CD2 1 
ATOM   6275 N N   . PHE F 1 153 ? 79.471  -8.095  8.417   1.00 30.94  ? 230 PHE F N   1 
ATOM   6276 C CA  . PHE F 1 153 ? 80.034  -8.551  9.690   1.00 28.85  ? 230 PHE F CA  1 
ATOM   6277 C C   . PHE F 1 153 ? 81.220  -9.423  9.430   1.00 33.10  ? 230 PHE F C   1 
ATOM   6278 O O   . PHE F 1 153 ? 81.204  -10.184 8.481   1.00 36.21  ? 230 PHE F O   1 
ATOM   6279 C CB  . PHE F 1 153 ? 78.986  -9.278  10.544  1.00 30.10  ? 230 PHE F CB  1 
ATOM   6280 C CG  . PHE F 1 153 ? 77.629  -8.623  10.481  1.00 32.49  ? 230 PHE F CG  1 
ATOM   6281 C CD1 . PHE F 1 153 ? 77.393  -7.405  11.114  1.00 37.24  ? 230 PHE F CD1 1 
ATOM   6282 C CD2 . PHE F 1 153 ? 76.620  -9.156  9.690   1.00 34.86  ? 230 PHE F CD2 1 
ATOM   6283 C CE1 . PHE F 1 153 ? 76.166  -6.737  10.966  1.00 38.74  ? 230 PHE F CE1 1 
ATOM   6284 C CE2 . PHE F 1 153 ? 75.390  -8.496  9.552   1.00 38.60  ? 230 PHE F CE2 1 
ATOM   6285 C CZ  . PHE F 1 153 ? 75.177  -7.282  10.182  1.00 37.88  ? 230 PHE F CZ  1 
ATOM   6286 N N   . ARG F 1 154 ? 82.265  -9.292  10.247  1.00 28.54  ? 231 ARG F N   1 
ATOM   6287 C CA  . ARG F 1 154 ? 83.518  -10.034 10.168  1.00 28.28  ? 231 ARG F CA  1 
ATOM   6288 C C   . ARG F 1 154 ? 83.926  -10.540 11.596  1.00 37.95  ? 231 ARG F C   1 
ATOM   6289 O O   . ARG F 1 154 ? 83.801  -9.793  12.561  1.00 37.81  ? 231 ARG F O   1 
ATOM   6290 C CB  . ARG F 1 154 ? 84.576  -9.145  9.490   1.00 25.28  ? 231 ARG F CB  1 
ATOM   6291 C CG  . ARG F 1 154 ? 86.049  -9.500  9.725   1.00 40.30  ? 231 ARG F CG  1 
ATOM   6292 C CD  . ARG F 1 154 ? 87.030  -8.736  8.822   1.00 37.55  ? 231 ARG F CD  1 
ATOM   6293 N NE  . ARG F 1 154 ? 86.956  -7.276  8.935   1.00 36.48  ? 231 ARG F NE  1 
ATOM   6294 C CZ  . ARG F 1 154 ? 87.904  -6.498  9.462   1.00 50.63  ? 231 ARG F CZ  1 
ATOM   6295 N NH1 . ARG F 1 154 ? 89.009  -7.034  9.968   1.00 45.80  ? 231 ARG F NH1 1 
ATOM   6296 N NH2 . ARG F 1 154 ? 87.757  -5.170  9.475   1.00 22.77  ? 231 ARG F NH2 1 
ATOM   6297 N N   . CYS F 1 155 ? 84.307  -11.849 11.713  1.00 37.64  ? 232 CYS F N   1 
ATOM   6298 C CA  . CYS F 1 155 ? 84.810  -12.593 12.886  1.00 36.67  ? 232 CYS F CA  1 
ATOM   6299 C C   . CYS F 1 155 ? 86.288  -12.701 12.699  1.00 40.88  ? 232 CYS F C   1 
ATOM   6300 O O   . CYS F 1 155 ? 86.742  -12.925 11.561  1.00 43.79  ? 232 CYS F O   1 
ATOM   6301 C CB  . CYS F 1 155 ? 84.284  -14.019 12.890  1.00 36.71  ? 232 CYS F CB  1 
ATOM   6302 S SG  A CYS F 1 155 ? 83.307  -14.449 14.341  0.30 41.20  ? 232 CYS F SG  1 
ATOM   6303 S SG  B CYS F 1 155 ? 82.569  -14.197 12.455  0.58 39.62  ? 232 CYS F SG  1 
ATOM   6304 N N   . ILE F 1 156 ? 87.008  -12.837 13.802  1.00 31.88  ? 233 ILE F N   1 
ATOM   6305 C CA  . ILE F 1 156 ? 88.424  -13.169 13.795  1.00 29.93  ? 233 ILE F CA  1 
ATOM   6306 C C   . ILE F 1 156 ? 88.678  -13.948 15.095  1.00 35.01  ? 233 ILE F C   1 
ATOM   6307 O O   . ILE F 1 156 ? 88.181  -13.582 16.171  1.00 35.02  ? 233 ILE F O   1 
ATOM   6308 C CB  . ILE F 1 156 ? 89.460  -12.007 13.557  1.00 31.30  ? 233 ILE F CB  1 
ATOM   6309 C CG1 . ILE F 1 156 ? 89.101  -11.127 12.351  1.00 28.82  ? 233 ILE F CG1 1 
ATOM   6310 C CG2 . ILE F 1 156 ? 90.889  -12.588 13.397  1.00 32.42  ? 233 ILE F CG2 1 
ATOM   6311 C CD1 . ILE F 1 156 ? 89.997  -9.918  12.051  1.00 32.00  ? 233 ILE F CD1 1 
ATOM   6312 N N   . GLN F 1 157 ? 89.405  -15.050 14.961  1.00 30.09  ? 234 GLN F N   1 
ATOM   6313 C CA  . GLN F 1 157 ? 89.825  -15.894 16.039  1.00 30.23  ? 234 GLN F CA  1 
ATOM   6314 C C   . GLN F 1 157 ? 91.286  -16.209 15.790  1.00 38.74  ? 234 GLN F C   1 
ATOM   6315 O O   . GLN F 1 157 ? 91.654  -16.682 14.697  1.00 39.48  ? 234 GLN F O   1 
ATOM   6316 C CB  . GLN F 1 157 ? 89.040  -17.223 16.080  1.00 30.43  ? 234 GLN F CB  1 
ATOM   6317 C CG  . GLN F 1 157 ? 87.692  -17.203 16.791  1.00 32.28  ? 234 GLN F CG  1 
ATOM   6318 C CD  . GLN F 1 157 ? 87.706  -16.710 18.205  1.00 45.20  ? 234 GLN F CD  1 
ATOM   6319 O OE1 . GLN F 1 157 ? 87.473  -15.530 18.462  1.00 46.93  ? 234 GLN F OE1 1 
ATOM   6320 N NE2 . GLN F 1 157 ? 87.901  -17.604 19.153  1.00 32.66  ? 234 GLN F NE2 1 
ATOM   6321 N N   . ASN F 1 158 ? 92.129  -15.998 16.820  1.00 35.46  ? 235 ASN F N   1 
ATOM   6322 C CA  . ASN F 1 158 ? 93.518  -16.391 16.724  1.00 35.00  ? 235 ASN F CA  1 
ATOM   6323 C C   . ASN F 1 158 ? 93.483  -17.904 16.914  1.00 38.24  ? 235 ASN F C   1 
ATOM   6324 O O   . ASN F 1 158 ? 92.558  -18.419 17.553  1.00 36.59  ? 235 ASN F O   1 
ATOM   6325 C CB  . ASN F 1 158 ? 94.352  -15.731 17.815  1.00 33.70  ? 235 ASN F CB  1 
ATOM   6326 C CG  . ASN F 1 158 ? 94.720  -14.302 17.560  1.00 48.43  ? 235 ASN F CG  1 
ATOM   6327 O OD1 . ASN F 1 158 ? 94.411  -13.434 18.378  1.00 46.82  ? 235 ASN F OD1 1 
ATOM   6328 N ND2 . ASN F 1 158 ? 95.415  -14.027 16.446  1.00 36.55  ? 235 ASN F ND2 1 
ATOM   6329 N N   . MET F 1 159 ? 94.445  -18.617 16.337  1.00 36.96  ? 236 MET F N   1 
ATOM   6330 C CA  . MET F 1 159 ? 94.482  -20.074 16.443  1.00 38.47  ? 236 MET F CA  1 
ATOM   6331 C C   . MET F 1 159 ? 95.800  -20.541 17.053  1.00 49.35  ? 236 MET F C   1 
ATOM   6332 O O   . MET F 1 159 ? 96.844  -19.926 16.793  1.00 53.76  ? 236 MET F O   1 
ATOM   6333 C CB  . MET F 1 159 ? 94.316  -20.725 15.059  1.00 40.23  ? 236 MET F CB  1 
ATOM   6334 C CG  . MET F 1 159 ? 93.141  -20.183 14.225  1.00 41.17  ? 236 MET F CG  1 
ATOM   6335 S SD  . MET F 1 159 ? 91.503  -20.557 14.883  1.00 42.80  ? 236 MET F SD  1 
ATOM   6336 C CE  . MET F 1 159 ? 91.534  -22.308 14.822  1.00 39.94  ? 236 MET F CE  1 
ATOM   6337 N N   . PRO F 1 160 ? 95.802  -21.643 17.831  1.00 45.73  ? 237 PRO F N   1 
ATOM   6338 C CA  . PRO F 1 160 ? 97.064  -22.139 18.376  1.00 47.97  ? 237 PRO F CA  1 
ATOM   6339 C C   . PRO F 1 160 ? 97.777  -23.077 17.382  1.00 57.17  ? 237 PRO F C   1 
ATOM   6340 O O   . PRO F 1 160 ? 97.150  -23.635 16.472  1.00 57.22  ? 237 PRO F O   1 
ATOM   6341 C CB  . PRO F 1 160 ? 96.613  -22.870 19.635  1.00 49.37  ? 237 PRO F CB  1 
ATOM   6342 C CG  . PRO F 1 160 ? 95.261  -23.377 19.316  1.00 51.71  ? 237 PRO F CG  1 
ATOM   6343 C CD  . PRO F 1 160 ? 94.672  -22.498 18.248  1.00 46.03  ? 237 PRO F CD  1 
ATOM   6344 N N   . GLU F 1 161 ? 99.085  -23.273 17.559  1.00 56.68  ? 238 GLU F N   1 
ATOM   6345 C CA  . GLU F 1 161 ? 99.841  -24.163 16.694  1.00 58.20  ? 238 GLU F CA  1 
ATOM   6346 C C   . GLU F 1 161 ? 99.387  -25.619 16.917  1.00 63.54  ? 238 GLU F C   1 
ATOM   6347 O O   . GLU F 1 161 ? 99.385  -26.417 15.979  1.00 64.82  ? 238 GLU F O   1 
ATOM   6348 C CB  . GLU F 1 161 ? 101.346 -23.985 16.963  1.00 62.86  ? 238 GLU F CB  1 
ATOM   6349 N N   . THR F 1 162 ? 98.951  -25.935 18.146  1.00 59.41  ? 239 THR F N   1 
ATOM   6350 C CA  . THR F 1 162 ? 98.501  -27.267 18.554  1.00 59.35  ? 239 THR F CA  1 
ATOM   6351 C C   . THR F 1 162 ? 96.970  -27.393 18.712  1.00 60.26  ? 239 THR F C   1 
ATOM   6352 O O   . THR F 1 162 ? 96.342  -26.592 19.411  1.00 58.29  ? 239 THR F O   1 
ATOM   6353 C CB  . THR F 1 162 ? 99.292  -27.767 19.783  1.00 68.32  ? 239 THR F CB  1 
ATOM   6354 O OG1 . THR F 1 162 ? 98.494  -28.703 20.511  1.00 65.28  ? 239 THR F OG1 1 
ATOM   6355 C CG2 . THR F 1 162 ? 99.664  -26.659 20.741  1.00 70.86  ? 239 THR F CG2 1 
ATOM   6356 N N   . LEU F 1 163 ? 96.409  -28.451 18.101  1.00 56.19  ? 240 LEU F N   1 
ATOM   6357 C CA  . LEU F 1 163 ? 94.991  -28.823 18.087  1.00 53.96  ? 240 LEU F CA  1 
ATOM   6358 C C   . LEU F 1 163 ? 94.052  -27.621 17.888  1.00 58.55  ? 240 LEU F C   1 
ATOM   6359 O O   . LEU F 1 163 ? 93.212  -27.354 18.766  1.00 59.08  ? 240 LEU F O   1 
ATOM   6360 C CB  . LEU F 1 163 ? 94.613  -29.601 19.351  1.00 54.39  ? 240 LEU F CB  1 
ATOM   6361 C CG  . LEU F 1 163 ? 95.325  -30.923 19.602  1.00 60.84  ? 240 LEU F CG  1 
ATOM   6362 C CD1 . LEU F 1 163 ? 95.207  -31.328 21.054  1.00 60.46  ? 240 LEU F CD1 1 
ATOM   6363 C CD2 . LEU F 1 163 ? 94.786  -32.010 18.693  1.00 64.66  ? 240 LEU F CD2 1 
ATOM   6364 N N   . PRO F 1 164 ? 94.192  -26.843 16.775  1.00 52.31  ? 241 PRO F N   1 
ATOM   6365 C CA  . PRO F 1 164 ? 93.304  -25.687 16.594  1.00 48.68  ? 241 PRO F CA  1 
ATOM   6366 C C   . PRO F 1 164 ? 91.851  -26.104 16.422  1.00 50.31  ? 241 PRO F C   1 
ATOM   6367 O O   . PRO F 1 164 ? 91.542  -26.973 15.602  1.00 51.24  ? 241 PRO F O   1 
ATOM   6368 C CB  . PRO F 1 164 ? 93.872  -25.001 15.351  1.00 49.94  ? 241 PRO F CB  1 
ATOM   6369 C CG  . PRO F 1 164 ? 94.571  -26.051 14.607  1.00 55.43  ? 241 PRO F CG  1 
ATOM   6370 C CD  . PRO F 1 164 ? 95.139  -26.968 15.642  1.00 53.28  ? 241 PRO F CD  1 
ATOM   6371 N N   . ASN F 1 165 ? 90.981  -25.548 17.273  1.00 43.90  ? 242 ASN F N   1 
ATOM   6372 C CA  . ASN F 1 165 ? 89.540  -25.795 17.291  1.00 40.91  ? 242 ASN F CA  1 
ATOM   6373 C C   . ASN F 1 165 ? 88.873  -24.574 17.899  1.00 41.89  ? 242 ASN F C   1 
ATOM   6374 O O   . ASN F 1 165 ? 88.727  -24.492 19.125  1.00 42.54  ? 242 ASN F O   1 
ATOM   6375 C CB  . ASN F 1 165 ? 89.187  -27.047 18.118  1.00 40.42  ? 242 ASN F CB  1 
ATOM   6376 C CG  . ASN F 1 165 ? 89.549  -28.363 17.500  1.00 62.68  ? 242 ASN F CG  1 
ATOM   6377 O OD1 . ASN F 1 165 ? 90.637  -28.896 17.725  1.00 68.78  ? 242 ASN F OD1 1 
ATOM   6378 N ND2 . ASN F 1 165 ? 88.633  -28.932 16.735  1.00 49.76  ? 242 ASN F ND2 1 
ATOM   6379 N N   . ASN F 1 166 ? 88.501  -23.606 17.052  1.00 36.07  ? 243 ASN F N   1 
ATOM   6380 C CA  . ASN F 1 166 ? 87.810  -22.379 17.485  1.00 33.97  ? 243 ASN F CA  1 
ATOM   6381 C C   . ASN F 1 166 ? 86.651  -22.112 16.579  1.00 35.65  ? 243 ASN F C   1 
ATOM   6382 O O   . ASN F 1 166 ? 86.829  -22.016 15.366  1.00 34.74  ? 243 ASN F O   1 
ATOM   6383 C CB  . ASN F 1 166 ? 88.738  -21.140 17.505  1.00 30.12  ? 243 ASN F CB  1 
ATOM   6384 C CG  . ASN F 1 166 ? 89.680  -21.059 18.666  1.00 50.26  ? 243 ASN F CG  1 
ATOM   6385 O OD1 . ASN F 1 166 ? 89.311  -21.270 19.831  1.00 46.44  ? 243 ASN F OD1 1 
ATOM   6386 N ND2 . ASN F 1 166 ? 90.912  -20.682 18.373  1.00 47.11  ? 243 ASN F ND2 1 
ATOM   6387 N N   . SER F 1 167 ? 85.462  -22.024 17.151  1.00 32.57  ? 244 SER F N   1 
ATOM   6388 C CA  . SER F 1 167 ? 84.271  -21.684 16.387  1.00 31.51  ? 244 SER F CA  1 
ATOM   6389 C C   . SER F 1 167 ? 84.115  -20.189 16.553  1.00 37.67  ? 244 SER F C   1 
ATOM   6390 O O   . SER F 1 167 ? 84.477  -19.638 17.617  1.00 40.27  ? 244 SER F O   1 
ATOM   6391 C CB  . SER F 1 167 ? 83.034  -22.414 16.912  1.00 33.65  ? 244 SER F CB  1 
ATOM   6392 O OG  . SER F 1 167 ? 82.673  -22.054 18.241  1.00 37.46  ? 244 SER F OG  1 
ATOM   6393 N N   . CYS F 1 168 ? 83.635  -19.517 15.501  1.00 31.07  ? 245 CYS F N   1 
ATOM   6394 C CA  . CYS F 1 168 ? 83.405  -18.087 15.599  1.00 29.11  ? 245 CYS F CA  1 
ATOM   6395 C C   . CYS F 1 168 ? 82.036  -17.754 15.083  1.00 34.97  ? 245 CYS F C   1 
ATOM   6396 O O   . CYS F 1 168 ? 81.672  -18.126 13.959  1.00 34.96  ? 245 CYS F O   1 
ATOM   6397 C CB  . CYS F 1 168 ? 84.485  -17.272 14.904  1.00 27.50  ? 245 CYS F CB  1 
ATOM   6398 S SG  A CYS F 1 168 ? 84.579  -15.560 15.476  0.30 31.04  ? 245 CYS F SG  1 
ATOM   6399 S SG  B CYS F 1 168 ? 84.665  -15.604 15.566  0.33 31.00  ? 245 CYS F SG  1 
ATOM   6400 N N   . TYR F 1 169 ? 81.269  -17.070 15.920  1.00 31.17  ? 246 TYR F N   1 
ATOM   6401 C CA  . TYR F 1 169 ? 79.931  -16.624 15.604  1.00 29.33  ? 246 TYR F CA  1 
ATOM   6402 C C   . TYR F 1 169 ? 79.927  -15.087 15.485  1.00 35.86  ? 246 TYR F C   1 
ATOM   6403 O O   . TYR F 1 169 ? 80.553  -14.399 16.293  1.00 38.14  ? 246 TYR F O   1 
ATOM   6404 C CB  . TYR F 1 169 ? 78.973  -17.058 16.726  1.00 28.92  ? 246 TYR F CB  1 
ATOM   6405 C CG  . TYR F 1 169 ? 77.534  -16.632 16.506  1.00 29.26  ? 246 TYR F CG  1 
ATOM   6406 C CD1 . TYR F 1 169 ? 77.082  -15.379 16.920  1.00 30.54  ? 246 TYR F CD1 1 
ATOM   6407 C CD2 . TYR F 1 169 ? 76.619  -17.483 15.886  1.00 29.76  ? 246 TYR F CD2 1 
ATOM   6408 C CE1 . TYR F 1 169 ? 75.766  -14.970 16.686  1.00 30.92  ? 246 TYR F CE1 1 
ATOM   6409 C CE2 . TYR F 1 169 ? 75.289  -17.097 15.682  1.00 30.74  ? 246 TYR F CE2 1 
ATOM   6410 C CZ  . TYR F 1 169 ? 74.863  -15.847 16.100  1.00 39.84  ? 246 TYR F CZ  1 
ATOM   6411 O OH  . TYR F 1 169 ? 73.546  -15.479 15.921  1.00 44.10  ? 246 TYR F OH  1 
ATOM   6412 N N   . SER F 1 170 ? 79.189  -14.560 14.501  1.00 30.76  ? 247 SER F N   1 
ATOM   6413 C CA  . SER F 1 170 ? 78.916  -13.149 14.366  1.00 30.28  ? 247 SER F CA  1 
ATOM   6414 C C   . SER F 1 170 ? 77.544  -12.990 13.736  1.00 35.31  ? 247 SER F C   1 
ATOM   6415 O O   . SER F 1 170 ? 77.125  -13.839 12.929  1.00 35.40  ? 247 SER F O   1 
ATOM   6416 C CB  . SER F 1 170 ? 79.969  -12.459 13.532  1.00 32.61  ? 247 SER F CB  1 
ATOM   6417 O OG  . SER F 1 170 ? 79.939  -11.074 13.803  1.00 40.55  ? 247 SER F OG  1 
ATOM   6418 N N   . ALA F 1 171 ? 76.826  -11.929 14.135  1.00 30.82  ? 248 ALA F N   1 
ATOM   6419 C CA  . ALA F 1 171 ? 75.497  -11.614 13.613  1.00 30.37  ? 248 ALA F CA  1 
ATOM   6420 C C   . ALA F 1 171 ? 75.179  -10.139 13.825  1.00 36.69  ? 248 ALA F C   1 
ATOM   6421 O O   . ALA F 1 171 ? 75.744  -9.519  14.723  1.00 38.82  ? 248 ALA F O   1 
ATOM   6422 C CB  . ALA F 1 171 ? 74.446  -12.451 14.312  1.00 31.68  ? 248 ALA F CB  1 
ATOM   6423 N N   . GLY F 1 172 ? 74.252  -9.611  13.025  1.00 31.83  ? 249 GLY F N   1 
ATOM   6424 C CA  . GLY F 1 172 ? 73.757  -8.241  13.110  1.00 32.08  ? 249 GLY F CA  1 
ATOM   6425 C C   . GLY F 1 172 ? 72.540  -8.007  12.236  1.00 37.78  ? 249 GLY F C   1 
ATOM   6426 O O   . GLY F 1 172 ? 72.000  -8.944  11.625  1.00 39.23  ? 249 GLY F O   1 
ATOM   6427 N N   . ILE F 1 173 ? 72.105  -6.756  12.152  1.00 33.38  ? 250 ILE F N   1 
ATOM   6428 C CA  . ILE F 1 173 ? 70.968  -6.382  11.311  1.00 32.49  ? 250 ILE F CA  1 
ATOM   6429 C C   . ILE F 1 173 ? 71.484  -5.588  10.107  1.00 38.59  ? 250 ILE F C   1 
ATOM   6430 O O   . ILE F 1 173 ? 72.432  -4.817  10.238  1.00 40.31  ? 250 ILE F O   1 
ATOM   6431 C CB  . ILE F 1 173 ? 69.896  -5.614  12.131  1.00 35.33  ? 250 ILE F CB  1 
ATOM   6432 C CG1 . ILE F 1 173 ? 69.437  -6.494  13.331  1.00 35.66  ? 250 ILE F CG1 1 
ATOM   6433 C CG2 . ILE F 1 173 ? 68.701  -5.225  11.250  1.00 34.89  ? 250 ILE F CG2 1 
ATOM   6434 C CD1 . ILE F 1 173 ? 68.744  -5.804  14.484  1.00 33.82  ? 250 ILE F CD1 1 
ATOM   6435 N N   . ALA F 1 174 ? 70.867  -5.780  8.939   1.00 33.64  ? 251 ALA F N   1 
ATOM   6436 C CA  . ALA F 1 174 ? 71.199  -5.019  7.745   1.00 32.57  ? 251 ALA F CA  1 
ATOM   6437 C C   . ALA F 1 174 ? 69.979  -4.805  6.876   1.00 36.94  ? 251 ALA F C   1 
ATOM   6438 O O   . ALA F 1 174 ? 69.141  -5.706  6.764   1.00 35.13  ? 251 ALA F O   1 
ATOM   6439 C CB  . ALA F 1 174 ? 72.276  -5.734  6.940   1.00 32.31  ? 251 ALA F CB  1 
ATOM   6440 N N   . LYS F 1 175 ? 69.889  -3.621  6.222   1.00 35.86  ? 252 LYS F N   1 
ATOM   6441 C CA  . LYS F 1 175 ? 68.822  -3.387  5.252   1.00 36.99  ? 252 LYS F CA  1 
ATOM   6442 C C   . LYS F 1 175 ? 69.303  -3.969  3.914   1.00 43.56  ? 252 LYS F C   1 
ATOM   6443 O O   . LYS F 1 175 ? 70.411  -3.640  3.448   1.00 42.51  ? 252 LYS F O   1 
ATOM   6444 C CB  . LYS F 1 175 ? 68.459  -1.906  5.123   1.00 39.29  ? 252 LYS F CB  1 
ATOM   6445 C CG  . LYS F 1 175 ? 67.677  -1.526  3.857   1.00 32.75  ? 252 LYS F CG  1 
ATOM   6446 C CD  . LYS F 1 175 ? 66.182  -1.536  4.053   1.00 47.30  ? 252 LYS F CD  1 
ATOM   6447 C CE  . LYS F 1 175 ? 65.461  -0.821  2.938   1.00 62.51  ? 252 LYS F CE  1 
ATOM   6448 N NZ  . LYS F 1 175 ? 65.269  0.620   3.253   1.00 80.88  ? 252 LYS F NZ  1 
ATOM   6449 N N   . LEU F 1 176 ? 68.496  -4.901  3.356   1.00 40.72  ? 253 LEU F N   1 
ATOM   6450 C CA  . LEU F 1 176 ? 68.736  -5.583  2.088   1.00 39.15  ? 253 LEU F CA  1 
ATOM   6451 C C   . LEU F 1 176 ? 67.602  -5.302  1.144   1.00 42.82  ? 253 LEU F C   1 
ATOM   6452 O O   . LEU F 1 176 ? 66.440  -5.212  1.562   1.00 42.00  ? 253 LEU F O   1 
ATOM   6453 C CB  . LEU F 1 176 ? 68.866  -7.099  2.267   1.00 38.24  ? 253 LEU F CB  1 
ATOM   6454 C CG  . LEU F 1 176 ? 69.935  -7.588  3.235   1.00 41.58  ? 253 LEU F CG  1 
ATOM   6455 C CD1 . LEU F 1 176 ? 69.825  -9.077  3.443   1.00 41.60  ? 253 LEU F CD1 1 
ATOM   6456 C CD2 . LEU F 1 176 ? 71.329  -7.195  2.801   1.00 39.82  ? 253 LEU F CD2 1 
ATOM   6457 N N   . GLU F 1 177 ? 67.962  -5.152  -0.139  1.00 39.74  ? 254 GLU F N   1 
ATOM   6458 C CA  . GLU F 1 177 ? 67.064  -4.882  -1.265  1.00 40.43  ? 254 GLU F CA  1 
ATOM   6459 C C   . GLU F 1 177 ? 66.823  -6.135  -2.089  1.00 43.78  ? 254 GLU F C   1 
ATOM   6460 O O   . GLU F 1 177 ? 67.721  -6.970  -2.240  1.00 43.39  ? 254 GLU F O   1 
ATOM   6461 C CB  . GLU F 1 177 ? 67.678  -3.819  -2.170  1.00 42.28  ? 254 GLU F CB  1 
ATOM   6462 C CG  . GLU F 1 177 ? 67.367  -2.402  -1.737  1.00 56.30  ? 254 GLU F CG  1 
ATOM   6463 C CD  . GLU F 1 177 ? 68.245  -1.428  -2.495  1.00 106.74 ? 254 GLU F CD  1 
ATOM   6464 O OE1 . GLU F 1 177 ? 69.362  -1.151  -2.000  1.00 112.93 ? 254 GLU F OE1 1 
ATOM   6465 O OE2 . GLU F 1 177 ? 67.869  -1.019  -3.621  1.00 114.46 ? 254 GLU F OE2 1 
ATOM   6466 N N   . GLU F 1 178 ? 65.621  -6.249  -2.657  1.00 40.73  ? 255 GLU F N   1 
ATOM   6467 C CA  . GLU F 1 178 ? 65.236  -7.365  -3.522  1.00 41.32  ? 255 GLU F CA  1 
ATOM   6468 C C   . GLU F 1 178 ? 66.272  -7.503  -4.664  1.00 45.72  ? 255 GLU F C   1 
ATOM   6469 O O   . GLU F 1 178 ? 66.522  -6.536  -5.375  1.00 48.43  ? 255 GLU F O   1 
ATOM   6470 C CB  . GLU F 1 178 ? 63.824  -7.116  -4.066  1.00 44.41  ? 255 GLU F CB  1 
ATOM   6471 C CG  . GLU F 1 178 ? 63.475  -7.928  -5.300  1.00 53.13  ? 255 GLU F CG  1 
ATOM   6472 C CD  . GLU F 1 178 ? 62.076  -7.725  -5.836  1.00 80.38  ? 255 GLU F CD  1 
ATOM   6473 O OE1 . GLU F 1 178 ? 61.514  -6.618  -5.660  1.00 72.85  ? 255 GLU F OE1 1 
ATOM   6474 O OE2 . GLU F 1 178 ? 61.565  -8.667  -6.487  1.00 74.43  ? 255 GLU F OE2 1 
ATOM   6475 N N   . GLY F 1 179 ? 66.922  -8.657  -4.754  1.00 38.75  ? 256 GLY F N   1 
ATOM   6476 C CA  . GLY F 1 179 ? 67.948  -8.895  -5.757  1.00 37.64  ? 256 GLY F CA  1 
ATOM   6477 C C   . GLY F 1 179 ? 69.329  -9.084  -5.170  1.00 40.20  ? 256 GLY F C   1 
ATOM   6478 O O   . GLY F 1 179 ? 70.213  -9.672  -5.821  1.00 38.78  ? 256 GLY F O   1 
ATOM   6479 N N   . ASP F 1 180 ? 69.533  -8.571  -3.926  1.00 35.61  ? 257 ASP F N   1 
ATOM   6480 C CA  . ASP F 1 180 ? 70.813  -8.723  -3.238  1.00 33.31  ? 257 ASP F CA  1 
ATOM   6481 C C   . ASP F 1 180 ? 71.030  -10.193 -2.902  1.00 35.70  ? 257 ASP F C   1 
ATOM   6482 O O   . ASP F 1 180 ? 70.066  -10.958 -2.790  1.00 34.64  ? 257 ASP F O   1 
ATOM   6483 C CB  . ASP F 1 180 ? 70.870  -7.883  -1.952  1.00 33.87  ? 257 ASP F CB  1 
ATOM   6484 C CG  . ASP F 1 180 ? 70.857  -6.385  -2.113  1.00 49.40  ? 257 ASP F CG  1 
ATOM   6485 O OD1 . ASP F 1 180 ? 71.153  -5.900  -3.235  1.00 53.63  ? 257 ASP F OD1 1 
ATOM   6486 O OD2 . ASP F 1 180 ? 70.567  -5.686  -1.114  1.00 54.42  ? 257 ASP F OD2 1 
ATOM   6487 N N   . GLU F 1 181 ? 72.300  -10.574 -2.723  1.00 32.07  ? 258 GLU F N   1 
ATOM   6488 C CA  . GLU F 1 181 ? 72.681  -11.921 -2.319  1.00 31.19  ? 258 GLU F CA  1 
ATOM   6489 C C   . GLU F 1 181 ? 73.617  -11.846 -1.129  1.00 33.64  ? 258 GLU F C   1 
ATOM   6490 O O   . GLU F 1 181 ? 74.418  -10.907 -1.035  1.00 35.14  ? 258 GLU F O   1 
ATOM   6491 C CB  . GLU F 1 181 ? 73.340  -12.655 -3.466  1.00 33.50  ? 258 GLU F CB  1 
ATOM   6492 C CG  . GLU F 1 181 ? 72.348  -13.108 -4.517  1.00 50.38  ? 258 GLU F CG  1 
ATOM   6493 C CD  . GLU F 1 181 ? 72.965  -13.519 -5.839  1.00 66.36  ? 258 GLU F CD  1 
ATOM   6494 O OE1 . GLU F 1 181 ? 74.203  -13.714 -5.880  1.00 40.71  ? 258 GLU F OE1 1 
ATOM   6495 O OE2 . GLU F 1 181 ? 72.208  -13.646 -6.833  1.00 64.01  ? 258 GLU F OE2 1 
ATOM   6496 N N   . LEU F 1 182 ? 73.489  -12.805 -0.212  1.00 27.31  ? 259 LEU F N   1 
ATOM   6497 C CA  . LEU F 1 182 ? 74.341  -12.899 0.959   1.00 26.64  ? 259 LEU F CA  1 
ATOM   6498 C C   . LEU F 1 182 ? 75.252  -14.097 0.830   1.00 33.07  ? 259 LEU F C   1 
ATOM   6499 O O   . LEU F 1 182 ? 74.823  -15.155 0.345   1.00 33.77  ? 259 LEU F O   1 
ATOM   6500 C CB  . LEU F 1 182 ? 73.532  -13.019 2.255   1.00 26.37  ? 259 LEU F CB  1 
ATOM   6501 C CG  . LEU F 1 182 ? 72.629  -11.860 2.622   1.00 30.12  ? 259 LEU F CG  1 
ATOM   6502 C CD1 . LEU F 1 182 ? 71.822  -12.208 3.823   1.00 28.92  ? 259 LEU F CD1 1 
ATOM   6503 C CD2 . LEU F 1 182 ? 73.425  -10.577 2.868   1.00 29.96  ? 259 LEU F CD2 1 
ATOM   6504 N N   . GLN F 1 183 ? 76.513  -13.940 1.273   1.00 29.76  ? 260 GLN F N   1 
ATOM   6505 C CA  . GLN F 1 183 ? 77.504  -15.015 1.227   1.00 29.23  ? 260 GLN F CA  1 
ATOM   6506 C C   . GLN F 1 183 ? 78.461  -14.964 2.415   1.00 35.04  ? 260 GLN F C   1 
ATOM   6507 O O   . GLN F 1 183 ? 78.747  -13.887 2.958   1.00 36.94  ? 260 GLN F O   1 
ATOM   6508 C CB  . GLN F 1 183 ? 78.275  -14.983 -0.093  1.00 30.69  ? 260 GLN F CB  1 
ATOM   6509 C CG  . GLN F 1 183 ? 79.179  -13.768 -0.276  1.00 35.17  ? 260 GLN F CG  1 
ATOM   6510 C CD  . GLN F 1 183 ? 80.054  -13.893 -1.485  1.00 44.16  ? 260 GLN F CD  1 
ATOM   6511 O OE1 . GLN F 1 183 ? 79.651  -14.450 -2.496  1.00 39.55  ? 260 GLN F OE1 1 
ATOM   6512 N NE2 . GLN F 1 183 ? 81.257  -13.334 -1.419  1.00 28.71  ? 260 GLN F NE2 1 
ATOM   6513 N N   . LEU F 1 184 ? 78.938  -16.139 2.824   1.00 29.60  ? 261 LEU F N   1 
ATOM   6514 C CA  . LEU F 1 184 ? 79.901  -16.285 3.899   1.00 27.83  ? 261 LEU F CA  1 
ATOM   6515 C C   . LEU F 1 184 ? 81.207  -16.669 3.209   1.00 35.13  ? 261 LEU F C   1 
ATOM   6516 O O   . LEU F 1 184 ? 81.263  -17.717 2.566   1.00 37.19  ? 261 LEU F O   1 
ATOM   6517 C CB  . LEU F 1 184 ? 79.443  -17.368 4.876   1.00 26.59  ? 261 LEU F CB  1 
ATOM   6518 C CG  . LEU F 1 184 ? 80.207  -17.467 6.193   1.00 30.90  ? 261 LEU F CG  1 
ATOM   6519 C CD1 . LEU F 1 184 ? 79.293  -17.904 7.311   1.00 30.31  ? 261 LEU F CD1 1 
ATOM   6520 C CD2 . LEU F 1 184 ? 81.390  -18.410 6.076   1.00 33.73  ? 261 LEU F CD2 1 
ATOM   6521 N N   . ALA F 1 185 ? 82.229  -15.807 3.303   1.00 30.62  ? 262 ALA F N   1 
ATOM   6522 C CA  . ALA F 1 185 ? 83.522  -16.014 2.675   1.00 31.07  ? 262 ALA F CA  1 
ATOM   6523 C C   . ALA F 1 185 ? 84.655  -16.074 3.699   1.00 35.22  ? 262 ALA F C   1 
ATOM   6524 O O   . ALA F 1 185 ? 84.703  -15.253 4.622   1.00 34.02  ? 262 ALA F O   1 
ATOM   6525 C CB  . ALA F 1 185 ? 83.788  -14.885 1.711   1.00 32.50  ? 262 ALA F CB  1 
ATOM   6526 N N   . ILE F 1 186 ? 85.569  -17.056 3.546   1.00 32.30  ? 263 ILE F N   1 
ATOM   6527 C CA  . ILE F 1 186 ? 86.725  -17.181 4.430   1.00 31.52  ? 263 ILE F CA  1 
ATOM   6528 C C   . ILE F 1 186 ? 87.944  -16.617 3.669   1.00 39.00  ? 263 ILE F C   1 
ATOM   6529 O O   . ILE F 1 186 ? 88.363  -17.215 2.658   1.00 41.73  ? 263 ILE F O   1 
ATOM   6530 C CB  . ILE F 1 186 ? 86.927  -18.605 4.944   1.00 33.73  ? 263 ILE F CB  1 
ATOM   6531 C CG1 . ILE F 1 186 ? 85.713  -19.065 5.776   1.00 31.72  ? 263 ILE F CG1 1 
ATOM   6532 C CG2 . ILE F 1 186 ? 88.225  -18.665 5.763   1.00 36.59  ? 263 ILE F CG2 1 
ATOM   6533 C CD1 . ILE F 1 186 ? 85.483  -20.576 5.798   1.00 36.64  ? 263 ILE F CD1 1 
ATOM   6534 N N   . PRO F 1 187 ? 88.511  -15.456 4.094   1.00 33.31  ? 264 PRO F N   1 
ATOM   6535 C CA  . PRO F 1 187 ? 89.645  -14.879 3.344   1.00 33.54  ? 264 PRO F CA  1 
ATOM   6536 C C   . PRO F 1 187 ? 90.963  -15.625 3.550   1.00 40.60  ? 264 PRO F C   1 
ATOM   6537 O O   . PRO F 1 187 ? 91.958  -15.026 3.952   1.00 44.24  ? 264 PRO F O   1 
ATOM   6538 C CB  . PRO F 1 187 ? 89.707  -13.422 3.824   1.00 33.74  ? 264 PRO F CB  1 
ATOM   6539 C CG  . PRO F 1 187 ? 88.629  -13.266 4.833   1.00 36.78  ? 264 PRO F CG  1 
ATOM   6540 C CD  . PRO F 1 187 ? 88.144  -14.606 5.243   1.00 32.84  ? 264 PRO F CD  1 
ATOM   6541 N N   . ARG F 1 188 ? 90.963  -16.941 3.301   1.00 34.31  ? 265 ARG F N   1 
ATOM   6542 C CA  . ARG F 1 188 ? 92.135  -17.808 3.444   1.00 35.47  ? 265 ARG F CA  1 
ATOM   6543 C C   . ARG F 1 188 ? 92.022  -18.918 2.387   1.00 42.11  ? 265 ARG F C   1 
ATOM   6544 O O   . ARG F 1 188 ? 90.943  -19.482 2.227   1.00 41.11  ? 265 ARG F O   1 
ATOM   6545 C CB  . ARG F 1 188 ? 92.220  -18.415 4.853   1.00 31.34  ? 265 ARG F CB  1 
ATOM   6546 C CG  . ARG F 1 188 ? 92.059  -17.419 6.022   1.00 31.80  ? 265 ARG F CG  1 
ATOM   6547 C CD  . ARG F 1 188 ? 93.387  -17.215 6.642   1.00 42.21  ? 265 ARG F CD  1 
ATOM   6548 N NE  . ARG F 1 188 ? 93.451  -16.215 7.707   1.00 43.35  ? 265 ARG F NE  1 
ATOM   6549 C CZ  . ARG F 1 188 ? 93.695  -14.926 7.506   1.00 60.98  ? 265 ARG F CZ  1 
ATOM   6550 N NH1 . ARG F 1 188 ? 93.716  -14.430 6.273   1.00 50.11  ? 265 ARG F NH1 1 
ATOM   6551 N NH2 . ARG F 1 188 ? 93.868  -14.113 8.533   1.00 51.43  ? 265 ARG F NH2 1 
ATOM   6552 N N   . GLU F 1 189 ? 93.091  -19.173 1.604   1.00 40.24  ? 266 GLU F N   1 
ATOM   6553 C CA  . GLU F 1 189 ? 93.058  -20.210 0.579   1.00 40.67  ? 266 GLU F CA  1 
ATOM   6554 C C   . GLU F 1 189 ? 93.143  -21.554 1.344   1.00 48.47  ? 266 GLU F C   1 
ATOM   6555 O O   . GLU F 1 189 ? 93.868  -21.653 2.347   1.00 49.77  ? 266 GLU F O   1 
ATOM   6556 C CB  . GLU F 1 189 ? 94.262  -20.088 -0.351  1.00 44.20  ? 266 GLU F CB  1 
ATOM   6557 C CG  . GLU F 1 189 ? 94.203  -18.990 -1.378  1.00 52.52  ? 266 GLU F CG  1 
ATOM   6558 C CD  . GLU F 1 189 ? 95.558  -18.745 -2.006  1.00 78.31  ? 266 GLU F CD  1 
ATOM   6559 O OE1 . GLU F 1 189 ? 96.144  -19.698 -2.581  1.00 63.95  ? 266 GLU F OE1 1 
ATOM   6560 O OE2 . GLU F 1 189 ? 96.053  -17.601 -1.877  1.00 75.12  ? 266 GLU F OE2 1 
ATOM   6561 N N   . ASN F 1 190 ? 92.397  -22.583 0.885   1.00 44.72  ? 267 ASN F N   1 
ATOM   6562 C CA  . ASN F 1 190 ? 92.362  -23.929 1.475   1.00 44.12  ? 267 ASN F CA  1 
ATOM   6563 C C   . ASN F 1 190 ? 92.173  -23.928 2.982   1.00 47.08  ? 267 ASN F C   1 
ATOM   6564 O O   . ASN F 1 190 ? 92.906  -24.620 3.699   1.00 48.22  ? 267 ASN F O   1 
ATOM   6565 C CB  . ASN F 1 190 ? 93.570  -24.746 1.059   1.00 41.37  ? 267 ASN F CB  1 
ATOM   6566 C CG  . ASN F 1 190 ? 93.731  -24.835 -0.431  1.00 61.94  ? 267 ASN F CG  1 
ATOM   6567 O OD1 . ASN F 1 190 ? 92.895  -25.413 -1.152  1.00 57.37  ? 267 ASN F OD1 1 
ATOM   6568 N ND2 . ASN F 1 190 ? 94.826  -24.276 -0.915  1.00 55.80  ? 267 ASN F ND2 1 
ATOM   6569 N N   . ALA F 1 191 ? 91.182  -23.145 3.452   1.00 40.13  ? 268 ALA F N   1 
ATOM   6570 C CA  . ALA F 1 191 ? 90.882  -23.006 4.863   1.00 39.61  ? 268 ALA F CA  1 
ATOM   6571 C C   . ALA F 1 191 ? 90.495  -24.341 5.441   1.00 48.94  ? 268 ALA F C   1 
ATOM   6572 O O   . ALA F 1 191 ? 89.772  -25.107 4.785   1.00 50.34  ? 268 ALA F O   1 
ATOM   6573 C CB  . ALA F 1 191 ? 89.753  -21.994 5.066   1.00 38.37  ? 268 ALA F CB  1 
ATOM   6574 N N   . GLN F 1 192 ? 91.022  -24.647 6.648   1.00 47.91  ? 269 GLN F N   1 
ATOM   6575 C CA  . GLN F 1 192 ? 90.746  -25.892 7.372   1.00 47.83  ? 269 GLN F CA  1 
ATOM   6576 C C   . GLN F 1 192 ? 89.628  -25.640 8.338   1.00 50.79  ? 269 GLN F C   1 
ATOM   6577 O O   . GLN F 1 192 ? 89.817  -24.951 9.335   1.00 52.43  ? 269 GLN F O   1 
ATOM   6578 C CB  . GLN F 1 192 ? 91.991  -26.407 8.088   1.00 50.49  ? 269 GLN F CB  1 
ATOM   6579 C CG  . GLN F 1 192 ? 93.148  -26.724 7.161   1.00 57.61  ? 269 GLN F CG  1 
ATOM   6580 C CD  . GLN F 1 192 ? 92.751  -27.695 6.060   1.00 65.62  ? 269 GLN F CD  1 
ATOM   6581 O OE1 . GLN F 1 192 ? 92.413  -28.894 6.279   1.00 52.66  ? 269 GLN F OE1 1 
ATOM   6582 N NE2 . GLN F 1 192 ? 92.708  -27.157 4.848   1.00 58.48  ? 269 GLN F NE2 1 
ATOM   6583 N N   . ILE F 1 193 ? 88.435  -26.120 7.994   1.00 43.44  ? 270 ILE F N   1 
ATOM   6584 C CA  . ILE F 1 193 ? 87.217  -25.896 8.772   1.00 39.83  ? 270 ILE F CA  1 
ATOM   6585 C C   . ILE F 1 193 ? 86.425  -27.184 8.966   1.00 43.36  ? 270 ILE F C   1 
ATOM   6586 O O   . ILE F 1 193 ? 86.670  -28.155 8.263   1.00 45.87  ? 270 ILE F O   1 
ATOM   6587 C CB  . ILE F 1 193 ? 86.353  -24.820 8.070   1.00 40.19  ? 270 ILE F CB  1 
ATOM   6588 C CG1 . ILE F 1 193 ? 85.869  -25.296 6.667   1.00 39.23  ? 270 ILE F CG1 1 
ATOM   6589 C CG2 . ILE F 1 193 ? 87.104  -23.480 7.996   1.00 40.77  ? 270 ILE F CG2 1 
ATOM   6590 C CD1 . ILE F 1 193 ? 84.690  -24.649 6.160   1.00 38.31  ? 270 ILE F CD1 1 
ATOM   6591 N N   . SER F 1 194 ? 85.470  -27.200 9.898   1.00 37.19  ? 271 SER F N   1 
ATOM   6592 C CA  . SER F 1 194 ? 84.612  -28.373 10.125  1.00 35.53  ? 271 SER F CA  1 
ATOM   6593 C C   . SER F 1 194 ? 83.333  -28.188 9.331   1.00 39.92  ? 271 SER F C   1 
ATOM   6594 O O   . SER F 1 194 ? 82.746  -27.092 9.336   1.00 38.96  ? 271 SER F O   1 
ATOM   6595 C CB  . SER F 1 194 ? 84.294  -28.551 11.604  1.00 33.92  ? 271 SER F CB  1 
ATOM   6596 O OG  . SER F 1 194 ? 83.272  -29.513 11.791  1.00 32.33  ? 271 SER F OG  1 
ATOM   6597 N N   . LEU F 1 195 ? 82.915  -29.237 8.623   1.00 37.06  ? 272 LEU F N   1 
ATOM   6598 C CA  . LEU F 1 195 ? 81.718  -29.163 7.797   1.00 35.74  ? 272 LEU F CA  1 
ATOM   6599 C C   . LEU F 1 195 ? 80.508  -29.827 8.466   1.00 42.82  ? 272 LEU F C   1 
ATOM   6600 O O   . LEU F 1 195 ? 79.581  -30.287 7.775   1.00 43.84  ? 272 LEU F O   1 
ATOM   6601 C CB  . LEU F 1 195 ? 81.973  -29.659 6.359   1.00 35.60  ? 272 LEU F CB  1 
ATOM   6602 C CG  . LEU F 1 195 ? 82.951  -28.859 5.501   1.00 38.70  ? 272 LEU F CG  1 
ATOM   6603 C CD1 . LEU F 1 195 ? 83.076  -29.462 4.139   1.00 39.47  ? 272 LEU F CD1 1 
ATOM   6604 C CD2 . LEU F 1 195 ? 82.493  -27.420 5.326   1.00 41.89  ? 272 LEU F CD2 1 
ATOM   6605 N N   . ASP F 1 196 ? 80.492  -29.830 9.823   1.00 38.94  ? 273 ASP F N   1 
ATOM   6606 C CA  . ASP F 1 196 ? 79.372  -30.377 10.596  1.00 38.82  ? 273 ASP F CA  1 
ATOM   6607 C C   . ASP F 1 196 ? 78.296  -29.288 10.759  1.00 41.91  ? 273 ASP F C   1 
ATOM   6608 O O   . ASP F 1 196 ? 78.600  -28.160 11.182  1.00 40.12  ? 273 ASP F O   1 
ATOM   6609 C CB  . ASP F 1 196 ? 79.857  -30.917 11.960  1.00 41.55  ? 273 ASP F CB  1 
ATOM   6610 C CG  . ASP F 1 196 ? 80.851  -32.058 11.904  1.00 62.56  ? 273 ASP F CG  1 
ATOM   6611 O OD1 . ASP F 1 196 ? 80.771  -32.875 10.950  1.00 65.32  ? 273 ASP F OD1 1 
ATOM   6612 O OD2 . ASP F 1 196 ? 81.701  -32.159 12.834  1.00 74.31  ? 273 ASP F OD2 1 
ATOM   6613 N N   . GLY F 1 197 ? 77.061  -29.643 10.429  1.00 39.78  ? 274 GLY F N   1 
ATOM   6614 C CA  . GLY F 1 197 ? 75.902  -28.741 10.472  1.00 39.65  ? 274 GLY F CA  1 
ATOM   6615 C C   . GLY F 1 197 ? 75.603  -28.022 11.779  1.00 42.88  ? 274 GLY F C   1 
ATOM   6616 O O   . GLY F 1 197 ? 74.987  -26.956 11.765  1.00 40.53  ? 274 GLY F O   1 
ATOM   6617 N N   . ASP F 1 198 ? 76.029  -28.598 12.912  1.00 40.78  ? 275 ASP F N   1 
ATOM   6618 C CA  . ASP F 1 198 ? 75.806  -28.025 14.248  1.00 40.79  ? 275 ASP F CA  1 
ATOM   6619 C C   . ASP F 1 198 ? 76.873  -26.983 14.608  1.00 41.87  ? 275 ASP F C   1 
ATOM   6620 O O   . ASP F 1 198 ? 76.761  -26.289 15.626  1.00 40.73  ? 275 ASP F O   1 
ATOM   6621 C CB  . ASP F 1 198 ? 75.795  -29.157 15.321  1.00 43.22  ? 275 ASP F CB  1 
ATOM   6622 C CG  . ASP F 1 198 ? 77.093  -29.957 15.453  1.00 44.41  ? 275 ASP F CG  1 
ATOM   6623 O OD1 . ASP F 1 198 ? 77.820  -30.084 14.444  1.00 43.88  ? 275 ASP F OD1 1 
ATOM   6624 O OD2 . ASP F 1 198 ? 77.355  -30.493 16.556  1.00 46.17  ? 275 ASP F OD2 1 
ATOM   6625 N N   . VAL F 1 199 ? 77.918  -26.907 13.783  1.00 35.81  ? 276 VAL F N   1 
ATOM   6626 C CA  . VAL F 1 199 ? 79.076  -26.088 14.068  1.00 34.04  ? 276 VAL F CA  1 
ATOM   6627 C C   . VAL F 1 199 ? 79.376  -25.012 13.004  1.00 37.89  ? 276 VAL F C   1 
ATOM   6628 O O   . VAL F 1 199 ? 79.921  -23.969 13.343  1.00 36.08  ? 276 VAL F O   1 
ATOM   6629 C CB  . VAL F 1 199 ? 80.208  -27.088 14.366  1.00 37.01  ? 276 VAL F CB  1 
ATOM   6630 C CG1 . VAL F 1 199 ? 81.138  -27.327 13.194  1.00 35.90  ? 276 VAL F CG1 1 
ATOM   6631 C CG2 . VAL F 1 199 ? 80.932  -26.748 15.643  1.00 37.23  ? 276 VAL F CG2 1 
ATOM   6632 N N   . THR F 1 200 ? 78.983  -25.258 11.737  1.00 35.13  ? 277 THR F N   1 
ATOM   6633 C CA  . THR F 1 200 ? 79.164  -24.357 10.601  1.00 33.15  ? 277 THR F CA  1 
ATOM   6634 C C   . THR F 1 200 ? 77.798  -24.166 9.955   1.00 36.58  ? 277 THR F C   1 
ATOM   6635 O O   . THR F 1 200 ? 77.234  -25.091 9.352   1.00 38.11  ? 277 THR F O   1 
ATOM   6636 C CB  . THR F 1 200 ? 80.242  -24.893 9.660   1.00 40.31  ? 277 THR F CB  1 
ATOM   6637 O OG1 . THR F 1 200 ? 81.463  -25.010 10.386  1.00 39.62  ? 277 THR F OG1 1 
ATOM   6638 C CG2 . THR F 1 200 ? 80.456  -24.000 8.444   1.00 38.71  ? 277 THR F CG2 1 
ATOM   6639 N N   . PHE F 1 201 ? 77.239  -22.976 10.134  1.00 29.62  ? 278 PHE F N   1 
ATOM   6640 C CA  . PHE F 1 201 ? 75.891  -22.648 9.652   1.00 26.68  ? 278 PHE F CA  1 
ATOM   6641 C C   . PHE F 1 201 ? 75.794  -21.164 9.324   1.00 29.59  ? 278 PHE F C   1 
ATOM   6642 O O   . PHE F 1 201 ? 76.655  -20.377 9.737   1.00 28.49  ? 278 PHE F O   1 
ATOM   6643 C CB  . PHE F 1 201 ? 74.809  -23.093 10.660  1.00 27.60  ? 278 PHE F CB  1 
ATOM   6644 C CG  . PHE F 1 201 ? 75.025  -22.590 12.075  1.00 28.47  ? 278 PHE F CG  1 
ATOM   6645 C CD1 . PHE F 1 201 ? 75.699  -23.371 13.015  1.00 32.70  ? 278 PHE F CD1 1 
ATOM   6646 C CD2 . PHE F 1 201 ? 74.593  -21.318 12.455  1.00 29.72  ? 278 PHE F CD2 1 
ATOM   6647 C CE1 . PHE F 1 201 ? 75.915  -22.899 14.319  1.00 34.19  ? 278 PHE F CE1 1 
ATOM   6648 C CE2 . PHE F 1 201 ? 74.811  -20.841 13.752  1.00 32.96  ? 278 PHE F CE2 1 
ATOM   6649 C CZ  . PHE F 1 201 ? 75.461  -21.637 14.682  1.00 32.50  ? 278 PHE F CZ  1 
ATOM   6650 N N   . PHE F 1 202 ? 74.757  -20.792 8.560   1.00 26.72  ? 279 PHE F N   1 
ATOM   6651 C CA  . PHE F 1 202 ? 74.547  -19.447 8.026   1.00 26.42  ? 279 PHE F CA  1 
ATOM   6652 C C   . PHE F 1 202 ? 73.057  -19.246 7.777   1.00 34.01  ? 279 PHE F C   1 
ATOM   6653 O O   . PHE F 1 202 ? 72.405  -20.099 7.174   1.00 36.77  ? 279 PHE F O   1 
ATOM   6654 C CB  . PHE F 1 202 ? 75.356  -19.316 6.704   1.00 27.04  ? 279 PHE F CB  1 
ATOM   6655 C CG  . PHE F 1 202 ? 75.288  -18.047 5.886   1.00 27.20  ? 279 PHE F CG  1 
ATOM   6656 C CD1 . PHE F 1 202 ? 75.322  -16.801 6.501   1.00 28.93  ? 279 PHE F CD1 1 
ATOM   6657 C CD2 . PHE F 1 202 ? 75.303  -18.095 4.491   1.00 26.93  ? 279 PHE F CD2 1 
ATOM   6658 C CE1 . PHE F 1 202 ? 75.311  -15.635 5.740   1.00 28.93  ? 279 PHE F CE1 1 
ATOM   6659 C CE2 . PHE F 1 202 ? 75.281  -16.920 3.733   1.00 28.14  ? 279 PHE F CE2 1 
ATOM   6660 C CZ  . PHE F 1 202 ? 75.278  -15.701 4.360   1.00 26.01  ? 279 PHE F CZ  1 
ATOM   6661 N N   . GLY F 1 203 ? 72.524  -18.143 8.275   1.00 29.18  ? 280 GLY F N   1 
ATOM   6662 C CA  . GLY F 1 203 ? 71.116  -17.833 8.105   1.00 28.59  ? 280 GLY F CA  1 
ATOM   6663 C C   . GLY F 1 203 ? 70.775  -16.364 8.135   1.00 30.87  ? 280 GLY F C   1 
ATOM   6664 O O   . GLY F 1 203 ? 71.614  -15.506 8.452   1.00 28.87  ? 280 GLY F O   1 
ATOM   6665 N N   . ALA F 1 204 ? 69.532  -16.079 7.764   1.00 29.35  ? 281 ALA F N   1 
ATOM   6666 C CA  . ALA F 1 204 ? 68.956  -14.733 7.746   1.00 30.69  ? 281 ALA F CA  1 
ATOM   6667 C C   . ALA F 1 204 ? 67.507  -14.808 8.151   1.00 36.54  ? 281 ALA F C   1 
ATOM   6668 O O   . ALA F 1 204 ? 66.831  -15.781 7.833   1.00 37.91  ? 281 ALA F O   1 
ATOM   6669 C CB  . ALA F 1 204 ? 69.089  -14.088 6.370   1.00 31.12  ? 281 ALA F CB  1 
ATOM   6670 N N   . LEU F 1 205 ? 67.044  -13.799 8.869   1.00 32.88  ? 282 LEU F N   1 
ATOM   6671 C CA  . LEU F 1 205 ? 65.687  -13.722 9.376   1.00 33.70  ? 282 LEU F CA  1 
ATOM   6672 C C   . LEU F 1 205 ? 65.096  -12.331 9.101   1.00 35.80  ? 282 LEU F C   1 
ATOM   6673 O O   . LEU F 1 205 ? 65.662  -11.334 9.540   1.00 35.16  ? 282 LEU F O   1 
ATOM   6674 C CB  . LEU F 1 205 ? 65.740  -14.044 10.878  1.00 34.14  ? 282 LEU F CB  1 
ATOM   6675 C CG  . LEU F 1 205 ? 64.567  -13.637 11.767  1.00 40.09  ? 282 LEU F CG  1 
ATOM   6676 C CD1 . LEU F 1 205 ? 63.336  -14.405 11.419  1.00 40.93  ? 282 LEU F CD1 1 
ATOM   6677 C CD2 . LEU F 1 205 ? 64.911  -13.886 13.220  1.00 42.93  ? 282 LEU F CD2 1 
ATOM   6678 N N   . LYS F 1 206 ? 63.986  -12.271 8.346   1.00 32.00  ? 283 LYS F N   1 
ATOM   6679 C CA  . LYS F 1 206 ? 63.320  -11.017 8.007   1.00 32.46  ? 283 LYS F CA  1 
ATOM   6680 C C   . LYS F 1 206 ? 62.619  -10.483 9.223   1.00 41.66  ? 283 LYS F C   1 
ATOM   6681 O O   . LYS F 1 206 ? 61.928  -11.225 9.912   1.00 42.97  ? 283 LYS F O   1 
ATOM   6682 C CB  . LYS F 1 206 ? 62.345  -11.166 6.829   1.00 34.55  ? 283 LYS F CB  1 
ATOM   6683 C CG  . LYS F 1 206 ? 62.115  -9.844  6.097   1.00 39.67  ? 283 LYS F CG  1 
ATOM   6684 C CD  . LYS F 1 206 ? 61.147  -9.936  4.961   1.00 39.67  ? 283 LYS F CD  1 
ATOM   6685 C CE  . LYS F 1 206 ? 60.683  -8.566  4.534   1.00 47.95  ? 283 LYS F CE  1 
ATOM   6686 N NZ  . LYS F 1 206 ? 59.492  -8.640  3.617   1.00 65.97  ? 283 LYS F NZ  1 
ATOM   6687 N N   . LEU F 1 207 ? 62.871  -9.209  9.536   1.00 41.35  ? 284 LEU F N   1 
ATOM   6688 C CA  . LEU F 1 207 ? 62.264  -8.532  10.678  1.00 42.98  ? 284 LEU F CA  1 
ATOM   6689 C C   . LEU F 1 207 ? 60.948  -7.935  10.248  1.00 50.54  ? 284 LEU F C   1 
ATOM   6690 O O   . LEU F 1 207 ? 60.867  -7.399  9.146   1.00 50.93  ? 284 LEU F O   1 
ATOM   6691 C CB  . LEU F 1 207 ? 63.184  -7.417  11.191  1.00 41.63  ? 284 LEU F CB  1 
ATOM   6692 C CG  . LEU F 1 207 ? 64.538  -7.838  11.692  1.00 43.10  ? 284 LEU F CG  1 
ATOM   6693 C CD1 . LEU F 1 207 ? 65.292  -6.652  12.182  1.00 43.42  ? 284 LEU F CD1 1 
ATOM   6694 C CD2 . LEU F 1 207 ? 64.406  -8.827  12.827  1.00 45.44  ? 284 LEU F CD2 1 
ATOM   6695 N N   . LEU F 1 208 ? 59.929  -8.004  11.108  1.00 49.97  ? 285 LEU F N   1 
ATOM   6696 C CA  . LEU F 1 208 ? 58.633  -7.415  10.801  1.00 57.82  ? 285 LEU F CA  1 
ATOM   6697 C C   . LEU F 1 208 ? 58.698  -5.899  10.823  1.00 62.70  ? 285 LEU F C   1 
ATOM   6698 O O   . LEU F 1 208 ? 58.013  -5.259  9.994   1.00 70.80  ? 285 LEU F O   1 
ATOM   6699 C CB  . LEU F 1 208 ? 57.557  -7.918  11.751  1.00 60.56  ? 285 LEU F CB  1 
ATOM   6700 C CG  . LEU F 1 208 ? 57.065  -9.309  11.429  1.00 66.88  ? 285 LEU F CG  1 
ATOM   6701 C CD1 . LEU F 1 208 ? 56.725  -10.071 12.706  1.00 68.98  ? 285 LEU F CD1 1 
ATOM   6702 C CD2 . LEU F 1 208 ? 55.884  -9.261  10.475  1.00 71.47  ? 285 LEU F CD2 1 
ATOM   6703 O OXT . LEU F 1 208 ? 59.497  -5.358  11.611  1.00 65.63  ? 285 LEU F OXT 1 
HETATM 6704 C C   . ACE G 2 1   ? 106.256 16.175  -3.006  1.00 105.97 ? 22  ACE G C   1 
HETATM 6705 O O   . ACE G 2 1   ? 105.568 16.600  -3.951  1.00 104.55 ? 22  ACE G O   1 
HETATM 6706 C CH3 . ACE G 2 1   ? 107.329 17.051  -2.366  1.00 109.74 ? 22  ACE G CH3 1 
ATOM   6707 N N   . CYS G 2 2   ? 106.118 14.956  -2.482  1.00 104.40 ? 23  CYS G N   1 
ATOM   6708 C CA  . CYS G 2 2   ? 105.120 14.022  -2.991  1.00 101.15 ? 23  CYS G CA  1 
ATOM   6709 C C   . CYS G 2 2   ? 103.947 13.807  -2.052  1.00 100.25 ? 23  CYS G C   1 
ATOM   6710 O O   . CYS G 2 2   ? 104.141 13.485  -0.882  1.00 100.38 ? 23  CYS G O   1 
ATOM   6711 C CB  . CYS G 2 2   ? 105.742 12.712  -3.452  1.00 102.58 ? 23  CYS G CB  1 
ATOM   6712 S SG  . CYS G 2 2   ? 104.827 11.929  -4.790  1.00 105.23 ? 23  CYS G SG  1 
ATOM   6713 N N   . HIS G 2 3   ? 102.729 14.024  -2.567  1.00 92.39  ? 24  HIS G N   1 
ATOM   6714 C CA  . HIS G 2 3   ? 101.493 13.896  -1.799  1.00 88.52  ? 24  HIS G CA  1 
ATOM   6715 C C   . HIS G 2 3   ? 100.353 13.269  -2.611  1.00 83.03  ? 24  HIS G C   1 
ATOM   6716 O O   . HIS G 2 3   ? 100.426 13.137  -3.837  1.00 82.16  ? 24  HIS G O   1 
ATOM   6717 C CB  . HIS G 2 3   ? 101.070 15.258  -1.240  1.00 90.49  ? 24  HIS G CB  1 
ATOM   6718 C CG  . HIS G 2 3   ? 100.642 16.201  -2.311  1.00 94.53  ? 24  HIS G CG  1 
ATOM   6719 N ND1 . HIS G 2 3   ? 101.563 16.963  -3.007  1.00 99.37  ? 24  HIS G ND1 1 
ATOM   6720 C CD2 . HIS G 2 3   ? 99.409  16.417  -2.827  1.00 94.73  ? 24  HIS G CD2 1 
ATOM   6721 C CE1 . HIS G 2 3   ? 100.860 17.645  -3.897  1.00 98.25  ? 24  HIS G CE1 1 
ATOM   6722 N NE2 . HIS G 2 3   ? 99.559  17.344  -3.832  1.00 95.54  ? 24  HIS G NE2 1 
ATOM   6723 N N   . TRP G 2 4   ? 99.292  12.905  -1.901  1.00 73.02  ? 25  TRP G N   1 
ATOM   6724 C CA  . TRP G 2 4   ? 98.122  12.233  -2.438  1.00 68.39  ? 25  TRP G CA  1 
ATOM   6725 C C   . TRP G 2 4   ? 97.070  13.251  -2.900  1.00 66.69  ? 25  TRP G C   1 
ATOM   6726 O O   . TRP G 2 4   ? 96.656  14.113  -2.117  1.00 65.71  ? 25  TRP G O   1 
ATOM   6727 C CB  . TRP G 2 4   ? 97.548  11.303  -1.365  1.00 66.11  ? 25  TRP G CB  1 
ATOM   6728 C CG  . TRP G 2 4   ? 96.264  10.672  -1.767  1.00 65.28  ? 25  TRP G CG  1 
ATOM   6729 C CD1 . TRP G 2 4   ? 95.007  11.112  -1.476  1.00 66.88  ? 25  TRP G CD1 1 
ATOM   6730 C CD2 . TRP G 2 4   ? 96.109  9.527   -2.609  1.00 65.26  ? 25  TRP G CD2 1 
ATOM   6731 N NE1 . TRP G 2 4   ? 94.070  10.293  -2.069  1.00 65.77  ? 25  TRP G NE1 1 
ATOM   6732 C CE2 . TRP G 2 4   ? 94.720  9.312   -2.771  1.00 67.76  ? 25  TRP G CE2 1 
ATOM   6733 C CE3 . TRP G 2 4   ? 97.012  8.659   -3.250  1.00 67.66  ? 25  TRP G CE3 1 
ATOM   6734 C CZ2 . TRP G 2 4   ? 94.213  8.268   -3.543  1.00 67.09  ? 25  TRP G CZ2 1 
ATOM   6735 C CZ3 . TRP G 2 4   ? 96.508  7.627   -4.014  1.00 69.61  ? 25  TRP G CZ3 1 
ATOM   6736 C CH2 . TRP G 2 4   ? 95.122  7.439   -4.156  1.00 69.18  ? 25  TRP G CH2 1 
ATOM   6737 N N   . ASP G 2 5   ? 96.640  13.141  -4.169  1.00 59.38  ? 26  ASP G N   1 
ATOM   6738 C CA  . ASP G 2 5   ? 95.637  14.030  -4.745  1.00 55.87  ? 26  ASP G CA  1 
ATOM   6739 C C   . ASP G 2 5   ? 94.269  13.381  -4.593  1.00 59.66  ? 26  ASP G C   1 
ATOM   6740 O O   . ASP G 2 5   ? 94.004  12.339  -5.207  1.00 61.24  ? 26  ASP G O   1 
ATOM   6741 C CB  . ASP G 2 5   ? 95.949  14.351  -6.220  1.00 55.98  ? 26  ASP G CB  1 
ATOM   6742 C CG  . ASP G 2 5   ? 95.058  15.441  -6.806  1.00 54.12  ? 26  ASP G CG  1 
ATOM   6743 O OD1 . ASP G 2 5   ? 93.848  15.478  -6.464  1.00 49.35  ? 26  ASP G OD1 1 
ATOM   6744 O OD2 . ASP G 2 5   ? 95.563  16.260  -7.610  1.00 57.80  ? 26  ASP G OD2 1 
ATOM   6745 N N   . LEU G 2 6   ? 93.403  14.000  -3.767  1.00 53.17  ? 27  LEU G N   1 
ATOM   6746 C CA  . LEU G 2 6   ? 92.061  13.489  -3.474  1.00 50.79  ? 27  LEU G CA  1 
ATOM   6747 C C   . LEU G 2 6   ? 91.142  13.462  -4.671  1.00 54.30  ? 27  LEU G C   1 
ATOM   6748 O O   . LEU G 2 6   ? 90.292  12.580  -4.744  1.00 55.88  ? 27  LEU G O   1 
ATOM   6749 C CB  . LEU G 2 6   ? 91.400  14.253  -2.316  1.00 50.27  ? 27  LEU G CB  1 
ATOM   6750 C CG  . LEU G 2 6   ? 92.100  14.180  -0.945  1.00 54.84  ? 27  LEU G CG  1 
ATOM   6751 C CD1 . LEU G 2 6   ? 91.557  15.212  0.005   1.00 53.80  ? 27  LEU G CD1 1 
ATOM   6752 C CD2 . LEU G 2 6   ? 91.952  12.794  -0.323  1.00 57.40  ? 27  LEU G CD2 1 
ATOM   6753 N N   . LEU G 2 7   ? 91.308  14.408  -5.614  1.00 48.53  ? 28  LEU G N   1 
ATOM   6754 C CA  . LEU G 2 7   ? 90.478  14.495  -6.812  1.00 45.32  ? 28  LEU G CA  1 
ATOM   6755 C C   . LEU G 2 7   ? 90.812  13.427  -7.841  1.00 52.31  ? 28  LEU G C   1 
ATOM   6756 O O   . LEU G 2 7   ? 89.910  12.709  -8.271  1.00 50.65  ? 28  LEU G O   1 
ATOM   6757 C CB  . LEU G 2 7   ? 90.523  15.900  -7.433  1.00 43.24  ? 28  LEU G CB  1 
ATOM   6758 C CG  . LEU G 2 7   ? 89.689  16.134  -8.696  1.00 43.17  ? 28  LEU G CG  1 
ATOM   6759 C CD1 . LEU G 2 7   ? 88.186  16.069  -8.421  1.00 41.09  ? 28  LEU G CD1 1 
ATOM   6760 C CD2 . LEU G 2 7   ? 90.007  17.437  -9.271  1.00 40.09  ? 28  LEU G CD2 1 
ATOM   6761 N N   . VAL G 2 8   ? 92.085  13.333  -8.260  1.00 53.28  ? 29  VAL G N   1 
ATOM   6762 C CA  . VAL G 2 8   ? 92.497  12.343  -9.265  1.00 55.02  ? 29  VAL G CA  1 
ATOM   6763 C C   . VAL G 2 8   ? 92.690  10.934  -8.676  1.00 65.99  ? 29  VAL G C   1 
ATOM   6764 O O   . VAL G 2 8   ? 92.688  9.947   -9.424  1.00 68.70  ? 29  VAL G O   1 
ATOM   6765 C CB  . VAL G 2 8   ? 93.696  12.771  -10.142 1.00 58.77  ? 29  VAL G CB  1 
ATOM   6766 C CG1 . VAL G 2 8   ? 93.459  14.129  -10.768 1.00 57.09  ? 29  VAL G CG1 1 
ATOM   6767 C CG2 . VAL G 2 8   ? 94.980  12.765  -9.346  1.00 60.85  ? 29  VAL G CG2 1 
ATOM   6768 N N   . ARG G 2 9   ? 92.821  10.842  -7.347  1.00 64.39  ? 30  ARG G N   1 
ATOM   6769 C CA  . ARG G 2 9   ? 93.032  9.578   -6.645  1.00 67.75  ? 30  ARG G CA  1 
ATOM   6770 C C   . ARG G 2 9   ? 94.316  8.834   -7.084  1.00 78.63  ? 30  ARG G C   1 
ATOM   6771 O O   . ARG G 2 9   ? 94.283  7.660   -7.456  1.00 79.53  ? 30  ARG G O   1 
ATOM   6772 C CB  . ARG G 2 9   ? 91.759  8.701   -6.578  1.00 67.04  ? 30  ARG G CB  1 
ATOM   6773 C CG  . ARG G 2 9   ? 90.743  9.235   -5.580  1.00 69.49  ? 30  ARG G CG  1 
ATOM   6774 C CD  . ARG G 2 9   ? 89.402  8.541   -5.642  1.00 73.13  ? 30  ARG G CD  1 
ATOM   6775 N NE  . ARG G 2 9   ? 88.386  9.412   -5.044  1.00 82.24  ? 30  ARG G NE  1 
ATOM   6776 C CZ  . ARG G 2 9   ? 87.070  9.298   -5.214  1.00 94.44  ? 30  ARG G CZ  1 
ATOM   6777 N NH1 . ARG G 2 9   ? 86.570  8.324   -5.971  1.00 78.78  ? 30  ARG G NH1 1 
ATOM   6778 N NH2 . ARG G 2 9   ? 86.245  10.159  -4.636  1.00 78.10  ? 30  ARG G NH2 1 
ATOM   6779 N N   . HIS G 2 10  ? 95.441  9.580   -7.072  1.00 79.23  ? 31  HIS G N   1 
ATOM   6780 C CA  . HIS G 2 10  ? 96.811  9.139   -7.311  1.00 82.71  ? 31  HIS G CA  1 
ATOM   6781 C C   . HIS G 2 10  ? 97.842  10.017  -6.631  1.00 85.96  ? 31  HIS G C   1 
ATOM   6782 O O   . HIS G 2 10  ? 97.478  11.007  -6.000  1.00 82.60  ? 31  HIS G O   1 
ATOM   6783 C CB  . HIS G 2 10  ? 97.202  8.566   -8.701  1.00 86.76  ? 31  HIS G CB  1 
ATOM   6784 C CG  . HIS G 2 10  ? 96.748  9.276   -9.921  1.00 90.72  ? 31  HIS G CG  1 
ATOM   6785 N ND1 . HIS G 2 10  ? 97.406  10.406  -10.376 1.00 93.91  ? 31  HIS G ND1 1 
ATOM   6786 C CD2 . HIS G 2 10  ? 95.825  8.906   -10.839 1.00 93.18  ? 31  HIS G CD2 1 
ATOM   6787 C CE1 . HIS G 2 10  ? 96.805  10.740  -11.512 1.00 93.29  ? 31  HIS G CE1 1 
ATOM   6788 N NE2 . HIS G 2 10  ? 95.839  9.873   -11.828 1.00 92.82  ? 31  HIS G NE2 1 
ATOM   6789 N N   . TRP G 2 11  ? 99.112  9.601   -6.675  1.00 86.82  ? 32  TRP G N   1 
ATOM   6790 C CA  . TRP G 2 11  ? 100.218 10.314  -6.051  1.00 88.26  ? 32  TRP G CA  1 
ATOM   6791 C C   . TRP G 2 11  ? 100.779 11.331  -7.027  1.00 93.67  ? 32  TRP G C   1 
ATOM   6792 O O   . TRP G 2 11  ? 101.136 10.989  -8.158  1.00 94.67  ? 32  TRP G O   1 
ATOM   6793 C CB  . TRP G 2 11  ? 101.308 9.346   -5.553  1.00 89.25  ? 32  TRP G CB  1 
ATOM   6794 C CG  . TRP G 2 11  ? 100.899 8.584   -4.334  1.00 89.33  ? 32  TRP G CG  1 
ATOM   6795 C CD1 . TRP G 2 11  ? 100.336 7.344   -4.294  1.00 92.56  ? 32  TRP G CD1 1 
ATOM   6796 C CD2 . TRP G 2 11  ? 100.957 9.042   -2.980  1.00 88.22  ? 32  TRP G CD2 1 
ATOM   6797 N NE1 . TRP G 2 11  ? 100.070 6.986   -2.993  1.00 91.49  ? 32  TRP G NE1 1 
ATOM   6798 C CE2 . TRP G 2 11  ? 100.436 8.012   -2.166  1.00 91.94  ? 32  TRP G CE2 1 
ATOM   6799 C CE3 . TRP G 2 11  ? 101.424 10.208  -2.369  1.00 89.22  ? 32  TRP G CE3 1 
ATOM   6800 C CZ2 . TRP G 2 11  ? 100.344 8.130   -0.776  1.00 90.63  ? 32  TRP G CZ2 1 
ATOM   6801 C CZ3 . TRP G 2 11  ? 101.322 10.329  -0.992  1.00 90.07  ? 32  TRP G CZ3 1 
ATOM   6802 C CH2 . TRP G 2 11  ? 100.789 9.297   -0.211  1.00 90.29  ? 32  TRP G CH2 1 
ATOM   6803 N N   . VAL G 2 12  ? 100.802 12.595  -6.596  1.00 89.82  ? 33  VAL G N   1 
ATOM   6804 C CA  . VAL G 2 12  ? 101.321 13.712  -7.362  1.00 91.00  ? 33  VAL G CA  1 
ATOM   6805 C C   . VAL G 2 12  ? 102.661 14.159  -6.726  1.00 98.92  ? 33  VAL G C   1 
ATOM   6806 O O   . VAL G 2 12  ? 102.745 14.305  -5.499  1.00 97.45  ? 33  VAL G O   1 
ATOM   6807 C CB  . VAL G 2 12  ? 100.270 14.849  -7.413  1.00 91.80  ? 33  VAL G CB  1 
ATOM   6808 N N   . CYS G 2 13  ? 103.713 14.329  -7.555  1.00 100.07 ? 34  CYS G N   1 
ATOM   6809 C CA  . CYS G 2 13  ? 105.006 14.803  -7.052  1.00 104.09 ? 34  CYS G CA  1 
ATOM   6810 C C   . CYS G 2 13  ? 105.389 16.144  -7.680  1.00 111.07 ? 34  CYS G C   1 
ATOM   6811 O O   . CYS G 2 13  ? 105.394 16.273  -8.903  1.00 112.19 ? 34  CYS G O   1 
ATOM   6812 C CB  . CYS G 2 13  ? 106.122 13.778  -7.225  1.00 107.55 ? 34  CYS G CB  1 
ATOM   6813 S SG  . CYS G 2 13  ? 105.785 12.107  -6.582  1.00 109.36 ? 34  CYS G SG  1 
HETATM 6814 N N   . NH2 G 2 14  ? 105.815 17.104  -6.851  1.00 108.69 ? 35  NH2 G N   1 
ATOM   6815 N N   . CYS H 2 2   ? 99.836  10.892  -42.013 1.00 95.35  ? 23  CYS H N   1 
ATOM   6816 C CA  . CYS H 2 2   ? 98.461  11.369  -41.896 1.00 92.21  ? 23  CYS H CA  1 
ATOM   6817 C C   . CYS H 2 2   ? 97.437  10.248  -41.822 1.00 92.20  ? 23  CYS H C   1 
ATOM   6818 O O   . CYS H 2 2   ? 97.504  9.285   -42.586 1.00 92.38  ? 23  CYS H O   1 
ATOM   6819 C CB  . CYS H 2 2   ? 98.109  12.326  -43.027 1.00 93.95  ? 23  CYS H CB  1 
ATOM   6820 S SG  . CYS H 2 2   ? 99.167  13.777  -43.132 1.00 101.55 ? 23  CYS H SG  1 
ATOM   6821 N N   . HIS H 2 3   ? 96.434  10.426  -40.969 1.00 84.65  ? 24  HIS H N   1 
ATOM   6822 C CA  . HIS H 2 3   ? 95.331  9.486   -40.829 1.00 81.44  ? 24  HIS H CA  1 
ATOM   6823 C C   . HIS H 2 3   ? 94.058  10.281  -40.641 1.00 80.39  ? 24  HIS H C   1 
ATOM   6824 O O   . HIS H 2 3   ? 94.108  11.460  -40.282 1.00 79.36  ? 24  HIS H O   1 
ATOM   6825 C CB  . HIS H 2 3   ? 95.551  8.546   -39.624 1.00 81.34  ? 24  HIS H CB  1 
ATOM   6826 N N   . TRP H 2 4   ? 92.920  9.638   -40.897 1.00 74.16  ? 25  TRP H N   1 
ATOM   6827 C CA  . TRP H 2 4   ? 91.600  10.196  -40.679 1.00 71.87  ? 25  TRP H CA  1 
ATOM   6828 C C   . TRP H 2 4   ? 91.211  9.959   -39.192 1.00 67.75  ? 25  TRP H C   1 
ATOM   6829 O O   . TRP H 2 4   ? 91.251  8.820   -38.708 1.00 63.05  ? 25  TRP H O   1 
ATOM   6830 C CB  . TRP H 2 4   ? 90.592  9.532   -41.620 1.00 72.00  ? 25  TRP H CB  1 
ATOM   6831 C CG  . TRP H 2 4   ? 89.171  9.897   -41.304 1.00 72.66  ? 25  TRP H CG  1 
ATOM   6832 C CD1 . TRP H 2 4   ? 88.291  9.211   -40.505 1.00 74.08  ? 25  TRP H CD1 1 
ATOM   6833 C CD2 . TRP H 2 4   ? 88.508  11.097  -41.696 1.00 73.19  ? 25  TRP H CD2 1 
ATOM   6834 N NE1 . TRP H 2 4   ? 87.099  9.892   -40.417 1.00 73.05  ? 25  TRP H NE1 1 
ATOM   6835 C CE2 . TRP H 2 4   ? 87.207  11.061  -41.132 1.00 75.94  ? 25  TRP H CE2 1 
ATOM   6836 C CE3 . TRP H 2 4   ? 88.893  12.217  -42.464 1.00 75.75  ? 25  TRP H CE3 1 
ATOM   6837 C CZ2 . TRP H 2 4   ? 86.280  12.084  -41.340 1.00 75.74  ? 25  TRP H CZ2 1 
ATOM   6838 C CZ3 . TRP H 2 4   ? 87.973  13.233  -42.661 1.00 77.39  ? 25  TRP H CZ3 1 
ATOM   6839 C CH2 . TRP H 2 4   ? 86.682  13.160  -42.112 1.00 77.06  ? 25  TRP H CH2 1 
ATOM   6840 N N   . ASP H 2 5   ? 90.840  11.048  -38.485 1.00 62.88  ? 26  ASP H N   1 
ATOM   6841 C CA  . ASP H 2 5   ? 90.435  11.006  -37.084 1.00 60.15  ? 26  ASP H CA  1 
ATOM   6842 C C   . ASP H 2 5   ? 88.926  10.879  -37.023 1.00 62.95  ? 26  ASP H C   1 
ATOM   6843 O O   . ASP H 2 5   ? 88.201  11.796  -37.415 1.00 64.51  ? 26  ASP H O   1 
ATOM   6844 C CB  . ASP H 2 5   ? 90.925  12.241  -36.318 1.00 61.50  ? 26  ASP H CB  1 
ATOM   6845 C CG  . ASP H 2 5   ? 90.744  12.149  -34.821 1.00 69.33  ? 26  ASP H CG  1 
ATOM   6846 O OD1 . ASP H 2 5   ? 89.713  11.599  -34.379 1.00 68.20  ? 26  ASP H OD1 1 
ATOM   6847 O OD2 . ASP H 2 5   ? 91.620  12.644  -34.088 1.00 74.28  ? 26  ASP H OD2 1 
ATOM   6848 N N   . LEU H 2 6   ? 88.460  9.733   -36.522 1.00 56.31  ? 27  LEU H N   1 
ATOM   6849 C CA  . LEU H 2 6   ? 87.041  9.399   -36.433 1.00 54.76  ? 27  LEU H CA  1 
ATOM   6850 C C   . LEU H 2 6   ? 86.273  10.298  -35.519 1.00 55.76  ? 27  LEU H C   1 
ATOM   6851 O O   . LEU H 2 6   ? 85.097  10.560  -35.778 1.00 55.84  ? 27  LEU H O   1 
ATOM   6852 C CB  . LEU H 2 6   ? 86.824  7.917   -36.043 1.00 54.25  ? 27  LEU H CB  1 
ATOM   6853 C CG  . LEU H 2 6   ? 87.455  6.847   -36.982 1.00 59.74  ? 27  LEU H CG  1 
ATOM   6854 C CD1 . LEU H 2 6   ? 87.541  5.490   -36.301 1.00 58.23  ? 27  LEU H CD1 1 
ATOM   6855 C CD2 . LEU H 2 6   ? 86.733  6.770   -38.327 1.00 62.67  ? 27  LEU H CD2 1 
ATOM   6856 N N   . LEU H 2 7   ? 86.933  10.774  -34.448 1.00 50.41  ? 28  LEU H N   1 
ATOM   6857 C CA  . LEU H 2 7   ? 86.337  11.623  -33.413 1.00 47.96  ? 28  LEU H CA  1 
ATOM   6858 C C   . LEU H 2 7   ? 86.126  13.052  -33.896 1.00 57.63  ? 28  LEU H C   1 
ATOM   6859 O O   . LEU H 2 7   ? 84.995  13.541  -33.833 1.00 59.18  ? 28  LEU H O   1 
ATOM   6860 C CB  . LEU H 2 7   ? 87.135  11.559  -32.086 1.00 44.91  ? 28  LEU H CB  1 
ATOM   6861 C CG  . LEU H 2 7   ? 86.606  12.372  -30.968 1.00 46.50  ? 28  LEU H CG  1 
ATOM   6862 C CD1 . LEU H 2 7   ? 85.379  11.765  -30.410 1.00 45.82  ? 28  LEU H CD1 1 
ATOM   6863 C CD2 . LEU H 2 7   ? 87.582  12.475  -29.923 1.00 47.52  ? 28  LEU H CD2 1 
ATOM   6864 N N   . VAL H 2 8   ? 87.191  13.722  -34.373 1.00 56.33  ? 29  VAL H N   1 
ATOM   6865 C CA  . VAL H 2 8   ? 87.082  15.114  -34.837 1.00 57.94  ? 29  VAL H CA  1 
ATOM   6866 C C   . VAL H 2 8   ? 86.504  15.233  -36.249 1.00 68.07  ? 29  VAL H C   1 
ATOM   6867 O O   . VAL H 2 8   ? 86.065  16.324  -36.639 1.00 69.68  ? 29  VAL H O   1 
ATOM   6868 C CB  . VAL H 2 8   ? 88.368  15.949  -34.669 1.00 61.27  ? 29  VAL H CB  1 
ATOM   6869 C CG1 . VAL H 2 8   ? 88.893  15.898  -33.237 1.00 60.15  ? 29  VAL H CG1 1 
ATOM   6870 C CG2 . VAL H 2 8   ? 89.432  15.502  -35.647 1.00 62.20  ? 29  VAL H CG2 1 
ATOM   6871 N N   . ARG H 2 9   ? 86.503  14.111  -37.000 1.00 66.39  ? 30  ARG H N   1 
ATOM   6872 C CA  . ARG H 2 9   ? 86.036  14.033  -38.378 1.00 68.92  ? 30  ARG H CA  1 
ATOM   6873 C C   . ARG H 2 9   ? 86.810  14.998  -39.317 1.00 78.57  ? 30  ARG H C   1 
ATOM   6874 O O   . ARG H 2 9   ? 86.226  15.824  -40.018 1.00 79.79  ? 30  ARG H O   1 
ATOM   6875 C CB  . ARG H 2 9   ? 84.501  14.105  -38.476 1.00 68.88  ? 30  ARG H CB  1 
ATOM   6876 C CG  . ARG H 2 9   ? 83.827  12.813  -38.041 1.00 71.99  ? 30  ARG H CG  1 
ATOM   6877 C CD  . ARG H 2 9   ? 82.323  12.929  -38.047 1.00 72.20  ? 30  ARG H CD  1 
ATOM   6878 N N   . HIS H 2 10  ? 88.150  14.871  -39.292 1.00 78.34  ? 31  HIS H N   1 
ATOM   6879 C CA  . HIS H 2 10  ? 89.154  15.611  -40.068 1.00 81.42  ? 31  HIS H CA  1 
ATOM   6880 C C   . HIS H 2 10  ? 90.392  14.775  -40.287 1.00 88.01  ? 31  HIS H C   1 
ATOM   6881 O O   . HIS H 2 10  ? 90.565  13.743  -39.643 1.00 87.21  ? 31  HIS H O   1 
ATOM   6882 C CB  . HIS H 2 10  ? 89.681  16.786  -39.255 1.00 83.25  ? 31  HIS H CB  1 
ATOM   6883 C CG  . HIS H 2 10  ? 88.808  17.969  -39.227 1.00 88.29  ? 31  HIS H CG  1 
ATOM   6884 N ND1 . HIS H 2 10  ? 88.272  18.432  -38.037 1.00 89.90  ? 31  HIS H ND1 1 
ATOM   6885 C CD2 . HIS H 2 10  ? 88.448  18.802  -40.236 1.00 92.40  ? 31  HIS H CD2 1 
ATOM   6886 C CE1 . HIS H 2 10  ? 87.566  19.506  -38.362 1.00 90.83  ? 31  HIS H CE1 1 
ATOM   6887 N NE2 . HIS H 2 10  ? 87.652  19.775  -39.679 1.00 92.53  ? 31  HIS H NE2 1 
ATOM   6888 N N   . TRP H 2 11  ? 91.305  15.271  -41.122 1.00 87.85  ? 32  TRP H N   1 
ATOM   6889 C CA  . TRP H 2 11  ? 92.581  14.621  -41.363 1.00 89.39  ? 32  TRP H CA  1 
ATOM   6890 C C   . TRP H 2 11  ? 93.583  15.179  -40.378 1.00 90.76  ? 32  TRP H C   1 
ATOM   6891 O O   . TRP H 2 11  ? 93.746  16.397  -40.287 1.00 90.67  ? 32  TRP H O   1 
ATOM   6892 C CB  . TRP H 2 11  ? 93.031  14.829  -42.814 1.00 91.60  ? 32  TRP H CB  1 
ATOM   6893 C CG  . TRP H 2 11  ? 92.265  13.982  -43.785 1.00 93.35  ? 32  TRP H CG  1 
ATOM   6894 C CD1 . TRP H 2 11  ? 91.156  14.342  -44.496 1.00 96.33  ? 32  TRP H CD1 1 
ATOM   6895 C CD2 . TRP H 2 11  ? 92.505  12.605  -44.083 1.00 93.79  ? 32  TRP H CD2 1 
ATOM   6896 N NE1 . TRP H 2 11  ? 90.710  13.282  -45.245 1.00 96.19  ? 32  TRP H NE1 1 
ATOM   6897 C CE2 . TRP H 2 11  ? 91.513  12.198  -45.004 1.00 97.97  ? 32  TRP H CE2 1 
ATOM   6898 C CE3 . TRP H 2 11  ? 93.479  11.673  -43.673 1.00 95.82  ? 32  TRP H CE3 1 
ATOM   6899 C CZ2 . TRP H 2 11  ? 91.459  10.896  -45.515 1.00 98.11  ? 32  TRP H CZ2 1 
ATOM   6900 C CZ3 . TRP H 2 11  ? 93.420  10.381  -44.172 1.00 97.96  ? 32  TRP H CZ3 1 
ATOM   6901 C CH2 . TRP H 2 11  ? 92.423  10.004  -45.088 1.00 98.71  ? 32  TRP H CH2 1 
ATOM   6902 N N   . VAL H 2 12  ? 94.200  14.292  -39.587 1.00 86.02  ? 33  VAL H N   1 
ATOM   6903 C CA  . VAL H 2 12  ? 95.216  14.660  -38.600 1.00 85.80  ? 33  VAL H CA  1 
ATOM   6904 C C   . VAL H 2 12  ? 96.596  14.233  -39.129 1.00 92.37  ? 33  VAL H C   1 
ATOM   6905 O O   . VAL H 2 12  ? 96.752  13.086  -39.563 1.00 92.05  ? 33  VAL H O   1 
ATOM   6906 C CB  . VAL H 2 12  ? 94.903  14.058  -37.221 1.00 86.20  ? 33  VAL H CB  1 
ATOM   6907 N N   . CYS H 2 13  ? 97.564  15.174  -39.162 1.00 90.93  ? 34  CYS H N   1 
ATOM   6908 C CA  . CYS H 2 13  ? 98.909  14.925  -39.679 1.00 94.70  ? 34  CYS H CA  1 
ATOM   6909 C C   . CYS H 2 13  ? 99.957  15.166  -38.616 1.00 103.73 ? 34  CYS H C   1 
ATOM   6910 O O   . CYS H 2 13  ? 99.921  16.188  -37.918 1.00 103.96 ? 34  CYS H O   1 
ATOM   6911 C CB  . CYS H 2 13  ? 99.171  15.767  -40.923 1.00 96.73  ? 34  CYS H CB  1 
ATOM   6912 S SG  . CYS H 2 13  ? 98.129  15.332  -42.345 1.00 98.94  ? 34  CYS H SG  1 
HETATM 6913 N N   . NH2 H 2 14  ? 100.926 14.246  -38.516 1.00 103.21 ? 35  NH2 H N   1 
ATOM   6914 N N   . CYS I 2 2   ? 93.595  45.745  -24.195 1.00 110.43 ? 23  CYS I N   1 
ATOM   6915 C CA  . CYS I 2 2   ? 92.723  45.173  -23.180 1.00 106.82 ? 23  CYS I CA  1 
ATOM   6916 C C   . CYS I 2 2   ? 91.278  45.480  -23.418 1.00 107.53 ? 23  CYS I C   1 
ATOM   6917 O O   . CYS I 2 2   ? 90.906  46.643  -23.652 1.00 109.05 ? 23  CYS I O   1 
ATOM   6918 C CB  . CYS I 2 2   ? 93.167  45.565  -21.780 1.00 108.67 ? 23  CYS I CB  1 
ATOM   6919 S SG  . CYS I 2 2   ? 94.864  45.071  -21.426 1.00 116.21 ? 23  CYS I SG  1 
ATOM   6920 N N   . HIS I 2 3   ? 90.472  44.393  -23.410 1.00 98.13  ? 24  HIS I N   1 
ATOM   6921 C CA  . HIS I 2 3   ? 89.035  44.369  -23.639 1.00 93.25  ? 24  HIS I CA  1 
ATOM   6922 C C   . HIS I 2 3   ? 88.280  43.801  -22.446 1.00 91.82  ? 24  HIS I C   1 
ATOM   6923 O O   . HIS I 2 3   ? 88.862  43.180  -21.545 1.00 90.69  ? 24  HIS I O   1 
ATOM   6924 C CB  . HIS I 2 3   ? 88.717  43.527  -24.895 1.00 91.85  ? 24  HIS I CB  1 
ATOM   6925 N N   . TRP I 2 4   ? 86.974  44.079  -22.424 1.00 84.67  ? 25  TRP I N   1 
ATOM   6926 C CA  . TRP I 2 4   ? 86.065  43.473  -21.481 1.00 81.32  ? 25  TRP I CA  1 
ATOM   6927 C C   . TRP I 2 4   ? 85.576  42.209  -22.185 1.00 78.19  ? 25  TRP I C   1 
ATOM   6928 O O   . TRP I 2 4   ? 85.052  42.280  -23.311 1.00 76.47  ? 25  TRP I O   1 
ATOM   6929 C CB  . TRP I 2 4   ? 84.880  44.387  -21.140 1.00 80.25  ? 25  TRP I CB  1 
ATOM   6930 C CG  . TRP I 2 4   ? 83.806  43.670  -20.371 1.00 80.34  ? 25  TRP I CG  1 
ATOM   6931 C CD1 . TRP I 2 4   ? 82.680  43.091  -20.878 1.00 81.55  ? 25  TRP I CD1 1 
ATOM   6932 C CD2 . TRP I 2 4   ? 83.817  43.371  -18.973 1.00 81.62  ? 25  TRP I CD2 1 
ATOM   6933 N NE1 . TRP I 2 4   ? 81.974  42.467  -19.876 1.00 81.43  ? 25  TRP I NE1 1 
ATOM   6934 C CE2 . TRP I 2 4   ? 82.644  42.631  -18.693 1.00 85.03  ? 25  TRP I CE2 1 
ATOM   6935 C CE3 . TRP I 2 4   ? 84.704  43.661  -17.922 1.00 85.17  ? 25  TRP I CE3 1 
ATOM   6936 C CZ2 . TRP I 2 4   ? 82.331  42.182  -17.406 1.00 86.31  ? 25  TRP I CZ2 1 
ATOM   6937 C CZ3 . TRP I 2 4   ? 84.394  43.216  -16.647 1.00 88.14  ? 25  TRP I CZ3 1 
ATOM   6938 C CH2 . TRP I 2 4   ? 83.225  42.479  -16.398 1.00 88.38  ? 25  TRP I CH2 1 
ATOM   6939 N N   . ASP I 2 5   ? 85.775  41.052  -21.526 1.00 69.91  ? 26  ASP I N   1 
ATOM   6940 C CA  . ASP I 2 5   ? 85.350  39.771  -22.059 1.00 64.90  ? 26  ASP I CA  1 
ATOM   6941 C C   . ASP I 2 5   ? 83.961  39.451  -21.526 1.00 66.92  ? 26  ASP I C   1 
ATOM   6942 O O   . ASP I 2 5   ? 83.790  39.244  -20.326 1.00 66.48  ? 26  ASP I O   1 
ATOM   6943 C CB  . ASP I 2 5   ? 86.363  38.675  -21.734 1.00 64.15  ? 26  ASP I CB  1 
ATOM   6944 C CG  . ASP I 2 5   ? 86.122  37.383  -22.473 1.00 59.25  ? 26  ASP I CG  1 
ATOM   6945 O OD1 . ASP I 2 5   ? 84.954  36.985  -22.608 1.00 55.67  ? 26  ASP I OD1 1 
ATOM   6946 O OD2 . ASP I 2 5   ? 87.100  36.752  -22.884 1.00 64.94  ? 26  ASP I OD2 1 
ATOM   6947 N N   . LEU I 2 6   ? 82.972  39.420  -22.430 1.00 62.44  ? 27  LEU I N   1 
ATOM   6948 C CA  . LEU I 2 6   ? 81.580  39.145  -22.086 1.00 61.91  ? 27  LEU I CA  1 
ATOM   6949 C C   . LEU I 2 6   ? 81.353  37.745  -21.543 1.00 67.17  ? 27  LEU I C   1 
ATOM   6950 O O   . LEU I 2 6   ? 80.469  37.578  -20.696 1.00 70.28  ? 27  LEU I O   1 
ATOM   6951 C CB  . LEU I 2 6   ? 80.639  39.401  -23.269 1.00 60.49  ? 27  LEU I CB  1 
ATOM   6952 C CG  . LEU I 2 6   ? 80.620  40.809  -23.865 1.00 64.55  ? 27  LEU I CG  1 
ATOM   6953 C CD1 . LEU I 2 6   ? 79.833  40.813  -25.161 1.00 63.70  ? 27  LEU I CD1 1 
ATOM   6954 C CD2 . LEU I 2 6   ? 79.991  41.789  -22.925 1.00 66.66  ? 27  LEU I CD2 1 
ATOM   6955 N N   . LEU I 2 7   ? 82.137  36.745  -22.015 1.00 60.30  ? 28  LEU I N   1 
ATOM   6956 C CA  . LEU I 2 7   ? 82.019  35.364  -21.572 1.00 58.33  ? 28  LEU I CA  1 
ATOM   6957 C C   . LEU I 2 7   ? 82.565  35.153  -20.173 1.00 63.06  ? 28  LEU I C   1 
ATOM   6958 O O   . LEU I 2 7   ? 81.834  34.644  -19.332 1.00 64.42  ? 28  LEU I O   1 
ATOM   6959 C CB  . LEU I 2 7   ? 82.653  34.390  -22.573 1.00 56.36  ? 28  LEU I CB  1 
ATOM   6960 C CG  . LEU I 2 7   ? 82.604  32.897  -22.204 1.00 59.16  ? 28  LEU I CG  1 
ATOM   6961 C CD1 . LEU I 2 7   ? 81.220  32.336  -22.375 1.00 58.74  ? 28  LEU I CD1 1 
ATOM   6962 C CD2 . LEU I 2 7   ? 83.551  32.112  -23.029 1.00 57.16  ? 28  LEU I CD2 1 
ATOM   6963 N N   . VAL I 2 8   ? 83.824  35.520  -19.917 1.00 61.11  ? 29  VAL I N   1 
ATOM   6964 C CA  . VAL I 2 8   ? 84.441  35.330  -18.583 1.00 63.43  ? 29  VAL I CA  1 
ATOM   6965 C C   . VAL I 2 8   ? 84.013  36.398  -17.561 1.00 73.54  ? 29  VAL I C   1 
ATOM   6966 O O   . VAL I 2 8   ? 84.196  36.193  -16.366 1.00 75.25  ? 29  VAL I O   1 
ATOM   6967 C CB  . VAL I 2 8   ? 85.984  35.126  -18.594 1.00 65.35  ? 29  VAL I CB  1 
ATOM   6968 C CG1 . VAL I 2 8   ? 86.398  34.023  -19.548 1.00 62.88  ? 29  VAL I CG1 1 
ATOM   6969 C CG2 . VAL I 2 8   ? 86.708  36.413  -18.917 1.00 65.76  ? 29  VAL I CG2 1 
ATOM   6970 N N   . ARG I 2 9   ? 83.461  37.527  -18.037 1.00 72.36  ? 30  ARG I N   1 
ATOM   6971 C CA  . ARG I 2 9   ? 83.043  38.655  -17.213 1.00 75.64  ? 30  ARG I CA  1 
ATOM   6972 C C   . ARG I 2 9   ? 84.185  39.250  -16.374 1.00 88.79  ? 30  ARG I C   1 
ATOM   6973 O O   . ARG I 2 9   ? 84.068  39.411  -15.161 1.00 91.50  ? 30  ARG I O   1 
ATOM   6974 C CB  . ARG I 2 9   ? 81.739  38.389  -16.441 1.00 72.22  ? 30  ARG I CB  1 
ATOM   6975 C CG  . ARG I 2 9   ? 80.516  38.397  -17.336 1.00 70.35  ? 30  ARG I CG  1 
ATOM   6976 C CD  . ARG I 2 9   ? 79.262  37.977  -16.600 1.00 69.03  ? 30  ARG I CD  1 
ATOM   6977 N N   . HIS I 2 10  ? 85.305  39.538  -17.051 1.00 89.44  ? 31  HIS I N   1 
ATOM   6978 C CA  . HIS I 2 10  ? 86.486  40.215  -16.541 1.00 93.41  ? 31  HIS I CA  1 
ATOM   6979 C C   . HIS I 2 10  ? 87.248  40.949  -17.634 1.00 97.53  ? 31  HIS I C   1 
ATOM   6980 O O   . HIS I 2 10  ? 86.860  40.873  -18.803 1.00 96.12  ? 31  HIS I O   1 
ATOM   6981 C CB  . HIS I 2 10  ? 87.325  39.505  -15.442 1.00 97.06  ? 31  HIS I CB  1 
ATOM   6982 C CG  . HIS I 2 10  ? 87.767  38.094  -15.661 1.00 100.65 ? 31  HIS I CG  1 
ATOM   6983 N ND1 . HIS I 2 10  ? 87.147  37.018  -15.027 1.00 103.06 ? 31  HIS I ND1 1 
ATOM   6984 C CD2 . HIS I 2 10  ? 88.870  37.640  -16.297 1.00 102.88 ? 31  HIS I CD2 1 
ATOM   6985 C CE1 . HIS I 2 10  ? 87.848  35.944  -15.364 1.00 101.44 ? 31  HIS I CE1 1 
ATOM   6986 N NE2 . HIS I 2 10  ? 88.896  36.266  -16.125 1.00 101.66 ? 31  HIS I NE2 1 
ATOM   6987 N N   . TRP I 2 11  ? 88.283  41.701  -17.260 1.00 95.93  ? 32  TRP I N   1 
ATOM   6988 C CA  . TRP I 2 11  ? 89.107  42.428  -18.217 1.00 96.48  ? 32  TRP I CA  1 
ATOM   6989 C C   . TRP I 2 11  ? 90.250  41.529  -18.682 1.00 99.25  ? 32  TRP I C   1 
ATOM   6990 O O   . TRP I 2 11  ? 91.033  41.051  -17.865 1.00 100.22 ? 32  TRP I O   1 
ATOM   6991 C CB  . TRP I 2 11  ? 89.623  43.720  -17.585 1.00 98.41  ? 32  TRP I CB  1 
ATOM   6992 C CG  . TRP I 2 11  ? 88.556  44.772  -17.450 1.00 99.53  ? 32  TRP I CG  1 
ATOM   6993 C CD1 . TRP I 2 11  ? 87.766  45.026  -16.361 1.00 102.84 ? 32  TRP I CD1 1 
ATOM   6994 C CD2 . TRP I 2 11  ? 88.123  45.666  -18.480 1.00 99.10  ? 32  TRP I CD2 1 
ATOM   6995 N NE1 . TRP I 2 11  ? 86.876  46.036  -16.646 1.00 101.92 ? 32  TRP I NE1 1 
ATOM   6996 C CE2 . TRP I 2 11  ? 87.074  46.450  -17.942 1.00 102.88 ? 32  TRP I CE2 1 
ATOM   6997 C CE3 . TRP I 2 11  ? 88.528  45.884  -19.815 1.00 100.14 ? 32  TRP I CE3 1 
ATOM   6998 C CZ2 . TRP I 2 11  ? 86.417  47.429  -18.693 1.00 102.11 ? 32  TRP I CZ2 1 
ATOM   6999 C CZ3 . TRP I 2 11  ? 87.872  46.846  -20.559 1.00 101.49 ? 32  TRP I CZ3 1 
ATOM   7000 C CH2 . TRP I 2 11  ? 86.833  47.611  -19.999 1.00 102.12 ? 32  TRP I CH2 1 
ATOM   7001 N N   . VAL I 2 12  ? 90.296  41.238  -19.977 1.00 94.07  ? 33  VAL I N   1 
ATOM   7002 C CA  . VAL I 2 12  ? 91.299  40.345  -20.554 1.00 94.09  ? 33  VAL I CA  1 
ATOM   7003 C C   . VAL I 2 12  ? 92.216  41.141  -21.445 1.00 102.26 ? 33  VAL I C   1 
ATOM   7004 O O   . VAL I 2 12  ? 91.764  42.064  -22.130 1.00 102.49 ? 33  VAL I O   1 
ATOM   7005 C CB  . VAL I 2 12  ? 90.683  39.123  -21.283 1.00 94.45  ? 33  VAL I CB  1 
ATOM   7006 N N   . CYS I 2 13  ? 93.519  40.806  -21.418 1.00 102.13 ? 34  CYS I N   1 
ATOM   7007 C CA  . CYS I 2 13  ? 94.548  41.506  -22.192 1.00 105.61 ? 34  CYS I CA  1 
ATOM   7008 C C   . CYS I 2 13  ? 95.249  40.609  -23.207 1.00 108.46 ? 34  CYS I C   1 
ATOM   7009 O O   . CYS I 2 13  ? 95.745  39.536  -22.846 1.00 106.77 ? 34  CYS I O   1 
ATOM   7010 C CB  . CYS I 2 13  ? 95.545  42.187  -21.259 1.00 109.63 ? 34  CYS I CB  1 
ATOM   7011 S SG  . CYS I 2 13  ? 94.808  43.458  -20.200 1.00 113.56 ? 34  CYS I SG  1 
HETATM 7012 N N   . NH2 I 2 14  ? 95.291  41.045  -24.475 1.00 105.47 ? 35  NH2 I N   1 
ATOM   7013 N N   . CYS J 2 2   ? 100.103 -7.042  42.282  1.00 122.97 ? 23  CYS J N   1 
ATOM   7014 C CA  . CYS J 2 2   ? 98.771  -7.637  42.214  1.00 120.00 ? 23  CYS J CA  1 
ATOM   7015 C C   . CYS J 2 2   ? 97.661  -6.561  42.131  1.00 119.00 ? 23  CYS J C   1 
ATOM   7016 O O   . CYS J 2 2   ? 97.651  -5.607  42.923  1.00 118.97 ? 23  CYS J O   1 
ATOM   7017 C CB  . CYS J 2 2   ? 98.550  -8.595  43.385  1.00 121.00 ? 23  CYS J CB  1 
ATOM   7018 S SG  . CYS J 2 2   ? 98.112  -10.293 42.918  1.00 124.38 ? 23  CYS J SG  1 
ATOM   7019 N N   . HIS J 2 3   ? 96.734  -6.739  41.158  1.00 110.64 ? 24  HIS J N   1 
ATOM   7020 C CA  . HIS J 2 3   ? 95.610  -5.824  40.905  1.00 107.21 ? 24  HIS J CA  1 
ATOM   7021 C C   . HIS J 2 3   ? 94.269  -6.568  40.749  1.00 105.08 ? 24  HIS J C   1 
ATOM   7022 O O   . HIS J 2 3   ? 94.269  -7.771  40.469  1.00 105.87 ? 24  HIS J O   1 
ATOM   7023 C CB  . HIS J 2 3   ? 95.890  -4.966  39.655  1.00 107.23 ? 24  HIS J CB  1 
ATOM   7024 N N   . TRP J 2 4   ? 93.132  -5.863  40.970  1.00 94.60  ? 25  TRP J N   1 
ATOM   7025 C CA  . TRP J 2 4   ? 91.800  -6.433  40.793  1.00 89.92  ? 25  TRP J CA  1 
ATOM   7026 C C   . TRP J 2 4   ? 91.407  -6.255  39.315  1.00 85.48  ? 25  TRP J C   1 
ATOM   7027 O O   . TRP J 2 4   ? 91.422  -5.131  38.808  1.00 84.12  ? 25  TRP J O   1 
ATOM   7028 C CB  . TRP J 2 4   ? 90.768  -5.765  41.725  1.00 88.42  ? 25  TRP J CB  1 
ATOM   7029 C CG  . TRP J 2 4   ? 89.351  -6.181  41.431  1.00 88.00  ? 25  TRP J CG  1 
ATOM   7030 C CD1 . TRP J 2 4   ? 88.452  -5.531  40.630  1.00 89.27  ? 25  TRP J CD1 1 
ATOM   7031 C CD2 . TRP J 2 4   ? 88.716  -7.399  41.841  1.00 87.94  ? 25  TRP J CD2 1 
ATOM   7032 N NE1 . TRP J 2 4   ? 87.283  -6.258  40.541  1.00 88.05  ? 25  TRP J NE1 1 
ATOM   7033 C CE2 . TRP J 2 4   ? 87.417  -7.411  41.274  1.00 90.67  ? 25  TRP J CE2 1 
ATOM   7034 C CE3 . TRP J 2 4   ? 89.123  -8.492  42.620  1.00 90.41  ? 25  TRP J CE3 1 
ATOM   7035 C CZ2 . TRP J 2 4   ? 86.513  -8.463  41.486  1.00 89.91  ? 25  TRP J CZ2 1 
ATOM   7036 C CZ3 . TRP J 2 4   ? 88.225  -9.528  42.834  1.00 91.92  ? 25  TRP J CZ3 1 
ATOM   7037 C CH2 . TRP J 2 4   ? 86.939  -9.509  42.268  1.00 91.31  ? 25  TRP J CH2 1 
ATOM   7038 N N   . ASP J 2 5   ? 91.059  -7.361  38.636  1.00 76.07  ? 26  ASP J N   1 
ATOM   7039 C CA  . ASP J 2 5   ? 90.641  -7.323  37.244  1.00 71.98  ? 26  ASP J CA  1 
ATOM   7040 C C   . ASP J 2 5   ? 89.127  -7.249  37.184  1.00 74.94  ? 26  ASP J C   1 
ATOM   7041 O O   . ASP J 2 5   ? 88.439  -8.191  37.578  1.00 73.74  ? 26  ASP J O   1 
ATOM   7042 C CB  . ASP J 2 5   ? 91.175  -8.533  36.475  1.00 72.54  ? 26  ASP J CB  1 
ATOM   7043 C CG  . ASP J 2 5   ? 90.995  -8.438  34.983  1.00 70.12  ? 26  ASP J CG  1 
ATOM   7044 O OD1 . ASP J 2 5   ? 89.935  -7.951  34.538  1.00 67.00  ? 26  ASP J OD1 1 
ATOM   7045 O OD2 . ASP J 2 5   ? 91.897  -8.860  34.261  1.00 77.40  ? 26  ASP J OD2 1 
ATOM   7046 N N   . LEU J 2 6   ? 88.611  -6.120  36.680  1.00 72.19  ? 27  LEU J N   1 
ATOM   7047 C CA  . LEU J 2 6   ? 87.169  -5.861  36.583  1.00 70.99  ? 27  LEU J CA  1 
ATOM   7048 C C   . LEU J 2 6   ? 86.439  -6.804  35.649  1.00 74.58  ? 27  LEU J C   1 
ATOM   7049 O O   . LEU J 2 6   ? 85.278  -7.129  35.924  1.00 75.88  ? 27  LEU J O   1 
ATOM   7050 C CB  . LEU J 2 6   ? 86.859  -4.402  36.195  1.00 69.71  ? 27  LEU J CB  1 
ATOM   7051 C CG  . LEU J 2 6   ? 87.465  -3.303  37.056  1.00 75.99  ? 27  LEU J CG  1 
ATOM   7052 C CD1 . LEU J 2 6   ? 87.372  -1.959  36.343  1.00 75.11  ? 27  LEU J CD1 1 
ATOM   7053 C CD2 . LEU J 2 6   ? 86.785  -3.232  38.414  1.00 81.00  ? 27  LEU J CD2 1 
ATOM   7054 N N   . LEU J 2 7   ? 87.107  -7.232  34.545  1.00 67.95  ? 28  LEU J N   1 
ATOM   7055 C CA  . LEU J 2 7   ? 86.526  -8.129  33.553  1.00 65.15  ? 28  LEU J CA  1 
ATOM   7056 C C   . LEU J 2 7   ? 86.396  -9.563  34.067  1.00 72.90  ? 28  LEU J C   1 
ATOM   7057 O O   . LEU J 2 7   ? 85.295  -10.105 34.026  1.00 73.55  ? 28  LEU J O   1 
ATOM   7058 C CB  . LEU J 2 7   ? 87.300  -8.082  32.233  1.00 63.39  ? 28  LEU J CB  1 
ATOM   7059 C CG  . LEU J 2 7   ? 86.806  -9.006  31.124  1.00 65.22  ? 28  LEU J CG  1 
ATOM   7060 C CD1 . LEU J 2 7   ? 85.495  -8.531  30.528  1.00 62.67  ? 28  LEU J CD1 1 
ATOM   7061 C CD2 . LEU J 2 7   ? 87.809  -9.116  30.055  1.00 66.63  ? 28  LEU J CD2 1 
ATOM   7062 N N   . VAL J 2 8   ? 87.495  -10.183 34.535  1.00 71.29  ? 29  VAL J N   1 
ATOM   7063 C CA  . VAL J 2 8   ? 87.452  -11.567 35.017  1.00 72.61  ? 29  VAL J CA  1 
ATOM   7064 C C   . VAL J 2 8   ? 86.881  -11.697 36.422  1.00 81.32  ? 29  VAL J C   1 
ATOM   7065 O O   . VAL J 2 8   ? 86.488  -12.802 36.816  1.00 81.95  ? 29  VAL J O   1 
ATOM   7066 C CB  . VAL J 2 8   ? 88.779  -12.347 34.848  1.00 77.02  ? 29  VAL J CB  1 
ATOM   7067 C CG1 . VAL J 2 8   ? 89.285  -12.281 33.413  1.00 76.09  ? 29  VAL J CG1 1 
ATOM   7068 C CG2 . VAL J 2 8   ? 89.835  -11.859 35.821  1.00 78.06  ? 29  VAL J CG2 1 
ATOM   7069 N N   . ARG J 2 9   ? 86.841  -10.576 37.173  1.00 80.92  ? 30  ARG J N   1 
ATOM   7070 C CA  . ARG J 2 9   ? 86.362  -10.514 38.556  1.00 83.23  ? 30  ARG J CA  1 
ATOM   7071 C C   . ARG J 2 9   ? 87.157  -11.419 39.504  1.00 93.89  ? 30  ARG J C   1 
ATOM   7072 O O   . ARG J 2 9   ? 86.593  -12.248 40.216  1.00 94.35  ? 30  ARG J O   1 
ATOM   7073 C CB  . ARG J 2 9   ? 84.825  -10.639 38.666  1.00 80.35  ? 30  ARG J CB  1 
ATOM   7074 C CG  . ARG J 2 9   ? 84.095  -9.387  38.217  1.00 83.74  ? 30  ARG J CG  1 
ATOM   7075 C CD  . ARG J 2 9   ? 82.600  -9.606  38.157  1.00 89.08  ? 30  ARG J CD  1 
ATOM   7076 N N   . HIS J 2 10  ? 88.488  -11.261 39.461  1.00 95.53  ? 31  HIS J N   1 
ATOM   7077 C CA  . HIS J 2 10  ? 89.473  -11.897 40.322  1.00 99.61  ? 31  HIS J CA  1 
ATOM   7078 C C   . HIS J 2 10  ? 90.744  -11.067 40.484  1.00 104.87 ? 31  HIS J C   1 
ATOM   7079 O O   . HIS J 2 10  ? 90.881  -10.026 39.835  1.00 102.98 ? 31  HIS J O   1 
ATOM   7080 C CB  . HIS J 2 10  ? 89.648  -13.442 40.229  1.00 102.70 ? 31  HIS J CB  1 
ATOM   7081 C CG  . HIS J 2 10  ? 89.862  -14.069 38.892  1.00 107.16 ? 31  HIS J CG  1 
ATOM   7082 N ND1 . HIS J 2 10  ? 88.866  -14.795 38.260  1.00 109.29 ? 31  HIS J ND1 1 
ATOM   7083 C CD2 . HIS J 2 10  ? 91.006  -14.189 38.179  1.00 111.09 ? 31  HIS J CD2 1 
ATOM   7084 C CE1 . HIS J 2 10  ? 89.415  -15.272 37.145  1.00 109.49 ? 31  HIS J CE1 1 
ATOM   7085 N NE2 . HIS J 2 10  ? 90.700  -14.927 37.047  1.00 110.86 ? 31  HIS J NE2 1 
ATOM   7086 N N   . TRP J 2 11  ? 91.635  -11.488 41.393  1.00 104.17 ? 32  TRP J N   1 
ATOM   7087 C CA  . TRP J 2 11  ? 92.901  -10.814 41.631  1.00 105.46 ? 32  TRP J CA  1 
ATOM   7088 C C   . TRP J 2 11  ? 93.938  -11.385 40.686  1.00 111.55 ? 32  TRP J C   1 
ATOM   7089 O O   . TRP J 2 11  ? 94.165  -12.600 40.669  1.00 112.38 ? 32  TRP J O   1 
ATOM   7090 C CB  . TRP J 2 11  ? 93.333  -10.962 43.093  1.00 105.66 ? 32  TRP J CB  1 
ATOM   7091 C CG  . TRP J 2 11  ? 92.534  -10.105 44.018  1.00 106.19 ? 32  TRP J CG  1 
ATOM   7092 C CD1 . TRP J 2 11  ? 91.429  -10.472 44.726  1.00 108.89 ? 32  TRP J CD1 1 
ATOM   7093 C CD2 . TRP J 2 11  ? 92.739  -8.713  44.282  1.00 106.30 ? 32  TRP J CD2 1 
ATOM   7094 N NE1 . TRP J 2 11  ? 90.950  -9.402  45.445  1.00 108.67 ? 32  TRP J NE1 1 
ATOM   7095 C CE2 . TRP J 2 11  ? 91.731  -8.304  45.184  1.00 110.26 ? 32  TRP J CE2 1 
ATOM   7096 C CE3 . TRP J 2 11  ? 93.692  -7.769  43.856  1.00 108.06 ? 32  TRP J CE3 1 
ATOM   7097 C CZ2 . TRP J 2 11  ? 91.637  -6.987  45.658  1.00 109.99 ? 32  TRP J CZ2 1 
ATOM   7098 C CZ3 . TRP J 2 11  ? 93.593  -6.462  44.315  1.00 109.82 ? 32  TRP J CZ3 1 
ATOM   7099 C CH2 . TRP J 2 11  ? 92.578  -6.081  45.207  1.00 110.43 ? 32  TRP J CH2 1 
ATOM   7100 N N   . VAL J 2 12  ? 94.522  -10.511 39.859  1.00 108.86 ? 33  VAL J N   1 
ATOM   7101 C CA  . VAL J 2 12  ? 95.535  -10.879 38.879  1.00 110.32 ? 33  VAL J CA  1 
ATOM   7102 C C   . VAL J 2 12  ? 96.907  -10.409 39.374  1.00 118.03 ? 33  VAL J C   1 
ATOM   7103 O O   . VAL J 2 12  ? 97.028  -9.289  39.877  1.00 117.29 ? 33  VAL J O   1 
ATOM   7104 C CB  . VAL J 2 12  ? 95.172  -10.335 37.479  1.00 112.15 ? 33  VAL J CB  1 
ATOM   7105 N N   . CYS J 2 13  ? 97.924  -11.280 39.279  1.00 118.34 ? 34  CYS J N   1 
ATOM   7106 C CA  . CYS J 2 13  ? 99.289  -10.986 39.728  1.00 121.67 ? 34  CYS J CA  1 
ATOM   7107 C C   . CYS J 2 13  ? 100.284 -11.029 38.559  1.00 128.35 ? 34  CYS J C   1 
ATOM   7108 O O   . CYS J 2 13  ? 100.296 -11.988 37.778  1.00 128.85 ? 34  CYS J O   1 
ATOM   7109 C CB  . CYS J 2 13  ? 99.692  -11.945 40.845  1.00 123.64 ? 34  CYS J CB  1 
ATOM   7110 S SG  . CYS J 2 13  ? 99.886  -11.182 42.476  1.00 127.93 ? 34  CYS J SG  1 
HETATM 7111 N N   . NH2 J 2 14  ? 101.147 -10.012 38.469  1.00 126.12 ? 35  NH2 J N   1 
ATOM   7112 N N   . CYS K 2 2   ? 95.197  -43.001 23.881  1.00 98.62  ? 23  CYS K N   1 
ATOM   7113 C CA  . CYS K 2 2   ? 94.288  -42.261 23.002  1.00 95.78  ? 23  CYS K CA  1 
ATOM   7114 C C   . CYS K 2 2   ? 92.851  -42.533 23.300  1.00 94.49  ? 23  CYS K C   1 
ATOM   7115 O O   . CYS K 2 2   ? 92.461  -43.653 23.629  1.00 94.84  ? 23  CYS K O   1 
ATOM   7116 C CB  . CYS K 2 2   ? 94.589  -42.496 21.526  1.00 97.16  ? 23  CYS K CB  1 
ATOM   7117 S SG  . CYS K 2 2   ? 96.272  -42.067 21.050  1.00 105.11 ? 23  CYS K SG  1 
ATOM   7118 N N   . HIS K 2 3   ? 92.046  -41.519 23.100  1.00 85.55  ? 24  HIS K N   1 
ATOM   7119 C CA  . HIS K 2 3   ? 90.629  -41.588 23.348  1.00 81.87  ? 24  HIS K CA  1 
ATOM   7120 C C   . HIS K 2 3   ? 89.908  -40.742 22.310  1.00 80.36  ? 24  HIS K C   1 
ATOM   7121 O O   . HIS K 2 3   ? 90.518  -39.976 21.547  1.00 80.62  ? 24  HIS K O   1 
ATOM   7122 C CB  . HIS K 2 3   ? 90.355  -41.000 24.729  1.00 82.28  ? 24  HIS K CB  1 
ATOM   7123 C CG  . HIS K 2 3   ? 90.690  -39.547 24.777  1.00 85.25  ? 24  HIS K CG  1 
ATOM   7124 N ND1 . HIS K 2 3   ? 91.963  -39.117 25.091  1.00 89.48  ? 24  HIS K ND1 1 
ATOM   7125 C CD2 . HIS K 2 3   ? 89.933  -38.478 24.440  1.00 85.18  ? 24  HIS K CD2 1 
ATOM   7126 C CE1 . HIS K 2 3   ? 91.927  -37.799 25.000  1.00 88.14  ? 24  HIS K CE1 1 
ATOM   7127 N NE2 . HIS K 2 3   ? 90.723  -37.367 24.614  1.00 85.80  ? 24  HIS K NE2 1 
ATOM   7128 N N   . TRP K 2 4   ? 88.597  -40.849 22.330  1.00 70.84  ? 25  TRP K N   1 
ATOM   7129 C CA  . TRP K 2 4   ? 87.737  -40.089 21.467  1.00 66.52  ? 25  TRP K CA  1 
ATOM   7130 C C   . TRP K 2 4   ? 87.225  -38.849 22.247  1.00 62.92  ? 25  TRP K C   1 
ATOM   7131 O O   . TRP K 2 4   ? 86.697  -38.993 23.357  1.00 59.90  ? 25  TRP K O   1 
ATOM   7132 C CB  . TRP K 2 4   ? 86.588  -40.989 21.028  1.00 64.80  ? 25  TRP K CB  1 
ATOM   7133 C CG  . TRP K 2 4   ? 85.525  -40.240 20.302  1.00 64.92  ? 25  TRP K CG  1 
ATOM   7134 C CD1 . TRP K 2 4   ? 84.382  -39.700 20.828  1.00 66.57  ? 25  TRP K CD1 1 
ATOM   7135 C CD2 . TRP K 2 4   ? 85.556  -39.861 18.924  1.00 65.66  ? 25  TRP K CD2 1 
ATOM   7136 N NE1 . TRP K 2 4   ? 83.682  -39.034 19.847  1.00 66.51  ? 25  TRP K NE1 1 
ATOM   7137 C CE2 . TRP K 2 4   ? 84.378  -39.123 18.666  1.00 69.13  ? 25  TRP K CE2 1 
ATOM   7138 C CE3 . TRP K 2 4   ? 86.470  -40.077 17.874  1.00 68.28  ? 25  TRP K CE3 1 
ATOM   7139 C CZ2 . TRP K 2 4   ? 84.083  -38.616 17.399  1.00 69.70  ? 25  TRP K CZ2 1 
ATOM   7140 C CZ3 . TRP K 2 4   ? 86.186  -39.555 16.625  1.00 70.93  ? 25  TRP K CZ3 1 
ATOM   7141 C CH2 . TRP K 2 4   ? 85.004  -38.839 16.395  1.00 71.45  ? 25  TRP K CH2 1 
ATOM   7142 N N   . ASP K 2 5   ? 87.394  -37.634 21.657  1.00 55.78  ? 26  ASP K N   1 
ATOM   7143 C CA  . ASP K 2 5   ? 86.932  -36.379 22.249  1.00 51.37  ? 26  ASP K CA  1 
ATOM   7144 C C   . ASP K 2 5   ? 85.557  -36.060 21.683  1.00 53.16  ? 26  ASP K C   1 
ATOM   7145 O O   . ASP K 2 5   ? 85.407  -35.809 20.480  1.00 52.41  ? 26  ASP K O   1 
ATOM   7146 C CB  . ASP K 2 5   ? 87.913  -35.242 22.000  1.00 52.01  ? 26  ASP K CB  1 
ATOM   7147 C CG  . ASP K 2 5   ? 87.594  -33.965 22.760  1.00 59.02  ? 26  ASP K CG  1 
ATOM   7148 O OD1 . ASP K 2 5   ? 86.395  -33.626 22.894  1.00 58.06  ? 26  ASP K OD1 1 
ATOM   7149 O OD2 . ASP K 2 5   ? 88.537  -33.284 23.184  1.00 65.27  ? 26  ASP K OD2 1 
ATOM   7150 N N   . LEU K 2 6   ? 84.549  -36.073 22.569  1.00 47.99  ? 27  LEU K N   1 
ATOM   7151 C CA  . LEU K 2 6   ? 83.146  -35.847 22.221  1.00 46.72  ? 27  LEU K CA  1 
ATOM   7152 C C   . LEU K 2 6   ? 82.870  -34.458 21.679  1.00 53.02  ? 27  LEU K C   1 
ATOM   7153 O O   . LEU K 2 6   ? 82.022  -34.328 20.789  1.00 55.45  ? 27  LEU K O   1 
ATOM   7154 C CB  . LEU K 2 6   ? 82.226  -36.142 23.415  1.00 45.12  ? 27  LEU K CB  1 
ATOM   7155 C CG  . LEU K 2 6   ? 82.296  -37.551 24.017  1.00 49.58  ? 27  LEU K CG  1 
ATOM   7156 C CD1 . LEU K 2 6   ? 81.632  -37.573 25.397  1.00 48.00  ? 27  LEU K CD1 1 
ATOM   7157 C CD2 . LEU K 2 6   ? 81.712  -38.604 23.048  1.00 52.38  ? 27  LEU K CD2 1 
ATOM   7158 N N   . LEU K 2 7   ? 83.582  -33.423 22.204  1.00 47.28  ? 28  LEU K N   1 
ATOM   7159 C CA  . LEU K 2 7   ? 83.409  -32.038 21.789  1.00 44.52  ? 28  LEU K CA  1 
ATOM   7160 C C   . LEU K 2 7   ? 83.982  -31.766 20.424  1.00 51.25  ? 28  LEU K C   1 
ATOM   7161 O O   . LEU K 2 7   ? 83.251  -31.255 19.572  1.00 50.88  ? 28  LEU K O   1 
ATOM   7162 C CB  . LEU K 2 7   ? 83.953  -31.050 22.825  1.00 42.12  ? 28  LEU K CB  1 
ATOM   7163 C CG  . LEU K 2 7   ? 83.866  -29.538 22.459  1.00 43.62  ? 28  LEU K CG  1 
ATOM   7164 C CD1 . LEU K 2 7   ? 82.463  -29.017 22.526  1.00 43.32  ? 28  LEU K CD1 1 
ATOM   7165 C CD2 . LEU K 2 7   ? 84.706  -28.713 23.343  1.00 40.36  ? 28  LEU K CD2 1 
ATOM   7166 N N   . VAL K 2 8   ? 85.281  -32.073 20.206  1.00 51.50  ? 29  VAL K N   1 
ATOM   7167 C CA  . VAL K 2 8   ? 85.934  -31.809 18.907  1.00 53.57  ? 29  VAL K CA  1 
ATOM   7168 C C   . VAL K 2 8   ? 85.586  -32.826 17.840  1.00 60.61  ? 29  VAL K C   1 
ATOM   7169 O O   . VAL K 2 8   ? 85.753  -32.535 16.665  1.00 61.95  ? 29  VAL K O   1 
ATOM   7170 C CB  . VAL K 2 8   ? 87.454  -31.529 18.990  1.00 57.95  ? 29  VAL K CB  1 
ATOM   7171 C CG1 . VAL K 2 8   ? 87.770  -30.436 20.009  1.00 55.87  ? 29  VAL K CG1 1 
ATOM   7172 C CG2 . VAL K 2 8   ? 88.228  -32.803 19.287  1.00 59.24  ? 29  VAL K CG2 1 
ATOM   7173 N N   . ARG K 2 9   ? 85.076  -33.999 18.250  1.00 59.90  ? 30  ARG K N   1 
ATOM   7174 C CA  . ARG K 2 9   ? 84.706  -35.113 17.371  1.00 62.96  ? 30  ARG K CA  1 
ATOM   7175 C C   . ARG K 2 9   ? 85.897  -35.621 16.554  1.00 75.93  ? 30  ARG K C   1 
ATOM   7176 O O   . ARG K 2 9   ? 85.836  -35.699 15.331  1.00 77.78  ? 30  ARG K O   1 
ATOM   7177 C CB  . ARG K 2 9   ? 83.425  -34.843 16.561  1.00 59.50  ? 30  ARG K CB  1 
ATOM   7178 C CG  . ARG K 2 9   ? 82.181  -34.962 17.422  1.00 68.89  ? 30  ARG K CG  1 
ATOM   7179 C CD  . ARG K 2 9   ? 80.904  -34.525 16.743  1.00 86.64  ? 30  ARG K CD  1 
ATOM   7180 N NE  . ARG K 2 9   ? 79.852  -34.325 17.747  1.00 100.89 ? 30  ARG K NE  1 
ATOM   7181 C CZ  . ARG K 2 9   ? 78.725  -33.643 17.543  1.00 114.56 ? 30  ARG K CZ  1 
ATOM   7182 N NH1 . ARG K 2 9   ? 78.486  -33.075 16.365  1.00 102.31 ? 30  ARG K NH1 1 
ATOM   7183 N NH2 . ARG K 2 9   ? 77.831  -33.521 18.517  1.00 94.26  ? 30  ARG K NH2 1 
ATOM   7184 N N   . HIS K 2 10  ? 86.997  -35.940 17.271  1.00 78.18  ? 31  HIS K N   1 
ATOM   7185 C CA  . HIS K 2 10  ? 88.282  -36.467 16.780  1.00 82.71  ? 31  HIS K CA  1 
ATOM   7186 C C   . HIS K 2 10  ? 88.950  -37.333 17.821  1.00 87.60  ? 31  HIS K C   1 
ATOM   7187 O O   . HIS K 2 10  ? 88.556  -37.307 18.989  1.00 85.76  ? 31  HIS K O   1 
ATOM   7188 C CB  . HIS K 2 10  ? 89.298  -35.331 16.609  1.00 85.06  ? 31  HIS K CB  1 
ATOM   7189 C CG  . HIS K 2 10  ? 89.146  -34.489 15.415  1.00 91.02  ? 31  HIS K CG  1 
ATOM   7190 N ND1 . HIS K 2 10  ? 88.954  -33.128 15.535  1.00 92.73  ? 31  HIS K ND1 1 
ATOM   7191 C CD2 . HIS K 2 10  ? 89.228  -34.812 14.102  1.00 96.55  ? 31  HIS K CD2 1 
ATOM   7192 C CE1 . HIS K 2 10  ? 88.899  -32.658 14.298  1.00 94.56  ? 31  HIS K CE1 1 
ATOM   7193 N NE2 . HIS K 2 10  ? 89.053  -33.638 13.397  1.00 97.31  ? 31  HIS K NE2 1 
ATOM   7194 N N   . TRP K 2 11  ? 90.039  -38.007 17.422  1.00 87.34  ? 32  TRP K N   1 
ATOM   7195 C CA  . TRP K 2 11  ? 90.847  -38.801 18.333  1.00 89.25  ? 32  TRP K CA  1 
ATOM   7196 C C   . TRP K 2 11  ? 91.956  -37.931 18.930  1.00 91.33  ? 32  TRP K C   1 
ATOM   7197 O O   . TRP K 2 11  ? 92.738  -37.336 18.194  1.00 91.61  ? 32  TRP K O   1 
ATOM   7198 C CB  . TRP K 2 11  ? 91.412  -40.037 17.626  1.00 91.48  ? 32  TRP K CB  1 
ATOM   7199 C CG  . TRP K 2 11  ? 90.368  -41.074 17.383  1.00 93.44  ? 32  TRP K CG  1 
ATOM   7200 C CD1 . TRP K 2 11  ? 89.617  -41.235 16.255  1.00 97.50  ? 32  TRP K CD1 1 
ATOM   7201 C CD2 . TRP K 2 11  ? 89.902  -42.050 18.322  1.00 93.19  ? 32  TRP K CD2 1 
ATOM   7202 N NE1 . TRP K 2 11  ? 88.732  -42.280 16.421  1.00 97.72  ? 32  TRP K NE1 1 
ATOM   7203 C CE2 . TRP K 2 11  ? 88.879  -42.791 17.686  1.00 98.07  ? 32  TRP K CE2 1 
ATOM   7204 C CE3 . TRP K 2 11  ? 90.273  -42.395 19.629  1.00 94.58  ? 32  TRP K CE3 1 
ATOM   7205 C CZ2 . TRP K 2 11  ? 88.216  -43.846 18.324  1.00 97.01  ? 32  TRP K CZ2 1 
ATOM   7206 C CZ3 . TRP K 2 11  ? 89.600  -43.420 20.269  1.00 96.02  ? 32  TRP K CZ3 1 
ATOM   7207 C CH2 . TRP K 2 11  ? 88.592  -44.137 19.617  1.00 96.72  ? 32  TRP K CH2 1 
ATOM   7208 N N   . VAL K 2 12  ? 91.973  -37.814 20.259  1.00 86.14  ? 33  VAL K N   1 
ATOM   7209 C CA  . VAL K 2 12  ? 92.953  -37.029 21.000  1.00 86.41  ? 33  VAL K CA  1 
ATOM   7210 C C   . VAL K 2 12  ? 93.864  -37.993 21.764  1.00 94.55  ? 33  VAL K C   1 
ATOM   7211 O O   . VAL K 2 12  ? 93.396  -38.983 22.334  1.00 93.73  ? 33  VAL K O   1 
ATOM   7212 C CB  . VAL K 2 12  ? 92.285  -35.975 21.909  1.00 86.95  ? 33  VAL K CB  1 
ATOM   7213 N N   . CYS K 2 13  ? 95.177  -37.724 21.732  1.00 95.51  ? 34  CYS K N   1 
ATOM   7214 C CA  . CYS K 2 13  ? 96.179  -38.582 22.374  1.00 99.20  ? 34  CYS K CA  1 
ATOM   7215 C C   . CYS K 2 13  ? 96.970  -37.893 23.486  1.00 106.35 ? 34  CYS K C   1 
ATOM   7216 O O   . CYS K 2 13  ? 97.531  -36.826 23.264  1.00 107.97 ? 34  CYS K O   1 
ATOM   7217 C CB  . CYS K 2 13  ? 97.097  -39.201 21.326  1.00 101.83 ? 34  CYS K CB  1 
ATOM   7218 S SG  . CYS K 2 13  ? 96.229  -40.259 20.140  1.00 103.95 ? 34  CYS K SG  1 
HETATM 7219 N N   . NH2 K 2 14  ? 97.025  -38.505 24.678  1.00 103.22 ? 35  NH2 K N   1 
ATOM   7220 N N   . CYS L 2 2   ? 106.588 -10.584 2.969   1.00 109.03 ? 23  CYS L N   1 
ATOM   7221 C CA  . CYS L 2 2   ? 105.398 -9.866  3.435   1.00 103.13 ? 23  CYS L CA  1 
ATOM   7222 C C   . CYS L 2 2   ? 104.285 -9.847  2.408   1.00 102.37 ? 23  CYS L C   1 
ATOM   7223 O O   . CYS L 2 2   ? 104.528 -9.543  1.241   1.00 103.59 ? 23  CYS L O   1 
ATOM   7224 C CB  . CYS L 2 2   ? 105.738 -8.448  3.882   1.00 103.92 ? 23  CYS L CB  1 
ATOM   7225 S SG  . CYS L 2 2   ? 106.956 -8.368  5.210   1.00 112.29 ? 23  CYS L SG  1 
ATOM   7226 N N   . HIS L 2 3   ? 103.050 -10.098 2.856   1.00 93.47  ? 24  HIS L N   1 
ATOM   7227 C CA  . HIS L 2 3   ? 101.844 -10.092 2.023   1.00 89.45  ? 24  HIS L CA  1 
ATOM   7228 C C   . HIS L 2 3   ? 100.716 -9.355  2.763   1.00 85.11  ? 24  HIS L C   1 
ATOM   7229 O O   . HIS L 2 3   ? 100.840 -9.056  3.955   1.00 84.80  ? 24  HIS L O   1 
ATOM   7230 C CB  . HIS L 2 3   ? 101.411 -11.533 1.696   1.00 90.87  ? 24  HIS L CB  1 
ATOM   7231 C CG  . HIS L 2 3   ? 100.842 -12.252 2.881   1.00 93.29  ? 24  HIS L CG  1 
ATOM   7232 N ND1 . HIS L 2 3   ? 101.656 -12.704 3.911   1.00 97.58  ? 24  HIS L ND1 1 
ATOM   7233 C CD2 . HIS L 2 3   ? 99.551  -12.515 3.199   1.00 92.43  ? 24  HIS L CD2 1 
ATOM   7234 C CE1 . HIS L 2 3   ? 100.841 -13.244 4.804   1.00 94.81  ? 24  HIS L CE1 1 
ATOM   7235 N NE2 . HIS L 2 3   ? 99.564  -13.158 4.420   1.00 92.00  ? 24  HIS L NE2 1 
ATOM   7236 N N   . TRP L 2 4   ? 99.626  -9.067  2.053   1.00 75.28  ? 25  TRP L N   1 
ATOM   7237 C CA  . TRP L 2 4   ? 98.457  -8.389  2.594   1.00 70.69  ? 25  TRP L CA  1 
ATOM   7238 C C   . TRP L 2 4   ? 97.432  -9.439  3.086   1.00 68.19  ? 25  TRP L C   1 
ATOM   7239 O O   . TRP L 2 4   ? 97.038  -10.319 2.315   1.00 68.81  ? 25  TRP L O   1 
ATOM   7240 C CB  . TRP L 2 4   ? 97.848  -7.466  1.532   1.00 69.56  ? 25  TRP L CB  1 
ATOM   7241 C CG  . TRP L 2 4   ? 96.546  -6.877  1.950   1.00 69.53  ? 25  TRP L CG  1 
ATOM   7242 C CD1 . TRP L 2 4   ? 95.298  -7.357  1.672   1.00 71.41  ? 25  TRP L CD1 1 
ATOM   7243 C CD2 . TRP L 2 4   ? 96.362  -5.752  2.814   1.00 70.08  ? 25  TRP L CD2 1 
ATOM   7244 N NE1 . TRP L 2 4   ? 94.341  -6.574  2.282   1.00 70.80  ? 25  TRP L NE1 1 
ATOM   7245 C CE2 . TRP L 2 4   ? 94.968  -5.579  2.989   1.00 73.19  ? 25  TRP L CE2 1 
ATOM   7246 C CE3 . TRP L 2 4   ? 97.243  -4.860  3.454   1.00 72.92  ? 25  TRP L CE3 1 
ATOM   7247 C CZ2 . TRP L 2 4   ? 94.438  -4.545  3.769   1.00 73.32  ? 25  TRP L CZ2 1 
ATOM   7248 C CZ3 . TRP L 2 4   ? 96.714  -3.846  4.238   1.00 74.95  ? 25  TRP L CZ3 1 
ATOM   7249 C CH2 . TRP L 2 4   ? 95.329  -3.695  4.390   1.00 74.94  ? 25  TRP L CH2 1 
ATOM   7250 N N   . ASP L 2 5   ? 97.012  -9.348  4.369   1.00 57.64  ? 26  ASP L N   1 
ATOM   7251 C CA  . ASP L 2 5   ? 96.040  -10.261 4.947   1.00 52.52  ? 26  ASP L CA  1 
ATOM   7252 C C   . ASP L 2 5   ? 94.659  -9.652  4.808   1.00 52.25  ? 26  ASP L C   1 
ATOM   7253 O O   . ASP L 2 5   ? 94.365  -8.615  5.413   1.00 51.18  ? 26  ASP L O   1 
ATOM   7254 C CB  . ASP L 2 5   ? 96.375  -10.575 6.412   1.00 52.89  ? 26  ASP L CB  1 
ATOM   7255 C CG  . ASP L 2 5   ? 95.522  -11.682 7.030   1.00 53.22  ? 26  ASP L CG  1 
ATOM   7256 O OD1 . ASP L 2 5   ? 94.307  -11.779 6.689   1.00 46.52  ? 26  ASP L OD1 1 
ATOM   7257 O OD2 . ASP L 2 5   ? 96.056  -12.440 7.853   1.00 61.48  ? 26  ASP L OD2 1 
ATOM   7258 N N   . LEU L 2 6   ? 93.811  -10.306 4.011   1.00 46.95  ? 27  LEU L N   1 
ATOM   7259 C CA  . LEU L 2 6   ? 92.454  -9.834  3.719   1.00 46.27  ? 27  LEU L CA  1 
ATOM   7260 C C   . LEU L 2 6   ? 91.539  -9.817  4.922   1.00 51.36  ? 27  LEU L C   1 
ATOM   7261 O O   . LEU L 2 6   ? 90.660  -8.960  4.989   1.00 54.18  ? 27  LEU L O   1 
ATOM   7262 C CB  . LEU L 2 6   ? 91.803  -10.616 2.552   1.00 46.22  ? 27  LEU L CB  1 
ATOM   7263 C CG  . LEU L 2 6   ? 92.546  -10.561 1.186   1.00 51.47  ? 27  LEU L CG  1 
ATOM   7264 C CD1 . LEU L 2 6   ? 92.077  -11.624 0.233   1.00 51.83  ? 27  LEU L CD1 1 
ATOM   7265 C CD2 . LEU L 2 6   ? 92.427  -9.214  0.535   1.00 53.60  ? 27  LEU L CD2 1 
ATOM   7266 N N   . LEU L 2 7   ? 91.732  -10.747 5.871   1.00 45.44  ? 28  LEU L N   1 
ATOM   7267 C CA  . LEU L 2 7   ? 90.903  -10.855 7.070   1.00 43.03  ? 28  LEU L CA  1 
ATOM   7268 C C   . LEU L 2 7   ? 91.234  -9.794  8.100   1.00 48.43  ? 28  LEU L C   1 
ATOM   7269 O O   . LEU L 2 7   ? 90.323  -9.106  8.554   1.00 48.71  ? 28  LEU L O   1 
ATOM   7270 C CB  . LEU L 2 7   ? 90.984  -12.269 7.674   1.00 41.24  ? 28  LEU L CB  1 
ATOM   7271 C CG  . LEU L 2 7   ? 90.219  -12.522 8.967   1.00 44.84  ? 28  LEU L CG  1 
ATOM   7272 C CD1 . LEU L 2 7   ? 88.719  -12.534 8.752   1.00 46.31  ? 28  LEU L CD1 1 
ATOM   7273 C CD2 . LEU L 2 7   ? 90.615  -13.790 9.545   1.00 43.99  ? 28  LEU L CD2 1 
ATOM   7274 N N   . VAL L 2 8   ? 92.515  -9.668  8.494   1.00 47.17  ? 29  VAL L N   1 
ATOM   7275 C CA  . VAL L 2 8   ? 92.910  -8.680  9.506   1.00 49.24  ? 29  VAL L CA  1 
ATOM   7276 C C   . VAL L 2 8   ? 93.052  -7.267  8.942   1.00 60.35  ? 29  VAL L C   1 
ATOM   7277 O O   . VAL L 2 8   ? 93.028  -6.295  9.713   1.00 62.11  ? 29  VAL L O   1 
ATOM   7278 C CB  . VAL L 2 8   ? 94.120  -9.086  10.371  1.00 51.64  ? 29  VAL L CB  1 
ATOM   7279 C CG1 . VAL L 2 8   ? 93.916  -10.445 11.022  1.00 49.41  ? 29  VAL L CG1 1 
ATOM   7280 C CG2 . VAL L 2 8   ? 95.401  -9.040  9.570   1.00 52.43  ? 29  VAL L CG2 1 
ATOM   7281 N N   . ARG L 2 9   ? 93.162  -7.157  7.599   1.00 59.64  ? 30  ARG L N   1 
ATOM   7282 C CA  . ARG L 2 9   ? 93.331  -5.892  6.879   1.00 62.29  ? 30  ARG L CA  1 
ATOM   7283 C C   . ARG L 2 9   ? 94.599  -5.133  7.324   1.00 72.64  ? 30  ARG L C   1 
ATOM   7284 O O   . ARG L 2 9   ? 94.549  -3.973  7.718   1.00 74.90  ? 30  ARG L O   1 
ATOM   7285 C CB  . ARG L 2 9   ? 92.039  -5.052  6.828   1.00 61.44  ? 30  ARG L CB  1 
ATOM   7286 C CG  . ARG L 2 9   ? 91.040  -5.635  5.836   1.00 66.50  ? 30  ARG L CG  1 
ATOM   7287 C CD  . ARG L 2 9   ? 89.691  -4.973  5.793   1.00 76.20  ? 30  ARG L CD  1 
ATOM   7288 N NE  . ARG L 2 9   ? 88.739  -5.879  5.144   1.00 83.53  ? 30  ARG L NE  1 
ATOM   7289 C CZ  . ARG L 2 9   ? 87.414  -5.792  5.239   1.00 101.30 ? 30  ARG L CZ  1 
ATOM   7290 N NH1 . ARG L 2 9   ? 86.854  -4.812  5.938   1.00 95.71  ? 30  ARG L NH1 1 
ATOM   7291 N NH2 . ARG L 2 9   ? 86.640  -6.682  4.633   1.00 82.27  ? 30  ARG L NH2 1 
ATOM   7292 N N   . HIS L 2 10  ? 95.739  -5.849  7.273   1.00 72.16  ? 31  HIS L N   1 
ATOM   7293 C CA  . HIS L 2 10  ? 97.105  -5.417  7.596   1.00 74.92  ? 31  HIS L CA  1 
ATOM   7294 C C   . HIS L 2 10  ? 98.128  -6.184  6.765   1.00 77.85  ? 31  HIS L C   1 
ATOM   7295 O O   . HIS L 2 10  ? 97.803  -7.208  6.159   1.00 75.89  ? 31  HIS L O   1 
ATOM   7296 C CB  . HIS L 2 10  ? 97.466  -5.844  9.019   1.00 77.01  ? 31  HIS L CB  1 
ATOM   7297 C CG  . HIS L 2 10  ? 96.910  -5.024  10.101  1.00 82.92  ? 31  HIS L CG  1 
ATOM   7298 N ND1 . HIS L 2 10  ? 96.111  -5.589  11.070  1.00 84.58  ? 31  HIS L ND1 1 
ATOM   7299 C CD2 . HIS L 2 10  ? 97.106  -3.717  10.393  1.00 88.35  ? 31  HIS L CD2 1 
ATOM   7300 C CE1 . HIS L 2 10  ? 95.814  -4.612  11.909  1.00 86.70  ? 31  HIS L CE1 1 
ATOM   7301 N NE2 . HIS L 2 10  ? 96.387  -3.461  11.539  1.00 89.42  ? 31  HIS L NE2 1 
ATOM   7302 N N   . TRP L 2 11  ? 99.390  -5.752  6.834   1.00 75.28  ? 32  TRP L N   1 
ATOM   7303 C CA  . TRP L 2 11  ? 100.491 -6.439  6.192   1.00 75.61  ? 32  TRP L CA  1 
ATOM   7304 C C   . TRP L 2 11  ? 101.041 -7.441  7.199   1.00 81.80  ? 32  TRP L C   1 
ATOM   7305 O O   . TRP L 2 11  ? 101.308 -7.092  8.352   1.00 82.35  ? 32  TRP L O   1 
ATOM   7306 C CB  . TRP L 2 11  ? 101.552 -5.434  5.723   1.00 76.57  ? 32  TRP L CB  1 
ATOM   7307 C CG  . TRP L 2 11  ? 101.131 -4.672  4.502   1.00 76.56  ? 32  TRP L CG  1 
ATOM   7308 C CD1 . TRP L 2 11  ? 100.540 -3.439  4.464   1.00 79.41  ? 32  TRP L CD1 1 
ATOM   7309 C CD2 . TRP L 2 11  ? 101.202 -5.127  3.142   1.00 75.91  ? 32  TRP L CD2 1 
ATOM   7310 N NE1 . TRP L 2 11  ? 100.253 -3.090  3.160   1.00 78.40  ? 32  TRP L NE1 1 
ATOM   7311 C CE2 . TRP L 2 11  ? 100.650 -4.111  2.329   1.00 79.52  ? 32  TRP L CE2 1 
ATOM   7312 C CE3 . TRP L 2 11  ? 101.681 -6.294  2.529   1.00 77.22  ? 32  TRP L CE3 1 
ATOM   7313 C CZ2 . TRP L 2 11  ? 100.556 -4.238  0.937   1.00 78.59  ? 32  TRP L CZ2 1 
ATOM   7314 C CZ3 . TRP L 2 11  ? 101.575 -6.424  1.154   1.00 78.63  ? 32  TRP L CZ3 1 
ATOM   7315 C CH2 . TRP L 2 11  ? 101.020 -5.406  0.374   1.00 78.72  ? 32  TRP L CH2 1 
ATOM   7316 N N   . VAL L 2 12  ? 101.115 -8.705  6.796   1.00 80.19  ? 33  VAL L N   1 
ATOM   7317 C CA  . VAL L 2 12  ? 101.628 -9.783  7.649   1.00 82.20  ? 33  VAL L CA  1 
ATOM   7318 C C   . VAL L 2 12  ? 102.997 -10.189 7.098   1.00 93.50  ? 33  VAL L C   1 
ATOM   7319 O O   . VAL L 2 12  ? 103.133 -10.355 5.875   1.00 93.26  ? 33  VAL L O   1 
ATOM   7320 C CB  . VAL L 2 12  ? 100.639 -10.977 7.733   1.00 82.60  ? 33  VAL L CB  1 
ATOM   7321 N N   . CYS L 2 13  ? 104.017 -10.290 7.984   1.00 95.86  ? 34  CYS L N   1 
ATOM   7322 C CA  . CYS L 2 13  ? 105.390 -10.627 7.583   1.00 101.97 ? 34  CYS L CA  1 
ATOM   7323 C C   . CYS L 2 13  ? 105.906 -11.940 8.159   1.00 109.12 ? 34  CYS L C   1 
ATOM   7324 O O   . CYS L 2 13  ? 106.889 -12.498 7.646   1.00 113.29 ? 34  CYS L O   1 
ATOM   7325 C CB  . CYS L 2 13  ? 106.323 -9.465  7.894   1.00 105.91 ? 34  CYS L CB  1 
ATOM   7326 S SG  . CYS L 2 13  ? 105.962 -7.974  6.936   1.00 108.13 ? 34  CYS L SG  1 
HETATM 7327 N N   . NH2 L 2 14  ? 105.347 -12.355 9.302   1.00 104.07 ? 35  NH2 L N   1 
ATOM   7328 N N   . CYS M 2 2   ? 86.507  -38.985 31.564  1.00 94.31  ? 23  CYS Z N   1 
ATOM   7329 C CA  . CYS M 2 2   ? 86.658  -40.058 30.573  1.00 92.95  ? 23  CYS Z CA  1 
ATOM   7330 C C   . CYS M 2 2   ? 86.091  -41.412 31.016  1.00 96.69  ? 23  CYS Z C   1 
ATOM   7331 O O   . CYS M 2 2   ? 86.418  -41.929 32.093  1.00 96.39  ? 23  CYS Z O   1 
ATOM   7332 C CB  . CYS M 2 2   ? 88.093  -40.175 30.077  1.00 93.42  ? 23  CYS Z CB  1 
ATOM   7333 S SG  . CYS M 2 2   ? 88.743  -38.637 29.373  1.00 97.84  ? 23  CYS Z SG  1 
ATOM   7334 N N   . HIS M 2 3   ? 85.222  -41.957 30.148  1.00 92.22  ? 24  HIS Z N   1 
ATOM   7335 C CA  . HIS M 2 3   ? 84.440  -43.172 30.342  1.00 91.55  ? 24  HIS Z CA  1 
ATOM   7336 C C   . HIS M 2 3   ? 84.514  -44.156 29.155  1.00 92.01  ? 24  HIS Z C   1 
ATOM   7337 O O   . HIS M 2 3   ? 84.818  -43.755 28.023  1.00 90.40  ? 24  HIS Z O   1 
ATOM   7338 C CB  . HIS M 2 3   ? 82.965  -42.774 30.590  1.00 92.97  ? 24  HIS Z CB  1 
ATOM   7339 N N   . TRP M 2 4   ? 84.224  -45.452 29.433  1.00 86.29  ? 25  TRP Z N   1 
ATOM   7340 C CA  . TRP M 2 4   ? 84.182  -46.500 28.424  1.00 83.88  ? 25  TRP Z CA  1 
ATOM   7341 C C   . TRP M 2 4   ? 82.775  -46.524 27.795  1.00 89.98  ? 25  TRP Z C   1 
ATOM   7342 O O   . TRP M 2 4   ? 81.778  -46.667 28.510  1.00 91.00  ? 25  TRP Z O   1 
ATOM   7343 C CB  . TRP M 2 4   ? 84.532  -47.866 29.036  1.00 81.32  ? 25  TRP Z CB  1 
ATOM   7344 C CG  . TRP M 2 4   ? 84.336  -49.004 28.080  1.00 81.03  ? 25  TRP Z CG  1 
ATOM   7345 C CD1 . TRP M 2 4   ? 83.241  -49.807 27.971  1.00 84.10  ? 25  TRP Z CD1 1 
ATOM   7346 C CD2 . TRP M 2 4   ? 85.219  -49.383 27.023  1.00 80.12  ? 25  TRP Z CD2 1 
ATOM   7347 N NE1 . TRP M 2 4   ? 83.401  -50.686 26.925  1.00 83.09  ? 25  TRP Z NE1 1 
ATOM   7348 C CE2 . TRP M 2 4   ? 84.609  -50.453 26.327  1.00 83.74  ? 25  TRP Z CE2 1 
ATOM   7349 C CE3 . TRP M 2 4   ? 86.477  -48.930 26.599  1.00 80.66  ? 25  TRP Z CE3 1 
ATOM   7350 C CZ2 . TRP M 2 4   ? 85.215  -51.080 25.238  1.00 82.58  ? 25  TRP Z CZ2 1 
ATOM   7351 C CZ3 . TRP M 2 4   ? 87.075  -49.561 25.527  1.00 81.61  ? 25  TRP Z CZ3 1 
ATOM   7352 C CH2 . TRP M 2 4   ? 86.448  -50.620 24.859  1.00 82.36  ? 25  TRP Z CH2 1 
ATOM   7353 N N   . ASP M 2 5   ? 82.697  -46.386 26.463  1.00 87.26  ? 26  ASP Z N   1 
ATOM   7354 C CA  . ASP M 2 5   ? 81.429  -46.425 25.743  1.00 88.39  ? 26  ASP Z CA  1 
ATOM   7355 C C   . ASP M 2 5   ? 81.198  -47.844 25.251  1.00 95.45  ? 26  ASP Z C   1 
ATOM   7356 O O   . ASP M 2 5   ? 81.948  -48.339 24.403  1.00 94.45  ? 26  ASP Z O   1 
ATOM   7357 C CB  . ASP M 2 5   ? 81.416  -45.415 24.580  1.00 89.93  ? 26  ASP Z CB  1 
ATOM   7358 C CG  . ASP M 2 5   ? 80.051  -45.238 23.923  1.00 98.94  ? 26  ASP Z CG  1 
ATOM   7359 O OD1 . ASP M 2 5   ? 79.331  -46.242 23.759  1.00 101.38 ? 26  ASP Z OD1 1 
ATOM   7360 O OD2 . ASP M 2 5   ? 79.710  -44.100 23.564  1.00 101.54 ? 26  ASP Z OD2 1 
ATOM   7361 N N   . LEU M 2 6   ? 80.156  -48.499 25.793  1.00 94.96  ? 27  LEU Z N   1 
ATOM   7362 C CA  . LEU M 2 6   ? 79.809  -49.884 25.459  1.00 96.28  ? 27  LEU Z CA  1 
ATOM   7363 C C   . LEU M 2 6   ? 79.399  -50.076 24.001  1.00 101.65 ? 27  LEU Z C   1 
ATOM   7364 O O   . LEU M 2 6   ? 79.681  -51.139 23.442  1.00 102.51 ? 27  LEU Z O   1 
ATOM   7365 C CB  . LEU M 2 6   ? 78.726  -50.427 26.399  1.00 97.62  ? 27  LEU Z CB  1 
ATOM   7366 N N   . LEU M 2 7   ? 78.749  -49.057 23.391  1.00 97.45  ? 28  LEU Z N   1 
ATOM   7367 C CA  . LEU M 2 7   ? 78.286  -49.119 22.011  1.00 98.64  ? 28  LEU Z CA  1 
ATOM   7368 C C   . LEU M 2 7   ? 79.420  -49.002 21.003  1.00 100.79 ? 28  LEU Z C   1 
ATOM   7369 O O   . LEU M 2 7   ? 79.550  -49.891 20.162  1.00 101.94 ? 28  LEU Z O   1 
ATOM   7370 C CB  . LEU M 2 7   ? 77.187  -48.084 21.738  1.00 100.02 ? 28  LEU Z CB  1 
ATOM   7371 N N   . VAL M 2 8   ? 80.240  -47.924 21.077  1.00 94.78  ? 29  VAL Z N   1 
ATOM   7372 C CA  . VAL M 2 8   ? 81.361  -47.717 20.142  1.00 93.36  ? 29  VAL Z CA  1 
ATOM   7373 C C   . VAL M 2 8   ? 82.579  -48.586 20.466  1.00 96.98  ? 29  VAL Z C   1 
ATOM   7374 O O   . VAL M 2 8   ? 83.433  -48.780 19.592  1.00 97.82  ? 29  VAL Z O   1 
ATOM   7375 C CB  . VAL M 2 8   ? 81.752  -46.237 19.941  1.00 94.96  ? 29  VAL Z CB  1 
ATOM   7376 N N   . ARG M 2 9   ? 82.638  -49.136 21.707  1.00 90.91  ? 30  ARG Z N   1 
ATOM   7377 C CA  . ARG M 2 9   ? 83.734  -49.967 22.208  1.00 89.24  ? 30  ARG Z CA  1 
ATOM   7378 C C   . ARG M 2 9   ? 85.089  -49.231 22.147  1.00 90.66  ? 30  ARG Z C   1 
ATOM   7379 O O   . ARG M 2 9   ? 86.062  -49.724 21.568  1.00 88.78  ? 30  ARG Z O   1 
ATOM   7380 C CB  . ARG M 2 9   ? 83.753  -51.373 21.582  1.00 89.68  ? 30  ARG Z CB  1 
ATOM   7381 N N   . HIS M 2 10  ? 85.110  -48.012 22.745  1.00 86.72  ? 31  HIS Z N   1 
ATOM   7382 C CA  . HIS M 2 10  ? 86.242  -47.088 22.883  1.00 85.76  ? 31  HIS Z CA  1 
ATOM   7383 C C   . HIS M 2 10  ? 86.123  -46.234 24.119  1.00 87.27  ? 31  HIS Z C   1 
ATOM   7384 O O   . HIS M 2 10  ? 85.060  -46.192 24.731  1.00 86.90  ? 31  HIS Z O   1 
ATOM   7385 C CB  . HIS M 2 10  ? 86.269  -46.113 21.714  1.00 87.10  ? 31  HIS Z CB  1 
ATOM   7386 C CG  . HIS M 2 10  ? 86.836  -46.675 20.464  1.00 91.79  ? 31  HIS Z CG  1 
ATOM   7387 N ND1 . HIS M 2 10  ? 88.107  -47.251 20.429  1.00 94.04  ? 31  HIS Z ND1 1 
ATOM   7388 C CD2 . HIS M 2 10  ? 86.321  -46.682 19.216  1.00 95.01  ? 31  HIS Z CD2 1 
ATOM   7389 C CE1 . HIS M 2 10  ? 88.307  -47.603 19.169  1.00 94.71  ? 31  HIS Z CE1 1 
ATOM   7390 N NE2 . HIS M 2 10  ? 87.265  -47.274 18.399  1.00 95.69  ? 31  HIS Z NE2 1 
ATOM   7391 N N   . TRP M 2 11  ? 87.194  -45.495 24.446  1.00 83.27  ? 32  TRP Z N   1 
ATOM   7392 C CA  . TRP M 2 11  ? 87.209  -44.557 25.563  1.00 83.70  ? 32  TRP Z CA  1 
ATOM   7393 C C   . TRP M 2 11  ? 86.788  -43.178 25.066  1.00 88.16  ? 32  TRP Z C   1 
ATOM   7394 O O   . TRP M 2 11  ? 87.391  -42.637 24.140  1.00 87.17  ? 32  TRP Z O   1 
ATOM   7395 C CB  . TRP M 2 11  ? 88.585  -44.517 26.234  1.00 83.37  ? 32  TRP Z CB  1 
ATOM   7396 C CG  . TRP M 2 11  ? 88.873  -45.743 27.057  1.00 84.60  ? 32  TRP Z CG  1 
ATOM   7397 C CD1 . TRP M 2 11  ? 89.550  -46.860 26.665  1.00 87.26  ? 32  TRP Z CD1 1 
ATOM   7398 C CD2 . TRP M 2 11  ? 88.436  -45.990 28.394  1.00 85.07  ? 32  TRP Z CD2 1 
ATOM   7399 N NE1 . TRP M 2 11  ? 89.571  -47.787 27.679  1.00 86.55  ? 32  TRP Z NE1 1 
ATOM   7400 C CE2 . TRP M 2 11  ? 88.892  -47.281 28.755  1.00 88.52  ? 32  TRP Z CE2 1 
ATOM   7401 C CE3 . TRP M 2 11  ? 87.713  -45.236 29.338  1.00 87.22  ? 32  TRP Z CE3 1 
ATOM   7402 C CZ2 . TRP M 2 11  ? 88.650  -47.836 30.018  1.00 88.14  ? 32  TRP Z CZ2 1 
ATOM   7403 C CZ3 . TRP M 2 11  ? 87.447  -45.801 30.580  1.00 89.23  ? 32  TRP Z CZ3 1 
ATOM   7404 C CH2 . TRP M 2 11  ? 87.923  -47.079 30.914  1.00 89.43  ? 32  TRP Z CH2 1 
ATOM   7405 N N   . VAL M 2 12  ? 85.708  -42.648 25.646  1.00 85.92  ? 33  VAL Z N   1 
ATOM   7406 C CA  . VAL M 2 12  ? 85.086  -41.371 25.305  1.00 85.33  ? 33  VAL Z CA  1 
ATOM   7407 C C   . VAL M 2 12  ? 85.391  -40.330 26.376  1.00 89.52  ? 33  VAL Z C   1 
ATOM   7408 O O   . VAL M 2 12  ? 85.327  -40.645 27.559  1.00 89.01  ? 33  VAL Z O   1 
ATOM   7409 C CB  . VAL M 2 12  ? 83.579  -41.662 25.122  1.00 89.44  ? 33  VAL Z CB  1 
ATOM   7410 C CG1 . VAL M 2 12  ? 82.654  -40.841 26.006  1.00 90.00  ? 33  VAL Z CG1 1 
ATOM   7411 C CG2 . VAL M 2 12  ? 83.176  -41.678 23.662  1.00 89.20  ? 33  VAL Z CG2 1 
ATOM   7412 N N   . CYS M 2 13  ? 85.724  -39.101 25.971  1.00 87.53  ? 34  CYS Z N   1 
ATOM   7413 C CA  . CYS M 2 13  ? 86.041  -38.015 26.905  1.00 89.01  ? 34  CYS Z CA  1 
ATOM   7414 C C   . CYS M 2 13  ? 85.128  -36.807 26.734  1.00 92.45  ? 34  CYS Z C   1 
ATOM   7415 O O   . CYS M 2 13  ? 85.054  -36.258 25.639  1.00 91.03  ? 34  CYS Z O   1 
ATOM   7416 C CB  . CYS M 2 13  ? 87.509  -37.616 26.801  1.00 90.42  ? 34  CYS Z CB  1 
ATOM   7417 S SG  . CYS M 2 13  ? 88.655  -38.896 27.357  1.00 95.39  ? 34  CYS Z SG  1 
HETATM 7418 N N   . NH2 M 2 14  ? 84.717  -36.209 27.854  1.00 90.38  ? 35  NH2 Z N   1 
HETATM 7419 S S   . SO4 N 3 .   ? 90.170  21.388  -21.167 1.00 108.57 ? 499 SO4 A S   1 
HETATM 7420 O O1  . SO4 N 3 .   ? 91.649  21.388  -21.294 1.00 108.48 ? 499 SO4 A O1  1 
HETATM 7421 O O2  . SO4 N 3 .   ? 89.549  20.437  -22.104 1.00 105.78 ? 499 SO4 A O2  1 
HETATM 7422 O O3  . SO4 N 3 .   ? 89.809  21.002  -19.811 1.00 106.77 ? 499 SO4 A O3  1 
HETATM 7423 O O4  . SO4 N 3 .   ? 89.637  22.726  -21.438 1.00 109.98 ? 499 SO4 A O4  1 
HETATM 7424 S S   . SO4 O 3 .   ? 90.866  -17.804 21.483  1.00 129.24 ? 499 SO4 D S   1 
HETATM 7425 O O1  . SO4 O 3 .   ? 91.505  -17.396 20.224  1.00 128.19 ? 499 SO4 D O1  1 
HETATM 7426 O O2  . SO4 O 3 .   ? 89.459  -17.439 21.430  1.00 125.24 ? 499 SO4 D O2  1 
HETATM 7427 O O3  . SO4 O 3 .   ? 90.997  -19.255 21.683  1.00 129.88 ? 499 SO4 D O3  1 
HETATM 7428 O O4  . SO4 O 3 .   ? 91.519  -17.118 22.598  1.00 131.85 ? 499 SO4 D O4  1 
HETATM 7429 O O   . HOH P 4 .   ? 72.594  16.666  -18.074 1.00 34.75  ? 500 HOH A O   1 
HETATM 7430 O O   . HOH P 4 .   ? 82.455  16.011  -17.028 1.00 53.88  ? 501 HOH A O   1 
HETATM 7431 O O   . HOH P 4 .   ? 71.525  29.115  -12.771 1.00 41.73  ? 502 HOH A O   1 
HETATM 7432 O O   . HOH Q 4 .   ? 80.662  18.325  -23.860 1.00 39.95  ? 501 HOH B O   1 
HETATM 7433 O O   . HOH Q 4 .   ? 77.911  6.843   -10.602 1.00 18.60  ? 502 HOH B O   1 
HETATM 7434 O O   . HOH Q 4 .   ? 83.535  -0.124  -10.774 1.00 34.98  ? 503 HOH B O   1 
HETATM 7435 O O   . HOH Q 4 .   ? 83.425  -1.894  -9.029  1.00 31.71  ? 504 HOH B O   1 
HETATM 7436 O O   . HOH R 4 .   ? 80.369  22.843  -18.134 1.00 53.64  ? 501 HOH C O   1 
HETATM 7437 O O   . HOH R 4 .   ? 71.796  15.255  -31.872 1.00 44.46  ? 502 HOH C O   1 
HETATM 7438 O O   . HOH S 4 .   ? 72.922  -13.994 18.128  1.00 37.50  ? 500 HOH D O   1 
HETATM 7439 O O   . HOH S 4 .   ? 81.181  -15.040 24.003  1.00 39.09  ? 501 HOH D O   1 
HETATM 7440 O O   . HOH S 4 .   ? 78.109  -3.781  10.705  1.00 28.90  ? 502 HOH D O   1 
HETATM 7441 O O   . HOH T 4 .   ? 81.151  -19.517 18.322  1.00 33.20  ? 501 HOH E O   1 
HETATM 7442 O O   . HOH T 4 .   ? 72.077  -12.186 31.985  1.00 55.77  ? 502 HOH E O   1 
HETATM 7443 O O   . HOH U 4 .   ? 82.897  -12.730 17.244  1.00 39.24  ? 501 HOH F O   1 
HETATM 7444 O O   . HOH U 4 .   ? 72.443  -26.249 13.006  1.00 38.53  ? 502 HOH F O   1 
HETATM 7445 O O   . HOH U 4 .   ? 82.218  -2.442  -6.929  1.00 41.45  ? 505 HOH F O   1 
HETATM 7446 O O   . HOH U 4 .   ? 81.916  1.894   -7.899  1.00 40.27  ? 506 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 65  ? 0.6719 0.9807 1.0116 0.0065  0.0775  0.1228  142 VAL A N   
2    C CA  . VAL A 65  ? 0.6818 0.9443 0.9734 0.0074  0.0868  0.1220  142 VAL A CA  
3    C C   . VAL A 65  ? 0.7253 0.9516 0.9697 0.0144  0.0706  0.1102  142 VAL A C   
4    O O   . VAL A 65  ? 0.7388 0.9693 0.9886 0.0081  0.0502  0.1015  142 VAL A O   
5    C CB  . VAL A 65  ? 0.7272 0.9778 1.0269 -0.0152 0.0908  0.1240  142 VAL A CB  
6    C CG1 . VAL A 65  ? 0.7306 0.9418 0.9864 -0.0090 0.1070  0.1276  142 VAL A CG1 
7    C CG2 . VAL A 65  ? 0.7278 1.0190 1.0841 -0.0278 0.1013  0.1347  142 VAL A CG2 
8    N N   . THR A 66  ? 0.6428 0.8335 0.8411 0.0275  0.0797  0.1103  143 THR A N   
9    C CA  . THR A 66  ? 0.6135 0.7698 0.7686 0.0337  0.0666  0.1009  143 THR A CA  
10   C C   . THR A 66  ? 0.6297 0.7483 0.7522 0.0242  0.0654  0.0968  143 THR A C   
11   O O   . THR A 66  ? 0.6332 0.7455 0.7565 0.0181  0.0782  0.1021  143 THR A O   
12   C CB  . THR A 66  ? 0.6752 0.8204 0.8031 0.0582  0.0729  0.1025  143 THR A CB  
13   O OG1 . THR A 66  ? 0.6835 0.8070 0.7853 0.0677  0.0909  0.1080  143 THR A OG1 
14   C CG2 . THR A 66  ? 0.6481 0.8305 0.8061 0.0713  0.0743  0.1069  143 THR A CG2 
15   N N   . GLN A 67  ? 0.5378 0.6314 0.6310 0.0243  0.0505  0.0879  144 GLN A N   
16   C CA  . GLN A 67  ? 0.5063 0.5656 0.5678 0.0176  0.0469  0.0832  144 GLN A CA  
17   C C   . GLN A 67  ? 0.5572 0.5870 0.5791 0.0330  0.0526  0.0834  144 GLN A C   
18   O O   . GLN A 67  ? 0.5531 0.5719 0.5570 0.0415  0.0440  0.0794  144 GLN A O   
19   C CB  . GLN A 67  ? 0.4935 0.5467 0.5505 0.0080  0.0281  0.0743  144 GLN A CB  
20   C CG  . GLN A 67  ? 0.6224 0.6888 0.7048 -0.0095 0.0216  0.0719  144 GLN A CG  
21   C CD  . GLN A 67  ? 0.8618 0.9255 0.9393 -0.0146 0.0036  0.0635  144 GLN A CD  
22   O OE1 . GLN A 67  ? 0.7145 0.7947 0.8026 -0.0101 -0.0056 0.0615  144 GLN A OE1 
23   N NE2 . GLN A 67  ? 0.9135 0.9555 0.9721 -0.0222 -0.0014 0.0587  144 GLN A NE2 
24   N N   . ASP A 68  ? 0.5157 0.5311 0.5229 0.0371  0.0669  0.0884  145 ASP A N   
25   C CA  . ASP A 68  ? 0.5255 0.5093 0.4920 0.0516  0.0710  0.0877  145 ASP A CA  
26   C C   . ASP A 68  ? 0.5679 0.5238 0.5080 0.0455  0.0555  0.0792  145 ASP A C   
27   O O   . ASP A 68  ? 0.5369 0.4925 0.4842 0.0309  0.0482  0.0760  145 ASP A O   
28   C CB  . ASP A 68  ? 0.5678 0.5398 0.5213 0.0563  0.0882  0.0944  145 ASP A CB  
29   C CG  . ASP A 68  ? 0.7233 0.7203 0.6981 0.0658  0.1074  0.1047  145 ASP A CG  
30   O OD1 . ASP A 68  ? 0.7567 0.7840 0.7608 0.0686  0.1066  0.1065  145 ASP A OD1 
31   O OD2 . ASP A 68  ? 0.6931 0.6791 0.6534 0.0726  0.1237  0.1114  145 ASP A OD2 
32   N N   . CYS A 69  ? 0.5573 0.4907 0.4684 0.0567  0.0504  0.0759  146 CYS A N   
33   C CA  . CYS A 69  ? 0.5656 0.4741 0.4541 0.0509  0.0363  0.0690  146 CYS A CA  
34   C C   . CYS A 69  ? 0.6424 0.5189 0.4940 0.0642  0.0348  0.0669  146 CYS A C   
35   O O   . CYS A 69  ? 0.6599 0.5337 0.5022 0.0800  0.0422  0.0695  146 CYS A O   
36   C CB  . CYS A 69  ? 0.5624 0.4828 0.4656 0.0421  0.0230  0.0652  146 CYS A CB  
37   S SG  . CYS A 69  ? 0.6196 0.5641 0.5414 0.0523  0.0229  0.0677  146 CYS A SG  
38   N N   . LEU A 70  ? 0.5965 0.4485 0.4271 0.0583  0.0251  0.0620  147 LEU A N   
39   C CA  . LEU A 70  ? 0.6126 0.4310 0.4079 0.0678  0.0197  0.0585  147 LEU A CA  
40   C C   . LEU A 70  ? 0.6295 0.4365 0.4209 0.0556  0.0038  0.0533  147 LEU A C   
41   O O   . LEU A 70  ? 0.6071 0.4224 0.4107 0.0425  -0.0005 0.0520  147 LEU A O   
42   C CB  . LEU A 70  ? 0.6366 0.4343 0.4073 0.0745  0.0260  0.0587  147 LEU A CB  
43   C CG  . LEU A 70  ? 0.7410 0.5008 0.4716 0.0861  0.0195  0.0541  147 LEU A CG  
44   C CD1 . LEU A 70  ? 0.7736 0.5205 0.4808 0.1041  0.0334  0.0573  147 LEU A CD1 
45   C CD2 . LEU A 70  ? 0.7789 0.5189 0.4962 0.0754  0.0046  0.0482  147 LEU A CD2 
46   N N   . GLN A 71  ? 0.5730 0.3615 0.3482 0.0603  -0.0041 0.0510  148 GLN A N   
47   C CA  . GLN A 71  ? 0.5646 0.3410 0.3360 0.0488  -0.0180 0.0476  148 GLN A CA  
48   C C   . GLN A 71  ? 0.6519 0.3906 0.3903 0.0547  -0.0261 0.0436  148 GLN A C   
49   O O   . GLN A 71  ? 0.6581 0.3793 0.3759 0.0697  -0.0228 0.0435  148 GLN A O   
50   C CB  . GLN A 71  ? 0.5658 0.3563 0.3529 0.0450  -0.0216 0.0494  148 GLN A CB  
51   C CG  . GLN A 71  ? 0.5955 0.3766 0.3816 0.0322  -0.0334 0.0479  148 GLN A CG  
52   C CD  . GLN A 71  ? 0.6150 0.4110 0.4149 0.0299  -0.0348 0.0508  148 GLN A CD  
53   O OE1 . GLN A 71  ? 0.4298 0.2505 0.2510 0.0223  -0.0338 0.0517  148 GLN A OE1 
54   N NE2 . GLN A 71  ? 0.5337 0.3125 0.3189 0.0379  -0.0375 0.0520  148 GLN A NE2 
55   N N   . LEU A 72  ? 0.6193 0.3460 0.3532 0.0430  -0.0374 0.0402  149 LEU A N   
56   C CA  . LEU A 72  ? 0.6568 0.3482 0.3633 0.0439  -0.0494 0.0355  149 LEU A CA  
57   C C   . LEU A 72  ? 0.6822 0.3700 0.3976 0.0297  -0.0610 0.0355  149 LEU A C   
58   O O   . LEU A 72  ? 0.6672 0.3792 0.4078 0.0173  -0.0613 0.0379  149 LEU A O   
59   C CB  . LEU A 72  ? 0.6689 0.3502 0.3641 0.0420  -0.0540 0.0317  149 LEU A CB  
60   C CG  . LEU A 72  ? 0.7172 0.3988 0.4004 0.0552  -0.0419 0.0327  149 LEU A CG  
61   C CD1 . LEU A 72  ? 0.6958 0.3724 0.3731 0.0507  -0.0475 0.0301  149 LEU A CD1 
62   C CD2 . LEU A 72  ? 0.8081 0.4614 0.4577 0.0742  -0.0381 0.0312  149 LEU A CD2 
63   N N   . ILE A 73  ? 0.6438 0.2999 0.3375 0.0320  -0.0700 0.0332  150 ILE A N   
64   C CA  . ILE A 73  ? 0.6366 0.2841 0.3364 0.0179  -0.0808 0.0343  150 ILE A CA  
65   C C   . ILE A 73  ? 0.7390 0.3519 0.4174 0.0134  -0.0961 0.0285  150 ILE A C   
66   O O   . ILE A 73  ? 0.7798 0.3657 0.4289 0.0264  -0.0983 0.0235  150 ILE A O   
67   C CB  . ILE A 73  ? 0.6642 0.3070 0.3622 0.0224  -0.0779 0.0386  150 ILE A CB  
68   C CG1 . ILE A 73  ? 0.6933 0.3045 0.3592 0.0410  -0.0769 0.0360  150 ILE A CG1 
69   C CG2 . ILE A 73  ? 0.6187 0.2995 0.3427 0.0230  -0.0667 0.0439  150 ILE A CG2 
70   C CD1 . ILE A 73  ? 0.6252 0.2230 0.2841 0.0453  -0.0774 0.0397  150 ILE A CD1 
71   N N   . ALA A 74  ? 0.6790 0.2942 0.3728 -0.0045 -0.1067 0.0293  151 ALA A N   
72   C CA  . ALA A 74  ? 0.7185 0.3054 0.3989 -0.0123 -0.1238 0.0238  151 ALA A CA  
73   C C   . ALA A 74  ? 0.8812 0.4217 0.5272 -0.0044 -0.1321 0.0198  151 ALA A C   
74   O O   . ALA A 74  ? 0.9062 0.4367 0.5478 -0.0020 -0.1283 0.0239  151 ALA A O   
75   C CB  . ALA A 74  ? 0.7090 0.3115 0.4183 -0.0337 -0.1315 0.0276  151 ALA A CB  
76   N N   . ASP A 75  ? 0.8862 0.3963 0.5047 0.0013  -0.1437 0.0116  152 ASP A N   
77   C CA  . ASP A 75  ? 0.9629 0.4239 0.5442 0.0095  -0.1538 0.0060  152 ASP A CA  
78   C C   . ASP A 75  ? 1.0677 0.5072 0.6544 -0.0113 -0.1738 0.0042  152 ASP A C   
79   O O   . ASP A 75  ? 1.0854 0.5150 0.6690 -0.0188 -0.1897 -0.0022 152 ASP A O   
80   C CB  . ASP A 75  ? 1.0266 0.4620 0.5698 0.0291  -0.1555 -0.0023 152 ASP A CB  
81   C CG  . ASP A 75  ? 1.2226 0.6021 0.7214 0.0393  -0.1681 -0.0101 152 ASP A CG  
82   O OD1 . ASP A 75  ? 1.2376 0.5957 0.7325 0.0342  -0.1727 -0.0082 152 ASP A OD1 
83   O OD2 . ASP A 75  ? 1.3642 0.7188 0.8294 0.0534  -0.1733 -0.0179 152 ASP A OD2 
84   N N   . SER A 76  ? 1.0347 0.4668 0.6299 -0.0206 -0.1734 0.0104  153 SER A N   
85   C CA  . SER A 76  ? 1.0613 0.4733 0.6650 -0.0422 -0.1901 0.0112  153 SER A CA  
86   C C   . SER A 76  ? 1.1530 0.5100 0.7200 -0.0408 -0.2114 0.0004  153 SER A C   
87   O O   . SER A 76  ? 1.1673 0.5110 0.7454 -0.0612 -0.2289 -0.0008 153 SER A O   
88   C CB  . SER A 76  ? 1.1313 0.5424 0.7457 -0.0493 -0.1826 0.0211  153 SER A CB  
89   O OG  . SER A 76  ? 1.3665 0.7379 0.9436 -0.0321 -0.1810 0.0190  153 SER A OG  
90   N N   . GLU A 77  ? 1.1246 0.4509 0.6489 -0.0171 -0.2104 -0.0075 154 GLU A N   
91   C CA  . GLU A 77  ? 1.1765 0.4467 0.6596 -0.0126 -0.2310 -0.0191 154 GLU A CA  
92   C C   . GLU A 77  ? 1.2338 0.5025 0.7066 -0.0104 -0.2441 -0.0288 154 GLU A C   
93   O O   . GLU A 77  ? 1.2843 0.5055 0.7185 -0.0043 -0.2624 -0.0399 154 GLU A O   
94   C CB  . GLU A 77  ? 1.2347 0.4662 0.6708 0.0144  -0.2236 -0.0228 154 GLU A CB  
95   C CG  . GLU A 77  ? 1.4140 0.6362 0.8499 0.0167  -0.2137 -0.0148 154 GLU A CG  
96   C CD  . GLU A 77  ? 1.7425 0.9406 1.1367 0.0488  -0.2022 -0.0181 154 GLU A CD  
97   O OE1 . GLU A 77  ? 1.2816 0.4237 0.6299 0.0604  -0.2148 -0.0274 154 GLU A OE1 
98   O OE2 . GLU A 77  ? 1.7867 1.0234 1.1939 0.0630  -0.1812 -0.0124 154 GLU A OE2 
99   N N   . THR A 78  ? 1.1321 0.4493 0.6361 -0.0142 -0.2359 -0.0253 155 THR A N   
100  C CA  . THR A 78  ? 1.1291 0.4462 0.6227 -0.0104 -0.2475 -0.0336 155 THR A CA  
101  C C   . THR A 78  ? 1.1617 0.5166 0.7016 -0.0342 -0.2570 -0.0305 155 THR A C   
102  O O   . THR A 78  ? 1.1470 0.5465 0.7278 -0.0443 -0.2425 -0.0202 155 THR A O   
103  C CB  . THR A 78  ? 1.1179 0.4503 0.5945 0.0141  -0.2278 -0.0331 155 THR A CB  
104  O OG1 . THR A 78  ? 1.1663 0.4618 0.5996 0.0367  -0.2205 -0.0361 155 THR A OG1 
105  C CG2 . THR A 78  ? 1.0475 0.3799 0.5108 0.0202  -0.2374 -0.0402 155 THR A CG2 
106  N N   . PRO A 79  ? 1.0949 0.4344 0.6297 -0.0424 -0.2815 -0.0393 156 PRO A N   
107  C CA  . PRO A 79  ? 1.0535 0.4341 0.6357 -0.0633 -0.2899 -0.0358 156 PRO A CA  
108  C C   . PRO A 79  ? 1.0715 0.4956 0.6692 -0.0535 -0.2743 -0.0321 156 PRO A C   
109  O O   . PRO A 79  ? 1.0735 0.4856 0.6373 -0.0315 -0.2671 -0.0365 156 PRO A O   
110  C CB  . PRO A 79  ? 1.1145 0.4628 0.6809 -0.0705 -0.3216 -0.0476 156 PRO A CB  
111  C CG  . PRO A 79  ? 1.2110 0.5089 0.7157 -0.0457 -0.3256 -0.0583 156 PRO A CG  
112  C CD  . PRO A 79  ? 1.1547 0.4402 0.6406 -0.0319 -0.3032 -0.0530 156 PRO A CD  
113  N N   . THR A 80  ? 0.9900 0.4627 0.6374 -0.0695 -0.2687 -0.0237 157 THR A N   
114  C CA  . THR A 80  ? 0.9564 0.4702 0.6220 -0.0628 -0.2558 -0.0201 157 THR A CA  
115  C C   . THR A 80  ? 1.0434 0.5436 0.6838 -0.0511 -0.2703 -0.0296 157 THR A C   
116  O O   . THR A 80  ? 1.0841 0.5598 0.7141 -0.0574 -0.2956 -0.0380 157 THR A O   
117  C CB  . THR A 80  ? 1.0254 0.5873 0.7451 -0.0819 -0.2528 -0.0114 157 THR A CB  
118  O OG1 . THR A 80  ? 0.9761 0.5368 0.7157 -0.1000 -0.2767 -0.0144 157 THR A OG1 
119  C CG2 . THR A 80  ? 1.0235 0.6032 0.7653 -0.0895 -0.2345 -0.0009 157 THR A CG2 
120  N N   . ILE A 81  ? 0.9712 0.4848 0.6002 -0.0341 -0.2547 -0.0283 158 ILE A N   
121  C CA  . ILE A 81  ? 0.9845 0.4856 0.5854 -0.0194 -0.2636 -0.0354 158 ILE A CA  
122  C C   . ILE A 81  ? 1.0541 0.5920 0.6915 -0.0299 -0.2729 -0.0338 158 ILE A C   
123  O O   . ILE A 81  ? 1.0063 0.5836 0.6754 -0.0332 -0.2563 -0.0255 158 ILE A O   
124  C CB  . ILE A 81  ? 1.0068 0.5048 0.5798 0.0032  -0.2397 -0.0325 158 ILE A CB  
125  C CG1 . ILE A 81  ? 1.0328 0.4980 0.5730 0.0148  -0.2304 -0.0336 158 ILE A CG1 
126  C CG2 . ILE A 81  ? 1.0494 0.5334 0.5908 0.0196  -0.2461 -0.0380 158 ILE A CG2 
127  C CD1 . ILE A 81  ? 1.1028 0.5911 0.6564 0.0197  -0.2031 -0.0243 158 ILE A CD1 
128  N N   . GLN A 82  ? 1.0629 0.5882 0.6957 -0.0344 -0.3001 -0.0420 159 GLN A N   
129  C CA  . GLN A 82  ? 1.0367 0.5987 0.7063 -0.0436 -0.3108 -0.0406 159 GLN A CA  
130  C C   . GLN A 82  ? 1.0838 0.6379 0.7254 -0.0254 -0.3180 -0.0462 159 GLN A C   
131  O O   . GLN A 82  ? 1.1366 0.6673 0.7587 -0.0236 -0.3440 -0.0559 159 GLN A O   
132  C CB  . GLN A 82  ? 1.0673 0.6318 0.7662 -0.0660 -0.3367 -0.0437 159 GLN A CB  
133  C CG  . GLN A 82  ? 1.0979 0.6793 0.8341 -0.0866 -0.3270 -0.0348 159 GLN A CG  
134  C CD  . GLN A 82  ? 1.1701 0.7432 0.9279 -0.1089 -0.3530 -0.0379 159 GLN A CD  
135  O OE1 . GLN A 82  ? 1.1296 0.6735 0.8777 -0.1178 -0.3562 -0.0384 159 GLN A OE1 
136  N NE2 . GLN A 82  ? 0.9294 0.5268 0.7171 -0.1184 -0.3731 -0.0402 159 GLN A NE2 
137  N N   . LYS A 83  ? 0.9915 0.5631 0.6295 -0.0119 -0.2960 -0.0403 160 LYS A N   
138  C CA  . LYS A 83  ? 0.9870 0.5502 0.5959 0.0071  -0.2980 -0.0433 160 LYS A CA  
139  C C   . LYS A 83  ? 1.0339 0.6377 0.6803 0.0020  -0.3026 -0.0398 160 LYS A C   
140  O O   . LYS A 83  ? 1.0054 0.6371 0.6701 0.0047  -0.2816 -0.0316 160 LYS A O   
141  C CB  . LYS A 83  ? 0.9869 0.5373 0.5634 0.0261  -0.2706 -0.0386 160 LYS A CB  
142  N N   . GLY A 84  ? 1.0145 0.6213 0.6731 -0.0054 -0.3313 -0.0463 161 GLY A N   
143  C CA  . GLY A 84  ? 0.9878 0.6320 0.6813 -0.0087 -0.3412 -0.0444 161 GLY A CA  
144  C C   . GLY A 84  ? 0.9622 0.6545 0.7158 -0.0275 -0.3317 -0.0355 161 GLY A C   
145  O O   . GLY A 84  ? 0.9425 0.6403 0.7220 -0.0464 -0.3380 -0.0346 161 GLY A O   
146  N N   . SER A 85  ? 0.8724 0.5973 0.6460 -0.0217 -0.3155 -0.0283 162 SER A N   
147  C CA  . SER A 85  ? 0.8200 0.5910 0.6468 -0.0358 -0.3035 -0.0193 162 SER A CA  
148  C C   . SER A 85  ? 0.7878 0.5597 0.6190 -0.0421 -0.2778 -0.0124 162 SER A C   
149  O O   . SER A 85  ? 0.7341 0.5400 0.6046 -0.0533 -0.2666 -0.0048 162 SER A O   
150  C CB  . SER A 85  ? 0.8501 0.6504 0.6909 -0.0247 -0.2965 -0.0153 162 SER A CB  
151  O OG  . SER A 85  ? 0.9190 0.7275 0.7659 -0.0205 -0.3212 -0.0205 162 SER A OG  
152  N N   . TYR A 86  ? 0.7355 0.4703 0.5257 -0.0337 -0.2692 -0.0151 163 TYR A N   
153  C CA  . TYR A 86  ? 0.7079 0.4399 0.4964 -0.0363 -0.2463 -0.0095 163 TYR A CA  
154  C C   . TYR A 86  ? 0.7495 0.4533 0.5240 -0.0439 -0.2515 -0.0123 163 TYR A C   
155  O O   . TYR A 86  ? 0.7921 0.4646 0.5413 -0.0420 -0.2713 -0.0205 163 TYR A O   
156  C CB  . TYR A 86  ? 0.7282 0.4467 0.4852 -0.0186 -0.2264 -0.0079 163 TYR A CB  
157  C CG  . TYR A 86  ? 0.7321 0.4761 0.5023 -0.0116 -0.2168 -0.0037 163 TYR A CG  
158  C CD1 . TYR A 86  ? 0.7590 0.4996 0.5168 -0.0007 -0.2294 -0.0073 163 TYR A CD1 
159  C CD2 . TYR A 86  ? 0.7104 0.4786 0.5020 -0.0144 -0.1957 0.0035  163 TYR A CD2 
160  C CE1 . TYR A 86  ? 0.7266 0.4868 0.4935 0.0071  -0.2205 -0.0033 163 TYR A CE1 
161  C CE2 . TYR A 86  ? 0.7090 0.4958 0.5092 -0.0073 -0.1873 0.0067  163 TYR A CE2 
162  C CZ  . TYR A 86  ? 0.8126 0.5950 0.6006 0.0035  -0.1994 0.0036  163 TYR A CZ  
163  O OH  . TYR A 86  ? 0.8602 0.6577 0.6544 0.0117  -0.1915 0.0068  163 TYR A OH  
164  N N   . THR A 87  ? 0.6521 0.3645 0.4404 -0.0512 -0.2340 -0.0058 164 THR A N   
165  C CA  . THR A 87  ? 0.6551 0.3413 0.4297 -0.0566 -0.2340 -0.0067 164 THR A CA  
166  C C   . THR A 87  ? 0.7068 0.3851 0.4615 -0.0448 -0.2105 -0.0032 164 THR A C   
167  O O   . THR A 87  ? 0.6663 0.3717 0.4389 -0.0437 -0.1926 0.0032  164 THR A O   
168  C CB  . THR A 87  ? 0.7046 0.4092 0.5175 -0.0778 -0.2378 -0.0013 164 THR A CB  
169  O OG1 . THR A 87  ? 0.8029 0.5161 0.6367 -0.0891 -0.2608 -0.0045 164 THR A OG1 
170  C CG2 . THR A 87  ? 0.6572 0.3323 0.4547 -0.0830 -0.2370 -0.0012 164 THR A CG2 
171  N N   . PHE A 88  ? 0.7142 0.3553 0.4318 -0.0356 -0.2114 -0.0077 165 PHE A N   
172  C CA  . PHE A 88  ? 0.7052 0.3382 0.4039 -0.0234 -0.1906 -0.0046 165 PHE A CA  
173  C C   . PHE A 88  ? 0.7912 0.4055 0.4838 -0.0279 -0.1891 -0.0038 165 PHE A C   
174  O O   . PHE A 88  ? 0.8175 0.4041 0.4975 -0.0335 -0.2066 -0.0091 165 PHE A O   
175  C CB  . PHE A 88  ? 0.7472 0.3542 0.4042 -0.0033 -0.1884 -0.0093 165 PHE A CB  
176  C CG  . PHE A 88  ? 0.7470 0.3725 0.4090 0.0027  -0.1849 -0.0079 165 PHE A CG  
177  C CD1 . PHE A 88  ? 0.7429 0.3911 0.4166 0.0070  -0.1634 -0.0010 165 PHE A CD1 
178  C CD2 . PHE A 88  ? 0.7823 0.4018 0.4375 0.0039  -0.2045 -0.0136 165 PHE A CD2 
179  C CE1 . PHE A 88  ? 0.7432 0.4048 0.4199 0.0125  -0.1603 0.0006  165 PHE A CE1 
180  C CE2 . PHE A 88  ? 0.8002 0.4356 0.4590 0.0106  -0.2016 -0.0118 165 PHE A CE2 
181  C CZ  . PHE A 88  ? 0.7524 0.4075 0.4211 0.0148  -0.1790 -0.0046 165 PHE A CZ  
182  N N   . VAL A 89  ? 0.7226 0.3514 0.4244 -0.0258 -0.1695 0.0027  166 VAL A N   
183  C CA  . VAL A 89  ? 0.7328 0.3461 0.4290 -0.0280 -0.1663 0.0046  166 VAL A CA  
184  C C   . VAL A 89  ? 0.8501 0.4278 0.5037 -0.0094 -0.1628 0.0001  166 VAL A C   
185  O O   . VAL A 89  ? 0.8618 0.4458 0.5046 0.0047  -0.1486 0.0015  166 VAL A O   
186  C CB  . VAL A 89  ? 0.7264 0.3711 0.4499 -0.0323 -0.1481 0.0134  166 VAL A CB  
187  C CG1 . VAL A 89  ? 0.7371 0.3650 0.4516 -0.0313 -0.1437 0.0159  166 VAL A CG1 
188  C CG2 . VAL A 89  ? 0.6828 0.3610 0.4449 -0.0484 -0.1500 0.0181  166 VAL A CG2 
189  N N   . PRO A 90  ? 0.8403 0.3804 0.4692 -0.0084 -0.1744 -0.0046 167 PRO A N   
190  C CA  . PRO A 90  ? 0.8586 0.3666 0.4466 0.0121  -0.1680 -0.0080 167 PRO A CA  
191  C C   . PRO A 90  ? 0.9067 0.4315 0.5053 0.0177  -0.1473 -0.0004 167 PRO A C   
192  O O   . PRO A 90  ? 0.9175 0.4485 0.5344 0.0069  -0.1472 0.0038  167 PRO A O   
193  C CB  . PRO A 90  ? 0.9212 0.3845 0.4830 0.0094  -0.1882 -0.0155 167 PRO A CB  
194  C CG  . PRO A 90  ? 0.9733 0.4489 0.5687 -0.0147 -0.2007 -0.0131 167 PRO A CG  
195  C CD  . PRO A 90  ? 0.8821 0.4078 0.5206 -0.0256 -0.1916 -0.0059 167 PRO A CD  
196  N N   . TRP A 91  ? 0.8395 0.3751 0.4299 0.0338  -0.1297 0.0021  168 TRP A N   
197  C CA  . TRP A 91  ? 0.8052 0.3616 0.4092 0.0396  -0.1110 0.0091  168 TRP A CA  
198  C C   . TRP A 91  ? 0.8858 0.4141 0.4587 0.0577  -0.1055 0.0078  168 TRP A C   
199  O O   . TRP A 91  ? 0.9467 0.4411 0.4823 0.0713  -0.1106 0.0018  168 TRP A O   
200  C CB  . TRP A 91  ? 0.7539 0.3443 0.3753 0.0441  -0.0940 0.0141  168 TRP A CB  
201  C CG  . TRP A 91  ? 0.7214 0.3417 0.3744 0.0285  -0.0967 0.0161  168 TRP A CG  
202  C CD1 . TRP A 91  ? 0.7488 0.3743 0.4007 0.0285  -0.0990 0.0143  168 TRP A CD1 
203  C CD2 . TRP A 91  ? 0.6893 0.3354 0.3761 0.0122  -0.0980 0.0201  168 TRP A CD2 
204  N NE1 . TRP A 91  ? 0.7071 0.3609 0.3912 0.0137  -0.1016 0.0168  168 TRP A NE1 
205  C CE2 . TRP A 91  ? 0.7044 0.3716 0.4103 0.0035  -0.1006 0.0203  168 TRP A CE2 
206  C CE3 . TRP A 91  ? 0.7005 0.3525 0.4011 0.0054  -0.0968 0.0239  168 TRP A CE3 
207  C CZ2 . TRP A 91  ? 0.6615 0.3565 0.3997 -0.0110 -0.1010 0.0241  168 TRP A CZ2 
208  C CZ3 . TRP A 91  ? 0.6876 0.3667 0.4194 -0.0094 -0.0970 0.0281  168 TRP A CZ3 
209  C CH2 . TRP A 91  ? 0.6707 0.3712 0.4209 -0.0172 -0.0988 0.0280  168 TRP A CH2 
210  N N   . LEU A 92  ? 0.8169 0.3599 0.4042 0.0595  -0.0950 0.0135  169 LEU A N   
211  C CA  . LEU A 92  ? 0.8339 0.3599 0.3996 0.0780  -0.0865 0.0144  169 LEU A CA  
212  C C   . LEU A 92  ? 0.8283 0.3965 0.4220 0.0830  -0.0670 0.0221  169 LEU A C   
213  O O   . LEU A 92  ? 0.8068 0.4080 0.4353 0.0682  -0.0651 0.0264  169 LEU A O   
214  C CB  . LEU A 92  ? 0.8486 0.3536 0.4107 0.0716  -0.0964 0.0144  169 LEU A CB  
215  N N   . LEU A 93  ? 0.7174 0.2854 0.2971 0.1036  -0.0527 0.0240  170 LEU A N   
216  C CA  . LEU A 93  ? 0.6462 0.2559 0.2563 0.1066  -0.0358 0.0313  170 LEU A CA  
217  C C   . LEU A 93  ? 0.7358 0.3589 0.3641 0.1042  -0.0356 0.0351  170 LEU A C   
218  O O   . LEU A 93  ? 0.7614 0.3605 0.3685 0.1163  -0.0376 0.0342  170 LEU A O   
219  C CB  . LEU A 93  ? 0.6340 0.2449 0.2293 0.1285  -0.0191 0.0338  170 LEU A CB  
220  C CG  . LEU A 93  ? 0.6073 0.2609 0.2355 0.1323  -0.0021 0.0417  170 LEU A CG  
221  C CD1 . LEU A 93  ? 0.5700 0.2545 0.2255 0.1202  0.0049  0.0451  170 LEU A CD1 
222  C CD2 . LEU A 93  ? 0.5985 0.2468 0.2089 0.1563  0.0123  0.0444  170 LEU A CD2 
223  N N   . SER A 94  ? 0.6911 0.3506 0.3562 0.0897  -0.0337 0.0392  171 SER A N   
224  C CA  . SER A 94  ? 0.6848 0.3605 0.3680 0.0876  -0.0336 0.0432  171 SER A CA  
225  C C   . SER A 94  ? 0.7387 0.4391 0.4337 0.1035  -0.0195 0.0477  171 SER A C   
226  O O   . SER A 94  ? 0.7610 0.4571 0.4509 0.1146  -0.0190 0.0496  171 SER A O   
227  C CB  . SER A 94  ? 0.7017 0.4041 0.4153 0.0678  -0.0376 0.0452  171 SER A CB  
228  O OG  . SER A 94  ? 0.8609 0.5792 0.5888 0.0689  -0.0364 0.0492  171 SER A OG  
229  N N   . PHE A 95  ? 0.6524 0.3782 0.3634 0.1050  -0.0081 0.0498  172 PHE A N   
230  C CA  . PHE A 95  ? 0.6394 0.3921 0.3659 0.1187  0.0066  0.0549  172 PHE A CA  
231  C C   . PHE A 95  ? 0.6714 0.4423 0.4107 0.1150  0.0171  0.0571  172 PHE A C   
232  O O   . PHE A 95  ? 0.6706 0.4424 0.4159 0.0994  0.0119  0.0550  172 PHE A O   
233  C CB  . PHE A 95  ? 0.6425 0.4281 0.4005 0.1156  0.0063  0.0586  172 PHE A CB  
234  C CG  . PHE A 95  ? 0.6387 0.4562 0.4303 0.0970  0.0049  0.0596  172 PHE A CG  
235  C CD1 . PHE A 95  ? 0.6567 0.5065 0.4754 0.0959  0.0158  0.0632  172 PHE A CD1 
236  C CD2 . PHE A 95  ? 0.6583 0.4721 0.4537 0.0807  -0.0068 0.0571  172 PHE A CD2 
237  C CE1 . PHE A 95  ? 0.6319 0.5052 0.4774 0.0789  0.0134  0.0631  172 PHE A CE1 
238  C CE2 . PHE A 95  ? 0.6628 0.5029 0.4851 0.0659  -0.0079 0.0574  172 PHE A CE2 
239  C CZ  . PHE A 95  ? 0.6211 0.4884 0.4665 0.0650  0.0014  0.0597  172 PHE A CZ  
240  N N   . LYS A 96  ? 0.6185 0.4049 0.3633 0.1296  0.0327  0.0621  173 LYS A N   
241  C CA  . LYS A 96  ? 0.6081 0.4141 0.3675 0.1278  0.0464  0.0667  173 LYS A CA  
242  C C   . LYS A 96  ? 0.6978 0.5445 0.4925 0.1335  0.0588  0.0738  173 LYS A C   
243  O O   . LYS A 96  ? 0.7440 0.5930 0.5341 0.1514  0.0647  0.0762  173 LYS A O   
244  C CB  . LYS A 96  ? 0.6374 0.4140 0.3597 0.1431  0.0548  0.0665  173 LYS A CB  
245  C CG  . LYS A 96  ? 0.6259 0.4212 0.3604 0.1449  0.0727  0.0736  173 LYS A CG  
246  C CD  . LYS A 96  ? 0.7001 0.4651 0.3932 0.1639  0.0829  0.0743  173 LYS A CD  
247  C CE  . LYS A 96  ? 0.6546 0.4415 0.3620 0.1682  0.1048  0.0842  173 LYS A CE  
248  N NZ  . LYS A 96  ? 0.8773 0.6962 0.6101 0.1806  0.1208  0.0923  173 LYS A NZ  
249  N N   . ARG A 97  ? 0.6126 0.4910 0.4430 0.1183  0.0618  0.0770  174 ARG A N   
250  C CA  . ARG A 97  ? 0.5767 0.4972 0.4470 0.1193  0.0709  0.0834  174 ARG A CA  
251  C C   . ARG A 97  ? 0.6424 0.5793 0.5308 0.1120  0.0847  0.0894  174 ARG A C   
252  O O   . ARG A 97  ? 0.6515 0.5825 0.5416 0.0958  0.0798  0.0871  174 ARG A O   
253  C CB  . ARG A 97  ? 0.4840 0.4248 0.3811 0.1050  0.0567  0.0803  174 ARG A CB  
254  C CG  . ARG A 97  ? 0.4570 0.4397 0.3938 0.1073  0.0609  0.0852  174 ARG A CG  
255  C CD  . ARG A 97  ? 0.5356 0.5345 0.4948 0.0912  0.0457  0.0811  174 ARG A CD  
256  N NE  . ARG A 97  ? 0.6387 0.6776 0.6360 0.0934  0.0459  0.0846  174 ARG A NE  
257  C CZ  . ARG A 97  ? 0.8567 0.9228 0.8877 0.0776  0.0392  0.0837  174 ARG A CZ  
258  N NH1 . ARG A 97  ? 0.7225 0.7785 0.7517 0.0597  0.0333  0.0797  174 ARG A NH1 
259  N NH2 . ARG A 97  ? 0.6963 0.7993 0.7625 0.0802  0.0378  0.0865  174 ARG A NH2 
260  N N   . GLY A 98  ? 0.5989 0.5535 0.4978 0.1254  0.1029  0.0976  175 GLY A N   
261  C CA  . GLY A 98  ? 0.5981 0.5688 0.5150 0.1199  0.1193  0.1057  175 GLY A CA  
262  C C   . GLY A 98  ? 0.6945 0.6317 0.5724 0.1276  0.1291  0.1072  175 GLY A C   
263  O O   . GLY A 98  ? 0.7072 0.6084 0.5420 0.1406  0.1241  0.1017  175 GLY A O   
264  N N   . SER A 99  ? 0.6642 0.6116 0.5565 0.1191  0.1421  0.1145  176 SER A N   
265  C CA  . SER A 99  ? 0.7026 0.6222 0.5609 0.1268  0.1545  0.1184  176 SER A CA  
266  C C   . SER A 99  ? 0.7834 0.6783 0.6249 0.1119  0.1439  0.1134  176 SER A C   
267  O O   . SER A 99  ? 0.8258 0.6868 0.6258 0.1217  0.1461  0.1122  176 SER A O   
268  C CB  . SER A 99  ? 0.7480 0.6933 0.6297 0.1311  0.1803  0.1326  176 SER A CB  
269  O OG  . SER A 99  ? 0.8108 0.7958 0.7467 0.1114  0.1813  0.1375  176 SER A OG  
270  N N   . ALA A 100 ? 0.6958 0.6073 0.5684 0.0898  0.1330  0.1107  177 ALA A N   
271  C CA  . ALA A 100 ? 0.6723 0.5657 0.5352 0.0755  0.1239  0.1068  177 ALA A CA  
272  C C   . ALA A 100 ? 0.7279 0.5849 0.5500 0.0794  0.1081  0.0970  177 ALA A C   
273  O O   . ALA A 100 ? 0.7416 0.5786 0.5454 0.0755  0.1058  0.0960  177 ALA A O   
274  C CB  . ALA A 100 ? 0.6424 0.5600 0.5444 0.0542  0.1135  0.1042  177 ALA A CB  
275  N N   . LEU A 101 ? 0.6747 0.5232 0.4837 0.0866  0.0965  0.0901  178 LEU A N   
276  C CA  . LEU A 101 ? 0.6771 0.4932 0.4523 0.0878  0.0800  0.0810  178 LEU A CA  
277  C C   . LEU A 101 ? 0.7794 0.5694 0.5180 0.1075  0.0797  0.0782  178 LEU A C   
278  O O   . LEU A 101 ? 0.7681 0.5686 0.5128 0.1181  0.0856  0.0803  178 LEU A O   
279  C CB  . LEU A 101 ? 0.6386 0.4631 0.4316 0.0723  0.0614  0.0738  178 LEU A CB  
280  C CG  . LEU A 101 ? 0.6355 0.4792 0.4578 0.0537  0.0582  0.0741  178 LEU A CG  
281  C CD1 . LEU A 101 ? 0.5882 0.4483 0.4327 0.0428  0.0451  0.0694  178 LEU A CD1 
282  C CD2 . LEU A 101 ? 0.6359 0.4589 0.4395 0.0492  0.0536  0.0719  178 LEU A CD2 
283  N N   . GLU A 102 ? 0.7474 0.5018 0.4470 0.1128  0.0713  0.0728  179 GLU A N   
284  C CA  . GLU A 102 ? 0.7602 0.4803 0.4167 0.1309  0.0674  0.0681  179 GLU A CA  
285  C C   . GLU A 102 ? 0.8617 0.5533 0.4957 0.1241  0.0448  0.0579  179 GLU A C   
286  O O   . GLU A 102 ? 0.8576 0.5527 0.5015 0.1098  0.0362  0.0560  179 GLU A O   
287  C CB  . GLU A 102 ? 0.7974 0.4998 0.4230 0.1482  0.0835  0.0734  179 GLU A CB  
288  C CG  . GLU A 102 ? 0.8408 0.5640 0.4781 0.1620  0.1074  0.0837  179 GLU A CG  
289  C CD  . GLU A 102 ? 1.0316 0.7354 0.6344 0.1810  0.1254  0.0901  179 GLU A CD  
290  O OE1 . GLU A 102 ? 0.8478 0.5122 0.4041 0.1906  0.1168  0.0840  179 GLU A OE1 
291  O OE2 . GLU A 102 ? 0.7553 0.4839 0.3777 0.1869  0.1484  0.1017  179 GLU A OE2 
292  N N   . GLU A 103 ? 0.8722 0.5350 0.4761 0.1347  0.0351  0.0516  180 GLU A N   
293  C CA  . GLU A 103 ? 0.8980 0.5307 0.4787 0.1292  0.0128  0.0419  180 GLU A CA  
294  C C   . GLU A 103 ? 0.9750 0.5740 0.5108 0.1447  0.0136  0.0396  180 GLU A C   
295  O O   . GLU A 103 ? 0.9913 0.5756 0.5000 0.1651  0.0265  0.0421  180 GLU A O   
296  C CB  . GLU A 103 ? 0.9407 0.5558 0.5103 0.1329  0.0019  0.0366  180 GLU A CB  
297  C CG  . GLU A 103 ? 1.1624 0.7530 0.7204 0.1211  -0.0223 0.0277  180 GLU A CG  
298  C CD  . GLU A 103 ? 1.6765 1.2233 1.1889 0.1303  -0.0356 0.0196  180 GLU A CD  
299  O OE1 . GLU A 103 ? 1.8313 1.3560 1.3084 0.1514  -0.0263 0.0196  180 GLU A OE1 
300  O OE2 . GLU A 103 ? 1.6032 1.1375 1.1149 0.1169  -0.0558 0.0132  180 GLU A OE2 
301  N N   . LYS A 104 ? 0.9423 0.5297 0.4693 0.1365  0.0005  0.0353  181 LYS A N   
302  C CA  . LYS A 104 ? 0.9873 0.5403 0.4685 0.1513  -0.0022 0.0321  181 LYS A CA  
303  C C   . LYS A 104 ? 1.0087 0.5423 0.4792 0.1409  -0.0286 0.0223  181 LYS A C   
304  O O   . LYS A 104 ? 0.9648 0.5183 0.4621 0.1249  -0.0351 0.0229  181 LYS A O   
305  C CB  . LYS A 104 ? 1.0300 0.5933 0.5099 0.1576  0.0173  0.0412  181 LYS A CB  
306  N N   . GLU A 105 ? 0.9817 0.4768 0.4145 0.1499  -0.0445 0.0132  182 GLU A N   
307  C CA  . GLU A 105 ? 0.9893 0.4618 0.4082 0.1416  -0.0718 0.0031  182 GLU A CA  
308  C C   . GLU A 105 ? 0.9901 0.4918 0.4553 0.1163  -0.0839 0.0027  182 GLU A C   
309  O O   . GLU A 105 ? 0.9962 0.5053 0.4709 0.1071  -0.0947 0.0010  182 GLU A O   
310  C CB  . GLU A 105 ? 1.0365 0.4909 0.4241 0.1519  -0.0751 0.0015  182 GLU A CB  
311  C CG  . GLU A 105 ? 1.2438 0.6605 0.5755 0.1789  -0.0673 0.0002  182 GLU A CG  
312  C CD  . GLU A 105 ? 1.5957 0.9902 0.8921 0.1893  -0.0740 -0.0022 182 GLU A CD  
313  O OE1 . GLU A 105 ? 1.5147 0.9330 0.8335 0.1813  -0.0686 0.0037  182 GLU A OE1 
314  O OE2 . GLU A 105 ? 1.6358 0.9873 0.8804 0.2060  -0.0860 -0.0105 182 GLU A OE2 
315  N N   . ASN A 106 ? 0.8968 0.4168 0.3909 0.1064  -0.0803 0.0053  183 ASN A N   
316  C CA  . ASN A 106 ? 0.8307 0.3780 0.3672 0.0839  -0.0891 0.0061  183 ASN A CA  
317  C C   . ASN A 106 ? 0.8151 0.4013 0.3880 0.0737  -0.0786 0.0127  183 ASN A C   
318  O O   . ASN A 106 ? 0.7814 0.3869 0.3831 0.0572  -0.0880 0.0123  183 ASN A O   
319  C CB  . ASN A 106 ? 0.8154 0.3438 0.3458 0.0733  -0.1151 -0.0023 183 ASN A CB  
320  C CG  . ASN A 106 ? 1.1682 0.6928 0.7121 0.0612  -0.1249 -0.0039 183 ASN A CG  
321  O OD1 . ASN A 106 ? 1.0178 0.5266 0.5475 0.0694  -0.1194 -0.0036 183 ASN A OD1 
322  N ND2 . ASN A 106 ? 1.1211 0.6606 0.6931 0.0420  -0.1388 -0.0048 183 ASN A ND2 
323  N N   . LYS A 107 ? 0.7635 0.3606 0.3352 0.0837  -0.0588 0.0192  184 LYS A N   
324  C CA  . LYS A 107 ? 0.7158 0.3450 0.3182 0.0754  -0.0475 0.0256  184 LYS A CA  
325  C C   . LYS A 107 ? 0.7804 0.4295 0.3982 0.0802  -0.0261 0.0332  184 LYS A C   
326  O O   . LYS A 107 ? 0.7981 0.4341 0.3963 0.0944  -0.0175 0.0344  184 LYS A O   
327  C CB  . LYS A 107 ? 0.7395 0.3589 0.3230 0.0825  -0.0457 0.0265  184 LYS A CB  
328  C CG  . LYS A 107 ? 0.7665 0.3689 0.3352 0.0797  -0.0676 0.0191  184 LYS A CG  
329  C CD  . LYS A 107 ? 0.8070 0.3828 0.3354 0.0964  -0.0662 0.0187  184 LYS A CD  
330  N N   . ILE A 108 ? 0.7125 0.3934 0.3660 0.0686  -0.0183 0.0382  185 ILE A N   
331  C CA  . ILE A 108 ? 0.6822 0.3854 0.3552 0.0711  0.0003  0.0455  185 ILE A CA  
332  C C   . ILE A 108 ? 0.7282 0.4305 0.3932 0.0776  0.0149  0.0515  185 ILE A C   
333  O O   . ILE A 108 ? 0.7140 0.4183 0.3834 0.0706  0.0115  0.0516  185 ILE A O   
334  C CB  . ILE A 108 ? 0.6692 0.4046 0.3828 0.0558  -0.0001 0.0471  185 ILE A CB  
335  C CG1 . ILE A 108 ? 0.6482 0.3812 0.3661 0.0498  -0.0140 0.0423  185 ILE A CG1 
336  C CG2 . ILE A 108 ? 0.6478 0.4061 0.3818 0.0587  0.0173  0.0541  185 ILE A CG2 
337  C CD1 . ILE A 108 ? 0.5312 0.2916 0.2832 0.0353  -0.0169 0.0431  185 ILE A CD1 
338  N N   . LEU A 109 ? 0.6867 0.3835 0.3369 0.0925  0.0312  0.0569  186 LEU A N   
339  C CA  . LEU A 109 ? 0.6917 0.3858 0.3323 0.0998  0.0478  0.0646  186 LEU A CA  
340  C C   . LEU A 109 ? 0.7183 0.4456 0.3968 0.0928  0.0651  0.0736  186 LEU A C   
341  O O   . LEU A 109 ? 0.7130 0.4571 0.4076 0.0960  0.0724  0.0761  186 LEU A O   
342  C CB  . LEU A 109 ? 0.7415 0.4069 0.3390 0.1220  0.0560  0.0658  186 LEU A CB  
343  C CG  . LEU A 109 ? 0.8221 0.4860 0.4084 0.1329  0.0793  0.0767  186 LEU A CG  
344  C CD1 . LEU A 109 ? 0.8280 0.4799 0.4030 0.1285  0.0767  0.0781  186 LEU A CD1 
345  C CD2 . LEU A 109 ? 0.8782 0.5171 0.4235 0.1566  0.0890  0.0780  186 LEU A CD2 
346  N N   . VAL A 110 ? 0.6664 0.4023 0.3591 0.0834  0.0707  0.0783  187 VAL A N   
347  C CA  . VAL A 110 ? 0.6423 0.4073 0.3722 0.0736  0.0849  0.0864  187 VAL A CA  
348  C C   . VAL A 110 ? 0.7386 0.5017 0.4588 0.0863  0.1083  0.0975  187 VAL A C   
349  O O   . VAL A 110 ? 0.7791 0.5184 0.4687 0.0953  0.1150  0.1012  187 VAL A O   
350  C CB  . VAL A 110 ? 0.6628 0.4331 0.4097 0.0577  0.0791  0.0858  187 VAL A CB  
351  C CG1 . VAL A 110 ? 0.6460 0.4435 0.4313 0.0459  0.0915  0.0933  187 VAL A CG1 
352  C CG2 . VAL A 110 ? 0.6287 0.4022 0.3839 0.0475  0.0579  0.0757  187 VAL A CG2 
353  N N   . LYS A 111 ? 0.6607 0.4497 0.4070 0.0880  0.1210  0.1034  188 LYS A N   
354  C CA  . LYS A 111 ? 0.6537 0.4483 0.3981 0.1001  0.1458  0.1155  188 LYS A CA  
355  C C   . LYS A 111 ? 0.6978 0.5222 0.4855 0.0854  0.1602  0.1261  188 LYS A C   
356  O O   . LYS A 111 ? 0.7268 0.5524 0.5127 0.0915  0.1817  0.1380  188 LYS A O   
357  C CB  . LYS A 111 ? 0.6547 0.4550 0.3932 0.1170  0.1517  0.1157  188 LYS A CB  
358  C CG  . LYS A 111 ? 0.6523 0.4160 0.3414 0.1339  0.1403  0.1066  188 LYS A CG  
359  C CD  . LYS A 111 ? 0.8035 0.5320 0.4435 0.1510  0.1494  0.1097  188 LYS A CD  
360  C CE  . LYS A 111 ? 0.8188 0.5464 0.4426 0.1727  0.1745  0.1200  188 LYS A CE  
361  N NZ  . LYS A 111 ? 1.1310 0.8180 0.6972 0.1962  0.1697  0.1134  188 LYS A NZ  
362  N N   . GLU A 112 ? 0.6207 0.4675 0.4458 0.0661  0.1486  0.1219  189 GLU A N   
363  C CA  . GLU A 112 ? 0.5967 0.4689 0.4637 0.0491  0.1573  0.1296  189 GLU A CA  
364  C C   . GLU A 112 ? 0.6606 0.5247 0.5331 0.0319  0.1410  0.1226  189 GLU A C   
365  O O   . GLU A 112 ? 0.6467 0.5065 0.5140 0.0285  0.1213  0.1112  189 GLU A O   
366  C CB  . GLU A 112 ? 0.5857 0.4971 0.4969 0.0434  0.1575  0.1306  189 GLU A CB  
367  C CG  . GLU A 112 ? 0.7461 0.6748 0.6643 0.0584  0.1779  0.1407  189 GLU A CG  
368  C CD  . GLU A 112 ? 1.0137 0.9728 0.9592 0.0619  0.1729  0.1380  189 GLU A CD  
369  O OE1 . GLU A 112 ? 1.0590 1.0414 1.0400 0.0459  0.1600  0.1335  189 GLU A OE1 
370  O OE2 . GLU A 112 ? 0.8116 0.7697 0.7409 0.0820  0.1818  0.1403  189 GLU A OE2 
371  N N   . THR A 113 ? 0.6170 0.4781 0.4993 0.0214  0.1499  0.1298  190 THR A N   
372  C CA  . THR A 113 ? 0.5884 0.4404 0.4752 0.0065  0.1361  0.1238  190 THR A CA  
373  C C   . THR A 113 ? 0.6177 0.4988 0.5460 -0.0094 0.1246  0.1182  190 THR A C   
374  O O   . THR A 113 ? 0.6132 0.5224 0.5750 -0.0140 0.1326  0.1237  190 THR A O   
375  C CB  . THR A 113 ? 0.6122 0.4484 0.4941 0.0014  0.1497  0.1337  190 THR A CB  
376  O OG1 . THR A 113 ? 0.6733 0.4802 0.5109 0.0187  0.1580  0.1376  190 THR A OG1 
377  C CG2 . THR A 113 ? 0.5857 0.4107 0.4717 -0.0128 0.1366  0.1280  190 THR A CG2 
378  N N   . GLY A 114 ? 0.5600 0.4347 0.4850 -0.0163 0.1058  0.1075  191 GLY A N   
379  C CA  . GLY A 114 ? 0.5363 0.4326 0.4932 -0.0302 0.0932  0.1012  191 GLY A CA  
380  C C   . GLY A 114 ? 0.5766 0.4623 0.5216 -0.0334 0.0742  0.0897  191 GLY A C   
381  O O   . GLY A 114 ? 0.5495 0.4115 0.4653 -0.0275 0.0702  0.0869  191 GLY A O   
382  N N   . TYR A 115 ? 0.5395 0.4447 0.5082 -0.0420 0.0625  0.0834  192 TYR A N   
383  C CA  . TYR A 115 ? 0.5308 0.4316 0.4920 -0.0445 0.0455  0.0732  192 TYR A CA  
384  C C   . TYR A 115 ? 0.5385 0.4489 0.4954 -0.0361 0.0393  0.0695  192 TYR A C   
385  O O   . TYR A 115 ? 0.5134 0.4434 0.4881 -0.0344 0.0427  0.0721  192 TYR A O   
386  C CB  . TYR A 115 ? 0.5396 0.4505 0.5242 -0.0585 0.0367  0.0686  192 TYR A CB  
387  C CG  . TYR A 115 ? 0.5839 0.4762 0.5646 -0.0663 0.0393  0.0701  192 TYR A CG  
388  C CD1 . TYR A 115 ? 0.6054 0.4979 0.6010 -0.0734 0.0518  0.0788  192 TYR A CD1 
389  C CD2 . TYR A 115 ? 0.6238 0.4977 0.5858 -0.0660 0.0300  0.0635  192 TYR A CD2 
390  C CE1 . TYR A 115 ? 0.6279 0.4993 0.6180 -0.0809 0.0542  0.0807  192 TYR A CE1 
391  C CE2 . TYR A 115 ? 0.6674 0.5211 0.6232 -0.0716 0.0321  0.0648  192 TYR A CE2 
392  C CZ  . TYR A 115 ? 0.7566 0.6072 0.7254 -0.0794 0.0438  0.0732  192 TYR A CZ  
393  O OH  . TYR A 115 ? 0.7569 0.5833 0.7167 -0.0846 0.0457  0.0748  192 TYR A OH  
394  N N   . PHE A 116 ? 0.5029 0.3993 0.4370 -0.0306 0.0306  0.0641  193 PHE A N   
395  C CA  . PHE A 116 ? 0.4940 0.3937 0.4203 -0.0231 0.0245  0.0612  193 PHE A CA  
396  C C   . PHE A 116 ? 0.5426 0.4421 0.4657 -0.0266 0.0108  0.0541  193 PHE A C   
397  O O   . PHE A 116 ? 0.5530 0.4403 0.4647 -0.0285 0.0060  0.0513  193 PHE A O   
398  C CB  . PHE A 116 ? 0.5279 0.4079 0.4262 -0.0114 0.0286  0.0630  193 PHE A CB  
399  C CG  . PHE A 116 ? 0.5752 0.4541 0.4708 -0.0037 0.0439  0.0707  193 PHE A CG  
400  C CD1 . PHE A 116 ? 0.6332 0.5027 0.5246 -0.0048 0.0545  0.0763  193 PHE A CD1 
401  C CD2 . PHE A 116 ? 0.6185 0.5044 0.5138 0.0060  0.0489  0.0731  193 PHE A CD2 
402  C CE1 . PHE A 116 ? 0.6733 0.5426 0.5618 0.0030  0.0711  0.0849  193 PHE A CE1 
403  C CE2 . PHE A 116 ? 0.6648 0.5506 0.5565 0.0153  0.0650  0.0809  193 PHE A CE2 
404  C CZ  . PHE A 116 ? 0.6585 0.5372 0.5478 0.0134  0.0767  0.0872  193 PHE A CZ  
405  N N   . PHE A 117 ? 0.4630 0.3755 0.3946 -0.0258 0.0051  0.0521  194 PHE A N   
406  C CA  . PHE A 117 ? 0.4426 0.3544 0.3688 -0.0275 -0.0058 0.0472  194 PHE A CA  
407  C C   . PHE A 117 ? 0.5357 0.4323 0.4411 -0.0202 -0.0074 0.0475  194 PHE A C   
408  O O   . PHE A 117 ? 0.5499 0.4453 0.4507 -0.0130 -0.0043 0.0497  194 PHE A O   
409  C CB  . PHE A 117 ? 0.4475 0.3766 0.3882 -0.0286 -0.0111 0.0457  194 PHE A CB  
410  C CG  . PHE A 117 ? 0.4551 0.3819 0.3874 -0.0291 -0.0202 0.0424  194 PHE A CG  
411  C CD1 . PHE A 117 ? 0.4797 0.4058 0.4114 -0.0344 -0.0252 0.0387  194 PHE A CD1 
412  C CD2 . PHE A 117 ? 0.4872 0.4112 0.4110 -0.0234 -0.0227 0.0436  194 PHE A CD2 
413  C CE1 . PHE A 117 ? 0.4881 0.4137 0.4127 -0.0341 -0.0311 0.0372  194 PHE A CE1 
414  C CE2 . PHE A 117 ? 0.5202 0.4416 0.4369 -0.0246 -0.0293 0.0422  194 PHE A CE2 
415  C CZ  . PHE A 117 ? 0.4900 0.4137 0.4080 -0.0300 -0.0328 0.0395  194 PHE A CZ  
416  N N   . ILE A 118 ? 0.4930 0.3774 0.3858 -0.0215 -0.0124 0.0453  195 ILE A N   
417  C CA  . ILE A 118 ? 0.4999 0.3685 0.3740 -0.0165 -0.0164 0.0448  195 ILE A CA  
418  C C   . ILE A 118 ? 0.5604 0.4316 0.4358 -0.0209 -0.0257 0.0424  195 ILE A C   
419  O O   . ILE A 118 ? 0.5784 0.4575 0.4617 -0.0261 -0.0283 0.0408  195 ILE A O   
420  C CB  . ILE A 118 ? 0.5405 0.3931 0.3995 -0.0136 -0.0151 0.0448  195 ILE A CB  
421  C CG1 . ILE A 118 ? 0.5417 0.3913 0.3989 -0.0094 -0.0033 0.0490  195 ILE A CG1 
422  C CG2 . ILE A 118 ? 0.5521 0.3874 0.3914 -0.0088 -0.0220 0.0432  195 ILE A CG2 
423  C CD1 . ILE A 118 ? 0.5872 0.4319 0.4433 -0.0118 -0.0005 0.0498  195 ILE A CD1 
424  N N   . TYR A 119 ? 0.4779 0.3412 0.3447 -0.0184 -0.0298 0.0428  196 TYR A N   
425  C CA  . TYR A 119 ? 0.4436 0.3084 0.3120 -0.0231 -0.0371 0.0425  196 TYR A CA  
426  C C   . TYR A 119 ? 0.5379 0.3845 0.3920 -0.0223 -0.0436 0.0421  196 TYR A C   
427  O O   . TYR A 119 ? 0.5704 0.4010 0.4094 -0.0154 -0.0427 0.0416  196 TYR A O   
428  C CB  . TYR A 119 ? 0.4273 0.3020 0.3029 -0.0228 -0.0365 0.0441  196 TYR A CB  
429  C CG  . TYR A 119 ? 0.4423 0.3101 0.3108 -0.0148 -0.0337 0.0456  196 TYR A CG  
430  C CD1 . TYR A 119 ? 0.4524 0.3289 0.3276 -0.0097 -0.0264 0.0464  196 TYR A CD1 
431  C CD2 . TYR A 119 ? 0.4557 0.3085 0.3115 -0.0121 -0.0379 0.0466  196 TYR A CD2 
432  C CE1 . TYR A 119 ? 0.4292 0.3019 0.2988 -0.0003 -0.0226 0.0483  196 TYR A CE1 
433  C CE2 . TYR A 119 ? 0.4721 0.3169 0.3190 -0.0025 -0.0351 0.0478  196 TYR A CE2 
434  C CZ  . TYR A 119 ? 0.5689 0.4252 0.4231 0.0043  -0.0271 0.0487  196 TYR A CZ  
435  O OH  . TYR A 119 ? 0.6319 0.4825 0.4782 0.0157  -0.0233 0.0503  196 TYR A OH  
436  N N   . GLY A 120 ? 0.4878 0.3362 0.3464 -0.0290 -0.0501 0.0425  197 GLY A N   
437  C CA  . GLY A 120 ? 0.4988 0.3309 0.3478 -0.0313 -0.0585 0.0421  197 GLY A CA  
438  C C   . GLY A 120 ? 0.5469 0.3868 0.4075 -0.0405 -0.0631 0.0449  197 GLY A C   
439  O O   . GLY A 120 ? 0.5614 0.4195 0.4362 -0.0444 -0.0609 0.0462  197 GLY A O   
440  N N   . GLN A 121 ? 0.4866 0.3112 0.3403 -0.0435 -0.0688 0.0464  198 GLN A N   
441  C CA  . GLN A 121 ? 0.4753 0.3041 0.3398 -0.0535 -0.0727 0.0507  198 GLN A CA  
442  C C   . GLN A 121 ? 0.5533 0.3607 0.4101 -0.0588 -0.0839 0.0495  198 GLN A C   
443  O O   . GLN A 121 ? 0.5720 0.3554 0.4087 -0.0527 -0.0877 0.0459  198 GLN A O   
444  C CB  . GLN A 121 ? 0.4793 0.3103 0.3442 -0.0534 -0.0674 0.0556  198 GLN A CB  
445  C CG  . GLN A 121 ? 0.4590 0.2939 0.3344 -0.0639 -0.0689 0.0620  198 GLN A CG  
446  C CD  . GLN A 121 ? 0.6538 0.4902 0.5265 -0.0623 -0.0629 0.0676  198 GLN A CD  
447  O OE1 . GLN A 121 ? 0.5665 0.4209 0.4446 -0.0588 -0.0562 0.0688  198 GLN A OE1 
448  N NE2 . GLN A 121 ? 0.5178 0.3330 0.3799 -0.0643 -0.0659 0.0712  198 GLN A NE2 
449  N N   . VAL A 122 ? 0.4884 0.3049 0.3615 -0.0699 -0.0895 0.0523  199 VAL A N   
450  C CA  . VAL A 122 ? 0.4969 0.2962 0.3690 -0.0787 -0.1024 0.0515  199 VAL A CA  
451  C C   . VAL A 122 ? 0.6011 0.4133 0.4943 -0.0917 -0.1012 0.0598  199 VAL A C   
452  O O   . VAL A 122 ? 0.6093 0.4490 0.5209 -0.0934 -0.0931 0.0641  199 VAL A O   
453  C CB  . VAL A 122 ? 0.5190 0.3204 0.3940 -0.0792 -0.1127 0.0460  199 VAL A CB  
454  C CG1 . VAL A 122 ? 0.5308 0.3140 0.4056 -0.0892 -0.1288 0.0443  199 VAL A CG1 
455  C CG2 . VAL A 122 ? 0.5210 0.3105 0.3740 -0.0655 -0.1112 0.0395  199 VAL A CG2 
456  N N   . LEU A 123 ? 0.5786 0.3693 0.4677 -0.1005 -0.1085 0.0624  200 LEU A N   
457  C CA  . LEU A 123 ? 0.5727 0.3731 0.4828 -0.1149 -0.1076 0.0716  200 LEU A CA  
458  C C   . LEU A 123 ? 0.6216 0.4237 0.5484 -0.1272 -0.1219 0.0699  200 LEU A C   
459  O O   . LEU A 123 ? 0.6521 0.4262 0.5638 -0.1287 -0.1359 0.0635  200 LEU A O   
460  C CB  . LEU A 123 ? 0.5931 0.3674 0.4892 -0.1182 -0.1064 0.0769  200 LEU A CB  
461  C CG  . LEU A 123 ? 0.6471 0.4221 0.5622 -0.1356 -0.1073 0.0873  200 LEU A CG  
462  C CD1 . LEU A 123 ? 0.6297 0.4419 0.5701 -0.1391 -0.0939 0.0966  200 LEU A CD1 
463  C CD2 . LEU A 123 ? 0.6461 0.3899 0.5414 -0.1362 -0.1061 0.0919  200 LEU A CD2 
464  N N   . TYR A 124 ? 0.5502 0.3851 0.5073 -0.1346 -0.1189 0.0753  201 TYR A N   
465  C CA  . TYR A 124 ? 0.5493 0.3951 0.5298 -0.1462 -0.1323 0.0746  201 TYR A CA  
466  C C   . TYR A 124 ? 0.6319 0.4797 0.6350 -0.1648 -0.1342 0.0845  201 TYR A C   
467  O O   . TYR A 124 ? 0.6552 0.5190 0.6705 -0.1681 -0.1194 0.0952  201 TYR A O   
468  C CB  . TYR A 124 ? 0.5283 0.4116 0.5303 -0.1412 -0.1279 0.0744  201 TYR A CB  
469  C CG  . TYR A 124 ? 0.5392 0.4171 0.5188 -0.1244 -0.1271 0.0650  201 TYR A CG  
470  C CD1 . TYR A 124 ? 0.5771 0.4377 0.5426 -0.1204 -0.1421 0.0557  201 TYR A CD1 
471  C CD2 . TYR A 124 ? 0.5293 0.4157 0.4991 -0.1126 -0.1118 0.0655  201 TYR A CD2 
472  C CE1 . TYR A 124 ? 0.5863 0.4394 0.5294 -0.1051 -0.1395 0.0486  201 TYR A CE1 
473  C CE2 . TYR A 124 ? 0.5302 0.4099 0.4807 -0.0990 -0.1104 0.0580  201 TYR A CE2 
474  C CZ  . TYR A 124 ? 0.6098 0.4732 0.5473 -0.0953 -0.1232 0.0503  201 TYR A CZ  
475  O OH  . TYR A 124 ? 0.5859 0.4414 0.5037 -0.0822 -0.1202 0.0445  201 TYR A OH  
476  N N   . THR A 125 ? 0.5769 0.4055 0.5832 -0.1768 -0.1525 0.0812  202 THR A N   
477  C CA  . THR A 125 ? 0.5858 0.4132 0.6163 -0.1978 -0.1575 0.0904  202 THR A CA  
478  C C   . THR A 125 ? 0.6401 0.4877 0.7029 -0.2101 -0.1745 0.0882  202 THR A C   
479  O O   . THR A 125 ? 0.6564 0.4903 0.7328 -0.2282 -0.1895 0.0896  202 THR A O   
480  C CB  . THR A 125 ? 0.6652 0.4446 0.6679 -0.2025 -0.1642 0.0894  202 THR A CB  
481  O OG1 . THR A 125 ? 0.7496 0.4960 0.7237 -0.1955 -0.1819 0.0755  202 THR A OG1 
482  C CG2 . THR A 125 ? 0.6355 0.4031 0.6143 -0.1914 -0.1463 0.0944  202 THR A CG2 
483  N N   . ASP A 126 ? 0.5616 0.4417 0.6367 -0.1997 -0.1724 0.0846  203 ASP A N   
484  C CA  . ASP A 126 ? 0.5571 0.4616 0.6608 -0.2054 -0.1877 0.0813  203 ASP A CA  
485  C C   . ASP A 126 ? 0.5701 0.5260 0.7204 -0.2122 -0.1761 0.0933  203 ASP A C   
486  O O   . ASP A 126 ? 0.5130 0.4902 0.6634 -0.2011 -0.1557 0.0987  203 ASP A O   
487  C CB  . ASP A 126 ? 0.5747 0.4745 0.6540 -0.1863 -0.1941 0.0687  203 ASP A CB  
488  C CG  . ASP A 126 ? 0.7584 0.6616 0.8485 -0.1894 -0.2181 0.0604  203 ASP A CG  
489  O OD1 . ASP A 126 ? 0.7636 0.7047 0.8957 -0.1986 -0.2221 0.0658  203 ASP A OD1 
490  O OD2 . ASP A 126 ? 0.8505 0.7198 0.9063 -0.1808 -0.2324 0.0486  203 ASP A OD2 
491  N N   . LYS A 127 ? 0.5640 0.5401 0.7542 -0.2300 -0.1897 0.0974  204 LYS A N   
492  C CA  . LYS A 127 ? 0.5380 0.5665 0.7775 -0.2370 -0.1791 0.1098  204 LYS A CA  
493  C C   . LYS A 127 ? 0.5433 0.6085 0.7946 -0.2201 -0.1771 0.1057  204 LYS A C   
494  O O   . LYS A 127 ? 0.5422 0.6508 0.8267 -0.2192 -0.1623 0.1162  204 LYS A O   
495  C CB  . LYS A 127 ? 0.5702 0.6100 0.8528 -0.2636 -0.1919 0.1179  204 LYS A CB  
496  N N   . THR A 128 ? 0.4552 0.5011 0.6760 -0.2050 -0.1898 0.0913  205 THR A N   
497  C CA  . THR A 128 ? 0.4323 0.5038 0.6555 -0.1869 -0.1885 0.0865  205 THR A CA  
498  C C   . THR A 128 ? 0.4740 0.5707 0.6993 -0.1742 -0.1613 0.0944  205 THR A C   
499  O O   . THR A 128 ? 0.4638 0.5393 0.6606 -0.1688 -0.1467 0.0953  205 THR A O   
500  C CB  . THR A 128 ? 0.5726 0.6086 0.7509 -0.1714 -0.2005 0.0715  205 THR A CB  
501  O OG1 . THR A 128 ? 0.6119 0.6206 0.7830 -0.1815 -0.2262 0.0635  205 THR A OG1 
502  C CG2 . THR A 128 ? 0.5307 0.5878 0.7084 -0.1529 -0.2003 0.0668  205 THR A CG2 
503  N N   . TYR A 129 ? 0.4438 0.5851 0.7020 -0.1686 -0.1554 0.0996  206 TYR A N   
504  C CA  . TYR A 129 ? 0.4266 0.5952 0.6901 -0.1559 -0.1308 0.1073  206 TYR A CA  
505  C C   . TYR A 129 ? 0.4829 0.6240 0.7009 -0.1395 -0.1175 0.1015  206 TYR A C   
506  O O   . TYR A 129 ? 0.4747 0.6229 0.6883 -0.1349 -0.0974 0.1086  206 TYR A O   
507  C CB  . TYR A 129 ? 0.4279 0.6400 0.7222 -0.1457 -0.1312 0.1089  206 TYR A CB  
508  C CG  . TYR A 129 ? 0.4622 0.6621 0.7278 -0.1253 -0.1376 0.0968  206 TYR A CG  
509  C CD1 . TYR A 129 ? 0.4964 0.6756 0.7489 -0.1250 -0.1611 0.0858  206 TYR A CD1 
510  C CD2 . TYR A 129 ? 0.4730 0.6772 0.7202 -0.1061 -0.1202 0.0962  206 TYR A CD2 
511  C CE1 . TYR A 129 ? 0.5199 0.6853 0.7436 -0.1060 -0.1656 0.0760  206 TYR A CE1 
512  C CE2 . TYR A 129 ? 0.4915 0.6806 0.7111 -0.0885 -0.1254 0.0860  206 TYR A CE2 
513  C CZ  . TYR A 129 ? 0.6209 0.7909 0.8289 -0.0885 -0.1472 0.0766  206 TYR A CZ  
514  O OH  . TYR A 129 ? 0.6460 0.7991 0.8248 -0.0709 -0.1508 0.0679  206 TYR A OH  
515  N N   . ALA A 130 ? 0.4399 0.5506 0.6247 -0.1305 -0.1290 0.0891  207 ALA A N   
516  C CA  . ALA A 130 ? 0.4358 0.5195 0.5801 -0.1170 -0.1192 0.0831  207 ALA A CA  
517  C C   . ALA A 130 ? 0.5037 0.5462 0.6160 -0.1177 -0.1337 0.0731  207 ALA A C   
518  O O   . ALA A 130 ? 0.4994 0.5353 0.6130 -0.1197 -0.1525 0.0670  207 ALA A O   
519  C CB  . ALA A 130 ? 0.4378 0.5351 0.5756 -0.0985 -0.1127 0.0795  207 ALA A CB  
520  N N   . MET A 131 ? 0.4569 0.4725 0.5406 -0.1157 -0.1250 0.0719  208 MET A N   
521  C CA  . MET A 131 ? 0.4563 0.4323 0.5064 -0.1138 -0.1336 0.0638  208 MET A CA  
522  C C   . MET A 131 ? 0.5085 0.4726 0.5310 -0.0998 -0.1205 0.0605  208 MET A C   
523  O O   . MET A 131 ? 0.4950 0.4768 0.5235 -0.0951 -0.1057 0.0650  208 MET A O   
524  C CB  . MET A 131 ? 0.4921 0.4477 0.5395 -0.1275 -0.1365 0.0674  208 MET A CB  
525  C CG  . MET A 131 ? 0.5495 0.5075 0.6203 -0.1436 -0.1535 0.0689  208 MET A CG  
526  S SD  . MET A 131 ? 0.6240 0.5652 0.6839 -0.1407 -0.1794 0.0566  208 MET A SD  
527  C CE  . MET A 131 ? 0.5889 0.4768 0.5990 -0.1343 -0.1835 0.0480  208 MET A CE  
528  N N   . GLY A 132 ? 0.4690 0.4044 0.4620 -0.0925 -0.1262 0.0526  209 GLY A N   
529  C CA  . GLY A 132 ? 0.4518 0.3765 0.4215 -0.0804 -0.1148 0.0496  209 GLY A CA  
530  C C   . GLY A 132 ? 0.5296 0.4264 0.4707 -0.0722 -0.1217 0.0420  209 GLY A C   
531  O O   . GLY A 132 ? 0.5642 0.4481 0.5001 -0.0742 -0.1367 0.0380  209 GLY A O   
532  N N   . HIS A 133 ? 0.4745 0.3610 0.3965 -0.0630 -0.1110 0.0402  210 HIS A N   
533  C CA  . HIS A 133 ? 0.4984 0.3589 0.3923 -0.0539 -0.1141 0.0346  210 HIS A CA  
534  C C   . HIS A 133 ? 0.5653 0.4278 0.4500 -0.0433 -0.1042 0.0334  210 HIS A C   
535  O O   . HIS A 133 ? 0.5464 0.4270 0.4435 -0.0428 -0.0946 0.0360  210 HIS A O   
536  C CB  . HIS A 133 ? 0.5134 0.3505 0.3890 -0.0542 -0.1122 0.0340  210 HIS A CB  
537  C CG  . HIS A 133 ? 0.5391 0.3845 0.4195 -0.0549 -0.0988 0.0381  210 HIS A CG  
538  N ND1 . HIS A 133 ? 0.5642 0.4201 0.4603 -0.0640 -0.0971 0.0431  210 HIS A ND1 
539  C CD2 . HIS A 133 ? 0.5642 0.4088 0.4359 -0.0476 -0.0875 0.0380  210 HIS A CD2 
540  C CE1 . HIS A 133 ? 0.5504 0.4102 0.4440 -0.0607 -0.0858 0.0453  210 HIS A CE1 
541  N NE2 . HIS A 133 ? 0.5511 0.4058 0.4322 -0.0515 -0.0804 0.0420  210 HIS A NE2 
542  N N   . LEU A 134 ? 0.5179 0.3590 0.3784 -0.0345 -0.1063 0.0296  211 LEU A N   
543  C CA  . LEU A 134 ? 0.5006 0.3386 0.3501 -0.0252 -0.0968 0.0294  211 LEU A CA  
544  C C   . LEU A 134 ? 0.5889 0.4075 0.4179 -0.0201 -0.0886 0.0293  211 LEU A C   
545  O O   . LEU A 134 ? 0.6106 0.4089 0.4213 -0.0172 -0.0947 0.0269  211 LEU A O   
546  C CB  . LEU A 134 ? 0.5049 0.3356 0.3432 -0.0173 -0.1051 0.0267  211 LEU A CB  
547  C CG  . LEU A 134 ? 0.5416 0.3869 0.3963 -0.0204 -0.1192 0.0256  211 LEU A CG  
548  C CD1 . LEU A 134 ? 0.5440 0.3758 0.3805 -0.0103 -0.1289 0.0223  211 LEU A CD1 
549  C CD2 . LEU A 134 ? 0.5721 0.4457 0.4526 -0.0230 -0.1134 0.0289  211 LEU A CD2 
550  N N   . ILE A 135 ? 0.5440 0.3689 0.3762 -0.0186 -0.0753 0.0316  212 ILE A N   
551  C CA  . ILE A 135 ? 0.5502 0.3622 0.3678 -0.0131 -0.0656 0.0326  212 ILE A CA  
552  C C   . ILE A 135 ? 0.6116 0.4137 0.4154 -0.0052 -0.0615 0.0330  212 ILE A C   
553  O O   . ILE A 135 ? 0.6145 0.4261 0.4275 -0.0059 -0.0567 0.0341  212 ILE A O   
554  C CB  . ILE A 135 ? 0.5611 0.3865 0.3926 -0.0170 -0.0552 0.0352  212 ILE A CB  
555  C CG1 . ILE A 135 ? 0.5629 0.3907 0.4000 -0.0221 -0.0592 0.0355  212 ILE A CG1 
556  C CG2 . ILE A 135 ? 0.5384 0.3558 0.3601 -0.0108 -0.0439 0.0372  212 ILE A CG2 
557  C CD1 . ILE A 135 ? 0.6252 0.4693 0.4776 -0.0261 -0.0523 0.0377  212 ILE A CD1 
558  N N   . GLN A 136 ? 0.5628 0.3432 0.3421 0.0030  -0.0643 0.0318  213 GLN A N   
559  C CA  . GLN A 136 ? 0.5780 0.3445 0.3388 0.0120  -0.0615 0.0327  213 GLN A CA  
560  C C   . GLN A 136 ? 0.6641 0.4164 0.4074 0.0196  -0.0476 0.0366  213 GLN A C   
561  O O   . GLN A 136 ? 0.7035 0.4495 0.4396 0.0220  -0.0438 0.0369  213 GLN A O   
562  C CB  . GLN A 136 ? 0.6219 0.3737 0.3649 0.0176  -0.0770 0.0286  213 GLN A CB  
563  C CG  . GLN A 136 ? 0.6661 0.4356 0.4305 0.0098  -0.0908 0.0259  213 GLN A CG  
564  C CD  . GLN A 136 ? 0.7689 0.5257 0.5181 0.0153  -0.1075 0.0216  213 GLN A CD  
565  O OE1 . GLN A 136 ? 0.7442 0.4812 0.4738 0.0183  -0.1163 0.0181  213 GLN A OE1 
566  N NE2 . GLN A 136 ? 0.4246 0.1914 0.1814 0.0177  -0.1130 0.0215  213 GLN A NE2 
567  N N   . ARG A 137 ? 0.6067 0.3526 0.3420 0.0244  -0.0395 0.0400  214 ARG A N   
568  C CA  . ARG A 137 ? 0.5992 0.3323 0.3191 0.0314  -0.0242 0.0456  214 ARG A CA  
569  C C   . ARG A 137 ? 0.6592 0.3667 0.3456 0.0442  -0.0265 0.0462  214 ARG A C   
570  O O   . ARG A 137 ? 0.6581 0.3620 0.3407 0.0460  -0.0317 0.0458  214 ARG A O   
571  C CB  . ARG A 137 ? 0.5844 0.3289 0.3228 0.0250  -0.0125 0.0502  214 ARG A CB  
572  C CG  . ARG A 137 ? 0.6635 0.3990 0.3931 0.0295  0.0051  0.0578  214 ARG A CG  
573  C CD  . ARG A 137 ? 0.6378 0.3806 0.3849 0.0216  0.0132  0.0616  214 ARG A CD  
574  N NE  . ARG A 137 ? 0.6662 0.4001 0.4071 0.0242  0.0307  0.0703  214 ARG A NE  
575  C CZ  . ARG A 137 ? 0.7457 0.4736 0.4900 0.0203  0.0389  0.0754  214 ARG A CZ  
576  N NH1 . ARG A 137 ? 0.7548 0.4819 0.5043 0.0159  0.0304  0.0717  214 ARG A NH1 
577  N NH2 . ARG A 137 ? 0.5547 0.2765 0.2969 0.0211  0.0561  0.0848  214 ARG A NH2 
578  N N   . LYS A 138 ? 0.6317 0.3200 0.2913 0.0548  -0.0229 0.0470  215 LYS A N   
579  C CA  . LYS A 138 ? 0.6504 0.3107 0.2720 0.0694  -0.0242 0.0478  215 LYS A CA  
580  C C   . LYS A 138 ? 0.6968 0.3514 0.3116 0.0741  -0.0018 0.0577  215 LYS A C   
581  O O   . LYS A 138 ? 0.7184 0.3727 0.3303 0.0778  0.0120  0.0620  215 LYS A O   
582  C CB  . LYS A 138 ? 0.6985 0.3374 0.2902 0.0797  -0.0343 0.0424  215 LYS A CB  
583  C CG  . LYS A 138 ? 0.8635 0.4700 0.4099 0.0969  -0.0380 0.0421  215 LYS A CG  
584  C CD  . LYS A 138 ? 0.8842 0.4856 0.4235 0.0998  -0.0468 0.0420  215 LYS A CD  
585  N N   . LYS A 139 ? 0.6133 0.2659 0.2297 0.0729  0.0023  0.0618  216 LYS A N   
586  C CA  . LYS A 139 ? 0.6189 0.2658 0.2328 0.0742  0.0230  0.0722  216 LYS A CA  
587  C C   . LYS A 139 ? 0.7407 0.3604 0.3143 0.0911  0.0338  0.0780  216 LYS A C   
588  O O   . LYS A 139 ? 0.7736 0.3704 0.3131 0.1038  0.0224  0.0743  216 LYS A O   
589  C CB  . LYS A 139 ? 0.6468 0.2901 0.2644 0.0709  0.0214  0.0742  216 LYS A CB  
590  C CG  . LYS A 139 ? 0.7513 0.4197 0.4073 0.0552  0.0168  0.0708  216 LYS A CG  
591  C CD  . LYS A 139 ? 0.8050 0.4674 0.4579 0.0565  0.0073  0.0686  216 LYS A CD  
592  C CE  . LYS A 139 ? 0.6933 0.3442 0.3452 0.0544  0.0199  0.0760  216 LYS A CE  
593  N NZ  . LYS A 139 ? 1.0925 0.7133 0.7067 0.0691  0.0229  0.0813  216 LYS A NZ  
594  N N   . VAL A 140 ? 0.7136 0.3363 0.2907 0.0923  0.0556  0.0873  217 VAL A N   
595  C CA  . VAL A 140 ? 0.7620 0.3589 0.2994 0.1100  0.0697  0.0947  217 VAL A CA  
596  C C   . VAL A 140 ? 0.8612 0.4358 0.3759 0.1158  0.0766  0.1024  217 VAL A C   
597  O O   . VAL A 140 ? 0.9237 0.4689 0.3940 0.1333  0.0770  0.1043  217 VAL A O   
598  C CB  . VAL A 140 ? 0.7968 0.4050 0.3436 0.1123  0.0919  0.1030  217 VAL A CB  
599  C CG1 . VAL A 140 ? 0.7799 0.4115 0.3667 0.0971  0.1098  0.1131  217 VAL A CG1 
600  C CG2 . VAL A 140 ? 0.8248 0.4046 0.3249 0.1339  0.1050  0.1093  217 VAL A CG2 
601  N N   . HIS A 141 ? 0.7804 0.3665 0.3229 0.1018  0.0795  0.1057  218 HIS A N   
602  C CA  . HIS A 141 ? 0.8084 0.3738 0.3344 0.1048  0.0861  0.1133  218 HIS A CA  
603  C C   . HIS A 141 ? 0.8015 0.3694 0.3377 0.0987  0.0666  0.1053  218 HIS A C   
604  O O   . HIS A 141 ? 0.7708 0.3640 0.3433 0.0843  0.0581  0.0988  218 HIS A O   
605  C CB  . HIS A 141 ? 0.8253 0.3980 0.3741 0.0941  0.1106  0.1266  218 HIS A CB  
606  C CG  . HIS A 141 ? 0.8878 0.4589 0.4268 0.1019  0.1332  0.1372  218 HIS A CG  
607  N ND1 . HIS A 141 ? 0.8981 0.4879 0.4699 0.0897  0.1538  0.1479  218 HIS A ND1 
608  C CD2 . HIS A 141 ? 0.9404 0.4932 0.4400 0.1216  0.1379  0.1387  218 HIS A CD2 
609  C CE1 . HIS A 141 ? 0.9177 0.5023 0.4710 0.1027  0.1723  0.1567  218 HIS A CE1 
610  N NE2 . HIS A 141 ? 0.9480 0.5087 0.4553 0.1229  0.1638  0.1513  218 HIS A NE2 
611  N N   . VAL A 142 ? 0.7381 0.2800 0.2407 0.1114  0.0592  0.1056  219 VAL A N   
612  C CA  . VAL A 142 ? 0.7069 0.2506 0.2163 0.1092  0.0414  0.0987  219 VAL A CA  
613  C C   . VAL A 142 ? 0.7782 0.2960 0.2674 0.1146  0.0521  0.1085  219 VAL A C   
614  O O   . VAL A 142 ? 0.8043 0.2952 0.2576 0.1275  0.0648  0.1177  219 VAL A O   
615  C CB  . VAL A 142 ? 0.7512 0.2916 0.2421 0.1203  0.0166  0.0876  219 VAL A CB  
616  C CG1 . VAL A 142 ? 0.7298 0.2825 0.2390 0.1162  -0.0007 0.0806  219 VAL A CG1 
617  C CG2 . VAL A 142 ? 0.7395 0.2979 0.2438 0.1159  0.0084  0.0797  219 VAL A CG2 
618  N N   . PHE A 143 ? 0.6733 0.1964 0.1826 0.1058  0.0475  0.1070  220 PHE A N   
619  C CA  . PHE A 143 ? 0.6887 0.1840 0.1783 0.1107  0.0563  0.1159  220 PHE A CA  
620  C C   . PHE A 143 ? 0.7358 0.2276 0.2205 0.1175  0.0370  0.1084  220 PHE A C   
621  O O   . PHE A 143 ? 0.6677 0.1859 0.1809 0.1102  0.0224  0.0981  220 PHE A O   
622  C CB  . PHE A 143 ? 0.6957 0.1954 0.2135 0.0929  0.0743  0.1238  220 PHE A CB  
623  C CG  . PHE A 143 ? 0.7080 0.2148 0.2350 0.0863  0.0949  0.1329  220 PHE A CG  
624  C CD1 . PHE A 143 ? 0.8022 0.2832 0.3040 0.0926  0.1162  0.1477  220 PHE A CD1 
625  C CD2 . PHE A 143 ? 0.6507 0.1906 0.2120 0.0747  0.0939  0.1274  220 PHE A CD2 
626  C CE1 . PHE A 143 ? 0.8034 0.2950 0.3177 0.0869  0.1370  0.1572  220 PHE A CE1 
627  C CE2 . PHE A 143 ? 0.6808 0.2299 0.2526 0.0703  0.1129  0.1360  220 PHE A CE2 
628  C CZ  . PHE A 143 ? 0.7105 0.2374 0.2612 0.0759  0.1348  0.1510  220 PHE A CZ  
629  N N   . GLY A 144 ? 0.7589 0.2185 0.2069 0.1327  0.0374  0.1141  221 GLY A N   
630  C CA  . GLY A 144 ? 0.7763 0.2297 0.2160 0.1427  0.0203  0.1086  221 GLY A CA  
631  C C   . GLY A 144 ? 0.8594 0.3419 0.3171 0.1445  -0.0038 0.0949  221 GLY A C   
632  O O   . GLY A 144 ? 0.9074 0.3975 0.3579 0.1492  -0.0131 0.0899  221 GLY A O   
633  N N   . ASP A 145 ? 0.7848 0.2844 0.2683 0.1394  -0.0130 0.0889  222 ASP A N   
634  C CA  . ASP A 145 ? 0.7490 0.2796 0.2546 0.1402  -0.0344 0.0773  222 ASP A CA  
635  C C   . ASP A 145 ? 0.7623 0.3280 0.3054 0.1234  -0.0366 0.0707  222 ASP A C   
636  O O   . ASP A 145 ? 0.7225 0.3152 0.2880 0.1217  -0.0524 0.0624  222 ASP A O   
637  C CB  . ASP A 145 ? 0.7678 0.3018 0.2801 0.1472  -0.0442 0.0741  222 ASP A CB  
638  C CG  . ASP A 145 ? 0.9215 0.4653 0.4616 0.1342  -0.0358 0.0735  222 ASP A CG  
639  O OD1 . ASP A 145 ? 0.9290 0.4785 0.4865 0.1177  -0.0229 0.0756  222 ASP A OD1 
640  O OD2 . ASP A 145 ? 1.0388 0.5853 0.5833 0.1414  -0.0433 0.0704  222 ASP A OD2 
641  N N   . GLU A 146 ? 0.7143 0.2802 0.2647 0.1116  -0.0207 0.0752  223 GLU A N   
642  C CA  . GLU A 146 ? 0.6640 0.2598 0.2462 0.0972  -0.0218 0.0699  223 GLU A CA  
643  C C   . GLU A 146 ? 0.7420 0.3460 0.3174 0.1028  -0.0370 0.0635  223 GLU A C   
644  O O   . GLU A 146 ? 0.7851 0.3676 0.3272 0.1170  -0.0422 0.0646  223 GLU A O   
645  C CB  . GLU A 146 ? 0.6641 0.2562 0.2508 0.0872  -0.0020 0.0769  223 GLU A CB  
646  C CG  . GLU A 146 ? 0.7185 0.3121 0.3257 0.0741  0.0115  0.0814  223 GLU A CG  
647  C CD  . GLU A 146 ? 0.9705 0.5645 0.5852 0.0649  0.0299  0.0888  223 GLU A CD  
648  O OE1 . GLU A 146 ? 0.7848 0.3660 0.3766 0.0733  0.0374  0.0941  223 GLU A OE1 
649  O OE2 . GLU A 146 ? 0.7976 0.4065 0.4418 0.0498  0.0361  0.0889  223 GLU A OE2 
650  N N   . LEU A 147 ? 0.6852 0.3172 0.2899 0.0917  -0.0439 0.0571  224 LEU A N   
651  C CA  . LEU A 147 ? 0.7000 0.3389 0.3020 0.0933  -0.0576 0.0510  224 LEU A CA  
652  C C   . LEU A 147 ? 0.8015 0.4356 0.3991 0.0885  -0.0447 0.0539  224 LEU A C   
653  O O   . LEU A 147 ? 0.7910 0.4346 0.4081 0.0778  -0.0299 0.0579  224 LEU A O   
654  C CB  . LEU A 147 ? 0.6649 0.3370 0.3037 0.0823  -0.0702 0.0439  224 LEU A CB  
655  C CG  . LEU A 147 ? 0.6907 0.3780 0.3444 0.0853  -0.0820 0.0408  224 LEU A CG  
656  C CD1 . LEU A 147 ? 0.6577 0.3783 0.3505 0.0720  -0.0850 0.0371  224 LEU A CD1 
657  C CD2 . LEU A 147 ? 0.6689 0.3501 0.3057 0.0976  -0.1008 0.0370  224 LEU A CD2 
658  N N   . SER A 148 ? 0.8026 0.4232 0.3759 0.0967  -0.0517 0.0513  225 SER A N   
659  C CA  . SER A 148 ? 0.7960 0.4116 0.3626 0.0953  -0.0403 0.0534  225 SER A CA  
660  C C   . SER A 148 ? 0.8056 0.4486 0.4073 0.0805  -0.0437 0.0487  225 SER A C   
661  O O   . SER A 148 ? 0.7677 0.4176 0.3805 0.0745  -0.0299 0.0521  225 SER A O   
662  C CB  . SER A 148 ? 0.8431 0.4337 0.3705 0.1097  -0.0488 0.0505  225 SER A CB  
663  O OG  . SER A 148 ? 1.0596 0.6285 0.5556 0.1242  -0.0581 0.0503  225 SER A OG  
664  N N   . LEU A 149 ? 0.7565 0.4162 0.3766 0.0751  -0.0621 0.0414  226 LEU A N   
665  C CA  . LEU A 149 ? 0.7138 0.3976 0.3649 0.0618  -0.0669 0.0373  226 LEU A CA  
666  C C   . LEU A 149 ? 0.6900 0.3995 0.3751 0.0512  -0.0650 0.0377  226 LEU A C   
667  O O   . LEU A 149 ? 0.6843 0.3993 0.3742 0.0538  -0.0732 0.0363  226 LEU A O   
668  C CB  . LEU A 149 ? 0.7207 0.4031 0.3670 0.0628  -0.0883 0.0297  226 LEU A CB  
669  C CG  . LEU A 149 ? 0.7465 0.4395 0.4092 0.0526  -0.0924 0.0263  226 LEU A CG  
670  C CD1 . LEU A 149 ? 0.7470 0.4229 0.3898 0.0572  -0.0808 0.0282  226 LEU A CD1 
671  C CD2 . LEU A 149 ? 0.7797 0.4729 0.4434 0.0508  -0.1149 0.0194  226 LEU A CD2 
672  N N   . VAL A 150 ? 0.6070 0.3308 0.3133 0.0411  -0.0535 0.0399  227 VAL A N   
673  C CA  . VAL A 150 ? 0.5681 0.3135 0.3032 0.0317  -0.0505 0.0400  227 VAL A CA  
674  C C   . VAL A 150 ? 0.5962 0.3642 0.3564 0.0214  -0.0565 0.0365  227 VAL A C   
675  O O   . VAL A 150 ? 0.5747 0.3438 0.3373 0.0174  -0.0521 0.0370  227 VAL A O   
676  C CB  . VAL A 150 ? 0.5843 0.3283 0.3251 0.0274  -0.0333 0.0452  227 VAL A CB  
677  C CG1 . VAL A 150 ? 0.5563 0.3202 0.3239 0.0180  -0.0325 0.0436  227 VAL A CG1 
678  C CG2 . VAL A 150 ? 0.5971 0.3181 0.3151 0.0358  -0.0250 0.0504  227 VAL A CG2 
679  N N   . THR A 151 ? 0.5390 0.3253 0.3180 0.0177  -0.0650 0.0339  228 THR A N   
680  C CA  . THR A 151 ? 0.5104 0.3174 0.3128 0.0077  -0.0672 0.0326  228 THR A CA  
681  C C   . THR A 151 ? 0.5300 0.3460 0.3453 0.0024  -0.0551 0.0345  228 THR A C   
682  O O   . THR A 151 ? 0.5117 0.3321 0.3324 0.0036  -0.0527 0.0345  228 THR A O   
683  C CB  . THR A 151 ? 0.5768 0.4017 0.3958 0.0055  -0.0791 0.0304  228 THR A CB  
684  O OG1 . THR A 151 ? 0.6499 0.4648 0.4568 0.0098  -0.0922 0.0280  228 THR A OG1 
685  C CG2 . THR A 151 ? 0.5362 0.3808 0.3777 -0.0049 -0.0791 0.0307  228 THR A CG2 
686  N N   . LEU A 152 ? 0.4661 0.2829 0.2847 -0.0025 -0.0485 0.0357  229 LEU A N   
687  C CA  . LEU A 152 ? 0.4435 0.2693 0.2751 -0.0081 -0.0393 0.0368  229 LEU A CA  
688  C C   . LEU A 152 ? 0.5164 0.3626 0.3671 -0.0141 -0.0434 0.0349  229 LEU A C   
689  O O   . LEU A 152 ? 0.5056 0.3587 0.3638 -0.0151 -0.0410 0.0340  229 LEU A O   
690  C CB  . LEU A 152 ? 0.4286 0.2509 0.2585 -0.0097 -0.0315 0.0391  229 LEU A CB  
691  C CG  . LEU A 152 ? 0.4868 0.2915 0.3000 -0.0038 -0.0229 0.0428  229 LEU A CG  
692  C CD1 . LEU A 152 ? 0.4780 0.2822 0.2901 -0.0030 -0.0157 0.0454  229 LEU A CD1 
693  C CD2 . LEU A 152 ? 0.5274 0.3293 0.3443 -0.0057 -0.0153 0.0451  229 LEU A CD2 
694  N N   . PHE A 153 ? 0.4765 0.3300 0.3327 -0.0174 -0.0491 0.0346  230 PHE A N   
695  C CA  . PHE A 153 ? 0.4561 0.3278 0.3287 -0.0228 -0.0515 0.0345  230 PHE A CA  
696  C C   . PHE A 153 ? 0.5165 0.3924 0.3932 -0.0246 -0.0611 0.0347  230 PHE A C   
697  O O   . PHE A 153 ? 0.5432 0.4061 0.4092 -0.0237 -0.0665 0.0340  230 PHE A O   
698  C CB  . PHE A 153 ? 0.4703 0.3470 0.3486 -0.0274 -0.0468 0.0355  230 PHE A CB  
699  C CG  . PHE A 153 ? 0.4869 0.3581 0.3623 -0.0266 -0.0391 0.0355  230 PHE A CG  
700  C CD1 . PHE A 153 ? 0.5281 0.4029 0.4082 -0.0273 -0.0355 0.0342  230 PHE A CD1 
701  C CD2 . PHE A 153 ? 0.5065 0.3679 0.3741 -0.0247 -0.0353 0.0371  230 PHE A CD2 
702  C CE1 . PHE A 153 ? 0.5464 0.4162 0.4269 -0.0286 -0.0293 0.0347  230 PHE A CE1 
703  C CE2 . PHE A 153 ? 0.5397 0.3995 0.4091 -0.0247 -0.0272 0.0384  230 PHE A CE2 
704  C CZ  . PHE A 153 ? 0.5217 0.3859 0.3990 -0.0278 -0.0247 0.0374  230 PHE A CZ  
705  N N   . ARG A 154 ? 0.4670 0.3608 0.3591 -0.0270 -0.0633 0.0356  231 ARG A N   
706  C CA  . ARG A 154 ? 0.4706 0.3742 0.3739 -0.0308 -0.0722 0.0368  231 ARG A CA  
707  C C   . ARG A 154 ? 0.5455 0.4685 0.4666 -0.0371 -0.0686 0.0405  231 ARG A C   
708  O O   . ARG A 154 ? 0.5485 0.4812 0.4733 -0.0346 -0.0611 0.0410  231 ARG A O   
709  C CB  . ARG A 154 ? 0.4717 0.3798 0.3769 -0.0246 -0.0781 0.0355  231 ARG A CB  
710  C CG  . ARG A 154 ? 0.6075 0.5360 0.5333 -0.0280 -0.0860 0.0375  231 ARG A CG  
711  C CD  . ARG A 154 ? 0.6386 0.5690 0.5635 -0.0200 -0.0945 0.0355  231 ARG A CD  
712  N NE  . ARG A 154 ? 0.5643 0.4955 0.4835 -0.0100 -0.0872 0.0348  231 ARG A NE  
713  C CZ  . ARG A 154 ? 0.6771 0.6283 0.6107 -0.0046 -0.0865 0.0361  231 ARG A CZ  
714  N NH1 . ARG A 154 ? 0.4759 0.4521 0.4342 -0.0087 -0.0920 0.0391  231 ARG A NH1 
715  N NH2 . ARG A 154 ? 0.5784 0.5243 0.5022 0.0053  -0.0803 0.0349  231 ARG A NH2 
716  N N   . CYS A 155 ? 0.5069 0.4316 0.4356 -0.0450 -0.0738 0.0432  232 CYS A N   
717  C CA  . CYS A 155 ? 0.4911 0.4311 0.4356 -0.0523 -0.0709 0.0485  232 CYS A CA  
718  C C   . CYS A 155 ? 0.5486 0.5054 0.5128 -0.0562 -0.0776 0.0512  232 CYS A C   
719  O O   . CYS A 155 ? 0.5828 0.5320 0.5456 -0.0571 -0.0889 0.0484  232 CYS A O   
720  C CB  . CYS A 155 ? 0.5001 0.4260 0.4389 -0.0591 -0.0733 0.0502  232 CYS A CB  
721  S SG  A CYS A 155 ? 0.5467 0.4742 0.4820 -0.0596 -0.0626 0.0538  232 CYS A SG  
722  S SG  B CYS A 155 ? 0.5561 0.4596 0.4719 -0.0536 -0.0696 0.0465  232 CYS A SG  
723  N N   . ILE A 156 ? 0.4459 0.4243 0.4288 -0.0601 -0.0718 0.0573  233 ILE A N   
724  C CA  . ILE A 156 ? 0.4121 0.4110 0.4203 -0.0667 -0.0772 0.0620  233 ILE A CA  
725  C C   . ILE A 156 ? 0.4645 0.4761 0.4856 -0.0740 -0.0680 0.0706  233 ILE A C   
726  O O   . ILE A 156 ? 0.4670 0.4818 0.4805 -0.0686 -0.0561 0.0725  233 ILE A O   
727  C CB  . ILE A 156 ? 0.4282 0.4485 0.4504 -0.0587 -0.0787 0.0613  233 ILE A CB  
728  C CG1 . ILE A 156 ? 0.4127 0.4163 0.4162 -0.0491 -0.0858 0.0534  233 ILE A CG1 
729  C CG2 . ILE A 156 ? 0.4386 0.4824 0.4919 -0.0675 -0.0865 0.0666  233 ILE A CG2 
730  C CD1 . ILE A 156 ? 0.4701 0.4893 0.4816 -0.0388 -0.0878 0.0522  233 ILE A CD1 
731  N N   . GLN A 157 ? 0.3993 0.4149 0.4375 -0.0866 -0.0742 0.0758  234 GLN A N   
732  C CA  . GLN A 157 ? 0.3730 0.4006 0.4267 -0.0958 -0.0660 0.0861  234 GLN A CA  
733  C C   . GLN A 157 ? 0.4468 0.4987 0.5346 -0.1059 -0.0721 0.0921  234 GLN A C   
734  O O   . GLN A 157 ? 0.4578 0.5017 0.5515 -0.1131 -0.0879 0.0882  234 GLN A O   
735  C CB  . GLN A 157 ? 0.3811 0.3819 0.4201 -0.1042 -0.0683 0.0875  234 GLN A CB  
736  C CG  . GLN A 157 ? 0.4681 0.4527 0.4810 -0.0960 -0.0593 0.0857  234 GLN A CG  
737  C CD  . GLN A 157 ? 0.6365 0.6383 0.6507 -0.0900 -0.0443 0.0915  234 GLN A CD  
738  O OE1 . GLN A 157 ? 0.5910 0.6016 0.5995 -0.0788 -0.0391 0.0873  234 GLN A OE1 
739  N NE2 . GLN A 157 ? 0.4267 0.4301 0.4452 -0.0965 -0.0370 0.1012  234 GLN A NE2 
740  N N   . ASN A 158 ? 0.3843 0.4663 0.4949 -0.1063 -0.0599 0.1017  235 ASN A N   
741  C CA  . ASN A 158 ? 0.3684 0.4778 0.5171 -0.1177 -0.0639 0.1096  235 ASN A CA  
742  C C   . ASN A 158 ? 0.4973 0.5912 0.6505 -0.1355 -0.0666 0.1163  235 ASN A C   
743  O O   . ASN A 158 ? 0.5336 0.6057 0.6634 -0.1348 -0.0586 0.1181  235 ASN A O   
744  C CB  . ASN A 158 ? 0.2559 0.4025 0.4270 -0.1115 -0.0474 0.1192  235 ASN A CB  
745  C CG  . ASN A 158 ? 0.5785 0.7441 0.7525 -0.0952 -0.0468 0.1138  235 ASN A CG  
746  O OD1 . ASN A 158 ? 0.4109 0.5826 0.5720 -0.0807 -0.0328 0.1140  235 ASN A OD1 
747  N ND2 . ASN A 158 ? 0.5436 0.7183 0.7340 -0.0965 -0.0626 0.1090  235 ASN A ND2 
748  N N   . MET A 159 ? 0.4620 0.5647 0.6440 -0.1512 -0.0793 0.1196  236 MET A N   
749  C CA  . MET A 159 ? 0.4677 0.5514 0.6538 -0.1695 -0.0837 0.1258  236 MET A CA  
750  C C   . MET A 159 ? 0.5235 0.6405 0.7541 -0.1847 -0.0781 0.1403  236 MET A C   
751  O O   . MET A 159 ? 0.5222 0.6746 0.7855 -0.1845 -0.0814 0.1419  236 MET A O   
752  C CB  . MET A 159 ? 0.5100 0.5634 0.6853 -0.1773 -0.1075 0.1152  236 MET A CB  
753  C CG  . MET A 159 ? 0.5502 0.5741 0.6849 -0.1617 -0.1135 0.1011  236 MET A CG  
754  S SD  . MET A 159 ? 0.6037 0.5941 0.6965 -0.1530 -0.1006 0.1001  236 MET A SD  
755  C CE  . MET A 159 ? 0.5771 0.5371 0.6675 -0.1710 -0.1091 0.1047  236 MET A CE  
756  N N   . PRO A 160 ? 0.4806 0.5874 0.7148 -0.1983 -0.0700 0.1518  237 PRO A N   
757  C CA  . PRO A 160 ? 0.4887 0.6271 0.7687 -0.2154 -0.0642 0.1674  237 PRO A CA  
758  C C   . PRO A 160 ? 0.5716 0.7019 0.8764 -0.2374 -0.0875 0.1656  237 PRO A C   
759  O O   . PRO A 160 ? 0.5889 0.6792 0.8669 -0.2402 -0.1056 0.1540  237 PRO A O   
760  C CB  . PRO A 160 ? 0.5249 0.6492 0.7909 -0.2189 -0.0450 0.1802  237 PRO A CB  
761  C CG  . PRO A 160 ? 0.5888 0.6637 0.8073 -0.2132 -0.0522 0.1697  237 PRO A CG  
762  C CD  . PRO A 160 ? 0.5136 0.5799 0.7116 -0.1986 -0.0657 0.1520  237 PRO A CD  
763  N N   . GLU A 161 ? 0.5237 0.6916 0.8797 -0.2531 -0.0872 0.1773  238 GLU A N   
764  C CA  . GLU A 161 ? 0.5478 0.7108 0.9323 -0.2763 -0.1104 0.1764  238 GLU A CA  
765  C C   . GLU A 161 ? 0.6683 0.7861 1.0343 -0.2933 -0.1128 0.1810  238 GLU A C   
766  O O   . GLU A 161 ? 0.7053 0.7913 1.0650 -0.3062 -0.1365 0.1724  238 GLU A O   
767  C CB  . GLU A 161 ? 0.5608 0.7796 1.0098 -0.2902 -0.1067 0.1904  238 GLU A CB  
768  C CG  . GLU A 161 ? 0.5975 0.8492 1.0764 -0.2866 -0.1256 0.1816  238 GLU A CG  
769  N N   . THR A 162 ? 0.6362 0.7477 0.9886 -0.2912 -0.0889 0.1936  239 THR A N   
770  C CA  . THR A 162 ? 0.6607 0.7308 0.9948 -0.3052 -0.0870 0.2008  239 THR A CA  
771  C C   . THR A 162 ? 0.6894 0.7153 0.9646 -0.2879 -0.0817 0.1929  239 THR A C   
772  O O   . THR A 162 ? 0.6635 0.7005 0.9191 -0.2679 -0.0639 0.1934  239 THR A O   
773  C CB  . THR A 162 ? 0.7707 0.8660 1.1403 -0.3210 -0.0660 0.2243  239 THR A CB  
774  O OG1 . THR A 162 ? 0.7679 0.8198 1.1075 -0.3271 -0.0587 0.2316  239 THR A OG1 
775  C CG2 . THR A 162 ? 0.7540 0.8948 1.1349 -0.3040 -0.0386 0.2344  239 THR A CG2 
776  N N   . LEU A 163 ? 0.6682 0.6441 0.9165 -0.2958 -0.0974 0.1863  240 LEU A N   
777  C CA  . LEU A 163 ? 0.6834 0.6138 0.8777 -0.2812 -0.0957 0.1787  240 LEU A CA  
778  C C   . LEU A 163 ? 0.7287 0.6652 0.8946 -0.2547 -0.0921 0.1655  240 LEU A C   
779  O O   . LEU A 163 ? 0.7253 0.6589 0.8667 -0.2399 -0.0751 0.1685  240 LEU A O   
780  C CB  . LEU A 163 ? 0.7054 0.6214 0.8865 -0.2832 -0.0754 0.1944  240 LEU A CB  
781  C CG  . LEU A 163 ? 0.8183 0.7123 1.0155 -0.3090 -0.0791 0.2072  240 LEU A CG  
782  C CD1 . LEU A 163 ? 0.8358 0.7312 1.0295 -0.3099 -0.0537 0.2268  240 LEU A CD1 
783  C CD2 . LEU A 163 ? 0.8766 0.7117 1.0395 -0.3132 -0.0998 0.1961  240 LEU A CD2 
784  N N   . PRO A 164 ? 0.6668 0.6119 0.8356 -0.2485 -0.1079 0.1513  241 PRO A N   
785  C CA  . PRO A 164 ? 0.6266 0.5769 0.7701 -0.2248 -0.1031 0.1404  241 PRO A CA  
786  C C   . PRO A 164 ? 0.6699 0.5775 0.7662 -0.2128 -0.1041 0.1322  241 PRO A C   
787  O O   . PRO A 164 ? 0.6958 0.5667 0.7743 -0.2181 -0.1196 0.1254  241 PRO A O   
788  C CB  . PRO A 164 ? 0.6441 0.6081 0.8019 -0.2240 -0.1214 0.1290  241 PRO A CB  
789  C CG  . PRO A 164 ? 0.7281 0.6737 0.9000 -0.2442 -0.1419 0.1281  241 PRO A CG  
790  C CD  . PRO A 164 ? 0.6918 0.6418 0.8863 -0.2623 -0.1310 0.1450  241 PRO A CD  
791  N N   . ASN A 165 ? 0.6061 0.5183 0.6827 -0.1968 -0.0873 0.1336  242 ASN A N   
792  C CA  . ASN A 165 ? 0.6047 0.4844 0.6402 -0.1831 -0.0855 0.1271  242 ASN A CA  
793  C C   . ASN A 165 ? 0.5881 0.4880 0.6134 -0.1647 -0.0721 0.1243  242 ASN A C   
794  O O   . ASN A 165 ? 0.5587 0.4687 0.5816 -0.1604 -0.0565 0.1331  242 ASN A O   
795  C CB  . ASN A 165 ? 0.6588 0.5119 0.6801 -0.1891 -0.0788 0.1372  242 ASN A CB  
796  C CG  . ASN A 165 ? 0.8827 0.7034 0.9042 -0.2058 -0.0932 0.1384  242 ASN A CG  
797  O OD1 . ASN A 165 ? 0.8784 0.7080 0.9283 -0.2244 -0.0937 0.1488  242 ASN A OD1 
798  N ND2 . ASN A 165 ? 0.7259 0.5077 0.7158 -0.1995 -0.1049 0.1282  242 ASN A ND2 
799  N N   . ASN A 166 ? 0.5359 0.4408 0.5545 -0.1538 -0.0784 0.1124  243 ASN A N   
800  C CA  . ASN A 166 ? 0.5049 0.4256 0.5134 -0.1373 -0.0680 0.1083  243 ASN A CA  
801  C C   . ASN A 166 ? 0.5643 0.4636 0.5464 -0.1259 -0.0747 0.0963  243 ASN A C   
802  O O   . ASN A 166 ? 0.5770 0.4672 0.5574 -0.1267 -0.0874 0.0885  243 ASN A O   
803  C CB  . ASN A 166 ? 0.4420 0.3985 0.4750 -0.1349 -0.0650 0.1083  243 ASN A CB  
804  C CG  . ASN A 166 ? 0.6008 0.5864 0.6584 -0.1400 -0.0517 0.1211  243 ASN A CG  
805  O OD1 . ASN A 166 ? 0.5356 0.5216 0.5840 -0.1364 -0.0380 0.1286  243 ASN A OD1 
806  N ND2 . ASN A 166 ? 0.4315 0.4436 0.5204 -0.1469 -0.0551 0.1239  243 ASN A ND2 
807  N N   . SER A 167 ? 0.5190 0.4096 0.4799 -0.1150 -0.0667 0.0951  244 SER A N   
808  C CA  . SER A 167 ? 0.5081 0.3830 0.4470 -0.1035 -0.0705 0.0850  244 SER A CA  
809  C C   . SER A 167 ? 0.5429 0.4403 0.4862 -0.0941 -0.0645 0.0808  244 SER A C   
810  O O   . SER A 167 ? 0.5333 0.4513 0.4860 -0.0926 -0.0550 0.0858  244 SER A O   
811  C CB  . SER A 167 ? 0.5478 0.4031 0.4647 -0.0968 -0.0664 0.0860  244 SER A CB  
812  O OG  . SER A 167 ? 0.6084 0.4779 0.5244 -0.0913 -0.0550 0.0909  244 SER A OG  
813  N N   . CYS A 168 ? 0.4981 0.3901 0.4331 -0.0874 -0.0696 0.0722  245 CYS A N   
814  C CA  . CYS A 168 ? 0.4715 0.3798 0.4083 -0.0788 -0.0643 0.0681  245 CYS A CA  
815  C C   . CYS A 168 ? 0.5330 0.4278 0.4514 -0.0695 -0.0637 0.0616  245 CYS A C   
816  O O   . CYS A 168 ? 0.5524 0.4290 0.4593 -0.0679 -0.0702 0.0573  245 CYS A O   
817  C CB  . CYS A 168 ? 0.4673 0.3893 0.4183 -0.0802 -0.0695 0.0659  245 CYS A CB  
818  S SG  A CYS A 168 ? 0.4984 0.4424 0.4545 -0.0706 -0.0610 0.0638  245 CYS A SG  
819  S SG  B CYS A 168 ? 0.4982 0.4440 0.4561 -0.0713 -0.0606 0.0646  245 CYS A SG  
820  N N   . TYR A 169 ? 0.4769 0.3805 0.3924 -0.0633 -0.0559 0.0611  246 TYR A N   
821  C CA  . TYR A 169 ? 0.4634 0.3599 0.3672 -0.0554 -0.0539 0.0561  246 TYR A CA  
822  C C   . TYR A 169 ? 0.5278 0.4357 0.4356 -0.0511 -0.0510 0.0520  246 TYR A C   
823  O O   . TYR A 169 ? 0.5624 0.4853 0.4782 -0.0511 -0.0475 0.0534  246 TYR A O   
824  C CB  . TYR A 169 ? 0.4587 0.3555 0.3569 -0.0523 -0.0493 0.0585  246 TYR A CB  
825  C CG  . TYR A 169 ? 0.4700 0.3644 0.3615 -0.0450 -0.0474 0.0541  246 TYR A CG  
826  C CD1 . TYR A 169 ? 0.4855 0.3918 0.3812 -0.0420 -0.0443 0.0508  246 TYR A CD1 
827  C CD2 . TYR A 169 ? 0.4841 0.3643 0.3659 -0.0412 -0.0489 0.0536  246 TYR A CD2 
828  C CE1 . TYR A 169 ? 0.4914 0.3976 0.3858 -0.0375 -0.0429 0.0474  246 TYR A CE1 
829  C CE2 . TYR A 169 ? 0.4952 0.3776 0.3755 -0.0347 -0.0461 0.0507  246 TYR A CE2 
830  C CZ  . TYR A 169 ? 0.6062 0.5029 0.4947 -0.0339 -0.0433 0.0480  246 TYR A CZ  
831  O OH  . TYR A 169 ? 0.6276 0.5288 0.5190 -0.0295 -0.0409 0.0459  246 TYR A OH  
832  N N   . SER A 170 ? 0.4412 0.3405 0.3416 -0.0467 -0.0516 0.0476  247 SER A N   
833  C CA  . SER A 170 ? 0.4241 0.3289 0.3256 -0.0428 -0.0483 0.0441  247 SER A CA  
834  C C   . SER A 170 ? 0.4733 0.3691 0.3673 -0.0388 -0.0456 0.0418  247 SER A C   
835  O O   . SER A 170 ? 0.5116 0.3950 0.3972 -0.0371 -0.0470 0.0421  247 SER A O   
836  C CB  . SER A 170 ? 0.4570 0.3624 0.3606 -0.0423 -0.0517 0.0426  247 SER A CB  
837  O OG  . SER A 170 ? 0.5173 0.4292 0.4228 -0.0388 -0.0480 0.0404  247 SER A OG  
838  N N   . ALA A 171 ? 0.3875 0.2891 0.2845 -0.0371 -0.0415 0.0397  248 ALA A N   
839  C CA  . ALA A 171 ? 0.3973 0.2947 0.2926 -0.0347 -0.0377 0.0386  248 ALA A CA  
840  C C   . ALA A 171 ? 0.4809 0.3819 0.3807 -0.0352 -0.0350 0.0361  248 ALA A C   
841  O O   . ALA A 171 ? 0.4911 0.3985 0.3938 -0.0362 -0.0363 0.0344  248 ALA A O   
842  C CB  . ALA A 171 ? 0.4137 0.3159 0.3118 -0.0339 -0.0369 0.0398  248 ALA A CB  
843  N N   . GLY A 172 ? 0.4357 0.3316 0.3354 -0.0343 -0.0306 0.0363  249 GLY A N   
844  C CA  . GLY A 172 ? 0.4334 0.3289 0.3375 -0.0364 -0.0278 0.0346  249 GLY A CA  
845  C C   . GLY A 172 ? 0.4730 0.3652 0.3803 -0.0365 -0.0213 0.0370  249 GLY A C   
846  O O   . GLY A 172 ? 0.4986 0.3903 0.4040 -0.0333 -0.0184 0.0398  249 GLY A O   
847  N N   . ILE A 173 ? 0.4019 0.2909 0.3136 -0.0399 -0.0184 0.0365  250 ILE A N   
848  C CA  . ILE A 173 ? 0.4050 0.2919 0.3225 -0.0414 -0.0102 0.0405  250 ILE A CA  
849  C C   . ILE A 173 ? 0.4754 0.3444 0.3790 -0.0385 -0.0050 0.0431  250 ILE A C   
850  O O   . ILE A 173 ? 0.5078 0.3680 0.4033 -0.0379 -0.0087 0.0406  250 ILE A O   
851  C CB  . ILE A 173 ? 0.4327 0.3294 0.3689 -0.0493 -0.0107 0.0391  250 ILE A CB  
852  C CG1 . ILE A 173 ? 0.4238 0.3373 0.3703 -0.0502 -0.0178 0.0359  250 ILE A CG1 
853  C CG2 . ILE A 173 ? 0.4408 0.3394 0.3879 -0.0518 -0.0007 0.0451  250 ILE A CG2 
854  C CD1 . ILE A 173 ? 0.4129 0.3346 0.3745 -0.0576 -0.0233 0.0319  250 ILE A CD1 
855  N N   . ALA A 174 ? 0.3979 0.2610 0.2969 -0.0350 0.0038  0.0486  251 ALA A N   
856  C CA  . ALA A 174 ? 0.3982 0.2424 0.2816 -0.0314 0.0096  0.0520  251 ALA A CA  
857  C C   . ALA A 174 ? 0.4764 0.3188 0.3637 -0.0314 0.0233  0.0597  251 ALA A C   
858  O O   . ALA A 174 ? 0.4470 0.3021 0.3445 -0.0302 0.0284  0.0625  251 ALA A O   
859  C CB  . ALA A 174 ? 0.4032 0.2350 0.2643 -0.0223 0.0050  0.0509  251 ALA A CB  
860  N N   . LYS A 175 ? 0.4573 0.2839 0.3369 -0.0321 0.0300  0.0638  252 LYS A N   
861  C CA  . LYS A 175 ? 0.4777 0.3013 0.3591 -0.0315 0.0450  0.0728  252 LYS A CA  
862  C C   . LYS A 175 ? 0.5544 0.3615 0.4069 -0.0179 0.0495  0.0759  252 LYS A C   
863  O O   . LYS A 175 ? 0.5604 0.3492 0.3906 -0.0122 0.0440  0.0737  252 LYS A O   
864  C CB  . LYS A 175 ? 0.5225 0.3345 0.4088 -0.0396 0.0513  0.0771  252 LYS A CB  
865  C CG  . LYS A 175 ? 0.5478 0.3489 0.4280 -0.0372 0.0691  0.0887  252 LYS A CG  
866  C CD  . LYS A 175 ? 0.6276 0.4492 0.5397 -0.0471 0.0794  0.0952  252 LYS A CD  
867  C CE  . LYS A 175 ? 0.7550 0.5640 0.6632 -0.0474 0.0983  0.1080  252 LYS A CE  
868  N NZ  . LYS A 175 ? 0.8803 0.6777 0.7998 -0.0615 0.0991  0.1104  252 LYS A NZ  
869  N N   . LEU A 176 ? 0.5155 0.3290 0.3674 -0.0114 0.0583  0.0803  253 LEU A N   
870  C CA  . LEU A 176 ? 0.5272 0.3227 0.3480 0.0033  0.0631  0.0831  253 LEU A CA  
871  C C   . LEU A 176 ? 0.6217 0.4150 0.4414 0.0076  0.0831  0.0942  253 LEU A C   
872  O O   . LEU A 176 ? 0.6060 0.4203 0.4545 0.0003  0.0922  0.0991  253 LEU A O   
873  C CB  . LEU A 176 ? 0.5058 0.3055 0.3191 0.0107  0.0549  0.0775  253 LEU A CB  
874  C CG  . LEU A 176 ? 0.5142 0.3226 0.3365 0.0044  0.0373  0.0683  253 LEU A CG  
875  C CD1 . LEU A 176 ? 0.4958 0.3057 0.3113 0.0106  0.0314  0.0647  253 LEU A CD1 
876  C CD2 . LEU A 176 ? 0.5445 0.3386 0.3522 0.0044  0.0268  0.0639  253 LEU A CD2 
877  N N   . GLU A 177 ? 0.6185 0.3868 0.4053 0.0194  0.0899  0.0986  254 GLU A N   
878  C CA  . GLU A 177 ? 0.6400 0.4006 0.4169 0.0267  0.1110  0.1107  254 GLU A CA  
879  C C   . GLU A 177 ? 0.6883 0.4424 0.4409 0.0440  0.1165  0.1116  254 GLU A C   
880  O O   . GLU A 177 ? 0.6909 0.4312 0.4188 0.0528  0.1026  0.1031  254 GLU A O   
881  C CB  . GLU A 177 ? 0.6894 0.4210 0.4383 0.0310  0.1148  0.1151  254 GLU A CB  
882  C CG  . GLU A 177 ? 0.8936 0.6266 0.6637 0.0164  0.1211  0.1209  254 GLU A CG  
883  C CD  . GLU A 177 ? 1.6086 1.3096 1.3471 0.0221  0.1201  0.1230  254 GLU A CD  
884  O OE1 . GLU A 177 ? 1.8351 1.5300 1.5689 0.0201  0.1029  0.1138  254 GLU A OE1 
885  O OE2 . GLU A 177 ? 1.6324 1.3141 1.3481 0.0308  0.1365  0.1340  254 GLU A OE2 
886  N N   . GLU A 178 ? 0.6581 0.4214 0.4176 0.0491  0.1367  0.1221  255 GLU A N   
887  C CA  . GLU A 178 ? 0.6788 0.4345 0.4130 0.0682  0.1457  0.1244  255 GLU A CA  
888  C C   . GLU A 178 ? 0.7631 0.4798 0.4437 0.0843  0.1402  0.1213  255 GLU A C   
889  O O   . GLU A 178 ? 0.7952 0.4927 0.4572 0.0865  0.1475  0.1276  255 GLU A O   
890  C CB  . GLU A 178 ? 0.7056 0.4768 0.4560 0.0713  0.1725  0.1393  255 GLU A CB  
891  C CG  . GLU A 178 ? 0.8757 0.6304 0.5892 0.0948  0.1876  0.1450  255 GLU A CG  
892  C CD  . GLU A 178 ? 1.1484 0.9211 0.8791 0.0992  0.2165  0.1611  255 GLU A CD  
893  O OE1 . GLU A 178 ? 0.8808 0.6667 0.6410 0.0841  0.2278  0.1709  255 GLU A OE1 
894  O OE2 . GLU A 178 ? 1.1550 0.9268 0.8680 0.1182  0.2283  0.1644  255 GLU A OE2 
895  N N   . GLY A 179 ? 0.7087 0.4134 0.3661 0.0942  0.1252  0.1112  256 GLY A N   
896  C CA  . GLY A 179 ? 0.7466 0.4158 0.3555 0.1085  0.1152  0.1060  256 GLY A CA  
897  C C   . GLY A 179 ? 0.8231 0.4869 0.4307 0.1008  0.0883  0.0931  256 GLY A C   
898  O O   . GLY A 179 ? 0.8524 0.4913 0.4251 0.1116  0.0744  0.0857  256 GLY A O   
899  N N   . ASP A 180 ? 0.7476 0.4350 0.3938 0.0823  0.0804  0.0902  257 ASP A N   
900  C CA  . ASP A 180 ? 0.7166 0.4050 0.3682 0.0741  0.0571  0.0793  257 ASP A CA  
901  C C   . ASP A 180 ? 0.7826 0.4723 0.4315 0.0766  0.0449  0.0712  257 ASP A C   
902  O O   . ASP A 180 ? 0.7996 0.4969 0.4533 0.0813  0.0543  0.0737  257 ASP A O   
903  C CB  . ASP A 180 ? 0.6873 0.4007 0.3790 0.0557  0.0541  0.0787  257 ASP A CB  
904  C CG  . ASP A 180 ? 0.8283 0.5370 0.5232 0.0508  0.0618  0.0848  257 ASP A CG  
905  O OD1 . ASP A 180 ? 0.9058 0.5898 0.5693 0.0615  0.0658  0.0885  257 ASP A OD1 
906  O OD2 . ASP A 180 ? 0.8101 0.5374 0.5366 0.0369  0.0634  0.0857  257 ASP A OD2 
907  N N   . GLU A 181 ? 0.7153 0.3975 0.3575 0.0737  0.0240  0.0621  258 GLU A N   
908  C CA  . GLU A 181 ? 0.6887 0.3693 0.3293 0.0733  0.0100  0.0543  258 GLU A CA  
909  C C   . GLU A 181 ? 0.7249 0.4232 0.3932 0.0579  -0.0052 0.0488  258 GLU A C   
910  O O   . GLU A 181 ? 0.7542 0.4553 0.4280 0.0527  -0.0111 0.0480  258 GLU A O   
911  C CB  . GLU A 181 ? 0.7356 0.3835 0.3338 0.0871  -0.0011 0.0487  258 GLU A CB  
912  C CG  . GLU A 181 ? 0.8270 0.4562 0.3944 0.1050  0.0139  0.0532  258 GLU A CG  
913  C CD  . GLU A 181 ? 1.2596 0.8514 0.7777 0.1213  0.0046  0.0484  258 GLU A CD  
914  O OE1 . GLU A 181 ? 1.3034 0.8842 0.8135 0.1175  -0.0179 0.0395  258 GLU A OE1 
915  O OE2 . GLU A 181 ? 1.2538 0.8277 0.7412 0.1383  0.0197  0.0537  258 GLU A OE2 
916  N N   . LEU A 182 ? 0.6466 0.3570 0.3317 0.0516  -0.0102 0.0459  259 LEU A N   
917  C CA  . LEU A 182 ? 0.5977 0.3251 0.3081 0.0378  -0.0230 0.0417  259 LEU A CA  
918  C C   . LEU A 182 ? 0.6378 0.3504 0.3349 0.0379  -0.0401 0.0350  259 LEU A C   
919  O O   . LEU A 182 ? 0.6627 0.3582 0.3400 0.0463  -0.0403 0.0335  259 LEU A O   
920  C CB  . LEU A 182 ? 0.5597 0.3125 0.3007 0.0291  -0.0161 0.0442  259 LEU A CB  
921  C CG  . LEU A 182 ? 0.5848 0.3549 0.3455 0.0251  -0.0023 0.0498  259 LEU A CG  
922  C CD1 . LEU A 182 ? 0.5547 0.3480 0.3426 0.0180  0.0009  0.0508  259 LEU A CD1 
923  C CD2 . LEU A 182 ? 0.5773 0.3509 0.3452 0.0187  -0.0058 0.0493  259 LEU A CD2 
924  N N   . GLN A 183 ? 0.5523 0.2715 0.2611 0.0289  -0.0542 0.0313  260 GLN A N   
925  C CA  . GLN A 183 ? 0.5728 0.2812 0.2759 0.0253  -0.0718 0.0256  260 GLN A CA  
926  C C   . GLN A 183 ? 0.6747 0.4062 0.4090 0.0106  -0.0804 0.0251  260 GLN A C   
927  O O   . GLN A 183 ? 0.6835 0.4343 0.4365 0.0060  -0.0768 0.0272  260 GLN A O   
928  C CB  . GLN A 183 ? 0.6127 0.2963 0.2864 0.0338  -0.0839 0.0211  260 GLN A CB  
929  C CG  . GLN A 183 ? 0.7182 0.4106 0.3985 0.0324  -0.0891 0.0211  260 GLN A CG  
930  C CD  . GLN A 183 ? 0.9454 0.6146 0.5986 0.0401  -0.1057 0.0155  260 GLN A CD  
931  O OE1 . GLN A 183 ? 0.9631 0.6039 0.5823 0.0514  -0.1081 0.0126  260 GLN A OE1 
932  N NE2 . GLN A 183 ? 0.7774 0.4584 0.4441 0.0355  -0.1179 0.0136  260 GLN A NE2 
933  N N   . LEU A 184 ? 0.6335 0.3611 0.3719 0.0038  -0.0911 0.0226  261 LEU A N   
934  C CA  . LEU A 184 ? 0.6053 0.3530 0.3717 -0.0098 -0.0983 0.0233  261 LEU A CA  
935  C C   . LEU A 184 ? 0.6917 0.4286 0.4529 -0.0130 -0.1172 0.0186  261 LEU A C   
936  O O   . LEU A 184 ? 0.7273 0.4394 0.4689 -0.0112 -0.1272 0.0146  261 LEU A O   
937  C CB  . LEU A 184 ? 0.5914 0.3420 0.3671 -0.0158 -0.0954 0.0255  261 LEU A CB  
938  C CG  . LEU A 184 ? 0.6137 0.3874 0.4185 -0.0288 -0.0972 0.0287  261 LEU A CG  
939  C CD1 . LEU A 184 ? 0.5920 0.3740 0.4045 -0.0300 -0.0868 0.0325  261 LEU A CD1 
940  C CD2 . LEU A 184 ? 0.6663 0.4321 0.4750 -0.0381 -0.1127 0.0270  261 LEU A CD2 
941  N N   . ALA A 185 ? 0.6195 0.3743 0.3976 -0.0169 -0.1229 0.0187  262 ALA A N   
942  C CA  . ALA A 185 ? 0.6114 0.3622 0.3902 -0.0201 -0.1420 0.0145  262 ALA A CA  
943  C C   . ALA A 185 ? 0.6665 0.4455 0.4818 -0.0341 -0.1477 0.0172  262 ALA A C   
944  O O   . ALA A 185 ? 0.6709 0.4755 0.5074 -0.0362 -0.1370 0.0217  262 ALA A O   
945  C CB  . ALA A 185 ? 0.6189 0.3658 0.3838 -0.0092 -0.1444 0.0125  262 ALA A CB  
946  N N   . ILE A 186 ? 0.6109 0.3847 0.4333 -0.0436 -0.1644 0.0149  263 ILE A N   
947  C CA  . ILE A 186 ? 0.5894 0.3915 0.4489 -0.0577 -0.1698 0.0188  263 ILE A CA  
948  C C   . ILE A 186 ? 0.6751 0.4870 0.5437 -0.0569 -0.1860 0.0154  263 ILE A C   
949  O O   . ILE A 186 ? 0.7123 0.5036 0.5673 -0.0576 -0.2044 0.0094  263 ILE A O   
950  C CB  . ILE A 186 ? 0.6258 0.4202 0.4946 -0.0717 -0.1757 0.0206  263 ILE A CB  
951  C CG1 . ILE A 186 ? 0.6021 0.3893 0.4623 -0.0703 -0.1590 0.0246  263 ILE A CG1 
952  C CG2 . ILE A 186 ? 0.6261 0.4527 0.5360 -0.0864 -0.1802 0.0262  263 ILE A CG2 
953  C CD1 . ILE A 186 ? 0.4994 0.2608 0.3485 -0.0770 -0.1653 0.0241  263 ILE A CD1 
954  N N   . PRO A 187 ? 0.6120 0.4537 0.5017 -0.0540 -0.1806 0.0186  264 PRO A N   
955  C CA  . PRO A 187 ? 0.6150 0.4668 0.5125 -0.0504 -0.1965 0.0154  264 PRO A CA  
956  C C   . PRO A 187 ? 0.6523 0.5246 0.5842 -0.0654 -0.2124 0.0167  264 PRO A C   
957  O O   . PRO A 187 ? 0.6409 0.5470 0.6044 -0.0673 -0.2135 0.0203  264 PRO A O   
958  C CB  . PRO A 187 ? 0.6189 0.4926 0.5245 -0.0406 -0.1833 0.0188  264 PRO A CB  
959  C CG  . PRO A 187 ? 0.6541 0.5299 0.5585 -0.0411 -0.1615 0.0234  264 PRO A CG  
960  C CD  . PRO A 187 ? 0.5970 0.4616 0.5011 -0.0521 -0.1609 0.0246  264 PRO A CD  
961  N N   . ARG A 188 ? 0.5970 0.4488 0.5240 -0.0763 -0.2242 0.0141  265 ARG A N   
962  C CA  . ARG A 188 ? 0.5811 0.4466 0.5401 -0.0938 -0.2408 0.0154  265 ARG A CA  
963  C C   . ARG A 188 ? 0.6850 0.5103 0.6168 -0.0970 -0.2616 0.0068  265 ARG A C   
964  O O   . ARG A 188 ? 0.6949 0.4863 0.5926 -0.0919 -0.2557 0.0040  265 ARG A O   
965  C CB  . ARG A 188 ? 0.4814 0.3661 0.4698 -0.1087 -0.2268 0.0251  265 ARG A CB  
966  C CG  . ARG A 188 ? 0.5047 0.4218 0.5113 -0.1038 -0.2039 0.0331  265 ARG A CG  
967  C CD  . ARG A 188 ? 0.5935 0.5528 0.6462 -0.1130 -0.2062 0.0398  265 ARG A CD  
968  N NE  . ARG A 188 ? 0.5945 0.5858 0.6643 -0.1063 -0.1861 0.0469  265 ARG A NE  
969  C CZ  . ARG A 188 ? 0.6550 0.6611 0.7235 -0.0917 -0.1826 0.0451  265 ARG A CZ  
970  N NH1 . ARG A 188 ? 0.3742 0.3633 0.4204 -0.0807 -0.1955 0.0370  265 ARG A NH1 
971  N NH2 . ARG A 188 ? 0.4207 0.4551 0.5061 -0.0865 -0.1658 0.0515  265 ARG A NH2 
972  N N   . GLU A 189 ? 0.6764 0.5047 0.6216 -0.1039 -0.2866 0.0020  266 GLU A N   
973  C CA  . GLU A 189 ? 0.7299 0.5183 0.6489 -0.1075 -0.3101 -0.0075 266 GLU A CA  
974  C C   . GLU A 189 ? 0.8067 0.5852 0.7399 -0.1273 -0.3108 -0.0037 266 GLU A C   
975  O O   . GLU A 189 ? 0.7902 0.6030 0.7686 -0.1432 -0.3054 0.0055  266 GLU A O   
976  C CB  . GLU A 189 ? 0.7710 0.5703 0.7069 -0.1114 -0.3388 -0.0135 266 GLU A CB  
977  C CG  . GLU A 189 ? 0.9508 0.7451 0.8597 -0.0900 -0.3450 -0.0199 266 GLU A CG  
978  C CD  . GLU A 189 ? 1.2280 1.0419 1.1605 -0.0931 -0.3728 -0.0245 266 GLU A CD  
979  O OE1 . GLU A 189 ? 1.0186 0.8159 0.9531 -0.1051 -0.3992 -0.0314 266 GLU A OE1 
980  O OE2 . GLU A 189 ? 1.1994 1.0442 1.1473 -0.0827 -0.3690 -0.0217 266 GLU A OE2 
981  N N   . ASN A 190 ? 0.7885 0.5190 0.6825 -0.1256 -0.3172 -0.0102 267 ASN A N   
982  C CA  . ASN A 190 ? 0.7892 0.5002 0.6883 -0.1427 -0.3193 -0.0074 267 ASN A CA  
983  C C   . ASN A 190 ? 0.7846 0.5242 0.7134 -0.1513 -0.2935 0.0061  267 ASN A C   
984  O O   . ASN A 190 ? 0.7672 0.5192 0.7294 -0.1716 -0.2962 0.0132  267 ASN A O   
985  C CB  . ASN A 190 ? 0.7934 0.5008 0.7160 -0.1628 -0.3491 -0.0113 267 ASN A CB  
986  C CG  . ASN A 190 ? 1.1530 0.8312 1.0758 -0.1811 -0.3554 -0.0096 267 ASN A CG  
987  O OD1 . ASN A 190 ? 1.0951 0.7253 0.9737 -0.1738 -0.3563 -0.0155 267 ASN A OD1 
988  N ND2 . ASN A 190 ? 1.0734 0.7795 1.0462 -0.2049 -0.3593 -0.0009 267 ASN A ND2 
989  N N   . ALA A 191 ? 0.7013 0.4517 0.6180 -0.1359 -0.2687 0.0100  268 ALA A N   
990  C CA  . ALA A 191 ? 0.6477 0.4241 0.5867 -0.1403 -0.2446 0.0215  268 ALA A CA  
991  C C   . ALA A 191 ? 0.7339 0.4857 0.6670 -0.1514 -0.2421 0.0255  268 ALA A C   
992  O O   . ALA A 191 ? 0.7707 0.4796 0.6665 -0.1457 -0.2490 0.0185  268 ALA A O   
993  C CB  . ALA A 191 ? 0.6187 0.4001 0.5377 -0.1215 -0.2237 0.0220  268 ALA A CB  
994  N N   . GLN A 192 ? 0.6680 0.4452 0.6369 -0.1668 -0.2329 0.0369  269 GLN A N   
995  C CA  . GLN A 192 ? 0.6786 0.4344 0.6450 -0.1786 -0.2292 0.0429  269 GLN A CA  
996  C C   . GLN A 192 ? 0.7453 0.5050 0.6988 -0.1674 -0.2047 0.0488  269 GLN A C   
997  O O   . GLN A 192 ? 0.7337 0.5294 0.7115 -0.1677 -0.1885 0.0574  269 GLN A O   
998  C CB  . GLN A 192 ? 0.6846 0.4643 0.6966 -0.2022 -0.2332 0.0531  269 GLN A CB  
999  C CG  . GLN A 192 ? 0.7402 0.5193 0.7710 -0.2156 -0.2601 0.0473  269 GLN A CG  
1000 C CD  . GLN A 192 ? 0.9463 0.6707 0.9386 -0.2154 -0.2814 0.0355  269 GLN A CD  
1001 O OE1 . GLN A 192 ? 0.9234 0.6153 0.9058 -0.2264 -0.2851 0.0376  269 GLN A OE1 
1002 N NE2 . GLN A 192 ? 0.8715 0.5820 0.8380 -0.2013 -0.2956 0.0228  269 GLN A NE2 
1003 N N   . ILE A 193 ? 0.7190 0.4421 0.6329 -0.1555 -0.2023 0.0436  270 ILE A N   
1004 C CA  . ILE A 193 ? 0.6927 0.4173 0.5914 -0.1427 -0.1815 0.0475  270 ILE A CA  
1005 C C   . ILE A 193 ? 0.7668 0.4528 0.6392 -0.1420 -0.1808 0.0483  270 ILE A C   
1006 O O   . ILE A 193 ? 0.8073 0.4587 0.6643 -0.1476 -0.1969 0.0433  270 ILE A O   
1007 C CB  . ILE A 193 ? 0.7176 0.4450 0.5947 -0.1224 -0.1756 0.0400  270 ILE A CB  
1008 C CG1 . ILE A 193 ? 0.7464 0.4330 0.5851 -0.1120 -0.1890 0.0289  270 ILE A CG1 
1009 C CG2 . ILE A 193 ? 0.6977 0.4624 0.5993 -0.1215 -0.1746 0.0401  270 ILE A CG2 
1010 C CD1 . ILE A 193 ? 0.7220 0.4026 0.5344 -0.0923 -0.1781 0.0248  270 ILE A CD1 
1011 N N   . SER A 194 ? 0.7224 0.4125 0.5875 -0.1339 -0.1632 0.0540  271 SER A N   
1012 C CA  . SER A 194 ? 0.7391 0.3935 0.5770 -0.1293 -0.1613 0.0549  271 SER A CA  
1013 C C   . SER A 194 ? 0.7785 0.4139 0.5818 -0.1080 -0.1586 0.0462  271 SER A C   
1014 O O   . SER A 194 ? 0.7209 0.3798 0.5263 -0.0966 -0.1481 0.0449  271 SER A O   
1015 C CB  . SER A 194 ? 0.7531 0.4222 0.6014 -0.1312 -0.1448 0.0663  271 SER A CB  
1016 O OG  . SER A 194 ? 0.8736 0.5094 0.6931 -0.1227 -0.1423 0.0668  271 SER A OG  
1017 N N   . LEU A 195 ? 0.7842 0.3764 0.5558 -0.1025 -0.1680 0.0406  272 LEU A N   
1018 C CA  . LEU A 195 ? 0.7712 0.3435 0.5087 -0.0811 -0.1646 0.0332  272 LEU A CA  
1019 C C   . LEU A 195 ? 0.8142 0.3729 0.5343 -0.0696 -0.1527 0.0374  272 LEU A C   
1020 O O   . LEU A 195 ? 0.8185 0.3486 0.5063 -0.0533 -0.1529 0.0319  272 LEU A O   
1021 C CB  . LEU A 195 ? 0.7989 0.3322 0.5073 -0.0774 -0.1828 0.0223  272 LEU A CB  
1022 C CG  . LEU A 195 ? 0.8280 0.3740 0.5474 -0.0830 -0.1953 0.0164  272 LEU A CG  
1023 C CD1 . LEU A 195 ? 0.8614 0.3642 0.5450 -0.0762 -0.2133 0.0052  272 LEU A CD1 
1024 C CD2 . LEU A 195 ? 0.8374 0.4169 0.5641 -0.0712 -0.1821 0.0164  272 LEU A CD2 
1025 N N   . ASP A 196 ? 0.7560 0.3368 0.4971 -0.0763 -0.1420 0.0472  273 ASP A N   
1026 C CA  . ASP A 196 ? 0.7736 0.3475 0.5019 -0.0650 -0.1309 0.0521  273 ASP A CA  
1027 C C   . ASP A 196 ? 0.8150 0.4198 0.5474 -0.0495 -0.1167 0.0513  273 ASP A C   
1028 O O   . ASP A 196 ? 0.7788 0.4195 0.5358 -0.0545 -0.1108 0.0533  273 ASP A O   
1029 C CB  . ASP A 196 ? 0.7864 0.3667 0.5314 -0.0784 -0.1266 0.0633  273 ASP A CB  
1030 C CG  . ASP A 196 ? 0.9003 0.4487 0.6429 -0.0951 -0.1391 0.0659  273 ASP A CG  
1031 O OD1 . ASP A 196 ? 0.9818 0.4897 0.6978 -0.0916 -0.1514 0.0587  273 ASP A OD1 
1032 O OD2 . ASP A 196 ? 0.8377 0.4004 0.6044 -0.1118 -0.1365 0.0756  273 ASP A OD2 
1033 N N   . GLY A 197 ? 0.7857 0.3756 0.4947 -0.0311 -0.1117 0.0487  274 GLY A N   
1034 C CA  . GLY A 197 ? 0.7555 0.3717 0.4685 -0.0163 -0.0991 0.0481  274 GLY A CA  
1035 C C   . GLY A 197 ? 0.7380 0.3914 0.4761 -0.0192 -0.0888 0.0545  274 GLY A C   
1036 O O   . GLY A 197 ? 0.6956 0.3767 0.4457 -0.0137 -0.0810 0.0532  274 GLY A O   
1037 N N   . ASP A 198 ? 0.6937 0.3456 0.4380 -0.0278 -0.0888 0.0616  275 ASP A N   
1038 C CA  . ASP A 198 ? 0.6748 0.3577 0.4378 -0.0294 -0.0801 0.0677  275 ASP A CA  
1039 C C   . ASP A 198 ? 0.6952 0.4063 0.4838 -0.0436 -0.0790 0.0694  275 ASP A C   
1040 O O   . ASP A 198 ? 0.6576 0.3952 0.4605 -0.0442 -0.0719 0.0731  275 ASP A O   
1041 C CB  . ASP A 198 ? 0.7060 0.3726 0.4602 -0.0305 -0.0794 0.0757  275 ASP A CB  
1042 C CG  . ASP A 198 ? 0.7998 0.4466 0.5556 -0.0476 -0.0860 0.0806  275 ASP A CG  
1043 O OD1 . ASP A 198 ? 0.7944 0.4273 0.5495 -0.0558 -0.0950 0.0758  275 ASP A OD1 
1044 O OD2 . ASP A 198 ? 0.9505 0.5944 0.7074 -0.0527 -0.0826 0.0895  275 ASP A OD2 
1045 N N   . VAL A 199 ? 0.6365 0.3406 0.4294 -0.0537 -0.0870 0.0663  276 VAL A N   
1046 C CA  . VAL A 199 ? 0.6034 0.3315 0.4204 -0.0666 -0.0874 0.0684  276 VAL A CA  
1047 C C   . VAL A 199 ? 0.6434 0.3831 0.4664 -0.0655 -0.0907 0.0611  276 VAL A C   
1048 O O   . VAL A 199 ? 0.6417 0.4088 0.4840 -0.0697 -0.0870 0.0621  276 VAL A O   
1049 C CB  . VAL A 199 ? 0.6671 0.3796 0.4892 -0.0822 -0.0940 0.0744  276 VAL A CB  
1050 C CG1 . VAL A 199 ? 0.6671 0.3644 0.4900 -0.0914 -0.1076 0.0693  276 VAL A CG1 
1051 C CG2 . VAL A 199 ? 0.6576 0.3965 0.5025 -0.0919 -0.0862 0.0836  276 VAL A CG2 
1052 N N   . THR A 200 ? 0.6069 0.3243 0.4106 -0.0581 -0.0969 0.0542  277 THR A N   
1053 C CA  . THR A 200 ? 0.5975 0.3193 0.3999 -0.0546 -0.1003 0.0476  277 THR A CA  
1054 C C   . THR A 200 ? 0.6636 0.3781 0.4470 -0.0377 -0.0936 0.0436  277 THR A C   
1055 O O   . THR A 200 ? 0.7040 0.3906 0.4637 -0.0291 -0.0962 0.0411  277 THR A O   
1056 C CB  . THR A 200 ? 0.6553 0.3561 0.4521 -0.0628 -0.1156 0.0435  277 THR A CB  
1057 O OG1 . THR A 200 ? 0.7116 0.4258 0.5328 -0.0795 -0.1197 0.0491  277 THR A OG1 
1058 C CG2 . THR A 200 ? 0.5324 0.2350 0.3239 -0.0576 -0.1204 0.0367  277 THR A CG2 
1059 N N   . PHE A 201 ? 0.5689 0.3087 0.3633 -0.0329 -0.0842 0.0437  278 PHE A N   
1060 C CA  . PHE A 201 ? 0.5545 0.2947 0.3383 -0.0187 -0.0755 0.0419  278 PHE A CA  
1061 C C   . PHE A 201 ? 0.5972 0.3585 0.3921 -0.0175 -0.0696 0.0406  278 PHE A C   
1062 O O   . PHE A 201 ? 0.5875 0.3656 0.3991 -0.0265 -0.0714 0.0412  278 PHE A O   
1063 C CB  . PHE A 201 ? 0.5596 0.3077 0.3464 -0.0128 -0.0677 0.0460  278 PHE A CB  
1064 C CG  . PHE A 201 ? 0.5413 0.3151 0.3498 -0.0207 -0.0642 0.0503  278 PHE A CG  
1065 C CD1 . PHE A 201 ? 0.5778 0.3472 0.3892 -0.0287 -0.0677 0.0549  278 PHE A CD1 
1066 C CD2 . PHE A 201 ? 0.5425 0.3427 0.3667 -0.0200 -0.0574 0.0501  278 PHE A CD2 
1067 C CE1 . PHE A 201 ? 0.5701 0.3618 0.3976 -0.0341 -0.0635 0.0592  278 PHE A CE1 
1068 C CE2 . PHE A 201 ? 0.5632 0.3838 0.4030 -0.0258 -0.0552 0.0531  278 PHE A CE2 
1069 C CZ  . PHE A 201 ? 0.5440 0.3605 0.3842 -0.0317 -0.0578 0.0577  278 PHE A CZ  
1070 N N   . PHE A 202 ? 0.5350 0.2944 0.3200 -0.0058 -0.0619 0.0393  279 PHE A N   
1071 C CA  . PHE A 202 ? 0.5068 0.2796 0.2978 -0.0035 -0.0555 0.0387  279 PHE A CA  
1072 C C   . PHE A 202 ? 0.5759 0.3543 0.3648 0.0077  -0.0434 0.0406  279 PHE A C   
1073 O O   . PHE A 202 ? 0.6009 0.3621 0.3714 0.0186  -0.0414 0.0403  279 PHE A O   
1074 C CB  . PHE A 202 ? 0.5365 0.2895 0.3093 -0.0014 -0.0627 0.0346  279 PHE A CB  
1075 C CG  . PHE A 202 ? 0.5382 0.2959 0.3088 0.0028  -0.0573 0.0341  279 PHE A CG  
1076 C CD1 . PHE A 202 ? 0.5386 0.3202 0.3303 -0.0029 -0.0518 0.0362  279 PHE A CD1 
1077 C CD2 . PHE A 202 ? 0.5720 0.3069 0.3165 0.0126  -0.0590 0.0315  279 PHE A CD2 
1078 C CE1 . PHE A 202 ? 0.5388 0.3209 0.3267 0.0006  -0.0473 0.0363  279 PHE A CE1 
1079 C CE2 . PHE A 202 ? 0.5971 0.3338 0.3369 0.0169  -0.0537 0.0320  279 PHE A CE2 
1080 C CZ  . PHE A 202 ? 0.5473 0.3073 0.3095 0.0104  -0.0478 0.0347  279 PHE A CZ  
1081 N N   . GLY A 203 ? 0.4999 0.3023 0.3082 0.0052  -0.0356 0.0427  280 GLY A N   
1082 C CA  . GLY A 203 ? 0.5012 0.3144 0.3148 0.0134  -0.0241 0.0454  280 GLY A CA  
1083 C C   . GLY A 203 ? 0.5967 0.4283 0.4271 0.0091  -0.0169 0.0469  280 GLY A C   
1084 O O   . GLY A 203 ? 0.5756 0.4127 0.4138 0.0005  -0.0209 0.0454  280 GLY A O   
1085 N N   . ALA A 204 ? 0.5936 0.4347 0.4302 0.0157  -0.0058 0.0503  281 ALA A N   
1086 C CA  . ALA A 204 ? 0.5759 0.4336 0.4305 0.0111  0.0023  0.0528  281 ALA A CA  
1087 C C   . ALA A 204 ? 0.6167 0.4956 0.4910 0.0142  0.0103  0.0566  281 ALA A C   
1088 O O   . ALA A 204 ? 0.6223 0.4988 0.4899 0.0249  0.0137  0.0583  281 ALA A O   
1089 C CB  . ALA A 204 ? 0.5987 0.4416 0.4373 0.0159  0.0094  0.0547  281 ALA A CB  
1090 N N   . LEU A 205 ? 0.5536 0.4529 0.4526 0.0053  0.0120  0.0574  282 LEU A N   
1091 C CA  . LEU A 205 ? 0.5425 0.4666 0.4669 0.0054  0.0170  0.0606  282 LEU A CA  
1092 C C   . LEU A 205 ? 0.5534 0.4889 0.4968 -0.0024 0.0251  0.0639  282 LEU A C   
1093 O O   . LEU A 205 ? 0.5482 0.4807 0.4947 -0.0125 0.0204  0.0611  282 LEU A O   
1094 C CB  . LEU A 205 ? 0.5362 0.4728 0.4725 0.0000  0.0055  0.0567  282 LEU A CB  
1095 C CG  . LEU A 205 ? 0.5948 0.5589 0.5605 -0.0040 0.0045  0.0574  282 LEU A CG  
1096 C CD1 . LEU A 205 ? 0.6036 0.5815 0.5786 0.0070  0.0110  0.0618  282 LEU A CD1 
1097 C CD2 . LEU A 205 ? 0.6184 0.5872 0.5859 -0.0080 -0.0082 0.0527  282 LEU A CD2 
1098 N N   . LYS A 206 ? 0.4929 0.4400 0.4482 0.0027  0.0379  0.0704  283 LYS A N   
1099 C CA  . LYS A 206 ? 0.4793 0.4368 0.4545 -0.0056 0.0473  0.0754  283 LYS A CA  
1100 C C   . LYS A 206 ? 0.5643 0.5474 0.5735 -0.0175 0.0405  0.0737  283 LYS A C   
1101 O O   . LYS A 206 ? 0.5781 0.5822 0.6048 -0.0141 0.0377  0.0739  283 LYS A O   
1102 C CB  . LYS A 206 ? 0.4826 0.4447 0.4597 0.0039  0.0656  0.0847  283 LYS A CB  
1103 C CG  . LYS A 206 ? 0.4737 0.4341 0.4599 -0.0048 0.0763  0.0907  283 LYS A CG  
1104 C CD  . LYS A 206 ? 0.5274 0.4881 0.5105 0.0048  0.0968  0.1013  283 LYS A CD  
1105 C CE  . LYS A 206 ? 0.6594 0.6178 0.6534 -0.0063 0.1071  0.1082  283 LYS A CE  
1106 N NZ  . LYS A 206 ? 0.9202 0.9011 0.9400 -0.0048 0.1267  0.1204  283 LYS A NZ  
1107 N N   . LEU A 207 ? 0.5281 0.5076 0.5447 -0.0306 0.0366  0.0714  284 LEU A N   
1108 C CA  . LEU A 207 ? 0.5199 0.5189 0.5657 -0.0428 0.0280  0.0684  284 LEU A CA  
1109 C C   . LEU A 207 ? 0.5975 0.6169 0.6747 -0.0486 0.0391  0.0763  284 LEU A C   
1110 O O   . LEU A 207 ? 0.6044 0.6147 0.6770 -0.0479 0.0536  0.0837  284 LEU A O   
1111 C CB  . LEU A 207 ? 0.5135 0.4965 0.5514 -0.0534 0.0188  0.0622  284 LEU A CB  
1112 C CG  . LEU A 207 ? 0.5629 0.5286 0.5732 -0.0487 0.0090  0.0554  284 LEU A CG  
1113 C CD1 . LEU A 207 ? 0.5758 0.5289 0.5808 -0.0572 0.0019  0.0501  284 LEU A CD1 
1114 C CD2 . LEU A 207 ? 0.5622 0.5399 0.5741 -0.0439 -0.0009 0.0515  284 LEU A CD2 
1115 N N   . LEU A 208 ? 0.5624 0.6098 0.6719 -0.0541 0.0323  0.0753  285 LEU A N   
1116 C CA  . LEU A 208 ? 0.5867 0.6588 0.7336 -0.0618 0.0416  0.0832  285 LEU A CA  
1117 C C   . LEU A 208 ? 0.5945 0.6575 0.7525 -0.0797 0.0391  0.0823  285 LEU A C   
1118 O O   . LEU A 208 ? 0.6969 0.7650 0.8730 -0.0866 0.0532  0.0916  285 LEU A O   
1119 C CB  . LEU A 208 ? 0.5770 0.6843 0.7573 -0.0615 0.0329  0.0819  285 LEU A CB  
1120 C CG  . LEU A 208 ? 0.6276 0.7491 0.8057 -0.0435 0.0399  0.0862  285 LEU A CG  
1121 C CD1 . LEU A 208 ? 0.6266 0.7659 0.8143 -0.0393 0.0229  0.0795  285 LEU A CD1 
1122 C CD2 . LEU A 208 ? 0.6671 0.8130 0.8737 -0.0411 0.0583  0.0981  285 LEU A CD2 
1123 O OXT . LEU A 208 ? 0.6209 0.6691 0.7668 -0.0860 0.0242  0.0728  285 LEU A OXT 
1124 N N   . VAL B 65  ? 0.8349 1.1069 1.0402 -0.1653 0.0950  -0.0733 142 VAL B N   
1125 C CA  . VAL B 65  ? 0.8278 1.0675 1.0080 -0.1681 0.0776  -0.0677 142 VAL B CA  
1126 C C   . VAL B 65  ? 0.8470 1.0495 0.9925 -0.1536 0.0755  -0.0664 142 VAL B C   
1127 O O   . VAL B 65  ? 0.8419 1.0489 0.9933 -0.1372 0.0789  -0.0706 142 VAL B O   
1128 C CB  . VAL B 65  ? 0.8728 1.1310 1.0798 -0.1651 0.0573  -0.0672 142 VAL B CB  
1129 C CG1 . VAL B 65  ? 0.8748 1.1026 1.0542 -0.1739 0.0429  -0.0621 142 VAL B CG1 
1130 C CG2 . VAL B 65  ? 0.8725 1.1760 1.1229 -0.1754 0.0589  -0.0699 142 VAL B CG2 
1131 N N   . THR B 66  ? 0.7691 0.9352 0.8795 -0.1597 0.0697  -0.0613 143 THR B N   
1132 C CA  . THR B 66  ? 0.7477 0.8804 0.8269 -0.1479 0.0671  -0.0595 143 THR B CA  
1133 C C   . THR B 66  ? 0.7511 0.8683 0.8229 -0.1409 0.0492  -0.0562 143 THR B C   
1134 O O   . THR B 66  ? 0.7496 0.8738 0.8305 -0.1479 0.0389  -0.0548 143 THR B O   
1135 C CB  . THR B 66  ? 0.8975 0.9993 0.9398 -0.1575 0.0772  -0.0561 143 THR B CB  
1136 O OG1 . THR B 66  ? 0.8899 0.9727 0.9166 -0.1705 0.0705  -0.0518 143 THR B OG1 
1137 C CG2 . THR B 66  ? 0.9168 1.0315 0.9609 -0.1664 0.0962  -0.0579 143 THR B CG2 
1138 N N   . GLN B 67  ? 0.6596 0.7551 0.7130 -0.1280 0.0460  -0.0551 144 GLN B N   
1139 C CA  . GLN B 67  ? 0.6105 0.6899 0.6536 -0.1210 0.0320  -0.0514 144 GLN B CA  
1140 C C   . GLN B 67  ? 0.6215 0.6692 0.6312 -0.1268 0.0328  -0.0480 144 GLN B C   
1141 O O   . GLN B 67  ? 0.6090 0.6371 0.5985 -0.1221 0.0378  -0.0472 144 GLN B O   
1142 C CB  . GLN B 67  ? 0.6093 0.6860 0.6559 -0.1043 0.0282  -0.0521 144 GLN B CB  
1143 C CG  . GLN B 67  ? 0.6123 0.7142 0.6904 -0.0959 0.0207  -0.0537 144 GLN B CG  
1144 C CD  . GLN B 67  ? 0.8565 0.9525 0.9367 -0.0807 0.0191  -0.0554 144 GLN B CD  
1145 O OE1 . GLN B 67  ? 0.7867 0.8850 0.8685 -0.0757 0.0295  -0.0610 144 GLN B OE1 
1146 N NE2 . GLN B 67  ? 0.8384 0.9247 0.9163 -0.0739 0.0064  -0.0507 144 GLN B NE2 
1147 N N   . ASP B 68  ? 0.5811 0.6234 0.5850 -0.1371 0.0272  -0.0464 145 ASP B N   
1148 C CA  . ASP B 68  ? 0.5831 0.5949 0.5571 -0.1421 0.0267  -0.0440 145 ASP B CA  
1149 C C   . ASP B 68  ? 0.6063 0.6022 0.5670 -0.1291 0.0203  -0.0417 145 ASP B C   
1150 O O   . ASP B 68  ? 0.5958 0.6028 0.5686 -0.1213 0.0119  -0.0409 145 ASP B O   
1151 C CB  . ASP B 68  ? 0.6083 0.6181 0.5803 -0.1542 0.0201  -0.0446 145 ASP B CB  
1152 C CG  . ASP B 68  ? 0.7752 0.8031 0.7637 -0.1697 0.0241  -0.0466 145 ASP B CG  
1153 O OD1 . ASP B 68  ? 0.8280 0.8849 0.8433 -0.1684 0.0279  -0.0482 145 ASP B OD1 
1154 O OD2 . ASP B 68  ? 0.8548 0.8703 0.8326 -0.1828 0.0218  -0.0470 145 ASP B OD2 
1155 N N   . CYS B 69  ? 0.5441 0.5148 0.4808 -0.1269 0.0238  -0.0399 146 CYS B N   
1156 C CA  . CYS B 69  ? 0.5246 0.4821 0.4507 -0.1154 0.0182  -0.0375 146 CYS B CA  
1157 C C   . CYS B 69  ? 0.5552 0.4843 0.4550 -0.1161 0.0195  -0.0359 146 CYS B C   
1158 O O   . CYS B 69  ? 0.5407 0.4563 0.4274 -0.1240 0.0256  -0.0357 146 CYS B O   
1159 C CB  . CYS B 69  ? 0.5191 0.4831 0.4532 -0.1046 0.0187  -0.0373 146 CYS B CB  
1160 S SG  . CYS B 69  ? 0.5875 0.5532 0.5196 -0.1071 0.0306  -0.0401 146 CYS B SG  
1161 N N   . LEU B 70  ? 0.5077 0.4283 0.4006 -0.1081 0.0137  -0.0344 147 LEU B N   
1162 C CA  . LEU B 70  ? 0.5205 0.4162 0.3920 -0.1051 0.0137  -0.0332 147 LEU B CA  
1163 C C   . LEU B 70  ? 0.5353 0.4314 0.4084 -0.0926 0.0098  -0.0308 147 LEU B C   
1164 O O   . LEU B 70  ? 0.5287 0.4399 0.4145 -0.0885 0.0054  -0.0300 147 LEU B O   
1165 C CB  . LEU B 70  ? 0.5430 0.4286 0.4051 -0.1098 0.0111  -0.0355 147 LEU B CB  
1166 C CG  . LEU B 70  ? 0.6453 0.5025 0.4853 -0.1060 0.0112  -0.0355 147 LEU B CG  
1167 C CD1 . LEU B 70  ? 0.6856 0.5250 0.5122 -0.1171 0.0122  -0.0383 147 LEU B CD1 
1168 C CD2 . LEU B 70  ? 0.6553 0.5131 0.4943 -0.0947 0.0074  -0.0358 147 LEU B CD2 
1169 N N   . GLN B 71  ? 0.4660 0.3459 0.3264 -0.0874 0.0105  -0.0289 148 GLN B N   
1170 C CA  . GLN B 71  ? 0.4549 0.3350 0.3174 -0.0766 0.0060  -0.0265 148 GLN B CA  
1171 C C   . GLN B 71  ? 0.5346 0.3940 0.3810 -0.0713 0.0048  -0.0256 148 GLN B C   
1172 O O   . GLN B 71  ? 0.5733 0.4126 0.4030 -0.0747 0.0070  -0.0253 148 GLN B O   
1173 C CB  . GLN B 71  ? 0.4586 0.3426 0.3253 -0.0733 0.0056  -0.0255 148 GLN B CB  
1174 C CG  . GLN B 71  ? 0.3417 0.2285 0.2142 -0.0639 -0.0006 -0.0229 148 GLN B CG  
1175 C CD  . GLN B 71  ? 0.5504 0.4401 0.4263 -0.0621 -0.0020 -0.0234 148 GLN B CD  
1176 O OE1 . GLN B 71  ? 0.5225 0.4264 0.4139 -0.0615 -0.0036 -0.0243 148 GLN B OE1 
1177 N NE2 . GLN B 71  ? 0.3690 0.2432 0.2287 -0.0609 -0.0020 -0.0231 148 GLN B NE2 
1178 N N   . LEU B 72  ? 0.4485 0.3131 0.3006 -0.0630 0.0014  -0.0248 149 LEU B N   
1179 C CA  . LEU B 72  ? 0.4465 0.2965 0.2890 -0.0546 -0.0002 -0.0245 149 LEU B CA  
1180 C C   . LEU B 72  ? 0.5119 0.3703 0.3645 -0.0455 -0.0049 -0.0210 149 LEU B C   
1181 O O   . LEU B 72  ? 0.4674 0.3448 0.3360 -0.0452 -0.0067 -0.0194 149 LEU B O   
1182 C CB  . LEU B 72  ? 0.4360 0.2884 0.2783 -0.0522 0.0012  -0.0276 149 LEU B CB  
1183 C CG  . LEU B 72  ? 0.4722 0.3172 0.3050 -0.0616 0.0038  -0.0320 149 LEU B CG  
1184 C CD1 . LEU B 72  ? 0.4562 0.3080 0.2892 -0.0587 0.0045  -0.0353 149 LEU B CD1 
1185 C CD2 . LEU B 72  ? 0.5228 0.3393 0.3363 -0.0646 0.0048  -0.0337 149 LEU B CD2 
1186 N N   . ILE B 73  ? 0.5191 0.3622 0.3626 -0.0385 -0.0081 -0.0195 150 ILE B N   
1187 C CA  . ILE B 73  ? 0.5220 0.3724 0.3753 -0.0300 -0.0143 -0.0164 150 ILE B CA  
1188 C C   . ILE B 73  ? 0.5779 0.4229 0.4312 -0.0191 -0.0159 -0.0167 150 ILE B C   
1189 O O   . ILE B 73  ? 0.5801 0.4046 0.4179 -0.0176 -0.0140 -0.0189 150 ILE B O   
1190 C CB  . ILE B 73  ? 0.5804 0.4204 0.4244 -0.0312 -0.0190 -0.0140 150 ILE B CB  
1191 C CG1 . ILE B 73  ? 0.6129 0.4247 0.4323 -0.0321 -0.0187 -0.0132 150 ILE B CG1 
1192 C CG2 . ILE B 73  ? 0.5894 0.4396 0.4382 -0.0393 -0.0167 -0.0151 150 ILE B CG2 
1193 C CD1 . ILE B 73  ? 0.6704 0.4696 0.4766 -0.0305 -0.0249 -0.0098 150 ILE B CD1 
1194 N N   . ALA B 74  ? 0.5298 0.3935 0.4018 -0.0117 -0.0192 -0.0148 151 ALA B N   
1195 C CA  . ALA B 74  ? 0.5410 0.4064 0.4190 0.0003  -0.0198 -0.0156 151 ALA B CA  
1196 C C   . ALA B 74  ? 0.6253 0.4660 0.4889 0.0081  -0.0256 -0.0149 151 ALA B C   
1197 O O   . ALA B 74  ? 0.6214 0.4525 0.4777 0.0066  -0.0325 -0.0113 151 ALA B O   
1198 C CB  . ALA B 74  ? 0.5360 0.4286 0.4393 0.0048  -0.0229 -0.0125 151 ALA B CB  
1199 N N   . ASP B 75  ? 0.6141 0.4418 0.4708 0.0164  -0.0229 -0.0185 152 ASP B N   
1200 C CA  . ASP B 75  ? 0.6522 0.4531 0.4946 0.0253  -0.0294 -0.0173 152 ASP B CA  
1201 C C   . ASP B 75  ? 0.7020 0.5182 0.5649 0.0404  -0.0360 -0.0156 152 ASP B C   
1202 O O   . ASP B 75  ? 0.7126 0.5380 0.5869 0.0511  -0.0318 -0.0198 152 ASP B O   
1203 C CB  . ASP B 75  ? 0.7033 0.4771 0.5263 0.0266  -0.0245 -0.0224 152 ASP B CB  
1204 C CG  . ASP B 75  ? 0.8400 0.5823 0.6478 0.0373  -0.0316 -0.0209 152 ASP B CG  
1205 O OD1 . ASP B 75  ? 0.8870 0.6250 0.6943 0.0417  -0.0411 -0.0148 152 ASP B OD1 
1206 O OD2 . ASP B 75  ? 0.8446 0.5644 0.6394 0.0414  -0.0286 -0.0259 152 ASP B OD2 
1207 N N   . SER B 76  ? 0.6221 0.4421 0.4899 0.0412  -0.0465 -0.0099 153 SER B N   
1208 C CA  . SER B 76  ? 0.6131 0.4498 0.5027 0.0542  -0.0555 -0.0075 153 SER B CA  
1209 C C   . SER B 76  ? 0.7037 0.5227 0.5898 0.0711  -0.0601 -0.0086 153 SER B C   
1210 O O   . SER B 76  ? 0.7044 0.5426 0.6143 0.0841  -0.0655 -0.0080 153 SER B O   
1211 C CB  . SER B 76  ? 0.6718 0.5097 0.5608 0.0499  -0.0677 -0.0018 153 SER B CB  
1212 O OG  . SER B 76  ? 0.8876 0.6913 0.7473 0.0498  -0.0749 0.0014  153 SER B OG  
1213 N N   . GLU B 77  ? 0.6835 0.4663 0.5415 0.0712  -0.0583 -0.0101 154 GLU B N   
1214 C CA  . GLU B 77  ? 0.7124 0.4731 0.5648 0.0878  -0.0633 -0.0113 154 GLU B CA  
1215 C C   . GLU B 77  ? 0.7951 0.5585 0.6538 0.0965  -0.0520 -0.0204 154 GLU B C   
1216 O O   . GLU B 77  ? 0.8680 0.6101 0.7213 0.1116  -0.0551 -0.0232 154 GLU B O   
1217 C CB  . GLU B 77  ? 0.7629 0.4781 0.5795 0.0833  -0.0691 -0.0071 154 GLU B CB  
1218 C CG  . GLU B 77  ? 0.9124 0.6188 0.7153 0.0759  -0.0798 0.0015  154 GLU B CG  
1219 C CD  . GLU B 77  ? 1.2958 0.9590 1.0606 0.0665  -0.0796 0.0051  154 GLU B CD  
1220 O OE1 . GLU B 77  ? 1.0569 0.6882 0.8057 0.0766  -0.0879 0.0085  154 GLU B OE1 
1221 O OE2 . GLU B 77  ? 1.3462 1.0074 1.0985 0.0492  -0.0703 0.0043  154 GLU B OE2 
1222 N N   . THR B 78  ? 0.6772 0.4645 0.5454 0.0879  -0.0396 -0.0253 155 THR B N   
1223 C CA  . THR B 78  ? 0.6579 0.4473 0.5275 0.0949  -0.0284 -0.0346 155 THR B CA  
1224 C C   . THR B 78  ? 0.6560 0.4904 0.5564 0.0987  -0.0204 -0.0369 155 THR B C   
1225 O O   . THR B 78  ? 0.6296 0.4889 0.5418 0.0866  -0.0192 -0.0323 155 THR B O   
1226 C CB  . THR B 78  ? 0.6982 0.4655 0.5416 0.0799  -0.0209 -0.0387 155 THR B CB  
1227 O OG1 . THR B 78  ? 0.7791 0.5048 0.5956 0.0769  -0.0279 -0.0360 155 THR B OG1 
1228 C CG2 . THR B 78  ? 0.6569 0.4238 0.4967 0.0854  -0.0100 -0.0494 155 THR B CG2 
1229 N N   . PRO B 79  ? 0.5827 0.4280 0.4961 0.1152  -0.0139 -0.0439 156 PRO B N   
1230 C CA  . PRO B 79  ? 0.5523 0.4422 0.4939 0.1169  -0.0041 -0.0454 156 PRO B CA  
1231 C C   . PRO B 79  ? 0.6153 0.5129 0.5455 0.1020  0.0080  -0.0485 156 PRO B C   
1232 O O   . PRO B 79  ? 0.6665 0.5357 0.5694 0.0975  0.0115  -0.0544 156 PRO B O   
1233 C CB  . PRO B 79  ? 0.5739 0.4684 0.5277 0.1396  0.0008  -0.0535 156 PRO B CB  
1234 C CG  . PRO B 79  ? 0.6420 0.4906 0.5673 0.1462  -0.0029 -0.0588 156 PRO B CG  
1235 C CD  . PRO B 79  ? 0.5939 0.4117 0.4972 0.1332  -0.0146 -0.0511 156 PRO B CD  
1236 N N   . THR B 80  ? 0.5238 0.4588 0.4747 0.0941  0.0134  -0.0442 157 THR B N   
1237 C CA  . THR B 80  ? 0.5058 0.4514 0.4478 0.0807  0.0237  -0.0456 157 THR B CA  
1238 C C   . THR B 80  ? 0.6089 0.5458 0.5352 0.0885  0.0354  -0.0567 157 THR B C   
1239 O O   . THR B 80  ? 0.6507 0.5919 0.5861 0.1060  0.0397  -0.0629 157 THR B O   
1240 C CB  . THR B 80  ? 0.5429 0.5299 0.5116 0.0741  0.0279  -0.0388 157 THR B CB  
1241 O OG1 . THR B 80  ? 0.5439 0.5588 0.5390 0.0886  0.0332  -0.0404 157 THR B OG1 
1242 C CG2 . THR B 80  ? 0.5137 0.5055 0.4924 0.0624  0.0164  -0.0289 157 THR B CG2 
1243 N N   . ILE B 81  ? 0.5832 0.5071 0.4857 0.0762  0.0397  -0.0599 158 ILE B N   
1244 C CA  . ILE B 81  ? 0.6187 0.5305 0.5001 0.0805  0.0495  -0.0713 158 ILE B CA  
1245 C C   . ILE B 81  ? 0.6779 0.6255 0.5701 0.0803  0.0624  -0.0717 158 ILE B C   
1246 O O   . ILE B 81  ? 0.6719 0.6374 0.5666 0.0654  0.0634  -0.0644 158 ILE B O   
1247 C CB  . ILE B 81  ? 0.6714 0.5529 0.5225 0.0658  0.0460  -0.0740 158 ILE B CB  
1248 C CG1 . ILE B 81  ? 0.6763 0.5230 0.5167 0.0647  0.0346  -0.0723 158 ILE B CG1 
1249 C CG2 . ILE B 81  ? 0.7184 0.5867 0.5456 0.0690  0.0549  -0.0866 158 ILE B CG2 
1250 C CD1 . ILE B 81  ? 0.6794 0.5216 0.5149 0.0465  0.0278  -0.0647 158 ILE B CD1 
1251 N N   . GLN B 82  ? 0.6392 0.5975 0.5382 0.0973  0.0725  -0.0800 159 GLN B N   
1252 C CA  . GLN B 82  ? 0.6249 0.6191 0.5340 0.0985  0.0873  -0.0808 159 GLN B CA  
1253 C C   . GLN B 82  ? 0.7435 0.7231 0.6208 0.0999  0.0982  -0.0934 159 GLN B C   
1254 O O   . GLN B 82  ? 0.7712 0.7366 0.6402 0.1168  0.1039  -0.1061 159 GLN B O   
1255 C CB  . GLN B 82  ? 0.6221 0.6481 0.5666 0.1148  0.0924  -0.0800 159 GLN B CB  
1256 C CG  . GLN B 82  ? 0.6552 0.7035 0.6313 0.1078  0.0819  -0.0659 159 GLN B CG  
1257 C CD  . GLN B 82  ? 0.9981 1.0587 1.0044 0.1260  0.0773  -0.0663 159 GLN B CD  
1258 O OE1 . GLN B 82  ? 0.9718 1.0089 0.9781 0.1305  0.0625  -0.0642 159 GLN B OE1 
1259 N NE2 . GLN B 82  ? 0.7838 0.8823 0.8166 0.1369  0.0898  -0.0686 159 GLN B NE2 
1260 N N   . LYS B 83  ? 0.7135 0.6929 0.5710 0.0822  0.0992  -0.0903 160 LYS B N   
1261 C CA  . LYS B 83  ? 0.7313 0.6964 0.5546 0.0798  0.1070  -0.1012 160 LYS B CA  
1262 C C   . LYS B 83  ? 0.7701 0.7695 0.5934 0.0735  0.1201  -0.0971 160 LYS B C   
1263 O O   . LYS B 83  ? 0.7474 0.7528 0.5621 0.0561  0.1165  -0.0882 160 LYS B O   
1264 C CB  . LYS B 83  ? 0.7573 0.6881 0.5531 0.0648  0.0950  -0.1021 160 LYS B CB  
1265 N N   . GLY B 84  ? 0.7419 0.7638 0.5756 0.0883  0.1354  -0.1033 161 GLY B N   
1266 C CA  . GLY B 84  ? 0.7598 0.8154 0.5924 0.0848  0.1515  -0.1008 161 GLY B CA  
1267 C C   . GLY B 84  ? 0.8127 0.9049 0.6763 0.0732  0.1512  -0.0829 161 GLY B C   
1268 O O   . GLY B 84  ? 0.8015 0.9117 0.7009 0.0796  0.1483  -0.0772 161 GLY B O   
1269 N N   . SER B 85  ? 0.7672 0.8691 0.6166 0.0559  0.1528  -0.0737 162 SER B N   
1270 C CA  . SER B 85  ? 0.7387 0.8702 0.6128 0.0422  0.1514  -0.0558 162 SER B CA  
1271 C C   . SER B 85  ? 0.7322 0.8489 0.6193 0.0315  0.1310  -0.0454 162 SER B C   
1272 O O   . SER B 85  ? 0.7180 0.8538 0.6263 0.0204  0.1269  -0.0312 162 SER B O   
1273 C CB  . SER B 85  ? 0.8122 0.9550 0.6625 0.0283  0.1599  -0.0494 162 SER B CB  
1274 O OG  . SER B 85  ? 1.0040 1.1152 0.8142 0.0228  0.1536  -0.0563 162 SER B OG  
1275 N N   . TYR B 86  ? 0.6491 0.7315 0.5234 0.0350  0.1191  -0.0530 163 TYR B N   
1276 C CA  . TYR B 86  ? 0.6116 0.6780 0.4938 0.0261  0.1018  -0.0456 163 TYR B CA  
1277 C C   . TYR B 86  ? 0.6408 0.6955 0.5407 0.0374  0.0937  -0.0488 163 TYR B C   
1278 O O   . TYR B 86  ? 0.6799 0.7269 0.5784 0.0532  0.0988  -0.0596 163 TYR B O   
1279 C CB  . TYR B 86  ? 0.6261 0.6629 0.4769 0.0160  0.0932  -0.0488 163 TYR B CB  
1280 C CG  . TYR B 86  ? 0.6366 0.6825 0.4702 0.0026  0.0957  -0.0425 163 TYR B CG  
1281 C CD1 . TYR B 86  ? 0.6826 0.7330 0.4919 0.0048  0.1082  -0.0493 163 TYR B CD1 
1282 C CD2 . TYR B 86  ? 0.6233 0.6725 0.4635 -0.0116 0.0853  -0.0298 163 TYR B CD2 
1283 C CE1 . TYR B 86  ? 0.6804 0.7389 0.4715 -0.0078 0.1098  -0.0421 163 TYR B CE1 
1284 C CE2 . TYR B 86  ? 0.6506 0.7069 0.4749 -0.0232 0.0861  -0.0226 163 TYR B CE2 
1285 C CZ  . TYR B 86  ? 0.8106 0.8714 0.6094 -0.0217 0.0980  -0.0282 163 TYR B CZ  
1286 O OH  . TYR B 86  ? 0.8857 0.9519 0.6655 -0.0335 0.0977  -0.0201 163 TYR B OH  
1287 N N   . THR B 87  ? 0.5311 0.5822 0.4455 0.0295  0.0806  -0.0397 164 THR B N   
1288 C CA  . THR B 87  ? 0.5188 0.5552 0.4451 0.0369  0.0702  -0.0407 164 THR B CA  
1289 C C   . THR B 87  ? 0.5311 0.5391 0.4410 0.0261  0.0579  -0.0391 164 THR B C   
1290 O O   . THR B 87  ? 0.5060 0.5185 0.4146 0.0124  0.0539  -0.0317 164 THR B O   
1291 C CB  . THR B 87  ? 0.6041 0.6672 0.5656 0.0390  0.0671  -0.0318 164 THR B CB  
1292 O OG1 . THR B 87  ? 0.5810 0.6727 0.5594 0.0495  0.0799  -0.0343 164 THR B OG1 
1293 C CG2 . THR B 87  ? 0.5594 0.6059 0.5300 0.0457  0.0543  -0.0319 164 THR B CG2 
1294 N N   . PHE B 88  ? 0.4678 0.4471 0.3660 0.0326  0.0525  -0.0459 165 PHE B N   
1295 C CA  . PHE B 88  ? 0.4561 0.4093 0.3394 0.0230  0.0428  -0.0453 165 PHE B CA  
1296 C C   . PHE B 88  ? 0.5101 0.4513 0.4030 0.0269  0.0332  -0.0421 165 PHE B C   
1297 O O   . PHE B 88  ? 0.5134 0.4513 0.4137 0.0405  0.0327  -0.0448 165 PHE B O   
1298 C CB  . PHE B 88  ? 0.4990 0.4249 0.3532 0.0227  0.0451  -0.0557 165 PHE B CB  
1299 C CG  . PHE B 88  ? 0.5121 0.4477 0.3522 0.0154  0.0517  -0.0580 165 PHE B CG  
1300 C CD1 . PHE B 88  ? 0.5420 0.4771 0.3744 0.0002  0.0464  -0.0535 165 PHE B CD1 
1301 C CD2 . PHE B 88  ? 0.5329 0.4785 0.3667 0.0245  0.0633  -0.0649 165 PHE B CD2 
1302 C CE1 . PHE B 88  ? 0.5636 0.5064 0.3809 -0.0064 0.0506  -0.0547 165 PHE B CE1 
1303 C CE2 . PHE B 88  ? 0.5552 0.5083 0.3716 0.0173  0.0691  -0.0667 165 PHE B CE2 
1304 C CZ  . PHE B 88  ? 0.5253 0.4762 0.3328 0.0016  0.0618  -0.0611 165 PHE B CZ  
1305 N N   . VAL B 89  ? 0.4713 0.4069 0.3641 0.0157  0.0252  -0.0361 166 VAL B N   
1306 C CA  . VAL B 89  ? 0.4846 0.4083 0.3824 0.0174  0.0160  -0.0325 166 VAL B CA  
1307 C C   . VAL B 89  ? 0.5883 0.4769 0.4627 0.0183  0.0133  -0.0380 166 VAL B C   
1308 O O   . VAL B 89  ? 0.5953 0.4712 0.4533 0.0083  0.0146  -0.0408 166 VAL B O   
1309 C CB  . VAL B 89  ? 0.5203 0.4520 0.4258 0.0053  0.0100  -0.0250 166 VAL B CB  
1310 C CG1 . VAL B 89  ? 0.5161 0.4328 0.4209 0.0060  0.0010  -0.0223 166 VAL B CG1 
1311 C CG2 . VAL B 89  ? 0.5018 0.4642 0.4295 0.0029  0.0115  -0.0188 166 VAL B CG2 
1312 N N   . PRO B 90  ? 0.5436 0.4155 0.4164 0.0293  0.0088  -0.0389 167 PRO B N   
1313 C CA  . PRO B 90  ? 0.5449 0.3804 0.3940 0.0276  0.0054  -0.0419 167 PRO B CA  
1314 C C   . PRO B 90  ? 0.5892 0.4178 0.4333 0.0143  -0.0002 -0.0358 167 PRO B C   
1315 O O   . PRO B 90  ? 0.5820 0.4199 0.4375 0.0152  -0.0060 -0.0297 167 PRO B O   
1316 C CB  . PRO B 90  ? 0.5800 0.4024 0.4313 0.0442  0.0009  -0.0427 167 PRO B CB  
1317 C CG  . PRO B 90  ? 0.6070 0.4614 0.4865 0.0523  -0.0006 -0.0383 167 PRO B CG  
1318 C CD  . PRO B 90  ? 0.5404 0.4259 0.4336 0.0422  0.0049  -0.0357 167 PRO B CD  
1319 N N   . TRP B 91  ? 0.5735 0.3892 0.4021 0.0017  0.0018  -0.0379 168 TRP B N   
1320 C CA  . TRP B 91  ? 0.5887 0.4014 0.4140 -0.0109 -0.0012 -0.0332 168 TRP B CA  
1321 C C   . TRP B 91  ? 0.6829 0.4639 0.4887 -0.0134 -0.0045 -0.0319 168 TRP B C   
1322 O O   . TRP B 91  ? 0.7095 0.4654 0.5003 -0.0092 -0.0045 -0.0356 168 TRP B O   
1323 C CB  . TRP B 91  ? 0.5685 0.3911 0.3931 -0.0243 0.0025  -0.0351 168 TRP B CB  
1324 C CG  . TRP B 91  ? 0.5583 0.4102 0.3993 -0.0242 0.0048  -0.0341 168 TRP B CG  
1325 C CD1 . TRP B 91  ? 0.5932 0.4530 0.4317 -0.0249 0.0091  -0.0383 168 TRP B CD1 
1326 C CD2 . TRP B 91  ? 0.5376 0.4124 0.3978 -0.0235 0.0024  -0.0282 168 TRP B CD2 
1327 N NE1 . TRP B 91  ? 0.5666 0.4532 0.4211 -0.0249 0.0101  -0.0342 168 TRP B NE1 
1328 C CE2 . TRP B 91  ? 0.5645 0.4603 0.4336 -0.0244 0.0058  -0.0279 168 TRP B CE2 
1329 C CE3 . TRP B 91  ? 0.5528 0.4307 0.4217 -0.0228 -0.0027 -0.0233 168 TRP B CE3 
1330 C CZ2 . TRP B 91  ? 0.5294 0.4479 0.4169 -0.0255 0.0042  -0.0220 168 TRP B CZ2 
1331 C CZ3 . TRP B 91  ? 0.5544 0.4547 0.4417 -0.0236 -0.0048 -0.0188 168 TRP B CZ3 
1332 C CH2 . TRP B 91  ? 0.5458 0.4656 0.4429 -0.0252 -0.0014 -0.0178 168 TRP B CH2 
1333 N N   . LEU B 92  ? 0.6259 0.4074 0.4308 -0.0208 -0.0070 -0.0268 169 LEU B N   
1334 C CA  . LEU B 92  ? 0.6421 0.3972 0.4276 -0.0267 -0.0090 -0.0237 169 LEU B CA  
1335 C C   . LEU B 92  ? 0.6565 0.4222 0.4432 -0.0418 -0.0048 -0.0230 169 LEU B C   
1336 O O   . LEU B 92  ? 0.6380 0.4294 0.4417 -0.0431 -0.0044 -0.0224 169 LEU B O   
1337 C CB  . LEU B 92  ? 0.6530 0.4053 0.4388 -0.0185 -0.0161 -0.0181 169 LEU B CB  
1338 C CG  . LEU B 92  ? 0.7544 0.4744 0.5200 -0.0132 -0.0215 -0.0148 169 LEU B CG  
1339 C CD1 . LEU B 92  ? 0.7829 0.5086 0.5557 -0.0018 -0.0305 -0.0104 169 LEU B CD1 
1340 C CD2 . LEU B 92  ? 0.7620 0.4609 0.5054 -0.0269 -0.0194 -0.0111 169 LEU B CD2 
1341 N N   . LEU B 93  ? 0.5909 0.3378 0.3616 -0.0533 -0.0017 -0.0231 170 LEU B N   
1342 C CA  . LEU B 93  ? 0.5468 0.3076 0.3224 -0.0667 0.0031  -0.0229 170 LEU B CA  
1343 C C   . LEU B 93  ? 0.6043 0.3696 0.3791 -0.0668 0.0025  -0.0185 170 LEU B C   
1344 O O   . LEU B 93  ? 0.6322 0.3754 0.3885 -0.0659 0.0004  -0.0143 170 LEU B O   
1345 C CB  . LEU B 93  ? 0.5457 0.2888 0.3072 -0.0809 0.0074  -0.0240 170 LEU B CB  
1346 C CG  . LEU B 93  ? 0.5655 0.3252 0.3344 -0.0946 0.0132  -0.0236 170 LEU B CG  
1347 C CD1 . LEU B 93  ? 0.5447 0.3310 0.3336 -0.0989 0.0141  -0.0283 170 LEU B CD1 
1348 C CD2 . LEU B 93  ? 0.5750 0.3127 0.3255 -0.1077 0.0175  -0.0206 170 LEU B CD2 
1349 N N   . SER B 94  ? 0.5051 0.2971 0.2982 -0.0675 0.0035  -0.0196 171 SER B N   
1350 C CA  . SER B 94  ? 0.4905 0.2877 0.2829 -0.0679 0.0034  -0.0175 171 SER B CA  
1351 C C   . SER B 94  ? 0.5315 0.3244 0.3142 -0.0810 0.0114  -0.0177 171 SER B C   
1352 O O   . SER B 94  ? 0.4993 0.2752 0.2626 -0.0837 0.0128  -0.0144 171 SER B O   
1353 C CB  . SER B 94  ? 0.4890 0.3125 0.3037 -0.0636 0.0011  -0.0191 171 SER B CB  
1354 O OG  . SER B 94  ? 0.6299 0.4552 0.4415 -0.0639 0.0009  -0.0187 171 SER B OG  
1355 N N   . PHE B 95  ? 0.5028 0.3108 0.2982 -0.0894 0.0164  -0.0210 172 PHE B N   
1356 C CA  . PHE B 95  ? 0.5284 0.3389 0.3213 -0.1029 0.0247  -0.0216 172 PHE B CA  
1357 C C   . PHE B 95  ? 0.6121 0.4389 0.4218 -0.1098 0.0259  -0.0253 172 PHE B C   
1358 O O   . PHE B 95  ? 0.6243 0.4644 0.4482 -0.1035 0.0209  -0.0274 172 PHE B O   
1359 C CB  . PHE B 95  ? 0.5570 0.3829 0.3555 -0.1034 0.0297  -0.0226 172 PHE B CB  
1360 C CG  . PHE B 95  ? 0.5609 0.4164 0.3867 -0.1002 0.0291  -0.0268 172 PHE B CG  
1361 C CD1 . PHE B 95  ? 0.5926 0.4675 0.4348 -0.1088 0.0346  -0.0298 172 PHE B CD1 
1362 C CD2 . PHE B 95  ? 0.5610 0.4244 0.3971 -0.0890 0.0221  -0.0272 172 PHE B CD2 
1363 C CE1 . PHE B 95  ? 0.5680 0.4681 0.4351 -0.1046 0.0324  -0.0329 172 PHE B CE1 
1364 C CE2 . PHE B 95  ? 0.5754 0.4619 0.4347 -0.0864 0.0206  -0.0300 172 PHE B CE2 
1365 C CZ  . PHE B 95  ? 0.5467 0.4505 0.4208 -0.0934 0.0253  -0.0327 172 PHE B CZ  
1366 N N   . LYS B 96  ? 0.5838 0.4106 0.3919 -0.1235 0.0321  -0.0258 173 LYS B N   
1367 C CA  . LYS B 96  ? 0.5724 0.4145 0.3958 -0.1330 0.0324  -0.0293 173 LYS B CA  
1368 C C   . LYS B 96  ? 0.6273 0.4863 0.4606 -0.1447 0.0414  -0.0296 173 LYS B C   
1369 O O   . LYS B 96  ? 0.6493 0.4952 0.4670 -0.1516 0.0486  -0.0264 173 LYS B O   
1370 C CB  . LYS B 96  ? 0.6100 0.4275 0.4179 -0.1395 0.0295  -0.0298 173 LYS B CB  
1371 C CG  . LYS B 96  ? 0.7683 0.5976 0.5878 -0.1528 0.0292  -0.0334 173 LYS B CG  
1372 C CD  . LYS B 96  ? 0.8354 0.6345 0.6353 -0.1613 0.0266  -0.0345 173 LYS B CD  
1373 N N   . ARG B 97  ? 0.5532 0.4423 0.4125 -0.1460 0.0413  -0.0331 174 ARG B N   
1374 C CA  . ARG B 97  ? 0.5278 0.4404 0.4037 -0.1546 0.0501  -0.0346 174 ARG B CA  
1375 C C   . ARG B 97  ? 0.6015 0.5354 0.4998 -0.1631 0.0463  -0.0376 174 ARG B C   
1376 O O   . ARG B 97  ? 0.6137 0.5591 0.5248 -0.1556 0.0373  -0.0394 174 ARG B O   
1377 C CB  . ARG B 97  ? 0.4567 0.3872 0.3455 -0.1423 0.0517  -0.0366 174 ARG B CB  
1378 C CG  . ARG B 97  ? 0.5613 0.5134 0.4635 -0.1475 0.0628  -0.0390 174 ARG B CG  
1379 C CD  . ARG B 97  ? 0.5558 0.5252 0.4735 -0.1336 0.0623  -0.0428 174 ARG B CD  
1380 N NE  . ARG B 97  ? 0.6371 0.6290 0.5688 -0.1374 0.0747  -0.0467 174 ARG B NE  
1381 C CZ  . ARG B 97  ? 0.8874 0.9090 0.8494 -0.1318 0.0751  -0.0517 174 ARG B CZ  
1382 N NH1 . ARG B 97  ? 0.7184 0.7479 0.6971 -0.1220 0.0628  -0.0524 174 ARG B NH1 
1383 N NH2 . ARG B 97  ? 0.8179 0.8612 0.7932 -0.1351 0.0881  -0.0558 174 ARG B NH2 
1384 N N   . GLY B 98  ? 0.5534 0.4903 0.4541 -0.1796 0.0520  -0.0374 175 GLY B N   
1385 C CA  . GLY B 98  ? 0.5458 0.5031 0.4680 -0.1900 0.0472  -0.0403 175 GLY B CA  
1386 C C   . GLY B 98  ? 0.6374 0.5728 0.5450 -0.1961 0.0377  -0.0411 175 GLY B C   
1387 O O   . GLY B 98  ? 0.6742 0.5761 0.5543 -0.1930 0.0363  -0.0393 175 GLY B O   
1388 N N   . SER B 99  ? 0.5824 0.5371 0.5087 -0.2034 0.0303  -0.0444 176 SER B N   
1389 C CA  . SER B 99  ? 0.5922 0.5305 0.5071 -0.2113 0.0204  -0.0472 176 SER B CA  
1390 C C   . SER B 99  ? 0.6729 0.6122 0.5858 -0.1994 0.0086  -0.0499 176 SER B C   
1391 O O   . SER B 99  ? 0.7163 0.6303 0.6075 -0.2006 0.0030  -0.0525 176 SER B O   
1392 C CB  . SER B 99  ? 0.6265 0.5832 0.5602 -0.2310 0.0190  -0.0492 176 SER B CB  
1393 O OG  . SER B 99  ? 0.6971 0.6963 0.6661 -0.2292 0.0190  -0.0500 176 SER B OG  
1394 N N   . ALA B 100 ? 0.5951 0.5622 0.5291 -0.1884 0.0051  -0.0494 177 ALA B N   
1395 C CA  . ALA B 100 ? 0.5732 0.5446 0.5063 -0.1786 -0.0058 -0.0503 177 ALA B CA  
1396 C C   . ALA B 100 ? 0.6196 0.5641 0.5264 -0.1673 -0.0066 -0.0499 177 ALA B C   
1397 O O   . ALA B 100 ? 0.6132 0.5535 0.5106 -0.1648 -0.0143 -0.0520 177 ALA B O   
1398 C CB  . ALA B 100 ? 0.5545 0.5565 0.5139 -0.1685 -0.0086 -0.0482 177 ALA B CB  
1399 N N   . LEU B 101 ? 0.5866 0.5138 0.4812 -0.1604 0.0012  -0.0475 178 LEU B N   
1400 C CA  . LEU B 101 ? 0.5750 0.4804 0.4490 -0.1486 0.0006  -0.0470 178 LEU B CA  
1401 C C   . LEU B 101 ? 0.6674 0.5403 0.5181 -0.1504 0.0054  -0.0473 178 LEU B C   
1402 O O   . LEU B 101 ? 0.6571 0.5238 0.5063 -0.1567 0.0117  -0.0449 178 LEU B O   
1403 C CB  . LEU B 101 ? 0.5422 0.4593 0.4254 -0.1341 0.0016  -0.0431 178 LEU B CB  
1404 C CG  . LEU B 101 ? 0.5673 0.5119 0.4714 -0.1300 -0.0046 -0.0416 178 LEU B CG  
1405 C CD1 . LEU B 101 ? 0.5444 0.4991 0.4606 -0.1197 -0.0023 -0.0380 178 LEU B CD1 
1406 C CD2 . LEU B 101 ? 0.5862 0.5291 0.4812 -0.1262 -0.0115 -0.0421 178 LEU B CD2 
1407 N N   . GLU B 102 ? 0.6770 0.5287 0.5085 -0.1443 0.0024  -0.0501 179 GLU B N   
1408 C CA  . GLU B 102 ? 0.7125 0.5294 0.5202 -0.1425 0.0046  -0.0510 179 GLU B CA  
1409 C C   . GLU B 102 ? 0.7912 0.5988 0.5892 -0.1257 0.0038  -0.0517 179 GLU B C   
1410 O O   . GLU B 102 ? 0.7758 0.6000 0.5804 -0.1190 0.0012  -0.0530 179 GLU B O   
1411 C CB  . GLU B 102 ? 0.7571 0.5538 0.5505 -0.1549 0.0012  -0.0568 179 GLU B CB  
1412 C CG  . GLU B 102 ? 0.9034 0.6992 0.7014 -0.1736 0.0033  -0.0555 179 GLU B CG  
1413 C CD  . GLU B 102 ? 1.1806 0.9492 0.9613 -0.1868 -0.0007 -0.0608 179 GLU B CD  
1414 O OE1 . GLU B 102 ? 0.8912 0.6325 0.6508 -0.1793 -0.0038 -0.0658 179 GLU B OE1 
1415 O OE2 . GLU B 102 ? 1.1982 0.9724 0.9872 -0.2050 -0.0005 -0.0603 179 GLU B OE2 
1416 N N   . GLU B 103 ? 0.7926 0.5738 0.5751 -0.1192 0.0059  -0.0506 180 GLU B N   
1417 C CA  . GLU B 103 ? 0.8034 0.5743 0.5777 -0.1030 0.0054  -0.0518 180 GLU B CA  
1418 C C   . GLU B 103 ? 0.8749 0.6207 0.6301 -0.1043 0.0035  -0.0596 180 GLU B C   
1419 O O   . GLU B 103 ? 0.8956 0.6161 0.6373 -0.1143 0.0028  -0.0610 180 GLU B O   
1420 C CB  . GLU B 103 ? 0.8354 0.5895 0.6032 -0.0952 0.0069  -0.0465 180 GLU B CB  
1421 C CG  . GLU B 103 ? 1.0952 0.8482 0.8633 -0.0770 0.0059  -0.0463 180 GLU B CG  
1422 C CD  . GLU B 103 ? 1.7067 1.4339 1.4587 -0.0674 0.0050  -0.0520 180 GLU B CD  
1423 O OE1 . GLU B 103 ? 1.8852 1.5836 1.6196 -0.0745 0.0040  -0.0554 180 GLU B OE1 
1424 O OE2 . GLU B 103 ? 1.6742 1.4097 1.4321 -0.0525 0.0054  -0.0531 180 GLU B OE2 
1425 N N   . LYS B 104 ? 0.8365 0.5878 0.5890 -0.0951 0.0029  -0.0648 181 LYS B N   
1426 C CA  . LYS B 104 ? 0.8652 0.5911 0.5969 -0.0940 0.0016  -0.0741 181 LYS B CA  
1427 C C   . LYS B 104 ? 0.9313 0.6601 0.6603 -0.0757 0.0046  -0.0777 181 LYS B C   
1428 O O   . LYS B 104 ? 0.9253 0.6815 0.6644 -0.0718 0.0060  -0.0770 181 LYS B O   
1429 C CB  . LYS B 104 ? 0.8881 0.6189 0.6157 -0.1084 -0.0026 -0.0800 181 LYS B CB  
1430 N N   . GLU B 105 ? 0.8948 0.5966 0.6116 -0.0642 0.0057  -0.0808 182 GLU B N   
1431 C CA  . GLU B 105 ? 0.8864 0.5892 0.6016 -0.0452 0.0095  -0.0854 182 GLU B CA  
1432 C C   . GLU B 105 ? 0.8470 0.5872 0.5844 -0.0370 0.0128  -0.0790 182 GLU B C   
1433 O O   . GLU B 105 ? 0.8236 0.5813 0.5625 -0.0311 0.0169  -0.0827 182 GLU B O   
1434 C CB  . GLU B 105 ? 0.9371 0.6287 0.6336 -0.0441 0.0109  -0.0978 182 GLU B CB  
1435 C CG  . GLU B 105 ? 1.1563 0.8053 0.8286 -0.0500 0.0070  -0.1061 182 GLU B CG  
1436 C CD  . GLU B 105 ? 1.4167 1.0540 1.0684 -0.0481 0.0080  -0.1199 182 GLU B CD  
1437 O OE1 . GLU B 105 ? 1.1314 0.7936 0.7846 -0.0539 0.0086  -0.1214 182 GLU B OE1 
1438 O OE2 . GLU B 105 ? 1.3387 0.9408 0.9713 -0.0398 0.0079  -0.1293 182 GLU B OE2 
1439 N N   . ASN B 106 ? 0.7750 0.5265 0.5280 -0.0379 0.0111  -0.0693 183 ASN B N   
1440 C CA  . ASN B 106 ? 0.7371 0.5211 0.5120 -0.0319 0.0126  -0.0624 183 ASN B CA  
1441 C C   . ASN B 106 ? 0.7380 0.5505 0.5231 -0.0411 0.0129  -0.0599 183 ASN B C   
1442 O O   . ASN B 106 ? 0.7307 0.5681 0.5307 -0.0359 0.0148  -0.0555 183 ASN B O   
1443 C CB  . ASN B 106 ? 0.7127 0.5029 0.4933 -0.0142 0.0164  -0.0645 183 ASN B CB  
1444 C CG  . ASN B 106 ? 0.9653 0.7623 0.7614 -0.0057 0.0138  -0.0572 183 ASN B CG  
1445 O OD1 . ASN B 106 ? 0.9408 0.7188 0.7317 -0.0074 0.0091  -0.0536 183 ASN B OD1 
1446 N ND2 . ASN B 106 ? 0.8798 0.7039 0.6941 0.0028  0.0166  -0.0545 183 ASN B ND2 
1447 N N   . LYS B 107 ? 0.6576 0.4663 0.4358 -0.0549 0.0102  -0.0619 184 LYS B N   
1448 C CA  . LYS B 107 ? 0.6372 0.4699 0.4245 -0.0638 0.0082  -0.0592 184 LYS B CA  
1449 C C   . LYS B 107 ? 0.7142 0.5481 0.5086 -0.0769 0.0044  -0.0559 184 LYS B C   
1450 O O   . LYS B 107 ? 0.7456 0.5582 0.5317 -0.0819 0.0042  -0.0574 184 LYS B O   
1451 C CB  . LYS B 107 ? 0.6742 0.5040 0.4451 -0.0675 0.0078  -0.0669 184 LYS B CB  
1452 C CG  . LYS B 107 ? 0.5977 0.4280 0.3587 -0.0553 0.0136  -0.0719 184 LYS B CG  
1453 C CD  . LYS B 107 ? 0.5648 0.3747 0.2997 -0.0578 0.0134  -0.0835 184 LYS B CD  
1454 N N   . ILE B 108 ? 0.6313 0.4896 0.4412 -0.0824 0.0017  -0.0512 185 ILE B N   
1455 C CA  . ILE B 108 ? 0.6142 0.4786 0.4338 -0.0940 -0.0010 -0.0493 185 ILE B CA  
1456 C C   . ILE B 108 ? 0.7046 0.5695 0.5171 -0.1048 -0.0056 -0.0545 185 ILE B C   
1457 O O   . ILE B 108 ? 0.6933 0.5701 0.5040 -0.1036 -0.0086 -0.0550 185 ILE B O   
1458 C CB  . ILE B 108 ? 0.6098 0.4985 0.4515 -0.0927 -0.0023 -0.0424 185 ILE B CB  
1459 C CG1 . ILE B 108 ? 0.5989 0.4857 0.4457 -0.0829 0.0006  -0.0381 185 ILE B CG1 
1460 C CG2 . ILE B 108 ? 0.6060 0.5022 0.4585 -0.1036 -0.0037 -0.0421 185 ILE B CG2 
1461 C CD1 . ILE B 108 ? 0.5777 0.4842 0.4436 -0.0800 -0.0011 -0.0324 185 ILE B CD1 
1462 N N   . LEU B 109 ? 0.6862 0.5370 0.4927 -0.1160 -0.0067 -0.0581 186 LEU B N   
1463 C CA  . LEU B 109 ? 0.6943 0.5445 0.4949 -0.1281 -0.0125 -0.0635 186 LEU B CA  
1464 C C   . LEU B 109 ? 0.7085 0.5824 0.5313 -0.1387 -0.0162 -0.0600 186 LEU B C   
1465 O O   . LEU B 109 ? 0.7237 0.5985 0.5568 -0.1433 -0.0122 -0.0572 186 LEU B O   
1466 C CB  . LEU B 109 ? 0.7328 0.5508 0.5129 -0.1350 -0.0122 -0.0702 186 LEU B CB  
1467 C CG  . LEU B 109 ? 0.8374 0.6521 0.6130 -0.1517 -0.0192 -0.0758 186 LEU B CG  
1468 C CD1 . LEU B 109 ? 0.8616 0.6831 0.6264 -0.1507 -0.0259 -0.0813 186 LEU B CD1 
1469 C CD2 . LEU B 109 ? 0.9210 0.7011 0.6787 -0.1601 -0.0184 -0.0807 186 LEU B CD2 
1470 N N   . VAL B 110 ? 0.6057 0.4992 0.4356 -0.1421 -0.0238 -0.0602 187 VAL B N   
1471 C CA  . VAL B 110 ? 0.5524 0.4718 0.4064 -0.1506 -0.0292 -0.0575 187 VAL B CA  
1472 C C   . VAL B 110 ? 0.6081 0.5215 0.4600 -0.1671 -0.0335 -0.0630 187 VAL B C   
1473 O O   . VAL B 110 ? 0.6380 0.5376 0.4710 -0.1724 -0.0392 -0.0691 187 VAL B O   
1474 C CB  . VAL B 110 ? 0.5640 0.5049 0.4255 -0.1459 -0.0373 -0.0541 187 VAL B CB  
1475 C CG1 . VAL B 110 ? 0.5424 0.5106 0.4311 -0.1524 -0.0443 -0.0515 187 VAL B CG1 
1476 C CG2 . VAL B 110 ? 0.5435 0.4881 0.4067 -0.1317 -0.0328 -0.0481 187 VAL B CG2 
1477 N N   . LYS B 111 ? 0.5504 0.4735 0.4206 -0.1759 -0.0301 -0.0612 188 LYS B N   
1478 C CA  . LYS B 111 ? 0.5582 0.4783 0.4309 -0.1941 -0.0331 -0.0653 188 LYS B CA  
1479 C C   . LYS B 111 ? 0.6071 0.5631 0.5105 -0.2026 -0.0403 -0.0641 188 LYS B C   
1480 O O   . LYS B 111 ? 0.6278 0.5866 0.5360 -0.2186 -0.0459 -0.0678 188 LYS B O   
1481 C CB  . LYS B 111 ? 0.5822 0.4843 0.4504 -0.2004 -0.0228 -0.0640 188 LYS B CB  
1482 C CG  . LYS B 111 ? 0.6695 0.5327 0.5073 -0.1947 -0.0184 -0.0659 188 LYS B CG  
1483 C CD  . LYS B 111 ? 0.8306 0.6777 0.6653 -0.2084 -0.0124 -0.0644 188 LYS B CD  
1484 N N   . GLU B 112 ? 0.5485 0.5310 0.4735 -0.1918 -0.0409 -0.0592 189 GLU B N   
1485 C CA  . GLU B 112 ? 0.5628 0.5806 0.5193 -0.1958 -0.0488 -0.0578 189 GLU B CA  
1486 C C   . GLU B 112 ? 0.6306 0.6611 0.5903 -0.1829 -0.0579 -0.0542 189 GLU B C   
1487 O O   . GLU B 112 ? 0.6488 0.6722 0.6014 -0.1694 -0.0527 -0.0504 189 GLU B O   
1488 C CB  . GLU B 112 ? 0.5681 0.6081 0.5538 -0.1960 -0.0392 -0.0553 189 GLU B CB  
1489 C CG  . GLU B 112 ? 0.7568 0.7950 0.7473 -0.2135 -0.0323 -0.0577 189 GLU B CG  
1490 C CD  . GLU B 112 ? 1.1167 1.1594 1.1169 -0.2117 -0.0167 -0.0551 189 GLU B CD  
1491 O OE1 . GLU B 112 ? 1.1494 1.2153 1.1713 -0.2005 -0.0136 -0.0531 189 GLU B OE1 
1492 O OE2 . GLU B 112 ? 0.9694 0.9910 0.9541 -0.2219 -0.0079 -0.0552 189 GLU B OE2 
1493 N N   . THR B 113 ? 0.5638 0.6130 0.5344 -0.1877 -0.0721 -0.0545 190 THR B N   
1494 C CA  . THR B 113 ? 0.5411 0.6022 0.5145 -0.1765 -0.0821 -0.0494 190 THR B CA  
1495 C C   . THR B 113 ? 0.5535 0.6385 0.5592 -0.1662 -0.0792 -0.0443 190 THR B C   
1496 O O   . THR B 113 ? 0.5487 0.6528 0.5813 -0.1710 -0.0752 -0.0460 190 THR B O   
1497 C CB  . THR B 113 ? 0.5703 0.6422 0.5430 -0.1849 -0.0999 -0.0509 190 THR B CB  
1498 O OG1 . THR B 113 ? 0.6361 0.6816 0.5747 -0.1933 -0.1017 -0.0572 190 THR B OG1 
1499 C CG2 . THR B 113 ? 0.4889 0.5711 0.4620 -0.1741 -0.1112 -0.0441 190 THR B CG2 
1500 N N   . GLY B 114 ? 0.4961 0.5789 0.4981 -0.1524 -0.0802 -0.0384 191 GLY B N   
1501 C CA  . GLY B 114 ? 0.4730 0.5730 0.5018 -0.1410 -0.0785 -0.0342 191 GLY B CA  
1502 C C   . GLY B 114 ? 0.5123 0.6005 0.5294 -0.1279 -0.0781 -0.0278 191 GLY B C   
1503 O O   . GLY B 114 ? 0.4922 0.5656 0.4837 -0.1274 -0.0819 -0.0251 191 GLY B O   
1504 N N   . TYR B 115 ? 0.4837 0.5790 0.5200 -0.1177 -0.0732 -0.0256 192 TYR B N   
1505 C CA  . TYR B 115 ? 0.4867 0.5718 0.5172 -0.1059 -0.0728 -0.0194 192 TYR B CA  
1506 C C   . TYR B 115 ? 0.5454 0.6153 0.5670 -0.1030 -0.0584 -0.0220 192 TYR B C   
1507 O O   . TYR B 115 ? 0.5582 0.6333 0.5913 -0.1048 -0.0496 -0.0270 192 TYR B O   
1508 C CB  . TYR B 115 ? 0.4883 0.5899 0.5462 -0.0959 -0.0810 -0.0155 192 TYR B CB  
1509 C CG  . TYR B 115 ? 0.5137 0.6273 0.5775 -0.0963 -0.0984 -0.0103 192 TYR B CG  
1510 C CD1 . TYR B 115 ? 0.5303 0.6642 0.6106 -0.1034 -0.1061 -0.0139 192 TYR B CD1 
1511 C CD2 . TYR B 115 ? 0.5371 0.6417 0.5900 -0.0902 -0.1078 -0.0010 192 TYR B CD2 
1512 C CE1 . TYR B 115 ? 0.5577 0.7026 0.6428 -0.1036 -0.1241 -0.0089 192 TYR B CE1 
1513 C CE2 . TYR B 115 ? 0.5654 0.6791 0.6207 -0.0905 -0.1249 0.0049  192 TYR B CE2 
1514 C CZ  . TYR B 115 ? 0.6834 0.8175 0.7550 -0.0965 -0.1338 0.0008  192 TYR B CZ  
1515 O OH  . TYR B 115 ? 0.6869 0.8310 0.7615 -0.0967 -0.1529 0.0066  192 TYR B OH  
1516 N N   . PHE B 116 ? 0.4775 0.5294 0.4780 -0.0993 -0.0558 -0.0183 193 PHE B N   
1517 C CA  . PHE B 116 ? 0.4621 0.4992 0.4532 -0.0964 -0.0442 -0.0203 193 PHE B CA  
1518 C C   . PHE B 116 ? 0.4927 0.5227 0.4831 -0.0870 -0.0441 -0.0149 193 PHE B C   
1519 O O   . PHE B 116 ? 0.4877 0.5157 0.4715 -0.0849 -0.0503 -0.0086 193 PHE B O   
1520 C CB  . PHE B 116 ? 0.4894 0.5096 0.4556 -0.1025 -0.0383 -0.0236 193 PHE B CB  
1521 C CG  . PHE B 116 ? 0.5211 0.5425 0.4850 -0.1136 -0.0375 -0.0295 193 PHE B CG  
1522 C CD1 . PHE B 116 ? 0.5678 0.5968 0.5302 -0.1204 -0.0471 -0.0303 193 PHE B CD1 
1523 C CD2 . PHE B 116 ? 0.5504 0.5628 0.5106 -0.1183 -0.0280 -0.0339 193 PHE B CD2 
1524 C CE1 . PHE B 116 ? 0.5906 0.6195 0.5510 -0.1325 -0.0474 -0.0361 193 PHE B CE1 
1525 C CE2 . PHE B 116 ? 0.5962 0.6072 0.5533 -0.1306 -0.0274 -0.0386 193 PHE B CE2 
1526 C CZ  . PHE B 116 ? 0.5789 0.5989 0.5378 -0.1380 -0.0372 -0.0400 193 PHE B CZ  
1527 N N   . PHE B 117 ? 0.4300 0.4555 0.4258 -0.0825 -0.0371 -0.0173 194 PHE B N   
1528 C CA  . PHE B 117 ? 0.4267 0.4432 0.4207 -0.0753 -0.0370 -0.0133 194 PHE B CA  
1529 C C   . PHE B 117 ? 0.5279 0.5297 0.5013 -0.0771 -0.0304 -0.0138 194 PHE B C   
1530 O O   . PHE B 117 ? 0.5545 0.5492 0.5211 -0.0794 -0.0231 -0.0188 194 PHE B O   
1531 C CB  . PHE B 117 ? 0.4325 0.4497 0.4399 -0.0694 -0.0337 -0.0168 194 PHE B CB  
1532 C CG  . PHE B 117 ? 0.4422 0.4475 0.4459 -0.0635 -0.0348 -0.0134 194 PHE B CG  
1533 C CD1 . PHE B 117 ? 0.4834 0.4886 0.4936 -0.0599 -0.0436 -0.0064 194 PHE B CD1 
1534 C CD2 . PHE B 117 ? 0.4684 0.4620 0.4615 -0.0626 -0.0281 -0.0164 194 PHE B CD2 
1535 C CE1 . PHE B 117 ? 0.5037 0.4978 0.5116 -0.0565 -0.0451 -0.0029 194 PHE B CE1 
1536 C CE2 . PHE B 117 ? 0.5066 0.4906 0.4981 -0.0583 -0.0306 -0.0135 194 PHE B CE2 
1537 C CZ  . PHE B 117 ? 0.4816 0.4664 0.4815 -0.0558 -0.0389 -0.0070 194 PHE B CZ  
1538 N N   . ILE B 118 ? 0.4778 0.4754 0.4412 -0.0762 -0.0328 -0.0085 195 ILE B N   
1539 C CA  . ILE B 118 ? 0.4582 0.4449 0.4049 -0.0760 -0.0269 -0.0091 195 ILE B CA  
1540 C C   . ILE B 118 ? 0.5043 0.4878 0.4545 -0.0707 -0.0269 -0.0043 195 ILE B C   
1541 O O   . ILE B 118 ? 0.5148 0.5036 0.4724 -0.0695 -0.0324 0.0021  195 ILE B O   
1542 C CB  . ILE B 118 ? 0.4856 0.4723 0.4173 -0.0797 -0.0277 -0.0083 195 ILE B CB  
1543 C CG1 . ILE B 118 ? 0.4629 0.4526 0.3920 -0.0866 -0.0301 -0.0133 195 ILE B CG1 
1544 C CG2 . ILE B 118 ? 0.5043 0.4800 0.4207 -0.0774 -0.0206 -0.0106 195 ILE B CG2 
1545 C CD1 . ILE B 118 ? 0.3325 0.3294 0.2578 -0.0896 -0.0371 -0.0104 195 ILE B CD1 
1546 N N   . TYR B 119 ? 0.4399 0.4143 0.3843 -0.0680 -0.0218 -0.0069 196 TYR B N   
1547 C CA  . TYR B 119 ? 0.4139 0.3856 0.3626 -0.0637 -0.0226 -0.0033 196 TYR B CA  
1548 C C   . TYR B 119 ? 0.4623 0.4281 0.4009 -0.0611 -0.0178 -0.0043 196 TYR B C   
1549 O O   . TYR B 119 ? 0.4754 0.4334 0.4020 -0.0617 -0.0135 -0.0091 196 TYR B O   
1550 C CB  . TYR B 119 ? 0.4070 0.3741 0.3633 -0.0612 -0.0239 -0.0061 196 TYR B CB  
1551 C CG  . TYR B 119 ? 0.4262 0.3848 0.3733 -0.0618 -0.0184 -0.0127 196 TYR B CG  
1552 C CD1 . TYR B 119 ? 0.4596 0.4215 0.4080 -0.0655 -0.0158 -0.0169 196 TYR B CD1 
1553 C CD2 . TYR B 119 ? 0.4420 0.3897 0.3797 -0.0592 -0.0163 -0.0139 196 TYR B CD2 
1554 C CE1 . TYR B 119 ? 0.4880 0.4418 0.4268 -0.0681 -0.0097 -0.0217 196 TYR B CE1 
1555 C CE2 . TYR B 119 ? 0.4653 0.4025 0.3914 -0.0606 -0.0115 -0.0184 196 TYR B CE2 
1556 C CZ  . TYR B 119 ? 0.5703 0.5102 0.4963 -0.0657 -0.0076 -0.0220 196 TYR B CZ  
1557 O OH  . TYR B 119 ? 0.5727 0.5023 0.4864 -0.0689 -0.0019 -0.0252 196 TYR B OH  
1558 N N   . GLY B 120 ? 0.4065 0.3758 0.3513 -0.0584 -0.0192 0.0004  197 GLY B N   
1559 C CA  . GLY B 120 ? 0.4116 0.3792 0.3521 -0.0543 -0.0155 -0.0001 197 GLY B CA  
1560 C C   . GLY B 120 ? 0.4793 0.4535 0.4328 -0.0524 -0.0188 0.0052  197 GLY B C   
1561 O O   . GLY B 120 ? 0.5091 0.4915 0.4724 -0.0557 -0.0221 0.0113  197 GLY B O   
1562 N N   . GLN B 121 ? 0.3929 0.3628 0.3463 -0.0476 -0.0188 0.0033  198 GLN B N   
1563 C CA  . GLN B 121 ? 0.3657 0.3432 0.3329 -0.0461 -0.0228 0.0076  198 GLN B CA  
1564 C C   . GLN B 121 ? 0.4072 0.3879 0.3743 -0.0394 -0.0196 0.0062  198 GLN B C   
1565 O O   . GLN B 121 ? 0.4184 0.3869 0.3725 -0.0350 -0.0172 0.0010  198 GLN B O   
1566 C CB  . GLN B 121 ? 0.3760 0.3445 0.3466 -0.0465 -0.0305 0.0063  198 GLN B CB  
1567 C CG  . GLN B 121 ? 0.4465 0.4225 0.4320 -0.0465 -0.0369 0.0104  198 GLN B CG  
1568 C CD  . GLN B 121 ? 0.5599 0.5248 0.5456 -0.0475 -0.0453 0.0081  198 GLN B CD  
1569 O OE1 . GLN B 121 ? 0.5269 0.4881 0.5159 -0.0513 -0.0487 0.0086  198 GLN B OE1 
1570 N NE2 . GLN B 121 ? 0.3955 0.3538 0.3767 -0.0434 -0.0496 0.0054  198 GLN B NE2 
1571 N N   . VAL B 122 ? 0.3536 0.3508 0.3362 -0.0388 -0.0195 0.0112  199 VAL B N   
1572 C CA  . VAL B 122 ? 0.3555 0.3614 0.3449 -0.0311 -0.0168 0.0103  199 VAL B CA  
1573 C C   . VAL B 122 ? 0.4000 0.4200 0.4113 -0.0331 -0.0237 0.0158  199 VAL B C   
1574 O O   . VAL B 122 ? 0.3887 0.4172 0.4101 -0.0412 -0.0257 0.0217  199 VAL B O   
1575 C CB  . VAL B 122 ? 0.4089 0.4277 0.3966 -0.0287 -0.0060 0.0102  199 VAL B CB  
1576 C CG1 . VAL B 122 ? 0.4056 0.4348 0.4030 -0.0185 -0.0025 0.0081  199 VAL B CG1 
1577 C CG2 . VAL B 122 ? 0.4112 0.4154 0.3766 -0.0289 -0.0009 0.0045  199 VAL B CG2 
1578 N N   . LEU B 123 ? 0.3673 0.3883 0.3858 -0.0261 -0.0286 0.0143  200 LEU B N   
1579 C CA  . LEU B 123 ? 0.3544 0.3916 0.3964 -0.0280 -0.0361 0.0191  200 LEU B CA  
1580 C C   . LEU B 123 ? 0.4185 0.4805 0.4776 -0.0222 -0.0284 0.0208  200 LEU B C   
1581 O O   . LEU B 123 ? 0.3958 0.4554 0.4500 -0.0112 -0.0246 0.0160  200 LEU B O   
1582 C CB  . LEU B 123 ? 0.3531 0.3778 0.3931 -0.0242 -0.0483 0.0165  200 LEU B CB  
1583 C CG  . LEU B 123 ? 0.4045 0.4472 0.4696 -0.0242 -0.0579 0.0203  200 LEU B CG  
1584 C CD1 . LEU B 123 ? 0.4128 0.4671 0.4948 -0.0366 -0.0619 0.0262  200 LEU B CD1 
1585 C CD2 . LEU B 123 ? 0.4146 0.4408 0.4710 -0.0205 -0.0708 0.0172  200 LEU B CD2 
1586 N N   . TYR B 124 ? 0.4007 0.4855 0.4793 -0.0299 -0.0254 0.0277  201 TYR B N   
1587 C CA  . TYR B 124 ? 0.4035 0.5171 0.5010 -0.0263 -0.0157 0.0301  201 TYR B CA  
1588 C C   . TYR B 124 ? 0.4626 0.5968 0.5898 -0.0254 -0.0238 0.0333  201 TYR B C   
1589 O O   . TYR B 124 ? 0.4573 0.5921 0.5958 -0.0352 -0.0346 0.0381  201 TYR B O   
1590 C CB  . TYR B 124 ? 0.4043 0.5319 0.5032 -0.0366 -0.0057 0.0368  201 TYR B CB  
1591 C CG  . TYR B 124 ? 0.4202 0.5299 0.4905 -0.0367 0.0012  0.0334  201 TYR B CG  
1592 C CD1 . TYR B 124 ? 0.4339 0.5440 0.4909 -0.0275 0.0125  0.0269  201 TYR B CD1 
1593 C CD2 . TYR B 124 ? 0.4445 0.5350 0.5008 -0.0451 -0.0049 0.0353  201 TYR B CD2 
1594 C CE1 . TYR B 124 ? 0.4139 0.5066 0.4443 -0.0285 0.0169  0.0231  201 TYR B CE1 
1595 C CE2 . TYR B 124 ? 0.4598 0.5356 0.4923 -0.0452 -0.0004 0.0320  201 TYR B CE2 
1596 C CZ  . TYR B 124 ? 0.4904 0.5676 0.5098 -0.0379 0.0101  0.0261  201 TYR B CZ  
1597 O OH  . TYR B 124 ? 0.4582 0.5210 0.4548 -0.0394 0.0127  0.0226  201 TYR B OH  
1598 N N   . THR B 125 ? 0.4165 0.5662 0.5562 -0.0127 -0.0198 0.0298  202 THR B N   
1599 C CA  . THR B 125 ? 0.4040 0.5781 0.5758 -0.0096 -0.0275 0.0323  202 THR B CA  
1600 C C   . THR B 125 ? 0.4386 0.6489 0.6340 -0.0048 -0.0128 0.0337  202 THR B C   
1601 O O   . THR B 125 ? 0.4349 0.6665 0.6548 0.0058  -0.0146 0.0321  202 THR B O   
1602 C CB  . THR B 125 ? 0.4205 0.5770 0.5864 0.0026  -0.0407 0.0269  202 THR B CB  
1603 O OG1 . THR B 125 ? 0.4294 0.5725 0.5773 0.0173  -0.0326 0.0198  202 THR B OG1 
1604 C CG2 . THR B 125 ? 0.3334 0.4589 0.4783 -0.0047 -0.0546 0.0265  202 THR B CG2 
1605 N N   . ASP B 126 ? 0.3850 0.6028 0.5726 -0.0128 0.0017  0.0369  203 ASP B N   
1606 C CA  . ASP B 126 ? 0.3683 0.6186 0.5706 -0.0104 0.0196  0.0382  203 ASP B CA  
1607 C C   . ASP B 126 ? 0.3684 0.6485 0.5963 -0.0273 0.0227  0.0499  203 ASP B C   
1608 O O   . ASP B 126 ? 0.3473 0.6136 0.5650 -0.0428 0.0174  0.0569  203 ASP B O   
1609 C CB  . ASP B 126 ? 0.3940 0.6276 0.5627 -0.0079 0.0333  0.0335  203 ASP B CB  
1610 C CG  . ASP B 126 ? 0.4885 0.7455 0.6616 0.0026  0.0521  0.0288  203 ASP B CG  
1611 O OD1 . ASP B 126 ? 0.4635 0.7555 0.6597 -0.0035 0.0624  0.0352  203 ASP B OD1 
1612 O OD2 . ASP B 126 ? 0.6260 0.8649 0.7770 0.0159  0.0574  0.0185  203 ASP B OD2 
1613 N N   . LYS B 127 ? 0.3061 0.6272 0.5680 -0.0244 0.0314  0.0522  204 LYS B N   
1614 C CA  . LYS B 127 ? 0.2886 0.6422 0.5783 -0.0416 0.0359  0.0641  204 LYS B CA  
1615 C C   . LYS B 127 ? 0.3476 0.7063 0.6195 -0.0531 0.0538  0.0707  204 LYS B C   
1616 O O   . LYS B 127 ? 0.3365 0.7125 0.6237 -0.0712 0.0557  0.0827  204 LYS B O   
1617 C CB  . LYS B 127 ? 0.2939 0.6927 0.6300 -0.0361 0.0381  0.0649  204 LYS B CB  
1618 N N   . THR B 128 ? 0.3260 0.6672 0.5640 -0.0438 0.0653  0.0633  205 THR B N   
1619 C CA  . THR B 128 ? 0.3440 0.6851 0.5577 -0.0528 0.0807  0.0683  205 THR B CA  
1620 C C   . THR B 128 ? 0.3953 0.7196 0.6003 -0.0737 0.0707  0.0809  205 THR B C   
1621 O O   . THR B 128 ? 0.3576 0.6503 0.5509 -0.0752 0.0538  0.0794  205 THR B O   
1622 C CB  . THR B 128 ? 0.4269 0.7404 0.6010 -0.0404 0.0869  0.0570  205 THR B CB  
1623 O OG1 . THR B 128 ? 0.4296 0.7536 0.6110 -0.0203 0.0945  0.0448  205 THR B OG1 
1624 C CG2 . THR B 128 ? 0.3343 0.6467 0.4803 -0.0493 0.1010  0.0615  205 THR B CG2 
1625 N N   . TYR B 129 ? 0.3539 0.6994 0.5645 -0.0894 0.0817  0.0935  206 TYR B N   
1626 C CA  . TYR B 129 ? 0.3279 0.6604 0.5339 -0.1102 0.0733  0.1078  206 TYR B CA  
1627 C C   . TYR B 129 ? 0.3965 0.6842 0.5701 -0.1109 0.0592  0.1058  206 TYR B C   
1628 O O   . TYR B 129 ? 0.3920 0.6622 0.5694 -0.1221 0.0442  0.1126  206 TYR B O   
1629 C CB  . TYR B 129 ? 0.3280 0.6833 0.5312 -0.1241 0.0906  0.1203  206 TYR B CB  
1630 C CG  . TYR B 129 ? 0.3512 0.6877 0.5114 -0.1223 0.0999  0.1193  206 TYR B CG  
1631 C CD1 . TYR B 129 ? 0.3737 0.7164 0.5168 -0.1063 0.1146  0.1069  206 TYR B CD1 
1632 C CD2 . TYR B 129 ? 0.3709 0.6805 0.5064 -0.1358 0.0920  0.1299  206 TYR B CD2 
1633 C CE1 . TYR B 129 ? 0.3938 0.7177 0.4957 -0.1052 0.1212  0.1050  206 TYR B CE1 
1634 C CE2 . TYR B 129 ? 0.4012 0.6942 0.4973 -0.1343 0.0984  0.1291  206 TYR B CE2 
1635 C CZ  . TYR B 129 ? 0.5262 0.8262 0.6050 -0.1193 0.1125  0.1163  206 TYR B CZ  
1636 O OH  . TYR B 129 ? 0.6061 0.8895 0.6448 -0.1181 0.1178  0.1144  206 TYR B OH  
1637 N N   . ALA B 130 ? 0.3769 0.6467 0.5198 -0.0989 0.0641  0.0960  207 ALA B N   
1638 C CA  . ALA B 130 ? 0.3885 0.6204 0.5025 -0.0976 0.0526  0.0924  207 ALA B CA  
1639 C C   . ALA B 130 ? 0.4464 0.6646 0.5431 -0.0799 0.0545  0.0768  207 ALA B C   
1640 O O   . ALA B 130 ? 0.4642 0.6967 0.5559 -0.0704 0.0687  0.0702  207 ALA B O   
1641 C CB  . ALA B 130 ? 0.4179 0.6401 0.5060 -0.1085 0.0568  0.1019  207 ALA B CB  
1642 N N   . MET B 131 ? 0.3907 0.5812 0.4795 -0.0756 0.0402  0.0707  208 MET B N   
1643 C CA  . MET B 131 ? 0.3838 0.5550 0.4555 -0.0616 0.0386  0.0573  208 MET B CA  
1644 C C   . MET B 131 ? 0.4318 0.5730 0.4796 -0.0654 0.0295  0.0565  208 MET B C   
1645 O O   . MET B 131 ? 0.4317 0.5655 0.4821 -0.0762 0.0209  0.0650  208 MET B O   
1646 C CB  . MET B 131 ? 0.3999 0.5701 0.4902 -0.0526 0.0296  0.0511  208 MET B CB  
1647 C CG  . MET B 131 ? 0.4414 0.6415 0.5565 -0.0443 0.0378  0.0493  208 MET B CG  
1648 S SD  . MET B 131 ? 0.5035 0.7136 0.6047 -0.0300 0.0569  0.0396  208 MET B SD  
1649 C CE  . MET B 131 ? 0.4515 0.6256 0.5301 -0.0157 0.0485  0.0261  208 MET B CE  
1650 N N   . GLY B 132 ? 0.3730 0.4975 0.3988 -0.0569 0.0313  0.0465  209 GLY B N   
1651 C CA  . GLY B 132 ? 0.3721 0.4721 0.3775 -0.0600 0.0236  0.0448  209 GLY B CA  
1652 C C   . GLY B 132 ? 0.4468 0.5338 0.4284 -0.0523 0.0285  0.0342  209 GLY B C   
1653 O O   . GLY B 132 ? 0.4522 0.5469 0.4304 -0.0441 0.0384  0.0278  209 GLY B O   
1654 N N   . HIS B 133 ? 0.4051 0.4720 0.3715 -0.0548 0.0212  0.0315  210 HIS B N   
1655 C CA  . HIS B 133 ? 0.4122 0.4645 0.3566 -0.0498 0.0238  0.0214  210 HIS B CA  
1656 C C   . HIS B 133 ? 0.4726 0.5164 0.3989 -0.0569 0.0203  0.0232  210 HIS B C   
1657 O O   . HIS B 133 ? 0.4820 0.5280 0.4132 -0.0646 0.0141  0.0323  210 HIS B O   
1658 C CB  . HIS B 133 ? 0.4189 0.4543 0.3642 -0.0435 0.0182  0.0134  210 HIS B CB  
1659 C CG  . HIS B 133 ? 0.4612 0.4876 0.4148 -0.0482 0.0074  0.0166  210 HIS B CG  
1660 N ND1 . HIS B 133 ? 0.4901 0.5220 0.4629 -0.0486 0.0021  0.0211  210 HIS B ND1 
1661 C CD2 . HIS B 133 ? 0.4903 0.5037 0.4357 -0.0523 0.0014  0.0150  210 HIS B CD2 
1662 C CE1 . HIS B 133 ? 0.4787 0.4986 0.4519 -0.0521 -0.0063 0.0213  210 HIS B CE1 
1663 N NE2 . HIS B 133 ? 0.4835 0.4936 0.4421 -0.0541 -0.0065 0.0179  210 HIS B NE2 
1664 N N   . LEU B 134 ? 0.4256 0.4587 0.3310 -0.0543 0.0232  0.0143  211 LEU B N   
1665 C CA  . LEU B 134 ? 0.4300 0.4554 0.3176 -0.0606 0.0185  0.0144  211 LEU B CA  
1666 C C   . LEU B 134 ? 0.5072 0.5151 0.3888 -0.0595 0.0129  0.0055  211 LEU B C   
1667 O O   . LEU B 134 ? 0.5253 0.5237 0.4009 -0.0533 0.0172  -0.0035 211 LEU B O   
1668 C CB  . LEU B 134 ? 0.4412 0.4704 0.3056 -0.0609 0.0269  0.0116  211 LEU B CB  
1669 C CG  . LEU B 134 ? 0.4738 0.5216 0.3397 -0.0594 0.0387  0.0163  211 LEU B CG  
1670 C CD1 . LEU B 134 ? 0.4752 0.5224 0.3141 -0.0579 0.0476  0.0097  211 LEU B CD1 
1671 C CD2 . LEU B 134 ? 0.4972 0.5572 0.3727 -0.0683 0.0358  0.0310  211 LEU B CD2 
1672 N N   . ILE B 135 ? 0.4589 0.4623 0.3429 -0.0654 0.0034  0.0083  212 ILE B N   
1673 C CA  . ILE B 135 ? 0.4727 0.4632 0.3517 -0.0668 -0.0014 0.0008  212 ILE B CA  
1674 C C   . ILE B 135 ? 0.5795 0.5686 0.4385 -0.0718 -0.0030 -0.0017 212 ILE B C   
1675 O O   . ILE B 135 ? 0.5787 0.5748 0.4365 -0.0768 -0.0089 0.0054  212 ILE B O   
1676 C CB  . ILE B 135 ? 0.4940 0.4835 0.3898 -0.0691 -0.0096 0.0037  212 ILE B CB  
1677 C CG1 . ILE B 135 ? 0.4834 0.4698 0.3928 -0.0640 -0.0080 0.0031  212 ILE B CG1 
1678 C CG2 . ILE B 135 ? 0.4895 0.4713 0.3800 -0.0731 -0.0137 -0.0029 212 ILE B CG2 
1679 C CD1 . ILE B 135 ? 0.5618 0.5485 0.4876 -0.0652 -0.0150 0.0065  212 ILE B CD1 
1680 N N   . GLN B 136 ? 0.5787 0.5574 0.4203 -0.0699 0.0018  -0.0114 213 GLN B N   
1681 C CA  . GLN B 136 ? 0.6018 0.5767 0.4200 -0.0742 0.0007  -0.0159 213 GLN B CA  
1682 C C   . GLN B 136 ? 0.6540 0.6164 0.4652 -0.0797 -0.0058 -0.0238 213 GLN B C   
1683 O O   . GLN B 136 ? 0.6416 0.5930 0.4584 -0.0784 -0.0048 -0.0293 213 GLN B O   
1684 C CB  . GLN B 136 ? 0.6384 0.6104 0.4385 -0.0681 0.0117  -0.0223 213 GLN B CB  
1685 C CG  . GLN B 136 ? 0.7376 0.7261 0.5466 -0.0637 0.0198  -0.0144 213 GLN B CG  
1686 C CD  . GLN B 136 ? 0.9235 0.9122 0.7148 -0.0573 0.0318  -0.0216 213 GLN B CD  
1687 O OE1 . GLN B 136 ? 0.9315 0.9092 0.7197 -0.0492 0.0371  -0.0317 213 GLN B OE1 
1688 N NE2 . GLN B 136 ? 0.6502 0.6509 0.4286 -0.0603 0.0365  -0.0165 213 GLN B NE2 
1689 N N   . ARG B 137 ? 0.6235 0.5871 0.4205 -0.0865 -0.0126 -0.0243 214 ARG B N   
1690 C CA  . ARG B 137 ? 0.6239 0.5787 0.4144 -0.0940 -0.0204 -0.0314 214 ARG B CA  
1691 C C   . ARG B 137 ? 0.7142 0.6565 0.4744 -0.0958 -0.0187 -0.0410 214 ARG B C   
1692 O O   . ARG B 137 ? 0.7388 0.6866 0.4817 -0.0966 -0.0191 -0.0385 214 ARG B O   
1693 C CB  . ARG B 137 ? 0.6000 0.5679 0.4013 -0.1005 -0.0327 -0.0240 214 ARG B CB  
1694 C CG  . ARG B 137 ? 0.7492 0.7138 0.5495 -0.1094 -0.0421 -0.0304 214 ARG B CG  
1695 C CD  . ARG B 137 ? 0.7359 0.7156 0.5450 -0.1138 -0.0552 -0.0227 214 ARG B CD  
1696 N NE  . ARG B 137 ? 0.6404 0.6212 0.4507 -0.1229 -0.0657 -0.0284 214 ARG B NE  
1697 C CZ  . ARG B 137 ? 0.8087 0.8009 0.6206 -0.1277 -0.0795 -0.0241 214 ARG B CZ  
1698 N NH1 . ARG B 137 ? 0.6736 0.6736 0.4828 -0.1241 -0.0840 -0.0135 214 ARG B NH1 
1699 N NH2 . ARG B 137 ? 0.7494 0.7448 0.5652 -0.1367 -0.0896 -0.0298 214 ARG B NH2 
1700 N N   . LYS B 138 ? 0.6641 0.5876 0.4155 -0.0966 -0.0167 -0.0520 215 LYS B N   
1701 C CA  . LYS B 138 ? 0.6973 0.6044 0.4184 -0.0986 -0.0163 -0.0633 215 LYS B CA  
1702 C C   . LYS B 138 ? 0.7456 0.6510 0.4646 -0.1116 -0.0298 -0.0660 215 LYS B C   
1703 O O   . LYS B 138 ? 0.7514 0.6483 0.4808 -0.1174 -0.0330 -0.0697 215 LYS B O   
1704 C CB  . LYS B 138 ? 0.7379 0.6222 0.4494 -0.0917 -0.0076 -0.0738 215 LYS B CB  
1705 C CG  . LYS B 138 ? 0.9120 0.7761 0.5898 -0.0919 -0.0063 -0.0872 215 LYS B CG  
1706 N N   . LYS B 139 ? 0.6810 0.5966 0.3884 -0.1167 -0.0381 -0.0627 216 LYS B N   
1707 C CA  . LYS B 139 ? 0.6777 0.5967 0.3846 -0.1289 -0.0534 -0.0641 216 LYS B CA  
1708 C C   . LYS B 139 ? 0.7307 0.6272 0.4168 -0.1364 -0.0567 -0.0783 216 LYS B C   
1709 O O   . LYS B 139 ? 0.7497 0.6291 0.4057 -0.1327 -0.0509 -0.0873 216 LYS B O   
1710 C CB  . LYS B 139 ? 0.7181 0.6499 0.4114 -0.1312 -0.0622 -0.0571 216 LYS B CB  
1711 C CG  . LYS B 139 ? 0.8107 0.7637 0.5268 -0.1269 -0.0637 -0.0415 216 LYS B CG  
1712 C CD  . LYS B 139 ? 0.9474 0.9138 0.6653 -0.1336 -0.0810 -0.0339 216 LYS B CD  
1713 C CE  . LYS B 139 ? 1.2105 1.1782 0.8992 -0.1333 -0.0832 -0.0277 216 LYS B CE  
1714 N NZ  . LYS B 139 ? 1.4207 1.3764 1.0735 -0.1404 -0.0901 -0.0378 216 LYS B NZ  
1715 N N   . VAL B 140 ? 0.6779 0.5741 0.3796 -0.1472 -0.0655 -0.0807 217 VAL B N   
1716 C CA  . VAL B 140 ? 0.6997 0.5728 0.3821 -0.1572 -0.0705 -0.0939 217 VAL B CA  
1717 C C   . VAL B 140 ? 0.8499 0.7239 0.5078 -0.1654 -0.0842 -0.0982 217 VAL B C   
1718 O O   . VAL B 140 ? 0.8878 0.7383 0.5141 -0.1691 -0.0858 -0.1107 217 VAL B O   
1719 C CB  . VAL B 140 ? 0.6829 0.5535 0.3886 -0.1678 -0.0737 -0.0953 217 VAL B CB  
1720 C CG1 . VAL B 140 ? 0.6483 0.5476 0.3831 -0.1769 -0.0859 -0.0877 217 VAL B CG1 
1721 C CG2 . VAL B 140 ? 0.7045 0.5451 0.3874 -0.1777 -0.0769 -0.1087 217 VAL B CG2 
1722 N N   . HIS B 141 ? 0.8214 0.7212 0.4931 -0.1673 -0.0944 -0.0875 218 HIS B N   
1723 C CA  . HIS B 141 ? 0.8400 0.7463 0.4935 -0.1746 -0.1100 -0.0875 218 HIS B CA  
1724 C C   . HIS B 141 ? 0.8541 0.7731 0.4966 -0.1657 -0.1083 -0.0766 218 HIS B C   
1725 O O   . HIS B 141 ? 0.8134 0.7507 0.4817 -0.1594 -0.1057 -0.0639 218 HIS B O   
1726 C CB  . HIS B 141 ? 0.8475 0.7740 0.5315 -0.1859 -0.1266 -0.0834 218 HIS B CB  
1727 C CG  . HIS B 141 ? 0.9259 0.8645 0.5983 -0.1915 -0.1450 -0.0798 218 HIS B CG  
1728 N ND1 . HIS B 141 ? 0.9359 0.9004 0.6316 -0.1876 -0.1535 -0.0657 218 HIS B ND1 
1729 C CD2 . HIS B 141 ? 0.9943 0.9200 0.6310 -0.1995 -0.1565 -0.0883 218 HIS B CD2 
1730 C CE1 . HIS B 141 ? 0.9621 0.9294 0.6367 -0.1936 -0.1706 -0.0651 218 HIS B CE1 
1731 N NE2 . HIS B 141 ? 1.0014 0.9464 0.6398 -0.2014 -0.1731 -0.0787 218 HIS B NE2 
1732 N N   . VAL B 142 ? 0.8329 0.7406 0.4350 -0.1663 -0.1100 -0.0819 219 VAL B N   
1733 C CA  . VAL B 142 ? 0.8233 0.7398 0.4067 -0.1602 -0.1078 -0.0720 219 VAL B CA  
1734 C C   . VAL B 142 ? 0.8886 0.8061 0.4456 -0.1699 -0.1272 -0.0723 219 VAL B C   
1735 O O   . VAL B 142 ? 0.9111 0.8138 0.4488 -0.1790 -0.1363 -0.0856 219 VAL B O   
1736 C CB  . VAL B 142 ? 0.8793 0.7811 0.4351 -0.1501 -0.0874 -0.0785 219 VAL B CB  
1737 C CG1 . VAL B 142 ? 0.8880 0.7984 0.4199 -0.1461 -0.0834 -0.0691 219 VAL B CG1 
1738 C CG2 . VAL B 142 ? 0.8461 0.7493 0.4310 -0.1402 -0.0711 -0.0768 219 VAL B CG2 
1739 N N   . PHE B 143 ? 0.8169 0.7503 0.3728 -0.1687 -0.1352 -0.0574 220 PHE B N   
1740 C CA  . PHE B 143 ? 0.8325 0.7665 0.3599 -0.1769 -0.1546 -0.0557 220 PHE B CA  
1741 C C   . PHE B 143 ? 0.9002 0.8257 0.3811 -0.1728 -0.1450 -0.0532 220 PHE B C   
1742 O O   . PHE B 143 ? 0.8637 0.7984 0.3500 -0.1653 -0.1340 -0.0400 220 PHE B O   
1743 C CB  . PHE B 143 ? 0.8325 0.7890 0.3910 -0.1795 -0.1741 -0.0407 220 PHE B CB  
1744 C CG  . PHE B 143 ? 0.8921 0.8506 0.4232 -0.1871 -0.1967 -0.0366 220 PHE B CG  
1745 C CD1 . PHE B 143 ? 0.9425 0.9023 0.4757 -0.1984 -0.2175 -0.0451 220 PHE B CD1 
1746 C CD2 . PHE B 143 ? 0.9383 0.8968 0.4399 -0.1840 -0.1979 -0.0238 220 PHE B CD2 
1747 C CE1 . PHE B 143 ? 0.9873 0.9479 0.4921 -0.2056 -0.2402 -0.0419 220 PHE B CE1 
1748 C CE2 . PHE B 143 ? 1.0100 0.9674 0.4804 -0.1913 -0.2197 -0.0199 220 PHE B CE2 
1749 C CZ  . PHE B 143 ? 0.9976 0.9564 0.4703 -0.2016 -0.2416 -0.0291 220 PHE B CZ  
1750 N N   . GLY B 144 ? 0.9240 0.8310 0.3599 -0.1779 -0.1476 -0.0671 221 GLY B N   
1751 C CA  . GLY B 144 ? 0.9876 0.8849 0.3732 -0.1750 -0.1375 -0.0684 221 GLY B CA  
1752 C C   . GLY B 144 ? 1.0835 0.9854 0.4734 -0.1631 -0.1111 -0.0629 221 GLY B C   
1753 O O   . GLY B 144 ? 1.0492 0.9474 0.4618 -0.1561 -0.0960 -0.0704 221 GLY B O   
1754 N N   . ASP B 145 ? 1.0948 1.0063 0.4670 -0.1614 -0.1069 -0.0480 222 ASP B N   
1755 C CA  . ASP B 145 ? 1.0970 1.0168 0.4710 -0.1525 -0.0833 -0.0399 222 ASP B CA  
1756 C C   . ASP B 145 ? 1.1409 1.0730 0.5664 -0.1450 -0.0725 -0.0331 222 ASP B C   
1757 O O   . ASP B 145 ? 1.1262 1.0636 0.5538 -0.1374 -0.0513 -0.0312 222 ASP B O   
1758 C CB  . ASP B 145 ? 1.1521 1.0809 0.5027 -0.1563 -0.0872 -0.0209 222 ASP B CB  
1759 C CG  . ASP B 145 ? 1.4417 1.3641 0.7397 -0.1554 -0.0708 -0.0253 222 ASP B CG  
1760 O OD1 . ASP B 145 ? 1.5129 1.4190 0.7779 -0.1549 -0.0668 -0.0453 222 ASP B OD1 
1761 O OD2 . ASP B 145 ? 1.5269 1.4596 0.8138 -0.1560 -0.0627 -0.0086 222 ASP B OD2 
1762 N N   . GLU B 146 ? 1.1057 1.0441 0.5728 -0.1472 -0.0869 -0.0291 223 GLU B N   
1763 C CA  . GLU B 146 ? 1.0721 1.0217 0.5883 -0.1410 -0.0799 -0.0222 223 GLU B CA  
1764 C C   . GLU B 146 ? 1.1023 1.0458 0.6279 -0.1323 -0.0591 -0.0337 223 GLU B C   
1765 O O   . GLU B 146 ? 1.1365 1.0641 0.6395 -0.1316 -0.0540 -0.0505 223 GLU B O   
1766 C CB  . GLU B 146 ? 1.0737 1.0295 0.6264 -0.1452 -0.0983 -0.0200 223 GLU B CB  
1767 C CG  . GLU B 146 ? 1.2899 1.2577 0.8489 -0.1491 -0.1168 -0.0030 223 GLU B CG  
1768 C CD  . GLU B 146 ? 1.6846 1.6615 1.2756 -0.1532 -0.1376 -0.0011 223 GLU B CD  
1769 O OE1 . GLU B 146 ? 1.5378 1.5161 1.1131 -0.1598 -0.1572 0.0018  223 GLU B OE1 
1770 O OE2 . GLU B 146 ? 1.6118 1.5963 1.2438 -0.1495 -0.1346 -0.0012 223 GLU B OE2 
1771 N N   . LEU B 147 ? 0.9996 0.9542 0.5575 -0.1256 -0.0482 -0.0251 224 LEU B N   
1772 C CA  . LEU B 147 ? 0.9862 0.9367 0.5547 -0.1163 -0.0296 -0.0344 224 LEU B CA  
1773 C C   . LEU B 147 ? 0.9905 0.9323 0.5842 -0.1158 -0.0339 -0.0438 224 LEU B C   
1774 O O   . LEU B 147 ? 0.9515 0.9003 0.5728 -0.1198 -0.0460 -0.0370 224 LEU B O   
1775 C CB  . LEU B 147 ? 0.9687 0.9351 0.5611 -0.1101 -0.0169 -0.0216 224 LEU B CB  
1776 C CG  . LEU B 147 ? 1.0445 1.0222 0.6182 -0.1115 -0.0096 -0.0092 224 LEU B CG  
1777 C CD1 . LEU B 147 ? 1.0009 0.9939 0.6077 -0.1077 -0.0012 0.0039  224 LEU B CD1 
1778 C CD2 . LEU B 147 ? 1.1297 1.1027 0.6655 -0.1077 0.0067  -0.0202 224 LEU B CD2 
1779 N N   . SER B 148 ? 0.9417 0.8682 0.5267 -0.1100 -0.0230 -0.0588 225 SER B N   
1780 C CA  . SER B 148 ? 0.9000 0.8146 0.5050 -0.1099 -0.0255 -0.0673 225 SER B CA  
1781 C C   . SER B 148 ? 0.8610 0.7866 0.5040 -0.1032 -0.0186 -0.0587 225 SER B C   
1782 O O   . SER B 148 ? 0.8398 0.7651 0.5080 -0.1063 -0.0254 -0.0574 225 SER B O   
1783 C CB  . SER B 148 ? 0.9743 0.8654 0.5552 -0.1052 -0.0169 -0.0851 225 SER B CB  
1784 O OG  . SER B 148 ? 1.1332 1.0079 0.7242 -0.1099 -0.0239 -0.0934 225 SER B OG  
1785 N N   . LEU B 149 ? 0.7548 0.6909 0.4013 -0.0946 -0.0050 -0.0530 226 LEU B N   
1786 C CA  . LEU B 149 ? 0.6957 0.6420 0.3752 -0.0882 0.0014  -0.0454 226 LEU B CA  
1787 C C   . LEU B 149 ? 0.7385 0.7046 0.4315 -0.0907 -0.0013 -0.0288 226 LEU B C   
1788 O O   . LEU B 149 ? 0.7488 0.7228 0.4238 -0.0916 0.0033  -0.0234 226 LEU B O   
1789 C CB  . LEU B 149 ? 0.6854 0.6283 0.3637 -0.0762 0.0179  -0.0525 226 LEU B CB  
1790 C CG  . LEU B 149 ? 0.7105 0.6573 0.4204 -0.0692 0.0221  -0.0490 226 LEU B CG  
1791 C CD1 . LEU B 149 ? 0.7120 0.6401 0.4292 -0.0704 0.0159  -0.0566 226 LEU B CD1 
1792 C CD2 . LEU B 149 ? 0.7436 0.6957 0.4543 -0.0575 0.0373  -0.0522 226 LEU B CD2 
1793 N N   . VAL B 150 ? 0.6739 0.6462 0.3967 -0.0924 -0.0090 -0.0209 227 VAL B N   
1794 C CA  . VAL B 150 ? 0.6644 0.6513 0.4022 -0.0949 -0.0140 -0.0054 227 VAL B CA  
1795 C C   . VAL B 150 ? 0.6857 0.6788 0.4546 -0.0900 -0.0103 0.0001  227 VAL B C   
1796 O O   . VAL B 150 ? 0.6940 0.6807 0.4781 -0.0877 -0.0112 -0.0061 227 VAL B O   
1797 C CB  . VAL B 150 ? 0.7265 0.7152 0.4646 -0.1028 -0.0315 0.0003  227 VAL B CB  
1798 C CG1 . VAL B 150 ? 0.7708 0.7551 0.4738 -0.1083 -0.0362 -0.0025 227 VAL B CG1 
1799 C CG2 . VAL B 150 ? 0.7111 0.6954 0.4678 -0.1048 -0.0399 -0.0064 227 VAL B CG2 
1800 N N   . THR B 151 ? 0.6144 0.6192 0.3916 -0.0895 -0.0065 0.0120  228 THR B N   
1801 C CA  . THR B 151 ? 0.5824 0.5928 0.3888 -0.0861 -0.0049 0.0177  228 THR B CA  
1802 C C   . THR B 151 ? 0.6422 0.6532 0.4649 -0.0900 -0.0188 0.0256  228 THR B C   
1803 O O   . THR B 151 ? 0.6689 0.6837 0.4861 -0.0947 -0.0257 0.0361  228 THR B O   
1804 C CB  . THR B 151 ? 0.6534 0.6760 0.4630 -0.0849 0.0053  0.0261  228 THR B CB  
1805 O OG1 . THR B 151 ? 0.7274 0.7509 0.5229 -0.0794 0.0188  0.0169  228 THR B OG1 
1806 C CG2 . THR B 151 ? 0.5819 0.6097 0.4217 -0.0825 0.0050  0.0318  228 THR B CG2 
1807 N N   . LEU B 152 ? 0.5641 0.5706 0.4056 -0.0876 -0.0228 0.0204  229 LEU B N   
1808 C CA  . LEU B 152 ? 0.5415 0.5494 0.4016 -0.0891 -0.0344 0.0254  229 LEU B CA  
1809 C C   . LEU B 152 ? 0.5464 0.5580 0.4246 -0.0874 -0.0345 0.0351  229 LEU B C   
1810 O O   . LEU B 152 ? 0.5243 0.5378 0.4069 -0.0899 -0.0431 0.0453  229 LEU B O   
1811 C CB  . LEU B 152 ? 0.5351 0.5381 0.4069 -0.0879 -0.0363 0.0156  229 LEU B CB  
1812 C CG  . LEU B 152 ? 0.6116 0.6104 0.4692 -0.0923 -0.0397 0.0068  229 LEU B CG  
1813 C CD1 . LEU B 152 ? 0.6036 0.5970 0.4721 -0.0922 -0.0381 -0.0022 229 LEU B CD1 
1814 C CD2 . LEU B 152 ? 0.6458 0.6508 0.5023 -0.0970 -0.0527 0.0119  229 LEU B CD2 
1815 N N   . PHE B 153 ? 0.5064 0.5177 0.3950 -0.0831 -0.0262 0.0322  230 PHE B N   
1816 C CA  . PHE B 153 ? 0.4883 0.5023 0.3950 -0.0821 -0.0266 0.0399  230 PHE B CA  
1817 C C   . PHE B 153 ? 0.5381 0.5583 0.4441 -0.0802 -0.0154 0.0399  230 PHE B C   
1818 O O   . PHE B 153 ? 0.5454 0.5640 0.4439 -0.0760 -0.0079 0.0307  230 PHE B O   
1819 C CB  . PHE B 153 ? 0.4854 0.4936 0.4112 -0.0786 -0.0315 0.0356  230 PHE B CB  
1820 C CG  . PHE B 153 ? 0.5121 0.5176 0.4400 -0.0790 -0.0394 0.0317  230 PHE B CG  
1821 C CD1 . PHE B 153 ? 0.5458 0.5529 0.4782 -0.0808 -0.0498 0.0392  230 PHE B CD1 
1822 C CD2 . PHE B 153 ? 0.5391 0.5412 0.4639 -0.0780 -0.0367 0.0210  230 PHE B CD2 
1823 C CE1 . PHE B 153 ? 0.5510 0.5597 0.4882 -0.0806 -0.0574 0.0353  230 PHE B CE1 
1824 C CE2 . PHE B 153 ? 0.5557 0.5595 0.4850 -0.0797 -0.0433 0.0175  230 PHE B CE2 
1825 C CZ  . PHE B 153 ? 0.5303 0.5390 0.4672 -0.0805 -0.0536 0.0243  230 PHE B CZ  
1826 N N   . ARG B 154 ? 0.4778 0.5050 0.3928 -0.0833 -0.0147 0.0504  231 ARG B N   
1827 C CA  . ARG B 154 ? 0.4615 0.4998 0.3823 -0.0823 -0.0046 0.0523  231 ARG B CA  
1828 C C   . ARG B 154 ? 0.5223 0.5628 0.4666 -0.0846 -0.0092 0.0597  231 ARG B C   
1829 O O   . ARG B 154 ? 0.5087 0.5435 0.4583 -0.0895 -0.0184 0.0681  231 ARG B O   
1830 C CB  . ARG B 154 ? 0.4267 0.4748 0.3299 -0.0868 0.0031  0.0584  231 ARG B CB  
1831 C CG  . ARG B 154 ? 0.5066 0.5715 0.4186 -0.0890 0.0135  0.0652  231 ARG B CG  
1832 C CD  . ARG B 154 ? 0.3874 0.4625 0.2773 -0.0925 0.0241  0.0688  231 ARG B CD  
1833 N NE  . ARG B 154 ? 0.4345 0.5030 0.3072 -0.1007 0.0165  0.0792  231 ARG B NE  
1834 C CZ  . ARG B 154 ? 0.6914 0.7663 0.5620 -0.1100 0.0173  0.0944  231 ARG B CZ  
1835 N NH1 . ARG B 154 ? 0.5878 0.6784 0.4745 -0.1135 0.0265  0.1009  231 ARG B NH1 
1836 N NH2 . ARG B 154 ? 0.5482 0.6141 0.4004 -0.1164 0.0086  0.1036  231 ARG B NH2 
1837 N N   . CYS B 155 ? 0.4778 0.5241 0.4357 -0.0803 -0.0045 0.0555  232 CYS B N   
1838 C CA  . CYS B 155 ? 0.4571 0.5070 0.4370 -0.0822 -0.0085 0.0602  232 CYS B CA  
1839 C C   . CYS B 155 ? 0.5378 0.6075 0.5249 -0.0858 0.0008  0.0670  232 CYS B C   
1840 O O   . CYS B 155 ? 0.5619 0.6418 0.5409 -0.0810 0.0118  0.0620  232 CYS B O   
1841 C CB  . CYS B 155 ? 0.4399 0.4849 0.4284 -0.0745 -0.0098 0.0503  232 CYS B CB  
1842 S SG  A CYS B 155 ? 0.4803 0.5091 0.4799 -0.0750 -0.0232 0.0489  232 CYS B SG  
1843 S SG  B CYS B 155 ? 0.4888 0.5151 0.4650 -0.0689 -0.0142 0.0392  232 CYS B SG  
1844 N N   . ILE B 156 ? 0.4521 0.5277 0.4576 -0.0929 -0.0033 0.0762  233 ILE B N   
1845 C CA  . ILE B 156 ? 0.4401 0.5383 0.4601 -0.0970 0.0053  0.0824  233 ILE B CA  
1846 C C   . ILE B 156 ? 0.4784 0.5765 0.5230 -0.1014 -0.0043 0.0860  233 ILE B C   
1847 O O   . ILE B 156 ? 0.5020 0.5835 0.5486 -0.1068 -0.0160 0.0903  233 ILE B O   
1848 C CB  . ILE B 156 ? 0.5051 0.6165 0.5159 -0.1063 0.0144  0.0943  233 ILE B CB  
1849 C CG1 . ILE B 156 ? 0.5261 0.6339 0.5074 -0.1022 0.0217  0.0896  233 ILE B CG1 
1850 C CG2 . ILE B 156 ? 0.5239 0.6640 0.5536 -0.1093 0.0261  0.0986  233 ILE B CG2 
1851 C CD1 . ILE B 156 ? 0.6389 0.7557 0.6031 -0.1111 0.0299  0.1006  233 ILE B CD1 
1852 N N   . GLN B 157 ? 0.3818 0.4976 0.4451 -0.0983 -0.0003 0.0832  234 GLN B N   
1853 C CA  . GLN B 157 ? 0.3575 0.4778 0.4455 -0.1031 -0.0091 0.0862  234 GLN B CA  
1854 C C   . GLN B 157 ? 0.4282 0.5805 0.5372 -0.1074 0.0009  0.0924  234 GLN B C   
1855 O O   . GLN B 157 ? 0.4333 0.6027 0.5433 -0.0980 0.0123  0.0862  234 GLN B O   
1856 C CB  . GLN B 157 ? 0.3496 0.4603 0.4416 -0.0925 -0.0167 0.0744  234 GLN B CB  
1857 C CG  . GLN B 157 ? 0.3314 0.4130 0.4111 -0.0907 -0.0286 0.0691  234 GLN B CG  
1858 C CD  . GLN B 157 ? 0.5793 0.6484 0.6658 -0.1012 -0.0400 0.0763  234 GLN B CD  
1859 O OE1 . GLN B 157 ? 0.5317 0.5904 0.6083 -0.1064 -0.0412 0.0822  234 GLN B OE1 
1860 N NE2 . GLN B 157 ? 0.4346 0.5020 0.5370 -0.1041 -0.0500 0.0754  234 GLN B NE2 
1861 N N   . ASN B 158 ? 0.3656 0.5264 0.4933 -0.1214 -0.0034 0.1039  235 ASN B N   
1862 C CA  . ASN B 158 ? 0.3582 0.5531 0.5114 -0.1268 0.0056  0.1099  235 ASN B CA  
1863 C C   . ASN B 158 ? 0.4449 0.6474 0.6201 -0.1189 -0.0023 0.1013  235 ASN B C   
1864 O O   . ASN B 158 ? 0.4699 0.6483 0.6408 -0.1158 -0.0170 0.0954  235 ASN B O   
1865 C CB  . ASN B 158 ? 0.3511 0.5518 0.5183 -0.1465 0.0025  0.1257  235 ASN B CB  
1866 C CG  . ASN B 158 ? 0.5304 0.7299 0.6780 -0.1558 0.0121  0.1372  235 ASN B CG  
1867 O OD1 . ASN B 158 ? 0.4495 0.6255 0.5862 -0.1655 0.0027  0.1458  235 ASN B OD1 
1868 N ND2 . ASN B 158 ? 0.3967 0.6202 0.5378 -0.1524 0.0307  0.1375  235 ASN B ND2 
1869 N N   . MET B 159 ? 0.3949 0.6303 0.5924 -0.1143 0.0071  0.1002  236 MET B N   
1870 C CA  . MET B 159 ? 0.3732 0.6175 0.5923 -0.1054 -0.0016 0.0925  236 MET B CA  
1871 C C   . MET B 159 ? 0.4547 0.7334 0.7127 -0.1160 -0.0021 0.1008  236 MET B C   
1872 O O   . MET B 159 ? 0.4659 0.7718 0.7351 -0.1243 0.0123  0.1095  236 MET B O   
1873 C CB  . MET B 159 ? 0.3958 0.6481 0.6089 -0.0858 0.0083  0.0811  236 MET B CB  
1874 C CG  . MET B 159 ? 0.4376 0.6610 0.6134 -0.0766 0.0121  0.0732  236 MET B CG  
1875 S SD  . MET B 159 ? 0.4925 0.6743 0.6478 -0.0740 -0.0059 0.0666  236 MET B SD  
1876 C CE  . MET B 159 ? 0.4533 0.6409 0.6268 -0.0616 -0.0157 0.0587  236 MET B CE  
1877 N N   . PRO B 160 ? 0.4161 0.6960 0.6954 -0.1166 -0.0183 0.0984  237 PRO B N   
1878 C CA  . PRO B 160 ? 0.4131 0.7290 0.7332 -0.1274 -0.0199 0.1060  237 PRO B CA  
1879 C C   . PRO B 160 ? 0.4987 0.8520 0.8434 -0.1127 -0.0102 0.1004  237 PRO B C   
1880 O O   . PRO B 160 ? 0.5041 0.8470 0.8337 -0.0933 -0.0086 0.0893  237 PRO B O   
1881 C CB  . PRO B 160 ? 0.4301 0.7264 0.7576 -0.1334 -0.0438 0.1042  237 PRO B CB  
1882 C CG  . PRO B 160 ? 0.4796 0.7423 0.7776 -0.1172 -0.0516 0.0918  237 PRO B CG  
1883 C CD  . PRO B 160 ? 0.4307 0.6806 0.6976 -0.1082 -0.0358 0.0888  237 PRO B CD  
1884 N N   . GLU B 161 ? 0.4601 0.8568 0.8440 -0.1215 -0.0038 0.1081  238 GLU B N   
1885 C CA  . GLU B 161 ? 0.4624 0.8982 0.8748 -0.1064 0.0053  0.1026  238 GLU B CA  
1886 C C   . GLU B 161 ? 0.5184 0.9479 0.9432 -0.0940 -0.0151 0.0939  238 GLU B C   
1887 O O   . GLU B 161 ? 0.5192 0.9592 0.9493 -0.0735 -0.0117 0.0850  238 GLU B O   
1888 C CB  . GLU B 161 ? 0.4896 0.9765 0.9442 -0.1200 0.0168  0.1132  238 GLU B CB  
1889 N N   . THR B 162 ? 0.4722 0.8803 0.8973 -0.1056 -0.0368 0.0962  239 THR B N   
1890 C CA  . THR B 162 ? 0.4664 0.8663 0.9004 -0.0974 -0.0587 0.0894  239 THR B CA  
1891 C C   . THR B 162 ? 0.4950 0.8425 0.8858 -0.0906 -0.0714 0.0814  239 THR B C   
1892 O O   . THR B 162 ? 0.4843 0.8013 0.8512 -0.1024 -0.0751 0.0839  239 THR B O   
1893 C CB  . THR B 162 ? 0.5636 0.9870 1.0370 -0.1153 -0.0744 0.0968  239 THR B CB  
1894 O OG1 . THR B 162 ? 0.6448 1.0493 1.1157 -0.1096 -0.0986 0.0901  239 THR B OG1 
1895 C CG2 . THR B 162 ? 0.4982 0.9081 0.9666 -0.1409 -0.0760 0.1073  239 THR B CG2 
1896 N N   . LEU B 163 ? 0.4415 0.7794 0.8242 -0.0717 -0.0787 0.0722  240 LEU B N   
1897 C CA  . LEU B 163 ? 0.4430 0.7353 0.7865 -0.0635 -0.0898 0.0642  240 LEU B CA  
1898 C C   . LEU B 163 ? 0.5114 0.7709 0.8153 -0.0655 -0.0786 0.0628  240 LEU B C   
1899 O O   . LEU B 163 ? 0.5425 0.7702 0.8245 -0.0734 -0.0888 0.0619  240 LEU B O   
1900 C CB  . LEU B 163 ? 0.4465 0.7223 0.7916 -0.0727 -0.1144 0.0638  240 LEU B CB  
1901 C CG  . LEU B 163 ? 0.5042 0.8053 0.8820 -0.0681 -0.1306 0.0633  240 LEU B CG  
1902 C CD1 . LEU B 163 ? 0.5162 0.8071 0.9003 -0.0840 -0.1532 0.0649  240 LEU B CD1 
1903 C CD2 . LEU B 163 ? 0.5153 0.8017 0.8760 -0.0468 -0.1365 0.0554  240 LEU B CD2 
1904 N N   . PRO B 164 ? 0.4363 0.7031 0.7306 -0.0586 -0.0583 0.0622  241 PRO B N   
1905 C CA  . PRO B 164 ? 0.4306 0.6682 0.6893 -0.0618 -0.0499 0.0614  241 PRO B CA  
1906 C C   . PRO B 164 ? 0.5029 0.7016 0.7278 -0.0522 -0.0576 0.0527  241 PRO B C   
1907 O O   . PRO B 164 ? 0.5259 0.7205 0.7448 -0.0370 -0.0582 0.0460  241 PRO B O   
1908 C CB  . PRO B 164 ? 0.4501 0.7076 0.7082 -0.0554 -0.0282 0.0616  241 PRO B CB  
1909 C CG  . PRO B 164 ? 0.5014 0.7856 0.7835 -0.0407 -0.0259 0.0574  241 PRO B CG  
1910 C CD  . PRO B 164 ? 0.4460 0.7475 0.7607 -0.0475 -0.0425 0.0615  241 PRO B CD  
1911 N N   . ASN B 165 ? 0.4447 0.6149 0.6490 -0.0614 -0.0645 0.0530  242 ASN B N   
1912 C CA  . ASN B 165 ? 0.4328 0.5670 0.6051 -0.0552 -0.0707 0.0454  242 ASN B CA  
1913 C C   . ASN B 165 ? 0.4312 0.5449 0.5855 -0.0653 -0.0690 0.0474  242 ASN B C   
1914 O O   . ASN B 165 ? 0.4088 0.5118 0.5659 -0.0754 -0.0802 0.0495  242 ASN B O   
1915 C CB  . ASN B 165 ? 0.4620 0.5841 0.6352 -0.0540 -0.0894 0.0417  242 ASN B CB  
1916 C CG  . ASN B 165 ? 0.6091 0.7445 0.7951 -0.0419 -0.0949 0.0391  242 ASN B CG  
1917 O OD1 . ASN B 165 ? 0.4787 0.6422 0.6968 -0.0443 -0.1008 0.0431  242 ASN B OD1 
1918 N ND2 . ASN B 165 ? 0.4664 0.5808 0.6279 -0.0294 -0.0947 0.0328  242 ASN B ND2 
1919 N N   . ASN B 166 ? 0.3719 0.4806 0.5089 -0.0626 -0.0557 0.0469  243 ASN B N   
1920 C CA  . ASN B 166 ? 0.3593 0.4498 0.4794 -0.0700 -0.0542 0.0488  243 ASN B CA  
1921 C C   . ASN B 166 ? 0.3902 0.4623 0.4836 -0.0615 -0.0479 0.0417  243 ASN B C   
1922 O O   . ASN B 166 ? 0.3866 0.4669 0.4745 -0.0544 -0.0370 0.0396  243 ASN B O   
1923 C CB  . ASN B 166 ? 0.3333 0.4407 0.4628 -0.0801 -0.0453 0.0588  243 ASN B CB  
1924 C CG  . ASN B 166 ? 0.7030 0.8208 0.8552 -0.0937 -0.0529 0.0677  243 ASN B CG  
1925 O OD1 . ASN B 166 ? 0.5404 0.6405 0.6930 -0.0996 -0.0664 0.0672  243 ASN B OD1 
1926 N ND2 . ASN B 166 ? 0.7198 0.8658 0.8905 -0.1000 -0.0437 0.0761  243 ASN B ND2 
1927 N N   . SER B 167 ? 0.3297 0.3770 0.4065 -0.0621 -0.0545 0.0374  244 SER B N   
1928 C CA  . SER B 167 ? 0.3207 0.3516 0.3740 -0.0564 -0.0487 0.0312  244 SER B CA  
1929 C C   . SER B 167 ? 0.3863 0.4149 0.4346 -0.0631 -0.0449 0.0357  244 SER B C   
1930 O O   . SER B 167 ? 0.3990 0.4270 0.4567 -0.0714 -0.0508 0.0416  244 SER B O   
1931 C CB  . SER B 167 ? 0.3737 0.3818 0.4126 -0.0532 -0.0566 0.0240  244 SER B CB  
1932 O OG  . SER B 167 ? 0.4201 0.4170 0.4607 -0.0596 -0.0654 0.0245  244 SER B OG  
1933 N N   . CYS B 168 ? 0.3367 0.3633 0.3704 -0.0600 -0.0361 0.0334  245 CYS B N   
1934 C CA  . CYS B 168 ? 0.3173 0.3415 0.3448 -0.0657 -0.0341 0.0378  245 CYS B CA  
1935 C C   . CYS B 168 ? 0.4035 0.4134 0.4136 -0.0619 -0.0326 0.0310  245 CYS B C   
1936 O O   . CYS B 168 ? 0.4359 0.4443 0.4349 -0.0565 -0.0265 0.0253  245 CYS B O   
1937 C CB  . CYS B 168 ? 0.3161 0.3583 0.3457 -0.0690 -0.0251 0.0447  245 CYS B CB  
1938 S SG  A CYS B 168 ? 0.3710 0.4106 0.3963 -0.0788 -0.0270 0.0547  245 CYS B SG  
1939 S SG  B CYS B 168 ? 0.3703 0.4106 0.3974 -0.0793 -0.0274 0.0553  245 CYS B SG  
1940 N N   . TYR B 169 ? 0.3683 0.3675 0.3770 -0.0649 -0.0385 0.0314  246 TYR B N   
1941 C CA  . TYR B 169 ? 0.3624 0.3509 0.3590 -0.0624 -0.0378 0.0254  246 TYR B CA  
1942 C C   . TYR B 169 ? 0.4296 0.4210 0.4242 -0.0665 -0.0381 0.0311  246 TYR B C   
1943 O O   . TYR B 169 ? 0.4556 0.4483 0.4586 -0.0713 -0.0432 0.0391  246 TYR B O   
1944 C CB  . TYR B 169 ? 0.3682 0.3430 0.3664 -0.0608 -0.0447 0.0203  246 TYR B CB  
1945 C CG  . TYR B 169 ? 0.3941 0.3614 0.3839 -0.0585 -0.0431 0.0140  246 TYR B CG  
1946 C CD1 . TYR B 169 ? 0.4111 0.3781 0.4049 -0.0599 -0.0463 0.0162  246 TYR B CD1 
1947 C CD2 . TYR B 169 ? 0.4034 0.3645 0.3822 -0.0551 -0.0387 0.0062  246 TYR B CD2 
1948 C CE1 . TYR B 169 ? 0.4271 0.3916 0.4173 -0.0577 -0.0447 0.0102  246 TYR B CE1 
1949 C CE2 . TYR B 169 ? 0.4021 0.3594 0.3756 -0.0545 -0.0361 0.0008  246 TYR B CE2 
1950 C CZ  . TYR B 169 ? 0.4540 0.4148 0.4350 -0.0555 -0.0390 0.0023  246 TYR B CZ  
1951 O OH  . TYR B 169 ? 0.3981 0.3593 0.3780 -0.0548 -0.0363 -0.0033 246 TYR B OH  
1952 N N   . SER B 170 ? 0.3675 0.3585 0.3506 -0.0652 -0.0341 0.0272  247 SER B N   
1953 C CA  . SER B 170 ? 0.3664 0.3592 0.3458 -0.0682 -0.0364 0.0312  247 SER B CA  
1954 C C   . SER B 170 ? 0.4466 0.4351 0.4191 -0.0661 -0.0356 0.0232  247 SER B C   
1955 O O   . SER B 170 ? 0.4518 0.4374 0.4164 -0.0639 -0.0300 0.0160  247 SER B O   
1956 C CB  . SER B 170 ? 0.3891 0.3920 0.3606 -0.0718 -0.0315 0.0374  247 SER B CB  
1957 O OG  . SER B 170 ? 0.5156 0.5188 0.4854 -0.0759 -0.0371 0.0450  247 SER B OG  
1958 N N   . ALA B 171 ? 0.4087 0.3967 0.3852 -0.0669 -0.0416 0.0247  248 ALA B N   
1959 C CA  . ALA B 171 ? 0.4264 0.4147 0.4007 -0.0660 -0.0415 0.0179  248 ALA B CA  
1960 C C   . ALA B 171 ? 0.5063 0.4992 0.4848 -0.0673 -0.0492 0.0229  248 ALA B C   
1961 O O   . ALA B 171 ? 0.5304 0.5219 0.5140 -0.0680 -0.0554 0.0314  248 ALA B O   
1962 C CB  . ALA B 171 ? 0.4395 0.4218 0.4211 -0.0622 -0.0411 0.0105  248 ALA B CB  
1963 N N   . GLY B 172 ? 0.4461 0.4438 0.4233 -0.0682 -0.0498 0.0180  249 GLY B N   
1964 C CA  . GLY B 172 ? 0.4353 0.4392 0.4179 -0.0688 -0.0588 0.0220  249 GLY B CA  
1965 C C   . GLY B 172 ? 0.4776 0.4888 0.4609 -0.0707 -0.0583 0.0145  249 GLY B C   
1966 O O   . GLY B 172 ? 0.4851 0.4946 0.4636 -0.0723 -0.0504 0.0067  249 GLY B O   
1967 N N   . ILE B 173 ? 0.4109 0.4303 0.4008 -0.0711 -0.0676 0.0173  250 ILE B N   
1968 C CA  . ILE B 173 ? 0.3796 0.4092 0.3738 -0.0744 -0.0689 0.0107  250 ILE B CA  
1969 C C   . ILE B 173 ? 0.4645 0.4956 0.4402 -0.0810 -0.0731 0.0134  250 ILE B C   
1970 O O   . ILE B 173 ? 0.4840 0.5126 0.4502 -0.0811 -0.0789 0.0223  250 ILE B O   
1971 C CB  . ILE B 173 ? 0.3800 0.4210 0.3991 -0.0692 -0.0772 0.0101  250 ILE B CB  
1972 C CG1 . ILE B 173 ? 0.3428 0.3802 0.3765 -0.0620 -0.0720 0.0060  250 ILE B CG1 
1973 C CG2 . ILE B 173 ? 0.3902 0.4465 0.4179 -0.0740 -0.0789 0.0036  250 ILE B CG2 
1974 C CD1 . ILE B 173 ? 0.3231 0.3693 0.3811 -0.0540 -0.0798 0.0057  250 ILE B CD1 
1975 N N   . ALA B 174 ? 0.4105 0.4440 0.3789 -0.0871 -0.0701 0.0058  251 ALA B N   
1976 C CA  . ALA B 174 ? 0.4244 0.4575 0.3728 -0.0936 -0.0748 0.0062  251 ALA B CA  
1977 C C   . ALA B 174 ? 0.5073 0.5488 0.4614 -0.1003 -0.0784 -0.0015 251 ALA B C   
1978 O O   . ALA B 174 ? 0.5009 0.5419 0.4624 -0.1023 -0.0706 -0.0087 251 ALA B O   
1979 C CB  . ALA B 174 ? 0.4317 0.4517 0.3553 -0.0951 -0.0647 0.0043  251 ALA B CB  
1980 N N   . LYS B 175 ? 0.4888 0.5388 0.4406 -0.1045 -0.0911 0.0008  252 LYS B N   
1981 C CA  . LYS B 175 ? 0.5009 0.5600 0.4583 -0.1129 -0.0961 -0.0065 252 LYS B CA  
1982 C C   . LYS B 175 ? 0.5534 0.5968 0.4811 -0.1204 -0.0901 -0.0132 252 LYS B C   
1983 O O   . LYS B 175 ? 0.5329 0.5675 0.4352 -0.1210 -0.0924 -0.0106 252 LYS B O   
1984 C CB  . LYS B 175 ? 0.5566 0.6316 0.5244 -0.1146 -0.1139 -0.0022 252 LYS B CB  
1985 C CG  . LYS B 175 ? 0.8458 0.9165 0.7982 -0.1107 -0.1237 0.0085  252 LYS B CG  
1986 N N   . LEU B 176 ? 0.5293 0.5666 0.4586 -0.1250 -0.0807 -0.0214 253 LEU B N   
1987 C CA  . LEU B 176 ? 0.5362 0.5548 0.4391 -0.1313 -0.0749 -0.0290 253 LEU B CA  
1988 C C   . LEU B 176 ? 0.6180 0.6410 0.5247 -0.1440 -0.0815 -0.0362 253 LEU B C   
1989 O O   . LEU B 176 ? 0.5983 0.6404 0.5331 -0.1473 -0.0857 -0.0359 253 LEU B O   
1990 C CB  . LEU B 176 ? 0.5169 0.5203 0.4155 -0.1271 -0.0601 -0.0318 253 LEU B CB  
1991 C CG  . LEU B 176 ? 0.5459 0.5480 0.4481 -0.1156 -0.0537 -0.0251 253 LEU B CG  
1992 C CD1 . LEU B 176 ? 0.5238 0.5126 0.4242 -0.1123 -0.0417 -0.0282 253 LEU B CD1 
1993 C CD2 . LEU B 176 ? 0.5889 0.5859 0.4707 -0.1117 -0.0545 -0.0208 253 LEU B CD2 
1994 N N   . GLU B 177 ? 0.5944 0.6006 0.4734 -0.1511 -0.0829 -0.0429 254 GLU B N   
1995 C CA  . GLU B 177 ? 0.6063 0.6106 0.4823 -0.1650 -0.0900 -0.0507 254 GLU B CA  
1996 C C   . GLU B 177 ? 0.6752 0.6561 0.5384 -0.1702 -0.0791 -0.0584 254 GLU B C   
1997 O O   . GLU B 177 ? 0.6669 0.6276 0.5106 -0.1626 -0.0691 -0.0596 254 GLU B O   
1998 C CB  . GLU B 177 ? 0.6563 0.6537 0.5048 -0.1693 -0.1012 -0.0535 254 GLU B CB  
1999 C CG  . GLU B 177 ? 0.8514 0.8717 0.7128 -0.1715 -0.1183 -0.0480 254 GLU B CG  
2000 C CD  . GLU B 177 ? 1.1303 1.1406 0.9570 -0.1733 -0.1278 -0.0491 254 GLU B CD  
2001 O OE1 . GLU B 177 ? 1.0216 1.0280 0.8324 -0.1639 -0.1245 -0.0426 254 GLU B OE1 
2002 O OE2 . GLU B 177 ? 1.1194 1.1241 0.9325 -0.1849 -0.1379 -0.0569 254 GLU B OE2 
2003 N N   . GLU B 178 ? 0.6549 0.6384 0.5296 -0.1836 -0.0818 -0.0631 255 GLU B N   
2004 C CA  . GLU B 178 ? 0.6693 0.6287 0.5322 -0.1915 -0.0735 -0.0695 255 GLU B CA  
2005 C C   . GLU B 178 ? 0.7354 0.6638 0.5601 -0.1902 -0.0733 -0.0767 255 GLU B C   
2006 O O   . GLU B 178 ? 0.7636 0.6901 0.5728 -0.1959 -0.0844 -0.0813 255 GLU B O   
2007 C CB  . GLU B 178 ? 0.6967 0.6681 0.5787 -0.2091 -0.0797 -0.0726 255 GLU B CB  
2008 C CG  . GLU B 178 ? 0.8698 0.8141 0.7349 -0.2232 -0.0777 -0.0800 255 GLU B CG  
2009 C CD  . GLU B 178 ? 1.2233 1.1845 1.1099 -0.2428 -0.0861 -0.0824 255 GLU B CD  
2010 O OE1 . GLU B 178 ? 1.0433 1.0289 0.9438 -0.2470 -0.1001 -0.0823 255 GLU B OE1 
2011 O OE2 . GLU B 178 ? 1.2540 1.2032 1.1427 -0.2548 -0.0794 -0.0840 255 GLU B OE2 
2012 N N   . GLY B 179 ? 0.6680 0.5738 0.4776 -0.1813 -0.0614 -0.0777 256 GLY B N   
2013 C CA  . GLY B 179 ? 0.6922 0.5690 0.4674 -0.1766 -0.0590 -0.0852 256 GLY B CA  
2014 C C   . GLY B 179 ? 0.7447 0.6225 0.5107 -0.1595 -0.0518 -0.0815 256 GLY B C   
2015 O O   . GLY B 179 ? 0.7753 0.6304 0.5177 -0.1522 -0.0455 -0.0873 256 GLY B O   
2016 N N   . ASP B 180 ? 0.6712 0.5755 0.4568 -0.1531 -0.0528 -0.0720 257 ASP B N   
2017 C CA  . ASP B 180 ? 0.6579 0.5663 0.4395 -0.1388 -0.0458 -0.0667 257 ASP B CA  
2018 C C   . ASP B 180 ? 0.6912 0.5871 0.4763 -0.1298 -0.0338 -0.0659 257 ASP B C   
2019 O O   . ASP B 180 ? 0.6822 0.5723 0.4782 -0.1342 -0.0314 -0.0661 257 ASP B O   
2020 C CB  . ASP B 180 ? 0.6487 0.5847 0.4526 -0.1354 -0.0504 -0.0559 257 ASP B CB  
2021 C CG  . ASP B 180 ? 0.7275 0.6767 0.5270 -0.1407 -0.0632 -0.0540 257 ASP B CG  
2022 O OD1 . ASP B 180 ? 0.8084 0.7456 0.5818 -0.1457 -0.0675 -0.0611 257 ASP B OD1 
2023 O OD2 . ASP B 180 ? 0.6688 0.6390 0.4897 -0.1396 -0.0697 -0.0456 257 ASP B OD2 
2024 N N   . GLU B 181 ? 0.6268 0.5191 0.4018 -0.1178 -0.0266 -0.0648 258 GLU B N   
2025 C CA  . GLU B 181 ? 0.6062 0.4895 0.3855 -0.1078 -0.0171 -0.0634 258 GLU B CA  
2026 C C   . GLU B 181 ? 0.6302 0.5323 0.4225 -0.0982 -0.0136 -0.0546 258 GLU B C   
2027 O O   . GLU B 181 ? 0.6460 0.5597 0.4324 -0.0969 -0.0152 -0.0518 258 GLU B O   
2028 C CB  . GLU B 181 ? 0.6434 0.5009 0.3987 -0.1019 -0.0114 -0.0726 258 GLU B CB  
2029 C CG  . GLU B 181 ? 0.6917 0.5242 0.4363 -0.1111 -0.0141 -0.0802 258 GLU B CG  
2030 C CD  . GLU B 181 ? 0.9779 0.7815 0.6951 -0.1063 -0.0110 -0.0912 258 GLU B CD  
2031 O OE1 . GLU B 181 ? 0.6896 0.4927 0.3996 -0.0925 -0.0040 -0.0928 258 GLU B OE1 
2032 O OE2 . GLU B 181 ? 1.0586 0.8402 0.7622 -0.1164 -0.0157 -0.0986 258 GLU B OE2 
2033 N N   . LEU B 182 ? 0.5440 0.4486 0.3527 -0.0928 -0.0096 -0.0497 259 LEU B N   
2034 C CA  . LEU B 182 ? 0.5262 0.4464 0.3486 -0.0847 -0.0070 -0.0416 259 LEU B CA  
2035 C C   . LEU B 182 ? 0.6053 0.5163 0.4241 -0.0738 0.0009  -0.0430 259 LEU B C   
2036 O O   . LEU B 182 ? 0.5888 0.4818 0.4024 -0.0720 0.0030  -0.0474 259 LEU B O   
2037 C CB  . LEU B 182 ? 0.5017 0.4336 0.3470 -0.0866 -0.0101 -0.0351 259 LEU B CB  
2038 C CG  . LEU B 182 ? 0.5491 0.4943 0.4049 -0.0948 -0.0181 -0.0329 259 LEU B CG  
2039 C CD1 . LEU B 182 ? 0.5340 0.4882 0.4120 -0.0942 -0.0189 -0.0288 259 LEU B CD1 
2040 C CD2 . LEU B 182 ? 0.5499 0.5080 0.4031 -0.0947 -0.0231 -0.0280 259 LEU B CD2 
2041 N N   . GLN B 183 ? 0.5862 0.5101 0.4083 -0.0669 0.0047  -0.0387 260 GLN B N   
2042 C CA  . GLN B 183 ? 0.5914 0.5128 0.4153 -0.0558 0.0118  -0.0394 260 GLN B CA  
2043 C C   . GLN B 183 ? 0.6130 0.5555 0.4548 -0.0520 0.0133  -0.0302 260 GLN B C   
2044 O O   . GLN B 183 ? 0.6155 0.5724 0.4602 -0.0568 0.0112  -0.0241 260 GLN B O   
2045 C CB  . GLN B 183 ? 0.6431 0.5546 0.4466 -0.0501 0.0181  -0.0481 260 GLN B CB  
2046 C CG  . GLN B 183 ? 0.8697 0.7952 0.6629 -0.0515 0.0211  -0.0472 260 GLN B CG  
2047 C CD  . GLN B 183 ? 1.0954 1.0129 0.8697 -0.0429 0.0299  -0.0567 260 GLN B CD  
2048 O OE1 . GLN B 183 ? 0.9787 0.8736 0.7403 -0.0390 0.0309  -0.0665 260 GLN B OE1 
2049 N NE2 . GLN B 183 ? 1.0506 0.9855 0.8217 -0.0398 0.0371  -0.0541 260 GLN B NE2 
2050 N N   . LEU B 184 ? 0.5259 0.4689 0.3791 -0.0439 0.0160  -0.0288 261 LEU B N   
2051 C CA  . LEU B 184 ? 0.4964 0.4585 0.3682 -0.0407 0.0172  -0.0208 261 LEU B CA  
2052 C C   . LEU B 184 ? 0.5608 0.5297 0.4307 -0.0312 0.0262  -0.0238 261 LEU B C   
2053 O O   . LEU B 184 ? 0.5687 0.5261 0.4356 -0.0224 0.0287  -0.0300 261 LEU B O   
2054 C CB  . LEU B 184 ? 0.4717 0.4308 0.3589 -0.0391 0.0121  -0.0175 261 LEU B CB  
2055 C CG  . LEU B 184 ? 0.4826 0.4590 0.3905 -0.0389 0.0099  -0.0090 261 LEU B CG  
2056 C CD1 . LEU B 184 ? 0.4675 0.4384 0.3844 -0.0422 0.0023  -0.0065 261 LEU B CD1 
2057 C CD2 . LEU B 184 ? 0.4250 0.4102 0.3430 -0.0298 0.0141  -0.0087 261 LEU B CD2 
2058 N N   . ALA B 185 ? 0.5127 0.5000 0.3839 -0.0328 0.0312  -0.0193 262 ALA B N   
2059 C CA  . ALA B 185 ? 0.5115 0.5106 0.3820 -0.0244 0.0420  -0.0220 262 ALA B CA  
2060 C C   . ALA B 185 ? 0.4954 0.5204 0.3892 -0.0249 0.0448  -0.0119 262 ALA B C   
2061 O O   . ALA B 185 ? 0.4442 0.4786 0.3431 -0.0345 0.0411  -0.0024 262 ALA B O   
2062 C CB  . ALA B 185 ? 0.5439 0.5418 0.3896 -0.0273 0.0478  -0.0266 262 ALA B CB  
2063 N N   . ILE B 186 ? 0.4644 0.5008 0.3729 -0.0148 0.0510  -0.0137 263 ILE B N   
2064 C CA  . ILE B 186 ? 0.4635 0.5275 0.3967 -0.0160 0.0544  -0.0045 263 ILE B CA  
2065 C C   . ILE B 186 ? 0.5669 0.6502 0.4946 -0.0129 0.0693  -0.0059 263 ILE B C   
2066 O O   . ILE B 186 ? 0.6074 0.6914 0.5334 -0.0002 0.0775  -0.0154 263 ILE B O   
2067 C CB  . ILE B 186 ? 0.4769 0.5465 0.4356 -0.0082 0.0498  -0.0038 263 ILE B CB  
2068 C CG1 . ILE B 186 ? 0.4473 0.4982 0.4075 -0.0128 0.0360  -0.0018 263 ILE B CG1 
2069 C CG2 . ILE B 186 ? 0.4694 0.5708 0.4554 -0.0110 0.0539  0.0054  263 ILE B CG2 
2070 C CD1 . ILE B 186 ? 0.4482 0.4905 0.4179 -0.0032 0.0301  -0.0054 263 ILE B CD1 
2071 N N   . PRO B 187 ? 0.5001 0.5974 0.4231 -0.0236 0.0733  0.0030  264 PRO B N   
2072 C CA  . PRO B 187 ? 0.5200 0.6355 0.4333 -0.0215 0.0892  0.0015  264 PRO B CA  
2073 C C   . PRO B 187 ? 0.5671 0.7137 0.5093 -0.0161 0.0995  0.0049  264 PRO B C   
2074 O O   . PRO B 187 ? 0.5805 0.7507 0.5293 -0.0243 0.1077  0.0146  264 PRO B O   
2075 C CB  . PRO B 187 ? 0.5481 0.6649 0.4444 -0.0362 0.0878  0.0117  264 PRO B CB  
2076 C CG  . PRO B 187 ? 0.5726 0.6730 0.4738 -0.0445 0.0708  0.0179  264 PRO B CG  
2077 C CD  . PRO B 187 ? 0.4983 0.5936 0.4222 -0.0376 0.0637  0.0145  264 PRO B CD  
2078 N N   . ARG B 188 ? 0.5020 0.6489 0.4622 -0.0029 0.0983  -0.0024 265 ARG B N   
2079 C CA  . ARG B 188 ? 0.4890 0.6668 0.4815 0.0047  0.1062  -0.0008 265 ARG B CA  
2080 C C   . ARG B 188 ? 0.5690 0.7388 0.5633 0.0243  0.1089  -0.0147 265 ARG B C   
2081 O O   . ARG B 188 ? 0.5435 0.6841 0.5282 0.0291  0.0976  -0.0204 265 ARG B O   
2082 C CB  . ARG B 188 ? 0.4169 0.6049 0.4410 -0.0025 0.0937  0.0101  265 ARG B CB  
2083 C CG  . ARG B 188 ? 0.4670 0.6558 0.4902 -0.0214 0.0873  0.0238  265 ARG B CG  
2084 C CD  . ARG B 188 ? 0.5378 0.7620 0.5857 -0.0291 0.0963  0.0345  265 ARG B CD  
2085 N NE  . ARG B 188 ? 0.5866 0.8117 0.6330 -0.0475 0.0916  0.0488  265 ARG B NE  
2086 C CZ  . ARG B 188 ? 0.8796 1.1035 0.9022 -0.0568 0.0988  0.0546  265 ARG B CZ  
2087 N NH1 . ARG B 188 ? 0.6922 0.9106 0.6863 -0.0500 0.1097  0.0458  265 ARG B NH1 
2088 N NH2 . ARG B 188 ? 0.8468 1.0712 0.8710 -0.0730 0.0934  0.0691  265 ARG B NH2 
2089 N N   . GLU B 189 ? 0.5774 0.7722 0.5828 0.0359  0.1247  -0.0203 266 GLU B N   
2090 C CA  . GLU B 189 ? 0.5954 0.7843 0.6058 0.0569  0.1277  -0.0336 266 GLU B CA  
2091 C C   . GLU B 189 ? 0.6311 0.8271 0.6755 0.0629  0.1152  -0.0295 266 GLU B C   
2092 O O   . GLU B 189 ? 0.5984 0.8241 0.6734 0.0552  0.1138  -0.0187 266 GLU B O   
2093 C CB  . GLU B 189 ? 0.6360 0.8548 0.6537 0.0683  0.1487  -0.0403 266 GLU B CB  
2094 C CG  . GLU B 189 ? 0.8653 1.0702 0.8429 0.0690  0.1616  -0.0500 266 GLU B CG  
2095 C CD  . GLU B 189 ? 1.3042 1.5426 1.2877 0.0783  0.1847  -0.0556 266 GLU B CD  
2096 O OE1 . GLU B 189 ? 1.2568 1.5120 1.2659 0.0970  0.1912  -0.0635 266 GLU B OE1 
2097 O OE2 . GLU B 189 ? 1.2630 1.5117 1.2256 0.0670  0.1965  -0.0520 266 GLU B OE2 
2098 N N   . ASN B 190 ? 0.6104 0.7772 0.6477 0.0754  0.1052  -0.0377 267 ASN B N   
2099 C CA  . ASN B 190 ? 0.5979 0.7633 0.6601 0.0833  0.0910  -0.0354 267 ASN B CA  
2100 C C   . ASN B 190 ? 0.6120 0.7884 0.6930 0.0674  0.0786  -0.0218 267 ASN B C   
2101 O O   . ASN B 190 ? 0.6067 0.8120 0.7228 0.0688  0.0754  -0.0159 267 ASN B O   
2102 C CB  . ASN B 190 ? 0.5914 0.7819 0.6828 0.1041  0.0978  -0.0415 267 ASN B CB  
2103 C CG  . ASN B 190 ? 1.0215 1.2087 1.1364 0.1138  0.0812  -0.0392 267 ASN B CG  
2104 O OD1 . ASN B 190 ? 1.0201 1.2414 1.1726 0.1227  0.0820  -0.0372 267 ASN B OD1 
2105 N ND2 . ASN B 190 ? 0.9448 1.0934 1.0393 0.1106  0.0652  -0.0383 267 ASN B ND2 
2106 N N   . ALA B 191 ? 0.5337 0.6872 0.5915 0.0520  0.0717  -0.0174 268 ALA B N   
2107 C CA  . ALA B 191 ? 0.4958 0.6520 0.5646 0.0366  0.0597  -0.0061 268 ALA B CA  
2108 C C   . ALA B 191 ? 0.5144 0.6624 0.5986 0.0424  0.0438  -0.0051 268 ALA B C   
2109 O O   . ALA B 191 ? 0.5312 0.6539 0.6022 0.0538  0.0384  -0.0122 268 ALA B O   
2110 C CB  . ALA B 191 ? 0.4991 0.6287 0.5382 0.0235  0.0555  -0.0045 268 ALA B CB  
2111 N N   . GLN B 192 ? 0.4172 0.5869 0.5293 0.0347  0.0363  0.0038  269 GLN B N   
2112 C CA  . GLN B 192 ? 0.3915 0.5564 0.5186 0.0382  0.0196  0.0058  269 GLN B CA  
2113 C C   . GLN B 192 ? 0.4445 0.5839 0.5543 0.0248  0.0076  0.0098  269 GLN B C   
2114 O O   . GLN B 192 ? 0.4353 0.5841 0.5523 0.0101  0.0056  0.0172  269 GLN B O   
2115 C CB  . GLN B 192 ? 0.3921 0.5963 0.5605 0.0371  0.0175  0.0121  269 GLN B CB  
2116 C CG  . GLN B 192 ? 0.4482 0.6836 0.6383 0.0511  0.0314  0.0078  269 GLN B CG  
2117 C CD  . GLN B 192 ? 0.4312 0.6500 0.6145 0.0725  0.0292  -0.0020 269 GLN B CD  
2118 O OE1 . GLN B 192 ? 0.2587 0.4753 0.4565 0.0812  0.0149  -0.0017 269 GLN B OE1 
2119 N NE2 . GLN B 192 ? 0.2700 0.4758 0.4305 0.0812  0.0426  -0.0106 269 GLN B NE2 
2120 N N   . ILE B 193 ? 0.4130 0.5189 0.4983 0.0297  0.0006  0.0047  270 ILE B N   
2121 C CA  . ILE B 193 ? 0.4112 0.4916 0.4772 0.0187  -0.0086 0.0066  270 ILE B CA  
2122 C C   . ILE B 193 ? 0.4647 0.5224 0.5226 0.0246  -0.0223 0.0048  270 ILE B C   
2123 O O   . ILE B 193 ? 0.4820 0.5373 0.5431 0.0381  -0.0243 0.0015  270 ILE B O   
2124 C CB  . ILE B 193 ? 0.4534 0.5136 0.4898 0.0139  -0.0001 0.0027  270 ILE B CB  
2125 C CG1 . ILE B 193 ? 0.4603 0.4988 0.4767 0.0261  0.0039  -0.0059 270 ILE B CG1 
2126 C CG2 . ILE B 193 ? 0.4597 0.5405 0.4999 0.0063  0.0118  0.0059  270 ILE B CG2 
2127 C CD1 . ILE B 193 ? 0.4747 0.4873 0.4629 0.0204  0.0055  -0.0096 270 ILE B CD1 
2128 N N   . SER B 194 ? 0.4168 0.4568 0.4625 0.0152  -0.0315 0.0068  271 SER B N   
2129 C CA  . SER B 194 ? 0.4125 0.4285 0.4441 0.0191  -0.0434 0.0053  271 SER B CA  
2130 C C   . SER B 194 ? 0.5067 0.4922 0.5066 0.0196  -0.0387 0.0006  271 SER B C   
2131 O O   . SER B 194 ? 0.4965 0.4767 0.4847 0.0107  -0.0319 -0.0003 271 SER B O   
2132 C CB  . SER B 194 ? 0.4175 0.4307 0.4512 0.0089  -0.0548 0.0088  271 SER B CB  
2133 O OG  . SER B 194 ? 0.5514 0.5393 0.5656 0.0119  -0.0649 0.0071  271 SER B OG  
2134 N N   . LEU B 195 ? 0.4890 0.4543 0.4755 0.0296  -0.0430 -0.0019 272 LEU B N   
2135 C CA  . LEU B 195 ? 0.4826 0.4173 0.4391 0.0288  -0.0390 -0.0057 272 LEU B CA  
2136 C C   . LEU B 195 ? 0.5534 0.4643 0.4896 0.0230  -0.0475 -0.0041 272 LEU B C   
2137 O O   . LEU B 195 ? 0.5822 0.4660 0.4947 0.0245  -0.0473 -0.0057 272 LEU B O   
2138 C CB  . LEU B 195 ? 0.4867 0.4097 0.4368 0.0423  -0.0354 -0.0100 272 LEU B CB  
2139 C CG  . LEU B 195 ? 0.5098 0.4517 0.4716 0.0476  -0.0231 -0.0141 272 LEU B CG  
2140 C CD1 . LEU B 195 ? 0.5113 0.4353 0.4628 0.0611  -0.0207 -0.0197 272 LEU B CD1 
2141 C CD2 . LEU B 195 ? 0.5319 0.4744 0.4825 0.0356  -0.0132 -0.0161 272 LEU B CD2 
2142 N N   . ASP B 196 ? 0.4967 0.4165 0.4407 0.0157  -0.0544 -0.0011 273 ASP B N   
2143 C CA  . ASP B 196 ? 0.5064 0.4058 0.4302 0.0099  -0.0612 -0.0006 273 ASP B CA  
2144 C C   . ASP B 196 ? 0.5455 0.4375 0.4559 -0.0010 -0.0525 -0.0031 273 ASP B C   
2145 O O   . ASP B 196 ? 0.5276 0.4363 0.4516 -0.0069 -0.0479 -0.0031 273 ASP B O   
2146 C CB  . ASP B 196 ? 0.5313 0.4420 0.4686 0.0079  -0.0734 0.0021  273 ASP B CB  
2147 C CG  . ASP B 196 ? 0.6528 0.5714 0.6041 0.0184  -0.0848 0.0047  273 ASP B CG  
2148 O OD1 . ASP B 196 ? 0.6330 0.5364 0.5729 0.0284  -0.0866 0.0048  273 ASP B OD1 
2149 O OD2 . ASP B 196 ? 0.6643 0.6028 0.6378 0.0165  -0.0933 0.0069  273 ASP B OD2 
2150 N N   . GLY B 197 ? 0.5155 0.3831 0.4002 -0.0037 -0.0506 -0.0044 274 GLY B N   
2151 C CA  . GLY B 197 ? 0.5217 0.3832 0.3949 -0.0136 -0.0423 -0.0070 274 GLY B CA  
2152 C C   . GLY B 197 ? 0.5865 0.4588 0.4673 -0.0211 -0.0427 -0.0079 274 GLY B C   
2153 O O   . GLY B 197 ? 0.5971 0.4738 0.4789 -0.0274 -0.0354 -0.0100 274 GLY B O   
2154 N N   . ASP B 198 ? 0.5424 0.4185 0.4292 -0.0200 -0.0522 -0.0067 275 ASP B N   
2155 C CA  . ASP B 198 ? 0.5280 0.4108 0.4216 -0.0259 -0.0544 -0.0083 275 ASP B CA  
2156 C C   . ASP B 198 ? 0.5507 0.4556 0.4706 -0.0275 -0.0547 -0.0061 275 ASP B C   
2157 O O   . ASP B 198 ? 0.5649 0.4744 0.4922 -0.0324 -0.0563 -0.0069 275 ASP B O   
2158 C CB  . ASP B 198 ? 0.5635 0.4375 0.4492 -0.0248 -0.0659 -0.0087 275 ASP B CB  
2159 C CG  . ASP B 198 ? 0.6317 0.5148 0.5320 -0.0192 -0.0773 -0.0050 275 ASP B CG  
2160 O OD1 . ASP B 198 ? 0.6351 0.5260 0.5453 -0.0134 -0.0755 -0.0024 275 ASP B OD1 
2161 O OD2 . ASP B 198 ? 0.6821 0.5638 0.5832 -0.0203 -0.0885 -0.0055 275 ASP B OD2 
2162 N N   . VAL B 199 ? 0.4816 0.3991 0.4145 -0.0233 -0.0529 -0.0032 276 VAL B N   
2163 C CA  . VAL B 199 ? 0.4492 0.3886 0.4059 -0.0253 -0.0526 0.0003  276 VAL B CA  
2164 C C   . VAL B 199 ? 0.4656 0.4149 0.4258 -0.0255 -0.0419 0.0009  276 VAL B C   
2165 O O   . VAL B 199 ? 0.4540 0.4173 0.4270 -0.0304 -0.0397 0.0039  276 VAL B O   
2166 C CB  . VAL B 199 ? 0.4912 0.4412 0.4634 -0.0206 -0.0619 0.0033  276 VAL B CB  
2167 C CG1 . VAL B 199 ? 0.4850 0.4480 0.4679 -0.0128 -0.0572 0.0048  276 VAL B CG1 
2168 C CG2 . VAL B 199 ? 0.4838 0.4467 0.4751 -0.0271 -0.0693 0.0063  276 VAL B CG2 
2169 N N   . THR B 200 ? 0.4171 0.3565 0.3634 -0.0209 -0.0360 -0.0019 277 THR B N   
2170 C CA  . THR B 200 ? 0.4122 0.3566 0.3564 -0.0207 -0.0265 -0.0032 277 THR B CA  
2171 C C   . THR B 200 ? 0.4885 0.4141 0.4118 -0.0240 -0.0222 -0.0074 277 THR B C   
2172 O O   . THR B 200 ? 0.5173 0.4249 0.4257 -0.0206 -0.0228 -0.0096 277 THR B O   
2173 C CB  . THR B 200 ? 0.4294 0.3815 0.3803 -0.0114 -0.0238 -0.0035 277 THR B CB  
2174 O OG1 . THR B 200 ? 0.3908 0.3648 0.3652 -0.0103 -0.0276 0.0011  277 THR B OG1 
2175 C CG2 . THR B 200 ? 0.3792 0.3345 0.3242 -0.0107 -0.0137 -0.0063 277 THR B CG2 
2176 N N   . PHE B 201 ? 0.4417 0.3712 0.3646 -0.0313 -0.0188 -0.0079 278 PHE B N   
2177 C CA  . PHE B 201 ? 0.4484 0.3650 0.3564 -0.0365 -0.0151 -0.0116 278 PHE B CA  
2178 C C   . PHE B 201 ? 0.4976 0.4244 0.4089 -0.0421 -0.0114 -0.0119 278 PHE B C   
2179 O O   . PHE B 201 ? 0.5020 0.4441 0.4256 -0.0426 -0.0122 -0.0082 278 PHE B O   
2180 C CB  . PHE B 201 ? 0.4710 0.3790 0.3741 -0.0399 -0.0181 -0.0125 278 PHE B CB  
2181 C CG  . PHE B 201 ? 0.4696 0.3886 0.3869 -0.0419 -0.0227 -0.0106 278 PHE B CG  
2182 C CD1 . PHE B 201 ? 0.4944 0.4144 0.4182 -0.0388 -0.0298 -0.0086 278 PHE B CD1 
2183 C CD2 . PHE B 201 ? 0.4738 0.4013 0.3985 -0.0467 -0.0213 -0.0107 278 PHE B CD2 
2184 C CE1 . PHE B 201 ? 0.4885 0.4152 0.4244 -0.0413 -0.0349 -0.0074 278 PHE B CE1 
2185 C CE2 . PHE B 201 ? 0.4804 0.4143 0.4176 -0.0476 -0.0264 -0.0090 278 PHE B CE2 
2186 C CZ  . PHE B 201 ? 0.4502 0.3825 0.3922 -0.0453 -0.0329 -0.0076 278 PHE B CZ  
2187 N N   . PHE B 202 ? 0.4294 0.3474 0.3291 -0.0469 -0.0079 -0.0156 279 PHE B N   
2188 C CA  . PHE B 202 ? 0.4132 0.3388 0.3131 -0.0524 -0.0058 -0.0166 279 PHE B CA  
2189 C C   . PHE B 202 ? 0.5087 0.4270 0.4020 -0.0596 -0.0044 -0.0201 279 PHE B C   
2190 O O   . PHE B 202 ? 0.5489 0.4511 0.4294 -0.0607 -0.0020 -0.0228 279 PHE B O   
2191 C CB  . PHE B 202 ? 0.4406 0.3637 0.3314 -0.0493 -0.0021 -0.0188 279 PHE B CB  
2192 C CG  . PHE B 202 ? 0.4789 0.4065 0.3639 -0.0546 -0.0006 -0.0209 279 PHE B CG  
2193 C CD1 . PHE B 202 ? 0.5192 0.4619 0.4134 -0.0592 -0.0035 -0.0171 279 PHE B CD1 
2194 C CD2 . PHE B 202 ? 0.5226 0.4377 0.3914 -0.0543 0.0027  -0.0267 279 PHE B CD2 
2195 C CE1 . PHE B 202 ? 0.5284 0.4750 0.4150 -0.0640 -0.0038 -0.0185 279 PHE B CE1 
2196 C CE2 . PHE B 202 ? 0.5717 0.4902 0.4326 -0.0596 0.0029  -0.0293 279 PHE B CE2 
2197 C CZ  . PHE B 202 ? 0.5335 0.4685 0.4031 -0.0646 -0.0007 -0.0249 279 PHE B CZ  
2198 N N   . GLY B 203 ? 0.4340 0.3643 0.3371 -0.0644 -0.0060 -0.0195 280 GLY B N   
2199 C CA  . GLY B 203 ? 0.4267 0.3561 0.3290 -0.0714 -0.0043 -0.0228 280 GLY B CA  
2200 C C   . GLY B 203 ? 0.4900 0.4345 0.4031 -0.0761 -0.0072 -0.0226 280 GLY B C   
2201 O O   . GLY B 203 ? 0.4971 0.4517 0.4171 -0.0739 -0.0112 -0.0188 280 GLY B O   
2202 N N   . ALA B 204 ? 0.4600 0.4066 0.3747 -0.0831 -0.0054 -0.0259 281 ALA B N   
2203 C CA  . ALA B 204 ? 0.4561 0.4188 0.3835 -0.0877 -0.0094 -0.0262 281 ALA B CA  
2204 C C   . ALA B 204 ? 0.5408 0.5105 0.4787 -0.0923 -0.0059 -0.0294 281 ALA B C   
2205 O O   . ALA B 204 ? 0.5603 0.5192 0.4888 -0.0960 0.0005  -0.0317 281 ALA B O   
2206 C CB  . ALA B 204 ? 0.4712 0.4314 0.3882 -0.0938 -0.0115 -0.0282 281 ALA B CB  
2207 N N   . LEU B 205 ? 0.4962 0.4843 0.4535 -0.0919 -0.0099 -0.0291 282 LEU B N   
2208 C CA  . LEU B 205 ? 0.5012 0.5020 0.4739 -0.0946 -0.0059 -0.0326 282 LEU B CA  
2209 C C   . LEU B 205 ? 0.5077 0.5289 0.4985 -0.0988 -0.0121 -0.0331 282 LEU B C   
2210 O O   . LEU B 205 ? 0.5001 0.5285 0.4984 -0.0941 -0.0210 -0.0296 282 LEU B O   
2211 C CB  . LEU B 205 ? 0.5065 0.5091 0.4882 -0.0850 -0.0049 -0.0326 282 LEU B CB  
2212 C CG  . LEU B 205 ? 0.5616 0.5812 0.5641 -0.0826 -0.0022 -0.0365 282 LEU B CG  
2213 C CD1 . LEU B 205 ? 0.5641 0.5842 0.5625 -0.0891 0.0093  -0.0410 282 LEU B CD1 
2214 C CD2 . LEU B 205 ? 0.6075 0.6230 0.6144 -0.0721 -0.0041 -0.0365 282 LEU B CD2 
2215 N N   . LYS B 206 ? 0.4504 0.4811 0.4483 -0.1082 -0.0083 -0.0369 283 LYS B N   
2216 C CA  . LYS B 206 ? 0.4312 0.4834 0.4484 -0.1129 -0.0159 -0.0375 283 LYS B CA  
2217 C C   . LYS B 206 ? 0.5137 0.5878 0.5586 -0.1059 -0.0162 -0.0386 283 LYS B C   
2218 O O   . LYS B 206 ? 0.5295 0.6086 0.5815 -0.1055 -0.0060 -0.0423 283 LYS B O   
2219 C CB  . LYS B 206 ? 0.4237 0.4791 0.4397 -0.1276 -0.0135 -0.0408 283 LYS B CB  
2220 C CG  . LYS B 206 ? 0.3484 0.4203 0.3766 -0.1328 -0.0258 -0.0407 283 LYS B CG  
2221 C CD  . LYS B 206 ? 0.5008 0.5808 0.5348 -0.1487 -0.0248 -0.0446 283 LYS B CD  
2222 C CE  . LYS B 206 ? 0.7093 0.8225 0.7760 -0.1514 -0.0331 -0.0454 283 LYS B CE  
2223 N NZ  . LYS B 206 ? 1.0249 1.1428 1.0920 -0.1679 -0.0395 -0.0482 283 LYS B NZ  
2224 N N   . LEU B 207 ? 0.4710 0.5570 0.5301 -0.0998 -0.0278 -0.0356 284 LEU B N   
2225 C CA  . LEU B 207 ? 0.4785 0.5850 0.5663 -0.0911 -0.0301 -0.0369 284 LEU B CA  
2226 C C   . LEU B 207 ? 0.5411 0.6740 0.6527 -0.0988 -0.0297 -0.0409 284 LEU B C   
2227 O O   . LEU B 207 ? 0.5395 0.6746 0.6459 -0.1101 -0.0346 -0.0404 284 LEU B O   
2228 C CB  . LEU B 207 ? 0.4883 0.5952 0.5816 -0.0820 -0.0444 -0.0308 284 LEU B CB  
2229 C CG  . LEU B 207 ? 0.5643 0.6473 0.6360 -0.0763 -0.0453 -0.0257 284 LEU B CG  
2230 C CD1 . LEU B 207 ? 0.5738 0.6576 0.6510 -0.0696 -0.0589 -0.0184 284 LEU B CD1 
2231 C CD2 . LEU B 207 ? 0.6011 0.6740 0.6711 -0.0695 -0.0353 -0.0292 284 LEU B CD2 
2232 N N   . LEU B 208 ? 0.5183 0.6715 0.6559 -0.0933 -0.0234 -0.0455 285 LEU B N   
2233 C CA  . LEU B 208 ? 0.6151 0.7996 0.7818 -0.1002 -0.0225 -0.0493 285 LEU B CA  
2234 C C   . LEU B 208 ? 0.6309 0.8349 0.8211 -0.0951 -0.0400 -0.0464 285 LEU B C   
2235 O O   . LEU B 208 ? 0.5420 0.7671 0.7482 -0.1052 -0.0460 -0.0472 285 LEU B O   
2236 C CB  . LEU B 208 ? 0.6266 0.8286 0.8137 -0.0952 -0.0079 -0.0559 285 LEU B CB  
2237 C CG  . LEU B 208 ? 0.7275 0.9179 0.8948 -0.1058 0.0095  -0.0586 285 LEU B CG  
2238 C CD1 . LEU B 208 ? 0.7463 0.9357 0.9144 -0.0952 0.0231  -0.0637 285 LEU B CD1 
2239 C CD2 . LEU B 208 ? 0.7903 1.0021 0.9717 -0.1233 0.0149  -0.0603 285 LEU B CD2 
2240 O OXT . LEU B 208 ? 0.8694 1.0656 1.0598 -0.0818 -0.0491 -0.0425 285 LEU B OXT 
2241 N N   . VAL C 65  ? 0.8001 1.1238 1.0463 -0.1844 0.0748  -0.1468 142 VAL C N   
2242 C CA  . VAL C 65  ? 0.7908 1.0979 1.0155 -0.1592 0.0612  -0.1329 142 VAL C CA  
2243 C C   . VAL C 65  ? 0.8082 1.0691 0.9931 -0.1548 0.0522  -0.1138 142 VAL C C   
2244 O O   . VAL C 65  ? 0.8250 1.0517 0.9862 -0.1700 0.0638  -0.1048 142 VAL C O   
2245 C CB  . VAL C 65  ? 0.8562 1.1602 1.0746 -0.1528 0.0731  -0.1291 142 VAL C CB  
2246 C CG1 . VAL C 65  ? 0.8418 1.1483 1.0572 -0.1245 0.0547  -0.1237 142 VAL C CG1 
2247 C CG2 . VAL C 65  ? 0.8617 1.2058 1.1155 -0.1648 0.0907  -0.1481 142 VAL C CG2 
2248 N N   . THR C 66  ? 0.7030 0.9634 0.8810 -0.1336 0.0315  -0.1078 143 THR C N   
2249 C CA  . THR C 66  ? 0.6758 0.8997 0.8207 -0.1274 0.0220  -0.0917 143 THR C CA  
2250 C C   . THR C 66  ? 0.6848 0.8883 0.8073 -0.1091 0.0153  -0.0764 143 THR C C   
2251 O O   . THR C 66  ? 0.6895 0.9089 0.8234 -0.0978 0.0139  -0.0792 143 THR C O   
2252 C CB  . THR C 66  ? 0.7129 0.9498 0.8640 -0.1225 0.0047  -0.0976 143 THR C CB  
2253 O OG1 . THR C 66  ? 0.7459 1.0088 0.9100 -0.1027 -0.0123 -0.1011 143 THR C OG1 
2254 C CG2 . THR C 66  ? 0.6447 0.8998 0.8172 -0.1414 0.0096  -0.1137 143 THR C CG2 
2255 N N   . GLN C 67  ? 0.5855 0.7544 0.6779 -0.1061 0.0108  -0.0613 144 GLN C N   
2256 C CA  . GLN C 67  ? 0.5552 0.7031 0.6258 -0.0909 0.0036  -0.0464 144 GLN C CA  
2257 C C   . GLN C 67  ? 0.5690 0.7242 0.6376 -0.0760 -0.0152 -0.0438 144 GLN C C   
2258 O O   . GLN C 67  ? 0.5596 0.7037 0.6159 -0.0781 -0.0203 -0.0403 144 GLN C O   
2259 C CB  . GLN C 67  ? 0.5736 0.6819 0.6149 -0.0972 0.0103  -0.0323 144 GLN C CB  
2260 C CG  . GLN C 67  ? 0.5348 0.6275 0.5667 -0.1059 0.0256  -0.0289 144 GLN C CG  
2261 C CD  . GLN C 67  ? 0.7090 0.7633 0.7130 -0.1121 0.0294  -0.0161 144 GLN C CD  
2262 O OE1 . GLN C 67  ? 0.6983 0.7403 0.6984 -0.1255 0.0358  -0.0175 144 GLN C OE1 
2263 N NE2 . GLN C 67  ? 0.5047 0.5389 0.4895 -0.1022 0.0247  -0.0038 144 GLN C NE2 
2264 N N   . ASP C 68  ? 0.5071 0.6802 0.5865 -0.0607 -0.0254 -0.0459 145 ASP C N   
2265 C CA  . ASP C 68  ? 0.4778 0.6545 0.5507 -0.0460 -0.0437 -0.0414 145 ASP C CA  
2266 C C   . ASP C 68  ? 0.4903 0.6327 0.5318 -0.0420 -0.0458 -0.0235 145 ASP C C   
2267 O O   . ASP C 68  ? 0.4680 0.5883 0.4973 -0.0447 -0.0369 -0.0151 145 ASP C O   
2268 C CB  . ASP C 68  ? 0.4863 0.6841 0.5759 -0.0295 -0.0543 -0.0462 145 ASP C CB  
2269 C CG  . ASP C 68  ? 0.5994 0.8379 0.7242 -0.0309 -0.0562 -0.0657 145 ASP C CG  
2270 O OD1 . ASP C 68  ? 0.6187 0.8690 0.7550 -0.0467 -0.0485 -0.0757 145 ASP C OD1 
2271 O OD2 . ASP C 68  ? 0.6731 0.9316 0.8151 -0.0159 -0.0662 -0.0716 145 ASP C OD2 
2272 N N   . CYS C 69  ? 0.4508 0.5898 0.4794 -0.0374 -0.0566 -0.0188 146 CYS C N   
2273 C CA  . CYS C 69  ? 0.4666 0.5782 0.4689 -0.0343 -0.0581 -0.0034 146 CYS C CA  
2274 C C   . CYS C 69  ? 0.5076 0.6229 0.4980 -0.0255 -0.0719 0.0006  146 CYS C C   
2275 O O   . CYS C 69  ? 0.5174 0.6536 0.5165 -0.0250 -0.0795 -0.0094 146 CYS C O   
2276 C CB  . CYS C 69  ? 0.4907 0.5830 0.4826 -0.0470 -0.0467 -0.0007 146 CYS C CB  
2277 S SG  . CYS C 69  ? 0.5483 0.6528 0.5488 -0.0592 -0.0446 -0.0144 146 CYS C SG  
2278 N N   . LEU C 70  ? 0.4513 0.5462 0.4209 -0.0194 -0.0751 0.0150  147 LEU C N   
2279 C CA  . LEU C 70  ? 0.4495 0.5428 0.4016 -0.0124 -0.0862 0.0218  147 LEU C CA  
2280 C C   . LEU C 70  ? 0.5210 0.5912 0.4529 -0.0162 -0.0801 0.0340  147 LEU C C   
2281 O O   . LEU C 70  ? 0.5370 0.5904 0.4661 -0.0166 -0.0745 0.0420  147 LEU C O   
2282 C CB  . LEU C 70  ? 0.4546 0.5491 0.4049 0.0019  -0.0989 0.0273  147 LEU C CB  
2283 C CG  . LEU C 70  ? 0.5266 0.6178 0.4554 0.0093  -0.1116 0.0354  147 LEU C CG  
2284 C CD1 . LEU C 70  ? 0.5404 0.6493 0.4778 0.0222  -0.1280 0.0298  147 LEU C CD1 
2285 C CD2 . LEU C 70  ? 0.5391 0.6033 0.4458 0.0115  -0.1107 0.0526  147 LEU C CD2 
2286 N N   . GLN C 71  ? 0.4762 0.5468 0.3946 -0.0190 -0.0810 0.0345  148 GLN C N   
2287 C CA  . GLN C 71  ? 0.4584 0.5118 0.3597 -0.0221 -0.0752 0.0446  148 GLN C CA  
2288 C C   . GLN C 71  ? 0.5194 0.5736 0.3997 -0.0177 -0.0828 0.0510  148 GLN C C   
2289 O O   . GLN C 71  ? 0.5268 0.5958 0.4035 -0.0158 -0.0902 0.0437  148 GLN C O   
2290 C CB  . GLN C 71  ? 0.4652 0.5164 0.3700 -0.0315 -0.0652 0.0376  148 GLN C CB  
2291 C CG  . GLN C 71  ? 0.4312 0.4672 0.3242 -0.0338 -0.0585 0.0464  148 GLN C CG  
2292 C CD  . GLN C 71  ? 0.6054 0.6372 0.5046 -0.0407 -0.0500 0.0389  148 GLN C CD  
2293 O OE1 . GLN C 71  ? 0.5947 0.6161 0.5024 -0.0440 -0.0446 0.0390  148 GLN C OE1 
2294 N NE2 . GLN C 71  ? 0.5930 0.6311 0.4865 -0.0425 -0.0490 0.0319  148 GLN C NE2 
2295 N N   . LEU C 72  ? 0.4702 0.5079 0.3357 -0.0168 -0.0808 0.0648  149 LEU C N   
2296 C CA  . LEU C 72  ? 0.4808 0.5137 0.3222 -0.0149 -0.0848 0.0743  149 LEU C CA  
2297 C C   . LEU C 72  ? 0.5335 0.5606 0.3671 -0.0227 -0.0732 0.0773  149 LEU C C   
2298 O O   . LEU C 72  ? 0.5021 0.5212 0.3463 -0.0267 -0.0651 0.0788  149 LEU C O   
2299 C CB  . LEU C 72  ? 0.4918 0.5089 0.3233 -0.0086 -0.0915 0.0884  149 LEU C CB  
2300 C CG  . LEU C 72  ? 0.5539 0.5749 0.3946 0.0019  -0.1039 0.0862  149 LEU C CG  
2301 C CD1 . LEU C 72  ? 0.5599 0.5596 0.3929 0.0072  -0.1080 0.0994  149 LEU C CD1 
2302 C CD2 . LEU C 72  ? 0.6201 0.6549 0.4511 0.0085  -0.1167 0.0820  149 LEU C CD2 
2303 N N   . ILE C 73  ? 0.5279 0.5603 0.3430 -0.0244 -0.0727 0.0773  150 ILE C N   
2304 C CA  . ILE C 73  ? 0.5250 0.5558 0.3328 -0.0311 -0.0611 0.0786  150 ILE C CA  
2305 C C   . ILE C 73  ? 0.5937 0.6184 0.3740 -0.0319 -0.0617 0.0912  150 ILE C C   
2306 O O   . ILE C 73  ? 0.5733 0.5984 0.3357 -0.0271 -0.0721 0.0947  150 ILE C O   
2307 C CB  . ILE C 73  ? 0.5503 0.5940 0.3631 -0.0344 -0.0556 0.0630  150 ILE C CB  
2308 C CG1 . ILE C 73  ? 0.5524 0.6088 0.3512 -0.0318 -0.0643 0.0552  150 ILE C CG1 
2309 C CG2 . ILE C 73  ? 0.5409 0.5840 0.3790 -0.0359 -0.0525 0.0534  150 ILE C CG2 
2310 C CD1 . ILE C 73  ? 0.5070 0.5735 0.3035 -0.0356 -0.0585 0.0409  150 ILE C CD1 
2311 N N   . ALA C 74  ? 0.5539 0.5726 0.3311 -0.0381 -0.0510 0.0983  151 ALA C N   
2312 C CA  . ALA C 74  ? 0.5588 0.5702 0.3105 -0.0421 -0.0482 0.1111  151 ALA C CA  
2313 C C   . ALA C 74  ? 0.6603 0.6811 0.3856 -0.0424 -0.0491 0.1077  151 ALA C C   
2314 O O   . ALA C 74  ? 0.6659 0.7016 0.3950 -0.0436 -0.0442 0.0936  151 ALA C O   
2315 C CB  . ALA C 74  ? 0.5539 0.5641 0.3133 -0.0504 -0.0345 0.1148  151 ALA C CB  
2316 N N   . ASP C 75  ? 0.6528 0.6627 0.3493 -0.0410 -0.0564 0.1205  152 ASP C N   
2317 C CA  . ASP C 75  ? 0.6784 0.6943 0.3433 -0.0414 -0.0584 0.1195  152 ASP C CA  
2318 C C   . ASP C 75  ? 0.7566 0.7712 0.4022 -0.0525 -0.0420 0.1263  152 ASP C C   
2319 O O   . ASP C 75  ? 0.7959 0.7935 0.4211 -0.0569 -0.0408 0.1434  152 ASP C O   
2320 C CB  . ASP C 75  ? 0.7207 0.7245 0.3620 -0.0330 -0.0765 0.1297  152 ASP C CB  
2321 C CG  . ASP C 75  ? 0.9232 0.9289 0.5245 -0.0332 -0.0807 0.1318  152 ASP C CG  
2322 O OD1 . ASP C 75  ? 0.9320 0.9525 0.5256 -0.0392 -0.0698 0.1213  152 ASP C OD1 
2323 O OD2 . ASP C 75  ? 1.0542 1.0460 0.6307 -0.0267 -0.0954 0.1435  152 ASP C OD2 
2324 N N   . SER C 76  ? 0.6948 0.7273 0.3476 -0.0570 -0.0291 0.1124  153 SER C N   
2325 C CA  . SER C 76  ? 0.7195 0.7575 0.3584 -0.0674 -0.0113 0.1146  153 SER C CA  
2326 C C   . SER C 76  ? 0.8168 0.8483 0.4077 -0.0718 -0.0108 0.1253  153 SER C C   
2327 O O   . SER C 76  ? 0.8143 0.8470 0.3900 -0.0824 0.0048  0.1313  153 SER C O   
2328 C CB  . SER C 76  ? 0.7377 0.7969 0.3948 -0.0685 0.0006  0.0946  153 SER C CB  
2329 O OG  . SER C 76  ? 0.8670 0.9359 0.5054 -0.0648 -0.0042 0.0824  153 SER C OG  
2330 N N   . GLU C 77  ? 0.7976 0.8226 0.3648 -0.0640 -0.0280 0.1278  154 GLU C N   
2331 C CA  . GLU C 77  ? 0.8480 0.8640 0.3657 -0.0668 -0.0303 0.1387  154 GLU C CA  
2332 C C   . GLU C 77  ? 0.9477 0.9344 0.4426 -0.0670 -0.0392 0.1630  154 GLU C C   
2333 O O   . GLU C 77  ? 1.0022 0.9755 0.4519 -0.0690 -0.0430 0.1754  154 GLU C O   
2334 C CB  . GLU C 77  ? 0.8764 0.9024 0.3756 -0.0581 -0.0450 0.1268  154 GLU C CB  
2335 C CG  . GLU C 77  ? 0.9551 1.0062 0.4736 -0.0573 -0.0391 0.1017  154 GLU C CG  
2336 C CD  . GLU C 77  ? 1.4412 1.5059 0.9478 -0.0667 -0.0179 0.0924  154 GLU C CD  
2337 O OE1 . GLU C 77  ? 1.3842 1.4555 0.9190 -0.0722 -0.0015 0.0887  154 GLU C OE1 
2338 O OE2 . GLU C 77  ? 1.6488 1.7179 1.1173 -0.0683 -0.0177 0.0888  154 GLU C OE2 
2339 N N   . THR C 78  ? 0.8667 0.8414 0.3901 -0.0651 -0.0426 0.1699  155 THR C N   
2340 C CA  . THR C 78  ? 0.8739 0.8181 0.3790 -0.0645 -0.0516 0.1915  155 THR C CA  
2341 C C   . THR C 78  ? 0.8660 0.7999 0.3877 -0.0763 -0.0369 0.2008  155 THR C C   
2342 O O   . THR C 78  ? 0.7844 0.7313 0.3463 -0.0771 -0.0303 0.1903  155 THR C O   
2343 C CB  . THR C 78  ? 0.9496 0.8867 0.4700 -0.0483 -0.0744 0.1902  155 THR C CB  
2344 O OG1 . THR C 78  ? 1.0120 0.9611 0.5161 -0.0390 -0.0879 0.1812  155 THR C OG1 
2345 C CG2 . THR C 78  ? 0.8935 0.7966 0.3978 -0.0446 -0.0861 0.2109  155 THR C CG2 
2346 N N   . PRO C 79  ? 0.8418 0.7502 0.3325 -0.0858 -0.0329 0.2211  156 PRO C N   
2347 C CA  . PRO C 79  ? 0.8152 0.7132 0.3239 -0.0979 -0.0207 0.2295  156 PRO C CA  
2348 C C   . PRO C 79  ? 0.8259 0.7091 0.3638 -0.0887 -0.0341 0.2311  156 PRO C C   
2349 O O   . PRO C 79  ? 0.8132 0.6819 0.3435 -0.0749 -0.0534 0.2347  156 PRO C O   
2350 C CB  . PRO C 79  ? 0.8849 0.7551 0.3476 -0.1098 -0.0159 0.2514  156 PRO C CB  
2351 C CG  . PRO C 79  ? 0.9690 0.8241 0.3933 -0.0980 -0.0344 0.2584  156 PRO C CG  
2352 C CD  . PRO C 79  ? 0.8913 0.7770 0.3285 -0.0863 -0.0405 0.2377  156 PRO C CD  
2353 N N   . THR C 80  ? 0.7711 0.6592 0.3425 -0.0963 -0.0239 0.2277  157 THR C N   
2354 C CA  . THR C 80  ? 0.7433 0.6177 0.3420 -0.0901 -0.0335 0.2284  157 THR C CA  
2355 C C   . THR C 80  ? 0.8409 0.6767 0.4133 -0.0879 -0.0458 0.2474  157 THR C C   
2356 O O   . THR C 80  ? 0.9058 0.7224 0.4444 -0.0987 -0.0404 0.2630  157 THR C O   
2357 C CB  . THR C 80  ? 0.7734 0.6568 0.4042 -0.1015 -0.0198 0.2240  157 THR C CB  
2358 O OG1 . THR C 80  ? 0.7318 0.6069 0.3462 -0.1195 -0.0053 0.2359  157 THR C OG1 
2359 C CG2 . THR C 80  ? 0.7208 0.6381 0.3834 -0.0993 -0.0121 0.2044  157 THR C CG2 
2360 N N   . ILE C 81  ? 0.7567 0.5805 0.3430 -0.0737 -0.0622 0.2456  158 ILE C N   
2361 C CA  . ILE C 81  ? 0.7821 0.5685 0.3491 -0.0676 -0.0765 0.2609  158 ILE C CA  
2362 C C   . ILE C 81  ? 0.8738 0.6387 0.4526 -0.0793 -0.0698 0.2686  158 ILE C C   
2363 O O   . ILE C 81  ? 0.8384 0.6131 0.4524 -0.0783 -0.0680 0.2578  158 ILE C O   
2364 C CB  . ILE C 81  ? 0.7881 0.5762 0.3696 -0.0463 -0.0960 0.2522  158 ILE C CB  
2365 C CG1 . ILE C 81  ? 0.7685 0.5803 0.3403 -0.0367 -0.1028 0.2432  158 ILE C CG1 
2366 C CG2 . ILE C 81  ? 0.8322 0.5808 0.3971 -0.0373 -0.1120 0.2663  158 ILE C CG2 
2367 C CD1 . ILE C 81  ? 0.6522 0.4940 0.2588 -0.0277 -0.1053 0.2233  158 ILE C CD1 
2368 N N   . GLN C 82  ? 0.8802 0.6145 0.4275 -0.0911 -0.0663 0.2873  159 GLN C N   
2369 C CA  . GLN C 82  ? 0.8869 0.5972 0.4408 -0.1048 -0.0600 0.2961  159 GLN C CA  
2370 C C   . GLN C 82  ? 0.9598 0.6279 0.5019 -0.0932 -0.0786 0.3066  159 GLN C C   
2371 O O   . GLN C 82  ? 0.9910 0.6283 0.4944 -0.0910 -0.0868 0.3229  159 GLN C O   
2372 C CB  . GLN C 82  ? 0.9424 0.6437 0.4691 -0.1275 -0.0429 0.3102  159 GLN C CB  
2373 C CG  . GLN C 82  ? 1.1897 0.9266 0.7103 -0.1348 -0.0276 0.3032  159 GLN C CG  
2374 C CD  . GLN C 82  ? 1.4534 1.2229 1.0115 -0.1479 -0.0094 0.2901  159 GLN C CD  
2375 O OE1 . GLN C 82  ? 1.4214 1.2158 1.0176 -0.1390 -0.0118 0.2730  159 GLN C OE1 
2376 N NE2 . GLN C 82  ? 1.2208 0.9908 0.7679 -0.1695 0.0090  0.2979  159 GLN C NE2 
2377 N N   . LYS C 83  ? 0.8970 0.5630 0.4707 -0.0845 -0.0859 0.2966  160 LYS C N   
2378 C CA  . LYS C 83  ? 0.9191 0.5460 0.4856 -0.0726 -0.1027 0.3038  160 LYS C CA  
2379 C C   . LYS C 83  ? 1.0230 0.6317 0.6085 -0.0840 -0.0976 0.3036  160 LYS C C   
2380 O O   . LYS C 83  ? 1.0061 0.6274 0.6241 -0.0772 -0.1001 0.2889  160 LYS C O   
2381 C CB  . LYS C 83  ? 0.9028 0.5409 0.4845 -0.0473 -0.1197 0.2913  160 LYS C CB  
2382 N N   . GLY C 84  ? 1.0311 0.6101 0.5949 -0.1025 -0.0902 0.3197  161 GLY C N   
2383 C CA  . GLY C 84  ? 1.0478 0.6046 0.6255 -0.1160 -0.0861 0.3212  161 GLY C CA  
2384 C C   . GLY C 84  ? 1.0996 0.6921 0.7116 -0.1312 -0.0703 0.3082  161 GLY C C   
2385 O O   . GLY C 84  ? 1.1053 0.7235 0.7159 -0.1453 -0.0549 0.3089  161 GLY C O   
2386 N N   . SER C 85  ? 1.0375 0.6323 0.6802 -0.1276 -0.0744 0.2954  162 SER C N   
2387 C CA  . SER C 85  ? 0.9941 0.6214 0.6714 -0.1391 -0.0633 0.2818  162 SER C CA  
2388 C C   . SER C 85  ? 1.0222 0.6953 0.7198 -0.1278 -0.0607 0.2663  162 SER C C   
2389 O O   . SER C 85  ? 1.0026 0.7051 0.7276 -0.1350 -0.0522 0.2550  162 SER C O   
2390 C CB  . SER C 85  ? 1.0034 0.6133 0.7010 -0.1378 -0.0709 0.2739  162 SER C CB  
2391 O OG  . SER C 85  ? 1.0800 0.6520 0.7660 -0.1537 -0.0701 0.2853  162 SER C OG  
2392 N N   . TYR C 86  ? 0.9701 0.6484 0.6548 -0.1103 -0.0688 0.2657  163 TYR C N   
2393 C CA  . TYR C 86  ? 0.9233 0.6400 0.6248 -0.0989 -0.0679 0.2513  163 TYR C CA  
2394 C C   . TYR C 86  ? 0.9604 0.6971 0.6444 -0.0996 -0.0616 0.2542  163 TYR C C   
2395 O O   . TYR C 86  ? 0.9997 0.7169 0.6512 -0.1029 -0.0625 0.2687  163 TYR C O   
2396 C CB  . TYR C 86  ? 0.9268 0.6391 0.6349 -0.0773 -0.0829 0.2431  163 TYR C CB  
2397 C CG  . TYR C 86  ? 0.9540 0.6529 0.6814 -0.0746 -0.0881 0.2357  163 TYR C CG  
2398 C CD1 . TYR C 86  ? 1.0087 0.6680 0.7247 -0.0756 -0.0955 0.2444  163 TYR C CD1 
2399 C CD2 . TYR C 86  ? 0.9279 0.6515 0.6826 -0.0708 -0.0861 0.2200  163 TYR C CD2 
2400 C CE1 . TYR C 86  ? 0.9963 0.6428 0.7286 -0.0732 -0.1003 0.2361  163 TYR C CE1 
2401 C CE2 . TYR C 86  ? 0.9334 0.6445 0.7023 -0.0687 -0.0908 0.2128  163 TYR C CE2 
2402 C CZ  . TYR C 86  ? 1.0424 0.7159 0.8004 -0.0696 -0.0978 0.2201  163 TYR C CZ  
2403 O OH  . TYR C 86  ? 1.0748 0.7346 0.8449 -0.0675 -0.1026 0.2118  163 TYR C OH  
2404 N N   . THR C 87  ? 0.8289 0.6027 0.5329 -0.0959 -0.0561 0.2399  164 THR C N   
2405 C CA  . THR C 87  ? 0.8013 0.5989 0.4942 -0.0944 -0.0506 0.2373  164 THR C CA  
2406 C C   . THR C 87  ? 0.8270 0.6424 0.5328 -0.0769 -0.0597 0.2240  164 THR C C   
2407 O O   . THR C 87  ? 0.8064 0.6328 0.5394 -0.0722 -0.0609 0.2122  164 THR C O   
2408 C CB  . THR C 87  ? 0.6959 0.5208 0.4014 -0.1093 -0.0330 0.2321  164 THR C CB  
2409 O OG1 . THR C 87  ? 0.6896 0.4985 0.3830 -0.1269 -0.0239 0.2447  164 THR C OG1 
2410 C CG2 . THR C 87  ? 0.5947 0.4447 0.2896 -0.1071 -0.0267 0.2268  164 THR C CG2 
2411 N N   . PHE C 88  ? 0.7800 0.5982 0.4653 -0.0682 -0.0660 0.2257  165 PHE C N   
2412 C CA  . PHE C 88  ? 0.7517 0.5878 0.4484 -0.0531 -0.0748 0.2131  165 PHE C CA  
2413 C C   . PHE C 88  ? 0.8110 0.6741 0.5025 -0.0544 -0.0683 0.2056  165 PHE C C   
2414 O O   . PHE C 88  ? 0.8150 0.6764 0.4802 -0.0616 -0.0630 0.2138  165 PHE C O   
2415 C CB  . PHE C 88  ? 0.7972 0.6131 0.4797 -0.0384 -0.0922 0.2186  165 PHE C CB  
2416 C CG  . PHE C 88  ? 0.8159 0.6078 0.5094 -0.0340 -0.0990 0.2210  165 PHE C CG  
2417 C CD1 . PHE C 88  ? 0.7940 0.5966 0.5158 -0.0252 -0.1023 0.2073  165 PHE C CD1 
2418 C CD2 . PHE C 88  ? 0.8972 0.6541 0.5712 -0.0396 -0.1014 0.2366  165 PHE C CD2 
2419 C CE1 . PHE C 88  ? 0.8064 0.5871 0.5369 -0.0210 -0.1081 0.2079  165 PHE C CE1 
2420 C CE2 . PHE C 88  ? 0.9295 0.6627 0.6137 -0.0356 -0.1079 0.2371  165 PHE C CE2 
2421 C CZ  . PHE C 88  ? 0.8528 0.5992 0.5653 -0.0257 -0.1112 0.2221  165 PHE C CZ  
2422 N N   . VAL C 89  ? 0.7449 0.6320 0.4605 -0.0485 -0.0679 0.1897  166 VAL C N   
2423 C CA  . VAL C 89  ? 0.7228 0.6352 0.4373 -0.0491 -0.0622 0.1796  166 VAL C CA  
2424 C C   . VAL C 89  ? 0.8170 0.7314 0.5137 -0.0381 -0.0752 0.1785  166 VAL C C   
2425 O O   . VAL C 89  ? 0.7991 0.7115 0.5069 -0.0266 -0.0873 0.1743  166 VAL C O   
2426 C CB  . VAL C 89  ? 0.7110 0.6437 0.4576 -0.0481 -0.0569 0.1637  166 VAL C CB  
2427 C CG1 . VAL C 89  ? 0.6998 0.6560 0.4462 -0.0479 -0.0521 0.1516  166 VAL C CG1 
2428 C CG2 . VAL C 89  ? 0.6855 0.6171 0.4490 -0.0576 -0.0465 0.1645  166 VAL C CG2 
2429 N N   . PRO C 90  ? 0.8282 0.7490 0.4986 -0.0410 -0.0731 0.1807  167 PRO C N   
2430 C CA  . PRO C 90  ? 0.8321 0.7589 0.4881 -0.0300 -0.0870 0.1769  167 PRO C CA  
2431 C C   . PRO C 90  ? 0.8239 0.7778 0.5073 -0.0258 -0.0867 0.1569  167 PRO C C   
2432 O O   . PRO C 90  ? 0.8072 0.7771 0.4989 -0.0331 -0.0740 0.1476  167 PRO C O   
2433 C CB  . PRO C 90  ? 0.8979 0.8227 0.5157 -0.0367 -0.0826 0.1848  167 PRO C CB  
2434 C CG  . PRO C 90  ? 0.9665 0.8953 0.5870 -0.0518 -0.0627 0.1864  167 PRO C CG  
2435 C CD  . PRO C 90  ? 0.8823 0.8093 0.5374 -0.0544 -0.0573 0.1838  167 PRO C CD  
2436 N N   . TRP C 91  ? 0.7551 0.7133 0.4549 -0.0144 -0.0996 0.1498  168 TRP C N   
2437 C CA  . TRP C 91  ? 0.7252 0.7068 0.4517 -0.0119 -0.0991 0.1313  168 TRP C CA  
2438 C C   . TRP C 91  ? 0.7614 0.7598 0.4777 -0.0072 -0.1079 0.1220  168 TRP C C   
2439 O O   . TRP C 91  ? 0.8163 0.8085 0.5075 -0.0010 -0.1202 0.1293  168 TRP C O   
2440 C CB  . TRP C 91  ? 0.6943 0.6753 0.4493 -0.0046 -0.1049 0.1262  168 TRP C CB  
2441 C CG  . TRP C 91  ? 0.6982 0.6645 0.4655 -0.0094 -0.0965 0.1321  168 TRP C CG  
2442 C CD1 . TRP C 91  ? 0.7471 0.6929 0.5132 -0.0053 -0.1018 0.1420  168 TRP C CD1 
2443 C CD2 . TRP C 91  ? 0.6753 0.6451 0.4561 -0.0191 -0.0823 0.1284  168 TRP C CD2 
2444 N NE1 . TRP C 91  ? 0.7299 0.6672 0.5076 -0.0128 -0.0918 0.1443  168 TRP C NE1 
2445 C CE2 . TRP C 91  ? 0.7288 0.6813 0.5160 -0.0209 -0.0803 0.1363  168 TRP C CE2 
2446 C CE3 . TRP C 91  ? 0.6764 0.6616 0.4646 -0.0255 -0.0721 0.1185  168 TRP C CE3 
2447 C CZ2 . TRP C 91  ? 0.7071 0.6592 0.5081 -0.0287 -0.0695 0.1347  168 TRP C CZ2 
2448 C CZ3 . TRP C 91  ? 0.6823 0.6658 0.4848 -0.0322 -0.0614 0.1174  168 TRP C CZ3 
2449 C CH2 . TRP C 91  ? 0.6904 0.6585 0.4993 -0.0336 -0.0607 0.1255  168 TRP C CH2 
2450 N N   . LEU C 92  ? 0.6486 0.6669 0.3843 -0.0098 -0.1029 0.1055  169 LEU C N   
2451 C CA  . LEU C 92  ? 0.6307 0.6687 0.3649 -0.0069 -0.1106 0.0917  169 LEU C CA  
2452 C C   . LEU C 92  ? 0.6358 0.6876 0.4060 -0.0058 -0.1108 0.0768  169 LEU C C   
2453 O O   . LEU C 92  ? 0.6030 0.6512 0.3924 -0.0113 -0.0992 0.0747  169 LEU C O   
2454 C CB  . LEU C 92  ? 0.6315 0.6775 0.3530 -0.0157 -0.0989 0.0851  169 LEU C CB  
2455 C CG  . LEU C 92  ? 0.7048 0.7566 0.3947 -0.0146 -0.1055 0.0839  169 LEU C CG  
2456 C CD1 . LEU C 92  ? 0.7333 0.7680 0.3928 -0.0086 -0.1171 0.1022  169 LEU C CD1 
2457 C CD2 . LEU C 92  ? 0.7275 0.7826 0.4040 -0.0240 -0.0894 0.0805  169 LEU C CD2 
2458 N N   . LEU C 93  ? 0.5924 0.6596 0.3719 0.0010  -0.1238 0.0668  170 LEU C N   
2459 C CA  . LEU C 93  ? 0.5640 0.6452 0.3778 -0.0001 -0.1221 0.0526  170 LEU C CA  
2460 C C   . LEU C 93  ? 0.6406 0.7322 0.4623 -0.0100 -0.1118 0.0384  170 LEU C C   
2461 O O   . LEU C 93  ? 0.6573 0.7604 0.4667 -0.0108 -0.1168 0.0300  170 LEU C O   
2462 C CB  . LEU C 93  ? 0.5613 0.6597 0.3875 0.0095  -0.1387 0.0444  170 LEU C CB  
2463 C CG  . LEU C 93  ? 0.5915 0.7088 0.4533 0.0062  -0.1359 0.0278  170 LEU C CG  
2464 C CD1 . LEU C 93  ? 0.5855 0.6951 0.4677 0.0087  -0.1310 0.0319  170 LEU C CD1 
2465 C CD2 . LEU C 93  ? 0.5869 0.7289 0.4584 0.0124  -0.1517 0.0150  170 LEU C CD2 
2466 N N   . SER C 94  ? 0.5666 0.6522 0.4063 -0.0171 -0.0984 0.0357  171 SER C N   
2467 C CA  . SER C 94  ? 0.5388 0.6301 0.3874 -0.0255 -0.0895 0.0222  171 SER C CA  
2468 C C   . SER C 94  ? 0.5918 0.7002 0.4623 -0.0267 -0.0953 0.0072  171 SER C C   
2469 O O   . SER C 94  ? 0.6058 0.7260 0.4758 -0.0304 -0.0976 -0.0062 171 SER C O   
2470 C CB  . SER C 94  ? 0.5694 0.6462 0.4285 -0.0311 -0.0758 0.0256  171 SER C CB  
2471 O OG  . SER C 94  ? 0.7207 0.7997 0.5859 -0.0379 -0.0685 0.0129  171 SER C OG  
2472 N N   . PHE C 95  ? 0.5447 0.6556 0.4350 -0.0240 -0.0973 0.0082  172 PHE C N   
2473 C CA  . PHE C 95  ? 0.5372 0.6673 0.4530 -0.0258 -0.1013 -0.0061 172 PHE C CA  
2474 C C   . PHE C 95  ? 0.5466 0.6792 0.4793 -0.0198 -0.1037 -0.0023 172 PHE C C   
2475 O O   . PHE C 95  ? 0.5443 0.6590 0.4719 -0.0174 -0.0985 0.0101  172 PHE C O   
2476 C CB  . PHE C 95  ? 0.5592 0.6894 0.4901 -0.0385 -0.0899 -0.0186 172 PHE C CB  
2477 C CG  . PHE C 95  ? 0.5905 0.7001 0.5255 -0.0438 -0.0760 -0.0115 172 PHE C CG  
2478 C CD1 . PHE C 95  ? 0.6283 0.7373 0.5805 -0.0451 -0.0717 -0.0105 172 PHE C CD1 
2479 C CD2 . PHE C 95  ? 0.6401 0.7319 0.5621 -0.0473 -0.0675 -0.0070 172 PHE C CD2 
2480 C CE1 . PHE C 95  ? 0.6295 0.7182 0.5818 -0.0500 -0.0601 -0.0038 172 PHE C CE1 
2481 C CE2 . PHE C 95  ? 0.6734 0.7464 0.5990 -0.0512 -0.0571 -0.0007 172 PHE C CE2 
2482 C CZ  . PHE C 95  ? 0.6395 0.7099 0.5784 -0.0527 -0.0539 0.0014  172 PHE C CZ  
2483 N N   . LYS C 96  ? 0.4671 0.6234 0.4215 -0.0177 -0.1115 -0.0148 173 LYS C N   
2484 C CA  . LYS C 96  ? 0.4446 0.6109 0.4207 -0.0115 -0.1141 -0.0165 173 LYS C CA  
2485 C C   . LYS C 96  ? 0.4886 0.6778 0.4955 -0.0215 -0.1085 -0.0349 173 LYS C C   
2486 O O   . LYS C 96  ? 0.5157 0.7234 0.5297 -0.0261 -0.1140 -0.0480 173 LYS C O   
2487 C CB  . LYS C 96  ? 0.4752 0.6513 0.4463 0.0046  -0.1330 -0.0132 173 LYS C CB  
2488 C CG  . LYS C 96  ? 0.4984 0.6910 0.4965 0.0136  -0.1384 -0.0193 173 LYS C CG  
2489 C CD  . LYS C 96  ? 0.5696 0.7732 0.5644 0.0311  -0.1602 -0.0182 173 LYS C CD  
2490 C CE  . LYS C 96  ? 0.7237 0.9506 0.7519 0.0407  -0.1659 -0.0291 173 LYS C CE  
2491 N NZ  . LYS C 96  ? 0.9493 1.2124 1.0096 0.0327  -0.1654 -0.0505 173 LYS C NZ  
2492 N N   . ARG C 97  ? 0.4065 0.5935 0.4300 -0.0262 -0.0969 -0.0360 174 ARG C N   
2493 C CA  . ARG C 97  ? 0.3914 0.5983 0.4432 -0.0378 -0.0888 -0.0520 174 ARG C CA  
2494 C C   . ARG C 97  ? 0.4464 0.6680 0.5205 -0.0312 -0.0879 -0.0554 174 ARG C C   
2495 O O   . ARG C 97  ? 0.4374 0.6406 0.5032 -0.0265 -0.0821 -0.0445 174 ARG C O   
2496 C CB  . ARG C 97  ? 0.3699 0.5555 0.4162 -0.0537 -0.0713 -0.0505 174 ARG C CB  
2497 C CG  . ARG C 97  ? 0.4673 0.6683 0.5383 -0.0692 -0.0613 -0.0660 174 ARG C CG  
2498 C CD  . ARG C 97  ? 0.5102 0.6831 0.5719 -0.0821 -0.0440 -0.0599 174 ARG C CD  
2499 N NE  . ARG C 97  ? 0.4501 0.6319 0.5306 -0.0997 -0.0332 -0.0733 174 ARG C NE  
2500 C CZ  . ARG C 97  ? 0.5595 0.7264 0.6407 -0.1113 -0.0173 -0.0709 174 ARG C CZ  
2501 N NH1 . ARG C 97  ? 0.5444 0.6886 0.6090 -0.1062 -0.0117 -0.0567 174 ARG C NH1 
2502 N NH2 . ARG C 97  ? 0.3029 0.4772 0.4003 -0.1290 -0.0070 -0.0828 174 ARG C NH2 
2503 N N   . GLY C 98  ? 0.4104 0.6665 0.5125 -0.0294 -0.0953 -0.0714 175 GLY C N   
2504 C CA  . GLY C 98  ? 0.4132 0.6907 0.5426 -0.0225 -0.0948 -0.0790 175 GLY C CA  
2505 C C   . GLY C 98  ? 0.4990 0.7784 0.6248 -0.0003 -0.1117 -0.0725 175 GLY C C   
2506 O O   . GLY C 98  ? 0.5227 0.7910 0.6256 0.0095  -0.1264 -0.0630 175 GLY C O   
2507 N N   . SER C 99  ? 0.4574 0.7493 0.6049 0.0074  -0.1088 -0.0778 176 SER C N   
2508 C CA  . SER C 99  ? 0.4621 0.7579 0.6135 0.0297  -0.1244 -0.0751 176 SER C CA  
2509 C C   . SER C 99  ? 0.5395 0.8004 0.6684 0.0385  -0.1212 -0.0585 176 SER C C   
2510 O O   . SER C 99  ? 0.5809 0.8311 0.6983 0.0562  -0.1374 -0.0500 176 SER C O   
2511 C CB  . SER C 99  ? 0.4626 0.8001 0.6577 0.0352  -0.1259 -0.0954 176 SER C CB  
2512 O OG  . SER C 99  ? 0.4640 0.8116 0.6786 0.0188  -0.1031 -0.1053 176 SER C OG  
2513 N N   . ALA C 100 ? 0.4617 0.7044 0.5842 0.0264  -0.1016 -0.0545 177 ALA C N   
2514 C CA  . ALA C 100 ? 0.4676 0.6801 0.5725 0.0326  -0.0970 -0.0420 177 ALA C CA  
2515 C C   . ALA C 100 ? 0.5460 0.7247 0.6171 0.0401  -0.1074 -0.0225 177 ALA C C   
2516 O O   . ALA C 100 ? 0.5449 0.7039 0.6068 0.0507  -0.1106 -0.0145 177 ALA C O   
2517 C CB  . ALA C 100 ? 0.4692 0.6688 0.5698 0.0160  -0.0752 -0.0414 177 ALA C CB  
2518 N N   . LEU C 101 ? 0.5129 0.6845 0.5653 0.0338  -0.1115 -0.0155 178 LEU C N   
2519 C CA  . LEU C 101 ? 0.5086 0.6498 0.5282 0.0381  -0.1186 0.0028  178 LEU C CA  
2520 C C   . LEU C 101 ? 0.5945 0.7423 0.6025 0.0447  -0.1351 0.0053  178 LEU C C   
2521 O O   . LEU C 101 ? 0.5990 0.7697 0.6171 0.0391  -0.1372 -0.0056 178 LEU C O   
2522 C CB  . LEU C 101 ? 0.4853 0.6034 0.4859 0.0229  -0.1041 0.0120  178 LEU C CB  
2523 C CG  . LEU C 101 ? 0.5098 0.6148 0.5135 0.0167  -0.0893 0.0127  178 LEU C CG  
2524 C CD1 . LEU C 101 ? 0.4886 0.5804 0.4810 0.0014  -0.0765 0.0166  178 LEU C CD1 
2525 C CD2 . LEU C 101 ? 0.5514 0.6326 0.5429 0.0270  -0.0936 0.0237  178 LEU C CD2 
2526 N N   . GLU C 102 ? 0.5866 0.7123 0.5711 0.0558  -0.1468 0.0199  179 GLU C N   
2527 C CA  . GLU C 102 ? 0.6134 0.7379 0.5779 0.0636  -0.1636 0.0263  179 GLU C CA  
2528 C C   . GLU C 102 ? 0.6981 0.7884 0.6264 0.0619  -0.1633 0.0463  179 GLU C C   
2529 O O   . GLU C 102 ? 0.7004 0.7674 0.6227 0.0604  -0.1556 0.0555  179 GLU C O   
2530 C CB  . GLU C 102 ? 0.6501 0.7849 0.6255 0.0835  -0.1831 0.0228  179 GLU C CB  
2531 C CG  . GLU C 102 ? 0.7788 0.9549 0.7890 0.0872  -0.1894 0.0019  179 GLU C CG  
2532 C CD  . GLU C 102 ? 1.0022 1.1897 1.0242 0.1094  -0.2112 -0.0019 179 GLU C CD  
2533 O OE1 . GLU C 102 ? 0.6941 0.8564 0.6881 0.1217  -0.2261 0.0133  179 GLU C OE1 
2534 O OE2 . GLU C 102 ? 0.9320 1.1541 0.9917 0.1144  -0.2137 -0.0206 179 GLU C OE2 
2535 N N   . GLU C 103 ? 0.7009 0.7890 0.6049 0.0617  -0.1717 0.0524  180 GLU C N   
2536 C CA  . GLU C 103 ? 0.7351 0.7935 0.6029 0.0596  -0.1718 0.0714  180 GLU C CA  
2537 C C   . GLU C 103 ? 0.8182 0.8634 0.6721 0.0767  -0.1913 0.0808  180 GLU C C   
2538 O O   . GLU C 103 ? 0.8203 0.8840 0.6796 0.0876  -0.2075 0.0733  180 GLU C O   
2539 C CB  . GLU C 103 ? 0.7632 0.8274 0.6101 0.0502  -0.1697 0.0716  180 GLU C CB  
2540 C CG  . GLU C 103 ? 0.9664 1.0040 0.7790 0.0432  -0.1632 0.0890  180 GLU C CG  
2541 C CD  . GLU C 103 ? 1.4429 1.4596 1.2212 0.0514  -0.1766 0.1053  180 GLU C CD  
2542 O OE1 . GLU C 103 ? 1.5375 1.5618 1.3126 0.0645  -0.1951 0.1031  180 GLU C OE1 
2543 O OE2 . GLU C 103 ? 1.3716 1.3644 1.1255 0.0443  -0.1688 0.1204  180 GLU C OE2 
2544 N N   . LYS C 104 ? 0.8056 0.8187 0.6430 0.0794  -0.1908 0.0963  181 LYS C N   
2545 C CA  . LYS C 104 ? 0.8508 0.8436 0.6710 0.0955  -0.2095 0.1074  181 LYS C CA  
2546 C C   . LYS C 104 ? 0.9218 0.8755 0.7078 0.0893  -0.2052 0.1287  181 LYS C C   
2547 O O   . LYS C 104 ? 0.9003 0.8368 0.6912 0.0827  -0.1934 0.1330  181 LYS C O   
2548 C CB  . LYS C 104 ? 0.8816 0.8784 0.7302 0.1114  -0.2179 0.0989  181 LYS C CB  
2549 N N   . GLU C 105 ? 0.8964 0.8372 0.6467 0.0900  -0.2143 0.1414  182 GLU C N   
2550 C CA  . GLU C 105 ? 0.9141 0.8179 0.6271 0.0830  -0.2110 0.1628  182 GLU C CA  
2551 C C   . GLU C 105 ? 0.8968 0.7935 0.6130 0.0643  -0.1884 0.1659  182 GLU C C   
2552 O O   . GLU C 105 ? 0.8892 0.7580 0.6006 0.0613  -0.1841 0.1765  182 GLU C O   
2553 C CB  . GLU C 105 ? 0.9682 0.8388 0.6710 0.0976  -0.2260 0.1749  182 GLU C CB  
2554 C CG  . GLU C 105 ? 1.1710 1.0426 0.8628 0.1174  -0.2511 0.1757  182 GLU C CG  
2555 C CD  . GLU C 105 ? 1.4894 1.3281 1.1747 0.1350  -0.2679 0.1855  182 GLU C CD  
2556 O OE1 . GLU C 105 ? 1.1977 1.0202 0.8993 0.1347  -0.2607 0.1853  182 GLU C OE1 
2557 O OE2 . GLU C 105 ? 1.5019 1.3307 1.1660 0.1502  -0.2896 0.1925  182 GLU C OE2 
2558 N N   . ASN C 106 ? 0.7836 0.7060 0.5104 0.0524  -0.1750 0.1552  183 ASN C N   
2559 C CA  . ASN C 106 ? 0.7407 0.6614 0.4729 0.0360  -0.1549 0.1559  183 ASN C CA  
2560 C C   . ASN C 106 ? 0.7712 0.6907 0.5332 0.0350  -0.1471 0.1493  183 ASN C C   
2561 O O   . ASN C 106 ? 0.7788 0.6889 0.5424 0.0235  -0.1340 0.1534  183 ASN C O   
2562 C CB  . ASN C 106 ? 0.6927 0.5876 0.3919 0.0258  -0.1487 0.1743  183 ASN C CB  
2563 C CG  . ASN C 106 ? 1.0879 0.9973 0.7787 0.0118  -0.1343 0.1719  183 ASN C CG  
2564 O OD1 . ASN C 106 ? 0.9867 0.9178 0.6746 0.0127  -0.1362 0.1624  183 ASN C OD1 
2565 N ND2 . ASN C 106 ? 1.1001 0.9986 0.7886 -0.0012 -0.1198 0.1790  183 ASN C ND2 
2566 N N   . LYS C 107 ? 0.6902 0.6215 0.4762 0.0467  -0.1550 0.1380  184 LYS C N   
2567 C CA  . LYS C 107 ? 0.6483 0.5807 0.4607 0.0467  -0.1480 0.1298  184 LYS C CA  
2568 C C   . LYS C 107 ? 0.6474 0.6126 0.4885 0.0496  -0.1470 0.1108  184 LYS C C   
2569 O O   . LYS C 107 ? 0.6089 0.5935 0.4520 0.0558  -0.1565 0.1041  184 LYS C O   
2570 C CB  . LYS C 107 ? 0.6973 0.6065 0.5098 0.0592  -0.1583 0.1351  184 LYS C CB  
2571 C CG  . LYS C 107 ? 0.7763 0.6481 0.5615 0.0562  -0.1604 0.1540  184 LYS C CG  
2572 C CD  . LYS C 107 ? 0.9043 0.7536 0.6818 0.0736  -0.1781 0.1600  184 LYS C CD  
2573 N N   . ILE C 108 ? 0.6166 0.5876 0.4788 0.0443  -0.1356 0.1021  185 ILE C N   
2574 C CA  . ILE C 108 ? 0.5977 0.5971 0.4873 0.0451  -0.1325 0.0847  185 ILE C CA  
2575 C C   . ILE C 108 ? 0.6497 0.6503 0.5559 0.0593  -0.1406 0.0786  185 ILE C C   
2576 O O   . ILE C 108 ? 0.6378 0.6180 0.5426 0.0616  -0.1382 0.0832  185 ILE C O   
2577 C CB  . ILE C 108 ? 0.5985 0.6032 0.4995 0.0313  -0.1155 0.0783  185 ILE C CB  
2578 C CG1 . ILE C 108 ? 0.5785 0.5814 0.4646 0.0195  -0.1084 0.0834  185 ILE C CG1 
2579 C CG2 . ILE C 108 ? 0.5999 0.6323 0.5272 0.0311  -0.1122 0.0610  185 ILE C CG2 
2580 C CD1 . ILE C 108 ? 0.4997 0.5015 0.3924 0.0076  -0.0940 0.0802  185 ILE C CD1 
2581 N N   . LEU C 109 ? 0.6023 0.6269 0.5242 0.0696  -0.1510 0.0678  186 LEU C N   
2582 C CA  . LEU C 109 ? 0.5948 0.6257 0.5364 0.0851  -0.1595 0.0595  186 LEU C CA  
2583 C C   . LEU C 109 ? 0.5974 0.6575 0.5712 0.0807  -0.1483 0.0409  186 LEU C C   
2584 O O   . LEU C 109 ? 0.5762 0.6626 0.5623 0.0732  -0.1449 0.0308  186 LEU C O   
2585 C CB  . LEU C 109 ? 0.6159 0.6543 0.5548 0.1015  -0.1807 0.0599  186 LEU C CB  
2586 C CG  . LEU C 109 ? 0.6775 0.7327 0.6443 0.1197  -0.1915 0.0469  186 LEU C CG  
2587 C CD1 . LEU C 109 ? 0.6808 0.7076 0.6453 0.1298  -0.1927 0.0521  186 LEU C CD1 
2588 C CD2 . LEU C 109 ? 0.7585 0.8254 0.7229 0.1345  -0.2133 0.0463  186 LEU C CD2 
2589 N N   . VAL C 110 ? 0.5216 0.5754 0.5073 0.0842  -0.1417 0.0361  187 VAL C N   
2590 C CA  . VAL C 110 ? 0.4788 0.5575 0.4925 0.0796  -0.1290 0.0191  187 VAL C CA  
2591 C C   . VAL C 110 ? 0.5724 0.6818 0.6155 0.0952  -0.1399 0.0036  187 VAL C C   
2592 O O   . VAL C 110 ? 0.6054 0.7056 0.6503 0.1130  -0.1526 0.0047  187 VAL C O   
2593 C CB  . VAL C 110 ? 0.4907 0.5492 0.5008 0.0763  -0.1169 0.0203  187 VAL C CB  
2594 C CG1 . VAL C 110 ? 0.4671 0.5499 0.5018 0.0705  -0.1022 0.0033  187 VAL C CG1 
2595 C CG2 . VAL C 110 ? 0.4788 0.5104 0.4628 0.0621  -0.1088 0.0347  187 VAL C CG2 
2596 N N   . LYS C 111 ? 0.4975 0.6429 0.5642 0.0886  -0.1357 -0.0111 188 LYS C N   
2597 C CA  . LYS C 111 ? 0.4778 0.6599 0.5779 0.1011  -0.1451 -0.0285 188 LYS C CA  
2598 C C   . LYS C 111 ? 0.5264 0.7344 0.6588 0.0968  -0.1289 -0.0470 188 LYS C C   
2599 O O   . LYS C 111 ? 0.5233 0.7593 0.6862 0.1103  -0.1354 -0.0621 188 LYS C O   
2600 C CB  . LYS C 111 ? 0.4779 0.6849 0.5835 0.0982  -0.1554 -0.0333 188 LYS C CB  
2601 C CG  . LYS C 111 ? 0.5534 0.7385 0.6275 0.1065  -0.1740 -0.0169 188 LYS C CG  
2602 C CD  . LYS C 111 ? 0.5998 0.7799 0.6746 0.1314  -0.1965 -0.0143 188 LYS C CD  
2603 N N   . GLU C 112 ? 0.4811 0.6797 0.6061 0.0786  -0.1080 -0.0459 189 GLU C N   
2604 C CA  . GLU C 112 ? 0.4800 0.6982 0.6283 0.0719  -0.0899 -0.0613 189 GLU C CA  
2605 C C   . GLU C 112 ? 0.5559 0.7403 0.6809 0.0666  -0.0774 -0.0520 189 GLU C C   
2606 O O   . GLU C 112 ? 0.5782 0.7334 0.6739 0.0570  -0.0753 -0.0364 189 GLU C O   
2607 C CB  . GLU C 112 ? 0.4827 0.7248 0.6440 0.0509  -0.0755 -0.0706 189 GLU C CB  
2608 C CG  . GLU C 112 ? 0.6079 0.8933 0.8029 0.0541  -0.0842 -0.0869 189 GLU C CG  
2609 C CD  . GLU C 112 ? 0.9097 1.2077 1.1070 0.0338  -0.0772 -0.0904 189 GLU C CD  
2610 O OE1 . GLU C 112 ? 0.7738 1.0603 0.9616 0.0145  -0.0578 -0.0884 189 GLU C OE1 
2611 O OE2 . GLU C 112 ? 0.9175 1.2360 1.1255 0.0377  -0.0920 -0.0955 189 GLU C OE2 
2612 N N   . THR C 113 ? 0.5048 0.6942 0.6426 0.0726  -0.0689 -0.0625 190 THR C N   
2613 C CA  . THR C 113 ? 0.5129 0.6714 0.6276 0.0669  -0.0570 -0.0555 190 THR C CA  
2614 C C   . THR C 113 ? 0.5966 0.7567 0.7039 0.0434  -0.0367 -0.0560 190 THR C C   
2615 O O   . THR C 113 ? 0.6106 0.8024 0.7407 0.0342  -0.0273 -0.0689 190 THR C O   
2616 C CB  . THR C 113 ? 0.5670 0.7308 0.6967 0.0810  -0.0542 -0.0684 190 THR C CB  
2617 O OG1 . THR C 113 ? 0.6771 0.8341 0.8114 0.1036  -0.0753 -0.0662 190 THR C OG1 
2618 C CG2 . THR C 113 ? 0.4276 0.5610 0.5330 0.0747  -0.0418 -0.0637 190 THR C CG2 
2619 N N   . GLY C 114 ? 0.5284 0.6544 0.6045 0.0338  -0.0308 -0.0421 191 GLY C N   
2620 C CA  . GLY C 114 ? 0.5032 0.6242 0.5676 0.0132  -0.0134 -0.0405 191 GLY C CA  
2621 C C   . GLY C 114 ? 0.5377 0.6207 0.5683 0.0063  -0.0129 -0.0237 191 GLY C C   
2622 O O   . GLY C 114 ? 0.5396 0.6002 0.5564 0.0163  -0.0238 -0.0143 191 GLY C O   
2623 N N   . TYR C 115 ? 0.4846 0.5597 0.5023 -0.0110 -0.0005 -0.0201 192 TYR C N   
2624 C CA  . TYR C 115 ? 0.4814 0.5231 0.4694 -0.0175 -0.0011 -0.0048 192 TYR C CA  
2625 C C   . TYR C 115 ? 0.5304 0.5704 0.5157 -0.0217 -0.0085 0.0035  192 TYR C C   
2626 O O   . TYR C 115 ? 0.5186 0.5772 0.5171 -0.0293 -0.0047 -0.0027 192 TYR C O   
2627 C CB  . TYR C 115 ? 0.4989 0.5280 0.4704 -0.0318 0.0149  -0.0049 192 TYR C CB  
2628 C CG  . TYR C 115 ? 0.5350 0.5583 0.4999 -0.0278 0.0219  -0.0110 192 TYR C CG  
2629 C CD1 . TYR C 115 ? 0.5645 0.6139 0.5497 -0.0259 0.0320  -0.0273 192 TYR C CD1 
2630 C CD2 . TYR C 115 ? 0.5531 0.5467 0.4925 -0.0259 0.0185  -0.0021 192 TYR C CD2 
2631 C CE1 . TYR C 115 ? 0.6026 0.6473 0.5811 -0.0217 0.0394  -0.0347 192 TYR C CE1 
2632 C CE2 . TYR C 115 ? 0.5833 0.5706 0.5147 -0.0223 0.0247  -0.0092 192 TYR C CE2 
2633 C CZ  . TYR C 115 ? 0.7066 0.7190 0.6567 -0.0200 0.0356  -0.0256 192 TYR C CZ  
2634 O OH  . TYR C 115 ? 0.7104 0.7184 0.6525 -0.0163 0.0433  -0.0347 192 TYR C OH  
2635 N N   . PHE C 116 ? 0.4908 0.5101 0.4606 -0.0167 -0.0192 0.0163  193 PHE C N   
2636 C CA  . PHE C 116 ? 0.4821 0.4996 0.4478 -0.0195 -0.0259 0.0238  193 PHE C CA  
2637 C C   . PHE C 116 ? 0.5455 0.5371 0.4897 -0.0260 -0.0247 0.0357  193 PHE C C   
2638 O O   . PHE C 116 ? 0.5486 0.5217 0.4805 -0.0230 -0.0262 0.0413  193 PHE C O   
2639 C CB  . PHE C 116 ? 0.4959 0.5171 0.4649 -0.0065 -0.0410 0.0278  193 PHE C CB  
2640 C CG  . PHE C 116 ? 0.4979 0.5461 0.4895 0.0025  -0.0460 0.0161  193 PHE C CG  
2641 C CD1 . PHE C 116 ? 0.5259 0.5785 0.5276 0.0133  -0.0472 0.0092  193 PHE C CD1 
2642 C CD2 . PHE C 116 ? 0.4875 0.5586 0.4923 0.0003  -0.0491 0.0098  193 PHE C CD2 
2643 C CE1 . PHE C 116 ? 0.5283 0.6089 0.5547 0.0229  -0.0524 -0.0033 193 PHE C CE1 
2644 C CE2 . PHE C 116 ? 0.5071 0.6064 0.5357 0.0088  -0.0547 -0.0026 193 PHE C CE2 
2645 C CZ  . PHE C 116 ? 0.4924 0.5972 0.5328 0.0205  -0.0565 -0.0090 193 PHE C CZ  
2646 N N   . PHE C 117 ? 0.4664 0.4574 0.4076 -0.0340 -0.0232 0.0385  194 PHE C N   
2647 C CA  . PHE C 117 ? 0.4424 0.4127 0.3674 -0.0383 -0.0241 0.0488  194 PHE C CA  
2648 C C   . PHE C 117 ? 0.5183 0.4916 0.4432 -0.0321 -0.0343 0.0546  194 PHE C C   
2649 O O   . PHE C 117 ? 0.5415 0.5308 0.4749 -0.0318 -0.0368 0.0501  194 PHE C O   
2650 C CB  . PHE C 117 ? 0.4440 0.4111 0.3666 -0.0495 -0.0164 0.0471  194 PHE C CB  
2651 C CG  . PHE C 117 ? 0.4368 0.3854 0.3464 -0.0514 -0.0190 0.0563  194 PHE C CG  
2652 C CD1 . PHE C 117 ? 0.4408 0.3690 0.3362 -0.0518 -0.0190 0.0632  194 PHE C CD1 
2653 C CD2 . PHE C 117 ? 0.4367 0.3902 0.3493 -0.0519 -0.0222 0.0567  194 PHE C CD2 
2654 C CE1 . PHE C 117 ? 0.4453 0.3600 0.3329 -0.0522 -0.0227 0.0703  194 PHE C CE1 
2655 C CE2 . PHE C 117 ? 0.4549 0.3943 0.3589 -0.0524 -0.0243 0.0634  194 PHE C CE2 
2656 C CZ  . PHE C 117 ? 0.4374 0.3585 0.3306 -0.0523 -0.0248 0.0701  194 PHE C CZ  
2657 N N   . ILE C 118 ? 0.4687 0.4273 0.3836 -0.0277 -0.0401 0.0638  195 ILE C N   
2658 C CA  . ILE C 118 ? 0.4627 0.4214 0.3742 -0.0230 -0.0484 0.0708  195 ILE C CA  
2659 C C   . ILE C 118 ? 0.5109 0.4580 0.4133 -0.0281 -0.0475 0.0785  195 ILE C C   
2660 O O   . ILE C 118 ? 0.4954 0.4282 0.3921 -0.0306 -0.0457 0.0818  195 ILE C O   
2661 C CB  . ILE C 118 ? 0.4948 0.4464 0.4040 -0.0140 -0.0560 0.0748  195 ILE C CB  
2662 C CG1 . ILE C 118 ? 0.4773 0.4421 0.3988 -0.0068 -0.0573 0.0652  195 ILE C CG1 
2663 C CG2 . ILE C 118 ? 0.5152 0.4638 0.4170 -0.0109 -0.0637 0.0836  195 ILE C CG2 
2664 C CD1 . ILE C 118 ? 0.5049 0.4588 0.4256 -0.0020 -0.0573 0.0637  195 ILE C CD1 
2665 N N   . TYR C 119 ? 0.4639 0.4183 0.3653 -0.0290 -0.0492 0.0804  196 TYR C N   
2666 C CA  . TYR C 119 ? 0.4543 0.4031 0.3509 -0.0331 -0.0476 0.0855  196 TYR C CA  
2667 C C   . TYR C 119 ? 0.5095 0.4626 0.4005 -0.0315 -0.0513 0.0913  196 TYR C C   
2668 O O   . TYR C 119 ? 0.4869 0.4489 0.3762 -0.0277 -0.0554 0.0903  196 TYR C O   
2669 C CB  . TYR C 119 ? 0.4454 0.3981 0.3457 -0.0380 -0.0420 0.0791  196 TYR C CB  
2670 C CG  . TYR C 119 ? 0.4426 0.4113 0.3478 -0.0383 -0.0418 0.0713  196 TYR C CG  
2671 C CD1 . TYR C 119 ? 0.4720 0.4495 0.3852 -0.0391 -0.0404 0.0633  196 TYR C CD1 
2672 C CD2 . TYR C 119 ? 0.4470 0.4236 0.3494 -0.0384 -0.0428 0.0708  196 TYR C CD2 
2673 C CE1 . TYR C 119 ? 0.4668 0.4611 0.3864 -0.0398 -0.0417 0.0548  196 TYR C CE1 
2674 C CE2 . TYR C 119 ? 0.4499 0.4412 0.3552 -0.0387 -0.0439 0.0625  196 TYR C CE2 
2675 C CZ  . TYR C 119 ? 0.4926 0.4928 0.4074 -0.0395 -0.0441 0.0544  196 TYR C CZ  
2676 O OH  . TYR C 119 ? 0.4776 0.4942 0.3972 -0.0404 -0.0465 0.0451  196 TYR C OH  
2677 N N   . GLY C 120 ? 0.4817 0.4295 0.3699 -0.0348 -0.0496 0.0969  197 GLY C N   
2678 C CA  . GLY C 120 ? 0.4983 0.4498 0.3797 -0.0357 -0.0503 0.1028  197 GLY C CA  
2679 C C   . GLY C 120 ? 0.5929 0.5445 0.4770 -0.0405 -0.0458 0.1051  197 GLY C C   
2680 O O   . GLY C 120 ? 0.6214 0.5649 0.5109 -0.0420 -0.0458 0.1063  197 GLY C O   
2681 N N   . GLN C 121 ? 0.5344 0.4967 0.4152 -0.0425 -0.0423 0.1046  198 GLN C N   
2682 C CA  . GLN C 121 ? 0.5163 0.4840 0.4021 -0.0465 -0.0368 0.1051  198 GLN C CA  
2683 C C   . GLN C 121 ? 0.5702 0.5444 0.4452 -0.0501 -0.0336 0.1107  198 GLN C C   
2684 O O   . GLN C 121 ? 0.5783 0.5562 0.4407 -0.0483 -0.0352 0.1109  198 GLN C O   
2685 C CB  . GLN C 121 ? 0.5160 0.4915 0.4105 -0.0454 -0.0327 0.0951  198 GLN C CB  
2686 C CG  . GLN C 121 ? 0.3847 0.3684 0.2883 -0.0476 -0.0273 0.0935  198 GLN C CG  
2687 C CD  . GLN C 121 ? 0.6338 0.6210 0.5465 -0.0445 -0.0248 0.0834  198 GLN C CD  
2688 O OE1 . GLN C 121 ? 0.6936 0.6706 0.6128 -0.0420 -0.0280 0.0814  198 GLN C OE1 
2689 N NE2 . GLN C 121 ? 0.4173 0.4171 0.3289 -0.0444 -0.0193 0.0767  198 GLN C NE2 
2690 N N   . VAL C 122 ? 0.4994 0.4753 0.3788 -0.0557 -0.0292 0.1151  199 VAL C N   
2691 C CA  . VAL C 122 ? 0.4910 0.4732 0.3603 -0.0619 -0.0233 0.1208  199 VAL C CA  
2692 C C   . VAL C 122 ? 0.5258 0.5225 0.4112 -0.0661 -0.0149 0.1157  199 VAL C C   
2693 O O   . VAL C 122 ? 0.5079 0.5030 0.4101 -0.0657 -0.0171 0.1136  199 VAL C O   
2694 C CB  . VAL C 122 ? 0.5403 0.5067 0.3987 -0.0665 -0.0266 0.1336  199 VAL C CB  
2695 C CG1 . VAL C 122 ? 0.5538 0.5242 0.3981 -0.0749 -0.0190 0.1410  199 VAL C CG1 
2696 C CG2 . VAL C 122 ? 0.5437 0.4957 0.3903 -0.0596 -0.0363 0.1373  199 VAL C CG2 
2697 N N   . LEU C 123 ? 0.4841 0.4957 0.3643 -0.0696 -0.0059 0.1129  200 LEU C N   
2698 C CA  . LEU C 123 ? 0.4806 0.5098 0.3779 -0.0736 0.0034  0.1071  200 LEU C CA  
2699 C C   . LEU C 123 ? 0.5554 0.5859 0.4456 -0.0849 0.0101  0.1171  200 LEU C C   
2700 O O   . LEU C 123 ? 0.5593 0.5870 0.4259 -0.0893 0.0139  0.1238  200 LEU C O   
2701 C CB  . LEU C 123 ? 0.4818 0.5282 0.3795 -0.0703 0.0111  0.0951  200 LEU C CB  
2702 C CG  . LEU C 123 ? 0.5387 0.6073 0.4516 -0.0745 0.0233  0.0881  200 LEU C CG  
2703 C CD1 . LEU C 123 ? 0.5330 0.6069 0.4757 -0.0718 0.0206  0.0834  200 LEU C CD1 
2704 C CD2 . LEU C 123 ? 0.5614 0.6436 0.4723 -0.0697 0.0298  0.0749  200 LEU C CD2 
2705 N N   . TYR C 124 ? 0.5120 0.5457 0.4218 -0.0901 0.0110  0.1183  201 TYR C N   
2706 C CA  . TYR C 124 ? 0.5115 0.5460 0.4196 -0.1034 0.0177  0.1272  201 TYR C CA  
2707 C C   . TYR C 124 ? 0.5512 0.6128 0.4740 -0.1100 0.0318  0.1200  201 TYR C C   
2708 O O   . TYR C 124 ? 0.5569 0.6360 0.5060 -0.1043 0.0323  0.1080  201 TYR C O   
2709 C CB  . TYR C 124 ? 0.5049 0.5263 0.4259 -0.1064 0.0093  0.1320  201 TYR C CB  
2710 C CG  . TYR C 124 ? 0.5333 0.5279 0.4382 -0.1001 -0.0030 0.1387  201 TYR C CG  
2711 C CD1 . TYR C 124 ? 0.5934 0.5684 0.4739 -0.1042 -0.0047 0.1508  201 TYR C CD1 
2712 C CD2 . TYR C 124 ? 0.5226 0.5113 0.4353 -0.0893 -0.0126 0.1325  201 TYR C CD2 
2713 C CE1 . TYR C 124 ? 0.6336 0.5864 0.5018 -0.0965 -0.0161 0.1550  201 TYR C CE1 
2714 C CE2 . TYR C 124 ? 0.5381 0.5058 0.4377 -0.0835 -0.0220 0.1368  201 TYR C CE2 
2715 C CZ  . TYR C 124 ? 0.7324 0.6837 0.6117 -0.0864 -0.0239 0.1472  201 TYR C CZ  
2716 O OH  . TYR C 124 ? 0.8239 0.7571 0.6932 -0.0790 -0.0333 0.1496  201 TYR C OH  
2717 N N   . THR C 125 ? 0.4908 0.5560 0.3956 -0.1211 0.0432  0.1267  202 THR C N   
2718 C CA  . THR C 125 ? 0.4992 0.5923 0.4155 -0.1302 0.0601  0.1203  202 THR C CA  
2719 C C   . THR C 125 ? 0.5788 0.6683 0.4921 -0.1483 0.0680  0.1320  202 THR C C   
2720 O O   . THR C 125 ? 0.5948 0.6981 0.4998 -0.1604 0.0841  0.1334  202 THR C O   
2721 C CB  . THR C 125 ? 0.6653 0.7693 0.5616 -0.1271 0.0693  0.1144  202 THR C CB  
2722 O OG1 . THR C 125 ? 0.6844 0.7665 0.5412 -0.1305 0.0670  0.1278  202 THR C OG1 
2723 C CG2 . THR C 125 ? 0.6658 0.7757 0.5726 -0.1109 0.0627  0.1001  202 THR C CG2 
2724 N N   . ASP C 126 ? 0.5387 0.6084 0.4583 -0.1508 0.0569  0.1397  203 ASP C N   
2725 C CA  . ASP C 126 ? 0.5559 0.6140 0.4726 -0.1676 0.0605  0.1514  203 ASP C CA  
2726 C C   . ASP C 126 ? 0.6231 0.7011 0.5798 -0.1744 0.0617  0.1433  203 ASP C C   
2727 O O   . ASP C 126 ? 0.6019 0.6831 0.5811 -0.1632 0.0496  0.1349  203 ASP C O   
2728 C CB  . ASP C 126 ? 0.5805 0.5996 0.4741 -0.1643 0.0456  0.1645  203 ASP C CB  
2729 C CG  . ASP C 126 ? 0.8063 0.8020 0.6794 -0.1809 0.0497  0.1805  203 ASP C CG  
2730 O OD1 . ASP C 126 ? 0.8373 0.8405 0.7298 -0.1959 0.0563  0.1808  203 ASP C OD1 
2731 O OD2 . ASP C 126 ? 0.8668 0.8353 0.7049 -0.1787 0.0451  0.1928  203 ASP C OD2 
2732 N N   . LYS C 127 ? 0.6014 0.6929 0.5665 -0.1935 0.0761  0.1460  204 LYS C N   
2733 C CA  . LYS C 127 ? 0.5764 0.6914 0.5825 -0.2021 0.0780  0.1374  204 LYS C CA  
2734 C C   . LYS C 127 ? 0.6360 0.7262 0.6482 -0.2063 0.0631  0.1436  204 LYS C C   
2735 O O   . LYS C 127 ? 0.6266 0.7351 0.6744 -0.2091 0.0588  0.1343  204 LYS C O   
2736 C CB  . LYS C 127 ? 0.5877 0.7323 0.6056 -0.2216 0.1004  0.1350  204 LYS C CB  
2737 N N   . THR C 128 ? 0.5970 0.6464 0.5756 -0.2049 0.0538  0.1577  205 THR C N   
2738 C CA  . THR C 128 ? 0.6075 0.6288 0.5870 -0.2072 0.0394  0.1629  205 THR C CA  
2739 C C   . THR C 128 ? 0.6661 0.6992 0.6751 -0.1941 0.0251  0.1496  205 THR C C   
2740 O O   . THR C 128 ? 0.6489 0.6873 0.6572 -0.1764 0.0191  0.1431  205 THR C O   
2741 C CB  . THR C 128 ? 0.6423 0.6213 0.5825 -0.2001 0.0299  0.1763  205 THR C CB  
2742 O OG1 . THR C 128 ? 0.6230 0.5893 0.5331 -0.2112 0.0415  0.1895  205 THR C OG1 
2743 C CG2 . THR C 128 ? 0.5792 0.5275 0.5186 -0.2018 0.0161  0.1807  205 THR C CG2 
2744 N N   . TYR C 129 ? 0.6343 0.6699 0.6674 -0.2036 0.0192  0.1460  206 TYR C N   
2745 C CA  . TYR C 129 ? 0.6053 0.6519 0.6657 -0.1935 0.0047  0.1339  206 TYR C CA  
2746 C C   . TYR C 129 ? 0.6430 0.6724 0.6887 -0.1723 -0.0094 0.1321  206 TYR C C   
2747 O O   . TYR C 129 ? 0.6352 0.6810 0.6994 -0.1602 -0.0169 0.1216  206 TYR C O   
2748 C CB  . TYR C 129 ? 0.6217 0.6602 0.6975 -0.2073 -0.0027 0.1334  206 TYR C CB  
2749 C CG  . TYR C 129 ? 0.6454 0.6409 0.6951 -0.2044 -0.0154 0.1415  206 TYR C CG  
2750 C CD1 . TYR C 129 ? 0.6916 0.6551 0.7105 -0.2125 -0.0104 0.1557  206 TYR C CD1 
2751 C CD2 . TYR C 129 ? 0.6430 0.6285 0.6964 -0.1921 -0.0327 0.1348  206 TYR C CD2 
2752 C CE1 . TYR C 129 ? 0.7103 0.6347 0.7070 -0.2076 -0.0223 0.1616  206 TYR C CE1 
2753 C CE2 . TYR C 129 ? 0.6681 0.6157 0.6979 -0.1886 -0.0430 0.1404  206 TYR C CE2 
2754 C CZ  . TYR C 129 ? 0.7999 0.7177 0.8030 -0.1958 -0.0378 0.1532  206 TYR C CZ  
2755 O OH  . TYR C 129 ? 0.8311 0.7115 0.8128 -0.1914 -0.0479 0.1576  206 TYR C OH  
2756 N N   . ALA C 130 ? 0.6113 0.6076 0.6244 -0.1682 -0.0130 0.1423  207 ALA C N   
2757 C CA  . ALA C 130 ? 0.5979 0.5774 0.5947 -0.1502 -0.0237 0.1415  207 ALA C CA  
2758 C C   . ALA C 130 ? 0.6520 0.6128 0.6169 -0.1467 -0.0193 0.1514  207 ALA C C   
2759 O O   . ALA C 130 ? 0.6883 0.6316 0.6365 -0.1572 -0.0149 0.1621  207 ALA C O   
2760 C CB  . ALA C 130 ? 0.6110 0.5677 0.6062 -0.1477 -0.0383 0.1406  207 ALA C CB  
2761 N N   . MET C 131 ? 0.5633 0.5282 0.5203 -0.1322 -0.0207 0.1477  208 MET C N   
2762 C CA  . MET C 131 ? 0.5440 0.4963 0.4740 -0.1255 -0.0190 0.1539  208 MET C CA  
2763 C C   . MET C 131 ? 0.5785 0.5200 0.5032 -0.1105 -0.0296 0.1495  208 MET C C   
2764 O O   . MET C 131 ? 0.5726 0.5204 0.5131 -0.1052 -0.0353 0.1415  208 MET C O   
2765 C CB  . MET C 131 ? 0.5588 0.5341 0.4873 -0.1252 -0.0073 0.1510  208 MET C CB  
2766 C CG  . MET C 131 ? 0.6194 0.6041 0.5459 -0.1410 0.0060  0.1567  208 MET C CG  
2767 S SD  . MET C 131 ? 0.7096 0.6601 0.6035 -0.1515 0.0061  0.1747  208 MET C SD  
2768 C CE  . MET C 131 ? 0.6771 0.6198 0.5391 -0.1390 0.0046  0.1786  208 MET C CE  
2769 N N   . GLY C 132 ? 0.5332 0.4582 0.4358 -0.1040 -0.0325 0.1549  209 GLY C N   
2770 C CA  . GLY C 132 ? 0.5240 0.4397 0.4217 -0.0912 -0.0409 0.1506  209 GLY C CA  
2771 C C   . GLY C 132 ? 0.6165 0.5134 0.4927 -0.0860 -0.0450 0.1573  209 GLY C C   
2772 O O   . GLY C 132 ? 0.6576 0.5441 0.5197 -0.0920 -0.0428 0.1668  209 GLY C O   
2773 N N   . HIS C 133 ? 0.5412 0.4342 0.4147 -0.0747 -0.0508 0.1522  210 HIS C N   
2774 C CA  . HIS C 133 ? 0.5430 0.4224 0.4004 -0.0674 -0.0560 0.1562  210 HIS C CA  
2775 C C   . HIS C 133 ? 0.5852 0.4511 0.4442 -0.0592 -0.0637 0.1517  210 HIS C C   
2776 O O   . HIS C 133 ? 0.5590 0.4269 0.4287 -0.0589 -0.0645 0.1450  210 HIS C O   
2777 C CB  . HIS C 133 ? 0.5497 0.4440 0.4009 -0.0618 -0.0535 0.1534  210 HIS C CB  
2778 C CG  . HIS C 133 ? 0.5752 0.4858 0.4390 -0.0572 -0.0514 0.1424  210 HIS C CG  
2779 N ND1 . HIS C 133 ? 0.5870 0.5139 0.4615 -0.0615 -0.0446 0.1379  210 HIS C ND1 
2780 C CD2 . HIS C 133 ? 0.5949 0.5060 0.4621 -0.0493 -0.0549 0.1352  210 HIS C CD2 
2781 C CE1 . HIS C 133 ? 0.5675 0.5009 0.4493 -0.0558 -0.0452 0.1292  210 HIS C CE1 
2782 N NE2 . HIS C 133 ? 0.5720 0.4965 0.4494 -0.0496 -0.0506 0.1276  210 HIS C NE2 
2783 N N   . LEU C 134 ? 0.5219 0.3742 0.3692 -0.0518 -0.0696 0.1550  211 LEU C N   
2784 C CA  . LEU C 134 ? 0.5030 0.3446 0.3519 -0.0428 -0.0759 0.1494  211 LEU C CA  
2785 C C   . LEU C 134 ? 0.5763 0.4285 0.4237 -0.0323 -0.0780 0.1447  211 LEU C C   
2786 O O   . LEU C 134 ? 0.5827 0.4356 0.4201 -0.0296 -0.0803 0.1502  211 LEU C O   
2787 C CB  . LEU C 134 ? 0.5204 0.3348 0.3604 -0.0421 -0.0825 0.1558  211 LEU C CB  
2788 C CG  . LEU C 134 ? 0.5834 0.3835 0.4207 -0.0547 -0.0811 0.1640  211 LEU C CG  
2789 C CD1 . LEU C 134 ? 0.6051 0.3748 0.4306 -0.0525 -0.0883 0.1707  211 LEU C CD1 
2790 C CD2 . LEU C 134 ? 0.5982 0.4023 0.4489 -0.0614 -0.0794 0.1577  211 LEU C CD2 
2791 N N   . ILE C 135 ? 0.5301 0.3907 0.3869 -0.0269 -0.0773 0.1343  212 ILE C N   
2792 C CA  . ILE C 135 ? 0.5150 0.3872 0.3748 -0.0175 -0.0792 0.1276  212 ILE C CA  
2793 C C   . ILE C 135 ? 0.5642 0.4207 0.4234 -0.0089 -0.0858 0.1257  212 ILE C C   
2794 O O   . ILE C 135 ? 0.5600 0.4091 0.4232 -0.0089 -0.0846 0.1203  212 ILE C O   
2795 C CB  . ILE C 135 ? 0.5388 0.4289 0.4089 -0.0185 -0.0730 0.1174  212 ILE C CB  
2796 C CG1 . ILE C 135 ? 0.5494 0.4540 0.4197 -0.0244 -0.0680 0.1184  212 ILE C CG1 
2797 C CG2 . ILE C 135 ? 0.5406 0.4417 0.4174 -0.0100 -0.0748 0.1086  212 ILE C CG2 
2798 C CD1 . ILE C 135 ? 0.6704 0.5856 0.5493 -0.0277 -0.0616 0.1101  212 ILE C CD1 
2799 N N   . GLN C 136 ? 0.5255 0.3744 0.3775 -0.0014 -0.0934 0.1308  213 GLN C N   
2800 C CA  . GLN C 136 ? 0.5264 0.3571 0.3770 0.0087  -0.1014 0.1300  213 GLN C CA  
2801 C C   . GLN C 136 ? 0.6031 0.4472 0.4627 0.0221  -0.1063 0.1211  213 GLN C C   
2802 O O   . GLN C 136 ? 0.6132 0.4766 0.4750 0.0245  -0.1073 0.1196  213 GLN C O   
2803 C CB  . GLN C 136 ? 0.5605 0.3660 0.3950 0.0077  -0.1081 0.1436  213 GLN C CB  
2804 C CG  . GLN C 136 ? 0.7893 0.5836 0.6180 -0.0072 -0.1025 0.1516  213 GLN C CG  
2805 C CD  . GLN C 136 ? 1.0024 0.7686 0.8148 -0.0099 -0.1080 0.1649  213 GLN C CD  
2806 O OE1 . GLN C 136 ? 0.8751 0.6383 0.6737 -0.0079 -0.1116 0.1740  213 GLN C OE1 
2807 N NE2 . GLN C 136 ? 0.8985 0.6416 0.7103 -0.0148 -0.1092 0.1663  213 GLN C NE2 
2808 N N   . ARG C 137 ? 0.5647 0.3991 0.4304 0.0313  -0.1098 0.1141  214 ARG C N   
2809 C CA  . ARG C 137 ? 0.5509 0.3992 0.4297 0.0455  -0.1144 0.1032  214 ARG C CA  
2810 C C   . ARG C 137 ? 0.6547 0.4793 0.5271 0.0588  -0.1274 0.1079  214 ARG C C   
2811 O O   . ARG C 137 ? 0.6774 0.4760 0.5443 0.0594  -0.1291 0.1095  214 ARG C O   
2812 C CB  . ARG C 137 ? 0.4894 0.3470 0.3814 0.0457  -0.1060 0.0890  214 ARG C CB  
2813 C CG  . ARG C 137 ? 0.6362 0.5133 0.5462 0.0591  -0.1081 0.0753  214 ARG C CG  
2814 C CD  . ARG C 137 ? 0.7411 0.6222 0.6593 0.0579  -0.0983 0.0624  214 ARG C CD  
2815 N NE  . ARG C 137 ? 0.7192 0.6205 0.6572 0.0706  -0.0985 0.0473  214 ARG C NE  
2816 C CZ  . ARG C 137 ? 0.8210 0.7238 0.7662 0.0738  -0.0914 0.0345  214 ARG C CZ  
2817 N NH1 . ARG C 137 ? 0.5574 0.4407 0.4889 0.0655  -0.0851 0.0357  214 ARG C NH1 
2818 N NH2 . ARG C 137 ? 0.6845 0.6098 0.6510 0.0854  -0.0906 0.0195  214 ARG C NH2 
2819 N N   . LYS C 138 ? 0.6011 0.4329 0.4732 0.0698  -0.1377 0.1101  215 LYS C N   
2820 C CA  . LYS C 138 ? 0.6050 0.4140 0.4713 0.0854  -0.1522 0.1141  215 LYS C CA  
2821 C C   . LYS C 138 ? 0.6384 0.4676 0.5294 0.1008  -0.1543 0.0960  215 LYS C C   
2822 O O   . LYS C 138 ? 0.6309 0.4905 0.5362 0.1070  -0.1567 0.0879  215 LYS C O   
2823 C CB  . LYS C 138 ? 0.6198 0.4234 0.4690 0.0895  -0.1637 0.1272  215 LYS C CB  
2824 C CG  . LYS C 138 ? 0.6449 0.4169 0.4825 0.1050  -0.1801 0.1349  215 LYS C CG  
2825 N N   . LYS C 139 ? 0.5914 0.4065 0.4885 0.1051  -0.1517 0.0879  216 LYS C N   
2826 C CA  . LYS C 139 ? 0.5956 0.4289 0.5166 0.1189  -0.1508 0.0688  216 LYS C CA  
2827 C C   . LYS C 139 ? 0.7186 0.5536 0.6487 0.1412  -0.1678 0.0660  216 LYS C C   
2828 O O   . LYS C 139 ? 0.7710 0.5724 0.6844 0.1495  -0.1814 0.0781  216 LYS C O   
2829 C CB  . LYS C 139 ? 0.6359 0.4464 0.5552 0.1188  -0.1456 0.0624  216 LYS C CB  
2830 C CG  . LYS C 139 ? 0.7600 0.5742 0.6742 0.0999  -0.1297 0.0607  216 LYS C CG  
2831 C CD  . LYS C 139 ? 0.8999 0.7150 0.8229 0.1034  -0.1215 0.0440  216 LYS C CD  
2832 C CE  . LYS C 139 ? 0.8993 0.6768 0.8107 0.1067  -0.1262 0.0442  216 LYS C CE  
2833 N NZ  . LYS C 139 ? 1.0317 0.7927 0.9263 0.0885  -0.1194 0.0510  216 LYS C NZ  
2834 N N   . VAL C 140 ? 0.6585 0.5316 0.6150 0.1507  -0.1675 0.0501  217 VAL C N   
2835 C CA  . VAL C 140 ? 0.6765 0.5557 0.6466 0.1741  -0.1850 0.0446  217 VAL C CA  
2836 C C   . VAL C 140 ? 0.7758 0.6344 0.7544 0.1910  -0.1895 0.0348  217 VAL C C   
2837 O O   . VAL C 140 ? 0.8149 0.6535 0.7913 0.2103  -0.2074 0.0381  217 VAL C O   
2838 C CB  . VAL C 140 ? 0.6892 0.6186 0.6877 0.1794  -0.1858 0.0301  217 VAL C CB  
2839 C CG1 . VAL C 140 ? 0.6447 0.6081 0.6717 0.1750  -0.1683 0.0088  217 VAL C CG1 
2840 C CG2 . VAL C 140 ? 0.7146 0.6486 0.7243 0.2042  -0.2079 0.0271  217 VAL C CG2 
2841 N N   . HIS C 141 ? 0.7297 0.5901 0.7149 0.1833  -0.1735 0.0234  218 HIS C N   
2842 C CA  . HIS C 141 ? 0.7452 0.5881 0.7377 0.1962  -0.1737 0.0112  218 HIS C CA  
2843 C C   . HIS C 141 ? 0.7358 0.5397 0.7033 0.1823  -0.1669 0.0198  218 HIS C C   
2844 O O   . HIS C 141 ? 0.7229 0.5326 0.6808 0.1616  -0.1531 0.0237  218 HIS C O   
2845 C CB  . HIS C 141 ? 0.7549 0.6389 0.7780 0.1994  -0.1594 -0.0136 218 HIS C CB  
2846 C CG  . HIS C 141 ? 0.8080 0.7359 0.8621 0.2123  -0.1649 -0.0259 218 HIS C CG  
2847 N ND1 . HIS C 141 ? 0.8101 0.7842 0.8899 0.2052  -0.1487 -0.0435 218 HIS C ND1 
2848 C CD2 . HIS C 141 ? 0.8642 0.7952 0.9268 0.2314  -0.1854 -0.0233 218 HIS C CD2 
2849 C CE1 . HIS C 141 ? 0.8171 0.8233 0.9234 0.2198  -0.1595 -0.0523 218 HIS C CE1 
2850 N NE2 . HIS C 141 ? 0.8486 0.8307 0.9454 0.2368  -0.1827 -0.0407 218 HIS C NE2 
2851 N N   . VAL C 142 ? 0.6573 0.4206 0.6146 0.1938  -0.1778 0.0226  219 VAL C N   
2852 C CA  . VAL C 142 ? 0.6334 0.3568 0.5688 0.1822  -0.1740 0.0291  219 VAL C CA  
2853 C C   . VAL C 142 ? 0.6383 0.3477 0.5841 0.1984  -0.1755 0.0113  219 VAL C C   
2854 O O   . VAL C 142 ? 0.6517 0.3537 0.6086 0.2212  -0.1893 0.0061  219 VAL C O   
2855 C CB  . VAL C 142 ? 0.7074 0.3866 0.6148 0.1764  -0.1864 0.0532  219 VAL C CB  
2856 C CG1 . VAL C 142 ? 0.7118 0.3586 0.6002 0.1588  -0.1797 0.0590  219 VAL C CG1 
2857 C CG2 . VAL C 142 ? 0.6916 0.3867 0.5901 0.1659  -0.1876 0.0694  219 VAL C CG2 
2858 N N   . PHE C 143 ? 0.5572 0.2595 0.4975 0.1877  -0.1628 0.0023  220 PHE C N   
2859 C CA  . PHE C 143 ? 0.5666 0.2529 0.5137 0.2018  -0.1628 -0.0163 220 PHE C CA  
2860 C C   . PHE C 143 ? 0.6443 0.2852 0.5673 0.1905  -0.1636 -0.0105 220 PHE C C   
2861 O O   . PHE C 143 ? 0.6327 0.2710 0.5399 0.1685  -0.1559 -0.0006 220 PHE C O   
2862 C CB  . PHE C 143 ? 0.5549 0.2832 0.5223 0.2030  -0.1455 -0.0399 220 PHE C CB  
2863 C CG  . PHE C 143 ? 0.5439 0.3193 0.5400 0.2142  -0.1450 -0.0482 220 PHE C CG  
2864 C CD1 . PHE C 143 ? 0.5985 0.3833 0.6196 0.2407  -0.1545 -0.0631 220 PHE C CD1 
2865 C CD2 . PHE C 143 ? 0.5121 0.3211 0.5111 0.1990  -0.1368 -0.0409 220 PHE C CD2 
2866 C CE1 . PHE C 143 ? 0.5804 0.4108 0.6305 0.2508  -0.1559 -0.0712 220 PHE C CE1 
2867 C CE2 . PHE C 143 ? 0.5215 0.3738 0.5480 0.2081  -0.1373 -0.0493 220 PHE C CE2 
2868 C CZ  . PHE C 143 ? 0.5133 0.3779 0.5661 0.2335  -0.1467 -0.0647 220 PHE C CZ  
2869 N N   . GLY C 144 ? 0.6561 0.2609 0.5773 0.2061  -0.1741 -0.0168 221 GLY C N   
2870 C CA  . GLY C 144 ? 0.6900 0.2477 0.5904 0.1974  -0.1767 -0.0144 221 GLY C CA  
2871 C C   . GLY C 144 ? 0.7543 0.2909 0.6317 0.1733  -0.1778 0.0090  221 GLY C C   
2872 O O   . GLY C 144 ? 0.7474 0.2757 0.6181 0.1719  -0.1866 0.0283  221 GLY C O   
2873 N N   . ASP C 145 ? 0.7242 0.2563 0.5901 0.1539  -0.1681 0.0065  222 ASP C N   
2874 C CA  . ASP C 145 ? 0.7283 0.2426 0.5761 0.1304  -0.1684 0.0256  222 ASP C CA  
2875 C C   . ASP C 145 ? 0.7709 0.3203 0.6189 0.1143  -0.1601 0.0383  222 ASP C C   
2876 O O   . ASP C 145 ? 0.7751 0.3154 0.6111 0.0947  -0.1586 0.0515  222 ASP C O   
2877 C CB  . ASP C 145 ? 0.7777 0.2643 0.6131 0.1184  -0.1666 0.0180  222 ASP C CB  
2878 C CG  . ASP C 145 ? 0.9567 0.4704 0.7933 0.1109  -0.1533 0.0017  222 ASP C CG  
2879 O OD1 . ASP C 145 ? 0.9824 0.4778 0.8065 0.0970  -0.1525 -0.0014 222 ASP C OD1 
2880 O OD2 . ASP C 145 ? 1.0237 0.5764 0.8726 0.1179  -0.1440 -0.0076 222 ASP C OD2 
2881 N N   . GLU C 146 ? 0.7186 0.3079 0.5815 0.1227  -0.1553 0.0344  223 GLU C N   
2882 C CA  . GLU C 146 ? 0.6837 0.3051 0.5476 0.1096  -0.1483 0.0454  223 GLU C CA  
2883 C C   . GLU C 146 ? 0.7675 0.3733 0.6213 0.1058  -0.1577 0.0671  223 GLU C C   
2884 O O   . GLU C 146 ? 0.7809 0.3597 0.6308 0.1185  -0.1701 0.0724  223 GLU C O   
2885 C CB  . GLU C 146 ? 0.6817 0.3459 0.5654 0.1211  -0.1429 0.0347  223 GLU C CB  
2886 C CG  . GLU C 146 ? 0.8725 0.5640 0.7654 0.1196  -0.1285 0.0156  223 GLU C CG  
2887 C CD  . GLU C 146 ? 1.2063 0.9401 1.1213 0.1296  -0.1227 0.0048  223 GLU C CD  
2888 O OE1 . GLU C 146 ? 0.8636 0.6036 0.7912 0.1451  -0.1325 0.0057  223 GLU C OE1 
2889 O OE2 . GLU C 146 ? 1.2796 1.0404 1.1986 0.1212  -0.1083 -0.0046 223 GLU C OE2 
2890 N N   . LEU C 147 ? 0.7571 0.3798 0.6058 0.0892  -0.1519 0.0794  224 LEU C N   
2891 C CA  . LEU C 147 ? 0.7871 0.4020 0.6252 0.0845  -0.1580 0.0992  224 LEU C CA  
2892 C C   . LEU C 147 ? 0.8194 0.4709 0.6689 0.0938  -0.1578 0.0980  224 LEU C C   
2893 O O   . LEU C 147 ? 0.7882 0.4741 0.6518 0.0932  -0.1483 0.0860  224 LEU C O   
2894 C CB  . LEU C 147 ? 0.7810 0.3977 0.6094 0.0612  -0.1506 0.1113  224 LEU C CB  
2895 C CG  . LEU C 147 ? 0.8504 0.4383 0.6699 0.0472  -0.1500 0.1131  224 LEU C CG  
2896 C CD1 . LEU C 147 ? 0.8402 0.4471 0.6595 0.0269  -0.1406 0.1182  224 LEU C CD1 
2897 C CD2 . LEU C 147 ? 0.8555 0.4006 0.6605 0.0465  -0.1599 0.1260  224 LEU C CD2 
2898 N N   . SER C 148 ? 0.7846 0.4276 0.6261 0.1009  -0.1684 0.1108  225 SER C N   
2899 C CA  . SER C 148 ? 0.7526 0.4279 0.6025 0.1090  -0.1708 0.1107  225 SER C CA  
2900 C C   . SER C 148 ? 0.7384 0.4414 0.5866 0.0909  -0.1594 0.1162  225 SER C C   
2901 O O   . SER C 148 ? 0.6964 0.4357 0.5588 0.0931  -0.1547 0.1078  225 SER C O   
2902 C CB  . SER C 148 ? 0.8518 0.5043 0.6871 0.1200  -0.1866 0.1249  225 SER C CB  
2903 O OG  . SER C 148 ? 1.0467 0.7294 0.8936 0.1337  -0.1930 0.1202  225 SER C OG  
2904 N N   . LEU C 149 ? 0.6892 0.3749 0.5212 0.0730  -0.1551 0.1296  226 LEU C N   
2905 C CA  . LEU C 149 ? 0.6605 0.3689 0.4907 0.0564  -0.1448 0.1349  226 LEU C CA  
2906 C C   . LEU C 149 ? 0.7381 0.4494 0.5731 0.0430  -0.1342 0.1289  226 LEU C C   
2907 O O   . LEU C 149 ? 0.7711 0.4550 0.5992 0.0370  -0.1354 0.1315  226 LEU C O   
2908 C CB  . LEU C 149 ? 0.6745 0.3657 0.4840 0.0467  -0.1476 0.1541  226 LEU C CB  
2909 C CG  . LEU C 149 ? 0.6837 0.4015 0.4910 0.0351  -0.1395 0.1592  226 LEU C CG  
2910 C CD1 . LEU C 149 ? 0.6651 0.4083 0.4771 0.0468  -0.1442 0.1552  226 LEU C CD1 
2911 C CD2 . LEU C 149 ? 0.7159 0.4142 0.5030 0.0215  -0.1382 0.1763  226 LEU C CD2 
2912 N N   . VAL C 150 ? 0.6770 0.4200 0.5232 0.0384  -0.1247 0.1207  227 VAL C N   
2913 C CA  . VAL C 150 ? 0.6589 0.4071 0.5086 0.0273  -0.1157 0.1144  227 VAL C CA  
2914 C C   . VAL C 150 ? 0.6743 0.4453 0.5255 0.0151  -0.1075 0.1181  227 VAL C C   
2915 O O   . VAL C 150 ? 0.6413 0.4344 0.4971 0.0177  -0.1058 0.1177  227 VAL C O   
2916 C CB  . VAL C 150 ? 0.7200 0.4771 0.5802 0.0357  -0.1121 0.0974  227 VAL C CB  
2917 C CG1 . VAL C 150 ? 0.7613 0.4917 0.6197 0.0469  -0.1197 0.0923  227 VAL C CG1 
2918 C CG2 . VAL C 150 ? 0.6994 0.4879 0.5731 0.0439  -0.1086 0.0885  227 VAL C CG2 
2919 N N   . THR C 151 ? 0.6322 0.3977 0.4806 0.0021  -0.1034 0.1208  228 THR C N   
2920 C CA  . THR C 151 ? 0.6016 0.3872 0.4530 -0.0083 -0.0962 0.1231  228 THR C CA  
2921 C C   . THR C 151 ? 0.6132 0.4148 0.4716 -0.0071 -0.0901 0.1115  228 THR C C   
2922 O O   . THR C 151 ? 0.6160 0.4079 0.4728 -0.0082 -0.0898 0.1054  228 THR C O   
2923 C CB  . THR C 151 ? 0.7486 0.5235 0.5964 -0.0216 -0.0956 0.1309  228 THR C CB  
2924 O OG1 . THR C 151 ? 0.8400 0.5974 0.6789 -0.0236 -0.0999 0.1422  228 THR C OG1 
2925 C CG2 . THR C 151 ? 0.7000 0.4964 0.5533 -0.0306 -0.0888 0.1322  228 THR C CG2 
2926 N N   . LEU C 152 ? 0.5381 0.3625 0.4024 -0.0054 -0.0855 0.1084  229 LEU C N   
2927 C CA  . LEU C 152 ? 0.5204 0.3588 0.3895 -0.0066 -0.0783 0.0990  229 LEU C CA  
2928 C C   . LEU C 152 ? 0.5573 0.3974 0.4240 -0.0172 -0.0747 0.1022  229 LEU C C   
2929 O O   . LEU C 152 ? 0.5167 0.3502 0.3794 -0.0201 -0.0732 0.0980  229 LEU C O   
2930 C CB  . LEU C 152 ? 0.5102 0.3710 0.3876 -0.0022 -0.0750 0.0942  229 LEU C CB  
2931 C CG  . LEU C 152 ? 0.5720 0.4374 0.4566 0.0100  -0.0787 0.0873  229 LEU C CG  
2932 C CD1 . LEU C 152 ? 0.5472 0.4367 0.4417 0.0132  -0.0778 0.0836  229 LEU C CD1 
2933 C CD2 . LEU C 152 ? 0.6117 0.4764 0.4994 0.0131  -0.0738 0.0758  229 LEU C CD2 
2934 N N   . PHE C 153 ? 0.5268 0.3754 0.3951 -0.0223 -0.0740 0.1094  230 PHE C N   
2935 C CA  . PHE C 153 ? 0.5138 0.3670 0.3835 -0.0305 -0.0712 0.1118  230 PHE C CA  
2936 C C   . PHE C 153 ? 0.5934 0.4451 0.4636 -0.0362 -0.0730 0.1205  230 PHE C C   
2937 O O   . PHE C 153 ? 0.6130 0.4657 0.4804 -0.0343 -0.0740 0.1255  230 PHE C O   
2938 C CB  . PHE C 153 ? 0.5157 0.3857 0.3896 -0.0311 -0.0654 0.1079  230 PHE C CB  
2939 C CG  . PHE C 153 ? 0.5458 0.4202 0.4202 -0.0266 -0.0619 0.0996  230 PHE C CG  
2940 C CD1 . PHE C 153 ? 0.6216 0.4876 0.4906 -0.0274 -0.0599 0.0946  230 PHE C CD1 
2941 C CD2 . PHE C 153 ? 0.5723 0.4596 0.4522 -0.0218 -0.0608 0.0962  230 PHE C CD2 
2942 C CE1 . PHE C 153 ? 0.6424 0.5136 0.5119 -0.0245 -0.0545 0.0863  230 PHE C CE1 
2943 C CE2 . PHE C 153 ? 0.6290 0.5237 0.5131 -0.0185 -0.0568 0.0871  230 PHE C CE2 
2944 C CZ  . PHE C 153 ? 0.6314 0.5183 0.5105 -0.0203 -0.0526 0.0822  230 PHE C CZ  
2945 N N   . ARG C 154 ? 0.5431 0.3932 0.4166 -0.0434 -0.0734 0.1222  231 ARG C N   
2946 C CA  . ARG C 154 ? 0.5481 0.3997 0.4251 -0.0512 -0.0732 0.1292  231 ARG C CA  
2947 C C   . ARG C 154 ? 0.6048 0.4708 0.4919 -0.0559 -0.0705 0.1272  231 ARG C C   
2948 O O   . ARG C 154 ? 0.6067 0.4713 0.4955 -0.0546 -0.0728 0.1222  231 ARG C O   
2949 C CB  . ARG C 154 ? 0.5941 0.4256 0.4679 -0.0551 -0.0786 0.1322  231 ARG C CB  
2950 C CG  . ARG C 154 ? 0.7131 0.5450 0.5937 -0.0665 -0.0784 0.1371  231 ARG C CG  
2951 C CD  . ARG C 154 ? 0.5464 0.3554 0.4223 -0.0714 -0.0833 0.1406  231 ARG C CD  
2952 N NE  . ARG C 154 ? 0.6547 0.4498 0.5281 -0.0680 -0.0896 0.1332  231 ARG C NE  
2953 C CZ  . ARG C 154 ? 0.8016 0.5899 0.6798 -0.0752 -0.0943 0.1301  231 ARG C CZ  
2954 N NH1 . ARG C 154 ? 0.5665 0.3634 0.4561 -0.0867 -0.0932 0.1335  231 ARG C NH1 
2955 N NH2 . ARG C 154 ? 0.5984 0.3731 0.4706 -0.0713 -0.0999 0.1226  231 ARG C NH2 
2956 N N   . CYS C 155 ? 0.5672 0.4473 0.4598 -0.0601 -0.0656 0.1306  232 CYS C N   
2957 C CA  . CYS C 155 ? 0.5413 0.4382 0.4467 -0.0637 -0.0623 0.1282  232 CYS C CA  
2958 C C   . CYS C 155 ? 0.6110 0.5095 0.5244 -0.0733 -0.0620 0.1323  232 CYS C C   
2959 O O   . CYS C 155 ? 0.6346 0.5256 0.5404 -0.0781 -0.0601 0.1392  232 CYS C O   
2960 C CB  . CYS C 155 ? 0.5265 0.4392 0.4323 -0.0622 -0.0554 0.1276  232 CYS C CB  
2961 S SG  A CYS C 155 ? 0.5581 0.4817 0.4708 -0.0562 -0.0536 0.1191  232 CYS C SG  
2962 S SG  B CYS C 155 ? 0.5677 0.4798 0.4634 -0.0539 -0.0547 0.1241  232 CYS C SG  
2963 N N   . ILE C 156 ? 0.5231 0.4345 0.4523 -0.0764 -0.0624 0.1284  233 ILE C N   
2964 C CA  . ILE C 156 ? 0.5083 0.4294 0.4507 -0.0869 -0.0598 0.1304  233 ILE C CA  
2965 C C   . ILE C 156 ? 0.5632 0.5085 0.5250 -0.0854 -0.0571 0.1237  233 ILE C C   
2966 O O   . ILE C 156 ? 0.5431 0.4895 0.5093 -0.0776 -0.0630 0.1179  233 ILE C O   
2967 C CB  . ILE C 156 ? 0.5497 0.4574 0.4955 -0.0944 -0.0668 0.1315  233 ILE C CB  
2968 C CG1 . ILE C 156 ? 0.5669 0.4472 0.4933 -0.0928 -0.0708 0.1362  233 ILE C CG1 
2969 C CG2 . ILE C 156 ? 0.5444 0.4646 0.5051 -0.1082 -0.0613 0.1340  233 ILE C CG2 
2970 C CD1 . ILE C 156 ? 0.5967 0.4591 0.5233 -0.0997 -0.0779 0.1362  233 ILE C CD1 
2971 N N   . GLN C 157 ? 0.5211 0.4847 0.4928 -0.0925 -0.0479 0.1245  234 GLN C N   
2972 C CA  . GLN C 157 ? 0.5036 0.4931 0.4972 -0.0917 -0.0439 0.1170  234 GLN C CA  
2973 C C   . GLN C 157 ? 0.5921 0.5969 0.6025 -0.1052 -0.0379 0.1179  234 GLN C C   
2974 O O   . GLN C 157 ? 0.6160 0.6171 0.6154 -0.1150 -0.0295 0.1254  234 GLN C O   
2975 C CB  . GLN C 157 ? 0.5057 0.5069 0.4943 -0.0866 -0.0347 0.1146  234 GLN C CB  
2976 C CG  . GLN C 157 ? 0.4235 0.4176 0.4049 -0.0739 -0.0392 0.1100  234 GLN C CG  
2977 C CD  . GLN C 157 ? 0.5073 0.5042 0.5037 -0.0665 -0.0475 0.1031  234 GLN C CD  
2978 O OE1 . GLN C 157 ? 0.5126 0.4937 0.5039 -0.0641 -0.0574 0.1043  234 GLN C OE1 
2979 N NE2 . GLN C 157 ? 0.3185 0.3343 0.3318 -0.0619 -0.0441 0.0953  234 GLN C NE2 
2980 N N   . ASN C 158 ? 0.5330 0.5558 0.5700 -0.1062 -0.0422 0.1103  235 ASN C N   
2981 C CA  . ASN C 158 ? 0.5279 0.5722 0.5866 -0.1201 -0.0346 0.1088  235 ASN C CA  
2982 C C   . ASN C 158 ? 0.5581 0.6270 0.6235 -0.1196 -0.0202 0.1050  235 ASN C C   
2983 O O   . ASN C 158 ? 0.5539 0.6267 0.6169 -0.1066 -0.0205 0.0998  235 ASN C O   
2984 C CB  . ASN C 158 ? 0.5261 0.5868 0.6150 -0.1200 -0.0447 0.0997  235 ASN C CB  
2985 C CG  . ASN C 158 ? 0.6916 0.7318 0.7761 -0.1247 -0.0574 0.1022  235 ASN C CG  
2986 O OD1 . ASN C 158 ? 0.5229 0.5566 0.6093 -0.1153 -0.0717 0.0975  235 ASN C OD1 
2987 N ND2 . ASN C 158 ? 0.5458 0.5735 0.6227 -0.1398 -0.0529 0.1094  235 ASN C ND2 
2988 N N   . MET C 159 ? 0.5030 0.5867 0.5744 -0.1343 -0.0068 0.1074  236 MET C N   
2989 C CA  . MET C 159 ? 0.4737 0.5819 0.5494 -0.1354 0.0090  0.1030  236 MET C CA  
2990 C C   . MET C 159 ? 0.4959 0.6408 0.6082 -0.1450 0.0177  0.0936  236 MET C C   
2991 O O   . MET C 159 ? 0.5159 0.6626 0.6410 -0.1587 0.0167  0.0960  236 MET C O   
2992 C CB  . MET C 159 ? 0.5137 0.6074 0.5575 -0.1451 0.0205  0.1149  236 MET C CB  
2993 C CG  . MET C 159 ? 0.5460 0.6048 0.5561 -0.1371 0.0113  0.1244  236 MET C CG  
2994 S SD  . MET C 159 ? 0.5518 0.6087 0.5528 -0.1171 0.0059  0.1173  236 MET C SD  
2995 C CE  . MET C 159 ? 0.5095 0.5910 0.5070 -0.1197 0.0235  0.1126  236 MET C CE  
2996 N N   . PRO C 160 ? 0.4224 0.5975 0.5531 -0.1385 0.0267  0.0820  237 PRO C N   
2997 C CA  . PRO C 160 ? 0.4288 0.6429 0.5964 -0.1479 0.0373  0.0718  237 PRO C CA  
2998 C C   . PRO C 160 ? 0.5546 0.7789 0.7108 -0.1679 0.0597  0.0779  237 PRO C C   
2999 O O   . PRO C 160 ? 0.5360 0.7409 0.6554 -0.1697 0.0671  0.0876  237 PRO C O   
3000 C CB  . PRO C 160 ? 0.4252 0.6631 0.6135 -0.1301 0.0371  0.0565  237 PRO C CB  
3001 C CG  . PRO C 160 ? 0.4723 0.6874 0.6258 -0.1197 0.0381  0.0609  237 PRO C CG  
3002 C CD  . PRO C 160 ? 0.4291 0.6047 0.5476 -0.1236 0.0295  0.0768  237 PRO C CD  
3003 N N   . GLU C 161 ? 0.5564 0.8118 0.7438 -0.1833 0.0705  0.0719  238 GLU C N   
3004 C CA  . GLU C 161 ? 0.5874 0.8535 0.7645 -0.2041 0.0933  0.0774  238 GLU C CA  
3005 C C   . GLU C 161 ? 0.6553 0.9421 0.8256 -0.1968 0.1090  0.0693  238 GLU C C   
3006 O O   . GLU C 161 ? 0.6850 0.9642 0.8234 -0.2078 0.1248  0.0781  238 GLU C O   
3007 C CB  . GLU C 161 ? 0.6114 0.9104 0.8288 -0.2230 0.1021  0.0706  238 GLU C CB  
3008 N N   . THR C 162 ? 0.5777 0.8868 0.7745 -0.1774 0.1033  0.0528  239 THR C N   
3009 C CA  . THR C 162 ? 0.5656 0.8964 0.7617 -0.1682 0.1169  0.0411  239 THR C CA  
3010 C C   . THR C 162 ? 0.5813 0.8868 0.7517 -0.1473 0.1053  0.0410  239 THR C C   
3011 O O   . THR C 162 ? 0.5723 0.8643 0.7521 -0.1314 0.0857  0.0384  239 THR C O   
3012 C CB  . THR C 162 ? 0.5371 0.9192 0.7856 -0.1657 0.1258  0.0201  239 THR C CB  
3013 O OG1 . THR C 162 ? 0.4602 0.8562 0.7087 -0.1496 0.1324  0.0065  239 THR C OG1 
3014 C CG2 . THR C 162 ? 0.4533 0.8451 0.7431 -0.1558 0.1055  0.0120  239 THR C CG2 
3015 N N   . LEU C 163 ? 0.5040 0.8049 0.6423 -0.1484 0.1183  0.0429  240 LEU C N   
3016 C CA  . LEU C 163 ? 0.4898 0.7693 0.6007 -0.1323 0.1111  0.0421  240 LEU C CA  
3017 C C   . LEU C 163 ? 0.5098 0.7495 0.6013 -0.1242 0.0896  0.0540  240 LEU C C   
3018 O O   . LEU C 163 ? 0.4690 0.7011 0.5684 -0.1072 0.0766  0.0470  240 LEU C O   
3019 C CB  . LEU C 163 ? 0.4789 0.7825 0.6169 -0.1145 0.1120  0.0212  240 LEU C CB  
3020 C CG  . LEU C 163 ? 0.5468 0.8894 0.6983 -0.1197 0.1354  0.0067  240 LEU C CG  
3021 C CD1 . LEU C 163 ? 0.5289 0.8971 0.7187 -0.1011 0.1332  -0.0153 240 LEU C CD1 
3022 C CD2 . LEU C 163 ? 0.5947 0.9277 0.7021 -0.1242 0.1485  0.0102  240 LEU C CD2 
3023 N N   . PRO C 164 ? 0.4990 0.7121 0.5660 -0.1359 0.0854  0.0715  241 PRO C N   
3024 C CA  . PRO C 164 ? 0.4967 0.6758 0.5495 -0.1274 0.0659  0.0804  241 PRO C CA  
3025 C C   . PRO C 164 ? 0.5906 0.7515 0.6158 -0.1150 0.0611  0.0805  241 PRO C C   
3026 O O   . PRO C 164 ? 0.6130 0.7704 0.6102 -0.1195 0.0703  0.0847  241 PRO C O   
3027 C CB  . PRO C 164 ? 0.5296 0.6877 0.5639 -0.1434 0.0656  0.0971  241 PRO C CB  
3028 C CG  . PRO C 164 ? 0.5984 0.7684 0.6181 -0.1585 0.0850  0.1011  241 PRO C CG  
3029 C CD  . PRO C 164 ? 0.5405 0.7516 0.5918 -0.1571 0.0982  0.0838  241 PRO C CD  
3030 N N   . ASN C 165 ? 0.5399 0.6909 0.5737 -0.0998 0.0470  0.0747  242 ASN C N   
3031 C CA  . ASN C 165 ? 0.5361 0.6704 0.5498 -0.0881 0.0411  0.0729  242 ASN C CA  
3032 C C   . ASN C 165 ? 0.5804 0.6945 0.5998 -0.0782 0.0240  0.0741  242 ASN C C   
3033 O O   . ASN C 165 ? 0.5722 0.6925 0.6125 -0.0677 0.0184  0.0641  242 ASN C O   
3034 C CB  . ASN C 165 ? 0.5065 0.6605 0.5291 -0.0795 0.0493  0.0572  242 ASN C CB  
3035 C CG  . ASN C 165 ? 0.6874 0.8595 0.6973 -0.0878 0.0669  0.0544  242 ASN C CG  
3036 O OD1 . ASN C 165 ? 0.8010 1.0001 0.8300 -0.0944 0.0796  0.0481  242 ASN C OD1 
3037 N ND2 . ASN C 165 ? 0.5227 0.6821 0.5002 -0.0880 0.0683  0.0583  242 ASN C ND2 
3038 N N   . ASN C 166 ? 0.5173 0.6064 0.5173 -0.0812 0.0156  0.0863  243 ASN C N   
3039 C CA  . ASN C 166 ? 0.4886 0.5571 0.4889 -0.0731 0.0009  0.0880  243 ASN C CA  
3040 C C   . ASN C 166 ? 0.5194 0.5658 0.4926 -0.0710 -0.0034 0.0947  243 ASN C C   
3041 O O   . ASN C 166 ? 0.5290 0.5667 0.4847 -0.0782 -0.0017 0.1043  243 ASN C O   
3042 C CB  . ASN C 166 ? 0.4686 0.5314 0.4802 -0.0786 -0.0067 0.0935  243 ASN C CB  
3043 C CG  . ASN C 166 ? 0.6713 0.7544 0.7146 -0.0771 -0.0085 0.0850  243 ASN C CG  
3044 O OD1 . ASN C 166 ? 0.5437 0.6329 0.6008 -0.0658 -0.0129 0.0756  243 ASN C OD1 
3045 N ND2 . ASN C 166 ? 0.6208 0.7129 0.6766 -0.0884 -0.0067 0.0880  243 ASN C ND2 
3046 N N   . SER C 167 ? 0.4611 0.4985 0.4312 -0.0612 -0.0090 0.0893  244 SER C N   
3047 C CA  . SER C 167 ? 0.4621 0.4818 0.4110 -0.0589 -0.0135 0.0937  244 SER C CA  
3048 C C   . SER C 167 ? 0.5421 0.5436 0.4912 -0.0569 -0.0237 0.0983  244 SER C C   
3049 O O   . SER C 167 ? 0.5465 0.5474 0.5098 -0.0537 -0.0286 0.0950  244 SER C O   
3050 C CB  . SER C 167 ? 0.4856 0.5062 0.4306 -0.0520 -0.0122 0.0847  244 SER C CB  
3051 O OG  . SER C 167 ? 0.5642 0.5802 0.5221 -0.0449 -0.0168 0.0778  244 SER C OG  
3052 N N   . CYS C 168 ? 0.5272 0.5141 0.4606 -0.0584 -0.0275 0.1054  245 CYS C N   
3053 C CA  . CYS C 168 ? 0.5315 0.5013 0.4632 -0.0564 -0.0360 0.1083  245 CYS C CA  
3054 C C   . CYS C 168 ? 0.5950 0.5539 0.5132 -0.0522 -0.0386 0.1082  245 CYS C C   
3055 O O   . CYS C 168 ? 0.6192 0.5779 0.5259 -0.0529 -0.0373 0.1113  245 CYS C O   
3056 C CB  . CYS C 168 ? 0.5504 0.5129 0.4816 -0.0628 -0.0389 0.1159  245 CYS C CB  
3057 S SG  A CYS C 168 ? 0.6007 0.5461 0.5340 -0.0605 -0.0493 0.1160  245 CYS C SG  
3058 S SG  B CYS C 168 ? 0.6006 0.5474 0.5356 -0.0607 -0.0492 0.1156  245 CYS C SG  
3059 N N   . TYR C 169 ? 0.5169 0.4669 0.4363 -0.0480 -0.0423 0.1043  246 TYR C N   
3060 C CA  . TYR C 169 ? 0.4904 0.4320 0.4005 -0.0451 -0.0435 0.1024  246 TYR C CA  
3061 C C   . TYR C 169 ? 0.5339 0.4604 0.4394 -0.0447 -0.0487 0.1053  246 TYR C C   
3062 O O   . TYR C 169 ? 0.5503 0.4704 0.4593 -0.0450 -0.0524 0.1059  246 TYR C O   
3063 C CB  . TYR C 169 ? 0.4875 0.4293 0.4007 -0.0424 -0.0415 0.0950  246 TYR C CB  
3064 C CG  . TYR C 169 ? 0.4859 0.4210 0.3921 -0.0417 -0.0410 0.0919  246 TYR C CG  
3065 C CD1 . TYR C 169 ? 0.5007 0.4215 0.4022 -0.0416 -0.0433 0.0927  246 TYR C CD1 
3066 C CD2 . TYR C 169 ? 0.4898 0.4342 0.3942 -0.0418 -0.0380 0.0872  246 TYR C CD2 
3067 C CE1 . TYR C 169 ? 0.5080 0.4253 0.4048 -0.0427 -0.0409 0.0890  246 TYR C CE1 
3068 C CE2 . TYR C 169 ? 0.5013 0.4430 0.4032 -0.0424 -0.0372 0.0829  246 TYR C CE2 
3069 C CZ  . TYR C 169 ? 0.5636 0.4924 0.4626 -0.0433 -0.0377 0.0838  246 TYR C CZ  
3070 O OH  . TYR C 169 ? 0.4977 0.4261 0.3957 -0.0454 -0.0350 0.0788  246 TYR C OH  
3071 N N   . SER C 170 ? 0.4810 0.4026 0.3787 -0.0434 -0.0495 0.1059  247 SER C N   
3072 C CA  . SER C 170 ? 0.4917 0.4000 0.3840 -0.0422 -0.0527 0.1061  247 SER C CA  
3073 C C   . SER C 170 ? 0.5586 0.4691 0.4475 -0.0396 -0.0505 0.1016  247 SER C C   
3074 O O   . SER C 170 ? 0.5527 0.4736 0.4426 -0.0382 -0.0495 0.1006  247 SER C O   
3075 C CB  . SER C 170 ? 0.5371 0.4373 0.4271 -0.0434 -0.0571 0.1115  247 SER C CB  
3076 O OG  . SER C 170 ? 0.7107 0.5976 0.5960 -0.0428 -0.0604 0.1100  247 SER C OG  
3077 N N   . ALA C 171 ? 0.4984 0.4003 0.3833 -0.0394 -0.0496 0.0984  248 ALA C N   
3078 C CA  . ALA C 171 ? 0.5058 0.4124 0.3908 -0.0380 -0.0462 0.0926  248 ALA C CA  
3079 C C   . ALA C 171 ? 0.5689 0.4642 0.4473 -0.0380 -0.0452 0.0904  248 ALA C C   
3080 O O   . ALA C 171 ? 0.5741 0.4567 0.4453 -0.0398 -0.0470 0.0930  248 ALA C O   
3081 C CB  . ALA C 171 ? 0.5120 0.4258 0.4004 -0.0409 -0.0410 0.0874  248 ALA C CB  
3082 N N   . GLY C 172 ? 0.4957 0.3971 0.3766 -0.0357 -0.0424 0.0848  249 GLY C N   
3083 C CA  . GLY C 172 ? 0.4875 0.3816 0.3625 -0.0357 -0.0391 0.0804  249 GLY C CA  
3084 C C   . GLY C 172 ? 0.5143 0.4227 0.3980 -0.0336 -0.0339 0.0717  249 GLY C C   
3085 O O   . GLY C 172 ? 0.5141 0.4384 0.4087 -0.0326 -0.0339 0.0688  249 GLY C O   
3086 N N   . ILE C 173 ? 0.4475 0.3522 0.3271 -0.0331 -0.0295 0.0663  250 ILE C N   
3087 C CA  . ILE C 173 ? 0.4484 0.3694 0.3393 -0.0310 -0.0235 0.0560  250 ILE C CA  
3088 C C   . ILE C 173 ? 0.5598 0.4790 0.4538 -0.0211 -0.0287 0.0531  250 ILE C C   
3089 O O   . ILE C 173 ? 0.6108 0.5120 0.4930 -0.0197 -0.0324 0.0568  250 ILE C O   
3090 C CB  . ILE C 173 ? 0.4852 0.4056 0.3696 -0.0397 -0.0109 0.0500  250 ILE C CB  
3091 C CG1 . ILE C 173 ? 0.4737 0.3888 0.3523 -0.0493 -0.0073 0.0546  250 ILE C CG1 
3092 C CG2 . ILE C 173 ? 0.4868 0.4305 0.3885 -0.0384 -0.0031 0.0373  250 ILE C CG2 
3093 C CD1 . ILE C 173 ? 0.4707 0.3752 0.3352 -0.0591 0.0034  0.0533  250 ILE C CD1 
3094 N N   . ALA C 174 ? 0.5028 0.4398 0.4131 -0.0138 -0.0302 0.0461  251 ALA C N   
3095 C CA  . ALA C 174 ? 0.5071 0.4416 0.4220 -0.0023 -0.0361 0.0423  251 ALA C CA  
3096 C C   . ALA C 174 ? 0.5794 0.5394 0.5148 0.0036  -0.0326 0.0294  251 ALA C C   
3097 O O   . ALA C 174 ? 0.6134 0.5927 0.5609 0.0011  -0.0320 0.0270  251 ALA C O   
3098 C CB  . ALA C 174 ? 0.5157 0.4405 0.4285 0.0042  -0.0490 0.0522  251 ALA C CB  
3099 N N   . LYS C 175 ? 0.5022 0.4637 0.4426 0.0108  -0.0297 0.0195  252 LYS C N   
3100 C CA  . LYS C 175 ? 0.4813 0.4693 0.4453 0.0188  -0.0270 0.0051  252 LYS C CA  
3101 C C   . LYS C 175 ? 0.5313 0.5189 0.5043 0.0344  -0.0435 0.0081  252 LYS C C   
3102 O O   . LYS C 175 ? 0.5650 0.5288 0.5268 0.0417  -0.0522 0.0144  252 LYS C O   
3103 C CB  . LYS C 175 ? 0.5159 0.5043 0.4797 0.0205  -0.0163 -0.0072 252 LYS C CB  
3104 C CG  . LYS C 175 ? 0.6962 0.7080 0.6857 0.0343  -0.0168 -0.0229 252 LYS C CG  
3105 C CD  . LYS C 175 ? 0.7191 0.7653 0.7297 0.0273  -0.0029 -0.0367 252 LYS C CD  
3106 C CE  . LYS C 175 ? 0.7109 0.7817 0.7484 0.0414  -0.0015 -0.0549 252 LYS C CE  
3107 N NZ  . LYS C 175 ? 0.9119 0.9761 0.9399 0.0397  0.0125  -0.0646 252 LYS C NZ  
3108 N N   . LEU C 176 ? 0.4566 0.4671 0.4462 0.0377  -0.0487 0.0053  253 LEU C N   
3109 C CA  . LEU C 176 ? 0.4651 0.4738 0.4593 0.0522  -0.0654 0.0097  253 LEU C CA  
3110 C C   . LEU C 176 ? 0.5300 0.5680 0.5523 0.0652  -0.0692 -0.0056 253 LEU C C   
3111 O O   . LEU C 176 ? 0.4984 0.5665 0.5400 0.0592  -0.0598 -0.0178 253 LEU C O   
3112 C CB  . LEU C 176 ? 0.4572 0.4632 0.4414 0.0472  -0.0733 0.0224  253 LEU C CB  
3113 C CG  . LEU C 176 ? 0.4900 0.4724 0.4507 0.0346  -0.0700 0.0366  253 LEU C CG  
3114 C CD1 . LEU C 176 ? 0.4762 0.4667 0.4335 0.0289  -0.0735 0.0431  253 LEU C CD1 
3115 C CD2 . LEU C 176 ? 0.5075 0.4592 0.4516 0.0394  -0.0776 0.0475  253 LEU C CD2 
3116 N N   . GLU C 177 ? 0.5136 0.5419 0.5389 0.0832  -0.0832 -0.0052 254 GLU C N   
3117 C CA  . GLU C 177 ? 0.5053 0.5587 0.5584 0.1002  -0.0905 -0.0198 254 GLU C CA  
3118 C C   . GLU C 177 ? 0.5579 0.6231 0.6167 0.1087  -0.1075 -0.0152 254 GLU C C   
3119 O O   . GLU C 177 ? 0.5629 0.6043 0.5986 0.1079  -0.1177 0.0016  254 GLU C O   
3120 C CB  . GLU C 177 ? 0.5348 0.5664 0.5861 0.1167  -0.0974 -0.0222 254 GLU C CB  
3121 C CG  . GLU C 177 ? 0.6596 0.6992 0.7218 0.1168  -0.0825 -0.0384 254 GLU C CG  
3122 C CD  . GLU C 177 ? 1.1315 1.1817 1.2176 0.1399  -0.0914 -0.0531 254 GLU C CD  
3123 O OE1 . GLU C 177 ? 0.9550 1.0434 1.0720 0.1476  -0.0930 -0.0670 254 GLU C OE1 
3124 O OE2 . GLU C 177 ? 1.1658 1.1848 1.2404 0.1512  -0.0987 -0.0504 254 GLU C OE2 
3125 N N   . GLU C 178 ? 0.5026 0.6056 0.5924 0.1171  -0.1109 -0.0309 255 GLU C N   
3126 C CA  . GLU C 178 ? 0.4986 0.6176 0.5966 0.1273  -0.1291 -0.0299 255 GLU C CA  
3127 C C   . GLU C 178 ? 0.5590 0.6455 0.6388 0.1453  -0.1490 -0.0168 255 GLU C C   
3128 O O   . GLU C 178 ? 0.5781 0.6545 0.6655 0.1608  -0.1536 -0.0223 255 GLU C O   
3129 C CB  . GLU C 178 ? 0.5050 0.6709 0.6447 0.1362  -0.1299 -0.0524 255 GLU C CB  
3130 C CG  . GLU C 178 ? 0.5352 0.7185 0.6882 0.1541  -0.1533 -0.0548 255 GLU C CG  
3131 C CD  . GLU C 178 ? 0.8633 1.0976 1.0623 0.1620  -0.1535 -0.0792 255 GLU C CD  
3132 O OE1 . GLU C 178 ? 0.9997 1.2610 1.2175 0.1454  -0.1336 -0.0921 255 GLU C OE1 
3133 O OE2 . GLU C 178 ? 0.8749 1.1229 1.0912 0.1839  -0.1740 -0.0853 255 GLU C OE2 
3134 N N   . GLY C 179 ? 0.5012 0.5688 0.5551 0.1419  -0.1592 0.0004  256 GLY C N   
3135 C CA  . GLY C 179 ? 0.5243 0.5567 0.5552 0.1556  -0.1770 0.0158  256 GLY C CA  
3136 C C   . GLY C 179 ? 0.5655 0.5575 0.5612 0.1423  -0.1715 0.0354  256 GLY C C   
3137 O O   . GLY C 179 ? 0.5884 0.5515 0.5592 0.1472  -0.1843 0.0517  256 GLY C O   
3138 N N   . ASP C 180 ? 0.4932 0.4827 0.4863 0.1252  -0.1526 0.0341  257 ASP C N   
3139 C CA  . ASP C 180 ? 0.4931 0.4502 0.4576 0.1110  -0.1464 0.0506  257 ASP C CA  
3140 C C   . ASP C 180 ? 0.5343 0.4933 0.4815 0.1006  -0.1485 0.0626  257 ASP C C   
3141 O O   . ASP C 180 ? 0.4921 0.4802 0.4505 0.0991  -0.1494 0.0556  257 ASP C O   
3142 C CB  . ASP C 180 ? 0.4912 0.4491 0.4579 0.0961  -0.1275 0.0453  257 ASP C CB  
3143 C CG  . ASP C 180 ? 0.6892 0.6402 0.6656 0.1030  -0.1225 0.0345  257 ASP C CG  
3144 O OD1 . ASP C 180 ? 0.7542 0.6897 0.7321 0.1194  -0.1342 0.0338  257 ASP C OD1 
3145 O OD2 . ASP C 180 ? 0.7085 0.6678 0.6894 0.0923  -0.1073 0.0266  257 ASP C OD2 
3146 N N   . GLU C 181 ? 0.5225 0.4505 0.4429 0.0933  -0.1491 0.0796  258 GLU C N   
3147 C CA  . GLU C 181 ? 0.5278 0.4550 0.4293 0.0828  -0.1491 0.0912  258 GLU C CA  
3148 C C   . GLU C 181 ? 0.6071 0.5200 0.4968 0.0655  -0.1354 0.0986  258 GLU C C   
3149 O O   . GLU C 181 ? 0.6195 0.5100 0.5050 0.0637  -0.1323 0.1018  258 GLU C O   
3150 C CB  . GLU C 181 ? 0.5716 0.4768 0.4502 0.0916  -0.1648 0.1057  258 GLU C CB  
3151 C CG  . GLU C 181 ? 0.7123 0.6367 0.6002 0.1078  -0.1804 0.0991  258 GLU C CG  
3152 C CD  . GLU C 181 ? 0.9895 0.8867 0.8543 0.1209  -0.1989 0.1131  258 GLU C CD  
3153 O OE1 . GLU C 181 ? 0.9773 0.8424 0.8134 0.1128  -0.1978 0.1305  258 GLU C OE1 
3154 O OE2 . GLU C 181 ? 0.8673 0.7749 0.7428 0.1392  -0.2148 0.1067  258 GLU C OE2 
3155 N N   . LEU C 182 ? 0.5606 0.4874 0.4466 0.0533  -0.1278 0.0996  259 LEU C N   
3156 C CA  . LEU C 182 ? 0.5651 0.4821 0.4422 0.0382  -0.1162 0.1058  259 LEU C CA  
3157 C C   . LEU C 182 ? 0.6625 0.5689 0.5176 0.0320  -0.1182 0.1197  259 LEU C C   
3158 O O   . LEU C 182 ? 0.6674 0.5850 0.5158 0.0353  -0.1244 0.1208  259 LEU C O   
3159 C CB  . LEU C 182 ? 0.5371 0.4766 0.4280 0.0287  -0.1043 0.0952  259 LEU C CB  
3160 C CG  . LEU C 182 ? 0.5776 0.5284 0.4876 0.0308  -0.0985 0.0818  259 LEU C CG  
3161 C CD1 . LEU C 182 ? 0.5582 0.5274 0.4771 0.0202  -0.0875 0.0738  259 LEU C CD1 
3162 C CD2 . LEU C 182 ? 0.6429 0.5721 0.5493 0.0303  -0.0953 0.0840  259 LEU C CD2 
3163 N N   . GLN C 183 ? 0.6297 0.5162 0.4736 0.0223  -0.1126 0.1295  260 GLN C N   
3164 C CA  . GLN C 183 ? 0.6494 0.5272 0.4734 0.0138  -0.1111 0.1422  260 GLN C CA  
3165 C C   . GLN C 183 ? 0.6851 0.5595 0.5102 -0.0003 -0.0993 0.1450  260 GLN C C   
3166 O O   . GLN C 183 ? 0.6931 0.5596 0.5276 -0.0026 -0.0961 0.1418  260 GLN C O   
3167 C CB  . GLN C 183 ? 0.7047 0.5552 0.5087 0.0190  -0.1213 0.1557  260 GLN C CB  
3168 C CG  . GLN C 183 ? 0.9368 0.7596 0.7407 0.0182  -0.1219 0.1602  260 GLN C CG  
3169 C CD  . GLN C 183 ? 1.0270 0.8183 0.8080 0.0202  -0.1306 0.1754  260 GLN C CD  
3170 O OE1 . GLN C 183 ? 0.8428 0.6304 0.6100 0.0293  -0.1408 0.1808  260 GLN C OE1 
3171 N NE2 . GLN C 183 ? 1.0065 0.7731 0.7824 0.0115  -0.1273 0.1825  260 GLN C NE2 
3172 N N   . LEU C 184 ? 0.5862 0.4675 0.4017 -0.0093 -0.0934 0.1500  261 LEU C N   
3173 C CA  . LEU C 184 ? 0.5376 0.4194 0.3558 -0.0219 -0.0830 0.1522  261 LEU C CA  
3174 C C   . LEU C 184 ? 0.6395 0.5024 0.4394 -0.0290 -0.0828 0.1665  261 LEU C C   
3175 O O   . LEU C 184 ? 0.6941 0.5570 0.4762 -0.0294 -0.0842 0.1733  261 LEU C O   
3176 C CB  . LEU C 184 ? 0.5024 0.4078 0.3255 -0.0263 -0.0755 0.1452  261 LEU C CB  
3177 C CG  . LEU C 184 ? 0.5333 0.4446 0.3660 -0.0361 -0.0656 0.1433  261 LEU C CG  
3178 C CD1 . LEU C 184 ? 0.5090 0.4393 0.3540 -0.0354 -0.0609 0.1316  261 LEU C CD1 
3179 C CD2 . LEU C 184 ? 0.5521 0.4625 0.3735 -0.0453 -0.0596 0.1519  261 LEU C CD2 
3180 N N   . ALA C 185 ? 0.5946 0.4400 0.3971 -0.0350 -0.0815 0.1712  262 ALA C N   
3181 C CA  . ALA C 185 ? 0.6122 0.4368 0.3991 -0.0441 -0.0804 0.1846  262 ALA C CA  
3182 C C   . ALA C 185 ? 0.6734 0.5044 0.4705 -0.0587 -0.0699 0.1848  262 ALA C C   
3183 O O   . ALA C 185 ? 0.6744 0.5105 0.4896 -0.0597 -0.0686 0.1767  262 ALA C O   
3184 C CB  . ALA C 185 ? 0.6429 0.4378 0.4248 -0.0385 -0.0899 0.1894  262 ALA C CB  
3185 N N   . ILE C 186 ? 0.6420 0.4733 0.4272 -0.0701 -0.0625 0.1937  263 ILE C N   
3186 C CA  . ILE C 186 ? 0.6497 0.4896 0.4470 -0.0845 -0.0523 0.1936  263 ILE C CA  
3187 C C   . ILE C 186 ? 0.7841 0.5962 0.5731 -0.0947 -0.0534 0.2047  263 ILE C C   
3188 O O   . ILE C 186 ? 0.8356 0.6314 0.6014 -0.0998 -0.0524 0.2173  263 ILE C O   
3189 C CB  . ILE C 186 ? 0.6851 0.5488 0.4799 -0.0919 -0.0406 0.1929  263 ILE C CB  
3190 C CG1 . ILE C 186 ? 0.6553 0.5436 0.4604 -0.0820 -0.0402 0.1801  263 ILE C CG1 
3191 C CG2 . ILE C 186 ? 0.7015 0.5757 0.5130 -0.1067 -0.0302 0.1920  263 ILE C CG2 
3192 C CD1 . ILE C 186 ? 0.7137 0.6188 0.5070 -0.0839 -0.0329 0.1794  263 ILE C CD1 
3193 N N   . PRO C 187 ? 0.7255 0.5290 0.5306 -0.0981 -0.0562 0.2006  264 PRO C N   
3194 C CA  . PRO C 187 ? 0.7474 0.5217 0.5448 -0.1084 -0.0580 0.2102  264 PRO C CA  
3195 C C   . PRO C 187 ? 0.7991 0.5799 0.5983 -0.1283 -0.0460 0.2164  264 PRO C C   
3196 O O   . PRO C 187 ? 0.8103 0.5887 0.6249 -0.1396 -0.0442 0.2143  264 PRO C O   
3197 C CB  . PRO C 187 ? 0.7604 0.5262 0.5743 -0.1044 -0.0655 0.2011  264 PRO C CB  
3198 C CG  . PRO C 187 ? 0.7828 0.5742 0.6117 -0.0932 -0.0662 0.1879  264 PRO C CG  
3199 C CD  . PRO C 187 ? 0.7102 0.5276 0.5382 -0.0929 -0.0584 0.1874  264 PRO C CD  
3200 N N   . ARG C 188 ? 0.7492 0.5404 0.5333 -0.1329 -0.0373 0.2230  265 ARG C N   
3201 C CA  . ARG C 188 ? 0.7647 0.5657 0.5481 -0.1523 -0.0229 0.2288  265 ARG C CA  
3202 C C   . ARG C 188 ? 0.8623 0.6504 0.6106 -0.1548 -0.0189 0.2427  265 ARG C C   
3203 O O   . ARG C 188 ? 0.8564 0.6515 0.5917 -0.1414 -0.0231 0.2411  265 ARG C O   
3204 C CB  . ARG C 188 ? 0.7043 0.5474 0.5137 -0.1547 -0.0126 0.2159  265 ARG C CB  
3205 C CG  . ARG C 188 ? 0.7274 0.5851 0.5685 -0.1486 -0.0185 0.2017  265 ARG C CG  
3206 C CD  . ARG C 188 ? 0.7083 0.5771 0.5721 -0.1649 -0.0119 0.1990  265 ARG C CD  
3207 N NE  . ARG C 188 ? 0.7030 0.5824 0.5945 -0.1607 -0.0193 0.1868  265 ARG C NE  
3208 C CZ  . ARG C 188 ? 0.8567 0.7141 0.7509 -0.1603 -0.0299 0.1862  265 ARG C CZ  
3209 N NH1 . ARG C 188 ? 0.6110 0.4333 0.4832 -0.1605 -0.0355 0.1960  265 ARG C NH1 
3210 N NH2 . ARG C 188 ? 0.8087 0.6777 0.7262 -0.1582 -0.0361 0.1751  265 ARG C NH2 
3211 N N   . GLU C 189 ? 0.8469 0.6145 0.5780 -0.1723 -0.0117 0.2565  266 GLU C N   
3212 C CA  . GLU C 189 ? 0.8753 0.6267 0.5675 -0.1765 -0.0076 0.2717  266 GLU C CA  
3213 C C   . GLU C 189 ? 0.9221 0.7108 0.6149 -0.1823 0.0080  0.2663  266 GLU C C   
3214 O O   . GLU C 189 ? 0.9244 0.7417 0.6448 -0.1938 0.0206  0.2572  266 GLU C O   
3215 C CB  . GLU C 189 ? 0.9394 0.6561 0.6124 -0.1963 -0.0025 0.2885  266 GLU C CB  
3216 N N   . ASN C 190 ? 0.8688 0.6589 0.5330 -0.1733 0.0064  0.2702  267 ASN C N   
3217 C CA  . ASN C 190 ? 0.8513 0.6745 0.5111 -0.1776 0.0209  0.2643  267 ASN C CA  
3218 C C   . ASN C 190 ? 0.8300 0.6954 0.5323 -0.1748 0.0277  0.2438  267 ASN C C   
3219 O O   . ASN C 190 ? 0.8223 0.7130 0.5404 -0.1883 0.0440  0.2384  267 ASN C O   
3220 C CB  . ASN C 190 ? 0.9145 0.7300 0.5487 -0.2002 0.0382  0.2780  267 ASN C CB  
3221 C CG  . ASN C 190 ? 1.3963 1.2468 1.0262 -0.2070 0.0561  0.2709  267 ASN C CG  
3222 O OD1 . ASN C 190 ? 1.4376 1.3034 1.0577 -0.1935 0.0527  0.2634  267 ASN C OD1 
3223 N ND2 . ASN C 190 ? 1.2729 1.1400 0.9148 -0.2280 0.0760  0.2705  267 ASN C ND2 
3224 N N   . ALA C 191 ? 0.7526 0.6235 0.4748 -0.1576 0.0146  0.2328  268 ALA C N   
3225 C CA  . ALA C 191 ? 0.7083 0.6118 0.4675 -0.1522 0.0173  0.2148  268 ALA C CA  
3226 C C   . ALA C 191 ? 0.7629 0.6970 0.5205 -0.1506 0.0283  0.2054  268 ALA C C   
3227 O O   . ALA C 191 ? 0.7929 0.7227 0.5219 -0.1450 0.0263  0.2089  268 ALA C O   
3228 C CB  . ALA C 191 ? 0.6840 0.5811 0.4560 -0.1346 0.0012  0.2074  268 ALA C CB  
3229 N N   . GLN C 192 ? 0.6809 0.6456 0.4686 -0.1558 0.0395  0.1930  269 GLN C N   
3230 C CA  . GLN C 192 ? 0.6628 0.6581 0.4543 -0.1538 0.0508  0.1811  269 GLN C CA  
3231 C C   . GLN C 192 ? 0.6834 0.6907 0.4953 -0.1371 0.0417  0.1665  269 GLN C C   
3232 O O   . GLN C 192 ? 0.6610 0.6780 0.5047 -0.1341 0.0389  0.1579  269 GLN C O   
3233 C CB  . GLN C 192 ? 0.6797 0.7016 0.4933 -0.1684 0.0685  0.1754  269 GLN C CB  
3234 C CG  . GLN C 192 ? 0.7731 0.7827 0.5672 -0.1889 0.0801  0.1906  269 GLN C CG  
3235 C CD  . GLN C 192 ? 0.8782 0.8744 0.6262 -0.1919 0.0849  0.2016  269 GLN C CD  
3236 O OE1 . GLN C 192 ? 0.8704 0.8885 0.6091 -0.1929 0.0972  0.1944  269 GLN C OE1 
3237 N NE2 . GLN C 192 ? 0.7455 0.7045 0.4628 -0.1919 0.0741  0.2183  269 GLN C NE2 
3238 N N   . ILE C 193 ? 0.6604 0.6638 0.4526 -0.1263 0.0354  0.1645  270 ILE C N   
3239 C CA  . ILE C 193 ? 0.6276 0.6382 0.4354 -0.1113 0.0263  0.1516  270 ILE C CA  
3240 C C   . ILE C 193 ? 0.6559 0.6830 0.4523 -0.1061 0.0312  0.1415  270 ILE C C   
3241 O O   . ILE C 193 ? 0.6487 0.6773 0.4185 -0.1121 0.0385  0.1464  270 ILE C O   
3242 C CB  . ILE C 193 ? 0.6598 0.6457 0.4606 -0.1018 0.0093  0.1576  270 ILE C CB  
3243 C CG1 . ILE C 193 ? 0.6952 0.6651 0.4599 -0.0995 0.0034  0.1679  270 ILE C CG1 
3244 C CG2 . ILE C 193 ? 0.6392 0.6089 0.4532 -0.1061 0.0043  0.1646  270 ILE C CG2 
3245 C CD1 . ILE C 193 ? 0.7477 0.7058 0.5092 -0.0870 -0.0114 0.1671  270 ILE C CD1 
3246 N N   . SER C 194 ? 0.6093 0.6466 0.4234 -0.0955 0.0270  0.1274  271 SER C N   
3247 C CA  . SER C 194 ? 0.6064 0.6566 0.4106 -0.0901 0.0299  0.1160  271 SER C CA  
3248 C C   . SER C 194 ? 0.6942 0.7301 0.4799 -0.0818 0.0159  0.1186  271 SER C C   
3249 O O   . SER C 194 ? 0.7116 0.7354 0.5082 -0.0758 0.0048  0.1203  271 SER C O   
3250 C CB  . SER C 194 ? 0.5925 0.6586 0.4257 -0.0835 0.0325  0.0993  271 SER C CB  
3251 O OG  . SER C 194 ? 0.6744 0.7490 0.4985 -0.0778 0.0334  0.0872  271 SER C OG  
3252 N N   . LEU C 195 ? 0.6447 0.6833 0.4027 -0.0816 0.0165  0.1183  272 LEU C N   
3253 C CA  . LEU C 195 ? 0.6371 0.6661 0.3789 -0.0735 0.0023  0.1194  272 LEU C CA  
3254 C C   . LEU C 195 ? 0.7054 0.7482 0.4540 -0.0667 0.0003  0.1018  272 LEU C C   
3255 O O   . LEU C 195 ? 0.7309 0.7736 0.4613 -0.0623 -0.0081 0.0995  272 LEU C O   
3256 C CB  . LEU C 195 ? 0.6719 0.6894 0.3753 -0.0768 -0.0008 0.1332  272 LEU C CB  
3257 C CG  . LEU C 195 ? 0.7250 0.7204 0.4187 -0.0825 -0.0027 0.1522  272 LEU C CG  
3258 C CD1 . LEU C 195 ? 0.7399 0.7212 0.3924 -0.0847 -0.0065 0.1656  272 LEU C CD1 
3259 C CD2 . LEU C 195 ? 0.7285 0.7090 0.4404 -0.0747 -0.0163 0.1552  272 LEU C CD2 
3260 N N   . ASP C 196 ? 0.6539 0.7073 0.4296 -0.0656 0.0069  0.0893  273 ASP C N   
3261 C CA  . ASP C 196 ? 0.6571 0.7194 0.4420 -0.0599 0.0053  0.0723  273 ASP C CA  
3262 C C   . ASP C 196 ? 0.6908 0.7432 0.4916 -0.0539 -0.0067 0.0706  273 ASP C C   
3263 O O   . ASP C 196 ? 0.6549 0.6989 0.4733 -0.0534 -0.0082 0.0757  273 ASP C O   
3264 C CB  . ASP C 196 ? 0.6809 0.7561 0.4858 -0.0605 0.0173  0.0598  273 ASP C CB  
3265 C CG  . ASP C 196 ? 0.9032 0.9932 0.6955 -0.0665 0.0317  0.0576  273 ASP C CG  
3266 O OD1 . ASP C 196 ? 0.9199 1.0116 0.6815 -0.0694 0.0325  0.0604  273 ASP C OD1 
3267 O OD2 . ASP C 196 ? 1.0562 1.1572 0.8690 -0.0680 0.0421  0.0522  273 ASP C OD2 
3268 N N   . GLY C 197 ? 0.6673 0.7219 0.4613 -0.0500 -0.0146 0.0628  274 GLY C N   
3269 C CA  . GLY C 197 ? 0.6469 0.6957 0.4545 -0.0458 -0.0247 0.0596  274 GLY C CA  
3270 C C   . GLY C 197 ? 0.6693 0.7135 0.5028 -0.0451 -0.0220 0.0530  274 GLY C C   
3271 O O   . GLY C 197 ? 0.6480 0.6843 0.4924 -0.0433 -0.0281 0.0550  274 GLY C O   
3272 N N   . ASP C 198 ? 0.6084 0.6567 0.4512 -0.0460 -0.0129 0.0449  275 ASP C N   
3273 C CA  . ASP C 198 ? 0.5784 0.6193 0.4430 -0.0443 -0.0113 0.0391  275 ASP C CA  
3274 C C   . ASP C 198 ? 0.5888 0.6224 0.4646 -0.0446 -0.0101 0.0496  275 ASP C C   
3275 O O   . ASP C 198 ? 0.5656 0.5902 0.4564 -0.0426 -0.0110 0.0478  275 ASP C O   
3276 C CB  . ASP C 198 ? 0.6061 0.6536 0.4764 -0.0430 -0.0039 0.0246  275 ASP C CB  
3277 C CG  . ASP C 198 ? 0.6969 0.7566 0.5652 -0.0439 0.0060  0.0246  275 ASP C CG  
3278 O OD1 . ASP C 198 ? 0.7018 0.7669 0.5555 -0.0477 0.0078  0.0348  275 ASP C OD1 
3279 O OD2 . ASP C 198 ? 0.7641 0.8280 0.6452 -0.0409 0.0123  0.0138  275 ASP C OD2 
3280 N N   . VAL C 199 ? 0.5415 0.5778 0.4085 -0.0475 -0.0083 0.0606  276 VAL C N   
3281 C CA  . VAL C 199 ? 0.5148 0.5471 0.3919 -0.0494 -0.0065 0.0695  276 VAL C CA  
3282 C C   . VAL C 199 ? 0.5723 0.5933 0.4417 -0.0512 -0.0130 0.0833  276 VAL C C   
3283 O O   . VAL C 199 ? 0.5839 0.5967 0.4642 -0.0517 -0.0150 0.0885  276 VAL C O   
3284 C CB  . VAL C 199 ? 0.5593 0.6066 0.4379 -0.0528 0.0043  0.0668  276 VAL C CB  
3285 C CG1 . VAL C 199 ? 0.5677 0.6177 0.4291 -0.0597 0.0081  0.0783  276 VAL C CG1 
3286 C CG2 . VAL C 199 ? 0.5494 0.5998 0.4521 -0.0509 0.0073  0.0628  276 VAL C CG2 
3287 N N   . THR C 200 ? 0.5060 0.5254 0.3563 -0.0513 -0.0173 0.0884  277 THR C N   
3288 C CA  . THR C 200 ? 0.4866 0.4934 0.3276 -0.0512 -0.0244 0.1007  277 THR C CA  
3289 C C   . THR C 200 ? 0.5367 0.5419 0.3731 -0.0454 -0.0336 0.0972  277 THR C C   
3290 O O   . THR C 200 ? 0.5412 0.5541 0.3640 -0.0440 -0.0359 0.0937  277 THR C O   
3291 C CB  . THR C 200 ? 0.5028 0.5082 0.3249 -0.0568 -0.0208 0.1117  277 THR C CB  
3292 O OG1 . THR C 200 ? 0.5458 0.5572 0.3782 -0.0633 -0.0108 0.1125  277 THR C OG1 
3293 C CG2 . THR C 200 ? 0.3818 0.3696 0.1928 -0.0560 -0.0291 0.1249  277 THR C CG2 
3294 N N   . PHE C 201 ? 0.4845 0.4817 0.3330 -0.0424 -0.0386 0.0967  278 PHE C N   
3295 C CA  . PHE C 201 ? 0.4813 0.4804 0.3318 -0.0375 -0.0460 0.0913  278 PHE C CA  
3296 C C   . PHE C 201 ? 0.5229 0.5105 0.3806 -0.0345 -0.0510 0.0959  278 PHE C C   
3297 O O   . PHE C 201 ? 0.5092 0.4864 0.3712 -0.0367 -0.0486 0.1016  278 PHE C O   
3298 C CB  . PHE C 201 ? 0.4882 0.4961 0.3497 -0.0382 -0.0430 0.0774  278 PHE C CB  
3299 C CG  . PHE C 201 ? 0.4951 0.4965 0.3707 -0.0405 -0.0372 0.0743  278 PHE C CG  
3300 C CD1 . PHE C 201 ? 0.5517 0.5564 0.4301 -0.0425 -0.0304 0.0709  278 PHE C CD1 
3301 C CD2 . PHE C 201 ? 0.5148 0.5067 0.3998 -0.0400 -0.0388 0.0748  278 PHE C CD2 
3302 C CE1 . PHE C 201 ? 0.5546 0.5518 0.4455 -0.0427 -0.0274 0.0685  278 PHE C CE1 
3303 C CE2 . PHE C 201 ? 0.5420 0.5251 0.4358 -0.0415 -0.0350 0.0733  278 PHE C CE2 
3304 C CZ  . PHE C 201 ? 0.5208 0.5061 0.4178 -0.0423 -0.0303 0.0704  278 PHE C CZ  
3305 N N   . PHE C 202 ? 0.4778 0.4687 0.3375 -0.0293 -0.0581 0.0922  279 PHE C N   
3306 C CA  . PHE C 202 ? 0.4769 0.4596 0.3431 -0.0249 -0.0629 0.0945  279 PHE C CA  
3307 C C   . PHE C 202 ? 0.5440 0.5394 0.4213 -0.0211 -0.0666 0.0836  279 PHE C C   
3308 O O   . PHE C 202 ? 0.5446 0.5527 0.4186 -0.0185 -0.0718 0.0789  279 PHE C O   
3309 C CB  . PHE C 202 ? 0.5149 0.4867 0.3669 -0.0207 -0.0699 0.1061  279 PHE C CB  
3310 C CG  . PHE C 202 ? 0.5348 0.4956 0.3906 -0.0141 -0.0765 0.1090  279 PHE C CG  
3311 C CD1 . PHE C 202 ? 0.5515 0.5051 0.4189 -0.0152 -0.0729 0.1064  279 PHE C CD1 
3312 C CD2 . PHE C 202 ? 0.5748 0.5298 0.4201 -0.0062 -0.0867 0.1147  279 PHE C CD2 
3313 C CE1 . PHE C 202 ? 0.5604 0.5037 0.4306 -0.0087 -0.0782 0.1074  279 PHE C CE1 
3314 C CE2 . PHE C 202 ? 0.6120 0.5555 0.4619 0.0014  -0.0931 0.1162  279 PHE C CE2 
3315 C CZ  . PHE C 202 ? 0.5746 0.5131 0.4374 0.0000  -0.0881 0.1118  279 PHE C CZ  
3316 N N   . GLY C 203 ? 0.4924 0.4856 0.3827 -0.0219 -0.0634 0.0787  280 GLY C N   
3317 C CA  . GLY C 203 ? 0.4763 0.4834 0.3802 -0.0206 -0.0644 0.0675  280 GLY C CA  
3318 C C   . GLY C 203 ? 0.5382 0.5410 0.4523 -0.0193 -0.0619 0.0650  280 GLY C C   
3319 O O   . GLY C 203 ? 0.5351 0.5217 0.4447 -0.0198 -0.0595 0.0716  280 GLY C O   
3320 N N   . ALA C 204 ? 0.5053 0.5240 0.4336 -0.0182 -0.0622 0.0543  281 ALA C N   
3321 C CA  . ALA C 204 ? 0.5154 0.5351 0.4549 -0.0177 -0.0579 0.0490  281 ALA C CA  
3322 C C   . ALA C 204 ? 0.6020 0.6400 0.5575 -0.0244 -0.0518 0.0357  281 ALA C C   
3323 O O   . ALA C 204 ? 0.6147 0.6691 0.5763 -0.0254 -0.0556 0.0290  281 ALA C O   
3324 C CB  . ALA C 204 ? 0.5309 0.5531 0.4740 -0.0057 -0.0668 0.0499  281 ALA C CB  
3325 N N   . LEU C 205 ? 0.5498 0.5849 0.5113 -0.0297 -0.0422 0.0315  282 LEU C N   
3326 C CA  . LEU C 205 ? 0.5468 0.5962 0.5226 -0.0390 -0.0335 0.0196  282 LEU C CA  
3327 C C   . LEU C 205 ? 0.5904 0.6466 0.5770 -0.0381 -0.0270 0.0133  282 LEU C C   
3328 O O   . LEU C 205 ? 0.6131 0.6510 0.5881 -0.0376 -0.0228 0.0194  282 LEU C O   
3329 C CB  . LEU C 205 ? 0.5576 0.5884 0.5219 -0.0503 -0.0249 0.0235  282 LEU C CB  
3330 C CG  . LEU C 205 ? 0.6331 0.6636 0.6026 -0.0633 -0.0127 0.0163  282 LEU C CG  
3331 C CD1 . LEU C 205 ? 0.6589 0.7132 0.6466 -0.0690 -0.0127 0.0034  282 LEU C CD1 
3332 C CD2 . LEU C 205 ? 0.6466 0.6513 0.5995 -0.0701 -0.0083 0.0238  282 LEU C CD2 
3333 N N   . LYS C 206 ? 0.4999 0.5839 0.5092 -0.0378 -0.0262 -0.0002 283 LYS C N   
3334 C CA  . LYS C 206 ? 0.4797 0.5753 0.5027 -0.0374 -0.0180 -0.0091 283 LYS C CA  
3335 C C   . LYS C 206 ? 0.5529 0.6413 0.5721 -0.0544 -0.0008 -0.0119 283 LYS C C   
3336 O O   . LYS C 206 ? 0.5898 0.6846 0.6148 -0.0661 0.0040  -0.0168 283 LYS C O   
3337 C CB  . LYS C 206 ? 0.4794 0.6110 0.5318 -0.0306 -0.0236 -0.0238 283 LYS C CB  
3338 C CG  . LYS C 206 ? 0.5092 0.6561 0.5787 -0.0287 -0.0142 -0.0348 283 LYS C CG  
3339 C CD  . LYS C 206 ? 0.5463 0.7247 0.6438 -0.0143 -0.0240 -0.0472 283 LYS C CD  
3340 C CE  . LYS C 206 ? 0.7870 0.9789 0.9002 -0.0129 -0.0120 -0.0588 283 LYS C CE  
3341 N NZ  . LYS C 206 ? 1.0152 1.2428 1.1619 0.0017  -0.0208 -0.0741 283 LYS C NZ  
3342 N N   . LEU C 207 ? 0.4793 0.5522 0.4866 -0.0561 0.0081  -0.0088 284 LEU C N   
3343 C CA  . LEU C 207 ? 0.4811 0.5429 0.4789 -0.0719 0.0244  -0.0096 284 LEU C CA  
3344 C C   . LEU C 207 ? 0.5841 0.6745 0.6051 -0.0787 0.0364  -0.0251 284 LEU C C   
3345 O O   . LEU C 207 ? 0.6023 0.7155 0.6425 -0.0677 0.0330  -0.0342 284 LEU C O   
3346 C CB  . LEU C 207 ? 0.4769 0.5100 0.4489 -0.0706 0.0279  0.0002  284 LEU C CB  
3347 C CG  . LEU C 207 ? 0.5022 0.5087 0.4535 -0.0645 0.0168  0.0148  284 LEU C CG  
3348 C CD1 . LEU C 207 ? 0.5157 0.4990 0.4455 -0.0638 0.0197  0.0213  284 LEU C CD1 
3349 C CD2 . LEU C 207 ? 0.4701 0.4645 0.4136 -0.0728 0.0161  0.0206  284 LEU C CD2 
3350 N N   . LEU C 208 ? 0.5622 0.6512 0.5824 -0.0969 0.0507  -0.0287 285 LEU C N   
3351 C CA  . LEU C 208 ? 0.6401 0.7579 0.6835 -0.1066 0.0651  -0.0442 285 LEU C CA  
3352 C C   . LEU C 208 ? 0.6904 0.8046 0.7249 -0.1064 0.0774  -0.0463 285 LEU C C   
3353 O O   . LEU C 208 ? 0.7404 0.8868 0.8008 -0.1036 0.0838  -0.0612 285 LEU C O   
3354 C CB  . LEU C 208 ? 0.6596 0.7761 0.7050 -0.1281 0.0769  -0.0475 285 LEU C CB  
3355 C CG  . LEU C 208 ? 0.7302 0.8692 0.7997 -0.1284 0.0664  -0.0556 285 LEU C CG  
3356 C CD1 . LEU C 208 ? 0.7400 0.8569 0.7967 -0.1442 0.0703  -0.0509 285 LEU C CD1 
3357 C CD2 . LEU C 208 ? 0.7955 0.9810 0.9047 -0.1308 0.0705  -0.0754 285 LEU C CD2 
3358 O OXT . LEU C 208 ? 0.8644 0.9452 0.8671 -0.1065 0.0787  -0.0337 285 LEU C OXT 
3359 N N   . VAL D 65  ? 0.8048 1.2561 1.1547 0.1928  0.0636  0.0174  142 VAL D N   
3360 C CA  . VAL D 65  ? 0.8134 1.2067 1.1157 0.1978  0.0903  0.0217  142 VAL D CA  
3361 C C   . VAL D 65  ? 0.8098 1.1454 1.0564 0.1832  0.0814  0.0164  142 VAL D C   
3362 O O   . VAL D 65  ? 0.7897 1.1301 1.0414 0.1616  0.0630  0.0086  142 VAL D O   
3363 C CB  . VAL D 65  ? 0.8784 1.2773 1.2005 0.1861  0.1200  0.0242  142 VAL D CB  
3364 C CG1 . VAL D 65  ? 0.8945 1.2405 1.1690 0.1987  0.1477  0.0280  142 VAL D CG1 
3365 C CG2 . VAL D 65  ? 0.8805 1.3480 1.2702 0.1953  0.1262  0.0285  142 VAL D CG2 
3366 N N   . THR D 66  ? 0.7411 1.0229 0.9374 0.1952  0.0944  0.0200  143 THR D N   
3367 C CA  . THR D 66  ? 0.7231 0.9526 0.8700 0.1838  0.0875  0.0162  143 THR D CA  
3368 C C   . THR D 66  ? 0.7433 0.9279 0.8599 0.1673  0.1065  0.0151  143 THR D C   
3369 O O   . THR D 66  ? 0.7378 0.9206 0.8579 0.1707  0.1291  0.0181  143 THR D O   
3370 C CB  . THR D 66  ? 0.8166 1.0199 0.9291 0.2065  0.0803  0.0208  143 THR D CB  
3371 O OG1 . THR D 66  ? 0.8584 1.0304 0.9496 0.2237  0.1026  0.0267  143 THR D OG1 
3372 C CG2 . THR D 66  ? 0.7856 1.0324 0.9221 0.2249  0.0598  0.0237  143 THR D CG2 
3373 N N   . GLN D 67  ? 0.6674 0.8168 0.7533 0.1504  0.0965  0.0107  144 GLN D N   
3374 C CA  . GLN D 67  ? 0.6561 0.7613 0.7094 0.1344  0.1082  0.0098  144 GLN D CA  
3375 C C   . GLN D 67  ? 0.7301 0.7878 0.7384 0.1470  0.1134  0.0115  144 GLN D C   
3376 O O   . GLN D 67  ? 0.7284 0.7665 0.7165 0.1464  0.0998  0.0102  144 GLN D O   
3377 C CB  . GLN D 67  ? 0.6441 0.7425 0.6972 0.1095  0.0934  0.0045  144 GLN D CB  
3378 C CG  . GLN D 67  ? 0.7610 0.8847 0.8472 0.0903  0.0982  0.0043  144 GLN D CG  
3379 C CD  . GLN D 67  ? 0.9604 1.0819 1.0544 0.0685  0.0813  -0.0015 144 GLN D CD  
3380 O OE1 . GLN D 67  ? 0.8601 1.0068 0.9756 0.0676  0.0623  -0.0081 144 GLN D OE1 
3381 N NE2 . GLN D 67  ? 0.8878 0.9800 0.9655 0.0509  0.0879  0.0005  144 GLN D NE2 
3382 N N   . ASP D 68  ? 0.6990 0.7377 0.6920 0.1584  0.1341  0.0140  145 ASP D N   
3383 C CA  . ASP D 68  ? 0.7144 0.7050 0.6666 0.1690  0.1402  0.0146  145 ASP D CA  
3384 C C   . ASP D 68  ? 0.7411 0.6931 0.6619 0.1489  0.1343  0.0111  145 ASP D C   
3385 O O   . ASP D 68  ? 0.7531 0.7056 0.6750 0.1295  0.1353  0.0091  145 ASP D O   
3386 C CB  . ASP D 68  ? 0.7692 0.7445 0.7104 0.1825  0.1644  0.0147  145 ASP D CB  
3387 C CG  . ASP D 68  ? 0.9619 0.9699 0.9326 0.2085  0.1726  0.0192  145 ASP D CG  
3388 O OD1 . ASP D 68  ? 0.9900 1.0384 0.9927 0.2152  0.1576  0.0228  145 ASP D OD1 
3389 O OD2 . ASP D 68  ? 1.0328 1.0251 0.9934 0.2234  0.1931  0.0187  145 ASP D OD2 
3390 N N   . CYS D 69  ? 0.6732 0.5939 0.5689 0.1533  0.1278  0.0118  146 CYS D N   
3391 C CA  . CYS D 69  ? 0.6570 0.5436 0.5269 0.1352  0.1213  0.0089  146 CYS D CA  
3392 C C   . CYS D 69  ? 0.6836 0.5308 0.5253 0.1431  0.1227  0.0104  146 CYS D C   
3393 O O   . CYS D 69  ? 0.6608 0.5086 0.5036 0.1621  0.1239  0.0152  146 CYS D O   
3394 C CB  . CYS D 69  ? 0.6326 0.5373 0.5173 0.1202  0.1037  0.0072  146 CYS D CB  
3395 S SG  . CYS D 69  ? 0.6725 0.6157 0.5818 0.1335  0.0886  0.0086  146 CYS D SG  
3396 N N   . LEU D 70  ? 0.6314 0.4444 0.4491 0.1282  0.1226  0.0071  147 LEU D N   
3397 C CA  . LEU D 70  ? 0.6425 0.4167 0.4364 0.1303  0.1235  0.0078  147 LEU D CA  
3398 C C   . LEU D 70  ? 0.6810 0.4422 0.4677 0.1104  0.1120  0.0060  147 LEU D C   
3399 O O   . LEU D 70  ? 0.6670 0.4285 0.4513 0.0949  0.1095  0.0025  147 LEU D O   
3400 C CB  . LEU D 70  ? 0.6715 0.4116 0.4419 0.1346  0.1385  0.0034  147 LEU D CB  
3401 C CG  . LEU D 70  ? 0.7440 0.4411 0.4926 0.1366  0.1408  0.0034  147 LEU D CG  
3402 C CD1 . LEU D 70  ? 0.7703 0.4471 0.5093 0.1557  0.1564  0.0026  147 LEU D CD1 
3403 C CD2 . LEU D 70  ? 0.7756 0.4435 0.5036 0.1157  0.1362  -0.0033 147 LEU D CD2 
3404 N N   . GLN D 71  ? 0.6178 0.3682 0.4014 0.1118  0.1060  0.0096  148 GLN D N   
3405 C CA  . GLN D 71  ? 0.5907 0.3292 0.3708 0.0953  0.0967  0.0086  148 GLN D CA  
3406 C C   . GLN D 71  ? 0.6656 0.3684 0.4296 0.0947  0.1006  0.0105  148 GLN D C   
3407 O O   . GLN D 71  ? 0.6808 0.3742 0.4410 0.1091  0.1071  0.0161  148 GLN D O   
3408 C CB  . GLN D 71  ? 0.5684 0.3337 0.3656 0.0944  0.0857  0.0104  148 GLN D CB  
3409 C CG  . GLN D 71  ? 0.5105 0.2682 0.3091 0.0787  0.0770  0.0090  148 GLN D CG  
3410 C CD  . GLN D 71  ? 0.5766 0.3609 0.3909 0.0799  0.0680  0.0082  148 GLN D CD  
3411 O OE1 . GLN D 71  ? 0.4983 0.3020 0.3264 0.0732  0.0617  0.0041  148 GLN D OE1 
3412 N NE2 . GLN D 71  ? 0.5433 0.3276 0.3544 0.0886  0.0680  0.0120  148 GLN D NE2 
3413 N N   . LEU D 72  ? 0.6137 0.2971 0.3699 0.0776  0.0960  0.0067  149 LEU D N   
3414 C CA  . LEU D 72  ? 0.6275 0.2794 0.3740 0.0709  0.0971  0.0071  149 LEU D CA  
3415 C C   . LEU D 72  ? 0.6591 0.3192 0.4188 0.0583  0.0867  0.0094  149 LEU D C   
3416 O O   . LEU D 72  ? 0.6104 0.2888 0.3796 0.0494  0.0775  0.0073  149 LEU D O   
3417 C CB  . LEU D 72  ? 0.6596 0.2826 0.3863 0.0606  0.0988  -0.0013 149 LEU D CB  
3418 C CG  . LEU D 72  ? 0.7380 0.3489 0.4484 0.0723  0.1112  -0.0062 149 LEU D CG  
3419 C CD1 . LEU D 72  ? 0.7525 0.3402 0.4401 0.0597  0.1102  -0.0163 149 LEU D CD1 
3420 C CD2 . LEU D 72  ? 0.7781 0.3671 0.4840 0.0881  0.1228  -0.0026 149 LEU D CD2 
3421 N N   . ILE D 73  ? 0.6447 0.2909 0.4066 0.0583  0.0897  0.0147  150 ILE D N   
3422 C CA  . ILE D 73  ? 0.6182 0.2718 0.3951 0.0479  0.0833  0.0177  150 ILE D CA  
3423 C C   . ILE D 73  ? 0.7015 0.3262 0.4768 0.0356  0.0849  0.0177  150 ILE D C   
3424 O O   . ILE D 73  ? 0.7304 0.3282 0.4934 0.0399  0.0940  0.0184  150 ILE D O   
3425 C CB  . ILE D 73  ? 0.6263 0.3001 0.4119 0.0598  0.0862  0.0252  150 ILE D CB  
3426 C CG1 . ILE D 73  ? 0.6272 0.2853 0.4021 0.0743  0.0985  0.0340  150 ILE D CG1 
3427 C CG2 . ILE D 73  ? 0.6060 0.3109 0.3975 0.0668  0.0799  0.0219  150 ILE D CG2 
3428 C CD1 . ILE D 73  ? 0.6168 0.2884 0.3947 0.0835  0.1021  0.0430  150 ILE D CD1 
3429 N N   . ALA D 74  ? 0.6390 0.2689 0.4287 0.0202  0.0754  0.0163  151 ALA D N   
3430 C CA  . ALA D 74  ? 0.6603 0.2685 0.4549 0.0054  0.0738  0.0154  151 ALA D CA  
3431 C C   . ALA D 74  ? 0.7548 0.3464 0.5533 0.0094  0.0870  0.0240  151 ALA D C   
3432 O O   . ALA D 74  ? 0.7361 0.3427 0.5424 0.0195  0.0943  0.0333  151 ALA D O   
3433 C CB  . ALA D 74  ? 0.6471 0.2728 0.4637 -0.0084 0.0613  0.0150  151 ALA D CB  
3434 N N   . ASP D 75  ? 0.7582 0.3162 0.5483 0.0016  0.0907  0.0208  152 ASP D N   
3435 C CA  . ASP D 75  ? 0.7863 0.3227 0.5809 0.0031  0.1041  0.0302  152 ASP D CA  
3436 C C   . ASP D 75  ? 0.8454 0.3853 0.6675 -0.0164 0.1002  0.0329  152 ASP D C   
3437 O O   . ASP D 75  ? 0.8725 0.3937 0.6986 -0.0343 0.0926  0.0247  152 ASP D O   
3438 C CB  . ASP D 75  ? 0.8533 0.3482 0.6270 0.0054  0.1117  0.0253  152 ASP D CB  
3439 C CG  . ASP D 75  ? 1.0071 0.4715 0.7855 0.0042  0.1256  0.0352  152 ASP D CG  
3440 O OD1 . ASP D 75  ? 1.0102 0.4886 0.8053 0.0054  0.1326  0.0489  152 ASP D OD1 
3441 O OD2 . ASP D 75  ? 1.0831 0.5081 0.8478 0.0022  0.1307  0.0294  152 ASP D OD2 
3442 N N   . SER D 76  ? 0.7717 0.3369 0.6130 -0.0127 0.1055  0.0437  153 SER D N   
3443 C CA  . SER D 76  ? 0.7618 0.3371 0.6348 -0.0284 0.1050  0.0483  153 SER D CA  
3444 C C   . SER D 76  ? 0.8590 0.4024 0.7415 -0.0419 0.1143  0.0528  153 SER D C   
3445 O O   . SER D 76  ? 0.8744 0.4247 0.7871 -0.0602 0.1104  0.0534  153 SER D O   
3446 C CB  . SER D 76  ? 0.7730 0.3788 0.6592 -0.0177 0.1137  0.0590  153 SER D CB  
3447 O OG  . SER D 76  ? 0.8457 0.4401 0.7195 -0.0041 0.1322  0.0721  153 SER D OG  
3448 N N   . GLU D 77  ? 0.8186 0.3271 0.6785 -0.0335 0.1261  0.0559  154 GLU D N   
3449 C CA  . GLU D 77  ? 0.8355 0.3084 0.7041 -0.0463 0.1363  0.0606  154 GLU D CA  
3450 C C   . GLU D 77  ? 0.8985 0.3386 0.7593 -0.0628 0.1249  0.0436  154 GLU D C   
3451 O O   . GLU D 77  ? 0.9124 0.3165 0.7785 -0.0748 0.1320  0.0443  154 GLU D O   
3452 C CB  . GLU D 77  ? 0.8758 0.3243 0.7259 -0.0281 0.1565  0.0754  154 GLU D CB  
3453 C CG  . GLU D 77  ? 0.9947 0.4697 0.8453 -0.0109 0.1691  0.0929  154 GLU D CG  
3454 C CD  . GLU D 77  ? 1.4079 0.8579 1.2304 0.0114  0.1834  0.1048  154 GLU D CD  
3455 O OE1 . GLU D 77  ? 1.2529 0.6708 1.0772 0.0088  0.1989  0.1180  154 GLU D OE1 
3456 O OE2 . GLU D 77  ? 1.4688 0.9290 1.2691 0.0306  0.1783  0.1007  154 GLU D OE2 
3457 N N   . THR D 78  ? 0.8523 0.3025 0.6988 -0.0640 0.1076  0.0282  155 THR D N   
3458 C CA  . THR D 78  ? 0.8781 0.2982 0.7101 -0.0786 0.0958  0.0101  155 THR D CA  
3459 C C   . THR D 78  ? 0.9050 0.3498 0.7512 -0.0968 0.0728  -0.0006 155 THR D C   
3460 O O   . THR D 78  ? 0.8517 0.3327 0.7016 -0.0897 0.0650  0.0017  155 THR D O   
3461 C CB  . THR D 78  ? 0.9788 0.3774 0.7711 -0.0608 0.0998  0.0015  155 THR D CB  
3462 O OG1 . THR D 78  ? 1.0583 0.4320 0.8415 -0.0440 0.1202  0.0128  155 THR D OG1 
3463 C CG2 . THR D 78  ? 0.9433 0.3094 0.7137 -0.0738 0.0892  -0.0191 155 THR D CG2 
3464 N N   . PRO D 79  ? 0.9010 0.3269 0.7563 -0.1205 0.0604  -0.0121 156 PRO D N   
3465 C CA  . PRO D 79  ? 0.8855 0.3373 0.7527 -0.1363 0.0355  -0.0214 156 PRO D CA  
3466 C C   . PRO D 79  ? 0.9370 0.3861 0.7638 -0.1288 0.0237  -0.0344 156 PRO D C   
3467 O O   . PRO D 79  ? 0.9622 0.3779 0.7531 -0.1202 0.0318  -0.0432 156 PRO D O   
3468 C CB  . PRO D 79  ? 0.9396 0.3683 0.8248 -0.1634 0.0258  -0.0310 156 PRO D CB  
3469 C CG  . PRO D 79  ? 1.0316 0.4090 0.8946 -0.1601 0.0430  -0.0346 156 PRO D CG  
3470 C CD  . PRO D 79  ? 0.9539 0.3336 0.8089 -0.1342 0.0670  -0.0177 156 PRO D CD  
3471 N N   . THR D 80  ? 0.8575 0.3414 0.6910 -0.1313 0.0057  -0.0347 157 THR D N   
3472 C CA  . THR D 80  ? 0.8397 0.3246 0.6368 -0.1263 -0.0062 -0.0444 157 THR D CA  
3473 C C   . THR D 80  ? 0.9314 0.3776 0.6950 -0.1386 -0.0151 -0.0636 157 THR D C   
3474 O O   . THR D 80  ? 0.9520 0.3831 0.7303 -0.1585 -0.0246 -0.0711 157 THR D O   
3475 C CB  . THR D 80  ? 0.7662 0.2896 0.5797 -0.1309 -0.0262 -0.0403 157 THR D CB  
3476 O OG1 . THR D 80  ? 0.8060 0.3371 0.6489 -0.1521 -0.0441 -0.0433 157 THR D OG1 
3477 C CG2 . THR D 80  ? 0.6598 0.2177 0.4982 -0.1165 -0.0174 -0.0249 157 THR D CG2 
3478 N N   . ILE D 81  ? 0.8920 0.3222 0.6116 -0.1265 -0.0105 -0.0719 158 ILE D N   
3479 C CA  . ILE D 81  ? 0.9411 0.3328 0.6190 -0.1331 -0.0152 -0.0917 158 ILE D CA  
3480 C C   . ILE D 81  ? 1.0221 0.4262 0.6837 -0.1469 -0.0420 -0.1006 158 ILE D C   
3481 O O   . ILE D 81  ? 1.0046 0.4344 0.6550 -0.1382 -0.0469 -0.0940 158 ILE D O   
3482 C CB  . ILE D 81  ? 0.9870 0.3596 0.6275 -0.1108 0.0056  -0.0946 158 ILE D CB  
3483 C CG1 . ILE D 81  ? 0.9602 0.3216 0.6177 -0.0959 0.0298  -0.0839 158 ILE D CG1 
3484 C CG2 . ILE D 81  ? 1.0741 0.4051 0.6669 -0.1156 0.0031  -0.1170 158 ILE D CG2 
3485 C CD1 . ILE D 81  ? 0.8628 0.2486 0.5198 -0.0729 0.0437  -0.0715 158 ILE D CD1 
3486 N N   . GLN D 82  ? 1.0296 0.4135 0.6875 -0.1684 -0.0598 -0.1157 159 GLN D N   
3487 C CA  . GLN D 82  ? 1.0559 0.4520 0.6985 -0.1827 -0.0889 -0.1241 159 GLN D CA  
3488 C C   . GLN D 82  ? 1.2544 0.6133 0.8352 -0.1859 -0.0950 -0.1466 159 GLN D C   
3489 O O   . GLN D 82  ? 1.3256 0.6549 0.8959 -0.2038 -0.1069 -0.1652 159 GLN D O   
3490 C CB  . GLN D 82  ? 1.0509 0.4653 0.7407 -0.2057 -0.1107 -0.1231 159 GLN D CB  
3491 C CG  . GLN D 82  ? 0.9264 0.3924 0.6564 -0.2031 -0.1217 -0.1041 159 GLN D CG  
3492 C CD  . GLN D 82  ? 1.1801 0.6658 0.9689 -0.2036 -0.1087 -0.0892 159 GLN D CD  
3493 O OE1 . GLN D 82  ? 1.0463 0.5270 0.8683 -0.2215 -0.1131 -0.0926 159 GLN D OE1 
3494 N NE2 . GLN D 82  ? 1.2483 0.7593 1.0526 -0.1850 -0.0932 -0.0721 159 GLN D NE2 
3495 N N   . LYS D 83  ? 1.2450 0.6058 0.7847 -0.1694 -0.0870 -0.1454 160 LYS D N   
3496 C CA  . LYS D 83  ? 1.3154 0.6419 0.7923 -0.1694 -0.0884 -0.1660 160 LYS D CA  
3497 C C   . LYS D 83  ? 1.4043 0.7491 0.8522 -0.1774 -0.1153 -0.1676 160 LYS D C   
3498 O O   . LYS D 83  ? 1.3936 0.7566 0.8200 -0.1641 -0.1103 -0.1569 160 LYS D O   
3499 C CB  . LYS D 83  ? 1.3456 0.6561 0.7928 -0.1451 -0.0571 -0.1654 160 LYS D CB  
3500 N N   . GLY D 84  ? 1.3936 0.7341 0.8436 -0.1998 -0.1442 -0.1799 161 GLY D N   
3501 C CA  . GLY D 84  ? 1.4214 0.7767 0.8423 -0.2094 -0.1747 -0.1830 161 GLY D CA  
3502 C C   . GLY D 84  ? 1.4319 0.8378 0.8910 -0.2071 -0.1896 -0.1583 161 GLY D C   
3503 O O   . GLY D 84  ? 1.3965 0.8283 0.9174 -0.2141 -0.1959 -0.1474 161 GLY D O   
3504 N N   . SER D 85  ? 1.3907 0.8098 0.8130 -0.1968 -0.1937 -0.1490 162 SER D N   
3505 C CA  . SER D 85  ? 1.3424 0.8046 0.7944 -0.1922 -0.2066 -0.1249 162 SER D CA  
3506 C C   . SER D 85  ? 1.2969 0.7797 0.7897 -0.1749 -0.1795 -0.1049 162 SER D C   
3507 O O   . SER D 85  ? 1.2639 0.7800 0.7873 -0.1696 -0.1863 -0.0852 162 SER D O   
3508 C CB  . SER D 85  ? 1.4234 0.8865 0.8170 -0.1877 -0.2193 -0.1214 162 SER D CB  
3509 O OG  . SER D 85  ? 1.5394 0.9886 0.8941 -0.2034 -0.2490 -0.1386 162 SER D OG  
3510 N N   . TYR D 86  ? 1.2069 0.6688 0.7000 -0.1658 -0.1499 -0.1105 163 TYR D N   
3511 C CA  . TYR D 86  ? 1.1358 0.6135 0.6602 -0.1491 -0.1241 -0.0950 163 TYR D CA  
3512 C C   . TYR D 86  ? 1.1368 0.6149 0.7105 -0.1503 -0.1119 -0.0938 163 TYR D C   
3513 O O   . TYR D 86  ? 1.1759 0.6302 0.7521 -0.1622 -0.1145 -0.1078 163 TYR D O   
3514 C CB  . TYR D 86  ? 1.1536 0.6125 0.6352 -0.1328 -0.0977 -0.0983 163 TYR D CB  
3515 C CG  . TYR D 86  ? 1.1779 0.6403 0.6133 -0.1287 -0.1027 -0.0943 163 TYR D CG  
3516 C CD1 . TYR D 86  ? 1.2505 0.6892 0.6300 -0.1368 -0.1159 -0.1097 163 TYR D CD1 
3517 C CD2 . TYR D 86  ? 1.1512 0.6386 0.5964 -0.1168 -0.0932 -0.0753 163 TYR D CD2 
3518 C CE1 . TYR D 86  ? 1.2637 0.7050 0.5965 -0.1326 -0.1191 -0.1039 163 TYR D CE1 
3519 C CE2 . TYR D 86  ? 1.1924 0.6814 0.5954 -0.1136 -0.0957 -0.0690 163 TYR D CE2 
3520 C CZ  . TYR D 86  ? 1.3391 0.8055 0.6849 -0.1210 -0.1081 -0.0824 163 TYR D CZ  
3521 O OH  . TYR D 86  ? 1.3885 0.8553 0.6880 -0.1174 -0.1089 -0.0747 163 TYR D OH  
3522 N N   . THR D 87  ? 0.9988 0.5024 0.6095 -0.1378 -0.0976 -0.0768 164 THR D N   
3523 C CA  . THR D 87  ? 0.9500 0.4572 0.6031 -0.1344 -0.0820 -0.0716 164 THR D CA  
3524 C C   . THR D 87  ? 0.9591 0.4648 0.6039 -0.1141 -0.0549 -0.0656 164 THR D C   
3525 O O   . THR D 87  ? 0.9184 0.4418 0.5551 -0.1036 -0.0515 -0.0569 164 THR D O   
3526 C CB  . THR D 87  ? 0.9455 0.4885 0.6533 -0.1393 -0.0933 -0.0578 164 THR D CB  
3527 O OG1 . THR D 87  ? 0.9197 0.4661 0.6384 -0.1584 -0.1193 -0.0640 164 THR D OG1 
3528 C CG2 . THR D 87  ? 0.8641 0.4122 0.6121 -0.1346 -0.0747 -0.0508 164 THR D CG2 
3529 N N   . PHE D 88  ? 0.9125 0.3970 0.5609 -0.1089 -0.0364 -0.0698 165 PHE D N   
3530 C CA  . PHE D 88  ? 0.8842 0.3672 0.5277 -0.0892 -0.0121 -0.0647 165 PHE D CA  
3531 C C   . PHE D 88  ? 0.9014 0.3961 0.5851 -0.0830 -0.0003 -0.0534 165 PHE D C   
3532 O O   . PHE D 88  ? 0.8917 0.3768 0.5971 -0.0935 -0.0023 -0.0541 165 PHE D O   
3533 C CB  . PHE D 88  ? 0.9423 0.3872 0.5455 -0.0835 0.0013  -0.0791 165 PHE D CB  
3534 C CG  . PHE D 88  ? 0.9913 0.4288 0.5497 -0.0848 -0.0052 -0.0884 165 PHE D CG  
3535 C CD1 . PHE D 88  ? 1.0214 0.4740 0.5638 -0.0704 0.0064  -0.0821 165 PHE D CD1 
3536 C CD2 . PHE D 88  ? 1.0650 0.4813 0.5964 -0.1012 -0.0231 -0.1031 165 PHE D CD2 
3537 C CE1 . PHE D 88  ? 1.0726 0.5181 0.5710 -0.0715 0.0031  -0.0889 165 PHE D CE1 
3538 C CE2 . PHE D 88  ? 1.1300 0.5389 0.6136 -0.1017 -0.0287 -0.1110 165 PHE D CE2 
3539 C CZ  . PHE D 88  ? 1.0948 0.5182 0.5616 -0.0865 -0.0144 -0.1029 165 PHE D CZ  
3540 N N   . VAL D 89  ? 0.8274 0.3439 0.5206 -0.0666 0.0119  -0.0427 166 VAL D N   
3541 C CA  . VAL D 89  ? 0.8013 0.3307 0.5255 -0.0583 0.0232  -0.0317 166 VAL D CA  
3542 C C   . VAL D 89  ? 0.8866 0.3893 0.5990 -0.0469 0.0423  -0.0334 166 VAL D C   
3543 O O   . VAL D 89  ? 0.8935 0.3875 0.5811 -0.0344 0.0520  -0.0376 166 VAL D O   
3544 C CB  . VAL D 89  ? 0.8233 0.3869 0.5607 -0.0461 0.0256  -0.0215 166 VAL D CB  
3545 C CG1 . VAL D 89  ? 0.8024 0.3791 0.5648 -0.0353 0.0379  -0.0113 166 VAL D CG1 
3546 C CG2 . VAL D 89  ? 0.8048 0.3913 0.5553 -0.0559 0.0074  -0.0184 166 VAL D CG2 
3547 N N   . PRO D 90  ? 0.8576 0.3476 0.5889 -0.0497 0.0493  -0.0288 167 PRO D N   
3548 C CA  . PRO D 90  ? 0.8639 0.3287 0.5847 -0.0353 0.0684  -0.0268 167 PRO D CA  
3549 C C   . PRO D 90  ? 0.8822 0.3739 0.6098 -0.0142 0.0791  -0.0148 167 PRO D C   
3550 O O   . PRO D 90  ? 0.8508 0.3698 0.6021 -0.0132 0.0775  -0.0044 167 PRO D O   
3551 C CB  . PRO D 90  ? 0.8942 0.3401 0.6356 -0.0468 0.0717  -0.0227 167 PRO D CB  
3552 C CG  . PRO D 90  ? 0.9281 0.4018 0.6993 -0.0624 0.0576  -0.0187 167 PRO D CG  
3553 C CD  . PRO D 90  ? 0.8571 0.3581 0.6226 -0.0638 0.0424  -0.0225 167 PRO D CD  
3554 N N   . TRP D 91  ? 0.8573 0.3442 0.5645 0.0023  0.0888  -0.0173 168 TRP D N   
3555 C CA  . TRP D 91  ? 0.8467 0.3617 0.5608 0.0216  0.0961  -0.0077 168 TRP D CA  
3556 C C   . TRP D 91  ? 0.8834 0.3859 0.5991 0.0382  0.1109  0.0018  168 TRP D C   
3557 O O   . TRP D 91  ? 0.9107 0.3761 0.6158 0.0390  0.1194  -0.0005 168 TRP D O   
3558 C CB  . TRP D 91  ? 0.8377 0.3650 0.5359 0.0309  0.0977  -0.0136 168 TRP D CB  
3559 C CG  . TRP D 91  ? 0.8386 0.3807 0.5331 0.0172  0.0844  -0.0193 168 TRP D CG  
3560 C CD1 . TRP D 91  ? 0.8978 0.4236 0.5672 0.0095  0.0811  -0.0302 168 TRP D CD1 
3561 C CD2 . TRP D 91  ? 0.8065 0.3795 0.5209 0.0098  0.0724  -0.0138 168 TRP D CD2 
3562 N NE1 . TRP D 91  ? 0.8749 0.4204 0.5470 -0.0020 0.0672  -0.0297 168 TRP D NE1 
3563 C CE2 . TRP D 91  ? 0.8582 0.4320 0.5596 -0.0019 0.0618  -0.0197 168 TRP D CE2 
3564 C CE3 . TRP D 91  ? 0.7975 0.3961 0.5374 0.0131  0.0703  -0.0046 168 TRP D CE3 
3565 C CZ2 . TRP D 91  ? 0.8251 0.4235 0.5411 -0.0098 0.0490  -0.0153 168 TRP D CZ2 
3566 C CZ3 . TRP D 91  ? 0.7967 0.4191 0.5511 0.0052  0.0584  -0.0027 168 TRP D CZ3 
3567 C CH2 . TRP D 91  ? 0.8102 0.4319 0.5542 -0.0059 0.0478  -0.0073 168 TRP D CH2 
3568 N N   . LEU D 92  ? 0.8002 0.3325 0.5274 0.0519  0.1132  0.0122  169 LEU D N   
3569 C CA  . LEU D 92  ? 0.8155 0.3454 0.5427 0.0714  0.1248  0.0239  169 LEU D CA  
3570 C C   . LEU D 92  ? 0.8254 0.3889 0.5536 0.0880  0.1238  0.0248  169 LEU D C   
3571 O O   . LEU D 92  ? 0.8119 0.4056 0.5491 0.0816  0.1139  0.0213  169 LEU D O   
3572 C CB  . LEU D 92  ? 0.8209 0.3628 0.5636 0.0680  0.1245  0.0353  169 LEU D CB  
3573 C CG  . LEU D 92  ? 0.9420 0.4581 0.6832 0.0739  0.1370  0.0477  169 LEU D CG  
3574 C CD1 . LEU D 92  ? 0.9475 0.4766 0.7057 0.0634  0.1364  0.0560  169 LEU D CD1 
3575 C CD2 . LEU D 92  ? 1.0039 0.5280 0.7365 0.0998  0.1451  0.0590  169 LEU D CD2 
3576 N N   . LEU D 93  ? 0.7645 0.3230 0.4856 0.1088  0.1336  0.0294  170 LEU D N   
3577 C CA  . LEU D 93  ? 0.7207 0.3150 0.4480 0.1236  0.1316  0.0300  170 LEU D CA  
3578 C C   . LEU D 93  ? 0.7493 0.3762 0.4886 0.1287  0.1248  0.0388  170 LEU D C   
3579 O O   . LEU D 93  ? 0.7331 0.3528 0.4695 0.1388  0.1295  0.0505  170 LEU D O   
3580 C CB  . LEU D 93  ? 0.7284 0.3138 0.4495 0.1465  0.1430  0.0332  170 LEU D CB  
3581 C CG  . LEU D 93  ? 0.7417 0.3700 0.4758 0.1623  0.1401  0.0353  170 LEU D CG  
3582 C CD1 . LEU D 93  ? 0.7432 0.3856 0.4798 0.1565  0.1404  0.0236  170 LEU D CD1 
3583 C CD2 . LEU D 93  ? 0.7488 0.3756 0.4830 0.1883  0.1478  0.0460  170 LEU D CD2 
3584 N N   . SER D 94  ? 0.6678 0.3289 0.4187 0.1217  0.1142  0.0328  171 SER D N   
3585 C CA  . SER D 94  ? 0.6300 0.3242 0.3914 0.1261  0.1061  0.0368  171 SER D CA  
3586 C C   . SER D 94  ? 0.6427 0.3590 0.4065 0.1480  0.1071  0.0415  171 SER D C   
3587 O O   . SER D 94  ? 0.6295 0.3512 0.3889 0.1620  0.1075  0.0511  171 SER D O   
3588 C CB  . SER D 94  ? 0.6202 0.3374 0.3940 0.1108  0.0949  0.0282  171 SER D CB  
3589 O OG  . SER D 94  ? 0.7124 0.4615 0.4953 0.1179  0.0874  0.0291  171 SER D OG  
3590 N N   . PHE D 95  ? 0.5604 0.2888 0.3309 0.1516  0.1083  0.0357  172 PHE D N   
3591 C CA  . PHE D 95  ? 0.5569 0.3107 0.3362 0.1718  0.1089  0.0394  172 PHE D CA  
3592 C C   . PHE D 95  ? 0.6289 0.3858 0.4144 0.1721  0.1158  0.0325  172 PHE D C   
3593 O O   . PHE D 95  ? 0.6091 0.3593 0.3928 0.1548  0.1161  0.0241  172 PHE D O   
3594 C CB  . PHE D 95  ? 0.5598 0.3567 0.3540 0.1738  0.0949  0.0387  172 PHE D CB  
3595 C CG  . PHE D 95  ? 0.5627 0.3864 0.3757 0.1603  0.0884  0.0284  172 PHE D CG  
3596 C CD1 . PHE D 95  ? 0.5963 0.4464 0.4269 0.1685  0.0901  0.0267  172 PHE D CD1 
3597 C CD2 . PHE D 95  ? 0.5685 0.3899 0.3835 0.1397  0.0820  0.0217  172 PHE D CD2 
3598 C CE1 . PHE D 95  ? 0.5769 0.4494 0.4258 0.1544  0.0865  0.0190  172 PHE D CE1 
3599 C CE2 . PHE D 95  ? 0.5710 0.4127 0.4025 0.1272  0.0773  0.0143  172 PHE D CE2 
3600 C CZ  . PHE D 95  ? 0.5313 0.3969 0.3788 0.1336  0.0803  0.0134  172 PHE D CZ  
3601 N N   . LYS D 96  ? 0.6206 0.3906 0.4137 0.1931  0.1214  0.0371  173 LYS D N   
3602 C CA  . LYS D 96  ? 0.6280 0.4066 0.4301 0.1989  0.1312  0.0320  173 LYS D CA  
3603 C C   . LYS D 96  ? 0.6784 0.5049 0.5072 0.2159  0.1256  0.0366  173 LYS D C   
3604 O O   . LYS D 96  ? 0.6857 0.5206 0.5156 0.2332  0.1205  0.0460  173 LYS D O   
3605 C CB  . LYS D 96  ? 0.6680 0.4037 0.4516 0.2102  0.1478  0.0325  173 LYS D CB  
3606 C CG  . LYS D 96  ? 0.6343 0.3789 0.4260 0.2216  0.1611  0.0278  173 LYS D CG  
3607 C CD  . LYS D 96  ? 0.8423 0.5432 0.6159 0.2372  0.1778  0.0275  173 LYS D CD  
3608 C CE  . LYS D 96  ? 1.0039 0.7207 0.7903 0.2551  0.1925  0.0246  173 LYS D CE  
3609 N NZ  . LYS D 96  ? 1.1371 0.8935 0.9520 0.2799  0.1891  0.0361  173 LYS D NZ  
3610 N N   . ARG D 97  ? 0.6276 0.4868 0.4782 0.2100  0.1255  0.0307  174 ARG D N   
3611 C CA  . ARG D 97  ? 0.6093 0.5199 0.4924 0.2217  0.1186  0.0331  174 ARG D CA  
3612 C C   . ARG D 97  ? 0.6945 0.6193 0.5946 0.2240  0.1336  0.0292  174 ARG D C   
3613 O O   . ARG D 97  ? 0.7086 0.6241 0.6032 0.2055  0.1403  0.0223  174 ARG D O   
3614 C CB  . ARG D 97  ? 0.5559 0.4963 0.4532 0.2036  0.1005  0.0283  174 ARG D CB  
3615 C CG  . ARG D 97  ? 0.5019 0.4957 0.4327 0.2116  0.0883  0.0289  174 ARG D CG  
3616 C CD  . ARG D 97  ? 0.4702 0.4842 0.4131 0.1895  0.0731  0.0206  174 ARG D CD  
3617 N NE  . ARG D 97  ? 0.5421 0.6064 0.5157 0.1955  0.0574  0.0193  174 ARG D NE  
3618 C CZ  . ARG D 97  ? 0.8216 0.9213 0.8287 0.1814  0.0515  0.0125  174 ARG D CZ  
3619 N NH1 . ARG D 97  ? 0.6660 0.7546 0.6773 0.1610  0.0611  0.0082  174 ARG D NH1 
3620 N NH2 . ARG D 97  ? 0.8063 0.9524 0.8425 0.1866  0.0352  0.0103  174 ARG D NH2 
3621 N N   . GLY D 98  ? 0.6550 0.6005 0.5736 0.2480  0.1401  0.0348  175 GLY D N   
3622 C CA  . GLY D 98  ? 0.6685 0.6301 0.6055 0.2545  0.1575  0.0321  175 GLY D CA  
3623 C C   . GLY D 98  ? 0.7899 0.7021 0.6970 0.2614  0.1790  0.0287  175 GLY D C   
3624 O O   . GLY D 98  ? 0.8213 0.6860 0.6962 0.2621  0.1796  0.0293  175 GLY D O   
3625 N N   . SER D 99  ? 0.7427 0.6665 0.6609 0.2653  0.1977  0.0245  176 SER D N   
3626 C CA  . SER D 99  ? 0.7665 0.6494 0.6587 0.2748  0.2209  0.0187  176 SER D CA  
3627 C C   . SER D 99  ? 0.8270 0.6821 0.6892 0.2516  0.2300  0.0083  176 SER D C   
3628 O O   . SER D 99  ? 0.8682 0.6750 0.6951 0.2546  0.2433  0.0010  176 SER D O   
3629 C CB  . SER D 99  ? 0.8124 0.7264 0.7350 0.3005  0.2384  0.0213  176 SER D CB  
3630 O OG  . SER D 99  ? 0.8784 0.8541 0.8442 0.2940  0.2348  0.0238  176 SER D OG  
3631 N N   . ALA D 100 ? 0.7295 0.6130 0.6042 0.2289  0.2226  0.0075  177 ALA D N   
3632 C CA  . ALA D 100 ? 0.7139 0.5779 0.5624 0.2078  0.2304  0.0006  177 ALA D CA  
3633 C C   . ALA D 100 ? 0.7815 0.5916 0.5850 0.1934  0.2237  -0.0055 177 ALA D C   
3634 O O   . ALA D 100 ? 0.8076 0.5901 0.5793 0.1846  0.2344  -0.0129 177 ALA D O   
3635 C CB  . ALA D 100 ? 0.6852 0.5898 0.5601 0.1878  0.2224  0.0040  177 ALA D CB  
3636 N N   . LEU D 101 ? 0.7380 0.5335 0.5379 0.1909  0.2063  -0.0026 178 LEU D N   
3637 C CA  . LEU D 101 ? 0.7589 0.5075 0.5228 0.1755  0.1988  -0.0079 178 LEU D CA  
3638 C C   . LEU D 101 ? 0.8408 0.5536 0.5912 0.1873  0.1975  -0.0069 178 LEU D C   
3639 O O   . LEU D 101 ? 0.8421 0.5715 0.6128 0.2028  0.1930  0.0017  178 LEU D O   
3640 C CB  . LEU D 101 ? 0.7266 0.4870 0.4956 0.1519  0.1794  -0.0056 178 LEU D CB  
3641 C CG  . LEU D 101 ? 0.7667 0.5538 0.5454 0.1363  0.1800  -0.0054 178 LEU D CG  
3642 C CD1 . LEU D 101 ? 0.7212 0.5323 0.5217 0.1213  0.1605  -0.0009 178 LEU D CD1 
3643 C CD2 . LEU D 101 ? 0.8402 0.5954 0.5823 0.1234  0.1866  -0.0118 178 LEU D CD2 
3644 N N   . GLU D 102 ? 0.8284 0.4918 0.5438 0.1793  0.2010  -0.0153 179 GLU D N   
3645 C CA  . GLU D 102 ? 0.8658 0.4855 0.5650 0.1863  0.2020  -0.0158 179 GLU D CA  
3646 C C   . GLU D 102 ? 0.9116 0.4956 0.5862 0.1628  0.1914  -0.0222 179 GLU D C   
3647 O O   . GLU D 102 ? 0.9059 0.4893 0.5660 0.1448  0.1873  -0.0293 179 GLU D O   
3648 C CB  . GLU D 102 ? 0.9352 0.5239 0.6180 0.2053  0.2228  -0.0232 179 GLU D CB  
3649 C CG  . GLU D 102 ? 1.0360 0.6501 0.7455 0.2348  0.2336  -0.0147 179 GLU D CG  
3650 C CD  . GLU D 102 ? 1.3152 0.8949 1.0088 0.2554  0.2556  -0.0226 179 GLU D CD  
3651 O OE1 . GLU D 102 ? 1.0261 0.5508 0.6871 0.2490  0.2598  -0.0330 179 GLU D OE1 
3652 O OE2 . GLU D 102 ? 1.3405 0.9485 1.0562 0.2782  0.2686  -0.0190 179 GLU D OE2 
3653 N N   . GLU D 103 ? 0.8591 0.4138 0.5297 0.1634  0.1875  -0.0186 180 GLU D N   
3654 C CA  . GLU D 103 ? 0.8574 0.3781 0.5104 0.1418  0.1779  -0.0241 180 GLU D CA  
3655 C C   . GLU D 103 ? 0.9320 0.4026 0.5569 0.1453  0.1904  -0.0367 180 GLU D C   
3656 O O   . GLU D 103 ? 0.9613 0.4132 0.5869 0.1661  0.2035  -0.0342 180 GLU D O   
3657 C CB  . GLU D 103 ? 0.8607 0.3771 0.5275 0.1407  0.1698  -0.0123 180 GLU D CB  
3658 C CG  . GLU D 103 ? 0.9899 0.4859 0.6504 0.1161  0.1578  -0.0155 180 GLU D CG  
3659 C CD  . GLU D 103 ? 1.4535 0.8963 1.0946 0.1074  0.1616  -0.0241 180 GLU D CD  
3660 O OE1 . GLU D 103 ? 1.8993 1.3117 1.5310 0.1233  0.1756  -0.0254 180 GLU D OE1 
3661 O OE2 . GLU D 103 ? 1.1563 0.5877 0.7937 0.0848  0.1501  -0.0294 180 GLU D OE2 
3662 N N   . LYS D 104 ? 0.8806 0.3282 0.4796 0.1264  0.1859  -0.0503 181 LYS D N   
3663 C CA  . LYS D 104 ? 0.9369 0.3326 0.5050 0.1270  0.1957  -0.0658 181 LYS D CA  
3664 C C   . LYS D 104 ? 1.0008 0.3707 0.5500 0.0994  0.1802  -0.0762 181 LYS D C   
3665 O O   . LYS D 104 ? 0.9712 0.3580 0.5095 0.0843  0.1699  -0.0807 181 LYS D O   
3666 C CB  . LYS D 104 ? 0.9842 0.3786 0.5322 0.1412  0.2134  -0.0766 181 LYS D CB  
3667 N N   . GLU D 105 ? 0.9792 0.3097 0.5276 0.0927  0.1778  -0.0784 182 GLU D N   
3668 C CA  . GLU D 105 ? 0.9943 0.2960 0.5292 0.0666  0.1632  -0.0895 182 GLU D CA  
3669 C C   . GLU D 105 ? 1.0128 0.3516 0.5583 0.0465  0.1428  -0.0848 182 GLU D C   
3670 O O   . GLU D 105 ? 0.9986 0.3313 0.5213 0.0302  0.1316  -0.0969 182 GLU D O   
3671 C CB  . GLU D 105 ? 1.0685 0.3269 0.5616 0.0629  0.1684  -0.1129 182 GLU D CB  
3672 C CG  . GLU D 105 ? 1.1838 0.3965 0.6640 0.0819  0.1887  -0.1208 182 GLU D CG  
3673 C CD  . GLU D 105 ? 1.5475 0.7202 0.9830 0.0823  0.1969  -0.1457 182 GLU D CD  
3674 O OE1 . GLU D 105 ? 1.1909 0.3770 0.6017 0.0703  0.1882  -0.1555 182 GLU D OE1 
3675 O OE2 . GLU D 105 ? 1.7507 0.8783 1.1741 0.0965  0.2132  -0.1550 182 GLU D OE2 
3676 N N   . ASN D 106 ? 0.9538 0.3305 0.5323 0.0494  0.1382  -0.0672 183 ASN D N   
3677 C CA  . ASN D 106 ? 0.9222 0.3344 0.5170 0.0336  0.1206  -0.0606 183 ASN D CA  
3678 C C   . ASN D 106 ? 0.9727 0.4141 0.5575 0.0331  0.1172  -0.0620 183 ASN D C   
3679 O O   . ASN D 106 ? 0.9757 0.4351 0.5647 0.0176  0.1014  -0.0602 183 ASN D O   
3680 C CB  . ASN D 106 ? 0.9468 0.3404 0.5418 0.0094  0.1044  -0.0666 183 ASN D CB  
3681 C CG  . ASN D 106 ? 1.2063 0.6210 0.8365 0.0024  0.0966  -0.0528 183 ASN D CG  
3682 O OD1 . ASN D 106 ? 0.9834 0.4003 0.6312 0.0145  0.1069  -0.0413 183 ASN D OD1 
3683 N ND2 . ASN D 106 ? 1.1503 0.5814 0.7901 -0.0162 0.0786  -0.0533 183 ASN D ND2 
3684 N N   . LYS D 107 ? 0.9282 0.3757 0.5026 0.0507  0.1328  -0.0635 184 LYS D N   
3685 C CA  . LYS D 107 ? 0.9047 0.3806 0.4718 0.0519  0.1344  -0.0627 184 LYS D CA  
3686 C C   . LYS D 107 ? 0.9270 0.4356 0.5185 0.0726  0.1476  -0.0524 184 LYS D C   
3687 O O   . LYS D 107 ? 0.9449 0.4456 0.5471 0.0891  0.1578  -0.0493 184 LYS D O   
3688 C CB  . LYS D 107 ? 0.9710 0.4194 0.4954 0.0515  0.1430  -0.0783 184 LYS D CB  
3689 C CG  . LYS D 107 ? 0.9379 0.3543 0.4321 0.0310  0.1282  -0.0915 184 LYS D CG  
3690 C CD  . LYS D 107 ? 0.9194 0.2915 0.3705 0.0363  0.1410  -0.1110 184 LYS D CD  
3691 N N   . ILE D 108 ? 0.8303 0.3755 0.4320 0.0716  0.1468  -0.0464 185 ILE D N   
3692 C CA  . ILE D 108 ? 0.7923 0.3716 0.4185 0.0892  0.1582  -0.0386 185 ILE D CA  
3693 C C   . ILE D 108 ? 0.9187 0.4907 0.5229 0.0997  0.1776  -0.0465 185 ILE D C   
3694 O O   . ILE D 108 ? 0.9368 0.5037 0.5159 0.0891  0.1784  -0.0518 185 ILE D O   
3695 C CB  . ILE D 108 ? 0.7656 0.3884 0.4198 0.0820  0.1481  -0.0284 185 ILE D CB  
3696 C CG1 . ILE D 108 ? 0.7260 0.3531 0.3982 0.0725  0.1307  -0.0226 185 ILE D CG1 
3697 C CG2 . ILE D 108 ? 0.7411 0.4000 0.4227 0.0991  0.1588  -0.0222 185 ILE D CG2 
3698 C CD1 . ILE D 108 ? 0.7175 0.3786 0.4132 0.0633  0.1191  -0.0154 185 ILE D CD1 
3699 N N   . LEU D 109 ? 0.8974 0.4668 0.5089 0.1217  0.1938  -0.0470 186 LEU D N   
3700 C CA  . LEU D 109 ? 0.9219 0.4854 0.5165 0.1355  0.2154  -0.0546 186 LEU D CA  
3701 C C   . LEU D 109 ? 0.9243 0.5387 0.5526 0.1475  0.2250  -0.0449 186 LEU D C   
3702 O O   . LEU D 109 ? 0.9046 0.5454 0.5678 0.1596  0.2221  -0.0354 186 LEU D O   
3703 C CB  . LEU D 109 ? 0.9627 0.4864 0.5441 0.1535  0.2284  -0.0626 186 LEU D CB  
3704 C CG  . LEU D 109 ? 1.0633 0.5842 0.6360 0.1752  0.2540  -0.0694 186 LEU D CG  
3705 C CD1 . LEU D 109 ? 1.1079 0.6106 0.6375 0.1656  0.2634  -0.0832 186 LEU D CD1 
3706 C CD2 . LEU D 109 ? 1.1276 0.6115 0.6967 0.1952  0.2648  -0.0738 186 LEU D CD2 
3707 N N   . VAL D 110 ? 0.8608 0.4894 0.4782 0.1434  0.2360  -0.0469 187 VAL D N   
3708 C CA  . VAL D 110 ? 0.8358 0.5136 0.4869 0.1513  0.2470  -0.0382 187 VAL D CA  
3709 C C   . VAL D 110 ? 0.9073 0.5867 0.5644 0.1781  0.2713  -0.0419 187 VAL D C   
3710 O O   . VAL D 110 ? 0.9480 0.5945 0.5689 0.1845  0.2881  -0.0536 187 VAL D O   
3711 C CB  . VAL D 110 ? 0.8913 0.5826 0.5288 0.1338  0.2497  -0.0361 187 VAL D CB  
3712 C CG1 . VAL D 110 ? 0.8730 0.6159 0.5496 0.1394  0.2627  -0.0266 187 VAL D CG1 
3713 C CG2 . VAL D 110 ? 0.8567 0.5437 0.4895 0.1098  0.2250  -0.0318 187 VAL D CG2 
3714 N N   . LYS D 111 ? 0.8142 0.5317 0.5167 0.1946  0.2723  -0.0326 188 LYS D N   
3715 C CA  . LYS D 111 ? 0.8134 0.5409 0.5326 0.2232  0.2936  -0.0332 188 LYS D CA  
3716 C C   . LYS D 111 ? 0.8536 0.6370 0.6098 0.2296  0.3088  -0.0266 188 LYS D C   
3717 O O   . LYS D 111 ? 0.8690 0.6592 0.6331 0.2517  0.3316  -0.0291 188 LYS D O   
3718 C CB  . LYS D 111 ? 0.8069 0.5311 0.5474 0.2419  0.2850  -0.0272 188 LYS D CB  
3719 C CG  . LYS D 111 ? 0.7101 0.3751 0.4159 0.2391  0.2771  -0.0333 188 LYS D CG  
3720 C CD  . LYS D 111 ? 0.7529 0.3663 0.4217 0.2515  0.2976  -0.0475 188 LYS D CD  
3721 N N   . GLU D 112 ? 0.7887 0.6116 0.5702 0.2104  0.2971  -0.0183 189 GLU D N   
3722 C CA  . GLU D 112 ? 0.7656 0.6424 0.5856 0.2101  0.3100  -0.0113 189 GLU D CA  
3723 C C   . GLU D 112 ? 0.8248 0.7006 0.6266 0.1830  0.3080  -0.0096 189 GLU D C   
3724 O O   . GLU D 112 ? 0.8051 0.6672 0.5960 0.1633  0.2853  -0.0081 189 GLU D O   
3725 C CB  . GLU D 112 ? 0.7340 0.6644 0.6127 0.2130  0.2944  -0.0012 189 GLU D CB  
3726 C CG  . GLU D 112 ? 0.9116 0.8623 0.8210 0.2435  0.3014  0.0012  189 GLU D CG  
3727 C CD  . GLU D 112 ? 1.1157 1.0988 1.0637 0.2485  0.2768  0.0090  189 GLU D CD  
3728 O OE1 . GLU D 112 ? 0.9459 0.9710 0.9277 0.2326  0.2633  0.0138  189 GLU D OE1 
3729 O OE2 . GLU D 112 ? 0.9212 0.8872 0.8650 0.2689  0.2718  0.0103  189 GLU D OE2 
3730 N N   . THR D 113 ? 0.7942 0.6851 0.5934 0.1830  0.3328  -0.0086 190 THR D N   
3731 C CA  . THR D 113 ? 0.7882 0.6798 0.5698 0.1590  0.3346  -0.0039 190 THR D CA  
3732 C C   . THR D 113 ? 0.7802 0.7180 0.6141 0.1433  0.3192  0.0078  190 THR D C   
3733 O O   . THR D 113 ? 0.7598 0.7435 0.6468 0.1535  0.3219  0.0124  190 THR D O   
3734 C CB  . THR D 113 ? 0.9682 0.8640 0.7324 0.1658  0.3684  -0.0049 190 THR D CB  
3735 O OG1 . THR D 113 ? 1.0641 0.9112 0.7752 0.1797  0.3802  -0.0190 190 THR D OG1 
3736 C CG2 . THR D 113 ? 0.9577 0.8559 0.7031 0.1421  0.3731  0.0033  190 THR D CG2 
3737 N N   . GLY D 114 ? 0.7096 0.6339 0.5288 0.1194  0.3016  0.0117  191 GLY D N   
3738 C CA  . GLY D 114 ? 0.6677 0.6278 0.5317 0.1025  0.2866  0.0209  191 GLY D CA  
3739 C C   . GLY D 114 ? 0.7066 0.6422 0.5459 0.0783  0.2703  0.0249  191 GLY D C   
3740 O O   . GLY D 114 ? 0.7078 0.6037 0.4947 0.0731  0.2728  0.0225  191 GLY D O   
3741 N N   . TYR D 115 ? 0.6358 0.5966 0.5149 0.0639  0.2529  0.0308  192 TYR D N   
3742 C CA  . TYR D 115 ? 0.6237 0.5656 0.4908 0.0423  0.2347  0.0353  192 TYR D CA  
3743 C C   . TYR D 115 ? 0.6324 0.5625 0.5023 0.0453  0.2091  0.0283  192 TYR D C   
3744 O O   . TYR D 115 ? 0.6071 0.5642 0.5122 0.0555  0.2021  0.0251  192 TYR D O   
3745 C CB  . TYR D 115 ? 0.6182 0.5928 0.5284 0.0246  0.2352  0.0454  192 TYR D CB  
3746 C CG  . TYR D 115 ? 0.6669 0.6505 0.5719 0.0182  0.2623  0.0557  192 TYR D CG  
3747 C CD1 . TYR D 115 ? 0.6931 0.7073 0.6183 0.0316  0.2877  0.0561  192 TYR D CD1 
3748 C CD2 . TYR D 115 ? 0.6940 0.6572 0.5757 -0.0003 0.2636  0.0665  192 TYR D CD2 
3749 C CE1 . TYR D 115 ? 0.7327 0.7573 0.6539 0.0258  0.3156  0.0665  192 TYR D CE1 
3750 C CE2 . TYR D 115 ? 0.7296 0.7016 0.6057 -0.0067 0.2900  0.0783  192 TYR D CE2 
3751 C CZ  . TYR D 115 ? 0.8267 0.8295 0.7216 0.0061  0.3170  0.0779  192 TYR D CZ  
3752 O OH  . TYR D 115 ? 0.8803 0.8928 0.7685 0.0005  0.3464  0.0902  192 TYR D OH  
3753 N N   . PHE D 116 ? 0.5776 0.4686 0.4094 0.0381  0.1956  0.0262  193 PHE D N   
3754 C CA  . PHE D 116 ? 0.5591 0.4373 0.3912 0.0415  0.1743  0.0201  193 PHE D CA  
3755 C C   . PHE D 116 ? 0.6301 0.4943 0.4594 0.0247  0.1551  0.0230  193 PHE D C   
3756 O O   . PHE D 116 ? 0.6404 0.4817 0.4410 0.0135  0.1554  0.0275  193 PHE D O   
3757 C CB  . PHE D 116 ? 0.5978 0.4406 0.3902 0.0533  0.1764  0.0124  193 PHE D CB  
3758 C CG  . PHE D 116 ? 0.6281 0.4764 0.4209 0.0742  0.1939  0.0077  193 PHE D CG  
3759 C CD1 . PHE D 116 ? 0.6941 0.5397 0.4686 0.0797  0.2173  0.0072  193 PHE D CD1 
3760 C CD2 . PHE D 116 ? 0.6267 0.4809 0.4358 0.0900  0.1880  0.0044  193 PHE D CD2 
3761 C CE1 . PHE D 116 ? 0.7195 0.5687 0.4958 0.1013  0.2348  0.0022  193 PHE D CE1 
3762 C CE2 . PHE D 116 ? 0.6801 0.5369 0.4903 0.1115  0.2042  0.0013  193 PHE D CE2 
3763 C CZ  . PHE D 116 ? 0.6886 0.5426 0.4838 0.1174  0.2276  -0.0004 193 PHE D CZ  
3764 N N   . PHE D 117 ? 0.5601 0.4360 0.4157 0.0247  0.1376  0.0199  194 PHE D N   
3765 C CA  . PHE D 117 ? 0.5308 0.3917 0.3850 0.0124  0.1190  0.0206  194 PHE D CA  
3766 C C   . PHE D 117 ? 0.5712 0.4025 0.3961 0.0192  0.1116  0.0154  194 PHE D C   
3767 O O   . PHE D 117 ? 0.5427 0.3778 0.3722 0.0323  0.1104  0.0105  194 PHE D O   
3768 C CB  . PHE D 117 ? 0.5208 0.4071 0.4140 0.0096  0.1059  0.0180  194 PHE D CB  
3769 C CG  . PHE D 117 ? 0.5240 0.3926 0.4147 0.0002  0.0885  0.0171  194 PHE D CG  
3770 C CD1 . PHE D 117 ? 0.5743 0.4309 0.4638 -0.0151 0.0853  0.0238  194 PHE D CD1 
3771 C CD2 . PHE D 117 ? 0.5163 0.3795 0.4055 0.0078  0.0768  0.0108  194 PHE D CD2 
3772 C CE1 . PHE D 117 ? 0.5713 0.4116 0.4609 -0.0213 0.0700  0.0231  194 PHE D CE1 
3773 C CE2 . PHE D 117 ? 0.5332 0.3820 0.4222 0.0006  0.0632  0.0097  194 PHE D CE2 
3774 C CZ  . PHE D 117 ? 0.5190 0.3568 0.4096 -0.0133 0.0596  0.0154  194 PHE D CZ  
3775 N N   . ILE D 118 ? 0.5642 0.3666 0.3590 0.0104  0.1073  0.0174  195 ILE D N   
3776 C CA  . ILE D 118 ? 0.5811 0.3551 0.3496 0.0134  0.1004  0.0125  195 ILE D CA  
3777 C C   . ILE D 118 ? 0.6268 0.3921 0.4010 0.0034  0.0823  0.0144  195 ILE D C   
3778 O O   . ILE D 118 ? 0.6717 0.4360 0.4474 -0.0079 0.0771  0.0208  195 ILE D O   
3779 C CB  . ILE D 118 ? 0.6649 0.4131 0.3920 0.0124  0.1096  0.0109  195 ILE D CB  
3780 C CG1 . ILE D 118 ? 0.6819 0.4393 0.4044 0.0244  0.1310  0.0084  195 ILE D CG1 
3781 C CG2 . ILE D 118 ? 0.7188 0.4379 0.4230 0.0135  0.1011  0.0041  195 ILE D CG2 
3782 C CD1 . ILE D 118 ? 0.8119 0.5640 0.5108 0.0194  0.1430  0.0119  195 ILE D CD1 
3783 N N   . TYR D 119 ? 0.5356 0.2942 0.3133 0.0082  0.0740  0.0100  196 TYR D N   
3784 C CA  . TYR D 119 ? 0.5200 0.2733 0.3075 0.0014  0.0587  0.0110  196 TYR D CA  
3785 C C   . TYR D 119 ? 0.6447 0.3768 0.4173 0.0026  0.0537  0.0076  196 TYR D C   
3786 O O   . TYR D 119 ? 0.6721 0.3946 0.4324 0.0108  0.0617  0.0035  196 TYR D O   
3787 C CB  . TYR D 119 ? 0.4886 0.2641 0.3071 0.0055  0.0539  0.0093  196 TYR D CB  
3788 C CG  . TYR D 119 ? 0.4874 0.2729 0.3110 0.0196  0.0591  0.0050  196 TYR D CG  
3789 C CD1 . TYR D 119 ? 0.5144 0.3188 0.3458 0.0283  0.0687  0.0043  196 TYR D CD1 
3790 C CD2 . TYR D 119 ? 0.4975 0.2752 0.3198 0.0251  0.0548  0.0032  196 TYR D CD2 
3791 C CE1 . TYR D 119 ? 0.5585 0.3724 0.3941 0.0433  0.0720  0.0022  196 TYR D CE1 
3792 C CE2 . TYR D 119 ? 0.5129 0.2981 0.3370 0.0392  0.0596  0.0019  196 TYR D CE2 
3793 C CZ  . TYR D 119 ? 0.6109 0.4138 0.4409 0.0489  0.0672  0.0016  196 TYR D CZ  
3794 O OH  . TYR D 119 ? 0.5377 0.3479 0.3686 0.0646  0.0709  0.0021  196 TYR D OH  
3795 N N   . GLY D 120 ? 0.5967 0.3219 0.3739 -0.0057 0.0409  0.0098  197 GLY D N   
3796 C CA  . GLY D 120 ? 0.5993 0.3082 0.3698 -0.0076 0.0349  0.0074  197 GLY D CA  
3797 C C   . GLY D 120 ? 0.6801 0.3926 0.4694 -0.0142 0.0214  0.0108  197 GLY D C   
3798 O O   . GLY D 120 ? 0.7110 0.4270 0.5055 -0.0205 0.0139  0.0158  197 GLY D O   
3799 N N   . GLN D 121 ? 0.6065 0.3175 0.4070 -0.0120 0.0195  0.0091  198 GLN D N   
3800 C CA  . GLN D 121 ? 0.5967 0.3122 0.4177 -0.0165 0.0091  0.0118  198 GLN D CA  
3801 C C   . GLN D 121 ? 0.6877 0.3916 0.5081 -0.0206 0.0068  0.0105  198 GLN D C   
3802 O O   . GLN D 121 ? 0.7219 0.4167 0.5332 -0.0163 0.0161  0.0075  198 GLN D O   
3803 C CB  . GLN D 121 ? 0.5864 0.3192 0.4312 -0.0088 0.0116  0.0113  198 GLN D CB  
3804 C CG  . GLN D 121 ? 0.6470 0.3850 0.5148 -0.0115 0.0032  0.0136  198 GLN D CG  
3805 C CD  . GLN D 121 ? 0.7130 0.4654 0.5993 -0.0034 0.0063  0.0108  198 GLN D CD  
3806 O OE1 . GLN D 121 ? 0.6273 0.3855 0.5200 -0.0031 0.0038  0.0095  198 GLN D OE1 
3807 N NE2 . GLN D 121 ? 0.5511 0.3080 0.4453 0.0025  0.0122  0.0095  198 GLN D NE2 
3808 N N   . VAL D 122 ? 0.6174 0.3217 0.4495 -0.0292 -0.0061 0.0134  199 VAL D N   
3809 C CA  . VAL D 122 ? 0.6015 0.2995 0.4419 -0.0362 -0.0109 0.0126  199 VAL D CA  
3810 C C   . VAL D 122 ? 0.6156 0.3307 0.4896 -0.0373 -0.0193 0.0175  199 VAL D C   
3811 O O   . VAL D 122 ? 0.5914 0.3138 0.4719 -0.0373 -0.0279 0.0214  199 VAL D O   
3812 C CB  . VAL D 122 ? 0.6501 0.3307 0.4672 -0.0477 -0.0215 0.0095  199 VAL D CB  
3813 C CG1 . VAL D 122 ? 0.6478 0.3233 0.4785 -0.0573 -0.0280 0.0074  199 VAL D CG1 
3814 C CG2 . VAL D 122 ? 0.6617 0.3245 0.4439 -0.0448 -0.0116 0.0036  199 VAL D CG2 
3815 N N   . LEU D 123 ? 0.5565 0.2775 0.4528 -0.0373 -0.0149 0.0182  200 LEU D N   
3816 C CA  . LEU D 123 ? 0.5463 0.2848 0.4773 -0.0378 -0.0208 0.0226  200 LEU D CA  
3817 C C   . LEU D 123 ? 0.5987 0.3353 0.5397 -0.0511 -0.0342 0.0235  200 LEU D C   
3818 O O   . LEU D 123 ? 0.6008 0.3267 0.5379 -0.0578 -0.0300 0.0207  200 LEU D O   
3819 C CB  . LEU D 123 ? 0.5402 0.2898 0.4907 -0.0290 -0.0057 0.0233  200 LEU D CB  
3820 C CG  . LEU D 123 ? 0.5846 0.3529 0.5742 -0.0294 -0.0073 0.0275  200 LEU D CG  
3821 C CD1 . LEU D 123 ? 0.5777 0.3577 0.5843 -0.0254 -0.0181 0.0295  200 LEU D CD1 
3822 C CD2 . LEU D 123 ? 0.5623 0.3389 0.5613 -0.0196 0.0109  0.0281  200 LEU D CD2 
3823 N N   . TYR D 124 ? 0.5379 0.2839 0.4921 -0.0549 -0.0513 0.0278  201 TYR D N   
3824 C CA  . TYR D 124 ? 0.5495 0.2984 0.5150 -0.0676 -0.0691 0.0289  201 TYR D CA  
3825 C C   . TYR D 124 ? 0.6254 0.3982 0.6392 -0.0675 -0.0710 0.0338  201 TYR D C   
3826 O O   . TYR D 124 ? 0.6324 0.4206 0.6694 -0.0570 -0.0680 0.0384  201 TYR D O   
3827 C CB  . TYR D 124 ? 0.5799 0.3249 0.5264 -0.0708 -0.0882 0.0322  201 TYR D CB  
3828 C CG  . TYR D 124 ? 0.6177 0.3402 0.5159 -0.0717 -0.0842 0.0275  201 TYR D CG  
3829 C CD1 . TYR D 124 ? 0.6562 0.3602 0.5262 -0.0816 -0.0874 0.0195  201 TYR D CD1 
3830 C CD2 . TYR D 124 ? 0.6340 0.3534 0.5167 -0.0624 -0.0750 0.0299  201 TYR D CD2 
3831 C CE1 . TYR D 124 ? 0.6679 0.3517 0.4941 -0.0803 -0.0804 0.0143  201 TYR D CE1 
3832 C CE2 . TYR D 124 ? 0.6712 0.3735 0.5138 -0.0625 -0.0683 0.0260  201 TYR D CE2 
3833 C CZ  . TYR D 124 ? 0.7662 0.4510 0.5800 -0.0704 -0.0703 0.0184  201 TYR D CZ  
3834 O OH  . TYR D 124 ? 0.7180 0.3865 0.4930 -0.0686 -0.0612 0.0141  201 TYR D OH  
3835 N N   . THR D 125 ? 0.5988 0.3742 0.6294 -0.0791 -0.0741 0.0322  202 THR D N   
3836 C CA  . THR D 125 ? 0.5834 0.3848 0.6654 -0.0814 -0.0750 0.0373  202 THR D CA  
3837 C C   . THR D 125 ? 0.6095 0.4189 0.7074 -0.0975 -0.0999 0.0372  202 THR D C   
3838 O O   . THR D 125 ? 0.6103 0.4351 0.7460 -0.1073 -0.1011 0.0383  202 THR D O   
3839 C CB  . THR D 125 ? 0.6714 0.4731 0.7668 -0.0798 -0.0509 0.0371  202 THR D CB  
3840 O OG1 . THR D 125 ? 0.7558 0.5333 0.8270 -0.0911 -0.0475 0.0315  202 THR D OG1 
3841 C CG2 . THR D 125 ? 0.5799 0.3805 0.6632 -0.0622 -0.0307 0.0377  202 THR D CG2 
3842 N N   . ASP D 126 ? 0.5414 0.3408 0.6093 -0.1003 -0.1197 0.0363  203 ASP D N   
3843 C CA  . ASP D 126 ? 0.5609 0.3637 0.6286 -0.1145 -0.1471 0.0348  203 ASP D CA  
3844 C C   . ASP D 126 ? 0.6186 0.4453 0.7111 -0.1085 -0.1677 0.0453  203 ASP D C   
3845 O O   . ASP D 126 ? 0.6127 0.4355 0.6904 -0.0954 -0.1657 0.0514  203 ASP D O   
3846 C CB  . ASP D 126 ? 0.6096 0.3802 0.6164 -0.1206 -0.1528 0.0261  203 ASP D CB  
3847 C CG  . ASP D 126 ? 0.7154 0.4797 0.7114 -0.1391 -0.1762 0.0180  203 ASP D CG  
3848 O OD1 . ASP D 126 ? 0.7034 0.4883 0.7189 -0.1439 -0.2019 0.0230  203 ASP D OD1 
3849 O OD2 . ASP D 126 ? 0.8093 0.5466 0.7743 -0.1481 -0.1701 0.0061  203 ASP D OD2 
3850 N N   . LYS D 127 ? 0.5828 0.4341 0.7146 -0.1185 -0.1885 0.0478  204 LYS D N   
3851 C CA  . LYS D 127 ? 0.5785 0.4555 0.7393 -0.1122 -0.2109 0.0592  204 LYS D CA  
3852 C C   . LYS D 127 ? 0.7003 0.5634 0.8152 -0.1135 -0.2363 0.0622  204 LYS D C   
3853 O O   . LYS D 127 ? 0.7154 0.5934 0.8454 -0.1036 -0.2517 0.0746  204 LYS D O   
3854 C CB  . LYS D 127 ? 0.5839 0.4979 0.8097 -0.1204 -0.2234 0.0623  204 LYS D CB  
3855 N N   . THR D 128 ? 0.6801 0.5127 0.7368 -0.1237 -0.2381 0.0518  205 THR D N   
3856 C CA  . THR D 128 ? 0.7141 0.5297 0.7172 -0.1248 -0.2576 0.0539  205 THR D CA  
3857 C C   . THR D 128 ? 0.7768 0.5902 0.7712 -0.1069 -0.2526 0.0686  205 THR D C   
3858 O O   . THR D 128 ? 0.7413 0.5449 0.7338 -0.0968 -0.2266 0.0686  205 THR D O   
3859 C CB  . THR D 128 ? 0.7305 0.5102 0.6720 -0.1331 -0.2475 0.0395  205 THR D CB  
3860 O OG1 . THR D 128 ? 0.7409 0.5181 0.6925 -0.1495 -0.2506 0.0257  205 THR D OG1 
3861 C CG2 . THR D 128 ? 0.6983 0.4602 0.5800 -0.1347 -0.2652 0.0408  205 THR D CG2 
3862 N N   . TYR D 129 ? 0.7529 0.5744 0.7415 -0.1036 -0.2785 0.0812  206 TYR D N   
3863 C CA  . TYR D 129 ? 0.7425 0.5607 0.7262 -0.0878 -0.2779 0.0978  206 TYR D CA  
3864 C C   . TYR D 129 ? 0.7565 0.5473 0.7036 -0.0810 -0.2507 0.0966  206 TYR D C   
3865 O O   . TYR D 129 ? 0.7273 0.5181 0.6924 -0.0681 -0.2394 0.1058  206 TYR D O   
3866 C CB  . TYR D 129 ? 0.8038 0.6240 0.7634 -0.0884 -0.3101 0.1105  206 TYR D CB  
3867 C CG  . TYR D 129 ? 0.8766 0.6665 0.7605 -0.0942 -0.3117 0.1080  206 TYR D CG  
3868 C CD1 . TYR D 129 ? 0.9193 0.6976 0.7662 -0.1097 -0.3177 0.0910  206 TYR D CD1 
3869 C CD2 . TYR D 129 ? 0.9047 0.6752 0.7543 -0.0843 -0.3034 0.1215  206 TYR D CD2 
3870 C CE1 . TYR D 129 ? 0.9642 0.7139 0.7398 -0.1134 -0.3156 0.0873  206 TYR D CE1 
3871 C CE2 . TYR D 129 ? 0.9497 0.6937 0.7305 -0.0892 -0.3003 0.1197  206 TYR D CE2 
3872 C CZ  . TYR D 129 ? 1.0760 0.8102 0.8189 -0.1028 -0.3060 0.1022  206 TYR D CZ  
3873 O OH  . TYR D 129 ? 1.1427 0.8508 0.8162 -0.1059 -0.3010 0.0997  206 TYR D OH  
3874 N N   . ALA D 130 ? 0.7332 0.5011 0.6309 -0.0897 -0.2411 0.0847  207 ALA D N   
3875 C CA  . ALA D 130 ? 0.7291 0.4745 0.5934 -0.0850 -0.2154 0.0818  207 ALA D CA  
3876 C C   . ALA D 130 ? 0.7552 0.4869 0.5976 -0.0933 -0.1999 0.0639  207 ALA D C   
3877 O O   . ALA D 130 ? 0.7419 0.4685 0.5657 -0.1051 -0.2127 0.0543  207 ALA D O   
3878 C CB  . ALA D 130 ? 0.7731 0.5008 0.5878 -0.0833 -0.2212 0.0923  207 ALA D CB  
3879 N N   . MET D 131 ? 0.6775 0.4038 0.5259 -0.0868 -0.1733 0.0591  208 MET D N   
3880 C CA  . MET D 131 ? 0.6541 0.3667 0.4856 -0.0902 -0.1544 0.0447  208 MET D CA  
3881 C C   . MET D 131 ? 0.7133 0.4121 0.5163 -0.0824 -0.1339 0.0454  208 MET D C   
3882 O O   . MET D 131 ? 0.7198 0.4227 0.5298 -0.0750 -0.1314 0.0560  208 MET D O   
3883 C CB  . MET D 131 ? 0.6433 0.3697 0.5200 -0.0885 -0.1427 0.0401  208 MET D CB  
3884 C CG  . MET D 131 ? 0.6966 0.4370 0.6039 -0.0989 -0.1588 0.0375  208 MET D CG  
3885 S SD  . MET D 131 ? 0.8005 0.5209 0.6700 -0.1165 -0.1728 0.0238  208 MET D SD  
3886 C CE  . MET D 131 ? 0.7460 0.4446 0.6027 -0.1160 -0.1433 0.0113  208 MET D CE  
3887 N N   . GLY D 132 ? 0.6576 0.3398 0.4302 -0.0845 -0.1198 0.0343  209 GLY D N   
3888 C CA  . GLY D 132 ? 0.6449 0.3175 0.3933 -0.0775 -0.1001 0.0342  209 GLY D CA  
3889 C C   . GLY D 132 ? 0.7243 0.3774 0.4357 -0.0798 -0.0885 0.0217  209 GLY D C   
3890 O O   . GLY D 132 ? 0.7359 0.3785 0.4357 -0.0880 -0.0969 0.0123  209 GLY D O   
3891 N N   . HIS D 133 ? 0.6889 0.3371 0.3844 -0.0724 -0.0687 0.0209  210 HIS D N   
3892 C CA  . HIS D 133 ? 0.7033 0.3336 0.3664 -0.0710 -0.0541 0.0093  210 HIS D CA  
3893 C C   . HIS D 133 ? 0.8050 0.4287 0.4333 -0.0670 -0.0419 0.0120  210 HIS D C   
3894 O O   . HIS D 133 ? 0.8027 0.4367 0.4363 -0.0654 -0.0420 0.0240  210 HIS D O   
3895 C CB  . HIS D 133 ? 0.6734 0.3062 0.3593 -0.0636 -0.0376 0.0032  210 HIS D CB  
3896 C CG  . HIS D 133 ? 0.6736 0.3254 0.3872 -0.0542 -0.0269 0.0103  210 HIS D CG  
3897 N ND1 . HIS D 133 ? 0.6748 0.3436 0.4265 -0.0531 -0.0334 0.0159  210 HIS D ND1 
3898 C CD2 . HIS D 133 ? 0.6751 0.3319 0.3840 -0.0460 -0.0109 0.0113  210 HIS D CD2 
3899 C CE1 . HIS D 133 ? 0.6386 0.3193 0.4039 -0.0449 -0.0223 0.0188  210 HIS D CE1 
3900 N NE2 . HIS D 133 ? 0.6427 0.3184 0.3852 -0.0411 -0.0095 0.0165  210 HIS D NE2 
3901 N N   . LEU D 134 ? 0.7947 0.4003 0.3886 -0.0654 -0.0300 0.0009  211 LEU D N   
3902 C CA  . LEU D 134 ? 0.8147 0.4141 0.3741 -0.0606 -0.0141 0.0018  211 LEU D CA  
3903 C C   . LEU D 134 ? 0.8905 0.4898 0.4566 -0.0497 0.0090  -0.0056 211 LEU D C   
3904 O O   . LEU D 134 ? 0.9251 0.5111 0.4911 -0.0479 0.0119  -0.0169 211 LEU D O   
3905 C CB  . LEU D 134 ? 0.8623 0.4383 0.3670 -0.0665 -0.0199 -0.0062 211 LEU D CB  
3906 C CG  . LEU D 134 ? 0.9302 0.5008 0.4219 -0.0781 -0.0476 -0.0052 211 LEU D CG  
3907 C CD1 . LEU D 134 ? 0.9697 0.5149 0.4047 -0.0827 -0.0510 -0.0181 211 LEU D CD1 
3908 C CD2 . LEU D 134 ? 0.9843 0.5697 0.4831 -0.0798 -0.0590 0.0135  211 LEU D CD2 
3909 N N   . ILE D 135 ? 0.8240 0.4384 0.3983 -0.0425 0.0250  0.0014  212 ILE D N   
3910 C CA  . ILE D 135 ? 0.8132 0.4316 0.3930 -0.0306 0.0468  -0.0042 212 ILE D CA  
3911 C C   . ILE D 135 ? 0.9159 0.5195 0.4501 -0.0287 0.0601  -0.0086 212 ILE D C   
3912 O O   . ILE D 135 ? 0.9340 0.5446 0.4547 -0.0315 0.0641  0.0009  212 ILE D O   
3913 C CB  . ILE D 135 ? 0.8073 0.4544 0.4272 -0.0244 0.0550  0.0044  212 ILE D CB  
3914 C CG1 . ILE D 135 ? 0.7651 0.4226 0.4231 -0.0234 0.0449  0.0046  212 ILE D CG1 
3915 C CG2 . ILE D 135 ? 0.8230 0.4773 0.4426 -0.0121 0.0774  0.0004  212 ILE D CG2 
3916 C CD1 . ILE D 135 ? 0.8228 0.5071 0.5188 -0.0206 0.0462  0.0120  212 ILE D CD1 
3917 N N   . GLN D 136 ? 0.8996 0.4795 0.4073 -0.0248 0.0662  -0.0229 213 GLN D N   
3918 C CA  . GLN D 136 ? 0.9347 0.4946 0.3925 -0.0224 0.0785  -