data_3V81
# 
_entry.id   3V81 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V81         
NDB   NA1483       
RCSB  RCSB069711   
WWPDB D_1000069711 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3V4I . unspecified 
PDB 3V6D . unspecified 
PDB 1RTD . unspecified 
PDB 2ZD1 . unspecified 
PDB 1VRT . unspecified 
PDB 3KLE . unspecified 
PDB 3KLF . unspecified 
PDB 3JSM . unspecified 
# 
_pdbx_database_status.entry_id                        3V81 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-22 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Das, K.'        1 
'Martinez, S.E.' 2 
'Arnold, E.'     3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.' 
Nat.Struct.Mol.Biol.   19  253   259   2012 ?      US 1545-9993 ?    ? 22266819 10.1038/nsmb.2223       
1       
;Structural basis for the role of the K65R mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
;
J.Biol.Chem.           284 35092 35100 2009 JBCHA3 US 0021-9258 0071 ? 19812032 10.1074/jbc.M109.022525 
2       'Structural basis of HIV-1 resistance to AZT by excision.' Nat.Struct.Mol.Biol.   17  1202  1209  2010 ?      US 1545-9993 
?    ? 20852643 10.1038/nsmb.1908       
3       
;High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: strategic flexibility explains potency against resistance mutations.
;
Proc.Natl.Acad.Sci.USA 105 1466  1471  2008 PNASA6 US 0027-8424 0040 ? 18230722 10.1073/pnas.0711209105 
4       
;Roles of conformational and positional adaptability in structure-based design of TMC125-R165335 (etravirine) and related non-nucleoside reverse transcriptase inhibitors that are highly potent and effective against wild-type and drug-resistant HIV-1 variants.
;
J.Med.Chem.            47  2550  2560  2004 JMCMAR US 0022-2623 0151 ? 15115397 10.1021/jm030558s       
5       'Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.' 
Science                282 1669  1675  1998 SCIEAS US 0036-8075 0038 ? 9831551  ?                       
6       'High resolution structures of HIV-1 RT from four RT-inhibitor complexes.' Nat.Struct.Biol.       2   293   302   1995 
NSBIEW US 1072-8368 2024 ? 7540934  10.1038/NSB0495-293     
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Das, K.'            1  
primary 'Martinez, S.E.'     2  
primary 'Bauman, J.D.'       3  
primary 'Arnold, E.'         4  
1       'Das, K.'            5  
1       'Bandwar, R.P.'      6  
1       'White, K.L.'        7  
1       'Feng, J.Y.'         8  
1       'Sarafianos, S.G.'   9  
1       'Tuske, S.'          10 
1       'Tu, X.'             11 
1       'Clark, A.D.'        12 
1       'Boyer, P.L.'        13 
1       'Hou, X.'            14 
1       'Gaffney, B.L.'      15 
1       'Jones, R.A.'        16 
1       'Miller, M.D.'       17 
1       'Hughes, S.H.'       18 
1       'Arnold, E.'         19 
2       'Tu, X.'             20 
2       'Das, K.'            21 
2       'Han, Q.'            22 
2       'Bauman, J.D.'       23 
2       'Clark, A.D.'        24 
2       'Hou, X.'            25 
2       'Frenkel, Y.V.'      26 
2       'Gaffney, B.L.'      27 
2       'Jones, R.A.'        28 
2       'Boyer, P.L.'        29 
2       'Hughes, S.H.'       30 
2       'Sarafianos, S.G.'   31 
2       'Arnold, E.'         32 
3       'Das, K.'            33 
3       'Bauman, J.D.'       34 
3       'Clark, A.D.'        35 
3       'Frenkel, Y.V.'      36 
3       'Lewi, P.J.'         37 
3       'Shatkin, A.J.'      38 
3       'Hughes, S.H.'       39 
3       'Arnold, E.'         40 
4       'Das, K.'            41 
4       'Clark, A.D.'        42 
4       'Lewi, P.J.'         43 
4       'Heeres, J.'         44 
4       'De Jonge, M.R.'     45 
4       'Koymans, L.M.'      46 
4       'Vinkers, H.M.'      47 
4       'Daeyaert, F.'       48 
4       'Ludovici, D.W.'     49 
4       'Kukla, M.J.'        50 
4       'De Corte, B.'       51 
4       'Kavash, R.W.'       52 
4       'Ho, C.Y.'           53 
4       'Ye, H.'             54 
4       'Lichtenstein, M.A.' 55 
4       'Andries, K.'        56 
4       'Pauwels, R.'        57 
4       'De Bethune, M.P.'   58 
4       'Boyer, P.L.'        59 
4       'Clark, P.'          60 
4       'Hughes, S.H.'       61 
4       'Janssen, P.A.'      62 
4       'Arnold, E.'         63 
5       'Huang, H.'          64 
5       'Chopra, R.'         65 
5       'Verdine, G.L.'      66 
5       'Harrison, S.C.'     67 
6       'Ren, J.'            68 
6       'Esnouf, R.'         69 
6       'Garman, E.'         70 
6       'Somers, D.'         71 
6       'Ross, C.'           72 
6       'Kirby, I.'          73 
6       'Keeling, J.'        74 
6       'Darby, G.'          75 
6       'Jones, Y.'          76 
6       'Stuart, D.'         77 
# 
_cell.entry_id           3V81 
_cell.length_a           89.822 
_cell.length_b           132.052 
_cell.length_c           142.732 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.84 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V81 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 Reverse Transcriptase P66 subunit'                                                         64022.414 2 
'2.7.7.49, 2.7.7.7' 'Q258C, C280S, D498N' 'UNP Residues 600-1153' ? 
2 polymer     man 'HIV-1 Reverse Transcriptase P51 subunit'                                                         50039.488 2 
'2.7.7.49, 2.7.7.7' ?                     'UNP Residues 600-1027' ? 
3 polymer     syn 
;DNA (5'-D(*AP*TP*GP*GP*AP*AP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*CP*TP*GP*TP*G)-3')
;
8416.424  2 ?                   ?                     ?                       ? 
4 polymer     syn 
;DNA (5'-D(*A*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*(MRG)P*CP*GP*CP*CP*(ATM))-3')
;
6490.267  2 ?                   ?                     ?                       ? 
5 non-polymer syn "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE"              266.298   2 ? 
?                     ?                       ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
A,C ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
B,D ? 
3 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DA)(DA)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGAAGGCGCCCGAACAGGGACTGTG T,E ? 
4 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(MRG)(DC)(DG)(DC)
(DC)(ATM)
;
ACAGTCCCTGTTCGGGCGCCT P,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   ILE n 
1 5   SER n 
1 6   PRO n 
1 7   ILE n 
1 8   GLU n 
1 9   THR n 
1 10  VAL n 
1 11  PRO n 
1 12  VAL n 
1 13  LYS n 
1 14  LEU n 
1 15  LYS n 
1 16  PRO n 
1 17  GLY n 
1 18  MET n 
1 19  ASP n 
1 20  GLY n 
1 21  PRO n 
1 22  LYS n 
1 23  VAL n 
1 24  LYS n 
1 25  GLN n 
1 26  TRP n 
1 27  PRO n 
1 28  LEU n 
1 29  THR n 
1 30  GLU n 
1 31  GLU n 
1 32  LYS n 
1 33  ILE n 
1 34  LYS n 
1 35  ALA n 
1 36  LEU n 
1 37  VAL n 
1 38  GLU n 
1 39  ILE n 
1 40  CYS n 
1 41  THR n 
1 42  GLU n 
1 43  MET n 
1 44  GLU n 
1 45  LYS n 
1 46  GLU n 
1 47  GLY n 
1 48  LYS n 
1 49  ILE n 
1 50  SER n 
1 51  LYS n 
1 52  ILE n 
1 53  GLY n 
1 54  PRO n 
1 55  GLU n 
1 56  ASN n 
1 57  PRO n 
1 58  TYR n 
1 59  ASN n 
1 60  THR n 
1 61  PRO n 
1 62  VAL n 
1 63  PHE n 
1 64  ALA n 
1 65  ILE n 
1 66  LYS n 
1 67  LYS n 
1 68  LYS n 
1 69  ASP n 
1 70  SER n 
1 71  THR n 
1 72  LYS n 
1 73  TRP n 
1 74  ARG n 
1 75  LYS n 
1 76  LEU n 
1 77  VAL n 
1 78  ASP n 
1 79  PHE n 
1 80  ARG n 
1 81  GLU n 
1 82  LEU n 
1 83  ASN n 
1 84  LYS n 
1 85  ARG n 
1 86  THR n 
1 87  GLN n 
1 88  ASP n 
1 89  PHE n 
1 90  TRP n 
1 91  GLU n 
1 92  VAL n 
1 93  GLN n 
1 94  LEU n 
1 95  GLY n 
1 96  ILE n 
1 97  PRO n 
1 98  HIS n 
1 99  PRO n 
1 100 ALA n 
1 101 GLY n 
1 102 LEU n 
1 103 LYS n 
1 104 LYS n 
1 105 LYS n 
1 106 LYS n 
1 107 SER n 
1 108 VAL n 
1 109 THR n 
1 110 VAL n 
1 111 LEU n 
1 112 ASP n 
1 113 VAL n 
1 114 GLY n 
1 115 ASP n 
1 116 ALA n 
1 117 TYR n 
1 118 PHE n 
1 119 SER n 
1 120 VAL n 
1 121 PRO n 
1 122 LEU n 
1 123 ASP n 
1 124 GLU n 
1 125 ASP n 
1 126 PHE n 
1 127 ARG n 
1 128 LYS n 
1 129 TYR n 
1 130 THR n 
1 131 ALA n 
1 132 PHE n 
1 133 THR n 
1 134 ILE n 
1 135 PRO n 
1 136 SER n 
1 137 ILE n 
1 138 ASN n 
1 139 ASN n 
1 140 GLU n 
1 141 THR n 
1 142 PRO n 
1 143 GLY n 
1 144 ILE n 
1 145 ARG n 
1 146 TYR n 
1 147 GLN n 
1 148 TYR n 
1 149 ASN n 
1 150 VAL n 
1 151 LEU n 
1 152 PRO n 
1 153 GLN n 
1 154 GLY n 
1 155 TRP n 
1 156 LYS n 
1 157 GLY n 
1 158 SER n 
1 159 PRO n 
1 160 ALA n 
1 161 ILE n 
1 162 PHE n 
1 163 GLN n 
1 164 SER n 
1 165 SER n 
1 166 MET n 
1 167 THR n 
1 168 LYS n 
1 169 ILE n 
1 170 LEU n 
1 171 GLU n 
1 172 PRO n 
1 173 PHE n 
1 174 LYS n 
1 175 LYS n 
1 176 GLN n 
1 177 ASN n 
1 178 PRO n 
1 179 ASP n 
1 180 ILE n 
1 181 VAL n 
1 182 ILE n 
1 183 TYR n 
1 184 GLN n 
1 185 TYR n 
1 186 MET n 
1 187 ASP n 
1 188 ASP n 
1 189 LEU n 
1 190 TYR n 
1 191 VAL n 
1 192 GLY n 
1 193 SER n 
1 194 ASP n 
1 195 LEU n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 GLN n 
1 200 HIS n 
1 201 ARG n 
1 202 THR n 
1 203 LYS n 
1 204 ILE n 
1 205 GLU n 
1 206 GLU n 
1 207 LEU n 
1 208 ARG n 
1 209 GLN n 
1 210 HIS n 
1 211 LEU n 
1 212 LEU n 
1 213 ARG n 
1 214 TRP n 
1 215 GLY n 
1 216 LEU n 
1 217 THR n 
1 218 THR n 
1 219 PRO n 
1 220 ASP n 
1 221 LYS n 
1 222 LYS n 
1 223 HIS n 
1 224 GLN n 
1 225 LYS n 
1 226 GLU n 
1 227 PRO n 
1 228 PRO n 
1 229 PHE n 
1 230 LEU n 
1 231 TRP n 
1 232 MET n 
1 233 GLY n 
1 234 TYR n 
1 235 GLU n 
1 236 LEU n 
1 237 HIS n 
1 238 PRO n 
1 239 ASP n 
1 240 LYS n 
1 241 TRP n 
1 242 THR n 
1 243 VAL n 
1 244 GLN n 
1 245 PRO n 
1 246 ILE n 
1 247 VAL n 
1 248 LEU n 
1 249 PRO n 
1 250 GLU n 
1 251 LYS n 
1 252 ASP n 
1 253 SER n 
1 254 TRP n 
1 255 THR n 
1 256 VAL n 
1 257 ASN n 
1 258 ASP n 
1 259 ILE n 
1 260 CYS n 
1 261 LYS n 
1 262 LEU n 
1 263 VAL n 
1 264 GLY n 
1 265 LYS n 
1 266 LEU n 
1 267 ASN n 
1 268 TRP n 
1 269 ALA n 
1 270 SER n 
1 271 GLN n 
1 272 ILE n 
1 273 TYR n 
1 274 PRO n 
1 275 GLY n 
1 276 ILE n 
1 277 LYS n 
1 278 VAL n 
1 279 ARG n 
1 280 GLN n 
1 281 LEU n 
1 282 SER n 
1 283 LYS n 
1 284 LEU n 
1 285 LEU n 
1 286 ARG n 
1 287 GLY n 
1 288 THR n 
1 289 LYS n 
1 290 ALA n 
1 291 LEU n 
1 292 THR n 
1 293 GLU n 
1 294 VAL n 
1 295 ILE n 
1 296 PRO n 
1 297 LEU n 
1 298 THR n 
1 299 GLU n 
1 300 GLU n 
1 301 ALA n 
1 302 GLU n 
1 303 LEU n 
1 304 GLU n 
1 305 LEU n 
1 306 ALA n 
1 307 GLU n 
1 308 ASN n 
1 309 ARG n 
1 310 GLU n 
1 311 ILE n 
1 312 LEU n 
1 313 LYS n 
1 314 GLU n 
1 315 PRO n 
1 316 VAL n 
1 317 HIS n 
1 318 GLY n 
1 319 VAL n 
1 320 TYR n 
1 321 TYR n 
1 322 ASP n 
1 323 PRO n 
1 324 SER n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 ILE n 
1 329 ALA n 
1 330 GLU n 
1 331 ILE n 
1 332 GLN n 
1 333 LYS n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 GLY n 
1 338 GLN n 
1 339 TRP n 
1 340 THR n 
1 341 TYR n 
1 342 GLN n 
1 343 ILE n 
1 344 TYR n 
1 345 GLN n 
1 346 GLU n 
1 347 PRO n 
1 348 PHE n 
1 349 LYS n 
1 350 ASN n 
1 351 LEU n 
1 352 LYS n 
1 353 THR n 
1 354 GLY n 
1 355 LYS n 
1 356 TYR n 
1 357 ALA n 
1 358 ARG n 
1 359 MET n 
1 360 ARG n 
1 361 GLY n 
1 362 ALA n 
1 363 HIS n 
1 364 THR n 
1 365 ASN n 
1 366 ASP n 
1 367 VAL n 
1 368 LYS n 
1 369 GLN n 
1 370 LEU n 
1 371 THR n 
1 372 GLU n 
1 373 ALA n 
1 374 VAL n 
1 375 GLN n 
1 376 LYS n 
1 377 ILE n 
1 378 THR n 
1 379 THR n 
1 380 GLU n 
1 381 SER n 
1 382 ILE n 
1 383 VAL n 
1 384 ILE n 
1 385 TRP n 
1 386 GLY n 
1 387 LYS n 
1 388 THR n 
1 389 PRO n 
1 390 LYS n 
1 391 PHE n 
1 392 LYS n 
1 393 LEU n 
1 394 PRO n 
1 395 ILE n 
1 396 GLN n 
1 397 LYS n 
1 398 GLU n 
1 399 THR n 
1 400 TRP n 
1 401 GLU n 
1 402 THR n 
1 403 TRP n 
1 404 TRP n 
1 405 THR n 
1 406 GLU n 
1 407 TYR n 
1 408 TRP n 
1 409 GLN n 
1 410 ALA n 
1 411 THR n 
1 412 TRP n 
1 413 ILE n 
1 414 PRO n 
1 415 GLU n 
1 416 TRP n 
1 417 GLU n 
1 418 PHE n 
1 419 VAL n 
1 420 ASN n 
1 421 THR n 
1 422 PRO n 
1 423 PRO n 
1 424 LEU n 
1 425 VAL n 
1 426 LYS n 
1 427 LEU n 
1 428 TRP n 
1 429 TYR n 
1 430 GLN n 
1 431 LEU n 
1 432 GLU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 ILE n 
1 437 VAL n 
1 438 GLY n 
1 439 ALA n 
1 440 GLU n 
1 441 THR n 
1 442 PHE n 
1 443 TYR n 
1 444 VAL n 
1 445 ASP n 
1 446 GLY n 
1 447 ALA n 
1 448 ALA n 
1 449 ASN n 
1 450 ARG n 
1 451 GLU n 
1 452 THR n 
1 453 LYS n 
1 454 LEU n 
1 455 GLY n 
1 456 LYS n 
1 457 ALA n 
1 458 GLY n 
1 459 TYR n 
1 460 VAL n 
1 461 THR n 
1 462 ASN n 
1 463 LYS n 
1 464 GLY n 
1 465 ARG n 
1 466 GLN n 
1 467 LYS n 
1 468 VAL n 
1 469 VAL n 
1 470 PRO n 
1 471 LEU n 
1 472 THR n 
1 473 ASN n 
1 474 THR n 
1 475 THR n 
1 476 ASN n 
1 477 GLN n 
1 478 LYS n 
1 479 THR n 
1 480 GLU n 
1 481 LEU n 
1 482 GLN n 
1 483 ALA n 
1 484 ILE n 
1 485 TYR n 
1 486 LEU n 
1 487 ALA n 
1 488 LEU n 
1 489 GLN n 
1 490 ASP n 
1 491 SER n 
1 492 GLY n 
1 493 LEU n 
1 494 GLU n 
1 495 VAL n 
1 496 ASN n 
1 497 ILE n 
1 498 VAL n 
1 499 THR n 
1 500 ASN n 
1 501 SER n 
1 502 GLN n 
1 503 TYR n 
1 504 ALA n 
1 505 LEU n 
1 506 GLY n 
1 507 ILE n 
1 508 ILE n 
1 509 GLN n 
1 510 ALA n 
1 511 GLN n 
1 512 PRO n 
1 513 ASP n 
1 514 LYS n 
1 515 SER n 
1 516 GLU n 
1 517 SER n 
1 518 GLU n 
1 519 LEU n 
1 520 VAL n 
1 521 ASN n 
1 522 GLN n 
1 523 ILE n 
1 524 ILE n 
1 525 GLU n 
1 526 GLN n 
1 527 LEU n 
1 528 ILE n 
1 529 LYS n 
1 530 LYS n 
1 531 GLU n 
1 532 LYS n 
1 533 VAL n 
1 534 TYR n 
1 535 LEU n 
1 536 ALA n 
1 537 TRP n 
1 538 VAL n 
1 539 PRO n 
1 540 ALA n 
1 541 HIS n 
1 542 LYS n 
1 543 GLY n 
1 544 ILE n 
1 545 GLY n 
1 546 GLY n 
1 547 ASN n 
1 548 GLU n 
1 549 GLN n 
1 550 VAL n 
1 551 ASP n 
1 552 LYS n 
1 553 LEU n 
1 554 VAL n 
1 555 SER n 
1 556 ALA n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 LYS n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
3 1   DA  n 
3 2   DT  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DG  n 
3 8   DG  n 
3 9   DC  n 
3 10  DG  n 
3 11  DC  n 
3 12  DC  n 
3 13  DC  n 
3 14  DG  n 
3 15  DA  n 
3 16  DA  n 
3 17  DC  n 
3 18  DA  n 
3 19  DG  n 
3 20  DG  n 
3 21  DG  n 
3 22  DA  n 
3 23  DC  n 
3 24  DT  n 
3 25  DG  n 
3 26  DT  n 
3 27  DG  n 
4 1   DA  n 
4 2   DC  n 
4 3   DA  n 
4 4   DG  n 
4 5   DT  n 
4 6   DC  n 
4 7   DC  n 
4 8   DC  n 
4 9   DT  n 
4 10  DG  n 
4 11  DT  n 
4 12  DT  n 
4 13  DC  n 
4 14  DG  n 
4 15  DG  n 
4 16  MRG n 
4 17  DC  n 
4 18  DG  n 
4 19  DC  n 
4 20  DC  n 
4 21  ATM n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HIV-1 ? gag-pol ? 'BH10 ISOLATE' ? ? ? ? 'Human immunodeficiency virus type 1 BH10' 11678 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Plasmid ? ? ? ? ? ? 
2 1 sample ? ? ? HIV-1 ? gag-pol ? 'BH10 isolate' ? ? ? ? 'Human immunodeficiency virus type 1 BH10' 11678 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Plasmid ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? ? ? ? Synthesized 
4 1 sample ? ? ? ? ? Synthesized 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1B1 P03366 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
600 ? 
2 UNP POL_HV1B1 P03366 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
600 ? 
3 PDB 3V81      3V81   3 ATGGAAGGCGCCCGAACAGGGACTGTG 701 ? 
4 PDB 3V81      3V81   4 ACAGTCCCTGTTCGGGCGCCT 802 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V81 A 3 ? 556 ? P03366 600 ? 1153 ? 1   554 
2 2 3V81 B 1 ? 428 ? P03366 600 ? 1027 ? 1   428 
3 1 3V81 C 3 ? 556 ? P03366 600 ? 1153 ? 1   554 
4 2 3V81 D 1 ? 428 ? P03366 600 ? 1027 ? 1   428 
5 3 3V81 T 1 ? 27  ? 3V81   701 ? 727  ? 701 727 
6 4 3V81 P 1 ? 21  ? 3V81   802 ? 822  ? 802 822 
7 3 3V81 E 1 ? 27  ? 3V81   701 ? 727  ? 701 727 
8 4 3V81 F 1 ? 21  ? 3V81   802 ? 822  ? 802 822 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V81 MET A 1   ? UNP P03366 ?   ?    'EXPRESSION TAG'      -1  1  
1 3V81 VAL A 2   ? UNP P03366 ?   ?    'EXPRESSION TAG'      0   2  
1 3V81 CYS A 260 ? UNP P03366 GLN 857  'ENGINEERED MUTATION' 258 3  
1 3V81 SER A 282 ? UNP P03366 CYS 879  'ENGINEERED MUTATION' 280 4  
1 3V81 ASN A 500 ? UNP P03366 ASP 1097 'ENGINEERED MUTATION' 498 5  
2 3V81 SER B 280 ? UNP P03366 CYS 879  'ENGINEERED MUTATION' 280 6  
3 3V81 MET C 1   ? UNP P03366 ?   ?    'EXPRESSION TAG'      -1  7  
3 3V81 VAL C 2   ? UNP P03366 ?   ?    'EXPRESSION TAG'      0   8  
3 3V81 CYS C 260 ? UNP P03366 GLN 857  'ENGINEERED MUTATION' 258 9  
3 3V81 SER C 282 ? UNP P03366 CYS 879  'ENGINEERED MUTATION' 280 10 
3 3V81 ASN C 500 ? UNP P03366 ASP 1097 'ENGINEERED MUTATION' 498 11 
4 3V81 SER D 280 ? UNP P03366 CYS 879  'ENGINEERED MUTATION' 280 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                              ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                             ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                           ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                      ? 'C4 H7 N O4' 
133.103 
ATM 'DNA linking'       n "3'-AZIDO-3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE"                                        ? 'C10 H14 N5 O7 P' 
347.221 
CYS 'L-peptide linking' y CYSTEINE                                                                             ? 'C3 H7 N O2 S' 
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                 ? 'C10 H14 N5 O6 P' 
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                  ? 'C9 H14 N3 O7 P' 
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                 ? 'C10 H14 N5 O7 P' 
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                         ? 'C10 H15 N2 O8 P' 
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                            ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                      ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                              ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                            ? 'C6 H10 N3 O2 1' 
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                           ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                               ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                           ? 'C5 H11 N O2 S' 
149.211 
MRG 'DNA linking'       n "N2-(3-MERCAPTOPROPYL)-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                           ? 
'C13 H20 N5 O7 P S' 421.366 
NVP non-polymer         . "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 
'NON-NUCLEOSIDE RT INHIBITOR NEVIRAPINE' 'C15 H14 N4 O'      266.298 
PHE 'L-peptide linking' y PHENYLALANINE                                                                        ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                              ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                               ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                            ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                           ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                             ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                               ? 'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3V81 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.22 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, ammonium sulfate, sucrose, glycerol, magnesium chloride, Bis-Tris propane , pH 6.8, VAPOR DIFFUSION, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2011-03-13 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Rh coated Si' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_wavelength_list        0.918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
# 
_reflns.entry_id                     3V81 
_reflns.d_resolution_high            2.850 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   75389 
_reflns.pdbx_Rmerge_I_obs            0.090 
_reflns.pdbx_netI_over_sigmaI        10.100 
_reflns.pdbx_chi_squared             1.214 
_reflns.pdbx_redundancy              3.600 
_reflns.percent_possible_obs         99.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -1.0 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.850 2.900  ? ? ? 0.618 ? ? 1.088 2.900 ? 3706 97.700 1  1 
2.900 2.950  ? ? ? 0.577 ? ? 1.131 3.000 ? 3653 98.100 2  1 
2.950 3.010  ? ? ? 0.522 ? ? 1.129 3.100 ? 3775 98.500 3  1 
3.010 3.070  ? ? ? 0.506 ? ? 1.165 3.100 ? 3758 98.800 4  1 
3.070 3.140  ? ? ? 0.408 ? ? 1.196 3.200 ? 3741 99.000 5  1 
3.140 3.210  ? ? ? 0.374 ? ? 1.260 3.300 ? 3768 99.100 6  1 
3.210 3.290  ? ? ? 0.321 ? ? 1.280 3.400 ? 3765 99.500 7  1 
3.290 3.380  ? ? ? 0.269 ? ? 1.311 3.500 ? 3767 99.500 8  1 
3.380 3.480  ? ? ? 0.213 ? ? 1.295 3.600 ? 3822 99.600 9  1 
3.480 3.590  ? ? ? 0.173 ? ? 1.339 3.700 ? 3787 99.700 10 1 
3.590 3.720  ? ? ? 0.137 ? ? 1.308 3.800 ? 3795 99.700 11 1 
3.720 3.870  ? ? ? 0.112 ? ? 1.293 3.900 ? 3765 99.700 12 1 
3.870 4.040  ? ? ? 0.092 ? ? 1.284 3.900 ? 3803 99.600 13 1 
4.040 4.260  ? ? ? 0.075 ? ? 1.251 4.000 ? 3786 99.700 14 1 
4.260 4.520  ? ? ? 0.064 ? ? 1.202 4.100 ? 3804 99.600 15 1 
4.520 4.870  ? ? ? 0.059 ? ? 1.200 4.100 ? 3789 99.600 16 1 
4.870 5.360  ? ? ? 0.057 ? ? 1.073 4.100 ? 3821 99.800 17 1 
5.360 6.130  ? ? ? 0.060 ? ? 1.151 4.100 ? 3842 99.800 18 1 
6.130 7.720  ? ? ? 0.057 ? ? 1.201 4.200 ? 3839 99.800 19 1 
7.720 40.000 ? ? ? 0.055 ? ? 1.087 4.000 ? 3603 92.100 20 1 
# 
_refine.entry_id                                 3V81 
_refine.ls_d_res_high                            2.8503 
_refine.ls_d_res_low                             38.4130 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.6800 
_refine.ls_number_reflns_obs                     75359 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2520 
_refine.ls_R_factor_R_work                       0.2505 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.298 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 3.0300 
_refine.ls_number_reflns_R_free                  2287 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               82.9103 
_refine.solvent_model_param_bsol                 54.0130 
_refine.solvent_model_param_ksol                 0.2930 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -2.1261 
_refine.aniso_B[2][2]                            5.1163 
_refine.aniso_B[3][3]                            -2.9902 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            2.7078 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.9400 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3V6D' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7429 
_refine.B_iso_max                                199.740 
_refine.B_iso_min                                18.310 
_refine.pdbx_overall_phase_error                 32.5200 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15824 
_refine_hist.pdbx_number_atoms_nucleic_acid   1646 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               17510 
_refine_hist.d_res_high                       2.8503 
_refine_hist.d_res_low                        38.4130 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           18152 0.010  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          24992 1.337  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     2718  0.091  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      2878  0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 6950  18.556 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.8503 2.9123  16 93.0000  4322 . 0.3912 0.4495 . 121 . 4443 . . 'X-RAY DIFFRACTION' 
2.9123 2.9800  16 98.0000  4517 . 0.3635 0.4280 . 135 . 4652 . . 'X-RAY DIFFRACTION' 
2.9800 3.0545  16 99.0000  4544 . 0.3502 0.3582 . 151 . 4695 . . 'X-RAY DIFFRACTION' 
3.0545 3.1370  16 99.0000  4582 . 0.3325 0.3543 . 137 . 4719 . . 'X-RAY DIFFRACTION' 
3.1370 3.2293  16 99.0000  4529 . 0.3066 0.3405 . 149 . 4678 . . 'X-RAY DIFFRACTION' 
3.2293 3.3335  16 99.0000  4595 . 0.2904 0.3453 . 163 . 4758 . . 'X-RAY DIFFRACTION' 
3.3335 3.4525  16 100.0000 4614 . 0.2735 0.3420 . 142 . 4756 . . 'X-RAY DIFFRACTION' 
3.4525 3.5907  16 100.0000 4590 . 0.2595 0.3284 . 151 . 4741 . . 'X-RAY DIFFRACTION' 
3.5907 3.7540  16 100.0000 4619 . 0.2456 0.2657 . 138 . 4757 . . 'X-RAY DIFFRACTION' 
3.7540 3.9517  16 100.0000 4574 . 0.2278 0.2709 . 141 . 4715 . . 'X-RAY DIFFRACTION' 
3.9517 4.1990  16 100.0000 4605 . 0.2110 0.2565 . 151 . 4756 . . 'X-RAY DIFFRACTION' 
4.1990 4.5228  16 100.0000 4616 . 0.2026 0.2497 . 157 . 4773 . . 'X-RAY DIFFRACTION' 
4.5228 4.9770  16 100.0000 4634 . 0.2035 0.2653 . 145 . 4779 . . 'X-RAY DIFFRACTION' 
4.9770 5.6952  16 100.0000 4639 . 0.2146 0.2698 . 134 . 4773 . . 'X-RAY DIFFRACTION' 
5.6952 7.1677  16 100.0000 4659 . 0.2507 0.3282 . 129 . 4788 . . 'X-RAY DIFFRACTION' 
7.1677 38.4166 16 93.0000  4433 . 0.2249 0.2658 . 143 . 4576 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3V81 
_struct.title                     
'Crystal structure of HIV-1 reverse transcriptase (RT) with DNA and the nonnucleoside inhibitor nevirapine' 
_struct.pdbx_descriptor           
'HIV-1 Reverse Transcriptase P66 subunit (E.C.2.7.7.49, 2.7.7.7), HIV-1 Reverse Transcriptase P51 subunit (E.C.2.7.7.49, 2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V81 
_struct_keywords.text            
;P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, DNA, recombination, RNA-directed DNA polymerase, viramune, DNA polymerase, endonuclease, hydrolase, multifunctional enzyme, transferase, TRANSFERASE-DNA complex, AZT, ZIDOVUDINE
;
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 31  ? LYS A 34  ? GLU A 29  LYS A 32  5 ? 4  
HELX_P HELX_P2  2  ALA A 35  ? GLY A 47  ? ALA A 33  GLY A 45  1 ? 13 
HELX_P HELX_P3  3  PHE A 79  ? ARG A 85  ? PHE A 77  ARG A 83  1 ? 7  
HELX_P HELX_P4  4  HIS A 98  ? LEU A 102 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P5  5  ALA A 116 ? VAL A 120 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P6  6  ASP A 123 ? ALA A 131 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P7  7  GLY A 157 ? ASN A 177 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P8  8  GLU A 196 ? ARG A 213 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P9  9  THR A 255 ? SER A 270 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 10 VAL A 278 ? LEU A 285 ? VAL A 276 LEU A 283 1 ? 8  
HELX_P HELX_P11 11 THR A 298 ? GLU A 314 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 12 ASN A 365 ? GLY A 386 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 13 GLN A 396 ? TYR A 407 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 14 THR A 475 ? ASP A 490 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 15 SER A 501 ? ALA A 510 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 16 SER A 517 ? LYS A 530 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 17 GLY A 546 ? ALA A 556 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P18 18 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 19 PHE B 77  ? LEU B 92  ? PHE B 77  LEU B 92  1 ? 16 
HELX_P HELX_P20 20 GLY B 112 ? SER B 117 ? GLY B 112 SER B 117 5 ? 6  
HELX_P HELX_P21 21 PHE B 124 ? THR B 128 ? PHE B 124 THR B 128 5 ? 5  
HELX_P HELX_P22 22 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P23 23 LYS B 154 ? PHE B 160 ? LYS B 154 PHE B 160 1 ? 7  
HELX_P HELX_P24 24 PHE B 160 ? ASN B 175 ? PHE B 160 ASN B 175 1 ? 16 
HELX_P HELX_P25 25 GLU B 194 ? TRP B 212 ? GLU B 194 TRP B 212 1 ? 19 
HELX_P HELX_P26 26 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P27 27 THR B 253 ? SER B 268 ? THR B 253 SER B 268 1 ? 16 
HELX_P HELX_P28 28 VAL B 276 ? LEU B 282 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P29 29 THR B 296 ? LEU B 310 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P30 30 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P31 31 GLN B 394 ? TRP B 406 ? GLN B 394 TRP B 406 1 ? 13 
HELX_P HELX_P32 32 VAL B 423 ? TYR B 427 ? VAL B 423 TYR B 427 5 ? 5  
HELX_P HELX_P33 33 LYS C 32  ? CYS C 40  ? LYS C 30  CYS C 38  1 ? 9  
HELX_P HELX_P34 34 ARG C 80  ? THR C 86  ? ARG C 78  THR C 84  1 ? 7  
HELX_P HELX_P35 35 HIS C 98  ? LEU C 102 ? HIS C 96  LEU C 100 5 ? 5  
HELX_P HELX_P36 36 ALA C 116 ? VAL C 120 ? ALA C 114 VAL C 118 5 ? 5  
HELX_P HELX_P37 37 ASP C 123 ? THR C 130 ? ASP C 121 THR C 128 5 ? 8  
HELX_P HELX_P38 38 GLY C 157 ? ASN C 177 ? GLY C 155 ASN C 175 1 ? 21 
HELX_P HELX_P39 39 GLU C 196 ? ARG C 213 ? GLU C 194 ARG C 211 1 ? 18 
HELX_P HELX_P40 40 THR C 255 ? SER C 270 ? THR C 253 SER C 268 1 ? 16 
HELX_P HELX_P41 41 THR C 298 ? GLU C 314 ? THR C 296 GLU C 312 1 ? 17 
HELX_P HELX_P42 42 ASN C 365 ? GLY C 386 ? ASN C 363 GLY C 384 1 ? 22 
HELX_P HELX_P43 43 GLN C 396 ? TYR C 407 ? GLN C 394 TYR C 405 1 ? 12 
HELX_P HELX_P44 44 THR C 475 ? SER C 491 ? THR C 473 SER C 489 1 ? 17 
HELX_P HELX_P45 45 SER C 501 ? ALA C 510 ? SER C 499 ALA C 508 1 ? 10 
HELX_P HELX_P46 46 SER C 517 ? LYS C 530 ? SER C 515 LYS C 528 1 ? 14 
HELX_P HELX_P47 47 ILE C 544 ? ALA C 556 ? ILE C 542 ALA C 554 1 ? 13 
HELX_P HELX_P48 48 THR D 27  ? GLU D 44  ? THR D 27  GLU D 44  1 ? 18 
HELX_P HELX_P49 49 PHE D 77  ? THR D 84  ? PHE D 77  THR D 84  1 ? 8  
HELX_P HELX_P50 50 THR D 84  ? GLU D 89  ? THR D 84  GLU D 89  1 ? 6  
HELX_P HELX_P51 51 GLY D 99  ? LYS D 103 ? GLY D 99  LYS D 103 5 ? 5  
HELX_P HELX_P52 52 GLY D 112 ? SER D 117 ? GLY D 112 SER D 117 5 ? 6  
HELX_P HELX_P53 53 PHE D 124 ? THR D 128 ? PHE D 124 THR D 128 5 ? 5  
HELX_P HELX_P54 54 SER D 134 ? GLU D 138 ? SER D 134 GLU D 138 5 ? 5  
HELX_P HELX_P55 55 GLY D 155 ? PHE D 160 ? GLY D 155 PHE D 160 1 ? 6  
HELX_P HELX_P56 56 PHE D 160 ? LYS D 173 ? PHE D 160 LYS D 173 1 ? 14 
HELX_P HELX_P57 57 GLU D 194 ? ARG D 211 ? GLU D 194 ARG D 211 1 ? 18 
HELX_P HELX_P58 58 HIS D 235 ? TRP D 239 ? HIS D 235 TRP D 239 5 ? 5  
HELX_P HELX_P59 59 VAL D 254 ? SER D 268 ? VAL D 254 SER D 268 1 ? 15 
HELX_P HELX_P60 60 VAL D 276 ? LYS D 281 ? VAL D 276 LYS D 281 1 ? 6  
HELX_P HELX_P61 61 LEU D 282 ? ARG D 284 ? LEU D 282 ARG D 284 5 ? 3  
HELX_P HELX_P62 62 THR D 296 ? GLU D 312 ? THR D 296 GLU D 312 1 ? 17 
HELX_P HELX_P63 63 ASN D 363 ? GLY D 384 ? ASN D 363 GLY D 384 1 ? 22 
HELX_P HELX_P64 64 GLN D 394 ? TRP D 406 ? GLN D 394 TRP D 406 1 ? 13 
HELX_P HELX_P65 65 LEU D 422 ? TYR D 427 ? LEU D 422 TYR D 427 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? F DG  15  "O3'" ? ? ? 1_555 F MRG 16 P   ? ? P DG  816 P MRG 817 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale2   covale ? ? F MRG 16  "O3'" ? ? ? 1_555 F DC  17 P   ? ? P MRG 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.615 ? 
covale3   covale ? ? F DC  20  "O3'" ? ? ? 1_555 F ATM 21 P   ? ? P DC  821 P ATM 822 1_555 ? ? ? ? ? ? ?            1.615 ? 
covale4   covale ? ? H DG  15  "O3'" ? ? ? 1_555 H MRG 16 P   ? ? F DG  816 F MRG 817 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale5   covale ? ? H MRG 16  "O3'" ? ? ? 1_555 H DC  17 P   ? ? F MRG 817 F DC  818 1_555 ? ? ? ? ? ? ?            1.611 ? 
covale6   covale ? ? H DC  20  "O3'" ? ? ? 1_555 H ATM 21 P   ? ? F DC  821 F ATM 822 1_555 ? ? ? ? ? ? ?            1.649 ? 
covale7   covale ? ? A CYS 260 SG    ? ? ? 1_555 F MRG 16 S24 ? ? A CYS 258 P MRG 817 1_555 ? ? ? ? ? ? ?            2.008 ? 
covale8   covale ? ? C CYS 260 SG    ? ? ? 1_555 H MRG 16 S24 ? ? C CYS 258 F MRG 817 1_555 ? ? ? ? ? ? ?            2.010 ? 
hydrog1   hydrog ? ? E DA  6   N1    ? ? ? 1_555 F ATM 21 N3  ? ? T DA  706 P ATM 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? E DA  6   N6    ? ? ? 1_555 F ATM 21 O4  ? ? T DA  706 P ATM 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? E DG  7   N1    ? ? ? 1_555 F DC  20 N3  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? E DG  7   N2    ? ? ? 1_555 F DC  20 O2  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? E DG  7   O6    ? ? ? 1_555 F DC  20 N4  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? E DG  8   N1    ? ? ? 1_555 F DC  19 N3  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? E DG  8   N2    ? ? ? 1_555 F DC  19 O2  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? E DG  8   O6    ? ? ? 1_555 F DC  19 N4  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? E DC  9   N3    ? ? ? 1_555 F DG  18 N1  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? E DC  9   N4    ? ? ? 1_555 F DG  18 O6  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? E DC  9   O2    ? ? ? 1_555 F DG  18 N2  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? E DG  10  N1    ? ? ? 1_555 F DC  17 N3  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? E DG  10  N2    ? ? ? 1_555 F DC  17 O2  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? E DG  10  O6    ? ? ? 1_555 F DC  17 N4  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? E DC  11  N3    ? ? ? 1_555 F MRG 16 N1  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? E DC  11  N4    ? ? ? 1_555 F MRG 16 O6  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? E DC  11  O2    ? ? ? 1_555 F MRG 16 N2  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? E DC  12  N3    ? ? ? 1_555 F DG  15 N1  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? E DC  12  N4    ? ? ? 1_555 F DG  15 O6  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? E DC  12  O2    ? ? ? 1_555 F DG  15 N2  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? E DC  13  N3    ? ? ? 1_555 F DG  14 N1  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? E DC  13  N4    ? ? ? 1_555 F DG  14 O6  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? E DC  13  O2    ? ? ? 1_555 F DG  14 N2  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? E DG  14  N1    ? ? ? 1_555 F DC  13 N3  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? E DG  14  N2    ? ? ? 1_555 F DC  13 O2  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? E DG  14  O6    ? ? ? 1_555 F DC  13 N4  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? E DA  15  N1    ? ? ? 1_555 F DT  12 N3  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? E DA  15  N6    ? ? ? 1_555 F DT  12 O4  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? E DA  16  N1    ? ? ? 1_555 F DT  11 N3  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? E DA  16  N6    ? ? ? 1_555 F DT  11 O4  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? E DC  17  N3    ? ? ? 1_555 F DG  10 N1  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? E DC  17  N4    ? ? ? 1_555 F DG  10 O6  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? E DC  17  O2    ? ? ? 1_555 F DG  10 N2  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? E DA  18  N1    ? ? ? 1_555 F DT  9  N3  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? E DA  18  N6    ? ? ? 1_555 F DT  9  O4  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? E DG  19  N1    ? ? ? 1_555 F DC  8  N3  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? E DG  19  N2    ? ? ? 1_555 F DC  8  O2  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? E DG  19  O6    ? ? ? 1_555 F DC  8  N4  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? E DG  20  N1    ? ? ? 1_555 F DC  7  N3  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? E DG  20  N2    ? ? ? 1_555 F DC  7  O2  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? E DG  20  O6    ? ? ? 1_555 F DC  7  N4  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? E DG  21  N1    ? ? ? 1_555 F DC  6  N3  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? E DG  21  N2    ? ? ? 1_555 F DC  6  O2  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? E DG  21  O6    ? ? ? 1_555 F DC  6  N4  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? E DA  22  N1    ? ? ? 1_555 F DT  5  N3  ? ? T DA  722 P DT  806 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog46  hydrog ? ? E DC  23  N4    ? ? ? 1_555 F DG  4  O6  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog47  hydrog ? ? E DT  24  N3    ? ? ? 1_555 F DA  3  N1  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? E DT  24  O4    ? ? ? 1_555 F DA  3  N6  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? E DG  25  N1    ? ? ? 1_555 F DC  2  N3  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? E DG  25  N2    ? ? ? 1_555 F DC  2  O2  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? E DG  25  O6    ? ? ? 1_555 F DC  2  N4  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? G DA  6   N1    ? ? ? 1_555 H ATM 21 N3  ? ? E DA  706 F ATM 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? G DA  6   N6    ? ? ? 1_555 H ATM 21 O4  ? ? E DA  706 F ATM 822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? G DG  7   N1    ? ? ? 1_555 H DC  20 N3  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? G DG  7   N2    ? ? ? 1_555 H DC  20 O2  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? G DG  7   O6    ? ? ? 1_555 H DC  20 N4  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? G DG  8   N1    ? ? ? 1_555 H DC  19 N3  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? G DG  8   N2    ? ? ? 1_555 H DC  19 O2  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? G DG  8   O6    ? ? ? 1_555 H DC  19 N4  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? G DC  9   N3    ? ? ? 1_555 H DG  18 N1  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? G DC  9   N4    ? ? ? 1_555 H DG  18 O6  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? G DC  9   O2    ? ? ? 1_555 H DG  18 N2  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? G DG  10  N1    ? ? ? 1_555 H DC  17 N3  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? G DG  10  N2    ? ? ? 1_555 H DC  17 O2  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? G DG  10  O6    ? ? ? 1_555 H DC  17 N4  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? G DC  11  N4    ? ? ? 1_555 H DG  15 O6  ? ? E DC  711 F DG  816 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog67  hydrog ? ? G DC  11  N3    ? ? ? 1_555 H MRG 16 N1  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? G DC  11  N4    ? ? ? 1_555 H MRG 16 O6  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? G DC  11  O2    ? ? ? 1_555 H MRG 16 N2  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? G DC  12  N3    ? ? ? 1_555 H DG  15 N1  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? G DC  12  N4    ? ? ? 1_555 H DG  15 O6  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? G DC  12  O2    ? ? ? 1_555 H DG  15 N2  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? G DC  13  O2    ? ? ? 1_555 H DG  14 N2  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog74  hydrog ? ? G DG  14  N1    ? ? ? 1_555 H DC  13 N3  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? G DG  14  N2    ? ? ? 1_555 H DC  13 O2  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? G DG  14  O6    ? ? ? 1_555 H DC  13 N4  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? G DA  15  N1    ? ? ? 1_555 H DT  12 N3  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? G DA  15  N6    ? ? ? 1_555 H DT  12 O4  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? G DA  16  N1    ? ? ? 1_555 H DT  11 N3  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? G DA  16  N6    ? ? ? 1_555 H DT  11 O4  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? G DC  17  O2    ? ? ? 1_555 H DG  10 N1  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog82  hydrog ? ? G DA  18  N1    ? ? ? 1_555 H DT  9  N3  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? G DA  18  N6    ? ? ? 1_555 H DT  9  O4  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? G DG  19  N1    ? ? ? 1_555 H DC  8  N3  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? G DG  19  N2    ? ? ? 1_555 H DC  8  O2  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? G DG  19  O6    ? ? ? 1_555 H DC  8  N4  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? G DG  20  N1    ? ? ? 1_555 H DC  7  N3  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? G DG  20  N2    ? ? ? 1_555 H DC  7  O2  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? G DG  20  O6    ? ? ? 1_555 H DC  7  N4  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? G DG  21  N1    ? ? ? 1_555 H DC  6  N3  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? G DG  21  N2    ? ? ? 1_555 H DC  6  O2  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? G DG  21  O6    ? ? ? 1_555 H DC  6  N4  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? G DA  22  N1    ? ? ? 1_555 H DT  5  N3  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? G DA  22  N6    ? ? ? 1_555 H DT  5  O4  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? G DC  23  N4    ? ? ? 1_555 H DG  4  O6  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog96  hydrog ? ? G DT  24  N3    ? ? ? 1_555 H DA  3  N1  ? ? E DT  724 F DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? G DT  24  O4    ? ? ? 1_555 H DA  3  N6  ? ? E DT  724 F DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? G DG  25  N1    ? ? ? 1_555 H DC  2  N3  ? ? E DG  725 F DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? G DG  25  N2    ? ? ? 1_555 H DC  2  O2  ? ? E DG  725 F DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? G DG  25  O6    ? ? ? 1_555 H DC  2  N4  ? ? E DG  725 F DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 227 A . ? PRO 225 A PRO 228 A ? PRO 226 A 1 10.49  
2 PRO 422 A . ? PRO 420 A PRO 423 A ? PRO 421 A 1 1.36   
3 PRO 227 C . ? PRO 225 C PRO 228 C ? PRO 226 C 1 -10.51 
4 PRO 422 C . ? PRO 420 C PRO 423 C ? PRO 421 C 1 1.13   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 3 ? 
D ? 5 ? 
E ? 2 ? 
F ? 5 ? 
G ? 3 ? 
H ? 2 ? 
I ? 3 ? 
J ? 5 ? 
K ? 2 ? 
L ? 3 ? 
M ? 3 ? 
N ? 5 ? 
O ? 2 ? 
P ? 5 ? 
Q ? 3 ? 
R ? 2 ? 
S ? 4 ? 
T ? 2 ? 
U ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? parallel      
N 4 5 ? parallel      
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
P 4 5 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? parallel      
U 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 49  ? SER A 50  ? ILE A 47  SER A 48  
A 2 GLN A 147 ? TYR A 148 ? GLN A 145 TYR A 146 
B 1 SER A 107 ? ASP A 112 ? SER A 105 ASP A 110 
B 2 ASP A 188 ? SER A 193 ? ASP A 186 SER A 191 
B 3 VAL A 181 ? TYR A 185 ? VAL A 179 TYR A 183 
C 1 PHE A 229 ? TRP A 231 ? PHE A 227 TRP A 229 
C 2 TYR A 234 ? LEU A 236 ? TYR A 232 LEU A 234 
C 3 TRP A 241 ? VAL A 243 ? TRP A 239 VAL A 241 
D 1 ASN A 350 ? TYR A 356 ? ASN A 348 TYR A 354 
D 2 TRP A 339 ? TYR A 344 ? TRP A 337 TYR A 342 
D 3 ILE A 328 ? LYS A 333 ? ILE A 326 LYS A 331 
D 4 LYS A 390 ? LEU A 393 ? LYS A 388 LEU A 391 
D 5 TRP A 416 ? PHE A 418 ? TRP A 414 PHE A 416 
E 1 HIS A 363 ? THR A 364 ? HIS A 361 THR A 362 
E 2 LYS A 514 ? SER A 515 ? LYS A 512 SER A 513 
F 1 GLN A 466 ? THR A 472 ? GLN A 464 THR A 470 
F 2 LEU A 454 ? THR A 461 ? LEU A 452 THR A 459 
F 3 GLU A 440 ? ALA A 448 ? GLU A 438 ALA A 446 
F 4 GLU A 494 ? THR A 499 ? GLU A 492 THR A 497 
F 5 LYS A 532 ? TRP A 537 ? LYS A 530 TRP A 535 
G 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
G 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
G 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
H 1 VAL B 60  ? ILE B 63  ? VAL B 60  ILE B 63  
H 2 ARG B 72  ? VAL B 75  ? ARG B 72  VAL B 75  
I 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
I 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
I 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
J 1 LYS B 347 ? TYR B 354 ? LYS B 347 TYR B 354 
J 2 GLN B 336 ? GLU B 344 ? GLN B 336 GLU B 344 
J 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
J 4 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
J 5 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
K 1 ILE C 49  ? LYS C 51  ? ILE C 47  LYS C 49  
K 2 TYR C 146 ? TYR C 148 ? TYR C 144 TYR C 146 
L 1 SER C 107 ? ASP C 112 ? SER C 105 ASP C 110 
L 2 ASP C 188 ? SER C 193 ? ASP C 186 SER C 191 
L 3 VAL C 181 ? TYR C 185 ? VAL C 179 TYR C 183 
M 1 PHE C 229 ? TRP C 231 ? PHE C 227 TRP C 229 
M 2 TYR C 234 ? LEU C 236 ? TYR C 232 LEU C 234 
M 3 TRP C 241 ? VAL C 243 ? TRP C 239 VAL C 241 
N 1 ASN C 350 ? TYR C 356 ? ASN C 348 TYR C 354 
N 2 GLN C 338 ? TYR C 344 ? GLN C 336 TYR C 342 
N 3 ILE C 328 ? GLY C 335 ? ILE C 326 GLY C 333 
N 4 LYS C 390 ? LEU C 393 ? LYS C 388 LEU C 391 
N 5 TRP C 416 ? PHE C 418 ? TRP C 414 PHE C 416 
O 1 HIS C 363 ? THR C 364 ? HIS C 361 THR C 362 
O 2 LYS C 514 ? SER C 515 ? LYS C 512 SER C 513 
P 1 GLN C 466 ? THR C 472 ? GLN C 464 THR C 470 
P 2 LEU C 454 ? THR C 461 ? LEU C 452 THR C 459 
P 3 GLU C 440 ? ASN C 449 ? GLU C 438 ASN C 447 
P 4 GLU C 494 ? THR C 499 ? GLU C 492 THR C 497 
P 5 LYS C 532 ? TRP C 537 ? LYS C 530 TRP C 535 
Q 1 ILE D 47  ? LYS D 49  ? ILE D 47  LYS D 49  
Q 2 ILE D 142 ? TYR D 146 ? ILE D 142 TYR D 146 
Q 3 PHE D 130 ? ILE D 132 ? PHE D 130 ILE D 132 
R 1 VAL D 60  ? ILE D 63  ? VAL D 60  ILE D 63  
R 2 ARG D 72  ? VAL D 75  ? ARG D 72  VAL D 75  
S 1 VAL D 179 ? TYR D 183 ? VAL D 179 TYR D 183 
S 2 ASP D 186 ? SER D 191 ? ASP D 186 SER D 191 
S 3 SER D 105 ? ASP D 110 ? SER D 105 ASP D 110 
S 4 GLU D 233 ? LEU D 234 ? GLU D 233 LEU D 234 
T 1 TRP D 252 ? THR D 253 ? TRP D 252 THR D 253 
T 2 VAL D 292 ? ILE D 293 ? VAL D 292 ILE D 293 
U 1 LYS D 347 ? TYR D 354 ? LYS D 347 TYR D 354 
U 2 GLN D 336 ? GLU D 344 ? GLN D 336 GLU D 344 
U 3 ILE D 326 ? GLY D 333 ? ILE D 326 GLY D 333 
U 4 LYS D 388 ? LEU D 391 ? LYS D 388 LEU D 391 
U 5 GLU D 413 ? PHE D 416 ? GLU D 413 PHE D 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 50  ? N SER A 48  O GLN A 147 ? O GLN A 145 
B 1 2 N LEU A 111 ? N LEU A 109 O LEU A 189 ? O LEU A 187 
B 2 3 O ASP A 188 ? O ASP A 186 N TYR A 185 ? N TYR A 183 
C 1 2 N PHE A 229 ? N PHE A 227 O LEU A 236 ? O LEU A 234 
C 2 3 N GLU A 235 ? N GLU A 233 O THR A 242 ? O THR A 240 
D 1 2 O LYS A 352 ? O LYS A 350 N ILE A 343 ? N ILE A 341 
D 2 3 O THR A 340 ? O THR A 338 N GLN A 332 ? N GLN A 330 
D 3 4 N ALA A 329 ? N ALA A 327 O LYS A 392 ? O LYS A 390 
D 4 5 N PHE A 391 ? N PHE A 389 O GLU A 417 ? O GLU A 415 
E 1 2 O THR A 364 ? O THR A 362 N LYS A 514 ? N LYS A 512 
F 1 2 O LEU A 471 ? O LEU A 469 N GLY A 455 ? N GLY A 453 
F 2 3 O VAL A 460 ? O VAL A 458 N TYR A 443 ? N TYR A 441 
F 3 4 N PHE A 442 ? N PHE A 440 O ASN A 496 ? O ASN A 494 
F 4 5 N ILE A 497 ? N ILE A 495 O TYR A 534 ? O TYR A 532 
G 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
G 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
H 1 2 N ILE B 63  ? N ILE B 63  O ARG B 72  ? O ARG B 72  
I 1 2 N THR B 107 ? N THR B 107 O VAL B 189 ? O VAL B 189 
I 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
J 1 2 O TYR B 354 ? O TYR B 354 N TRP B 337 ? N TRP B 337 
J 2 3 O THR B 338 ? O THR B 338 N GLN B 330 ? N GLN B 330 
J 3 4 N ALA B 327 ? N ALA B 327 O LYS B 388 ? O LYS B 388 
J 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
K 1 2 N SER C 50  ? N SER C 48  O GLN C 147 ? O GLN C 145 
L 1 2 N SER C 107 ? N SER C 105 O SER C 193 ? O SER C 191 
L 2 3 O TYR C 190 ? O TYR C 188 N TYR C 183 ? N TYR C 181 
M 1 2 N PHE C 229 ? N PHE C 227 O LEU C 236 ? O LEU C 234 
M 2 3 N GLU C 235 ? N GLU C 233 O THR C 242 ? O THR C 240 
N 1 2 O LYS C 352 ? O LYS C 350 N ILE C 343 ? N ILE C 341 
N 2 3 O THR C 340 ? O THR C 338 N GLN C 332 ? N GLN C 330 
N 3 4 N ALA C 329 ? N ALA C 327 O LYS C 392 ? O LYS C 390 
N 4 5 N PHE C 391 ? N PHE C 389 O GLU C 417 ? O GLU C 415 
O 1 2 N THR C 364 ? N THR C 362 O LYS C 514 ? O LYS C 512 
P 1 2 O LEU C 471 ? O LEU C 469 N GLY C 455 ? N GLY C 453 
P 2 3 O LEU C 454 ? O LEU C 452 N ASN C 449 ? N ASN C 447 
P 3 4 N PHE C 442 ? N PHE C 440 O VAL C 498 ? O VAL C 496 
P 4 5 N THR C 499 ? N THR C 497 O ALA C 536 ? O ALA C 534 
Q 1 2 N SER D 48  ? N SER D 48  O GLN D 145 ? O GLN D 145 
Q 2 3 O ILE D 142 ? O ILE D 142 N ILE D 132 ? N ILE D 132 
R 1 2 N PHE D 61  ? N PHE D 61  O LEU D 74  ? O LEU D 74  
S 1 2 N TYR D 181 ? N TYR D 181 O TYR D 188 ? O TYR D 188 
S 2 3 O VAL D 189 ? O VAL D 189 N THR D 107 ? N THR D 107 
S 3 4 N VAL D 106 ? N VAL D 106 O LEU D 234 ? O LEU D 234 
T 1 2 N TRP D 252 ? N TRP D 252 O ILE D 293 ? O ILE D 293 
U 1 2 O LYS D 350 ? O LYS D 350 N ILE D 341 ? N ILE D 341 
U 2 3 O THR D 338 ? O THR D 338 N GLN D 330 ? N GLN D 330 
U 3 4 N ALA D 327 ? N ALA D 327 O LYS D 388 ? O LYS D 388 
U 4 5 N LEU D 391 ? N LEU D 391 O GLU D 415 ? O GLU D 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NVP A 901' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NVP C 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 LEU A 102 ? LEU A 100 . ? 1_555 ? 
2  AC1 7 LYS A 103 ? LYS A 101 . ? 1_555 ? 
3  AC1 7 VAL A 181 ? VAL A 179 . ? 1_555 ? 
4  AC1 7 TYR A 183 ? TYR A 181 . ? 1_555 ? 
5  AC1 7 TYR A 190 ? TYR A 188 . ? 1_555 ? 
6  AC1 7 TRP A 231 ? TRP A 229 . ? 1_555 ? 
7  AC1 7 LEU A 236 ? LEU A 234 . ? 1_555 ? 
8  AC2 7 LEU C 102 ? LEU C 100 . ? 1_555 ? 
9  AC2 7 LYS C 103 ? LYS C 101 . ? 1_555 ? 
10 AC2 7 VAL C 181 ? VAL C 179 . ? 1_555 ? 
11 AC2 7 TYR C 183 ? TYR C 181 . ? 1_555 ? 
12 AC2 7 TYR C 190 ? TYR C 188 . ? 1_555 ? 
13 AC2 7 TRP C 231 ? TRP C 229 . ? 1_555 ? 
14 AC2 7 LEU C 236 ? LEU C 234 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3V81 
_atom_sites.fract_transf_matrix[1][1]   0.011133 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002132 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007573 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007133 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . VAL A 1 2   ? 47.412  49.960  6.995   1.00 87.44  ? 0   VAL A N     1 
ATOM   2     C CA    . VAL A 1 2   ? 47.687  49.281  8.256   1.00 90.33  ? 0   VAL A CA    1 
ATOM   3     C C     . VAL A 1 2   ? 47.517  50.220  9.479   1.00 93.03  ? 0   VAL A C     1 
ATOM   4     O O     . VAL A 1 2   ? 47.984  51.366  9.461   1.00 93.47  ? 0   VAL A O     1 
ATOM   5     C CB    . VAL A 1 2   ? 49.103  48.642  8.220   1.00 72.33  ? 0   VAL A CB    1 
ATOM   6     N N     . PRO A 1 3   ? 46.781  49.762  10.513  1.00 86.97  ? 1   PRO A N     1 
ATOM   7     C CA    . PRO A 1 3   ? 46.794  50.289  11.880  1.00 79.81  ? 1   PRO A CA    1 
ATOM   8     C C     . PRO A 1 3   ? 47.756  49.452  12.714  1.00 80.16  ? 1   PRO A C     1 
ATOM   9     O O     . PRO A 1 3   ? 48.407  48.561  12.165  1.00 80.19  ? 1   PRO A O     1 
ATOM   10    C CB    . PRO A 1 3   ? 45.361  50.066  12.344  1.00 81.23  ? 1   PRO A CB    1 
ATOM   11    C CG    . PRO A 1 3   ? 44.871  48.882  11.527  1.00 89.87  ? 1   PRO A CG    1 
ATOM   12    C CD    . PRO A 1 3   ? 45.867  48.614  10.412  1.00 90.22  ? 1   PRO A CD    1 
ATOM   13    N N     . ILE A 1 4   ? 47.844  49.706  14.012  1.00 75.82  ? 2   ILE A N     1 
ATOM   14    C CA    . ILE A 1 4   ? 48.808  48.986  14.839  1.00 72.48  ? 2   ILE A CA    1 
ATOM   15    C C     . ILE A 1 4   ? 48.140  48.252  16.014  1.00 74.09  ? 2   ILE A C     1 
ATOM   16    O O     . ILE A 1 4   ? 46.926  48.307  16.140  1.00 76.76  ? 2   ILE A O     1 
ATOM   17    C CB    . ILE A 1 4   ? 49.921  49.911  15.342  1.00 70.48  ? 2   ILE A CB    1 
ATOM   18    C CG1   . ILE A 1 4   ? 50.078  51.152  14.443  1.00 67.91  ? 2   ILE A CG1   1 
ATOM   19    C CG2   . ILE A 1 4   ? 51.209  49.116  15.453  1.00 68.90  ? 2   ILE A CG2   1 
ATOM   20    C CD1   . ILE A 1 4   ? 48.862  52.083  14.342  1.00 70.02  ? 2   ILE A CD1   1 
ATOM   21    N N     . SER A 1 5   ? 48.928  47.607  16.884  1.00 75.42  ? 3   SER A N     1 
ATOM   22    C CA    . SER A 1 5   ? 48.409  46.573  17.820  1.00 79.68  ? 3   SER A CA    1 
ATOM   23    C C     . SER A 1 5   ? 48.741  46.663  19.365  1.00 77.98  ? 3   SER A C     1 
ATOM   24    O O     . SER A 1 5   ? 49.729  46.086  19.840  1.00 76.82  ? 3   SER A O     1 
ATOM   25    C CB    . SER A 1 5   ? 48.831  45.199  17.268  1.00 74.98  ? 3   SER A CB    1 
ATOM   26    O OG    . SER A 1 5   ? 49.558  45.342  16.058  1.00 63.85  ? 3   SER A OG    1 
ATOM   27    N N     . PRO A 1 6   ? 47.904  47.366  20.151  1.00 72.27  ? 4   PRO A N     1 
ATOM   28    C CA    . PRO A 1 6   ? 48.362  47.740  21.500  1.00 67.90  ? 4   PRO A CA    1 
ATOM   29    C C     . PRO A 1 6   ? 48.544  46.650  22.570  1.00 68.09  ? 4   PRO A C     1 
ATOM   30    O O     . PRO A 1 6   ? 49.664  46.487  23.048  1.00 64.86  ? 4   PRO A O     1 
ATOM   31    C CB    . PRO A 1 6   ? 47.281  48.715  21.955  1.00 68.29  ? 4   PRO A CB    1 
ATOM   32    C CG    . PRO A 1 6   ? 46.034  48.229  21.267  1.00 69.33  ? 4   PRO A CG    1 
ATOM   33    C CD    . PRO A 1 6   ? 46.461  47.602  19.963  1.00 70.79  ? 4   PRO A CD    1 
ATOM   34    N N     . ILE A 1 7   ? 47.486  45.880  22.860  1.00 73.03  ? 5   ILE A N     1 
ATOM   35    C CA    . ILE A 1 7   ? 47.379  44.999  24.050  1.00 68.34  ? 5   ILE A CA    1 
ATOM   36    C C     . ILE A 1 7   ? 46.534  43.756  23.763  1.00 68.50  ? 5   ILE A C     1 
ATOM   37    O O     . ILE A 1 7   ? 45.546  43.831  23.030  1.00 69.33  ? 5   ILE A O     1 
ATOM   38    C CB    . ILE A 1 7   ? 46.660  45.687  25.263  1.00 68.22  ? 5   ILE A CB    1 
ATOM   39    C CG1   . ILE A 1 7   ? 45.195  45.969  24.943  1.00 68.49  ? 5   ILE A CG1   1 
ATOM   40    C CG2   . ILE A 1 7   ? 47.345  46.962  25.713  1.00 68.06  ? 5   ILE A CG2   1 
ATOM   41    C CD1   . ILE A 1 7   ? 44.627  47.154  25.684  1.00 71.16  ? 5   ILE A CD1   1 
ATOM   42    N N     . GLU A 1 8   ? 46.866  42.651  24.428  1.00 68.07  ? 6   GLU A N     1 
ATOM   43    C CA    . GLU A 1 8   ? 46.358  41.301  24.123  1.00 65.28  ? 6   GLU A CA    1 
ATOM   44    C C     . GLU A 1 8   ? 44.850  41.193  23.961  1.00 66.09  ? 6   GLU A C     1 
ATOM   45    O O     . GLU A 1 8   ? 44.086  41.774  24.715  1.00 69.22  ? 6   GLU A O     1 
ATOM   46    C CB    . GLU A 1 8   ? 46.774  40.376  25.239  1.00 67.65  ? 6   GLU A CB    1 
ATOM   47    C CG    . GLU A 1 8   ? 47.063  38.986  24.843  1.00 74.46  ? 6   GLU A CG    1 
ATOM   48    C CD    . GLU A 1 8   ? 48.091  38.386  25.781  1.00 90.04  ? 6   GLU A CD    1 
ATOM   49    O OE1   . GLU A 1 8   ? 49.281  38.767  25.679  1.00 84.00  ? 6   GLU A OE1   1 
ATOM   50    O OE2   . GLU A 1 8   ? 47.705  37.564  26.644  1.00 97.01  ? 6   GLU A OE2   1 
ATOM   51    N N     . THR A 1 9   ? 44.410  40.411  22.993  1.00 67.71  ? 7   THR A N     1 
ATOM   52    C CA    . THR A 1 9   ? 43.015  40.486  22.563  1.00 68.27  ? 7   THR A CA    1 
ATOM   53    C C     . THR A 1 9   ? 42.184  39.309  23.115  1.00 62.35  ? 7   THR A C     1 
ATOM   54    O O     . THR A 1 9   ? 42.727  38.239  23.401  1.00 61.33  ? 7   THR A O     1 
ATOM   55    C CB    . THR A 1 9   ? 42.931  40.632  21.008  1.00 69.16  ? 7   THR A CB    1 
ATOM   56    O OG1   . THR A 1 9   ? 41.584  40.891  20.594  1.00 71.00  ? 7   THR A OG1   1 
ATOM   57    C CG2   . THR A 1 9   ? 43.477  39.388  20.305  1.00 63.50  ? 7   THR A CG2   1 
ATOM   58    N N     . VAL A 1 10  ? 40.889  39.539  23.331  1.00 56.73  ? 8   VAL A N     1 
ATOM   59    C CA    . VAL A 1 10  ? 40.014  38.537  23.939  1.00 57.11  ? 8   VAL A CA    1 
ATOM   60    C C     . VAL A 1 10  ? 38.980  37.960  22.959  1.00 58.95  ? 8   VAL A C     1 
ATOM   61    O O     . VAL A 1 10  ? 38.099  38.679  22.477  1.00 56.20  ? 8   VAL A O     1 
ATOM   62    C CB    . VAL A 1 10  ? 39.319  39.095  25.222  1.00 57.31  ? 8   VAL A CB    1 
ATOM   63    C CG1   . VAL A 1 10  ? 38.097  38.278  25.613  1.00 56.25  ? 8   VAL A CG1   1 
ATOM   64    C CG2   . VAL A 1 10  ? 40.298  39.146  26.360  1.00 55.76  ? 8   VAL A CG2   1 
ATOM   65    N N     . PRO A 1 11  ? 39.082  36.642  22.686  1.00 57.58  ? 9   PRO A N     1 
ATOM   66    C CA    . PRO A 1 11  ? 38.236  35.889  21.760  1.00 54.23  ? 9   PRO A CA    1 
ATOM   67    C C     . PRO A 1 11  ? 36.783  36.143  22.026  1.00 56.00  ? 9   PRO A C     1 
ATOM   68    O O     . PRO A 1 11  ? 36.376  36.052  23.155  1.00 62.80  ? 9   PRO A O     1 
ATOM   69    C CB    . PRO A 1 11  ? 38.549  34.448  22.132  1.00 53.91  ? 9   PRO A CB    1 
ATOM   70    C CG    . PRO A 1 11  ? 39.956  34.487  22.577  1.00 53.06  ? 9   PRO A CG    1 
ATOM   71    C CD    . PRO A 1 11  ? 40.109  35.781  23.301  1.00 54.67  ? 9   PRO A CD    1 
ATOM   72    N N     . VAL A 1 12  ? 35.997  36.439  21.011  1.00 61.27  ? 10  VAL A N     1 
ATOM   73    C CA    . VAL A 1 12  ? 34.572  36.651  21.229  1.00 68.87  ? 10  VAL A CA    1 
ATOM   74    C C     . VAL A 1 12  ? 33.749  35.925  20.173  1.00 74.62  ? 10  VAL A C     1 
ATOM   75    O O     . VAL A 1 12  ? 33.991  36.069  18.975  1.00 76.64  ? 10  VAL A O     1 
ATOM   76    C CB    . VAL A 1 12  ? 34.210  38.143  21.211  1.00 63.58  ? 10  VAL A CB    1 
ATOM   77    C CG1   . VAL A 1 12  ? 32.784  38.351  21.674  1.00 63.25  ? 10  VAL A CG1   1 
ATOM   78    C CG2   . VAL A 1 12  ? 35.162  38.904  22.077  1.00 60.86  ? 10  VAL A CG2   1 
ATOM   79    N N     . LYS A 1 13  ? 32.791  35.127  20.625  1.00 74.41  ? 11  LYS A N     1 
ATOM   80    C CA    . LYS A 1 13  ? 31.892  34.436  19.720  1.00 74.70  ? 11  LYS A CA    1 
ATOM   81    C C     . LYS A 1 13  ? 30.511  35.071  19.715  1.00 79.61  ? 11  LYS A C     1 
ATOM   82    O O     . LYS A 1 13  ? 30.284  36.115  20.324  1.00 75.34  ? 11  LYS A O     1 
ATOM   83    C CB    . LYS A 1 13  ? 31.811  32.955  20.075  1.00 75.47  ? 11  LYS A CB    1 
ATOM   84    C CG    . LYS A 1 13  ? 33.114  32.224  19.830  1.00 76.52  ? 11  LYS A CG    1 
ATOM   85    C CD    . LYS A 1 13  ? 32.964  30.741  20.095  1.00 81.84  ? 11  LYS A CD    1 
ATOM   86    C CE    . LYS A 1 13  ? 33.985  29.919  19.299  1.00 89.74  ? 11  LYS A CE    1 
ATOM   87    N NZ    . LYS A 1 13  ? 35.409  30.308  19.540  1.00 87.76  ? 11  LYS A NZ    1 
ATOM   88    N N     . LEU A 1 14  ? 29.598  34.442  18.991  1.00 87.85  ? 12  LEU A N     1 
ATOM   89    C CA    . LEU A 1 14  ? 28.214  34.873  18.963  1.00 90.73  ? 12  LEU A CA    1 
ATOM   90    C C     . LEU A 1 14  ? 27.334  33.733  19.416  1.00 93.15  ? 12  LEU A C     1 
ATOM   91    O O     . LEU A 1 14  ? 27.678  32.568  19.219  1.00 95.41  ? 12  LEU A O     1 
ATOM   92    C CB    . LEU A 1 14  ? 27.825  35.272  17.553  1.00 96.05  ? 12  LEU A CB    1 
ATOM   93    C CG    . LEU A 1 14  ? 27.933  36.754  17.235  1.00 96.06  ? 12  LEU A CG    1 
ATOM   94    C CD1   . LEU A 1 14  ? 27.241  37.018  15.914  1.00 105.11 ? 12  LEU A CD1   1 
ATOM   95    C CD2   . LEU A 1 14  ? 27.288  37.561  18.345  1.00 94.62  ? 12  LEU A CD2   1 
ATOM   96    N N     . LYS A 1 15  ? 26.194  34.056  20.013  1.00 94.61  ? 13  LYS A N     1 
ATOM   97    C CA    . LYS A 1 15  ? 25.309  33.003  20.476  1.00 105.19 ? 13  LYS A CA    1 
ATOM   98    C C     . LYS A 1 15  ? 25.073  32.099  19.280  1.00 112.65 ? 13  LYS A C     1 
ATOM   99    O O     . LYS A 1 15  ? 24.518  32.533  18.271  1.00 112.53 ? 13  LYS A O     1 
ATOM   100   C CB    . LYS A 1 15  ? 23.987  33.577  20.989  1.00 103.69 ? 13  LYS A CB    1 
ATOM   101   C CG    . LYS A 1 15  ? 24.081  34.227  22.365  1.00 98.46  ? 13  LYS A CG    1 
ATOM   102   C CD    . LYS A 1 15  ? 22.725  34.732  22.858  1.00 99.68  ? 13  LYS A CD    1 
ATOM   103   C CE    . LYS A 1 15  ? 22.836  35.432  24.210  1.00 90.58  ? 13  LYS A CE    1 
ATOM   104   N NZ    . LYS A 1 15  ? 21.549  36.042  24.651  1.00 88.86  ? 13  LYS A NZ    1 
ATOM   105   N N     . PRO A 1 16  ? 25.476  30.826  19.396  1.00 115.12 ? 14  PRO A N     1 
ATOM   106   C CA    . PRO A 1 16  ? 25.555  29.974  18.207  1.00 118.66 ? 14  PRO A CA    1 
ATOM   107   C C     . PRO A 1 16  ? 24.281  30.092  17.386  1.00 122.43 ? 14  PRO A C     1 
ATOM   108   O O     . PRO A 1 16  ? 23.203  30.317  17.948  1.00 119.42 ? 14  PRO A O     1 
ATOM   109   C CB    . PRO A 1 16  ? 25.700  28.569  18.794  1.00 116.64 ? 14  PRO A CB    1 
ATOM   110   C CG    . PRO A 1 16  ? 26.378  28.792  20.097  1.00 116.71 ? 14  PRO A CG    1 
ATOM   111   C CD    . PRO A 1 16  ? 25.828  30.093  20.623  1.00 114.01 ? 14  PRO A CD    1 
ATOM   112   N N     . GLY A 1 17  ? 24.420  29.999  16.067  1.00 122.55 ? 15  GLY A N     1 
ATOM   113   C CA    . GLY A 1 17  ? 23.288  30.160  15.180  1.00 122.04 ? 15  GLY A CA    1 
ATOM   114   C C     . GLY A 1 17  ? 22.632  31.511  15.374  1.00 121.77 ? 15  GLY A C     1 
ATOM   115   O O     . GLY A 1 17  ? 21.434  31.594  15.650  1.00 118.64 ? 15  GLY A O     1 
ATOM   116   N N     . MET A 1 18  ? 23.431  32.569  15.260  1.00 119.76 ? 16  MET A N     1 
ATOM   117   C CA    . MET A 1 18  ? 22.911  33.934  15.224  1.00 121.24 ? 16  MET A CA    1 
ATOM   118   C C     . MET A 1 18  ? 23.899  34.858  14.507  1.00 119.84 ? 16  MET A C     1 
ATOM   119   O O     . MET A 1 18  ? 25.072  34.516  14.351  1.00 115.47 ? 16  MET A O     1 
ATOM   120   C CB    . MET A 1 18  ? 22.599  34.463  16.630  1.00 117.28 ? 16  MET A CB    1 
ATOM   121   C CG    . MET A 1 18  ? 21.512  33.709  17.383  1.00 118.43 ? 16  MET A CG    1 
ATOM   122   S SD    . MET A 1 18  ? 20.741  34.707  18.677  1.00 121.75 ? 16  MET A SD    1 
ATOM   123   C CE    . MET A 1 18  ? 19.793  33.472  19.575  1.00 120.68 ? 16  MET A CE    1 
ATOM   124   N N     . ASP A 1 19  ? 23.416  36.021  14.074  1.00 120.70 ? 17  ASP A N     1 
ATOM   125   C CA    . ASP A 1 19  ? 24.232  36.972  13.320  1.00 121.43 ? 17  ASP A CA    1 
ATOM   126   C C     . ASP A 1 19  ? 23.787  38.424  13.539  1.00 122.67 ? 17  ASP A C     1 
ATOM   127   O O     . ASP A 1 19  ? 22.683  38.680  14.021  1.00 122.06 ? 17  ASP A O     1 
ATOM   128   C CB    . ASP A 1 19  ? 24.213  36.624  11.829  1.00 121.23 ? 17  ASP A CB    1 
ATOM   129   C CG    . ASP A 1 19  ? 25.401  37.197  11.083  1.00 121.43 ? 17  ASP A CG    1 
ATOM   130   O OD1   . ASP A 1 19  ? 25.842  38.314  11.427  1.00 123.20 ? 17  ASP A OD1   1 
ATOM   131   O OD2   . ASP A 1 19  ? 25.903  36.527  10.158  1.00 118.57 ? 17  ASP A OD2   1 
ATOM   132   N N     . GLY A 1 20  ? 24.648  39.367  13.166  1.00 123.68 ? 18  GLY A N     1 
ATOM   133   C CA    . GLY A 1 20  ? 24.429  40.779  13.443  1.00 130.89 ? 18  GLY A CA    1 
ATOM   134   C C     . GLY A 1 20  ? 23.113  41.364  12.954  1.00 139.51 ? 18  GLY A C     1 
ATOM   135   O O     . GLY A 1 20  ? 22.525  40.872  11.993  1.00 141.09 ? 18  GLY A O     1 
ATOM   136   N N     . PRO A 1 21  ? 22.652  42.432  13.626  1.00 142.75 ? 19  PRO A N     1 
ATOM   137   C CA    . PRO A 1 21  ? 21.349  43.116  13.523  1.00 151.37 ? 19  PRO A CA    1 
ATOM   138   C C     . PRO A 1 21  ? 21.158  44.106  12.351  1.00 159.25 ? 19  PRO A C     1 
ATOM   139   O O     . PRO A 1 21  ? 22.134  44.617  11.801  1.00 159.40 ? 19  PRO A O     1 
ATOM   140   C CB    . PRO A 1 21  ? 21.266  43.869  14.851  1.00 148.79 ? 19  PRO A CB    1 
ATOM   141   C CG    . PRO A 1 21  ? 22.696  44.217  15.146  1.00 144.33 ? 19  PRO A CG    1 
ATOM   142   C CD    . PRO A 1 21  ? 23.539  43.088  14.604  1.00 136.32 ? 19  PRO A CD    1 
ATOM   143   N N     . LYS A 1 22  ? 19.899  44.362  11.987  1.00 161.18 ? 20  LYS A N     1 
ATOM   144   C CA    . LYS A 1 22  ? 19.539  45.405  11.021  1.00 164.52 ? 20  LYS A CA    1 
ATOM   145   C C     . LYS A 1 22  ? 18.359  46.203  11.584  1.00 167.39 ? 20  LYS A C     1 
ATOM   146   O O     . LYS A 1 22  ? 17.277  45.649  11.759  1.00 168.13 ? 20  LYS A O     1 
ATOM   147   C CB    . LYS A 1 22  ? 19.150  44.773  9.681   1.00 161.79 ? 20  LYS A CB    1 
ATOM   148   C CG    . LYS A 1 22  ? 19.823  45.389  8.458   1.00 161.83 ? 20  LYS A CG    1 
ATOM   149   C CD    . LYS A 1 22  ? 19.522  44.582  7.197   1.00 159.12 ? 20  LYS A CD    1 
ATOM   150   C CE    . LYS A 1 22  ? 20.361  45.047  6.015   1.00 153.53 ? 20  LYS A CE    1 
ATOM   151   N NZ    . LYS A 1 22  ? 20.282  44.098  4.874   1.00 146.83 ? 20  LYS A NZ    1 
ATOM   152   N N     . VAL A 1 23  ? 18.552  47.495  11.856  1.00 169.97 ? 21  VAL A N     1 
ATOM   153   C CA    . VAL A 1 23  ? 17.557  48.262  12.623  1.00 172.55 ? 21  VAL A CA    1 
ATOM   154   C C     . VAL A 1 23  ? 17.199  49.655  12.069  1.00 176.59 ? 21  VAL A C     1 
ATOM   155   O O     . VAL A 1 23  ? 18.002  50.295  11.385  1.00 176.00 ? 21  VAL A O     1 
ATOM   156   C CB    . VAL A 1 23  ? 17.998  48.420  14.104  1.00 172.54 ? 21  VAL A CB    1 
ATOM   157   C CG1   . VAL A 1 23  ? 16.847  48.927  14.964  1.00 172.09 ? 21  VAL A CG1   1 
ATOM   158   C CG2   . VAL A 1 23  ? 18.518  47.102  14.651  1.00 168.79 ? 21  VAL A CG2   1 
ATOM   159   N N     . LYS A 1 24  ? 15.975  50.100  12.370  1.00 179.18 ? 22  LYS A N     1 
ATOM   160   C CA    . LYS A 1 24  ? 15.511  51.465  12.093  1.00 180.87 ? 22  LYS A CA    1 
ATOM   161   C C     . LYS A 1 24  ? 15.932  52.426  13.213  1.00 182.84 ? 22  LYS A C     1 
ATOM   162   O O     . LYS A 1 24  ? 15.999  52.032  14.379  1.00 182.02 ? 22  LYS A O     1 
ATOM   163   C CB    . LYS A 1 24  ? 13.983  51.495  11.936  1.00 177.36 ? 22  LYS A CB    1 
ATOM   164   C CG    . LYS A 1 24  ? 13.417  52.845  11.490  1.00 175.24 ? 22  LYS A CG    1 
ATOM   165   C CD    . LYS A 1 24  ? 11.963  53.024  11.916  1.00 169.44 ? 22  LYS A CD    1 
ATOM   166   C CE    . LYS A 1 24  ? 11.845  53.143  13.429  1.00 167.21 ? 22  LYS A CE    1 
ATOM   167   N NZ    . LYS A 1 24  ? 10.448  53.383  13.879  1.00 155.95 ? 22  LYS A NZ    1 
ATOM   168   N N     . GLN A 1 25  ? 16.200  53.683  12.861  1.00 184.86 ? 23  GLN A N     1 
ATOM   169   C CA    . GLN A 1 25  ? 16.662  54.681  13.834  1.00 185.73 ? 23  GLN A CA    1 
ATOM   170   C C     . GLN A 1 25  ? 15.594  55.076  14.864  1.00 185.69 ? 23  GLN A C     1 
ATOM   171   O O     . GLN A 1 25  ? 14.394  54.968  14.607  1.00 184.13 ? 23  GLN A O     1 
ATOM   172   C CB    . GLN A 1 25  ? 17.200  55.932  13.124  1.00 183.47 ? 23  GLN A CB    1 
ATOM   173   C CG    . GLN A 1 25  ? 18.374  55.672  12.187  1.00 183.47 ? 23  GLN A CG    1 
ATOM   174   C CD    . GLN A 1 25  ? 17.944  55.082  10.855  1.00 183.83 ? 23  GLN A CD    1 
ATOM   175   O OE1   . GLN A 1 25  ? 18.557  54.140  10.348  1.00 181.81 ? 23  GLN A OE1   1 
ATOM   176   N NE2   . GLN A 1 25  ? 16.886  55.640  10.277  1.00 182.80 ? 23  GLN A NE2   1 
ATOM   177   N N     . TRP A 1 26  ? 16.050  55.530  16.030  1.00 186.89 ? 24  TRP A N     1 
ATOM   178   C CA    . TRP A 1 26  ? 15.164  55.983  17.101  1.00 188.71 ? 24  TRP A CA    1 
ATOM   179   C C     . TRP A 1 26  ? 15.630  57.352  17.603  1.00 190.87 ? 24  TRP A C     1 
ATOM   180   O O     . TRP A 1 26  ? 16.832  57.622  17.638  1.00 191.01 ? 24  TRP A O     1 
ATOM   181   C CB    . TRP A 1 26  ? 15.130  54.957  18.243  1.00 188.75 ? 24  TRP A CB    1 
ATOM   182   C CG    . TRP A 1 26  ? 14.071  55.222  19.288  1.00 190.79 ? 24  TRP A CG    1 
ATOM   183   C CD1   . TRP A 1 26  ? 14.270  55.686  20.560  1.00 190.36 ? 24  TRP A CD1   1 
ATOM   184   C CD2   . TRP A 1 26  ? 12.651  55.045  19.145  1.00 190.96 ? 24  TRP A CD2   1 
ATOM   185   N NE1   . TRP A 1 26  ? 13.065  55.805  21.214  1.00 190.14 ? 24  TRP A NE1   1 
ATOM   186   C CE2   . TRP A 1 26  ? 12.057  55.421  20.368  1.00 190.42 ? 24  TRP A CE2   1 
ATOM   187   C CE3   . TRP A 1 26  ? 11.826  54.611  18.099  1.00 186.54 ? 24  TRP A CE3   1 
ATOM   188   C CZ2   . TRP A 1 26  ? 10.677  55.371  20.577  1.00 186.25 ? 24  TRP A CZ2   1 
ATOM   189   C CZ3   . TRP A 1 26  ? 10.456  54.563  18.309  1.00 184.09 ? 24  TRP A CZ3   1 
ATOM   190   C CH2   . TRP A 1 26  ? 9.897   54.940  19.538  1.00 184.37 ? 24  TRP A CH2   1 
ATOM   191   N N     . PRO A 1 27  ? 14.678  58.218  17.997  1.00 192.83 ? 25  PRO A N     1 
ATOM   192   C CA    . PRO A 1 27  ? 14.916  59.632  18.325  1.00 194.15 ? 25  PRO A CA    1 
ATOM   193   C C     . PRO A 1 27  ? 16.067  59.930  19.293  1.00 196.48 ? 25  PRO A C     1 
ATOM   194   O O     . PRO A 1 27  ? 16.310  59.199  20.258  1.00 194.85 ? 25  PRO A O     1 
ATOM   195   C CB    . PRO A 1 27  ? 13.576  60.087  18.937  1.00 192.83 ? 25  PRO A CB    1 
ATOM   196   C CG    . PRO A 1 27  ? 12.773  58.831  19.149  1.00 191.26 ? 25  PRO A CG    1 
ATOM   197   C CD    . PRO A 1 27  ? 13.248  57.889  18.093  1.00 192.00 ? 25  PRO A CD    1 
ATOM   198   N N     . LEU A 1 28  ? 16.766  61.026  18.998  1.00 198.20 ? 26  LEU A N     1 
ATOM   199   C CA    . LEU A 1 28  ? 17.817  61.582  19.845  1.00 198.53 ? 26  LEU A CA    1 
ATOM   200   C C     . LEU A 1 28  ? 17.835  63.100  19.625  1.00 198.88 ? 26  LEU A C     1 
ATOM   201   O O     . LEU A 1 28  ? 17.544  63.566  18.522  1.00 198.46 ? 26  LEU A O     1 
ATOM   202   C CB    . LEU A 1 28  ? 19.176  60.979  19.481  1.00 197.02 ? 26  LEU A CB    1 
ATOM   203   C CG    . LEU A 1 28  ? 20.322  61.271  20.451  1.00 195.45 ? 26  LEU A CG    1 
ATOM   204   C CD1   . LEU A 1 28  ? 20.142  60.471  21.735  1.00 193.08 ? 26  LEU A CD1   1 
ATOM   205   C CD2   . LEU A 1 28  ? 21.664  60.966  19.810  1.00 193.21 ? 26  LEU A CD2   1 
ATOM   206   N N     . THR A 1 29  ? 18.177  63.867  20.662  1.00 199.32 ? 27  THR A N     1 
ATOM   207   C CA    . THR A 1 29  ? 18.116  65.336  20.588  1.00 199.09 ? 27  THR A CA    1 
ATOM   208   C C     . THR A 1 29  ? 18.885  65.934  19.397  1.00 199.56 ? 27  THR A C     1 
ATOM   209   O O     . THR A 1 29  ? 19.984  65.487  19.061  1.00 198.87 ? 27  THR A O     1 
ATOM   210   C CB    . THR A 1 29  ? 18.550  66.018  21.916  1.00 194.97 ? 27  THR A CB    1 
ATOM   211   O OG1   . THR A 1 29  ? 19.795  65.468  22.365  1.00 192.87 ? 27  THR A OG1   1 
ATOM   212   C CG2   . THR A 1 29  ? 17.491  65.816  22.991  1.00 188.77 ? 27  THR A CG2   1 
ATOM   213   N N     . GLU A 1 30  ? 18.289  66.950  18.774  1.00 199.03 ? 28  GLU A N     1 
ATOM   214   C CA    . GLU A 1 30  ? 18.764  67.505  17.501  1.00 196.92 ? 28  GLU A CA    1 
ATOM   215   C C     . GLU A 1 30  ? 20.031  68.364  17.596  1.00 196.30 ? 28  GLU A C     1 
ATOM   216   O O     . GLU A 1 30  ? 20.778  68.491  16.620  1.00 193.30 ? 28  GLU A O     1 
ATOM   217   C CB    . GLU A 1 30  ? 17.640  68.310  16.840  1.00 194.13 ? 28  GLU A CB    1 
ATOM   218   C CG    . GLU A 1 30  ? 17.112  69.455  17.698  1.00 190.55 ? 28  GLU A CG    1 
ATOM   219   C CD    . GLU A 1 30  ? 15.707  69.879  17.314  1.00 187.12 ? 28  GLU A CD    1 
ATOM   220   O OE1   . GLU A 1 30  ? 15.409  71.089  17.386  1.00 184.37 ? 28  GLU A OE1   1 
ATOM   221   O OE2   . GLU A 1 30  ? 14.898  69.000  16.950  1.00 185.06 ? 28  GLU A OE2   1 
ATOM   222   N N     . GLU A 1 31  ? 20.258  68.965  18.763  1.00 197.10 ? 29  GLU A N     1 
ATOM   223   C CA    . GLU A 1 31  ? 21.413  69.839  18.970  1.00 195.71 ? 29  GLU A CA    1 
ATOM   224   C C     . GLU A 1 31  ? 22.748  69.094  19.051  1.00 194.64 ? 29  GLU A C     1 
ATOM   225   O O     . GLU A 1 31  ? 23.677  69.385  18.294  1.00 192.37 ? 29  GLU A O     1 
ATOM   226   C CB    . GLU A 1 31  ? 21.215  70.691  20.229  1.00 191.77 ? 29  GLU A CB    1 
ATOM   227   C CG    . GLU A 1 31  ? 20.117  71.733  20.110  1.00 189.19 ? 29  GLU A CG    1 
ATOM   228   C CD    . GLU A 1 31  ? 19.932  72.529  21.385  1.00 186.48 ? 29  GLU A CD    1 
ATOM   229   O OE1   . GLU A 1 31  ? 20.094  71.949  22.480  1.00 183.12 ? 29  GLU A OE1   1 
ATOM   230   O OE2   . GLU A 1 31  ? 19.630  73.737  21.290  1.00 186.16 ? 29  GLU A OE2   1 
ATOM   231   N N     . LYS A 1 32  ? 22.832  68.127  19.962  1.00 193.76 ? 30  LYS A N     1 
ATOM   232   C CA    . LYS A 1 32  ? 24.088  67.428  20.225  1.00 192.26 ? 30  LYS A CA    1 
ATOM   233   C C     . LYS A 1 32  ? 24.522  66.544  19.055  1.00 192.79 ? 30  LYS A C     1 
ATOM   234   O O     . LYS A 1 32  ? 25.712  66.269  18.886  1.00 190.54 ? 30  LYS A O     1 
ATOM   235   C CB    . LYS A 1 32  ? 23.984  66.599  21.510  1.00 187.63 ? 30  LYS A CB    1 
ATOM   236   C CG    . LYS A 1 32  ? 23.716  67.420  22.760  1.00 183.14 ? 30  LYS A CG    1 
ATOM   237   C CD    . LYS A 1 32  ? 23.653  66.540  23.993  1.00 178.63 ? 30  LYS A CD    1 
ATOM   238   C CE    . LYS A 1 32  ? 23.377  67.362  25.234  1.00 176.10 ? 30  LYS A CE    1 
ATOM   239   N NZ    . LYS A 1 32  ? 23.221  66.498  26.430  1.00 174.72 ? 30  LYS A NZ    1 
ATOM   240   N N     . ILE A 1 33  ? 23.552  66.115  18.250  1.00 194.46 ? 31  ILE A N     1 
ATOM   241   C CA    . ILE A 1 33  ? 23.808  65.205  17.131  1.00 195.34 ? 31  ILE A CA    1 
ATOM   242   C C     . ILE A 1 33  ? 24.609  65.838  15.985  1.00 194.98 ? 31  ILE A C     1 
ATOM   243   O O     . ILE A 1 33  ? 25.011  65.148  15.045  1.00 194.34 ? 31  ILE A O     1 
ATOM   244   C CB    . ILE A 1 33  ? 22.502  64.574  16.574  1.00 195.27 ? 31  ILE A CB    1 
ATOM   245   C CG1   . ILE A 1 33  ? 21.510  65.659  16.145  1.00 194.07 ? 31  ILE A CG1   1 
ATOM   246   C CG2   . ILE A 1 33  ? 21.882  63.629  17.598  1.00 194.32 ? 31  ILE A CG2   1 
ATOM   247   C CD1   . ILE A 1 33  ? 20.248  65.121  15.494  1.00 192.78 ? 31  ILE A CD1   1 
ATOM   248   N N     . LYS A 1 34  ? 24.828  67.147  16.053  1.00 194.50 ? 32  LYS A N     1 
ATOM   249   C CA    . LYS A 1 34  ? 25.642  67.820  15.047  1.00 192.88 ? 32  LYS A CA    1 
ATOM   250   C C     . LYS A 1 34  ? 27.136  67.615  15.322  1.00 192.08 ? 32  LYS A C     1 
ATOM   251   O O     . LYS A 1 34  ? 27.963  67.673  14.407  1.00 189.93 ? 32  LYS A O     1 
ATOM   252   C CB    . LYS A 1 34  ? 25.295  69.310  14.978  1.00 190.98 ? 32  LYS A CB    1 
ATOM   253   C CG    . LYS A 1 34  ? 25.650  69.950  13.650  1.00 188.74 ? 32  LYS A CG    1 
ATOM   254   C CD    . LYS A 1 34  ? 25.151  69.082  12.509  1.00 190.11 ? 32  LYS A CD    1 
ATOM   255   C CE    . LYS A 1 34  ? 25.462  69.683  11.152  1.00 188.88 ? 32  LYS A CE    1 
ATOM   256   N NZ    . LYS A 1 34  ? 24.930  68.829  10.053  1.00 188.00 ? 32  LYS A NZ    1 
ATOM   257   N N     . ALA A 1 35  ? 27.463  67.352  16.587  1.00 192.08 ? 33  ALA A N     1 
ATOM   258   C CA    . ALA A 1 35  ? 28.849  67.238  17.045  1.00 190.38 ? 33  ALA A CA    1 
ATOM   259   C C     . ALA A 1 35  ? 29.584  65.998  16.524  1.00 188.11 ? 33  ALA A C     1 
ATOM   260   O O     . ALA A 1 35  ? 30.781  66.056  16.228  1.00 185.61 ? 33  ALA A O     1 
ATOM   261   C CB    . ALA A 1 35  ? 28.900  67.282  18.576  1.00 186.00 ? 33  ALA A CB    1 
ATOM   262   N N     . LEU A 1 36  ? 28.862  64.884  16.415  1.00 188.82 ? 34  LEU A N     1 
ATOM   263   C CA    . LEU A 1 36  ? 29.457  63.588  16.067  1.00 187.63 ? 34  LEU A CA    1 
ATOM   264   C C     . LEU A 1 36  ? 29.748  63.386  14.570  1.00 184.54 ? 34  LEU A C     1 
ATOM   265   O O     . LEU A 1 36  ? 30.614  62.583  14.206  1.00 180.13 ? 34  LEU A O     1 
ATOM   266   C CB    . LEU A 1 36  ? 28.601  62.434  16.622  1.00 188.65 ? 34  LEU A CB    1 
ATOM   267   C CG    . LEU A 1 36  ? 27.153  62.281  16.136  1.00 190.43 ? 34  LEU A CG    1 
ATOM   268   C CD1   . LEU A 1 36  ? 27.099  61.546  14.799  1.00 188.19 ? 34  LEU A CD1   1 
ATOM   269   C CD2   . LEU A 1 36  ? 26.287  61.569  17.174  1.00 187.49 ? 34  LEU A CD2   1 
ATOM   270   N N     . VAL A 1 37  ? 29.027  64.103  13.710  1.00 184.74 ? 35  VAL A N     1 
ATOM   271   C CA    . VAL A 1 37  ? 29.266  64.017  12.275  1.00 183.34 ? 35  VAL A CA    1 
ATOM   272   C C     . VAL A 1 37  ? 30.755  64.211  12.030  1.00 180.91 ? 35  VAL A C     1 
ATOM   273   O O     . VAL A 1 37  ? 31.350  63.576  11.158  1.00 176.37 ? 35  VAL A O     1 
ATOM   274   C CB    . VAL A 1 37  ? 28.482  65.092  11.498  1.00 182.17 ? 35  VAL A CB    1 
ATOM   275   C CG1   . VAL A 1 37  ? 28.758  64.971  10.008  1.00 178.52 ? 35  VAL A CG1   1 
ATOM   276   C CG2   . VAL A 1 37  ? 26.991  64.979  11.781  1.00 181.99 ? 35  VAL A CG2   1 
ATOM   277   N N     . GLU A 1 38  ? 31.344  65.106  12.817  1.00 182.84 ? 36  GLU A N     1 
ATOM   278   C CA    . GLU A 1 38  ? 32.776  65.368  12.784  1.00 181.14 ? 36  GLU A CA    1 
ATOM   279   C C     . GLU A 1 38  ? 33.578  64.323  13.550  1.00 177.52 ? 36  GLU A C     1 
ATOM   280   O O     . GLU A 1 38  ? 34.571  63.803  13.045  1.00 173.75 ? 36  GLU A O     1 
ATOM   281   C CB    . GLU A 1 38  ? 33.059  66.735  13.398  1.00 183.65 ? 36  GLU A CB    1 
ATOM   282   C CG    . GLU A 1 38  ? 31.990  67.768  13.120  1.00 187.07 ? 36  GLU A CG    1 
ATOM   283   C CD    . GLU A 1 38  ? 32.031  68.911  14.110  1.00 192.94 ? 36  GLU A CD    1 
ATOM   284   O OE1   . GLU A 1 38  ? 32.423  68.674  15.274  1.00 192.71 ? 36  GLU A OE1   1 
ATOM   285   O OE2   . GLU A 1 38  ? 31.678  70.046  13.725  1.00 195.46 ? 36  GLU A OE2   1 
ATOM   286   N N     . ILE A 1 39  ? 33.137  64.024  14.772  1.00 178.77 ? 37  ILE A N     1 
ATOM   287   C CA    . ILE A 1 39  ? 33.911  63.203  15.705  1.00 176.27 ? 37  ILE A CA    1 
ATOM   288   C C     . ILE A 1 39  ? 34.355  61.860  15.121  1.00 173.29 ? 37  ILE A C     1 
ATOM   289   O O     . ILE A 1 39  ? 35.446  61.375  15.426  1.00 169.29 ? 37  ILE A O     1 
ATOM   290   C CB    . ILE A 1 39  ? 33.164  62.986  17.046  1.00 175.09 ? 37  ILE A CB    1 
ATOM   291   C CG1   . ILE A 1 39  ? 32.965  64.319  17.768  1.00 174.77 ? 37  ILE A CG1   1 
ATOM   292   C CG2   . ILE A 1 39  ? 33.935  62.033  17.945  1.00 171.85 ? 37  ILE A CG2   1 
ATOM   293   C CD1   . ILE A 1 39  ? 32.498  64.170  19.198  1.00 171.67 ? 37  ILE A CD1   1 
ATOM   294   N N     . CYS A 1 40  ? 33.517  61.266  14.278  1.00 172.92 ? 38  CYS A N     1 
ATOM   295   C CA    . CYS A 1 40  ? 33.880  60.016  13.620  1.00 170.24 ? 38  CYS A CA    1 
ATOM   296   C C     . CYS A 1 40  ? 35.157  60.172  12.793  1.00 168.58 ? 38  CYS A C     1 
ATOM   297   O O     . CYS A 1 40  ? 35.945  59.232  12.665  1.00 164.77 ? 38  CYS A O     1 
ATOM   298   C CB    . CYS A 1 40  ? 32.739  59.515  12.732  1.00 171.31 ? 38  CYS A CB    1 
ATOM   299   S SG    . CYS A 1 40  ? 33.166  58.061  11.731  1.00 167.14 ? 38  CYS A SG    1 
ATOM   300   N N     . THR A 1 41  ? 35.356  61.365  12.236  1.00 170.69 ? 39  THR A N     1 
ATOM   301   C CA    . THR A 1 41  ? 36.519  61.640  11.397  1.00 169.11 ? 39  THR A CA    1 
ATOM   302   C C     . THR A 1 41  ? 37.794  61.737  12.240  1.00 166.65 ? 39  THR A C     1 
ATOM   303   O O     . THR A 1 41  ? 38.901  61.508  11.743  1.00 162.88 ? 39  THR A O     1 
ATOM   304   C CB    . THR A 1 41  ? 36.336  62.939  10.577  1.00 168.47 ? 39  THR A CB    1 
ATOM   305   O OG1   . THR A 1 41  ? 34.997  63.012  10.069  1.00 164.74 ? 39  THR A OG1   1 
ATOM   306   C CG2   . THR A 1 41  ? 37.326  62.987  9.419   1.00 165.84 ? 39  THR A CG2   1 
ATOM   307   N N     . GLU A 1 42  ? 37.625  62.079  13.516  1.00 167.54 ? 40  GLU A N     1 
ATOM   308   C CA    . GLU A 1 42  ? 38.739  62.163  14.456  1.00 165.73 ? 40  GLU A CA    1 
ATOM   309   C C     . GLU A 1 42  ? 39.329  60.779  14.672  1.00 160.64 ? 40  GLU A C     1 
ATOM   310   O O     . GLU A 1 42  ? 40.535  60.563  14.524  1.00 155.72 ? 40  GLU A O     1 
ATOM   311   C CB    . GLU A 1 42  ? 38.265  62.708  15.810  1.00 167.52 ? 40  GLU A CB    1 
ATOM   312   C CG    . GLU A 1 42  ? 37.455  63.998  15.745  1.00 171.07 ? 40  GLU A CG    1 
ATOM   313   C CD    . GLU A 1 42  ? 36.979  64.462  17.115  1.00 172.91 ? 40  GLU A CD    1 
ATOM   314   O OE1   . GLU A 1 42  ? 37.507  63.962  18.132  1.00 171.62 ? 40  GLU A OE1   1 
ATOM   315   O OE2   . GLU A 1 42  ? 36.075  65.325  17.172  1.00 171.49 ? 40  GLU A OE2   1 
ATOM   316   N N     . MET A 1 43  ? 38.448  59.847  15.019  1.00 162.08 ? 41  MET A N     1 
ATOM   317   C CA    . MET A 1 43  ? 38.831  58.496  15.405  1.00 156.62 ? 41  MET A CA    1 
ATOM   318   C C     . MET A 1 43  ? 39.532  57.721  14.284  1.00 152.60 ? 41  MET A C     1 
ATOM   319   O O     . MET A 1 43  ? 40.397  56.888  14.549  1.00 148.62 ? 41  MET A O     1 
ATOM   320   C CB    . MET A 1 43  ? 37.602  57.733  15.926  1.00 154.86 ? 41  MET A CB    1 
ATOM   321   C CG    . MET A 1 43  ? 36.893  58.429  17.097  1.00 158.56 ? 41  MET A CG    1 
ATOM   322   S SD    . MET A 1 43  ? 35.382  57.615  17.669  1.00 155.31 ? 41  MET A SD    1 
ATOM   323   C CE    . MET A 1 43  ? 34.865  58.717  18.986  1.00 151.89 ? 41  MET A CE    1 
ATOM   324   N N     . GLU A 1 44  ? 39.168  58.000  13.037  1.00 155.55 ? 42  GLU A N     1 
ATOM   325   C CA    . GLU A 1 44  ? 39.805  57.336  11.906  1.00 154.38 ? 42  GLU A CA    1 
ATOM   326   C C     . GLU A 1 44  ? 41.318  57.395  12.059  1.00 151.25 ? 42  GLU A C     1 
ATOM   327   O O     . GLU A 1 44  ? 42.017  56.399  11.875  1.00 144.02 ? 42  GLU A O     1 
ATOM   328   C CB    . GLU A 1 44  ? 39.410  58.019  10.600  1.00 158.17 ? 42  GLU A CB    1 
ATOM   329   C CG    . GLU A 1 44  ? 37.922  58.214  10.421  1.00 160.94 ? 42  GLU A CG    1 
ATOM   330   C CD    . GLU A 1 44  ? 37.596  59.033  9.191   1.00 164.25 ? 42  GLU A CD    1 
ATOM   331   O OE1   . GLU A 1 44  ? 38.528  59.346  8.418   1.00 161.97 ? 42  GLU A OE1   1 
ATOM   332   O OE2   . GLU A 1 44  ? 36.410  59.369  9.000   1.00 166.39 ? 42  GLU A OE2   1 
ATOM   333   N N     . LYS A 1 45  ? 41.806  58.579  12.412  1.00 152.71 ? 43  LYS A N     1 
ATOM   334   C CA    . LYS A 1 45  ? 43.236  58.842  12.503  1.00 150.23 ? 43  LYS A CA    1 
ATOM   335   C C     . LYS A 1 45  ? 43.867  58.226  13.748  1.00 146.50 ? 43  LYS A C     1 
ATOM   336   O O     . LYS A 1 45  ? 45.060  57.917  13.758  1.00 138.37 ? 43  LYS A O     1 
ATOM   337   C CB    . LYS A 1 45  ? 43.490  60.352  12.476  1.00 148.85 ? 43  LYS A CB    1 
ATOM   338   C CG    . LYS A 1 45  ? 43.037  61.030  11.188  1.00 149.61 ? 43  LYS A CG    1 
ATOM   339   C CD    . LYS A 1 45  ? 43.714  60.403  9.974   1.00 146.58 ? 43  LYS A CD    1 
ATOM   340   C CE    . LYS A 1 45  ? 43.463  61.207  8.710   1.00 138.37 ? 43  LYS A CE    1 
ATOM   341   N NZ    . LYS A 1 45  ? 44.233  60.656  7.564   1.00 130.03 ? 43  LYS A NZ    1 
ATOM   342   N N     . GLU A 1 46  ? 43.063  58.054  14.793  1.00 149.14 ? 44  GLU A N     1 
ATOM   343   C CA    . GLU A 1 46  ? 43.549  57.526  16.066  1.00 144.94 ? 44  GLU A CA    1 
ATOM   344   C C     . GLU A 1 46  ? 43.559  55.991  16.098  1.00 139.06 ? 44  GLU A C     1 
ATOM   345   O O     . GLU A 1 46  ? 44.216  55.387  16.943  1.00 133.75 ? 44  GLU A O     1 
ATOM   346   C CB    . GLU A 1 46  ? 42.706  58.083  17.220  1.00 143.15 ? 44  GLU A CB    1 
ATOM   347   C CG    . GLU A 1 46  ? 42.344  59.559  17.066  1.00 144.96 ? 44  GLU A CG    1 
ATOM   348   C CD    . GLU A 1 46  ? 41.309  60.027  18.075  1.00 146.96 ? 44  GLU A CD    1 
ATOM   349   O OE1   . GLU A 1 46  ? 40.318  60.665  17.661  1.00 148.40 ? 44  GLU A OE1   1 
ATOM   350   O OE2   . GLU A 1 46  ? 41.486  59.767  19.283  1.00 144.97 ? 44  GLU A OE2   1 
ATOM   351   N N     . GLY A 1 47  ? 42.844  55.370  15.163  1.00 139.22 ? 45  GLY A N     1 
ATOM   352   C CA    . GLY A 1 47  ? 42.765  53.920  15.091  1.00 135.29 ? 45  GLY A CA    1 
ATOM   353   C C     . GLY A 1 47  ? 41.469  53.318  15.614  1.00 133.21 ? 45  GLY A C     1 
ATOM   354   O O     . GLY A 1 47  ? 41.352  52.100  15.739  1.00 125.17 ? 45  GLY A O     1 
ATOM   355   N N     . LYS A 1 48  ? 40.490  54.168  15.906  1.00 137.38 ? 46  LYS A N     1 
ATOM   356   C CA    . LYS A 1 48  ? 39.243  53.729  16.530  1.00 132.66 ? 46  LYS A CA    1 
ATOM   357   C C     . LYS A 1 48  ? 38.101  53.409  15.556  1.00 134.69 ? 46  LYS A C     1 
ATOM   358   O O     . LYS A 1 48  ? 37.016  53.032  15.993  1.00 130.55 ? 46  LYS A O     1 
ATOM   359   C CB    . LYS A 1 48  ? 38.752  54.780  17.531  1.00 133.11 ? 46  LYS A CB    1 
ATOM   360   C CG    . LYS A 1 48  ? 39.709  55.095  18.663  1.00 128.66 ? 46  LYS A CG    1 
ATOM   361   C CD    . LYS A 1 48  ? 39.167  56.245  19.497  1.00 132.72 ? 46  LYS A CD    1 
ATOM   362   C CE    . LYS A 1 48  ? 39.986  56.472  20.755  1.00 129.29 ? 46  LYS A CE    1 
ATOM   363   N NZ    . LYS A 1 48  ? 41.408  56.778  20.466  1.00 132.12 ? 46  LYS A NZ    1 
ATOM   364   N N     . ILE A 1 49  ? 38.322  53.566  14.252  1.00 138.04 ? 47  ILE A N     1 
ATOM   365   C CA    . ILE A 1 49  ? 37.243  53.367  13.272  1.00 139.55 ? 47  ILE A CA    1 
ATOM   366   C C     . ILE A 1 49  ? 37.729  52.893  11.888  1.00 140.09 ? 47  ILE A C     1 
ATOM   367   O O     . ILE A 1 49  ? 38.913  52.996  11.562  1.00 138.22 ? 47  ILE A O     1 
ATOM   368   C CB    . ILE A 1 49  ? 36.383  54.659  13.102  1.00 145.58 ? 47  ILE A CB    1 
ATOM   369   C CG1   . ILE A 1 49  ? 35.827  55.133  14.446  1.00 145.77 ? 47  ILE A CG1   1 
ATOM   370   C CG2   . ILE A 1 49  ? 35.236  54.433  12.130  1.00 147.14 ? 47  ILE A CG2   1 
ATOM   371   C CD1   . ILE A 1 49  ? 34.881  56.304  14.335  1.00 152.14 ? 47  ILE A CD1   1 
ATOM   372   N N     . SER A 1 50  ? 36.803  52.359  11.091  1.00 139.48 ? 48  SER A N     1 
ATOM   373   C CA    . SER A 1 50  ? 37.052  52.018  9.689   1.00 141.44 ? 48  SER A CA    1 
ATOM   374   C C     . SER A 1 50  ? 35.728  52.001  8.923   1.00 145.90 ? 48  SER A C     1 
ATOM   375   O O     . SER A 1 50  ? 34.700  52.419  9.457   1.00 145.62 ? 48  SER A O     1 
ATOM   376   C CB    . SER A 1 50  ? 37.755  50.665  9.574   1.00 134.06 ? 48  SER A CB    1 
ATOM   377   O OG    . SER A 1 50  ? 39.040  50.709  10.166  1.00 126.17 ? 48  SER A OG    1 
ATOM   378   N N     . LYS A 1 51  ? 35.747  51.546  7.672   1.00 149.72 ? 49  LYS A N     1 
ATOM   379   C CA    . LYS A 1 51  ? 34.500  51.352  6.931   1.00 154.82 ? 49  LYS A CA    1 
ATOM   380   C C     . LYS A 1 51  ? 34.635  50.378  5.767   1.00 156.59 ? 49  LYS A C     1 
ATOM   381   O O     . LYS A 1 51  ? 35.736  50.131  5.281   1.00 155.32 ? 49  LYS A O     1 
ATOM   382   C CB    . LYS A 1 51  ? 33.953  52.685  6.414   1.00 158.09 ? 49  LYS A CB    1 
ATOM   383   C CG    . LYS A 1 51  ? 34.779  53.313  5.301   1.00 156.72 ? 49  LYS A CG    1 
ATOM   384   C CD    . LYS A 1 51  ? 33.914  54.212  4.438   1.00 155.88 ? 49  LYS A CD    1 
ATOM   385   C CE    . LYS A 1 51  ? 33.070  55.136  5.297   1.00 159.12 ? 49  LYS A CE    1 
ATOM   386   N NZ    . LYS A 1 51  ? 31.947  55.737  4.532   1.00 161.01 ? 49  LYS A NZ    1 
ATOM   387   N N     . ILE A 1 52  ? 33.498  49.829  5.341   1.00 159.66 ? 50  ILE A N     1 
ATOM   388   C CA    . ILE A 1 52  ? 33.385  49.058  4.100   1.00 162.33 ? 50  ILE A CA    1 
ATOM   389   C C     . ILE A 1 52  ? 31.967  49.240  3.552   1.00 160.88 ? 50  ILE A C     1 
ATOM   390   O O     . ILE A 1 52  ? 31.011  49.314  4.322   1.00 159.27 ? 50  ILE A O     1 
ATOM   391   C CB    . ILE A 1 52  ? 33.654  47.541  4.310   1.00 163.79 ? 50  ILE A CB    1 
ATOM   392   C CG1   . ILE A 1 52  ? 35.048  47.298  4.903   1.00 163.02 ? 50  ILE A CG1   1 
ATOM   393   C CG2   . ILE A 1 52  ? 33.500  46.778  2.997   1.00 159.31 ? 50  ILE A CG2   1 
ATOM   394   C CD1   . ILE A 1 52  ? 35.360  45.831  5.163   1.00 156.01 ? 50  ILE A CD1   1 
ATOM   395   N N     . GLY A 1 53  ? 31.829  49.348  2.234   1.00 161.12 ? 51  GLY A N     1 
ATOM   396   C CA    . GLY A 1 53  ? 30.514  49.472  1.627   1.00 160.93 ? 51  GLY A CA    1 
ATOM   397   C C     . GLY A 1 53  ? 29.632  48.230  1.587   1.00 160.56 ? 51  GLY A C     1 
ATOM   398   O O     . GLY A 1 53  ? 28.514  48.243  2.103   1.00 155.65 ? 51  GLY A O     1 
ATOM   399   N N     . PRO A 1 54  ? 30.130  47.148  0.964   1.00 163.02 ? 52  PRO A N     1 
ATOM   400   C CA    . PRO A 1 54  ? 29.372  45.909  0.733   1.00 161.98 ? 52  PRO A CA    1 
ATOM   401   C C     . PRO A 1 54  ? 29.096  45.025  1.954   1.00 161.79 ? 52  PRO A C     1 
ATOM   402   O O     . PRO A 1 54  ? 28.018  44.437  2.044   1.00 160.52 ? 52  PRO A O     1 
ATOM   403   C CB    . PRO A 1 54  ? 30.249  45.147  -0.270  1.00 161.01 ? 52  PRO A CB    1 
ATOM   404   C CG    . PRO A 1 54  ? 31.624  45.640  -0.009  1.00 161.01 ? 52  PRO A CG    1 
ATOM   405   C CD    . PRO A 1 54  ? 31.472  47.089  0.354   1.00 162.52 ? 52  PRO A CD    1 
ATOM   406   N N     . GLU A 1 55  ? 30.052  44.939  2.874   1.00 161.82 ? 53  GLU A N     1 
ATOM   407   C CA    . GLU A 1 55  ? 30.123  43.803  3.797   1.00 158.52 ? 53  GLU A CA    1 
ATOM   408   C C     . GLU A 1 55  ? 29.184  43.817  5.003   1.00 152.97 ? 53  GLU A C     1 
ATOM   409   O O     . GLU A 1 55  ? 29.028  42.798  5.673   1.00 148.15 ? 53  GLU A O     1 
ATOM   410   C CB    . GLU A 1 55  ? 31.571  43.591  4.252   1.00 158.51 ? 53  GLU A CB    1 
ATOM   411   C CG    . GLU A 1 55  ? 32.555  43.489  3.095   1.00 159.77 ? 53  GLU A CG    1 
ATOM   412   C CD    . GLU A 1 55  ? 32.096  42.512  2.025   1.00 159.60 ? 53  GLU A CD    1 
ATOM   413   O OE1   . GLU A 1 55  ? 31.657  41.399  2.383   1.00 158.36 ? 53  GLU A OE1   1 
ATOM   414   O OE2   . GLU A 1 55  ? 32.165  42.860  0.827   1.00 158.27 ? 53  GLU A OE2   1 
ATOM   415   N N     . ASN A 1 56  ? 28.554  44.952  5.279   1.00 154.53 ? 54  ASN A N     1 
ATOM   416   C CA    . ASN A 1 56  ? 27.724  45.056  6.475   1.00 155.62 ? 54  ASN A CA    1 
ATOM   417   C C     . ASN A 1 56  ? 26.219  45.077  6.221   1.00 156.62 ? 54  ASN A C     1 
ATOM   418   O O     . ASN A 1 56  ? 25.672  46.092  5.790   1.00 159.08 ? 54  ASN A O     1 
ATOM   419   C CB    . ASN A 1 56  ? 28.101  46.309  7.272   1.00 156.39 ? 54  ASN A CB    1 
ATOM   420   C CG    . ASN A 1 56  ? 27.672  47.594  6.578   1.00 157.43 ? 54  ASN A CG    1 
ATOM   421   O OD1   . ASN A 1 56  ? 27.922  47.783  5.388   1.00 157.50 ? 54  ASN A OD1   1 
ATOM   422   N ND2   . ASN A 1 56  ? 27.006  48.474  7.317   1.00 158.71 ? 54  ASN A ND2   1 
ATOM   423   N N     . PRO A 1 57  ? 25.536  43.959  6.506   1.00 154.20 ? 55  PRO A N     1 
ATOM   424   C CA    . PRO A 1 57  ? 24.077  44.028  6.639   1.00 155.70 ? 55  PRO A CA    1 
ATOM   425   C C     . PRO A 1 57  ? 23.721  44.362  8.088   1.00 156.78 ? 55  PRO A C     1 
ATOM   426   O O     . PRO A 1 57  ? 22.936  43.644  8.719   1.00 155.64 ? 55  PRO A O     1 
ATOM   427   C CB    . PRO A 1 57  ? 23.628  42.609  6.285   1.00 156.14 ? 55  PRO A CB    1 
ATOM   428   C CG    . PRO A 1 57  ? 24.784  41.747  6.673   1.00 151.70 ? 55  PRO A CG    1 
ATOM   429   C CD    . PRO A 1 57  ? 26.026  42.570  6.432   1.00 151.53 ? 55  PRO A CD    1 
ATOM   430   N N     . TYR A 1 58  ? 24.294  45.453  8.597   1.00 157.59 ? 56  TYR A N     1 
ATOM   431   C CA    . TYR A 1 58  ? 24.204  45.796  10.016  1.00 158.19 ? 56  TYR A CA    1 
ATOM   432   C C     . TYR A 1 58  ? 23.842  47.268  10.260  1.00 161.87 ? 56  TYR A C     1 
ATOM   433   O O     . TYR A 1 58  ? 24.447  48.166  9.676   1.00 163.11 ? 56  TYR A O     1 
ATOM   434   C CB    . TYR A 1 58  ? 25.526  45.466  10.716  1.00 150.68 ? 56  TYR A CB    1 
ATOM   435   C CG    . TYR A 1 58  ? 26.049  44.062  10.459  1.00 144.87 ? 56  TYR A CG    1 
ATOM   436   C CD1   . TYR A 1 58  ? 25.404  42.946  10.982  1.00 141.29 ? 56  TYR A CD1   1 
ATOM   437   C CD2   . TYR A 1 58  ? 27.203  43.856  9.713   1.00 143.48 ? 56  TYR A CD2   1 
ATOM   438   C CE1   . TYR A 1 58  ? 25.888  41.662  10.755  1.00 134.74 ? 56  TYR A CE1   1 
ATOM   439   C CE2   . TYR A 1 58  ? 27.694  42.575  9.484   1.00 138.15 ? 56  TYR A CE2   1 
ATOM   440   C CZ    . TYR A 1 58  ? 27.033  41.484  10.008  1.00 130.81 ? 56  TYR A CZ    1 
ATOM   441   O OH    . TYR A 1 58  ? 27.519  40.215  9.782   1.00 121.41 ? 56  TYR A OH    1 
ATOM   442   N N     . ASN A 1 59  ? 22.861  47.504  11.130  1.00 163.66 ? 57  ASN A N     1 
ATOM   443   C CA    . ASN A 1 59  ? 22.413  48.861  11.450  1.00 168.94 ? 57  ASN A CA    1 
ATOM   444   C C     . ASN A 1 59  ? 21.945  48.976  12.904  1.00 170.53 ? 57  ASN A C     1 
ATOM   445   O O     . ASN A 1 59  ? 21.296  48.067  13.418  1.00 168.57 ? 57  ASN A O     1 
ATOM   446   C CB    . ASN A 1 59  ? 21.288  49.277  10.496  1.00 171.34 ? 57  ASN A CB    1 
ATOM   447   C CG    . ASN A 1 59  ? 20.936  50.753  10.605  1.00 174.91 ? 57  ASN A CG    1 
ATOM   448   O OD1   . ASN A 1 59  ? 21.729  51.559  11.093  1.00 175.19 ? 57  ASN A OD1   1 
ATOM   449   N ND2   . ASN A 1 59  ? 19.742  51.112  10.142  1.00 174.81 ? 57  ASN A ND2   1 
ATOM   450   N N     . THR A 1 60  ? 22.269  50.090  13.564  1.00 172.69 ? 58  THR A N     1 
ATOM   451   C CA    . THR A 1 60  ? 21.893  50.285  14.970  1.00 175.32 ? 58  THR A CA    1 
ATOM   452   C C     . THR A 1 60  ? 21.407  51.706  15.300  1.00 177.94 ? 58  THR A C     1 
ATOM   453   O O     . THR A 1 60  ? 21.926  52.683  14.759  1.00 178.59 ? 58  THR A O     1 
ATOM   454   C CB    . THR A 1 60  ? 23.056  49.933  15.932  1.00 175.24 ? 58  THR A CB    1 
ATOM   455   O OG1   . THR A 1 60  ? 23.844  51.102  16.191  1.00 175.02 ? 58  THR A OG1   1 
ATOM   456   C CG2   . THR A 1 60  ? 23.938  48.832  15.349  1.00 168.99 ? 58  THR A CG2   1 
ATOM   457   N N     . PRO A 1 61  ? 20.407  51.814  16.201  1.00 180.68 ? 59  PRO A N     1 
ATOM   458   C CA    . PRO A 1 61  ? 19.794  53.053  16.714  1.00 183.39 ? 59  PRO A CA    1 
ATOM   459   C C     . PRO A 1 61  ? 20.537  53.703  17.899  1.00 184.43 ? 59  PRO A C     1 
ATOM   460   O O     . PRO A 1 61  ? 21.647  53.274  18.229  1.00 181.44 ? 59  PRO A O     1 
ATOM   461   C CB    . PRO A 1 61  ? 18.405  52.586  17.160  1.00 182.83 ? 59  PRO A CB    1 
ATOM   462   C CG    . PRO A 1 61  ? 18.616  51.174  17.578  1.00 179.54 ? 59  PRO A CG    1 
ATOM   463   C CD    . PRO A 1 61  ? 19.676  50.616  16.657  1.00 179.17 ? 59  PRO A CD    1 
ATOM   464   N N     . VAL A 1 62  ? 19.931  54.729  18.510  1.00 189.14 ? 60  VAL A N     1 
ATOM   465   C CA    . VAL A 1 62  ? 20.531  55.441  19.657  1.00 191.23 ? 60  VAL A CA    1 
ATOM   466   C C     . VAL A 1 62  ? 19.561  55.772  20.826  1.00 192.48 ? 60  VAL A C     1 
ATOM   467   O O     . VAL A 1 62  ? 18.544  56.455  20.641  1.00 191.30 ? 60  VAL A O     1 
ATOM   468   C CB    . VAL A 1 62  ? 21.278  56.741  19.204  1.00 190.72 ? 60  VAL A CB    1 
ATOM   469   C CG1   . VAL A 1 62  ? 21.641  57.603  20.405  1.00 191.22 ? 60  VAL A CG1   1 
ATOM   470   C CG2   . VAL A 1 62  ? 22.529  56.401  18.393  1.00 183.66 ? 60  VAL A CG2   1 
ATOM   471   N N     . PHE A 1 63  ? 19.902  55.273  22.021  1.00 192.57 ? 61  PHE A N     1 
ATOM   472   C CA    . PHE A 1 63  ? 19.224  55.593  23.289  1.00 192.75 ? 61  PHE A CA    1 
ATOM   473   C C     . PHE A 1 63  ? 20.288  55.743  24.391  1.00 192.59 ? 61  PHE A C     1 
ATOM   474   O O     . PHE A 1 63  ? 21.127  54.856  24.569  1.00 188.88 ? 61  PHE A O     1 
ATOM   475   C CB    . PHE A 1 63  ? 18.206  54.499  23.658  1.00 189.45 ? 61  PHE A CB    1 
ATOM   476   C CG    . PHE A 1 63  ? 17.479  54.742  24.963  1.00 190.42 ? 61  PHE A CG    1 
ATOM   477   C CD1   . PHE A 1 63  ? 16.216  55.315  24.976  1.00 189.24 ? 61  PHE A CD1   1 
ATOM   478   C CD2   . PHE A 1 63  ? 18.057  54.382  26.174  1.00 189.77 ? 61  PHE A CD2   1 
ATOM   479   C CE1   . PHE A 1 63  ? 15.547  55.532  26.172  1.00 188.56 ? 61  PHE A CE1   1 
ATOM   480   C CE2   . PHE A 1 63  ? 17.394  54.599  27.373  1.00 187.99 ? 61  PHE A CE2   1 
ATOM   481   C CZ    . PHE A 1 63  ? 16.138  55.173  27.370  1.00 187.55 ? 61  PHE A CZ    1 
ATOM   482   N N     . ALA A 1 64  ? 20.253  56.851  25.131  1.00 192.62 ? 62  ALA A N     1 
ATOM   483   C CA    . ALA A 1 64  ? 21.348  57.190  26.048  1.00 191.03 ? 62  ALA A CA    1 
ATOM   484   C C     . ALA A 1 64  ? 20.916  57.503  27.484  1.00 190.77 ? 62  ALA A C     1 
ATOM   485   O O     . ALA A 1 64  ? 19.730  57.676  27.766  1.00 189.31 ? 62  ALA A O     1 
ATOM   486   C CB    . ALA A 1 64  ? 22.174  58.344  25.481  1.00 188.89 ? 62  ALA A CB    1 
ATOM   487   N N     . ILE A 1 65  ? 21.897  57.554  28.387  1.00 191.85 ? 63  ILE A N     1 
ATOM   488   C CA    . ILE A 1 65  ? 21.666  57.920  29.788  1.00 192.24 ? 63  ILE A CA    1 
ATOM   489   C C     . ILE A 1 65  ? 22.566  59.102  30.205  1.00 191.93 ? 63  ILE A C     1 
ATOM   490   O O     . ILE A 1 65  ? 23.720  59.194  29.777  1.00 190.94 ? 63  ILE A O     1 
ATOM   491   C CB    . ILE A 1 65  ? 21.861  56.701  30.731  1.00 188.94 ? 63  ILE A CB    1 
ATOM   492   C CG1   . ILE A 1 65  ? 20.980  55.530  30.277  1.00 183.18 ? 63  ILE A CG1   1 
ATOM   493   C CG2   . ILE A 1 65  ? 21.557  57.074  32.178  1.00 183.81 ? 63  ILE A CG2   1 
ATOM   494   C CD1   . ILE A 1 65  ? 21.033  54.325  31.185  1.00 174.97 ? 63  ILE A CD1   1 
ATOM   495   N N     . LYS A 1 66  ? 22.029  59.999  31.037  1.00 191.47 ? 64  LYS A N     1 
ATOM   496   C CA    . LYS A 1 66  ? 22.695  61.265  31.380  1.00 190.65 ? 64  LYS A CA    1 
ATOM   497   C C     . LYS A 1 66  ? 23.369  61.268  32.756  1.00 189.85 ? 64  LYS A C     1 
ATOM   498   O O     . LYS A 1 66  ? 22.892  60.625  33.694  1.00 187.95 ? 64  LYS A O     1 
ATOM   499   C CB    . LYS A 1 66  ? 21.702  62.437  31.307  1.00 188.69 ? 64  LYS A CB    1 
ATOM   500   C CG    . LYS A 1 66  ? 22.335  63.816  31.530  1.00 184.98 ? 64  LYS A CG    1 
ATOM   501   C CD    . LYS A 1 66  ? 21.287  64.894  31.789  1.00 180.03 ? 64  LYS A CD    1 
ATOM   502   C CE    . LYS A 1 66  ? 21.876  66.292  31.638  1.00 174.77 ? 64  LYS A CE    1 
ATOM   503   N NZ    . LYS A 1 66  ? 23.071  66.500  32.495  1.00 172.18 ? 64  LYS A NZ    1 
ATOM   504   N N     . LYS A 1 67  ? 24.478  62.000  32.863  1.00 188.78 ? 65  LYS A N     1 
ATOM   505   C CA    . LYS A 1 67  ? 25.167  62.184  34.142  1.00 188.16 ? 65  LYS A CA    1 
ATOM   506   C C     . LYS A 1 67  ? 25.332  63.666  34.530  1.00 185.95 ? 65  LYS A C     1 
ATOM   507   O O     . LYS A 1 67  ? 25.613  64.518  33.683  1.00 184.53 ? 65  LYS A O     1 
ATOM   508   C CB    . LYS A 1 67  ? 26.527  61.470  34.142  1.00 186.81 ? 65  LYS A CB    1 
ATOM   509   C CG    . LYS A 1 67  ? 27.612  62.147  33.310  1.00 187.43 ? 65  LYS A CG    1 
ATOM   510   C CD    . LYS A 1 67  ? 28.959  61.448  33.480  1.00 185.96 ? 65  LYS A CD    1 
ATOM   511   C CE    . LYS A 1 67  ? 30.090  62.239  32.834  1.00 184.29 ? 65  LYS A CE    1 
ATOM   512   N NZ    . LYS A 1 67  ? 29.887  62.440  31.372  1.00 183.71 ? 65  LYS A NZ    1 
ATOM   513   N N     . LYS A 1 68  ? 25.132  63.957  35.815  1.00 183.64 ? 66  LYS A N     1 
ATOM   514   C CA    . LYS A 1 68  ? 25.347  65.293  36.380  1.00 179.82 ? 66  LYS A CA    1 
ATOM   515   C C     . LYS A 1 68  ? 26.836  65.613  36.546  1.00 180.87 ? 66  LYS A C     1 
ATOM   516   O O     . LYS A 1 68  ? 27.679  64.717  36.479  1.00 181.90 ? 66  LYS A O     1 
ATOM   517   C CB    . LYS A 1 68  ? 24.618  65.460  37.720  1.00 175.15 ? 66  LYS A CB    1 
ATOM   518   C CG    . LYS A 1 68  ? 24.123  66.883  37.964  1.00 170.21 ? 66  LYS A CG    1 
ATOM   519   C CD    . LYS A 1 68  ? 24.131  67.274  39.434  1.00 164.24 ? 66  LYS A CD    1 
ATOM   520   C CE    . LYS A 1 68  ? 23.756  68.743  39.591  1.00 157.60 ? 66  LYS A CE    1 
ATOM   521   N NZ    . LYS A 1 68  ? 24.040  69.283  40.948  1.00 149.49 ? 66  LYS A NZ    1 
ATOM   522   N N     . ASP A 1 69  ? 27.151  66.892  36.747  1.00 179.59 ? 67  ASP A N     1 
ATOM   523   C CA    . ASP A 1 69  ? 28.530  67.338  36.979  1.00 180.53 ? 67  ASP A CA    1 
ATOM   524   C C     . ASP A 1 69  ? 29.474  67.130  35.786  1.00 180.45 ? 67  ASP A C     1 
ATOM   525   O O     . ASP A 1 69  ? 30.559  66.564  35.935  1.00 180.11 ? 67  ASP A O     1 
ATOM   526   C CB    . ASP A 1 69  ? 29.119  66.668  38.235  1.00 179.18 ? 67  ASP A CB    1 
ATOM   527   C CG    . ASP A 1 69  ? 28.684  67.345  39.532  1.00 175.63 ? 67  ASP A CG    1 
ATOM   528   O OD1   . ASP A 1 69  ? 29.449  68.187  40.050  1.00 170.53 ? 67  ASP A OD1   1 
ATOM   529   O OD2   . ASP A 1 69  ? 27.586  67.027  40.039  1.00 173.00 ? 67  ASP A OD2   1 
ATOM   530   N N     . SER A 1 70  ? 29.053  67.586  34.608  1.00 179.41 ? 68  SER A N     1 
ATOM   531   C CA    . SER A 1 70  ? 29.886  67.517  33.407  1.00 176.65 ? 68  SER A CA    1 
ATOM   532   C C     . SER A 1 70  ? 30.053  68.897  32.766  1.00 172.12 ? 68  SER A C     1 
ATOM   533   O O     . SER A 1 70  ? 29.092  69.660  32.673  1.00 170.72 ? 68  SER A O     1 
ATOM   534   C CB    . SER A 1 70  ? 29.281  66.543  32.390  1.00 177.92 ? 68  SER A CB    1 
ATOM   535   O OG    . SER A 1 70  ? 29.083  65.257  32.955  1.00 178.69 ? 68  SER A OG    1 
ATOM   536   N N     . THR A 1 71  ? 31.272  69.217  32.335  1.00 171.88 ? 69  THR A N     1 
ATOM   537   C CA    . THR A 1 71  ? 31.531  70.461  31.601  1.00 168.87 ? 69  THR A CA    1 
ATOM   538   C C     . THR A 1 71  ? 31.509  70.231  30.084  1.00 170.81 ? 69  THR A C     1 
ATOM   539   O O     . THR A 1 71  ? 31.684  71.160  29.291  1.00 166.45 ? 69  THR A O     1 
ATOM   540   C CB    . THR A 1 71  ? 32.864  71.133  32.028  1.00 156.31 ? 69  THR A CB    1 
ATOM   541   O OG1   . THR A 1 71  ? 33.920  70.166  32.026  1.00 156.74 ? 69  THR A OG1   1 
ATOM   542   C CG2   . THR A 1 71  ? 32.741  71.734  33.423  1.00 146.04 ? 69  THR A CG2   1 
ATOM   543   N N     . LYS A 1 72  ? 31.289  68.978  29.697  1.00 172.93 ? 70  LYS A N     1 
ATOM   544   C CA    . LYS A 1 72  ? 31.147  68.599  28.297  1.00 174.05 ? 70  LYS A CA    1 
ATOM   545   C C     . LYS A 1 72  ? 30.193  67.413  28.211  1.00 177.75 ? 70  LYS A C     1 
ATOM   546   O O     . LYS A 1 72  ? 30.002  66.694  29.194  1.00 176.86 ? 70  LYS A O     1 
ATOM   547   C CB    . LYS A 1 72  ? 32.503  68.232  27.697  1.00 173.64 ? 70  LYS A CB    1 
ATOM   548   C CG    . LYS A 1 72  ? 33.194  67.064  28.389  1.00 171.97 ? 70  LYS A CG    1 
ATOM   549   C CD    . LYS A 1 72  ? 34.522  66.740  27.727  1.00 167.78 ? 70  LYS A CD    1 
ATOM   550   C CE    . LYS A 1 72  ? 35.413  67.970  27.665  1.00 164.02 ? 70  LYS A CE    1 
ATOM   551   N NZ    . LYS A 1 72  ? 36.699  67.692  26.972  1.00 158.70 ? 70  LYS A NZ    1 
ATOM   552   N N     . TRP A 1 73  ? 29.597  67.208  27.039  1.00 181.22 ? 71  TRP A N     1 
ATOM   553   C CA    . TRP A 1 73  ? 28.577  66.170  26.866  1.00 184.03 ? 71  TRP A CA    1 
ATOM   554   C C     . TRP A 1 73  ? 29.158  64.801  26.476  1.00 184.92 ? 71  TRP A C     1 
ATOM   555   O O     . TRP A 1 73  ? 30.125  64.720  25.718  1.00 182.84 ? 71  TRP A O     1 
ATOM   556   C CB    . TRP A 1 73  ? 27.504  66.637  25.870  1.00 180.91 ? 71  TRP A CB    1 
ATOM   557   C CG    . TRP A 1 73  ? 26.906  67.967  26.248  1.00 179.86 ? 71  TRP A CG    1 
ATOM   558   C CD1   . TRP A 1 73  ? 27.175  69.180  25.679  1.00 176.42 ? 71  TRP A CD1   1 
ATOM   559   C CD2   . TRP A 1 73  ? 25.959  68.219  27.300  1.00 179.73 ? 71  TRP A CD2   1 
ATOM   560   N NE1   . TRP A 1 73  ? 26.447  70.166  26.302  1.00 176.90 ? 71  TRP A NE1   1 
ATOM   561   C CE2   . TRP A 1 73  ? 25.694  69.603  27.300  1.00 178.07 ? 71  TRP A CE2   1 
ATOM   562   C CE3   . TRP A 1 73  ? 25.309  67.407  28.238  1.00 176.80 ? 71  TRP A CE3   1 
ATOM   563   C CZ2   . TRP A 1 73  ? 24.803  70.193  28.198  1.00 174.93 ? 71  TRP A CZ2   1 
ATOM   564   C CZ3   . TRP A 1 73  ? 24.425  67.995  29.128  1.00 174.31 ? 71  TRP A CZ3   1 
ATOM   565   C CH2   . TRP A 1 73  ? 24.181  69.374  29.102  1.00 173.87 ? 71  TRP A CH2   1 
ATOM   566   N N     . ARG A 1 74  ? 28.562  63.733  27.006  1.00 186.82 ? 72  ARG A N     1 
ATOM   567   C CA    . ARG A 1 74  ? 29.077  62.374  26.818  1.00 188.14 ? 72  ARG A CA    1 
ATOM   568   C C     . ARG A 1 74  ? 28.180  61.512  25.917  1.00 189.56 ? 72  ARG A C     1 
ATOM   569   O O     . ARG A 1 74  ? 27.006  61.286  26.225  1.00 187.34 ? 72  ARG A O     1 
ATOM   570   C CB    . ARG A 1 74  ? 29.285  61.697  28.178  1.00 188.00 ? 72  ARG A CB    1 
ATOM   571   C CG    . ARG A 1 74  ? 29.834  60.278  28.111  1.00 186.46 ? 72  ARG A CG    1 
ATOM   572   C CD    . ARG A 1 74  ? 29.966  59.673  29.505  1.00 185.89 ? 72  ARG A CD    1 
ATOM   573   N NE    . ARG A 1 74  ? 28.750  59.847  30.298  1.00 189.36 ? 72  ARG A NE    1 
ATOM   574   C CZ    . ARG A 1 74  ? 27.749  58.971  30.352  1.00 188.27 ? 72  ARG A CZ    1 
ATOM   575   N NH1   . ARG A 1 74  ? 27.807  57.842  29.659  1.00 187.12 ? 72  ARG A NH1   1 
ATOM   576   N NH2   . ARG A 1 74  ? 26.685  59.225  31.104  1.00 185.69 ? 72  ARG A NH2   1 
ATOM   577   N N     . LYS A 1 75  ? 28.754  61.029  24.814  1.00 190.84 ? 73  LYS A N     1 
ATOM   578   C CA    . LYS A 1 75  ? 28.026  60.287  23.773  1.00 191.20 ? 73  LYS A CA    1 
ATOM   579   C C     . LYS A 1 75  ? 27.670  58.833  24.145  1.00 189.49 ? 73  LYS A C     1 
ATOM   580   O O     . LYS A 1 75  ? 28.276  58.242  25.043  1.00 186.61 ? 73  LYS A O     1 
ATOM   581   C CB    . LYS A 1 75  ? 28.820  60.317  22.454  1.00 186.68 ? 73  LYS A CB    1 
ATOM   582   C CG    . LYS A 1 75  ? 28.023  59.924  21.211  1.00 184.11 ? 73  LYS A CG    1 
ATOM   583   C CD    . LYS A 1 75  ? 28.931  59.708  20.008  1.00 180.24 ? 73  LYS A CD    1 
ATOM   584   C CE    . LYS A 1 75  ? 28.130  59.399  18.752  1.00 177.62 ? 73  LYS A CE    1 
ATOM   585   N NZ    . LYS A 1 75  ? 27.163  58.282  18.936  1.00 177.74 ? 73  LYS A NZ    1 
ATOM   586   N N     . LEU A 1 76  ? 26.677  58.274  23.448  1.00 188.39 ? 74  LEU A N     1 
ATOM   587   C CA    . LEU A 1 76  ? 26.291  56.865  23.594  1.00 184.97 ? 74  LEU A CA    1 
ATOM   588   C C     . LEU A 1 76  ? 25.665  56.299  22.306  1.00 182.14 ? 74  LEU A C     1 
ATOM   589   O O     . LEU A 1 76  ? 25.098  57.040  21.497  1.00 181.92 ? 74  LEU A O     1 
ATOM   590   C CB    . LEU A 1 76  ? 25.330  56.674  24.780  1.00 186.10 ? 74  LEU A CB    1 
ATOM   591   C CG    . LEU A 1 76  ? 25.890  56.147  26.110  1.00 182.81 ? 74  LEU A CG    1 
ATOM   592   C CD1   . LEU A 1 76  ? 24.838  56.200  27.216  1.00 184.24 ? 74  LEU A CD1   1 
ATOM   593   C CD2   . LEU A 1 76  ? 26.431  54.731  25.950  1.00 166.99 ? 74  LEU A CD2   1 
ATOM   594   N N     . VAL A 1 77  ? 25.781  54.984  22.123  1.00 176.87 ? 75  VAL A N     1 
ATOM   595   C CA    . VAL A 1 77  ? 25.167  54.291  20.989  1.00 174.14 ? 75  VAL A CA    1 
ATOM   596   C C     . VAL A 1 77  ? 24.443  53.029  21.476  1.00 170.30 ? 75  VAL A C     1 
ATOM   597   O O     . VAL A 1 77  ? 24.868  52.399  22.447  1.00 162.05 ? 75  VAL A O     1 
ATOM   598   C CB    . VAL A 1 77  ? 26.205  53.935  19.896  1.00 168.80 ? 75  VAL A CB    1 
ATOM   599   C CG1   . VAL A 1 77  ? 25.575  53.073  18.815  1.00 167.06 ? 75  VAL A CG1   1 
ATOM   600   C CG2   . VAL A 1 77  ? 26.794  55.199  19.290  1.00 171.13 ? 75  VAL A CG2   1 
ATOM   601   N N     . ASP A 1 78  ? 23.351  52.668  20.805  1.00 170.87 ? 76  ASP A N     1 
ATOM   602   C CA    . ASP A 1 78  ? 22.489  51.576  21.261  1.00 164.56 ? 76  ASP A CA    1 
ATOM   603   C C     . ASP A 1 78  ? 22.662  50.298  20.440  1.00 158.48 ? 76  ASP A C     1 
ATOM   604   O O     . ASP A 1 78  ? 22.286  50.231  19.270  1.00 160.51 ? 76  ASP A O     1 
ATOM   605   C CB    . ASP A 1 78  ? 21.023  52.024  21.256  1.00 170.47 ? 76  ASP A CB    1 
ATOM   606   C CG    . ASP A 1 78  ? 20.088  50.995  21.867  1.00 166.43 ? 76  ASP A CG    1 
ATOM   607   O OD1   . ASP A 1 78  ? 19.386  51.338  22.842  1.00 168.62 ? 76  ASP A OD1   1 
ATOM   608   O OD2   . ASP A 1 78  ? 20.038  49.853  21.364  1.00 159.42 ? 76  ASP A OD2   1 
ATOM   609   N N     . PHE A 1 79  ? 23.256  49.295  21.075  1.00 151.33 ? 77  PHE A N     1 
ATOM   610   C CA    . PHE A 1 79  ? 23.450  47.971  20.487  1.00 143.03 ? 77  PHE A CA    1 
ATOM   611   C C     . PHE A 1 79  ? 22.393  46.947  20.896  1.00 137.01 ? 77  PHE A C     1 
ATOM   612   O O     . PHE A 1 79  ? 22.526  45.759  20.598  1.00 130.51 ? 77  PHE A O     1 
ATOM   613   C CB    . PHE A 1 79  ? 24.854  47.452  20.773  1.00 134.28 ? 77  PHE A CB    1 
ATOM   614   C CG    . PHE A 1 79  ? 25.931  48.260  20.121  1.00 135.31 ? 77  PHE A CG    1 
ATOM   615   C CD1   . PHE A 1 79  ? 26.232  49.531  20.579  1.00 142.40 ? 77  PHE A CD1   1 
ATOM   616   C CD2   . PHE A 1 79  ? 26.639  47.754  19.051  1.00 133.32 ? 77  PHE A CD2   1 
ATOM   617   C CE1   . PHE A 1 79  ? 27.221  50.279  19.984  1.00 143.95 ? 77  PHE A CE1   1 
ATOM   618   C CE2   . PHE A 1 79  ? 27.630  48.494  18.453  1.00 134.66 ? 77  PHE A CE2   1 
ATOM   619   C CZ    . PHE A 1 79  ? 27.922  49.761  18.921  1.00 137.53 ? 77  PHE A CZ    1 
ATOM   620   N N     . ARG A 1 80  ? 21.344  47.411  21.570  1.00 141.91 ? 78  ARG A N     1 
ATOM   621   C CA    . ARG A 1 80  ? 20.402  46.526  22.246  1.00 140.31 ? 78  ARG A CA    1 
ATOM   622   C C     . ARG A 1 80  ? 20.098  45.322  21.367  1.00 135.80 ? 78  ARG A C     1 
ATOM   623   O O     . ARG A 1 80  ? 19.969  44.202  21.859  1.00 133.24 ? 78  ARG A O     1 
ATOM   624   C CB    . ARG A 1 80  ? 19.104  47.277  22.565  1.00 146.81 ? 78  ARG A CB    1 
ATOM   625   C CG    . ARG A 1 80  ? 18.219  46.599  23.601  1.00 151.16 ? 78  ARG A CG    1 
ATOM   626   C CD    . ARG A 1 80  ? 16.894  47.338  23.796  1.00 158.14 ? 78  ARG A CD    1 
ATOM   627   N NE    . ARG A 1 80  ? 17.072  48.772  24.023  1.00 164.01 ? 78  ARG A NE    1 
ATOM   628   C CZ    . ARG A 1 80  ? 16.111  49.590  24.449  1.00 167.04 ? 78  ARG A CZ    1 
ATOM   629   N NH1   . ARG A 1 80  ? 14.899  49.117  24.708  1.00 166.61 ? 78  ARG A NH1   1 
ATOM   630   N NH2   . ARG A 1 80  ? 16.362  50.882  24.625  1.00 169.39 ? 78  ARG A NH2   1 
ATOM   631   N N     . GLU A 1 81  ? 19.994  45.544  20.065  1.00 137.05 ? 79  GLU A N     1 
ATOM   632   C CA    . GLU A 1 81  ? 19.818  44.427  19.153  1.00 135.10 ? 79  GLU A CA    1 
ATOM   633   C C     . GLU A 1 81  ? 21.076  43.568  19.076  1.00 128.18 ? 79  GLU A C     1 
ATOM   634   O O     . GLU A 1 81  ? 20.993  42.347  19.139  1.00 126.93 ? 79  GLU A O     1 
ATOM   635   C CB    . GLU A 1 81  ? 19.360  44.901  17.774  1.00 137.92 ? 79  GLU A CB    1 
ATOM   636   C CG    . GLU A 1 81  ? 17.926  45.420  17.779  1.00 141.95 ? 79  GLU A CG    1 
ATOM   637   C CD    . GLU A 1 81  ? 16.996  44.566  18.637  1.00 139.53 ? 79  GLU A CD    1 
ATOM   638   O OE1   . GLU A 1 81  ? 17.003  43.320  18.493  1.00 134.91 ? 79  GLU A OE1   1 
ATOM   639   O OE2   . GLU A 1 81  ? 16.262  45.144  19.467  1.00 138.55 ? 79  GLU A OE2   1 
ATOM   640   N N     . LEU A 1 82  ? 22.239  44.199  18.968  1.00 126.22 ? 80  LEU A N     1 
ATOM   641   C CA    . LEU A 1 82  ? 23.489  43.447  18.946  1.00 121.23 ? 80  LEU A CA    1 
ATOM   642   C C     . LEU A 1 82  ? 23.694  42.695  20.253  1.00 117.38 ? 80  LEU A C     1 
ATOM   643   O O     . LEU A 1 82  ? 24.083  41.533  20.251  1.00 113.17 ? 80  LEU A O     1 
ATOM   644   C CB    . LEU A 1 82  ? 24.687  44.359  18.686  1.00 117.13 ? 80  LEU A CB    1 
ATOM   645   C CG    . LEU A 1 82  ? 26.049  43.689  18.880  1.00 106.60 ? 80  LEU A CG    1 
ATOM   646   C CD1   . LEU A 1 82  ? 26.126  42.379  18.131  1.00 104.19 ? 80  LEU A CD1   1 
ATOM   647   C CD2   . LEU A 1 82  ? 27.170  44.599  18.449  1.00 105.43 ? 80  LEU A CD2   1 
ATOM   648   N N     . ASN A 1 83  ? 23.436  43.364  21.369  1.00 120.04 ? 81  ASN A N     1 
ATOM   649   C CA    . ASN A 1 83  ? 23.604  42.741  22.675  1.00 116.31 ? 81  ASN A CA    1 
ATOM   650   C C     . ASN A 1 83  ? 22.929  41.379  22.756  1.00 114.43 ? 81  ASN A C     1 
ATOM   651   O O     . ASN A 1 83  ? 23.598  40.355  22.876  1.00 108.29 ? 81  ASN A O     1 
ATOM   652   C CB    . ASN A 1 83  ? 23.090  43.658  23.785  1.00 117.89 ? 81  ASN A CB    1 
ATOM   653   C CG    . ASN A 1 83  ? 23.859  44.957  23.865  1.00 117.55 ? 81  ASN A CG    1 
ATOM   654   O OD1   . ASN A 1 83  ? 24.989  45.046  23.390  1.00 113.51 ? 81  ASN A OD1   1 
ATOM   655   N ND2   . ASN A 1 83  ? 23.253  45.972  24.469  1.00 122.59 ? 81  ASN A ND2   1 
ATOM   656   N N     . LYS A 1 84  ? 21.604  41.371  22.645  1.00 118.84 ? 82  LYS A N     1 
ATOM   657   C CA    . LYS A 1 84  ? 20.820  40.154  22.823  1.00 115.57 ? 82  LYS A CA    1 
ATOM   658   C C     . LYS A 1 84  ? 21.353  39.023  21.962  1.00 108.53 ? 82  LYS A C     1 
ATOM   659   O O     . LYS A 1 84  ? 21.119  37.854  22.250  1.00 105.72 ? 82  LYS A O     1 
ATOM   660   C CB    . LYS A 1 84  ? 19.357  40.406  22.456  1.00 124.06 ? 82  LYS A CB    1 
ATOM   661   C CG    . LYS A 1 84  ? 18.691  41.538  23.222  1.00 131.42 ? 82  LYS A CG    1 
ATOM   662   C CD    . LYS A 1 84  ? 17.215  41.665  22.853  1.00 136.31 ? 82  LYS A CD    1 
ATOM   663   C CE    . LYS A 1 84  ? 16.547  42.800  23.617  1.00 142.13 ? 82  LYS A CE    1 
ATOM   664   N NZ    . LYS A 1 84  ? 15.077  42.844  23.396  1.00 144.83 ? 82  LYS A NZ    1 
ATOM   665   N N     . ARG A 1 85  ? 22.061  39.382  20.896  1.00 110.07 ? 83  ARG A N     1 
ATOM   666   C CA    . ARG A 1 85  ? 22.578  38.415  19.934  1.00 107.56 ? 83  ARG A CA    1 
ATOM   667   C C     . ARG A 1 85  ? 24.025  38.026  20.239  1.00 101.55 ? 83  ARG A C     1 
ATOM   668   O O     . ARG A 1 85  ? 24.627  37.218  19.532  1.00 94.95  ? 83  ARG A O     1 
ATOM   669   C CB    . ARG A 1 85  ? 22.443  38.981  18.512  1.00 114.82 ? 83  ARG A CB    1 
ATOM   670   C CG    . ARG A 1 85  ? 20.978  39.144  18.053  1.00 125.25 ? 83  ARG A CG    1 
ATOM   671   C CD    . ARG A 1 85  ? 20.796  39.965  16.760  1.00 132.01 ? 83  ARG A CD    1 
ATOM   672   N NE    . ARG A 1 85  ? 19.405  39.945  16.292  1.00 132.49 ? 83  ARG A NE    1 
ATOM   673   C CZ    . ARG A 1 85  ? 18.453  40.785  16.698  1.00 134.02 ? 83  ARG A CZ    1 
ATOM   674   N NH1   . ARG A 1 85  ? 18.721  41.735  17.583  1.00 135.03 ? 83  ARG A NH1   1 
ATOM   675   N NH2   . ARG A 1 85  ? 17.223  40.673  16.217  1.00 132.24 ? 83  ARG A NH2   1 
ATOM   676   N N     . THR A 1 86  ? 24.563  38.597  21.313  1.00 102.90 ? 84  THR A N     1 
ATOM   677   C CA    . THR A 1 86  ? 25.971  38.447  21.666  1.00 95.52  ? 84  THR A CA    1 
ATOM   678   C C     . THR A 1 86  ? 26.153  37.508  22.849  1.00 91.41  ? 84  THR A C     1 
ATOM   679   O O     . THR A 1 86  ? 25.318  37.473  23.752  1.00 90.64  ? 84  THR A O     1 
ATOM   680   C CB    . THR A 1 86  ? 26.590  39.803  22.047  1.00 94.37  ? 84  THR A CB    1 
ATOM   681   O OG1   . THR A 1 86  ? 26.255  40.783  21.064  1.00 98.38  ? 84  THR A OG1   1 
ATOM   682   C CG2   . THR A 1 86  ? 28.105  39.692  22.153  1.00 91.33  ? 84  THR A CG2   1 
ATOM   683   N N     . GLN A 1 87  ? 27.263  36.775  22.856  1.00 88.33  ? 85  GLN A N     1 
ATOM   684   C CA    . GLN A 1 87  ? 27.516  35.782  23.890  1.00 82.68  ? 85  GLN A CA    1 
ATOM   685   C C     . GLN A 1 87  ? 27.486  36.436  25.252  1.00 84.59  ? 85  GLN A C     1 
ATOM   686   O O     . GLN A 1 87  ? 27.775  37.618  25.380  1.00 83.86  ? 85  GLN A O     1 
ATOM   687   C CB    . GLN A 1 87  ? 28.869  35.104  23.687  1.00 78.50  ? 85  GLN A CB    1 
ATOM   688   C CG    . GLN A 1 87  ? 30.059  35.982  24.008  1.00 75.78  ? 85  GLN A CG    1 
ATOM   689   C CD    . GLN A 1 87  ? 31.276  35.191  24.464  1.00 75.73  ? 85  GLN A CD    1 
ATOM   690   O OE1   . GLN A 1 87  ? 32.041  34.661  23.653  1.00 70.01  ? 85  GLN A OE1   1 
ATOM   691   N NE2   . GLN A 1 87  ? 31.463  35.116  25.777  1.00 79.98  ? 85  GLN A NE2   1 
ATOM   692   N N     . ASP A 1 88  ? 27.093  35.668  26.263  1.00 87.80  ? 86  ASP A N     1 
ATOM   693   C CA    . ASP A 1 88  ? 27.175  36.121  27.643  1.00 83.26  ? 86  ASP A CA    1 
ATOM   694   C C     . ASP A 1 88  ? 28.611  36.034  28.100  1.00 81.03  ? 86  ASP A C     1 
ATOM   695   O O     . ASP A 1 88  ? 29.409  35.270  27.546  1.00 75.79  ? 86  ASP A O     1 
ATOM   696   C CB    . ASP A 1 88  ? 26.321  35.250  28.550  1.00 84.61  ? 86  ASP A CB    1 
ATOM   697   C CG    . ASP A 1 88  ? 24.875  35.272  28.168  1.00 88.50  ? 86  ASP A CG    1 
ATOM   698   O OD1   . ASP A 1 88  ? 24.374  36.370  27.844  1.00 87.80  ? 86  ASP A OD1   1 
ATOM   699   O OD2   . ASP A 1 88  ? 24.246  34.193  28.188  1.00 90.11  ? 86  ASP A OD2   1 
ATOM   700   N N     . PHE A 1 89  ? 28.926  36.810  29.130  1.00 82.94  ? 87  PHE A N     1 
ATOM   701   C CA    . PHE A 1 89  ? 30.253  36.802  29.725  1.00 80.78  ? 87  PHE A CA    1 
ATOM   702   C C     . PHE A 1 89  ? 30.106  36.418  31.183  1.00 82.54  ? 87  PHE A C     1 
ATOM   703   O O     . PHE A 1 89  ? 28.992  36.421  31.714  1.00 84.04  ? 87  PHE A O     1 
ATOM   704   C CB    . PHE A 1 89  ? 30.891  38.182  29.619  1.00 78.40  ? 87  PHE A CB    1 
ATOM   705   C CG    . PHE A 1 89  ? 31.122  38.631  28.208  1.00 79.53  ? 87  PHE A CG    1 
ATOM   706   C CD1   . PHE A 1 89  ? 32.274  38.264  27.531  1.00 76.25  ? 87  PHE A CD1   1 
ATOM   707   C CD2   . PHE A 1 89  ? 30.185  39.415  27.555  1.00 79.84  ? 87  PHE A CD2   1 
ATOM   708   C CE1   . PHE A 1 89  ? 32.484  38.671  26.240  1.00 74.23  ? 87  PHE A CE1   1 
ATOM   709   C CE2   . PHE A 1 89  ? 30.391  39.821  26.259  1.00 79.16  ? 87  PHE A CE2   1 
ATOM   710   C CZ    . PHE A 1 89  ? 31.541  39.452  25.603  1.00 78.13  ? 87  PHE A CZ    1 
ATOM   711   N N     . TRP A 1 90  ? 31.213  36.047  31.822  1.00 81.64  ? 88  TRP A N     1 
ATOM   712   C CA    . TRP A 1 90  ? 31.197  35.897  33.265  1.00 81.12  ? 88  TRP A CA    1 
ATOM   713   C C     . TRP A 1 90  ? 31.423  37.294  33.786  1.00 84.20  ? 88  TRP A C     1 
ATOM   714   O O     . TRP A 1 90  ? 32.475  37.878  33.544  1.00 85.46  ? 88  TRP A O     1 
ATOM   715   C CB    . TRP A 1 90  ? 32.310  34.955  33.744  1.00 79.95  ? 88  TRP A CB    1 
ATOM   716   C CG    . TRP A 1 90  ? 32.123  34.475  35.192  1.00 81.01  ? 88  TRP A CG    1 
ATOM   717   C CD1   . TRP A 1 90  ? 33.031  34.563  36.231  1.00 74.28  ? 88  TRP A CD1   1 
ATOM   718   C CD2   . TRP A 1 90  ? 30.944  33.861  35.746  1.00 77.40  ? 88  TRP A CD2   1 
ATOM   719   N NE1   . TRP A 1 90  ? 32.485  34.033  37.382  1.00 68.48  ? 88  TRP A NE1   1 
ATOM   720   C CE2   . TRP A 1 90  ? 31.211  33.600  37.114  1.00 72.41  ? 88  TRP A CE2   1 
ATOM   721   C CE3   . TRP A 1 90  ? 29.690  33.510  35.218  1.00 74.14  ? 88  TRP A CE3   1 
ATOM   722   C CZ2   . TRP A 1 90  ? 30.262  33.006  37.958  1.00 69.42  ? 88  TRP A CZ2   1 
ATOM   723   C CZ3   . TRP A 1 90  ? 28.752  32.918  36.061  1.00 72.54  ? 88  TRP A CZ3   1 
ATOM   724   C CH2   . TRP A 1 90  ? 29.045  32.671  37.414  1.00 67.59  ? 88  TRP A CH2   1 
ATOM   725   N N     . GLU A 1 91  ? 30.438  37.840  34.490  1.00 86.95  ? 89  GLU A N     1 
ATOM   726   C CA    . GLU A 1 91  ? 30.536  39.226  34.919  1.00 97.88  ? 89  GLU A CA    1 
ATOM   727   C C     . GLU A 1 91  ? 31.693  39.421  35.885  1.00 101.16 ? 89  GLU A C     1 
ATOM   728   O O     . GLU A 1 91  ? 31.942  38.583  36.755  1.00 95.08  ? 89  GLU A O     1 
ATOM   729   C CB    . GLU A 1 91  ? 29.248  39.713  35.561  1.00 101.98 ? 89  GLU A CB    1 
ATOM   730   C CG    . GLU A 1 91  ? 29.412  41.104  36.148  1.00 109.82 ? 89  GLU A CG    1 
ATOM   731   C CD    . GLU A 1 91  ? 28.134  41.635  36.756  1.00 115.34 ? 89  GLU A CD    1 
ATOM   732   O OE1   . GLU A 1 91  ? 27.061  41.072  36.445  1.00 114.96 ? 89  GLU A OE1   1 
ATOM   733   O OE2   . GLU A 1 91  ? 28.206  42.610  37.543  1.00 116.62 ? 89  GLU A OE2   1 
ATOM   734   N N     . VAL A 1 92  ? 32.415  40.522  35.708  1.00 102.77 ? 90  VAL A N     1 
ATOM   735   C CA    . VAL A 1 92  ? 33.583  40.802  36.534  1.00 106.66 ? 90  VAL A CA    1 
ATOM   736   C C     . VAL A 1 92  ? 33.232  41.443  37.885  1.00 105.00 ? 90  VAL A C     1 
ATOM   737   O O     . VAL A 1 92  ? 33.978  41.293  38.857  1.00 97.85  ? 90  VAL A O     1 
ATOM   738   C CB    . VAL A 1 92  ? 34.662  41.612  35.757  1.00 105.02 ? 90  VAL A CB    1 
ATOM   739   C CG1   . VAL A 1 92  ? 35.847  41.945  36.658  1.00 102.47 ? 90  VAL A CG1   1 
ATOM   740   C CG2   . VAL A 1 92  ? 35.136  40.822  34.527  1.00 94.93  ? 90  VAL A CG2   1 
ATOM   741   N N     . GLN A 1 93  ? 32.085  42.118  37.962  1.00 107.26 ? 91  GLN A N     1 
ATOM   742   C CA    . GLN A 1 93  ? 31.732  42.790  39.210  1.00 108.34 ? 91  GLN A CA    1 
ATOM   743   C C     . GLN A 1 93  ? 30.894  41.920  40.121  1.00 106.11 ? 91  GLN A C     1 
ATOM   744   O O     . GLN A 1 93  ? 29.679  41.784  39.967  1.00 106.45 ? 91  GLN A O     1 
ATOM   745   C CB    . GLN A 1 93  ? 30.993  44.098  38.937  1.00 113.85 ? 91  GLN A CB    1 
ATOM   746   C CG    . GLN A 1 93  ? 31.933  45.205  38.544  1.00 119.60 ? 91  GLN A CG    1 
ATOM   747   C CD    . GLN A 1 93  ? 33.264  45.078  39.261  1.00 117.63 ? 91  GLN A CD    1 
ATOM   748   O OE1   . GLN A 1 93  ? 34.247  44.604  38.686  1.00 115.81 ? 91  GLN A OE1   1 
ATOM   749   N NE2   . GLN A 1 93  ? 33.299  45.487  40.530  1.00 114.95 ? 91  GLN A NE2   1 
ATOM   750   N N     . LEU A 1 94  ? 31.568  41.430  41.147  1.00 102.82 ? 92  LEU A N     1 
ATOM   751   C CA    . LEU A 1 94  ? 31.018  40.466  42.077  1.00 98.65  ? 92  LEU A CA    1 
ATOM   752   C C     . LEU A 1 94  ? 30.448  41.239  43.248  1.00 93.01  ? 92  LEU A C     1 
ATOM   753   O O     . LEU A 1 94  ? 30.087  40.668  44.278  1.00 88.43  ? 92  LEU A O     1 
ATOM   754   C CB    . LEU A 1 94  ? 32.091  39.460  42.496  1.00 97.13  ? 92  LEU A CB    1 
ATOM   755   C CG    . LEU A 1 94  ? 32.731  38.746  41.293  1.00 97.99  ? 92  LEU A CG    1 
ATOM   756   C CD1   . LEU A 1 94  ? 33.630  37.574  41.712  1.00 83.28  ? 92  LEU A CD1   1 
ATOM   757   C CD2   . LEU A 1 94  ? 31.650  38.282  40.319  1.00 94.61  ? 92  LEU A CD2   1 
ATOM   758   N N     . GLY A 1 95  ? 30.387  42.557  43.058  1.00 94.39  ? 93  GLY A N     1 
ATOM   759   C CA    . GLY A 1 95  ? 30.048  43.502  44.104  1.00 88.13  ? 93  GLY A CA    1 
ATOM   760   C C     . GLY A 1 95  ? 31.264  44.320  44.495  1.00 79.85  ? 93  GLY A C     1 
ATOM   761   O O     . GLY A 1 95  ? 32.351  44.124  43.954  1.00 78.47  ? 93  GLY A O     1 
ATOM   762   N N     . ILE A 1 96  ? 31.077  45.244  45.432  1.00 78.51  ? 94  ILE A N     1 
ATOM   763   C CA    . ILE A 1 96  ? 32.120  46.204  45.793  1.00 73.87  ? 94  ILE A CA    1 
ATOM   764   C C     . ILE A 1 96  ? 32.596  46.097  47.236  1.00 68.01  ? 94  ILE A C     1 
ATOM   765   O O     . ILE A 1 96  ? 31.824  45.754  48.130  1.00 66.36  ? 94  ILE A O     1 
ATOM   766   C CB    . ILE A 1 96  ? 31.620  47.615  45.591  1.00 69.90  ? 94  ILE A CB    1 
ATOM   767   C CG1   . ILE A 1 96  ? 30.137  47.657  45.918  1.00 70.99  ? 94  ILE A CG1   1 
ATOM   768   C CG2   . ILE A 1 96  ? 31.829  48.020  44.165  1.00 78.55  ? 94  ILE A CG2   1 
ATOM   769   C CD1   . ILE A 1 96  ? 29.607  49.034  46.031  1.00 81.65  ? 94  ILE A CD1   1 
ATOM   770   N N     . PRO A 1 97  ? 33.878  46.416  47.468  1.00 66.35  ? 95  PRO A N     1 
ATOM   771   C CA    . PRO A 1 97  ? 34.470  46.388  48.805  1.00 61.49  ? 95  PRO A CA    1 
ATOM   772   C C     . PRO A 1 97  ? 33.772  47.375  49.730  1.00 61.11  ? 95  PRO A C     1 
ATOM   773   O O     . PRO A 1 97  ? 33.305  48.412  49.258  1.00 60.49  ? 95  PRO A O     1 
ATOM   774   C CB    . PRO A 1 97  ? 35.908  46.826  48.546  1.00 58.95  ? 95  PRO A CB    1 
ATOM   775   C CG    . PRO A 1 97  ? 35.853  47.585  47.298  1.00 58.85  ? 95  PRO A CG    1 
ATOM   776   C CD    . PRO A 1 97  ? 34.822  46.935  46.468  1.00 65.92  ? 95  PRO A CD    1 
ATOM   777   N N     . HIS A 1 98  ? 33.664  47.045  51.016  1.00 58.04  ? 96  HIS A N     1 
ATOM   778   C CA    . HIS A 1 98  ? 33.127  48.000  51.978  1.00 55.35  ? 96  HIS A CA    1 
ATOM   779   C C     . HIS A 1 98  ? 34.274  48.798  52.559  1.00 57.61  ? 96  HIS A C     1 
ATOM   780   O O     . HIS A 1 98  ? 35.329  48.230  52.879  1.00 58.82  ? 96  HIS A O     1 
ATOM   781   C CB    . HIS A 1 98  ? 32.346  47.321  53.101  1.00 52.30  ? 96  HIS A CB    1 
ATOM   782   C CG    . HIS A 1 98  ? 31.422  48.251  53.837  1.00 54.38  ? 96  HIS A CG    1 
ATOM   783   N ND1   . HIS A 1 98  ? 31.816  48.977  54.942  1.00 52.08  ? 96  HIS A ND1   1 
ATOM   784   C CD2   . HIS A 1 98  ? 30.129  48.579  53.618  1.00 54.07  ? 96  HIS A CD2   1 
ATOM   785   C CE1   . HIS A 1 98  ? 30.801  49.699  55.375  1.00 50.57  ? 96  HIS A CE1   1 
ATOM   786   N NE2   . HIS A 1 98  ? 29.764  49.479  54.592  1.00 51.27  ? 96  HIS A NE2   1 
ATOM   787   N N     . PRO A 1 99  ? 34.082  50.123  52.689  1.00 56.79  ? 97  PRO A N     1 
ATOM   788   C CA    . PRO A 1 99  ? 35.151  50.951  53.240  1.00 56.37  ? 97  PRO A CA    1 
ATOM   789   C C     . PRO A 1 99  ? 35.728  50.318  54.518  1.00 52.81  ? 97  PRO A C     1 
ATOM   790   O O     . PRO A 1 99  ? 36.936  50.306  54.706  1.00 52.80  ? 97  PRO A O     1 
ATOM   791   C CB    . PRO A 1 99  ? 34.428  52.268  53.528  1.00 59.93  ? 97  PRO A CB    1 
ATOM   792   C CG    . PRO A 1 99  ? 33.375  52.330  52.478  1.00 59.98  ? 97  PRO A CG    1 
ATOM   793   C CD    . PRO A 1 99  ? 32.909  50.926  52.293  1.00 57.29  ? 97  PRO A CD    1 
ATOM   794   N N     . ALA A 1 100 ? 34.865  49.761  55.354  1.00 47.38  ? 98  ALA A N     1 
ATOM   795   C CA    . ALA A 1 100 ? 35.274  49.222  56.637  1.00 48.58  ? 98  ALA A CA    1 
ATOM   796   C C     . ALA A 1 100 ? 36.192  47.997  56.575  1.00 50.64  ? 98  ALA A C     1 
ATOM   797   O O     . ALA A 1 100 ? 36.643  47.507  57.623  1.00 47.25  ? 98  ALA A O     1 
ATOM   798   C CB    . ALA A 1 100 ? 34.061  48.942  57.500  1.00 47.89  ? 98  ALA A CB    1 
ATOM   799   N N     . GLY A 1 101 ? 36.438  47.486  55.368  1.00 50.26  ? 99  GLY A N     1 
ATOM   800   C CA    . GLY A 1 101 ? 37.260  46.302  55.218  1.00 49.94  ? 99  GLY A CA    1 
ATOM   801   C C     . GLY A 1 101 ? 38.684  46.588  54.784  1.00 55.89  ? 99  GLY A C     1 
ATOM   802   O O     . GLY A 1 101 ? 39.545  45.686  54.796  1.00 56.81  ? 99  GLY A O     1 
ATOM   803   N N     . LEU A 1 102 ? 38.910  47.843  54.387  1.00 57.78  ? 100 LEU A N     1 
ATOM   804   C CA    . LEU A 1 102 ? 40.205  48.367  53.942  1.00 57.77  ? 100 LEU A CA    1 
ATOM   805   C C     . LEU A 1 102 ? 41.186  48.473  55.096  1.00 59.00  ? 100 LEU A C     1 
ATOM   806   O O     . LEU A 1 102 ? 40.786  48.820  56.200  1.00 61.94  ? 100 LEU A O     1 
ATOM   807   C CB    . LEU A 1 102 ? 39.982  49.754  53.366  1.00 58.91  ? 100 LEU A CB    1 
ATOM   808   C CG    . LEU A 1 102 ? 38.904  49.723  52.298  1.00 60.65  ? 100 LEU A CG    1 
ATOM   809   C CD1   . LEU A 1 102 ? 38.648  51.092  51.678  1.00 61.97  ? 100 LEU A CD1   1 
ATOM   810   C CD2   . LEU A 1 102 ? 39.349  48.736  51.257  1.00 64.40  ? 100 LEU A CD2   1 
ATOM   811   N N     . LYS A 1 103 ? 42.457  48.155  54.861  1.00 60.51  ? 101 LYS A N     1 
ATOM   812   C CA    . LYS A 1 103 ? 43.497  48.374  55.864  1.00 62.25  ? 101 LYS A CA    1 
ATOM   813   C C     . LYS A 1 103 ? 44.015  49.807  55.760  1.00 69.85  ? 101 LYS A C     1 
ATOM   814   O O     . LYS A 1 103 ? 44.059  50.361  54.667  1.00 72.24  ? 101 LYS A O     1 
ATOM   815   C CB    . LYS A 1 103 ? 44.645  47.386  55.694  1.00 59.20  ? 101 LYS A CB    1 
ATOM   816   C CG    . LYS A 1 103 ? 44.314  45.961  56.083  1.00 61.20  ? 101 LYS A CG    1 
ATOM   817   C CD    . LYS A 1 103 ? 43.286  45.341  55.139  1.00 68.85  ? 101 LYS A CD    1 
ATOM   818   C CE    . LYS A 1 103 ? 43.888  45.075  53.754  1.00 75.12  ? 101 LYS A CE    1 
ATOM   819   N NZ    . LYS A 1 103 ? 42.836  45.020  52.686  1.00 79.62  ? 101 LYS A NZ    1 
ATOM   820   N N     . LYS A 1 104 ? 44.392  50.418  56.885  1.00 74.94  ? 102 LYS A N     1 
ATOM   821   C CA    . LYS A 1 104 ? 44.949  51.777  56.862  1.00 79.28  ? 102 LYS A CA    1 
ATOM   822   C C     . LYS A 1 104 ? 46.254  51.837  56.078  1.00 78.60  ? 102 LYS A C     1 
ATOM   823   O O     . LYS A 1 104 ? 47.173  51.033  56.274  1.00 74.44  ? 102 LYS A O     1 
ATOM   824   C CB    . LYS A 1 104 ? 45.178  52.326  58.277  1.00 82.63  ? 102 LYS A CB    1 
ATOM   825   C CG    . LYS A 1 104 ? 45.173  53.861  58.382  1.00 84.59  ? 102 LYS A CG    1 
ATOM   826   C CD    . LYS A 1 104 ? 46.510  54.422  58.890  1.00 90.05  ? 102 LYS A CD    1 
ATOM   827   C CE    . LYS A 1 104 ? 46.624  55.941  58.664  1.00 95.95  ? 102 LYS A CE    1 
ATOM   828   N NZ    . LYS A 1 104 ? 47.993  56.387  58.230  1.00 90.92  ? 102 LYS A NZ    1 
ATOM   829   N N     . LYS A 1 105 ? 46.314  52.813  55.186  1.00 82.07  ? 103 LYS A N     1 
ATOM   830   C CA    . LYS A 1 105 ? 47.467  53.018  54.335  1.00 82.49  ? 103 LYS A CA    1 
ATOM   831   C C     . LYS A 1 105 ? 47.942  54.458  54.531  1.00 86.46  ? 103 LYS A C     1 
ATOM   832   O O     . LYS A 1 105 ? 47.138  55.398  54.493  1.00 85.21  ? 103 LYS A O     1 
ATOM   833   C CB    . LYS A 1 105 ? 47.097  52.746  52.864  1.00 80.20  ? 103 LYS A CB    1 
ATOM   834   C CG    . LYS A 1 105 ? 46.873  51.278  52.521  1.00 72.47  ? 103 LYS A CG    1 
ATOM   835   C CD    . LYS A 1 105 ? 48.091  50.467  52.879  1.00 73.33  ? 103 LYS A CD    1 
ATOM   836   C CE    . LYS A 1 105 ? 47.753  49.025  53.137  1.00 68.75  ? 103 LYS A CE    1 
ATOM   837   N NZ    . LYS A 1 105 ? 48.972  48.268  53.521  1.00 63.33  ? 103 LYS A NZ    1 
ATOM   838   N N     . LYS A 1 106 ? 49.242  54.619  54.762  1.00 88.71  ? 104 LYS A N     1 
ATOM   839   C CA    . LYS A 1 106 ? 49.851  55.931  54.965  1.00 90.08  ? 104 LYS A CA    1 
ATOM   840   C C     . LYS A 1 106 ? 49.624  56.820  53.758  1.00 86.83  ? 104 LYS A C     1 
ATOM   841   O O     . LYS A 1 106 ? 49.288  57.999  53.885  1.00 84.88  ? 104 LYS A O     1 
ATOM   842   C CB    . LYS A 1 106 ? 51.352  55.760  55.182  1.00 94.78  ? 104 LYS A CB    1 
ATOM   843   C CG    . LYS A 1 106 ? 52.091  56.981  55.709  1.00 98.82  ? 104 LYS A CG    1 
ATOM   844   C CD    . LYS A 1 106 ? 53.457  56.540  56.225  1.00 106.28 ? 104 LYS A CD    1 
ATOM   845   C CE    . LYS A 1 106 ? 53.338  55.193  56.950  1.00 101.63 ? 104 LYS A CE    1 
ATOM   846   N NZ    . LYS A 1 106 ? 54.634  54.649  57.443  1.00 99.62  ? 104 LYS A NZ    1 
ATOM   847   N N     . SER A 1 107 ? 49.810  56.241  52.576  1.00 88.74  ? 105 SER A N     1 
ATOM   848   C CA    . SER A 1 107 ? 49.745  57.010  51.337  1.00 90.62  ? 105 SER A CA    1 
ATOM   849   C C     . SER A 1 107 ? 48.696  56.438  50.372  1.00 81.98  ? 105 SER A C     1 
ATOM   850   O O     . SER A 1 107 ? 48.770  55.262  50.027  1.00 81.16  ? 105 SER A O     1 
ATOM   851   C CB    . SER A 1 107 ? 51.134  57.026  50.668  1.00 96.41  ? 105 SER A CB    1 
ATOM   852   O OG    . SER A 1 107 ? 52.194  57.369  51.565  1.00 96.12  ? 105 SER A OG    1 
ATOM   853   N N     . VAL A 1 108 ? 47.729  57.257  49.946  1.00 76.31  ? 106 VAL A N     1 
ATOM   854   C CA    . VAL A 1 108 ? 46.676  56.797  49.027  1.00 79.68  ? 106 VAL A CA    1 
ATOM   855   C C     . VAL A 1 108 ? 46.316  57.760  47.882  1.00 87.06  ? 106 VAL A C     1 
ATOM   856   O O     . VAL A 1 108 ? 45.782  58.855  48.109  1.00 88.70  ? 106 VAL A O     1 
ATOM   857   C CB    . VAL A 1 108 ? 45.377  56.423  49.789  1.00 85.71  ? 106 VAL A CB    1 
ATOM   858   C CG1   . VAL A 1 108 ? 44.164  56.452  48.859  1.00 84.64  ? 106 VAL A CG1   1 
ATOM   859   C CG2   . VAL A 1 108 ? 45.512  55.060  50.476  1.00 80.47  ? 106 VAL A CG2   1 
ATOM   860   N N     . THR A 1 109 ? 46.542  57.298  46.650  1.00 90.79  ? 107 THR A N     1 
ATOM   861   C CA    . THR A 1 109 ? 46.401  58.116  45.439  1.00 94.89  ? 107 THR A CA    1 
ATOM   862   C C     . THR A 1 109 ? 45.345  57.521  44.504  1.00 89.11  ? 107 THR A C     1 
ATOM   863   O O     . THR A 1 109 ? 45.006  56.343  44.620  1.00 82.20  ? 107 THR A O     1 
ATOM   864   C CB    . THR A 1 109 ? 47.750  58.210  44.646  1.00 93.39  ? 107 THR A CB    1 
ATOM   865   O OG1   . THR A 1 109 ? 48.875  58.095  45.536  1.00 87.05  ? 107 THR A OG1   1 
ATOM   866   C CG2   . THR A 1 109 ? 47.834  59.520  43.879  1.00 101.74 ? 107 THR A CG2   1 
ATOM   867   N N     . VAL A 1 110 ? 44.833  58.336  43.580  1.00 92.37  ? 108 VAL A N     1 
ATOM   868   C CA    . VAL A 1 110 ? 43.878  57.862  42.575  1.00 89.98  ? 108 VAL A CA    1 
ATOM   869   C C     . VAL A 1 110 ? 44.230  58.277  41.141  1.00 96.70  ? 108 VAL A C     1 
ATOM   870   O O     . VAL A 1 110 ? 44.168  59.458  40.800  1.00 106.81 ? 108 VAL A O     1 
ATOM   871   C CB    . VAL A 1 110 ? 42.473  58.393  42.863  1.00 90.59  ? 108 VAL A CB    1 
ATOM   872   C CG1   . VAL A 1 110 ? 42.530  59.877  43.113  1.00 113.52 ? 108 VAL A CG1   1 
ATOM   873   C CG2   . VAL A 1 110 ? 41.551  58.111  41.699  1.00 84.94  ? 108 VAL A CG2   1 
ATOM   874   N N     . LEU A 1 111 ? 44.553  57.304  40.288  1.00 95.63  ? 109 LEU A N     1 
ATOM   875   C CA    . LEU A 1 111 ? 44.808  57.587  38.870  1.00 91.85  ? 109 LEU A CA    1 
ATOM   876   C C     . LEU A 1 111 ? 43.564  57.265  38.047  1.00 92.88  ? 109 LEU A C     1 
ATOM   877   O O     . LEU A 1 111 ? 42.937  56.218  38.220  1.00 90.94  ? 109 LEU A O     1 
ATOM   878   C CB    . LEU A 1 111 ? 45.983  56.766  38.340  1.00 91.89  ? 109 LEU A CB    1 
ATOM   879   C CG    . LEU A 1 111 ? 47.121  56.347  39.272  1.00 89.88  ? 109 LEU A CG    1 
ATOM   880   C CD1   . LEU A 1 111 ? 47.976  55.264  38.629  1.00 83.39  ? 109 LEU A CD1   1 
ATOM   881   C CD2   . LEU A 1 111 ? 47.965  57.538  39.650  1.00 100.60 ? 109 LEU A CD2   1 
ATOM   882   N N     . ASP A 1 112 ? 43.201  58.161  37.145  1.00 95.53  ? 110 ASP A N     1 
ATOM   883   C CA    . ASP A 1 112 ? 42.014  57.953  36.335  1.00 99.15  ? 110 ASP A CA    1 
ATOM   884   C C     . ASP A 1 112 ? 42.384  57.706  34.874  1.00 106.40 ? 110 ASP A C     1 
ATOM   885   O O     . ASP A 1 112 ? 42.940  58.584  34.215  1.00 112.41 ? 110 ASP A O     1 
ATOM   886   C CB    . ASP A 1 112 ? 41.085  59.158  36.466  1.00 104.61 ? 110 ASP A CB    1 
ATOM   887   C CG    . ASP A 1 112 ? 40.165  59.320  35.274  1.00 111.67 ? 110 ASP A CG    1 
ATOM   888   O OD1   . ASP A 1 112 ? 39.256  58.476  35.100  1.00 112.01 ? 110 ASP A OD1   1 
ATOM   889   O OD2   . ASP A 1 112 ? 40.345  60.302  34.518  1.00 111.05 ? 110 ASP A OD2   1 
ATOM   890   N N     . VAL A 1 113 ? 42.078  56.515  34.365  1.00 103.60 ? 111 VAL A N     1 
ATOM   891   C CA    . VAL A 1 113 ? 42.443  56.166  32.996  1.00 103.04 ? 111 VAL A CA    1 
ATOM   892   C C     . VAL A 1 113 ? 41.530  56.836  31.978  1.00 106.43 ? 111 VAL A C     1 
ATOM   893   O O     . VAL A 1 113 ? 40.317  56.633  31.990  1.00 106.99 ? 111 VAL A O     1 
ATOM   894   C CB    . VAL A 1 113 ? 42.403  54.654  32.768  1.00 99.82  ? 111 VAL A CB    1 
ATOM   895   C CG1   . VAL A 1 113 ? 42.453  54.356  31.284  1.00 101.14 ? 111 VAL A CG1   1 
ATOM   896   C CG2   . VAL A 1 113 ? 43.553  53.975  33.497  1.00 98.28  ? 111 VAL A CG2   1 
ATOM   897   N N     . GLY A 1 114 ? 42.126  57.634  31.096  1.00 109.90 ? 112 GLY A N     1 
ATOM   898   C CA    . GLY A 1 114 ? 41.383  58.345  30.071  1.00 109.65 ? 112 GLY A CA    1 
ATOM   899   C C     . GLY A 1 114 ? 41.306  57.547  28.790  1.00 111.99 ? 112 GLY A C     1 
ATOM   900   O O     . GLY A 1 114 ? 42.202  56.751  28.487  1.00 108.92 ? 112 GLY A O     1 
ATOM   901   N N     . ASP A 1 115 ? 40.248  57.777  28.020  1.00 115.70 ? 113 ASP A N     1 
ATOM   902   C CA    . ASP A 1 115 ? 39.979  56.959  26.842  1.00 119.44 ? 113 ASP A CA    1 
ATOM   903   C C     . ASP A 1 115 ? 40.076  55.488  27.223  1.00 112.69 ? 113 ASP A C     1 
ATOM   904   O O     . ASP A 1 115 ? 40.626  54.674  26.481  1.00 109.29 ? 113 ASP A O     1 
ATOM   905   C CB    . ASP A 1 115 ? 40.958  57.280  25.710  1.00 124.37 ? 113 ASP A CB    1 
ATOM   906   C CG    . ASP A 1 115 ? 40.350  58.187  24.649  1.00 134.01 ? 113 ASP A CG    1 
ATOM   907   O OD1   . ASP A 1 115 ? 39.104  58.328  24.621  1.00 131.38 ? 113 ASP A OD1   1 
ATOM   908   O OD2   . ASP A 1 115 ? 41.121  58.749  23.837  1.00 139.22 ? 113 ASP A OD2   1 
ATOM   909   N N     . ALA A 1 116 ? 39.531  55.170  28.393  1.00 111.79 ? 114 ALA A N     1 
ATOM   910   C CA    . ALA A 1 116 ? 39.629  53.842  28.987  1.00 104.18 ? 114 ALA A CA    1 
ATOM   911   C C     . ALA A 1 116 ? 39.046  52.744  28.101  1.00 102.77 ? 114 ALA A C     1 
ATOM   912   O O     . ALA A 1 116 ? 39.716  51.755  27.803  1.00 99.29  ? 114 ALA A O     1 
ATOM   913   C CB    . ALA A 1 116 ? 38.954  53.842  30.343  1.00 102.38 ? 114 ALA A CB    1 
ATOM   914   N N     . TYR A 1 117 ? 37.797  52.917  27.683  1.00 104.40 ? 115 TYR A N     1 
ATOM   915   C CA    . TYR A 1 117 ? 37.146  51.924  26.841  1.00 104.30 ? 115 TYR A CA    1 
ATOM   916   C C     . TYR A 1 117 ? 37.718  51.876  25.427  1.00 103.50 ? 115 TYR A C     1 
ATOM   917   O O     . TYR A 1 117 ? 37.796  50.812  24.817  1.00 97.56  ? 115 TYR A O     1 
ATOM   918   C CB    . TYR A 1 117 ? 35.636  52.148  26.806  1.00 105.81 ? 115 TYR A CB    1 
ATOM   919   C CG    . TYR A 1 117 ? 34.893  51.406  27.897  1.00 103.86 ? 115 TYR A CG    1 
ATOM   920   C CD1   . TYR A 1 117 ? 35.569  50.613  28.810  1.00 97.50  ? 115 TYR A CD1   1 
ATOM   921   C CD2   . TYR A 1 117 ? 33.512  51.483  27.999  1.00 106.54 ? 115 TYR A CD2   1 
ATOM   922   C CE1   . TYR A 1 117 ? 34.893  49.932  29.796  1.00 94.26  ? 115 TYR A CE1   1 
ATOM   923   C CE2   . TYR A 1 117 ? 32.829  50.807  28.983  1.00 98.72  ? 115 TYR A CE2   1 
ATOM   924   C CZ    . TYR A 1 117 ? 33.522  50.035  29.878  1.00 95.41  ? 115 TYR A CZ    1 
ATOM   925   O OH    . TYR A 1 117 ? 32.837  49.361  30.862  1.00 96.94  ? 115 TYR A OH    1 
ATOM   926   N N     . PHE A 1 118 ? 38.131  53.028  24.914  1.00 109.00 ? 116 PHE A N     1 
ATOM   927   C CA    . PHE A 1 118 ? 38.670  53.102  23.563  1.00 106.76 ? 116 PHE A CA    1 
ATOM   928   C C     . PHE A 1 118 ? 40.159  52.782  23.513  1.00 99.17  ? 116 PHE A C     1 
ATOM   929   O O     . PHE A 1 118 ? 40.763  52.843  22.450  1.00 99.04  ? 116 PHE A O     1 
ATOM   930   C CB    . PHE A 1 118 ? 38.427  54.484  22.959  1.00 114.98 ? 116 PHE A CB    1 
ATOM   931   C CG    . PHE A 1 118 ? 36.981  54.884  22.908  1.00 120.62 ? 116 PHE A CG    1 
ATOM   932   C CD1   . PHE A 1 118 ? 36.229  54.681  21.758  1.00 122.27 ? 116 PHE A CD1   1 
ATOM   933   C CD2   . PHE A 1 118 ? 36.373  55.481  24.006  1.00 123.48 ? 116 PHE A CD2   1 
ATOM   934   C CE1   . PHE A 1 118 ? 34.891  55.059  21.702  1.00 126.08 ? 116 PHE A CE1   1 
ATOM   935   C CE2   . PHE A 1 118 ? 35.035  55.863  23.958  1.00 128.84 ? 116 PHE A CE2   1 
ATOM   936   C CZ    . PHE A 1 118 ? 34.293  55.650  22.804  1.00 128.77 ? 116 PHE A CZ    1 
ATOM   937   N N     . SER A 1 119 ? 40.748  52.458  24.661  1.00 97.76  ? 117 SER A N     1 
ATOM   938   C CA    . SER A 1 119 ? 42.169  52.115  24.735  1.00 95.26  ? 117 SER A CA    1 
ATOM   939   C C     . SER A 1 119 ? 42.387  50.612  24.603  1.00 90.80  ? 117 SER A C     1 
ATOM   940   O O     . SER A 1 119 ? 43.523  50.131  24.674  1.00 84.67  ? 117 SER A O     1 
ATOM   941   C CB    . SER A 1 119 ? 42.788  52.602  26.054  1.00 98.48  ? 117 SER A CB    1 
ATOM   942   O OG    . SER A 1 119 ? 43.404  53.875  25.926  1.00 100.62 ? 117 SER A OG    1 
ATOM   943   N N     . VAL A 1 120 ? 41.289  49.878  24.433  1.00 92.56  ? 118 VAL A N     1 
ATOM   944   C CA    . VAL A 1 120 ? 41.316  48.413  24.362  1.00 87.08  ? 118 VAL A CA    1 
ATOM   945   C C     . VAL A 1 120 ? 40.890  47.864  22.986  1.00 79.92  ? 118 VAL A C     1 
ATOM   946   O O     . VAL A 1 120 ? 39.781  48.111  22.516  1.00 80.93  ? 118 VAL A O     1 
ATOM   947   C CB    . VAL A 1 120 ? 40.466  47.771  25.504  1.00 87.14  ? 118 VAL A CB    1 
ATOM   948   C CG1   . VAL A 1 120 ? 40.848  46.316  25.718  1.00 79.75  ? 118 VAL A CG1   1 
ATOM   949   C CG2   . VAL A 1 120 ? 40.644  48.543  26.796  1.00 88.64  ? 118 VAL A CG2   1 
ATOM   950   N N     . PRO A 1 121 ? 41.783  47.113  22.342  1.00 73.66  ? 119 PRO A N     1 
ATOM   951   C CA    . PRO A 1 121 ? 41.547  46.530  21.028  1.00 75.93  ? 119 PRO A CA    1 
ATOM   952   C C     . PRO A 1 121 ? 40.377  45.589  21.061  1.00 79.18  ? 119 PRO A C     1 
ATOM   953   O O     . PRO A 1 121 ? 40.369  44.716  21.910  1.00 82.07  ? 119 PRO A O     1 
ATOM   954   C CB    . PRO A 1 121 ? 42.801  45.698  20.804  1.00 75.09  ? 119 PRO A CB    1 
ATOM   955   C CG    . PRO A 1 121 ? 43.300  45.397  22.154  1.00 71.71  ? 119 PRO A CG    1 
ATOM   956   C CD    . PRO A 1 121 ? 43.035  46.627  22.929  1.00 74.12  ? 119 PRO A CD    1 
ATOM   957   N N     . LEU A 1 122 ? 39.427  45.741  20.144  1.00 85.24  ? 120 LEU A N     1 
ATOM   958   C CA    . LEU A 1 122 ? 38.334  44.780  19.987  1.00 83.77  ? 120 LEU A CA    1 
ATOM   959   C C     . LEU A 1 122 ? 38.838  43.495  19.320  1.00 80.88  ? 120 LEU A C     1 
ATOM   960   O O     . LEU A 1 122 ? 39.910  43.480  18.735  1.00 83.12  ? 120 LEU A O     1 
ATOM   961   C CB    . LEU A 1 122 ? 37.187  45.399  19.195  1.00 83.19  ? 120 LEU A CB    1 
ATOM   962   C CG    . LEU A 1 122 ? 35.948  44.553  18.915  1.00 83.10  ? 120 LEU A CG    1 
ATOM   963   C CD1   . LEU A 1 122 ? 35.579  43.726  20.118  1.00 88.86  ? 120 LEU A CD1   1 
ATOM   964   C CD2   . LEU A 1 122 ? 34.794  45.446  18.527  1.00 84.41  ? 120 LEU A CD2   1 
ATOM   965   N N     . ASP A 1 123 ? 38.098  42.403  19.444  1.00 79.19  ? 121 ASP A N     1 
ATOM   966   C CA    . ASP A 1 123 ? 38.535  41.167  18.820  1.00 81.14  ? 121 ASP A CA    1 
ATOM   967   C C     . ASP A 1 123 ? 38.555  41.365  17.320  1.00 84.69  ? 121 ASP A C     1 
ATOM   968   O O     . ASP A 1 123 ? 37.586  41.868  16.740  1.00 83.06  ? 121 ASP A O     1 
ATOM   969   C CB    . ASP A 1 123 ? 37.606  39.999  19.161  1.00 77.97  ? 121 ASP A CB    1 
ATOM   970   C CG    . ASP A 1 123 ? 38.147  38.657  18.671  1.00 74.59  ? 121 ASP A CG    1 
ATOM   971   O OD1   . ASP A 1 123 ? 39.357  38.394  18.882  1.00 71.24  ? 121 ASP A OD1   1 
ATOM   972   O OD2   . ASP A 1 123 ? 37.361  37.874  18.082  1.00 71.68  ? 121 ASP A OD2   1 
ATOM   973   N N     . GLU A 1 124 ? 39.647  40.940  16.692  1.00 83.89  ? 122 GLU A N     1 
ATOM   974   C CA    . GLU A 1 124 ? 39.791  41.072  15.257  1.00 84.74  ? 122 GLU A CA    1 
ATOM   975   C C     . GLU A 1 124 ? 38.466  40.660  14.614  1.00 84.31  ? 122 GLU A C     1 
ATOM   976   O O     . GLU A 1 124 ? 37.701  41.503  14.134  1.00 82.42  ? 122 GLU A O     1 
ATOM   977   C CB    . GLU A 1 124 ? 40.932  40.159  14.781  1.00 85.25  ? 122 GLU A CB    1 
ATOM   978   C CG    . GLU A 1 124 ? 41.444  40.423  13.357  1.00 89.13  ? 122 GLU A CG    1 
ATOM   979   C CD    . GLU A 1 124 ? 42.131  41.786  13.186  1.00 95.60  ? 122 GLU A CD    1 
ATOM   980   O OE1   . GLU A 1 124 ? 43.191  42.020  13.813  1.00 93.93  ? 122 GLU A OE1   1 
ATOM   981   O OE2   . GLU A 1 124 ? 41.615  42.626  12.412  1.00 96.99  ? 122 GLU A OE2   1 
ATOM   982   N N     . ASP A 1 125 ? 38.175  39.365  14.700  1.00 83.24  ? 123 ASP A N     1 
ATOM   983   C CA    . ASP A 1 125 ? 37.107  38.713  13.950  1.00 78.72  ? 123 ASP A CA    1 
ATOM   984   C C     . ASP A 1 125 ? 35.679  39.146  14.309  1.00 81.74  ? 123 ASP A C     1 
ATOM   985   O O     . ASP A 1 125 ? 34.730  38.815  13.603  1.00 84.48  ? 123 ASP A O     1 
ATOM   986   C CB    . ASP A 1 125 ? 37.248  37.199  14.110  1.00 79.51  ? 123 ASP A CB    1 
ATOM   987   C CG    . ASP A 1 125 ? 38.707  36.751  14.214  1.00 83.82  ? 123 ASP A CG    1 
ATOM   988   O OD1   . ASP A 1 125 ? 39.206  36.139  13.246  1.00 89.58  ? 123 ASP A OD1   1 
ATOM   989   O OD2   . ASP A 1 125 ? 39.360  37.012  15.254  1.00 76.84  ? 123 ASP A OD2   1 
ATOM   990   N N     . PHE A 1 126 ? 35.513  39.852  15.416  1.00 81.28  ? 124 PHE A N     1 
ATOM   991   C CA    . PHE A 1 126 ? 34.179  40.257  15.837  1.00 81.92  ? 124 PHE A CA    1 
ATOM   992   C C     . PHE A 1 126 ? 33.836  41.663  15.358  1.00 85.30  ? 124 PHE A C     1 
ATOM   993   O O     . PHE A 1 126 ? 32.678  42.079  15.405  1.00 86.72  ? 124 PHE A O     1 
ATOM   994   C CB    . PHE A 1 126 ? 34.069  40.156  17.370  1.00 81.69  ? 124 PHE A CB    1 
ATOM   995   C CG    . PHE A 1 126 ? 32.663  40.311  17.909  1.00 77.94  ? 124 PHE A CG    1 
ATOM   996   C CD1   . PHE A 1 126 ? 31.869  39.208  18.133  1.00 75.64  ? 124 PHE A CD1   1 
ATOM   997   C CD2   . PHE A 1 126 ? 32.151  41.560  18.215  1.00 81.63  ? 124 PHE A CD2   1 
ATOM   998   C CE1   . PHE A 1 126 ? 30.589  39.353  18.626  1.00 81.04  ? 124 PHE A CE1   1 
ATOM   999   C CE2   . PHE A 1 126 ? 30.866  41.705  18.712  1.00 81.31  ? 124 PHE A CE2   1 
ATOM   1000  C CZ    . PHE A 1 126 ? 30.090  40.604  18.917  1.00 81.74  ? 124 PHE A CZ    1 
ATOM   1001  N N     . ARG A 1 127 ? 34.839  42.381  14.863  1.00 87.24  ? 125 ARG A N     1 
ATOM   1002  C CA    . ARG A 1 127 ? 34.688  43.814  14.588  1.00 91.22  ? 125 ARG A CA    1 
ATOM   1003  C C     . ARG A 1 127 ? 33.459  44.129  13.736  1.00 94.28  ? 125 ARG A C     1 
ATOM   1004  O O     . ARG A 1 127 ? 32.757  45.118  13.963  1.00 92.18  ? 125 ARG A O     1 
ATOM   1005  C CB    . ARG A 1 127 ? 35.962  44.367  13.939  1.00 87.00  ? 125 ARG A CB    1 
ATOM   1006  C CG    . ARG A 1 127 ? 36.959  44.963  14.924  1.00 85.54  ? 125 ARG A CG    1 
ATOM   1007  C CD    . ARG A 1 127 ? 38.404  44.791  14.480  1.00 86.58  ? 125 ARG A CD    1 
ATOM   1008  N NE    . ARG A 1 127 ? 39.330  45.515  15.350  1.00 89.17  ? 125 ARG A NE    1 
ATOM   1009  C CZ    . ARG A 1 127 ? 40.652  45.366  15.339  1.00 89.68  ? 125 ARG A CZ    1 
ATOM   1010  N NH1   . ARG A 1 127 ? 41.220  44.510  14.503  1.00 89.38  ? 125 ARG A NH1   1 
ATOM   1011  N NH2   . ARG A 1 127 ? 41.408  46.069  16.171  1.00 89.10  ? 125 ARG A NH2   1 
ATOM   1012  N N     . LYS A 1 128 ? 33.201  43.244  12.779  1.00 97.22  ? 126 LYS A N     1 
ATOM   1013  C CA    . LYS A 1 128 ? 32.187  43.430  11.748  1.00 97.78  ? 126 LYS A CA    1 
ATOM   1014  C C     . LYS A 1 128 ? 30.789  43.822  12.241  1.00 106.98 ? 126 LYS A C     1 
ATOM   1015  O O     . LYS A 1 128 ? 30.135  44.675  11.647  1.00 115.26 ? 126 LYS A O     1 
ATOM   1016  C CB    . LYS A 1 128 ? 32.125  42.191  10.844  1.00 96.61  ? 126 LYS A CB    1 
ATOM   1017  C CG    . LYS A 1 128 ? 32.347  40.865  11.566  1.00 100.56 ? 126 LYS A CG    1 
ATOM   1018  C CD    . LYS A 1 128 ? 32.624  39.689  10.615  1.00 98.09  ? 126 LYS A CD    1 
ATOM   1019  C CE    . LYS A 1 128 ? 31.485  39.467  9.621   1.00 105.38 ? 126 LYS A CE    1 
ATOM   1020  N NZ    . LYS A 1 128 ? 30.120  39.453  10.235  1.00 104.54 ? 126 LYS A NZ    1 
ATOM   1021  N N     . TYR A 1 129 ? 30.349  43.233  13.345  1.00 106.46 ? 127 TYR A N     1 
ATOM   1022  C CA    . TYR A 1 129 ? 28.943  43.313  13.758  1.00 110.77 ? 127 TYR A CA    1 
ATOM   1023  C C     . TYR A 1 129 ? 28.527  44.714  14.205  1.00 112.13 ? 127 TYR A C     1 
ATOM   1024  O O     . TYR A 1 129 ? 27.398  44.948  14.629  1.00 110.73 ? 127 TYR A O     1 
ATOM   1025  C CB    . TYR A 1 129 ? 28.625  42.233  14.791  1.00 103.69 ? 127 TYR A CB    1 
ATOM   1026  C CG    . TYR A 1 129 ? 28.951  40.849  14.267  1.00 102.84 ? 127 TYR A CG    1 
ATOM   1027  C CD1   . TYR A 1 129 ? 27.979  40.066  13.655  1.00 105.73 ? 127 TYR A CD1   1 
ATOM   1028  C CD2   . TYR A 1 129 ? 30.242  40.344  14.350  1.00 93.69  ? 127 TYR A CD2   1 
ATOM   1029  C CE1   . TYR A 1 129 ? 28.280  38.814  13.165  1.00 104.03 ? 127 TYR A CE1   1 
ATOM   1030  C CE2   . TYR A 1 129 ? 30.551  39.095  13.864  1.00 92.87  ? 127 TYR A CE2   1 
ATOM   1031  C CZ    . TYR A 1 129 ? 29.569  38.335  13.273  1.00 98.96  ? 127 TYR A CZ    1 
ATOM   1032  O OH    . TYR A 1 129 ? 29.885  37.092  12.790  1.00 97.49  ? 127 TYR A OH    1 
ATOM   1033  N N     . THR A 1 130 ? 29.479  45.630  14.115  1.00 111.74 ? 128 THR A N     1 
ATOM   1034  C CA    . THR A 1 130 ? 29.370  46.964  14.677  1.00 122.28 ? 128 THR A CA    1 
ATOM   1035  C C     . THR A 1 130 ? 28.563  48.066  13.940  1.00 139.42 ? 128 THR A C     1 
ATOM   1036  O O     . THR A 1 130 ? 28.222  49.069  14.563  1.00 146.39 ? 128 THR A O     1 
ATOM   1037  C CB    . THR A 1 130 ? 30.775  47.513  14.903  1.00 116.15 ? 128 THR A CB    1 
ATOM   1038  O OG1   . THR A 1 130 ? 31.534  47.388  13.696  1.00 104.43 ? 128 THR A OG1   1 
ATOM   1039  C CG2   . THR A 1 130 ? 31.448  46.759  16.024  1.00 119.97 ? 128 THR A CG2   1 
ATOM   1040  N N     . ALA A 1 131 ? 28.257  47.905  12.651  1.00 142.26 ? 129 ALA A N     1 
ATOM   1041  C CA    . ALA A 1 131 ? 27.723  49.020  11.826  1.00 152.54 ? 129 ALA A CA    1 
ATOM   1042  C C     . ALA A 1 131 ? 26.499  49.795  12.379  1.00 162.44 ? 129 ALA A C     1 
ATOM   1043  O O     . ALA A 1 131 ? 25.556  49.191  12.894  1.00 161.93 ? 129 ALA A O     1 
ATOM   1044  C CB    . ALA A 1 131 ? 27.448  48.536  10.407  1.00 156.06 ? 129 ALA A CB    1 
ATOM   1045  N N     . PHE A 1 132 ? 26.513  51.128  12.240  1.00 166.16 ? 130 PHE A N     1 
ATOM   1046  C CA    . PHE A 1 132 ? 25.502  52.001  12.872  1.00 172.98 ? 130 PHE A CA    1 
ATOM   1047  C C     . PHE A 1 132 ? 25.211  53.327  12.139  1.00 176.98 ? 130 PHE A C     1 
ATOM   1048  O O     . PHE A 1 132 ? 26.018  53.783  11.330  1.00 176.07 ? 130 PHE A O     1 
ATOM   1049  C CB    . PHE A 1 132 ? 25.902  52.278  14.331  1.00 175.88 ? 130 PHE A CB    1 
ATOM   1050  C CG    . PHE A 1 132 ? 25.757  53.724  14.763  1.00 180.57 ? 130 PHE A CG    1 
ATOM   1051  C CD1   . PHE A 1 132 ? 24.688  54.126  15.557  1.00 182.88 ? 130 PHE A CD1   1 
ATOM   1052  C CD2   . PHE A 1 132 ? 26.705  54.673  14.405  1.00 177.63 ? 130 PHE A CD2   1 
ATOM   1053  C CE1   . PHE A 1 132 ? 24.562  55.447  15.968  1.00 183.11 ? 130 PHE A CE1   1 
ATOM   1054  C CE2   . PHE A 1 132 ? 26.584  55.992  14.814  1.00 179.47 ? 130 PHE A CE2   1 
ATOM   1055  C CZ    . PHE A 1 132 ? 25.511  56.378  15.597  1.00 183.05 ? 130 PHE A CZ    1 
ATOM   1056  N N     . THR A 1 133 ? 24.059  53.937  12.442  1.00 180.80 ? 131 THR A N     1 
ATOM   1057  C CA    . THR A 1 133 ? 23.652  55.220  11.839  1.00 184.52 ? 131 THR A CA    1 
ATOM   1058  C C     . THR A 1 133 ? 22.789  56.111  12.778  1.00 186.90 ? 131 THR A C     1 
ATOM   1059  O O     . THR A 1 133 ? 21.953  55.606  13.532  1.00 184.32 ? 131 THR A O     1 
ATOM   1060  C CB    . THR A 1 133 ? 22.933  54.994  10.473  1.00 181.87 ? 131 THR A CB    1 
ATOM   1061  O OG1   . THR A 1 133 ? 23.104  56.140  9.628   1.00 180.17 ? 131 THR A OG1   1 
ATOM   1062  C CG2   . THR A 1 133 ? 21.450  54.712  10.671  1.00 181.09 ? 131 THR A CG2   1 
ATOM   1063  N N     . ILE A 1 134 ? 23.009  57.431  12.719  1.00 192.00 ? 132 ILE A N     1 
ATOM   1064  C CA    . ILE A 1 134 ? 22.342  58.422  13.593  1.00 196.27 ? 132 ILE A CA    1 
ATOM   1065  C C     . ILE A 1 134 ? 22.111  59.770  12.846  1.00 199.74 ? 132 ILE A C     1 
ATOM   1066  O O     . ILE A 1 134 ? 22.931  60.152  12.007  1.00 198.50 ? 132 ILE A O     1 
ATOM   1067  C CB    . ILE A 1 134 ? 23.184  58.638  14.897  1.00 194.23 ? 132 ILE A CB    1 
ATOM   1068  C CG1   . ILE A 1 134 ? 22.376  59.313  16.010  1.00 193.09 ? 132 ILE A CG1   1 
ATOM   1069  C CG2   . ILE A 1 134 ? 24.467  59.410  14.602  1.00 193.46 ? 132 ILE A CG2   1 
ATOM   1070  C CD1   . ILE A 1 134 ? 23.193  59.586  17.257  1.00 190.05 ? 132 ILE A CD1   1 
ATOM   1071  N N     . PRO A 1 135 ? 21.001  60.496  13.147  1.00 198.71 ? 133 PRO A N     1 
ATOM   1072  C CA    . PRO A 1 135 ? 20.604  61.733  12.431  1.00 199.44 ? 133 PRO A CA    1 
ATOM   1073  C C     . PRO A 1 135 ? 21.670  62.851  12.309  1.00 198.25 ? 133 PRO A C     1 
ATOM   1074  O O     . PRO A 1 135 ? 22.300  63.212  13.306  1.00 198.91 ? 133 PRO A O     1 
ATOM   1075  C CB    . PRO A 1 135 ? 19.404  62.236  13.247  1.00 197.06 ? 133 PRO A CB    1 
ATOM   1076  C CG    . PRO A 1 135 ? 18.804  60.997  13.815  1.00 196.18 ? 133 PRO A CG    1 
ATOM   1077  C CD    . PRO A 1 135 ? 19.964  60.072  14.111  1.00 198.59 ? 133 PRO A CD    1 
ATOM   1078  N N     . SER A 1 136 ? 21.843  63.396  11.100  1.00 196.45 ? 134 SER A N     1 
ATOM   1079  C CA    . SER A 1 136 ? 22.895  64.387  10.807  1.00 194.64 ? 134 SER A CA    1 
ATOM   1080  C C     . SER A 1 136 ? 22.836  65.661  11.654  1.00 193.14 ? 134 SER A C     1 
ATOM   1081  O O     . SER A 1 136 ? 23.678  65.883  12.526  1.00 192.01 ? 134 SER A O     1 
ATOM   1082  C CB    . SER A 1 136 ? 22.857  64.774  9.326   1.00 190.99 ? 134 SER A CB    1 
ATOM   1083  O OG    . SER A 1 136 ? 21.739  65.599  9.045   1.00 188.50 ? 134 SER A OG    1 
ATOM   1084  N N     . ILE A 1 137 ? 21.854  66.507  11.360  1.00 192.43 ? 135 ILE A N     1 
ATOM   1085  C CA    . ILE A 1 137 ? 21.514  67.650  12.202  1.00 192.72 ? 135 ILE A CA    1 
ATOM   1086  C C     . ILE A 1 137 ? 20.002  67.609  12.393  1.00 194.19 ? 135 ILE A C     1 
ATOM   1087  O O     . ILE A 1 137 ? 19.503  67.395  13.501  1.00 193.31 ? 135 ILE A O     1 
ATOM   1088  C CB    . ILE A 1 137 ? 21.972  68.991  11.582  1.00 189.93 ? 135 ILE A CB    1 
ATOM   1089  C CG1   . ILE A 1 137 ? 21.441  70.168  12.404  1.00 188.50 ? 135 ILE A CG1   1 
ATOM   1090  C CG2   . ILE A 1 137 ? 21.562  69.090  10.115  1.00 188.14 ? 135 ILE A CG2   1 
ATOM   1091  C CD1   . ILE A 1 137 ? 21.895  70.155  13.850  1.00 188.25 ? 135 ILE A CD1   1 
ATOM   1092  N N     . ASN A 1 138 ? 19.286  67.825  11.294  1.00 193.91 ? 136 ASN A N     1 
ATOM   1093  C CA    . ASN A 1 138 ? 17.916  67.362  11.154  1.00 191.95 ? 136 ASN A CA    1 
ATOM   1094  C C     . ASN A 1 138 ? 18.018  66.146  10.241  1.00 192.87 ? 136 ASN A C     1 
ATOM   1095  O O     . ASN A 1 138 ? 17.942  65.004  10.700  1.00 192.77 ? 136 ASN A O     1 
ATOM   1096  C CB    . ASN A 1 138 ? 17.053  68.445  10.510  1.00 188.91 ? 136 ASN A CB    1 
ATOM   1097  C CG    . ASN A 1 138 ? 15.574  68.130  10.579  1.00 186.37 ? 136 ASN A CG    1 
ATOM   1098  O OD1   . ASN A 1 138 ? 15.100  67.187  9.947   1.00 185.89 ? 136 ASN A OD1   1 
ATOM   1099  N ND2   . ASN A 1 138 ? 14.834  68.927  11.340  1.00 183.80 ? 136 ASN A ND2   1 
ATOM   1100  N N     . ASN A 1 139 ? 18.195  66.413  8.947   1.00 194.03 ? 137 ASN A N     1 
ATOM   1101  C CA    . ASN A 1 139 ? 18.792  65.471  7.992   1.00 193.76 ? 137 ASN A CA    1 
ATOM   1102  C C     . ASN A 1 139 ? 18.752  66.012  6.555   1.00 192.54 ? 137 ASN A C     1 
ATOM   1103  O O     . ASN A 1 139 ? 17.935  66.877  6.233   1.00 191.83 ? 137 ASN A O     1 
ATOM   1104  C CB    . ASN A 1 139 ? 18.132  64.091  8.066   1.00 192.23 ? 137 ASN A CB    1 
ATOM   1105  C CG    . ASN A 1 139 ? 19.146  62.961  8.057   1.00 190.12 ? 137 ASN A CG    1 
ATOM   1106  O OD1   . ASN A 1 139 ? 19.546  62.464  9.110   1.00 189.35 ? 137 ASN A OD1   1 
ATOM   1107  N ND2   . ASN A 1 139 ? 19.572  62.555  6.867   1.00 188.61 ? 137 ASN A ND2   1 
ATOM   1108  N N     . GLU A 1 140 ? 19.626  65.497  5.695   1.00 190.97 ? 138 GLU A N     1 
ATOM   1109  C CA    . GLU A 1 140 ? 19.625  65.883  4.286   1.00 189.02 ? 138 GLU A CA    1 
ATOM   1110  C C     . GLU A 1 140 ? 19.700  64.665  3.372   1.00 187.19 ? 138 GLU A C     1 
ATOM   1111  O O     . GLU A 1 140 ? 18.729  64.301  2.709   1.00 185.16 ? 138 GLU A O     1 
ATOM   1112  C CB    . GLU A 1 140 ? 20.788  66.836  3.992   1.00 187.76 ? 138 GLU A CB    1 
ATOM   1113  C CG    . GLU A 1 140 ? 20.535  68.289  4.398   1.00 190.06 ? 138 GLU A CG    1 
ATOM   1114  C CD    . GLU A 1 140 ? 20.461  68.497  5.905   1.00 191.41 ? 138 GLU A CD    1 
ATOM   1115  O OE1   . GLU A 1 140 ? 21.251  67.867  6.642   1.00 191.15 ? 138 GLU A OE1   1 
ATOM   1116  O OE2   . GLU A 1 140 ? 19.611  69.296  6.354   1.00 190.25 ? 138 GLU A OE2   1 
ATOM   1117  N N     . THR A 1 141 ? 20.874  64.044  3.345   1.00 187.46 ? 139 THR A N     1 
ATOM   1118  C CA    . THR A 1 141 ? 21.082  62.787  2.639   1.00 189.66 ? 139 THR A CA    1 
ATOM   1119  C C     . THR A 1 141 ? 20.841  61.614  3.598   1.00 191.73 ? 139 THR A C     1 
ATOM   1120  O O     . THR A 1 141 ? 20.908  61.793  4.816   1.00 190.95 ? 139 THR A O     1 
ATOM   1121  C CB    . THR A 1 141 ? 22.495  62.728  2.032   1.00 187.44 ? 139 THR A CB    1 
ATOM   1122  O OG1   . THR A 1 141 ? 23.436  63.265  2.970   1.00 184.26 ? 139 THR A OG1   1 
ATOM   1123  C CG2   . THR A 1 141 ? 22.553  63.552  0.754   1.00 185.46 ? 139 THR A CG2   1 
ATOM   1124  N N     . PRO A 1 142 ? 20.546  60.415  3.056   1.00 192.73 ? 140 PRO A N     1 
ATOM   1125  C CA    . PRO A 1 142 ? 20.202  59.248  3.887   1.00 191.75 ? 140 PRO A CA    1 
ATOM   1126  C C     . PRO A 1 142 ? 21.211  58.894  5.000   1.00 190.14 ? 140 PRO A C     1 
ATOM   1127  O O     . PRO A 1 142 ? 20.779  58.681  6.136   1.00 187.38 ? 140 PRO A O     1 
ATOM   1128  C CB    . PRO A 1 142 ? 20.109  58.111  2.863   1.00 189.44 ? 140 PRO A CB    1 
ATOM   1129  C CG    . PRO A 1 142 ? 19.689  58.790  1.603   1.00 187.46 ? 140 PRO A CG    1 
ATOM   1130  C CD    . PRO A 1 142 ? 20.387  60.129  1.617   1.00 189.24 ? 140 PRO A CD    1 
ATOM   1131  N N     . GLY A 1 143 ? 22.507  58.828  4.691   1.00 189.24 ? 141 GLY A N     1 
ATOM   1132  C CA    . GLY A 1 143 ? 23.521  58.578  5.709   1.00 184.64 ? 141 GLY A CA    1 
ATOM   1133  C C     . GLY A 1 143 ? 24.740  57.781  5.259   1.00 180.82 ? 141 GLY A C     1 
ATOM   1134  O O     . GLY A 1 143 ? 24.910  57.504  4.069   1.00 179.44 ? 141 GLY A O     1 
ATOM   1135  N N     . ILE A 1 144 ? 25.593  57.415  6.218   1.00 179.40 ? 142 ILE A N     1 
ATOM   1136  C CA    . ILE A 1 144 ? 26.737  56.531  5.961   1.00 179.29 ? 142 ILE A CA    1 
ATOM   1137  C C     . ILE A 1 144 ? 27.031  55.656  7.189   1.00 176.77 ? 142 ILE A C     1 
ATOM   1138  O O     . ILE A 1 144 ? 26.385  55.808  8.230   1.00 174.11 ? 142 ILE A O     1 
ATOM   1139  C CB    . ILE A 1 144 ? 28.010  57.324  5.554   1.00 176.35 ? 142 ILE A CB    1 
ATOM   1140  C CG1   . ILE A 1 144 ? 28.963  56.447  4.731   1.00 171.53 ? 142 ILE A CG1   1 
ATOM   1141  C CG2   . ILE A 1 144 ? 28.709  57.897  6.785   1.00 173.35 ? 142 ILE A CG2   1 
ATOM   1142  C CD1   . ILE A 1 144 ? 28.395  55.985  3.402   1.00 167.39 ? 142 ILE A CD1   1 
ATOM   1143  N N     . ARG A 1 145 ? 28.007  54.753  7.069   1.00 174.69 ? 143 ARG A N     1 
ATOM   1144  C CA    . ARG A 1 145 ? 28.311  53.804  8.146   1.00 171.83 ? 143 ARG A CA    1 
ATOM   1145  C C     . ARG A 1 145 ? 29.767  53.303  8.186   1.00 167.87 ? 143 ARG A C     1 
ATOM   1146  O O     . ARG A 1 145 ? 30.588  53.660  7.334   1.00 164.43 ? 143 ARG A O     1 
ATOM   1147  C CB    . ARG A 1 145 ? 27.331  52.621  8.127   1.00 172.49 ? 143 ARG A CB    1 
ATOM   1148  C CG    . ARG A 1 145 ? 25.899  52.992  8.505   1.00 173.73 ? 143 ARG A CG    1 
ATOM   1149  C CD    . ARG A 1 145 ? 25.111  51.790  9.002   1.00 172.79 ? 143 ARG A CD    1 
ATOM   1150  N NE    . ARG A 1 145 ? 24.708  50.898  7.919   1.00 172.16 ? 143 ARG A NE    1 
ATOM   1151  C CZ    . ARG A 1 145 ? 23.566  51.010  7.249   1.00 172.88 ? 143 ARG A CZ    1 
ATOM   1152  N NH1   . ARG A 1 145 ? 22.712  51.981  7.549   1.00 174.55 ? 143 ARG A NH1   1 
ATOM   1153  N NH2   . ARG A 1 145 ? 23.276  50.153  6.279   1.00 169.79 ? 143 ARG A NH2   1 
ATOM   1154  N N     . TYR A 1 146 ? 30.056  52.452  9.174   1.00 165.49 ? 144 TYR A N     1 
ATOM   1155  C CA    . TYR A 1 146 ? 31.431  52.133  9.578   1.00 159.34 ? 144 TYR A CA    1 
ATOM   1156  C C     . TYR A 1 146 ? 31.528  50.887  10.476  1.00 152.95 ? 144 TYR A C     1 
ATOM   1157  O O     . TYR A 1 146 ? 30.520  50.230  10.748  1.00 154.12 ? 144 TYR A O     1 
ATOM   1158  C CB    . TYR A 1 146 ? 32.005  53.320  10.349  1.00 158.28 ? 144 TYR A CB    1 
ATOM   1159  C CG    . TYR A 1 146 ? 31.262  53.611  11.641  1.00 159.49 ? 144 TYR A CG    1 
ATOM   1160  C CD1   . TYR A 1 146 ? 31.844  54.379  12.639  1.00 160.39 ? 144 TYR A CD1   1 
ATOM   1161  C CD2   . TYR A 1 146 ? 29.978  53.112  11.863  1.00 160.88 ? 144 TYR A CD2   1 
ATOM   1162  C CE1   . TYR A 1 146 ? 31.174  54.648  13.818  1.00 162.41 ? 144 TYR A CE1   1 
ATOM   1163  C CE2   . TYR A 1 146 ? 29.300  53.375  13.038  1.00 162.79 ? 144 TYR A CE2   1 
ATOM   1164  C CZ    . TYR A 1 146 ? 29.904  54.145  14.014  1.00 163.34 ? 144 TYR A CZ    1 
ATOM   1165  O OH    . TYR A 1 146 ? 29.246  54.419  15.192  1.00 161.75 ? 144 TYR A OH    1 
ATOM   1166  N N     . GLN A 1 147 ? 32.744  50.587  10.946  1.00 144.84 ? 145 GLN A N     1 
ATOM   1167  C CA    . GLN A 1 147 ? 32.988  49.488  11.894  1.00 127.38 ? 145 GLN A CA    1 
ATOM   1168  C C     . GLN A 1 147 ? 33.911  49.905  13.059  1.00 126.74 ? 145 GLN A C     1 
ATOM   1169  O O     . GLN A 1 147 ? 34.705  50.838  12.925  1.00 132.51 ? 145 GLN A O     1 
ATOM   1170  C CB    . GLN A 1 147 ? 33.545  48.253  11.171  1.00 113.19 ? 145 GLN A CB    1 
ATOM   1171  C CG    . GLN A 1 147 ? 35.062  48.134  11.142  1.00 109.52 ? 145 GLN A CG    1 
ATOM   1172  C CD    . GLN A 1 147 ? 35.515  46.789  10.608  1.00 94.86  ? 145 GLN A CD    1 
ATOM   1173  O OE1   . GLN A 1 147 ? 34.714  46.035  10.069  1.00 92.72  ? 145 GLN A OE1   1 
ATOM   1174  N NE2   . GLN A 1 147 ? 36.795  46.479  10.760  1.00 80.16  ? 145 GLN A NE2   1 
ATOM   1175  N N     . TYR A 1 148 ? 33.800  49.214  14.196  1.00 118.07 ? 146 TYR A N     1 
ATOM   1176  C CA    . TYR A 1 148 ? 34.579  49.540  15.397  1.00 108.85 ? 146 TYR A CA    1 
ATOM   1177  C C     . TYR A 1 148 ? 35.834  48.696  15.557  1.00 104.30 ? 146 TYR A C     1 
ATOM   1178  O O     . TYR A 1 148 ? 35.793  47.480  15.416  1.00 98.95  ? 146 TYR A O     1 
ATOM   1179  C CB    . TYR A 1 148 ? 33.733  49.329  16.635  1.00 103.70 ? 146 TYR A CB    1 
ATOM   1180  C CG    . TYR A 1 148 ? 33.349  50.589  17.342  1.00 105.24 ? 146 TYR A CG    1 
ATOM   1181  C CD1   . TYR A 1 148 ? 34.245  51.233  18.180  1.00 103.58 ? 146 TYR A CD1   1 
ATOM   1182  C CD2   . TYR A 1 148 ? 32.080  51.126  17.193  1.00 107.58 ? 146 TYR A CD2   1 
ATOM   1183  C CE1   . TYR A 1 148 ? 33.885  52.390  18.840  1.00 107.16 ? 146 TYR A CE1   1 
ATOM   1184  C CE2   . TYR A 1 148 ? 31.709  52.273  17.845  1.00 105.67 ? 146 TYR A CE2   1 
ATOM   1185  C CZ    . TYR A 1 148 ? 32.609  52.904  18.667  1.00 106.41 ? 146 TYR A CZ    1 
ATOM   1186  O OH    . TYR A 1 148 ? 32.229  54.054  19.318  1.00 108.39 ? 146 TYR A OH    1 
ATOM   1187  N N     . ASN A 1 149 ? 36.949  49.347  15.858  1.00 106.42 ? 147 ASN A N     1 
ATOM   1188  C CA    . ASN A 1 149 ? 38.201  48.642  16.116  1.00 103.44 ? 147 ASN A CA    1 
ATOM   1189  C C     . ASN A 1 149 ? 38.492  48.463  17.604  1.00 96.80  ? 147 ASN A C     1 
ATOM   1190  O O     . ASN A 1 149 ? 39.540  47.935  17.974  1.00 92.17  ? 147 ASN A O     1 
ATOM   1191  C CB    . ASN A 1 149 ? 39.374  49.354  15.438  1.00 114.02 ? 147 ASN A CB    1 
ATOM   1192  C CG    . ASN A 1 149 ? 38.997  49.952  14.094  1.00 123.14 ? 147 ASN A CG    1 
ATOM   1193  O OD1   . ASN A 1 149 ? 38.207  49.378  13.340  1.00 118.93 ? 147 ASN A OD1   1 
ATOM   1194  N ND2   . ASN A 1 149 ? 39.555  51.120  13.792  1.00 129.66 ? 147 ASN A ND2   1 
ATOM   1195  N N     . VAL A 1 150 ? 37.566  48.923  18.448  1.00 101.88 ? 148 VAL A N     1 
ATOM   1196  C CA    . VAL A 1 150 ? 37.725  48.893  19.910  1.00 97.47  ? 148 VAL A CA    1 
ATOM   1197  C C     . VAL A 1 150 ? 36.398  48.660  20.650  1.00 96.32  ? 148 VAL A C     1 
ATOM   1198  O O     . VAL A 1 150 ? 35.373  48.363  20.036  1.00 96.33  ? 148 VAL A O     1 
ATOM   1199  C CB    . VAL A 1 150 ? 38.354  50.202  20.439  1.00 97.28  ? 148 VAL A CB    1 
ATOM   1200  C CG1   . VAL A 1 150 ? 39.749  50.395  19.871  1.00 96.33  ? 148 VAL A CG1   1 
ATOM   1201  C CG2   . VAL A 1 150 ? 37.462  51.399  20.114  1.00 103.62 ? 148 VAL A CG2   1 
ATOM   1202  N N     . LEU A 1 151 ? 36.420  48.809  21.971  1.00 92.92  ? 149 LEU A N     1 
ATOM   1203  C CA    . LEU A 1 151 ? 35.238  48.546  22.780  1.00 93.56  ? 149 LEU A CA    1 
ATOM   1204  C C     . LEU A 1 151 ? 34.277  49.727  22.775  1.00 94.58  ? 149 LEU A C     1 
ATOM   1205  O O     . LEU A 1 151 ? 34.577  50.785  23.322  1.00 100.54 ? 149 LEU A O     1 
ATOM   1206  C CB    . LEU A 1 151 ? 35.643  48.183  24.213  1.00 96.54  ? 149 LEU A CB    1 
ATOM   1207  C CG    . LEU A 1 151 ? 36.599  46.994  24.401  1.00 90.25  ? 149 LEU A CG    1 
ATOM   1208  C CD1   . LEU A 1 151 ? 37.239  47.029  25.766  1.00 83.57  ? 149 LEU A CD1   1 
ATOM   1209  C CD2   . LEU A 1 151 ? 35.912  45.658  24.176  1.00 84.44  ? 149 LEU A CD2   1 
ATOM   1210  N N     . PRO A 1 152 ? 33.110  49.534  22.154  1.00 93.06  ? 150 PRO A N     1 
ATOM   1211  C CA    . PRO A 1 152 ? 32.017  50.487  21.964  1.00 99.72  ? 150 PRO A CA    1 
ATOM   1212  C C     . PRO A 1 152 ? 31.289  50.756  23.253  1.00 106.47 ? 150 PRO A C     1 
ATOM   1213  O O     . PRO A 1 152 ? 31.107  49.841  24.041  1.00 107.65 ? 150 PRO A O     1 
ATOM   1214  C CB    . PRO A 1 152 ? 31.061  49.740  21.031  1.00 103.43 ? 150 PRO A CB    1 
ATOM   1215  C CG    . PRO A 1 152 ? 31.850  48.652  20.446  1.00 100.70 ? 150 PRO A CG    1 
ATOM   1216  C CD    . PRO A 1 152 ? 32.828  48.259  21.489  1.00 96.81  ? 150 PRO A CD    1 
ATOM   1217  N N     . GLN A 1 153 ? 30.854  51.989  23.458  1.00 112.43 ? 151 GLN A N     1 
ATOM   1218  C CA    . GLN A 1 153 ? 30.128  52.332  24.670  1.00 119.81 ? 151 GLN A CA    1 
ATOM   1219  C C     . GLN A 1 153 ? 28.722  51.756  24.622  1.00 124.53 ? 151 GLN A C     1 
ATOM   1220  O O     . GLN A 1 153 ? 27.968  52.020  23.686  1.00 133.31 ? 151 GLN A O     1 
ATOM   1221  C CB    . GLN A 1 153 ? 30.072  53.850  24.843  1.00 131.57 ? 151 GLN A CB    1 
ATOM   1222  C CG    . GLN A 1 153 ? 31.438  54.523  24.762  1.00 131.34 ? 151 GLN A CG    1 
ATOM   1223  C CD    . GLN A 1 153 ? 32.410  53.997  25.810  1.00 128.65 ? 151 GLN A CD    1 
ATOM   1224  O OE1   . GLN A 1 153 ? 33.626  53.959  25.590  1.00 126.43 ? 151 GLN A OE1   1 
ATOM   1225  N NE2   . GLN A 1 153 ? 31.874  53.592  26.961  1.00 124.85 ? 151 GLN A NE2   1 
ATOM   1226  N N     . GLY A 1 154 ? 28.371  50.969  25.634  1.00 121.67 ? 152 GLY A N     1 
ATOM   1227  C CA    . GLY A 1 154 ? 27.046  50.384  25.714  1.00 119.10 ? 152 GLY A CA    1 
ATOM   1228  C C     . GLY A 1 154 ? 26.963  48.985  25.136  1.00 114.46 ? 152 GLY A C     1 
ATOM   1229  O O     . GLY A 1 154 ? 25.876  48.428  25.004  1.00 116.76 ? 152 GLY A O     1 
ATOM   1230  N N     . TRP A 1 155 ? 28.110  48.416  24.777  1.00 107.76 ? 153 TRP A N     1 
ATOM   1231  C CA    . TRP A 1 155 ? 28.155  47.026  24.342  1.00 102.47 ? 153 TRP A CA    1 
ATOM   1232  C C     . TRP A 1 155 ? 28.186  46.110  25.555  1.00 101.40 ? 153 TRP A C     1 
ATOM   1233  O O     . TRP A 1 155 ? 28.740  46.469  26.595  1.00 99.64  ? 153 TRP A O     1 
ATOM   1234  C CB    . TRP A 1 155 ? 29.372  46.761  23.458  1.00 98.20  ? 153 TRP A CB    1 
ATOM   1235  C CG    . TRP A 1 155 ? 29.437  45.363  22.946  1.00 89.88  ? 153 TRP A CG    1 
ATOM   1236  C CD1   . TRP A 1 155 ? 28.434  44.675  22.353  1.00 90.10  ? 153 TRP A CD1   1 
ATOM   1237  C CD2   . TRP A 1 155 ? 30.569  44.487  22.971  1.00 87.94  ? 153 TRP A CD2   1 
ATOM   1238  N NE1   . TRP A 1 155 ? 28.858  43.423  22.007  1.00 87.36  ? 153 TRP A NE1   1 
ATOM   1239  C CE2   . TRP A 1 155 ? 30.168  43.277  22.375  1.00 86.16  ? 153 TRP A CE2   1 
ATOM   1240  C CE3   . TRP A 1 155 ? 31.880  44.605  23.440  1.00 85.23  ? 153 TRP A CE3   1 
ATOM   1241  C CZ2   . TRP A 1 155 ? 31.029  42.188  22.234  1.00 79.75  ? 153 TRP A CZ2   1 
ATOM   1242  C CZ3   . TRP A 1 155 ? 32.736  43.521  23.300  1.00 83.99  ? 153 TRP A CZ3   1 
ATOM   1243  C CH2   . TRP A 1 155 ? 32.306  42.330  22.701  1.00 79.67  ? 153 TRP A CH2   1 
ATOM   1244  N N     . LYS A 1 156 ? 27.590  44.930  25.414  1.00 101.20 ? 154 LYS A N     1 
ATOM   1245  C CA    . LYS A 1 156 ? 27.466  43.987  26.518  1.00 94.79  ? 154 LYS A CA    1 
ATOM   1246  C C     . LYS A 1 156 ? 28.821  43.543  27.058  1.00 90.06  ? 154 LYS A C     1 
ATOM   1247  O O     . LYS A 1 156 ? 28.955  43.308  28.257  1.00 93.46  ? 154 LYS A O     1 
ATOM   1248  C CB    . LYS A 1 156 ? 26.648  42.760  26.092  1.00 97.95  ? 154 LYS A CB    1 
ATOM   1249  C CG    . LYS A 1 156 ? 25.756  42.182  27.192  1.00 100.92 ? 154 LYS A CG    1 
ATOM   1250  C CD    . LYS A 1 156 ? 25.121  40.851  26.781  1.00 98.46  ? 154 LYS A CD    1 
ATOM   1251  C CE    . LYS A 1 156 ? 26.163  39.745  26.673  1.00 89.88  ? 154 LYS A CE    1 
ATOM   1252  N NZ    . LYS A 1 156 ? 25.543  38.419  26.421  1.00 86.61  ? 154 LYS A NZ    1 
ATOM   1253  N N     . GLY A 1 157 ? 29.822  43.440  26.188  1.00 84.31  ? 155 GLY A N     1 
ATOM   1254  C CA    . GLY A 1 157 ? 31.107  42.880  26.579  1.00 85.08  ? 155 GLY A CA    1 
ATOM   1255  C C     . GLY A 1 157 ? 32.188  43.826  27.092  1.00 84.40  ? 155 GLY A C     1 
ATOM   1256  O O     . GLY A 1 157 ? 33.269  43.390  27.486  1.00 76.15  ? 155 GLY A O     1 
ATOM   1257  N N     . SER A 1 158 ? 31.902  45.123  27.093  1.00 88.05  ? 156 SER A N     1 
ATOM   1258  C CA    . SER A 1 158 ? 32.928  46.123  27.374  1.00 85.79  ? 156 SER A CA    1 
ATOM   1259  C C     . SER A 1 158 ? 33.524  46.078  28.777  1.00 83.46  ? 156 SER A C     1 
ATOM   1260  O O     . SER A 1 158 ? 34.738  45.915  28.924  1.00 81.69  ? 156 SER A O     1 
ATOM   1261  C CB    . SER A 1 158 ? 32.410  47.528  27.062  1.00 93.32  ? 156 SER A CB    1 
ATOM   1262  O OG    . SER A 1 158 ? 32.221  47.700  25.669  1.00 95.48  ? 156 SER A OG    1 
ATOM   1263  N N     . PRO A 1 159 ? 32.678  46.228  29.810  1.00 82.50  ? 157 PRO A N     1 
ATOM   1264  C CA    . PRO A 1 159 ? 33.188  46.266  31.184  1.00 79.43  ? 157 PRO A CA    1 
ATOM   1265  C C     . PRO A 1 159 ? 33.982  45.015  31.530  1.00 78.73  ? 157 PRO A C     1 
ATOM   1266  O O     . PRO A 1 159 ? 35.044  45.103  32.146  1.00 79.03  ? 157 PRO A O     1 
ATOM   1267  C CB    . PRO A 1 159 ? 31.915  46.336  32.020  1.00 78.95  ? 157 PRO A CB    1 
ATOM   1268  C CG    . PRO A 1 159 ? 30.922  46.977  31.126  1.00 84.84  ? 157 PRO A CG    1 
ATOM   1269  C CD    . PRO A 1 159 ? 31.225  46.446  29.762  1.00 83.11  ? 157 PRO A CD    1 
ATOM   1270  N N     . ALA A 1 160 ? 33.479  43.859  31.120  1.00 76.92  ? 158 ALA A N     1 
ATOM   1271  C CA    . ALA A 1 160 ? 34.142  42.597  31.412  1.00 75.78  ? 158 ALA A CA    1 
ATOM   1272  C C     . ALA A 1 160 ? 35.521  42.483  30.776  1.00 74.48  ? 158 ALA A C     1 
ATOM   1273  O O     . ALA A 1 160 ? 36.473  42.074  31.437  1.00 75.08  ? 158 ALA A O     1 
ATOM   1274  C CB    . ALA A 1 160 ? 33.270  41.440  30.981  1.00 80.24  ? 158 ALA A CB    1 
ATOM   1275  N N     . ILE A 1 161 ? 35.627  42.834  29.494  1.00 75.61  ? 159 ILE A N     1 
ATOM   1276  C CA    . ILE A 1 161 ? 36.897  42.698  28.780  1.00 75.89  ? 159 ILE A CA    1 
ATOM   1277  C C     . ILE A 1 161 ? 37.900  43.759  29.224  1.00 76.78  ? 159 ILE A C     1 
ATOM   1278  O O     . ILE A 1 161 ? 39.094  43.475  29.372  1.00 74.76  ? 159 ILE A O     1 
ATOM   1279  C CB    . ILE A 1 161 ? 36.737  42.726  27.243  1.00 73.71  ? 159 ILE A CB    1 
ATOM   1280  C CG1   . ILE A 1 161 ? 35.477  41.995  26.819  1.00 75.10  ? 159 ILE A CG1   1 
ATOM   1281  C CG2   . ILE A 1 161 ? 37.912  42.048  26.574  1.00 68.16  ? 159 ILE A CG2   1 
ATOM   1282  C CD1   . ILE A 1 161 ? 35.592  41.385  25.469  1.00 70.12  ? 159 ILE A CD1   1 
ATOM   1283  N N     . PHE A 1 162 ? 37.421  44.978  29.447  1.00 75.38  ? 160 PHE A N     1 
ATOM   1284  C CA    . PHE A 1 162 ? 38.270  45.995  30.052  1.00 77.57  ? 160 PHE A CA    1 
ATOM   1285  C C     . PHE A 1 162 ? 38.886  45.444  31.337  1.00 75.10  ? 160 PHE A C     1 
ATOM   1286  O O     . PHE A 1 162 ? 40.107  45.276  31.416  1.00 72.72  ? 160 PHE A O     1 
ATOM   1287  C CB    . PHE A 1 162 ? 37.483  47.280  30.329  1.00 81.13  ? 160 PHE A CB    1 
ATOM   1288  C CG    . PHE A 1 162 ? 38.334  48.427  30.801  1.00 78.73  ? 160 PHE A CG    1 
ATOM   1289  C CD1   . PHE A 1 162 ? 37.969  49.721  30.537  1.00 83.18  ? 160 PHE A CD1   1 
ATOM   1290  C CD2   . PHE A 1 162 ? 39.493  48.203  31.517  1.00 79.00  ? 160 PHE A CD2   1 
ATOM   1291  C CE1   . PHE A 1 162 ? 38.744  50.765  30.977  1.00 90.52  ? 160 PHE A CE1   1 
ATOM   1292  C CE2   . PHE A 1 162 ? 40.272  49.245  31.957  1.00 78.25  ? 160 PHE A CE2   1 
ATOM   1293  C CZ    . PHE A 1 162 ? 39.900  50.526  31.690  1.00 84.90  ? 160 PHE A CZ    1 
ATOM   1294  N N     . GLN A 1 163 ? 38.034  45.146  32.321  1.00 74.37  ? 161 GLN A N     1 
ATOM   1295  C CA    . GLN A 1 163 ? 38.472  44.692  33.644  1.00 76.11  ? 161 GLN A CA    1 
ATOM   1296  C C     . GLN A 1 163 ? 39.539  43.597  33.595  1.00 71.38  ? 161 GLN A C     1 
ATOM   1297  O O     . GLN A 1 163 ? 40.494  43.609  34.375  1.00 66.96  ? 161 GLN A O     1 
ATOM   1298  C CB    . GLN A 1 163 ? 37.277  44.191  34.458  1.00 81.37  ? 161 GLN A CB    1 
ATOM   1299  C CG    . GLN A 1 163 ? 36.392  45.277  35.038  1.00 89.14  ? 161 GLN A CG    1 
ATOM   1300  C CD    . GLN A 1 163 ? 36.391  45.272  36.561  1.00 99.43  ? 161 GLN A CD    1 
ATOM   1301  O OE1   . GLN A 1 163 ? 37.085  44.465  37.188  1.00 98.57  ? 161 GLN A OE1   1 
ATOM   1302  N NE2   . GLN A 1 163 ? 35.615  46.177  37.164  1.00 99.78  ? 161 GLN A NE2   1 
ATOM   1303  N N     . SER A 1 164 ? 39.377  42.650  32.682  1.00 69.58  ? 162 SER A N     1 
ATOM   1304  C CA    . SER A 1 164 ? 40.300  41.530  32.601  1.00 70.08  ? 162 SER A CA    1 
ATOM   1305  C C     . SER A 1 164 ? 41.650  41.920  31.997  1.00 70.04  ? 162 SER A C     1 
ATOM   1306  O O     . SER A 1 164 ? 42.693  41.407  32.402  1.00 65.84  ? 162 SER A O     1 
ATOM   1307  C CB    . SER A 1 164 ? 39.676  40.386  31.800  1.00 75.30  ? 162 SER A CB    1 
ATOM   1308  O OG    . SER A 1 164 ? 39.468  40.762  30.448  1.00 77.53  ? 162 SER A OG    1 
ATOM   1309  N N     . SER A 1 165 ? 41.624  42.818  31.016  1.00 74.12  ? 163 SER A N     1 
ATOM   1310  C CA    . SER A 1 165 ? 42.846  43.281  30.360  1.00 72.88  ? 163 SER A CA    1 
ATOM   1311  C C     . SER A 1 165 ? 43.663  44.082  31.358  1.00 69.49  ? 163 SER A C     1 
ATOM   1312  O O     . SER A 1 165 ? 44.869  43.842  31.537  1.00 62.11  ? 163 SER A O     1 
ATOM   1313  C CB    . SER A 1 165 ? 42.492  44.157  29.158  1.00 74.22  ? 163 SER A CB    1 
ATOM   1314  O OG    . SER A 1 165 ? 41.174  43.883  28.713  1.00 75.16  ? 163 SER A OG    1 
ATOM   1315  N N     . MET A 1 166 ? 42.975  45.027  32.008  1.00 69.75  ? 164 MET A N     1 
ATOM   1316  C CA    . MET A 1 166 ? 43.549  45.847  33.071  1.00 68.91  ? 164 MET A CA    1 
ATOM   1317  C C     . MET A 1 166 ? 44.201  44.998  34.164  1.00 64.06  ? 164 MET A C     1 
ATOM   1318  O O     . MET A 1 166 ? 45.382  45.161  34.471  1.00 61.04  ? 164 MET A O     1 
ATOM   1319  C CB    . MET A 1 166 ? 42.477  46.749  33.670  1.00 67.23  ? 164 MET A CB    1 
ATOM   1320  C CG    . MET A 1 166 ? 42.992  47.658  34.777  1.00 72.87  ? 164 MET A CG    1 
ATOM   1321  S SD    . MET A 1 166 ? 44.049  49.009  34.206  1.00 81.86  ? 164 MET A SD    1 
ATOM   1322  C CE    . MET A 1 166 ? 42.884  49.966  33.240  1.00 78.04  ? 164 MET A CE    1 
ATOM   1323  N N     . THR A 1 167 ? 43.427  44.082  34.731  1.00 62.25  ? 165 THR A N     1 
ATOM   1324  C CA    . THR A 1 167 ? 43.960  43.104  35.670  1.00 60.76  ? 165 THR A CA    1 
ATOM   1325  C C     . THR A 1 167 ? 45.218  42.423  35.133  1.00 63.03  ? 165 THR A C     1 
ATOM   1326  O O     . THR A 1 167 ? 46.203  42.273  35.849  1.00 63.78  ? 165 THR A O     1 
ATOM   1327  C CB    . THR A 1 167 ? 42.909  42.036  36.004  1.00 55.70  ? 165 THR A CB    1 
ATOM   1328  O OG1   . THR A 1 167 ? 41.747  42.668  36.540  1.00 54.24  ? 165 THR A OG1   1 
ATOM   1329  C CG2   . THR A 1 167 ? 43.447  41.037  37.007  1.00 49.67  ? 165 THR A CG2   1 
ATOM   1330  N N     . LYS A 1 168 ? 45.178  42.026  33.864  1.00 66.23  ? 166 LYS A N     1 
ATOM   1331  C CA    . LYS A 1 168 ? 46.269  41.282  33.226  1.00 67.90  ? 166 LYS A CA    1 
ATOM   1332  C C     . LYS A 1 168 ? 47.549  42.116  33.131  1.00 64.82  ? 166 LYS A C     1 
ATOM   1333  O O     . LYS A 1 168 ? 48.645  41.596  33.323  1.00 60.83  ? 166 LYS A O     1 
ATOM   1334  C CB    . LYS A 1 168 ? 45.829  40.836  31.827  1.00 71.18  ? 166 LYS A CB    1 
ATOM   1335  C CG    . LYS A 1 168 ? 46.026  39.353  31.480  1.00 72.96  ? 166 LYS A CG    1 
ATOM   1336  C CD    . LYS A 1 168 ? 45.363  39.056  30.122  1.00 84.07  ? 166 LYS A CD    1 
ATOM   1337  C CE    . LYS A 1 168 ? 45.429  37.584  29.730  1.00 92.75  ? 166 LYS A CE    1 
ATOM   1338  N NZ    . LYS A 1 168 ? 44.795  37.357  28.394  1.00 90.83  ? 166 LYS A NZ    1 
ATOM   1339  N N     . ILE A 1 169 ? 47.382  43.403  32.821  1.00 64.17  ? 167 ILE A N     1 
ATOM   1340  C CA    . ILE A 1 169 ? 48.474  44.375  32.734  1.00 64.61  ? 167 ILE A CA    1 
ATOM   1341  C C     . ILE A 1 169 ? 49.153  44.647  34.080  1.00 64.86  ? 167 ILE A C     1 
ATOM   1342  O O     . ILE A 1 169 ? 50.378  44.638  34.187  1.00 60.29  ? 167 ILE A O     1 
ATOM   1343  C CB    . ILE A 1 169 ? 47.933  45.718  32.229  1.00 64.44  ? 167 ILE A CB    1 
ATOM   1344  C CG1   . ILE A 1 169 ? 47.386  45.575  30.814  1.00 64.65  ? 167 ILE A CG1   1 
ATOM   1345  C CG2   . ILE A 1 169 ? 48.998  46.798  32.309  1.00 62.34  ? 167 ILE A CG2   1 
ATOM   1346  C CD1   . ILE A 1 169 ? 46.561  46.768  30.365  1.00 65.70  ? 167 ILE A CD1   1 
ATOM   1347  N N     . LEU A 1 170 ? 48.329  44.911  35.091  1.00 66.87  ? 168 LEU A N     1 
ATOM   1348  C CA    . LEU A 1 170 ? 48.775  45.287  36.427  1.00 63.54  ? 168 LEU A CA    1 
ATOM   1349  C C     . LEU A 1 170 ? 49.495  44.135  37.111  1.00 65.96  ? 168 LEU A C     1 
ATOM   1350  O O     . LEU A 1 170 ? 50.391  44.341  37.910  1.00 69.37  ? 168 LEU A O     1 
ATOM   1351  C CB    . LEU A 1 170 ? 47.573  45.724  37.273  1.00 61.13  ? 168 LEU A CB    1 
ATOM   1352  C CG    . LEU A 1 170 ? 46.914  47.102  37.113  1.00 64.31  ? 168 LEU A CG    1 
ATOM   1353  C CD1   . LEU A 1 170 ? 46.622  47.493  35.673  1.00 66.03  ? 168 LEU A CD1   1 
ATOM   1354  C CD2   . LEU A 1 170 ? 45.637  47.146  37.912  1.00 63.87  ? 168 LEU A CD2   1 
ATOM   1355  N N     . GLU A 1 171 ? 49.096  42.917  36.780  1.00 67.60  ? 169 GLU A N     1 
ATOM   1356  C CA    . GLU A 1 171 ? 49.622  41.714  37.417  1.00 70.27  ? 169 GLU A CA    1 
ATOM   1357  C C     . GLU A 1 171 ? 51.147  41.637  37.579  1.00 73.49  ? 169 GLU A C     1 
ATOM   1358  O O     . GLU A 1 171 ? 51.624  41.290  38.652  1.00 75.19  ? 169 GLU A O     1 
ATOM   1359  C CB    . GLU A 1 171 ? 49.098  40.476  36.683  1.00 75.11  ? 169 GLU A CB    1 
ATOM   1360  C CG    . GLU A 1 171 ? 49.662  39.136  37.159  1.00 82.59  ? 169 GLU A CG    1 
ATOM   1361  C CD    . GLU A 1 171 ? 49.072  37.947  36.389  1.00 89.52  ? 169 GLU A CD    1 
ATOM   1362  O OE1   . GLU A 1 171 ? 49.469  36.795  36.680  1.00 93.32  ? 169 GLU A OE1   1 
ATOM   1363  O OE2   . GLU A 1 171 ? 48.210  38.162  35.499  1.00 84.81  ? 169 GLU A OE2   1 
ATOM   1364  N N     . PRO A 1 172 ? 51.917  41.929  36.511  1.00 75.30  ? 170 PRO A N     1 
ATOM   1365  C CA    . PRO A 1 172 ? 53.377  41.827  36.598  1.00 77.65  ? 170 PRO A CA    1 
ATOM   1366  C C     . PRO A 1 172 ? 53.983  42.925  37.464  1.00 84.31  ? 170 PRO A C     1 
ATOM   1367  O O     . PRO A 1 172 ? 55.036  42.685  38.069  1.00 86.29  ? 170 PRO A O     1 
ATOM   1368  C CB    . PRO A 1 172 ? 53.812  42.022  35.153  1.00 73.97  ? 170 PRO A CB    1 
ATOM   1369  C CG    . PRO A 1 172 ? 52.787  42.929  34.607  1.00 70.72  ? 170 PRO A CG    1 
ATOM   1370  C CD    . PRO A 1 172 ? 51.504  42.439  35.194  1.00 73.14  ? 170 PRO A CD    1 
ATOM   1371  N N     . PHE A 1 173 ? 53.333  44.093  37.510  1.00 79.51  ? 171 PHE A N     1 
ATOM   1372  C CA    . PHE A 1 173 ? 53.733  45.196  38.390  1.00 81.13  ? 171 PHE A CA    1 
ATOM   1373  C C     . PHE A 1 173 ? 53.578  44.819  39.858  1.00 81.69  ? 171 PHE A C     1 
ATOM   1374  O O     . PHE A 1 173 ? 54.503  44.957  40.651  1.00 83.00  ? 171 PHE A O     1 
ATOM   1375  C CB    . PHE A 1 173 ? 52.895  46.447  38.120  1.00 77.00  ? 171 PHE A CB    1 
ATOM   1376  C CG    . PHE A 1 173 ? 53.191  47.579  39.064  1.00 81.41  ? 171 PHE A CG    1 
ATOM   1377  C CD1   . PHE A 1 173 ? 53.923  48.673  38.647  1.00 84.05  ? 171 PHE A CD1   1 
ATOM   1378  C CD2   . PHE A 1 173 ? 52.761  47.537  40.377  1.00 85.03  ? 171 PHE A CD2   1 
ATOM   1379  C CE1   . PHE A 1 173 ? 54.212  49.710  39.514  1.00 87.01  ? 171 PHE A CE1   1 
ATOM   1380  C CE2   . PHE A 1 173 ? 53.048  48.576  41.250  1.00 88.25  ? 171 PHE A CE2   1 
ATOM   1381  C CZ    . PHE A 1 173 ? 53.776  49.661  40.815  1.00 87.97  ? 171 PHE A CZ    1 
ATOM   1382  N N     . LYS A 1 174 ? 52.424  44.273  40.187  1.00 82.01  ? 172 LYS A N     1 
ATOM   1383  C CA    . LYS A 1 174 ? 52.116  43.918  41.548  1.00 83.17  ? 172 LYS A CA    1 
ATOM   1384  C C     . LYS A 1 174 ? 53.109  42.901  42.080  1.00 85.90  ? 172 LYS A C     1 
ATOM   1385  O O     . LYS A 1 174 ? 53.507  42.962  43.227  1.00 87.20  ? 172 LYS A O     1 
ATOM   1386  C CB    . LYS A 1 174 ? 50.710  43.324  41.630  1.00 88.73  ? 172 LYS A CB    1 
ATOM   1387  C CG    . LYS A 1 174 ? 49.573  44.296  41.467  1.00 89.21  ? 172 LYS A CG    1 
ATOM   1388  C CD    . LYS A 1 174 ? 48.308  43.701  42.055  1.00 91.42  ? 172 LYS A CD    1 
ATOM   1389  C CE    . LYS A 1 174 ? 47.108  44.578  41.828  1.00 90.78  ? 172 LYS A CE    1 
ATOM   1390  N NZ    . LYS A 1 174 ? 45.869  43.954  42.329  1.00 89.68  ? 172 LYS A NZ    1 
ATOM   1391  N N     . LYS A 1 175 ? 53.505  41.947  41.258  1.00 88.04  ? 173 LYS A N     1 
ATOM   1392  C CA    . LYS A 1 175 ? 54.390  40.908  41.744  1.00 90.30  ? 173 LYS A CA    1 
ATOM   1393  C C     . LYS A 1 175 ? 55.756  41.511  42.037  1.00 91.48  ? 173 LYS A C     1 
ATOM   1394  O O     . LYS A 1 175 ? 56.466  41.053  42.929  1.00 93.23  ? 173 LYS A O     1 
ATOM   1395  C CB    . LYS A 1 175 ? 54.488  39.754  40.745  1.00 93.87  ? 173 LYS A CB    1 
ATOM   1396  C CG    . LYS A 1 175 ? 54.936  38.451  41.383  1.00 106.36 ? 173 LYS A CG    1 
ATOM   1397  C CD    . LYS A 1 175 ? 55.118  37.343  40.355  1.00 117.87 ? 173 LYS A CD    1 
ATOM   1398  C CE    . LYS A 1 175 ? 55.688  36.082  41.005  1.00 125.85 ? 173 LYS A CE    1 
ATOM   1399  N NZ    . LYS A 1 175 ? 56.044  35.037  40.003  1.00 123.88 ? 173 LYS A NZ    1 
ATOM   1400  N N     . GLN A 1 176 ? 56.109  42.553  41.290  1.00 89.92  ? 174 GLN A N     1 
ATOM   1401  C CA    . GLN A 1 176 ? 57.370  43.257  41.506  1.00 93.43  ? 174 GLN A CA    1 
ATOM   1402  C C     . GLN A 1 176 ? 57.228  44.309  42.590  1.00 89.57  ? 174 GLN A C     1 
ATOM   1403  O O     . GLN A 1 176 ? 58.200  44.955  42.965  1.00 90.84  ? 174 GLN A O     1 
ATOM   1404  C CB    . GLN A 1 176 ? 57.851  43.930  40.221  1.00 98.82  ? 174 GLN A CB    1 
ATOM   1405  C CG    . GLN A 1 176 ? 58.345  42.974  39.137  1.00 107.54 ? 174 GLN A CG    1 
ATOM   1406  C CD    . GLN A 1 176 ? 58.568  43.676  37.793  1.00 117.83 ? 174 GLN A CD    1 
ATOM   1407  O OE1   . GLN A 1 176 ? 58.475  44.906  37.698  1.00 115.29 ? 174 GLN A OE1   1 
ATOM   1408  N NE2   . GLN A 1 176 ? 58.854  42.894  36.750  1.00 115.34 ? 174 GLN A NE2   1 
ATOM   1409  N N     . ASN A 1 177 ? 56.007  44.496  43.074  1.00 90.82  ? 175 ASN A N     1 
ATOM   1410  C CA    . ASN A 1 177 ? 55.751  45.435  44.160  1.00 88.68  ? 175 ASN A CA    1 
ATOM   1411  C C     . ASN A 1 177 ? 54.753  44.877  45.171  1.00 84.91  ? 175 ASN A C     1 
ATOM   1412  O O     . ASN A 1 177 ? 53.721  45.498  45.431  1.00 82.45  ? 175 ASN A O     1 
ATOM   1413  C CB    . ASN A 1 177 ? 55.231  46.757  43.587  1.00 88.04  ? 175 ASN A CB    1 
ATOM   1414  C CG    . ASN A 1 177 ? 56.134  47.315  42.500  1.00 88.12  ? 175 ASN A CG    1 
ATOM   1415  O OD1   . ASN A 1 177 ? 57.174  47.895  42.788  1.00 92.51  ? 175 ASN A OD1   1 
ATOM   1416  N ND2   . ASN A 1 177 ? 55.737  47.142  41.248  1.00 85.05  ? 175 ASN A ND2   1 
ATOM   1417  N N     . PRO A 1 178 ? 55.089  43.729  45.784  1.00 83.24  ? 176 PRO A N     1 
ATOM   1418  C CA    . PRO A 1 178 ? 54.140  42.979  46.609  1.00 86.93  ? 176 PRO A CA    1 
ATOM   1419  C C     . PRO A 1 178 ? 53.407  43.859  47.606  1.00 89.67  ? 176 PRO A C     1 
ATOM   1420  O O     . PRO A 1 178 ? 52.252  43.591  47.927  1.00 91.06  ? 176 PRO A O     1 
ATOM   1421  C CB    . PRO A 1 178 ? 55.036  41.989  47.352  1.00 85.59  ? 176 PRO A CB    1 
ATOM   1422  C CG    . PRO A 1 178 ? 56.169  41.772  46.434  1.00 86.68  ? 176 PRO A CG    1 
ATOM   1423  C CD    . PRO A 1 178 ? 56.416  43.093  45.770  1.00 85.59  ? 176 PRO A CD    1 
ATOM   1424  N N     . ASP A 1 179 ? 54.068  44.901  48.086  1.00 88.46  ? 177 ASP A N     1 
ATOM   1425  C CA    . ASP A 1 179 ? 53.507  45.678  49.171  1.00 85.61  ? 177 ASP A CA    1 
ATOM   1426  C C     . ASP A 1 179 ? 52.779  46.946  48.765  1.00 85.42  ? 177 ASP A C     1 
ATOM   1427  O O     . ASP A 1 179 ? 52.287  47.675  49.622  1.00 90.65  ? 177 ASP A O     1 
ATOM   1428  C CB    . ASP A 1 179 ? 54.551  45.916  50.253  1.00 92.57  ? 177 ASP A CB    1 
ATOM   1429  C CG    . ASP A 1 179 ? 54.916  44.628  50.973  1.00 106.27 ? 177 ASP A CG    1 
ATOM   1430  O OD1   . ASP A 1 179 ? 54.163  43.635  50.817  1.00 104.42 ? 177 ASP A OD1   1 
ATOM   1431  O OD2   . ASP A 1 179 ? 55.943  44.596  51.689  1.00 115.56 ? 177 ASP A OD2   1 
ATOM   1432  N N     . ILE A 1 180 ? 52.694  47.222  47.472  1.00 79.64  ? 178 ILE A N     1 
ATOM   1433  C CA    . ILE A 1 180 ? 51.738  48.226  47.028  1.00 78.05  ? 178 ILE A CA    1 
ATOM   1434  C C     . ILE A 1 180 ? 50.359  47.590  47.066  1.00 78.21  ? 178 ILE A C     1 
ATOM   1435  O O     . ILE A 1 180 ? 50.228  46.369  47.172  1.00 75.77  ? 178 ILE A O     1 
ATOM   1436  C CB    . ILE A 1 180 ? 52.032  48.773  45.633  1.00 77.93  ? 178 ILE A CB    1 
ATOM   1437  C CG1   . ILE A 1 180 ? 53.528  49.029  45.475  1.00 85.55  ? 178 ILE A CG1   1 
ATOM   1438  C CG2   . ILE A 1 180 ? 51.213  50.034  45.370  1.00 67.40  ? 178 ILE A CG2   1 
ATOM   1439  C CD1   . ILE A 1 180 ? 54.123  49.921  46.542  1.00 89.24  ? 178 ILE A CD1   1 
ATOM   1440  N N     . VAL A 1 181 ? 49.324  48.411  47.038  1.00 73.81  ? 179 VAL A N     1 
ATOM   1441  C CA    . VAL A 1 181 ? 47.980  47.867  47.026  1.00 69.89  ? 179 VAL A CA    1 
ATOM   1442  C C     . VAL A 1 181 ? 47.119  48.606  46.022  1.00 66.75  ? 179 VAL A C     1 
ATOM   1443  O O     . VAL A 1 181 ? 46.913  49.816  46.134  1.00 65.32  ? 179 VAL A O     1 
ATOM   1444  C CB    . VAL A 1 181 ? 47.364  47.868  48.448  1.00 67.72  ? 179 VAL A CB    1 
ATOM   1445  C CG1   . VAL A 1 181 ? 45.846  47.993  48.406  1.00 59.48  ? 179 VAL A CG1   1 
ATOM   1446  C CG2   . VAL A 1 181 ? 47.815  46.621  49.207  1.00 64.65  ? 179 VAL A CG2   1 
ATOM   1447  N N     . ILE A 1 182 ? 46.624  47.877  45.026  1.00 67.24  ? 180 ILE A N     1 
ATOM   1448  C CA    . ILE A 1 182 ? 45.803  48.509  43.998  1.00 71.01  ? 180 ILE A CA    1 
ATOM   1449  C C     . ILE A 1 182 ? 44.374  48.015  44.063  1.00 66.85  ? 180 ILE A C     1 
ATOM   1450  O O     . ILE A 1 182 ? 44.126  46.888  44.480  1.00 65.21  ? 180 ILE A O     1 
ATOM   1451  C CB    . ILE A 1 182 ? 46.334  48.258  42.565  1.00 69.22  ? 180 ILE A CB    1 
ATOM   1452  C CG1   . ILE A 1 182 ? 47.860  48.217  42.539  1.00 66.90  ? 180 ILE A CG1   1 
ATOM   1453  C CG2   . ILE A 1 182 ? 45.819  49.326  41.620  1.00 66.68  ? 180 ILE A CG2   1 
ATOM   1454  C CD1   . ILE A 1 182 ? 48.395  47.527  41.327  1.00 68.98  ? 180 ILE A CD1   1 
ATOM   1455  N N     . TYR A 1 183 ? 43.446  48.879  43.668  1.00 63.49  ? 181 TYR A N     1 
ATOM   1456  C CA    . TYR A 1 183 ? 42.064  48.478  43.472  1.00 64.73  ? 181 TYR A CA    1 
ATOM   1457  C C     . TYR A 1 183 ? 41.478  49.171  42.254  1.00 69.60  ? 181 TYR A C     1 
ATOM   1458  O O     . TYR A 1 183 ? 41.613  50.381  42.101  1.00 71.18  ? 181 TYR A O     1 
ATOM   1459  C CB    . TYR A 1 183 ? 41.208  48.798  44.700  1.00 66.11  ? 181 TYR A CB    1 
ATOM   1460  C CG    . TYR A 1 183 ? 39.718  48.766  44.413  1.00 68.61  ? 181 TYR A CG    1 
ATOM   1461  C CD1   . TYR A 1 183 ? 39.038  47.555  44.306  1.00 67.92  ? 181 TYR A CD1   1 
ATOM   1462  C CD2   . TYR A 1 183 ? 38.993  49.943  44.229  1.00 67.46  ? 181 TYR A CD2   1 
ATOM   1463  C CE1   . TYR A 1 183 ? 37.677  47.515  44.031  1.00 68.78  ? 181 TYR A CE1   1 
ATOM   1464  C CE2   . TYR A 1 183 ? 37.627  49.915  43.959  1.00 69.76  ? 181 TYR A CE2   1 
ATOM   1465  C CZ    . TYR A 1 183 ? 36.973  48.695  43.860  1.00 73.45  ? 181 TYR A CZ    1 
ATOM   1466  O OH    . TYR A 1 183 ? 35.618  48.636  43.588  1.00 78.58  ? 181 TYR A OH    1 
ATOM   1467  N N     . GLN A 1 184 ? 40.799  48.412  41.399  1.00 69.82  ? 182 GLN A N     1 
ATOM   1468  C CA    . GLN A 1 184 ? 40.219  48.976  40.184  1.00 68.90  ? 182 GLN A CA    1 
ATOM   1469  C C     . GLN A 1 184 ? 38.705  49.031  40.238  1.00 69.83  ? 182 GLN A C     1 
ATOM   1470  O O     . GLN A 1 184 ? 38.055  48.008  40.380  1.00 70.12  ? 182 GLN A O     1 
ATOM   1471  C CB    . GLN A 1 184 ? 40.652  48.130  39.003  1.00 68.04  ? 182 GLN A CB    1 
ATOM   1472  C CG    . GLN A 1 184 ? 41.255  46.834  39.481  1.00 69.02  ? 182 GLN A CG    1 
ATOM   1473  C CD    . GLN A 1 184 ? 41.589  45.892  38.368  1.00 61.07  ? 182 GLN A CD    1 
ATOM   1474  O OE1   . GLN A 1 184 ? 41.044  45.986  37.264  1.00 58.10  ? 182 GLN A OE1   1 
ATOM   1475  N NE2   . GLN A 1 184 ? 42.487  44.959  38.656  1.00 54.42  ? 182 GLN A NE2   1 
ATOM   1476  N N     . TYR A 1 185 ? 38.146  50.230  40.137  1.00 74.00  ? 183 TYR A N     1 
ATOM   1477  C CA    . TYR A 1 185 ? 36.706  50.371  39.982  1.00 79.73  ? 183 TYR A CA    1 
ATOM   1478  C C     . TYR A 1 185 ? 36.472  51.102  38.685  1.00 86.23  ? 183 TYR A C     1 
ATOM   1479  O O     . TYR A 1 185 ? 36.861  52.258  38.538  1.00 86.97  ? 183 TYR A O     1 
ATOM   1480  C CB    . TYR A 1 185 ? 36.067  51.126  41.156  1.00 84.77  ? 183 TYR A CB    1 
ATOM   1481  C CG    . TYR A 1 185 ? 34.598  51.491  40.960  1.00 90.64  ? 183 TYR A CG    1 
ATOM   1482  C CD1   . TYR A 1 185 ? 33.603  50.515  40.975  1.00 90.46  ? 183 TYR A CD1   1 
ATOM   1483  C CD2   . TYR A 1 185 ? 34.209  52.817  40.775  1.00 93.69  ? 183 TYR A CD2   1 
ATOM   1484  C CE1   . TYR A 1 185 ? 32.266  50.851  40.795  1.00 94.73  ? 183 TYR A CE1   1 
ATOM   1485  C CE2   . TYR A 1 185 ? 32.876  53.161  40.600  1.00 96.60  ? 183 TYR A CE2   1 
ATOM   1486  C CZ    . TYR A 1 185 ? 31.910  52.176  40.608  1.00 99.58  ? 183 TYR A CZ    1 
ATOM   1487  O OH    . TYR A 1 185 ? 30.588  52.523  40.423  1.00 102.89 ? 183 TYR A OH    1 
ATOM   1488  N N     . MET A 1 186 ? 35.850  50.417  37.736  1.00 91.45  ? 184 MET A N     1 
ATOM   1489  C CA    . MET A 1 186 ? 35.695  50.966  36.402  1.00 96.93  ? 184 MET A CA    1 
ATOM   1490  C C     . MET A 1 186 ? 37.066  51.320  35.852  1.00 95.15  ? 184 MET A C     1 
ATOM   1491  O O     . MET A 1 186 ? 38.002  50.509  35.879  1.00 88.65  ? 184 MET A O     1 
ATOM   1492  C CB    . MET A 1 186 ? 34.819  52.219  36.432  1.00 99.43  ? 184 MET A CB    1 
ATOM   1493  C CG    . MET A 1 186 ? 33.424  51.966  36.941  1.00 104.08 ? 184 MET A CG    1 
ATOM   1494  S SD    . MET A 1 186 ? 32.655  50.619  36.023  1.00 125.58 ? 184 MET A SD    1 
ATOM   1495  C CE    . MET A 1 186 ? 31.110  50.414  36.921  1.00 118.39 ? 184 MET A CE    1 
ATOM   1496  N N     . ASP A 1 187 ? 37.179  52.555  35.381  1.00 94.50  ? 185 ASP A N     1 
ATOM   1497  C CA    . ASP A 1 187 ? 38.404  53.040  34.779  1.00 94.48  ? 185 ASP A CA    1 
ATOM   1498  C C     . ASP A 1 187 ? 39.319  53.731  35.784  1.00 96.09  ? 185 ASP A C     1 
ATOM   1499  O O     . ASP A 1 187 ? 40.350  54.274  35.403  1.00 100.38 ? 185 ASP A O     1 
ATOM   1500  C CB    . ASP A 1 187 ? 38.068  54.021  33.671  1.00 96.23  ? 185 ASP A CB    1 
ATOM   1501  C CG    . ASP A 1 187 ? 37.331  55.219  34.186  1.00 101.03 ? 185 ASP A CG    1 
ATOM   1502  O OD1   . ASP A 1 187 ? 36.515  55.042  35.117  1.00 101.84 ? 185 ASP A OD1   1 
ATOM   1503  O OD2   . ASP A 1 187 ? 37.575  56.332  33.677  1.00 105.62 ? 185 ASP A OD2   1 
ATOM   1504  N N     . ASP A 1 188 ? 38.952  53.735  37.060  1.00 92.54  ? 186 ASP A N     1 
ATOM   1505  C CA    . ASP A 1 188 ? 39.810  54.378  38.047  1.00 89.41  ? 186 ASP A CA    1 
ATOM   1506  C C     . ASP A 1 188 ? 40.590  53.362  38.871  1.00 84.36  ? 186 ASP A C     1 
ATOM   1507  O O     . ASP A 1 188 ? 40.073  52.293  39.220  1.00 81.85  ? 186 ASP A O     1 
ATOM   1508  C CB    . ASP A 1 188 ? 38.998  55.299  38.957  1.00 89.46  ? 186 ASP A CB    1 
ATOM   1509  C CG    . ASP A 1 188 ? 38.060  56.191  38.181  1.00 96.57  ? 186 ASP A CG    1 
ATOM   1510  O OD1   . ASP A 1 188 ? 38.550  57.052  37.426  1.00 100.53 ? 186 ASP A OD1   1 
ATOM   1511  O OD2   . ASP A 1 188 ? 36.831  56.034  38.322  1.00 99.20  ? 186 ASP A OD2   1 
ATOM   1512  N N     . LEU A 1 189 ? 41.841  53.694  39.170  1.00 81.24  ? 187 LEU A N     1 
ATOM   1513  C CA    . LEU A 1 189 ? 42.643  52.862  40.051  1.00 79.68  ? 187 LEU A CA    1 
ATOM   1514  C C     . LEU A 1 189 ? 42.933  53.638  41.329  1.00 79.49  ? 187 LEU A C     1 
ATOM   1515  O O     . LEU A 1 189 ? 43.178  54.842  41.287  1.00 85.23  ? 187 LEU A O     1 
ATOM   1516  C CB    . LEU A 1 189 ? 43.962  52.424  39.391  1.00 77.25  ? 187 LEU A CB    1 
ATOM   1517  C CG    . LEU A 1 189 ? 44.096  52.046  37.908  1.00 76.09  ? 187 LEU A CG    1 
ATOM   1518  C CD1   . LEU A 1 189 ? 45.310  51.158  37.702  1.00 73.63  ? 187 LEU A CD1   1 
ATOM   1519  C CD2   . LEU A 1 189 ? 42.863  51.348  37.374  1.00 84.79  ? 187 LEU A CD2   1 
ATOM   1520  N N     . TYR A 1 190 ? 42.895  52.951  42.462  1.00 72.84  ? 188 TYR A N     1 
ATOM   1521  C CA    . TYR A 1 190 ? 43.281  53.549  43.724  1.00 70.78  ? 188 TYR A CA    1 
ATOM   1522  C C     . TYR A 1 190 ? 44.494  52.760  44.243  1.00 70.93  ? 188 TYR A C     1 
ATOM   1523  O O     . TYR A 1 190 ? 44.459  51.524  44.360  1.00 66.08  ? 188 TYR A O     1 
ATOM   1524  C CB    . TYR A 1 190 ? 42.111  53.555  44.715  1.00 71.24  ? 188 TYR A CB    1 
ATOM   1525  C CG    . TYR A 1 190 ? 40.838  54.306  44.309  1.00 75.24  ? 188 TYR A CG    1 
ATOM   1526  C CD1   . TYR A 1 190 ? 40.419  55.440  45.000  1.00 77.85  ? 188 TYR A CD1   1 
ATOM   1527  C CD2   . TYR A 1 190 ? 40.027  53.851  43.277  1.00 76.48  ? 188 TYR A CD2   1 
ATOM   1528  C CE1   . TYR A 1 190 ? 39.245  56.105  44.655  1.00 73.83  ? 188 TYR A CE1   1 
ATOM   1529  C CE2   . TYR A 1 190 ? 38.853  54.513  42.932  1.00 72.03  ? 188 TYR A CE2   1 
ATOM   1530  C CZ    . TYR A 1 190 ? 38.472  55.630  43.624  1.00 70.40  ? 188 TYR A CZ    1 
ATOM   1531  O OH    . TYR A 1 190 ? 37.314  56.280  43.284  1.00 70.31  ? 188 TYR A OH    1 
ATOM   1532  N N     . VAL A 1 191 ? 45.573  53.487  44.534  1.00 73.39  ? 189 VAL A N     1 
ATOM   1533  C CA    . VAL A 1 191 ? 46.842  52.882  44.941  1.00 72.24  ? 189 VAL A CA    1 
ATOM   1534  C C     . VAL A 1 191 ? 47.212  53.328  46.348  1.00 73.15  ? 189 VAL A C     1 
ATOM   1535  O O     . VAL A 1 191 ? 46.974  54.472  46.721  1.00 76.10  ? 189 VAL A O     1 
ATOM   1536  C CB    . VAL A 1 191 ? 48.012  53.303  44.033  1.00 71.80  ? 189 VAL A CB    1 
ATOM   1537  C CG1   . VAL A 1 191 ? 49.170  52.326  44.172  1.00 69.19  ? 189 VAL A CG1   1 
ATOM   1538  C CG2   . VAL A 1 191 ? 47.563  53.424  42.590  1.00 69.10  ? 189 VAL A CG2   1 
ATOM   1539  N N     . GLY A 1 192 ? 47.818  52.443  47.128  1.00 68.75  ? 190 GLY A N     1 
ATOM   1540  C CA    . GLY A 1 192 ? 48.254  52.835  48.453  1.00 73.93  ? 190 GLY A CA    1 
ATOM   1541  C C     . GLY A 1 192 ? 49.402  52.039  49.036  1.00 79.36  ? 190 GLY A C     1 
ATOM   1542  O O     . GLY A 1 192 ? 49.584  50.850  48.740  1.00 74.59  ? 190 GLY A O     1 
ATOM   1543  N N     . SER A 1 193 ? 50.155  52.696  49.917  1.00 86.76  ? 191 SER A N     1 
ATOM   1544  C CA    . SER A 1 193 ? 51.373  52.108  50.470  1.00 88.75  ? 191 SER A CA    1 
ATOM   1545  C C     . SER A 1 193 ? 51.751  52.662  51.827  1.00 88.38  ? 191 SER A C     1 
ATOM   1546  O O     . SER A 1 193 ? 51.270  53.714  52.257  1.00 86.79  ? 191 SER A O     1 
ATOM   1547  C CB    . SER A 1 193 ? 52.557  52.299  49.519  1.00 92.08  ? 191 SER A CB    1 
ATOM   1548  O OG    . SER A 1 193 ? 52.914  53.669  49.397  1.00 95.86  ? 191 SER A OG    1 
ATOM   1549  N N     . ASP A 1 194 ? 52.618  51.914  52.492  1.00 92.05  ? 192 ASP A N     1 
ATOM   1550  C CA    . ASP A 1 194 ? 53.208  52.313  53.757  1.00 97.85  ? 192 ASP A CA    1 
ATOM   1551  C C     . ASP A 1 194 ? 54.605  52.952  53.637  1.00 104.48 ? 192 ASP A C     1 
ATOM   1552  O O     . ASP A 1 194 ? 55.277  53.172  54.642  1.00 106.00 ? 192 ASP A O     1 
ATOM   1553  C CB    . ASP A 1 194 ? 53.177  51.147  54.737  1.00 96.40  ? 192 ASP A CB    1 
ATOM   1554  C CG    . ASP A 1 194 ? 51.769  50.849  55.213  1.00 93.02  ? 192 ASP A CG    1 
ATOM   1555  O OD1   . ASP A 1 194 ? 50.949  51.803  55.219  1.00 84.32  ? 192 ASP A OD1   1 
ATOM   1556  O OD2   . ASP A 1 194 ? 51.485  49.677  55.568  1.00 91.24  ? 192 ASP A OD2   1 
ATOM   1557  N N     . LEU A 1 195 ? 55.047  53.215  52.407  1.00 108.81 ? 193 LEU A N     1 
ATOM   1558  C CA    . LEU A 1 195 ? 56.324  53.886  52.168  1.00 108.71 ? 193 LEU A CA    1 
ATOM   1559  C C     . LEU A 1 195 ? 56.221  55.366  52.538  1.00 112.25 ? 193 LEU A C     1 
ATOM   1560  O O     . LEU A 1 195 ? 55.137  55.850  52.877  1.00 109.32 ? 193 LEU A O     1 
ATOM   1561  C CB    . LEU A 1 195 ? 56.712  53.763  50.694  1.00 109.12 ? 193 LEU A CB    1 
ATOM   1562  C CG    . LEU A 1 195 ? 56.581  52.391  50.034  1.00 105.96 ? 193 LEU A CG    1 
ATOM   1563  C CD1   . LEU A 1 195 ? 56.858  52.515  48.550  1.00 106.91 ? 193 LEU A CD1   1 
ATOM   1564  C CD2   . LEU A 1 195 ? 57.503  51.356  50.682  1.00 105.07 ? 193 LEU A CD2   1 
ATOM   1565  N N     . GLU A 1 196 ? 57.338  56.088  52.444  1.00 115.68 ? 194 GLU A N     1 
ATOM   1566  C CA    . GLU A 1 196 ? 57.366  57.506  52.809  1.00 118.83 ? 194 GLU A CA    1 
ATOM   1567  C C     . GLU A 1 196 ? 56.685  58.374  51.747  1.00 119.21 ? 194 GLU A C     1 
ATOM   1568  O O     . GLU A 1 196 ? 56.733  58.061  50.563  1.00 118.98 ? 194 GLU A O     1 
ATOM   1569  C CB    . GLU A 1 196 ? 58.800  57.979  53.060  1.00 121.44 ? 194 GLU A CB    1 
ATOM   1570  C CG    . GLU A 1 196 ? 59.634  58.191  51.802  1.00 125.33 ? 194 GLU A CG    1 
ATOM   1571  C CD    . GLU A 1 196 ? 59.826  59.667  51.453  1.00 126.58 ? 194 GLU A CD    1 
ATOM   1572  O OE1   . GLU A 1 196 ? 59.224  60.532  52.131  1.00 124.94 ? 194 GLU A OE1   1 
ATOM   1573  O OE2   . GLU A 1 196 ? 60.584  59.961  50.500  1.00 123.61 ? 194 GLU A OE2   1 
ATOM   1574  N N     . ILE A 1 197 ? 56.069  59.472  52.178  1.00 121.50 ? 195 ILE A N     1 
ATOM   1575  C CA    . ILE A 1 197 ? 55.176  60.260  51.321  1.00 121.54 ? 195 ILE A CA    1 
ATOM   1576  C C     . ILE A 1 197 ? 55.739  60.591  49.933  1.00 121.43 ? 195 ILE A C     1 
ATOM   1577  O O     . ILE A 1 197 ? 55.009  60.572  48.946  1.00 120.04 ? 195 ILE A O     1 
ATOM   1578  C CB    . ILE A 1 197 ? 54.690  61.559  52.029  1.00 122.95 ? 195 ILE A CB    1 
ATOM   1579  C CG1   . ILE A 1 197 ? 53.986  61.228  53.350  1.00 121.12 ? 195 ILE A CG1   1 
ATOM   1580  C CG2   . ILE A 1 197 ? 53.749  62.344  51.135  1.00 122.17 ? 195 ILE A CG2   1 
ATOM   1581  C CD1   . ILE A 1 197 ? 53.141  62.371  53.903  1.00 114.90 ? 195 ILE A CD1   1 
ATOM   1582  N N     . GLY A 1 198 ? 57.028  60.904  49.859  1.00 124.74 ? 196 GLY A N     1 
ATOM   1583  C CA    . GLY A 1 198 ? 57.665  61.199  48.584  1.00 123.14 ? 196 GLY A CA    1 
ATOM   1584  C C     . GLY A 1 198 ? 58.033  59.986  47.743  1.00 120.16 ? 196 GLY A C     1 
ATOM   1585  O O     . GLY A 1 198 ? 57.812  59.979  46.532  1.00 117.72 ? 196 GLY A O     1 
ATOM   1586  N N     . GLN A 1 199 ? 58.598  58.964  48.387  1.00 121.11 ? 197 GLN A N     1 
ATOM   1587  C CA    . GLN A 1 199 ? 59.021  57.732  47.712  1.00 119.49 ? 197 GLN A CA    1 
ATOM   1588  C C     . GLN A 1 199 ? 57.821  56.955  47.173  1.00 116.97 ? 197 GLN A C     1 
ATOM   1589  O O     . GLN A 1 199 ? 57.954  56.108  46.286  1.00 114.96 ? 197 GLN A O     1 
ATOM   1590  C CB    . GLN A 1 199 ? 59.828  56.851  48.670  1.00 117.43 ? 197 GLN A CB    1 
ATOM   1591  C CG    . GLN A 1 199 ? 60.185  55.485  48.119  1.00 117.46 ? 197 GLN A CG    1 
ATOM   1592  C CD    . GLN A 1 199 ? 60.684  54.545  49.196  1.00 120.36 ? 197 GLN A CD    1 
ATOM   1593  O OE1   . GLN A 1 199 ? 60.712  54.897  50.377  1.00 120.36 ? 197 GLN A OE1   1 
ATOM   1594  N NE2   . GLN A 1 199 ? 61.078  53.340  48.797  1.00 120.47 ? 197 GLN A NE2   1 
ATOM   1595  N N     . HIS A 1 200 ? 56.653  57.248  47.735  1.00 116.41 ? 198 HIS A N     1 
ATOM   1596  C CA    . HIS A 1 200 ? 55.390  56.687  47.279  1.00 109.46 ? 198 HIS A CA    1 
ATOM   1597  C C     . HIS A 1 200 ? 55.078  57.214  45.879  1.00 107.38 ? 198 HIS A C     1 
ATOM   1598  O O     . HIS A 1 200 ? 54.764  56.433  44.980  1.00 105.34 ? 198 HIS A O     1 
ATOM   1599  C CB    . HIS A 1 200 ? 54.282  57.034  48.285  1.00 107.12 ? 198 HIS A CB    1 
ATOM   1600  C CG    . HIS A 1 200 ? 52.889  56.864  47.758  1.00 98.26  ? 198 HIS A CG    1 
ATOM   1601  N ND1   . HIS A 1 200 ? 52.183  55.687  47.880  1.00 88.94  ? 198 HIS A ND1   1 
ATOM   1602  C CD2   . HIS A 1 200 ? 52.059  57.737  47.136  1.00 96.36  ? 198 HIS A CD2   1 
ATOM   1603  C CE1   . HIS A 1 200 ? 50.987  55.836  47.338  1.00 87.74  ? 198 HIS A CE1   1 
ATOM   1604  N NE2   . HIS A 1 200 ? 50.886  57.072  46.880  1.00 87.53  ? 198 HIS A NE2   1 
ATOM   1605  N N     . ARG A 1 201 ? 55.194  58.531  45.698  1.00 109.93 ? 199 ARG A N     1 
ATOM   1606  C CA    . ARG A 1 201 ? 54.959  59.177  44.403  1.00 110.10 ? 199 ARG A CA    1 
ATOM   1607  C C     . ARG A 1 201 ? 55.958  58.713  43.346  1.00 108.62 ? 199 ARG A C     1 
ATOM   1608  O O     . ARG A 1 201 ? 55.733  58.869  42.144  1.00 102.11 ? 199 ARG A O     1 
ATOM   1609  C CB    . ARG A 1 201 ? 55.030  60.695  44.542  1.00 115.15 ? 199 ARG A CB    1 
ATOM   1610  C CG    . ARG A 1 201 ? 54.062  61.257  45.548  1.00 122.92 ? 199 ARG A CG    1 
ATOM   1611  C CD    . ARG A 1 201 ? 54.213  62.759  45.691  1.00 131.46 ? 199 ARG A CD    1 
ATOM   1612  N NE    . ARG A 1 201 ? 53.263  63.287  46.667  1.00 138.29 ? 199 ARG A NE    1 
ATOM   1613  C CZ    . ARG A 1 201 ? 53.497  63.352  47.974  1.00 135.94 ? 199 ARG A CZ    1 
ATOM   1614  N NH1   . ARG A 1 201 ? 54.657  62.929  48.458  1.00 133.46 ? 199 ARG A NH1   1 
ATOM   1615  N NH2   . ARG A 1 201 ? 52.575  63.841  48.795  1.00 133.92 ? 199 ARG A NH2   1 
ATOM   1616  N N     . THR A 1 202 ? 57.073  58.160  43.808  1.00 110.28 ? 200 THR A N     1 
ATOM   1617  C CA    . THR A 1 202 ? 58.034  57.521  42.925  1.00 110.17 ? 200 THR A CA    1 
ATOM   1618  C C     . THR A 1 202 ? 57.324  56.384  42.201  1.00 106.55 ? 200 THR A C     1 
ATOM   1619  O O     . THR A 1 202 ? 57.327  56.309  40.968  1.00 102.97 ? 200 THR A O     1 
ATOM   1620  C CB    . THR A 1 202 ? 59.227  56.954  43.730  1.00 116.48 ? 200 THR A CB    1 
ATOM   1621  O OG1   . THR A 1 202 ? 59.879  58.019  44.438  1.00 117.52 ? 200 THR A OG1   1 
ATOM   1622  C CG2   . THR A 1 202 ? 60.231  56.249  42.815  1.00 115.42 ? 200 THR A CG2   1 
ATOM   1623  N N     . LYS A 1 203 ? 56.698  55.515  42.990  1.00 108.93 ? 201 LYS A N     1 
ATOM   1624  C CA    . LYS A 1 203 ? 55.976  54.358  42.475  1.00 102.44 ? 201 LYS A CA    1 
ATOM   1625  C C     . LYS A 1 203 ? 54.683  54.738  41.756  1.00 94.70  ? 201 LYS A C     1 
ATOM   1626  O O     . LYS A 1 203 ? 54.204  53.987  40.925  1.00 93.89  ? 201 LYS A O     1 
ATOM   1627  C CB    . LYS A 1 203 ? 55.688  53.368  43.602  1.00 100.28 ? 201 LYS A CB    1 
ATOM   1628  C CG    . LYS A 1 203 ? 56.920  52.926  44.378  1.00 104.66 ? 201 LYS A CG    1 
ATOM   1629  C CD    . LYS A 1 203 ? 57.655  51.782  43.697  1.00 102.32 ? 201 LYS A CD    1 
ATOM   1630  C CE    . LYS A 1 203 ? 58.565  51.056  44.688  1.00 104.60 ? 201 LYS A CE    1 
ATOM   1631  N NZ    . LYS A 1 203 ? 59.149  49.800  44.131  1.00 99.93  ? 201 LYS A NZ    1 
ATOM   1632  N N     . ILE A 1 204 ? 54.118  55.898  42.063  1.00 94.45  ? 202 ILE A N     1 
ATOM   1633  C CA    . ILE A 1 204 ? 52.918  56.346  41.365  1.00 93.28  ? 202 ILE A CA    1 
ATOM   1634  C C     . ILE A 1 204 ? 53.186  56.703  39.908  1.00 98.05  ? 202 ILE A C     1 
ATOM   1635  O O     . ILE A 1 204 ? 52.373  56.416  39.038  1.00 97.26  ? 202 ILE A O     1 
ATOM   1636  C CB    . ILE A 1 204 ? 52.265  57.544  42.046  1.00 96.35  ? 202 ILE A CB    1 
ATOM   1637  C CG1   . ILE A 1 204 ? 51.713  57.132  43.404  1.00 98.32  ? 202 ILE A CG1   1 
ATOM   1638  C CG2   . ILE A 1 204 ? 51.142  58.090  41.188  1.00 96.13  ? 202 ILE A CG2   1 
ATOM   1639  C CD1   . ILE A 1 204 ? 50.553  56.168  43.327  1.00 93.98  ? 202 ILE A CD1   1 
ATOM   1640  N N     . GLU A 1 205 ? 54.313  57.348  39.635  1.00 103.09 ? 203 GLU A N     1 
ATOM   1641  C CA    . GLU A 1 205 ? 54.659  57.655  38.253  1.00 99.53  ? 203 GLU A CA    1 
ATOM   1642  C C     . GLU A 1 205 ? 55.187  56.399  37.591  1.00 93.74  ? 203 GLU A C     1 
ATOM   1643  O O     . GLU A 1 205 ? 54.757  56.029  36.506  1.00 92.97  ? 203 GLU A O     1 
ATOM   1644  C CB    . GLU A 1 205 ? 55.700  58.766  38.185  1.00 101.79 ? 203 GLU A CB    1 
ATOM   1645  C CG    . GLU A 1 205 ? 55.728  59.477  36.846  1.00 107.80 ? 203 GLU A CG    1 
ATOM   1646  C CD    . GLU A 1 205 ? 54.424  60.198  36.542  1.00 111.08 ? 203 GLU A CD    1 
ATOM   1647  O OE1   . GLU A 1 205 ? 53.645  60.443  37.490  1.00 108.85 ? 203 GLU A OE1   1 
ATOM   1648  O OE2   . GLU A 1 205 ? 54.181  60.517  35.355  1.00 110.76 ? 203 GLU A OE2   1 
ATOM   1649  N N     . GLU A 1 206 ? 56.098  55.731  38.284  1.00 94.58  ? 204 GLU A N     1 
ATOM   1650  C CA    . GLU A 1 206 ? 56.688  54.485  37.816  1.00 94.90  ? 204 GLU A CA    1 
ATOM   1651  C C     . GLU A 1 206 ? 55.635  53.459  37.394  1.00 93.36  ? 204 GLU A C     1 
ATOM   1652  O O     . GLU A 1 206 ? 55.889  52.586  36.563  1.00 90.62  ? 204 GLU A O     1 
ATOM   1653  C CB    . GLU A 1 206 ? 57.570  53.905  38.913  1.00 92.22  ? 204 GLU A CB    1 
ATOM   1654  C CG    . GLU A 1 206 ? 57.925  52.462  38.707  1.00 96.67  ? 204 GLU A CG    1 
ATOM   1655  C CD    . GLU A 1 206 ? 58.841  51.952  39.788  1.00 106.03 ? 204 GLU A CD    1 
ATOM   1656  O OE1   . GLU A 1 206 ? 59.413  52.801  40.510  1.00 107.56 ? 204 GLU A OE1   1 
ATOM   1657  O OE2   . GLU A 1 206 ? 58.982  50.714  39.919  1.00 104.69 ? 204 GLU A OE2   1 
ATOM   1658  N N     . LEU A 1 207 ? 54.459  53.551  37.999  1.00 93.74  ? 205 LEU A N     1 
ATOM   1659  C CA    . LEU A 1 207 ? 53.319  52.757  37.573  1.00 92.35  ? 205 LEU A CA    1 
ATOM   1660  C C     . LEU A 1 207 ? 52.627  53.411  36.377  1.00 89.23  ? 205 LEU A C     1 
ATOM   1661  O O     . LEU A 1 207 ? 52.193  52.723  35.470  1.00 87.66  ? 205 LEU A O     1 
ATOM   1662  C CB    . LEU A 1 207 ? 52.335  52.545  38.728  1.00 93.19  ? 205 LEU A CB    1 
ATOM   1663  C CG    . LEU A 1 207 ? 51.083  51.721  38.436  1.00 88.87  ? 205 LEU A CG    1 
ATOM   1664  C CD1   . LEU A 1 207 ? 51.207  50.370  39.080  1.00 79.75  ? 205 LEU A CD1   1 
ATOM   1665  C CD2   . LEU A 1 207 ? 49.833  52.446  38.926  1.00 84.31  ? 205 LEU A CD2   1 
ATOM   1666  N N     . ARG A 1 208 ? 52.521  54.737  36.375  1.00 90.98  ? 206 ARG A N     1 
ATOM   1667  C CA    . ARG A 1 208 ? 51.965  55.432  35.222  1.00 92.20  ? 206 ARG A CA    1 
ATOM   1668  C C     . ARG A 1 208 ? 52.789  55.080  33.995  1.00 92.19  ? 206 ARG A C     1 
ATOM   1669  O O     . ARG A 1 208 ? 52.324  55.218  32.857  1.00 89.12  ? 206 ARG A O     1 
ATOM   1670  C CB    . ARG A 1 208 ? 51.973  56.941  35.435  1.00 96.86  ? 206 ARG A CB    1 
ATOM   1671  C CG    . ARG A 1 208 ? 50.911  57.428  36.377  1.00 102.05 ? 206 ARG A CG    1 
ATOM   1672  C CD    . ARG A 1 208 ? 50.972  58.933  36.551  1.00 110.21 ? 206 ARG A CD    1 
ATOM   1673  N NE    . ARG A 1 208 ? 51.004  59.630  35.271  1.00 117.16 ? 206 ARG A NE    1 
ATOM   1674  C CZ    . ARG A 1 208 ? 50.890  60.947  35.136  1.00 122.90 ? 206 ARG A CZ    1 
ATOM   1675  N NH1   . ARG A 1 208 ? 50.724  61.712  36.208  1.00 125.98 ? 206 ARG A NH1   1 
ATOM   1676  N NH2   . ARG A 1 208 ? 50.932  61.498  33.929  1.00 122.55 ? 206 ARG A NH2   1 
ATOM   1677  N N     . GLN A 1 209 ? 54.024  54.642  34.246  1.00 90.64  ? 207 GLN A N     1 
ATOM   1678  C CA    . GLN A 1 209 ? 54.934  54.171  33.205  1.00 90.91  ? 207 GLN A CA    1 
ATOM   1679  C C     . GLN A 1 209 ? 54.455  52.862  32.603  1.00 85.50  ? 207 GLN A C     1 
ATOM   1680  O O     . GLN A 1 209 ? 54.259  52.749  31.398  1.00 84.57  ? 207 GLN A O     1 
ATOM   1681  C CB    . GLN A 1 209 ? 56.337  53.953  33.780  1.00 91.31  ? 207 GLN A CB    1 
ATOM   1682  C CG    . GLN A 1 209 ? 57.104  55.222  34.107  1.00 96.99  ? 207 GLN A CG    1 
ATOM   1683  C CD    . GLN A 1 209 ? 57.502  56.009  32.870  1.00 103.23 ? 207 GLN A CD    1 
ATOM   1684  O OE1   . GLN A 1 209 ? 56.690  56.745  32.296  1.00 104.53 ? 207 GLN A OE1   1 
ATOM   1685  N NE2   . GLN A 1 209 ? 58.757  55.862  32.453  1.00 99.69  ? 207 GLN A NE2   1 
ATOM   1686  N N     . HIS A 1 210 ? 54.274  51.881  33.474  1.00 84.33  ? 208 HIS A N     1 
ATOM   1687  C CA    . HIS A 1 210 ? 53.892  50.526  33.111  1.00 80.85  ? 208 HIS A CA    1 
ATOM   1688  C C     . HIS A 1 210 ? 52.546  50.500  32.386  1.00 80.39  ? 208 HIS A C     1 
ATOM   1689  O O     . HIS A 1 210 ? 52.304  49.636  31.545  1.00 77.06  ? 208 HIS A O     1 
ATOM   1690  C CB    . HIS A 1 210 ? 53.826  49.703  34.391  1.00 80.38  ? 208 HIS A CB    1 
ATOM   1691  C CG    . HIS A 1 210 ? 53.687  48.235  34.177  1.00 75.65  ? 208 HIS A CG    1 
ATOM   1692  N ND1   . HIS A 1 210 ? 54.768  47.397  34.048  1.00 78.81  ? 208 HIS A ND1   1 
ATOM   1693  C CD2   . HIS A 1 210 ? 52.585  47.443  34.114  1.00 72.26  ? 208 HIS A CD2   1 
ATOM   1694  C CE1   . HIS A 1 210 ? 54.346  46.151  33.892  1.00 77.92  ? 208 HIS A CE1   1 
ATOM   1695  N NE2   . HIS A 1 210 ? 53.025  46.159  33.930  1.00 75.59  ? 208 HIS A NE2   1 
ATOM   1696  N N     . LEU A 1 211 ? 51.679  51.455  32.716  1.00 79.88  ? 209 LEU A N     1 
ATOM   1697  C CA    . LEU A 1 211 ? 50.379  51.593  32.067  1.00 77.81  ? 209 LEU A CA    1 
ATOM   1698  C C     . LEU A 1 211 ? 50.494  52.232  30.691  1.00 79.48  ? 209 LEU A C     1 
ATOM   1699  O O     . LEU A 1 211 ? 49.737  51.893  29.788  1.00 77.32  ? 209 LEU A O     1 
ATOM   1700  C CB    . LEU A 1 211 ? 49.431  52.445  32.912  1.00 81.43  ? 209 LEU A CB    1 
ATOM   1701  C CG    . LEU A 1 211 ? 48.689  51.834  34.097  1.00 80.00  ? 209 LEU A CG    1 
ATOM   1702  C CD1   . LEU A 1 211 ? 47.689  52.835  34.666  1.00 79.38  ? 209 LEU A CD1   1 
ATOM   1703  C CD2   . LEU A 1 211 ? 47.991  50.565  33.678  1.00 78.57  ? 209 LEU A CD2   1 
ATOM   1704  N N     . LEU A 1 212 ? 51.417  53.183  30.551  1.00 85.78  ? 210 LEU A N     1 
ATOM   1705  C CA    . LEU A 1 212 ? 51.652  53.889  29.283  1.00 83.99  ? 210 LEU A CA    1 
ATOM   1706  C C     . LEU A 1 212 ? 52.209  52.916  28.256  1.00 75.32  ? 210 LEU A C     1 
ATOM   1707  O O     . LEU A 1 212 ? 51.818  52.905  27.095  1.00 70.43  ? 210 LEU A O     1 
ATOM   1708  C CB    . LEU A 1 212 ? 52.638  55.047  29.496  1.00 86.36  ? 210 LEU A CB    1 
ATOM   1709  C CG    . LEU A 1 212 ? 52.701  56.176  28.459  1.00 93.58  ? 210 LEU A CG    1 
ATOM   1710  C CD1   . LEU A 1 212 ? 51.330  56.847  28.258  1.00 91.04  ? 210 LEU A CD1   1 
ATOM   1711  C CD2   . LEU A 1 212 ? 53.767  57.210  28.847  1.00 100.13 ? 210 LEU A CD2   1 
ATOM   1712  N N     . ARG A 1 213 ? 53.111  52.075  28.733  1.00 74.21  ? 211 ARG A N     1 
ATOM   1713  C CA    . ARG A 1 213 ? 53.762  51.063  27.935  1.00 72.82  ? 211 ARG A CA    1 
ATOM   1714  C C     . ARG A 1 213 ? 52.722  50.209  27.214  1.00 73.02  ? 211 ARG A C     1 
ATOM   1715  O O     . ARG A 1 213 ? 53.041  49.533  26.242  1.00 75.57  ? 211 ARG A O     1 
ATOM   1716  C CB    . ARG A 1 213 ? 54.627  50.210  28.862  1.00 73.99  ? 211 ARG A CB    1 
ATOM   1717  C CG    . ARG A 1 213 ? 55.642  49.341  28.195  1.00 74.63  ? 211 ARG A CG    1 
ATOM   1718  C CD    . ARG A 1 213 ? 56.412  48.560  29.232  1.00 71.85  ? 211 ARG A CD    1 
ATOM   1719  N NE    . ARG A 1 213 ? 57.096  47.431  28.612  1.00 83.49  ? 211 ARG A NE    1 
ATOM   1720  C CZ    . ARG A 1 213 ? 57.727  46.471  29.283  1.00 91.44  ? 211 ARG A CZ    1 
ATOM   1721  N NH1   . ARG A 1 213 ? 57.762  46.501  30.613  1.00 89.84  ? 211 ARG A NH1   1 
ATOM   1722  N NH2   . ARG A 1 213 ? 58.323  45.477  28.623  1.00 88.79  ? 211 ARG A NH2   1 
ATOM   1723  N N     . TRP A 1 214 ? 51.504  50.185  27.752  1.00 73.82  ? 212 TRP A N     1 
ATOM   1724  C CA    . TRP A 1 214 ? 50.323  49.585  27.110  1.00 70.25  ? 212 TRP A CA    1 
ATOM   1725  C C     . TRP A 1 214 ? 49.334  50.570  26.444  1.00 68.85  ? 212 TRP A C     1 
ATOM   1726  O O     . TRP A 1 214 ? 48.248  50.172  26.026  1.00 62.08  ? 212 TRP A O     1 
ATOM   1727  C CB    . TRP A 1 214 ? 49.589  48.656  28.081  1.00 68.24  ? 212 TRP A CB    1 
ATOM   1728  C CG    . TRP A 1 214 ? 50.098  47.253  28.106  1.00 64.54  ? 212 TRP A CG    1 
ATOM   1729  C CD1   . TRP A 1 214 ? 49.607  46.201  27.404  1.00 64.83  ? 212 TRP A CD1   1 
ATOM   1730  C CD2   . TRP A 1 214 ? 51.186  46.740  28.886  1.00 67.86  ? 212 TRP A CD2   1 
ATOM   1731  N NE1   . TRP A 1 214 ? 50.323  45.063  27.679  1.00 68.51  ? 212 TRP A NE1   1 
ATOM   1732  C CE2   . TRP A 1 214 ? 51.297  45.364  28.593  1.00 69.67  ? 212 TRP A CE2   1 
ATOM   1733  C CE3   . TRP A 1 214 ? 52.076  47.306  29.804  1.00 69.42  ? 212 TRP A CE3   1 
ATOM   1734  C CZ2   . TRP A 1 214 ? 52.260  44.546  29.181  1.00 71.18  ? 212 TRP A CZ2   1 
ATOM   1735  C CZ3   . TRP A 1 214 ? 53.037  46.488  30.392  1.00 71.82  ? 212 TRP A CZ3   1 
ATOM   1736  C CH2   . TRP A 1 214 ? 53.120  45.125  30.077  1.00 70.42  ? 212 TRP A CH2   1 
ATOM   1737  N N     . GLY A 1 215 ? 49.673  51.858  26.424  1.00 72.11  ? 213 GLY A N     1 
ATOM   1738  C CA    . GLY A 1 215 ? 48.838  52.863  25.781  1.00 70.63  ? 213 GLY A CA    1 
ATOM   1739  C C     . GLY A 1 215 ? 47.714  53.410  26.641  1.00 77.54  ? 213 GLY A C     1 
ATOM   1740  O O     . GLY A 1 215 ? 46.705  53.908  26.132  1.00 78.49  ? 213 GLY A O     1 
ATOM   1741  N N     . LEU A 1 216 ? 47.900  53.319  27.955  1.00 80.31  ? 214 LEU A N     1 
ATOM   1742  C CA    . LEU A 1 216 ? 46.911  53.766  28.926  1.00 81.35  ? 214 LEU A CA    1 
ATOM   1743  C C     . LEU A 1 216 ? 47.337  55.084  29.574  1.00 88.93  ? 214 LEU A C     1 
ATOM   1744  O O     . LEU A 1 216 ? 48.340  55.168  30.282  1.00 85.05  ? 214 LEU A O     1 
ATOM   1745  C CB    . LEU A 1 216 ? 46.666  52.676  29.973  1.00 82.35  ? 214 LEU A CB    1 
ATOM   1746  C CG    . LEU A 1 216 ? 45.943  51.413  29.466  1.00 80.49  ? 214 LEU A CG    1 
ATOM   1747  C CD1   . LEU A 1 216 ? 46.044  50.250  30.446  1.00 68.85  ? 214 LEU A CD1   1 
ATOM   1748  C CD2   . LEU A 1 216 ? 44.482  51.712  29.116  1.00 81.13  ? 214 LEU A CD2   1 
ATOM   1749  N N     . THR A 1 217 ? 46.547  56.114  29.312  1.00 95.74  ? 215 THR A N     1 
ATOM   1750  C CA    . THR A 1 217 ? 46.897  57.476  29.669  1.00 101.66 ? 215 THR A CA    1 
ATOM   1751  C C     . THR A 1 217 ? 46.459  57.839  31.087  1.00 109.64 ? 215 THR A C     1 
ATOM   1752  O O     . THR A 1 217 ? 45.294  57.679  31.442  1.00 110.58 ? 215 THR A O     1 
ATOM   1753  C CB    . THR A 1 217 ? 46.217  58.442  28.694  1.00 106.96 ? 215 THR A CB    1 
ATOM   1754  O OG1   . THR A 1 217 ? 44.888  58.725  29.151  1.00 110.99 ? 215 THR A OG1   1 
ATOM   1755  C CG2   . THR A 1 217 ? 46.144  57.820  27.303  1.00 100.46 ? 215 THR A CG2   1 
ATOM   1756  N N     . THR A 1 218 ? 47.383  58.359  31.889  1.00 112.78 ? 216 THR A N     1 
ATOM   1757  C CA    . THR A 1 218 ? 47.062  58.764  33.257  1.00 115.49 ? 216 THR A CA    1 
ATOM   1758  C C     . THR A 1 218 ? 47.372  60.236  33.505  1.00 123.78 ? 216 THR A C     1 
ATOM   1759  O O     . THR A 1 218 ? 48.490  60.574  33.884  1.00 124.80 ? 216 THR A O     1 
ATOM   1760  C CB    . THR A 1 218 ? 47.840  57.932  34.285  1.00 112.26 ? 216 THR A CB    1 
ATOM   1761  O OG1   . THR A 1 218 ? 49.220  57.871  33.908  1.00 113.17 ? 216 THR A OG1   1 
ATOM   1762  C CG2   . THR A 1 218 ? 47.298  56.526  34.348  1.00 108.51 ? 216 THR A CG2   1 
ATOM   1763  N N     . PRO A 1 219 ? 46.378  61.120  33.300  1.00 131.65 ? 217 PRO A N     1 
ATOM   1764  C CA    . PRO A 1 219 ? 46.610  62.564  33.458  1.00 136.32 ? 217 PRO A CA    1 
ATOM   1765  C C     . PRO A 1 219 ? 47.032  62.940  34.879  1.00 139.84 ? 217 PRO A C     1 
ATOM   1766  O O     . PRO A 1 219 ? 47.084  62.073  35.753  1.00 135.73 ? 217 PRO A O     1 
ATOM   1767  C CB    . PRO A 1 219 ? 45.236  63.174  33.150  1.00 134.86 ? 217 PRO A CB    1 
ATOM   1768  C CG    . PRO A 1 219 ? 44.567  62.173  32.269  1.00 130.13 ? 217 PRO A CG    1 
ATOM   1769  C CD    . PRO A 1 219 ? 45.040  60.829  32.753  1.00 127.85 ? 217 PRO A CD    1 
ATOM   1770  N N     . ASP A 1 220 ? 47.335  64.218  35.099  1.00 145.56 ? 218 ASP A N     1 
ATOM   1771  C CA    . ASP A 1 220 ? 47.740  64.691  36.426  1.00 149.70 ? 218 ASP A CA    1 
ATOM   1772  C C     . ASP A 1 220 ? 46.609  65.326  37.244  1.00 153.48 ? 218 ASP A C     1 
ATOM   1773  O O     . ASP A 1 220 ? 46.852  65.864  38.328  1.00 153.16 ? 218 ASP A O     1 
ATOM   1774  C CB    . ASP A 1 220 ? 48.954  65.626  36.363  1.00 149.81 ? 218 ASP A CB    1 
ATOM   1775  C CG    . ASP A 1 220 ? 49.646  65.772  37.716  1.00 148.01 ? 218 ASP A CG    1 
ATOM   1776  O OD1   . ASP A 1 220 ? 49.333  66.732  38.455  1.00 147.41 ? 218 ASP A OD1   1 
ATOM   1777  O OD2   . ASP A 1 220 ? 50.494  64.915  38.047  1.00 142.28 ? 218 ASP A OD2   1 
ATOM   1778  N N     . LYS A 1 221 ? 45.384  65.291  36.719  1.00 155.13 ? 219 LYS A N     1 
ATOM   1779  C CA    . LYS A 1 221 ? 44.217  65.715  37.495  1.00 156.55 ? 219 LYS A CA    1 
ATOM   1780  C C     . LYS A 1 221 ? 44.069  64.801  38.714  1.00 154.74 ? 219 LYS A C     1 
ATOM   1781  O O     . LYS A 1 221 ? 43.307  65.093  39.640  1.00 152.75 ? 219 LYS A O     1 
ATOM   1782  C CB    . LYS A 1 221 ? 42.945  65.696  36.639  1.00 156.80 ? 219 LYS A CB    1 
ATOM   1783  C CG    . LYS A 1 221 ? 41.713  66.282  37.328  1.00 158.42 ? 219 LYS A CG    1 
ATOM   1784  C CD    . LYS A 1 221 ? 41.875  67.772  37.604  1.00 159.38 ? 219 LYS A CD    1 
ATOM   1785  C CE    . LYS A 1 221 ? 40.718  68.319  38.434  1.00 158.77 ? 219 LYS A CE    1 
ATOM   1786  N NZ    . LYS A 1 221 ? 39.396  68.120  37.778  1.00 156.77 ? 219 LYS A NZ    1 
ATOM   1787  N N     . LYS A 1 222 ? 44.811  63.692  38.690  1.00 153.26 ? 220 LYS A N     1 
ATOM   1788  C CA    . LYS A 1 222 ? 44.916  62.776  39.821  1.00 146.76 ? 220 LYS A CA    1 
ATOM   1789  C C     . LYS A 1 222 ? 45.299  63.588  41.036  1.00 149.18 ? 220 LYS A C     1 
ATOM   1790  O O     . LYS A 1 222 ? 46.133  64.490  40.945  1.00 149.64 ? 220 LYS A O     1 
ATOM   1791  C CB    . LYS A 1 222 ? 46.018  61.747  39.573  1.00 141.11 ? 220 LYS A CB    1 
ATOM   1792  C CG    . LYS A 1 222 ? 47.421  62.327  39.715  1.00 141.37 ? 220 LYS A CG    1 
ATOM   1793  C CD    . LYS A 1 222 ? 48.487  61.255  39.855  1.00 134.51 ? 220 LYS A CD    1 
ATOM   1794  C CE    . LYS A 1 222 ? 49.860  61.888  40.017  1.00 133.56 ? 220 LYS A CE    1 
ATOM   1795  N NZ    . LYS A 1 222 ? 50.960  60.890  39.962  1.00 123.02 ? 220 LYS A NZ    1 
ATOM   1796  N N     . HIS A 1 223 ? 44.702  63.278  42.179  1.00 149.26 ? 221 HIS A N     1 
ATOM   1797  C CA    . HIS A 1 223 ? 44.947  64.096  43.357  1.00 149.95 ? 221 HIS A CA    1 
ATOM   1798  C C     . HIS A 1 223 ? 45.411  63.342  44.595  1.00 147.35 ? 221 HIS A C     1 
ATOM   1799  O O     . HIS A 1 223 ? 44.715  62.471  45.117  1.00 140.87 ? 221 HIS A O     1 
ATOM   1800  C CB    . HIS A 1 223 ? 43.729  64.959  43.675  1.00 148.25 ? 221 HIS A CB    1 
ATOM   1801  C CG    . HIS A 1 223 ? 42.440  64.395  43.165  1.00 146.31 ? 221 HIS A CG    1 
ATOM   1802  N ND1   . HIS A 1 223 ? 41.797  64.901  42.055  1.00 149.69 ? 221 HIS A ND1   1 
ATOM   1803  C CD2   . HIS A 1 223 ? 41.674  63.377  43.616  1.00 143.00 ? 221 HIS A CD2   1 
ATOM   1804  C CE1   . HIS A 1 223 ? 40.689  64.214  41.844  1.00 146.81 ? 221 HIS A CE1   1 
ATOM   1805  N NE2   . HIS A 1 223 ? 40.590  63.284  42.775  1.00 145.58 ? 221 HIS A NE2   1 
ATOM   1806  N N     . GLN A 1 224 ? 46.620  63.683  45.029  1.00 150.67 ? 222 GLN A N     1 
ATOM   1807  C CA    . GLN A 1 224 ? 47.115  63.322  46.346  1.00 150.18 ? 222 GLN A CA    1 
ATOM   1808  C C     . GLN A 1 224 ? 46.570  64.303  47.394  1.00 153.05 ? 222 GLN A C     1 
ATOM   1809  O O     . GLN A 1 224 ? 46.358  63.926  48.546  1.00 151.64 ? 222 GLN A O     1 
ATOM   1810  C CB    . GLN A 1 224 ? 48.642  63.342  46.348  1.00 150.75 ? 222 GLN A CB    1 
ATOM   1811  C CG    . GLN A 1 224 ? 49.221  64.684  45.925  1.00 153.16 ? 222 GLN A CG    1 
ATOM   1812  C CD    . GLN A 1 224 ? 50.725  64.652  45.749  1.00 151.46 ? 222 GLN A CD    1 
ATOM   1813  O OE1   . GLN A 1 224 ? 51.297  63.629  45.372  1.00 147.46 ? 222 GLN A OE1   1 
ATOM   1814  N NE2   . GLN A 1 224 ? 51.376  65.778  46.023  1.00 152.11 ? 222 GLN A NE2   1 
ATOM   1815  N N     . LYS A 1 225 ? 46.359  65.561  46.991  1.00 153.81 ? 223 LYS A N     1 
ATOM   1816  C CA    . LYS A 1 225 ? 45.859  66.598  47.906  1.00 153.03 ? 223 LYS A CA    1 
ATOM   1817  C C     . LYS A 1 225 ? 44.325  66.737  47.987  1.00 151.59 ? 223 LYS A C     1 
ATOM   1818  O O     . LYS A 1 225 ? 43.814  67.391  48.900  1.00 150.51 ? 223 LYS A O     1 
ATOM   1819  C CB    . LYS A 1 225 ? 46.521  67.961  47.626  1.00 151.95 ? 223 LYS A CB    1 
ATOM   1820  C CG    . LYS A 1 225 ? 46.098  68.646  46.332  1.00 151.51 ? 223 LYS A CG    1 
ATOM   1821  C CD    . LYS A 1 225 ? 46.669  70.060  46.260  1.00 149.07 ? 223 LYS A CD    1 
ATOM   1822  C CE    . LYS A 1 225 ? 46.190  70.811  45.025  1.00 146.28 ? 223 LYS A CE    1 
ATOM   1823  N NZ    . LYS A 1 225 ? 46.710  70.220  43.761  1.00 142.49 ? 223 LYS A NZ    1 
ATOM   1824  N N     . GLU A 1 226 ? 43.607  66.150  47.027  1.00 150.11 ? 224 GLU A N     1 
ATOM   1825  C CA    . GLU A 1 226 ? 42.130  66.075  47.062  1.00 148.50 ? 224 GLU A CA    1 
ATOM   1826  C C     . GLU A 1 226 ? 41.469  65.172  48.130  1.00 141.69 ? 224 GLU A C     1 
ATOM   1827  O O     . GLU A 1 226 ? 40.388  65.504  48.629  1.00 138.37 ? 224 GLU A O     1 
ATOM   1828  C CB    . GLU A 1 226 ? 41.536  65.798  45.676  1.00 147.25 ? 224 GLU A CB    1 
ATOM   1829  C CG    . GLU A 1 226 ? 41.437  67.028  44.779  1.00 148.29 ? 224 GLU A CG    1 
ATOM   1830  C CD    . GLU A 1 226 ? 40.046  67.637  44.762  1.00 147.39 ? 224 GLU A CD    1 
ATOM   1831  O OE1   . GLU A 1 226 ? 39.561  67.962  43.657  1.00 145.36 ? 224 GLU A OE1   1 
ATOM   1832  O OE2   . GLU A 1 226 ? 39.441  67.796  45.845  1.00 144.98 ? 224 GLU A OE2   1 
ATOM   1833  N N     . PRO A 1 227 ? 42.081  64.013  48.449  1.00 137.69 ? 225 PRO A N     1 
ATOM   1834  C CA    . PRO A 1 227 ? 41.460  63.149  49.461  1.00 132.10 ? 225 PRO A CA    1 
ATOM   1835  C C     . PRO A 1 227 ? 41.076  63.931  50.718  1.00 134.64 ? 225 PRO A C     1 
ATOM   1836  O O     . PRO A 1 227 ? 41.864  64.760  51.184  1.00 136.99 ? 225 PRO A O     1 
ATOM   1837  C CB    . PRO A 1 227 ? 42.561  62.121  49.778  1.00 130.11 ? 225 PRO A CB    1 
ATOM   1838  C CG    . PRO A 1 227 ? 43.815  62.651  49.148  1.00 134.82 ? 225 PRO A CG    1 
ATOM   1839  C CD    . PRO A 1 227 ? 43.359  63.458  47.975  1.00 139.20 ? 225 PRO A CD    1 
ATOM   1840  N N     . PRO A 1 228 ? 39.884  63.662  51.281  1.00 130.07 ? 226 PRO A N     1 
ATOM   1841  C CA    . PRO A 1 228 ? 38.942  62.564  50.995  1.00 122.25 ? 226 PRO A CA    1 
ATOM   1842  C C     . PRO A 1 228 ? 38.500  62.409  49.536  1.00 122.87 ? 226 PRO A C     1 
ATOM   1843  O O     . PRO A 1 228 ? 38.189  63.407  48.883  1.00 126.95 ? 226 PRO A O     1 
ATOM   1844  C CB    . PRO A 1 228 ? 37.723  62.912  51.867  1.00 119.02 ? 226 PRO A CB    1 
ATOM   1845  C CG    . PRO A 1 228 ? 37.862  64.368  52.182  1.00 124.82 ? 226 PRO A CG    1 
ATOM   1846  C CD    . PRO A 1 228 ? 39.339  64.597  52.281  1.00 128.46 ? 226 PRO A CD    1 
ATOM   1847  N N     . PHE A 1 229 ? 38.466  61.166  49.051  1.00 117.06 ? 227 PHE A N     1 
ATOM   1848  C CA    . PHE A 1 229 ? 37.901  60.855  47.738  1.00 112.36 ? 227 PHE A CA    1 
ATOM   1849  C C     . PHE A 1 229 ? 36.434  60.474  47.883  1.00 109.55 ? 227 PHE A C     1 
ATOM   1850  O O     . PHE A 1 229 ? 36.056  59.778  48.829  1.00 105.70 ? 227 PHE A O     1 
ATOM   1851  C CB    . PHE A 1 229 ? 38.639  59.693  47.077  1.00 108.89 ? 227 PHE A CB    1 
ATOM   1852  C CG    . PHE A 1 229 ? 40.113  59.903  46.930  1.00 110.70 ? 227 PHE A CG    1 
ATOM   1853  C CD1   . PHE A 1 229 ? 40.610  60.792  45.999  1.00 116.18 ? 227 PHE A CD1   1 
ATOM   1854  C CD2   . PHE A 1 229 ? 41.006  59.186  47.708  1.00 112.03 ? 227 PHE A CD2   1 
ATOM   1855  C CE1   . PHE A 1 229 ? 41.966  60.977  45.863  1.00 121.41 ? 227 PHE A CE1   1 
ATOM   1856  C CE2   . PHE A 1 229 ? 42.370  59.362  47.572  1.00 111.92 ? 227 PHE A CE2   1 
ATOM   1857  C CZ    . PHE A 1 229 ? 42.852  60.256  46.648  1.00 115.59 ? 227 PHE A CZ    1 
ATOM   1858  N N     . LEU A 1 230 ? 35.610  60.912  46.935  1.00 110.85 ? 228 LEU A N     1 
ATOM   1859  C CA    . LEU A 1 230 ? 34.190  60.580  46.953  1.00 109.57 ? 228 LEU A CA    1 
ATOM   1860  C C     . LEU A 1 230 ? 33.900  59.437  45.999  1.00 110.00 ? 228 LEU A C     1 
ATOM   1861  O O     . LEU A 1 230 ? 33.940  59.616  44.779  1.00 111.01 ? 228 LEU A O     1 
ATOM   1862  C CB    . LEU A 1 230 ? 33.343  61.782  46.542  1.00 109.47 ? 228 LEU A CB    1 
ATOM   1863  C CG    . LEU A 1 230 ? 33.020  62.818  47.612  1.00 111.64 ? 228 LEU A CG    1 
ATOM   1864  C CD1   . LEU A 1 230 ? 34.242  63.675  47.927  1.00 114.93 ? 228 LEU A CD1   1 
ATOM   1865  C CD2   . LEU A 1 230 ? 31.860  63.677  47.138  1.00 112.21 ? 228 LEU A CD2   1 
ATOM   1866  N N     . TRP A 1 231 ? 33.598  58.265  46.560  1.00 109.24 ? 229 TRP A N     1 
ATOM   1867  C CA    . TRP A 1 231 ? 33.307  57.076  45.758  1.00 105.78 ? 229 TRP A CA    1 
ATOM   1868  C C     . TRP A 1 231 ? 32.074  56.292  46.217  1.00 99.08  ? 229 TRP A C     1 
ATOM   1869  O O     . TRP A 1 231 ? 32.078  55.658  47.275  1.00 91.16  ? 229 TRP A O     1 
ATOM   1870  C CB    . TRP A 1 231 ? 34.533  56.162  45.719  1.00 99.06  ? 229 TRP A CB    1 
ATOM   1871  C CG    . TRP A 1 231 ? 34.240  54.794  45.225  1.00 97.89  ? 229 TRP A CG    1 
ATOM   1872  C CD1   . TRP A 1 231 ? 33.959  54.423  43.945  1.00 98.41  ? 229 TRP A CD1   1 
ATOM   1873  C CD2   . TRP A 1 231 ? 34.204  53.604  46.006  1.00 91.63  ? 229 TRP A CD2   1 
ATOM   1874  N NE1   . TRP A 1 231 ? 33.745  53.070  43.884  1.00 96.71  ? 229 TRP A NE1   1 
ATOM   1875  C CE2   . TRP A 1 231 ? 33.893  52.547  45.138  1.00 90.66  ? 229 TRP A CE2   1 
ATOM   1876  C CE3   . TRP A 1 231 ? 34.400  53.334  47.356  1.00 91.83  ? 229 TRP A CE3   1 
ATOM   1877  C CZ2   . TRP A 1 231 ? 33.778  51.242  45.578  1.00 89.43  ? 229 TRP A CZ2   1 
ATOM   1878  C CZ3   . TRP A 1 231 ? 34.289  52.038  47.791  1.00 86.39  ? 229 TRP A CZ3   1 
ATOM   1879  C CH2   . TRP A 1 231 ? 33.981  51.006  46.906  1.00 87.32  ? 229 TRP A CH2   1 
ATOM   1880  N N     . MET A 1 232 ? 31.047  56.302  45.370  1.00 101.14 ? 230 MET A N     1 
ATOM   1881  C CA    . MET A 1 232 ? 29.782  55.620  45.649  1.00 102.02 ? 230 MET A CA    1 
ATOM   1882  C C     . MET A 1 232 ? 29.161  55.932  47.012  1.00 97.46  ? 230 MET A C     1 
ATOM   1883  O O     . MET A 1 232 ? 28.834  55.023  47.771  1.00 91.40  ? 230 MET A O     1 
ATOM   1884  C CB    . MET A 1 232 ? 29.948  54.118  45.484  1.00 97.95  ? 230 MET A CB    1 
ATOM   1885  C CG    . MET A 1 232 ? 30.397  53.738  44.106  1.00 101.40 ? 230 MET A CG    1 
ATOM   1886  S SD    . MET A 1 232 ? 29.873  52.071  43.733  1.00 104.50 ? 230 MET A SD    1 
ATOM   1887  C CE    . MET A 1 232 ? 28.125  52.187  44.071  1.00 96.49  ? 230 MET A CE    1 
ATOM   1888  N N     . GLY A 1 233 ? 28.991  57.216  47.309  1.00 97.72  ? 231 GLY A N     1 
ATOM   1889  C CA    . GLY A 1 233 ? 28.383  57.630  48.555  1.00 91.50  ? 231 GLY A CA    1 
ATOM   1890  C C     . GLY A 1 233 ? 29.346  57.667  49.726  1.00 90.29  ? 231 GLY A C     1 
ATOM   1891  O O     . GLY A 1 233 ? 28.922  57.892  50.854  1.00 90.39  ? 231 GLY A O     1 
ATOM   1892  N N     . TYR A 1 234 ? 30.636  57.467  49.470  1.00 90.23  ? 232 TYR A N     1 
ATOM   1893  C CA    . TYR A 1 234 ? 31.628  57.429  50.552  1.00 91.86  ? 232 TYR A CA    1 
ATOM   1894  C C     . TYR A 1 234 ? 32.652  58.573  50.502  1.00 96.81  ? 232 TYR A C     1 
ATOM   1895  O O     . TYR A 1 234 ? 32.910  59.142  49.444  1.00 102.85 ? 232 TYR A O     1 
ATOM   1896  C CB    . TYR A 1 234 ? 32.352  56.067  50.595  1.00 89.20  ? 232 TYR A CB    1 
ATOM   1897  C CG    . TYR A 1 234 ? 31.468  54.908  51.014  1.00 79.87  ? 232 TYR A CG    1 
ATOM   1898  C CD1   . TYR A 1 234 ? 31.416  53.743  50.268  1.00 75.02  ? 232 TYR A CD1   1 
ATOM   1899  C CD2   . TYR A 1 234 ? 30.691  54.983  52.162  1.00 78.26  ? 232 TYR A CD2   1 
ATOM   1900  C CE1   . TYR A 1 234 ? 30.610  52.696  50.642  1.00 67.28  ? 232 TYR A CE1   1 
ATOM   1901  C CE2   . TYR A 1 234 ? 29.880  53.936  52.544  1.00 74.32  ? 232 TYR A CE2   1 
ATOM   1902  C CZ    . TYR A 1 234 ? 29.845  52.794  51.778  1.00 68.89  ? 232 TYR A CZ    1 
ATOM   1903  O OH    . TYR A 1 234 ? 29.030  51.753  52.158  1.00 66.29  ? 232 TYR A OH    1 
ATOM   1904  N N     . GLU A 1 235 ? 33.212  58.910  51.662  1.00 92.73  ? 233 GLU A N     1 
ATOM   1905  C CA    . GLU A 1 235 ? 34.309  59.861  51.768  1.00 93.98  ? 233 GLU A CA    1 
ATOM   1906  C C     . GLU A 1 235 ? 35.448  59.150  52.452  1.00 94.28  ? 233 GLU A C     1 
ATOM   1907  O O     . GLU A 1 235 ? 35.294  58.677  53.589  1.00 92.27  ? 233 GLU A O     1 
ATOM   1908  C CB    . GLU A 1 235 ? 33.920  61.066  52.618  1.00 97.48  ? 233 GLU A CB    1 
ATOM   1909  C CG    . GLU A 1 235 ? 32.965  62.048  51.964  1.00 103.75 ? 233 GLU A CG    1 
ATOM   1910  C CD    . GLU A 1 235 ? 32.643  63.214  52.884  1.00 108.40 ? 233 GLU A CD    1 
ATOM   1911  O OE1   . GLU A 1 235 ? 33.422  63.429  53.844  1.00 111.56 ? 233 GLU A OE1   1 
ATOM   1912  O OE2   . GLU A 1 235 ? 31.617  63.901  52.656  1.00 103.21 ? 233 GLU A OE2   1 
ATOM   1913  N N     . LEU A 1 236 ? 36.593  59.100  51.778  1.00 96.66  ? 234 LEU A N     1 
ATOM   1914  C CA    . LEU A 1 236 ? 37.696  58.258  52.221  1.00 94.56  ? 234 LEU A CA    1 
ATOM   1915  C C     . LEU A 1 236 ? 39.023  58.971  52.441  1.00 98.05  ? 234 LEU A C     1 
ATOM   1916  O O     . LEU A 1 236 ? 39.608  59.524  51.515  1.00 105.28 ? 234 LEU A O     1 
ATOM   1917  C CB    . LEU A 1 236 ? 37.893  57.106  51.235  1.00 95.36  ? 234 LEU A CB    1 
ATOM   1918  C CG    . LEU A 1 236 ? 36.825  56.014  51.320  1.00 91.47  ? 234 LEU A CG    1 
ATOM   1919  C CD1   . LEU A 1 236 ? 36.484  55.432  49.959  1.00 88.96  ? 234 LEU A CD1   1 
ATOM   1920  C CD2   . LEU A 1 236 ? 37.286  54.932  52.276  1.00 85.53  ? 234 LEU A CD2   1 
ATOM   1921  N N     . HIS A 1 237 ? 39.502  58.910  53.678  1.00 95.95  ? 235 HIS A N     1 
ATOM   1922  C CA    . HIS A 1 237 ? 40.829  59.378  54.034  1.00 95.38  ? 235 HIS A CA    1 
ATOM   1923  C C     . HIS A 1 237 ? 41.589  58.124  54.443  1.00 92.19  ? 235 HIS A C     1 
ATOM   1924  O O     . HIS A 1 237 ? 41.002  57.211  55.012  1.00 91.14  ? 235 HIS A O     1 
ATOM   1925  C CB    . HIS A 1 237 ? 40.765  60.326  55.241  1.00 97.15  ? 235 HIS A CB    1 
ATOM   1926  C CG    . HIS A 1 237 ? 39.664  61.348  55.173  1.00 106.12 ? 235 HIS A CG    1 
ATOM   1927  N ND1   . HIS A 1 237 ? 38.354  61.060  55.501  1.00 105.02 ? 235 HIS A ND1   1 
ATOM   1928  C CD2   . HIS A 1 237 ? 39.687  62.662  54.849  1.00 110.98 ? 235 HIS A CD2   1 
ATOM   1929  C CE1   . HIS A 1 237 ? 37.616  62.148  55.366  1.00 106.93 ? 235 HIS A CE1   1 
ATOM   1930  N NE2   . HIS A 1 237 ? 38.399  63.135  54.971  1.00 111.73 ? 235 HIS A NE2   1 
ATOM   1931  N N     . PRO A 1 238 ? 42.898  58.069  54.166  1.00 91.10  ? 236 PRO A N     1 
ATOM   1932  C CA    . PRO A 1 238 ? 43.706  56.895  54.525  1.00 88.77  ? 236 PRO A CA    1 
ATOM   1933  C C     . PRO A 1 238 ? 43.502  56.402  55.960  1.00 87.47  ? 236 PRO A C     1 
ATOM   1934  O O     . PRO A 1 238 ? 43.639  55.204  56.201  1.00 85.16  ? 236 PRO A O     1 
ATOM   1935  C CB    . PRO A 1 238 ? 45.133  57.407  54.348  1.00 88.54  ? 236 PRO A CB    1 
ATOM   1936  C CG    . PRO A 1 238 ? 45.018  58.378  53.213  1.00 88.47  ? 236 PRO A CG    1 
ATOM   1937  C CD    . PRO A 1 238 ? 43.648  59.016  53.323  1.00 91.92  ? 236 PRO A CD    1 
ATOM   1938  N N     . ASP A 1 239 ? 43.238  57.322  56.887  1.00 88.53  ? 237 ASP A N     1 
ATOM   1939  C CA    . ASP A 1 239 ? 42.946  57.019  58.300  1.00 90.06  ? 237 ASP A CA    1 
ATOM   1940  C C     . ASP A 1 239 ? 41.473  56.668  58.689  1.00 89.47  ? 237 ASP A C     1 
ATOM   1941  O O     . ASP A 1 239 ? 41.224  55.836  59.579  1.00 77.95  ? 237 ASP A O     1 
ATOM   1942  C CB    . ASP A 1 239 ? 43.469  58.169  59.164  1.00 94.19  ? 237 ASP A CB    1 
ATOM   1943  C CG    . ASP A 1 239 ? 43.114  59.533  58.586  1.00 101.60 ? 237 ASP A CG    1 
ATOM   1944  O OD1   . ASP A 1 239 ? 43.583  59.841  57.464  1.00 100.10 ? 237 ASP A OD1   1 
ATOM   1945  O OD2   . ASP A 1 239 ? 42.365  60.293  59.247  1.00 104.73 ? 237 ASP A OD2   1 
ATOM   1946  N N     . LYS A 1 240 ? 40.503  57.327  58.053  1.00 88.67  ? 238 LYS A N     1 
ATOM   1947  C CA    . LYS A 1 240 ? 39.103  57.157  58.437  1.00 82.04  ? 238 LYS A CA    1 
ATOM   1948  C C     . LYS A 1 240 ? 38.125  57.410  57.286  1.00 80.37  ? 238 LYS A C     1 
ATOM   1949  O O     . LYS A 1 240 ? 38.420  58.166  56.371  1.00 85.01  ? 238 LYS A O     1 
ATOM   1950  C CB    . LYS A 1 240 ? 38.773  58.062  59.629  1.00 86.52  ? 238 LYS A CB    1 
ATOM   1951  C CG    . LYS A 1 240 ? 38.687  59.549  59.309  1.00 91.53  ? 238 LYS A CG    1 
ATOM   1952  C CD    . LYS A 1 240 ? 38.808  60.383  60.579  1.00 97.38  ? 238 LYS A CD    1 
ATOM   1953  C CE    . LYS A 1 240 ? 38.565  61.866  60.318  1.00 100.09 ? 238 LYS A CE    1 
ATOM   1954  N NZ    . LYS A 1 240 ? 38.629  62.665  61.581  1.00 97.04  ? 238 LYS A NZ    1 
ATOM   1955  N N     . TRP A 1 241 ? 36.956  56.777  57.353  1.00 76.96  ? 239 TRP A N     1 
ATOM   1956  C CA    . TRP A 1 241 ? 35.943  56.872  56.304  1.00 72.85  ? 239 TRP A CA    1 
ATOM   1957  C C     . TRP A 1 241 ? 34.581  57.276  56.870  1.00 70.66  ? 239 TRP A C     1 
ATOM   1958  O O     . TRP A 1 241 ? 34.298  57.064  58.053  1.00 66.43  ? 239 TRP A O     1 
ATOM   1959  C CB    . TRP A 1 241 ? 35.803  55.520  55.586  1.00 72.32  ? 239 TRP A CB    1 
ATOM   1960  C CG    . TRP A 1 241 ? 35.090  54.452  56.408  1.00 66.41  ? 239 TRP A CG    1 
ATOM   1961  C CD1   . TRP A 1 241 ? 35.664  53.552  57.264  1.00 60.69  ? 239 TRP A CD1   1 
ATOM   1962  C CD2   . TRP A 1 241 ? 33.676  54.192  56.449  1.00 63.76  ? 239 TRP A CD2   1 
ATOM   1963  N NE1   . TRP A 1 241 ? 34.699  52.759  57.832  1.00 56.27  ? 239 TRP A NE1   1 
ATOM   1964  C CE2   . TRP A 1 241 ? 33.472  53.129  57.347  1.00 56.58  ? 239 TRP A CE2   1 
ATOM   1965  C CE3   . TRP A 1 241 ? 32.564  54.764  55.819  1.00 67.66  ? 239 TRP A CE3   1 
ATOM   1966  C CZ2   . TRP A 1 241 ? 32.209  52.626  57.631  1.00 52.89  ? 239 TRP A CZ2   1 
ATOM   1967  C CZ3   . TRP A 1 241 ? 31.308  54.257  56.102  1.00 65.01  ? 239 TRP A CZ3   1 
ATOM   1968  C CH2   . TRP A 1 241 ? 31.143  53.203  57.001  1.00 56.00  ? 239 TRP A CH2   1 
ATOM   1969  N N     . THR A 1 242 ? 33.732  57.846  56.018  1.00 76.43  ? 240 THR A N     1 
ATOM   1970  C CA    . THR A 1 242 ? 32.346  58.105  56.420  1.00 76.51  ? 240 THR A CA    1 
ATOM   1971  C C     . THR A 1 242 ? 31.396  58.149  55.244  1.00 76.40  ? 240 THR A C     1 
ATOM   1972  O O     . THR A 1 242 ? 31.808  58.371  54.120  1.00 78.17  ? 240 THR A O     1 
ATOM   1973  C CB    . THR A 1 242 ? 32.195  59.433  57.164  1.00 76.27  ? 240 THR A CB    1 
ATOM   1974  O OG1   . THR A 1 242 ? 30.832  59.587  57.575  1.00 74.75  ? 240 THR A OG1   1 
ATOM   1975  C CG2   . THR A 1 242 ? 32.567  60.586  56.255  1.00 82.13  ? 240 THR A CG2   1 
ATOM   1976  N N     . VAL A 1 243 ? 30.114  57.950  55.510  1.00 78.29  ? 241 VAL A N     1 
ATOM   1977  C CA    . VAL A 1 243 ? 29.117  58.112  54.467  1.00 82.34  ? 241 VAL A CA    1 
ATOM   1978  C C     . VAL A 1 243 ? 29.059  59.572  54.093  1.00 86.31  ? 241 VAL A C     1 
ATOM   1979  O O     . VAL A 1 243 ? 29.318  60.450  54.916  1.00 84.76  ? 241 VAL A O     1 
ATOM   1980  C CB    . VAL A 1 243 ? 27.701  57.695  54.914  1.00 79.57  ? 241 VAL A CB    1 
ATOM   1981  C CG1   . VAL A 1 243 ? 27.609  56.201  55.091  1.00 73.16  ? 241 VAL A CG1   1 
ATOM   1982  C CG2   . VAL A 1 243 ? 27.307  58.428  56.183  1.00 81.39  ? 241 VAL A CG2   1 
ATOM   1983  N N     . GLN A 1 244 ? 28.713  59.833  52.844  1.00 89.37  ? 242 GLN A N     1 
ATOM   1984  C CA    . GLN A 1 244 ? 28.500  61.196  52.423  1.00 94.37  ? 242 GLN A CA    1 
ATOM   1985  C C     . GLN A 1 244 ? 27.219  61.691  53.055  1.00 94.29  ? 242 GLN A C     1 
ATOM   1986  O O     . GLN A 1 244 ? 26.292  60.914  53.273  1.00 92.60  ? 242 GLN A O     1 
ATOM   1987  C CB    . GLN A 1 244 ? 28.460  61.285  50.908  1.00 96.16  ? 242 GLN A CB    1 
ATOM   1988  C CG    . GLN A 1 244 ? 29.803  60.981  50.288  1.00 96.79  ? 242 GLN A CG    1 
ATOM   1989  C CD    . GLN A 1 244 ? 29.716  60.827  48.794  1.00 102.93 ? 242 GLN A CD    1 
ATOM   1990  O OE1   . GLN A 1 244 ? 28.663  61.068  48.192  1.00 101.80 ? 242 GLN A OE1   1 
ATOM   1991  N NE2   . GLN A 1 244 ? 30.821  60.417  48.177  1.00 104.11 ? 242 GLN A NE2   1 
ATOM   1992  N N     . PRO A 1 245 ? 27.171  62.993  53.346  1.00 98.04  ? 243 PRO A N     1 
ATOM   1993  C CA    . PRO A 1 245 ? 26.187  63.617  54.231  1.00 100.23 ? 243 PRO A CA    1 
ATOM   1994  C C     . PRO A 1 245 ? 24.755  63.315  53.815  1.00 101.40 ? 243 PRO A C     1 
ATOM   1995  O O     . PRO A 1 245 ? 24.414  63.411  52.633  1.00 99.29  ? 243 PRO A O     1 
ATOM   1996  C CB    . PRO A 1 245 ? 26.492  65.112  54.089  1.00 104.47 ? 243 PRO A CB    1 
ATOM   1997  C CG    . PRO A 1 245 ? 27.176  65.234  52.766  1.00 103.46 ? 243 PRO A CG    1 
ATOM   1998  C CD    . PRO A 1 245 ? 27.989  63.993  52.641  1.00 101.24 ? 243 PRO A CD    1 
ATOM   1999  N N     . ILE A 1 246 ? 23.926  62.964  54.792  1.00 99.23  ? 244 ILE A N     1 
ATOM   2000  C CA    . ILE A 1 246 ? 22.564  62.531  54.518  1.00 102.66 ? 244 ILE A CA    1 
ATOM   2001  C C     . ILE A 1 246 ? 21.566  63.641  54.808  1.00 104.03 ? 244 ILE A C     1 
ATOM   2002  O O     . ILE A 1 246 ? 21.552  64.208  55.900  1.00 103.84 ? 244 ILE A O     1 
ATOM   2003  C CB    . ILE A 1 246 ? 22.204  61.266  55.343  1.00 101.65 ? 244 ILE A CB    1 
ATOM   2004  C CG1   . ILE A 1 246 ? 23.273  60.188  55.162  1.00 94.39  ? 244 ILE A CG1   1 
ATOM   2005  C CG2   . ILE A 1 246 ? 20.847  60.717  54.937  1.00 94.87  ? 244 ILE A CG2   1 
ATOM   2006  C CD1   . ILE A 1 246 ? 23.031  58.965  55.985  1.00 86.27  ? 244 ILE A CD1   1 
ATOM   2007  N N     . VAL A 1 247 ? 20.728  63.948  53.825  1.00 105.28 ? 245 VAL A N     1 
ATOM   2008  C CA    . VAL A 1 247 ? 19.703  64.963  54.004  1.00 109.06 ? 245 VAL A CA    1 
ATOM   2009  C C     . VAL A 1 247 ? 18.359  64.309  54.258  1.00 107.76 ? 245 VAL A C     1 
ATOM   2010  O O     . VAL A 1 247 ? 17.757  63.723  53.359  1.00 105.27 ? 245 VAL A O     1 
ATOM   2011  C CB    . VAL A 1 247 ? 19.578  65.847  52.759  1.00 116.71 ? 245 VAL A CB    1 
ATOM   2012  C CG1   . VAL A 1 247 ? 18.750  67.091  53.072  1.00 115.57 ? 245 VAL A CG1   1 
ATOM   2013  C CG2   . VAL A 1 247 ? 20.963  66.221  52.231  1.00 112.70 ? 245 VAL A CG2   1 
ATOM   2014  N N     . LEU A 1 248 ? 17.882  64.415  55.487  1.00 109.26 ? 246 LEU A N     1 
ATOM   2015  C CA    . LEU A 1 248 ? 16.600  63.826  55.830  1.00 119.21 ? 246 LEU A CA    1 
ATOM   2016  C C     . LEU A 1 248 ? 15.495  64.841  55.615  1.00 127.89 ? 246 LEU A C     1 
ATOM   2017  O O     . LEU A 1 248 ? 15.488  65.894  56.250  1.00 130.07 ? 246 LEU A O     1 
ATOM   2018  C CB    . LEU A 1 248 ? 16.581  63.334  57.280  1.00 117.94 ? 246 LEU A CB    1 
ATOM   2019  C CG    . LEU A 1 248 ? 17.062  61.909  57.555  1.00 108.85 ? 246 LEU A CG    1 
ATOM   2020  C CD1   . LEU A 1 248 ? 16.758  61.522  58.987  1.00 105.27 ? 246 LEU A CD1   1 
ATOM   2021  C CD2   . LEU A 1 248 ? 16.398  60.940  56.603  1.00 105.41 ? 246 LEU A CD2   1 
ATOM   2022  N N     . PRO A 1 249 ? 14.555  64.528  54.713  1.00 130.34 ? 247 PRO A N     1 
ATOM   2023  C CA    . PRO A 1 249 ? 13.425  65.426  54.461  1.00 135.64 ? 247 PRO A CA    1 
ATOM   2024  C C     . PRO A 1 249 ? 12.677  65.779  55.749  1.00 141.25 ? 247 PRO A C     1 
ATOM   2025  O O     . PRO A 1 249 ? 12.344  64.901  56.549  1.00 139.66 ? 247 PRO A O     1 
ATOM   2026  C CB    . PRO A 1 249 ? 12.530  64.602  53.530  1.00 137.13 ? 247 PRO A CB    1 
ATOM   2027  C CG    . PRO A 1 249 ? 13.472  63.677  52.833  1.00 132.57 ? 247 PRO A CG    1 
ATOM   2028  C CD    . PRO A 1 249 ? 14.531  63.339  53.843  1.00 126.12 ? 247 PRO A CD    1 
ATOM   2029  N N     . GLU A 1 250 ? 12.443  67.071  55.950  1.00 145.32 ? 248 GLU A N     1 
ATOM   2030  C CA    . GLU A 1 250 ? 11.657  67.559  57.081  1.00 149.04 ? 248 GLU A CA    1 
ATOM   2031  C C     . GLU A 1 250 ? 10.204  67.785  56.668  1.00 151.39 ? 248 GLU A C     1 
ATOM   2032  O O     . GLU A 1 250 ? 9.399   68.317  57.437  1.00 147.70 ? 248 GLU A O     1 
ATOM   2033  C CB    . GLU A 1 250 ? 12.264  68.841  57.650  1.00 149.52 ? 248 GLU A CB    1 
ATOM   2034  C CG    . GLU A 1 250 ? 11.760  69.198  59.035  1.00 149.50 ? 248 GLU A CG    1 
ATOM   2035  C CD    . GLU A 1 250 ? 12.649  70.209  59.730  1.00 155.60 ? 248 GLU A CD    1 
ATOM   2036  O OE1   . GLU A 1 250 ? 13.527  70.790  59.057  1.00 155.16 ? 248 GLU A OE1   1 
ATOM   2037  O OE2   . GLU A 1 250 ? 12.474  70.419  60.949  1.00 157.06 ? 248 GLU A OE2   1 
ATOM   2038  N N     . LYS A 1 251 ? 9.886   67.370  55.443  1.00 153.01 ? 249 LYS A N     1 
ATOM   2039  C CA    . LYS A 1 251 ? 8.627   67.705  54.786  1.00 154.10 ? 249 LYS A CA    1 
ATOM   2040  C C     . LYS A 1 251 ? 7.385   67.464  55.646  1.00 155.52 ? 249 LYS A C     1 
ATOM   2041  O O     . LYS A 1 251 ? 7.259   66.437  56.312  1.00 153.83 ? 249 LYS A O     1 
ATOM   2042  C CB    . LYS A 1 251 ? 8.499   66.925  53.474  1.00 151.31 ? 249 LYS A CB    1 
ATOM   2043  C CG    . LYS A 1 251 ? 9.538   67.280  52.429  1.00 148.17 ? 249 LYS A CG    1 
ATOM   2044  C CD    . LYS A 1 251 ? 9.315   66.476  51.163  1.00 150.09 ? 249 LYS A CD    1 
ATOM   2045  C CE    . LYS A 1 251 ? 7.838   66.436  50.798  1.00 152.74 ? 249 LYS A CE    1 
ATOM   2046  N NZ    . LYS A 1 251 ? 7.238   67.798  50.696  1.00 152.11 ? 249 LYS A NZ    1 
ATOM   2047  N N     . ASP A 1 252 ? 6.480   68.440  55.622  1.00 158.91 ? 250 ASP A N     1 
ATOM   2048  C CA    . ASP A 1 252 ? 5.186   68.355  56.294  1.00 158.93 ? 250 ASP A CA    1 
ATOM   2049  C C     . ASP A 1 252 ? 4.257   67.457  55.489  1.00 157.77 ? 250 ASP A C     1 
ATOM   2050  O O     . ASP A 1 252 ? 3.370   66.796  56.036  1.00 151.72 ? 250 ASP A O     1 
ATOM   2051  C CB    . ASP A 1 252 ? 4.567   69.751  56.407  1.00 160.27 ? 250 ASP A CB    1 
ATOM   2052  C CG    . ASP A 1 252 ? 4.291   70.384  55.045  1.00 160.66 ? 250 ASP A CG    1 
ATOM   2053  O OD1   . ASP A 1 252 ? 3.248   71.057  54.899  1.00 159.26 ? 250 ASP A OD1   1 
ATOM   2054  O OD2   . ASP A 1 252 ? 5.113   70.207  54.118  1.00 158.74 ? 250 ASP A OD2   1 
ATOM   2055  N N     . SER A 1 253 ? 4.472   67.461  54.176  1.00 161.07 ? 251 SER A N     1 
ATOM   2056  C CA    . SER A 1 253 ? 3.694   66.656  53.246  1.00 160.05 ? 251 SER A CA    1 
ATOM   2057  C C     . SER A 1 253 ? 4.262   65.239  53.202  1.00 157.38 ? 251 SER A C     1 
ATOM   2058  O O     . SER A 1 253 ? 5.422   65.036  52.824  1.00 155.29 ? 251 SER A O     1 
ATOM   2059  C CB    . SER A 1 253 ? 3.735   67.284  51.846  1.00 159.88 ? 251 SER A CB    1 
ATOM   2060  O OG    . SER A 1 253 ? 3.461   68.678  51.889  1.00 158.25 ? 251 SER A OG    1 
ATOM   2061  N N     . TRP A 1 254 ? 3.441   64.263  53.581  1.00 155.92 ? 252 TRP A N     1 
ATOM   2062  C CA    . TRP A 1 254 ? 3.874   62.869  53.608  1.00 152.32 ? 252 TRP A CA    1 
ATOM   2063  C C     . TRP A 1 254 ? 3.144   62.001  52.585  1.00 148.99 ? 252 TRP A C     1 
ATOM   2064  O O     . TRP A 1 254 ? 1.957   61.699  52.733  1.00 149.23 ? 252 TRP A O     1 
ATOM   2065  C CB    . TRP A 1 254 ? 3.714   62.273  55.013  1.00 153.01 ? 252 TRP A CB    1 
ATOM   2066  C CG    . TRP A 1 254 ? 4.643   62.859  56.040  1.00 152.61 ? 252 TRP A CG    1 
ATOM   2067  C CD1   . TRP A 1 254 ? 4.292   63.572  57.149  1.00 152.29 ? 252 TRP A CD1   1 
ATOM   2068  C CD2   . TRP A 1 254 ? 6.077   62.784  56.048  1.00 150.50 ? 252 TRP A CD2   1 
ATOM   2069  N NE1   . TRP A 1 254 ? 5.417   63.943  57.848  1.00 152.27 ? 252 TRP A NE1   1 
ATOM   2070  C CE2   . TRP A 1 254 ? 6.523   63.473  57.194  1.00 150.93 ? 252 TRP A CE2   1 
ATOM   2071  C CE3   . TRP A 1 254 ? 7.022   62.203  55.198  1.00 146.60 ? 252 TRP A CE3   1 
ATOM   2072  C CZ2   . TRP A 1 254 ? 7.877   63.595  57.511  1.00 149.24 ? 252 TRP A CZ2   1 
ATOM   2073  C CZ3   . TRP A 1 254 ? 8.365   62.325  55.516  1.00 145.12 ? 252 TRP A CZ3   1 
ATOM   2074  C CH2   . TRP A 1 254 ? 8.779   63.016  56.662  1.00 147.41 ? 252 TRP A CH2   1 
ATOM   2075  N N     . THR A 1 255 ? 3.876   61.593  51.555  1.00 146.07 ? 253 THR A N     1 
ATOM   2076  C CA    . THR A 1 255 ? 3.382   60.625  50.585  1.00 146.61 ? 253 THR A CA    1 
ATOM   2077  C C     . THR A 1 255 ? 4.068   59.289  50.857  1.00 143.70 ? 253 THR A C     1 
ATOM   2078  O O     . THR A 1 255 ? 5.189   59.254  51.359  1.00 140.64 ? 253 THR A O     1 
ATOM   2079  C CB    . THR A 1 255 ? 3.626   61.082  49.115  1.00 146.42 ? 253 THR A CB    1 
ATOM   2080  O OG1   . THR A 1 255 ? 3.252   60.033  48.211  1.00 148.51 ? 253 THR A OG1   1 
ATOM   2081  C CG2   . THR A 1 255 ? 5.086   61.448  48.876  1.00 140.64 ? 253 THR A CG2   1 
ATOM   2082  N N     . VAL A 1 256 ? 3.389   58.187  50.560  1.00 143.43 ? 254 VAL A N     1 
ATOM   2083  C CA    . VAL A 1 256 ? 4.001   56.879  50.744  1.00 138.75 ? 254 VAL A CA    1 
ATOM   2084  C C     . VAL A 1 256 ? 5.371   56.832  50.060  1.00 133.69 ? 254 VAL A C     1 
ATOM   2085  O O     . VAL A 1 256 ? 6.246   56.071  50.458  1.00 130.26 ? 254 VAL A O     1 
ATOM   2086  C CB    . VAL A 1 256 ? 3.092   55.744  50.235  1.00 143.47 ? 254 VAL A CB    1 
ATOM   2087  C CG1   . VAL A 1 256 ? 1.866   55.609  51.126  1.00 145.80 ? 254 VAL A CG1   1 
ATOM   2088  C CG2   . VAL A 1 256 ? 2.678   55.996  48.802  1.00 146.84 ? 254 VAL A CG2   1 
ATOM   2089  N N     . ASN A 1 257 ? 5.557   57.660  49.037  1.00 137.23 ? 255 ASN A N     1 
ATOM   2090  C CA    . ASN A 1 257 ? 6.854   57.782  48.380  1.00 135.32 ? 255 ASN A CA    1 
ATOM   2091  C C     . ASN A 1 257 ? 7.851   58.596  49.216  1.00 132.59 ? 255 ASN A C     1 
ATOM   2092  O O     . ASN A 1 257 ? 9.065   58.439  49.074  1.00 129.74 ? 255 ASN A O     1 
ATOM   2093  C CB    . ASN A 1 257 ? 6.695   58.395  46.984  1.00 139.18 ? 255 ASN A CB    1 
ATOM   2094  C CG    . ASN A 1 257 ? 7.815   57.993  46.032  1.00 137.76 ? 255 ASN A CG    1 
ATOM   2095  O OD1   . ASN A 1 257 ? 8.304   56.862  46.064  1.00 134.50 ? 255 ASN A OD1   1 
ATOM   2096  N ND2   . ASN A 1 257 ? 8.226   58.923  45.179  1.00 135.98 ? 255 ASN A ND2   1 
ATOM   2097  N N     . ASP A 1 258 ? 7.337   59.468  50.082  1.00 135.43 ? 256 ASP A N     1 
ATOM   2098  C CA    . ASP A 1 258 ? 8.187   60.227  51.003  1.00 133.47 ? 256 ASP A CA    1 
ATOM   2099  C C     . ASP A 1 258 ? 8.773   59.302  52.078  1.00 122.26 ? 256 ASP A C     1 
ATOM   2100  O O     . ASP A 1 258 ? 9.983   59.284  52.302  1.00 116.13 ? 256 ASP A O     1 
ATOM   2101  C CB    . ASP A 1 258 ? 7.415   61.393  51.655  1.00 140.59 ? 256 ASP A CB    1 
ATOM   2102  C CG    . ASP A 1 258 ? 7.299   62.623  50.747  1.00 141.49 ? 256 ASP A CG    1 
ATOM   2103  O OD1   . ASP A 1 258 ? 8.209   62.869  49.929  1.00 140.03 ? 256 ASP A OD1   1 
ATOM   2104  O OD2   . ASP A 1 258 ? 6.294   63.356  50.862  1.00 143.87 ? 256 ASP A OD2   1 
ATOM   2105  N N     . ILE A 1 259 ? 7.910   58.532  52.733  1.00 122.68 ? 257 ILE A N     1 
ATOM   2106  C CA    . ILE A 1 259 ? 8.353   57.565  53.731  1.00 115.00 ? 257 ILE A CA    1 
ATOM   2107  C C     . ILE A 1 259 ? 9.352   56.583  53.139  1.00 109.02 ? 257 ILE A C     1 
ATOM   2108  O O     . ILE A 1 259 ? 10.344  56.232  53.769  1.00 105.44 ? 257 ILE A O     1 
ATOM   2109  C CB    . ILE A 1 259 ? 7.180   56.777  54.320  1.00 111.60 ? 257 ILE A CB    1 
ATOM   2110  C CG1   . ILE A 1 259 ? 6.502   57.585  55.424  1.00 110.74 ? 257 ILE A CG1   1 
ATOM   2111  C CG2   . ILE A 1 259 ? 7.674   55.473  54.893  1.00 109.20 ? 257 ILE A CG2   1 
ATOM   2112  C CD1   . ILE A 1 259 ? 7.416   57.929  56.573  1.00 109.07 ? 257 ILE A CD1   1 
ATOM   2113  N N     . CYS A 1 260 ? 9.087   56.135  51.921  1.00 111.75 ? 258 CYS A N     1 
ATOM   2114  C CA    . CYS A 1 260 ? 10.033  55.267  51.236  1.00 110.22 ? 258 CYS A CA    1 
ATOM   2115  C C     . CYS A 1 260 ? 11.409  55.899  51.113  1.00 105.57 ? 258 CYS A C     1 
ATOM   2116  O O     . CYS A 1 260 ? 12.363  55.403  51.697  1.00 102.24 ? 258 CYS A O     1 
ATOM   2117  C CB    . CYS A 1 260 ? 9.507   54.842  49.873  1.00 111.18 ? 258 CYS A CB    1 
ATOM   2118  S SG    . CYS A 1 260 ? 8.300   53.532  50.010  1.00 100.42 ? 258 CYS A SG    1 
ATOM   2119  N N     . LYS A 1 261 ? 11.521  56.989  50.362  1.00 109.15 ? 259 LYS A N     1 
ATOM   2120  C CA    . LYS A 1 261 ? 12.819  57.627  50.209  1.00 107.60 ? 259 LYS A CA    1 
ATOM   2121  C C     . LYS A 1 261 ? 13.421  57.827  51.594  1.00 101.52 ? 259 LYS A C     1 
ATOM   2122  O O     . LYS A 1 261 ? 14.629  57.690  51.781  1.00 98.18  ? 259 LYS A O     1 
ATOM   2123  C CB    . LYS A 1 261 ? 12.714  58.956  49.448  1.00 111.57 ? 259 LYS A CB    1 
ATOM   2124  C CG    . LYS A 1 261 ? 14.070  59.504  48.980  1.00 111.99 ? 259 LYS A CG    1 
ATOM   2125  C CD    . LYS A 1 261 ? 13.940  60.629  47.946  1.00 116.56 ? 259 LYS A CD    1 
ATOM   2126  C CE    . LYS A 1 261 ? 13.608  61.974  48.590  1.00 121.08 ? 259 LYS A CE    1 
ATOM   2127  N NZ    . LYS A 1 261 ? 13.553  63.086  47.590  1.00 120.27 ? 259 LYS A NZ    1 
ATOM   2128  N N     . LEU A 1 262 ? 12.562  58.123  52.564  1.00 101.27 ? 260 LEU A N     1 
ATOM   2129  C CA    . LEU A 1 262 ? 12.983  58.317  53.947  1.00 98.97  ? 260 LEU A CA    1 
ATOM   2130  C C     . LEU A 1 262 ? 13.707  57.092  54.488  1.00 93.81  ? 260 LEU A C     1 
ATOM   2131  O O     . LEU A 1 262 ? 14.893  57.145  54.809  1.00 88.61  ? 260 LEU A O     1 
ATOM   2132  C CB    . LEU A 1 262 ? 11.774  58.646  54.825  1.00 103.17 ? 260 LEU A CB    1 
ATOM   2133  C CG    . LEU A 1 262 ? 12.020  58.845  56.323  1.00 103.06 ? 260 LEU A CG    1 
ATOM   2134  C CD1   . LEU A 1 262 ? 13.018  59.967  56.564  1.00 105.48 ? 260 LEU A CD1   1 
ATOM   2135  C CD2   . LEU A 1 262 ? 10.714  59.121  57.057  1.00 107.54 ? 260 LEU A CD2   1 
ATOM   2136  N N     . VAL A 1 263 ? 12.970  55.990  54.586  1.00 96.89  ? 261 VAL A N     1 
ATOM   2137  C CA    . VAL A 1 263 ? 13.498  54.722  55.071  1.00 87.87  ? 261 VAL A CA    1 
ATOM   2138  C C     . VAL A 1 263 ? 14.815  54.339  54.398  1.00 83.89  ? 261 VAL A C     1 
ATOM   2139  O O     . VAL A 1 263 ? 15.794  54.051  55.066  1.00 83.30  ? 261 VAL A O     1 
ATOM   2140  C CB    . VAL A 1 263 ? 12.485  53.600  54.837  1.00 83.92  ? 261 VAL A CB    1 
ATOM   2141  C CG1   . VAL A 1 263 ? 13.077  52.271  55.215  1.00 80.55  ? 261 VAL A CG1   1 
ATOM   2142  C CG2   . VAL A 1 263 ? 11.229  53.867  55.624  1.00 90.77  ? 261 VAL A CG2   1 
ATOM   2143  N N     . GLY A 1 264 ? 14.846  54.348  53.074  1.00 86.00  ? 262 GLY A N     1 
ATOM   2144  C CA    . GLY A 1 264 ? 16.048  53.981  52.352  1.00 85.00  ? 262 GLY A CA    1 
ATOM   2145  C C     . GLY A 1 264 ? 17.286  54.749  52.770  1.00 80.94  ? 262 GLY A C     1 
ATOM   2146  O O     . GLY A 1 264 ? 18.391  54.222  52.750  1.00 77.15  ? 262 GLY A O     1 
ATOM   2147  N N     . LYS A 1 265 ? 17.110  56.007  53.142  1.00 86.03  ? 263 LYS A N     1 
ATOM   2148  C CA    . LYS A 1 265 ? 18.238  56.819  53.577  1.00 84.34  ? 263 LYS A CA    1 
ATOM   2149  C C     . LYS A 1 265 ? 18.676  56.414  54.981  1.00 75.51  ? 263 LYS A C     1 
ATOM   2150  O O     . LYS A 1 265 ? 19.871  56.288  55.264  1.00 71.79  ? 263 LYS A O     1 
ATOM   2151  C CB    . LYS A 1 265 ? 17.901  58.316  53.500  1.00 88.64  ? 263 LYS A CB    1 
ATOM   2152  C CG    . LYS A 1 265 ? 18.083  58.916  52.101  1.00 91.77  ? 263 LYS A CG    1 
ATOM   2153  C CD    . LYS A 1 265 ? 17.936  60.439  52.098  1.00 101.25 ? 263 LYS A CD    1 
ATOM   2154  C CE    . LYS A 1 265 ? 18.463  61.068  50.803  1.00 98.44  ? 263 LYS A CE    1 
ATOM   2155  N NZ    . LYS A 1 265 ? 19.955  61.053  50.707  1.00 94.04  ? 263 LYS A NZ    1 
ATOM   2156  N N     . LEU A 1 266 ? 17.699  56.200  55.854  1.00 75.18  ? 264 LEU A N     1 
ATOM   2157  C CA    . LEU A 1 266 ? 17.977  55.701  57.194  1.00 76.36  ? 264 LEU A CA    1 
ATOM   2158  C C     . LEU A 1 266 ? 18.708  54.349  57.140  1.00 71.57  ? 264 LEU A C     1 
ATOM   2159  O O     . LEU A 1 266 ? 19.719  54.145  57.815  1.00 66.40  ? 264 LEU A O     1 
ATOM   2160  C CB    . LEU A 1 266 ? 16.681  55.594  57.996  1.00 74.00  ? 264 LEU A CB    1 
ATOM   2161  C CG    . LEU A 1 266 ? 16.038  56.929  58.331  1.00 75.08  ? 264 LEU A CG    1 
ATOM   2162  C CD1   . LEU A 1 266 ? 14.577  56.751  58.646  1.00 79.21  ? 264 LEU A CD1   1 
ATOM   2163  C CD2   . LEU A 1 266 ? 16.774  57.569  59.483  1.00 78.09  ? 264 LEU A CD2   1 
ATOM   2164  N N     . ASN A 1 267 ? 18.187  53.431  56.333  1.00 69.29  ? 265 ASN A N     1 
ATOM   2165  C CA    . ASN A 1 267 ? 18.821  52.142  56.141  1.00 67.00  ? 265 ASN A CA    1 
ATOM   2166  C C     . ASN A 1 267 ? 20.254  52.300  55.641  1.00 66.15  ? 265 ASN A C     1 
ATOM   2167  O O     . ASN A 1 267 ? 21.136  51.529  56.025  1.00 63.69  ? 265 ASN A O     1 
ATOM   2168  C CB    . ASN A 1 267 ? 18.003  51.262  55.185  1.00 72.00  ? 265 ASN A CB    1 
ATOM   2169  C CG    . ASN A 1 267 ? 16.945  50.418  55.901  1.00 69.19  ? 265 ASN A CG    1 
ATOM   2170  O OD1   . ASN A 1 267 ? 17.145  49.939  57.021  1.00 65.52  ? 265 ASN A OD1   1 
ATOM   2171  N ND2   . ASN A 1 267 ? 15.818  50.222  55.237  1.00 70.90  ? 265 ASN A ND2   1 
ATOM   2172  N N     . TRP A 1 268 ? 20.492  53.299  54.792  1.00 69.23  ? 266 TRP A N     1 
ATOM   2173  C CA    . TRP A 1 268 ? 21.846  53.570  54.293  1.00 68.99  ? 266 TRP A CA    1 
ATOM   2174  C C     . TRP A 1 268 ? 22.688  54.179  55.394  1.00 67.31  ? 266 TRP A C     1 
ATOM   2175  O O     . TRP A 1 268 ? 23.907  53.988  55.449  1.00 66.52  ? 266 TRP A O     1 
ATOM   2176  C CB    . TRP A 1 268 ? 21.833  54.488  53.063  1.00 72.81  ? 266 TRP A CB    1 
ATOM   2177  C CG    . TRP A 1 268 ? 23.199  55.016  52.649  1.00 71.44  ? 266 TRP A CG    1 
ATOM   2178  C CD1   . TRP A 1 268 ? 23.682  56.281  52.844  1.00 70.37  ? 266 TRP A CD1   1 
ATOM   2179  C CD2   . TRP A 1 268 ? 24.238  54.295  51.965  1.00 73.45  ? 266 TRP A CD2   1 
ATOM   2180  N NE1   . TRP A 1 268 ? 24.951  56.389  52.335  1.00 71.33  ? 266 TRP A NE1   1 
ATOM   2181  C CE2   . TRP A 1 268 ? 25.318  55.187  51.790  1.00 71.89  ? 266 TRP A CE2   1 
ATOM   2182  C CE3   . TRP A 1 268 ? 24.361  52.983  51.489  1.00 71.52  ? 266 TRP A CE3   1 
ATOM   2183  C CZ2   . TRP A 1 268 ? 26.505  54.808  51.166  1.00 70.65  ? 266 TRP A CZ2   1 
ATOM   2184  C CZ3   . TRP A 1 268 ? 25.545  52.609  50.873  1.00 69.84  ? 266 TRP A CZ3   1 
ATOM   2185  C CH2   . TRP A 1 268 ? 26.598  53.519  50.714  1.00 71.21  ? 266 TRP A CH2   1 
ATOM   2186  N N     . ALA A 1 269 ? 22.029  54.902  56.286  1.00 64.91  ? 267 ALA A N     1 
ATOM   2187  C CA    . ALA A 1 269 ? 22.720  55.480  57.418  1.00 65.85  ? 267 ALA A CA    1 
ATOM   2188  C C     . ALA A 1 269 ? 23.193  54.416  58.434  1.00 61.03  ? 267 ALA A C     1 
ATOM   2189  O O     . ALA A 1 269 ? 24.134  54.643  59.191  1.00 58.34  ? 267 ALA A O     1 
ATOM   2190  C CB    . ALA A 1 269 ? 21.836  56.524  58.084  1.00 67.26  ? 267 ALA A CB    1 
ATOM   2191  N N     . SER A 1 270 ? 22.558  53.252  58.443  1.00 59.81  ? 268 SER A N     1 
ATOM   2192  C CA    . SER A 1 270 ? 22.784  52.304  59.534  1.00 58.06  ? 268 SER A CA    1 
ATOM   2193  C C     . SER A 1 270 ? 24.144  51.586  59.546  1.00 52.56  ? 268 SER A C     1 
ATOM   2194  O O     . SER A 1 270 ? 24.490  50.941  60.535  1.00 47.06  ? 268 SER A O     1 
ATOM   2195  C CB    . SER A 1 270 ? 21.626  51.318  59.654  1.00 54.02  ? 268 SER A CB    1 
ATOM   2196  O OG    . SER A 1 270 ? 21.113  51.008  58.387  1.00 58.90  ? 268 SER A OG    1 
ATOM   2197  N N     . GLN A 1 271 ? 24.920  51.726  58.475  1.00 50.37  ? 269 GLN A N     1 
ATOM   2198  C CA    . GLN A 1 271 ? 26.231  51.102  58.417  1.00 48.71  ? 269 GLN A CA    1 
ATOM   2199  C C     . GLN A 1 271 ? 27.215  51.803  59.344  1.00 55.45  ? 269 GLN A C     1 
ATOM   2200  O O     . GLN A 1 271 ? 28.266  51.241  59.724  1.00 52.78  ? 269 GLN A O     1 
ATOM   2201  C CB    . GLN A 1 271 ? 26.766  51.111  56.997  1.00 49.33  ? 269 GLN A CB    1 
ATOM   2202  C CG    . GLN A 1 271 ? 26.493  52.392  56.266  1.00 57.03  ? 269 GLN A CG    1 
ATOM   2203  C CD    . GLN A 1 271 ? 26.875  52.314  54.809  1.00 59.30  ? 269 GLN A CD    1 
ATOM   2204  O OE1   . GLN A 1 271 ? 27.808  51.606  54.434  1.00 58.41  ? 269 GLN A OE1   1 
ATOM   2205  N NE2   . GLN A 1 271 ? 26.145  53.029  53.978  1.00 59.72  ? 269 GLN A NE2   1 
ATOM   2206  N N     . ILE A 1 272 ? 26.856  53.033  59.711  1.00 56.75  ? 270 ILE A N     1 
ATOM   2207  C CA    . ILE A 1 272 ? 27.731  53.897  60.499  1.00 53.97  ? 270 ILE A CA    1 
ATOM   2208  C C     . ILE A 1 272 ? 27.100  54.517  61.764  1.00 54.12  ? 270 ILE A C     1 
ATOM   2209  O O     . ILE A 1 272 ? 27.638  54.372  62.861  1.00 55.11  ? 270 ILE A O     1 
ATOM   2210  C CB    . ILE A 1 272 ? 28.499  54.894  59.619  1.00 54.29  ? 270 ILE A CB    1 
ATOM   2211  C CG1   . ILE A 1 272 ? 29.750  55.353  60.361  1.00 57.18  ? 270 ILE A CG1   1 
ATOM   2212  C CG2   . ILE A 1 272 ? 27.601  56.028  59.165  1.00 59.53  ? 270 ILE A CG2   1 
ATOM   2213  C CD1   . ILE A 1 272 ? 30.464  54.225  61.068  1.00 54.22  ? 270 ILE A CD1   1 
ATOM   2214  N N     . TYR A 1 273 ? 26.008  55.256  61.616  1.00 55.76  ? 271 TYR A N     1 
ATOM   2215  C CA    . TYR A 1 273 ? 25.348  55.835  62.783  1.00 58.61  ? 271 TYR A CA    1 
ATOM   2216  C C     . TYR A 1 273 ? 24.634  54.745  63.586  1.00 58.10  ? 271 TYR A C     1 
ATOM   2217  O O     . TYR A 1 273 ? 23.652  54.169  63.123  1.00 58.55  ? 271 TYR A O     1 
ATOM   2218  C CB    . TYR A 1 273 ? 24.339  56.910  62.355  1.00 65.66  ? 271 TYR A CB    1 
ATOM   2219  C CG    . TYR A 1 273 ? 24.959  58.132  61.711  1.00 73.09  ? 271 TYR A CG    1 
ATOM   2220  C CD1   . TYR A 1 273 ? 25.575  59.106  62.483  1.00 76.34  ? 271 TYR A CD1   1 
ATOM   2221  C CD2   . TYR A 1 273 ? 24.924  58.318  60.334  1.00 73.09  ? 271 TYR A CD2   1 
ATOM   2222  C CE1   . TYR A 1 273 ? 26.148  60.226  61.909  1.00 81.17  ? 271 TYR A CE1   1 
ATOM   2223  C CE2   . TYR A 1 273 ? 25.495  59.440  59.749  1.00 79.17  ? 271 TYR A CE2   1 
ATOM   2224  C CZ    . TYR A 1 273 ? 26.111  60.393  60.547  1.00 82.66  ? 271 TYR A CZ    1 
ATOM   2225  O OH    . TYR A 1 273 ? 26.696  61.517  59.993  1.00 82.90  ? 271 TYR A OH    1 
ATOM   2226  N N     . PRO A 1 274 ? 25.113  54.463  64.807  1.00 56.13  ? 272 PRO A N     1 
ATOM   2227  C CA    . PRO A 1 274 ? 24.473  53.403  65.590  1.00 54.97  ? 272 PRO A CA    1 
ATOM   2228  C C     . PRO A 1 274 ? 23.052  53.721  66.037  1.00 58.16  ? 272 PRO A C     1 
ATOM   2229  O O     . PRO A 1 274 ? 22.730  54.857  66.389  1.00 59.05  ? 272 PRO A O     1 
ATOM   2230  C CB    . PRO A 1 274 ? 25.390  53.256  66.805  1.00 50.41  ? 272 PRO A CB    1 
ATOM   2231  C CG    . PRO A 1 274 ? 26.156  54.509  66.862  1.00 53.14  ? 272 PRO A CG    1 
ATOM   2232  C CD    . PRO A 1 274 ? 26.338  54.951  65.453  1.00 53.19  ? 272 PRO A CD    1 
ATOM   2233  N N     . GLY A 1 275 ? 22.211  52.693  65.994  1.00 58.05  ? 273 GLY A N     1 
ATOM   2234  C CA    . GLY A 1 275 ? 20.918  52.701  66.647  1.00 57.67  ? 273 GLY A CA    1 
ATOM   2235  C C     . GLY A 1 275 ? 19.740  53.151  65.820  1.00 61.77  ? 273 GLY A C     1 
ATOM   2236  O O     . GLY A 1 275 ? 18.700  53.465  66.375  1.00 67.02  ? 273 GLY A O     1 
ATOM   2237  N N     . ILE A 1 276 ? 19.882  53.198  64.504  1.00 63.57  ? 274 ILE A N     1 
ATOM   2238  C CA    . ILE A 1 276 ? 18.755  53.588  63.666  1.00 66.20  ? 274 ILE A CA    1 
ATOM   2239  C C     . ILE A 1 276 ? 17.670  52.522  63.688  1.00 67.31  ? 274 ILE A C     1 
ATOM   2240  O O     . ILE A 1 276 ? 17.961  51.332  63.549  1.00 66.40  ? 274 ILE A O     1 
ATOM   2241  C CB    . ILE A 1 276 ? 19.175  53.848  62.220  1.00 66.94  ? 274 ILE A CB    1 
ATOM   2242  C CG1   . ILE A 1 276 ? 19.703  55.270  62.077  1.00 68.71  ? 274 ILE A CG1   1 
ATOM   2243  C CG2   . ILE A 1 276 ? 17.990  53.673  61.289  1.00 68.61  ? 274 ILE A CG2   1 
ATOM   2244  C CD1   . ILE A 1 276 ? 20.793  55.611  63.039  1.00 67.75  ? 274 ILE A CD1   1 
ATOM   2245  N N     . LYS A 1 277 ? 16.425  52.953  63.880  1.00 69.05  ? 275 LYS A N     1 
ATOM   2246  C CA    . LYS A 1 277 ? 15.279  52.051  63.869  1.00 70.56  ? 275 LYS A CA    1 
ATOM   2247  C C     . LYS A 1 277 ? 14.320  52.503  62.793  1.00 71.77  ? 275 LYS A C     1 
ATOM   2248  O O     . LYS A 1 277 ? 13.963  53.674  62.728  1.00 73.24  ? 275 LYS A O     1 
ATOM   2249  C CB    . LYS A 1 277 ? 14.578  52.037  65.223  1.00 68.65  ? 275 LYS A CB    1 
ATOM   2250  C CG    . LYS A 1 277 ? 15.441  51.529  66.343  1.00 65.06  ? 275 LYS A CG    1 
ATOM   2251  C CD    . LYS A 1 277 ? 14.727  51.560  67.677  1.00 69.83  ? 275 LYS A CD    1 
ATOM   2252  C CE    . LYS A 1 277 ? 14.508  52.969  68.176  1.00 74.67  ? 275 LYS A CE    1 
ATOM   2253  N NZ    . LYS A 1 277 ? 13.071  53.358  68.068  1.00 84.33  ? 275 LYS A NZ    1 
ATOM   2254  N N     . VAL A 1 278 ? 13.990  51.598  61.884  1.00 70.70  ? 276 VAL A N     1 
ATOM   2255  C CA    . VAL A 1 278 ? 12.989  51.886  60.873  1.00 73.70  ? 276 VAL A CA    1 
ATOM   2256  C C     . VAL A 1 278 ? 11.609  51.254  61.071  1.00 77.93  ? 276 VAL A C     1 
ATOM   2257  O O     . VAL A 1 278 ? 10.740  51.431  60.228  1.00 80.54  ? 276 VAL A O     1 
ATOM   2258  C CB    . VAL A 1 278 ? 13.492  51.539  59.487  1.00 73.42  ? 276 VAL A CB    1 
ATOM   2259  C CG1   . VAL A 1 278 ? 13.394  50.044  59.267  1.00 78.26  ? 276 VAL A CG1   1 
ATOM   2260  C CG2   . VAL A 1 278 ? 12.683  52.284  58.460  1.00 77.66  ? 276 VAL A CG2   1 
ATOM   2261  N N     . ARG A 1 279 ? 11.411  50.512  62.157  1.00 78.05  ? 277 ARG A N     1 
ATOM   2262  C CA    . ARG A 1 279 ? 10.233  49.635  62.308  1.00 79.57  ? 277 ARG A CA    1 
ATOM   2263  C C     . ARG A 1 279 ? 8.862   50.247  62.023  1.00 84.12  ? 277 ARG A C     1 
ATOM   2264  O O     . ARG A 1 279 ? 8.082   49.701  61.237  1.00 83.49  ? 277 ARG A O     1 
ATOM   2265  C CB    . ARG A 1 279 ? 10.214  48.991  63.704  1.00 80.36  ? 277 ARG A CB    1 
ATOM   2266  C CG    . ARG A 1 279 ? 8.831   48.574  64.245  1.00 81.87  ? 277 ARG A CG    1 
ATOM   2267  C CD    . ARG A 1 279 ? 8.156   47.524  63.388  1.00 79.96  ? 277 ARG A CD    1 
ATOM   2268  N NE    . ARG A 1 279 ? 9.099   46.487  63.005  1.00 80.81  ? 277 ARG A NE    1 
ATOM   2269  C CZ    . ARG A 1 279 ? 9.300   45.383  63.709  1.00 81.80  ? 277 ARG A CZ    1 
ATOM   2270  N NH1   . ARG A 1 279 ? 8.601   45.191  64.824  1.00 86.45  ? 277 ARG A NH1   1 
ATOM   2271  N NH2   . ARG A 1 279 ? 10.187  44.479  63.302  1.00 72.11  ? 277 ARG A NH2   1 
ATOM   2272  N N     . GLN A 1 280 ? 8.562   51.361  62.681  1.00 87.08  ? 278 GLN A N     1 
ATOM   2273  C CA    . GLN A 1 280 ? 7.214   51.910  62.657  1.00 88.47  ? 278 GLN A CA    1 
ATOM   2274  C C     . GLN A 1 280 ? 6.929   52.663  61.363  1.00 88.17  ? 278 GLN A C     1 
ATOM   2275  O O     . GLN A 1 280 ? 5.798   52.701  60.893  1.00 90.72  ? 278 GLN A O     1 
ATOM   2276  C CB    . GLN A 1 280 ? 6.982   52.797  63.883  1.00 92.21  ? 278 GLN A CB    1 
ATOM   2277  C CG    . GLN A 1 280 ? 7.210   52.090  65.219  1.00 88.79  ? 278 GLN A CG    1 
ATOM   2278  C CD    . GLN A 1 280 ? 6.140   51.065  65.538  1.00 91.33  ? 278 GLN A CD    1 
ATOM   2279  O OE1   . GLN A 1 280 ? 5.048   51.099  64.976  1.00 95.20  ? 278 GLN A OE1   1 
ATOM   2280  N NE2   . GLN A 1 280 ? 6.449   50.144  66.444  1.00 92.21  ? 278 GLN A NE2   1 
ATOM   2281  N N     . LEU A 1 281 ? 7.963   53.255  60.786  1.00 84.81  ? 279 LEU A N     1 
ATOM   2282  C CA    . LEU A 1 281 ? 7.821   53.936  59.517  1.00 87.03  ? 279 LEU A CA    1 
ATOM   2283  C C     . LEU A 1 281 ? 7.515   52.944  58.409  1.00 89.14  ? 279 LEU A C     1 
ATOM   2284  O O     . LEU A 1 281 ? 6.784   53.250  57.472  1.00 95.31  ? 279 LEU A O     1 
ATOM   2285  C CB    . LEU A 1 281 ? 9.096   54.695  59.182  1.00 91.33  ? 279 LEU A CB    1 
ATOM   2286  C CG    . LEU A 1 281 ? 9.434   55.878  60.079  1.00 92.51  ? 279 LEU A CG    1 
ATOM   2287  C CD1   . LEU A 1 281 ? 10.823  56.368  59.750  1.00 95.62  ? 279 LEU A CD1   1 
ATOM   2288  C CD2   . LEU A 1 281 ? 8.419   56.982  59.897  1.00 97.45  ? 279 LEU A CD2   1 
ATOM   2289  N N     . SER A 1 282 ? 8.081   51.752  58.506  1.00 88.01  ? 280 SER A N     1 
ATOM   2290  C CA    . SER A 1 282 ? 7.859   50.745  57.477  1.00 90.25  ? 280 SER A CA    1 
ATOM   2291  C C     . SER A 1 282 ? 6.450   50.174  57.555  1.00 91.63  ? 280 SER A C     1 
ATOM   2292  O O     . SER A 1 282 ? 5.972   49.560  56.601  1.00 90.71  ? 280 SER A O     1 
ATOM   2293  C CB    . SER A 1 282 ? 8.885   49.620  57.586  1.00 82.68  ? 280 SER A CB    1 
ATOM   2294  O OG    . SER A 1 282 ? 10.195  50.122  57.472  1.00 75.91  ? 280 SER A OG    1 
ATOM   2295  N N     . LYS A 1 283 ? 5.797   50.377  58.698  1.00 91.80  ? 281 LYS A N     1 
ATOM   2296  C CA    . LYS A 1 283 ? 4.438   49.887  58.909  1.00 95.92  ? 281 LYS A CA    1 
ATOM   2297  C C     . LYS A 1 283 ? 3.428   50.701  58.106  1.00 98.84  ? 281 LYS A C     1 
ATOM   2298  O O     . LYS A 1 283 ? 2.458   50.160  57.573  1.00 100.54 ? 281 LYS A O     1 
ATOM   2299  C CB    . LYS A 1 283 ? 4.079   49.906  60.395  1.00 94.22  ? 281 LYS A CB    1 
ATOM   2300  C CG    . LYS A 1 283 ? 4.935   48.988  61.243  1.00 92.59  ? 281 LYS A CG    1 
ATOM   2301  C CD    . LYS A 1 283 ? 4.443   48.934  62.677  1.00 93.07  ? 281 LYS A CD    1 
ATOM   2302  C CE    . LYS A 1 283 ? 3.055   48.318  62.770  1.00 99.57  ? 281 LYS A CE    1 
ATOM   2303  N NZ    . LYS A 1 283 ? 2.604   48.155  64.187  1.00 105.26 ? 281 LYS A NZ    1 
ATOM   2304  N N     . LEU A 1 284 ? 3.672   52.003  58.022  1.00 97.78  ? 282 LEU A N     1 
ATOM   2305  C CA    . LEU A 1 284 ? 2.850   52.889  57.217  1.00 98.83  ? 282 LEU A CA    1 
ATOM   2306  C C     . LEU A 1 284 ? 2.696   52.315  55.817  1.00 100.79 ? 282 LEU A C     1 
ATOM   2307  O O     . LEU A 1 284 ? 1.626   52.374  55.214  1.00 105.56 ? 282 LEU A O     1 
ATOM   2308  C CB    . LEU A 1 284 ? 3.498   54.268  57.149  1.00 96.91  ? 282 LEU A CB    1 
ATOM   2309  C CG    . LEU A 1 284 ? 3.806   54.863  58.518  1.00 96.02  ? 282 LEU A CG    1 
ATOM   2310  C CD1   . LEU A 1 284 ? 4.561   56.164  58.377  1.00 104.02 ? 282 LEU A CD1   1 
ATOM   2311  C CD2   . LEU A 1 284 ? 2.531   55.066  59.299  1.00 100.40 ? 282 LEU A CD2   1 
ATOM   2312  N N     . LEU A 1 285 ? 3.778   51.742  55.316  1.00 100.47 ? 283 LEU A N     1 
ATOM   2313  C CA    . LEU A 1 285 ? 3.833   51.251  53.949  1.00 103.82 ? 283 LEU A CA    1 
ATOM   2314  C C     . LEU A 1 285 ? 2.968   50.027  53.687  1.00 104.72 ? 283 LEU A C     1 
ATOM   2315  O O     . LEU A 1 285 ? 2.836   49.599  52.545  1.00 108.25 ? 283 LEU A O     1 
ATOM   2316  C CB    . LEU A 1 285 ? 5.280   50.953  53.570  1.00 101.51 ? 283 LEU A CB    1 
ATOM   2317  C CG    . LEU A 1 285 ? 6.203   52.136  53.855  1.00 101.92 ? 283 LEU A CG    1 
ATOM   2318  C CD1   . LEU A 1 285 ? 7.638   51.805  53.500  1.00 99.82  ? 283 LEU A CD1   1 
ATOM   2319  C CD2   . LEU A 1 285 ? 5.727   53.361  53.098  1.00 107.08 ? 283 LEU A CD2   1 
ATOM   2320  N N     . ARG A 1 286 ? 2.387   49.458  54.738  1.00 106.43 ? 284 ARG A N     1 
ATOM   2321  C CA    . ARG A 1 286 ? 1.649   48.204  54.596  1.00 109.60 ? 284 ARG A CA    1 
ATOM   2322  C C     . ARG A 1 286 ? 0.376   48.338  53.760  1.00 118.23 ? 284 ARG A C     1 
ATOM   2323  O O     . ARG A 1 286 ? -0.486  49.172  54.046  1.00 118.72 ? 284 ARG A O     1 
ATOM   2324  C CB    . ARG A 1 286 ? 1.324   47.600  55.965  1.00 107.98 ? 284 ARG A CB    1 
ATOM   2325  C CG    . ARG A 1 286 ? 2.544   47.156  56.748  1.00 100.38 ? 284 ARG A CG    1 
ATOM   2326  C CD    . ARG A 1 286 ? 2.209   46.058  57.746  1.00 100.16 ? 284 ARG A CD    1 
ATOM   2327  N NE    . ARG A 1 286 ? 3.414   45.467  58.330  1.00 100.91 ? 284 ARG A NE    1 
ATOM   2328  C CZ    . ARG A 1 286 ? 3.822   45.660  59.585  1.00 102.06 ? 284 ARG A CZ    1 
ATOM   2329  N NH1   . ARG A 1 286 ? 3.111   46.424  60.407  1.00 102.69 ? 284 ARG A NH1   1 
ATOM   2330  N NH2   . ARG A 1 286 ? 4.938   45.082  60.023  1.00 95.69  ? 284 ARG A NH2   1 
ATOM   2331  N N     . GLY A 1 287 ? 0.282   47.501  52.727  1.00 119.85 ? 285 GLY A N     1 
ATOM   2332  C CA    . GLY A 1 287 ? -0.904  47.385  51.893  1.00 126.90 ? 285 GLY A CA    1 
ATOM   2333  C C     . GLY A 1 287 ? -1.483  48.657  51.292  1.00 139.90 ? 285 GLY A C     1 
ATOM   2334  O O     . GLY A 1 287 ? -2.681  48.917  51.420  1.00 143.05 ? 285 GLY A O     1 
ATOM   2335  N N     . THR A 1 288 ? -0.650  49.447  50.623  1.00 139.68 ? 286 THR A N     1 
ATOM   2336  C CA    . THR A 1 288 ? -1.134  50.642  49.934  1.00 147.52 ? 286 THR A CA    1 
ATOM   2337  C C     . THR A 1 288 ? -1.105  50.425  48.417  1.00 156.53 ? 286 THR A C     1 
ATOM   2338  O O     . THR A 1 288 ? -0.178  49.802  47.899  1.00 157.31 ? 286 THR A O     1 
ATOM   2339  C CB    . THR A 1 288 ? -0.305  51.883  50.317  1.00 146.31 ? 286 THR A CB    1 
ATOM   2340  O OG1   . THR A 1 288 ? -0.274  52.017  51.745  1.00 137.30 ? 286 THR A OG1   1 
ATOM   2341  C CG2   . THR A 1 288 ? -0.899  53.140  49.703  1.00 149.65 ? 286 THR A CG2   1 
ATOM   2342  N N     . LYS A 1 289 ? -2.121  50.923  47.710  1.00 160.42 ? 287 LYS A N     1 
ATOM   2343  C CA    . LYS A 1 289 ? -2.244  50.699  46.260  1.00 164.00 ? 287 LYS A CA    1 
ATOM   2344  C C     . LYS A 1 289 ? -1.337  51.582  45.386  1.00 163.72 ? 287 LYS A C     1 
ATOM   2345  O O     . LYS A 1 289 ? -0.688  51.096  44.452  1.00 160.08 ? 287 LYS A O     1 
ATOM   2346  C CB    . LYS A 1 289 ? -3.704  50.843  45.805  1.00 162.10 ? 287 LYS A CB    1 
ATOM   2347  C CG    . LYS A 1 289 ? -3.912  50.619  44.307  1.00 161.96 ? 287 LYS A CG    1 
ATOM   2348  C CD    . LYS A 1 289 ? -3.490  49.214  43.890  1.00 162.95 ? 287 LYS A CD    1 
ATOM   2349  C CE    . LYS A 1 289 ? -3.569  49.022  42.384  1.00 159.92 ? 287 LYS A CE    1 
ATOM   2350  N NZ    . LYS A 1 289 ? -2.615  49.907  41.662  1.00 161.32 ? 287 LYS A NZ    1 
ATOM   2351  N N     . ALA A 1 290 ? -1.305  52.877  45.687  1.00 162.97 ? 288 ALA A N     1 
ATOM   2352  C CA    . ALA A 1 290 ? -0.555  53.831  44.879  1.00 159.02 ? 288 ALA A CA    1 
ATOM   2353  C C     . ALA A 1 290 ? 0.629   54.416  45.640  1.00 154.79 ? 288 ALA A C     1 
ATOM   2354  O O     . ALA A 1 290 ? 0.536   54.708  46.834  1.00 151.21 ? 288 ALA A O     1 
ATOM   2355  C CB    . ALA A 1 290 ? -1.472  54.940  44.380  1.00 158.15 ? 288 ALA A CB    1 
ATOM   2356  N N     . LEU A 1 291 ? 1.741   54.584  44.932  1.00 152.89 ? 289 LEU A N     1 
ATOM   2357  C CA    . LEU A 1 291 ? 2.954   55.152  45.508  1.00 152.10 ? 289 LEU A CA    1 
ATOM   2358  C C     . LEU A 1 291 ? 2.820   56.660  45.716  1.00 151.51 ? 289 LEU A C     1 
ATOM   2359  O O     . LEU A 1 291 ? 3.643   57.286  46.385  1.00 146.97 ? 289 LEU A O     1 
ATOM   2360  C CB    . LEU A 1 291 ? 4.158   54.843  44.614  1.00 149.42 ? 289 LEU A CB    1 
ATOM   2361  C CG    . LEU A 1 291 ? 5.521   55.328  45.115  1.00 144.14 ? 289 LEU A CG    1 
ATOM   2362  C CD1   . LEU A 1 291 ? 5.672   55.025  46.592  1.00 141.82 ? 289 LEU A CD1   1 
ATOM   2363  C CD2   . LEU A 1 291 ? 6.659   54.709  44.314  1.00 138.91 ? 289 LEU A CD2   1 
ATOM   2364  N N     . THR A 1 292 ? 1.780   57.240  45.129  1.00 154.92 ? 290 THR A N     1 
ATOM   2365  C CA    . THR A 1 292 ? 1.534   58.672  45.246  1.00 154.93 ? 290 THR A CA    1 
ATOM   2366  C C     . THR A 1 292 ? 0.516   59.005  46.346  1.00 154.44 ? 290 THR A C     1 
ATOM   2367  O O     . THR A 1 292 ? 0.167   60.169  46.544  1.00 152.39 ? 290 THR A O     1 
ATOM   2368  C CB    . THR A 1 292 ? 1.069   59.270  43.901  1.00 154.89 ? 290 THR A CB    1 
ATOM   2369  O OG1   . THR A 1 292 ? -0.230  58.762  43.574  1.00 157.90 ? 290 THR A OG1   1 
ATOM   2370  C CG2   . THR A 1 292 ? 2.043   58.904  42.787  1.00 149.84 ? 290 THR A CG2   1 
ATOM   2371  N N     . GLU A 1 293 ? 0.053   57.982  47.062  1.00 155.77 ? 291 GLU A N     1 
ATOM   2372  C CA    . GLU A 1 293 ? -1.013  58.145  48.054  1.00 156.45 ? 291 GLU A CA    1 
ATOM   2373  C C     . GLU A 1 293 ? -0.616  59.007  49.248  1.00 153.80 ? 291 GLU A C     1 
ATOM   2374  O O     . GLU A 1 293 ? 0.565   59.213  49.518  1.00 151.44 ? 291 GLU A O     1 
ATOM   2375  C CB    . GLU A 1 293 ? -1.516  56.786  48.550  1.00 157.26 ? 291 GLU A CB    1 
ATOM   2376  C CG    . GLU A 1 293 ? -2.477  56.088  47.607  1.00 159.13 ? 291 GLU A CG    1 
ATOM   2377  C CD    . GLU A 1 293 ? -3.215  54.947  48.279  1.00 160.93 ? 291 GLU A CD    1 
ATOM   2378  O OE1   . GLU A 1 293 ? -3.240  54.908  49.528  1.00 159.26 ? 291 GLU A OE1   1 
ATOM   2379  O OE2   . GLU A 1 293 ? -3.768  54.086  47.562  1.00 160.91 ? 291 GLU A OE2   1 
ATOM   2380  N N     . VAL A 1 294 ? -1.624  59.513  49.951  1.00 156.38 ? 292 VAL A N     1 
ATOM   2381  C CA    . VAL A 1 294 ? -1.419  60.381  51.107  1.00 157.27 ? 292 VAL A CA    1 
ATOM   2382  C C     . VAL A 1 294 ? -1.468  59.595  52.416  1.00 156.74 ? 292 VAL A C     1 
ATOM   2383  O O     . VAL A 1 294 ? -2.419  58.850  52.660  1.00 156.75 ? 292 VAL A O     1 
ATOM   2384  C CB    . VAL A 1 294 ? -2.486  61.499  51.158  1.00 159.31 ? 292 VAL A CB    1 
ATOM   2385  C CG1   . VAL A 1 294 ? -3.875  60.935  50.854  1.00 156.38 ? 292 VAL A CG1   1 
ATOM   2386  C CG2   . VAL A 1 294 ? -2.466  62.202  52.509  1.00 157.62 ? 292 VAL A CG2   1 
ATOM   2387  N N     . ILE A 1 295 ? -0.446  59.760  53.256  1.00 154.99 ? 293 ILE A N     1 
ATOM   2388  C CA    . ILE A 1 295 ? -0.424  59.103  54.563  1.00 154.01 ? 293 ILE A CA    1 
ATOM   2389  C C     . ILE A 1 295 ? 0.012   60.054  55.676  1.00 151.78 ? 293 ILE A C     1 
ATOM   2390  O O     . ILE A 1 295 ? 0.952   60.831  55.507  1.00 150.35 ? 293 ILE A O     1 
ATOM   2391  C CB    . ILE A 1 295 ? 0.525   57.877  54.565  1.00 152.41 ? 293 ILE A CB    1 
ATOM   2392  C CG1   . ILE A 1 295 ? -0.051  56.728  53.732  1.00 152.73 ? 293 ILE A CG1   1 
ATOM   2393  C CG2   . ILE A 1 295 ? 0.785   57.394  55.979  1.00 145.16 ? 293 ILE A CG2   1 
ATOM   2394  C CD1   . ILE A 1 295 ? -1.232  56.030  54.375  1.00 151.86 ? 293 ILE A CD1   1 
ATOM   2395  N N     . PRO A 1 296 ? -0.684  59.992  56.822  1.00 152.44 ? 294 PRO A N     1 
ATOM   2396  C CA    . PRO A 1 296 ? -0.351  60.679  58.078  1.00 149.69 ? 294 PRO A CA    1 
ATOM   2397  C C     . PRO A 1 296 ? 0.684   59.927  58.906  1.00 144.70 ? 294 PRO A C     1 
ATOM   2398  O O     . PRO A 1 296 ? 0.728   58.702  58.847  1.00 142.53 ? 294 PRO A O     1 
ATOM   2399  C CB    . PRO A 1 296 ? -1.683  60.696  58.822  1.00 149.71 ? 294 PRO A CB    1 
ATOM   2400  C CG    . PRO A 1 296 ? -2.375  59.452  58.350  1.00 153.17 ? 294 PRO A CG    1 
ATOM   2401  C CD    . PRO A 1 296 ? -1.969  59.272  56.911  1.00 152.74 ? 294 PRO A CD    1 
ATOM   2402  N N     . LEU A 1 297 ? 1.479   60.640  59.694  1.00 142.73 ? 295 LEU A N     1 
ATOM   2403  C CA    . LEU A 1 297 ? 2.461   59.987  60.553  1.00 138.52 ? 295 LEU A CA    1 
ATOM   2404  C C     . LEU A 1 297 ? 1.856   59.657  61.910  1.00 136.41 ? 295 LEU A C     1 
ATOM   2405  O O     . LEU A 1 297 ? 1.267   60.520  62.554  1.00 137.27 ? 295 LEU A O     1 
ATOM   2406  C CB    . LEU A 1 297 ? 3.696   60.870  60.748  1.00 138.97 ? 295 LEU A CB    1 
ATOM   2407  C CG    . LEU A 1 297 ? 4.680   61.055  59.591  1.00 144.21 ? 295 LEU A CG    1 
ATOM   2408  C CD1   . LEU A 1 297 ? 5.837   61.944  60.024  1.00 142.91 ? 295 LEU A CD1   1 
ATOM   2409  C CD2   . LEU A 1 297 ? 5.196   59.712  59.086  1.00 138.41 ? 295 LEU A CD2   1 
ATOM   2410  N N     . THR A 1 298 ? 1.993   58.403  62.331  1.00 132.09 ? 296 THR A N     1 
ATOM   2411  C CA    . THR A 1 298 ? 1.598   57.985  63.676  1.00 127.54 ? 296 THR A CA    1 
ATOM   2412  C C     . THR A 1 298 ? 2.608   58.436  64.744  1.00 126.00 ? 296 THR A C     1 
ATOM   2413  O O     . THR A 1 298 ? 3.741   58.783  64.417  1.00 126.02 ? 296 THR A O     1 
ATOM   2414  C CB    . THR A 1 298 ? 1.393   56.469  63.755  1.00 123.59 ? 296 THR A CB    1 
ATOM   2415  O OG1   . THR A 1 298 ? 1.072   56.106  65.100  1.00 126.11 ? 296 THR A OG1   1 
ATOM   2416  C CG2   . THR A 1 298 ? 2.648   55.739  63.329  1.00 122.09 ? 296 THR A CG2   1 
ATOM   2417  N N     . GLU A 1 299 ? 2.194   58.448  66.011  1.00 126.79 ? 297 GLU A N     1 
ATOM   2418  C CA    . GLU A 1 299 ? 3.070   58.882  67.114  1.00 127.76 ? 297 GLU A CA    1 
ATOM   2419  C C     . GLU A 1 299 ? 4.342   58.046  67.282  1.00 124.62 ? 297 GLU A C     1 
ATOM   2420  O O     . GLU A 1 299 ? 5.419   58.579  67.574  1.00 122.75 ? 297 GLU A O     1 
ATOM   2421  C CB    . GLU A 1 299 ? 2.316   58.904  68.449  1.00 131.95 ? 297 GLU A CB    1 
ATOM   2422  C CG    . GLU A 1 299 ? 3.236   58.725  69.664  1.00 136.72 ? 297 GLU A CG    1 
ATOM   2423  C CD    . GLU A 1 299 ? 3.248   59.927  70.601  1.00 144.10 ? 297 GLU A CD    1 
ATOM   2424  O OE1   . GLU A 1 299 ? 2.165   60.504  70.847  1.00 146.96 ? 297 GLU A OE1   1 
ATOM   2425  O OE2   . GLU A 1 299 ? 4.342   60.290  71.094  1.00 141.51 ? 297 GLU A OE2   1 
ATOM   2426  N N     . GLU A 1 300 ? 4.206   56.735  67.129  1.00 122.25 ? 298 GLU A N     1 
ATOM   2427  C CA    . GLU A 1 300 ? 5.352   55.848  67.217  1.00 117.86 ? 298 GLU A CA    1 
ATOM   2428  C C     . GLU A 1 300 ? 6.321   56.194  66.099  1.00 112.14 ? 298 GLU A C     1 
ATOM   2429  O O     . GLU A 1 300 ? 7.491   56.471  66.341  1.00 109.16 ? 298 GLU A O     1 
ATOM   2430  C CB    . GLU A 1 300 ? 4.917   54.385  67.096  1.00 117.57 ? 298 GLU A CB    1 
ATOM   2431  C CG    . GLU A 1 300 ? 3.854   53.949  68.097  1.00 120.20 ? 298 GLU A CG    1 
ATOM   2432  C CD    . GLU A 1 300 ? 2.476   54.460  67.732  1.00 123.92 ? 298 GLU A CD    1 
ATOM   2433  O OE1   . GLU A 1 300 ? 2.346   55.072  66.652  1.00 125.85 ? 298 GLU A OE1   1 
ATOM   2434  O OE2   . GLU A 1 300 ? 1.529   54.251  68.520  1.00 120.13 ? 298 GLU A OE2   1 
ATOM   2435  N N     . ALA A 1 301 ? 5.812   56.189  64.873  1.00 112.43 ? 299 ALA A N     1 
ATOM   2436  C CA    . ALA A 1 301 ? 6.622   56.479  63.699  1.00 106.81 ? 299 ALA A CA    1 
ATOM   2437  C C     . ALA A 1 301 ? 7.283   57.843  63.800  1.00 109.58 ? 299 ALA A C     1 
ATOM   2438  O O     . ALA A 1 301 ? 8.364   58.055  63.261  1.00 107.59 ? 299 ALA A O     1 
ATOM   2439  C CB    . ALA A 1 301 ? 5.780   56.387  62.435  1.00 108.25 ? 299 ALA A CB    1 
ATOM   2440  N N     . GLU A 1 302 ? 6.623   58.779  64.470  1.00 115.76 ? 300 GLU A N     1 
ATOM   2441  C CA    . GLU A 1 302 ? 7.209   60.095  64.687  1.00 115.88 ? 300 GLU A CA    1 
ATOM   2442  C C     . GLU A 1 302 ? 8.174   60.102  65.862  1.00 111.41 ? 300 GLU A C     1 
ATOM   2443  O O     . GLU A 1 302 ? 9.213   60.757  65.812  1.00 111.14 ? 300 GLU A O     1 
ATOM   2444  C CB    . GLU A 1 302 ? 6.128   61.167  64.828  1.00 120.85 ? 300 GLU A CB    1 
ATOM   2445  C CG    . GLU A 1 302 ? 5.616   61.642  63.479  1.00 127.35 ? 300 GLU A CG    1 
ATOM   2446  C CD    . GLU A 1 302 ? 4.554   62.708  63.586  1.00 131.75 ? 300 GLU A CD    1 
ATOM   2447  O OE1   . GLU A 1 302 ? 3.548   62.467  64.284  1.00 131.43 ? 300 GLU A OE1   1 
ATOM   2448  O OE2   . GLU A 1 302 ? 4.723   63.782  62.968  1.00 129.29 ? 300 GLU A OE2   1 
ATOM   2449  N N     . LEU A 1 303 ? 7.833   59.361  66.910  1.00 111.13 ? 301 LEU A N     1 
ATOM   2450  C CA    . LEU A 1 303 ? 8.722   59.216  68.052  1.00 112.10 ? 301 LEU A CA    1 
ATOM   2451  C C     . LEU A 1 303 ? 10.029  58.539  67.620  1.00 111.16 ? 301 LEU A C     1 
ATOM   2452  O O     . LEU A 1 303 ? 11.106  58.852  68.125  1.00 109.43 ? 301 LEU A O     1 
ATOM   2453  C CB    . LEU A 1 303 ? 8.029   58.434  69.167  1.00 114.58 ? 301 LEU A CB    1 
ATOM   2454  C CG    . LEU A 1 303 ? 8.812   58.247  70.466  1.00 118.89 ? 301 LEU A CG    1 
ATOM   2455  C CD1   . LEU A 1 303 ? 9.446   59.551  70.929  1.00 116.41 ? 301 LEU A CD1   1 
ATOM   2456  C CD2   . LEU A 1 303 ? 7.909   57.670  71.543  1.00 122.11 ? 301 LEU A CD2   1 
ATOM   2457  N N     . GLU A 1 304 ? 9.918   57.617  66.669  1.00 110.54 ? 302 GLU A N     1 
ATOM   2458  C CA    . GLU A 1 304 ? 11.069  56.952  66.063  1.00 103.01 ? 302 GLU A CA    1 
ATOM   2459  C C     . GLU A 1 304 ? 11.853  57.905  65.164  1.00 103.21 ? 302 GLU A C     1 
ATOM   2460  O O     . GLU A 1 304 ? 13.052  58.069  65.338  1.00 104.91 ? 302 GLU A O     1 
ATOM   2461  C CB    . GLU A 1 304 ? 10.588  55.734  65.269  1.00 98.32  ? 302 GLU A CB    1 
ATOM   2462  C CG    . GLU A 1 304 ? 11.637  54.979  64.464  1.00 91.88  ? 302 GLU A CG    1 
ATOM   2463  C CD    . GLU A 1 304 ? 11.080  53.684  63.852  1.00 85.92  ? 302 GLU A CD    1 
ATOM   2464  O OE1   . GLU A 1 304 ? 10.424  53.744  62.787  1.00 82.27  ? 302 GLU A OE1   1 
ATOM   2465  O OE2   . GLU A 1 304 ? 11.295  52.606  64.448  1.00 81.25  ? 302 GLU A OE2   1 
ATOM   2466  N N     . LEU A 1 305 ? 11.168  58.544  64.218  1.00 103.64 ? 303 LEU A N     1 
ATOM   2467  C CA    . LEU A 1 305 ? 11.794  59.507  63.312  1.00 103.49 ? 303 LEU A CA    1 
ATOM   2468  C C     . LEU A 1 305 ? 12.587  60.557  64.076  1.00 106.13 ? 303 LEU A C     1 
ATOM   2469  O O     . LEU A 1 305 ? 13.622  61.039  63.614  1.00 103.19 ? 303 LEU A O     1 
ATOM   2470  C CB    . LEU A 1 305 ? 10.734  60.197  62.458  1.00 106.32 ? 303 LEU A CB    1 
ATOM   2471  C CG    . LEU A 1 305 ? 11.200  61.359  61.577  1.00 110.45 ? 303 LEU A CG    1 
ATOM   2472  C CD1   . LEU A 1 305 ? 12.304  60.922  60.630  1.00 109.38 ? 303 LEU A CD1   1 
ATOM   2473  C CD2   . LEU A 1 305 ? 10.032  61.943  60.800  1.00 114.96 ? 303 LEU A CD2   1 
ATOM   2474  N N     . ALA A 1 306 ? 12.080  60.922  65.245  1.00 108.36 ? 304 ALA A N     1 
ATOM   2475  C CA    . ALA A 1 306 ? 12.770  61.871  66.101  1.00 109.27 ? 304 ALA A CA    1 
ATOM   2476  C C     . ALA A 1 306 ? 14.113  61.319  66.570  1.00 106.31 ? 304 ALA A C     1 
ATOM   2477  O O     . ALA A 1 306 ? 15.161  61.897  66.280  1.00 105.14 ? 304 ALA A O     1 
ATOM   2478  C CB    . ALA A 1 306 ? 11.898  62.226  67.293  1.00 111.08 ? 304 ALA A CB    1 
ATOM   2479  N N     . GLU A 1 307 ? 14.068  60.186  67.271  1.00 105.28 ? 305 GLU A N     1 
ATOM   2480  C CA    . GLU A 1 307 ? 15.261  59.568  67.848  1.00 103.86 ? 305 GLU A CA    1 
ATOM   2481  C C     . GLU A 1 307 ? 16.353  59.379  66.806  1.00 100.67 ? 305 GLU A C     1 
ATOM   2482  O O     . GLU A 1 307 ? 17.537  59.494  67.112  1.00 97.26  ? 305 GLU A O     1 
ATOM   2483  C CB    . GLU A 1 307 ? 14.914  58.208  68.448  1.00 106.84 ? 305 GLU A CB    1 
ATOM   2484  C CG    . GLU A 1 307 ? 13.660  58.200  69.295  1.00 113.07 ? 305 GLU A CG    1 
ATOM   2485  C CD    . GLU A 1 307 ? 13.119  56.798  69.530  1.00 112.00 ? 305 GLU A CD    1 
ATOM   2486  O OE1   . GLU A 1 307 ? 13.546  55.863  68.821  1.00 105.67 ? 305 GLU A OE1   1 
ATOM   2487  O OE2   . GLU A 1 307 ? 12.262  56.633  70.426  1.00 115.96 ? 305 GLU A OE2   1 
ATOM   2488  N N     . ASN A 1 308 ? 15.944  59.074  65.576  1.00 100.34 ? 306 ASN A N     1 
ATOM   2489  C CA    . ASN A 1 308 ? 16.880  58.862  64.477  1.00 98.16  ? 306 ASN A CA    1 
ATOM   2490  C C     . ASN A 1 308 ? 17.575  60.166  64.076  1.00 98.58  ? 306 ASN A C     1 
ATOM   2491  O O     . ASN A 1 308 ? 18.763  60.172  63.742  1.00 95.90  ? 306 ASN A O     1 
ATOM   2492  C CB    . ASN A 1 308 ? 16.172  58.220  63.267  1.00 93.58  ? 306 ASN A CB    1 
ATOM   2493  C CG    . ASN A 1 308 ? 15.832  56.740  63.486  1.00 85.32  ? 306 ASN A CG    1 
ATOM   2494  O OD1   . ASN A 1 308 ? 16.488  56.048  64.266  1.00 81.00  ? 306 ASN A OD1   1 
ATOM   2495  N ND2   . ASN A 1 308 ? 14.813  56.252  62.783  1.00 81.56  ? 306 ASN A ND2   1 
ATOM   2496  N N     . ARG A 1 309 ? 16.828  61.266  64.132  1.00 101.53 ? 307 ARG A N     1 
ATOM   2497  C CA    . ARG A 1 309 ? 17.339  62.582  63.755  1.00 100.02 ? 307 ARG A CA    1 
ATOM   2498  C C     . ARG A 1 309 ? 18.425  63.104  64.691  1.00 96.23  ? 307 ARG A C     1 
ATOM   2499  O O     . ARG A 1 309 ? 19.330  63.825  64.265  1.00 92.99  ? 307 ARG A O     1 
ATOM   2500  C CB    . ARG A 1 309 ? 16.190  63.586  63.667  1.00 105.91 ? 307 ARG A CB    1 
ATOM   2501  C CG    . ARG A 1 309 ? 15.359  63.446  62.400  1.00 112.71 ? 307 ARG A CG    1 
ATOM   2502  C CD    . ARG A 1 309 ? 14.156  64.384  62.385  1.00 117.30 ? 307 ARG A CD    1 
ATOM   2503  N NE    . ARG A 1 309 ? 13.571  64.480  61.048  1.00 121.75 ? 307 ARG A NE    1 
ATOM   2504  C CZ    . ARG A 1 309 ? 12.333  64.894  60.795  1.00 125.38 ? 307 ARG A CZ    1 
ATOM   2505  N NH1   . ARG A 1 309 ? 11.530  65.247  61.794  1.00 120.97 ? 307 ARG A NH1   1 
ATOM   2506  N NH2   . ARG A 1 309 ? 11.894  64.946  59.540  1.00 129.09 ? 307 ARG A NH2   1 
ATOM   2507  N N     . GLU A 1 310 ? 18.331  62.738  65.963  1.00 96.50  ? 308 GLU A N     1 
ATOM   2508  C CA    . GLU A 1 310 ? 19.303  63.184  66.950  1.00 99.72  ? 308 GLU A CA    1 
ATOM   2509  C C     . GLU A 1 310 ? 20.571  62.365  66.825  1.00 94.34  ? 308 GLU A C     1 
ATOM   2510  O O     . GLU A 1 310 ? 21.647  62.792  67.238  1.00 93.88  ? 308 GLU A O     1 
ATOM   2511  C CB    . GLU A 1 310 ? 18.742  63.070  68.369  1.00 103.67 ? 308 GLU A CB    1 
ATOM   2512  C CG    . GLU A 1 310 ? 19.331  64.089  69.343  1.00 109.82 ? 308 GLU A CG    1 
ATOM   2513  C CD    . GLU A 1 310 ? 19.547  63.526  70.738  1.00 113.59 ? 308 GLU A CD    1 
ATOM   2514  O OE1   . GLU A 1 310 ? 20.400  62.625  70.890  1.00 112.49 ? 308 GLU A OE1   1 
ATOM   2515  O OE2   . GLU A 1 310 ? 18.869  63.985  71.684  1.00 113.78 ? 308 GLU A OE2   1 
ATOM   2516  N N     . ILE A 1 311 ? 20.433  61.180  66.252  1.00 92.98  ? 309 ILE A N     1 
ATOM   2517  C CA    . ILE A 1 311 ? 21.577  60.321  66.005  1.00 94.10  ? 309 ILE A CA    1 
ATOM   2518  C C     . ILE A 1 311 ? 22.392  60.887  64.854  1.00 92.45  ? 309 ILE A C     1 
ATOM   2519  O O     . ILE A 1 311 ? 23.622  60.860  64.869  1.00 85.51  ? 309 ILE A O     1 
ATOM   2520  C CB    . ILE A 1 311 ? 21.136  58.906  65.621  1.00 91.90  ? 309 ILE A CB    1 
ATOM   2521  C CG1   . ILE A 1 311 ? 20.124  58.368  66.621  1.00 89.85  ? 309 ILE A CG1   1 
ATOM   2522  C CG2   . ILE A 1 311 ? 22.330  57.971  65.562  1.00 86.85  ? 309 ILE A CG2   1 
ATOM   2523  C CD1   . ILE A 1 311 ? 19.638  56.995  66.272  1.00 83.38  ? 309 ILE A CD1   1 
ATOM   2524  N N     . LEU A 1 312 ? 21.684  61.393  63.850  1.00 94.25  ? 310 LEU A N     1 
ATOM   2525  C CA    . LEU A 1 312 ? 22.316  61.978  62.681  1.00 91.76  ? 310 LEU A CA    1 
ATOM   2526  C C     . LEU A 1 312 ? 22.832  63.376  62.982  1.00 96.80  ? 310 LEU A C     1 
ATOM   2527  O O     . LEU A 1 312 ? 23.734  63.868  62.303  1.00 97.18  ? 310 LEU A O     1 
ATOM   2528  C CB    . LEU A 1 312 ? 21.338  62.011  61.507  1.00 92.14  ? 310 LEU A CB    1 
ATOM   2529  C CG    . LEU A 1 312 ? 20.954  60.653  60.915  1.00 88.34  ? 310 LEU A CG    1 
ATOM   2530  C CD1   . LEU A 1 312 ? 19.892  60.814  59.847  1.00 90.60  ? 310 LEU A CD1   1 
ATOM   2531  C CD2   . LEU A 1 312 ? 22.171  59.954  60.344  1.00 82.85  ? 310 LEU A CD2   1 
ATOM   2532  N N     . LYS A 1 313 ? 22.279  64.005  64.017  1.00 99.88  ? 311 LYS A N     1 
ATOM   2533  C CA    . LYS A 1 313 ? 22.683  65.357  64.381  1.00 99.56  ? 311 LYS A CA    1 
ATOM   2534  C C     . LYS A 1 313 ? 24.198  65.485  64.362  1.00 102.57 ? 311 LYS A C     1 
ATOM   2535  O O     . LYS A 1 313 ? 24.755  66.128  63.473  1.00 102.87 ? 311 LYS A O     1 
ATOM   2536  C CB    . LYS A 1 313 ? 22.173  65.712  65.772  1.00 99.91  ? 311 LYS A CB    1 
ATOM   2537  C CG    . LYS A 1 313 ? 20.815  66.349  65.787  1.00 98.73  ? 311 LYS A CG    1 
ATOM   2538  C CD    . LYS A 1 313 ? 20.595  67.059  67.102  1.00 104.18 ? 311 LYS A CD    1 
ATOM   2539  C CE    . LYS A 1 313 ? 19.376  67.956  67.033  1.00 110.13 ? 311 LYS A CE    1 
ATOM   2540  N NZ    . LYS A 1 313 ? 19.379  68.978  68.116  1.00 113.80 ? 311 LYS A NZ    1 
ATOM   2541  N N     . GLU A 1 314 ? 24.862  64.854  65.329  1.00 104.81 ? 312 GLU A N     1 
ATOM   2542  C CA    . GLU A 1 314 ? 26.321  64.878  65.398  1.00 105.73 ? 312 GLU A CA    1 
ATOM   2543  C C     . GLU A 1 314 ? 26.877  63.945  64.333  1.00 100.21 ? 312 GLU A C     1 
ATOM   2544  O O     . GLU A 1 314 ? 26.228  62.973  63.979  1.00 99.48  ? 312 GLU A O     1 
ATOM   2545  C CB    . GLU A 1 314 ? 26.791  64.454  66.786  1.00 109.98 ? 312 GLU A CB    1 
ATOM   2546  C CG    . GLU A 1 314 ? 26.133  65.250  67.910  1.00 121.53 ? 312 GLU A CG    1 
ATOM   2547  C CD    . GLU A 1 314 ? 26.589  64.821  69.298  1.00 135.18 ? 312 GLU A CD    1 
ATOM   2548  O OE1   . GLU A 1 314 ? 27.668  64.195  69.408  1.00 132.81 ? 312 GLU A OE1   1 
ATOM   2549  O OE2   . GLU A 1 314 ? 25.865  65.112  70.279  1.00 136.29 ? 312 GLU A OE2   1 
ATOM   2550  N N     . PRO A 1 315 ? 28.071  64.241  63.801  1.00 99.65  ? 313 PRO A N     1 
ATOM   2551  C CA    . PRO A 1 315 ? 28.579  63.382  62.730  1.00 95.48  ? 313 PRO A CA    1 
ATOM   2552  C C     . PRO A 1 315 ? 29.259  62.161  63.323  1.00 91.62  ? 313 PRO A C     1 
ATOM   2553  O O     . PRO A 1 315 ? 29.374  62.064  64.547  1.00 91.07  ? 313 PRO A O     1 
ATOM   2554  C CB    . PRO A 1 315 ? 29.619  64.268  62.054  1.00 96.32  ? 313 PRO A CB    1 
ATOM   2555  C CG    . PRO A 1 315 ? 30.186  65.059  63.188  1.00 100.70 ? 313 PRO A CG    1 
ATOM   2556  C CD    . PRO A 1 315 ? 29.031  65.303  64.152  1.00 102.95 ? 313 PRO A CD    1 
ATOM   2557  N N     . VAL A 1 316 ? 29.706  61.247  62.471  1.00 85.69  ? 314 VAL A N     1 
ATOM   2558  C CA    . VAL A 1 316 ? 30.409  60.065  62.943  1.00 81.75  ? 314 VAL A CA    1 
ATOM   2559  C C     . VAL A 1 316 ? 31.233  59.499  61.816  1.00 76.70  ? 314 VAL A C     1 
ATOM   2560  O O     . VAL A 1 316 ? 30.949  59.740  60.646  1.00 77.59  ? 314 VAL A O     1 
ATOM   2561  C CB    . VAL A 1 316 ? 29.439  58.979  63.443  1.00 78.39  ? 314 VAL A CB    1 
ATOM   2562  C CG1   . VAL A 1 316 ? 28.628  58.460  62.302  1.00 74.13  ? 314 VAL A CG1   1 
ATOM   2563  C CG2   . VAL A 1 316 ? 30.200  57.840  64.084  1.00 75.46  ? 314 VAL A CG2   1 
ATOM   2564  N N     . HIS A 1 317 ? 32.242  58.725  62.173  1.00 73.53  ? 315 HIS A N     1 
ATOM   2565  C CA    . HIS A 1 317 ? 33.169  58.205  61.190  1.00 77.17  ? 315 HIS A CA    1 
ATOM   2566  C C     . HIS A 1 317 ? 33.595  56.784  61.566  1.00 75.99  ? 315 HIS A C     1 
ATOM   2567  O O     . HIS A 1 317 ? 33.609  56.424  62.750  1.00 73.99  ? 315 HIS A O     1 
ATOM   2568  C CB    . HIS A 1 317 ? 34.386  59.139  61.074  1.00 81.83  ? 315 HIS A CB    1 
ATOM   2569  C CG    . HIS A 1 317 ? 35.266  59.149  62.291  1.00 86.81  ? 315 HIS A CG    1 
ATOM   2570  N ND1   . HIS A 1 317 ? 36.638  59.007  62.217  1.00 87.59  ? 315 HIS A ND1   1 
ATOM   2571  C CD2   . HIS A 1 317 ? 34.971  59.276  63.605  1.00 90.13  ? 315 HIS A CD2   1 
ATOM   2572  C CE1   . HIS A 1 317 ? 37.147  59.045  63.436  1.00 90.88  ? 315 HIS A CE1   1 
ATOM   2573  N NE2   . HIS A 1 317 ? 36.160  59.207  64.298  1.00 92.17  ? 315 HIS A NE2   1 
ATOM   2574  N N     . GLY A 1 318 ? 33.903  55.965  60.562  1.00 67.51  ? 316 GLY A N     1 
ATOM   2575  C CA    . GLY A 1 318 ? 34.392  54.629  60.829  1.00 62.08  ? 316 GLY A CA    1 
ATOM   2576  C C     . GLY A 1 318 ? 35.897  54.581  60.775  1.00 61.27  ? 316 GLY A C     1 
ATOM   2577  O O     . GLY A 1 318 ? 36.488  55.400  60.102  1.00 65.07  ? 316 GLY A O     1 
ATOM   2578  N N     . VAL A 1 319 ? 36.509  53.620  61.462  1.00 56.31  ? 317 VAL A N     1 
ATOM   2579  C CA    . VAL A 1 319 ? 37.938  53.345  61.303  1.00 56.71  ? 317 VAL A CA    1 
ATOM   2580  C C     . VAL A 1 319 ? 38.194  52.305  60.211  1.00 56.69  ? 317 VAL A C     1 
ATOM   2581  O O     . VAL A 1 319 ? 37.307  51.974  59.436  1.00 57.71  ? 317 VAL A O     1 
ATOM   2582  C CB    . VAL A 1 319 ? 38.601  52.880  62.616  1.00 55.48  ? 317 VAL A CB    1 
ATOM   2583  C CG1   . VAL A 1 319 ? 38.048  53.660  63.774  1.00 66.24  ? 317 VAL A CG1   1 
ATOM   2584  C CG2   . VAL A 1 319 ? 38.398  51.396  62.846  1.00 53.95  ? 317 VAL A CG2   1 
ATOM   2585  N N     . TYR A 1 320 ? 39.422  51.819  60.129  1.00 54.43  ? 318 TYR A N     1 
ATOM   2586  C CA    . TYR A 1 320 ? 39.750  50.759  59.200  1.00 54.90  ? 318 TYR A CA    1 
ATOM   2587  C C     . TYR A 1 320 ? 40.187  49.540  59.966  1.00 55.41  ? 318 TYR A C     1 
ATOM   2588  O O     . TYR A 1 320 ? 40.296  49.560  61.194  1.00 55.46  ? 318 TYR A O     1 
ATOM   2589  C CB    . TYR A 1 320 ? 40.860  51.181  58.244  1.00 62.74  ? 318 TYR A CB    1 
ATOM   2590  C CG    . TYR A 1 320 ? 40.405  52.192  57.230  1.00 64.98  ? 318 TYR A CG    1 
ATOM   2591  C CD1   . TYR A 1 320 ? 39.184  52.063  56.607  1.00 63.80  ? 318 TYR A CD1   1 
ATOM   2592  C CD2   . TYR A 1 320 ? 41.183  53.287  56.915  1.00 69.76  ? 318 TYR A CD2   1 
ATOM   2593  C CE1   . TYR A 1 320 ? 38.755  52.992  55.690  1.00 66.29  ? 318 TYR A CE1   1 
ATOM   2594  C CE2   . TYR A 1 320 ? 40.756  54.218  56.006  1.00 71.89  ? 318 TYR A CE2   1 
ATOM   2595  C CZ    . TYR A 1 320 ? 39.546  54.061  55.399  1.00 68.94  ? 318 TYR A CZ    1 
ATOM   2596  O OH    . TYR A 1 320 ? 39.120  54.979  54.487  1.00 76.38  ? 318 TYR A OH    1 
ATOM   2597  N N     . TYR A 1 321 ? 40.461  48.482  59.218  1.00 54.55  ? 319 TYR A N     1 
ATOM   2598  C CA    . TYR A 1 321 ? 40.673  47.172  59.794  1.00 54.62  ? 319 TYR A CA    1 
ATOM   2599  C C     . TYR A 1 321 ? 42.166  46.921  60.088  1.00 56.16  ? 319 TYR A C     1 
ATOM   2600  O O     . TYR A 1 321 ? 43.050  47.265  59.312  1.00 57.77  ? 319 TYR A O     1 
ATOM   2601  C CB    . TYR A 1 321 ? 40.050  46.107  58.872  1.00 50.55  ? 319 TYR A CB    1 
ATOM   2602  C CG    . TYR A 1 321 ? 40.335  44.667  59.245  1.00 49.32  ? 319 TYR A CG    1 
ATOM   2603  C CD1   . TYR A 1 321 ? 39.962  44.156  60.473  1.00 47.69  ? 319 TYR A CD1   1 
ATOM   2604  C CD2   . TYR A 1 321 ? 40.972  43.819  58.353  1.00 49.87  ? 319 TYR A CD2   1 
ATOM   2605  C CE1   . TYR A 1 321 ? 40.229  42.842  60.801  1.00 50.57  ? 319 TYR A CE1   1 
ATOM   2606  C CE2   . TYR A 1 321 ? 41.243  42.508  58.669  1.00 46.93  ? 319 TYR A CE2   1 
ATOM   2607  C CZ    . TYR A 1 321 ? 40.870  42.015  59.888  1.00 50.85  ? 319 TYR A CZ    1 
ATOM   2608  O OH    . TYR A 1 321 ? 41.149  40.695  60.198  1.00 49.53  ? 319 TYR A OH    1 
ATOM   2609  N N     . ASP A 1 322 ? 42.432  46.316  61.231  1.00 55.04  ? 320 ASP A N     1 
ATOM   2610  C CA    . ASP A 1 322 ? 43.786  46.005  61.629  1.00 60.04  ? 320 ASP A CA    1 
ATOM   2611  C C     . ASP A 1 322 ? 43.909  44.515  61.881  1.00 59.23  ? 320 ASP A C     1 
ATOM   2612  O O     . ASP A 1 322 ? 43.635  44.042  62.972  1.00 60.67  ? 320 ASP A O     1 
ATOM   2613  C CB    . ASP A 1 322 ? 44.143  46.776  62.897  1.00 67.09  ? 320 ASP A CB    1 
ATOM   2614  C CG    . ASP A 1 322 ? 45.590  46.602  63.297  1.00 68.58  ? 320 ASP A CG    1 
ATOM   2615  O OD1   . ASP A 1 322 ? 46.192  45.569  62.936  1.00 64.31  ? 320 ASP A OD1   1 
ATOM   2616  O OD2   . ASP A 1 322 ? 46.119  47.511  63.974  1.00 76.42  ? 320 ASP A OD2   1 
ATOM   2617  N N     . PRO A 1 323 ? 44.339  43.777  60.866  1.00 55.69  ? 321 PRO A N     1 
ATOM   2618  C CA    . PRO A 1 323 ? 44.451  42.319  60.882  1.00 56.88  ? 321 PRO A CA    1 
ATOM   2619  C C     . PRO A 1 323 ? 45.170  41.797  62.123  1.00 62.40  ? 321 PRO A C     1 
ATOM   2620  O O     . PRO A 1 323 ? 44.988  40.640  62.488  1.00 65.31  ? 321 PRO A O     1 
ATOM   2621  C CB    . PRO A 1 323 ? 45.296  42.030  59.645  1.00 56.69  ? 321 PRO A CB    1 
ATOM   2622  C CG    . PRO A 1 323 ? 44.989  43.156  58.711  1.00 57.38  ? 321 PRO A CG    1 
ATOM   2623  C CD    . PRO A 1 323 ? 44.749  44.361  59.580  1.00 56.35  ? 321 PRO A CD    1 
ATOM   2624  N N     . SER A 1 324 ? 45.981  42.634  62.760  1.00 66.97  ? 322 SER A N     1 
ATOM   2625  C CA    . SER A 1 324 ? 46.717  42.233  63.960  1.00 69.74  ? 322 SER A CA    1 
ATOM   2626  C C     . SER A 1 324 ? 45.793  42.119  65.181  1.00 73.93  ? 322 SER A C     1 
ATOM   2627  O O     . SER A 1 324 ? 46.045  41.315  66.087  1.00 75.25  ? 322 SER A O     1 
ATOM   2628  C CB    . SER A 1 324 ? 47.848  43.227  64.254  1.00 70.78  ? 322 SER A CB    1 
ATOM   2629  O OG    . SER A 1 324 ? 47.339  44.491  64.667  1.00 67.50  ? 322 SER A OG    1 
ATOM   2630  N N     . LYS A 1 325 ? 44.723  42.921  65.187  1.00 73.39  ? 323 LYS A N     1 
ATOM   2631  C CA    . LYS A 1 325 ? 43.772  42.989  66.308  1.00 73.92  ? 323 LYS A CA    1 
ATOM   2632  C C     . LYS A 1 325 ? 42.425  42.259  66.049  1.00 70.50  ? 323 LYS A C     1 
ATOM   2633  O O     . LYS A 1 325 ? 41.935  42.185  64.917  1.00 65.28  ? 323 LYS A O     1 
ATOM   2634  C CB    . LYS A 1 325 ? 43.512  44.453  66.714  1.00 71.31  ? 323 LYS A CB    1 
ATOM   2635  C CG    . LYS A 1 325 ? 44.760  45.272  67.033  1.00 76.58  ? 323 LYS A CG    1 
ATOM   2636  C CD    . LYS A 1 325 ? 44.419  46.541  67.827  1.00 80.99  ? 323 LYS A CD    1 
ATOM   2637  C CE    . LYS A 1 325 ? 43.590  47.537  67.016  1.00 80.58  ? 323 LYS A CE    1 
ATOM   2638  N NZ    . LYS A 1 325 ? 44.413  48.464  66.173  1.00 81.11  ? 323 LYS A NZ    1 
ATOM   2639  N N     . ASP A 1 326 ? 41.833  41.739  67.122  1.00 69.92  ? 324 ASP A N     1 
ATOM   2640  C CA    . ASP A 1 326 ? 40.587  40.975  67.050  1.00 68.67  ? 324 ASP A CA    1 
ATOM   2641  C C     . ASP A 1 326 ? 39.358  41.733  66.557  1.00 61.47  ? 324 ASP A C     1 
ATOM   2642  O O     . ASP A 1 326 ? 39.285  42.962  66.680  1.00 60.30  ? 324 ASP A O     1 
ATOM   2643  C CB    . ASP A 1 326 ? 40.277  40.394  68.422  1.00 71.69  ? 324 ASP A CB    1 
ATOM   2644  C CG    . ASP A 1 326 ? 40.766  38.985  68.559  1.00 84.10  ? 324 ASP A CG    1 
ATOM   2645  O OD1   . ASP A 1 326 ? 40.524  38.195  67.617  1.00 79.68  ? 324 ASP A OD1   1 
ATOM   2646  O OD2   . ASP A 1 326 ? 41.407  38.677  69.589  1.00 93.15  ? 324 ASP A OD2   1 
ATOM   2647  N N     . LEU A 1 327 ? 38.390  40.989  66.015  1.00 52.63  ? 325 LEU A N     1 
ATOM   2648  C CA    . LEU A 1 327 ? 37.110  41.583  65.612  1.00 51.68  ? 325 LEU A CA    1 
ATOM   2649  C C     . LEU A 1 327 ? 36.009  41.351  66.652  1.00 51.18  ? 325 LEU A C     1 
ATOM   2650  O O     . LEU A 1 327 ? 35.841  40.237  67.166  1.00 49.18  ? 325 LEU A O     1 
ATOM   2651  C CB    . LEU A 1 327 ? 36.655  41.078  64.240  1.00 45.90  ? 325 LEU A CB    1 
ATOM   2652  C CG    . LEU A 1 327 ? 36.868  41.927  62.989  1.00 45.51  ? 325 LEU A CG    1 
ATOM   2653  C CD1   . LEU A 1 327 ? 36.371  41.148  61.778  1.00 47.88  ? 325 LEU A CD1   1 
ATOM   2654  C CD2   . LEU A 1 327 ? 36.186  43.275  63.065  1.00 45.80  ? 325 LEU A CD2   1 
ATOM   2655  N N     . ILE A 1 328 ? 35.256  42.405  66.957  1.00 49.41  ? 326 ILE A N     1 
ATOM   2656  C CA    . ILE A 1 328 ? 34.230  42.318  67.993  1.00 48.61  ? 326 ILE A CA    1 
ATOM   2657  C C     . ILE A 1 328 ? 32.882  42.829  67.512  1.00 48.30  ? 326 ILE A C     1 
ATOM   2658  O O     . ILE A 1 328 ? 32.771  43.940  66.977  1.00 46.73  ? 326 ILE A O     1 
ATOM   2659  C CB    . ILE A 1 328 ? 34.625  43.096  69.267  1.00 49.88  ? 326 ILE A CB    1 
ATOM   2660  C CG1   . ILE A 1 328 ? 35.962  42.591  69.834  1.00 48.98  ? 326 ILE A CG1   1 
ATOM   2661  C CG2   . ILE A 1 328 ? 33.488  43.047  70.287  1.00 47.21  ? 326 ILE A CG2   1 
ATOM   2662  C CD1   . ILE A 1 328 ? 35.883  41.269  70.604  1.00 50.93  ? 326 ILE A CD1   1 
ATOM   2663  N N     . ALA A 1 329 ? 31.861  41.996  67.697  1.00 45.99  ? 327 ALA A N     1 
ATOM   2664  C CA    . ALA A 1 329 ? 30.508  42.353  67.305  1.00 40.24  ? 327 ALA A CA    1 
ATOM   2665  C C     . ALA A 1 329 ? 29.634  42.236  68.527  1.00 42.60  ? 327 ALA A C     1 
ATOM   2666  O O     . ALA A 1 329 ? 29.570  41.184  69.179  1.00 42.04  ? 327 ALA A O     1 
ATOM   2667  C CB    . ALA A 1 329 ? 30.014  41.453  66.218  1.00 37.71  ? 327 ALA A CB    1 
ATOM   2668  N N     . GLU A 1 330 ? 28.980  43.337  68.853  1.00 40.00  ? 328 GLU A N     1 
ATOM   2669  C CA    . GLU A 1 330 ? 28.157  43.388  70.035  1.00 42.87  ? 328 GLU A CA    1 
ATOM   2670  C C     . GLU A 1 330 ? 26.754  43.838  69.624  1.00 46.05  ? 328 GLU A C     1 
ATOM   2671  O O     . GLU A 1 330 ? 26.581  44.781  68.826  1.00 46.63  ? 328 GLU A O     1 
ATOM   2672  C CB    . GLU A 1 330 ? 28.794  44.329  71.056  1.00 46.79  ? 328 GLU A CB    1 
ATOM   2673  C CG    . GLU A 1 330 ? 28.204  44.253  72.439  1.00 51.31  ? 328 GLU A CG    1 
ATOM   2674  C CD    . GLU A 1 330 ? 28.652  45.400  73.348  1.00 59.52  ? 328 GLU A CD    1 
ATOM   2675  O OE1   . GLU A 1 330 ? 29.773  45.949  73.135  1.00 55.09  ? 328 GLU A OE1   1 
ATOM   2676  O OE2   . GLU A 1 330 ? 27.861  45.739  74.273  1.00 61.71  ? 328 GLU A OE2   1 
ATOM   2677  N N     . ILE A 1 331 ? 25.760  43.138  70.159  1.00 43.10  ? 329 ILE A N     1 
ATOM   2678  C CA    . ILE A 1 331 ? 24.375  43.303  69.745  1.00 43.19  ? 329 ILE A CA    1 
ATOM   2679  C C     . ILE A 1 331 ? 23.522  43.810  70.905  1.00 43.52  ? 329 ILE A C     1 
ATOM   2680  O O     . ILE A 1 331 ? 23.653  43.347  72.030  1.00 44.23  ? 329 ILE A O     1 
ATOM   2681  C CB    . ILE A 1 331 ? 23.785  41.938  69.252  1.00 43.27  ? 329 ILE A CB    1 
ATOM   2682  C CG1   . ILE A 1 331 ? 24.844  41.119  68.525  1.00 40.39  ? 329 ILE A CG1   1 
ATOM   2683  C CG2   . ILE A 1 331 ? 22.555  42.136  68.360  1.00 42.99  ? 329 ILE A CG2   1 
ATOM   2684  C CD1   . ILE A 1 331 ? 24.261  40.095  67.586  1.00 41.17  ? 329 ILE A CD1   1 
ATOM   2685  N N     . GLN A 1 332 ? 22.643  44.757  70.623  1.00 43.55  ? 330 GLN A N     1 
ATOM   2686  C CA    . GLN A 1 332 ? 21.668  45.205  71.603  1.00 47.66  ? 330 GLN A CA    1 
ATOM   2687  C C     . GLN A 1 332 ? 20.247  45.007  71.095  1.00 49.13  ? 330 GLN A C     1 
ATOM   2688  O O     . GLN A 1 332 ? 19.934  45.304  69.926  1.00 49.77  ? 330 GLN A O     1 
ATOM   2689  C CB    . GLN A 1 332 ? 21.872  46.683  71.952  1.00 46.81  ? 330 GLN A CB    1 
ATOM   2690  C CG    . GLN A 1 332 ? 23.233  47.018  72.499  1.00 46.90  ? 330 GLN A CG    1 
ATOM   2691  C CD    . GLN A 1 332 ? 24.214  47.360  71.410  1.00 51.41  ? 330 GLN A CD    1 
ATOM   2692  O OE1   . GLN A 1 332 ? 23.847  47.997  70.409  1.00 50.14  ? 330 GLN A OE1   1 
ATOM   2693  N NE2   . GLN A 1 332 ? 25.476  46.933  71.582  1.00 48.89  ? 330 GLN A NE2   1 
ATOM   2694  N N     . LYS A 1 333 ? 19.389  44.528  71.992  1.00 49.34  ? 331 LYS A N     1 
ATOM   2695  C CA    . LYS A 1 333 ? 17.969  44.386  71.693  1.00 51.72  ? 331 LYS A CA    1 
ATOM   2696  C C     . LYS A 1 333 ? 17.247  45.728  71.766  1.00 55.18  ? 331 LYS A C     1 
ATOM   2697  O O     . LYS A 1 333 ? 17.212  46.380  72.814  1.00 54.98  ? 331 LYS A O     1 
ATOM   2698  C CB    . LYS A 1 333 ? 17.303  43.416  72.670  1.00 47.44  ? 331 LYS A CB    1 
ATOM   2699  C CG    . LYS A 1 333 ? 15.820  43.313  72.450  1.00 48.41  ? 331 LYS A CG    1 
ATOM   2700  C CD    . LYS A 1 333 ? 15.190  42.207  73.265  1.00 49.64  ? 331 LYS A CD    1 
ATOM   2701  C CE    . LYS A 1 333 ? 13.720  42.078  72.909  1.00 44.10  ? 331 LYS A CE    1 
ATOM   2702  N NZ    . LYS A 1 333 ? 12.910  42.129  74.134  1.00 41.64  ? 331 LYS A NZ    1 
ATOM   2703  N N     . GLN A 1 334 ? 16.666  46.139  70.649  1.00 55.34  ? 332 GLN A N     1 
ATOM   2704  C CA    . GLN A 1 334 ? 15.918  47.379  70.619  1.00 55.77  ? 332 GLN A CA    1 
ATOM   2705  C C     . GLN A 1 334 ? 14.416  47.224  70.737  1.00 61.55  ? 332 GLN A C     1 
ATOM   2706  O O     . GLN A 1 334 ? 13.686  48.201  70.641  1.00 65.16  ? 332 GLN A O     1 
ATOM   2707  C CB    . GLN A 1 334 ? 16.280  48.173  69.392  1.00 57.33  ? 332 GLN A CB    1 
ATOM   2708  C CG    . GLN A 1 334 ? 17.592  48.862  69.576  1.00 57.96  ? 332 GLN A CG    1 
ATOM   2709  C CD    . GLN A 1 334 ? 17.843  49.832  68.471  1.00 67.34  ? 332 GLN A CD    1 
ATOM   2710  O OE1   . GLN A 1 334 ? 17.616  49.513  67.296  1.00 66.73  ? 332 GLN A OE1   1 
ATOM   2711  N NE2   . GLN A 1 334 ? 18.289  51.045  68.826  1.00 67.57  ? 332 GLN A NE2   1 
ATOM   2712  N N     . GLY A 1 335 ? 13.954  45.991  70.913  1.00 63.61  ? 333 GLY A N     1 
ATOM   2713  C CA    . GLY A 1 335 ? 12.544  45.734  71.129  1.00 64.70  ? 333 GLY A CA    1 
ATOM   2714  C C     . GLY A 1 335 ? 11.730  45.776  69.853  1.00 68.15  ? 333 GLY A C     1 
ATOM   2715  O O     . GLY A 1 335 ? 12.152  46.373  68.858  1.00 60.21  ? 333 GLY A O     1 
ATOM   2716  N N     . GLN A 1 336 ? 10.553  45.149  69.900  1.00 74.31  ? 334 GLN A N     1 
ATOM   2717  C CA    . GLN A 1 336 ? 9.691   45.021  68.734  1.00 74.09  ? 334 GLN A CA    1 
ATOM   2718  C C     . GLN A 1 336 ? 10.426  44.252  67.651  1.00 71.07  ? 334 GLN A C     1 
ATOM   2719  O O     . GLN A 1 336 ? 10.356  44.606  66.476  1.00 70.52  ? 334 GLN A O     1 
ATOM   2720  C CB    . GLN A 1 336 ? 9.294   46.404  68.215  1.00 80.05  ? 334 GLN A CB    1 
ATOM   2721  C CG    . GLN A 1 336 ? 8.493   47.224  69.208  1.00 84.28  ? 334 GLN A CG    1 
ATOM   2722  C CD    . GLN A 1 336 ? 7.151   46.587  69.481  1.00 101.62 ? 334 GLN A CD    1 
ATOM   2723  O OE1   . GLN A 1 336 ? 6.272   46.553  68.609  1.00 108.10 ? 334 GLN A OE1   1 
ATOM   2724  N NE2   . GLN A 1 336 ? 6.990   46.048  70.686  1.00 105.82 ? 334 GLN A NE2   1 
ATOM   2725  N N     . GLY A 1 337 ? 11.149  43.211  68.054  1.00 63.68  ? 335 GLY A N     1 
ATOM   2726  C CA    . GLY A 1 337 ? 11.952  42.431  67.129  1.00 62.30  ? 335 GLY A CA    1 
ATOM   2727  C C     . GLY A 1 337 ? 12.948  43.235  66.300  1.00 63.35  ? 335 GLY A C     1 
ATOM   2728  O O     . GLY A 1 337 ? 13.205  42.932  65.130  1.00 60.41  ? 335 GLY A O     1 
ATOM   2729  N N     . GLN A 1 338 ? 13.516  44.271  66.907  1.00 65.40  ? 336 GLN A N     1 
ATOM   2730  C CA    . GLN A 1 338 ? 14.546  45.056  66.249  1.00 59.14  ? 336 GLN A CA    1 
ATOM   2731  C C     . GLN A 1 338 ? 15.860  44.861  66.983  1.00 55.18  ? 336 GLN A C     1 
ATOM   2732  O O     . GLN A 1 338 ? 15.889  44.672  68.202  1.00 53.55  ? 336 GLN A O     1 
ATOM   2733  C CB    . GLN A 1 338 ? 14.156  46.527  66.215  1.00 63.45  ? 336 GLN A CB    1 
ATOM   2734  C CG    . GLN A 1 338 ? 12.693  46.756  65.891  1.00 68.97  ? 336 GLN A CG    1 
ATOM   2735  C CD    . GLN A 1 338 ? 12.359  48.221  65.748  1.00 71.84  ? 336 GLN A CD    1 
ATOM   2736  O OE1   . GLN A 1 338 ? 12.759  48.858  64.774  1.00 74.12  ? 336 GLN A OE1   1 
ATOM   2737  N NE2   . GLN A 1 338 ? 11.630  48.768  66.716  1.00 67.91  ? 336 GLN A NE2   1 
ATOM   2738  N N     . TRP A 1 339 ? 16.950  44.904  66.229  1.00 53.26  ? 337 TRP A N     1 
ATOM   2739  C CA    . TRP A 1 339 ? 18.258  44.582  66.767  1.00 51.50  ? 337 TRP A CA    1 
ATOM   2740  C C     . TRP A 1 339 ? 19.290  45.553  66.214  1.00 51.73  ? 337 TRP A C     1 
ATOM   2741  O O     . TRP A 1 339 ? 19.161  45.990  65.074  1.00 51.37  ? 337 TRP A O     1 
ATOM   2742  C CB    . TRP A 1 339 ? 18.607  43.142  66.387  1.00 47.37  ? 337 TRP A CB    1 
ATOM   2743  C CG    . TRP A 1 339 ? 17.604  42.168  66.918  1.00 46.69  ? 337 TRP A CG    1 
ATOM   2744  C CD1   . TRP A 1 339 ? 16.423  41.787  66.334  1.00 46.92  ? 337 TRP A CD1   1 
ATOM   2745  C CD2   . TRP A 1 339 ? 17.683  41.467  68.159  1.00 44.11  ? 337 TRP A CD2   1 
ATOM   2746  N NE1   . TRP A 1 339 ? 15.767  40.888  67.141  1.00 45.68  ? 337 TRP A NE1   1 
ATOM   2747  C CE2   . TRP A 1 339 ? 16.523  40.678  68.268  1.00 45.46  ? 337 TRP A CE2   1 
ATOM   2748  C CE3   . TRP A 1 339 ? 18.619  41.433  69.191  1.00 41.16  ? 337 TRP A CE3   1 
ATOM   2749  C CZ2   . TRP A 1 339 ? 16.278  39.877  69.379  1.00 41.12  ? 337 TRP A CZ2   1 
ATOM   2750  C CZ3   . TRP A 1 339 ? 18.376  40.631  70.275  1.00 41.54  ? 337 TRP A CZ3   1 
ATOM   2751  C CH2   . TRP A 1 339 ? 17.218  39.868  70.368  1.00 40.13  ? 337 TRP A CH2   1 
ATOM   2752  N N     . THR A 1 340 ? 20.294  45.921  67.013  1.00 48.81  ? 338 THR A N     1 
ATOM   2753  C CA    . THR A 1 340 ? 21.404  46.703  66.454  1.00 45.63  ? 338 THR A CA    1 
ATOM   2754  C C     . THR A 1 340 ? 22.727  46.131  66.862  1.00 45.65  ? 338 THR A C     1 
ATOM   2755  O O     . THR A 1 340 ? 22.854  45.499  67.898  1.00 44.88  ? 338 THR A O     1 
ATOM   2756  C CB    . THR A 1 340 ? 21.404  48.197  66.849  1.00 48.61  ? 338 THR A CB    1 
ATOM   2757  O OG1   . THR A 1 340 ? 21.266  48.325  68.272  1.00 48.02  ? 338 THR A OG1   1 
ATOM   2758  C CG2   . THR A 1 340 ? 20.300  48.949  66.134  1.00 49.79  ? 338 THR A CG2   1 
ATOM   2759  N N     . TYR A 1 341 ? 23.726  46.373  66.036  1.00 44.33  ? 339 TYR A N     1 
ATOM   2760  C CA    . TYR A 1 341 ? 25.034  45.837  66.307  1.00 44.20  ? 339 TYR A CA    1 
ATOM   2761  C C     . TYR A 1 341 ? 26.125  46.838  65.947  1.00 45.52  ? 339 TYR A C     1 
ATOM   2762  O O     . TYR A 1 341 ? 25.966  47.679  65.054  1.00 41.73  ? 339 TYR A O     1 
ATOM   2763  C CB    . TYR A 1 341 ? 25.236  44.491  65.578  1.00 42.36  ? 339 TYR A CB    1 
ATOM   2764  C CG    . TYR A 1 341 ? 25.146  44.551  64.057  1.00 42.50  ? 339 TYR A CG    1 
ATOM   2765  C CD1   . TYR A 1 341 ? 26.292  44.549  63.269  1.00 43.58  ? 339 TYR A CD1   1 
ATOM   2766  C CD2   . TYR A 1 341 ? 23.916  44.604  63.415  1.00 42.26  ? 339 TYR A CD2   1 
ATOM   2767  C CE1   . TYR A 1 341 ? 26.213  44.600  61.880  1.00 45.16  ? 339 TYR A CE1   1 
ATOM   2768  C CE2   . TYR A 1 341 ? 23.822  44.648  62.036  1.00 44.42  ? 339 TYR A CE2   1 
ATOM   2769  C CZ    . TYR A 1 341 ? 24.972  44.648  61.266  1.00 47.93  ? 339 TYR A CZ    1 
ATOM   2770  O OH    . TYR A 1 341 ? 24.873  44.701  59.883  1.00 46.89  ? 339 TYR A OH    1 
ATOM   2771  N N     . GLN A 1 342 ? 27.232  46.733  66.679  1.00 48.22  ? 340 GLN A N     1 
ATOM   2772  C CA    . GLN A 1 342 ? 28.441  47.475  66.367  1.00 45.41  ? 340 GLN A CA    1 
ATOM   2773  C C     . GLN A 1 342 ? 29.562  46.467  66.273  1.00 45.53  ? 340 GLN A C     1 
ATOM   2774  O O     . GLN A 1 342 ? 29.628  45.518  67.057  1.00 43.37  ? 340 GLN A O     1 
ATOM   2775  C CB    . GLN A 1 342 ? 28.755  48.524  67.433  1.00 43.38  ? 340 GLN A CB    1 
ATOM   2776  C CG    . GLN A 1 342 ? 27.665  49.566  67.638  1.00 45.05  ? 340 GLN A CG    1 
ATOM   2777  C CD    . GLN A 1 342 ? 26.585  49.080  68.596  1.00 52.32  ? 340 GLN A CD    1 
ATOM   2778  O OE1   . GLN A 1 342 ? 26.889  48.417  69.599  1.00 52.31  ? 340 GLN A OE1   1 
ATOM   2779  N NE2   . GLN A 1 342 ? 25.313  49.372  68.276  1.00 50.38  ? 340 GLN A NE2   1 
ATOM   2780  N N     . ILE A 1 343 ? 30.405  46.662  65.263  1.00 47.76  ? 341 ILE A N     1 
ATOM   2781  C CA    . ILE A 1 343 ? 31.583  45.845  65.029  1.00 45.73  ? 341 ILE A CA    1 
ATOM   2782  C C     . ILE A 1 343 ? 32.771  46.785  65.086  1.00 51.19  ? 341 ILE A C     1 
ATOM   2783  O O     . ILE A 1 343 ? 32.882  47.748  64.286  1.00 54.34  ? 341 ILE A O     1 
ATOM   2784  C CB    . ILE A 1 343 ? 31.518  45.129  63.667  1.00 44.02  ? 341 ILE A CB    1 
ATOM   2785  C CG1   . ILE A 1 343 ? 30.224  44.329  63.571  1.00 42.50  ? 341 ILE A CG1   1 
ATOM   2786  C CG2   . ILE A 1 343 ? 32.707  44.197  63.500  1.00 44.38  ? 341 ILE A CG2   1 
ATOM   2787  C CD1   . ILE A 1 343 ? 29.812  43.978  62.190  1.00 41.80  ? 341 ILE A CD1   1 
ATOM   2788  N N     . TYR A 1 344 ? 33.626  46.511  66.068  1.00 50.98  ? 342 TYR A N     1 
ATOM   2789  C CA    . TYR A 1 344 ? 34.763  47.350  66.415  1.00 55.90  ? 342 TYR A CA    1 
ATOM   2790  C C     . TYR A 1 344 ? 35.965  46.487  66.786  1.00 56.31  ? 342 TYR A C     1 
ATOM   2791  O O     . TYR A 1 344 ? 35.861  45.261  66.887  1.00 53.43  ? 342 TYR A O     1 
ATOM   2792  C CB    . TYR A 1 344 ? 34.408  48.242  67.614  1.00 59.14  ? 342 TYR A CB    1 
ATOM   2793  C CG    . TYR A 1 344 ? 34.008  47.488  68.891  1.00 55.21  ? 342 TYR A CG    1 
ATOM   2794  C CD1   . TYR A 1 344 ? 34.911  46.673  69.566  1.00 52.00  ? 342 TYR A CD1   1 
ATOM   2795  C CD2   . TYR A 1 344 ? 32.735  47.616  69.423  1.00 51.48  ? 342 TYR A CD2   1 
ATOM   2796  C CE1   . TYR A 1 344 ? 34.551  46.000  70.720  1.00 48.93  ? 342 TYR A CE1   1 
ATOM   2797  C CE2   . TYR A 1 344 ? 32.369  46.944  70.576  1.00 51.87  ? 342 TYR A CE2   1 
ATOM   2798  C CZ    . TYR A 1 344 ? 33.278  46.134  71.220  1.00 51.08  ? 342 TYR A CZ    1 
ATOM   2799  O OH    . TYR A 1 344 ? 32.896  45.468  72.369  1.00 51.40  ? 342 TYR A OH    1 
ATOM   2800  N N     . GLN A 1 345 ? 37.094  47.147  67.028  1.00 61.46  ? 343 GLN A N     1 
ATOM   2801  C CA    . GLN A 1 345 ? 38.331  46.482  67.449  1.00 66.17  ? 343 GLN A CA    1 
ATOM   2802  C C     . GLN A 1 345 ? 38.884  47.134  68.703  1.00 68.15  ? 343 GLN A C     1 
ATOM   2803  O O     . GLN A 1 345 ? 39.103  46.484  69.728  1.00 60.66  ? 343 GLN A O     1 
ATOM   2804  C CB    . GLN A 1 345 ? 39.361  46.532  66.336  1.00 63.45  ? 343 GLN A CB    1 
ATOM   2805  C CG    . GLN A 1 345 ? 39.014  45.647  65.181  1.00 58.11  ? 343 GLN A CG    1 
ATOM   2806  C CD    . GLN A 1 345 ? 40.046  45.710  64.104  1.00 60.65  ? 343 GLN A CD    1 
ATOM   2807  O OE1   . GLN A 1 345 ? 40.226  46.756  63.457  1.00 56.96  ? 343 GLN A OE1   1 
ATOM   2808  N NE2   . GLN A 1 345 ? 40.750  44.594  63.899  1.00 57.24  ? 343 GLN A NE2   1 
ATOM   2809  N N     . GLU A 1 346 ? 39.172  48.422  68.568  1.00 77.25  ? 344 GLU A N     1 
ATOM   2810  C CA    . GLU A 1 346 ? 39.439  49.286  69.703  1.00 85.83  ? 344 GLU A CA    1 
ATOM   2811  C C     . GLU A 1 346 ? 38.099  49.831  70.148  1.00 82.18  ? 344 GLU A C     1 
ATOM   2812  O O     . GLU A 1 346 ? 37.323  50.300  69.319  1.00 78.37  ? 344 GLU A O     1 
ATOM   2813  C CB    . GLU A 1 346 ? 40.356  50.451  69.304  1.00 92.45  ? 344 GLU A CB    1 
ATOM   2814  C CG    . GLU A 1 346 ? 41.702  50.044  68.684  1.00 95.15  ? 344 GLU A CG    1 
ATOM   2815  C CD    . GLU A 1 346 ? 42.698  49.480  69.700  1.00 99.58  ? 344 GLU A CD    1 
ATOM   2816  O OE1   . GLU A 1 346 ? 42.295  48.649  70.554  1.00 93.88  ? 344 GLU A OE1   1 
ATOM   2817  O OE2   . GLU A 1 346 ? 43.889  49.875  69.637  1.00 104.24 ? 344 GLU A OE2   1 
ATOM   2818  N N     . PRO A 1 347 ? 37.830  49.774  71.462  1.00 87.13  ? 345 PRO A N     1 
ATOM   2819  C CA    . PRO A 1 347 ? 36.569  50.202  72.077  1.00 87.05  ? 345 PRO A CA    1 
ATOM   2820  C C     . PRO A 1 347 ? 36.142  51.599  71.656  1.00 89.15  ? 345 PRO A C     1 
ATOM   2821  O O     . PRO A 1 347 ? 36.946  52.527  71.669  1.00 89.12  ? 345 PRO A O     1 
ATOM   2822  C CB    . PRO A 1 347 ? 36.903  50.203  73.566  1.00 90.69  ? 345 PRO A CB    1 
ATOM   2823  C CG    . PRO A 1 347 ? 37.945  49.154  73.705  1.00 90.10  ? 345 PRO A CG    1 
ATOM   2824  C CD    . PRO A 1 347 ? 38.775  49.241  72.459  1.00 88.02  ? 345 PRO A CD    1 
ATOM   2825  N N     . PHE A 1 348 ? 34.877  51.731  71.279  1.00 88.61  ? 346 PHE A N     1 
ATOM   2826  C CA    . PHE A 1 348 ? 34.278  53.032  70.998  1.00 93.40  ? 346 PHE A CA    1 
ATOM   2827  C C     . PHE A 1 348 ? 34.718  53.649  69.670  1.00 89.95  ? 346 PHE A C     1 
ATOM   2828  O O     . PHE A 1 348 ? 34.237  54.719  69.272  1.00 89.80  ? 346 PHE A O     1 
ATOM   2829  C CB    . PHE A 1 348 ? 34.481  53.982  72.180  1.00 99.60  ? 346 PHE A CB    1 
ATOM   2830  C CG    . PHE A 1 348 ? 33.878  53.470  73.461  1.00 105.43 ? 346 PHE A CG    1 
ATOM   2831  C CD1   . PHE A 1 348 ? 32.539  53.704  73.758  1.00 107.53 ? 346 PHE A CD1   1 
ATOM   2832  C CD2   . PHE A 1 348 ? 34.641  52.726  74.355  1.00 106.68 ? 346 PHE A CD2   1 
ATOM   2833  C CE1   . PHE A 1 348 ? 31.973  53.219  74.932  1.00 110.67 ? 346 PHE A CE1   1 
ATOM   2834  C CE2   . PHE A 1 348 ? 34.084  52.238  75.534  1.00 109.19 ? 346 PHE A CE2   1 
ATOM   2835  C CZ    . PHE A 1 348 ? 32.747  52.485  75.822  1.00 112.99 ? 346 PHE A CZ    1 
ATOM   2836  N N     . LYS A 1 349 ? 35.634  52.970  68.990  1.00 85.23  ? 347 LYS A N     1 
ATOM   2837  C CA    . LYS A 1 349 ? 35.932  53.296  67.604  1.00 81.64  ? 347 LYS A CA    1 
ATOM   2838  C C     . LYS A 1 349 ? 35.349  52.182  66.752  1.00 70.68  ? 347 LYS A C     1 
ATOM   2839  O O     . LYS A 1 349 ? 35.854  51.058  66.753  1.00 68.64  ? 347 LYS A O     1 
ATOM   2840  C CB    . LYS A 1 349 ? 37.443  53.386  67.374  1.00 89.68  ? 347 LYS A CB    1 
ATOM   2841  C CG    . LYS A 1 349 ? 38.241  54.053  68.492  1.00 90.78  ? 347 LYS A CG    1 
ATOM   2842  C CD    . LYS A 1 349 ? 39.727  53.912  68.223  1.00 91.33  ? 347 LYS A CD    1 
ATOM   2843  C CE    . LYS A 1 349 ? 40.549  54.449  69.370  1.00 100.99 ? 347 LYS A CE    1 
ATOM   2844  N NZ    . LYS A 1 349 ? 41.996  54.183  69.154  1.00 104.81 ? 347 LYS A NZ    1 
ATOM   2845  N N     . ASN A 1 350 ? 34.281  52.491  66.026  1.00 66.83  ? 348 ASN A N     1 
ATOM   2846  C CA    . ASN A 1 350 ? 33.576  51.465  65.261  1.00 62.34  ? 348 ASN A CA    1 
ATOM   2847  C C     . ASN A 1 350 ? 34.142  51.318  63.854  1.00 60.90  ? 348 ASN A C     1 
ATOM   2848  O O     . ASN A 1 350 ? 34.501  52.309  63.217  1.00 63.33  ? 348 ASN A O     1 
ATOM   2849  C CB    . ASN A 1 350 ? 32.074  51.770  65.165  1.00 55.12  ? 348 ASN A CB    1 
ATOM   2850  C CG    . ASN A 1 350 ? 31.330  51.539  66.467  1.00 53.20  ? 348 ASN A CG    1 
ATOM   2851  O OD1   . ASN A 1 350 ? 31.725  50.708  67.307  1.00 51.81  ? 348 ASN A OD1   1 
ATOM   2852  N ND2   . ASN A 1 350 ? 30.219  52.265  66.634  1.00 44.69  ? 348 ASN A ND2   1 
ATOM   2853  N N     . LEU A 1 351 ? 34.248  50.077  63.389  1.00 57.93  ? 349 LEU A N     1 
ATOM   2854  C CA    . LEU A 1 351 ? 34.458  49.802  61.976  1.00 52.56  ? 349 LEU A CA    1 
ATOM   2855  C C     . LEU A 1 351 ? 33.141  50.030  61.268  1.00 51.45  ? 349 LEU A C     1 
ATOM   2856  O O     . LEU A 1 351 ? 33.071  50.750  60.277  1.00 49.96  ? 349 LEU A O     1 
ATOM   2857  C CB    . LEU A 1 351 ? 34.893  48.360  61.788  1.00 49.33  ? 349 LEU A CB    1 
ATOM   2858  C CG    . LEU A 1 351 ? 36.296  48.086  62.291  1.00 49.98  ? 349 LEU A CG    1 
ATOM   2859  C CD1   . LEU A 1 351 ? 36.516  46.633  62.597  1.00 48.72  ? 349 LEU A CD1   1 
ATOM   2860  C CD2   . LEU A 1 351 ? 37.233  48.551  61.228  1.00 54.18  ? 349 LEU A CD2   1 
ATOM   2861  N N     . LYS A 1 352 ? 32.088  49.393  61.773  1.00 49.50  ? 350 LYS A N     1 
ATOM   2862  C CA    . LYS A 1 352 ? 30.753  49.681  61.241  1.00 48.22  ? 350 LYS A CA    1 
ATOM   2863  C C     . LYS A 1 352 ? 29.645  49.314  62.194  1.00 47.66  ? 350 LYS A C     1 
ATOM   2864  O O     . LYS A 1 352 ? 29.855  48.651  63.222  1.00 43.87  ? 350 LYS A O     1 
ATOM   2865  C CB    . LYS A 1 352 ? 30.481  49.111  59.823  1.00 46.62  ? 350 LYS A CB    1 
ATOM   2866  C CG    . LYS A 1 352 ? 30.533  47.561  59.662  1.00 46.15  ? 350 LYS A CG    1 
ATOM   2867  C CD    . LYS A 1 352 ? 29.864  47.089  58.369  1.00 39.74  ? 350 LYS A CD    1 
ATOM   2868  C CE    . LYS A 1 352 ? 28.353  47.181  58.506  1.00 46.58  ? 350 LYS A CE    1 
ATOM   2869  N NZ    . LYS A 1 352 ? 27.544  47.173  57.243  1.00 46.72  ? 350 LYS A NZ    1 
ATOM   2870  N N     . THR A 1 353 ? 28.462  49.800  61.854  1.00 44.35  ? 351 THR A N     1 
ATOM   2871  C CA    . THR A 1 353 ? 27.271  49.428  62.584  1.00 48.71  ? 351 THR A CA    1 
ATOM   2872  C C     . THR A 1 353 ? 26.215  48.748  61.693  1.00 47.76  ? 351 THR A C     1 
ATOM   2873  O O     . THR A 1 353 ? 26.416  48.553  60.498  1.00 46.55  ? 351 THR A O     1 
ATOM   2874  C CB    . THR A 1 353 ? 26.656  50.650  63.222  1.00 48.44  ? 351 THR A CB    1 
ATOM   2875  O OG1   . THR A 1 353 ? 26.372  51.599  62.196  1.00 49.95  ? 351 THR A OG1   1 
ATOM   2876  C CG2   . THR A 1 353 ? 27.611  51.241  64.234  1.00 47.90  ? 351 THR A CG2   1 
ATOM   2877  N N     . GLY A 1 354 ? 25.092  48.368  62.282  1.00 41.71  ? 352 GLY A N     1 
ATOM   2878  C CA    . GLY A 1 354 ? 24.006  47.894  61.465  1.00 43.99  ? 352 GLY A CA    1 
ATOM   2879  C C     . GLY A 1 354 ? 22.778  47.580  62.272  1.00 49.49  ? 352 GLY A C     1 
ATOM   2880  O O     . GLY A 1 354 ? 22.838  47.520  63.505  1.00 50.52  ? 352 GLY A O     1 
ATOM   2881  N N     . LYS A 1 355 ? 21.665  47.385  61.565  1.00 50.28  ? 353 LYS A N     1 
ATOM   2882  C CA    . LYS A 1 355 ? 20.425  46.892  62.156  1.00 48.59  ? 353 LYS A CA    1 
ATOM   2883  C C     . LYS A 1 355 ? 20.103  45.460  61.660  1.00 53.31  ? 353 LYS A C     1 
ATOM   2884  O O     . LYS A 1 355 ? 20.546  45.043  60.577  1.00 52.20  ? 353 LYS A O     1 
ATOM   2885  C CB    . LYS A 1 355 ? 19.292  47.856  61.823  1.00 50.55  ? 353 LYS A CB    1 
ATOM   2886  C CG    . LYS A 1 355 ? 19.287  48.292  60.352  1.00 58.84  ? 353 LYS A CG    1 
ATOM   2887  C CD    . LYS A 1 355 ? 18.355  49.465  60.106  1.00 59.96  ? 353 LYS A CD    1 
ATOM   2888  C CE    . LYS A 1 355 ? 16.916  49.104  60.407  1.00 62.03  ? 353 LYS A CE    1 
ATOM   2889  N NZ    . LYS A 1 355 ? 16.355  48.319  59.298  1.00 64.13  ? 353 LYS A NZ    1 
ATOM   2890  N N     . TYR A 1 356 ? 19.394  44.687  62.482  1.00 53.82  ? 354 TYR A N     1 
ATOM   2891  C CA    . TYR A 1 356 ? 18.665  43.518  61.984  1.00 52.74  ? 354 TYR A CA    1 
ATOM   2892  C C     . TYR A 1 356 ? 17.218  43.654  62.466  1.00 51.95  ? 354 TYR A C     1 
ATOM   2893  O O     . TYR A 1 356 ? 16.947  43.593  63.653  1.00 53.84  ? 354 TYR A O     1 
ATOM   2894  C CB    . TYR A 1 356 ? 19.304  42.202  62.458  1.00 44.87  ? 354 TYR A CB    1 
ATOM   2895  C CG    . TYR A 1 356 ? 18.528  40.982  62.021  1.00 51.00  ? 354 TYR A CG    1 
ATOM   2896  C CD1   . TYR A 1 356 ? 18.585  40.526  60.703  1.00 52.76  ? 354 TYR A CD1   1 
ATOM   2897  C CD2   . TYR A 1 356 ? 17.708  40.290  62.915  1.00 48.53  ? 354 TYR A CD2   1 
ATOM   2898  C CE1   . TYR A 1 356 ? 17.848  39.412  60.293  1.00 50.15  ? 354 TYR A CE1   1 
ATOM   2899  C CE2   . TYR A 1 356 ? 16.978  39.175  62.509  1.00 45.81  ? 354 TYR A CE2   1 
ATOM   2900  C CZ    . TYR A 1 356 ? 17.054  38.745  61.202  1.00 46.19  ? 354 TYR A CZ    1 
ATOM   2901  O OH    . TYR A 1 356 ? 16.328  37.653  60.808  1.00 48.67  ? 354 TYR A OH    1 
ATOM   2902  N N     . ALA A 1 357 ? 16.301  43.943  61.557  1.00 54.88  ? 355 ALA A N     1 
ATOM   2903  C CA    . ALA A 1 357 ? 14.901  44.103  61.945  1.00 57.02  ? 355 ALA A CA    1 
ATOM   2904  C C     . ALA A 1 357 ? 13.942  43.000  61.523  1.00 59.43  ? 355 ALA A C     1 
ATOM   2905  O O     . ALA A 1 357 ? 12.786  43.030  61.914  1.00 61.47  ? 355 ALA A O     1 
ATOM   2906  C CB    . ALA A 1 357 ? 14.369  45.470  61.503  1.00 59.30  ? 355 ALA A CB    1 
ATOM   2907  N N     . ARG A 1 358 ? 14.415  42.028  60.747  1.00 61.97  ? 356 ARG A N     1 
ATOM   2908  C CA    . ARG A 1 358 ? 13.508  41.168  59.973  1.00 64.19  ? 356 ARG A CA    1 
ATOM   2909  C C     . ARG A 1 358 ? 12.725  40.130  60.777  1.00 63.87  ? 356 ARG A C     1 
ATOM   2910  O O     . ARG A 1 358 ? 13.297  39.251  61.422  1.00 63.10  ? 356 ARG A O     1 
ATOM   2911  C CB    . ARG A 1 358 ? 14.278  40.457  58.865  1.00 65.90  ? 356 ARG A CB    1 
ATOM   2912  C CG    . ARG A 1 358 ? 13.434  39.463  58.110  1.00 73.36  ? 356 ARG A CG    1 
ATOM   2913  C CD    . ARG A 1 358 ? 14.233  38.769  57.019  1.00 82.25  ? 356 ARG A CD    1 
ATOM   2914  N NE    . ARG A 1 358 ? 13.740  37.409  56.783  1.00 92.82  ? 356 ARG A NE    1 
ATOM   2915  C CZ    . ARG A 1 358 ? 14.241  36.571  55.877  1.00 92.44  ? 356 ARG A CZ    1 
ATOM   2916  N NH1   . ARG A 1 358 ? 15.251  36.957  55.107  1.00 96.51  ? 356 ARG A NH1   1 
ATOM   2917  N NH2   . ARG A 1 358 ? 13.732  35.348  55.739  1.00 86.75  ? 356 ARG A NH2   1 
ATOM   2918  N N     . MET A 1 359 ? 11.405  40.204  60.710  1.00 61.99  ? 357 MET A N     1 
ATOM   2919  C CA    . MET A 1 359 ? 10.613  39.279  61.508  1.00 73.23  ? 357 MET A CA    1 
ATOM   2920  C C     . MET A 1 359 ? 10.264  38.046  60.655  1.00 73.40  ? 357 MET A C     1 
ATOM   2921  O O     . MET A 1 359 ? 9.559   38.123  59.643  1.00 75.15  ? 357 MET A O     1 
ATOM   2922  C CB    . MET A 1 359 ? 9.390   39.976  62.149  1.00 77.99  ? 357 MET A CB    1 
ATOM   2923  C CG    . MET A 1 359 ? 8.831   39.307  63.441  1.00 73.41  ? 357 MET A CG    1 
ATOM   2924  S SD    . MET A 1 359 ? 7.610   38.003  63.059  1.00 84.71  ? 357 MET A SD    1 
ATOM   2925  C CE    . MET A 1 359 ? 6.701   37.826  64.606  1.00 61.15  ? 357 MET A CE    1 
ATOM   2926  N N     . ARG A 1 360 ? 10.798  36.907  61.069  1.00 67.15  ? 358 ARG A N     1 
ATOM   2927  C CA    . ARG A 1 360 ? 10.818  35.733  60.226  1.00 63.14  ? 358 ARG A CA    1 
ATOM   2928  C C     . ARG A 1 360 ? 10.001  34.619  60.853  1.00 64.26  ? 358 ARG A C     1 
ATOM   2929  O O     . ARG A 1 360 ? 10.378  34.085  61.910  1.00 60.01  ? 358 ARG A O     1 
ATOM   2930  C CB    . ARG A 1 360 ? 12.261  35.290  60.056  1.00 63.98  ? 358 ARG A CB    1 
ATOM   2931  C CG    . ARG A 1 360 ? 12.440  34.126  59.161  1.00 67.10  ? 358 ARG A CG    1 
ATOM   2932  C CD    . ARG A 1 360 ? 13.875  34.011  58.772  1.00 65.83  ? 358 ARG A CD    1 
ATOM   2933  N NE    . ARG A 1 360 ? 14.081  32.823  57.964  1.00 68.88  ? 358 ARG A NE    1 
ATOM   2934  C CZ    . ARG A 1 360 ? 15.244  32.505  57.421  1.00 69.80  ? 358 ARG A CZ    1 
ATOM   2935  N NH1   . ARG A 1 360 ? 16.290  33.306  57.607  1.00 73.67  ? 358 ARG A NH1   1 
ATOM   2936  N NH2   . ARG A 1 360 ? 15.366  31.396  56.698  1.00 65.75  ? 358 ARG A NH2   1 
ATOM   2937  N N     . GLY A 1 361 ? 8.887   34.280  60.197  1.00 56.38  ? 359 GLY A N     1 
ATOM   2938  C CA    . GLY A 1 361 ? 7.943   33.298  60.702  1.00 46.85  ? 359 GLY A CA    1 
ATOM   2939  C C     . GLY A 1 361 ? 6.684   33.901  61.300  1.00 47.98  ? 359 GLY A C     1 
ATOM   2940  O O     . GLY A 1 361 ? 6.635   35.075  61.650  1.00 54.06  ? 359 GLY A O     1 
ATOM   2941  N N     . ALA A 1 362 ? 5.648   33.089  61.427  1.00 45.02  ? 360 ALA A N     1 
ATOM   2942  C CA    . ALA A 1 362 ? 4.380   33.577  61.949  1.00 44.71  ? 360 ALA A CA    1 
ATOM   2943  C C     . ALA A 1 362 ? 4.433   33.739  63.448  1.00 41.63  ? 360 ALA A C     1 
ATOM   2944  O O     . ALA A 1 362 ? 3.813   34.625  64.011  1.00 43.41  ? 360 ALA A O     1 
ATOM   2945  C CB    . ALA A 1 362 ? 3.258   32.635  61.576  1.00 47.47  ? 360 ALA A CB    1 
ATOM   2946  N N     . HIS A 1 363 ? 5.144   32.841  64.097  1.00 37.39  ? 361 HIS A N     1 
ATOM   2947  C CA    . HIS A 1 363 ? 5.340   32.942  65.524  1.00 37.73  ? 361 HIS A CA    1 
ATOM   2948  C C     . HIS A 1 363 ? 6.808   32.706  65.777  1.00 39.22  ? 361 HIS A C     1 
ATOM   2949  O O     . HIS A 1 363 ? 7.408   31.797  65.215  1.00 40.89  ? 361 HIS A O     1 
ATOM   2950  C CB    . HIS A 1 363 ? 4.488   31.923  66.279  1.00 37.32  ? 361 HIS A CB    1 
ATOM   2951  C CG    . HIS A 1 363 ? 3.259   31.502  65.535  1.00 39.68  ? 361 HIS A CG    1 
ATOM   2952  N ND1   . HIS A 1 363 ? 2.229   32.374  65.247  1.00 40.21  ? 361 HIS A ND1   1 
ATOM   2953  C CD2   . HIS A 1 363 ? 2.910   30.317  64.996  1.00 34.03  ? 361 HIS A CD2   1 
ATOM   2954  C CE1   . HIS A 1 363 ? 1.303   31.733  64.569  1.00 36.94  ? 361 HIS A CE1   1 
ATOM   2955  N NE2   . HIS A 1 363 ? 1.689   30.484  64.402  1.00 34.28  ? 361 HIS A NE2   1 
ATOM   2956  N N     . THR A 1 364 ? 7.389   33.554  66.613  1.00 39.18  ? 362 THR A N     1 
ATOM   2957  C CA    . THR A 1 364 ? 8.808   33.493  66.878  1.00 37.53  ? 362 THR A CA    1 
ATOM   2958  C C     . THR A 1 364 ? 9.104   33.852  68.316  1.00 37.20  ? 362 THR A C     1 
ATOM   2959  O O     . THR A 1 364 ? 8.187   34.037  69.116  1.00 36.99  ? 362 THR A O     1 
ATOM   2960  C CB    . THR A 1 364 ? 9.567   34.428  65.948  1.00 40.62  ? 362 THR A CB    1 
ATOM   2961  O OG1   . THR A 1 364 ? 10.962  34.097  65.995  1.00 41.93  ? 362 THR A OG1   1 
ATOM   2962  C CG2   . THR A 1 364 ? 9.319   35.886  66.317  1.00 37.75  ? 362 THR A CG2   1 
ATOM   2963  N N     . ASN A 1 365 ? 10.389  33.902  68.647  1.00 35.87  ? 363 ASN A N     1 
ATOM   2964  C CA    . ASN A 1 365 ? 10.840  34.428  69.926  1.00 34.83  ? 363 ASN A CA    1 
ATOM   2965  C C     . ASN A 1 365 ? 12.204  35.111  69.814  1.00 37.91  ? 363 ASN A C     1 
ATOM   2966  O O     . ASN A 1 365 ? 12.826  35.097  68.748  1.00 35.31  ? 363 ASN A O     1 
ATOM   2967  C CB    . ASN A 1 365 ? 10.854  33.332  70.982  1.00 31.38  ? 363 ASN A CB    1 
ATOM   2968  C CG    . ASN A 1 365 ? 11.915  32.318  70.737  1.00 33.52  ? 363 ASN A CG    1 
ATOM   2969  O OD1   . ASN A 1 365 ? 12.968  32.642  70.220  1.00 34.49  ? 363 ASN A OD1   1 
ATOM   2970  N ND2   . ASN A 1 365 ? 11.653  31.079  71.105  1.00 32.96  ? 363 ASN A ND2   1 
ATOM   2971  N N     . ASP A 1 366 ? 12.675  35.691  70.925  1.00 41.02  ? 364 ASP A N     1 
ATOM   2972  C CA    . ASP A 1 366 ? 13.903  36.499  70.922  1.00 35.38  ? 364 ASP A CA    1 
ATOM   2973  C C     . ASP A 1 366 ? 15.141  35.656  70.695  1.00 32.69  ? 364 ASP A C     1 
ATOM   2974  O O     . ASP A 1 366 ? 16.022  36.057  69.950  1.00 33.59  ? 364 ASP A O     1 
ATOM   2975  C CB    . ASP A 1 366 ? 14.036  37.352  72.185  1.00 34.02  ? 364 ASP A CB    1 
ATOM   2976  C CG    . ASP A 1 366 ? 12.994  38.445  72.257  1.00 41.87  ? 364 ASP A CG    1 
ATOM   2977  O OD1   . ASP A 1 366 ? 12.519  38.877  71.177  1.00 44.55  ? 364 ASP A OD1   1 
ATOM   2978  O OD2   . ASP A 1 366 ? 12.640  38.858  73.388  1.00 40.89  ? 364 ASP A OD2   1 
ATOM   2979  N N     . VAL A 1 367 ? 15.212  34.481  71.299  1.00 27.80  ? 365 VAL A N     1 
ATOM   2980  C CA    . VAL A 1 367 ? 16.370  33.640  71.054  1.00 28.98  ? 365 VAL A CA    1 
ATOM   2981  C C     . VAL A 1 367 ? 16.579  33.405  69.555  1.00 31.58  ? 365 VAL A C     1 
ATOM   2982  O O     . VAL A 1 367 ? 17.672  33.667  69.038  1.00 29.45  ? 365 VAL A O     1 
ATOM   2983  C CB    . VAL A 1 367 ? 16.282  32.320  71.801  1.00 31.44  ? 365 VAL A CB    1 
ATOM   2984  C CG1   . VAL A 1 367 ? 17.592  31.565  71.677  1.00 30.26  ? 365 VAL A CG1   1 
ATOM   2985  C CG2   . VAL A 1 367 ? 15.953  32.587  73.242  1.00 29.57  ? 365 VAL A CG2   1 
ATOM   2986  N N     . LYS A 1 368 ? 15.525  32.935  68.871  1.00 32.81  ? 366 LYS A N     1 
ATOM   2987  C CA    . LYS A 1 368 ? 15.517  32.741  67.413  1.00 32.89  ? 366 LYS A CA    1 
ATOM   2988  C C     . LYS A 1 368 ? 15.932  34.006  66.656  1.00 31.45  ? 366 LYS A C     1 
ATOM   2989  O O     . LYS A 1 368 ? 16.857  33.986  65.834  1.00 29.28  ? 366 LYS A O     1 
ATOM   2990  C CB    . LYS A 1 368 ? 14.128  32.321  66.909  1.00 32.79  ? 366 LYS A CB    1 
ATOM   2991  C CG    . LYS A 1 368 ? 13.681  30.928  67.222  1.00 34.63  ? 366 LYS A CG    1 
ATOM   2992  C CD    . LYS A 1 368 ? 12.271  30.659  66.663  1.00 39.61  ? 366 LYS A CD    1 
ATOM   2993  C CE    . LYS A 1 368 ? 11.821  29.192  66.932  1.00 44.35  ? 366 LYS A CE    1 
ATOM   2994  N NZ    . LYS A 1 368 ? 10.652  28.675  66.123  1.00 40.64  ? 366 LYS A NZ    1 
ATOM   2995  N N     . GLN A 1 369 ? 15.233  35.102  66.905  1.00 28.66  ? 367 GLN A N     1 
ATOM   2996  C CA    . GLN A 1 369 ? 15.625  36.344  66.254  1.00 35.41  ? 367 GLN A CA    1 
ATOM   2997  C C     . GLN A 1 369 ? 17.088  36.761  66.537  1.00 35.07  ? 367 GLN A C     1 
ATOM   2998  O O     . GLN A 1 369 ? 17.759  37.276  65.646  1.00 33.54  ? 367 GLN A O     1 
ATOM   2999  C CB    . GLN A 1 369 ? 14.656  37.476  66.574  1.00 37.54  ? 367 GLN A CB    1 
ATOM   3000  C CG    . GLN A 1 369 ? 13.225  37.123  66.328  1.00 39.22  ? 367 GLN A CG    1 
ATOM   3001  C CD    . GLN A 1 369 ? 12.334  38.321  66.335  1.00 44.34  ? 367 GLN A CD    1 
ATOM   3002  O OE1   . GLN A 1 369 ? 12.625  39.329  65.719  1.00 52.04  ? 367 GLN A OE1   1 
ATOM   3003  N NE2   . GLN A 1 369 ? 11.241  38.221  67.037  1.00 49.71  ? 367 GLN A NE2   1 
ATOM   3004  N N     . LEU A 1 370 ? 17.577  36.521  67.756  1.00 30.95  ? 368 LEU A N     1 
ATOM   3005  C CA    . LEU A 1 370 ? 18.980  36.756  68.066  1.00 30.86  ? 368 LEU A CA    1 
ATOM   3006  C C     . LEU A 1 370 ? 19.888  35.831  67.268  1.00 28.40  ? 368 LEU A C     1 
ATOM   3007  O O     . LEU A 1 370 ? 20.819  36.292  66.608  1.00 27.16  ? 368 LEU A O     1 
ATOM   3008  C CB    . LEU A 1 370 ? 19.265  36.647  69.573  1.00 30.91  ? 368 LEU A CB    1 
ATOM   3009  C CG    . LEU A 1 370 ? 20.707  36.966  69.981  1.00 26.64  ? 368 LEU A CG    1 
ATOM   3010  C CD1   . LEU A 1 370 ? 20.986  38.406  69.719  1.00 28.26  ? 368 LEU A CD1   1 
ATOM   3011  C CD2   . LEU A 1 370 ? 20.940  36.614  71.414  1.00 30.15  ? 368 LEU A CD2   1 
ATOM   3012  N N     . THR A 1 371 ? 19.621  34.530  67.327  1.00 27.49  ? 369 THR A N     1 
ATOM   3013  C CA    . THR A 1 371 ? 20.359  33.566  66.494  1.00 28.16  ? 369 THR A CA    1 
ATOM   3014  C C     . THR A 1 371 ? 20.455  33.985  65.016  1.00 30.19  ? 369 THR A C     1 
ATOM   3015  O O     . THR A 1 371 ? 21.501  33.890  64.387  1.00 26.99  ? 369 THR A O     1 
ATOM   3016  C CB    . THR A 1 371 ? 19.698  32.208  66.517  1.00 27.58  ? 369 THR A CB    1 
ATOM   3017  O OG1   . THR A 1 371 ? 19.913  31.585  67.780  1.00 28.44  ? 369 THR A OG1   1 
ATOM   3018  C CG2   . THR A 1 371 ? 20.290  31.339  65.432  1.00 30.81  ? 369 THR A CG2   1 
ATOM   3019  N N     . GLU A 1 372 ? 19.327  34.431  64.472  1.00 31.79  ? 370 GLU A N     1 
ATOM   3020  C CA    . GLU A 1 372 ? 19.284  34.968  63.128  1.00 34.08  ? 370 GLU A CA    1 
ATOM   3021  C C     . GLU A 1 372 ? 20.216  36.191  62.925  1.00 36.66  ? 370 GLU A C     1 
ATOM   3022  O O     . GLU A 1 372 ? 21.036  36.171  62.002  1.00 37.69  ? 370 GLU A O     1 
ATOM   3023  C CB    . GLU A 1 372 ? 17.850  35.324  62.726  1.00 34.81  ? 370 GLU A CB    1 
ATOM   3024  C CG    . GLU A 1 372 ? 16.856  34.216  62.678  1.00 32.82  ? 370 GLU A CG    1 
ATOM   3025  C CD    . GLU A 1 372 ? 15.456  34.771  62.616  1.00 41.48  ? 370 GLU A CD    1 
ATOM   3026  O OE1   . GLU A 1 372 ? 15.322  35.953  62.236  1.00 45.30  ? 370 GLU A OE1   1 
ATOM   3027  O OE2   . GLU A 1 372 ? 14.490  34.059  62.969  1.00 45.44  ? 370 GLU A OE2   1 
ATOM   3028  N N     . ALA A 1 373 ? 20.082  37.248  63.741  1.00 32.67  ? 371 ALA A N     1 
ATOM   3029  C CA    . ALA A 1 373 ? 20.998  38.396  63.664  1.00 32.85  ? 371 ALA A CA    1 
ATOM   3030  C C     . ALA A 1 373 ? 22.465  37.947  63.696  1.00 31.67  ? 371 ALA A C     1 
ATOM   3031  O O     . ALA A 1 373 ? 23.270  38.410  62.909  1.00 30.33  ? 371 ALA A O     1 
ATOM   3032  C CB    . ALA A 1 373 ? 20.724  39.406  64.777  1.00 30.56  ? 371 ALA A CB    1 
ATOM   3033  N N     . VAL A 1 374 ? 22.815  37.038  64.602  1.00 30.09  ? 372 VAL A N     1 
ATOM   3034  C CA    . VAL A 1 374 ? 24.193  36.549  64.674  1.00 31.10  ? 372 VAL A CA    1 
ATOM   3035  C C     . VAL A 1 374 ? 24.644  35.951  63.338  1.00 34.66  ? 372 VAL A C     1 
ATOM   3036  O O     . VAL A 1 374 ? 25.812  36.123  62.938  1.00 33.70  ? 372 VAL A O     1 
ATOM   3037  C CB    . VAL A 1 374 ? 24.404  35.496  65.789  1.00 26.73  ? 372 VAL A CB    1 
ATOM   3038  C CG1   . VAL A 1 374 ? 25.721  34.821  65.618  1.00 28.12  ? 372 VAL A CG1   1 
ATOM   3039  C CG2   . VAL A 1 374 ? 24.321  36.107  67.122  1.00 27.93  ? 372 VAL A CG2   1 
ATOM   3040  N N     . GLN A 1 375 ? 23.727  35.239  62.658  1.00 35.63  ? 373 GLN A N     1 
ATOM   3041  C CA    . GLN A 1 375 ? 24.001  34.666  61.336  1.00 33.33  ? 373 GLN A CA    1 
ATOM   3042  C C     . GLN A 1 375 ? 24.143  35.759  60.298  1.00 32.47  ? 373 GLN A C     1 
ATOM   3043  O O     . GLN A 1 375 ? 25.043  35.702  59.465  1.00 33.09  ? 373 GLN A O     1 
ATOM   3044  C CB    . GLN A 1 375 ? 22.945  33.648  60.909  1.00 35.31  ? 373 GLN A CB    1 
ATOM   3045  C CG    . GLN A 1 375 ? 23.252  32.209  61.359  1.00 40.41  ? 373 GLN A CG    1 
ATOM   3046  C CD    . GLN A 1 375 ? 22.029  31.473  62.011  1.00 47.18  ? 373 GLN A CD    1 
ATOM   3047  O OE1   . GLN A 1 375 ? 22.181  30.789  63.053  1.00 45.20  ? 373 GLN A OE1   1 
ATOM   3048  N NE2   . GLN A 1 375 ? 20.823  31.614  61.396  1.00 37.73  ? 373 GLN A NE2   1 
ATOM   3049  N N     . LYS A 1 376 ? 23.278  36.768  60.352  1.00 31.14  ? 374 LYS A N     1 
ATOM   3050  C CA    . LYS A 1 376 ? 23.427  37.899  59.444  1.00 32.46  ? 374 LYS A CA    1 
ATOM   3051  C C     . LYS A 1 376 ? 24.814  38.470  59.609  1.00 34.39  ? 374 LYS A C     1 
ATOM   3052  O O     . LYS A 1 376 ? 25.554  38.598  58.642  1.00 37.09  ? 374 LYS A O     1 
ATOM   3053  C CB    . LYS A 1 376 ? 22.384  38.980  59.679  1.00 35.92  ? 374 LYS A CB    1 
ATOM   3054  C CG    . LYS A 1 376 ? 22.463  40.122  58.667  1.00 40.51  ? 374 LYS A CG    1 
ATOM   3055  C CD    . LYS A 1 376 ? 21.917  41.446  59.243  1.00 46.87  ? 374 LYS A CD    1 
ATOM   3056  C CE    . LYS A 1 376 ? 21.795  42.544  58.172  1.00 54.04  ? 374 LYS A CE    1 
ATOM   3057  N NZ    . LYS A 1 376 ? 23.077  42.839  57.435  1.00 54.38  ? 374 LYS A NZ    1 
ATOM   3058  N N     . ILE A 1 377 ? 25.177  38.770  60.848  1.00 33.29  ? 375 ILE A N     1 
ATOM   3059  C CA    . ILE A 1 377 ? 26.474  39.374  61.158  1.00 34.13  ? 375 ILE A CA    1 
ATOM   3060  C C     . ILE A 1 377 ? 27.678  38.526  60.743  1.00 32.63  ? 375 ILE A C     1 
ATOM   3061  O O     . ILE A 1 377 ? 28.624  39.061  60.179  1.00 32.20  ? 375 ILE A O     1 
ATOM   3062  C CB    . ILE A 1 377 ? 26.578  39.843  62.658  1.00 34.11  ? 375 ILE A CB    1 
ATOM   3063  C CG1   . ILE A 1 377 ? 25.692  41.070  62.901  1.00 34.55  ? 375 ILE A CG1   1 
ATOM   3064  C CG2   . ILE A 1 377 ? 28.002  40.208  63.000  1.00 33.30  ? 375 ILE A CG2   1 
ATOM   3065  C CD1   . ILE A 1 377 ? 24.820  40.963  64.120  1.00 34.38  ? 375 ILE A CD1   1 
ATOM   3066  N N     . THR A 1 378 ? 27.642  37.222  61.010  1.00 29.90  ? 376 THR A N     1 
ATOM   3067  C CA    . THR A 1 378 ? 28.720  36.335  60.579  1.00 31.08  ? 376 THR A CA    1 
ATOM   3068  C C     . THR A 1 378 ? 28.899  36.378  59.051  1.00 33.03  ? 376 THR A C     1 
ATOM   3069  O O     . THR A 1 378 ? 29.992  36.532  58.519  1.00 32.54  ? 376 THR A O     1 
ATOM   3070  C CB    . THR A 1 378 ? 28.468  34.876  61.026  1.00 32.52  ? 376 THR A CB    1 
ATOM   3071  O OG1   . THR A 1 378 ? 28.291  34.820  62.442  1.00 31.15  ? 376 THR A OG1   1 
ATOM   3072  C CG2   . THR A 1 378 ? 29.620  33.976  60.626  1.00 28.50  ? 376 THR A CG2   1 
ATOM   3073  N N     . THR A 1 379 ? 27.802  36.238  58.336  1.00 34.47  ? 377 THR A N     1 
ATOM   3074  C CA    . THR A 1 379 ? 27.864  36.274  56.894  1.00 34.93  ? 377 THR A CA    1 
ATOM   3075  C C     . THR A 1 379 ? 28.532  37.566  56.414  1.00 35.05  ? 377 THR A C     1 
ATOM   3076  O O     . THR A 1 379 ? 29.528  37.497  55.687  1.00 34.00  ? 377 THR A O     1 
ATOM   3077  C CB    . THR A 1 379 ? 26.465  36.000  56.275  1.00 36.53  ? 377 THR A CB    1 
ATOM   3078  O OG1   . THR A 1 379 ? 26.206  34.597  56.377  1.00 36.97  ? 377 THR A OG1   1 
ATOM   3079  C CG2   . THR A 1 379 ? 26.400  36.395  54.804  1.00 33.59  ? 377 THR A CG2   1 
ATOM   3080  N N     . GLU A 1 380 ? 27.997  38.719  56.837  1.00 34.49  ? 378 GLU A N     1 
ATOM   3081  C CA    . GLU A 1 380 ? 28.575  40.046  56.545  1.00 35.63  ? 378 GLU A CA    1 
ATOM   3082  C C     . GLU A 1 380 ? 30.052  40.127  56.901  1.00 35.86  ? 378 GLU A C     1 
ATOM   3083  O O     . GLU A 1 380 ? 30.880  40.552  56.101  1.00 34.01  ? 378 GLU A O     1 
ATOM   3084  C CB    . GLU A 1 380 ? 27.824  41.127  57.315  1.00 37.07  ? 378 GLU A CB    1 
ATOM   3085  C CG    . GLU A 1 380 ? 28.110  42.568  56.882  1.00 40.50  ? 378 GLU A CG    1 
ATOM   3086  C CD    . GLU A 1 380 ? 27.146  43.571  57.536  1.00 49.49  ? 378 GLU A CD    1 
ATOM   3087  O OE1   . GLU A 1 380 ? 25.969  43.642  57.114  1.00 54.02  ? 378 GLU A OE1   1 
ATOM   3088  O OE2   . GLU A 1 380 ? 27.550  44.283  58.486  1.00 48.35  ? 378 GLU A OE2   1 
ATOM   3089  N N     . SER A 1 381 ? 30.379  39.701  58.113  1.00 35.06  ? 379 SER A N     1 
ATOM   3090  C CA    . SER A 1 381 ? 31.767  39.636  58.537  1.00 34.15  ? 379 SER A CA    1 
ATOM   3091  C C     . SER A 1 381 ? 32.662  38.805  57.661  1.00 35.15  ? 379 SER A C     1 
ATOM   3092  O O     . SER A 1 381 ? 33.827  39.117  57.543  1.00 40.57  ? 379 SER A O     1 
ATOM   3093  C CB    . SER A 1 381 ? 31.894  39.120  59.959  1.00 35.49  ? 379 SER A CB    1 
ATOM   3094  O OG    . SER A 1 381 ? 31.498  40.108  60.882  1.00 42.26  ? 379 SER A OG    1 
ATOM   3095  N N     . ILE A 1 382 ? 32.177  37.721  57.078  1.00 33.52  ? 380 ILE A N     1 
ATOM   3096  C CA    . ILE A 1 382 ? 33.096  36.946  56.254  1.00 35.35  ? 380 ILE A CA    1 
ATOM   3097  C C     . ILE A 1 382 ? 33.371  37.639  54.925  1.00 33.55  ? 380 ILE A C     1 
ATOM   3098  O O     . ILE A 1 382 ? 34.494  37.721  54.461  1.00 30.98  ? 380 ILE A O     1 
ATOM   3099  C CB    . ILE A 1 382 ? 32.658  35.496  56.081  1.00 32.91  ? 380 ILE A CB    1 
ATOM   3100  C CG1   . ILE A 1 382 ? 32.486  34.868  57.461  1.00 32.52  ? 380 ILE A CG1   1 
ATOM   3101  C CG2   . ILE A 1 382 ? 33.697  34.732  55.242  1.00 32.30  ? 380 ILE A CG2   1 
ATOM   3102  C CD1   . ILE A 1 382 ? 32.272  33.379  57.453  1.00 33.29  ? 380 ILE A CD1   1 
ATOM   3103  N N     . VAL A 1 383 ? 32.321  38.168  54.331  1.00 37.28  ? 381 VAL A N     1 
ATOM   3104  C CA    . VAL A 1 383 ? 32.453  38.922  53.109  1.00 37.89  ? 381 VAL A CA    1 
ATOM   3105  C C     . VAL A 1 383 ? 33.504  39.998  53.308  1.00 40.38  ? 381 VAL A C     1 
ATOM   3106  O O     . VAL A 1 383 ? 34.419  40.135  52.509  1.00 41.51  ? 381 VAL A O     1 
ATOM   3107  C CB    . VAL A 1 383 ? 31.116  39.572  52.739  1.00 35.00  ? 381 VAL A CB    1 
ATOM   3108  C CG1   . VAL A 1 383 ? 31.308  40.637  51.684  1.00 31.74  ? 381 VAL A CG1   1 
ATOM   3109  C CG2   . VAL A 1 383 ? 30.185  38.527  52.275  1.00 36.70  ? 381 VAL A CG2   1 
ATOM   3110  N N     . ILE A 1 384 ? 33.338  40.787  54.364  1.00 40.73  ? 382 ILE A N     1 
ATOM   3111  C CA    . ILE A 1 384 ? 34.183  41.949  54.581  1.00 40.46  ? 382 ILE A CA    1 
ATOM   3112  C C     . ILE A 1 384 ? 35.583  41.712  55.142  1.00 38.66  ? 382 ILE A C     1 
ATOM   3113  O O     . ILE A 1 384 ? 36.548  42.147  54.543  1.00 43.85  ? 382 ILE A O     1 
ATOM   3114  C CB    . ILE A 1 384 ? 33.440  42.989  55.408  1.00 41.46  ? 382 ILE A CB    1 
ATOM   3115  C CG1   . ILE A 1 384 ? 32.219  43.484  54.618  1.00 36.97  ? 382 ILE A CG1   1 
ATOM   3116  C CG2   . ILE A 1 384 ? 34.376  44.118  55.775  1.00 44.64  ? 382 ILE A CG2   1 
ATOM   3117  C CD1   . ILE A 1 384 ? 31.366  44.525  55.326  1.00 37.77  ? 382 ILE A CD1   1 
ATOM   3118  N N     . TRP A 1 385 ? 35.702  41.057  56.289  1.00 36.26  ? 383 TRP A N     1 
ATOM   3119  C CA    . TRP A 1 385 ? 37.023  40.838  56.904  1.00 40.35  ? 383 TRP A CA    1 
ATOM   3120  C C     . TRP A 1 385 ? 37.555  39.420  56.685  1.00 38.91  ? 383 TRP A C     1 
ATOM   3121  O O     . TRP A 1 385 ? 38.723  39.119  56.970  1.00 40.68  ? 383 TRP A O     1 
ATOM   3122  C CB    . TRP A 1 385 ? 37.049  41.271  58.410  1.00 40.41  ? 383 TRP A CB    1 
ATOM   3123  C CG    . TRP A 1 385 ? 36.599  42.680  58.581  1.00 39.42  ? 383 TRP A CG    1 
ATOM   3124  C CD1   . TRP A 1 385 ? 37.323  43.789  58.312  1.00 44.76  ? 383 TRP A CD1   1 
ATOM   3125  C CD2   . TRP A 1 385 ? 35.292  43.139  58.969  1.00 42.31  ? 383 TRP A CD2   1 
ATOM   3126  N NE1   . TRP A 1 385 ? 36.571  44.921  58.524  1.00 46.57  ? 383 TRP A NE1   1 
ATOM   3127  C CE2   . TRP A 1 385 ? 35.315  44.550  58.923  1.00 45.88  ? 383 TRP A CE2   1 
ATOM   3128  C CE3   . TRP A 1 385 ? 34.104  42.499  59.344  1.00 40.72  ? 383 TRP A CE3   1 
ATOM   3129  C CZ2   . TRP A 1 385 ? 34.194  45.336  59.241  1.00 44.65  ? 383 TRP A CZ2   1 
ATOM   3130  C CZ3   . TRP A 1 385 ? 32.992  43.275  59.658  1.00 40.33  ? 383 TRP A CZ3   1 
ATOM   3131  C CH2   . TRP A 1 385 ? 33.048  44.681  59.611  1.00 43.04  ? 383 TRP A CH2   1 
ATOM   3132  N N     . GLY A 1 386 ? 36.703  38.569  56.132  1.00 38.34  ? 384 GLY A N     1 
ATOM   3133  C CA    . GLY A 1 386 ? 37.052  37.181  55.865  1.00 38.63  ? 384 GLY A CA    1 
ATOM   3134  C C     . GLY A 1 386 ? 37.290  36.328  57.097  1.00 39.16  ? 384 GLY A C     1 
ATOM   3135  O O     . GLY A 1 386 ? 38.065  35.374  57.049  1.00 38.07  ? 384 GLY A O     1 
ATOM   3136  N N     . LYS A 1 387 ? 36.637  36.682  58.202  1.00 38.09  ? 385 LYS A N     1 
ATOM   3137  C CA    . LYS A 1 387 ? 36.790  35.966  59.471  1.00 40.68  ? 385 LYS A CA    1 
ATOM   3138  C C     . LYS A 1 387 ? 35.532  36.215  60.281  1.00 42.09  ? 385 LYS A C     1 
ATOM   3139  O O     . LYS A 1 387 ? 34.765  37.121  59.950  1.00 42.28  ? 385 LYS A O     1 
ATOM   3140  C CB    . LYS A 1 387 ? 38.028  36.448  60.238  1.00 41.93  ? 385 LYS A CB    1 
ATOM   3141  C CG    . LYS A 1 387 ? 37.972  37.918  60.693  1.00 46.36  ? 385 LYS A CG    1 
ATOM   3142  C CD    . LYS A 1 387 ? 39.281  38.370  61.367  1.00 52.25  ? 385 LYS A CD    1 
ATOM   3143  C CE    . LYS A 1 387 ? 39.532  37.678  62.711  1.00 54.37  ? 385 LYS A CE    1 
ATOM   3144  N NZ    . LYS A 1 387 ? 38.594  38.193  63.783  1.00 58.29  ? 385 LYS A NZ    1 
ATOM   3145  N N     . THR A 1 388 ? 35.298  35.418  61.323  1.00 38.45  ? 386 THR A N     1 
ATOM   3146  C CA    . THR A 1 388 ? 34.105  35.634  62.162  1.00 40.33  ? 386 THR A CA    1 
ATOM   3147  C C     . THR A 1 388 ? 34.407  36.440  63.417  1.00 39.85  ? 386 THR A C     1 
ATOM   3148  O O     . THR A 1 388 ? 35.363  36.136  64.109  1.00 44.79  ? 386 THR A O     1 
ATOM   3149  C CB    . THR A 1 388 ? 33.454  34.313  62.598  1.00 39.64  ? 386 THR A CB    1 
ATOM   3150  O OG1   . THR A 1 388 ? 33.070  33.562  61.440  1.00 40.72  ? 386 THR A OG1   1 
ATOM   3151  C CG2   . THR A 1 388 ? 32.242  34.587  63.456  1.00 33.02  ? 386 THR A CG2   1 
ATOM   3152  N N     . PRO A 1 389 ? 33.588  37.466  63.720  1.00 39.64  ? 387 PRO A N     1 
ATOM   3153  C CA    . PRO A 1 389 ? 33.821  38.247  64.936  1.00 38.67  ? 387 PRO A CA    1 
ATOM   3154  C C     . PRO A 1 389 ? 33.563  37.484  66.237  1.00 41.89  ? 387 PRO A C     1 
ATOM   3155  O O     . PRO A 1 389 ? 32.913  36.443  66.281  1.00 40.32  ? 387 PRO A O     1 
ATOM   3156  C CB    . PRO A 1 389 ? 32.865  39.435  64.792  1.00 36.68  ? 387 PRO A CB    1 
ATOM   3157  C CG    . PRO A 1 389 ? 31.853  39.018  63.883  1.00 37.50  ? 387 PRO A CG    1 
ATOM   3158  C CD    . PRO A 1 389 ? 32.433  37.974  62.963  1.00 39.63  ? 387 PRO A CD    1 
ATOM   3159  N N     . LYS A 1 390 ? 34.140  38.001  67.312  1.00 46.30  ? 388 LYS A N     1 
ATOM   3160  C CA    . LYS A 1 390 ? 33.868  37.470  68.631  1.00 45.19  ? 388 LYS A CA    1 
ATOM   3161  C C     . LYS A 1 390 ? 32.622  38.237  69.115  1.00 44.61  ? 388 LYS A C     1 
ATOM   3162  O O     . LYS A 1 390 ? 32.540  39.484  69.010  1.00 42.52  ? 388 LYS A O     1 
ATOM   3163  C CB    . LYS A 1 390 ? 35.105  37.616  69.522  1.00 43.28  ? 388 LYS A CB    1 
ATOM   3164  C CG    . LYS A 1 390 ? 34.855  37.440  71.004  1.00 53.96  ? 388 LYS A CG    1 
ATOM   3165  C CD    . LYS A 1 390 ? 34.749  35.972  71.458  1.00 52.22  ? 388 LYS A CD    1 
ATOM   3166  C CE    . LYS A 1 390 ? 34.519  35.872  72.994  1.00 47.42  ? 388 LYS A CE    1 
ATOM   3167  N NZ    . LYS A 1 390 ? 35.080  34.632  73.647  1.00 54.29  ? 388 LYS A NZ    1 
ATOM   3168  N N     . PHE A 1 391 ? 31.625  37.483  69.567  1.00 36.10  ? 389 PHE A N     1 
ATOM   3169  C CA    . PHE A 1 391 ? 30.316  38.059  69.772  1.00 39.13  ? 389 PHE A CA    1 
ATOM   3170  C C     . PHE A 1 391 ? 30.067  38.423  71.233  1.00 41.51  ? 389 PHE A C     1 
ATOM   3171  O O     . PHE A 1 391 ? 30.363  37.644  72.136  1.00 39.51  ? 389 PHE A O     1 
ATOM   3172  C CB    . PHE A 1 391 ? 29.211  37.128  69.237  1.00 38.21  ? 389 PHE A CB    1 
ATOM   3173  C CG    . PHE A 1 391 ? 28.917  37.301  67.766  1.00 35.93  ? 389 PHE A CG    1 
ATOM   3174  C CD1   . PHE A 1 391 ? 28.123  38.337  67.318  1.00 37.69  ? 389 PHE A CD1   1 
ATOM   3175  C CD2   . PHE A 1 391 ? 29.422  36.414  66.834  1.00 35.50  ? 389 PHE A CD2   1 
ATOM   3176  C CE1   . PHE A 1 391 ? 27.856  38.487  65.966  1.00 35.40  ? 389 PHE A CE1   1 
ATOM   3177  C CE2   . PHE A 1 391 ? 29.162  36.566  65.502  1.00 33.09  ? 389 PHE A CE2   1 
ATOM   3178  C CZ    . PHE A 1 391 ? 28.382  37.603  65.069  1.00 32.86  ? 389 PHE A CZ    1 
ATOM   3179  N N     . LYS A 1 392 ? 29.530  39.623  71.446  1.00 39.51  ? 390 LYS A N     1 
ATOM   3180  C CA    . LYS A 1 392 ? 29.122  40.060  72.771  1.00 42.44  ? 390 LYS A CA    1 
ATOM   3181  C C     . LYS A 1 392 ? 27.609  40.201  72.766  1.00 41.44  ? 390 LYS A C     1 
ATOM   3182  O O     . LYS A 1 392 ? 27.065  41.087  72.101  1.00 40.81  ? 390 LYS A O     1 
ATOM   3183  C CB    . LYS A 1 392 ? 29.780  41.397  73.119  1.00 46.00  ? 390 LYS A CB    1 
ATOM   3184  C CG    . LYS A 1 392 ? 31.225  41.314  73.608  1.00 47.91  ? 390 LYS A CG    1 
ATOM   3185  C CD    . LYS A 1 392 ? 31.743  42.716  73.899  1.00 55.33  ? 390 LYS A CD    1 
ATOM   3186  C CE    . LYS A 1 392 ? 32.933  42.713  74.854  1.00 61.62  ? 390 LYS A CE    1 
ATOM   3187  N NZ    . LYS A 1 392 ? 34.195  42.209  74.217  1.00 65.57  ? 390 LYS A NZ    1 
ATOM   3188  N N     . LEU A 1 393 ? 26.930  39.334  73.513  1.00 39.00  ? 391 LEU A N     1 
ATOM   3189  C CA    . LEU A 1 393 ? 25.478  39.196  73.356  1.00 37.84  ? 391 LEU A CA    1 
ATOM   3190  C C     . LEU A 1 393 ? 24.667  39.344  74.642  1.00 38.05  ? 391 LEU A C     1 
ATOM   3191  O O     . LEU A 1 393 ? 24.986  38.746  75.655  1.00 41.26  ? 391 LEU A O     1 
ATOM   3192  C CB    . LEU A 1 393 ? 25.166  37.811  72.772  1.00 36.47  ? 391 LEU A CB    1 
ATOM   3193  C CG    . LEU A 1 393 ? 25.900  37.330  71.524  1.00 36.63  ? 391 LEU A CG    1 
ATOM   3194  C CD1   . LEU A 1 393 ? 25.588  35.838  71.329  1.00 37.44  ? 391 LEU A CD1   1 
ATOM   3195  C CD2   . LEU A 1 393 ? 25.534  38.166  70.293  1.00 32.17  ? 391 LEU A CD2   1 
ATOM   3196  N N     . PRO A 1 394 ? 23.544  40.062  74.574  1.00 36.59  ? 392 PRO A N     1 
ATOM   3197  C CA    . PRO A 1 394 ? 22.723  40.255  75.773  1.00 36.05  ? 392 PRO A CA    1 
ATOM   3198  C C     . PRO A 1 394 ? 21.949  39.015  76.228  1.00 33.71  ? 392 PRO A C     1 
ATOM   3199  O O     . PRO A 1 394 ? 20.764  39.117  76.470  1.00 33.53  ? 392 PRO A O     1 
ATOM   3200  C CB    . PRO A 1 394 ? 21.727  41.328  75.332  1.00 35.25  ? 392 PRO A CB    1 
ATOM   3201  C CG    . PRO A 1 394 ? 21.664  41.205  73.848  1.00 38.08  ? 392 PRO A CG    1 
ATOM   3202  C CD    . PRO A 1 394 ? 23.044  40.828  73.420  1.00 37.18  ? 392 PRO A CD    1 
ATOM   3203  N N     . ILE A 1 395 ? 22.602  37.876  76.363  1.00 31.40  ? 393 ILE A N     1 
ATOM   3204  C CA    . ILE A 1 395 ? 21.884  36.662  76.738  1.00 33.70  ? 393 ILE A CA    1 
ATOM   3205  C C     . ILE A 1 395 ? 22.695  35.800  77.704  1.00 33.97  ? 393 ILE A C     1 
ATOM   3206  O O     . ILE A 1 395 ? 23.849  35.492  77.476  1.00 33.65  ? 393 ILE A O     1 
ATOM   3207  C CB    . ILE A 1 395 ? 21.385  35.854  75.490  1.00 33.56  ? 393 ILE A CB    1 
ATOM   3208  C CG1   . ILE A 1 395 ? 20.591  34.624  75.911  1.00 31.51  ? 393 ILE A CG1   1 
ATOM   3209  C CG2   . ILE A 1 395 ? 22.543  35.456  74.579  1.00 33.32  ? 393 ILE A CG2   1 
ATOM   3210  C CD1   . ILE A 1 395 ? 20.188  33.713  74.775  1.00 29.57  ? 393 ILE A CD1   1 
ATOM   3211  N N     . GLN A 1 396 ? 22.080  35.446  78.814  1.00 35.71  ? 394 GLN A N     1 
ATOM   3212  C CA    . GLN A 1 396 ? 22.713  34.577  79.782  1.00 39.20  ? 394 GLN A CA    1 
ATOM   3213  C C     . GLN A 1 396 ? 23.131  33.232  79.132  1.00 35.31  ? 394 GLN A C     1 
ATOM   3214  O O     . GLN A 1 396 ? 22.391  32.632  78.370  1.00 33.28  ? 394 GLN A O     1 
ATOM   3215  C CB    . GLN A 1 396 ? 21.725  34.352  80.945  1.00 43.38  ? 394 GLN A CB    1 
ATOM   3216  C CG    . GLN A 1 396 ? 22.291  34.446  82.380  1.00 48.65  ? 394 GLN A CG    1 
ATOM   3217  C CD    . GLN A 1 396 ? 22.903  35.794  82.677  1.00 48.08  ? 394 GLN A CD    1 
ATOM   3218  O OE1   . GLN A 1 396 ? 22.208  36.805  82.726  1.00 48.71  ? 394 GLN A OE1   1 
ATOM   3219  N NE2   . GLN A 1 396 ? 24.218  35.818  82.864  1.00 46.93  ? 394 GLN A NE2   1 
ATOM   3220  N N     . LYS A 1 397 ? 24.328  32.767  79.451  1.00 36.22  ? 395 LYS A N     1 
ATOM   3221  C CA    . LYS A 1 397 ? 24.852  31.518  78.912  1.00 36.13  ? 395 LYS A CA    1 
ATOM   3222  C C     . LYS A 1 397 ? 24.015  30.300  79.287  1.00 37.35  ? 395 LYS A C     1 
ATOM   3223  O O     . LYS A 1 397 ? 24.131  29.254  78.670  1.00 35.70  ? 395 LYS A O     1 
ATOM   3224  C CB    . LYS A 1 397 ? 26.291  31.293  79.382  1.00 31.77  ? 395 LYS A CB    1 
ATOM   3225  C CG    . LYS A 1 397 ? 27.301  32.079  78.616  1.00 30.90  ? 395 LYS A CG    1 
ATOM   3226  C CD    . LYS A 1 397 ? 28.066  31.214  77.657  1.00 32.49  ? 395 LYS A CD    1 
ATOM   3227  C CE    . LYS A 1 397 ? 28.641  32.081  76.546  1.00 35.50  ? 395 LYS A CE    1 
ATOM   3228  N NZ    . LYS A 1 397 ? 29.120  31.245  75.424  1.00 38.13  ? 395 LYS A NZ    1 
ATOM   3229  N N     . GLU A 1 398 ? 23.227  30.426  80.341  1.00 40.07  ? 396 GLU A N     1 
ATOM   3230  C CA    . GLU A 1 398 ? 22.256  29.419  80.724  1.00 39.60  ? 396 GLU A CA    1 
ATOM   3231  C C     . GLU A 1 398 ? 20.946  29.609  79.946  1.00 38.27  ? 396 GLU A C     1 
ATOM   3232  O O     . GLU A 1 398 ? 20.350  28.626  79.531  1.00 38.27  ? 396 GLU A O     1 
ATOM   3233  C CB    . GLU A 1 398 ? 22.036  29.465  82.237  1.00 51.47  ? 396 GLU A CB    1 
ATOM   3234  C CG    . GLU A 1 398 ? 20.904  28.612  82.796  1.00 63.82  ? 396 GLU A CG    1 
ATOM   3235  C CD    . GLU A 1 398 ? 20.313  29.225  84.075  1.00 79.80  ? 396 GLU A CD    1 
ATOM   3236  O OE1   . GLU A 1 398 ? 20.658  30.402  84.364  1.00 77.86  ? 396 GLU A OE1   1 
ATOM   3237  O OE2   . GLU A 1 398 ? 19.517  28.540  84.779  1.00 88.05  ? 396 GLU A OE2   1 
ATOM   3238  N N     . THR A 1 399 ? 20.482  30.850  79.758  1.00 34.80  ? 397 THR A N     1 
ATOM   3239  C CA    . THR A 1 399 ? 19.343  31.071  78.874  1.00 34.29  ? 397 THR A CA    1 
ATOM   3240  C C     . THR A 1 399 ? 19.596  30.295  77.575  1.00 36.40  ? 397 THR A C     1 
ATOM   3241  O O     . THR A 1 399 ? 18.812  29.401  77.201  1.00 31.49  ? 397 THR A O     1 
ATOM   3242  C CB    . THR A 1 399 ? 19.145  32.564  78.498  1.00 33.28  ? 397 THR A CB    1 
ATOM   3243  O OG1   . THR A 1 399 ? 18.780  33.333  79.646  1.00 34.05  ? 397 THR A OG1   1 
ATOM   3244  C CG2   . THR A 1 399 ? 18.068  32.726  77.396  1.00 29.45  ? 397 THR A CG2   1 
ATOM   3245  N N     . TRP A 1 400 ? 20.664  30.684  76.867  1.00 34.13  ? 398 TRP A N     1 
ATOM   3246  C CA    . TRP A 1 400 ? 21.016  30.050  75.612  1.00 30.85  ? 398 TRP A CA    1 
ATOM   3247  C C     . TRP A 1 400 ? 21.143  28.544  75.722  1.00 32.61  ? 398 TRP A C     1 
ATOM   3248  O O     . TRP A 1 400 ? 20.554  27.839  74.937  1.00 33.22  ? 398 TRP A O     1 
ATOM   3249  C CB    . TRP A 1 400 ? 22.276  30.662  74.986  1.00 30.29  ? 398 TRP A CB    1 
ATOM   3250  C CG    . TRP A 1 400 ? 22.783  29.919  73.726  1.00 32.94  ? 398 TRP A CG    1 
ATOM   3251  C CD1   . TRP A 1 400 ? 23.849  29.078  73.651  1.00 30.96  ? 398 TRP A CD1   1 
ATOM   3252  C CD2   . TRP A 1 400 ? 22.220  29.958  72.394  1.00 35.40  ? 398 TRP A CD2   1 
ATOM   3253  N NE1   . TRP A 1 400 ? 23.994  28.596  72.382  1.00 31.53  ? 398 TRP A NE1   1 
ATOM   3254  C CE2   . TRP A 1 400 ? 23.008  29.110  71.587  1.00 33.70  ? 398 TRP A CE2   1 
ATOM   3255  C CE3   . TRP A 1 400 ? 21.119  30.612  71.816  1.00 31.54  ? 398 TRP A CE3   1 
ATOM   3256  C CZ2   . TRP A 1 400 ? 22.735  28.899  70.239  1.00 31.98  ? 398 TRP A CZ2   1 
ATOM   3257  C CZ3   . TRP A 1 400 ? 20.861  30.415  70.490  1.00 32.37  ? 398 TRP A CZ3   1 
ATOM   3258  C CH2   . TRP A 1 400 ? 21.663  29.564  69.707  1.00 33.71  ? 398 TRP A CH2   1 
ATOM   3259  N N     . GLU A 1 401 ? 21.905  28.032  76.675  1.00 34.00  ? 399 GLU A N     1 
ATOM   3260  C CA    . GLU A 1 401 ? 22.016  26.578  76.787  1.00 36.31  ? 399 GLU A CA    1 
ATOM   3261  C C     . GLU A 1 401 ? 20.657  25.908  76.920  1.00 36.64  ? 399 GLU A C     1 
ATOM   3262  O O     . GLU A 1 401 ? 20.415  24.873  76.308  1.00 36.93  ? 399 GLU A O     1 
ATOM   3263  C CB    . GLU A 1 401 ? 22.955  26.116  77.912  1.00 35.48  ? 399 GLU A CB    1 
ATOM   3264  C CG    . GLU A 1 401 ? 23.628  24.745  77.640  1.00 41.50  ? 399 GLU A CG    1 
ATOM   3265  C CD    . GLU A 1 401 ? 23.275  23.712  78.694  1.00 56.80  ? 399 GLU A CD    1 
ATOM   3266  O OE1   . GLU A 1 401 ? 23.661  22.523  78.552  1.00 57.69  ? 399 GLU A OE1   1 
ATOM   3267  O OE2   . GLU A 1 401 ? 22.611  24.114  79.683  1.00 72.26  ? 399 GLU A OE2   1 
ATOM   3268  N N     . THR A 1 402 ? 19.765  26.492  77.709  1.00 34.47  ? 400 THR A N     1 
ATOM   3269  C CA    . THR A 1 402 ? 18.439  25.913  77.852  1.00 34.05  ? 400 THR A CA    1 
ATOM   3270  C C     . THR A 1 402 ? 17.723  25.838  76.513  1.00 34.43  ? 400 THR A C     1 
ATOM   3271  O O     . THR A 1 402 ? 17.165  24.804  76.178  1.00 36.08  ? 400 THR A O     1 
ATOM   3272  C CB    . THR A 1 402 ? 17.587  26.642  78.869  1.00 33.07  ? 400 THR A CB    1 
ATOM   3273  O OG1   . THR A 1 402 ? 18.348  26.838  80.060  1.00 36.98  ? 400 THR A OG1   1 
ATOM   3274  C CG2   . THR A 1 402 ? 16.390  25.831  79.197  1.00 31.62  ? 400 THR A CG2   1 
ATOM   3275  N N     . TRP A 1 403 ? 17.729  26.924  75.745  1.00 33.23  ? 401 TRP A N     1 
ATOM   3276  C CA    . TRP A 1 403 ? 17.129  26.911  74.400  1.00 33.76  ? 401 TRP A CA    1 
ATOM   3277  C C     . TRP A 1 403 ? 17.741  25.900  73.422  1.00 36.91  ? 401 TRP A C     1 
ATOM   3278  O O     . TRP A 1 403 ? 17.118  24.900  73.085  1.00 39.39  ? 401 TRP A O     1 
ATOM   3279  C CB    . TRP A 1 403 ? 17.150  28.303  73.768  1.00 32.06  ? 401 TRP A CB    1 
ATOM   3280  C CG    . TRP A 1 403 ? 16.743  28.356  72.323  1.00 32.59  ? 401 TRP A CG    1 
ATOM   3281  C CD1   . TRP A 1 403 ? 17.559  28.488  71.238  1.00 36.19  ? 401 TRP A CD1   1 
ATOM   3282  C CD2   . TRP A 1 403 ? 15.423  28.271  71.818  1.00 33.82  ? 401 TRP A CD2   1 
ATOM   3283  N NE1   . TRP A 1 403 ? 16.824  28.493  70.082  1.00 36.16  ? 401 TRP A NE1   1 
ATOM   3284  C CE2   . TRP A 1 403 ? 15.501  28.366  70.410  1.00 36.86  ? 401 TRP A CE2   1 
ATOM   3285  C CE3   . TRP A 1 403 ? 14.174  28.102  72.419  1.00 35.67  ? 401 TRP A CE3   1 
ATOM   3286  C CZ2   . TRP A 1 403 ? 14.369  28.306  69.586  1.00 39.00  ? 401 TRP A CZ2   1 
ATOM   3287  C CZ3   . TRP A 1 403 ? 13.041  28.048  71.612  1.00 40.39  ? 401 TRP A CZ3   1 
ATOM   3288  C CH2   . TRP A 1 403 ? 13.147  28.149  70.198  1.00 41.13  ? 401 TRP A CH2   1 
ATOM   3289  N N     . TRP A 1 404 ? 18.955  26.145  72.958  1.00 35.84  ? 402 TRP A N     1 
ATOM   3290  C CA    . TRP A 1 404 ? 19.481  25.315  71.882  1.00 34.49  ? 402 TRP A CA    1 
ATOM   3291  C C     . TRP A 1 404 ? 19.438  23.821  72.167  1.00 33.75  ? 402 TRP A C     1 
ATOM   3292  O O     . TRP A 1 404 ? 19.278  23.025  71.263  1.00 35.28  ? 402 TRP A O     1 
ATOM   3293  C CB    . TRP A 1 404 ? 20.869  25.782  71.396  1.00 34.20  ? 402 TRP A CB    1 
ATOM   3294  C CG    . TRP A 1 404 ? 22.030  25.370  72.243  1.00 33.88  ? 402 TRP A CG    1 
ATOM   3295  C CD1   . TRP A 1 404 ? 22.659  26.121  73.177  1.00 34.57  ? 402 TRP A CD1   1 
ATOM   3296  C CD2   . TRP A 1 404 ? 22.735  24.122  72.193  1.00 36.09  ? 402 TRP A CD2   1 
ATOM   3297  N NE1   . TRP A 1 404 ? 23.694  25.424  73.731  1.00 37.60  ? 402 TRP A NE1   1 
ATOM   3298  C CE2   . TRP A 1 404 ? 23.758  24.188  73.150  1.00 38.16  ? 402 TRP A CE2   1 
ATOM   3299  C CE3   . TRP A 1 404 ? 22.590  22.951  71.441  1.00 32.22  ? 402 TRP A CE3   1 
ATOM   3300  C CZ2   . TRP A 1 404 ? 24.631  23.128  73.370  1.00 35.61  ? 402 TRP A CZ2   1 
ATOM   3301  C CZ3   . TRP A 1 404 ? 23.447  21.922  71.657  1.00 30.38  ? 402 TRP A CZ3   1 
ATOM   3302  C CH2   . TRP A 1 404 ? 24.457  22.007  72.608  1.00 30.71  ? 402 TRP A CH2   1 
ATOM   3303  N N     . THR A 1 405 ? 19.580  23.420  73.409  1.00 34.05  ? 403 THR A N     1 
ATOM   3304  C CA    . THR A 1 405 ? 19.642  21.989  73.656  1.00 37.15  ? 403 THR A CA    1 
ATOM   3305  C C     . THR A 1 405 ? 18.257  21.354  73.602  1.00 39.52  ? 403 THR A C     1 
ATOM   3306  O O     . THR A 1 405 ? 18.125  20.163  73.395  1.00 42.35  ? 403 THR A O     1 
ATOM   3307  C CB    . THR A 1 405 ? 20.372  21.661  74.954  1.00 39.46  ? 403 THR A CB    1 
ATOM   3308  O OG1   . THR A 1 405 ? 19.886  22.504  75.999  1.00 38.70  ? 403 THR A OG1   1 
ATOM   3309  C CG2   . THR A 1 405 ? 21.853  21.900  74.787  1.00 37.80  ? 403 THR A CG2   1 
ATOM   3310  N N     . GLU A 1 406 ? 17.238  22.171  73.837  1.00 42.44  ? 404 GLU A N     1 
ATOM   3311  C CA    . GLU A 1 406 ? 15.827  21.803  73.703  1.00 40.61  ? 404 GLU A CA    1 
ATOM   3312  C C     . GLU A 1 406 ? 15.257  21.906  72.288  1.00 37.55  ? 404 GLU A C     1 
ATOM   3313  O O     . GLU A 1 406 ? 14.484  21.072  71.888  1.00 40.29  ? 404 GLU A O     1 
ATOM   3314  C CB    . GLU A 1 406 ? 14.974  22.665  74.636  1.00 44.99  ? 404 GLU A CB    1 
ATOM   3315  C CG    . GLU A 1 406 ? 15.262  22.484  76.125  1.00 47.04  ? 404 GLU A CG    1 
ATOM   3316  C CD    . GLU A 1 406 ? 15.159  21.029  76.554  1.00 58.16  ? 404 GLU A CD    1 
ATOM   3317  O OE1   . GLU A 1 406 ? 15.009  20.167  75.653  1.00 59.87  ? 404 GLU A OE1   1 
ATOM   3318  O OE2   . GLU A 1 406 ? 15.227  20.748  77.779  1.00 60.24  ? 404 GLU A OE2   1 
ATOM   3319  N N     . TYR A 1 407 ? 15.607  22.947  71.552  1.00 35.12  ? 405 TYR A N     1 
ATOM   3320  C CA    . TYR A 1 407 ? 15.029  23.175  70.228  1.00 39.19  ? 405 TYR A CA    1 
ATOM   3321  C C     . TYR A 1 407 ? 15.226  21.950  69.342  1.00 40.51  ? 405 TYR A C     1 
ATOM   3322  O O     . TYR A 1 407 ? 16.219  21.247  69.483  1.00 39.59  ? 405 TYR A O     1 
ATOM   3323  C CB    . TYR A 1 407 ? 15.660  24.420  69.586  1.00 39.19  ? 405 TYR A CB    1 
ATOM   3324  C CG    . TYR A 1 407 ? 14.885  25.031  68.430  1.00 38.53  ? 405 TYR A CG    1 
ATOM   3325  C CD1   . TYR A 1 407 ? 13.505  25.090  68.454  1.00 41.94  ? 405 TYR A CD1   1 
ATOM   3326  C CD2   . TYR A 1 407 ? 15.544  25.585  67.340  1.00 37.03  ? 405 TYR A CD2   1 
ATOM   3327  C CE1   . TYR A 1 407 ? 12.786  25.660  67.411  1.00 45.09  ? 405 TYR A CE1   1 
ATOM   3328  C CE2   . TYR A 1 407 ? 14.854  26.154  66.300  1.00 40.41  ? 405 TYR A CE2   1 
ATOM   3329  C CZ    . TYR A 1 407 ? 13.464  26.194  66.334  1.00 49.09  ? 405 TYR A CZ    1 
ATOM   3330  O OH    . TYR A 1 407 ? 12.737  26.764  65.299  1.00 52.27  ? 405 TYR A OH    1 
ATOM   3331  N N     . TRP A 1 408 ? 14.265  21.683  68.452  1.00 45.50  ? 406 TRP A N     1 
ATOM   3332  C CA    . TRP A 1 408 ? 14.232  20.442  67.643  1.00 45.39  ? 406 TRP A CA    1 
ATOM   3333  C C     . TRP A 1 408 ? 15.152  20.561  66.456  1.00 42.77  ? 406 TRP A C     1 
ATOM   3334  O O     . TRP A 1 408 ? 15.604  19.557  65.898  1.00 40.12  ? 406 TRP A O     1 
ATOM   3335  C CB    . TRP A 1 408 ? 12.806  20.118  67.148  1.00 49.78  ? 406 TRP A CB    1 
ATOM   3336  C CG    . TRP A 1 408 ? 12.212  21.207  66.315  1.00 50.17  ? 406 TRP A CG    1 
ATOM   3337  C CD1   . TRP A 1 408 ? 11.415  22.211  66.754  1.00 54.04  ? 406 TRP A CD1   1 
ATOM   3338  C CD2   . TRP A 1 408 ? 12.399  21.427  64.907  1.00 52.27  ? 406 TRP A CD2   1 
ATOM   3339  N NE1   . TRP A 1 408 ? 11.091  23.051  65.717  1.00 54.34  ? 406 TRP A NE1   1 
ATOM   3340  C CE2   . TRP A 1 408 ? 11.675  22.587  64.568  1.00 55.05  ? 406 TRP A CE2   1 
ATOM   3341  C CE3   . TRP A 1 408 ? 13.116  20.760  63.899  1.00 54.83  ? 406 TRP A CE3   1 
ATOM   3342  C CZ2   . TRP A 1 408 ? 11.631  23.093  63.260  1.00 58.00  ? 406 TRP A CZ2   1 
ATOM   3343  C CZ3   . TRP A 1 408 ? 13.073  21.260  62.595  1.00 51.48  ? 406 TRP A CZ3   1 
ATOM   3344  C CH2   . TRP A 1 408 ? 12.338  22.416  62.294  1.00 56.80  ? 406 TRP A CH2   1 
ATOM   3345  N N     . GLN A 1 409 ? 15.359  21.806  66.038  1.00 40.80  ? 407 GLN A N     1 
ATOM   3346  C CA    . GLN A 1 409 ? 16.284  22.132  64.976  1.00 38.89  ? 407 GLN A CA    1 
ATOM   3347  C C     . GLN A 1 409 ? 17.738  22.234  65.457  1.00 35.18  ? 407 GLN A C     1 
ATOM   3348  O O     . GLN A 1 409 ? 17.999  22.433  66.632  1.00 34.21  ? 407 GLN A O     1 
ATOM   3349  C CB    . GLN A 1 409 ? 15.856  23.420  64.310  1.00 42.89  ? 407 GLN A CB    1 
ATOM   3350  C CG    . GLN A 1 409 ? 15.206  23.226  62.964  1.00 43.93  ? 407 GLN A CG    1 
ATOM   3351  C CD    . GLN A 1 409 ? 14.837  24.549  62.319  1.00 50.77  ? 407 GLN A CD    1 
ATOM   3352  O OE1   . GLN A 1 409 ? 14.997  25.615  62.925  1.00 51.57  ? 407 GLN A OE1   1 
ATOM   3353  N NE2   . GLN A 1 409 ? 14.337  24.491  61.083  1.00 53.33  ? 407 GLN A NE2   1 
ATOM   3354  N N     . ALA A 1 410 ? 18.674  22.045  64.536  1.00 33.54  ? 408 ALA A N     1 
ATOM   3355  C CA    . ALA A 1 410 ? 20.087  22.239  64.800  1.00 32.89  ? 408 ALA A CA    1 
ATOM   3356  C C     . ALA A 1 410 ? 20.312  23.711  64.742  1.00 34.24  ? 408 ALA A C     1 
ATOM   3357  O O     . ALA A 1 410 ? 19.977  24.344  63.748  1.00 35.55  ? 408 ALA A O     1 
ATOM   3358  C CB    . ALA A 1 410 ? 20.912  21.579  63.754  1.00 31.18  ? 408 ALA A CB    1 
ATOM   3359  N N     . THR A 1 411 ? 20.887  24.263  65.803  1.00 33.29  ? 409 THR A N     1 
ATOM   3360  C CA    . THR A 1 411 ? 21.036  25.710  65.886  1.00 35.66  ? 409 THR A CA    1 
ATOM   3361  C C     . THR A 1 411 ? 22.330  26.026  66.599  1.00 32.10  ? 409 THR A C     1 
ATOM   3362  O O     . THR A 1 411 ? 22.752  25.273  67.467  1.00 32.48  ? 409 THR A O     1 
ATOM   3363  C CB    . THR A 1 411 ? 19.809  26.361  66.578  1.00 34.38  ? 409 THR A CB    1 
ATOM   3364  O OG1   . THR A 1 411 ? 19.958  27.774  66.578  1.00 32.69  ? 409 THR A OG1   1 
ATOM   3365  C CG2   . THR A 1 411 ? 19.634  25.851  68.007  1.00 32.59  ? 409 THR A CG2   1 
ATOM   3366  N N     . TRP A 1 412 ? 22.991  27.100  66.192  1.00 30.66  ? 410 TRP A N     1 
ATOM   3367  C CA    . TRP A 1 412 ? 24.298  27.401  66.755  1.00 30.79  ? 410 TRP A CA    1 
ATOM   3368  C C     . TRP A 1 412 ? 24.714  28.869  66.714  1.00 35.42  ? 410 TRP A C     1 
ATOM   3369  O O     . TRP A 1 412 ? 24.411  29.590  65.760  1.00 38.25  ? 410 TRP A O     1 
ATOM   3370  C CB    . TRP A 1 412 ? 25.344  26.566  66.036  1.00 31.14  ? 410 TRP A CB    1 
ATOM   3371  C CG    . TRP A 1 412 ? 26.644  26.552  66.720  1.00 33.74  ? 410 TRP A CG    1 
ATOM   3372  C CD1   . TRP A 1 412 ? 26.930  25.995  67.939  1.00 33.72  ? 410 TRP A CD1   1 
ATOM   3373  C CD2   . TRP A 1 412 ? 27.859  27.099  66.233  1.00 31.83  ? 410 TRP A CD2   1 
ATOM   3374  N NE1   . TRP A 1 412 ? 28.252  26.173  68.239  1.00 32.34  ? 410 TRP A NE1   1 
ATOM   3375  C CE2   . TRP A 1 412 ? 28.846  26.859  67.216  1.00 30.37  ? 410 TRP A CE2   1 
ATOM   3376  C CE3   . TRP A 1 412 ? 28.212  27.771  65.064  1.00 33.13  ? 410 TRP A CE3   1 
ATOM   3377  C CZ2   . TRP A 1 412 ? 30.148  27.264  67.067  1.00 30.21  ? 410 TRP A CZ2   1 
ATOM   3378  C CZ3   . TRP A 1 412 ? 29.502  28.167  64.912  1.00 34.85  ? 410 TRP A CZ3   1 
ATOM   3379  C CH2   . TRP A 1 412 ? 30.465  27.918  65.913  1.00 36.78  ? 410 TRP A CH2   1 
ATOM   3380  N N     . ILE A 1 413 ? 25.449  29.296  67.735  1.00 34.34  ? 411 ILE A N     1 
ATOM   3381  C CA    . ILE A 1 413 ? 26.079  30.612  67.711  1.00 35.02  ? 411 ILE A CA    1 
ATOM   3382  C C     . ILE A 1 413 ? 27.552  30.328  67.880  1.00 34.36  ? 411 ILE A C     1 
ATOM   3383  O O     . ILE A 1 413 ? 27.935  29.487  68.690  1.00 33.12  ? 411 ILE A O     1 
ATOM   3384  C CB    . ILE A 1 413 ? 25.656  31.521  68.911  1.00 34.24  ? 411 ILE A CB    1 
ATOM   3385  C CG1   . ILE A 1 413 ? 24.164  31.760  68.967  1.00 35.82  ? 411 ILE A CG1   1 
ATOM   3386  C CG2   . ILE A 1 413 ? 26.241  32.898  68.809  1.00 33.59  ? 411 ILE A CG2   1 
ATOM   3387  C CD1   . ILE A 1 413 ? 23.761  32.123  70.375  1.00 36.41  ? 411 ILE A CD1   1 
ATOM   3388  N N     . PRO A 1 414 ? 28.393  31.058  67.144  1.00 34.12  ? 412 PRO A N     1 
ATOM   3389  C CA    . PRO A 1 414 ? 29.835  30.863  67.290  1.00 31.52  ? 412 PRO A CA    1 
ATOM   3390  C C     . PRO A 1 414 ? 30.355  31.408  68.646  1.00 36.65  ? 412 PRO A C     1 
ATOM   3391  O O     . PRO A 1 414 ? 29.533  31.742  69.501  1.00 36.03  ? 412 PRO A O     1 
ATOM   3392  C CB    . PRO A 1 414 ? 30.408  31.585  66.074  1.00 30.20  ? 412 PRO A CB    1 
ATOM   3393  C CG    . PRO A 1 414 ? 29.358  32.540  65.625  1.00 31.63  ? 412 PRO A CG    1 
ATOM   3394  C CD    . PRO A 1 414 ? 28.042  32.040  66.100  1.00 33.20  ? 412 PRO A CD    1 
ATOM   3395  N N     . GLU A 1 415 ? 31.674  31.444  68.858  1.00 38.90  ? 413 GLU A N     1 
ATOM   3396  C CA    . GLU A 1 415 ? 32.264  31.843  70.140  1.00 37.60  ? 413 GLU A CA    1 
ATOM   3397  C C     . GLU A 1 415 ? 31.809  33.242  70.552  1.00 39.41  ? 413 GLU A C     1 
ATOM   3398  O O     . GLU A 1 415 ? 31.917  34.200  69.772  1.00 40.88  ? 413 GLU A O     1 
ATOM   3399  C CB    . GLU A 1 415 ? 33.785  31.737  70.066  1.00 40.08  ? 413 GLU A CB    1 
ATOM   3400  C CG    . GLU A 1 415 ? 34.518  32.296  71.250  1.00 43.59  ? 413 GLU A CG    1 
ATOM   3401  C CD    . GLU A 1 415 ? 35.882  31.643  71.503  1.00 50.99  ? 413 GLU A CD    1 
ATOM   3402  O OE1   . GLU A 1 415 ? 36.223  30.586  70.894  1.00 46.67  ? 413 GLU A OE1   1 
ATOM   3403  O OE2   . GLU A 1 415 ? 36.612  32.200  72.352  1.00 51.89  ? 413 GLU A OE2   1 
ATOM   3404  N N     . TRP A 1 416 ? 31.253  33.331  71.763  1.00 35.74  ? 414 TRP A N     1 
ATOM   3405  C CA    . TRP A 1 416 ? 30.537  34.528  72.214  1.00 36.59  ? 414 TRP A CA    1 
ATOM   3406  C C     . TRP A 1 416 ? 30.539  34.567  73.731  1.00 37.73  ? 414 TRP A C     1 
ATOM   3407  O O     . TRP A 1 416 ? 30.559  33.531  74.397  1.00 34.03  ? 414 TRP A O     1 
ATOM   3408  C CB    . TRP A 1 416 ? 29.060  34.543  71.709  1.00 34.59  ? 414 TRP A CB    1 
ATOM   3409  C CG    . TRP A 1 416 ? 28.179  33.502  72.394  1.00 32.19  ? 414 TRP A CG    1 
ATOM   3410  C CD1   . TRP A 1 416 ? 28.114  32.163  72.108  1.00 33.72  ? 414 TRP A CD1   1 
ATOM   3411  C CD2   . TRP A 1 416 ? 27.306  33.710  73.504  1.00 32.31  ? 414 TRP A CD2   1 
ATOM   3412  N NE1   . TRP A 1 416 ? 27.259  31.527  72.975  1.00 33.60  ? 414 TRP A NE1   1 
ATOM   3413  C CE2   . TRP A 1 416 ? 26.740  32.456  73.835  1.00 33.06  ? 414 TRP A CE2   1 
ATOM   3414  C CE3   . TRP A 1 416 ? 26.944  34.832  74.254  1.00 35.58  ? 414 TRP A CE3   1 
ATOM   3415  C CZ2   . TRP A 1 416 ? 25.819  32.299  74.877  1.00 32.53  ? 414 TRP A CZ2   1 
ATOM   3416  C CZ3   . TRP A 1 416 ? 26.032  34.675  75.289  1.00 36.77  ? 414 TRP A CZ3   1 
ATOM   3417  C CH2   . TRP A 1 416 ? 25.482  33.412  75.594  1.00 33.16  ? 414 TRP A CH2   1 
ATOM   3418  N N     . GLU A 1 417 ? 30.450  35.771  74.273  1.00 39.52  ? 415 GLU A N     1 
ATOM   3419  C CA    . GLU A 1 417 ? 30.325  35.959  75.699  1.00 39.83  ? 415 GLU A CA    1 
ATOM   3420  C C     . GLU A 1 417 ? 29.171  36.901  76.036  1.00 42.36  ? 415 GLU A C     1 
ATOM   3421  O O     . GLU A 1 417 ? 28.683  37.682  75.191  1.00 39.83  ? 415 GLU A O     1 
ATOM   3422  C CB    . GLU A 1 417 ? 31.613  36.534  76.267  1.00 42.06  ? 415 GLU A CB    1 
ATOM   3423  C CG    . GLU A 1 417 ? 31.705  38.021  75.995  1.00 52.06  ? 415 GLU A CG    1 
ATOM   3424  C CD    . GLU A 1 417 ? 33.092  38.595  76.205  1.00 64.56  ? 415 GLU A CD    1 
ATOM   3425  O OE1   . GLU A 1 417 ? 34.063  37.810  76.392  1.00 63.68  ? 415 GLU A OE1   1 
ATOM   3426  O OE2   . GLU A 1 417 ? 33.192  39.846  76.186  1.00 69.46  ? 415 GLU A OE2   1 
ATOM   3427  N N     . PHE A 1 418 ? 28.763  36.808  77.300  1.00 44.06  ? 416 PHE A N     1 
ATOM   3428  C CA    . PHE A 1 418 ? 27.744  37.655  77.894  1.00 39.98  ? 416 PHE A CA    1 
ATOM   3429  C C     . PHE A 1 418 ? 28.179  39.106  78.032  1.00 43.93  ? 416 PHE A C     1 
ATOM   3430  O O     . PHE A 1 418 ? 29.322  39.407  78.408  1.00 45.76  ? 416 PHE A O     1 
ATOM   3431  C CB    . PHE A 1 418 ? 27.435  37.138  79.282  1.00 41.49  ? 416 PHE A CB    1 
ATOM   3432  C CG    . PHE A 1 418 ? 26.266  37.791  79.911  1.00 41.81  ? 416 PHE A CG    1 
ATOM   3433  C CD1   . PHE A 1 418 ? 25.302  38.407  79.126  1.00 40.98  ? 416 PHE A CD1   1 
ATOM   3434  C CD2   . PHE A 1 418 ? 26.123  37.796  81.280  1.00 41.53  ? 416 PHE A CD2   1 
ATOM   3435  C CE1   . PHE A 1 418 ? 24.201  39.014  79.697  1.00 42.29  ? 416 PHE A CE1   1 
ATOM   3436  C CE2   . PHE A 1 418 ? 25.031  38.398  81.867  1.00 45.41  ? 416 PHE A CE2   1 
ATOM   3437  C CZ    . PHE A 1 418 ? 24.062  39.009  81.072  1.00 46.09  ? 416 PHE A CZ    1 
ATOM   3438  N N     . VAL A 1 419 ? 27.257  40.005  77.715  1.00 41.31  ? 417 VAL A N     1 
ATOM   3439  C CA    . VAL A 1 419 ? 27.414  41.413  78.012  1.00 40.15  ? 417 VAL A CA    1 
ATOM   3440  C C     . VAL A 1 419 ? 26.116  41.798  78.704  1.00 44.98  ? 417 VAL A C     1 
ATOM   3441  O O     . VAL A 1 419 ? 25.040  41.685  78.111  1.00 44.98  ? 417 VAL A O     1 
ATOM   3442  C CB    . VAL A 1 419 ? 27.653  42.244  76.732  1.00 43.72  ? 417 VAL A CB    1 
ATOM   3443  C CG1   . VAL A 1 419 ? 26.416  42.275  75.856  1.00 43.41  ? 417 VAL A CG1   1 
ATOM   3444  C CG2   . VAL A 1 419 ? 28.081  43.650  77.073  1.00 47.41  ? 417 VAL A CG2   1 
ATOM   3445  N N     . ASN A 1 420 ? 26.189  42.228  79.963  1.00 46.52  ? 418 ASN A N     1 
ATOM   3446  C CA    . ASN A 1 420 ? 24.956  42.490  80.683  1.00 43.34  ? 418 ASN A CA    1 
ATOM   3447  C C     . ASN A 1 420 ? 24.593  43.941  80.416  1.00 46.50  ? 418 ASN A C     1 
ATOM   3448  O O     . ASN A 1 420 ? 25.072  44.864  81.058  1.00 54.58  ? 418 ASN A O     1 
ATOM   3449  C CB    . ASN A 1 420 ? 25.162  42.249  82.177  1.00 39.08  ? 418 ASN A CB    1 
ATOM   3450  C CG    . ASN A 1 420 ? 23.924  42.536  82.985  1.00 46.38  ? 418 ASN A CG    1 
ATOM   3451  O OD1   . ASN A 1 420 ? 23.048  43.288  82.545  1.00 49.13  ? 418 ASN A OD1   1 
ATOM   3452  N ND2   . ASN A 1 420 ? 23.829  41.934  84.176  1.00 44.87  ? 418 ASN A ND2   1 
ATOM   3453  N N     . THR A 1 421 ? 23.672  44.098  79.486  1.00 42.53  ? 419 THR A N     1 
ATOM   3454  C CA    . THR A 1 421 ? 23.335  45.359  78.902  1.00 43.51  ? 419 THR A CA    1 
ATOM   3455  C C     . THR A 1 421 ? 21.870  45.287  78.587  1.00 48.18  ? 419 THR A C     1 
ATOM   3456  O O     . THR A 1 421 ? 21.500  45.100  77.433  1.00 48.52  ? 419 THR A O     1 
ATOM   3457  C CB    . THR A 1 421 ? 24.063  45.496  77.580  1.00 49.12  ? 419 THR A CB    1 
ATOM   3458  O OG1   . THR A 1 421 ? 25.459  45.238  77.791  1.00 51.47  ? 419 THR A OG1   1 
ATOM   3459  C CG2   . THR A 1 421 ? 23.841  46.899  76.952  1.00 48.89  ? 419 THR A CG2   1 
ATOM   3460  N N     . PRO A 1 422 ? 21.024  45.417  79.604  1.00 48.63  ? 420 PRO A N     1 
ATOM   3461  C CA    . PRO A 1 422 ? 19.581  45.202  79.425  1.00 47.05  ? 420 PRO A CA    1 
ATOM   3462  C C     . PRO A 1 422 ? 19.020  45.995  78.255  1.00 46.28  ? 420 PRO A C     1 
ATOM   3463  O O     . PRO A 1 422 ? 19.647  46.981  77.855  1.00 50.84  ? 420 PRO A O     1 
ATOM   3464  C CB    . PRO A 1 422 ? 19.004  45.702  80.748  1.00 49.29  ? 420 PRO A CB    1 
ATOM   3465  C CG    . PRO A 1 422 ? 20.098  45.299  81.758  1.00 51.75  ? 420 PRO A CG    1 
ATOM   3466  C CD    . PRO A 1 422 ? 21.419  45.443  81.024  1.00 47.86  ? 420 PRO A CD    1 
ATOM   3467  N N     . PRO A 1 423 ? 17.885  45.553  77.685  1.00 44.12  ? 421 PRO A N     1 
ATOM   3468  C CA    . PRO A 1 423 ? 17.104  44.376  78.104  1.00 43.27  ? 421 PRO A CA    1 
ATOM   3469  C C     . PRO A 1 423 ? 17.806  43.067  77.810  1.00 41.06  ? 421 PRO A C     1 
ATOM   3470  O O     . PRO A 1 423 ? 18.333  42.918  76.731  1.00 44.94  ? 421 PRO A O     1 
ATOM   3471  C CB    . PRO A 1 423 ? 15.835  44.472  77.252  1.00 44.65  ? 421 PRO A CB    1 
ATOM   3472  C CG    . PRO A 1 423 ? 16.188  45.370  76.100  1.00 46.81  ? 421 PRO A CG    1 
ATOM   3473  C CD    . PRO A 1 423 ? 17.228  46.312  76.603  1.00 44.82  ? 421 PRO A CD    1 
ATOM   3474  N N     . LEU A 1 424 ? 17.829  42.133  78.747  1.00 39.20  ? 422 LEU A N     1 
ATOM   3475  C CA    . LEU A 1 424 ? 18.432  40.837  78.464  1.00 36.98  ? 422 LEU A CA    1 
ATOM   3476  C C     . LEU A 1 424 ? 17.467  39.883  77.762  1.00 38.94  ? 422 LEU A C     1 
ATOM   3477  O O     . LEU A 1 424 ? 16.261  39.922  77.993  1.00 41.99  ? 422 LEU A O     1 
ATOM   3478  C CB    . LEU A 1 424 ? 18.972  40.200  79.730  1.00 36.81  ? 422 LEU A CB    1 
ATOM   3479  C CG    . LEU A 1 424 ? 20.073  41.033  80.391  1.00 42.03  ? 422 LEU A CG    1 
ATOM   3480  C CD1   . LEU A 1 424 ? 20.895  40.142  81.307  1.00 38.83  ? 422 LEU A CD1   1 
ATOM   3481  C CD2   . LEU A 1 424 ? 20.962  41.738  79.363  1.00 38.31  ? 422 LEU A CD2   1 
ATOM   3482  N N     . VAL A 1 425 ? 17.996  39.036  76.885  1.00 36.81  ? 423 VAL A N     1 
ATOM   3483  C CA    . VAL A 1 425 ? 17.180  38.041  76.198  1.00 33.05  ? 423 VAL A CA    1 
ATOM   3484  C C     . VAL A 1 425 ? 16.802  36.874  77.120  1.00 32.43  ? 423 VAL A C     1 
ATOM   3485  O O     . VAL A 1 425 ? 17.663  36.211  77.694  1.00 31.82  ? 423 VAL A O     1 
ATOM   3486  C CB    . VAL A 1 425 ? 17.897  37.522  74.956  1.00 30.84  ? 423 VAL A CB    1 
ATOM   3487  C CG1   . VAL A 1 425 ? 17.068  36.473  74.288  1.00 30.06  ? 423 VAL A CG1   1 
ATOM   3488  C CG2   . VAL A 1 425 ? 18.181  38.687  74.004  1.00 37.73  ? 423 VAL A CG2   1 
ATOM   3489  N N     . LYS A 1 426 ? 15.503  36.644  77.278  1.00 31.88  ? 424 LYS A N     1 
ATOM   3490  C CA    . LYS A 1 426 ? 15.032  35.559  78.128  1.00 34.55  ? 424 LYS A CA    1 
ATOM   3491  C C     . LYS A 1 426 ? 13.991  34.655  77.441  1.00 35.15  ? 424 LYS A C     1 
ATOM   3492  O O     . LYS A 1 426 ? 13.392  35.026  76.426  1.00 35.63  ? 424 LYS A O     1 
ATOM   3493  C CB    . LYS A 1 426 ? 14.489  36.107  79.454  1.00 34.13  ? 424 LYS A CB    1 
ATOM   3494  C CG    . LYS A 1 426 ? 13.347  37.109  79.309  1.00 39.96  ? 424 LYS A CG    1 
ATOM   3495  C CD    . LYS A 1 426 ? 13.084  37.896  80.594  1.00 43.79  ? 424 LYS A CD    1 
ATOM   3496  C CE    . LYS A 1 426 ? 11.783  37.459  81.255  1.00 47.37  ? 424 LYS A CE    1 
ATOM   3497  N NZ    . LYS A 1 426 ? 11.438  38.286  82.459  1.00 54.08  ? 424 LYS A NZ    1 
ATOM   3498  N N     . LEU A 1 427 ? 13.817  33.462  77.994  1.00 30.67  ? 425 LEU A N     1 
ATOM   3499  C CA    . LEU A 1 427 ? 12.741  32.579  77.601  1.00 32.48  ? 425 LEU A CA    1 
ATOM   3500  C C     . LEU A 1 427 ? 11.603  32.875  78.547  1.00 34.06  ? 425 LEU A C     1 
ATOM   3501  O O     . LEU A 1 427 ? 11.757  32.729  79.755  1.00 36.56  ? 425 LEU A O     1 
ATOM   3502  C CB    . LEU A 1 427 ? 13.162  31.108  77.748  1.00 30.07  ? 425 LEU A CB    1 
ATOM   3503  C CG    . LEU A 1 427 ? 14.215  30.609  76.761  1.00 29.60  ? 425 LEU A CG    1 
ATOM   3504  C CD1   . LEU A 1 427 ? 14.649  29.178  77.088  1.00 31.36  ? 425 LEU A CD1   1 
ATOM   3505  C CD2   . LEU A 1 427 ? 13.690  30.743  75.354  1.00 27.50  ? 425 LEU A CD2   1 
ATOM   3506  N N     . TRP A 1 428 ? 10.449  33.269  78.025  1.00 33.53  ? 426 TRP A N     1 
ATOM   3507  C CA    . TRP A 1 428 ? 9.363   33.698  78.916  1.00 33.87  ? 426 TRP A CA    1 
ATOM   3508  C C     . TRP A 1 428 ? 8.548   32.605  79.615  1.00 32.80  ? 426 TRP A C     1 
ATOM   3509  O O     . TRP A 1 428 ? 7.834   32.904  80.579  1.00 35.11  ? 426 TRP A O     1 
ATOM   3510  C CB    . TRP A 1 428 ? 8.448   34.671  78.208  1.00 32.50  ? 426 TRP A CB    1 
ATOM   3511  C CG    . TRP A 1 428 ? 9.183   35.843  77.783  1.00 37.16  ? 426 TRP A CG    1 
ATOM   3512  C CD1   . TRP A 1 428 ? 9.934   35.985  76.647  1.00 37.17  ? 426 TRP A CD1   1 
ATOM   3513  C CD2   . TRP A 1 428 ? 9.277   37.068  78.490  1.00 42.19  ? 426 TRP A CD2   1 
ATOM   3514  N NE1   . TRP A 1 428 ? 10.488  37.232  76.606  1.00 40.10  ? 426 TRP A NE1   1 
ATOM   3515  C CE2   . TRP A 1 428 ? 10.097  37.924  77.727  1.00 44.24  ? 426 TRP A CE2   1 
ATOM   3516  C CE3   . TRP A 1 428 ? 8.743   37.533  79.701  1.00 42.10  ? 426 TRP A CE3   1 
ATOM   3517  C CZ2   . TRP A 1 428 ? 10.402  39.220  78.139  1.00 42.95  ? 426 TRP A CZ2   1 
ATOM   3518  C CZ3   . TRP A 1 428 ? 9.040   38.806  80.108  1.00 42.50  ? 426 TRP A CZ3   1 
ATOM   3519  C CH2   . TRP A 1 428 ? 9.865   39.639  79.330  1.00 47.67  ? 426 TRP A CH2   1 
ATOM   3520  N N     . TYR A 1 429 ? 8.639   31.366  79.136  1.00 26.30  ? 427 TYR A N     1 
ATOM   3521  C CA    . TYR A 1 429 ? 8.035   30.234  79.825  1.00 27.81  ? 427 TYR A CA    1 
ATOM   3522  C C     . TYR A 1 429 ? 8.728   28.959  79.391  1.00 31.44  ? 427 TYR A C     1 
ATOM   3523  O O     . TYR A 1 429 ? 9.435   28.947  78.379  1.00 32.26  ? 427 TYR A O     1 
ATOM   3524  C CB    . TYR A 1 429 ? 6.514   30.159  79.570  1.00 28.95  ? 427 TYR A CB    1 
ATOM   3525  C CG    . TYR A 1 429 ? 6.166   30.100  78.110  1.00 28.81  ? 427 TYR A CG    1 
ATOM   3526  C CD1   . TYR A 1 429 ? 5.904   28.882  77.495  1.00 25.49  ? 427 TYR A CD1   1 
ATOM   3527  C CD2   . TYR A 1 429 ? 6.148   31.269  77.332  1.00 27.38  ? 427 TYR A CD2   1 
ATOM   3528  C CE1   . TYR A 1 429 ? 5.639   28.822  76.154  1.00 27.90  ? 427 TYR A CE1   1 
ATOM   3529  C CE2   . TYR A 1 429 ? 5.875   31.223  75.990  1.00 27.12  ? 427 TYR A CE2   1 
ATOM   3530  C CZ    . TYR A 1 429 ? 5.625   29.995  75.402  1.00 28.48  ? 427 TYR A CZ    1 
ATOM   3531  O OH    . TYR A 1 429 ? 5.336   29.931  74.072  1.00 26.51  ? 427 TYR A OH    1 
ATOM   3532  N N     . GLN A 1 430 ? 8.541   27.892  80.161  1.00 30.85  ? 428 GLN A N     1 
ATOM   3533  C CA    . GLN A 1 430 ? 9.010   26.563  79.758  1.00 33.73  ? 428 GLN A CA    1 
ATOM   3534  C C     . GLN A 1 430 ? 7.909   25.541  79.905  1.00 29.26  ? 428 GLN A C     1 
ATOM   3535  O O     . GLN A 1 430 ? 7.201   25.544  80.888  1.00 33.65  ? 428 GLN A O     1 
ATOM   3536  C CB    . GLN A 1 430 ? 10.229  26.128  80.594  1.00 34.90  ? 428 GLN A CB    1 
ATOM   3537  C CG    . GLN A 1 430 ? 11.573  26.289  79.859  1.00 41.19  ? 428 GLN A CG    1 
ATOM   3538  C CD    . GLN A 1 430 ? 12.656  26.947  80.723  1.00 51.54  ? 428 GLN A CD    1 
ATOM   3539  O OE1   . GLN A 1 430 ? 13.624  26.282  81.133  1.00 53.51  ? 428 GLN A OE1   1 
ATOM   3540  N NE2   . GLN A 1 430 ? 12.498  28.262  81.006  1.00 48.23  ? 428 GLN A NE2   1 
ATOM   3541  N N     . LEU A 1 431 ? 7.763   24.629  78.963  1.00 29.20  ? 429 LEU A N     1 
ATOM   3542  C CA    . LEU A 1 431 ? 6.827   23.532  79.206  1.00 27.32  ? 429 LEU A CA    1 
ATOM   3543  C C     . LEU A 1 431 ? 7.457   22.389  79.985  1.00 27.99  ? 429 LEU A C     1 
ATOM   3544  O O     . LEU A 1 431 ? 8.572   21.999  79.713  1.00 32.59  ? 429 LEU A O     1 
ATOM   3545  C CB    . LEU A 1 431 ? 6.244   23.014  77.909  1.00 24.31  ? 429 LEU A CB    1 
ATOM   3546  C CG    . LEU A 1 431 ? 5.637   24.138  77.104  1.00 24.04  ? 429 LEU A CG    1 
ATOM   3547  C CD1   . LEU A 1 431 ? 5.161   23.602  75.790  1.00 26.07  ? 429 LEU A CD1   1 
ATOM   3548  C CD2   . LEU A 1 431 ? 4.525   24.802  77.885  1.00 23.95  ? 429 LEU A CD2   1 
ATOM   3549  N N     . GLU A 1 432 ? 6.733   21.841  80.947  1.00 30.75  ? 430 GLU A N     1 
ATOM   3550  C CA    . GLU A 1 432 ? 7.191   20.674  81.693  1.00 33.46  ? 430 GLU A CA    1 
ATOM   3551  C C     . GLU A 1 432 ? 7.508   19.491  80.760  1.00 35.41  ? 430 GLU A C     1 
ATOM   3552  O O     . GLU A 1 432 ? 6.955   19.416  79.660  1.00 34.27  ? 430 GLU A O     1 
ATOM   3553  C CB    . GLU A 1 432 ? 6.159   20.282  82.747  1.00 31.73  ? 430 GLU A CB    1 
ATOM   3554  C CG    . GLU A 1 432 ? 5.936   21.332  83.817  1.00 34.92  ? 430 GLU A CG    1 
ATOM   3555  C CD    . GLU A 1 432 ? 7.120   21.486  84.793  1.00 43.90  ? 430 GLU A CD    1 
ATOM   3556  O OE1   . GLU A 1 432 ? 7.706   22.599  84.848  1.00 44.33  ? 430 GLU A OE1   1 
ATOM   3557  O OE2   . GLU A 1 432 ? 7.445   20.512  85.526  1.00 44.76  ? 430 GLU A OE2   1 
ATOM   3558  N N     . LYS A 1 433 ? 8.450   18.627  81.169  1.00 36.53  ? 431 LYS A N     1 
ATOM   3559  C CA    . LYS A 1 433 ? 8.839   17.451  80.388  1.00 36.44  ? 431 LYS A CA    1 
ATOM   3560  C C     . LYS A 1 433 ? 8.033   16.255  80.845  1.00 37.10  ? 431 LYS A C     1 
ATOM   3561  O O     . LYS A 1 433 ? 8.021   15.198  80.224  1.00 37.55  ? 431 LYS A O     1 
ATOM   3562  C CB    . LYS A 1 433 ? 10.330  17.151  80.546  1.00 42.95  ? 431 LYS A CB    1 
ATOM   3563  C CG    . LYS A 1 433 ? 11.268  18.191  79.956  1.00 52.68  ? 431 LYS A CG    1 
ATOM   3564  C CD    . LYS A 1 433 ? 12.715  17.727  80.002  1.00 65.76  ? 431 LYS A CD    1 
ATOM   3565  C CE    . LYS A 1 433 ? 13.682  18.902  79.837  1.00 77.79  ? 431 LYS A CE    1 
ATOM   3566  N NZ    . LYS A 1 433 ? 15.005  18.642  80.506  1.00 81.36  ? 431 LYS A NZ    1 
ATOM   3567  N N     . GLU A 1 434 ? 7.330   16.457  81.938  1.00 36.16  ? 432 GLU A N     1 
ATOM   3568  C CA    . GLU A 1 434 ? 6.600   15.394  82.573  1.00 38.10  ? 432 GLU A CA    1 
ATOM   3569  C C     . GLU A 1 434 ? 5.287   15.919  83.170  1.00 40.73  ? 432 GLU A C     1 
ATOM   3570  O O     . GLU A 1 434 ? 5.208   17.081  83.612  1.00 38.09  ? 432 GLU A O     1 
ATOM   3571  C CB    . GLU A 1 434 ? 7.485   14.773  83.662  1.00 38.78  ? 432 GLU A CB    1 
ATOM   3572  C CG    . GLU A 1 434 ? 8.536   13.804  83.130  1.00 41.53  ? 432 GLU A CG    1 
ATOM   3573  C CD    . GLU A 1 434 ? 7.912   12.488  82.668  1.00 48.42  ? 432 GLU A CD    1 
ATOM   3574  O OE1   . GLU A 1 434 ? 7.299   11.802  83.528  1.00 45.60  ? 432 GLU A OE1   1 
ATOM   3575  O OE2   . GLU A 1 434 ? 8.014   12.157  81.453  1.00 48.72  ? 432 GLU A OE2   1 
ATOM   3576  N N     . PRO A 1 435 ? 4.257   15.051  83.208  1.00 37.13  ? 433 PRO A N     1 
ATOM   3577  C CA    . PRO A 1 435 ? 2.940   15.337  83.773  1.00 34.06  ? 433 PRO A CA    1 
ATOM   3578  C C     . PRO A 1 435 ? 3.086   16.006  85.112  1.00 37.31  ? 433 PRO A C     1 
ATOM   3579  O O     . PRO A 1 435 ? 4.052   15.721  85.784  1.00 42.11  ? 433 PRO A O     1 
ATOM   3580  C CB    . PRO A 1 435 ? 2.386   13.958  83.987  1.00 35.09  ? 433 PRO A CB    1 
ATOM   3581  C CG    . PRO A 1 435 ? 3.044   13.131  82.915  1.00 38.56  ? 433 PRO A CG    1 
ATOM   3582  C CD    . PRO A 1 435 ? 4.224   13.846  82.379  1.00 33.96  ? 433 PRO A CD    1 
ATOM   3583  N N     . ILE A 1 436 ? 2.188   16.909  85.477  1.00 36.04  ? 434 ILE A N     1 
ATOM   3584  C CA    . ILE A 1 436 ? 2.247   17.541  86.784  1.00 34.80  ? 434 ILE A CA    1 
ATOM   3585  C C     . ILE A 1 436 ? 1.253   16.902  87.718  1.00 42.35  ? 434 ILE A C     1 
ATOM   3586  O O     . ILE A 1 436 ? 0.043   17.062  87.551  1.00 45.03  ? 434 ILE A O     1 
ATOM   3587  C CB    . ILE A 1 436 ? 1.908   19.027  86.717  1.00 36.22  ? 434 ILE A CB    1 
ATOM   3588  C CG1   . ILE A 1 436 ? 2.640   19.683  85.547  1.00 37.54  ? 434 ILE A CG1   1 
ATOM   3589  C CG2   . ILE A 1 436 ? 2.224   19.702  88.043  1.00 36.75  ? 434 ILE A CG2   1 
ATOM   3590  C CD1   . ILE A 1 436 ? 2.389   21.130  85.387  1.00 36.37  ? 434 ILE A CD1   1 
ATOM   3591  N N     . VAL A 1 437 ? 1.771   16.175  88.703  1.00 46.02  ? 435 VAL A N     1 
ATOM   3592  C CA    . VAL A 1 437 ? 0.970   15.580  89.775  1.00 48.63  ? 435 VAL A CA    1 
ATOM   3593  C C     . VAL A 1 437 ? 0.090   16.575  90.522  1.00 46.95  ? 435 VAL A C     1 
ATOM   3594  O O     . VAL A 1 437 ? 0.545   17.652  90.941  1.00 45.26  ? 435 VAL A O     1 
ATOM   3595  C CB    . VAL A 1 437 ? 1.885   14.977  90.806  1.00 54.60  ? 435 VAL A CB    1 
ATOM   3596  C CG1   . VAL A 1 437 ? 2.340   13.594  90.344  1.00 54.82  ? 435 VAL A CG1   1 
ATOM   3597  C CG2   . VAL A 1 437 ? 3.078   15.945  91.040  1.00 54.14  ? 435 VAL A CG2   1 
ATOM   3598  N N     . GLY A 1 438 ? -1.173  16.201  90.700  1.00 45.13  ? 436 GLY A N     1 
ATOM   3599  C CA    . GLY A 1 438 ? -2.102  17.046  91.422  1.00 46.22  ? 436 GLY A CA    1 
ATOM   3600  C C     . GLY A 1 438 ? -2.466  18.347  90.723  1.00 46.50  ? 436 GLY A C     1 
ATOM   3601  O O     . GLY A 1 438 ? -3.007  19.259  91.348  1.00 49.62  ? 436 GLY A O     1 
ATOM   3602  N N     . ALA A 1 439 ? -2.170  18.446  89.431  1.00 43.29  ? 437 ALA A N     1 
ATOM   3603  C CA    . ALA A 1 439 ? -2.744  19.514  88.621  1.00 40.25  ? 437 ALA A CA    1 
ATOM   3604  C C     . ALA A 1 439 ? -3.967  18.964  87.891  1.00 41.14  ? 437 ALA A C     1 
ATOM   3605  O O     . ALA A 1 439 ? -4.016  17.777  87.489  1.00 36.60  ? 437 ALA A O     1 
ATOM   3606  C CB    . ALA A 1 439 ? -1.728  20.105  87.633  1.00 36.04  ? 437 ALA A CB    1 
ATOM   3607  N N     . GLU A 1 440 ? -4.968  19.824  87.742  1.00 38.71  ? 438 GLU A N     1 
ATOM   3608  C CA    . GLU A 1 440 ? -6.115  19.458  86.938  1.00 37.55  ? 438 GLU A CA    1 
ATOM   3609  C C     . GLU A 1 440 ? -5.686  19.116  85.500  1.00 35.48  ? 438 GLU A C     1 
ATOM   3610  O O     . GLU A 1 440 ? -4.767  19.706  84.937  1.00 31.61  ? 438 GLU A O     1 
ATOM   3611  C CB    . GLU A 1 440 ? -7.172  20.554  86.976  1.00 35.84  ? 438 GLU A CB    1 
ATOM   3612  C CG    . GLU A 1 440 ? -8.583  20.036  87.007  1.00 36.66  ? 438 GLU A CG    1 
ATOM   3613  C CD    . GLU A 1 440 ? -9.601  21.161  87.080  1.00 43.81  ? 438 GLU A CD    1 
ATOM   3614  O OE1   . GLU A 1 440 ? -9.288  22.237  87.652  1.00 47.62  ? 438 GLU A OE1   1 
ATOM   3615  O OE2   . GLU A 1 440 ? -10.717 20.973  86.553  1.00 40.60  ? 438 GLU A OE2   1 
ATOM   3616  N N     . THR A 1 441 ? -6.341  18.118  84.929  1.00 36.66  ? 439 THR A N     1 
ATOM   3617  C CA    . THR A 1 441 ? -6.010  17.672  83.591  1.00 35.90  ? 439 THR A CA    1 
ATOM   3618  C C     . THR A 1 441 ? -7.158  18.029  82.654  1.00 37.19  ? 439 THR A C     1 
ATOM   3619  O O     . THR A 1 441 ? -8.226  17.434  82.719  1.00 36.45  ? 439 THR A O     1 
ATOM   3620  C CB    . THR A 1 441 ? -5.791  16.159  83.563  1.00 37.08  ? 439 THR A CB    1 
ATOM   3621  O OG1   . THR A 1 441 ? -4.773  15.807  84.506  1.00 37.99  ? 439 THR A OG1   1 
ATOM   3622  C CG2   . THR A 1 441 ? -5.412  15.713  82.171  1.00 35.69  ? 439 THR A CG2   1 
ATOM   3623  N N     . PHE A 1 442 ? -6.923  19.008  81.785  1.00 34.17  ? 440 PHE A N     1 
ATOM   3624  C CA    . PHE A 1 442 ? -7.899  19.453  80.812  1.00 30.73  ? 440 PHE A CA    1 
ATOM   3625  C C     . PHE A 1 442 ? -7.695  18.744  79.491  1.00 31.00  ? 440 PHE A C     1 
ATOM   3626  O O     . PHE A 1 442 ? -6.676  18.923  78.859  1.00 32.00  ? 440 PHE A O     1 
ATOM   3627  C CB    . PHE A 1 442 ? -7.742  20.953  80.590  1.00 31.64  ? 440 PHE A CB    1 
ATOM   3628  C CG    . PHE A 1 442 ? -8.163  21.789  81.759  1.00 33.41  ? 440 PHE A CG    1 
ATOM   3629  C CD1   . PHE A 1 442 ? -9.074  22.829  81.590  1.00 31.87  ? 440 PHE A CD1   1 
ATOM   3630  C CD2   . PHE A 1 442 ? -7.664  21.534  83.030  1.00 31.75  ? 440 PHE A CD2   1 
ATOM   3631  C CE1   . PHE A 1 442 ? -9.458  23.601  82.664  1.00 33.65  ? 440 PHE A CE1   1 
ATOM   3632  C CE2   . PHE A 1 442 ? -8.043  22.309  84.099  1.00 33.43  ? 440 PHE A CE2   1 
ATOM   3633  C CZ    . PHE A 1 442 ? -8.938  23.341  83.925  1.00 32.38  ? 440 PHE A CZ    1 
ATOM   3634  N N     . TYR A 1 443 ? -8.665  17.938  79.074  1.00 31.79  ? 441 TYR A N     1 
ATOM   3635  C CA    . TYR A 1 443 ? -8.721  17.417  77.713  1.00 31.04  ? 441 TYR A CA    1 
ATOM   3636  C C     . TYR A 1 443 ? -9.432  18.430  76.804  1.00 30.85  ? 441 TYR A C     1 
ATOM   3637  O O     . TYR A 1 443 ? -10.597 18.749  77.024  1.00 32.54  ? 441 TYR A O     1 
ATOM   3638  C CB    . TYR A 1 443 ? -9.464  16.088  77.699  1.00 34.06  ? 441 TYR A CB    1 
ATOM   3639  C CG    . TYR A 1 443 ? -8.747  14.989  78.417  1.00 39.22  ? 441 TYR A CG    1 
ATOM   3640  C CD1   . TYR A 1 443 ? -8.061  13.994  77.715  1.00 46.10  ? 441 TYR A CD1   1 
ATOM   3641  C CD2   . TYR A 1 443 ? -8.737  14.938  79.792  1.00 40.00  ? 441 TYR A CD2   1 
ATOM   3642  C CE1   . TYR A 1 443 ? -7.384  12.978  78.380  1.00 45.20  ? 441 TYR A CE1   1 
ATOM   3643  C CE2   . TYR A 1 443 ? -8.062  13.937  80.462  1.00 44.03  ? 441 TYR A CE2   1 
ATOM   3644  C CZ    . TYR A 1 443 ? -7.391  12.958  79.760  1.00 45.48  ? 441 TYR A CZ    1 
ATOM   3645  O OH    . TYR A 1 443 ? -6.739  11.968  80.460  1.00 43.22  ? 441 TYR A OH    1 
ATOM   3646  N N     . VAL A 1 444 ? -8.740  18.943  75.792  1.00 25.24  ? 442 VAL A N     1 
ATOM   3647  C CA    . VAL A 1 444 ? -9.310  20.001  74.982  1.00 29.15  ? 442 VAL A CA    1 
ATOM   3648  C C     . VAL A 1 444 ? -9.518  19.607  73.537  1.00 31.57  ? 442 VAL A C     1 
ATOM   3649  O O     . VAL A 1 444 ? -8.722  18.872  72.961  1.00 33.71  ? 442 VAL A O     1 
ATOM   3650  C CB    . VAL A 1 444 ? -8.505  21.342  75.077  1.00 28.82  ? 442 VAL A CB    1 
ATOM   3651  C CG1   . VAL A 1 444 ? -8.157  21.636  76.510  1.00 29.52  ? 442 VAL A CG1   1 
ATOM   3652  C CG2   . VAL A 1 444 ? -7.249  21.311  74.248  1.00 25.93  ? 442 VAL A CG2   1 
ATOM   3653  N N     . ASP A 1 445 ? -10.609 20.088  72.952  1.00 34.53  ? 443 ASP A N     1 
ATOM   3654  C CA    . ASP A 1 445 ? -10.830 19.901  71.526  1.00 35.53  ? 443 ASP A CA    1 
ATOM   3655  C C     . ASP A 1 445 ? -11.607 21.045  70.923  1.00 35.87  ? 443 ASP A C     1 
ATOM   3656  O O     . ASP A 1 445 ? -12.229 21.835  71.613  1.00 35.58  ? 443 ASP A O     1 
ATOM   3657  C CB    . ASP A 1 445 ? -11.498 18.551  71.211  1.00 37.97  ? 443 ASP A CB    1 
ATOM   3658  C CG    . ASP A 1 445 ? -11.243 18.086  69.764  1.00 47.54  ? 443 ASP A CG    1 
ATOM   3659  O OD1   . ASP A 1 445 ? -11.870 17.097  69.337  1.00 61.14  ? 443 ASP A OD1   1 
ATOM   3660  O OD2   . ASP A 1 445 ? -10.426 18.691  69.023  1.00 46.00  ? 443 ASP A OD2   1 
ATOM   3661  N N     . GLY A 1 446 ? -11.555 21.123  69.607  1.00 39.66  ? 444 GLY A N     1 
ATOM   3662  C CA    . GLY A 1 446 ? -12.342 22.077  68.874  1.00 41.04  ? 444 GLY A CA    1 
ATOM   3663  C C     . GLY A 1 446 ? -12.651 21.512  67.512  1.00 45.87  ? 444 GLY A C     1 
ATOM   3664  O O     . GLY A 1 446 ? -11.934 20.664  66.970  1.00 47.36  ? 444 GLY A O     1 
ATOM   3665  N N     . ALA A 1 447 ? -13.743 21.995  66.946  1.00 51.63  ? 445 ALA A N     1 
ATOM   3666  C CA    . ALA A 1 447 ? -14.106 21.601  65.601  1.00 44.73  ? 445 ALA A CA    1 
ATOM   3667  C C     . ALA A 1 447 ? -14.859 22.760  64.989  1.00 47.27  ? 445 ALA A C     1 
ATOM   3668  O O     . ALA A 1 447 ? -15.475 23.560  65.700  1.00 43.57  ? 445 ALA A O     1 
ATOM   3669  C CB    . ALA A 1 447 ? -14.942 20.365  65.632  1.00 47.17  ? 445 ALA A CB    1 
ATOM   3670  N N     . ALA A 1 448 ? -14.762 22.879  63.670  1.00 54.31  ? 446 ALA A N     1 
ATOM   3671  C CA    . ALA A 1 448 ? -15.559 23.842  62.926  1.00 54.45  ? 446 ALA A CA    1 
ATOM   3672  C C     . ALA A 1 448 ? -16.022 23.173  61.663  1.00 57.26  ? 446 ALA A C     1 
ATOM   3673  O O     . ALA A 1 448 ? -15.480 22.151  61.265  1.00 56.23  ? 446 ALA A O     1 
ATOM   3674  C CB    . ALA A 1 448 ? -14.776 25.071  62.610  1.00 50.98  ? 446 ALA A CB    1 
ATOM   3675  N N     . ASN A 1 449 ? -17.044 23.756  61.051  1.00 64.86  ? 447 ASN A N     1 
ATOM   3676  C CA    . ASN A 1 449 ? -17.655 23.210  59.853  1.00 74.39  ? 447 ASN A CA    1 
ATOM   3677  C C     . ASN A 1 449 ? -17.167 24.006  58.663  1.00 75.20  ? 447 ASN A C     1 
ATOM   3678  O O     . ASN A 1 449 ? -17.221 25.241  58.671  1.00 73.22  ? 447 ASN A O     1 
ATOM   3679  C CB    . ASN A 1 449 ? -19.185 23.263  59.974  1.00 81.78  ? 447 ASN A CB    1 
ATOM   3680  C CG    . ASN A 1 449 ? -19.895 22.745  58.735  1.00 88.33  ? 447 ASN A CG    1 
ATOM   3681  O OD1   . ASN A 1 449 ? -20.550 23.510  58.014  1.00 89.65  ? 447 ASN A OD1   1 
ATOM   3682  N ND2   . ASN A 1 449 ? -19.770 21.444  58.481  1.00 89.07  ? 447 ASN A ND2   1 
ATOM   3683  N N     . ARG A 1 450 ? -16.673 23.298  57.651  1.00 78.88  ? 448 ARG A N     1 
ATOM   3684  C CA    . ARG A 1 450 ? -15.966 23.945  56.552  1.00 85.98  ? 448 ARG A CA    1 
ATOM   3685  C C     . ARG A 1 450 ? -16.881 24.909  55.796  1.00 88.92  ? 448 ARG A C     1 
ATOM   3686  O O     . ARG A 1 450 ? -16.474 26.015  55.404  1.00 81.80  ? 448 ARG A O     1 
ATOM   3687  C CB    . ARG A 1 450 ? -15.374 22.898  55.612  1.00 89.87  ? 448 ARG A CB    1 
ATOM   3688  C CG    . ARG A 1 450 ? -14.399 23.476  54.608  1.00 99.81  ? 448 ARG A CG    1 
ATOM   3689  C CD    . ARG A 1 450 ? -13.751 22.389  53.762  1.00 109.76 ? 448 ARG A CD    1 
ATOM   3690  N NE    . ARG A 1 450 ? -13.106 21.372  54.589  1.00 114.58 ? 448 ARG A NE    1 
ATOM   3691  C CZ    . ARG A 1 450 ? -12.191 20.517  54.146  1.00 115.40 ? 448 ARG A CZ    1 
ATOM   3692  N NH1   . ARG A 1 450 ? -11.793 20.555  52.882  1.00 109.16 ? 448 ARG A NH1   1 
ATOM   3693  N NH2   . ARG A 1 450 ? -11.665 19.626  54.973  1.00 121.20 ? 448 ARG A NH2   1 
ATOM   3694  N N     . GLU A 1 451 ? -18.126 24.477  55.617  1.00 92.44  ? 449 GLU A N     1 
ATOM   3695  C CA    . GLU A 1 451 ? -19.137 25.260  54.925  1.00 91.31  ? 449 GLU A CA    1 
ATOM   3696  C C     . GLU A 1 451 ? -19.605 26.502  55.712  1.00 84.66  ? 449 GLU A C     1 
ATOM   3697  O O     . GLU A 1 451 ? -19.516 27.625  55.209  1.00 79.73  ? 449 GLU A O     1 
ATOM   3698  C CB    . GLU A 1 451 ? -20.325 24.359  54.577  1.00 96.24  ? 449 GLU A CB    1 
ATOM   3699  C CG    . GLU A 1 451 ? -21.403 25.043  53.741  1.00 110.71 ? 449 GLU A CG    1 
ATOM   3700  C CD    . GLU A 1 451 ? -22.801 24.486  54.005  1.00 119.37 ? 449 GLU A CD    1 
ATOM   3701  O OE1   . GLU A 1 451 ? -22.908 23.297  54.392  1.00 121.07 ? 449 GLU A OE1   1 
ATOM   3702  O OE2   . GLU A 1 451 ? -23.788 25.246  53.835  1.00 120.81 ? 449 GLU A OE2   1 
ATOM   3703  N N     . THR A 1 452 ? -20.072 26.312  56.946  1.00 80.70  ? 450 THR A N     1 
ATOM   3704  C CA    . THR A 1 452 ? -20.701 27.412  57.687  1.00 80.19  ? 450 THR A CA    1 
ATOM   3705  C C     . THR A 1 452 ? -19.712 28.357  58.384  1.00 74.82  ? 450 THR A C     1 
ATOM   3706  O O     . THR A 1 452 ? -20.104 29.431  58.859  1.00 68.21  ? 450 THR A O     1 
ATOM   3707  C CB    . THR A 1 452 ? -21.764 26.901  58.698  1.00 78.00  ? 450 THR A CB    1 
ATOM   3708  O OG1   . THR A 1 452 ? -21.131 26.396  59.870  1.00 77.76  ? 450 THR A OG1   1 
ATOM   3709  C CG2   . THR A 1 452 ? -22.574 25.787  58.093  1.00 87.87  ? 450 THR A CG2   1 
ATOM   3710  N N     . LYS A 1 453 ? -18.436 27.961  58.402  1.00 75.58  ? 451 LYS A N     1 
ATOM   3711  C CA    . LYS A 1 453 ? -17.387 28.646  59.160  1.00 69.23  ? 451 LYS A CA    1 
ATOM   3712  C C     . LYS A 1 453 ? -17.832 28.817  60.602  1.00 65.13  ? 451 LYS A C     1 
ATOM   3713  O O     . LYS A 1 453 ? -17.462 29.781  61.258  1.00 63.23  ? 451 LYS A O     1 
ATOM   3714  C CB    . LYS A 1 453 ? -17.043 30.022  58.586  1.00 67.06  ? 451 LYS A CB    1 
ATOM   3715  C CG    . LYS A 1 453 ? -16.748 30.076  57.105  1.00 71.65  ? 451 LYS A CG    1 
ATOM   3716  C CD    . LYS A 1 453 ? -15.969 28.885  56.625  1.00 73.18  ? 451 LYS A CD    1 
ATOM   3717  C CE    . LYS A 1 453 ? -15.522 29.107  55.191  1.00 77.20  ? 451 LYS A CE    1 
ATOM   3718  N NZ    . LYS A 1 453 ? -15.099 27.836  54.552  1.00 80.23  ? 451 LYS A NZ    1 
ATOM   3719  N N     . LEU A 1 454 ? -18.641 27.887  61.089  1.00 63.91  ? 452 LEU A N     1 
ATOM   3720  C CA    . LEU A 1 454 ? -19.167 27.969  62.448  1.00 62.23  ? 452 LEU A CA    1 
ATOM   3721  C C     . LEU A 1 454 ? -18.666 26.754  63.209  1.00 59.71  ? 452 LEU A C     1 
ATOM   3722  O O     . LEU A 1 454 ? -18.487 25.691  62.621  1.00 60.04  ? 452 LEU A O     1 
ATOM   3723  C CB    . LEU A 1 454 ? -20.700 28.012  62.439  1.00 64.62  ? 452 LEU A CB    1 
ATOM   3724  C CG    . LEU A 1 454 ? -21.401 29.291  62.906  1.00 63.79  ? 452 LEU A CG    1 
ATOM   3725  C CD1   . LEU A 1 454 ? -20.962 30.542  62.132  1.00 58.24  ? 452 LEU A CD1   1 
ATOM   3726  C CD2   . LEU A 1 454 ? -22.895 29.085  62.800  1.00 67.14  ? 452 LEU A CD2   1 
ATOM   3727  N N     . GLY A 1 455 ? -18.412 26.907  64.504  1.00 51.96  ? 453 GLY A N     1 
ATOM   3728  C CA    . GLY A 1 455 ? -17.776 25.833  65.241  1.00 45.43  ? 453 GLY A CA    1 
ATOM   3729  C C     . GLY A 1 455 ? -17.809 26.019  66.735  1.00 44.35  ? 453 GLY A C     1 
ATOM   3730  O O     . GLY A 1 455 ? -18.398 26.955  67.244  1.00 42.62  ? 453 GLY A O     1 
ATOM   3731  N N     . LYS A 1 456 ? -17.191 25.098  67.453  1.00 45.48  ? 454 LYS A N     1 
ATOM   3732  C CA    . LYS A 1 456 ? -17.138 25.222  68.898  1.00 43.50  ? 454 LYS A CA    1 
ATOM   3733  C C     . LYS A 1 456 ? -15.833 24.694  69.472  1.00 44.37  ? 454 LYS A C     1 
ATOM   3734  O O     . LYS A 1 456 ? -15.175 23.805  68.906  1.00 46.96  ? 454 LYS A O     1 
ATOM   3735  C CB    . LYS A 1 456 ? -18.359 24.576  69.565  1.00 44.53  ? 454 LYS A CB    1 
ATOM   3736  C CG    . LYS A 1 456 ? -18.565 23.117  69.221  1.00 50.99  ? 454 LYS A CG    1 
ATOM   3737  C CD    . LYS A 1 456 ? -19.807 22.542  69.902  1.00 55.53  ? 454 LYS A CD    1 
ATOM   3738  C CE    . LYS A 1 456 ? -21.099 23.151  69.377  1.00 56.13  ? 454 LYS A CE    1 
ATOM   3739  N NZ    . LYS A 1 456 ? -22.281 22.543  70.049  1.00 59.22  ? 454 LYS A NZ    1 
ATOM   3740  N N     . ALA A 1 457 ? -15.461 25.288  70.596  1.00 41.12  ? 455 ALA A N     1 
ATOM   3741  C CA    . ALA A 1 457 ? -14.195 25.022  71.246  1.00 35.56  ? 455 ALA A CA    1 
ATOM   3742  C C     . ALA A 1 457 ? -14.484 24.699  72.708  1.00 36.33  ? 455 ALA A C     1 
ATOM   3743  O O     . ALA A 1 457 ? -15.235 25.423  73.368  1.00 35.46  ? 455 ALA A O     1 
ATOM   3744  C CB    . ALA A 1 457 ? -13.330 26.265  71.149  1.00 32.71  ? 455 ALA A CB    1 
ATOM   3745  N N     . GLY A 1 458 ? -13.901 23.631  73.239  1.00 33.63  ? 456 GLY A N     1 
ATOM   3746  C CA    . GLY A 1 458 ? -14.150 23.343  74.639  1.00 31.11  ? 456 GLY A CA    1 
ATOM   3747  C C     . GLY A 1 458 ? -13.301 22.259  75.247  1.00 33.70  ? 456 GLY A C     1 
ATOM   3748  O O     . GLY A 1 458 ? -12.356 21.790  74.641  1.00 34.78  ? 456 GLY A O     1 
ATOM   3749  N N     . TYR A 1 459 ? -13.661 21.844  76.455  1.00 36.25  ? 457 TYR A N     1 
ATOM   3750  C CA    . TYR A 1 459 ? -12.832 20.923  77.218  1.00 33.85  ? 457 TYR A CA    1 
ATOM   3751  C C     . TYR A 1 459 ? -13.596 20.118  78.269  1.00 34.54  ? 457 TYR A C     1 
ATOM   3752  O O     . TYR A 1 459 ? -14.737 20.443  78.616  1.00 37.86  ? 457 TYR A O     1 
ATOM   3753  C CB    . TYR A 1 459 ? -11.704 21.701  77.885  1.00 30.10  ? 457 TYR A CB    1 
ATOM   3754  C CG    . TYR A 1 459 ? -12.164 22.698  78.911  1.00 29.44  ? 457 TYR A CG    1 
ATOM   3755  C CD1   . TYR A 1 459 ? -12.696 22.283  80.124  1.00 30.48  ? 457 TYR A CD1   1 
ATOM   3756  C CD2   . TYR A 1 459 ? -12.031 24.056  78.684  1.00 31.65  ? 457 TYR A CD2   1 
ATOM   3757  C CE1   . TYR A 1 459 ? -13.090 23.185  81.066  1.00 30.45  ? 457 TYR A CE1   1 
ATOM   3758  C CE2   . TYR A 1 459 ? -12.421 24.982  79.629  1.00 30.23  ? 457 TYR A CE2   1 
ATOM   3759  C CZ    . TYR A 1 459 ? -12.947 24.536  80.813  1.00 30.26  ? 457 TYR A CZ    1 
ATOM   3760  O OH    . TYR A 1 459 ? -13.329 25.446  81.742  1.00 29.44  ? 457 TYR A OH    1 
ATOM   3761  N N     . VAL A 1 460 ? -12.937 19.072  78.761  1.00 32.42  ? 458 VAL A N     1 
ATOM   3762  C CA    . VAL A 1 460 ? -13.425 18.230  79.850  1.00 35.34  ? 458 VAL A CA    1 
ATOM   3763  C C     . VAL A 1 460 ? -12.278 17.972  80.844  1.00 37.12  ? 458 VAL A C     1 
ATOM   3764  O O     . VAL A 1 460 ? -11.137 17.851  80.449  1.00 37.69  ? 458 VAL A O     1 
ATOM   3765  C CB    . VAL A 1 460 ? -13.884 16.860  79.315  1.00 38.68  ? 458 VAL A CB    1 
ATOM   3766  C CG1   . VAL A 1 460 ? -14.437 16.025  80.439  1.00 42.76  ? 458 VAL A CG1   1 
ATOM   3767  C CG2   . VAL A 1 460 ? -14.939 17.031  78.240  1.00 43.65  ? 458 VAL A CG2   1 
ATOM   3768  N N     . THR A 1 461 ? -12.553 17.873  82.135  1.00 35.35  ? 459 THR A N     1 
ATOM   3769  C CA    . THR A 1 461 ? -11.474 17.557  83.051  1.00 32.59  ? 459 THR A CA    1 
ATOM   3770  C C     . THR A 1 461 ? -11.760 16.355  83.937  1.00 35.46  ? 459 THR A C     1 
ATOM   3771  O O     . THR A 1 461 ? -12.869 15.849  84.001  1.00 38.38  ? 459 THR A O     1 
ATOM   3772  C CB    . THR A 1 461 ? -11.017 18.761  83.914  1.00 35.63  ? 459 THR A CB    1 
ATOM   3773  O OG1   . THR A 1 461 ? -11.654 18.719  85.190  1.00 37.34  ? 459 THR A OG1   1 
ATOM   3774  C CG2   . THR A 1 461 ? -11.271 20.095  83.229  1.00 32.33  ? 459 THR A CG2   1 
ATOM   3775  N N     . ASN A 1 462 ? -10.702 15.881  84.574  1.00 35.90  ? 460 ASN A N     1 
ATOM   3776  C CA    . ASN A 1 462 ? -10.722 14.745  85.471  1.00 35.53  ? 460 ASN A CA    1 
ATOM   3777  C C     . ASN A 1 462 ? -11.589 15.014  86.704  1.00 36.13  ? 460 ASN A C     1 
ATOM   3778  O O     . ASN A 1 462 ? -12.028 14.096  87.375  1.00 38.61  ? 460 ASN A O     1 
ATOM   3779  C CB    . ASN A 1 462 ? -9.273  14.404  85.872  1.00 35.56  ? 460 ASN A CB    1 
ATOM   3780  C CG    . ASN A 1 462 ? -8.569  15.546  86.648  1.00 37.43  ? 460 ASN A CG    1 
ATOM   3781  O OD1   . ASN A 1 462 ? -8.278  16.615  86.098  1.00 36.61  ? 460 ASN A OD1   1 
ATOM   3782  N ND2   . ASN A 1 462 ? -8.291  15.306  87.926  1.00 33.89  ? 460 ASN A ND2   1 
ATOM   3783  N N     . LYS A 1 463 ? -11.818 16.292  86.991  1.00 37.24  ? 461 LYS A N     1 
ATOM   3784  C CA    . LYS A 1 463 ? -12.598 16.728  88.141  1.00 38.58  ? 461 LYS A CA    1 
ATOM   3785  C C     . LYS A 1 463 ? -14.096 16.853  87.837  1.00 40.02  ? 461 LYS A C     1 
ATOM   3786  O O     . LYS A 1 463 ? -14.906 17.033  88.752  1.00 42.20  ? 461 LYS A O     1 
ATOM   3787  C CB    . LYS A 1 463 ? -12.081 18.076  88.645  1.00 40.96  ? 461 LYS A CB    1 
ATOM   3788  C CG    . LYS A 1 463 ? -10.863 17.985  89.555  1.00 44.98  ? 461 LYS A CG    1 
ATOM   3789  C CD    . LYS A 1 463 ? -10.507 19.392  90.087  1.00 52.48  ? 461 LYS A CD    1 
ATOM   3790  C CE    . LYS A 1 463 ? -9.215  19.428  90.922  1.00 60.10  ? 461 LYS A CE    1 
ATOM   3791  N NZ    . LYS A 1 463 ? -9.302  18.617  92.199  1.00 73.13  ? 461 LYS A NZ    1 
ATOM   3792  N N     . GLY A 1 464 ? -14.452 16.756  86.557  1.00 36.34  ? 462 GLY A N     1 
ATOM   3793  C CA    . GLY A 1 464 ? -15.829 16.825  86.132  1.00 36.95  ? 462 GLY A CA    1 
ATOM   3794  C C     . GLY A 1 464 ? -16.157 18.135  85.450  1.00 40.27  ? 462 GLY A C     1 
ATOM   3795  O O     . GLY A 1 464 ? -17.215 18.262  84.817  1.00 45.73  ? 462 GLY A O     1 
ATOM   3796  N N     . ARG A 1 465 ? -15.250 19.100  85.566  1.00 37.47  ? 463 ARG A N     1 
ATOM   3797  C CA    . ARG A 1 465 ? -15.434 20.429  85.000  1.00 35.55  ? 463 ARG A CA    1 
ATOM   3798  C C     . ARG A 1 465 ? -15.492 20.384  83.488  1.00 35.73  ? 463 ARG A C     1 
ATOM   3799  O O     . ARG A 1 465 ? -14.618 19.804  82.869  1.00 38.53  ? 463 ARG A O     1 
ATOM   3800  C CB    . ARG A 1 465 ? -14.293 21.331  85.436  1.00 32.54  ? 463 ARG A CB    1 
ATOM   3801  C CG    . ARG A 1 465 ? -14.094 22.546  84.586  1.00 34.06  ? 463 ARG A CG    1 
ATOM   3802  C CD    . ARG A 1 465 ? -12.856 23.299  85.043  1.00 39.25  ? 463 ARG A CD    1 
ATOM   3803  N NE    . ARG A 1 465 ? -12.564 22.946  86.429  1.00 42.99  ? 463 ARG A NE    1 
ATOM   3804  C CZ    . ARG A 1 465 ? -12.370 23.817  87.414  1.00 44.55  ? 463 ARG A CZ    1 
ATOM   3805  N NH1   . ARG A 1 465 ? -12.410 25.123  87.172  1.00 44.08  ? 463 ARG A NH1   1 
ATOM   3806  N NH2   . ARG A 1 465 ? -12.139 23.372  88.642  1.00 44.50  ? 463 ARG A NH2   1 
ATOM   3807  N N     . GLN A 1 466 ? -16.523 20.977  82.886  1.00 33.94  ? 464 GLN A N     1 
ATOM   3808  C CA    . GLN A 1 466 ? -16.614 21.041  81.429  1.00 33.37  ? 464 GLN A CA    1 
ATOM   3809  C C     . GLN A 1 466 ? -16.770 22.471  80.947  1.00 33.09  ? 464 GLN A C     1 
ATOM   3810  O O     . GLN A 1 466 ? -17.019 23.381  81.754  1.00 33.47  ? 464 GLN A O     1 
ATOM   3811  C CB    . GLN A 1 466 ? -17.744 20.174  80.910  1.00 33.28  ? 464 GLN A CB    1 
ATOM   3812  C CG    . GLN A 1 466 ? -17.761 18.807  81.566  1.00 43.35  ? 464 GLN A CG    1 
ATOM   3813  C CD    . GLN A 1 466 ? -18.669 17.809  80.860  1.00 55.80  ? 464 GLN A CD    1 
ATOM   3814  O OE1   . GLN A 1 466 ? -19.279 18.117  79.817  1.00 61.43  ? 464 GLN A OE1   1 
ATOM   3815  N NE2   . GLN A 1 466 ? -18.767 16.603  81.424  1.00 50.83  ? 464 GLN A NE2   1 
ATOM   3816  N N     . LYS A 1 467 ? -16.507 22.696  79.661  1.00 29.78  ? 465 LYS A N     1 
ATOM   3817  C CA    . LYS A 1 467 ? -16.942 23.936  79.025  1.00 29.63  ? 465 LYS A CA    1 
ATOM   3818  C C     . LYS A 1 467 ? -17.059 23.784  77.526  1.00 33.84  ? 465 LYS A C     1 
ATOM   3819  O O     . LYS A 1 467 ? -16.245 23.091  76.914  1.00 35.03  ? 465 LYS A O     1 
ATOM   3820  C CB    . LYS A 1 467 ? -15.989 25.061  79.366  1.00 28.35  ? 465 LYS A CB    1 
ATOM   3821  C CG    . LYS A 1 467 ? -16.125 26.331  78.608  1.00 25.56  ? 465 LYS A CG    1 
ATOM   3822  C CD    . LYS A 1 467 ? -15.904 27.384  79.646  1.00 26.62  ? 465 LYS A CD    1 
ATOM   3823  C CE    . LYS A 1 467 ? -15.227 28.598  79.087  1.00 29.34  ? 465 LYS A CE    1 
ATOM   3824  N NZ    . LYS A 1 467 ? -15.053 29.574  80.179  1.00 30.52  ? 465 LYS A NZ    1 
ATOM   3825  N N     . VAL A 1 468 ? -18.046 24.446  76.930  1.00 32.26  ? 466 VAL A N     1 
ATOM   3826  C CA    . VAL A 1 468 ? -18.153 24.501  75.479  1.00 34.14  ? 466 VAL A CA    1 
ATOM   3827  C C     . VAL A 1 468 ? -18.548 25.909  75.042  1.00 35.12  ? 466 VAL A C     1 
ATOM   3828  O O     . VAL A 1 468 ? -19.468 26.465  75.568  1.00 35.64  ? 466 VAL A O     1 
ATOM   3829  C CB    . VAL A 1 468 ? -19.133 23.497  74.891  1.00 27.57  ? 466 VAL A CB    1 
ATOM   3830  C CG1   . VAL A 1 468 ? -19.110 23.690  73.450  1.00 32.29  ? 466 VAL A CG1   1 
ATOM   3831  C CG2   . VAL A 1 468 ? -18.729 22.099  75.189  1.00 28.03  ? 466 VAL A CG2   1 
ATOM   3832  N N     . VAL A 1 469 ? -17.829 26.496  74.099  1.00 35.58  ? 467 VAL A N     1 
ATOM   3833  C CA    . VAL A 1 469 ? -18.097 27.861  73.704  1.00 34.63  ? 467 VAL A CA    1 
ATOM   3834  C C     . VAL A 1 469 ? -18.354 27.827  72.204  1.00 39.76  ? 467 VAL A C     1 
ATOM   3835  O O     . VAL A 1 469 ? -17.570 27.231  71.446  1.00 41.92  ? 467 VAL A O     1 
ATOM   3836  C CB    . VAL A 1 469 ? -16.845 28.757  74.019  1.00 34.99  ? 467 VAL A CB    1 
ATOM   3837  C CG1   . VAL A 1 469 ? -16.849 30.059  73.235  1.00 36.00  ? 467 VAL A CG1   1 
ATOM   3838  C CG2   . VAL A 1 469 ? -16.748 29.038  75.493  1.00 31.41  ? 467 VAL A CG2   1 
ATOM   3839  N N     . PRO A 1 470 ? -19.443 28.487  71.763  1.00 40.17  ? 468 PRO A N     1 
ATOM   3840  C CA    . PRO A 1 470 ? -19.796 28.578  70.351  1.00 39.13  ? 468 PRO A CA    1 
ATOM   3841  C C     . PRO A 1 470 ? -18.973 29.650  69.733  1.00 38.05  ? 468 PRO A C     1 
ATOM   3842  O O     . PRO A 1 470 ? -18.767 30.682  70.375  1.00 40.23  ? 468 PRO A O     1 
ATOM   3843  C CB    . PRO A 1 470 ? -21.268 29.003  70.384  1.00 36.38  ? 468 PRO A CB    1 
ATOM   3844  C CG    . PRO A 1 470 ? -21.721 28.765  71.801  1.00 38.32  ? 468 PRO A CG    1 
ATOM   3845  C CD    . PRO A 1 470 ? -20.506 29.056  72.605  1.00 42.76  ? 468 PRO A CD    1 
ATOM   3846  N N     . LEU A 1 471 ? -18.563 29.432  68.496  1.00 36.09  ? 469 LEU A N     1 
ATOM   3847  C CA    . LEU A 1 471 ? -17.701 30.364  67.791  1.00 42.90  ? 469 LEU A CA    1 
ATOM   3848  C C     . LEU A 1 471 ? -18.171 30.548  66.355  1.00 48.73  ? 469 LEU A C     1 
ATOM   3849  O O     . LEU A 1 471 ? -18.594 29.599  65.670  1.00 46.75  ? 469 LEU A O     1 
ATOM   3850  C CB    . LEU A 1 471 ? -16.236 29.884  67.790  1.00 44.52  ? 469 LEU A CB    1 
ATOM   3851  C CG    . LEU A 1 471 ? -15.548 29.382  69.061  1.00 39.50  ? 469 LEU A CG    1 
ATOM   3852  C CD1   . LEU A 1 471 ? -14.729 28.154  68.723  1.00 38.99  ? 469 LEU A CD1   1 
ATOM   3853  C CD2   . LEU A 1 471 ? -14.725 30.462  69.730  1.00 28.51  ? 469 LEU A CD2   1 
ATOM   3854  N N     . THR A 1 472 ? -18.056 31.786  65.897  1.00 52.43  ? 470 THR A N     1 
ATOM   3855  C CA    . THR A 1 472 ? -18.506 32.147  64.568  1.00 56.21  ? 470 THR A CA    1 
ATOM   3856  C C     . THR A 1 472 ? -17.356 32.487  63.613  1.00 55.52  ? 470 THR A C     1 
ATOM   3857  O O     . THR A 1 472 ? -16.386 33.135  63.976  1.00 55.86  ? 470 THR A O     1 
ATOM   3858  C CB    . THR A 1 472 ? -19.532 33.305  64.638  1.00 57.36  ? 470 THR A CB    1 
ATOM   3859  O OG1   . THR A 1 472 ? -18.942 34.446  65.288  1.00 58.24  ? 470 THR A OG1   1 
ATOM   3860  C CG2   . THR A 1 472 ? -20.774 32.856  65.416  1.00 50.04  ? 470 THR A CG2   1 
ATOM   3861  N N     . ASN A 1 473 ? -17.474 32.027  62.382  1.00 61.61  ? 471 ASN A N     1 
ATOM   3862  C CA    . ASN A 1 473 ? -16.533 32.423  61.353  1.00 64.81  ? 471 ASN A CA    1 
ATOM   3863  C C     . ASN A 1 473 ? -15.105 32.066  61.740  1.00 63.08  ? 471 ASN A C     1 
ATOM   3864  O O     . ASN A 1 473 ? -14.296 32.928  62.094  1.00 60.86  ? 471 ASN A O     1 
ATOM   3865  C CB    . ASN A 1 473 ? -16.660 33.907  61.045  1.00 71.29  ? 471 ASN A CB    1 
ATOM   3866  C CG    . ASN A 1 473 ? -16.021 34.260  59.724  1.00 83.68  ? 471 ASN A CG    1 
ATOM   3867  O OD1   . ASN A 1 473 ? -16.158 33.449  58.772  1.00 81.90  ? 471 ASN A OD1   1 
ATOM   3868  N ND2   . ASN A 1 473 ? -15.363 35.325  59.645  1.00 91.31  ? 471 ASN A ND2   1 
ATOM   3869  N N     . THR A 1 474 ? -14.821 30.771  61.677  1.00 61.60  ? 472 THR A N     1 
ATOM   3870  C CA    . THR A 1 474 ? -13.601 30.224  62.218  1.00 51.23  ? 472 THR A CA    1 
ATOM   3871  C C     . THR A 1 474 ? -13.188 29.019  61.404  1.00 51.76  ? 472 THR A C     1 
ATOM   3872  O O     . THR A 1 474 ? -13.894 28.600  60.480  1.00 53.34  ? 472 THR A O     1 
ATOM   3873  C CB    . THR A 1 474 ? -13.841 29.779  63.665  1.00 49.48  ? 472 THR A CB    1 
ATOM   3874  O OG1   . THR A 1 474 ? -12.606 29.770  64.389  1.00 48.22  ? 472 THR A OG1   1 
ATOM   3875  C CG2   . THR A 1 474 ? -14.485 28.414  63.701  1.00 47.23  ? 472 THR A CG2   1 
ATOM   3876  N N     . THR A 1 475 ? -12.040 28.454  61.765  1.00 49.52  ? 473 THR A N     1 
ATOM   3877  C CA    . THR A 1 475 ? -11.507 27.273  61.093  1.00 45.81  ? 473 THR A CA    1 
ATOM   3878  C C     . THR A 1 475 ? -11.178 26.192  62.100  1.00 41.69  ? 473 THR A C     1 
ATOM   3879  O O     . THR A 1 475 ? -11.146 26.428  63.296  1.00 39.41  ? 473 THR A O     1 
ATOM   3880  C CB    . THR A 1 475 ? -10.241 27.596  60.323  1.00 45.65  ? 473 THR A CB    1 
ATOM   3881  O OG1   . THR A 1 475 ? -9.114  27.068  61.031  1.00 46.40  ? 473 THR A OG1   1 
ATOM   3882  C CG2   . THR A 1 475 ? -10.094 29.105  60.180  1.00 45.27  ? 473 THR A CG2   1 
ATOM   3883  N N     . ASN A 1 476 ? -10.956 24.997  61.590  1.00 41.93  ? 474 ASN A N     1 
ATOM   3884  C CA    . ASN A 1 476 ? -10.636 23.844  62.410  1.00 45.43  ? 474 ASN A CA    1 
ATOM   3885  C C     . ASN A 1 476 ? -9.408  24.031  63.339  1.00 41.86  ? 474 ASN A C     1 
ATOM   3886  O O     . ASN A 1 476 ? -9.458  23.773  64.539  1.00 38.08  ? 474 ASN A O     1 
ATOM   3887  C CB    . ASN A 1 476 ? -10.454 22.644  61.488  1.00 46.77  ? 474 ASN A CB    1 
ATOM   3888  C CG    . ASN A 1 476 ? -11.247 21.467  61.938  1.00 54.85  ? 474 ASN A CG    1 
ATOM   3889  O OD1   . ASN A 1 476 ? -11.157 21.062  63.102  1.00 57.28  ? 474 ASN A OD1   1 
ATOM   3890  N ND2   . ASN A 1 476 ? -12.052 20.912  61.038  1.00 62.36  ? 474 ASN A ND2   1 
ATOM   3891  N N     . GLN A 1 477 ? -8.313  24.486  62.753  1.00 41.71  ? 475 GLN A N     1 
ATOM   3892  C CA    . GLN A 1 477 ? -7.137  24.929  63.487  1.00 40.06  ? 475 GLN A CA    1 
ATOM   3893  C C     . GLN A 1 477 ? -7.448  25.975  64.569  1.00 36.64  ? 475 GLN A C     1 
ATOM   3894  O O     . GLN A 1 477 ? -7.177  25.727  65.733  1.00 35.65  ? 475 GLN A O     1 
ATOM   3895  C CB    . GLN A 1 477 ? -6.088  25.463  62.501  1.00 38.44  ? 475 GLN A CB    1 
ATOM   3896  C CG    . GLN A 1 477 ? -5.479  24.389  61.608  1.00 40.18  ? 475 GLN A CG    1 
ATOM   3897  C CD    . GLN A 1 477 ? -6.236  24.144  60.274  1.00 49.60  ? 475 GLN A CD    1 
ATOM   3898  O OE1   . GLN A 1 477 ? -7.454  24.054  60.224  1.00 45.40  ? 475 GLN A OE1   1 
ATOM   3899  N NE2   . GLN A 1 477 ? -5.476  24.010  59.195  1.00 57.67  ? 475 GLN A NE2   1 
ATOM   3900  N N     . LYS A 1 478 ? -8.049  27.108  64.207  1.00 35.54  ? 476 LYS A N     1 
ATOM   3901  C CA    . LYS A 1 478 ? -8.321  28.165  65.194  1.00 36.12  ? 476 LYS A CA    1 
ATOM   3902  C C     . LYS A 1 478 ? -9.096  27.673  66.416  1.00 34.83  ? 476 LYS A C     1 
ATOM   3903  O O     . LYS A 1 478 ? -8.952  28.219  67.507  1.00 33.71  ? 476 LYS A O     1 
ATOM   3904  C CB    . LYS A 1 478 ? -9.091  29.348  64.590  1.00 37.50  ? 476 LYS A CB    1 
ATOM   3905  C CG    . LYS A 1 478 ? -8.514  29.926  63.352  1.00 39.95  ? 476 LYS A CG    1 
ATOM   3906  C CD    . LYS A 1 478 ? -9.015  31.341  63.133  1.00 42.13  ? 476 LYS A CD    1 
ATOM   3907  C CE    . LYS A 1 478 ? -8.529  31.844  61.782  1.00 44.45  ? 476 LYS A CE    1 
ATOM   3908  N NZ    . LYS A 1 478 ? -8.706  33.291  61.589  1.00 43.19  ? 476 LYS A NZ    1 
ATOM   3909  N N     . THR A 1 479 ? -9.952  26.683  66.230  1.00 32.01  ? 477 THR A N     1 
ATOM   3910  C CA    . THR A 1 479 ? -10.724 26.170  67.349  1.00 35.01  ? 477 THR A CA    1 
ATOM   3911  C C     . THR A 1 479 ? -9.832  25.314  68.235  1.00 33.47  ? 477 THR A C     1 
ATOM   3912  O O     . THR A 1 479 ? -10.053 25.196  69.441  1.00 31.55  ? 477 THR A O     1 
ATOM   3913  C CB    . THR A 1 479 ? -12.028 25.354  66.919  1.00 40.47  ? 477 THR A CB    1 
ATOM   3914  O OG1   . THR A 1 479 ? -11.690 24.126  66.247  1.00 35.37  ? 477 THR A OG1   1 
ATOM   3915  C CG2   . THR A 1 479 ? -12.915 26.194  66.032  1.00 41.75  ? 477 THR A CG2   1 
ATOM   3916  N N     . GLU A 1 480 ? -8.824  24.697  67.642  1.00 32.21  ? 478 GLU A N     1 
ATOM   3917  C CA    . GLU A 1 480 ? -7.972  23.853  68.451  1.00 35.49  ? 478 GLU A CA    1 
ATOM   3918  C C     . GLU A 1 480 ? -7.043  24.736  69.308  1.00 29.35  ? 478 GLU A C     1 
ATOM   3919  O O     . GLU A 1 480 ? -6.833  24.459  70.501  1.00 25.67  ? 478 GLU A O     1 
ATOM   3920  C CB    . GLU A 1 480 ? -7.237  22.820  67.606  1.00 33.28  ? 478 GLU A CB    1 
ATOM   3921  C CG    . GLU A 1 480 ? -8.137  21.769  67.031  1.00 35.70  ? 478 GLU A CG    1 
ATOM   3922  C CD    . GLU A 1 480 ? -7.609  21.249  65.673  1.00 47.96  ? 478 GLU A CD    1 
ATOM   3923  O OE1   . GLU A 1 480 ? -6.692  21.899  65.101  1.00 45.64  ? 478 GLU A OE1   1 
ATOM   3924  O OE2   . GLU A 1 480 ? -8.095  20.196  65.176  1.00 52.12  ? 478 GLU A OE2   1 
ATOM   3925  N N     . LEU A 1 481 ? -6.533  25.808  68.711  1.00 25.75  ? 479 LEU A N     1 
ATOM   3926  C CA    . LEU A 1 481 ? -5.890  26.852  69.489  1.00 26.05  ? 479 LEU A CA    1 
ATOM   3927  C C     . LEU A 1 481 ? -6.851  27.396  70.538  1.00 28.59  ? 479 LEU A C     1 
ATOM   3928  O O     . LEU A 1 481 ? -6.504  27.577  71.695  1.00 30.30  ? 479 LEU A O     1 
ATOM   3929  C CB    . LEU A 1 481 ? -5.378  27.964  68.593  1.00 24.91  ? 479 LEU A CB    1 
ATOM   3930  C CG    . LEU A 1 481 ? -4.108  27.590  67.840  1.00 25.59  ? 479 LEU A CG    1 
ATOM   3931  C CD1   . LEU A 1 481 ? -3.705  28.681  66.858  1.00 23.13  ? 479 LEU A CD1   1 
ATOM   3932  C CD2   . LEU A 1 481 ? -2.986  27.258  68.809  1.00 22.59  ? 479 LEU A CD2   1 
ATOM   3933  N N     . GLN A 1 482 ? -8.084  27.607  70.120  1.00 29.85  ? 480 GLN A N     1 
ATOM   3934  C CA    . GLN A 1 482 ? -9.115  28.214  70.932  1.00 27.12  ? 480 GLN A CA    1 
ATOM   3935  C C     . GLN A 1 482 ? -9.446  27.425  72.195  1.00 27.07  ? 480 GLN A C     1 
ATOM   3936  O O     . GLN A 1 482 ? -9.692  28.013  73.243  1.00 27.25  ? 480 GLN A O     1 
ATOM   3937  C CB    . GLN A 1 482 ? -10.358 28.415  70.054  1.00 30.36  ? 480 GLN A CB    1 
ATOM   3938  C CG    . GLN A 1 482 ? -11.381 29.359  70.625  1.00 30.22  ? 480 GLN A CG    1 
ATOM   3939  C CD    . GLN A 1 482 ? -10.818 30.747  70.761  1.00 30.88  ? 480 GLN A CD    1 
ATOM   3940  O OE1   . GLN A 1 482 ? -10.240 31.271  69.808  1.00 27.75  ? 480 GLN A OE1   1 
ATOM   3941  N NE2   . GLN A 1 482 ? -10.967 31.349  71.951  1.00 27.34  ? 480 GLN A NE2   1 
ATOM   3942  N N     . ALA A 1 483 ? -9.467  26.098  72.086  1.00 26.95  ? 481 ALA A N     1 
ATOM   3943  C CA    . ALA A 1 483 ? -9.698  25.216  73.239  1.00 29.83  ? 481 ALA A CA    1 
ATOM   3944  C C     . ALA A 1 483 ? -8.551  25.227  74.289  1.00 28.90  ? 481 ALA A C     1 
ATOM   3945  O O     . ALA A 1 483 ? -8.797  25.212  75.494  1.00 27.89  ? 481 ALA A O     1 
ATOM   3946  C CB    . ALA A 1 483 ? -9.989  23.791  72.777  1.00 27.99  ? 481 ALA A CB    1 
ATOM   3947  N N     . ILE A 1 484 ? -7.310  25.235  73.815  1.00 26.68  ? 482 ILE A N     1 
ATOM   3948  C CA    . ILE A 1 484 ? -6.146  25.320  74.682  1.00 29.40  ? 482 ILE A CA    1 
ATOM   3949  C C     . ILE A 1 484 ? -6.222  26.652  75.442  1.00 29.25  ? 482 ILE A C     1 
ATOM   3950  O O     . ILE A 1 484 ? -6.024  26.705  76.657  1.00 27.01  ? 482 ILE A O     1 
ATOM   3951  C CB    . ILE A 1 484 ? -4.797  25.156  73.864  1.00 28.29  ? 482 ILE A CB    1 
ATOM   3952  C CG1   . ILE A 1 484 ? -4.646  23.706  73.384  1.00 22.36  ? 482 ILE A CG1   1 
ATOM   3953  C CG2   . ILE A 1 484 ? -3.569  25.591  74.695  1.00 23.90  ? 482 ILE A CG2   1 
ATOM   3954  C CD1   . ILE A 1 484 ? -3.663  23.512  72.300  1.00 18.48  ? 482 ILE A CD1   1 
ATOM   3955  N N     . TYR A 1 485 ? -6.551  27.713  74.721  1.00 26.13  ? 483 TYR A N     1 
ATOM   3956  C CA    . TYR A 1 485 ? -6.767  28.986  75.347  1.00 26.23  ? 483 TYR A CA    1 
ATOM   3957  C C     . TYR A 1 485 ? -7.751  28.897  76.510  1.00 30.71  ? 483 TYR A C     1 
ATOM   3958  O O     . TYR A 1 485 ? -7.452  29.398  77.598  1.00 33.03  ? 483 TYR A O     1 
ATOM   3959  C CB    . TYR A 1 485 ? -7.260  29.990  74.336  1.00 28.36  ? 483 TYR A CB    1 
ATOM   3960  C CG    . TYR A 1 485 ? -7.354  31.378  74.890  1.00 32.86  ? 483 TYR A CG    1 
ATOM   3961  C CD1   . TYR A 1 485 ? -6.561  31.777  75.952  1.00 36.42  ? 483 TYR A CD1   1 
ATOM   3962  C CD2   . TYR A 1 485 ? -8.231  32.295  74.354  1.00 36.63  ? 483 TYR A CD2   1 
ATOM   3963  C CE1   . TYR A 1 485 ? -6.639  33.075  76.459  1.00 42.26  ? 483 TYR A CE1   1 
ATOM   3964  C CE2   . TYR A 1 485 ? -8.321  33.589  74.852  1.00 41.50  ? 483 TYR A CE2   1 
ATOM   3965  C CZ    . TYR A 1 485 ? -7.526  33.979  75.899  1.00 42.29  ? 483 TYR A CZ    1 
ATOM   3966  O OH    . TYR A 1 485 ? -7.632  35.262  76.390  1.00 42.24  ? 483 TYR A OH    1 
ATOM   3967  N N     . LEU A 1 486 ? -8.917  28.277  76.299  1.00 27.46  ? 484 LEU A N     1 
ATOM   3968  C CA    . LEU A 1 486 ? -9.888  28.127  77.382  1.00 26.78  ? 484 LEU A CA    1 
ATOM   3969  C C     . LEU A 1 486 ? -9.261  27.413  78.559  1.00 31.19  ? 484 LEU A C     1 
ATOM   3970  O O     . LEU A 1 486 ? -9.310  27.915  79.681  1.00 32.01  ? 484 LEU A O     1 
ATOM   3971  C CB    . LEU A 1 486 ? -11.137 27.368  76.948  1.00 26.65  ? 484 LEU A CB    1 
ATOM   3972  C CG    . LEU A 1 486 ? -11.979 27.955  75.813  1.00 28.91  ? 484 LEU A CG    1 
ATOM   3973  C CD1   . LEU A 1 486 ? -12.982 26.920  75.298  1.00 27.43  ? 484 LEU A CD1   1 
ATOM   3974  C CD2   . LEU A 1 486 ? -12.634 29.274  76.216  1.00 22.48  ? 484 LEU A CD2   1 
ATOM   3975  N N     . ALA A 1 487 ? -8.670  26.242  78.307  1.00 30.05  ? 485 ALA A N     1 
ATOM   3976  C CA    . ALA A 1 487 ? -8.037  25.446  79.359  1.00 29.81  ? 485 ALA A CA    1 
ATOM   3977  C C     . ALA A 1 487 ? -6.986  26.196  80.189  1.00 29.35  ? 485 ALA A C     1 
ATOM   3978  O O     . ALA A 1 487 ? -6.870  25.955  81.390  1.00 29.23  ? 485 ALA A O     1 
ATOM   3979  C CB    . ALA A 1 487 ? -7.461  24.170  78.785  1.00 29.21  ? 485 ALA A CB    1 
ATOM   3980  N N     . LEU A 1 488 ? -6.234  27.095  79.553  1.00 27.50  ? 486 LEU A N     1 
ATOM   3981  C CA    . LEU A 1 488 ? -5.322  27.979  80.283  1.00 29.17  ? 486 LEU A CA    1 
ATOM   3982  C C     . LEU A 1 488 ? -6.092  28.920  81.196  1.00 29.28  ? 486 LEU A C     1 
ATOM   3983  O O     . LEU A 1 488 ? -5.819  28.986  82.395  1.00 28.82  ? 486 LEU A O     1 
ATOM   3984  C CB    . LEU A 1 488 ? -4.369  28.770  79.358  1.00 27.08  ? 486 LEU A CB    1 
ATOM   3985  C CG    . LEU A 1 488 ? -3.515  27.895  78.436  1.00 26.63  ? 486 LEU A CG    1 
ATOM   3986  C CD1   . LEU A 1 488 ? -2.602  28.674  77.546  1.00 23.58  ? 486 LEU A CD1   1 
ATOM   3987  C CD2   . LEU A 1 488 ? -2.766  26.842  79.242  1.00 26.24  ? 486 LEU A CD2   1 
ATOM   3988  N N     . GLN A 1 489 ? -7.064  29.635  80.637  1.00 31.18  ? 487 GLN A N     1 
ATOM   3989  C CA    . GLN A 1 489 ? -7.889  30.560  81.428  1.00 31.33  ? 487 GLN A CA    1 
ATOM   3990  C C     . GLN A 1 489 ? -8.589  29.929  82.648  1.00 31.36  ? 487 GLN A C     1 
ATOM   3991  O O     . GLN A 1 489 ? -8.675  30.534  83.706  1.00 30.93  ? 487 GLN A O     1 
ATOM   3992  C CB    . GLN A 1 489 ? -8.939  31.199  80.551  1.00 28.51  ? 487 GLN A CB    1 
ATOM   3993  C CG    . GLN A 1 489 ? -8.405  31.987  79.409  1.00 34.40  ? 487 GLN A CG    1 
ATOM   3994  C CD    . GLN A 1 489 ? -9.542  32.617  78.600  1.00 42.32  ? 487 GLN A CD    1 
ATOM   3995  O OE1   . GLN A 1 489 ? -10.673 32.102  78.594  1.00 43.34  ? 487 GLN A OE1   1 
ATOM   3996  N NE2   . GLN A 1 489 ? -9.259  33.746  77.941  1.00 38.79  ? 487 GLN A NE2   1 
ATOM   3997  N N     . ASP A 1 490 ? -9.090  28.712  82.495  1.00 30.48  ? 488 ASP A N     1 
ATOM   3998  C CA    . ASP A 1 490 ? -9.944  28.132  83.509  1.00 29.84  ? 488 ASP A CA    1 
ATOM   3999  C C     . ASP A 1 490 ? -9.182  27.261  84.491  1.00 29.82  ? 488 ASP A C     1 
ATOM   4000  O O     . ASP A 1 490 ? -9.753  26.669  85.394  1.00 32.99  ? 488 ASP A O     1 
ATOM   4001  C CB    . ASP A 1 490 ? -11.085 27.350  82.854  1.00 30.42  ? 488 ASP A CB    1 
ATOM   4002  C CG    . ASP A 1 490 ? -11.986 28.226  81.998  1.00 30.53  ? 488 ASP A CG    1 
ATOM   4003  O OD1   . ASP A 1 490 ? -11.965 29.466  82.149  1.00 29.82  ? 488 ASP A OD1   1 
ATOM   4004  O OD2   . ASP A 1 490 ? -12.719 27.653  81.172  1.00 29.94  ? 488 ASP A OD2   1 
ATOM   4005  N N     . SER A 1 491 ? -7.874  27.233  84.359  1.00 30.37  ? 489 SER A N     1 
ATOM   4006  C CA    . SER A 1 491 ? -7.068  26.311  85.133  1.00 30.05  ? 489 SER A CA    1 
ATOM   4007  C C     . SER A 1 491 ? -6.299  27.074  86.205  1.00 29.55  ? 489 SER A C     1 
ATOM   4008  O O     . SER A 1 491 ? -6.191  28.310  86.159  1.00 30.90  ? 489 SER A O     1 
ATOM   4009  C CB    . SER A 1 491 ? -6.094  25.583  84.215  1.00 31.59  ? 489 SER A CB    1 
ATOM   4010  O OG    . SER A 1 491 ? -5.187  26.496  83.622  1.00 29.91  ? 489 SER A OG    1 
ATOM   4011  N N     . GLY A 1 492 ? -5.854  26.364  87.229  1.00 27.35  ? 490 GLY A N     1 
ATOM   4012  C CA    . GLY A 1 492 ? -4.965  26.986  88.186  1.00 31.50  ? 490 GLY A CA    1 
ATOM   4013  C C     . GLY A 1 492 ? -3.557  27.200  87.643  1.00 37.20  ? 490 GLY A C     1 
ATOM   4014  O O     . GLY A 1 492 ? -3.269  26.936  86.467  1.00 35.37  ? 490 GLY A O     1 
ATOM   4015  N N     . LEU A 1 493 ? -2.668  27.652  88.526  1.00 40.11  ? 491 LEU A N     1 
ATOM   4016  C CA    . LEU A 1 493 ? -1.250  27.869  88.210  1.00 39.35  ? 491 LEU A CA    1 
ATOM   4017  C C     . LEU A 1 493 ? -0.445  26.658  87.696  1.00 36.99  ? 491 LEU A C     1 
ATOM   4018  O O     . LEU A 1 493 ? 0.504   26.825  86.949  1.00 38.45  ? 491 LEU A O     1 
ATOM   4019  C CB    . LEU A 1 493 ? -0.543  28.478  89.408  1.00 44.28  ? 491 LEU A CB    1 
ATOM   4020  C CG    . LEU A 1 493 ? -0.827  29.944  89.645  1.00 48.48  ? 491 LEU A CG    1 
ATOM   4021  C CD1   . LEU A 1 493 ? 0.077   30.411  90.759  1.00 62.33  ? 491 LEU A CD1   1 
ATOM   4022  C CD2   . LEU A 1 493 ? -0.538  30.681  88.377  1.00 44.45  ? 491 LEU A CD2   1 
ATOM   4023  N N     . GLU A 1 494 ? -0.802  25.448  88.086  1.00 34.23  ? 492 GLU A N     1 
ATOM   4024  C CA    . GLU A 1 494 ? -0.247  24.298  87.401  1.00 35.47  ? 492 GLU A CA    1 
ATOM   4025  C C     . GLU A 1 494 ? -1.396  23.620  86.653  1.00 36.40  ? 492 GLU A C     1 
ATOM   4026  O O     . GLU A 1 494 ? -2.512  23.610  87.147  1.00 35.52  ? 492 GLU A O     1 
ATOM   4027  C CB    . GLU A 1 494 ? 0.405   23.353  88.393  1.00 37.12  ? 492 GLU A CB    1 
ATOM   4028  C CG    . GLU A 1 494 ? 1.271   24.050  89.404  1.00 45.56  ? 492 GLU A CG    1 
ATOM   4029  C CD    . GLU A 1 494 ? 1.872   23.097  90.400  1.00 55.06  ? 492 GLU A CD    1 
ATOM   4030  O OE1   . GLU A 1 494 ? 1.263   22.025  90.619  1.00 54.37  ? 492 GLU A OE1   1 
ATOM   4031  O OE2   . GLU A 1 494 ? 2.955   23.420  90.950  1.00 62.15  ? 492 GLU A OE2   1 
ATOM   4032  N N     . VAL A 1 495 ? -1.142  23.143  85.432  1.00 34.53  ? 493 VAL A N     1 
ATOM   4033  C CA    . VAL A 1 495 ? -2.159  22.446  84.634  1.00 32.29  ? 493 VAL A CA    1 
ATOM   4034  C C     . VAL A 1 495 ? -1.567  21.483  83.594  1.00 30.73  ? 493 VAL A C     1 
ATOM   4035  O O     . VAL A 1 495 ? -0.567  21.788  82.952  1.00 31.70  ? 493 VAL A O     1 
ATOM   4036  C CB    . VAL A 1 495 ? -3.106  23.481  83.934  1.00 31.09  ? 493 VAL A CB    1 
ATOM   4037  C CG1   . VAL A 1 495 ? -2.333  24.337  82.941  1.00 30.92  ? 493 VAL A CG1   1 
ATOM   4038  C CG2   . VAL A 1 495 ? -4.278  22.822  83.264  1.00 28.03  ? 493 VAL A CG2   1 
ATOM   4039  N N     . ASN A 1 496 ? -2.210  20.337  83.403  1.00 29.82  ? 494 ASN A N     1 
ATOM   4040  C CA    . ASN A 1 496 ? -1.922  19.486  82.252  1.00 28.21  ? 494 ASN A CA    1 
ATOM   4041  C C     . ASN A 1 496 ? -3.004  19.661  81.207  1.00 30.86  ? 494 ASN A C     1 
ATOM   4042  O O     . ASN A 1 496 ? -4.181  19.700  81.527  1.00 31.71  ? 494 ASN A O     1 
ATOM   4043  C CB    . ASN A 1 496 ? -1.861  18.023  82.660  1.00 32.05  ? 494 ASN A CB    1 
ATOM   4044  C CG    . ASN A 1 496 ? -1.048  17.814  83.900  1.00 36.13  ? 494 ASN A CG    1 
ATOM   4045  O OD1   . ASN A 1 496 ? 0.176   17.951  83.884  1.00 35.98  ? 494 ASN A OD1   1 
ATOM   4046  N ND2   . ASN A 1 496 ? -1.716  17.499  84.992  1.00 35.66  ? 494 ASN A ND2   1 
ATOM   4047  N N     . ILE A 1 497 ? -2.595  19.769  79.954  1.00 26.32  ? 495 ILE A N     1 
ATOM   4048  C CA    . ILE A 1 497 ? -3.507  19.912  78.851  1.00 25.50  ? 495 ILE A CA    1 
ATOM   4049  C C     . ILE A 1 497 ? -3.284  18.768  77.854  1.00 27.33  ? 495 ILE A C     1 
ATOM   4050  O O     . ILE A 1 497 ? -2.181  18.518  77.466  1.00 28.94  ? 495 ILE A O     1 
ATOM   4051  C CB    . ILE A 1 497 ? -3.326  21.289  78.222  1.00 24.91  ? 495 ILE A CB    1 
ATOM   4052  C CG1   . ILE A 1 497 ? -3.568  22.362  79.302  1.00 23.16  ? 495 ILE A CG1   1 
ATOM   4053  C CG2   . ILE A 1 497 ? -4.191  21.431  76.929  1.00 23.55  ? 495 ILE A CG2   1 
ATOM   4054  C CD1   . ILE A 1 497 ? -3.416  23.791  78.823  1.00 21.75  ? 495 ILE A CD1   1 
ATOM   4055  N N     . VAL A 1 498 ? -4.337  18.042  77.492  1.00 25.96  ? 496 VAL A N     1 
ATOM   4056  C CA    . VAL A 1 498 ? -4.264  17.037  76.438  1.00 27.76  ? 496 VAL A CA    1 
ATOM   4057  C C     . VAL A 1 498 ? -4.948  17.553  75.158  1.00 29.35  ? 496 VAL A C     1 
ATOM   4058  O O     . VAL A 1 498 ? -6.129  17.847  75.153  1.00 33.30  ? 496 VAL A O     1 
ATOM   4059  C CB    . VAL A 1 498 ? -4.873  15.671  76.877  1.00 29.79  ? 496 VAL A CB    1 
ATOM   4060  C CG1   . VAL A 1 498 ? -4.761  14.642  75.762  1.00 31.48  ? 496 VAL A CG1   1 
ATOM   4061  C CG2   . VAL A 1 498 ? -4.190  15.157  78.081  1.00 30.42  ? 496 VAL A CG2   1 
ATOM   4062  N N     . THR A 1 499 ? -4.189  17.665  74.081  1.00 24.73  ? 497 THR A N     1 
ATOM   4063  C CA    . THR A 1 499 ? -4.700  18.165  72.824  1.00 25.65  ? 497 THR A CA    1 
ATOM   4064  C C     . THR A 1 499 ? -4.452  17.089  71.795  1.00 30.30  ? 497 THR A C     1 
ATOM   4065  O O     . THR A 1 499 ? -3.540  16.306  71.935  1.00 30.92  ? 497 THR A O     1 
ATOM   4066  C CB    . THR A 1 499 ? -3.985  19.462  72.393  1.00 27.48  ? 497 THR A CB    1 
ATOM   4067  O OG1   . THR A 1 499 ? -4.492  19.909  71.146  1.00 25.39  ? 497 THR A OG1   1 
ATOM   4068  C CG2   . THR A 1 499 ? -2.499  19.230  72.217  1.00 29.42  ? 497 THR A CG2   1 
ATOM   4069  N N     . ASN A 1 500 ? -5.332  16.970  70.816  1.00 31.61  ? 498 ASN A N     1 
ATOM   4070  C CA    . ASN A 1 500 ? -5.033  16.129  69.666  1.00 33.37  ? 498 ASN A CA    1 
ATOM   4071  C C     . ASN A 1 500 ? -4.605  16.913  68.440  1.00 31.51  ? 498 ASN A C     1 
ATOM   4072  O O     . ASN A 1 500 ? -4.456  16.342  67.371  1.00 32.37  ? 498 ASN A O     1 
ATOM   4073  C CB    . ASN A 1 500 ? -6.076  15.020  69.391  1.00 37.59  ? 498 ASN A CB    1 
ATOM   4074  C CG    . ASN A 1 500 ? -7.303  15.521  68.672  1.00 39.03  ? 498 ASN A CG    1 
ATOM   4075  O OD1   . ASN A 1 500 ? -7.241  15.833  67.490  1.00 38.44  ? 498 ASN A OD1   1 
ATOM   4076  N ND2   . ASN A 1 500 ? -8.431  15.572  69.372  1.00 36.69  ? 498 ASN A ND2   1 
ATOM   4077  N N     . SER A 1 501 ? -4.417  18.220  68.604  1.00 29.50  ? 499 SER A N     1 
ATOM   4078  C CA    . SER A 1 501 ? -4.031  19.054  67.475  1.00 31.21  ? 499 SER A CA    1 
ATOM   4079  C C     . SER A 1 501 ? -2.517  19.143  67.338  1.00 31.93  ? 499 SER A C     1 
ATOM   4080  O O     . SER A 1 501 ? -1.864  19.895  68.051  1.00 30.70  ? 499 SER A O     1 
ATOM   4081  C CB    . SER A 1 501 ? -4.581  20.462  67.659  1.00 27.59  ? 499 SER A CB    1 
ATOM   4082  O OG    . SER A 1 501 ? -4.198  21.306  66.605  1.00 27.11  ? 499 SER A OG    1 
ATOM   4083  N N     . GLN A 1 502 ? -1.995  18.419  66.343  1.00 34.06  ? 500 GLN A N     1 
ATOM   4084  C CA    . GLN A 1 502 ? -0.602  18.491  65.932  1.00 35.08  ? 500 GLN A CA    1 
ATOM   4085  C C     . GLN A 1 502 ? -0.207  19.905  65.514  1.00 32.28  ? 500 GLN A C     1 
ATOM   4086  O O     . GLN A 1 502 ? 0.901   20.365  65.824  1.00 29.96  ? 500 GLN A O     1 
ATOM   4087  C CB    . GLN A 1 502 ? -0.355  17.535  64.773  1.00 40.26  ? 500 GLN A CB    1 
ATOM   4088  C CG    . GLN A 1 502 ? 0.399   16.284  65.163  1.00 50.09  ? 500 GLN A CG    1 
ATOM   4089  C CD    . GLN A 1 502 ? 0.790   15.453  63.969  1.00 61.23  ? 500 GLN A CD    1 
ATOM   4090  O OE1   . GLN A 1 502 ? 1.970   15.365  63.626  1.00 70.84  ? 500 GLN A OE1   1 
ATOM   4091  N NE2   . GLN A 1 502 ? -0.197  14.832  63.325  1.00 63.49  ? 500 GLN A NE2   1 
ATOM   4092  N N     . TYR A 1 503 ? -1.112  20.577  64.799  1.00 29.77  ? 501 TYR A N     1 
ATOM   4093  C CA    . TYR A 1 503 ? -0.935  21.984  64.462  1.00 29.44  ? 501 TYR A CA    1 
ATOM   4094  C C     . TYR A 1 503 ? -0.655  22.844  65.695  1.00 30.08  ? 501 TYR A C     1 
ATOM   4095  O O     . TYR A 1 503 ? 0.312   23.611  65.714  1.00 30.94  ? 501 TYR A O     1 
ATOM   4096  C CB    . TYR A 1 503 ? -2.150  22.536  63.720  1.00 27.27  ? 501 TYR A CB    1 
ATOM   4097  C CG    . TYR A 1 503 ? -2.204  24.044  63.686  1.00 25.64  ? 501 TYR A CG    1 
ATOM   4098  C CD1   . TYR A 1 503 ? -1.515  24.751  62.732  1.00 27.83  ? 501 TYR A CD1   1 
ATOM   4099  C CD2   . TYR A 1 503 ? -2.949  24.757  64.610  1.00 26.81  ? 501 TYR A CD2   1 
ATOM   4100  C CE1   . TYR A 1 503 ? -1.552  26.127  62.691  1.00 29.61  ? 501 TYR A CE1   1 
ATOM   4101  C CE2   . TYR A 1 503 ? -3.001  26.126  64.572  1.00 27.54  ? 501 TYR A CE2   1 
ATOM   4102  C CZ    . TYR A 1 503 ? -2.297  26.805  63.605  1.00 30.07  ? 501 TYR A CZ    1 
ATOM   4103  O OH    . TYR A 1 503 ? -2.330  28.167  63.551  1.00 30.25  ? 501 TYR A OH    1 
ATOM   4104  N N     . ALA A 1 504 ? -1.501  22.713  66.714  1.00 25.45  ? 502 ALA A N     1 
ATOM   4105  C CA    . ALA A 1 504 ? -1.411  23.543  67.906  1.00 27.58  ? 502 ALA A CA    1 
ATOM   4106  C C     . ALA A 1 504 ? -0.166  23.208  68.725  1.00 31.59  ? 502 ALA A C     1 
ATOM   4107  O O     . ALA A 1 504 ? 0.596   24.116  69.123  1.00 28.75  ? 502 ALA A O     1 
ATOM   4108  C CB    . ALA A 1 504 ? -2.680  23.421  68.754  1.00 25.16  ? 502 ALA A CB    1 
ATOM   4109  N N     . LEU A 1 505 ? 0.023   21.904  68.962  1.00 29.70  ? 503 LEU A N     1 
ATOM   4110  C CA    . LEU A 1 505 ? 1.180   21.393  69.670  1.00 29.22  ? 503 LEU A CA    1 
ATOM   4111  C C     . LEU A 1 505 ? 2.492   21.896  69.058  1.00 34.48  ? 503 LEU A C     1 
ATOM   4112  O O     . LEU A 1 505 ? 3.446   22.255  69.791  1.00 35.27  ? 503 LEU A O     1 
ATOM   4113  C CB    . LEU A 1 505 ? 1.190   19.876  69.658  1.00 31.19  ? 503 LEU A CB    1 
ATOM   4114  C CG    . LEU A 1 505 ? 2.410   19.258  70.347  1.00 33.17  ? 503 LEU A CG    1 
ATOM   4115  C CD1   . LEU A 1 505 ? 2.061   18.971  71.782  1.00 33.10  ? 503 LEU A CD1   1 
ATOM   4116  C CD2   . LEU A 1 505 ? 2.877   18.000  69.623  1.00 38.65  ? 503 LEU A CD2   1 
ATOM   4117  N N     . GLY A 1 506 ? 2.550   21.904  67.725  1.00 29.09  ? 504 GLY A N     1 
ATOM   4118  C CA    . GLY A 1 506 ? 3.716   22.396  67.020  1.00 29.58  ? 504 GLY A CA    1 
ATOM   4119  C C     . GLY A 1 506 ? 4.037   23.862  67.292  1.00 33.82  ? 504 GLY A C     1 
ATOM   4120  O O     . GLY A 1 506 ? 5.208   24.214  67.432  1.00 35.84  ? 504 GLY A O     1 
ATOM   4121  N N     . ILE A 1 507 ? 3.021   24.726  67.362  1.00 30.32  ? 505 ILE A N     1 
ATOM   4122  C CA    . ILE A 1 507 ? 3.277   26.140  67.601  1.00 31.33  ? 505 ILE A CA    1 
ATOM   4123  C C     . ILE A 1 507 ? 3.784   26.355  69.021  1.00 31.66  ? 505 ILE A C     1 
ATOM   4124  O O     . ILE A 1 507 ? 4.832   26.966  69.225  1.00 31.84  ? 505 ILE A O     1 
ATOM   4125  C CB    . ILE A 1 507 ? 2.016   27.012  67.395  1.00 30.66  ? 505 ILE A CB    1 
ATOM   4126  C CG1   . ILE A 1 507 ? 1.683   27.141  65.921  1.00 26.89  ? 505 ILE A CG1   1 
ATOM   4127  C CG2   . ILE A 1 507 ? 2.173   28.398  68.068  1.00 27.42  ? 505 ILE A CG2   1 
ATOM   4128  C CD1   . ILE A 1 507 ? 0.251   27.165  65.695  1.00 26.55  ? 505 ILE A CD1   1 
ATOM   4129  N N     . ILE A 1 508 ? 3.031   25.846  69.987  1.00 27.53  ? 506 ILE A N     1 
ATOM   4130  C CA    . ILE A 1 508 ? 3.273   26.148  71.385  1.00 29.37  ? 506 ILE A CA    1 
ATOM   4131  C C     . ILE A 1 508 ? 4.643   25.618  71.811  1.00 33.66  ? 506 ILE A C     1 
ATOM   4132  O O     . ILE A 1 508 ? 5.403   26.304  72.517  1.00 31.77  ? 506 ILE A O     1 
ATOM   4133  C CB    . ILE A 1 508 ? 2.133   25.587  72.287  1.00 28.66  ? 506 ILE A CB    1 
ATOM   4134  C CG1   . ILE A 1 508 ? 0.853   26.416  72.109  1.00 27.12  ? 506 ILE A CG1   1 
ATOM   4135  C CG2   . ILE A 1 508 ? 2.544   25.533  73.768  1.00 25.42  ? 506 ILE A CG2   1 
ATOM   4136  C CD1   . ILE A 1 508 ? -0.363  25.751  72.655  1.00 24.21  ? 506 ILE A CD1   1 
ATOM   4137  N N     . GLN A 1 509 ? 4.968   24.410  71.351  1.00 33.92  ? 507 GLN A N     1 
ATOM   4138  C CA    . GLN A 1 509 ? 6.175   23.712  71.786  1.00 33.17  ? 507 GLN A CA    1 
ATOM   4139  C C     . GLN A 1 509 ? 7.484   24.419  71.416  1.00 33.74  ? 507 GLN A C     1 
ATOM   4140  O O     . GLN A 1 509 ? 8.535   24.153  72.004  1.00 35.63  ? 507 GLN A O     1 
ATOM   4141  C CB    . GLN A 1 509 ? 6.176   22.323  71.188  1.00 34.79  ? 507 GLN A CB    1 
ATOM   4142  C CG    . GLN A 1 509 ? 6.574   21.241  72.146  1.00 38.68  ? 507 GLN A CG    1 
ATOM   4143  C CD    . GLN A 1 509 ? 5.940   19.912  71.766  1.00 46.06  ? 507 GLN A CD    1 
ATOM   4144  O OE1   . GLN A 1 509 ? 5.069   19.403  72.478  1.00 45.87  ? 507 GLN A OE1   1 
ATOM   4145  N NE2   . GLN A 1 509 ? 6.362   19.351  70.631  1.00 49.91  ? 507 GLN A NE2   1 
ATOM   4146  N N     . ALA A 1 510 ? 7.427   25.310  70.437  1.00 31.35  ? 508 ALA A N     1 
ATOM   4147  C CA    . ALA A 1 510 ? 8.603   26.050  70.034  1.00 30.60  ? 508 ALA A CA    1 
ATOM   4148  C C     . ALA A 1 510 ? 8.674   27.281  70.885  1.00 31.89  ? 508 ALA A C     1 
ATOM   4149  O O     . ALA A 1 510 ? 9.428   28.193  70.587  1.00 35.90  ? 508 ALA A O     1 
ATOM   4150  C CB    . ALA A 1 510 ? 8.535   26.426  68.621  1.00 29.82  ? 508 ALA A CB    1 
ATOM   4151  N N     . GLN A 1 511 ? 7.815   27.342  71.891  1.00 28.71  ? 509 GLN A N     1 
ATOM   4152  C CA    . GLN A 1 511 ? 7.869   28.396  72.893  1.00 30.97  ? 509 GLN A CA    1 
ATOM   4153  C C     . GLN A 1 511 ? 7.998   29.793  72.312  1.00 30.66  ? 509 GLN A C     1 
ATOM   4154  O O     . GLN A 1 511 ? 8.884   30.543  72.699  1.00 28.62  ? 509 GLN A O     1 
ATOM   4155  C CB    . GLN A 1 511 ? 8.990   28.143  73.898  1.00 32.18  ? 509 GLN A CB    1 
ATOM   4156  C CG    . GLN A 1 511 ? 8.998   26.723  74.479  1.00 34.50  ? 509 GLN A CG    1 
ATOM   4157  C CD    . GLN A 1 511 ? 10.041  26.519  75.597  1.00 42.33  ? 509 GLN A CD    1 
ATOM   4158  O OE1   . GLN A 1 511 ? 11.066  27.241  75.687  1.00 37.09  ? 509 GLN A OE1   1 
ATOM   4159  N NE2   . GLN A 1 511 ? 9.764   25.529  76.475  1.00 40.72  ? 509 GLN A NE2   1 
ATOM   4160  N N     . PRO A 1 512 ? 7.060   30.158  71.424  1.00 30.38  ? 510 PRO A N     1 
ATOM   4161  C CA    . PRO A 1 512 ? 6.970   31.480  70.803  1.00 30.13  ? 510 PRO A CA    1 
ATOM   4162  C C     . PRO A 1 512 ? 6.745   32.562  71.851  1.00 31.17  ? 510 PRO A C     1 
ATOM   4163  O O     . PRO A 1 512 ? 5.993   32.337  72.800  1.00 29.02  ? 510 PRO A O     1 
ATOM   4164  C CB    . PRO A 1 512 ? 5.721   31.361  69.944  1.00 31.53  ? 510 PRO A CB    1 
ATOM   4165  C CG    . PRO A 1 512 ? 4.888   30.311  70.636  1.00 28.26  ? 510 PRO A CG    1 
ATOM   4166  C CD    . PRO A 1 512 ? 5.835   29.356  71.224  1.00 28.14  ? 510 PRO A CD    1 
ATOM   4167  N N     . ASP A 1 513 ? 7.429   33.694  71.740  1.00 33.36  ? 511 ASP A N     1 
ATOM   4168  C CA    . ASP A 1 513 ? 7.055   34.840  72.565  1.00 33.38  ? 511 ASP A CA    1 
ATOM   4169  C C     . ASP A 1 513 ? 6.267   35.948  71.869  1.00 31.96  ? 511 ASP A C     1 
ATOM   4170  O O     . ASP A 1 513 ? 5.785   36.841  72.504  1.00 35.96  ? 511 ASP A O     1 
ATOM   4171  C CB    . ASP A 1 513 ? 8.233   35.371  73.413  1.00 33.67  ? 511 ASP A CB    1 
ATOM   4172  C CG    . ASP A 1 513 ? 9.312   36.063  72.585  1.00 40.15  ? 511 ASP A CG    1 
ATOM   4173  O OD1   . ASP A 1 513 ? 8.983   36.697  71.563  1.00 40.86  ? 511 ASP A OD1   1 
ATOM   4174  O OD2   . ASP A 1 513 ? 10.497  35.983  72.972  1.00 39.90  ? 511 ASP A OD2   1 
ATOM   4175  N N     . LYS A 1 514 ? 6.137   35.873  70.563  1.00 35.89  ? 512 LYS A N     1 
ATOM   4176  C CA    . LYS A 1 514 ? 5.324   36.830  69.837  1.00 38.23  ? 512 LYS A CA    1 
ATOM   4177  C C     . LYS A 1 514 ? 4.629   36.157  68.680  1.00 36.58  ? 512 LYS A C     1 
ATOM   4178  O O     . LYS A 1 514 ? 5.096   35.159  68.206  1.00 37.25  ? 512 LYS A O     1 
ATOM   4179  C CB    . LYS A 1 514 ? 6.163   37.968  69.307  1.00 36.64  ? 512 LYS A CB    1 
ATOM   4180  C CG    . LYS A 1 514 ? 5.309   39.102  68.814  1.00 37.30  ? 512 LYS A CG    1 
ATOM   4181  C CD    . LYS A 1 514 ? 5.778   39.594  67.462  1.00 38.11  ? 512 LYS A CD    1 
ATOM   4182  C CE    . LYS A 1 514 ? 4.735   40.466  66.798  1.00 37.63  ? 512 LYS A CE    1 
ATOM   4183  N NZ    . LYS A 1 514 ? 4.961   40.530  65.340  1.00 36.82  ? 512 LYS A NZ    1 
ATOM   4184  N N     . SER A 1 515 ? 3.517   36.702  68.218  1.00 35.05  ? 513 SER A N     1 
ATOM   4185  C CA    . SER A 1 515 ? 2.834   36.082  67.085  1.00 36.83  ? 513 SER A CA    1 
ATOM   4186  C C     . SER A 1 515 ? 2.159   37.137  66.232  1.00 37.02  ? 513 SER A C     1 
ATOM   4187  O O     . SER A 1 515 ? 1.767   38.190  66.741  1.00 38.36  ? 513 SER A O     1 
ATOM   4188  C CB    . SER A 1 515 ? 1.793   35.064  67.577  1.00 36.25  ? 513 SER A CB    1 
ATOM   4189  O OG    . SER A 1 515 ? 1.458   34.119  66.580  1.00 33.96  ? 513 SER A OG    1 
ATOM   4190  N N     . GLU A 1 516 ? 2.028   36.860  64.937  1.00 36.62  ? 514 GLU A N     1 
ATOM   4191  C CA    . GLU A 1 516 ? 1.150   37.643  64.070  1.00 39.75  ? 514 GLU A CA    1 
ATOM   4192  C C     . GLU A 1 516 ? -0.295  37.543  64.553  1.00 40.46  ? 514 GLU A C     1 
ATOM   4193  O O     . GLU A 1 516 ? -1.099  38.440  64.307  1.00 45.79  ? 514 GLU A O     1 
ATOM   4194  C CB    . GLU A 1 516 ? 1.200   37.121  62.643  1.00 43.13  ? 514 GLU A CB    1 
ATOM   4195  C CG    . GLU A 1 516 ? 2.457   37.461  61.887  1.00 55.82  ? 514 GLU A CG    1 
ATOM   4196  C CD    . GLU A 1 516 ? 2.652   36.585  60.640  1.00 68.21  ? 514 GLU A CD    1 
ATOM   4197  O OE1   . GLU A 1 516 ? 1.873   35.601  60.439  1.00 60.76  ? 514 GLU A OE1   1 
ATOM   4198  O OE2   . GLU A 1 516 ? 3.599   36.893  59.868  1.00 71.82  ? 514 GLU A OE2   1 
ATOM   4199  N N     . SER A 1 517 ? -0.593  36.449  65.248  1.00 32.69  ? 515 SER A N     1 
ATOM   4200  C CA    . SER A 1 517 ? -1.929  36.026  65.579  1.00 33.20  ? 515 SER A CA    1 
ATOM   4201  C C     . SER A 1 517 ? -2.325  36.404  66.991  1.00 40.05  ? 515 SER A C     1 
ATOM   4202  O O     . SER A 1 517 ? -1.692  35.964  67.948  1.00 40.16  ? 515 SER A O     1 
ATOM   4203  C CB    . SER A 1 517 ? -2.009  34.511  65.463  1.00 36.00  ? 515 SER A CB    1 
ATOM   4204  O OG    . SER A 1 517 ? -3.023  33.999  66.314  1.00 38.75  ? 515 SER A OG    1 
ATOM   4205  N N     . GLU A 1 518 ? -3.400  37.177  67.132  1.00 41.18  ? 516 GLU A N     1 
ATOM   4206  C CA    . GLU A 1 518 ? -3.803  37.628  68.446  1.00 40.34  ? 516 GLU A CA    1 
ATOM   4207  C C     . GLU A 1 518 ? -4.168  36.477  69.380  1.00 39.66  ? 516 GLU A C     1 
ATOM   4208  O O     . GLU A 1 518 ? -3.967  36.571  70.592  1.00 38.97  ? 516 GLU A O     1 
ATOM   4209  C CB    . GLU A 1 518 ? -4.943  38.639  68.365  1.00 47.61  ? 516 GLU A CB    1 
ATOM   4210  C CG    . GLU A 1 518 ? -4.541  40.088  68.738  1.00 61.22  ? 516 GLU A CG    1 
ATOM   4211  C CD    . GLU A 1 518 ? -3.581  40.199  69.950  1.00 62.97  ? 516 GLU A CD    1 
ATOM   4212  O OE1   . GLU A 1 518 ? -4.058  40.048  71.120  1.00 61.83  ? 516 GLU A OE1   1 
ATOM   4213  O OE2   . GLU A 1 518 ? -2.360  40.454  69.712  1.00 52.86  ? 516 GLU A OE2   1 
ATOM   4214  N N     . LEU A 1 519 ? -4.704  35.400  68.821  1.00 36.43  ? 517 LEU A N     1 
ATOM   4215  C CA    . LEU A 1 519 ? -5.097  34.251  69.639  1.00 36.32  ? 517 LEU A CA    1 
ATOM   4216  C C     . LEU A 1 519 ? -3.854  33.525  70.232  1.00 34.96  ? 517 LEU A C     1 
ATOM   4217  O O     . LEU A 1 519 ? -3.838  33.119  71.409  1.00 28.40  ? 517 LEU A O     1 
ATOM   4218  C CB    . LEU A 1 519 ? -5.982  33.296  68.817  1.00 29.86  ? 517 LEU A CB    1 
ATOM   4219  C CG    . LEU A 1 519 ? -6.220  31.907  69.404  1.00 27.68  ? 517 LEU A CG    1 
ATOM   4220  C CD1   . LEU A 1 519 ? -6.865  31.954  70.783  1.00 29.96  ? 517 LEU A CD1   1 
ATOM   4221  C CD2   . LEU A 1 519 ? -7.043  31.121  68.492  1.00 30.63  ? 517 LEU A CD2   1 
ATOM   4222  N N     . VAL A 1 520 ? -2.819  33.367  69.402  1.00 33.57  ? 518 VAL A N     1 
ATOM   4223  C CA    . VAL A 1 520 ? -1.576  32.776  69.860  1.00 33.91  ? 518 VAL A CA    1 
ATOM   4224  C C     . VAL A 1 520 ? -0.935  33.707  70.873  1.00 34.22  ? 518 VAL A C     1 
ATOM   4225  O O     . VAL A 1 520 ? -0.512  33.252  71.921  1.00 34.75  ? 518 VAL A O     1 
ATOM   4226  C CB    . VAL A 1 520 ? -0.612  32.438  68.719  1.00 31.91  ? 518 VAL A CB    1 
ATOM   4227  C CG1   . VAL A 1 520 ? 0.749   32.074  69.270  1.00 27.94  ? 518 VAL A CG1   1 
ATOM   4228  C CG2   . VAL A 1 520 ? -1.162  31.298  67.923  1.00 30.09  ? 518 VAL A CG2   1 
ATOM   4229  N N     . ASN A 1 521 ? -0.896  35.003  70.582  1.00 33.47  ? 519 ASN A N     1 
ATOM   4230  C CA    . ASN A 1 521 ? -0.461  35.989  71.579  1.00 34.39  ? 519 ASN A CA    1 
ATOM   4231  C C     . ASN A 1 521 ? -1.143  35.827  72.945  1.00 36.08  ? 519 ASN A C     1 
ATOM   4232  O O     . ASN A 1 521 ? -0.506  35.997  73.998  1.00 36.15  ? 519 ASN A O     1 
ATOM   4233  C CB    . ASN A 1 521 ? -0.679  37.414  71.072  1.00 32.80  ? 519 ASN A CB    1 
ATOM   4234  C CG    . ASN A 1 521 ? 0.445   37.893  70.206  1.00 38.46  ? 519 ASN A CG    1 
ATOM   4235  O OD1   . ASN A 1 521 ? 1.614   37.707  70.533  1.00 40.94  ? 519 ASN A OD1   1 
ATOM   4236  N ND2   . ASN A 1 521 ? 0.107   38.517  69.086  1.00 39.96  ? 519 ASN A ND2   1 
ATOM   4237  N N     . GLN A 1 522 ? -2.439  35.527  72.923  1.00 31.14  ? 520 GLN A N     1 
ATOM   4238  C CA    . GLN A 1 522 ? -3.207  35.375  74.136  1.00 32.77  ? 520 GLN A CA    1 
ATOM   4239  C C     . GLN A 1 522 ? -2.793  34.090  74.838  1.00 35.22  ? 520 GLN A C     1 
ATOM   4240  O O     . GLN A 1 522 ? -2.693  34.040  76.068  1.00 35.76  ? 520 GLN A O     1 
ATOM   4241  C CB    . GLN A 1 522 ? -4.703  35.361  73.810  1.00 37.49  ? 520 GLN A CB    1 
ATOM   4242  C CG    . GLN A 1 522 ? -5.416  36.699  73.997  1.00 45.75  ? 520 GLN A CG    1 
ATOM   4243  C CD    . GLN A 1 522 ? -6.562  36.911  73.016  1.00 50.13  ? 520 GLN A CD    1 
ATOM   4244  O OE1   . GLN A 1 522 ? -7.178  35.951  72.536  1.00 46.66  ? 520 GLN A OE1   1 
ATOM   4245  N NE2   . GLN A 1 522 ? -6.838  38.183  72.695  1.00 55.42  ? 520 GLN A NE2   1 
ATOM   4246  N N     . ILE A 1 523 ? -2.564  33.040  74.049  1.00 33.20  ? 521 ILE A N     1 
ATOM   4247  C CA    . ILE A 1 523 ? -2.101  31.777  74.594  1.00 30.16  ? 521 ILE A CA    1 
ATOM   4248  C C     . ILE A 1 523 ? -0.785  32.056  75.304  1.00 30.57  ? 521 ILE A C     1 
ATOM   4249  O O     . ILE A 1 523 ? -0.588  31.634  76.432  1.00 30.45  ? 521 ILE A O     1 
ATOM   4250  C CB    . ILE A 1 523 ? -2.000  30.691  73.490  1.00 28.25  ? 521 ILE A CB    1 
ATOM   4251  C CG1   . ILE A 1 523 ? -3.373  30.090  73.268  1.00 25.54  ? 521 ILE A CG1   1 
ATOM   4252  C CG2   . ILE A 1 523 ? -1.021  29.566  73.849  1.00 25.40  ? 521 ILE A CG2   1 
ATOM   4253  C CD1   . ILE A 1 523 ? -3.672  29.847  71.855  1.00 27.86  ? 521 ILE A CD1   1 
ATOM   4254  N N     . ILE A 1 524 ? 0.088   32.812  74.646  1.00 29.20  ? 522 ILE A N     1 
ATOM   4255  C CA    . ILE A 1 524 ? 1.374   33.216  75.204  1.00 29.05  ? 522 ILE A CA    1 
ATOM   4256  C C     . ILE A 1 524 ? 1.233   33.959  76.534  1.00 32.96  ? 522 ILE A C     1 
ATOM   4257  O O     . ILE A 1 524 ? 1.922   33.650  77.502  1.00 32.85  ? 522 ILE A O     1 
ATOM   4258  C CB    . ILE A 1 524 ? 2.179   34.065  74.202  1.00 29.56  ? 522 ILE A CB    1 
ATOM   4259  C CG1   . ILE A 1 524 ? 2.550   33.227  72.979  1.00 29.09  ? 522 ILE A CG1   1 
ATOM   4260  C CG2   . ILE A 1 524 ? 3.433   34.661  74.869  1.00 28.34  ? 522 ILE A CG2   1 
ATOM   4261  C CD1   . ILE A 1 524 ? 3.152   34.022  71.862  1.00 30.81  ? 522 ILE A CD1   1 
ATOM   4262  N N     . GLU A 1 525 ? 0.336   34.932  76.592  1.00 33.94  ? 523 GLU A N     1 
ATOM   4263  C CA    . GLU A 1 525 ? 0.173   35.709  77.808  1.00 35.10  ? 523 GLU A CA    1 
ATOM   4264  C C     . GLU A 1 525 ? -0.252  34.816  78.993  1.00 35.66  ? 523 GLU A C     1 
ATOM   4265  O O     . GLU A 1 525 ? 0.266   34.937  80.097  1.00 38.20  ? 523 GLU A O     1 
ATOM   4266  C CB    . GLU A 1 525 ? -0.794  36.859  77.543  1.00 39.66  ? 523 GLU A CB    1 
ATOM   4267  C CG    . GLU A 1 525 ? -1.217  37.670  78.762  1.00 49.20  ? 523 GLU A CG    1 
ATOM   4268  C CD    . GLU A 1 525 ? -2.611  38.289  78.582  1.00 60.17  ? 523 GLU A CD    1 
ATOM   4269  O OE1   . GLU A 1 525 ? -2.935  38.707  77.434  1.00 60.09  ? 523 GLU A OE1   1 
ATOM   4270  O OE2   . GLU A 1 525 ? -3.380  38.332  79.582  1.00 60.59  ? 523 GLU A OE2   1 
ATOM   4271  N N     . GLN A 1 526 ? -1.176  33.898  78.756  1.00 34.40  ? 524 GLN A N     1 
ATOM   4272  C CA    . GLN A 1 526 ? -1.581  32.953  79.785  1.00 33.78  ? 524 GLN A CA    1 
ATOM   4273  C C     . GLN A 1 526 ? -0.443  32.030  80.139  1.00 33.12  ? 524 GLN A C     1 
ATOM   4274  O O     . GLN A 1 526 ? -0.260  31.696  81.302  1.00 34.69  ? 524 GLN A O     1 
ATOM   4275  C CB    . GLN A 1 526 ? -2.777  32.110  79.323  1.00 30.55  ? 524 GLN A CB    1 
ATOM   4276  C CG    . GLN A 1 526 ? -4.076  32.866  79.255  1.00 33.53  ? 524 GLN A CG    1 
ATOM   4277  C CD    . GLN A 1 526 ? -4.603  33.225  80.633  1.00 38.36  ? 524 GLN A CD    1 
ATOM   4278  O OE1   . GLN A 1 526 ? -4.840  32.340  81.475  1.00 35.64  ? 524 GLN A OE1   1 
ATOM   4279  N NE2   . GLN A 1 526 ? -4.752  34.536  80.890  1.00 41.09  ? 524 GLN A NE2   1 
ATOM   4280  N N     . LEU A 1 527 ? 0.298   31.588  79.127  1.00 29.70  ? 525 LEU A N     1 
ATOM   4281  C CA    . LEU A 1 527 ? 1.425   30.685  79.333  1.00 30.88  ? 525 LEU A CA    1 
ATOM   4282  C C     . LEU A 1 527 ? 2.498   31.292  80.254  1.00 33.31  ? 525 LEU A C     1 
ATOM   4283  O O     . LEU A 1 527 ? 3.062   30.598  81.108  1.00 31.24  ? 525 LEU A O     1 
ATOM   4284  C CB    . LEU A 1 527 ? 2.029   30.268  77.988  1.00 28.62  ? 525 LEU A CB    1 
ATOM   4285  C CG    . LEU A 1 527 ? 1.388   29.064  77.306  1.00 27.69  ? 525 LEU A CG    1 
ATOM   4286  C CD1   . LEU A 1 527 ? 1.968   28.852  75.898  1.00 23.81  ? 525 LEU A CD1   1 
ATOM   4287  C CD2   . LEU A 1 527 ? 1.482   27.827  78.197  1.00 22.11  ? 525 LEU A CD2   1 
ATOM   4288  N N     . ILE A 1 528 ? 2.763   32.588  80.076  1.00 33.12  ? 526 ILE A N     1 
ATOM   4289  C CA    . ILE A 1 528 ? 3.719   33.316  80.898  1.00 31.59  ? 526 ILE A CA    1 
ATOM   4290  C C     . ILE A 1 528 ? 3.243   33.487  82.338  1.00 36.06  ? 526 ILE A C     1 
ATOM   4291  O O     . ILE A 1 528 ? 4.056   33.652  83.255  1.00 39.33  ? 526 ILE A O     1 
ATOM   4292  C CB    . ILE A 1 528 ? 3.984   34.690  80.330  1.00 30.79  ? 526 ILE A CB    1 
ATOM   4293  C CG1   . ILE A 1 528 ? 4.564   34.570  78.936  1.00 30.09  ? 526 ILE A CG1   1 
ATOM   4294  C CG2   . ILE A 1 528 ? 4.934   35.472  81.247  1.00 30.84  ? 526 ILE A CG2   1 
ATOM   4295  C CD1   . ILE A 1 528 ? 4.895   35.887  78.326  1.00 28.40  ? 526 ILE A CD1   1 
ATOM   4296  N N     . LYS A 1 529 ? 1.930   33.463  82.538  1.00 34.02  ? 527 LYS A N     1 
ATOM   4297  C CA    . LYS A 1 529 ? 1.362   33.628  83.875  1.00 37.13  ? 527 LYS A CA    1 
ATOM   4298  C C     . LYS A 1 529 ? 1.348   32.359  84.691  1.00 32.35  ? 527 LYS A C     1 
ATOM   4299  O O     . LYS A 1 529 ? 1.188   32.423  85.896  1.00 34.49  ? 527 LYS A O     1 
ATOM   4300  C CB    . LYS A 1 529 ? -0.084  34.186  83.836  1.00 41.68  ? 527 LYS A CB    1 
ATOM   4301  C CG    . LYS A 1 529 ? -0.217  35.664  83.531  1.00 43.56  ? 527 LYS A CG    1 
ATOM   4302  C CD    . LYS A 1 529 ? -1.681  36.119  83.587  1.00 50.52  ? 527 LYS A CD    1 
ATOM   4303  C CE    . LYS A 1 529 ? -1.799  37.612  83.221  1.00 55.64  ? 527 LYS A CE    1 
ATOM   4304  N NZ    . LYS A 1 529 ? -3.208  38.039  82.965  1.00 61.05  ? 527 LYS A NZ    1 
ATOM   4305  N N     . LYS A 1 530 ? 1.441   31.210  84.041  1.00 33.06  ? 528 LYS A N     1 
ATOM   4306  C CA    . LYS A 1 530 ? 1.324   29.937  84.765  1.00 36.50  ? 528 LYS A CA    1 
ATOM   4307  C C     . LYS A 1 530 ? 2.620   29.630  85.491  1.00 34.97  ? 528 LYS A C     1 
ATOM   4308  O O     . LYS A 1 530 ? 3.660   30.178  85.156  1.00 35.88  ? 528 LYS A O     1 
ATOM   4309  C CB    . LYS A 1 530 ? 0.977   28.780  83.816  1.00 33.13  ? 528 LYS A CB    1 
ATOM   4310  C CG    . LYS A 1 530 ? -0.362  28.892  83.122  1.00 30.81  ? 528 LYS A CG    1 
ATOM   4311  C CD    . LYS A 1 530 ? -1.515  28.713  84.110  1.00 32.13  ? 528 LYS A CD    1 
ATOM   4312  C CE    . LYS A 1 530 ? -2.856  28.706  83.413  1.00 29.40  ? 528 LYS A CE    1 
ATOM   4313  N NZ    . LYS A 1 530 ? -3.938  29.131  84.322  1.00 29.00  ? 528 LYS A NZ    1 
ATOM   4314  N N     . GLU A 1 531 ? 2.557   28.813  86.525  1.00 35.67  ? 529 GLU A N     1 
ATOM   4315  C CA    . GLU A 1 531 ? 3.776   28.244  87.090  1.00 39.49  ? 529 GLU A CA    1 
ATOM   4316  C C     . GLU A 1 531 ? 4.253   26.971  86.381  1.00 36.93  ? 529 GLU A C     1 
ATOM   4317  O O     . GLU A 1 531 ? 5.440   26.787  86.173  1.00 36.03  ? 529 GLU A O     1 
ATOM   4318  C CB    . GLU A 1 531 ? 3.613   27.994  88.589  1.00 43.41  ? 529 GLU A CB    1 
ATOM   4319  C CG    . GLU A 1 531 ? 4.121   29.143  89.435  1.00 51.20  ? 529 GLU A CG    1 
ATOM   4320  C CD    . GLU A 1 531 ? 3.443   29.210  90.789  1.00 63.28  ? 529 GLU A CD    1 
ATOM   4321  O OE1   . GLU A 1 531 ? 3.031   28.143  91.309  1.00 65.76  ? 529 GLU A OE1   1 
ATOM   4322  O OE2   . GLU A 1 531 ? 3.314   30.334  91.326  1.00 68.89  ? 529 GLU A OE2   1 
ATOM   4323  N N     . LYS A 1 532 ? 3.329   26.071  86.065  1.00 36.26  ? 530 LYS A N     1 
ATOM   4324  C CA    . LYS A 1 532 ? 3.691   24.812  85.413  1.00 39.31  ? 530 LYS A CA    1 
ATOM   4325  C C     . LYS A 1 532 ? 2.660   24.322  84.375  1.00 36.39  ? 530 LYS A C     1 
ATOM   4326  O O     . LYS A 1 532 ? 1.501   24.100  84.704  1.00 35.88  ? 530 LYS A O     1 
ATOM   4327  C CB    . LYS A 1 532 ? 3.977   23.729  86.471  1.00 39.39  ? 530 LYS A CB    1 
ATOM   4328  C CG    . LYS A 1 532 ? 5.438   23.677  86.967  1.00 41.37  ? 530 LYS A CG    1 
ATOM   4329  C CD    . LYS A 1 532 ? 5.502   23.284  88.451  1.00 49.63  ? 530 LYS A CD    1 
ATOM   4330  C CE    . LYS A 1 532 ? 6.512   22.177  88.744  1.00 51.39  ? 530 LYS A CE    1 
ATOM   4331  N NZ    . LYS A 1 532 ? 6.022   20.815  88.352  1.00 49.24  ? 530 LYS A NZ    1 
ATOM   4332  N N     . VAL A 1 533 ? 3.097   24.103  83.138  1.00 32.29  ? 531 VAL A N     1 
ATOM   4333  C CA    . VAL A 1 533 ? 2.178   23.676  82.087  1.00 31.51  ? 531 VAL A CA    1 
ATOM   4334  C C     . VAL A 1 533 ? 2.683   22.439  81.391  1.00 32.08  ? 531 VAL A C     1 
ATOM   4335  O O     . VAL A 1 533 ? 3.703   22.482  80.744  1.00 32.07  ? 531 VAL A O     1 
ATOM   4336  C CB    . VAL A 1 533 ? 2.012   24.732  80.977  1.00 29.40  ? 531 VAL A CB    1 
ATOM   4337  C CG1   . VAL A 1 533 ? 1.011   24.230  79.944  1.00 27.65  ? 531 VAL A CG1   1 
ATOM   4338  C CG2   . VAL A 1 533 ? 1.585   26.048  81.553  1.00 28.02  ? 531 VAL A CG2   1 
ATOM   4339  N N     . TYR A 1 534 ? 1.962   21.339  81.495  1.00 30.55  ? 532 TYR A N     1 
ATOM   4340  C CA    . TYR A 1 534 ? 2.357   20.161  80.750  1.00 30.73  ? 532 TYR A CA    1 
ATOM   4341  C C     . TYR A 1 534 ? 1.367   19.902  79.624  1.00 30.92  ? 532 TYR A C     1 
ATOM   4342  O O     . TYR A 1 534 ? 0.210   19.653  79.872  1.00 31.73  ? 532 TYR A O     1 
ATOM   4343  C CB    . TYR A 1 534 ? 2.465   18.939  81.663  1.00 32.59  ? 532 TYR A CB    1 
ATOM   4344  C CG    . TYR A 1 534 ? 2.783   17.666  80.909  1.00 34.49  ? 532 TYR A CG    1 
ATOM   4345  C CD1   . TYR A 1 534 ? 4.012   17.492  80.290  1.00 33.72  ? 532 TYR A CD1   1 
ATOM   4346  C CD2   . TYR A 1 534 ? 1.847   16.638  80.807  1.00 34.58  ? 532 TYR A CD2   1 
ATOM   4347  C CE1   . TYR A 1 534 ? 4.294   16.336  79.590  1.00 35.92  ? 532 TYR A CE1   1 
ATOM   4348  C CE2   . TYR A 1 534 ? 2.129   15.473  80.115  1.00 33.69  ? 532 TYR A CE2   1 
ATOM   4349  C CZ    . TYR A 1 534 ? 3.350   15.326  79.507  1.00 35.83  ? 532 TYR A CZ    1 
ATOM   4350  O OH    . TYR A 1 534 ? 3.638   14.169  78.810  1.00 39.34  ? 532 TYR A OH    1 
ATOM   4351  N N     . LEU A 1 535 ? 1.844   19.937  78.389  1.00 31.04  ? 533 LEU A N     1 
ATOM   4352  C CA    . LEU A 1 535 ? 0.993   19.832  77.213  1.00 30.25  ? 533 LEU A CA    1 
ATOM   4353  C C     . LEU A 1 535 ? 1.277   18.561  76.413  1.00 27.83  ? 533 LEU A C     1 
ATOM   4354  O O     . LEU A 1 535 ? 2.359   18.376  75.950  1.00 32.72  ? 533 LEU A O     1 
ATOM   4355  C CB    . LEU A 1 535 ? 1.189   21.084  76.353  1.00 27.84  ? 533 LEU A CB    1 
ATOM   4356  C CG    . LEU A 1 535 ? 0.502   21.115  75.004  1.00 30.66  ? 533 LEU A CG    1 
ATOM   4357  C CD1   . LEU A 1 535 ? -1.004  20.939  75.157  1.00 31.14  ? 533 LEU A CD1   1 
ATOM   4358  C CD2   . LEU A 1 535 ? 0.828   22.426  74.314  1.00 32.09  ? 533 LEU A CD2   1 
ATOM   4359  N N     . ALA A 1 536 ? 0.287   17.699  76.246  1.00 30.07  ? 534 ALA A N     1 
ATOM   4360  C CA    . ALA A 1 536 ? 0.458   16.362  75.649  1.00 29.31  ? 534 ALA A CA    1 
ATOM   4361  C C     . ALA A 1 536 ? -0.434  16.165  74.437  1.00 28.83  ? 534 ALA A C     1 
ATOM   4362  O O     . ALA A 1 536 ? -1.395  16.887  74.262  1.00 31.92  ? 534 ALA A O     1 
ATOM   4363  C CB    . ALA A 1 536 ? 0.172   15.278  76.681  1.00 26.03  ? 534 ALA A CB    1 
ATOM   4364  N N     . TRP A 1 537 ? -0.115  15.173  73.618  1.00 28.49  ? 535 TRP A N     1 
ATOM   4365  C CA    . TRP A 1 537 ? -0.813  14.904  72.377  1.00 27.44  ? 535 TRP A CA    1 
ATOM   4366  C C     . TRP A 1 537 ? -1.264  13.475  72.365  1.00 31.48  ? 535 TRP A C     1 
ATOM   4367  O O     . TRP A 1 537 ? -0.577  12.597  72.855  1.00 35.13  ? 535 TRP A O     1 
ATOM   4368  C CB    . TRP A 1 537 ? 0.118   15.142  71.190  1.00 29.74  ? 535 TRP A CB    1 
ATOM   4369  C CG    . TRP A 1 537 ? -0.496  14.872  69.849  1.00 36.12  ? 535 TRP A CG    1 
ATOM   4370  C CD1   . TRP A 1 537 ? -1.199  15.751  69.076  1.00 36.92  ? 535 TRP A CD1   1 
ATOM   4371  C CD2   . TRP A 1 537 ? -0.461  13.639  69.112  1.00 37.78  ? 535 TRP A CD2   1 
ATOM   4372  N NE1   . TRP A 1 537 ? -1.606  15.146  67.912  1.00 34.85  ? 535 TRP A NE1   1 
ATOM   4373  C CE2   . TRP A 1 537 ? -1.165  13.849  67.912  1.00 37.46  ? 535 TRP A CE2   1 
ATOM   4374  C CE3   . TRP A 1 537 ? 0.098   12.380  69.353  1.00 38.24  ? 535 TRP A CE3   1 
ATOM   4375  C CZ2   . TRP A 1 537 ? -1.320  12.848  66.958  1.00 40.22  ? 535 TRP A CZ2   1 
ATOM   4376  C CZ3   . TRP A 1 537 ? -0.070  11.393  68.412  1.00 38.35  ? 535 TRP A CZ3   1 
ATOM   4377  C CH2   . TRP A 1 537 ? -0.776  11.629  67.232  1.00 37.84  ? 535 TRP A CH2   1 
ATOM   4378  N N     . VAL A 1 538 ? -2.437  13.233  71.806  1.00 35.81  ? 536 VAL A N     1 
ATOM   4379  C CA    . VAL A 1 538 ? -2.909  11.870  71.587  1.00 37.43  ? 536 VAL A CA    1 
ATOM   4380  C C     . VAL A 1 538 ? -3.476  11.860  70.193  1.00 39.22  ? 536 VAL A C     1 
ATOM   4381  O O     . VAL A 1 538 ? -3.862  12.911  69.686  1.00 39.24  ? 536 VAL A O     1 
ATOM   4382  C CB    . VAL A 1 538 ? -3.994  11.458  72.610  1.00 37.49  ? 536 VAL A CB    1 
ATOM   4383  C CG1   . VAL A 1 538 ? -3.371  11.149  73.968  1.00 37.97  ? 536 VAL A CG1   1 
ATOM   4384  C CG2   . VAL A 1 538 ? -5.009  12.563  72.759  1.00 37.95  ? 536 VAL A CG2   1 
ATOM   4385  N N     . PRO A 1 539 ? -3.502  10.686  69.546  1.00 43.68  ? 537 PRO A N     1 
ATOM   4386  C CA    . PRO A 1 539 ? -4.125  10.588  68.218  1.00 42.59  ? 537 PRO A CA    1 
ATOM   4387  C C     . PRO A 1 539 ? -5.643  10.735  68.314  1.00 45.79  ? 537 PRO A C     1 
ATOM   4388  O O     . PRO A 1 539 ? -6.244  10.223  69.257  1.00 46.14  ? 537 PRO A O     1 
ATOM   4389  C CB    . PRO A 1 539 ? -3.764  9.175   67.775  1.00 44.61  ? 537 PRO A CB    1 
ATOM   4390  C CG    . PRO A 1 539 ? -3.517  8.412   69.068  1.00 42.87  ? 537 PRO A CG    1 
ATOM   4391  C CD    . PRO A 1 539 ? -2.904  9.409   69.986  1.00 41.75  ? 537 PRO A CD    1 
ATOM   4392  N N     . ALA A 1 540 ? -6.245  11.434  67.359  1.00 49.16  ? 538 ALA A N     1 
ATOM   4393  C CA    . ALA A 1 540 ? -7.700  11.583  67.295  1.00 51.07  ? 538 ALA A CA    1 
ATOM   4394  C C     . ALA A 1 540 ? -8.433  10.262  66.992  1.00 59.01  ? 538 ALA A C     1 
ATOM   4395  O O     . ALA A 1 540 ? -7.867  9.344   66.393  1.00 58.59  ? 538 ALA A O     1 
ATOM   4396  C CB    . ALA A 1 540 ? -8.061  12.624  66.261  1.00 46.89  ? 538 ALA A CB    1 
ATOM   4397  N N     . HIS A 1 541 ? -9.696  10.187  67.407  1.00 61.15  ? 539 HIS A N     1 
ATOM   4398  C CA    . HIS A 1 541 ? -10.580 9.056   67.109  1.00 64.98  ? 539 HIS A CA    1 
ATOM   4399  C C     . HIS A 1 541 ? -9.973  7.703   67.394  1.00 64.52  ? 539 HIS A C     1 
ATOM   4400  O O     . HIS A 1 541 ? -10.218 6.746   66.662  1.00 68.31  ? 539 HIS A O     1 
ATOM   4401  C CB    . HIS A 1 541 ? -11.002 9.044   65.641  1.00 62.50  ? 539 HIS A CB    1 
ATOM   4402  C CG    . HIS A 1 541 ? -10.919 10.373  64.981  1.00 64.46  ? 539 HIS A CG    1 
ATOM   4403  N ND1   . HIS A 1 541 ? -9.928  10.696  64.074  1.00 63.54  ? 539 HIS A ND1   1 
ATOM   4404  C CD2   . HIS A 1 541 ? -11.702 11.471  65.094  1.00 69.05  ? 539 HIS A CD2   1 
ATOM   4405  C CE1   . HIS A 1 541 ? -10.108 11.934  63.654  1.00 70.52  ? 539 HIS A CE1   1 
ATOM   4406  N NE2   . HIS A 1 541 ? -11.178 12.428  64.259  1.00 76.73  ? 539 HIS A NE2   1 
ATOM   4407  N N     . LYS A 1 542 ? -9.147  7.600   68.410  1.00 61.30  ? 540 LYS A N     1 
ATOM   4408  C CA    . LYS A 1 542 ? -8.713  6.271   68.778  1.00 66.86  ? 540 LYS A CA    1 
ATOM   4409  C C     . LYS A 1 542 ? -9.505  5.762   69.968  1.00 73.01  ? 540 LYS A C     1 
ATOM   4410  O O     . LYS A 1 542 ? -9.244  4.668   70.483  1.00 75.05  ? 540 LYS A O     1 
ATOM   4411  C CB    . LYS A 1 542 ? -7.202  6.188   68.951  1.00 65.02  ? 540 LYS A CB    1 
ATOM   4412  C CG    . LYS A 1 542 ? -6.500  6.170   67.607  1.00 61.85  ? 540 LYS A CG    1 
ATOM   4413  C CD    . LYS A 1 542 ? -7.106  5.097   66.720  1.00 66.73  ? 540 LYS A CD    1 
ATOM   4414  C CE    . LYS A 1 542 ? -6.522  5.120   65.322  1.00 66.84  ? 540 LYS A CE    1 
ATOM   4415  N NZ    . LYS A 1 542 ? -6.650  3.785   64.668  1.00 72.56  ? 540 LYS A NZ    1 
ATOM   4416  N N     . GLY A 1 543 ? -10.480 6.566   70.389  1.00 67.51  ? 541 GLY A N     1 
ATOM   4417  C CA    . GLY A 1 543 ? -11.310 6.210   71.521  1.00 71.04  ? 541 GLY A CA    1 
ATOM   4418  C C     . GLY A 1 543 ? -10.472 6.297   72.773  1.00 74.43  ? 541 GLY A C     1 
ATOM   4419  O O     . GLY A 1 543 ? -10.469 5.400   73.619  1.00 77.51  ? 541 GLY A O     1 
ATOM   4420  N N     . ILE A 1 544 ? -9.742  7.400   72.877  1.00 75.56  ? 542 ILE A N     1 
ATOM   4421  C CA    . ILE A 1 544 ? -8.806  7.608   73.973  1.00 73.13  ? 542 ILE A CA    1 
ATOM   4422  C C     . ILE A 1 544 ? -9.382  8.488   75.068  1.00 70.89  ? 542 ILE A C     1 
ATOM   4423  O O     . ILE A 1 544 ? -10.158 9.408   74.804  1.00 67.22  ? 542 ILE A O     1 
ATOM   4424  C CB    . ILE A 1 544 ? -7.476  8.233   73.482  1.00 64.00  ? 542 ILE A CB    1 
ATOM   4425  C CG1   . ILE A 1 544 ? -6.636  7.192   72.757  1.00 62.08  ? 542 ILE A CG1   1 
ATOM   4426  C CG2   . ILE A 1 544 ? -6.684  8.791   74.635  1.00 53.57  ? 542 ILE A CG2   1 
ATOM   4427  C CD1   . ILE A 1 544 ? -5.460  7.788   72.033  1.00 56.81  ? 542 ILE A CD1   1 
ATOM   4428  N N     . GLY A 1 545 ? -9.033  8.135   76.303  1.00 76.58  ? 543 GLY A N     1 
ATOM   4429  C CA    . GLY A 1 545 ? -9.064  9.045   77.428  1.00 69.95  ? 543 GLY A CA    1 
ATOM   4430  C C     . GLY A 1 545 ? -10.363 9.794   77.493  1.00 69.93  ? 543 GLY A C     1 
ATOM   4431  O O     . GLY A 1 545 ? -11.425 9.259   77.171  1.00 73.92  ? 543 GLY A O     1 
ATOM   4432  N N     . GLY A 1 546 ? -10.267 11.050  77.911  1.00 66.59  ? 544 GLY A N     1 
ATOM   4433  C CA    . GLY A 1 546 ? -11.391 11.951  77.870  1.00 60.67  ? 544 GLY A CA    1 
ATOM   4434  C C     . GLY A 1 546 ? -11.238 12.730  76.588  1.00 61.60  ? 544 GLY A C     1 
ATOM   4435  O O     . GLY A 1 546 ? -11.774 13.822  76.444  1.00 62.23  ? 544 GLY A O     1 
ATOM   4436  N N     . ASN A 1 547 ? -10.468 12.189  75.653  1.00 60.53  ? 545 ASN A N     1 
ATOM   4437  C CA    . ASN A 1 547 ? -10.375 12.835  74.367  1.00 57.54  ? 545 ASN A CA    1 
ATOM   4438  C C     . ASN A 1 547 ? -11.563 12.535  73.473  1.00 61.06  ? 545 ASN A C     1 
ATOM   4439  O O     . ASN A 1 547 ? -11.996 13.386  72.693  1.00 55.13  ? 545 ASN A O     1 
ATOM   4440  C CB    . ASN A 1 547 ? -9.091  12.500  73.650  1.00 53.36  ? 545 ASN A CB    1 
ATOM   4441  C CG    . ASN A 1 547 ? -8.766  13.529  72.612  1.00 54.87  ? 545 ASN A CG    1 
ATOM   4442  O OD1   . ASN A 1 547 ? -8.499  14.719  72.947  1.00 53.57  ? 545 ASN A OD1   1 
ATOM   4443  N ND2   . ASN A 1 547 ? -8.835  13.122  71.342  1.00 44.08  ? 545 ASN A ND2   1 
ATOM   4444  N N     . GLU A 1 548 ? -12.081 11.316  73.594  1.00 66.95  ? 546 GLU A N     1 
ATOM   4445  C CA    . GLU A 1 548 ? -13.256 10.896  72.841  1.00 71.25  ? 546 GLU A CA    1 
ATOM   4446  C C     . GLU A 1 548 ? -14.500 11.731  73.232  1.00 71.20  ? 546 GLU A C     1 
ATOM   4447  O O     . GLU A 1 548 ? -15.380 12.000  72.392  1.00 66.50  ? 546 GLU A O     1 
ATOM   4448  C CB    . GLU A 1 548 ? -13.488 9.402   73.062  1.00 70.58  ? 546 GLU A CB    1 
ATOM   4449  C CG    . GLU A 1 548 ? -14.682 8.836   72.315  1.00 81.07  ? 546 GLU A CG    1 
ATOM   4450  C CD    . GLU A 1 548 ? -15.207 7.547   72.941  1.00 91.72  ? 546 GLU A CD    1 
ATOM   4451  O OE1   . GLU A 1 548 ? -14.388 6.630   73.211  1.00 94.33  ? 546 GLU A OE1   1 
ATOM   4452  O OE2   . GLU A 1 548 ? -16.439 7.459   73.172  1.00 93.31  ? 546 GLU A OE2   1 
ATOM   4453  N N     . GLN A 1 549 ? -14.525 12.155  74.503  1.00 68.46  ? 547 GLN A N     1 
ATOM   4454  C CA    . GLN A 1 549 ? -15.644 12.873  75.127  1.00 66.76  ? 547 GLN A CA    1 
ATOM   4455  C C     . GLN A 1 549 ? -15.746 14.340  74.739  1.00 62.85  ? 547 GLN A C     1 
ATOM   4456  O O     . GLN A 1 549 ? -16.837 14.849  74.520  1.00 66.55  ? 547 GLN A O     1 
ATOM   4457  C CB    . GLN A 1 549 ? -15.555 12.792  76.656  1.00 65.18  ? 547 GLN A CB    1 
ATOM   4458  C CG    . GLN A 1 549 ? -16.166 11.546  77.269  1.00 73.90  ? 547 GLN A CG    1 
ATOM   4459  C CD    . GLN A 1 549 ? -15.264 10.325  77.177  1.00 77.34  ? 547 GLN A CD    1 
ATOM   4460  O OE1   . GLN A 1 549 ? -14.768 9.980   76.102  1.00 75.61  ? 547 GLN A OE1   1 
ATOM   4461  N NE2   . GLN A 1 549 ? -15.045 9.665   78.315  1.00 79.96  ? 547 GLN A NE2   1 
ATOM   4462  N N     . VAL A 1 550 ? -14.614 15.026  74.704  1.00 58.35  ? 548 VAL A N     1 
ATOM   4463  C CA    . VAL A 1 550 ? -14.589 16.426  74.341  1.00 53.05  ? 548 VAL A CA    1 
ATOM   4464  C C     . VAL A 1 550 ? -14.710 16.489  72.827  1.00 57.44  ? 548 VAL A C     1 
ATOM   4465  O O     . VAL A 1 550 ? -15.076 17.513  72.252  1.00 59.05  ? 548 VAL A O     1 
ATOM   4466  C CB    . VAL A 1 550 ? -13.304 17.136  74.859  1.00 44.87  ? 548 VAL A CB    1 
ATOM   4467  C CG1   . VAL A 1 550 ? -12.055 16.534  74.248  1.00 45.02  ? 548 VAL A CG1   1 
ATOM   4468  C CG2   . VAL A 1 550 ? -13.363 18.645  74.590  1.00 41.73  ? 548 VAL A CG2   1 
ATOM   4469  N N     . ASP A 1 551 ? -14.416 15.367  72.185  1.00 60.06  ? 549 ASP A N     1 
ATOM   4470  C CA    . ASP A 1 551 ? -14.575 15.246  70.747  1.00 62.36  ? 549 ASP A CA    1 
ATOM   4471  C C     . ASP A 1 551 ? -16.062 15.217  70.396  1.00 71.14  ? 549 ASP A C     1 
ATOM   4472  O O     . ASP A 1 551 ? -16.499 15.883  69.453  1.00 69.84  ? 549 ASP A O     1 
ATOM   4473  C CB    . ASP A 1 551 ? -13.897 13.976  70.255  1.00 64.88  ? 549 ASP A CB    1 
ATOM   4474  C CG    . ASP A 1 551 ? -14.120 13.738  68.790  1.00 72.88  ? 549 ASP A CG    1 
ATOM   4475  O OD1   . ASP A 1 551 ? -13.535 14.490  67.980  1.00 76.60  ? 549 ASP A OD1   1 
ATOM   4476  O OD2   . ASP A 1 551 ? -14.873 12.801  68.450  1.00 75.16  ? 549 ASP A OD2   1 
ATOM   4477  N N     . LYS A 1 552 ? -16.834 14.439  71.163  1.00 71.67  ? 550 LYS A N     1 
ATOM   4478  C CA    . LYS A 1 552 ? -18.291 14.426  71.039  1.00 70.08  ? 550 LYS A CA    1 
ATOM   4479  C C     . LYS A 1 552 ? -18.876 15.811  71.281  1.00 68.94  ? 550 LYS A C     1 
ATOM   4480  O O     . LYS A 1 552 ? -19.663 16.297  70.479  1.00 72.46  ? 550 LYS A O     1 
ATOM   4481  C CB    . LYS A 1 552 ? -18.917 13.416  72.002  1.00 70.26  ? 550 LYS A CB    1 
ATOM   4482  C CG    . LYS A 1 552 ? -18.924 12.001  71.474  1.00 79.57  ? 550 LYS A CG    1 
ATOM   4483  C CD    . LYS A 1 552 ? -19.525 11.037  72.480  1.00 94.11  ? 550 LYS A CD    1 
ATOM   4484  C CE    . LYS A 1 552 ? -19.379 9.590   72.006  1.00 104.41 ? 550 LYS A CE    1 
ATOM   4485  N NZ    . LYS A 1 552 ? -19.827 8.601   73.034  1.00 109.43 ? 550 LYS A NZ    1 
ATOM   4486  N N     . LEU A 1 553 ? -18.482 16.434  72.388  1.00 63.31  ? 551 LEU A N     1 
ATOM   4487  C CA    . LEU A 1 553 ? -18.935 17.769  72.741  1.00 59.78  ? 551 LEU A CA    1 
ATOM   4488  C C     . LEU A 1 553 ? -18.789 18.780  71.605  1.00 65.61  ? 551 LEU A C     1 
ATOM   4489  O O     . LEU A 1 553 ? -19.723 19.531  71.312  1.00 68.44  ? 551 LEU A O     1 
ATOM   4490  C CB    . LEU A 1 553 ? -18.201 18.268  73.982  1.00 54.80  ? 551 LEU A CB    1 
ATOM   4491  C CG    . LEU A 1 553 ? -18.555 17.612  75.320  1.00 57.47  ? 551 LEU A CG    1 
ATOM   4492  C CD1   . LEU A 1 553 ? -17.427 17.780  76.323  1.00 56.49  ? 551 LEU A CD1   1 
ATOM   4493  C CD2   . LEU A 1 553 ? -19.848 18.163  75.899  1.00 62.09  ? 551 LEU A CD2   1 
ATOM   4494  N N     . VAL A 1 554 ? -17.615 18.840  70.990  1.00 62.78  ? 552 VAL A N     1 
ATOM   4495  C CA    . VAL A 1 554 ? -17.397 19.807  69.910  1.00 63.06  ? 552 VAL A CA    1 
ATOM   4496  C C     . VAL A 1 554 ? -17.847 19.344  68.514  1.00 64.96  ? 552 VAL A C     1 
ATOM   4497  O O     . VAL A 1 554 ? -18.239 20.152  67.675  1.00 62.05  ? 552 VAL A O     1 
ATOM   4498  C CB    . VAL A 1 554 ? -15.954 20.388  69.926  1.00 57.07  ? 552 VAL A CB    1 
ATOM   4499  C CG1   . VAL A 1 554 ? -15.654 21.010  71.304  1.00 47.17  ? 552 VAL A CG1   1 
ATOM   4500  C CG2   . VAL A 1 554 ? -14.929 19.323  69.558  1.00 54.13  ? 552 VAL A CG2   1 
ATOM   4501  N N     . SER A 1 555 ? -17.778 18.040  68.271  1.00 71.42  ? 553 SER A N     1 
ATOM   4502  C CA    . SER A 1 555 ? -18.303 17.467  67.026  1.00 79.20  ? 553 SER A CA    1 
ATOM   4503  C C     . SER A 1 555 ? -19.828 17.602  66.995  1.00 81.26  ? 553 SER A C     1 
ATOM   4504  O O     . SER A 1 555 ? -20.457 17.445  65.942  1.00 80.71  ? 553 SER A O     1 
ATOM   4505  C CB    . SER A 1 555 ? -17.890 15.987  66.859  1.00 83.92  ? 553 SER A CB    1 
ATOM   4506  O OG    . SER A 1 555 ? -16.569 15.836  66.332  1.00 83.30  ? 553 SER A OG    1 
ATOM   4507  N N     . ALA A 1 556 ? -20.402 17.891  68.169  1.00 83.98  ? 554 ALA A N     1 
ATOM   4508  C CA    . ALA A 1 556 ? -21.842 18.127  68.338  1.00 85.47  ? 554 ALA A CA    1 
ATOM   4509  C C     . ALA A 1 556 ? -22.213 19.538  67.888  1.00 85.09  ? 554 ALA A C     1 
ATOM   4510  O O     . ALA A 1 556 ? -21.439 20.483  68.084  1.00 78.46  ? 554 ALA A O     1 
ATOM   4511  C CB    . ALA A 1 556 ? -22.268 17.904  69.804  1.00 74.08  ? 554 ALA A CB    1 
ATOM   4512  O OXT   . ALA A 1 556 ? -23.290 19.751  67.317  1.00 88.96  ? 554 ALA A OXT   1 
ATOM   4513  N N     . PRO B 2 4   ? 51.507  13.194  25.079  1.00 161.26 ? 4   PRO B N     1 
ATOM   4514  C CA    . PRO B 2 4   ? 50.782  12.879  23.844  1.00 161.92 ? 4   PRO B CA    1 
ATOM   4515  C C     . PRO B 2 4   ? 50.018  11.546  23.903  1.00 160.15 ? 4   PRO B C     1 
ATOM   4516  O O     . PRO B 2 4   ? 50.501  10.531  23.394  1.00 160.35 ? 4   PRO B O     1 
ATOM   4517  C CB    . PRO B 2 4   ? 51.901  12.819  22.801  1.00 162.78 ? 4   PRO B CB    1 
ATOM   4518  C CG    . PRO B 2 4   ? 52.902  13.812  23.299  1.00 159.79 ? 4   PRO B CG    1 
ATOM   4519  C CD    . PRO B 2 4   ? 52.853  13.733  24.806  1.00 159.77 ? 4   PRO B CD    1 
ATOM   4520  N N     . ILE B 2 5   ? 48.835  11.569  24.516  1.00 157.10 ? 5   ILE B N     1 
ATOM   4521  C CA    . ILE B 2 5   ? 47.932  10.414  24.569  1.00 154.73 ? 5   ILE B CA    1 
ATOM   4522  C C     . ILE B 2 5   ? 46.517  10.856  24.190  1.00 150.96 ? 5   ILE B C     1 
ATOM   4523  O O     . ILE B 2 5   ? 46.262  12.051  24.028  1.00 150.53 ? 5   ILE B O     1 
ATOM   4524  C CB    . ILE B 2 5   ? 47.920  9.711   25.951  1.00 150.90 ? 5   ILE B CB    1 
ATOM   4525  C CG1   . ILE B 2 5   ? 47.315  10.620  27.024  1.00 142.21 ? 5   ILE B CG1   1 
ATOM   4526  C CG2   . ILE B 2 5   ? 49.322  9.247   26.333  1.00 150.44 ? 5   ILE B CG2   1 
ATOM   4527  C CD1   . ILE B 2 5   ? 47.118  9.940   28.361  1.00 130.51 ? 5   ILE B CD1   1 
ATOM   4528  N N     . GLU B 2 6   ? 45.598  9.905   24.040  1.00 149.67 ? 6   GLU B N     1 
ATOM   4529  C CA    . GLU B 2 6   ? 44.269  10.236  23.536  1.00 148.49 ? 6   GLU B CA    1 
ATOM   4530  C C     . GLU B 2 6   ? 43.495  11.060  24.561  1.00 142.00 ? 6   GLU B C     1 
ATOM   4531  O O     . GLU B 2 6   ? 43.976  11.289  25.672  1.00 138.61 ? 6   GLU B O     1 
ATOM   4532  C CB    . GLU B 2 6   ? 43.484  8.950   23.254  1.00 149.04 ? 6   GLU B CB    1 
ATOM   4533  C CG    . GLU B 2 6   ? 44.164  7.991   22.299  1.00 153.01 ? 6   GLU B CG    1 
ATOM   4534  C CD    . GLU B 2 6   ? 44.278  8.556   20.899  1.00 156.28 ? 6   GLU B CD    1 
ATOM   4535  O OE1   . GLU B 2 6   ? 45.366  9.062   20.548  1.00 154.85 ? 6   GLU B OE1   1 
ATOM   4536  O OE2   . GLU B 2 6   ? 43.279  8.496   20.151  1.00 155.60 ? 6   GLU B OE2   1 
ATOM   4537  N N     . THR B 2 7   ? 42.302  11.511  24.178  1.00 135.71 ? 7   THR B N     1 
ATOM   4538  C CA    . THR B 2 7   ? 41.380  12.172  25.105  1.00 127.45 ? 7   THR B CA    1 
ATOM   4539  C C     . THR B 2 7   ? 39.943  11.726  24.827  1.00 123.81 ? 7   THR B C     1 
ATOM   4540  O O     . THR B 2 7   ? 39.452  11.869  23.704  1.00 123.31 ? 7   THR B O     1 
ATOM   4541  C CB    . THR B 2 7   ? 41.477  13.736  25.064  1.00 117.01 ? 7   THR B CB    1 
ATOM   4542  O OG1   . THR B 2 7   ? 40.531  14.275  24.128  1.00 111.25 ? 7   THR B OG1   1 
ATOM   4543  C CG2   . THR B 2 7   ? 42.891  14.199  24.710  1.00 122.80 ? 7   THR B CG2   1 
ATOM   4544  N N     . VAL B 2 8   ? 39.271  11.196  25.847  1.00 120.56 ? 8   VAL B N     1 
ATOM   4545  C CA    . VAL B 2 8   ? 37.891  10.743  25.694  1.00 114.75 ? 8   VAL B CA    1 
ATOM   4546  C C     . VAL B 2 8   ? 36.962  11.952  25.591  1.00 112.15 ? 8   VAL B C     1 
ATOM   4547  O O     . VAL B 2 8   ? 36.798  12.698  26.560  1.00 108.57 ? 8   VAL B O     1 
ATOM   4548  C CB    . VAL B 2 8   ? 37.449  9.867   26.890  1.00 106.13 ? 8   VAL B CB    1 
ATOM   4549  C CG1   . VAL B 2 8   ? 36.064  9.288   26.644  1.00 106.08 ? 8   VAL B CG1   1 
ATOM   4550  C CG2   . VAL B 2 8   ? 38.464  8.757   27.155  1.00 101.14 ? 8   VAL B CG2   1 
ATOM   4551  N N     . PRO B 2 9   ? 36.346  12.154  24.412  1.00 112.47 ? 9   PRO B N     1 
ATOM   4552  C CA    . PRO B 2 9   ? 35.428  13.291  24.268  1.00 109.38 ? 9   PRO B CA    1 
ATOM   4553  C C     . PRO B 2 9   ? 34.262  13.184  25.251  1.00 106.16 ? 9   PRO B C     1 
ATOM   4554  O O     . PRO B 2 9   ? 33.910  12.082  25.685  1.00 106.52 ? 9   PRO B O     1 
ATOM   4555  C CB    . PRO B 2 9   ? 34.942  13.181  22.814  1.00 107.66 ? 9   PRO B CB    1 
ATOM   4556  C CG    . PRO B 2 9   ? 35.243  11.772  22.403  1.00 110.60 ? 9   PRO B CG    1 
ATOM   4557  C CD    . PRO B 2 9   ? 36.464  11.370  23.170  1.00 112.24 ? 9   PRO B CD    1 
ATOM   4558  N N     . VAL B 2 10  ? 33.684  14.321  25.614  1.00 100.03 ? 10  VAL B N     1 
ATOM   4559  C CA    . VAL B 2 10  ? 32.601  14.332  26.578  1.00 95.97  ? 10  VAL B CA    1 
ATOM   4560  C C     . VAL B 2 10  ? 31.596  15.401  26.224  1.00 91.85  ? 10  VAL B C     1 
ATOM   4561  O O     . VAL B 2 10  ? 31.941  16.435  25.658  1.00 91.22  ? 10  VAL B O     1 
ATOM   4562  C CB    . VAL B 2 10  ? 33.118  14.595  27.992  1.00 90.27  ? 10  VAL B CB    1 
ATOM   4563  C CG1   . VAL B 2 10  ? 31.965  14.586  28.981  1.00 88.18  ? 10  VAL B CG1   1 
ATOM   4564  C CG2   . VAL B 2 10  ? 34.163  13.561  28.372  1.00 95.48  ? 10  VAL B CG2   1 
ATOM   4565  N N     . LYS B 2 11  ? 30.344  15.157  26.566  1.00 91.30  ? 11  LYS B N     1 
ATOM   4566  C CA    . LYS B 2 11  ? 29.309  16.090  26.191  1.00 97.88  ? 11  LYS B CA    1 
ATOM   4567  C C     . LYS B 2 11  ? 28.281  16.277  27.295  1.00 99.26  ? 11  LYS B C     1 
ATOM   4568  O O     . LYS B 2 11  ? 27.948  15.342  28.026  1.00 98.39  ? 11  LYS B O     1 
ATOM   4569  C CB    . LYS B 2 11  ? 28.619  15.605  24.915  1.00 106.47 ? 11  LYS B CB    1 
ATOM   4570  C CG    . LYS B 2 11  ? 29.567  15.044  23.854  1.00 109.07 ? 11  LYS B CG    1 
ATOM   4571  C CD    . LYS B 2 11  ? 28.789  14.367  22.727  1.00 114.52 ? 11  LYS B CD    1 
ATOM   4572  C CE    . LYS B 2 11  ? 29.703  13.637  21.746  1.00 117.56 ? 11  LYS B CE    1 
ATOM   4573  N NZ    . LYS B 2 11  ? 28.919  12.929  20.685  1.00 111.34 ? 11  LYS B NZ    1 
ATOM   4574  N N     . LEU B 2 12  ? 27.783  17.502  27.409  1.00 100.79 ? 12  LEU B N     1 
ATOM   4575  C CA    . LEU B 2 12  ? 26.648  17.790  28.273  1.00 105.62 ? 12  LEU B CA    1 
ATOM   4576  C C     . LEU B 2 12  ? 25.408  17.163  27.655  1.00 109.68 ? 12  LEU B C     1 
ATOM   4577  O O     . LEU B 2 12  ? 25.071  17.452  26.508  1.00 112.34 ? 12  LEU B O     1 
ATOM   4578  C CB    . LEU B 2 12  ? 26.435  19.305  28.398  1.00 103.01 ? 12  LEU B CB    1 
ATOM   4579  C CG    . LEU B 2 12  ? 27.239  20.106  29.424  1.00 90.97  ? 12  LEU B CG    1 
ATOM   4580  C CD1   . LEU B 2 12  ? 28.697  19.670  29.449  1.00 87.06  ? 12  LEU B CD1   1 
ATOM   4581  C CD2   . LEU B 2 12  ? 27.116  21.599  29.147  1.00 86.71  ? 12  LEU B CD2   1 
ATOM   4582  N N     . LYS B 2 13  ? 24.721  16.318  28.414  1.00 110.74 ? 13  LYS B N     1 
ATOM   4583  C CA    . LYS B 2 13  ? 23.504  15.687  27.917  1.00 116.82 ? 13  LYS B CA    1 
ATOM   4584  C C     . LYS B 2 13  ? 22.503  16.741  27.419  1.00 121.83 ? 13  LYS B C     1 
ATOM   4585  O O     . LYS B 2 13  ? 22.482  17.868  27.922  1.00 117.97 ? 13  LYS B O     1 
ATOM   4586  C CB    . LYS B 2 13  ? 22.896  14.776  28.987  1.00 118.61 ? 13  LYS B CB    1 
ATOM   4587  C CG    . LYS B 2 13  ? 22.766  15.408  30.353  1.00 107.42 ? 13  LYS B CG    1 
ATOM   4588  C CD    . LYS B 2 13  ? 22.438  14.356  31.384  1.00 108.16 ? 13  LYS B CD    1 
ATOM   4589  C CE    . LYS B 2 13  ? 21.538  14.907  32.473  1.00 108.08 ? 13  LYS B CE    1 
ATOM   4590  N NZ    . LYS B 2 13  ? 21.172  13.856  33.470  1.00 116.18 ? 13  LYS B NZ    1 
ATOM   4591  N N     . PRO B 2 14  ? 21.669  16.367  26.429  1.00 127.07 ? 14  PRO B N     1 
ATOM   4592  C CA    . PRO B 2 14  ? 20.885  17.295  25.598  1.00 125.76 ? 14  PRO B CA    1 
ATOM   4593  C C     . PRO B 2 14  ? 20.076  18.344  26.360  1.00 124.27 ? 14  PRO B C     1 
ATOM   4594  O O     . PRO B 2 14  ? 19.387  18.021  27.330  1.00 120.58 ? 14  PRO B O     1 
ATOM   4595  C CB    . PRO B 2 14  ? 19.930  16.363  24.844  1.00 126.27 ? 14  PRO B CB    1 
ATOM   4596  C CG    . PRO B 2 14  ? 20.642  15.063  24.789  1.00 125.74 ? 14  PRO B CG    1 
ATOM   4597  C CD    . PRO B 2 14  ? 21.395  14.959  26.082  1.00 124.54 ? 14  PRO B CD    1 
ATOM   4598  N N     . GLY B 2 15  ? 20.172  19.593  25.905  1.00 125.20 ? 15  GLY B N     1 
ATOM   4599  C CA    . GLY B 2 15  ? 19.309  20.672  26.362  1.00 124.30 ? 15  GLY B CA    1 
ATOM   4600  C C     . GLY B 2 15  ? 19.857  21.622  27.416  1.00 121.05 ? 15  GLY B C     1 
ATOM   4601  O O     . GLY B 2 15  ? 19.399  22.765  27.525  1.00 116.93 ? 15  GLY B O     1 
ATOM   4602  N N     . MET B 2 16  ? 20.855  21.167  28.170  1.00 118.86 ? 16  MET B N     1 
ATOM   4603  C CA    . MET B 2 16  ? 21.341  21.902  29.339  1.00 112.14 ? 16  MET B CA    1 
ATOM   4604  C C     . MET B 2 16  ? 22.719  22.502  29.130  1.00 108.81 ? 16  MET B C     1 
ATOM   4605  O O     . MET B 2 16  ? 23.528  21.981  28.356  1.00 110.28 ? 16  MET B O     1 
ATOM   4606  C CB    . MET B 2 16  ? 21.398  20.997  30.560  1.00 103.77 ? 16  MET B CB    1 
ATOM   4607  C CG    . MET B 2 16  ? 20.070  20.655  31.155  1.00 105.18 ? 16  MET B CG    1 
ATOM   4608  S SD    . MET B 2 16  ? 20.340  19.202  32.159  1.00 100.41 ? 16  MET B SD    1 
ATOM   4609  C CE    . MET B 2 16  ? 21.325  18.241  31.015  1.00 103.28 ? 16  MET B CE    1 
ATOM   4610  N N     . ASP B 2 17  ? 22.982  23.591  29.847  1.00 102.17 ? 17  ASP B N     1 
ATOM   4611  C CA    . ASP B 2 17  ? 24.223  24.335  29.686  1.00 96.25  ? 17  ASP B CA    1 
ATOM   4612  C C     . ASP B 2 17  ? 25.266  23.982  30.753  1.00 90.37  ? 17  ASP B C     1 
ATOM   4613  O O     . ASP B 2 17  ? 25.010  23.180  31.656  1.00 85.46  ? 17  ASP B O     1 
ATOM   4614  C CB    . ASP B 2 17  ? 23.921  25.833  29.728  1.00 96.06  ? 17  ASP B CB    1 
ATOM   4615  C CG    . ASP B 2 17  ? 24.887  26.637  28.896  1.00 97.94  ? 17  ASP B CG    1 
ATOM   4616  O OD1   . ASP B 2 17  ? 25.939  26.070  28.525  1.00 96.76  ? 17  ASP B OD1   1 
ATOM   4617  O OD2   . ASP B 2 17  ? 24.597  27.826  28.615  1.00 98.06  ? 17  ASP B OD2   1 
ATOM   4618  N N     . GLY B 2 18  ? 26.444  24.591  30.643  1.00 88.53  ? 18  GLY B N     1 
ATOM   4619  C CA    . GLY B 2 18  ? 27.476  24.443  31.651  1.00 78.78  ? 18  GLY B CA    1 
ATOM   4620  C C     . GLY B 2 18  ? 27.039  25.102  32.946  1.00 74.90  ? 18  GLY B C     1 
ATOM   4621  O O     . GLY B 2 18  ? 26.184  25.993  32.939  1.00 72.60  ? 18  GLY B O     1 
ATOM   4622  N N     . PRO B 2 19  ? 27.615  24.659  34.073  1.00 69.37  ? 19  PRO B N     1 
ATOM   4623  C CA    . PRO B 2 19  ? 27.211  25.237  35.351  1.00 65.41  ? 19  PRO B CA    1 
ATOM   4624  C C     . PRO B 2 19  ? 27.588  26.722  35.447  1.00 61.88  ? 19  PRO B C     1 
ATOM   4625  O O     . PRO B 2 19  ? 28.733  27.101  35.271  1.00 64.00  ? 19  PRO B O     1 
ATOM   4626  C CB    . PRO B 2 19  ? 28.006  24.402  36.355  1.00 60.13  ? 19  PRO B CB    1 
ATOM   4627  C CG    . PRO B 2 19  ? 29.213  23.993  35.615  1.00 56.41  ? 19  PRO B CG    1 
ATOM   4628  C CD    . PRO B 2 19  ? 28.788  23.780  34.207  1.00 62.44  ? 19  PRO B CD    1 
ATOM   4629  N N     . LYS B 2 20  ? 26.599  27.553  35.714  1.00 60.52  ? 20  LYS B N     1 
ATOM   4630  C CA    . LYS B 2 20  ? 26.774  28.980  35.983  1.00 59.96  ? 20  LYS B CA    1 
ATOM   4631  C C     . LYS B 2 20  ? 26.703  29.391  37.464  1.00 57.44  ? 20  LYS B C     1 
ATOM   4632  O O     . LYS B 2 20  ? 26.367  30.526  37.741  1.00 60.58  ? 20  LYS B O     1 
ATOM   4633  C CB    . LYS B 2 20  ? 25.861  29.854  35.119  1.00 62.59  ? 20  LYS B CB    1 
ATOM   4634  C CG    . LYS B 2 20  ? 26.218  29.890  33.636  1.00 67.61  ? 20  LYS B CG    1 
ATOM   4635  C CD    . LYS B 2 20  ? 25.405  30.984  32.923  1.00 71.39  ? 20  LYS B CD    1 
ATOM   4636  C CE    . LYS B 2 20  ? 25.278  30.747  31.424  1.00 74.41  ? 20  LYS B CE    1 
ATOM   4637  N NZ    . LYS B 2 20  ? 26.535  31.057  30.702  1.00 75.28  ? 20  LYS B NZ    1 
ATOM   4638  N N     . VAL B 2 21  ? 26.832  28.455  38.401  1.00 54.55  ? 21  VAL B N     1 
ATOM   4639  C CA    . VAL B 2 21  ? 26.633  28.756  39.831  1.00 50.38  ? 21  VAL B CA    1 
ATOM   4640  C C     . VAL B 2 21  ? 27.664  29.673  40.525  1.00 51.00  ? 21  VAL B C     1 
ATOM   4641  O O     . VAL B 2 21  ? 28.876  29.523  40.374  1.00 51.07  ? 21  VAL B O     1 
ATOM   4642  C CB    . VAL B 2 21  ? 26.411  27.466  40.667  1.00 43.91  ? 21  VAL B CB    1 
ATOM   4643  C CG1   . VAL B 2 21  ? 27.402  26.422  40.300  1.00 41.60  ? 21  VAL B CG1   1 
ATOM   4644  C CG2   . VAL B 2 21  ? 26.464  27.773  42.136  1.00 45.24  ? 21  VAL B CG2   1 
ATOM   4645  N N     . LYS B 2 22  ? 27.135  30.605  41.312  1.00 50.10  ? 22  LYS B N     1 
ATOM   4646  C CA    . LYS B 2 22  ? 27.886  31.669  41.981  1.00 51.27  ? 22  LYS B CA    1 
ATOM   4647  C C     . LYS B 2 22  ? 28.810  31.184  43.100  1.00 49.02  ? 22  LYS B C     1 
ATOM   4648  O O     . LYS B 2 22  ? 28.469  30.260  43.832  1.00 46.80  ? 22  LYS B O     1 
ATOM   4649  C CB    . LYS B 2 22  ? 26.872  32.645  42.574  1.00 55.21  ? 22  LYS B CB    1 
ATOM   4650  C CG    . LYS B 2 22  ? 27.466  33.798  43.310  1.00 58.96  ? 22  LYS B CG    1 
ATOM   4651  C CD    . LYS B 2 22  ? 26.411  34.495  44.155  1.00 71.56  ? 22  LYS B CD    1 
ATOM   4652  C CE    . LYS B 2 22  ? 25.262  35.033  43.311  1.00 77.61  ? 22  LYS B CE    1 
ATOM   4653  N NZ    . LYS B 2 22  ? 24.296  35.810  44.156  1.00 78.73  ? 22  LYS B NZ    1 
ATOM   4654  N N     . GLN B 2 23  ? 29.968  31.831  43.253  1.00 48.91  ? 23  GLN B N     1 
ATOM   4655  C CA    . GLN B 2 23  ? 30.927  31.476  44.316  1.00 40.65  ? 23  GLN B CA    1 
ATOM   4656  C C     . GLN B 2 23  ? 30.567  32.108  45.646  1.00 40.64  ? 23  GLN B C     1 
ATOM   4657  O O     . GLN B 2 23  ? 30.317  33.308  45.726  1.00 42.61  ? 23  GLN B O     1 
ATOM   4658  C CB    . GLN B 2 23  ? 32.344  31.896  43.944  1.00 36.77  ? 23  GLN B CB    1 
ATOM   4659  C CG    . GLN B 2 23  ? 33.348  31.793  45.079  1.00 36.79  ? 23  GLN B CG    1 
ATOM   4660  C CD    . GLN B 2 23  ? 33.729  30.355  45.471  1.00 38.94  ? 23  GLN B CD    1 
ATOM   4661  O OE1   . GLN B 2 23  ? 34.170  29.553  44.642  1.00 39.87  ? 23  GLN B OE1   1 
ATOM   4662  N NE2   . GLN B 2 23  ? 33.590  30.047  46.747  1.00 36.49  ? 23  GLN B NE2   1 
ATOM   4663  N N     . TRP B 2 24  ? 30.539  31.300  46.699  1.00 38.23  ? 24  TRP B N     1 
ATOM   4664  C CA    . TRP B 2 24  ? 30.237  31.822  48.022  1.00 35.78  ? 24  TRP B CA    1 
ATOM   4665  C C     . TRP B 2 24  ? 31.499  32.322  48.715  1.00 37.15  ? 24  TRP B C     1 
ATOM   4666  O O     . TRP B 2 24  ? 32.593  31.813  48.476  1.00 36.39  ? 24  TRP B O     1 
ATOM   4667  C CB    . TRP B 2 24  ? 29.507  30.790  48.880  1.00 32.98  ? 24  TRP B CB    1 
ATOM   4668  C CG    . TRP B 2 24  ? 30.230  29.490  49.079  1.00 36.09  ? 24  TRP B CG    1 
ATOM   4669  C CD1   . TRP B 2 24  ? 31.322  29.273  49.862  1.00 35.80  ? 24  TRP B CD1   1 
ATOM   4670  C CD2   . TRP B 2 24  ? 29.889  28.218  48.513  1.00 34.57  ? 24  TRP B CD2   1 
ATOM   4671  N NE1   . TRP B 2 24  ? 31.694  27.952  49.816  1.00 35.01  ? 24  TRP B NE1   1 
ATOM   4672  C CE2   . TRP B 2 24  ? 30.836  27.282  48.988  1.00 35.36  ? 24  TRP B CE2   1 
ATOM   4673  C CE3   . TRP B 2 24  ? 28.888  27.784  47.653  1.00 30.73  ? 24  TRP B CE3   1 
ATOM   4674  C CZ2   . TRP B 2 24  ? 30.805  25.932  48.630  1.00 33.79  ? 24  TRP B CZ2   1 
ATOM   4675  C CZ3   . TRP B 2 24  ? 28.857  26.455  47.308  1.00 36.61  ? 24  TRP B CZ3   1 
ATOM   4676  C CH2   . TRP B 2 24  ? 29.808  25.539  47.800  1.00 33.89  ? 24  TRP B CH2   1 
ATOM   4677  N N     . PRO B 2 25  ? 31.347  33.344  49.560  1.00 35.82  ? 25  PRO B N     1 
ATOM   4678  C CA    . PRO B 2 25  ? 32.430  33.928  50.351  1.00 33.98  ? 25  PRO B CA    1 
ATOM   4679  C C     . PRO B 2 25  ? 33.279  32.895  51.095  1.00 32.71  ? 25  PRO B C     1 
ATOM   4680  O O     . PRO B 2 25  ? 32.769  31.964  51.704  1.00 32.24  ? 25  PRO B O     1 
ATOM   4681  C CB    . PRO B 2 25  ? 31.677  34.812  51.362  1.00 34.44  ? 25  PRO B CB    1 
ATOM   4682  C CG    . PRO B 2 25  ? 30.190  34.732  50.977  1.00 34.11  ? 25  PRO B CG    1 
ATOM   4683  C CD    . PRO B 2 25  ? 30.130  34.164  49.617  1.00 34.32  ? 25  PRO B CD    1 
ATOM   4684  N N     . LEU B 2 26  ? 34.586  33.094  51.068  1.00 32.76  ? 26  LEU B N     1 
ATOM   4685  C CA    . LEU B 2 26  ? 35.491  32.222  51.796  1.00 31.93  ? 26  LEU B CA    1 
ATOM   4686  C C     . LEU B 2 26  ? 36.223  32.967  52.910  1.00 34.68  ? 26  LEU B C     1 
ATOM   4687  O O     . LEU B 2 26  ? 36.278  34.201  52.935  1.00 34.00  ? 26  LEU B O     1 
ATOM   4688  C CB    . LEU B 2 26  ? 36.485  31.567  50.850  1.00 31.28  ? 26  LEU B CB    1 
ATOM   4689  C CG    . LEU B 2 26  ? 35.917  30.725  49.703  1.00 35.49  ? 26  LEU B CG    1 
ATOM   4690  C CD1   . LEU B 2 26  ? 37.035  30.264  48.769  1.00 34.32  ? 26  LEU B CD1   1 
ATOM   4691  C CD2   . LEU B 2 26  ? 35.101  29.531  50.213  1.00 32.79  ? 26  LEU B CD2   1 
ATOM   4692  N N     . THR B 2 27  ? 36.733  32.204  53.871  1.00 35.92  ? 27  THR B N     1 
ATOM   4693  C CA    . THR B 2 27  ? 37.559  32.768  54.924  1.00 31.95  ? 27  THR B CA    1 
ATOM   4694  C C     . THR B 2 27  ? 38.921  33.037  54.338  1.00 37.28  ? 27  THR B C     1 
ATOM   4695  O O     . THR B 2 27  ? 39.330  32.380  53.374  1.00 36.24  ? 27  THR B O     1 
ATOM   4696  C CB    . THR B 2 27  ? 37.717  31.831  56.126  1.00 33.94  ? 27  THR B CB    1 
ATOM   4697  O OG1   . THR B 2 27  ? 38.195  30.547  55.706  1.00 38.46  ? 27  THR B OG1   1 
ATOM   4698  C CG2   . THR B 2 27  ? 36.410  31.665  56.844  1.00 30.70  ? 27  THR B CG2   1 
ATOM   4699  N N     . GLU B 2 28  ? 39.616  34.022  54.902  1.00 41.95  ? 28  GLU B N     1 
ATOM   4700  C CA    . GLU B 2 28  ? 40.958  34.357  54.450  1.00 41.87  ? 28  GLU B CA    1 
ATOM   4701  C C     . GLU B 2 28  ? 41.846  33.131  54.622  1.00 36.51  ? 28  GLU B C     1 
ATOM   4702  O O     . GLU B 2 28  ? 42.723  32.852  53.838  1.00 35.17  ? 28  GLU B O     1 
ATOM   4703  C CB    . GLU B 2 28  ? 41.503  35.525  55.249  1.00 40.70  ? 28  GLU B CB    1 
ATOM   4704  C CG    . GLU B 2 28  ? 42.910  35.868  54.872  1.00 51.59  ? 28  GLU B CG    1 
ATOM   4705  C CD    . GLU B 2 28  ? 43.476  36.987  55.702  1.00 63.06  ? 28  GLU B CD    1 
ATOM   4706  O OE1   . GLU B 2 28  ? 43.075  37.096  56.883  1.00 63.04  ? 28  GLU B OE1   1 
ATOM   4707  O OE2   . GLU B 2 28  ? 44.318  37.755  55.168  1.00 74.22  ? 28  GLU B OE2   1 
ATOM   4708  N N     . GLU B 2 29  ? 41.586  32.384  55.664  1.00 33.37  ? 29  GLU B N     1 
ATOM   4709  C CA    . GLU B 2 29  ? 42.269  31.142  55.842  1.00 39.54  ? 29  GLU B CA    1 
ATOM   4710  C C     . GLU B 2 29  ? 42.192  30.306  54.570  1.00 41.32  ? 29  GLU B C     1 
ATOM   4711  O O     . GLU B 2 29  ? 43.211  29.904  54.013  1.00 42.07  ? 29  GLU B O     1 
ATOM   4712  C CB    . GLU B 2 29  ? 41.588  30.396  56.969  1.00 42.13  ? 29  GLU B CB    1 
ATOM   4713  C CG    . GLU B 2 29  ? 42.190  29.072  57.257  1.00 46.83  ? 29  GLU B CG    1 
ATOM   4714  C CD    . GLU B 2 29  ? 41.676  28.540  58.561  1.00 58.23  ? 29  GLU B CD    1 
ATOM   4715  O OE1   . GLU B 2 29  ? 40.491  28.116  58.603  1.00 61.07  ? 29  GLU B OE1   1 
ATOM   4716  O OE2   . GLU B 2 29  ? 42.451  28.580  59.546  1.00 61.72  ? 29  GLU B OE2   1 
ATOM   4717  N N     . LYS B 2 30  ? 40.968  30.063  54.111  1.00 39.73  ? 30  LYS B N     1 
ATOM   4718  C CA    . LYS B 2 30  ? 40.707  29.186  52.984  1.00 37.16  ? 30  LYS B CA    1 
ATOM   4719  C C     . LYS B 2 30  ? 41.111  29.835  51.650  1.00 35.22  ? 30  LYS B C     1 
ATOM   4720  O O     . LYS B 2 30  ? 41.596  29.168  50.740  1.00 33.94  ? 30  LYS B O     1 
ATOM   4721  C CB    . LYS B 2 30  ? 39.237  28.746  52.999  1.00 37.49  ? 30  LYS B CB    1 
ATOM   4722  C CG    . LYS B 2 30  ? 38.861  27.832  54.148  1.00 36.77  ? 30  LYS B CG    1 
ATOM   4723  C CD    . LYS B 2 30  ? 37.589  27.039  53.831  1.00 35.59  ? 30  LYS B CD    1 
ATOM   4724  C CE    . LYS B 2 30  ? 36.826  26.551  55.094  1.00 40.02  ? 30  LYS B CE    1 
ATOM   4725  N NZ    . LYS B 2 30  ? 37.372  25.341  55.785  1.00 37.44  ? 30  LYS B NZ    1 
ATOM   4726  N N     . ILE B 2 31  ? 40.924  31.142  51.547  1.00 34.62  ? 31  ILE B N     1 
ATOM   4727  C CA    . ILE B 2 31  ? 41.439  31.886  50.403  1.00 35.51  ? 31  ILE B CA    1 
ATOM   4728  C C     . ILE B 2 31  ? 42.976  31.797  50.262  1.00 39.83  ? 31  ILE B C     1 
ATOM   4729  O O     . ILE B 2 31  ? 43.488  31.739  49.157  1.00 41.91  ? 31  ILE B O     1 
ATOM   4730  C CB    . ILE B 2 31  ? 40.995  33.351  50.443  1.00 32.66  ? 31  ILE B CB    1 
ATOM   4731  C CG1   . ILE B 2 31  ? 39.503  33.450  50.229  1.00 32.79  ? 31  ILE B CG1   1 
ATOM   4732  C CG2   . ILE B 2 31  ? 41.683  34.149  49.386  1.00 30.84  ? 31  ILE B CG2   1 
ATOM   4733  C CD1   . ILE B 2 31  ? 39.064  34.814  49.917  1.00 35.26  ? 31  ILE B CD1   1 
ATOM   4734  N N     . LYS B 2 32  ? 43.715  31.777  51.370  1.00 40.80  ? 32  LYS B N     1 
ATOM   4735  C CA    . LYS B 2 32  ? 45.161  31.612  51.289  1.00 40.25  ? 32  LYS B CA    1 
ATOM   4736  C C     . LYS B 2 32  ? 45.459  30.237  50.772  1.00 39.34  ? 32  LYS B C     1 
ATOM   4737  O O     . LYS B 2 32  ? 46.241  30.083  49.864  1.00 42.77  ? 32  LYS B O     1 
ATOM   4738  C CB    . LYS B 2 32  ? 45.868  31.800  52.646  1.00 43.75  ? 32  LYS B CB    1 
ATOM   4739  C CG    . LYS B 2 32  ? 46.012  33.253  53.124  1.00 42.12  ? 32  LYS B CG    1 
ATOM   4740  C CD    . LYS B 2 32  ? 45.968  34.222  51.962  1.00 49.87  ? 32  LYS B CD    1 
ATOM   4741  C CE    . LYS B 2 32  ? 45.089  35.437  52.278  1.00 54.28  ? 32  LYS B CE    1 
ATOM   4742  N NZ    . LYS B 2 32  ? 44.354  35.942  51.051  1.00 55.35  ? 32  LYS B NZ    1 
ATOM   4743  N N     . ALA B 2 33  ? 44.837  29.229  51.358  1.00 39.48  ? 33  ALA B N     1 
ATOM   4744  C CA    . ALA B 2 33  ? 45.152  27.850  50.982  1.00 45.93  ? 33  ALA B CA    1 
ATOM   4745  C C     . ALA B 2 33  ? 44.857  27.575  49.509  1.00 44.38  ? 33  ALA B C     1 
ATOM   4746  O O     . ALA B 2 33  ? 45.512  26.749  48.881  1.00 44.98  ? 33  ALA B O     1 
ATOM   4747  C CB    . ALA B 2 33  ? 44.425  26.836  51.897  1.00 39.44  ? 33  ALA B CB    1 
ATOM   4748  N N     . LEU B 2 34  ? 43.870  28.264  48.958  1.00 40.59  ? 34  LEU B N     1 
ATOM   4749  C CA    . LEU B 2 34  ? 43.525  28.025  47.566  1.00 44.50  ? 34  LEU B CA    1 
ATOM   4750  C C     . LEU B 2 34  ? 44.545  28.659  46.642  1.00 47.41  ? 34  LEU B C     1 
ATOM   4751  O O     . LEU B 2 34  ? 44.991  28.023  45.698  1.00 50.43  ? 34  LEU B O     1 
ATOM   4752  C CB    . LEU B 2 34  ? 42.090  28.467  47.229  1.00 40.04  ? 34  LEU B CB    1 
ATOM   4753  C CG    . LEU B 2 34  ? 41.020  27.473  47.690  1.00 35.17  ? 34  LEU B CG    1 
ATOM   4754  C CD1   . LEU B 2 34  ? 39.642  27.875  47.241  1.00 31.47  ? 34  LEU B CD1   1 
ATOM   4755  C CD2   . LEU B 2 34  ? 41.363  26.081  47.216  1.00 34.21  ? 34  LEU B CD2   1 
ATOM   4756  N N     . VAL B 2 35  ? 44.926  29.901  46.924  1.00 45.71  ? 35  VAL B N     1 
ATOM   4757  C CA    . VAL B 2 35  ? 45.961  30.567  46.141  1.00 47.57  ? 35  VAL B CA    1 
ATOM   4758  C C     . VAL B 2 35  ? 47.263  29.740  46.116  1.00 52.14  ? 35  VAL B C     1 
ATOM   4759  O O     . VAL B 2 35  ? 47.765  29.400  45.049  1.00 57.20  ? 35  VAL B O     1 
ATOM   4760  C CB    . VAL B 2 35  ? 46.185  32.037  46.594  1.00 41.20  ? 35  VAL B CB    1 
ATOM   4761  C CG1   . VAL B 2 35  ? 47.469  32.574  46.041  1.00 43.38  ? 35  VAL B CG1   1 
ATOM   4762  C CG2   . VAL B 2 35  ? 45.031  32.909  46.150  1.00 37.87  ? 35  VAL B CG2   1 
ATOM   4763  N N     . GLU B 2 36  ? 47.785  29.385  47.281  1.00 49.98  ? 36  GLU B N     1 
ATOM   4764  C CA    . GLU B 2 36  ? 48.989  28.570  47.349  1.00 55.45  ? 36  GLU B CA    1 
ATOM   4765  C C     . GLU B 2 36  ? 48.811  27.181  46.724  1.00 58.02  ? 36  GLU B C     1 
ATOM   4766  O O     . GLU B 2 36  ? 49.793  26.544  46.360  1.00 65.29  ? 36  GLU B O     1 
ATOM   4767  C CB    . GLU B 2 36  ? 49.477  28.449  48.799  1.00 60.90  ? 36  GLU B CB    1 
ATOM   4768  C CG    . GLU B 2 36  ? 50.785  27.679  48.991  1.00 68.96  ? 36  GLU B CG    1 
ATOM   4769  C CD    . GLU B 2 36  ? 50.876  27.009  50.368  1.00 83.64  ? 36  GLU B CD    1 
ATOM   4770  O OE1   . GLU B 2 36  ? 51.996  26.639  50.794  1.00 89.13  ? 36  GLU B OE1   1 
ATOM   4771  O OE2   . GLU B 2 36  ? 49.821  26.840  51.026  1.00 87.18  ? 36  GLU B OE2   1 
ATOM   4772  N N     . ILE B 2 37  ? 47.577  26.694  46.637  1.00 55.50  ? 37  ILE B N     1 
ATOM   4773  C CA    . ILE B 2 37  ? 47.303  25.396  46.003  1.00 56.19  ? 37  ILE B CA    1 
ATOM   4774  C C     . ILE B 2 37  ? 47.175  25.490  44.493  1.00 56.44  ? 37  ILE B C     1 
ATOM   4775  O O     . ILE B 2 37  ? 47.671  24.636  43.772  1.00 59.27  ? 37  ILE B O     1 
ATOM   4776  C CB    . ILE B 2 37  ? 46.039  24.701  46.578  1.00 53.63  ? 37  ILE B CB    1 
ATOM   4777  C CG1   . ILE B 2 37  ? 46.397  23.847  47.790  1.00 50.72  ? 37  ILE B CG1   1 
ATOM   4778  C CG2   . ILE B 2 37  ? 45.431  23.794  45.554  1.00 51.14  ? 37  ILE B CG2   1 
ATOM   4779  C CD1   . ILE B 2 37  ? 45.209  23.408  48.591  1.00 43.08  ? 37  ILE B CD1   1 
ATOM   4780  N N     . CYS B 2 38  ? 46.489  26.527  44.029  1.00 55.78  ? 38  CYS B N     1 
ATOM   4781  C CA    . CYS B 2 38  ? 46.270  26.741  42.602  1.00 58.42  ? 38  CYS B CA    1 
ATOM   4782  C C     . CYS B 2 38  ? 47.530  27.175  41.854  1.00 64.24  ? 38  CYS B C     1 
ATOM   4783  O O     . CYS B 2 38  ? 47.769  26.710  40.738  1.00 64.75  ? 38  CYS B O     1 
ATOM   4784  C CB    . CYS B 2 38  ? 45.163  27.773  42.357  1.00 57.22  ? 38  CYS B CB    1 
ATOM   4785  S SG    . CYS B 2 38  ? 43.488  27.193  42.649  1.00 57.12  ? 38  CYS B SG    1 
ATOM   4786  N N     . THR B 2 39  ? 48.332  28.070  42.438  1.00 66.56  ? 39  THR B N     1 
ATOM   4787  C CA    . THR B 2 39  ? 49.547  28.507  41.740  1.00 68.40  ? 39  THR B CA    1 
ATOM   4788  C C     . THR B 2 39  ? 50.385  27.287  41.398  1.00 66.93  ? 39  THR B C     1 
ATOM   4789  O O     . THR B 2 39  ? 50.913  27.208  40.297  1.00 68.54  ? 39  THR B O     1 
ATOM   4790  C CB    . THR B 2 39  ? 50.421  29.527  42.526  1.00 67.84  ? 39  THR B CB    1 
ATOM   4791  O OG1   . THR B 2 39  ? 51.077  28.862  43.615  1.00 72.79  ? 39  THR B OG1   1 
ATOM   4792  C CG2   . THR B 2 39  ? 49.594  30.716  43.033  1.00 61.18  ? 39  THR B CG2   1 
ATOM   4793  N N     . GLU B 2 40  ? 50.482  26.339  42.335  1.00 64.57  ? 40  GLU B N     1 
ATOM   4794  C CA    . GLU B 2 40  ? 51.223  25.101  42.114  1.00 65.17  ? 40  GLU B CA    1 
ATOM   4795  C C     . GLU B 2 40  ? 50.591  24.234  41.044  1.00 67.82  ? 40  GLU B C     1 
ATOM   4796  O O     . GLU B 2 40  ? 51.279  23.586  40.264  1.00 71.11  ? 40  GLU B O     1 
ATOM   4797  C CB    . GLU B 2 40  ? 51.340  24.293  43.397  1.00 68.55  ? 40  GLU B CB    1 
ATOM   4798  C CG    . GLU B 2 40  ? 52.608  23.478  43.451  1.00 75.50  ? 40  GLU B CG    1 
ATOM   4799  C CD    . GLU B 2 40  ? 53.840  24.349  43.199  1.00 91.57  ? 40  GLU B CD    1 
ATOM   4800  O OE1   . GLU B 2 40  ? 53.846  25.522  43.649  1.00 89.11  ? 40  GLU B OE1   1 
ATOM   4801  O OE2   . GLU B 2 40  ? 54.794  23.874  42.536  1.00 96.54  ? 40  GLU B OE2   1 
ATOM   4802  N N     . MET B 2 41  ? 49.271  24.211  41.013  1.00 66.18  ? 41  MET B N     1 
ATOM   4803  C CA    . MET B 2 41  ? 48.562  23.425  40.021  1.00 65.68  ? 41  MET B CA    1 
ATOM   4804  C C     . MET B 2 41  ? 48.642  24.084  38.643  1.00 64.35  ? 41  MET B C     1 
ATOM   4805  O O     . MET B 2 41  ? 48.404  23.445  37.627  1.00 64.47  ? 41  MET B O     1 
ATOM   4806  C CB    . MET B 2 41  ? 47.107  23.196  40.461  1.00 63.64  ? 41  MET B CB    1 
ATOM   4807  C CG    . MET B 2 41  ? 46.945  22.066  41.479  1.00 63.09  ? 41  MET B CG    1 
ATOM   4808  S SD    . MET B 2 41  ? 45.240  21.688  41.960  1.00 62.91  ? 41  MET B SD    1 
ATOM   4809  C CE    . MET B 2 41  ? 44.372  21.636  40.394  1.00 58.82  ? 41  MET B CE    1 
ATOM   4810  N N     . GLU B 2 42  ? 48.957  25.372  38.616  1.00 64.04  ? 42  GLU B N     1 
ATOM   4811  C CA    . GLU B 2 42  ? 49.186  26.087  37.361  1.00 67.75  ? 42  GLU B CA    1 
ATOM   4812  C C     . GLU B 2 42  ? 50.593  25.800  36.839  1.00 67.90  ? 42  GLU B C     1 
ATOM   4813  O O     . GLU B 2 42  ? 50.799  25.462  35.676  1.00 64.50  ? 42  GLU B O     1 
ATOM   4814  C CB    . GLU B 2 42  ? 49.022  27.589  37.594  1.00 67.39  ? 42  GLU B CB    1 
ATOM   4815  C CG    . GLU B 2 42  ? 48.899  28.436  36.349  1.00 65.52  ? 42  GLU B CG    1 
ATOM   4816  C CD    . GLU B 2 42  ? 48.896  29.917  36.683  1.00 75.12  ? 42  GLU B CD    1 
ATOM   4817  O OE1   . GLU B 2 42  ? 49.664  30.300  37.598  1.00 76.97  ? 42  GLU B OE1   1 
ATOM   4818  O OE2   . GLU B 2 42  ? 48.126  30.688  36.053  1.00 71.54  ? 42  GLU B OE2   1 
ATOM   4819  N N     . LYS B 2 43  ? 51.559  25.939  37.731  1.00 69.35  ? 43  LYS B N     1 
ATOM   4820  C CA    . LYS B 2 43  ? 52.929  25.607  37.435  1.00 71.05  ? 43  LYS B CA    1 
ATOM   4821  C C     . LYS B 2 43  ? 52.983  24.179  36.884  1.00 71.57  ? 43  LYS B C     1 
ATOM   4822  O O     . LYS B 2 43  ? 53.763  23.883  35.985  1.00 76.66  ? 43  LYS B O     1 
ATOM   4823  C CB    . LYS B 2 43  ? 53.783  25.769  38.700  1.00 75.46  ? 43  LYS B CB    1 
ATOM   4824  C CG    . LYS B 2 43  ? 55.215  25.308  38.543  1.00 91.26  ? 43  LYS B CG    1 
ATOM   4825  C CD    . LYS B 2 43  ? 56.035  25.533  39.809  1.00 103.84 ? 43  LYS B CD    1 
ATOM   4826  C CE    . LYS B 2 43  ? 57.511  25.201  39.558  1.00 111.47 ? 43  LYS B CE    1 
ATOM   4827  N NZ    . LYS B 2 43  ? 58.373  25.473  40.743  1.00 112.10 ? 43  LYS B NZ    1 
ATOM   4828  N N     . GLU B 2 44  ? 52.133  23.299  37.398  1.00 67.42  ? 44  GLU B N     1 
ATOM   4829  C CA    . GLU B 2 44  ? 52.122  21.916  36.937  1.00 66.51  ? 44  GLU B CA    1 
ATOM   4830  C C     . GLU B 2 44  ? 51.232  21.730  35.718  1.00 61.67  ? 44  GLU B C     1 
ATOM   4831  O O     . GLU B 2 44  ? 51.078  20.619  35.219  1.00 60.39  ? 44  GLU B O     1 
ATOM   4832  C CB    . GLU B 2 44  ? 51.662  20.980  38.053  1.00 69.30  ? 44  GLU B CB    1 
ATOM   4833  C CG    . GLU B 2 44  ? 52.486  21.058  39.329  1.00 73.47  ? 44  GLU B CG    1 
ATOM   4834  C CD    . GLU B 2 44  ? 51.729  20.517  40.538  1.00 78.84  ? 44  GLU B CD    1 
ATOM   4835  O OE1   . GLU B 2 44  ? 52.226  19.555  41.166  1.00 82.36  ? 44  GLU B OE1   1 
ATOM   4836  O OE2   . GLU B 2 44  ? 50.635  21.046  40.858  1.00 74.63  ? 44  GLU B OE2   1 
ATOM   4837  N N     . GLY B 2 45  ? 50.633  22.818  35.253  1.00 60.77  ? 45  GLY B N     1 
ATOM   4838  C CA    . GLY B 2 45  ? 49.768  22.777  34.083  1.00 61.95  ? 45  GLY B CA    1 
ATOM   4839  C C     . GLY B 2 45  ? 48.494  21.949  34.219  1.00 65.33  ? 45  GLY B C     1 
ATOM   4840  O O     . GLY B 2 45  ? 47.939  21.494  33.212  1.00 63.42  ? 45  GLY B O     1 
ATOM   4841  N N     . LYS B 2 46  ? 48.031  21.756  35.459  1.00 65.63  ? 46  LYS B N     1 
ATOM   4842  C CA    . LYS B 2 46  ? 46.766  21.071  35.749  1.00 58.51  ? 46  LYS B CA    1 
ATOM   4843  C C     . LYS B 2 46  ? 45.550  21.930  35.408  1.00 57.10  ? 46  LYS B C     1 
ATOM   4844  O O     . LYS B 2 46  ? 44.547  21.438  34.910  1.00 55.40  ? 46  LYS B O     1 
ATOM   4845  C CB    . LYS B 2 46  ? 46.710  20.686  37.220  1.00 57.28  ? 46  LYS B CB    1 
ATOM   4846  C CG    . LYS B 2 46  ? 47.332  19.368  37.539  1.00 62.01  ? 46  LYS B CG    1 
ATOM   4847  C CD    . LYS B 2 46  ? 48.060  19.417  38.857  1.00 64.27  ? 46  LYS B CD    1 
ATOM   4848  C CE    . LYS B 2 46  ? 48.525  18.032  39.240  1.00 66.49  ? 46  LYS B CE    1 
ATOM   4849  N NZ    . LYS B 2 46  ? 49.442  18.040  40.404  1.00 69.94  ? 46  LYS B NZ    1 
ATOM   4850  N N     . ILE B 2 47  ? 45.651  23.219  35.702  1.00 58.04  ? 47  ILE B N     1 
ATOM   4851  C CA    . ILE B 2 47  ? 44.590  24.183  35.444  1.00 57.48  ? 47  ILE B CA    1 
ATOM   4852  C C     . ILE B 2 47  ? 45.261  25.356  34.799  1.00 57.29  ? 47  ILE B C     1 
ATOM   4853  O O     . ILE B 2 47  ? 46.480  25.470  34.879  1.00 61.59  ? 47  ILE B O     1 
ATOM   4854  C CB    . ILE B 2 47  ? 44.022  24.727  36.760  1.00 60.02  ? 47  ILE B CB    1 
ATOM   4855  C CG1   . ILE B 2 47  ? 45.099  24.669  37.845  1.00 60.38  ? 47  ILE B CG1   1 
ATOM   4856  C CG2   . ILE B 2 47  ? 42.788  23.952  37.192  1.00 55.70  ? 47  ILE B CG2   1 
ATOM   4857  C CD1   . ILE B 2 47  ? 44.653  25.207  39.165  1.00 61.56  ? 47  ILE B CD1   1 
ATOM   4858  N N     . SER B 2 48  ? 44.502  26.248  34.176  1.00 52.25  ? 48  SER B N     1 
ATOM   4859  C CA    . SER B 2 48  ? 45.120  27.501  33.751  1.00 52.23  ? 48  SER B CA    1 
ATOM   4860  C C     . SER B 2 48  ? 44.132  28.628  33.626  1.00 52.50  ? 48  SER B C     1 
ATOM   4861  O O     . SER B 2 48  ? 42.926  28.398  33.475  1.00 53.15  ? 48  SER B O     1 
ATOM   4862  C CB    . SER B 2 48  ? 45.990  27.345  32.491  1.00 55.89  ? 48  SER B CB    1 
ATOM   4863  O OG    . SER B 2 48  ? 45.280  26.828  31.383  1.00 52.27  ? 48  SER B OG    1 
ATOM   4864  N N     . LYS B 2 49  ? 44.661  29.847  33.708  1.00 53.16  ? 49  LYS B N     1 
ATOM   4865  C CA    . LYS B 2 49  ? 43.839  31.043  33.870  1.00 55.90  ? 49  LYS B CA    1 
ATOM   4866  C C     . LYS B 2 49  ? 42.883  31.135  32.712  1.00 51.32  ? 49  LYS B C     1 
ATOM   4867  O O     . LYS B 2 49  ? 43.162  30.599  31.658  1.00 59.13  ? 49  LYS B O     1 
ATOM   4868  C CB    . LYS B 2 49  ? 44.708  32.304  33.925  1.00 59.19  ? 49  LYS B CB    1 
ATOM   4869  C CG    . LYS B 2 49  ? 45.709  32.341  35.061  1.00 65.91  ? 49  LYS B CG    1 
ATOM   4870  C CD    . LYS B 2 49  ? 45.459  33.540  35.967  1.00 70.60  ? 49  LYS B CD    1 
ATOM   4871  C CE    . LYS B 2 49  ? 46.628  33.783  36.931  1.00 78.61  ? 49  LYS B CE    1 
ATOM   4872  N NZ    . LYS B 2 49  ? 47.655  34.710  36.349  1.00 82.75  ? 49  LYS B NZ    1 
ATOM   4873  N N     . ILE B 2 50  ? 41.744  31.773  32.906  1.00 45.98  ? 50  ILE B N     1 
ATOM   4874  C CA    . ILE B 2 50  ? 40.780  31.906  31.829  1.00 51.95  ? 50  ILE B CA    1 
ATOM   4875  C C     . ILE B 2 50  ? 40.206  33.310  31.812  1.00 56.66  ? 50  ILE B C     1 
ATOM   4876  O O     . ILE B 2 50  ? 40.377  34.064  32.763  1.00 60.38  ? 50  ILE B O     1 
ATOM   4877  C CB    . ILE B 2 50  ? 39.635  30.880  31.940  1.00 53.70  ? 50  ILE B CB    1 
ATOM   4878  C CG1   . ILE B 2 50  ? 38.553  31.393  32.887  1.00 55.41  ? 50  ILE B CG1   1 
ATOM   4879  C CG2   . ILE B 2 50  ? 40.170  29.534  32.371  1.00 51.70  ? 50  ILE B CG2   1 
ATOM   4880  C CD1   . ILE B 2 50  ? 37.600  30.342  33.342  1.00 56.42  ? 50  ILE B CD1   1 
ATOM   4881  N N     . GLY B 2 51  ? 39.545  33.672  30.723  1.00 55.50  ? 51  GLY B N     1 
ATOM   4882  C CA    . GLY B 2 51  ? 39.091  35.034  30.559  1.00 58.22  ? 51  GLY B CA    1 
ATOM   4883  C C     . GLY B 2 51  ? 37.605  35.132  30.711  1.00 62.20  ? 51  GLY B C     1 
ATOM   4884  O O     . GLY B 2 51  ? 36.960  34.135  30.998  1.00 63.23  ? 51  GLY B O     1 
ATOM   4885  N N     . PRO B 2 52  ? 37.063  36.337  30.490  1.00 65.56  ? 52  PRO B N     1 
ATOM   4886  C CA    . PRO B 2 52  ? 35.650  36.736  30.548  1.00 68.37  ? 52  PRO B CA    1 
ATOM   4887  C C     . PRO B 2 52  ? 34.838  36.163  29.388  1.00 69.54  ? 52  PRO B C     1 
ATOM   4888  O O     . PRO B 2 52  ? 33.602  36.209  29.398  1.00 69.19  ? 52  PRO B O     1 
ATOM   4889  C CB    . PRO B 2 52  ? 35.708  38.261  30.485  1.00 68.20  ? 52  PRO B CB    1 
ATOM   4890  C CG    . PRO B 2 52  ? 37.031  38.593  29.880  1.00 66.99  ? 52  PRO B CG    1 
ATOM   4891  C CD    . PRO B 2 52  ? 37.887  37.356  29.824  1.00 65.52  ? 52  PRO B CD    1 
ATOM   4892  N N     . GLU B 2 53  ? 35.541  35.661  28.379  1.00 66.53  ? 53  GLU B N     1 
ATOM   4893  C CA    . GLU B 2 53  ? 34.887  34.928  27.315  1.00 68.01  ? 53  GLU B CA    1 
ATOM   4894  C C     . GLU B 2 53  ? 34.293  33.601  27.806  1.00 72.79  ? 53  GLU B C     1 
ATOM   4895  O O     . GLU B 2 53  ? 33.409  33.052  27.144  1.00 74.74  ? 53  GLU B O     1 
ATOM   4896  C CB    . GLU B 2 53  ? 35.835  34.688  26.144  1.00 66.95  ? 53  GLU B CB    1 
ATOM   4897  C CG    . GLU B 2 53  ? 36.758  33.509  26.316  1.00 65.99  ? 53  GLU B CG    1 
ATOM   4898  C CD    . GLU B 2 53  ? 38.030  33.894  27.015  1.00 69.69  ? 53  GLU B CD    1 
ATOM   4899  O OE1   . GLU B 2 53  ? 38.152  35.108  27.343  1.00 68.56  ? 53  GLU B OE1   1 
ATOM   4900  O OE2   . GLU B 2 53  ? 38.896  32.995  27.221  1.00 61.96  ? 53  GLU B OE2   1 
ATOM   4901  N N     . ASN B 2 54  ? 34.759  33.089  28.952  1.00 71.75  ? 54  ASN B N     1 
ATOM   4902  C CA    . ASN B 2 54  ? 34.182  31.882  29.556  1.00 67.79  ? 54  ASN B CA    1 
ATOM   4903  C C     . ASN B 2 54  ? 33.218  32.196  30.701  1.00 68.50  ? 54  ASN B C     1 
ATOM   4904  O O     . ASN B 2 54  ? 33.658  32.538  31.790  1.00 69.72  ? 54  ASN B O     1 
ATOM   4905  C CB    . ASN B 2 54  ? 35.314  31.010  30.093  1.00 62.79  ? 54  ASN B CB    1 
ATOM   4906  C CG    . ASN B 2 54  ? 34.810  29.741  30.730  1.00 64.31  ? 54  ASN B CG    1 
ATOM   4907  O OD1   . ASN B 2 54  ? 33.630  29.634  31.083  1.00 63.87  ? 54  ASN B OD1   1 
ATOM   4908  N ND2   . ASN B 2 54  ? 35.696  28.765  30.881  1.00 59.81  ? 54  ASN B ND2   1 
ATOM   4909  N N     . PRO B 2 55  ? 31.896  32.083  30.456  1.00 71.80  ? 55  PRO B N     1 
ATOM   4910  C CA    . PRO B 2 55  ? 30.930  32.549  31.457  1.00 74.28  ? 55  PRO B CA    1 
ATOM   4911  C C     . PRO B 2 55  ? 30.423  31.442  32.377  1.00 70.97  ? 55  PRO B C     1 
ATOM   4912  O O     . PRO B 2 55  ? 29.235  31.417  32.695  1.00 70.23  ? 55  PRO B O     1 
ATOM   4913  C CB    . PRO B 2 55  ? 29.763  32.918  30.569  1.00 72.37  ? 55  PRO B CB    1 
ATOM   4914  C CG    . PRO B 2 55  ? 29.725  31.729  29.623  1.00 68.52  ? 55  PRO B CG    1 
ATOM   4915  C CD    . PRO B 2 55  ? 31.201  31.329  29.395  1.00 68.30  ? 55  PRO B CD    1 
ATOM   4916  N N     . TYR B 2 56  ? 31.295  30.587  32.869  1.00 66.05  ? 56  TYR B N     1 
ATOM   4917  C CA    . TYR B 2 56  ? 30.818  29.450  33.626  1.00 64.51  ? 56  TYR B CA    1 
ATOM   4918  C C     . TYR B 2 56  ? 31.499  29.503  34.975  1.00 64.98  ? 56  TYR B C     1 
ATOM   4919  O O     . TYR B 2 56  ? 32.620  29.984  35.086  1.00 64.71  ? 56  TYR B O     1 
ATOM   4920  C CB    . TYR B 2 56  ? 31.154  28.143  32.894  1.00 65.65  ? 56  TYR B CB    1 
ATOM   4921  C CG    . TYR B 2 56  ? 30.429  27.963  31.576  1.00 74.67  ? 56  TYR B CG    1 
ATOM   4922  C CD1   . TYR B 2 56  ? 29.049  28.134  31.490  1.00 75.37  ? 56  TYR B CD1   1 
ATOM   4923  C CD2   . TYR B 2 56  ? 31.121  27.632  30.413  1.00 74.11  ? 56  TYR B CD2   1 
ATOM   4924  C CE1   . TYR B 2 56  ? 28.385  27.982  30.295  1.00 76.40  ? 56  TYR B CE1   1 
ATOM   4925  C CE2   . TYR B 2 56  ? 30.457  27.477  29.212  1.00 74.29  ? 56  TYR B CE2   1 
ATOM   4926  C CZ    . TYR B 2 56  ? 29.090  27.657  29.164  1.00 77.63  ? 56  TYR B CZ    1 
ATOM   4927  O OH    . TYR B 2 56  ? 28.416  27.509  27.981  1.00 81.26  ? 56  TYR B OH    1 
ATOM   4928  N N     . ASN B 2 57  ? 30.823  29.034  36.011  1.00 62.53  ? 57  ASN B N     1 
ATOM   4929  C CA    . ASN B 2 57  ? 31.474  28.916  37.301  1.00 58.08  ? 57  ASN B CA    1 
ATOM   4930  C C     . ASN B 2 57  ? 30.965  27.735  38.121  1.00 53.31  ? 57  ASN B C     1 
ATOM   4931  O O     . ASN B 2 57  ? 29.767  27.443  38.143  1.00 50.00  ? 57  ASN B O     1 
ATOM   4932  C CB    . ASN B 2 57  ? 31.355  30.234  38.087  1.00 57.05  ? 57  ASN B CB    1 
ATOM   4933  C CG    . ASN B 2 57  ? 32.528  30.468  39.036  1.00 54.07  ? 57  ASN B CG    1 
ATOM   4934  O OD1   . ASN B 2 57  ? 33.625  30.836  38.617  1.00 53.85  ? 57  ASN B OD1   1 
ATOM   4935  N ND2   . ASN B 2 57  ? 32.293  30.260  40.321  1.00 51.44  ? 57  ASN B ND2   1 
ATOM   4936  N N     . THR B 2 58  ? 31.901  27.076  38.799  1.00 51.44  ? 58  THR B N     1 
ATOM   4937  C CA    . THR B 2 58  ? 31.597  26.082  39.826  1.00 48.60  ? 58  THR B CA    1 
ATOM   4938  C C     . THR B 2 58  ? 32.174  26.566  41.157  1.00 44.26  ? 58  THR B C     1 
ATOM   4939  O O     . THR B 2 58  ? 33.217  27.206  41.189  1.00 45.55  ? 58  THR B O     1 
ATOM   4940  C CB    . THR B 2 58  ? 32.188  24.711  39.445  1.00 48.06  ? 58  THR B CB    1 
ATOM   4941  O OG1   . THR B 2 58  ? 31.342  24.088  38.473  1.00 54.24  ? 58  THR B OG1   1 
ATOM   4942  C CG2   . THR B 2 58  ? 32.293  23.813  40.643  1.00 43.71  ? 58  THR B CG2   1 
ATOM   4943  N N     . PRO B 2 59  ? 31.474  26.309  42.264  1.00 42.87  ? 59  PRO B N     1 
ATOM   4944  C CA    . PRO B 2 59  ? 32.037  26.793  43.527  1.00 40.99  ? 59  PRO B CA    1 
ATOM   4945  C C     . PRO B 2 59  ? 33.200  25.953  44.034  1.00 38.29  ? 59  PRO B C     1 
ATOM   4946  O O     . PRO B 2 59  ? 33.272  24.771  43.792  1.00 38.99  ? 59  PRO B O     1 
ATOM   4947  C CB    . PRO B 2 59  ? 30.845  26.734  44.488  1.00 39.21  ? 59  PRO B CB    1 
ATOM   4948  C CG    . PRO B 2 59  ? 29.653  26.778  43.610  1.00 41.49  ? 59  PRO B CG    1 
ATOM   4949  C CD    . PRO B 2 59  ? 30.044  26.002  42.392  1.00 44.02  ? 59  PRO B CD    1 
ATOM   4950  N N     . VAL B 2 60  ? 34.115  26.593  44.739  1.00 36.85  ? 60  VAL B N     1 
ATOM   4951  C CA    . VAL B 2 60  ? 35.283  25.918  45.257  1.00 35.97  ? 60  VAL B CA    1 
ATOM   4952  C C     . VAL B 2 60  ? 35.509  26.348  46.701  1.00 34.89  ? 60  VAL B C     1 
ATOM   4953  O O     . VAL B 2 60  ? 35.154  27.456  47.099  1.00 32.15  ? 60  VAL B O     1 
ATOM   4954  C CB    . VAL B 2 60  ? 36.523  26.240  44.394  1.00 36.81  ? 60  VAL B CB    1 
ATOM   4955  C CG1   . VAL B 2 60  ? 36.554  27.731  44.061  1.00 38.23  ? 60  VAL B CG1   1 
ATOM   4956  C CG2   . VAL B 2 60  ? 37.814  25.786  45.072  1.00 32.41  ? 60  VAL B CG2   1 
ATOM   4957  N N     . PHE B 2 61  ? 36.072  25.440  47.483  1.00 32.68  ? 61  PHE B N     1 
ATOM   4958  C CA    . PHE B 2 61  ? 36.513  25.760  48.819  1.00 32.71  ? 61  PHE B CA    1 
ATOM   4959  C C     . PHE B 2 61  ? 37.634  24.803  49.232  1.00 33.77  ? 61  PHE B C     1 
ATOM   4960  O O     . PHE B 2 61  ? 38.190  24.108  48.394  1.00 35.70  ? 61  PHE B O     1 
ATOM   4961  C CB    . PHE B 2 61  ? 35.328  25.835  49.813  1.00 34.79  ? 61  PHE B CB    1 
ATOM   4962  C CG    . PHE B 2 61  ? 34.616  24.514  50.075  1.00 35.61  ? 61  PHE B CG    1 
ATOM   4963  C CD1   . PHE B 2 61  ? 34.914  23.761  51.212  1.00 34.80  ? 61  PHE B CD1   1 
ATOM   4964  C CD2   . PHE B 2 61  ? 33.618  24.058  49.226  1.00 33.65  ? 61  PHE B CD2   1 
ATOM   4965  C CE1   . PHE B 2 61  ? 34.250  22.567  51.469  1.00 35.86  ? 61  PHE B CE1   1 
ATOM   4966  C CE2   . PHE B 2 61  ? 32.955  22.857  49.474  1.00 33.95  ? 61  PHE B CE2   1 
ATOM   4967  C CZ    . PHE B 2 61  ? 33.266  22.112  50.592  1.00 34.64  ? 61  PHE B CZ    1 
ATOM   4968  N N     . ALA B 2 62  ? 38.016  24.804  50.500  1.00 35.61  ? 62  ALA B N     1 
ATOM   4969  C CA    . ALA B 2 62  ? 39.037  23.868  50.969  1.00 34.60  ? 62  ALA B CA    1 
ATOM   4970  C C     . ALA B 2 62  ? 38.694  23.255  52.310  1.00 32.66  ? 62  ALA B C     1 
ATOM   4971  O O     . ALA B 2 62  ? 37.937  23.802  53.106  1.00 33.46  ? 62  ALA B O     1 
ATOM   4972  C CB    . ALA B 2 62  ? 40.392  24.524  51.022  1.00 36.84  ? 62  ALA B CB    1 
ATOM   4973  N N     . ILE B 2 63  ? 39.254  22.084  52.534  1.00 32.67  ? 63  ILE B N     1 
ATOM   4974  C CA    . ILE B 2 63  ? 38.919  21.322  53.707  1.00 33.36  ? 63  ILE B CA    1 
ATOM   4975  C C     . ILE B 2 63  ? 40.180  20.676  54.231  1.00 35.28  ? 63  ILE B C     1 
ATOM   4976  O O     . ILE B 2 63  ? 41.137  20.614  53.510  1.00 37.65  ? 63  ILE B O     1 
ATOM   4977  C CB    . ILE B 2 63  ? 37.894  20.249  53.344  1.00 33.46  ? 63  ILE B CB    1 
ATOM   4978  C CG1   . ILE B 2 63  ? 38.429  19.296  52.274  1.00 33.98  ? 63  ILE B CG1   1 
ATOM   4979  C CG2   . ILE B 2 63  ? 36.637  20.884  52.840  1.00 34.07  ? 63  ILE B CG2   1 
ATOM   4980  C CD1   . ILE B 2 63  ? 38.409  17.830  52.710  1.00 35.15  ? 63  ILE B CD1   1 
ATOM   4981  N N     . LYS B 2 64  ? 40.205  20.209  55.475  1.00 34.85  ? 64  LYS B N     1 
ATOM   4982  C CA    . LYS B 2 64  ? 41.259  19.279  55.903  1.00 39.99  ? 64  LYS B CA    1 
ATOM   4983  C C     . LYS B 2 64  ? 40.564  17.968  56.159  1.00 41.65  ? 64  LYS B C     1 
ATOM   4984  O O     . LYS B 2 64  ? 39.518  17.972  56.771  1.00 44.19  ? 64  LYS B O     1 
ATOM   4985  C CB    . LYS B 2 64  ? 41.995  19.769  57.155  1.00 38.33  ? 64  LYS B CB    1 
ATOM   4986  C CG    . LYS B 2 64  ? 42.563  21.171  56.977  1.00 44.46  ? 64  LYS B CG    1 
ATOM   4987  C CD    . LYS B 2 64  ? 43.467  21.567  58.102  1.00 52.47  ? 64  LYS B CD    1 
ATOM   4988  C CE    . LYS B 2 64  ? 44.095  22.941  57.861  1.00 53.95  ? 64  LYS B CE    1 
ATOM   4989  N NZ    . LYS B 2 64  ? 45.106  23.279  58.929  1.00 57.34  ? 64  LYS B NZ    1 
ATOM   4990  N N     . LYS B 2 65  ? 41.088  16.854  55.654  1.00 44.02  ? 65  LYS B N     1 
ATOM   4991  C CA    . LYS B 2 65  ? 40.460  15.563  55.941  1.00 42.05  ? 65  LYS B CA    1 
ATOM   4992  C C     . LYS B 2 65  ? 40.620  15.277  57.432  1.00 43.25  ? 65  LYS B C     1 
ATOM   4993  O O     . LYS B 2 65  ? 41.435  15.890  58.095  1.00 44.75  ? 65  LYS B O     1 
ATOM   4994  C CB    . LYS B 2 65  ? 41.040  14.435  55.080  1.00 39.33  ? 65  LYS B CB    1 
ATOM   4995  C CG    . LYS B 2 65  ? 40.975  14.683  53.598  1.00 40.95  ? 65  LYS B CG    1 
ATOM   4996  C CD    . LYS B 2 65  ? 41.176  13.407  52.782  1.00 51.82  ? 65  LYS B CD    1 
ATOM   4997  C CE    . LYS B 2 65  ? 40.237  12.276  53.258  1.00 63.29  ? 65  LYS B CE    1 
ATOM   4998  N NZ    . LYS B 2 65  ? 39.892  11.252  52.205  1.00 59.56  ? 65  LYS B NZ    1 
ATOM   4999  N N     . LYS B 2 66  ? 39.811  14.381  57.972  1.00 46.29  ? 66  LYS B N     1 
ATOM   5000  C CA    . LYS B 2 66  ? 39.887  14.054  59.395  1.00 48.24  ? 66  LYS B CA    1 
ATOM   5001  C C     . LYS B 2 66  ? 41.316  13.681  59.806  1.00 54.26  ? 66  LYS B C     1 
ATOM   5002  O O     . LYS B 2 66  ? 41.959  12.864  59.136  1.00 56.90  ? 66  LYS B O     1 
ATOM   5003  C CB    . LYS B 2 66  ? 38.924  12.908  59.702  1.00 47.89  ? 66  LYS B CB    1 
ATOM   5004  C CG    . LYS B 2 66  ? 38.654  12.664  61.169  1.00 52.25  ? 66  LYS B CG    1 
ATOM   5005  C CD    . LYS B 2 66  ? 37.484  11.692  61.324  1.00 52.21  ? 66  LYS B CD    1 
ATOM   5006  C CE    . LYS B 2 66  ? 36.164  12.285  60.805  1.00 50.74  ? 66  LYS B CE    1 
ATOM   5007  N NZ    . LYS B 2 66  ? 35.476  13.209  61.781  1.00 45.55  ? 66  LYS B NZ    1 
ATOM   5008  N N     . ASP B 2 67  ? 41.804  14.283  60.895  1.00 55.25  ? 67  ASP B N     1 
ATOM   5009  C CA    . ASP B 2 67  ? 43.176  14.064  61.410  1.00 57.65  ? 67  ASP B CA    1 
ATOM   5010  C C     . ASP B 2 67  ? 44.293  14.475  60.448  1.00 57.19  ? 67  ASP B C     1 
ATOM   5011  O O     . ASP B 2 67  ? 45.269  13.748  60.270  1.00 63.85  ? 67  ASP B O     1 
ATOM   5012  C CB    . ASP B 2 67  ? 43.400  12.604  61.827  1.00 58.61  ? 67  ASP B CB    1 
ATOM   5013  C CG    . ASP B 2 67  ? 42.789  12.278  63.169  1.00 63.56  ? 67  ASP B CG    1 
ATOM   5014  O OD1   . ASP B 2 67  ? 42.767  13.167  64.047  1.00 55.85  ? 67  ASP B OD1   1 
ATOM   5015  O OD2   . ASP B 2 67  ? 42.327  11.122  63.338  1.00 71.84  ? 67  ASP B OD2   1 
ATOM   5016  N N     . SER B 2 68  ? 44.155  15.634  59.833  1.00 49.95  ? 68  SER B N     1 
ATOM   5017  C CA    . SER B 2 68  ? 45.076  16.034  58.789  1.00 51.91  ? 68  SER B CA    1 
ATOM   5018  C C     . SER B 2 68  ? 45.343  17.522  58.916  1.00 56.80  ? 68  SER B C     1 
ATOM   5019  O O     . SER B 2 68  ? 44.437  18.334  59.083  1.00 57.30  ? 68  SER B O     1 
ATOM   5020  C CB    . SER B 2 68  ? 44.487  15.695  57.412  1.00 51.46  ? 68  SER B CB    1 
ATOM   5021  O OG    . SER B 2 68  ? 45.073  16.454  56.361  1.00 52.62  ? 68  SER B OG    1 
ATOM   5022  N N     . THR B 2 69  ? 46.594  17.910  58.878  1.00 57.68  ? 69  THR B N     1 
ATOM   5023  C CA    . THR B 2 69  ? 46.818  19.324  58.997  1.00 58.89  ? 69  THR B CA    1 
ATOM   5024  C C     . THR B 2 69  ? 47.045  19.997  57.619  1.00 55.03  ? 69  THR B C     1 
ATOM   5025  O O     . THR B 2 69  ? 47.390  21.174  57.534  1.00 50.32  ? 69  THR B O     1 
ATOM   5026  C CB    . THR B 2 69  ? 47.832  19.617  60.124  1.00 62.58  ? 69  THR B CB    1 
ATOM   5027  O OG1   . THR B 2 69  ? 47.451  20.818  60.822  1.00 65.28  ? 69  THR B OG1   1 
ATOM   5028  C CG2   . THR B 2 69  ? 49.257  19.682  59.585  1.00 66.05  ? 69  THR B CG2   1 
ATOM   5029  N N     . LYS B 2 70  ? 46.866  19.221  56.547  1.00 54.07  ? 70  LYS B N     1 
ATOM   5030  C CA    . LYS B 2 70  ? 47.077  19.714  55.175  1.00 55.91  ? 70  LYS B CA    1 
ATOM   5031  C C     . LYS B 2 70  ? 45.798  20.114  54.456  1.00 50.95  ? 70  LYS B C     1 
ATOM   5032  O O     . LYS B 2 70  ? 44.822  19.369  54.480  1.00 51.21  ? 70  LYS B O     1 
ATOM   5033  C CB    . LYS B 2 70  ? 47.807  18.675  54.315  1.00 57.82  ? 70  LYS B CB    1 
ATOM   5034  C CG    . LYS B 2 70  ? 49.243  18.382  54.742  1.00 71.50  ? 70  LYS B CG    1 
ATOM   5035  C CD    . LYS B 2 70  ? 50.070  19.659  54.934  1.00 74.20  ? 70  LYS B CD    1 
ATOM   5036  C CE    . LYS B 2 70  ? 51.259  19.372  55.847  1.00 77.62  ? 70  LYS B CE    1 
ATOM   5037  N NZ    . LYS B 2 70  ? 52.107  20.578  56.082  1.00 87.57  ? 70  LYS B NZ    1 
ATOM   5038  N N     . TRP B 2 71  ? 45.823  21.265  53.784  1.00 45.55  ? 71  TRP B N     1 
ATOM   5039  C CA    . TRP B 2 71  ? 44.653  21.766  53.071  1.00 43.74  ? 71  TRP B CA    1 
ATOM   5040  C C     . TRP B 2 71  ? 44.377  21.060  51.741  1.00 41.94  ? 71  TRP B C     1 
ATOM   5041  O O     . TRP B 2 71  ? 45.223  21.058  50.869  1.00 46.49  ? 71  TRP B O     1 
ATOM   5042  C CB    . TRP B 2 71  ? 44.830  23.241  52.779  1.00 46.92  ? 71  TRP B CB    1 
ATOM   5043  C CG    . TRP B 2 71  ? 44.544  24.167  53.917  1.00 48.32  ? 71  TRP B CG    1 
ATOM   5044  C CD1   . TRP B 2 71  ? 45.414  25.042  54.499  1.00 49.59  ? 71  TRP B CD1   1 
ATOM   5045  C CD2   . TRP B 2 71  ? 43.291  24.346  54.579  1.00 50.61  ? 71  TRP B CD2   1 
ATOM   5046  N NE1   . TRP B 2 71  ? 44.785  25.757  55.491  1.00 51.12  ? 71  TRP B NE1   1 
ATOM   5047  C CE2   . TRP B 2 71  ? 43.481  25.348  55.566  1.00 54.02  ? 71  TRP B CE2   1 
ATOM   5048  C CE3   . TRP B 2 71  ? 42.024  23.759  54.439  1.00 44.88  ? 71  TRP B CE3   1 
ATOM   5049  C CZ2   . TRP B 2 71  ? 42.451  25.769  56.415  1.00 52.75  ? 71  TRP B CZ2   1 
ATOM   5050  C CZ3   . TRP B 2 71  ? 41.007  24.171  55.279  1.00 45.87  ? 71  TRP B CZ3   1 
ATOM   5051  C CH2   . TRP B 2 71  ? 41.225  25.173  56.257  1.00 53.27  ? 71  TRP B CH2   1 
ATOM   5052  N N     . ARG B 2 72  ? 43.185  20.493  51.579  1.00 38.43  ? 72  ARG B N     1 
ATOM   5053  C CA    . ARG B 2 72  ? 42.746  19.843  50.341  1.00 35.78  ? 72  ARG B CA    1 
ATOM   5054  C C     . ARG B 2 72  ? 41.827  20.764  49.550  1.00 35.44  ? 72  ARG B C     1 
ATOM   5055  O O     . ARG B 2 72  ? 40.883  21.323  50.094  1.00 38.31  ? 72  ARG B O     1 
ATOM   5056  C CB    . ARG B 2 72  ? 41.961  18.596  50.689  1.00 36.33  ? 72  ARG B CB    1 
ATOM   5057  C CG    . ARG B 2 72  ? 42.245  17.385  49.845  1.00 42.48  ? 72  ARG B CG    1 
ATOM   5058  C CD    . ARG B 2 72  ? 41.165  17.125  48.816  1.00 43.80  ? 72  ARG B CD    1 
ATOM   5059  N NE    . ARG B 2 72  ? 41.196  15.734  48.365  1.00 48.41  ? 72  ARG B NE    1 
ATOM   5060  C CZ    . ARG B 2 72  ? 40.468  15.250  47.358  1.00 52.06  ? 72  ARG B CZ    1 
ATOM   5061  N NH1   . ARG B 2 72  ? 39.635  16.031  46.676  1.00 47.17  ? 72  ARG B NH1   1 
ATOM   5062  N NH2   . ARG B 2 72  ? 40.579  13.974  47.023  1.00 55.75  ? 72  ARG B NH2   1 
ATOM   5063  N N     . LYS B 2 73  ? 42.083  20.945  48.270  1.00 33.78  ? 73  LYS B N     1 
ATOM   5064  C CA    . LYS B 2 73  ? 41.141  21.706  47.480  1.00 35.58  ? 73  LYS B CA    1 
ATOM   5065  C C     . LYS B 2 73  ? 39.891  20.856  47.196  1.00 37.89  ? 73  LYS B C     1 
ATOM   5066  O O     . LYS B 2 73  ? 39.987  19.622  47.038  1.00 36.10  ? 73  LYS B O     1 
ATOM   5067  C CB    . LYS B 2 73  ? 41.782  22.188  46.179  1.00 37.84  ? 73  LYS B CB    1 
ATOM   5068  C CG    . LYS B 2 73  ? 40.820  22.902  45.249  1.00 34.50  ? 73  LYS B CG    1 
ATOM   5069  C CD    . LYS B 2 73  ? 41.487  23.213  43.920  1.00 35.81  ? 73  LYS B CD    1 
ATOM   5070  C CE    . LYS B 2 73  ? 40.450  23.248  42.810  1.00 41.35  ? 73  LYS B CE    1 
ATOM   5071  N NZ    . LYS B 2 73  ? 40.477  24.441  41.951  1.00 39.20  ? 73  LYS B NZ    1 
ATOM   5072  N N     . LEU B 2 74  ? 38.730  21.523  47.155  1.00 35.09  ? 74  LEU B N     1 
ATOM   5073  C CA    . LEU B 2 74  ? 37.434  20.869  46.937  1.00 31.35  ? 74  LEU B CA    1 
ATOM   5074  C C     . LEU B 2 74  ? 36.511  21.651  46.003  1.00 36.80  ? 74  LEU B C     1 
ATOM   5075  O O     . LEU B 2 74  ? 36.166  22.811  46.261  1.00 36.39  ? 74  LEU B O     1 
ATOM   5076  C CB    . LEU B 2 74  ? 36.734  20.648  48.264  1.00 31.68  ? 74  LEU B CB    1 
ATOM   5077  C CG    . LEU B 2 74  ? 35.355  20.022  48.211  1.00 33.43  ? 74  LEU B CG    1 
ATOM   5078  C CD1   . LEU B 2 74  ? 35.331  19.021  47.124  1.00 34.69  ? 74  LEU B CD1   1 
ATOM   5079  C CD2   . LEU B 2 74  ? 35.047  19.361  49.530  1.00 33.43  ? 74  LEU B CD2   1 
ATOM   5080  N N     . VAL B 2 75  ? 36.083  21.010  44.919  1.00 40.81  ? 75  VAL B N     1 
ATOM   5081  C CA    . VAL B 2 75  ? 35.155  21.662  43.995  1.00 36.74  ? 75  VAL B CA    1 
ATOM   5082  C C     . VAL B 2 75  ? 33.740  21.104  44.143  1.00 39.36  ? 75  VAL B C     1 
ATOM   5083  O O     . VAL B 2 75  ? 33.541  19.885  44.332  1.00 41.92  ? 75  VAL B O     1 
ATOM   5084  C CB    . VAL B 2 75  ? 35.631  21.540  42.554  1.00 36.07  ? 75  VAL B CB    1 
ATOM   5085  C CG1   . VAL B 2 75  ? 34.902  22.539  41.685  1.00 38.10  ? 75  VAL B CG1   1 
ATOM   5086  C CG2   . VAL B 2 75  ? 37.125  21.764  42.483  1.00 35.12  ? 75  VAL B CG2   1 
ATOM   5087  N N     . ASP B 2 76  ? 32.750  21.983  44.066  1.00 38.58  ? 76  ASP B N     1 
ATOM   5088  C CA    . ASP B 2 76  ? 31.391  21.509  44.236  1.00 42.07  ? 76  ASP B CA    1 
ATOM   5089  C C     . ASP B 2 76  ? 30.865  21.361  42.840  1.00 42.68  ? 76  ASP B C     1 
ATOM   5090  O O     . ASP B 2 76  ? 30.318  22.296  42.258  1.00 43.70  ? 76  ASP B O     1 
ATOM   5091  C CB    . ASP B 2 76  ? 30.551  22.537  45.014  1.00 39.76  ? 76  ASP B CB    1 
ATOM   5092  C CG    . ASP B 2 76  ? 29.130  22.071  45.253  1.00 40.24  ? 76  ASP B CG    1 
ATOM   5093  O OD1   . ASP B 2 76  ? 28.910  20.852  45.193  1.00 38.12  ? 76  ASP B OD1   1 
ATOM   5094  O OD2   . ASP B 2 76  ? 28.241  22.910  45.504  1.00 40.39  ? 76  ASP B OD2   1 
ATOM   5095  N N     . PHE B 2 77  ? 30.942  20.129  42.358  1.00 43.53  ? 77  PHE B N     1 
ATOM   5096  C CA    . PHE B 2 77  ? 30.646  19.839  40.970  1.00 45.03  ? 77  PHE B CA    1 
ATOM   5097  C C     . PHE B 2 77  ? 29.222  19.342  40.841  1.00 45.42  ? 77  PHE B C     1 
ATOM   5098  O O     . PHE B 2 77  ? 28.805  18.966  39.772  1.00 50.77  ? 77  PHE B O     1 
ATOM   5099  C CB    . PHE B 2 77  ? 31.645  18.836  40.395  1.00 46.27  ? 77  PHE B CB    1 
ATOM   5100  C CG    . PHE B 2 77  ? 32.877  19.464  39.802  1.00 45.66  ? 77  PHE B CG    1 
ATOM   5101  C CD1   . PHE B 2 77  ? 32.774  20.549  38.940  1.00 42.41  ? 77  PHE B CD1   1 
ATOM   5102  C CD2   . PHE B 2 77  ? 34.142  18.960  40.105  1.00 43.24  ? 77  PHE B CD2   1 
ATOM   5103  C CE1   . PHE B 2 77  ? 33.902  21.120  38.386  1.00 40.25  ? 77  PHE B CE1   1 
ATOM   5104  C CE2   . PHE B 2 77  ? 35.275  19.533  39.570  1.00 41.84  ? 77  PHE B CE2   1 
ATOM   5105  C CZ    . PHE B 2 77  ? 35.152  20.618  38.699  1.00 40.36  ? 77  PHE B CZ    1 
ATOM   5106  N N     . ARG B 2 78  ? 28.472  19.352  41.931  1.00 40.73  ? 78  ARG B N     1 
ATOM   5107  C CA    . ARG B 2 78  ? 27.109  18.866  41.896  1.00 42.98  ? 78  ARG B CA    1 
ATOM   5108  C C     . ARG B 2 78  ? 26.339  19.372  40.673  1.00 50.94  ? 78  ARG B C     1 
ATOM   5109  O O     . ARG B 2 78  ? 25.726  18.587  39.953  1.00 52.81  ? 78  ARG B O     1 
ATOM   5110  C CB    . ARG B 2 78  ? 26.377  19.210  43.198  1.00 36.16  ? 78  ARG B CB    1 
ATOM   5111  C CG    . ARG B 2 78  ? 26.805  18.306  44.338  1.00 35.54  ? 78  ARG B CG    1 
ATOM   5112  C CD    . ARG B 2 78  ? 26.257  18.690  45.697  1.00 34.11  ? 78  ARG B CD    1 
ATOM   5113  N NE    . ARG B 2 78  ? 26.673  20.022  46.120  1.00 34.88  ? 78  ARG B NE    1 
ATOM   5114  C CZ    . ARG B 2 78  ? 26.234  20.629  47.212  1.00 32.53  ? 78  ARG B CZ    1 
ATOM   5115  N NH1   . ARG B 2 78  ? 25.374  20.020  48.010  1.00 27.70  ? 78  ARG B NH1   1 
ATOM   5116  N NH2   . ARG B 2 78  ? 26.667  21.839  47.497  1.00 31.50  ? 78  ARG B NH2   1 
ATOM   5117  N N     . GLU B 2 79  ? 26.387  20.667  40.407  1.00 50.07  ? 79  GLU B N     1 
ATOM   5118  C CA    . GLU B 2 79  ? 25.656  21.180  39.273  1.00 52.22  ? 79  GLU B CA    1 
ATOM   5119  C C     . GLU B 2 79  ? 26.211  20.629  37.975  1.00 56.35  ? 79  GLU B C     1 
ATOM   5120  O O     . GLU B 2 79  ? 25.461  20.275  37.084  1.00 62.16  ? 79  GLU B O     1 
ATOM   5121  C CB    . GLU B 2 79  ? 25.669  22.697  39.247  1.00 55.90  ? 79  GLU B CB    1 
ATOM   5122  C CG    . GLU B 2 79  ? 24.469  23.250  38.522  1.00 60.94  ? 79  GLU B CG    1 
ATOM   5123  C CD    . GLU B 2 79  ? 23.180  22.586  38.982  1.00 62.51  ? 79  GLU B CD    1 
ATOM   5124  O OE1   . GLU B 2 79  ? 23.073  22.268  40.197  1.00 58.32  ? 79  GLU B OE1   1 
ATOM   5125  O OE2   . GLU B 2 79  ? 22.287  22.379  38.126  1.00 62.43  ? 79  GLU B OE2   1 
ATOM   5126  N N     . LEU B 2 80  ? 27.528  20.565  37.857  1.00 55.57  ? 80  LEU B N     1 
ATOM   5127  C CA    . LEU B 2 80  ? 28.130  19.988  36.668  1.00 57.96  ? 80  LEU B CA    1 
ATOM   5128  C C     . LEU B 2 80  ? 27.755  18.510  36.577  1.00 61.45  ? 80  LEU B C     1 
ATOM   5129  O O     . LEU B 2 80  ? 27.297  18.046  35.550  1.00 69.90  ? 80  LEU B O     1 
ATOM   5130  C CB    . LEU B 2 80  ? 29.656  20.168  36.667  1.00 55.16  ? 80  LEU B CB    1 
ATOM   5131  C CG    . LEU B 2 80  ? 30.413  19.704  35.420  1.00 53.46  ? 80  LEU B CG    1 
ATOM   5132  C CD1   . LEU B 2 80  ? 30.281  20.741  34.345  1.00 56.19  ? 80  LEU B CD1   1 
ATOM   5133  C CD2   . LEU B 2 80  ? 31.876  19.441  35.713  1.00 52.80  ? 80  LEU B CD2   1 
ATOM   5134  N N     . ASN B 2 81  ? 27.935  17.776  37.661  1.00 56.91  ? 81  ASN B N     1 
ATOM   5135  C CA    . ASN B 2 81  ? 27.653  16.355  37.662  1.00 61.48  ? 81  ASN B CA    1 
ATOM   5136  C C     . ASN B 2 81  ? 26.218  16.035  37.251  1.00 67.54  ? 81  ASN B C     1 
ATOM   5137  O O     . ASN B 2 81  ? 25.935  14.963  36.726  1.00 75.48  ? 81  ASN B O     1 
ATOM   5138  C CB    . ASN B 2 81  ? 27.955  15.758  39.039  1.00 63.26  ? 81  ASN B CB    1 
ATOM   5139  C CG    . ASN B 2 81  ? 29.427  15.733  39.351  1.00 55.33  ? 81  ASN B CG    1 
ATOM   5140  O OD1   . ASN B 2 81  ? 30.249  16.028  38.504  1.00 55.18  ? 81  ASN B OD1   1 
ATOM   5141  N ND2   . ASN B 2 81  ? 29.765  15.360  40.569  1.00 57.56  ? 81  ASN B ND2   1 
ATOM   5142  N N     . LYS B 2 82  ? 25.307  16.962  37.499  1.00 62.36  ? 82  LYS B N     1 
ATOM   5143  C CA    . LYS B 2 82  ? 23.932  16.753  37.095  1.00 66.45  ? 82  LYS B CA    1 
ATOM   5144  C C     . LYS B 2 82  ? 23.823  16.870  35.582  1.00 75.37  ? 82  LYS B C     1 
ATOM   5145  O O     . LYS B 2 82  ? 22.977  16.234  34.969  1.00 85.39  ? 82  LYS B O     1 
ATOM   5146  C CB    . LYS B 2 82  ? 22.991  17.748  37.786  1.00 61.48  ? 82  LYS B CB    1 
ATOM   5147  C CG    . LYS B 2 82  ? 22.768  17.484  39.264  1.00 60.81  ? 82  LYS B CG    1 
ATOM   5148  C CD    . LYS B 2 82  ? 21.938  18.585  39.919  1.00 59.92  ? 82  LYS B CD    1 
ATOM   5149  C CE    . LYS B 2 82  ? 22.121  18.577  41.435  1.00 53.56  ? 82  LYS B CE    1 
ATOM   5150  N NZ    . LYS B 2 82  ? 21.944  19.942  42.007  1.00 52.86  ? 82  LYS B NZ    1 
ATOM   5151  N N     . ARG B 2 83  ? 24.682  17.690  34.985  1.00 71.56  ? 83  ARG B N     1 
ATOM   5152  C CA    . ARG B 2 83  ? 24.616  17.967  33.555  1.00 77.55  ? 83  ARG B CA    1 
ATOM   5153  C C     . ARG B 2 83  ? 25.569  17.150  32.678  1.00 82.81  ? 83  ARG B C     1 
ATOM   5154  O O     . ARG B 2 83  ? 25.589  17.304  31.462  1.00 89.21  ? 83  ARG B O     1 
ATOM   5155  C CB    . ARG B 2 83  ? 24.829  19.453  33.326  1.00 75.33  ? 83  ARG B CB    1 
ATOM   5156  C CG    . ARG B 2 83  ? 23.887  20.295  34.129  1.00 69.73  ? 83  ARG B CG    1 
ATOM   5157  C CD    . ARG B 2 83  ? 24.338  21.711  34.141  1.00 68.66  ? 83  ARG B CD    1 
ATOM   5158  N NE    . ARG B 2 83  ? 23.491  22.504  35.004  1.00 65.48  ? 83  ARG B NE    1 
ATOM   5159  C CZ    . ARG B 2 83  ? 22.794  23.545  34.591  1.00 67.34  ? 83  ARG B CZ    1 
ATOM   5160  N NH1   . ARG B 2 83  ? 22.857  23.917  33.324  1.00 74.90  ? 83  ARG B NH1   1 
ATOM   5161  N NH2   . ARG B 2 83  ? 22.043  24.212  35.448  1.00 66.99  ? 83  ARG B NH2   1 
ATOM   5162  N N     . THR B 2 84  ? 26.402  16.333  33.301  1.00 83.05  ? 84  THR B N     1 
ATOM   5163  C CA    . THR B 2 84  ? 27.167  15.329  32.579  1.00 92.83  ? 84  THR B CA    1 
ATOM   5164  C C     . THR B 2 84  ? 26.567  13.913  32.721  1.00 106.18 ? 84  THR B C     1 
ATOM   5165  O O     . THR B 2 84  ? 27.039  12.966  32.086  1.00 113.82 ? 84  THR B O     1 
ATOM   5166  C CB    . THR B 2 84  ? 28.635  15.356  33.029  1.00 81.87  ? 84  THR B CB    1 
ATOM   5167  O OG1   . THR B 2 84  ? 29.024  16.712  33.233  1.00 73.94  ? 84  THR B OG1   1 
ATOM   5168  C CG2   . THR B 2 84  ? 29.539  14.759  31.979  1.00 88.86  ? 84  THR B CG2   1 
ATOM   5169  N N     . GLN B 2 85  ? 25.501  13.794  33.518  1.00 105.28 ? 85  GLN B N     1 
ATOM   5170  C CA    . GLN B 2 85  ? 25.019  12.501  34.059  1.00 116.72 ? 85  GLN B CA    1 
ATOM   5171  C C     . GLN B 2 85  ? 24.786  11.302  33.103  1.00 128.14 ? 85  GLN B C     1 
ATOM   5172  O O     . GLN B 2 85  ? 25.245  10.189  33.387  1.00 128.60 ? 85  GLN B O     1 
ATOM   5173  C CB    . GLN B 2 85  ? 23.779  12.707  34.952  1.00 115.27 ? 85  GLN B CB    1 
ATOM   5174  C CG    . GLN B 2 85  ? 23.388  11.465  35.765  1.00 125.92 ? 85  GLN B CG    1 
ATOM   5175  C CD    . GLN B 2 85  ? 22.279  11.731  36.778  1.00 130.07 ? 85  GLN B CD    1 
ATOM   5176  O OE1   . GLN B 2 85  ? 21.159  12.093  36.409  1.00 132.76 ? 85  GLN B OE1   1 
ATOM   5177  N NE2   . GLN B 2 85  ? 22.589  11.545  38.062  1.00 126.40 ? 85  GLN B NE2   1 
ATOM   5178  N N     . ASP B 2 86  ? 24.060  11.505  32.004  1.00 130.76 ? 86  ASP B N     1 
ATOM   5179  C CA    . ASP B 2 86  ? 23.786  10.401  31.082  1.00 132.56 ? 86  ASP B CA    1 
ATOM   5180  C C     . ASP B 2 86  ? 25.104  9.748   30.673  1.00 133.80 ? 86  ASP B C     1 
ATOM   5181  O O     . ASP B 2 86  ? 25.184  8.532   30.508  1.00 140.47 ? 86  ASP B O     1 
ATOM   5182  C CB    . ASP B 2 86  ? 23.006  10.874  29.848  1.00 137.37 ? 86  ASP B CB    1 
ATOM   5183  C CG    . ASP B 2 86  ? 22.050  9.811   29.313  1.00 143.15 ? 86  ASP B CG    1 
ATOM   5184  O OD1   . ASP B 2 86  ? 21.382  9.142   30.134  1.00 141.06 ? 86  ASP B OD1   1 
ATOM   5185  O OD2   . ASP B 2 86  ? 21.967  9.644   28.074  1.00 142.37 ? 86  ASP B OD2   1 
ATOM   5186  N N     . PHE B 2 87  ? 26.140  10.566  30.536  1.00 129.20 ? 87  PHE B N     1 
ATOM   5187  C CA    . PHE B 2 87  ? 27.465  10.067  30.206  1.00 129.76 ? 87  PHE B CA    1 
ATOM   5188  C C     . PHE B 2 87  ? 27.889  8.924   31.135  1.00 132.26 ? 87  PHE B C     1 
ATOM   5189  O O     . PHE B 2 87  ? 28.214  7.837   30.660  1.00 135.93 ? 87  PHE B O     1 
ATOM   5190  C CB    . PHE B 2 87  ? 28.478  11.217  30.246  1.00 122.10 ? 87  PHE B CB    1 
ATOM   5191  C CG    . PHE B 2 87  ? 29.916  10.776  30.380  1.00 120.71 ? 87  PHE B CG    1 
ATOM   5192  C CD1   . PHE B 2 87  ? 30.787  10.879  29.313  1.00 118.29 ? 87  PHE B CD1   1 
ATOM   5193  C CD2   . PHE B 2 87  ? 30.401  10.285  31.583  1.00 116.44 ? 87  PHE B CD2   1 
ATOM   5194  C CE1   . PHE B 2 87  ? 32.108  10.488  29.444  1.00 113.76 ? 87  PHE B CE1   1 
ATOM   5195  C CE2   . PHE B 2 87  ? 31.713  9.888   31.714  1.00 107.62 ? 87  PHE B CE2   1 
ATOM   5196  C CZ    . PHE B 2 87  ? 32.567  9.992   30.648  1.00 106.23 ? 87  PHE B CZ    1 
ATOM   5197  N N     . TRP B 2 88  ? 27.878  9.160   32.450  1.00 131.77 ? 88  TRP B N     1 
ATOM   5198  C CA    . TRP B 2 88  ? 28.390  8.153   33.402  1.00 134.54 ? 88  TRP B CA    1 
ATOM   5199  C C     . TRP B 2 88  ? 27.485  6.941   33.705  1.00 141.48 ? 88  TRP B C     1 
ATOM   5200  O O     . TRP B 2 88  ? 27.939  5.798   33.625  1.00 146.89 ? 88  TRP B O     1 
ATOM   5201  C CB    . TRP B 2 88  ? 29.002  8.764   34.702  1.00 124.44 ? 88  TRP B CB    1 
ATOM   5202  C CG    . TRP B 2 88  ? 28.322  9.994   35.335  1.00 120.15 ? 88  TRP B CG    1 
ATOM   5203  C CD1   . TRP B 2 88  ? 28.482  11.307  34.965  1.00 110.45 ? 88  TRP B CD1   1 
ATOM   5204  C CD2   . TRP B 2 88  ? 27.441  10.010  36.476  1.00 122.07 ? 88  TRP B CD2   1 
ATOM   5205  N NE1   . TRP B 2 88  ? 27.736  12.125  35.780  1.00 105.77 ? 88  TRP B NE1   1 
ATOM   5206  C CE2   . TRP B 2 88  ? 27.086  11.358  36.714  1.00 113.22 ? 88  TRP B CE2   1 
ATOM   5207  C CE3   . TRP B 2 88  ? 26.903  9.015   37.307  1.00 122.87 ? 88  TRP B CE3   1 
ATOM   5208  C CZ2   . TRP B 2 88  ? 26.213  11.734  37.743  1.00 109.82 ? 88  TRP B CZ2   1 
ATOM   5209  C CZ3   . TRP B 2 88  ? 26.040  9.394   38.334  1.00 120.23 ? 88  TRP B CZ3   1 
ATOM   5210  C CH2   . TRP B 2 88  ? 25.705  10.740  38.540  1.00 114.45 ? 88  TRP B CH2   1 
ATOM   5211  N N     . GLU B 2 89  ? 26.218  7.179   34.037  1.00 141.17 ? 89  GLU B N     1 
ATOM   5212  C CA    . GLU B 2 89  ? 25.337  6.084   34.455  1.00 145.56 ? 89  GLU B CA    1 
ATOM   5213  C C     . GLU B 2 89  ? 25.024  5.084   33.339  1.00 150.01 ? 89  GLU B C     1 
ATOM   5214  O O     . GLU B 2 89  ? 25.273  3.883   33.477  1.00 149.70 ? 89  GLU B O     1 
ATOM   5215  C CB    . GLU B 2 89  ? 24.044  6.629   35.070  1.00 141.43 ? 89  GLU B CB    1 
ATOM   5216  C CG    . GLU B 2 89  ? 24.225  7.175   36.477  1.00 139.08 ? 89  GLU B CG    1 
ATOM   5217  C CD    . GLU B 2 89  ? 22.966  7.816   37.025  1.00 142.02 ? 89  GLU B CD    1 
ATOM   5218  O OE1   . GLU B 2 89  ? 21.945  7.819   36.304  1.00 144.48 ? 89  GLU B OE1   1 
ATOM   5219  O OE2   . GLU B 2 89  ? 22.997  8.319   38.174  1.00 139.33 ? 89  GLU B OE2   1 
ATOM   5220  N N     . VAL B 2 90  ? 24.495  5.590   32.231  1.00 149.45 ? 90  VAL B N     1 
ATOM   5221  C CA    . VAL B 2 90  ? 24.067  4.741   31.125  1.00 151.62 ? 90  VAL B CA    1 
ATOM   5222  C C     . VAL B 2 90  ? 25.235  4.156   30.317  1.00 152.11 ? 90  VAL B C     1 
ATOM   5223  O O     . VAL B 2 90  ? 25.173  3.007   29.879  1.00 151.41 ? 90  VAL B O     1 
ATOM   5224  C CB    . VAL B 2 90  ? 23.087  5.496   30.192  1.00 146.87 ? 90  VAL B CB    1 
ATOM   5225  C CG1   . VAL B 2 90  ? 22.858  4.719   28.907  1.00 140.99 ? 90  VAL B CG1   1 
ATOM   5226  C CG2   . VAL B 2 90  ? 21.768  5.766   30.913  1.00 142.91 ? 90  VAL B CG2   1 
ATOM   5227  N N     . GLN B 2 91  ? 26.298  4.939   30.131  1.00 152.71 ? 91  GLN B N     1 
ATOM   5228  C CA    . GLN B 2 91  ? 27.415  4.520   29.275  1.00 156.55 ? 91  GLN B CA    1 
ATOM   5229  C C     . GLN B 2 91  ? 28.367  3.466   29.863  1.00 159.82 ? 91  GLN B C     1 
ATOM   5230  O O     . GLN B 2 91  ? 28.649  2.457   29.215  1.00 161.07 ? 91  GLN B O     1 
ATOM   5231  C CB    . GLN B 2 91  ? 28.216  5.729   28.775  1.00 154.50 ? 91  GLN B CB    1 
ATOM   5232  C CG    . GLN B 2 91  ? 29.579  5.355   28.201  1.00 157.99 ? 91  GLN B CG    1 
ATOM   5233  C CD    . GLN B 2 91  ? 30.109  6.373   27.212  1.00 159.93 ? 91  GLN B CD    1 
ATOM   5234  O OE1   . GLN B 2 91  ? 29.371  7.237   26.737  1.00 157.68 ? 91  GLN B OE1   1 
ATOM   5235  N NE2   . GLN B 2 91  ? 31.397  6.273   26.891  1.00 156.92 ? 91  GLN B NE2   1 
ATOM   5236  N N     . LEU B 2 92  ? 28.865  3.695   31.075  1.00 159.02 ? 92  LEU B N     1 
ATOM   5237  C CA    . LEU B 2 92  ? 29.810  2.760   31.691  1.00 160.70 ? 92  LEU B CA    1 
ATOM   5238  C C     . LEU B 2 92  ? 29.406  2.416   33.132  1.00 160.33 ? 92  LEU B C     1 
ATOM   5239  O O     . LEU B 2 92  ? 29.384  3.288   34.003  1.00 157.02 ? 92  LEU B O     1 
ATOM   5240  C CB    . LEU B 2 92  ? 31.241  3.325   31.657  1.00 159.89 ? 92  LEU B CB    1 
ATOM   5241  C CG    . LEU B 2 92  ? 31.850  3.823   30.336  1.00 157.14 ? 92  LEU B CG    1 
ATOM   5242  C CD1   . LEU B 2 92  ? 33.238  4.419   30.564  1.00 139.75 ? 92  LEU B CD1   1 
ATOM   5243  C CD2   . LEU B 2 92  ? 31.906  2.723   29.281  1.00 157.46 ? 92  LEU B CD2   1 
ATOM   5244  N N     . GLY B 2 93  ? 29.081  1.149   33.378  1.00 159.79 ? 93  GLY B N     1 
ATOM   5245  C CA    . GLY B 2 93  ? 28.686  0.711   34.708  1.00 154.77 ? 93  GLY B CA    1 
ATOM   5246  C C     . GLY B 2 93  ? 29.812  0.201   35.596  1.00 148.61 ? 93  GLY B C     1 
ATOM   5247  O O     . GLY B 2 93  ? 30.798  -0.357  35.104  1.00 143.81 ? 93  GLY B O     1 
ATOM   5248  N N     . ILE B 2 94  ? 29.653  0.387   36.909  1.00 144.55 ? 94  ILE B N     1 
ATOM   5249  C CA    . ILE B 2 94  ? 30.551  -0.188  37.919  1.00 134.92 ? 94  ILE B CA    1 
ATOM   5250  C C     . ILE B 2 94  ? 29.780  -1.194  38.790  1.00 126.58 ? 94  ILE B C     1 
ATOM   5251  O O     . ILE B 2 94  ? 28.891  -0.803  39.553  1.00 119.67 ? 94  ILE B O     1 
ATOM   5252  C CB    . ILE B 2 94  ? 31.172  0.901   38.852  1.00 129.38 ? 94  ILE B CB    1 
ATOM   5253  C CG1   . ILE B 2 94  ? 31.882  1.998   38.047  1.00 128.97 ? 94  ILE B CG1   1 
ATOM   5254  C CG2   . ILE B 2 94  ? 32.128  0.267   39.872  1.00 119.65 ? 94  ILE B CG2   1 
ATOM   5255  C CD1   . ILE B 2 94  ? 32.639  3.001   38.916  1.00 112.57 ? 94  ILE B CD1   1 
ATOM   5256  N N     . PRO B 2 95  ? 30.111  -2.494  38.682  1.00 123.35 ? 95  PRO B N     1 
ATOM   5257  C CA    . PRO B 2 95  ? 29.351  -3.455  39.495  1.00 114.15 ? 95  PRO B CA    1 
ATOM   5258  C C     . PRO B 2 95  ? 29.551  -3.169  40.983  1.00 97.62  ? 95  PRO B C     1 
ATOM   5259  O O     . PRO B 2 95  ? 30.689  -3.053  41.438  1.00 95.42  ? 95  PRO B O     1 
ATOM   5260  C CB    . PRO B 2 95  ? 29.962  -4.808  39.109  1.00 114.79 ? 95  PRO B CB    1 
ATOM   5261  C CG    . PRO B 2 95  ? 31.338  -4.475  38.587  1.00 118.71 ? 95  PRO B CG    1 
ATOM   5262  C CD    . PRO B 2 95  ? 31.216  -3.128  37.937  1.00 121.33 ? 95  PRO B CD    1 
ATOM   5263  N N     . HIS B 2 96  ? 28.466  -3.050  41.736  1.00 82.46  ? 96  HIS B N     1 
ATOM   5264  C CA    . HIS B 2 96  ? 28.619  -2.701  43.133  1.00 68.78  ? 96  HIS B CA    1 
ATOM   5265  C C     . HIS B 2 96  ? 28.776  -3.936  43.987  1.00 61.39  ? 96  HIS B C     1 
ATOM   5266  O O     . HIS B 2 96  ? 27.843  -4.725  44.130  1.00 60.81  ? 96  HIS B O     1 
ATOM   5267  C CB    . HIS B 2 96  ? 27.456  -1.847  43.651  1.00 66.17  ? 96  HIS B CB    1 
ATOM   5268  C CG    . HIS B 2 96  ? 27.604  -1.474  45.093  1.00 56.57  ? 96  HIS B CG    1 
ATOM   5269  N ND1   . HIS B 2 96  ? 28.547  -0.571  45.533  1.00 54.11  ? 96  HIS B ND1   1 
ATOM   5270  C CD2   . HIS B 2 96  ? 26.974  -1.929  46.204  1.00 48.73  ? 96  HIS B CD2   1 
ATOM   5271  C CE1   . HIS B 2 96  ? 28.485  -0.475  46.848  1.00 50.28  ? 96  HIS B CE1   1 
ATOM   5272  N NE2   . HIS B 2 96  ? 27.536  -1.288  47.277  1.00 46.24  ? 96  HIS B NE2   1 
ATOM   5273  N N     . PRO B 2 97  ? 29.955  -4.101  44.585  1.00 58.65  ? 97  PRO B N     1 
ATOM   5274  C CA    . PRO B 2 97  ? 30.123  -5.344  45.332  1.00 62.83  ? 97  PRO B CA    1 
ATOM   5275  C C     . PRO B 2 97  ? 29.146  -5.430  46.477  1.00 56.51  ? 97  PRO B C     1 
ATOM   5276  O O     . PRO B 2 97  ? 29.212  -4.624  47.392  1.00 56.44  ? 97  PRO B O     1 
ATOM   5277  C CB    . PRO B 2 97  ? 31.543  -5.214  45.899  1.00 64.56  ? 97  PRO B CB    1 
ATOM   5278  C CG    . PRO B 2 97  ? 31.825  -3.747  45.907  1.00 59.92  ? 97  PRO B CG    1 
ATOM   5279  C CD    . PRO B 2 97  ? 31.098  -3.189  44.731  1.00 59.28  ? 97  PRO B CD    1 
ATOM   5280  N N     . ALA B 2 98  ? 28.336  -6.475  46.486  1.00 57.17  ? 98  ALA B N     1 
ATOM   5281  C CA    . ALA B 2 98  ? 27.390  -6.686  47.563  1.00 54.49  ? 98  ALA B CA    1 
ATOM   5282  C C     . ALA B 2 98  ? 28.142  -7.207  48.763  1.00 56.50  ? 98  ALA B C     1 
ATOM   5283  O O     . ALA B 2 98  ? 27.579  -7.369  49.837  1.00 63.11  ? 98  ALA B O     1 
ATOM   5284  C CB    . ALA B 2 98  ? 26.345  -7.671  47.150  1.00 51.82  ? 98  ALA B CB    1 
ATOM   5285  N N     . GLY B 2 99  ? 29.417  -7.498  48.568  1.00 54.30  ? 99  GLY B N     1 
ATOM   5286  C CA    . GLY B 2 99  ? 30.215  -8.062  49.631  1.00 59.81  ? 99  GLY B CA    1 
ATOM   5287  C C     . GLY B 2 99  ? 30.960  -7.000  50.411  1.00 62.34  ? 99  GLY B C     1 
ATOM   5288  O O     . GLY B 2 99  ? 31.344  -7.215  51.561  1.00 63.29  ? 99  GLY B O     1 
ATOM   5289  N N     . LEU B 2 100 ? 31.150  -5.843  49.793  1.00 59.53  ? 100 LEU B N     1 
ATOM   5290  C CA    . LEU B 2 100 ? 31.902  -4.778  50.427  1.00 58.14  ? 100 LEU B CA    1 
ATOM   5291  C C     . LEU B 2 100 ? 31.397  -4.518  51.847  1.00 59.80  ? 100 LEU B C     1 
ATOM   5292  O O     . LEU B 2 100 ? 32.185  -4.215  52.745  1.00 60.54  ? 100 LEU B O     1 
ATOM   5293  C CB    . LEU B 2 100 ? 31.825  -3.513  49.580  1.00 54.45  ? 100 LEU B CB    1 
ATOM   5294  C CG    . LEU B 2 100 ? 32.524  -2.281  50.137  1.00 54.46  ? 100 LEU B CG    1 
ATOM   5295  C CD1   . LEU B 2 100 ? 33.882  -2.627  50.710  1.00 58.34  ? 100 LEU B CD1   1 
ATOM   5296  C CD2   . LEU B 2 100 ? 32.641  -1.227  49.052  1.00 56.97  ? 100 LEU B CD2   1 
ATOM   5297  N N     . LYS B 2 101 ? 30.088  -4.668  52.046  1.00 59.72  ? 101 LYS B N     1 
ATOM   5298  C CA    . LYS B 2 101 ? 29.453  -4.339  53.318  1.00 57.76  ? 101 LYS B CA    1 
ATOM   5299  C C     . LYS B 2 101 ? 29.682  -5.376  54.380  1.00 64.86  ? 101 LYS B C     1 
ATOM   5300  O O     . LYS B 2 101 ? 29.579  -5.071  55.564  1.00 65.23  ? 101 LYS B O     1 
ATOM   5301  C CB    . LYS B 2 101 ? 27.950  -4.114  53.155  1.00 57.67  ? 101 LYS B CB    1 
ATOM   5302  C CG    . LYS B 2 101 ? 27.178  -5.240  52.506  1.00 57.26  ? 101 LYS B CG    1 
ATOM   5303  C CD    . LYS B 2 101 ? 25.738  -4.818  52.285  1.00 52.67  ? 101 LYS B CD    1 
ATOM   5304  C CE    . LYS B 2 101 ? 25.015  -5.732  51.307  1.00 59.24  ? 101 LYS B CE    1 
ATOM   5305  N NZ    . LYS B 2 101 ? 24.084  -4.969  50.397  1.00 56.84  ? 101 LYS B NZ    1 
ATOM   5306  N N     . LYS B 2 102 ? 29.974  -6.607  53.957  1.00 69.92  ? 102 LYS B N     1 
ATOM   5307  C CA    . LYS B 2 102 ? 30.113  -7.730  54.890  1.00 70.18  ? 102 LYS B CA    1 
ATOM   5308  C C     . LYS B 2 102 ? 31.542  -7.921  55.408  1.00 70.16  ? 102 LYS B C     1 
ATOM   5309  O O     . LYS B 2 102 ? 31.770  -8.662  56.363  1.00 74.21  ? 102 LYS B O     1 
ATOM   5310  C CB    . LYS B 2 102 ? 29.575  -9.030  54.277  1.00 68.66  ? 102 LYS B CB    1 
ATOM   5311  C CG    . LYS B 2 102 ? 28.153  -8.942  53.750  1.00 70.67  ? 102 LYS B CG    1 
ATOM   5312  C CD    . LYS B 2 102 ? 27.614  -10.315 53.390  1.00 83.98  ? 102 LYS B CD    1 
ATOM   5313  C CE    . LYS B 2 102 ? 26.282  -10.225 52.660  1.00 88.97  ? 102 LYS B CE    1 
ATOM   5314  N NZ    . LYS B 2 102 ? 25.892  -11.542 52.072  1.00 91.87  ? 102 LYS B NZ    1 
ATOM   5315  N N     . LYS B 2 103 ? 32.494  -7.234  54.792  1.00 69.28  ? 103 LYS B N     1 
ATOM   5316  C CA    . LYS B 2 103 ? 33.888  -7.323  55.205  1.00 75.57  ? 103 LYS B CA    1 
ATOM   5317  C C     . LYS B 2 103 ? 34.113  -6.811  56.632  1.00 76.05  ? 103 LYS B C     1 
ATOM   5318  O O     . LYS B 2 103 ? 33.531  -5.819  57.042  1.00 73.53  ? 103 LYS B O     1 
ATOM   5319  C CB    . LYS B 2 103 ? 34.778  -6.582  54.207  1.00 73.58  ? 103 LYS B CB    1 
ATOM   5320  C CG    . LYS B 2 103 ? 34.780  -7.223  52.827  1.00 75.90  ? 103 LYS B CG    1 
ATOM   5321  C CD    . LYS B 2 103 ? 35.466  -8.590  52.841  1.00 82.03  ? 103 LYS B CD    1 
ATOM   5322  C CE    . LYS B 2 103 ? 34.956  -9.501  51.738  1.00 79.02  ? 103 LYS B CE    1 
ATOM   5323  N NZ    . LYS B 2 103 ? 33.610  -10.038 52.084  1.00 72.78  ? 103 LYS B NZ    1 
ATOM   5324  N N     . LYS B 2 104 ? 34.952  -7.505  57.393  1.00 80.13  ? 104 LYS B N     1 
ATOM   5325  C CA    . LYS B 2 104 ? 35.254  -7.077  58.753  1.00 80.92  ? 104 LYS B CA    1 
ATOM   5326  C C     . LYS B 2 104 ? 35.963  -5.735  58.745  1.00 74.91  ? 104 LYS B C     1 
ATOM   5327  O O     . LYS B 2 104 ? 35.836  -4.951  59.683  1.00 72.39  ? 104 LYS B O     1 
ATOM   5328  C CB    . LYS B 2 104 ? 36.068  -8.133  59.507  1.00 85.47  ? 104 LYS B CB    1 
ATOM   5329  C CG    . LYS B 2 104 ? 35.259  -9.381  59.859  1.00 92.65  ? 104 LYS B CG    1 
ATOM   5330  C CD    . LYS B 2 104 ? 36.037  -10.326 60.770  1.00 100.81 ? 104 LYS B CD    1 
ATOM   5331  C CE    . LYS B 2 104 ? 35.222  -11.570 61.118  1.00 99.61  ? 104 LYS B CE    1 
ATOM   5332  N NZ    . LYS B 2 104 ? 35.935  -12.432 62.103  1.00 95.96  ? 104 LYS B NZ    1 
ATOM   5333  N N     . SER B 2 105 ? 36.707  -5.459  57.683  1.00 74.59  ? 105 SER B N     1 
ATOM   5334  C CA    . SER B 2 105 ? 37.257  -4.122  57.566  1.00 73.10  ? 105 SER B CA    1 
ATOM   5335  C C     . SER B 2 105 ? 37.298  -3.558  56.154  1.00 73.50  ? 105 SER B C     1 
ATOM   5336  O O     . SER B 2 105 ? 37.466  -4.301  55.192  1.00 73.81  ? 105 SER B O     1 
ATOM   5337  C CB    . SER B 2 105 ? 38.607  -4.037  58.250  1.00 71.66  ? 105 SER B CB    1 
ATOM   5338  O OG    . SER B 2 105 ? 38.400  -3.824  59.626  1.00 70.07  ? 105 SER B OG    1 
ATOM   5339  N N     . VAL B 2 106 ? 37.096  -2.239  56.059  1.00 68.94  ? 106 VAL B N     1 
ATOM   5340  C CA    . VAL B 2 106 ? 37.160  -1.485  54.811  1.00 66.50  ? 106 VAL B CA    1 
ATOM   5341  C C     . VAL B 2 106 ? 37.920  -0.171  55.043  1.00 68.69  ? 106 VAL B C     1 
ATOM   5342  O O     . VAL B 2 106 ? 37.530  0.630   55.879  1.00 68.92  ? 106 VAL B O     1 
ATOM   5343  C CB    . VAL B 2 106 ? 35.740  -1.198  54.246  1.00 63.74  ? 106 VAL B CB    1 
ATOM   5344  C CG1   . VAL B 2 106 ? 35.816  -0.449  52.929  1.00 61.15  ? 106 VAL B CG1   1 
ATOM   5345  C CG2   . VAL B 2 106 ? 34.945  -2.487  54.071  1.00 62.75  ? 106 VAL B CG2   1 
ATOM   5346  N N     . THR B 2 107 ? 39.021  0.029   54.319  1.00 73.32  ? 107 THR B N     1 
ATOM   5347  C CA    . THR B 2 107 ? 39.798  1.271   54.362  1.00 76.13  ? 107 THR B CA    1 
ATOM   5348  C C     . THR B 2 107 ? 39.472  2.141   53.148  1.00 73.07  ? 107 THR B C     1 
ATOM   5349  O O     . THR B 2 107 ? 39.250  1.643   52.044  1.00 66.49  ? 107 THR B O     1 
ATOM   5350  C CB    . THR B 2 107 ? 41.343  1.023   54.413  1.00 79.78  ? 107 THR B CB    1 
ATOM   5351  O OG1   . THR B 2 107 ? 41.688  0.265   55.577  1.00 83.96  ? 107 THR B OG1   1 
ATOM   5352  C CG2   . THR B 2 107 ? 42.111  2.338   54.445  1.00 80.61  ? 107 THR B CG2   1 
ATOM   5353  N N     . VAL B 2 108 ? 39.429  3.450   53.367  1.00 79.09  ? 108 VAL B N     1 
ATOM   5354  C CA    . VAL B 2 108 ? 39.159  4.384   52.292  1.00 74.29  ? 108 VAL B CA    1 
ATOM   5355  C C     . VAL B 2 108 ? 40.431  5.151   51.975  1.00 74.06  ? 108 VAL B C     1 
ATOM   5356  O O     . VAL B 2 108 ? 40.975  5.863   52.824  1.00 76.01  ? 108 VAL B O     1 
ATOM   5357  C CB    . VAL B 2 108 ? 38.025  5.362   52.657  1.00 70.57  ? 108 VAL B CB    1 
ATOM   5358  C CG1   . VAL B 2 108 ? 37.464  6.019   51.391  1.00 64.69  ? 108 VAL B CG1   1 
ATOM   5359  C CG2   . VAL B 2 108 ? 36.936  4.639   53.423  1.00 60.65  ? 108 VAL B CG2   1 
ATOM   5360  N N     . LEU B 2 109 ? 40.908  4.982   50.747  1.00 73.36  ? 109 LEU B N     1 
ATOM   5361  C CA    . LEU B 2 109 ? 42.117  5.656   50.291  1.00 79.40  ? 109 LEU B CA    1 
ATOM   5362  C C     . LEU B 2 109 ? 41.776  6.742   49.287  1.00 71.69  ? 109 LEU B C     1 
ATOM   5363  O O     . LEU B 2 109 ? 40.897  6.568   48.445  1.00 68.52  ? 109 LEU B O     1 
ATOM   5364  C CB    . LEU B 2 109 ? 43.109  4.658   49.681  1.00 82.29  ? 109 LEU B CB    1 
ATOM   5365  C CG    . LEU B 2 109 ? 43.648  3.568   50.615  1.00 89.37  ? 109 LEU B CG    1 
ATOM   5366  C CD1   . LEU B 2 109 ? 44.547  2.613   49.856  1.00 102.39 ? 109 LEU B CD1   1 
ATOM   5367  C CD2   . LEU B 2 109 ? 44.382  4.159   51.815  1.00 101.10 ? 109 LEU B CD2   1 
ATOM   5368  N N     . ASP B 2 110 ? 42.483  7.862   49.370  1.00 71.85  ? 110 ASP B N     1 
ATOM   5369  C CA    . ASP B 2 110 ? 42.233  8.941   48.446  1.00 69.36  ? 110 ASP B CA    1 
ATOM   5370  C C     . ASP B 2 110 ? 43.166  8.752   47.235  1.00 76.96  ? 110 ASP B C     1 
ATOM   5371  O O     . ASP B 2 110 ? 44.380  8.961   47.306  1.00 86.61  ? 110 ASP B O     1 
ATOM   5372  C CB    . ASP B 2 110 ? 42.471  10.278  49.157  1.00 68.24  ? 110 ASP B CB    1 
ATOM   5373  C CG    . ASP B 2 110 ? 42.027  11.470  48.332  1.00 62.98  ? 110 ASP B CG    1 
ATOM   5374  O OD1   . ASP B 2 110 ? 41.211  11.290  47.415  1.00 65.06  ? 110 ASP B OD1   1 
ATOM   5375  O OD2   . ASP B 2 110 ? 42.493  12.593  48.596  1.00 61.61  ? 110 ASP B OD2   1 
ATOM   5376  N N     . VAL B 2 111 ? 42.568  8.322   46.128  1.00 71.43  ? 111 VAL B N     1 
ATOM   5377  C CA    . VAL B 2 111 ? 43.275  8.077   44.884  1.00 73.45  ? 111 VAL B CA    1 
ATOM   5378  C C     . VAL B 2 111 ? 43.080  9.221   43.908  1.00 74.18  ? 111 VAL B C     1 
ATOM   5379  O O     . VAL B 2 111 ? 43.483  9.149   42.759  1.00 76.07  ? 111 VAL B O     1 
ATOM   5380  C CB    . VAL B 2 111 ? 42.828  6.763   44.245  1.00 73.72  ? 111 VAL B CB    1 
ATOM   5381  C CG1   . VAL B 2 111 ? 42.777  5.674   45.295  1.00 72.65  ? 111 VAL B CG1   1 
ATOM   5382  C CG2   . VAL B 2 111 ? 41.478  6.929   43.567  1.00 69.16  ? 111 VAL B CG2   1 
ATOM   5383  N N     . GLY B 2 112 ? 42.407  10.263  44.361  1.00 71.17  ? 112 GLY B N     1 
ATOM   5384  C CA    . GLY B 2 112 ? 41.994  11.325  43.470  1.00 70.65  ? 112 GLY B CA    1 
ATOM   5385  C C     . GLY B 2 112 ? 43.136  11.900  42.675  1.00 75.66  ? 112 GLY B C     1 
ATOM   5386  O O     . GLY B 2 112 ? 42.944  12.382  41.559  1.00 71.80  ? 112 GLY B O     1 
ATOM   5387  N N     . ASP B 2 113 ? 44.329  11.849  43.256  1.00 79.50  ? 113 ASP B N     1 
ATOM   5388  C CA    . ASP B 2 113 ? 45.505  12.427  42.626  1.00 82.75  ? 113 ASP B CA    1 
ATOM   5389  C C     . ASP B 2 113 ? 45.774  11.802  41.255  1.00 85.59  ? 113 ASP B C     1 
ATOM   5390  O O     . ASP B 2 113 ? 46.220  12.480  40.328  1.00 83.68  ? 113 ASP B O     1 
ATOM   5391  C CB    . ASP B 2 113 ? 46.720  12.264  43.533  1.00 96.02  ? 113 ASP B CB    1 
ATOM   5392  C CG    . ASP B 2 113 ? 47.471  13.561  43.727  1.00 104.56 ? 113 ASP B CG    1 
ATOM   5393  O OD1   . ASP B 2 113 ? 47.281  14.476  42.895  1.00 93.51  ? 113 ASP B OD1   1 
ATOM   5394  O OD2   . ASP B 2 113 ? 48.243  13.666  44.710  1.00 115.58 ? 113 ASP B OD2   1 
ATOM   5395  N N     . ALA B 2 114 ? 45.484  10.508  41.132  1.00 87.88  ? 114 ALA B N     1 
ATOM   5396  C CA    . ALA B 2 114 ? 45.720  9.775   39.900  1.00 78.34  ? 114 ALA B CA    1 
ATOM   5397  C C     . ALA B 2 114 ? 45.080  10.478  38.726  1.00 74.38  ? 114 ALA B C     1 
ATOM   5398  O O     . ALA B 2 114 ? 45.607  10.451  37.633  1.00 77.76  ? 114 ALA B O     1 
ATOM   5399  C CB    . ALA B 2 114 ? 45.198  8.374   40.015  1.00 76.61  ? 114 ALA B CB    1 
ATOM   5400  N N     . TYR B 2 115 ? 43.947  11.124  38.960  1.00 75.75  ? 115 TYR B N     1 
ATOM   5401  C CA    . TYR B 2 115 ? 43.171  11.748  37.888  1.00 74.20  ? 115 TYR B CA    1 
ATOM   5402  C C     . TYR B 2 115 ? 43.884  12.886  37.150  1.00 70.54  ? 115 TYR B C     1 
ATOM   5403  O O     . TYR B 2 115 ? 43.456  13.283  36.071  1.00 66.19  ? 115 TYR B O     1 
ATOM   5404  C CB    . TYR B 2 115 ? 41.843  12.282  38.432  1.00 74.50  ? 115 TYR B CB    1 
ATOM   5405  C CG    . TYR B 2 115 ? 40.910  11.242  38.997  1.00 72.29  ? 115 TYR B CG    1 
ATOM   5406  C CD1   . TYR B 2 115 ? 39.577  11.217  38.629  1.00 68.87  ? 115 TYR B CD1   1 
ATOM   5407  C CD2   . TYR B 2 115 ? 41.358  10.297  39.912  1.00 77.61  ? 115 TYR B CD2   1 
ATOM   5408  C CE1   . TYR B 2 115 ? 38.713  10.278  39.149  1.00 72.39  ? 115 TYR B CE1   1 
ATOM   5409  C CE2   . TYR B 2 115 ? 40.498  9.346   40.446  1.00 77.20  ? 115 TYR B CE2   1 
ATOM   5410  C CZ    . TYR B 2 115 ? 39.174  9.340   40.058  1.00 74.89  ? 115 TYR B CZ    1 
ATOM   5411  O OH    . TYR B 2 115 ? 38.313  8.394   40.576  1.00 72.37  ? 115 TYR B OH    1 
ATOM   5412  N N     . PHE B 2 116 ? 44.949  13.426  37.731  1.00 73.51  ? 116 PHE B N     1 
ATOM   5413  C CA    . PHE B 2 116 ? 45.639  14.561  37.115  1.00 74.77  ? 116 PHE B CA    1 
ATOM   5414  C C     . PHE B 2 116 ? 46.514  14.162  35.911  1.00 75.04  ? 116 PHE B C     1 
ATOM   5415  O O     . PHE B 2 116 ? 46.921  15.020  35.129  1.00 72.14  ? 116 PHE B O     1 
ATOM   5416  C CB    . PHE B 2 116 ? 46.472  15.326  38.149  1.00 76.05  ? 116 PHE B CB    1 
ATOM   5417  C CG    . PHE B 2 116 ? 45.663  15.943  39.261  1.00 76.99  ? 116 PHE B CG    1 
ATOM   5418  C CD1   . PHE B 2 116 ? 44.705  16.909  38.994  1.00 75.63  ? 116 PHE B CD1   1 
ATOM   5419  C CD2   . PHE B 2 116 ? 45.883  15.575  40.584  1.00 80.16  ? 116 PHE B CD2   1 
ATOM   5420  C CE1   . PHE B 2 116 ? 43.968  17.487  40.028  1.00 73.31  ? 116 PHE B CE1   1 
ATOM   5421  C CE2   . PHE B 2 116 ? 45.149  16.145  41.615  1.00 76.18  ? 116 PHE B CE2   1 
ATOM   5422  C CZ    . PHE B 2 116 ? 44.193  17.102  41.334  1.00 71.90  ? 116 PHE B CZ    1 
ATOM   5423  N N     . SER B 2 117 ? 46.809  12.866  35.791  1.00 77.14  ? 117 SER B N     1 
ATOM   5424  C CA    . SER B 2 117 ? 47.472  12.290  34.618  1.00 73.93  ? 117 SER B CA    1 
ATOM   5425  C C     . SER B 2 117 ? 46.709  12.585  33.342  1.00 72.73  ? 117 SER B C     1 
ATOM   5426  O O     . SER B 2 117 ? 47.143  13.368  32.502  1.00 75.86  ? 117 SER B O     1 
ATOM   5427  C CB    . SER B 2 117 ? 47.557  10.771  34.755  1.00 72.27  ? 117 SER B CB    1 
ATOM   5428  O OG    . SER B 2 117 ? 48.352  10.401  35.863  1.00 77.13  ? 117 SER B OG    1 
ATOM   5429  N N     . VAL B 2 118 ? 45.562  11.945  33.202  1.00 68.19  ? 118 VAL B N     1 
ATOM   5430  C CA    . VAL B 2 118 ? 44.789  12.056  31.978  1.00 72.10  ? 118 VAL B CA    1 
ATOM   5431  C C     . VAL B 2 118 ? 44.480  13.498  31.602  1.00 70.25  ? 118 VAL B C     1 
ATOM   5432  O O     . VAL B 2 118 ? 44.110  14.288  32.448  1.00 71.10  ? 118 VAL B O     1 
ATOM   5433  C CB    . VAL B 2 118 ? 43.487  11.283  32.113  1.00 69.06  ? 118 VAL B CB    1 
ATOM   5434  C CG1   . VAL B 2 118 ? 42.760  11.220  30.785  1.00 62.17  ? 118 VAL B CG1   1 
ATOM   5435  C CG2   . VAL B 2 118 ? 43.786  9.894   32.659  1.00 71.60  ? 118 VAL B CG2   1 
ATOM   5436  N N     . PRO B 2 119 ? 44.694  13.853  30.330  1.00 75.43  ? 119 PRO B N     1 
ATOM   5437  C CA    . PRO B 2 119 ? 44.199  15.091  29.719  1.00 75.02  ? 119 PRO B CA    1 
ATOM   5438  C C     . PRO B 2 119 ? 42.680  15.086  29.627  1.00 69.92  ? 119 PRO B C     1 
ATOM   5439  O O     . PRO B 2 119 ? 42.078  14.039  29.827  1.00 65.44  ? 119 PRO B O     1 
ATOM   5440  C CB    . PRO B 2 119 ? 44.817  15.052  28.319  1.00 81.92  ? 119 PRO B CB    1 
ATOM   5441  C CG    . PRO B 2 119 ? 46.081  14.288  28.501  1.00 84.30  ? 119 PRO B CG    1 
ATOM   5442  C CD    . PRO B 2 119 ? 45.740  13.222  29.504  1.00 84.02  ? 119 PRO B CD    1 
ATOM   5443  N N     . LEU B 2 120 ? 42.082  16.245  29.354  1.00 68.34  ? 120 LEU B N     1 
ATOM   5444  C CA    . LEU B 2 120 ? 40.631  16.387  29.294  1.00 68.56  ? 120 LEU B CA    1 
ATOM   5445  C C     . LEU B 2 120 ? 40.214  16.923  27.940  1.00 73.22  ? 120 LEU B C     1 
ATOM   5446  O O     . LEU B 2 120 ? 40.918  17.744  27.366  1.00 75.64  ? 120 LEU B O     1 
ATOM   5447  C CB    . LEU B 2 120 ? 40.150  17.359  30.376  1.00 70.08  ? 120 LEU B CB    1 
ATOM   5448  C CG    . LEU B 2 120 ? 38.657  17.383  30.728  1.00 68.93  ? 120 LEU B CG    1 
ATOM   5449  C CD1   . LEU B 2 120 ? 38.398  16.430  31.877  1.00 59.78  ? 120 LEU B CD1   1 
ATOM   5450  C CD2   . LEU B 2 120 ? 38.183  18.796  31.061  1.00 65.82  ? 120 LEU B CD2   1 
ATOM   5451  N N     . ASP B 2 121 ? 39.053  16.496  27.448  1.00 76.33  ? 121 ASP B N     1 
ATOM   5452  C CA    . ASP B 2 121 ? 38.599  16.924  26.130  1.00 83.86  ? 121 ASP B CA    1 
ATOM   5453  C C     . ASP B 2 121 ? 38.592  18.442  26.085  1.00 80.11  ? 121 ASP B C     1 
ATOM   5454  O O     . ASP B 2 121 ? 37.905  19.095  26.860  1.00 77.05  ? 121 ASP B O     1 
ATOM   5455  C CB    . ASP B 2 121 ? 37.191  16.377  25.832  1.00 91.51  ? 121 ASP B CB    1 
ATOM   5456  C CG    . ASP B 2 121 ? 36.694  16.734  24.422  1.00 94.03  ? 121 ASP B CG    1 
ATOM   5457  O OD1   . ASP B 2 121 ? 37.466  16.549  23.457  1.00 99.29  ? 121 ASP B OD1   1 
ATOM   5458  O OD2   . ASP B 2 121 ? 35.533  17.192  24.276  1.00 87.37  ? 121 ASP B OD2   1 
ATOM   5459  N N     . GLU B 2 122 ? 39.333  18.995  25.138  1.00 81.11  ? 122 GLU B N     1 
ATOM   5460  C CA    . GLU B 2 122 ? 39.536  20.424  25.077  1.00 83.46  ? 122 GLU B CA    1 
ATOM   5461  C C     . GLU B 2 122 ? 38.205  21.158  24.968  1.00 82.48  ? 122 GLU B C     1 
ATOM   5462  O O     . GLU B 2 122 ? 38.101  22.330  25.314  1.00 79.96  ? 122 GLU B O     1 
ATOM   5463  C CB    . GLU B 2 122 ? 40.447  20.770  23.900  1.00 89.94  ? 122 GLU B CB    1 
ATOM   5464  C CG    . GLU B 2 122 ? 40.893  22.227  23.855  1.00 98.85  ? 122 GLU B CG    1 
ATOM   5465  C CD    . GLU B 2 122 ? 41.845  22.519  22.697  1.00 111.97 ? 122 GLU B CD    1 
ATOM   5466  O OE1   . GLU B 2 122 ? 42.503  23.586  22.720  1.00 115.01 ? 122 GLU B OE1   1 
ATOM   5467  O OE2   . GLU B 2 122 ? 41.936  21.683  21.766  1.00 112.94 ? 122 GLU B OE2   1 
ATOM   5468  N N     . ASP B 2 123 ? 37.185  20.463  24.484  1.00 85.40  ? 123 ASP B N     1 
ATOM   5469  C CA    . ASP B 2 123 ? 35.880  21.084  24.269  1.00 86.85  ? 123 ASP B CA    1 
ATOM   5470  C C     . ASP B 2 123 ? 35.063  21.165  25.556  1.00 81.59  ? 123 ASP B C     1 
ATOM   5471  O O     . ASP B 2 123 ? 34.174  22.009  25.680  1.00 80.32  ? 123 ASP B O     1 
ATOM   5472  C CB    . ASP B 2 123 ? 35.090  20.335  23.185  1.00 93.86  ? 123 ASP B CB    1 
ATOM   5473  C CG    . ASP B 2 123 ? 35.850  20.223  21.860  1.00 99.41  ? 123 ASP B CG    1 
ATOM   5474  O OD1   . ASP B 2 123 ? 37.094  20.086  21.876  1.00 96.79  ? 123 ASP B OD1   1 
ATOM   5475  O OD2   . ASP B 2 123 ? 35.197  20.261  20.795  1.00 105.33 ? 123 ASP B OD2   1 
ATOM   5476  N N     . PHE B 2 124 ? 35.354  20.256  26.489  1.00 80.90  ? 124 PHE B N     1 
ATOM   5477  C CA    . PHE B 2 124 ? 34.671  20.169  27.789  1.00 77.40  ? 124 PHE B CA    1 
ATOM   5478  C C     . PHE B 2 124 ? 35.221  21.131  28.864  1.00 76.17  ? 124 PHE B C     1 
ATOM   5479  O O     . PHE B 2 124 ? 34.482  21.571  29.754  1.00 72.23  ? 124 PHE B O     1 
ATOM   5480  C CB    . PHE B 2 124 ? 34.688  18.715  28.297  1.00 78.52  ? 124 PHE B CB    1 
ATOM   5481  C CG    . PHE B 2 124 ? 33.703  18.435  29.408  1.00 76.36  ? 124 PHE B CG    1 
ATOM   5482  C CD1   . PHE B 2 124 ? 32.360  18.752  29.261  1.00 72.84  ? 124 PHE B CD1   1 
ATOM   5483  C CD2   . PHE B 2 124 ? 34.126  17.837  30.594  1.00 73.72  ? 124 PHE B CD2   1 
ATOM   5484  C CE1   . PHE B 2 124 ? 31.471  18.494  30.272  1.00 73.46  ? 124 PHE B CE1   1 
ATOM   5485  C CE2   . PHE B 2 124 ? 33.238  17.585  31.610  1.00 66.57  ? 124 PHE B CE2   1 
ATOM   5486  C CZ    . PHE B 2 124 ? 31.911  17.906  31.450  1.00 70.49  ? 124 PHE B CZ    1 
ATOM   5487  N N     . ARG B 2 125 ? 36.511  21.456  28.759  1.00 76.54  ? 125 ARG B N     1 
ATOM   5488  C CA    . ARG B 2 125 ? 37.238  22.254  29.752  1.00 68.91  ? 125 ARG B CA    1 
ATOM   5489  C C     . ARG B 2 125 ? 36.589  23.578  30.157  1.00 64.61  ? 125 ARG B C     1 
ATOM   5490  O O     . ARG B 2 125 ? 36.759  24.033  31.285  1.00 61.23  ? 125 ARG B O     1 
ATOM   5491  C CB    . ARG B 2 125 ? 38.654  22.518  29.259  1.00 66.62  ? 125 ARG B CB    1 
ATOM   5492  C CG    . ARG B 2 125 ? 39.477  21.254  29.075  1.00 71.30  ? 125 ARG B CG    1 
ATOM   5493  C CD    . ARG B 2 125 ? 40.693  21.547  28.234  1.00 71.93  ? 125 ARG B CD    1 
ATOM   5494  N NE    . ARG B 2 125 ? 41.702  20.502  28.308  1.00 71.02  ? 125 ARG B NE    1 
ATOM   5495  C CZ    . ARG B 2 125 ? 42.929  20.646  27.819  1.00 75.95  ? 125 ARG B CZ    1 
ATOM   5496  N NH1   . ARG B 2 125 ? 43.270  21.788  27.229  1.00 79.21  ? 125 ARG B NH1   1 
ATOM   5497  N NH2   . ARG B 2 125 ? 43.814  19.663  27.921  1.00 72.92  ? 125 ARG B NH2   1 
ATOM   5498  N N     . LYS B 2 126 ? 35.834  24.188  29.258  1.00 64.60  ? 126 LYS B N     1 
ATOM   5499  C CA    . LYS B 2 126 ? 35.193  25.455  29.584  1.00 67.42  ? 126 LYS B CA    1 
ATOM   5500  C C     . LYS B 2 126 ? 34.106  25.328  30.661  1.00 68.07  ? 126 LYS B C     1 
ATOM   5501  O O     . LYS B 2 126 ? 33.591  26.324  31.165  1.00 67.57  ? 126 LYS B O     1 
ATOM   5502  C CB    . LYS B 2 126 ? 34.642  26.109  28.319  1.00 68.17  ? 126 LYS B CB    1 
ATOM   5503  C CG    . LYS B 2 126 ? 33.635  25.280  27.570  1.00 75.09  ? 126 LYS B CG    1 
ATOM   5504  C CD    . LYS B 2 126 ? 33.553  25.741  26.136  1.00 78.55  ? 126 LYS B CD    1 
ATOM   5505  C CE    . LYS B 2 126 ? 32.163  25.593  25.587  1.00 79.47  ? 126 LYS B CE    1 
ATOM   5506  N NZ    . LYS B 2 126 ? 32.224  25.744  24.116  1.00 89.83  ? 126 LYS B NZ    1 
ATOM   5507  N N     . TYR B 2 127 ? 33.761  24.097  31.003  1.00 66.14  ? 127 TYR B N     1 
ATOM   5508  C CA    . TYR B 2 127 ? 32.733  23.841  31.997  1.00 64.69  ? 127 TYR B CA    1 
ATOM   5509  C C     . TYR B 2 127 ? 33.324  23.574  33.383  1.00 60.83  ? 127 TYR B C     1 
ATOM   5510  O O     . TYR B 2 127 ? 32.592  23.367  34.350  1.00 59.66  ? 127 TYR B O     1 
ATOM   5511  C CB    . TYR B 2 127 ? 31.866  22.659  31.553  1.00 70.01  ? 127 TYR B CB    1 
ATOM   5512  C CG    . TYR B 2 127 ? 31.232  22.858  30.200  1.00 74.60  ? 127 TYR B CG    1 
ATOM   5513  C CD1   . TYR B 2 127 ? 30.524  24.021  29.917  1.00 76.67  ? 127 TYR B CD1   1 
ATOM   5514  C CD2   . TYR B 2 127 ? 31.357  21.897  29.198  1.00 74.98  ? 127 TYR B CD2   1 
ATOM   5515  C CE1   . TYR B 2 127 ? 29.946  24.221  28.682  1.00 79.43  ? 127 TYR B CE1   1 
ATOM   5516  C CE2   . TYR B 2 127 ? 30.787  22.093  27.955  1.00 76.92  ? 127 TYR B CE2   1 
ATOM   5517  C CZ    . TYR B 2 127 ? 30.082  23.259  27.706  1.00 81.35  ? 127 TYR B CZ    1 
ATOM   5518  O OH    . TYR B 2 127 ? 29.506  23.475  26.480  1.00 82.49  ? 127 TYR B OH    1 
ATOM   5519  N N     . THR B 2 128 ? 34.647  23.560  33.487  1.00 56.57  ? 128 THR B N     1 
ATOM   5520  C CA    . THR B 2 128 ? 35.274  23.382  34.792  1.00 55.55  ? 128 THR B CA    1 
ATOM   5521  C C     . THR B 2 128 ? 35.640  24.702  35.476  1.00 51.98  ? 128 THR B C     1 
ATOM   5522  O O     . THR B 2 128 ? 36.316  24.711  36.493  1.00 49.37  ? 128 THR B O     1 
ATOM   5523  C CB    . THR B 2 128 ? 36.471  22.437  34.747  1.00 51.25  ? 128 THR B CB    1 
ATOM   5524  O OG1   . THR B 2 128 ? 37.271  22.748  33.607  1.00 54.22  ? 128 THR B OG1   1 
ATOM   5525  C CG2   . THR B 2 128 ? 35.989  21.027  34.648  1.00 48.92  ? 128 THR B CG2   1 
ATOM   5526  N N     . ALA B 2 129 ? 35.204  25.809  34.891  1.00 52.10  ? 129 ALA B N     1 
ATOM   5527  C CA    . ALA B 2 129 ? 35.555  27.138  35.364  1.00 51.94  ? 129 ALA B CA    1 
ATOM   5528  C C     . ALA B 2 129 ? 35.196  27.396  36.828  1.00 54.26  ? 129 ALA B C     1 
ATOM   5529  O O     . ALA B 2 129 ? 34.042  27.235  37.236  1.00 55.75  ? 129 ALA B O     1 
ATOM   5530  C CB    . ALA B 2 129 ? 34.893  28.154  34.498  1.00 53.68  ? 129 ALA B CB    1 
ATOM   5531  N N     . PHE B 2 130 ? 36.178  27.832  37.611  1.00 49.52  ? 130 PHE B N     1 
ATOM   5532  C CA    . PHE B 2 130 ? 35.924  28.209  38.991  1.00 49.04  ? 130 PHE B CA    1 
ATOM   5533  C C     . PHE B 2 130 ? 36.673  29.494  39.410  1.00 49.66  ? 130 PHE B C     1 
ATOM   5534  O O     . PHE B 2 130 ? 37.809  29.682  39.034  1.00 51.13  ? 130 PHE B O     1 
ATOM   5535  C CB    . PHE B 2 130 ? 36.305  27.047  39.894  1.00 45.78  ? 130 PHE B CB    1 
ATOM   5536  C CG    . PHE B 2 130 ? 37.765  26.798  39.962  1.00 43.48  ? 130 PHE B CG    1 
ATOM   5537  C CD1   . PHE B 2 130 ? 38.557  27.514  40.829  1.00 44.35  ? 130 PHE B CD1   1 
ATOM   5538  C CD2   . PHE B 2 130 ? 38.351  25.852  39.164  1.00 47.57  ? 130 PHE B CD2   1 
ATOM   5539  C CE1   . PHE B 2 130 ? 39.908  27.286  40.897  1.00 46.36  ? 130 PHE B CE1   1 
ATOM   5540  C CE2   . PHE B 2 130 ? 39.705  25.617  39.234  1.00 49.13  ? 130 PHE B CE2   1 
ATOM   5541  C CZ    . PHE B 2 130 ? 40.483  26.341  40.100  1.00 46.63  ? 130 PHE B CZ    1 
ATOM   5542  N N     . THR B 2 131 ? 36.041  30.371  40.189  1.00 49.29  ? 131 THR B N     1 
ATOM   5543  C CA    . THR B 2 131 ? 36.688  31.607  40.668  1.00 48.40  ? 131 THR B CA    1 
ATOM   5544  C C     . THR B 2 131 ? 37.266  31.469  42.075  1.00 47.39  ? 131 THR B C     1 
ATOM   5545  O O     . THR B 2 131 ? 36.548  31.107  42.994  1.00 48.63  ? 131 THR B O     1 
ATOM   5546  C CB    . THR B 2 131 ? 35.670  32.766  40.825  1.00 48.18  ? 131 THR B CB    1 
ATOM   5547  O OG1   . THR B 2 131 ? 35.023  33.069  39.585  1.00 53.45  ? 131 THR B OG1   1 
ATOM   5548  C CG2   . THR B 2 131 ? 36.359  33.987  41.338  1.00 47.92  ? 131 THR B CG2   1 
ATOM   5549  N N     . ILE B 2 132 ? 38.538  31.786  42.278  1.00 47.87  ? 132 ILE B N     1 
ATOM   5550  C CA    . ILE B 2 132 ? 39.001  32.042  43.644  1.00 45.93  ? 132 ILE B CA    1 
ATOM   5551  C C     . ILE B 2 132 ? 38.759  33.499  44.006  1.00 41.33  ? 132 ILE B C     1 
ATOM   5552  O O     . ILE B 2 132 ? 39.339  34.380  43.402  1.00 40.01  ? 132 ILE B O     1 
ATOM   5553  C CB    . ILE B 2 132 ? 40.474  31.796  43.829  1.00 44.62  ? 132 ILE B CB    1 
ATOM   5554  C CG1   . ILE B 2 132 ? 40.797  30.336  43.599  1.00 41.89  ? 132 ILE B CG1   1 
ATOM   5555  C CG2   . ILE B 2 132 ? 40.864  32.176  45.244  1.00 42.18  ? 132 ILE B CG2   1 
ATOM   5556  C CD1   . ILE B 2 132 ? 42.216  30.027  43.963  1.00 43.00  ? 132 ILE B CD1   1 
ATOM   5557  N N     . PRO B 2 133 ? 37.903  33.740  45.007  1.00 40.24  ? 133 PRO B N     1 
ATOM   5558  C CA    . PRO B 2 133 ? 37.403  35.044  45.439  1.00 41.08  ? 133 PRO B CA    1 
ATOM   5559  C C     . PRO B 2 133 ? 38.419  35.867  46.244  1.00 43.48  ? 133 PRO B C     1 
ATOM   5560  O O     . PRO B 2 133 ? 39.465  35.361  46.688  1.00 40.71  ? 133 PRO B O     1 
ATOM   5561  C CB    . PRO B 2 133 ? 36.242  34.657  46.327  1.00 35.45  ? 133 PRO B CB    1 
ATOM   5562  C CG    . PRO B 2 133 ? 36.703  33.418  46.950  1.00 34.26  ? 133 PRO B CG    1 
ATOM   5563  C CD    . PRO B 2 133 ? 37.450  32.679  45.916  1.00 37.79  ? 133 PRO B CD    1 
ATOM   5564  N N     . SER B 2 134 ? 38.122  37.149  46.415  1.00 42.54  ? 134 SER B N     1 
ATOM   5565  C CA    . SER B 2 134 ? 38.930  37.973  47.317  1.00 46.35  ? 134 SER B CA    1 
ATOM   5566  C C     . SER B 2 134 ? 38.163  38.447  48.566  1.00 47.14  ? 134 SER B C     1 
ATOM   5567  O O     . SER B 2 134 ? 36.961  38.749  48.507  1.00 45.91  ? 134 SER B O     1 
ATOM   5568  C CB    . SER B 2 134 ? 39.526  39.182  46.580  1.00 50.37  ? 134 SER B CB    1 
ATOM   5569  O OG    . SER B 2 134 ? 38.515  40.105  46.187  1.00 54.93  ? 134 SER B OG    1 
ATOM   5570  N N     . ILE B 2 135 ? 38.874  38.526  49.689  1.00 45.26  ? 135 ILE B N     1 
ATOM   5571  C CA    . ILE B 2 135 ? 38.326  39.190  50.859  1.00 42.40  ? 135 ILE B CA    1 
ATOM   5572  C C     . ILE B 2 135 ? 37.876  40.603  50.492  1.00 45.67  ? 135 ILE B C     1 
ATOM   5573  O O     . ILE B 2 135 ? 38.550  41.322  49.791  1.00 50.36  ? 135 ILE B O     1 
ATOM   5574  C CB    . ILE B 2 135 ? 39.320  39.272  51.993  1.00 35.58  ? 135 ILE B CB    1 
ATOM   5575  C CG1   . ILE B 2 135 ? 39.779  37.886  52.414  1.00 39.88  ? 135 ILE B CG1   1 
ATOM   5576  C CG2   . ILE B 2 135 ? 38.674  39.895  53.154  1.00 37.99  ? 135 ILE B CG2   1 
ATOM   5577  C CD1   . ILE B 2 135 ? 40.789  37.921  53.522  1.00 40.58  ? 135 ILE B CD1   1 
ATOM   5578  N N     . ASN B 2 136 ? 36.685  40.957  50.918  1.00 43.90  ? 136 ASN B N     1 
ATOM   5579  C CA    . ASN B 2 136 ? 36.166  42.290  50.770  1.00 48.96  ? 136 ASN B CA    1 
ATOM   5580  C C     . ASN B 2 136 ? 36.149  42.780  49.327  1.00 54.53  ? 136 ASN B C     1 
ATOM   5581  O O     . ASN B 2 136 ? 35.973  43.970  49.087  1.00 57.60  ? 136 ASN B O     1 
ATOM   5582  C CB    . ASN B 2 136 ? 36.948  43.259  51.673  1.00 52.93  ? 136 ASN B CB    1 
ATOM   5583  C CG    . ASN B 2 136 ? 36.313  44.656  51.744  1.00 57.02  ? 136 ASN B CG    1 
ATOM   5584  O OD1   . ASN B 2 136 ? 35.094  44.824  51.633  1.00 54.51  ? 136 ASN B OD1   1 
ATOM   5585  N ND2   . ASN B 2 136 ? 37.152  45.663  51.917  1.00 61.73  ? 136 ASN B ND2   1 
ATOM   5586  N N     . ASN B 2 137 ? 36.236  41.870  48.362  1.00 53.99  ? 137 ASN B N     1 
ATOM   5587  C CA    . ASN B 2 137 ? 36.166  42.273  46.945  1.00 59.72  ? 137 ASN B CA    1 
ATOM   5588  C C     . ASN B 2 137 ? 37.275  43.239  46.440  1.00 59.72  ? 137 ASN B C     1 
ATOM   5589  O O     . ASN B 2 137 ? 37.036  44.064  45.554  1.00 57.77  ? 137 ASN B O     1 
ATOM   5590  C CB    . ASN B 2 137 ? 34.779  42.862  46.632  1.00 60.20  ? 137 ASN B CB    1 
ATOM   5591  C CG    . ASN B 2 137 ? 33.694  41.798  46.549  1.00 66.58  ? 137 ASN B CG    1 
ATOM   5592  O OD1   . ASN B 2 137 ? 33.956  40.647  46.192  1.00 67.07  ? 137 ASN B OD1   1 
ATOM   5593  N ND2   . ASN B 2 137 ? 32.469  42.181  46.871  1.00 68.74  ? 137 ASN B ND2   1 
ATOM   5594  N N     . GLU B 2 138 ? 38.482  43.115  46.989  1.00 55.97  ? 138 GLU B N     1 
ATOM   5595  C CA    . GLU B 2 138 ? 39.568  44.034  46.691  1.00 57.73  ? 138 GLU B CA    1 
ATOM   5596  C C     . GLU B 2 138 ? 40.226  43.794  45.320  1.00 63.27  ? 138 GLU B C     1 
ATOM   5597  O O     . GLU B 2 138 ? 40.553  44.740  44.593  1.00 63.18  ? 138 GLU B O     1 
ATOM   5598  C CB    . GLU B 2 138 ? 40.599  44.001  47.823  1.00 60.70  ? 138 GLU B CB    1 
ATOM   5599  C CG    . GLU B 2 138 ? 40.353  45.085  48.895  1.00 64.68  ? 138 GLU B CG    1 
ATOM   5600  C CD    . GLU B 2 138 ? 40.587  44.574  50.308  1.00 66.23  ? 138 GLU B CD    1 
ATOM   5601  O OE1   . GLU B 2 138 ? 41.184  43.470  50.434  1.00 68.30  ? 138 GLU B OE1   1 
ATOM   5602  O OE2   . GLU B 2 138 ? 40.171  45.262  51.280  1.00 59.45  ? 138 GLU B OE2   1 
ATOM   5603  N N     . THR B 2 139 ? 40.389  42.524  44.968  1.00 63.21  ? 139 THR B N     1 
ATOM   5604  C CA    . THR B 2 139 ? 40.865  42.099  43.661  1.00 55.93  ? 139 THR B CA    1 
ATOM   5605  C C     . THR B 2 139 ? 39.647  41.449  43.042  1.00 57.58  ? 139 THR B C     1 
ATOM   5606  O O     . THR B 2 139 ? 38.726  41.073  43.758  1.00 56.33  ? 139 THR B O     1 
ATOM   5607  C CB    . THR B 2 139 ? 41.926  41.006  43.810  1.00 56.33  ? 139 THR B CB    1 
ATOM   5608  O OG1   . THR B 2 139 ? 42.783  41.326  44.909  1.00 59.70  ? 139 THR B OG1   1 
ATOM   5609  C CG2   . THR B 2 139 ? 42.758  40.852  42.530  1.00 63.49  ? 139 THR B CG2   1 
ATOM   5610  N N     . PRO B 2 140 ? 39.585  41.355  41.710  1.00 62.68  ? 140 PRO B N     1 
ATOM   5611  C CA    . PRO B 2 140 ? 38.521  40.436  41.291  1.00 63.54  ? 140 PRO B CA    1 
ATOM   5612  C C     . PRO B 2 140 ? 38.990  38.983  41.418  1.00 58.28  ? 140 PRO B C     1 
ATOM   5613  O O     . PRO B 2 140 ? 40.121  38.720  41.868  1.00 50.96  ? 140 PRO B O     1 
ATOM   5614  C CB    . PRO B 2 140 ? 38.262  40.818  39.828  1.00 62.95  ? 140 PRO B CB    1 
ATOM   5615  C CG    . PRO B 2 140 ? 38.938  42.164  39.637  1.00 65.54  ? 140 PRO B CG    1 
ATOM   5616  C CD    . PRO B 2 140 ? 40.109  42.145  40.585  1.00 62.12  ? 140 PRO B CD    1 
ATOM   5617  N N     . GLY B 2 141 ? 38.114  38.053  41.048  1.00 54.05  ? 141 GLY B N     1 
ATOM   5618  C CA    . GLY B 2 141 ? 38.419  36.644  41.184  1.00 49.44  ? 141 GLY B CA    1 
ATOM   5619  C C     . GLY B 2 141 ? 39.569  36.188  40.309  1.00 49.18  ? 141 GLY B C     1 
ATOM   5620  O O     . GLY B 2 141 ? 39.765  36.693  39.213  1.00 53.86  ? 141 GLY B O     1 
ATOM   5621  N N     . ILE B 2 142 ? 40.324  35.216  40.790  1.00 46.32  ? 142 ILE B N     1 
ATOM   5622  C CA    . ILE B 2 142 ? 41.293  34.536  39.961  1.00 48.44  ? 142 ILE B CA    1 
ATOM   5623  C C     . ILE B 2 142 ? 40.562  33.346  39.353  1.00 48.17  ? 142 ILE B C     1 
ATOM   5624  O O     . ILE B 2 142 ? 40.280  32.393  40.056  1.00 48.31  ? 142 ILE B O     1 
ATOM   5625  C CB    . ILE B 2 142 ? 42.425  33.975  40.851  1.00 51.10  ? 142 ILE B CB    1 
ATOM   5626  C CG1   . ILE B 2 142 ? 43.103  35.086  41.654  1.00 53.33  ? 142 ILE B CG1   1 
ATOM   5627  C CG2   . ILE B 2 142 ? 43.450  33.220  40.044  1.00 51.23  ? 142 ILE B CG2   1 
ATOM   5628  C CD1   . ILE B 2 142 ? 44.263  34.562  42.515  1.00 54.64  ? 142 ILE B CD1   1 
ATOM   5629  N N     . ARG B 2 143 ? 40.272  33.376  38.053  1.00 50.38  ? 143 ARG B N     1 
ATOM   5630  C CA    . ARG B 2 143 ? 39.506  32.287  37.425  1.00 52.58  ? 143 ARG B CA    1 
ATOM   5631  C C     . ARG B 2 143 ? 40.364  31.285  36.664  1.00 52.09  ? 143 ARG B C     1 
ATOM   5632  O O     . ARG B 2 143 ? 41.209  31.656  35.880  1.00 55.07  ? 143 ARG B O     1 
ATOM   5633  C CB    . ARG B 2 143 ? 38.435  32.822  36.492  1.00 52.46  ? 143 ARG B CB    1 
ATOM   5634  C CG    . ARG B 2 143 ? 37.771  34.072  36.985  1.00 55.65  ? 143 ARG B CG    1 
ATOM   5635  C CD    . ARG B 2 143 ? 36.450  34.211  36.304  1.00 58.78  ? 143 ARG B CD    1 
ATOM   5636  N NE    . ARG B 2 143 ? 35.756  32.936  36.402  1.00 64.27  ? 143 ARG B NE    1 
ATOM   5637  C CZ    . ARG B 2 143 ? 34.955  32.458  35.460  1.00 69.18  ? 143 ARG B CZ    1 
ATOM   5638  N NH1   . ARG B 2 143 ? 34.753  33.157  34.355  1.00 72.75  ? 143 ARG B NH1   1 
ATOM   5639  N NH2   . ARG B 2 143 ? 34.358  31.288  35.617  1.00 65.83  ? 143 ARG B NH2   1 
ATOM   5640  N N     . TYR B 2 144 ? 40.147  30.007  36.915  1.00 51.63  ? 144 TYR B N     1 
ATOM   5641  C CA    . TYR B 2 144 ? 40.854  28.974  36.194  1.00 54.33  ? 144 TYR B CA    1 
ATOM   5642  C C     . TYR B 2 144 ? 39.889  28.082  35.441  1.00 55.89  ? 144 TYR B C     1 
ATOM   5643  O O     . TYR B 2 144 ? 38.663  28.206  35.562  1.00 53.85  ? 144 TYR B O     1 
ATOM   5644  C CB    . TYR B 2 144 ? 41.592  28.069  37.158  1.00 53.92  ? 144 TYR B CB    1 
ATOM   5645  C CG    . TYR B 2 144 ? 42.723  28.683  37.923  1.00 57.38  ? 144 TYR B CG    1 
ATOM   5646  C CD1   . TYR B 2 144 ? 43.982  28.097  37.895  1.00 57.38  ? 144 TYR B CD1   1 
ATOM   5647  C CD2   . TYR B 2 144 ? 42.532  29.808  38.716  1.00 55.12  ? 144 TYR B CD2   1 
ATOM   5648  C CE1   . TYR B 2 144 ? 45.029  28.625  38.613  1.00 64.45  ? 144 TYR B CE1   1 
ATOM   5649  C CE2   . TYR B 2 144 ? 43.577  30.344  39.452  1.00 56.71  ? 144 TYR B CE2   1 
ATOM   5650  C CZ    . TYR B 2 144 ? 44.828  29.753  39.391  1.00 63.87  ? 144 TYR B CZ    1 
ATOM   5651  O OH    . TYR B 2 144 ? 45.888  30.268  40.103  1.00 60.48  ? 144 TYR B OH    1 
ATOM   5652  N N     . GLN B 2 145 ? 40.462  27.155  34.679  1.00 57.66  ? 145 GLN B N     1 
ATOM   5653  C CA    . GLN B 2 145 ? 39.704  25.998  34.209  1.00 54.96  ? 145 GLN B CA    1 
ATOM   5654  C C     . GLN B 2 145 ? 40.627  24.789  34.181  1.00 52.76  ? 145 GLN B C     1 
ATOM   5655  O O     . GLN B 2 145 ? 41.858  24.929  34.163  1.00 53.33  ? 145 GLN B O     1 
ATOM   5656  C CB    . GLN B 2 145 ? 38.997  26.258  32.864  1.00 53.93  ? 145 GLN B CB    1 
ATOM   5657  C CG    . GLN B 2 145 ? 39.889  26.319  31.632  1.00 53.44  ? 145 GLN B CG    1 
ATOM   5658  C CD    . GLN B 2 145 ? 39.142  26.675  30.343  1.00 55.81  ? 145 GLN B CD    1 
ATOM   5659  O OE1   . GLN B 2 145 ? 38.093  27.341  30.344  1.00 53.80  ? 145 GLN B OE1   1 
ATOM   5660  N NE2   . GLN B 2 145 ? 39.699  26.238  29.233  1.00 54.11  ? 145 GLN B NE2   1 
ATOM   5661  N N     . TYR B 2 146 ? 40.030  23.608  34.215  1.00 51.38  ? 146 TYR B N     1 
ATOM   5662  C CA    . TYR B 2 146 ? 40.794  22.381  34.365  1.00 54.14  ? 146 TYR B CA    1 
ATOM   5663  C C     . TYR B 2 146 ? 41.362  21.874  33.032  1.00 59.10  ? 146 TYR B C     1 
ATOM   5664  O O     . TYR B 2 146 ? 40.638  21.734  32.059  1.00 63.76  ? 146 TYR B O     1 
ATOM   5665  C CB    . TYR B 2 146 ? 39.936  21.318  35.080  1.00 52.74  ? 146 TYR B CB    1 
ATOM   5666  C CG    . TYR B 2 146 ? 40.101  21.350  36.580  1.00 53.39  ? 146 TYR B CG    1 
ATOM   5667  C CD1   . TYR B 2 146 ? 41.138  20.649  37.187  1.00 53.54  ? 146 TYR B CD1   1 
ATOM   5668  C CD2   . TYR B 2 146 ? 39.253  22.114  37.393  1.00 51.27  ? 146 TYR B CD2   1 
ATOM   5669  C CE1   . TYR B 2 146 ? 41.329  20.691  38.553  1.00 52.28  ? 146 TYR B CE1   1 
ATOM   5670  C CE2   . TYR B 2 146 ? 39.435  22.157  38.776  1.00 45.41  ? 146 TYR B CE2   1 
ATOM   5671  C CZ    . TYR B 2 146 ? 40.478  21.438  39.345  1.00 49.01  ? 146 TYR B CZ    1 
ATOM   5672  O OH    . TYR B 2 146 ? 40.705  21.446  40.703  1.00 46.79  ? 146 TYR B OH    1 
ATOM   5673  N N     . ASN B 2 147 ? 42.670  21.664  32.964  1.00 61.70  ? 147 ASN B N     1 
ATOM   5674  C CA    . ASN B 2 147 ? 43.265  20.989  31.804  1.00 64.76  ? 147 ASN B CA    1 
ATOM   5675  C C     . ASN B 2 147 ? 43.175  19.472  31.938  1.00 67.36  ? 147 ASN B C     1 
ATOM   5676  O O     . ASN B 2 147 ? 42.840  18.784  30.981  1.00 74.79  ? 147 ASN B O     1 
ATOM   5677  C CB    . ASN B 2 147 ? 44.730  21.409  31.566  1.00 63.96  ? 147 ASN B CB    1 
ATOM   5678  C CG    . ASN B 2 147 ? 44.879  22.902  31.282  1.00 61.91  ? 147 ASN B CG    1 
ATOM   5679  O OD1   . ASN B 2 147 ? 44.017  23.531  30.636  1.00 58.32  ? 147 ASN B OD1   1 
ATOM   5680  N ND2   . ASN B 2 147 ? 45.972  23.479  31.777  1.00 53.08  ? 147 ASN B ND2   1 
ATOM   5681  N N     . VAL B 2 148 ? 43.476  18.957  33.130  1.00 64.39  ? 148 VAL B N     1 
ATOM   5682  C CA    . VAL B 2 148 ? 43.367  17.526  33.406  1.00 64.76  ? 148 VAL B CA    1 
ATOM   5683  C C     . VAL B 2 148 ? 41.988  17.119  33.987  1.00 63.22  ? 148 VAL B C     1 
ATOM   5684  O O     . VAL B 2 148 ? 41.053  17.923  34.022  1.00 60.01  ? 148 VAL B O     1 
ATOM   5685  C CB    . VAL B 2 148 ? 44.531  17.045  34.296  1.00 63.01  ? 148 VAL B CB    1 
ATOM   5686  C CG1   . VAL B 2 148 ? 45.808  17.162  33.548  1.00 65.82  ? 148 VAL B CG1   1 
ATOM   5687  C CG2   . VAL B 2 148 ? 44.622  17.871  35.548  1.00 64.99  ? 148 VAL B CG2   1 
ATOM   5688  N N     . LEU B 2 149 ? 41.859  15.865  34.416  1.00 61.36  ? 149 LEU B N     1 
ATOM   5689  C CA    . LEU B 2 149 ? 40.613  15.378  34.997  1.00 61.10  ? 149 LEU B CA    1 
ATOM   5690  C C     . LEU B 2 149 ? 40.414  15.953  36.389  1.00 59.89  ? 149 LEU B C     1 
ATOM   5691  O O     . LEU B 2 149 ? 41.180  15.640  37.295  1.00 63.45  ? 149 LEU B O     1 
ATOM   5692  C CB    . LEU B 2 149 ? 40.636  13.856  35.104  1.00 62.75  ? 149 LEU B CB    1 
ATOM   5693  C CG    . LEU B 2 149 ? 40.670  12.999  33.842  1.00 61.62  ? 149 LEU B CG    1 
ATOM   5694  C CD1   . LEU B 2 149 ? 40.826  11.544  34.245  1.00 62.87  ? 149 LEU B CD1   1 
ATOM   5695  C CD2   . LEU B 2 149 ? 39.428  13.199  32.999  1.00 58.43  ? 149 LEU B CD2   1 
ATOM   5696  N N     . PRO B 2 150 ? 39.372  16.779  36.575  1.00 57.93  ? 150 PRO B N     1 
ATOM   5697  C CA    . PRO B 2 150 ? 39.177  17.472  37.851  1.00 55.75  ? 150 PRO B CA    1 
ATOM   5698  C C     . PRO B 2 150 ? 38.751  16.515  38.965  1.00 58.65  ? 150 PRO B C     1 
ATOM   5699  O O     . PRO B 2 150 ? 37.847  15.700  38.757  1.00 57.46  ? 150 PRO B O     1 
ATOM   5700  C CB    . PRO B 2 150 ? 38.030  18.442  37.548  1.00 51.94  ? 150 PRO B CB    1 
ATOM   5701  C CG    . PRO B 2 150 ? 37.784  18.356  36.084  1.00 54.06  ? 150 PRO B CG    1 
ATOM   5702  C CD    . PRO B 2 150 ? 38.234  17.000  35.678  1.00 58.24  ? 150 PRO B CD    1 
ATOM   5703  N N     . GLN B 2 151 ? 39.371  16.623  40.138  1.00 57.92  ? 151 GLN B N     1 
ATOM   5704  C CA    . GLN B 2 151 ? 38.940  15.825  41.273  1.00 54.66  ? 151 GLN B CA    1 
ATOM   5705  C C     . GLN B 2 151 ? 37.479  16.140  41.598  1.00 54.68  ? 151 GLN B C     1 
ATOM   5706  O O     . GLN B 2 151 ? 37.055  17.307  41.567  1.00 52.57  ? 151 GLN B O     1 
ATOM   5707  C CB    . GLN B 2 151 ? 39.831  16.087  42.484  1.00 54.59  ? 151 GLN B CB    1 
ATOM   5708  C CG    . GLN B 2 151 ? 41.073  15.227  42.563  1.00 58.60  ? 151 GLN B CG    1 
ATOM   5709  C CD    . GLN B 2 151 ? 41.937  15.570  43.755  1.00 59.96  ? 151 GLN B CD    1 
ATOM   5710  O OE1   . GLN B 2 151 ? 42.616  14.712  44.315  1.00 61.29  ? 151 GLN B OE1   1 
ATOM   5711  N NE2   . GLN B 2 151 ? 41.920  16.836  44.148  1.00 58.35  ? 151 GLN B NE2   1 
ATOM   5712  N N     . GLY B 2 152 ? 36.703  15.097  41.871  1.00 51.47  ? 152 GLY B N     1 
ATOM   5713  C CA    . GLY B 2 152 ? 35.334  15.271  42.311  1.00 52.32  ? 152 GLY B CA    1 
ATOM   5714  C C     . GLY B 2 152 ? 34.272  15.426  41.244  1.00 54.71  ? 152 GLY B C     1 
ATOM   5715  O O     . GLY B 2 152 ? 33.085  15.508  41.558  1.00 54.78  ? 152 GLY B O     1 
ATOM   5716  N N     . TRP B 2 153 ? 34.686  15.492  39.984  1.00 58.70  ? 153 TRP B N     1 
ATOM   5717  C CA    . TRP B 2 153 ? 33.743  15.416  38.868  1.00 61.13  ? 153 TRP B CA    1 
ATOM   5718  C C     . TRP B 2 153 ? 33.393  13.949  38.569  1.00 65.42  ? 153 TRP B C     1 
ATOM   5719  O O     . TRP B 2 153 ? 34.213  13.059  38.781  1.00 65.53  ? 153 TRP B O     1 
ATOM   5720  C CB    . TRP B 2 153 ? 34.324  16.117  37.648  1.00 57.95  ? 153 TRP B CB    1 
ATOM   5721  C CG    . TRP B 2 153 ? 33.545  15.933  36.383  1.00 63.05  ? 153 TRP B CG    1 
ATOM   5722  C CD1   . TRP B 2 153 ? 32.220  16.176  36.189  1.00 61.16  ? 153 TRP B CD1   1 
ATOM   5723  C CD2   . TRP B 2 153 ? 34.064  15.500  35.118  1.00 67.03  ? 153 TRP B CD2   1 
ATOM   5724  N NE1   . TRP B 2 153 ? 31.879  15.907  34.893  1.00 64.99  ? 153 TRP B NE1   1 
ATOM   5725  C CE2   . TRP B 2 153 ? 32.996  15.494  34.213  1.00 69.18  ? 153 TRP B CE2   1 
ATOM   5726  C CE3   . TRP B 2 153 ? 35.332  15.112  34.668  1.00 64.22  ? 153 TRP B CE3   1 
ATOM   5727  C CZ2   . TRP B 2 153 ? 33.154  15.111  32.886  1.00 70.46  ? 153 TRP B CZ2   1 
ATOM   5728  C CZ3   . TRP B 2 153 ? 35.480  14.736  33.356  1.00 63.97  ? 153 TRP B CZ3   1 
ATOM   5729  C CH2   . TRP B 2 153 ? 34.403  14.741  32.480  1.00 66.20  ? 153 TRP B CH2   1 
ATOM   5730  N N     . LYS B 2 154 ? 32.177  13.688  38.100  1.00 66.45  ? 154 LYS B N     1 
ATOM   5731  C CA    . LYS B 2 154 ? 31.736  12.303  37.967  1.00 71.85  ? 154 LYS B CA    1 
ATOM   5732  C C     . LYS B 2 154 ? 32.288  11.578  36.745  1.00 73.07  ? 154 LYS B C     1 
ATOM   5733  O O     . LYS B 2 154 ? 32.348  10.353  36.729  1.00 73.87  ? 154 LYS B O     1 
ATOM   5734  C CB    . LYS B 2 154 ? 30.215  12.168  38.097  1.00 79.42  ? 154 LYS B CB    1 
ATOM   5735  C CG    . LYS B 2 154 ? 29.804  12.031  39.570  1.00 84.82  ? 154 LYS B CG    1 
ATOM   5736  C CD    . LYS B 2 154 ? 28.340  11.738  39.799  1.00 88.13  ? 154 LYS B CD    1 
ATOM   5737  C CE    . LYS B 2 154 ? 28.039  11.611  41.278  1.00 81.48  ? 154 LYS B CE    1 
ATOM   5738  N NZ    . LYS B 2 154 ? 26.578  11.645  41.541  1.00 88.17  ? 154 LYS B NZ    1 
ATOM   5739  N N     . GLY B 2 155 ? 32.729  12.337  35.748  1.00 70.61  ? 155 GLY B N     1 
ATOM   5740  C CA    . GLY B 2 155 ? 33.388  11.762  34.588  1.00 72.09  ? 155 GLY B CA    1 
ATOM   5741  C C     . GLY B 2 155 ? 34.808  11.303  34.873  1.00 68.26  ? 155 GLY B C     1 
ATOM   5742  O O     . GLY B 2 155 ? 35.300  10.340  34.305  1.00 67.06  ? 155 GLY B O     1 
ATOM   5743  N N     . SER B 2 156 ? 35.470  11.995  35.780  1.00 67.79  ? 156 SER B N     1 
ATOM   5744  C CA    . SER B 2 156 ? 36.844  11.680  36.114  1.00 65.74  ? 156 SER B CA    1 
ATOM   5745  C C     . SER B 2 156 ? 37.081  10.254  36.594  1.00 66.98  ? 156 SER B C     1 
ATOM   5746  O O     . SER B 2 156 ? 37.999  9.600   36.141  1.00 68.63  ? 156 SER B O     1 
ATOM   5747  C CB    . SER B 2 156 ? 37.371  12.688  37.123  1.00 63.89  ? 156 SER B CB    1 
ATOM   5748  O OG    . SER B 2 156 ? 37.445  13.964  36.510  1.00 64.51  ? 156 SER B OG    1 
ATOM   5749  N N     . PRO B 2 157 ? 36.268  9.761   37.528  1.00 71.00  ? 157 PRO B N     1 
ATOM   5750  C CA    . PRO B 2 157 ? 36.532  8.378   37.928  1.00 70.66  ? 157 PRO B CA    1 
ATOM   5751  C C     . PRO B 2 157 ? 36.132  7.409   36.814  1.00 70.87  ? 157 PRO B C     1 
ATOM   5752  O O     . PRO B 2 157 ? 36.585  6.268   36.808  1.00 71.18  ? 157 PRO B O     1 
ATOM   5753  C CB    . PRO B 2 157 ? 35.628  8.208   39.140  1.00 67.67  ? 157 PRO B CB    1 
ATOM   5754  C CG    . PRO B 2 157 ? 34.444  9.080   38.806  1.00 66.93  ? 157 PRO B CG    1 
ATOM   5755  C CD    . PRO B 2 157 ? 35.015  10.275  38.110  1.00 70.11  ? 157 PRO B CD    1 
ATOM   5756  N N     . ALA B 2 158 ? 35.281  7.878   35.901  1.00 69.12  ? 158 ALA B N     1 
ATOM   5757  C CA    . ALA B 2 158 ? 34.783  7.094   34.776  1.00 70.26  ? 158 ALA B CA    1 
ATOM   5758  C C     . ALA B 2 158 ? 35.828  6.895   33.682  1.00 76.78  ? 158 ALA B C     1 
ATOM   5759  O O     . ALA B 2 158 ? 36.090  5.776   33.239  1.00 79.05  ? 158 ALA B O     1 
ATOM   5760  C CB    . ALA B 2 158 ? 33.552  7.764   34.184  1.00 74.07  ? 158 ALA B CB    1 
ATOM   5761  N N     . ILE B 2 159 ? 36.413  7.997   33.239  1.00 74.09  ? 159 ILE B N     1 
ATOM   5762  C CA    . ILE B 2 159 ? 37.362  7.968   32.148  1.00 70.76  ? 159 ILE B CA    1 
ATOM   5763  C C     . ILE B 2 159 ? 38.660  7.276   32.552  1.00 72.67  ? 159 ILE B C     1 
ATOM   5764  O O     . ILE B 2 159 ? 39.322  6.655   31.726  1.00 82.70  ? 159 ILE B O     1 
ATOM   5765  C CB    . ILE B 2 159 ? 37.602  9.385   31.609  1.00 68.79  ? 159 ILE B CB    1 
ATOM   5766  C CG1   . ILE B 2 159 ? 36.439  9.779   30.701  1.00 74.48  ? 159 ILE B CG1   1 
ATOM   5767  C CG2   . ILE B 2 159 ? 38.909  9.468   30.870  1.00 70.26  ? 159 ILE B CG2   1 
ATOM   5768  C CD1   . ILE B 2 159 ? 36.387  11.245  30.370  1.00 78.70  ? 159 ILE B CD1   1 
ATOM   5769  N N     . PHE B 2 160 ? 39.007  7.350   33.825  1.00 68.30  ? 160 PHE B N     1 
ATOM   5770  C CA    . PHE B 2 160 ? 40.234  6.735   34.326  1.00 74.04  ? 160 PHE B CA    1 
ATOM   5771  C C     . PHE B 2 160 ? 39.977  5.273   34.691  1.00 78.22  ? 160 PHE B C     1 
ATOM   5772  O O     . PHE B 2 160 ? 40.857  4.586   35.198  1.00 79.49  ? 160 PHE B O     1 
ATOM   5773  C CB    . PHE B 2 160 ? 40.752  7.542   35.523  1.00 73.77  ? 160 PHE B CB    1 
ATOM   5774  C CG    . PHE B 2 160 ? 41.979  6.976   36.185  1.00 71.68  ? 160 PHE B CG    1 
ATOM   5775  C CD1   . PHE B 2 160 ? 43.232  7.460   35.875  1.00 71.79  ? 160 PHE B CD1   1 
ATOM   5776  C CD2   . PHE B 2 160 ? 41.872  6.007   37.166  1.00 76.27  ? 160 PHE B CD2   1 
ATOM   5777  C CE1   . PHE B 2 160 ? 44.358  6.963   36.500  1.00 74.10  ? 160 PHE B CE1   1 
ATOM   5778  C CE2   . PHE B 2 160 ? 42.996  5.505   37.794  1.00 77.61  ? 160 PHE B CE2   1 
ATOM   5779  C CZ    . PHE B 2 160 ? 44.242  5.983   37.460  1.00 75.20  ? 160 PHE B CZ    1 
ATOM   5780  N N     . GLN B 2 161 ? 38.756  4.811   34.424  1.00 81.72  ? 161 GLN B N     1 
ATOM   5781  C CA    . GLN B 2 161 ? 38.295  3.463   34.789  1.00 84.49  ? 161 GLN B CA    1 
ATOM   5782  C C     . GLN B 2 161 ? 39.194  2.344   34.274  1.00 88.55  ? 161 GLN B C     1 
ATOM   5783  O O     . GLN B 2 161 ? 39.649  1.495   35.045  1.00 90.91  ? 161 GLN B O     1 
ATOM   5784  C CB    . GLN B 2 161 ? 36.860  3.253   34.286  1.00 83.73  ? 161 GLN B CB    1 
ATOM   5785  C CG    . GLN B 2 161 ? 36.326  1.832   34.394  1.00 92.59  ? 161 GLN B CG    1 
ATOM   5786  C CD    . GLN B 2 161 ? 35.998  1.420   35.823  1.00 102.97 ? 161 GLN B CD    1 
ATOM   5787  O OE1   . GLN B 2 161 ? 36.835  1.535   36.727  1.00 103.68 ? 161 GLN B OE1   1 
ATOM   5788  N NE2   . GLN B 2 161 ? 34.776  0.928   36.034  1.00 105.96 ? 161 GLN B NE2   1 
ATOM   5789  N N     . SER B 2 162 ? 39.428  2.348   32.964  1.00 88.76  ? 162 SER B N     1 
ATOM   5790  C CA    . SER B 2 162 ? 40.329  1.402   32.314  1.00 87.89  ? 162 SER B CA    1 
ATOM   5791  C C     . SER B 2 162 ? 41.688  1.340   33.008  1.00 89.56  ? 162 SER B C     1 
ATOM   5792  O O     . SER B 2 162 ? 42.178  0.270   33.356  1.00 92.77  ? 162 SER B O     1 
ATOM   5793  C CB    . SER B 2 162 ? 40.517  1.805   30.855  1.00 81.71  ? 162 SER B CB    1 
ATOM   5794  O OG    . SER B 2 162 ? 40.736  3.200   30.755  1.00 79.47  ? 162 SER B OG    1 
ATOM   5795  N N     . SER B 2 163 ? 42.283  2.507   33.212  1.00 89.92  ? 163 SER B N     1 
ATOM   5796  C CA    . SER B 2 163 ? 43.600  2.613   33.820  1.00 87.26  ? 163 SER B CA    1 
ATOM   5797  C C     . SER B 2 163 ? 43.602  2.084   35.246  1.00 91.30  ? 163 SER B C     1 
ATOM   5798  O O     . SER B 2 163 ? 44.584  1.500   35.695  1.00 96.93  ? 163 SER B O     1 
ATOM   5799  C CB    . SER B 2 163 ? 44.062  4.071   33.804  1.00 79.42  ? 163 SER B CB    1 
ATOM   5800  O OG    . SER B 2 163 ? 43.524  4.761   32.691  1.00 74.57  ? 163 SER B OG    1 
ATOM   5801  N N     . MET B 2 164 ? 42.503  2.299   35.961  1.00 88.65  ? 164 MET B N     1 
ATOM   5802  C CA    . MET B 2 164 ? 42.413  1.864   37.348  1.00 92.50  ? 164 MET B CA    1 
ATOM   5803  C C     . MET B 2 164 ? 42.302  0.359   37.409  1.00 101.59 ? 164 MET B C     1 
ATOM   5804  O O     . MET B 2 164 ? 42.985  -0.296  38.195  1.00 105.69 ? 164 MET B O     1 
ATOM   5805  C CB    . MET B 2 164 ? 41.201  2.475   38.053  1.00 88.53  ? 164 MET B CB    1 
ATOM   5806  C CG    . MET B 2 164 ? 41.189  2.183   39.539  1.00 84.68  ? 164 MET B CG    1 
ATOM   5807  S SD    . MET B 2 164 ? 42.501  3.120   40.320  1.00 77.50  ? 164 MET B SD    1 
ATOM   5808  C CE    . MET B 2 164 ? 42.932  2.093   41.715  1.00 91.28  ? 164 MET B CE    1 
ATOM   5809  N N     . THR B 2 165 ? 41.421  -0.182  36.573  1.00 102.54 ? 165 THR B N     1 
ATOM   5810  C CA    . THR B 2 165 ? 41.163  -1.610  36.563  1.00 107.06 ? 165 THR B CA    1 
ATOM   5811  C C     . THR B 2 165 ? 42.455  -2.356  36.228  1.00 110.90 ? 165 THR B C     1 
ATOM   5812  O O     . THR B 2 165 ? 42.720  -3.439  36.756  1.00 116.81 ? 165 THR B O     1 
ATOM   5813  C CB    . THR B 2 165 ? 39.999  -1.965  35.598  1.00 103.41 ? 165 THR B CB    1 
ATOM   5814  O OG1   . THR B 2 165 ? 39.722  -3.369  35.664  1.00 110.66 ? 165 THR B OG1   1 
ATOM   5815  C CG2   . THR B 2 165 ? 40.326  -1.577  34.175  1.00 96.15  ? 165 THR B CG2   1 
ATOM   5816  N N     . LYS B 2 166 ? 43.260  -1.753  35.359  1.00 107.25 ? 166 LYS B N     1 
ATOM   5817  C CA    . LYS B 2 166 ? 44.566  -2.286  34.997  1.00 111.84 ? 166 LYS B CA    1 
ATOM   5818  C C     . LYS B 2 166 ? 45.491  -2.413  36.200  1.00 117.84 ? 166 LYS B C     1 
ATOM   5819  O O     . LYS B 2 166 ? 45.782  -3.512  36.658  1.00 124.89 ? 166 LYS B O     1 
ATOM   5820  C CB    . LYS B 2 166 ? 45.214  -1.391  33.939  1.00 110.55 ? 166 LYS B CB    1 
ATOM   5821  C CG    . LYS B 2 166 ? 46.228  -2.095  33.045  1.00 114.35 ? 166 LYS B CG    1 
ATOM   5822  C CD    . LYS B 2 166 ? 46.009  -1.731  31.581  1.00 113.38 ? 166 LYS B CD    1 
ATOM   5823  C CE    . LYS B 2 166 ? 44.618  -2.160  31.112  1.00 110.45 ? 166 LYS B CE    1 
ATOM   5824  N NZ    . LYS B 2 166 ? 44.281  -1.638  29.760  1.00 108.61 ? 166 LYS B NZ    1 
ATOM   5825  N N     . ILE B 2 167 ? 45.925  -1.271  36.718  1.00 117.77 ? 167 ILE B N     1 
ATOM   5826  C CA    . ILE B 2 167 ? 46.924  -1.213  37.780  1.00 125.01 ? 167 ILE B CA    1 
ATOM   5827  C C     . ILE B 2 167 ? 46.582  -2.092  38.983  1.00 128.65 ? 167 ILE B C     1 
ATOM   5828  O O     . ILE B 2 167 ? 47.471  -2.544  39.714  1.00 133.09 ? 167 ILE B O     1 
ATOM   5829  C CB    . ILE B 2 167 ? 47.107  0.237   38.254  1.00 126.40 ? 167 ILE B CB    1 
ATOM   5830  C CG1   . ILE B 2 167 ? 47.540  1.117   37.081  1.00 128.63 ? 167 ILE B CG1   1 
ATOM   5831  C CG2   . ILE B 2 167 ? 48.104  0.309   39.398  1.00 135.14 ? 167 ILE B CG2   1 
ATOM   5832  C CD1   . ILE B 2 167 ? 47.666  2.575   37.425  1.00 129.36 ? 167 ILE B CD1   1 
ATOM   5833  N N     . LEU B 2 168 ? 45.287  -2.310  39.191  1.00 127.07 ? 168 LEU B N     1 
ATOM   5834  C CA    . LEU B 2 168 ? 44.793  -3.124  40.303  1.00 130.61 ? 168 LEU B CA    1 
ATOM   5835  C C     . LEU B 2 168 ? 44.811  -4.637  40.044  1.00 135.37 ? 168 LEU B C     1 
ATOM   5836  O O     . LEU B 2 168 ? 44.903  -5.431  40.985  1.00 137.07 ? 168 LEU B O     1 
ATOM   5837  C CB    . LEU B 2 168 ? 43.384  -2.675  40.699  1.00 125.69 ? 168 LEU B CB    1 
ATOM   5838  C CG    . LEU B 2 168 ? 43.232  -1.237  41.200  1.00 118.43 ? 168 LEU B CG    1 
ATOM   5839  C CD1   . LEU B 2 168 ? 41.764  -0.837  41.201  1.00 108.66 ? 168 LEU B CD1   1 
ATOM   5840  C CD2   . LEU B 2 168 ? 43.867  -1.056  42.581  1.00 114.96 ? 168 LEU B CD2   1 
ATOM   5841  N N     . GLU B 2 169 ? 44.714  -5.023  38.771  1.00 136.35 ? 169 GLU B N     1 
ATOM   5842  C CA    . GLU B 2 169 ? 44.647  -6.437  38.371  1.00 141.23 ? 169 GLU B CA    1 
ATOM   5843  C C     . GLU B 2 169 ? 45.772  -7.326  38.919  1.00 142.94 ? 169 GLU B C     1 
ATOM   5844  O O     . GLU B 2 169 ? 45.542  -8.505  39.213  1.00 141.88 ? 169 GLU B O     1 
ATOM   5845  C CB    . GLU B 2 169 ? 44.569  -6.569  36.847  1.00 142.21 ? 169 GLU B CB    1 
ATOM   5846  C CG    . GLU B 2 169 ? 44.442  -8.006  36.360  1.00 148.36 ? 169 GLU B CG    1 
ATOM   5847  C CD    . GLU B 2 169 ? 44.217  -8.096  34.861  1.00 157.02 ? 169 GLU B CD    1 
ATOM   5848  O OE1   . GLU B 2 169 ? 43.964  -7.047  34.229  1.00 152.33 ? 169 GLU B OE1   1 
ATOM   5849  O OE2   . GLU B 2 169 ? 44.295  -9.218  34.313  1.00 162.46 ? 169 GLU B OE2   1 
ATOM   5850  N N     . PRO B 2 170 ? 46.998  -6.780  39.028  1.00 141.49 ? 170 PRO B N     1 
ATOM   5851  C CA    . PRO B 2 170 ? 48.048  -7.545  39.702  1.00 141.59 ? 170 PRO B CA    1 
ATOM   5852  C C     . PRO B 2 170 ? 47.619  -7.924  41.111  1.00 141.38 ? 170 PRO B C     1 
ATOM   5853  O O     . PRO B 2 170 ? 47.724  -9.087  41.501  1.00 141.03 ? 170 PRO B O     1 
ATOM   5854  C CB    . PRO B 2 170 ? 49.203  -6.543  39.783  1.00 140.72 ? 170 PRO B CB    1 
ATOM   5855  C CG    . PRO B 2 170 ? 49.007  -5.654  38.620  1.00 139.97 ? 170 PRO B CG    1 
ATOM   5856  C CD    . PRO B 2 170 ? 47.520  -5.540  38.425  1.00 139.79 ? 170 PRO B CD    1 
ATOM   5857  N N     . PHE B 2 171 ? 47.105  -6.947  41.852  1.00 140.97 ? 171 PHE B N     1 
ATOM   5858  C CA    . PHE B 2 171 ? 46.780  -7.143  43.257  1.00 140.71 ? 171 PHE B CA    1 
ATOM   5859  C C     . PHE B 2 171 ? 45.600  -8.087  43.441  1.00 140.01 ? 171 PHE B C     1 
ATOM   5860  O O     . PHE B 2 171 ? 45.646  -8.998  44.269  1.00 140.03 ? 171 PHE B O     1 
ATOM   5861  C CB    . PHE B 2 171 ? 46.486  -5.804  43.929  1.00 140.21 ? 171 PHE B CB    1 
ATOM   5862  C CG    . PHE B 2 171 ? 46.502  -5.866  45.426  1.00 140.98 ? 171 PHE B CG    1 
ATOM   5863  C CD1   . PHE B 2 171 ? 46.803  -7.052  46.079  1.00 140.63 ? 171 PHE B CD1   1 
ATOM   5864  C CD2   . PHE B 2 171 ? 46.211  -4.744  46.183  1.00 137.59 ? 171 PHE B CD2   1 
ATOM   5865  C CE1   . PHE B 2 171 ? 46.817  -7.114  47.457  1.00 140.47 ? 171 PHE B CE1   1 
ATOM   5866  C CE2   . PHE B 2 171 ? 46.223  -4.800  47.563  1.00 138.35 ? 171 PHE B CE2   1 
ATOM   5867  C CZ    . PHE B 2 171 ? 46.526  -5.985  48.202  1.00 138.85 ? 171 PHE B CZ    1 
ATOM   5868  N N     . LYS B 2 172 ? 44.544  -7.862  42.667  1.00 139.49 ? 172 LYS B N     1 
ATOM   5869  C CA    . LYS B 2 172 ? 43.343  -8.686  42.750  1.00 140.99 ? 172 LYS B CA    1 
ATOM   5870  C C     . LYS B 2 172 ? 43.642  -10.169 42.529  1.00 140.13 ? 172 LYS B C     1 
ATOM   5871  O O     . LYS B 2 172 ? 43.025  -11.033 43.155  1.00 136.05 ? 172 LYS B O     1 
ATOM   5872  C CB    . LYS B 2 172 ? 42.305  -8.210  41.733  1.00 141.61 ? 172 LYS B CB    1 
ATOM   5873  C CG    . LYS B 2 172 ? 41.744  -6.825  42.018  1.00 141.79 ? 172 LYS B CG    1 
ATOM   5874  C CD    . LYS B 2 172 ? 40.740  -6.406  40.959  1.00 142.56 ? 172 LYS B CD    1 
ATOM   5875  C CE    . LYS B 2 172 ? 40.162  -5.032  41.256  1.00 143.23 ? 172 LYS B CE    1 
ATOM   5876  N NZ    . LYS B 2 172 ? 39.194  -4.598  40.212  1.00 143.67 ? 172 LYS B NZ    1 
ATOM   5877  N N     . LYS B 2 173 ? 44.591  -10.454 41.641  1.00 141.72 ? 173 LYS B N     1 
ATOM   5878  C CA    . LYS B 2 173 ? 44.948  -11.833 41.321  1.00 141.73 ? 173 LYS B CA    1 
ATOM   5879  C C     . LYS B 2 173 ? 45.660  -12.516 42.483  1.00 141.66 ? 173 LYS B C     1 
ATOM   5880  O O     . LYS B 2 173 ? 45.351  -13.662 42.817  1.00 139.98 ? 173 LYS B O     1 
ATOM   5881  C CB    . LYS B 2 173 ? 45.811  -11.904 40.056  1.00 141.79 ? 173 LYS B CB    1 
ATOM   5882  C CG    . LYS B 2 173 ? 46.123  -13.333 39.615  1.00 142.57 ? 173 LYS B CG    1 
ATOM   5883  C CD    . LYS B 2 173 ? 46.958  -13.373 38.344  1.00 139.86 ? 173 LYS B CD    1 
ATOM   5884  C CE    . LYS B 2 173 ? 47.213  -14.805 37.906  1.00 134.75 ? 173 LYS B CE    1 
ATOM   5885  N NZ    . LYS B 2 173 ? 45.943  -15.538 37.670  1.00 129.75 ? 173 LYS B NZ    1 
ATOM   5886  N N     . GLN B 2 174 ? 46.615  -11.815 43.092  1.00 141.15 ? 174 GLN B N     1 
ATOM   5887  C CA    . GLN B 2 174 ? 47.344  -12.357 44.235  1.00 141.26 ? 174 GLN B CA    1 
ATOM   5888  C C     . GLN B 2 174 ? 46.433  -12.400 45.456  1.00 141.48 ? 174 GLN B C     1 
ATOM   5889  O O     . GLN B 2 174 ? 46.551  -13.290 46.298  1.00 140.67 ? 174 GLN B O     1 
ATOM   5890  C CB    . GLN B 2 174 ? 48.603  -11.538 44.539  1.00 144.09 ? 174 GLN B CB    1 
ATOM   5891  C CG    . GLN B 2 174 ? 49.601  -12.261 45.452  1.00 147.91 ? 174 GLN B CG    1 
ATOM   5892  C CD    . GLN B 2 174 ? 50.673  -11.342 46.027  1.00 149.29 ? 174 GLN B CD    1 
ATOM   5893  O OE1   . GLN B 2 174 ? 50.523  -10.119 46.038  1.00 150.79 ? 174 GLN B OE1   1 
ATOM   5894  N NE2   . GLN B 2 174 ? 51.759  -11.934 46.514  1.00 145.14 ? 174 GLN B NE2   1 
ATOM   5895  N N     . ASN B 2 175 ? 45.527  -11.430 45.543  1.00 141.39 ? 175 ASN B N     1 
ATOM   5896  C CA    . ASN B 2 175 ? 44.513  -11.408 46.592  1.00 137.58 ? 175 ASN B CA    1 
ATOM   5897  C C     . ASN B 2 175 ? 43.110  -11.416 45.992  1.00 134.58 ? 175 ASN B C     1 
ATOM   5898  O O     . ASN B 2 175 ? 42.497  -10.366 45.814  1.00 130.70 ? 175 ASN B O     1 
ATOM   5899  C CB    . ASN B 2 175 ? 44.702  -10.196 47.507  1.00 134.38 ? 175 ASN B CB    1 
ATOM   5900  C CG    . ASN B 2 175 ? 45.944  -10.306 48.377  1.00 136.86 ? 175 ASN B CG    1 
ATOM   5901  O OD1   . ASN B 2 175 ? 47.027  -9.861  47.996  1.00 139.33 ? 175 ASN B OD1   1 
ATOM   5902  N ND2   . ASN B 2 175 ? 45.788  -10.897 49.557  1.00 133.10 ? 175 ASN B ND2   1 
ATOM   5903  N N     . PRO B 2 176 ? 42.606  -12.610 45.656  1.00 135.40 ? 176 PRO B N     1 
ATOM   5904  C CA    . PRO B 2 176 ? 41.283  -12.777 45.052  1.00 133.32 ? 176 PRO B CA    1 
ATOM   5905  C C     . PRO B 2 176 ? 40.159  -12.505 46.045  1.00 128.57 ? 176 PRO B C     1 
ATOM   5906  O O     . PRO B 2 176 ? 39.059  -12.148 45.626  1.00 126.18 ? 176 PRO B O     1 
ATOM   5907  C CB    . PRO B 2 176 ? 41.275  -14.252 44.654  1.00 136.07 ? 176 PRO B CB    1 
ATOM   5908  C CG    . PRO B 2 176 ? 42.150  -14.900 45.666  1.00 135.50 ? 176 PRO B CG    1 
ATOM   5909  C CD    . PRO B 2 176 ? 43.247  -13.906 45.939  1.00 136.97 ? 176 PRO B CD    1 
ATOM   5910  N N     . ASP B 2 177 ? 40.437  -12.674 47.337  1.00 128.30 ? 177 ASP B N     1 
ATOM   5911  C CA    . ASP B 2 177 ? 39.413  -12.554 48.381  1.00 126.87 ? 177 ASP B CA    1 
ATOM   5912  C C     . ASP B 2 177 ? 39.198  -11.115 48.881  1.00 117.80 ? 177 ASP B C     1 
ATOM   5913  O O     . ASP B 2 177 ? 38.274  -10.848 49.653  1.00 113.08 ? 177 ASP B O     1 
ATOM   5914  C CB    . ASP B 2 177 ? 39.719  -13.492 49.562  1.00 128.27 ? 177 ASP B CB    1 
ATOM   5915  C CG    . ASP B 2 177 ? 39.239  -14.927 49.324  1.00 130.51 ? 177 ASP B CG    1 
ATOM   5916  O OD1   . ASP B 2 177 ? 38.206  -15.120 48.643  1.00 126.01 ? 177 ASP B OD1   1 
ATOM   5917  O OD2   . ASP B 2 177 ? 39.894  -15.867 49.832  1.00 131.95 ? 177 ASP B OD2   1 
ATOM   5918  N N     . ILE B 2 178 ? 40.043  -10.193 48.433  1.00 110.76 ? 178 ILE B N     1 
ATOM   5919  C CA    . ILE B 2 178 ? 39.915  -8.795  48.822  1.00 98.71  ? 178 ILE B CA    1 
ATOM   5920  C C     . ILE B 2 178 ? 38.989  -8.025  47.879  1.00 93.02  ? 178 ILE B C     1 
ATOM   5921  O O     . ILE B 2 178 ? 39.110  -8.136  46.660  1.00 92.02  ? 178 ILE B O     1 
ATOM   5922  C CB    . ILE B 2 178 ? 41.288  -8.118  48.907  1.00 98.75  ? 178 ILE B CB    1 
ATOM   5923  C CG1   . ILE B 2 178 ? 41.966  -8.499  50.220  1.00 101.03 ? 178 ILE B CG1   1 
ATOM   5924  C CG2   . ILE B 2 178 ? 41.154  -6.615  48.810  1.00 88.77  ? 178 ILE B CG2   1 
ATOM   5925  C CD1   . ILE B 2 178 ? 43.208  -7.708  50.511  1.00 109.08 ? 178 ILE B CD1   1 
ATOM   5926  N N     . VAL B 2 179 ? 38.058  -7.259  48.455  1.00 87.29  ? 179 VAL B N     1 
ATOM   5927  C CA    . VAL B 2 179 ? 37.042  -6.542  47.678  1.00 81.40  ? 179 VAL B CA    1 
ATOM   5928  C C     . VAL B 2 179 ? 37.400  -5.084  47.468  1.00 75.70  ? 179 VAL B C     1 
ATOM   5929  O O     . VAL B 2 179 ? 37.760  -4.380  48.412  1.00 72.49  ? 179 VAL B O     1 
ATOM   5930  C CB    . VAL B 2 179 ? 35.638  -6.592  48.322  1.00 76.89  ? 179 VAL B CB    1 
ATOM   5931  C CG1   . VAL B 2 179 ? 34.626  -5.943  47.385  1.00 70.61  ? 179 VAL B CG1   1 
ATOM   5932  C CG2   . VAL B 2 179 ? 35.222  -8.026  48.646  1.00 76.91  ? 179 VAL B CG2   1 
ATOM   5933  N N     . ILE B 2 180 ? 37.279  -4.631  46.226  1.00 70.14  ? 180 ILE B N     1 
ATOM   5934  C CA    . ILE B 2 180 ? 37.688  -3.285  45.890  1.00 68.57  ? 180 ILE B CA    1 
ATOM   5935  C C     . ILE B 2 180 ? 36.622  -2.528  45.105  1.00 70.02  ? 180 ILE B C     1 
ATOM   5936  O O     . ILE B 2 180 ? 36.250  -2.930  44.008  1.00 72.18  ? 180 ILE B O     1 
ATOM   5937  C CB    . ILE B 2 180 ? 39.020  -3.287  45.138  1.00 73.72  ? 180 ILE B CB    1 
ATOM   5938  C CG1   . ILE B 2 180 ? 40.152  -3.635  46.106  1.00 73.79  ? 180 ILE B CG1   1 
ATOM   5939  C CG2   . ILE B 2 180 ? 39.268  -1.939  44.491  1.00 77.03  ? 180 ILE B CG2   1 
ATOM   5940  C CD1   . ILE B 2 180 ? 41.527  -3.405  45.554  1.00 80.36  ? 180 ILE B CD1   1 
ATOM   5941  N N     . TYR B 2 181 ? 36.137  -1.435  45.696  1.00 66.48  ? 181 TYR B N     1 
ATOM   5942  C CA    . TYR B 2 181 ? 35.134  -0.560  45.093  1.00 65.28  ? 181 TYR B CA    1 
ATOM   5943  C C     . TYR B 2 181 ? 35.678  0.850   44.875  1.00 62.83  ? 181 TYR B C     1 
ATOM   5944  O O     . TYR B 2 181 ? 36.554  1.295   45.581  1.00 62.24  ? 181 TYR B O     1 
ATOM   5945  C CB    . TYR B 2 181 ? 33.892  -0.488  45.983  1.00 65.17  ? 181 TYR B CB    1 
ATOM   5946  C CG    . TYR B 2 181 ? 32.785  0.373   45.418  1.00 60.27  ? 181 TYR B CG    1 
ATOM   5947  C CD1   . TYR B 2 181 ? 32.076  -0.036  44.311  1.00 60.86  ? 181 TYR B CD1   1 
ATOM   5948  C CD2   . TYR B 2 181 ? 32.452  1.587   45.996  1.00 60.68  ? 181 TYR B CD2   1 
ATOM   5949  C CE1   . TYR B 2 181 ? 31.062  0.726   43.787  1.00 67.51  ? 181 TYR B CE1   1 
ATOM   5950  C CE2   . TYR B 2 181 ? 31.438  2.371   45.475  1.00 61.05  ? 181 TYR B CE2   1 
ATOM   5951  C CZ    . TYR B 2 181 ? 30.739  1.933   44.365  1.00 63.61  ? 181 TYR B CZ    1 
ATOM   5952  O OH    . TYR B 2 181 ? 29.717  2.686   43.812  1.00 56.88  ? 181 TYR B OH    1 
ATOM   5953  N N     . GLN B 2 182 ? 35.149  1.565   43.900  1.00 63.52  ? 182 GLN B N     1 
ATOM   5954  C CA    . GLN B 2 182 ? 35.630  2.912   43.655  1.00 62.90  ? 182 GLN B CA    1 
ATOM   5955  C C     . GLN B 2 182 ? 34.459  3.873   43.482  1.00 64.83  ? 182 GLN B C     1 
ATOM   5956  O O     . GLN B 2 182 ? 33.599  3.678   42.609  1.00 64.90  ? 182 GLN B O     1 
ATOM   5957  C CB    . GLN B 2 182 ? 36.524  2.934   42.421  1.00 63.41  ? 182 GLN B CB    1 
ATOM   5958  C CG    . GLN B 2 182 ? 37.298  4.212   42.265  1.00 67.98  ? 182 GLN B CG    1 
ATOM   5959  C CD    . GLN B 2 182 ? 37.767  4.427   40.849  1.00 71.68  ? 182 GLN B CD    1 
ATOM   5960  O OE1   . GLN B 2 182 ? 37.479  3.621   39.963  1.00 76.53  ? 182 GLN B OE1   1 
ATOM   5961  N NE2   . GLN B 2 182 ? 38.485  5.522   40.620  1.00 71.70  ? 182 GLN B NE2   1 
ATOM   5962  N N     . TYR B 2 183 ? 34.416  4.896   44.333  1.00 61.59  ? 183 TYR B N     1 
ATOM   5963  C CA    . TYR B 2 183 ? 33.381  5.924   44.236  1.00 58.92  ? 183 TYR B CA    1 
ATOM   5964  C C     . TYR B 2 183 ? 34.086  7.280   44.188  1.00 57.64  ? 183 TYR B C     1 
ATOM   5965  O O     . TYR B 2 183 ? 34.741  7.690   45.146  1.00 58.75  ? 183 TYR B O     1 
ATOM   5966  C CB    . TYR B 2 183 ? 32.350  5.831   45.401  1.00 54.25  ? 183 TYR B CB    1 
ATOM   5967  C CG    . TYR B 2 183 ? 31.213  6.833   45.279  1.00 50.27  ? 183 TYR B CG    1 
ATOM   5968  C CD1   . TYR B 2 183 ? 30.014  6.490   44.680  1.00 46.21  ? 183 TYR B CD1   1 
ATOM   5969  C CD2   . TYR B 2 183 ? 31.366  8.148   45.731  1.00 50.38  ? 183 TYR B CD2   1 
ATOM   5970  C CE1   . TYR B 2 183 ? 28.996  7.426   44.537  1.00 44.55  ? 183 TYR B CE1   1 
ATOM   5971  C CE2   . TYR B 2 183 ? 30.357  9.088   45.595  1.00 44.67  ? 183 TYR B CE2   1 
ATOM   5972  C CZ    . TYR B 2 183 ? 29.179  8.725   44.996  1.00 45.77  ? 183 TYR B CZ    1 
ATOM   5973  O OH    . TYR B 2 183 ? 28.187  9.671   44.861  1.00 46.16  ? 183 TYR B OH    1 
ATOM   5974  N N     . MET B 2 184 ? 33.988  7.951   43.050  1.00 55.11  ? 184 MET B N     1 
ATOM   5975  C CA    . MET B 2 184 ? 34.672  9.221   42.847  1.00 56.13  ? 184 MET B CA    1 
ATOM   5976  C C     . MET B 2 184 ? 36.128  9.161   43.315  1.00 57.41  ? 184 MET B C     1 
ATOM   5977  O O     . MET B 2 184 ? 36.794  8.164   43.149  1.00 63.63  ? 184 MET B O     1 
ATOM   5978  C CB    . MET B 2 184 ? 33.918  10.345  43.555  1.00 60.34  ? 184 MET B CB    1 
ATOM   5979  C CG    . MET B 2 184 ? 32.413  10.337  43.304  1.00 64.41  ? 184 MET B CG    1 
ATOM   5980  S SD    . MET B 2 184 ? 31.893  10.799  41.622  1.00 80.04  ? 184 MET B SD    1 
ATOM   5981  C CE    . MET B 2 184 ? 32.355  12.533  41.582  1.00 68.30  ? 184 MET B CE    1 
ATOM   5982  N N     . ASP B 2 185 ? 36.596  10.206  43.977  1.00 60.68  ? 185 ASP B N     1 
ATOM   5983  C CA    . ASP B 2 185 ? 37.997  10.320  44.382  1.00 57.20  ? 185 ASP B CA    1 
ATOM   5984  C C     . ASP B 2 185 ? 38.411  9.257   45.371  1.00 57.71  ? 185 ASP B C     1 
ATOM   5985  O O     . ASP B 2 185 ? 39.546  9.241   45.829  1.00 60.88  ? 185 ASP B O     1 
ATOM   5986  C CB    . ASP B 2 185 ? 38.298  11.699  44.972  1.00 50.03  ? 185 ASP B CB    1 
ATOM   5987  C CG    . ASP B 2 185 ? 37.968  12.827  44.015  1.00 56.74  ? 185 ASP B CG    1 
ATOM   5988  O OD1   . ASP B 2 185 ? 37.316  12.577  42.966  1.00 55.66  ? 185 ASP B OD1   1 
ATOM   5989  O OD2   . ASP B 2 185 ? 38.345  13.979  44.325  1.00 59.70  ? 185 ASP B OD2   1 
ATOM   5990  N N     . ASP B 2 186 ? 37.477  8.415   45.775  1.00 57.01  ? 186 ASP B N     1 
ATOM   5991  C CA    . ASP B 2 186 ? 37.801  7.450   46.817  1.00 63.49  ? 186 ASP B CA    1 
ATOM   5992  C C     . ASP B 2 186 ? 37.867  6.010   46.324  1.00 63.96  ? 186 ASP B C     1 
ATOM   5993  O O     . ASP B 2 186 ? 37.108  5.595   45.420  1.00 65.50  ? 186 ASP B O     1 
ATOM   5994  C CB    . ASP B 2 186 ? 36.802  7.547   47.976  1.00 68.55  ? 186 ASP B CB    1 
ATOM   5995  C CG    . ASP B 2 186 ? 36.978  8.807   48.809  1.00 61.61  ? 186 ASP B CG    1 
ATOM   5996  O OD1   . ASP B 2 186 ? 38.100  9.372   48.847  1.00 57.18  ? 186 ASP B OD1   1 
ATOM   5997  O OD2   . ASP B 2 186 ? 35.975  9.216   49.437  1.00 60.15  ? 186 ASP B OD2   1 
ATOM   5998  N N     . LEU B 2 187 ? 38.771  5.252   46.939  1.00 61.60  ? 187 LEU B N     1 
ATOM   5999  C CA    . LEU B 2 187 ? 38.871  3.822   46.695  1.00 62.94  ? 187 LEU B CA    1 
ATOM   6000  C C     . LEU B 2 187 ? 38.608  3.090   48.003  1.00 63.17  ? 187 LEU B C     1 
ATOM   6001  O O     . LEU B 2 187 ? 39.271  3.324   49.010  1.00 65.83  ? 187 LEU B O     1 
ATOM   6002  C CB    . LEU B 2 187 ? 40.246  3.455   46.127  1.00 68.75  ? 187 LEU B CB    1 
ATOM   6003  C CG    . LEU B 2 187 ? 40.364  2.312   45.113  1.00 68.24  ? 187 LEU B CG    1 
ATOM   6004  C CD1   . LEU B 2 187 ? 39.958  2.757   43.721  1.00 64.32  ? 187 LEU B CD1   1 
ATOM   6005  C CD2   . LEU B 2 187 ? 41.784  1.809   45.111  1.00 75.15  ? 187 LEU B CD2   1 
ATOM   6006  N N     . TYR B 2 188 ? 37.609  2.222   47.978  1.00 63.17  ? 188 TYR B N     1 
ATOM   6007  C CA    . TYR B 2 188 ? 37.208  1.434   49.128  1.00 65.87  ? 188 TYR B CA    1 
ATOM   6008  C C     . TYR B 2 188 ? 37.797  0.042   49.014  1.00 64.76  ? 188 TYR B C     1 
ATOM   6009  O O     . TYR B 2 188 ? 37.597  -0.647  48.029  1.00 64.72  ? 188 TYR B O     1 
ATOM   6010  C CB    . TYR B 2 188 ? 35.672  1.409   49.244  1.00 65.38  ? 188 TYR B CB    1 
ATOM   6011  C CG    . TYR B 2 188 ? 35.123  2.780   49.569  1.00 62.30  ? 188 TYR B CG    1 
ATOM   6012  C CD1   . TYR B 2 188 ? 34.922  3.182   50.887  1.00 59.97  ? 188 TYR B CD1   1 
ATOM   6013  C CD2   . TYR B 2 188 ? 34.861  3.693   48.561  1.00 65.42  ? 188 TYR B CD2   1 
ATOM   6014  C CE1   . TYR B 2 188 ? 34.450  4.437   51.186  1.00 57.87  ? 188 TYR B CE1   1 
ATOM   6015  C CE2   . TYR B 2 188 ? 34.394  4.965   48.852  1.00 65.70  ? 188 TYR B CE2   1 
ATOM   6016  C CZ    . TYR B 2 188 ? 34.190  5.327   50.163  1.00 62.33  ? 188 TYR B CZ    1 
ATOM   6017  O OH    . TYR B 2 188 ? 33.727  6.589   50.435  1.00 60.31  ? 188 TYR B OH    1 
ATOM   6018  N N     . VAL B 2 189 ? 38.549  -0.354  50.029  1.00 66.42  ? 189 VAL B N     1 
ATOM   6019  C CA    . VAL B 2 189 ? 39.280  -1.608  49.997  1.00 71.06  ? 189 VAL B CA    1 
ATOM   6020  C C     . VAL B 2 189 ? 38.939  -2.417  51.237  1.00 68.73  ? 189 VAL B C     1 
ATOM   6021  O O     . VAL B 2 189 ? 39.206  -1.977  52.338  1.00 65.72  ? 189 VAL B O     1 
ATOM   6022  C CB    . VAL B 2 189 ? 40.808  -1.337  50.011  1.00 75.34  ? 189 VAL B CB    1 
ATOM   6023  C CG1   . VAL B 2 189 ? 41.598  -2.615  49.756  1.00 76.53  ? 189 VAL B CG1   1 
ATOM   6024  C CG2   . VAL B 2 189 ? 41.174  -0.268  48.996  1.00 76.36  ? 189 VAL B CG2   1 
ATOM   6025  N N     . GLY B 2 190 ? 38.404  -3.620  51.091  1.00 69.56  ? 190 GLY B N     1 
ATOM   6026  C CA    . GLY B 2 190 ? 38.104  -4.352  52.300  1.00 71.58  ? 190 GLY B CA    1 
ATOM   6027  C C     . GLY B 2 190 ? 38.241  -5.850  52.276  1.00 77.86  ? 190 GLY B C     1 
ATOM   6028  O O     . GLY B 2 190 ? 38.094  -6.501  51.249  1.00 79.04  ? 190 GLY B O     1 
ATOM   6029  N N     . SER B 2 191 ? 38.460  -6.383  53.472  1.00 83.15  ? 191 SER B N     1 
ATOM   6030  C CA    . SER B 2 191 ? 38.918  -7.743  53.681  1.00 85.46  ? 191 SER B CA    1 
ATOM   6031  C C     . SER B 2 191 ? 38.505  -8.223  55.062  1.00 85.93  ? 191 SER B C     1 
ATOM   6032  O O     . SER B 2 191 ? 38.246  -7.417  55.969  1.00 85.82  ? 191 SER B O     1 
ATOM   6033  C CB    . SER B 2 191 ? 40.434  -7.748  53.645  1.00 94.20  ? 191 SER B CB    1 
ATOM   6034  O OG    . SER B 2 191 ? 40.935  -6.931  54.693  1.00 94.26  ? 191 SER B OG    1 
ATOM   6035  N N     . ASP B 2 192 ? 38.469  -9.541  55.219  1.00 90.33  ? 192 ASP B N     1 
ATOM   6036  C CA    . ASP B 2 192 ? 38.178  -10.161 56.504  1.00 95.02  ? 192 ASP B CA    1 
ATOM   6037  C C     . ASP B 2 192 ? 39.465  -10.461 57.274  1.00 98.61  ? 192 ASP B C     1 
ATOM   6038  O O     . ASP B 2 192 ? 39.430  -11.090 58.329  1.00 97.13  ? 192 ASP B O     1 
ATOM   6039  C CB    . ASP B 2 192 ? 37.348  -11.438 56.326  1.00 96.24  ? 192 ASP B CB    1 
ATOM   6040  C CG    . ASP B 2 192 ? 36.001  -11.180 55.641  1.00 97.47  ? 192 ASP B CG    1 
ATOM   6041  O OD1   . ASP B 2 192 ? 35.053  -10.705 56.313  1.00 92.44  ? 192 ASP B OD1   1 
ATOM   6042  O OD2   . ASP B 2 192 ? 35.884  -11.471 54.428  1.00 100.21 ? 192 ASP B OD2   1 
ATOM   6043  N N     . LEU B 2 193 ? 40.596  -10.018 56.729  1.00 101.37 ? 193 LEU B N     1 
ATOM   6044  C CA    . LEU B 2 193 ? 41.900  -10.228 57.356  1.00 105.71 ? 193 LEU B CA    1 
ATOM   6045  C C     . LEU B 2 193 ? 41.978  -9.547  58.716  1.00 109.84 ? 193 LEU B C     1 
ATOM   6046  O O     . LEU B 2 193 ? 41.330  -8.533  58.937  1.00 110.21 ? 193 LEU B O     1 
ATOM   6047  C CB    . LEU B 2 193 ? 43.023  -9.694  56.457  1.00 108.82 ? 193 LEU B CB    1 
ATOM   6048  C CG    . LEU B 2 193 ? 43.228  -10.333 55.079  1.00 110.16 ? 193 LEU B CG    1 
ATOM   6049  C CD1   . LEU B 2 193 ? 44.371  -9.650  54.327  1.00 115.29 ? 193 LEU B CD1   1 
ATOM   6050  C CD2   . LEU B 2 193 ? 43.479  -11.835 55.201  1.00 107.24 ? 193 LEU B CD2   1 
ATOM   6051  N N     . GLU B 2 194 ? 42.767  -10.106 59.627  1.00 115.39 ? 194 GLU B N     1 
ATOM   6052  C CA    . GLU B 2 194 ? 43.047  -9.444  60.896  1.00 121.13 ? 194 GLU B CA    1 
ATOM   6053  C C     . GLU B 2 194 ? 43.689  -8.088  60.591  1.00 123.50 ? 194 GLU B C     1 
ATOM   6054  O O     . GLU B 2 194 ? 44.445  -7.959  59.626  1.00 122.77 ? 194 GLU B O     1 
ATOM   6055  C CB    . GLU B 2 194 ? 43.957  -10.314 61.770  1.00 122.37 ? 194 GLU B CB    1 
ATOM   6056  C CG    . GLU B 2 194 ? 44.272  -9.726  63.137  1.00 125.85 ? 194 GLU B CG    1 
ATOM   6057  C CD    . GLU B 2 194 ? 45.701  -9.213  63.241  1.00 129.29 ? 194 GLU B CD    1 
ATOM   6058  O OE1   . GLU B 2 194 ? 46.539  -9.615  62.404  1.00 130.65 ? 194 GLU B OE1   1 
ATOM   6059  O OE2   . GLU B 2 194 ? 45.984  -8.407  64.157  1.00 124.01 ? 194 GLU B OE2   1 
ATOM   6060  N N     . ILE B 2 195 ? 43.382  -7.080  61.405  1.00 124.06 ? 195 ILE B N     1 
ATOM   6061  C CA    . ILE B 2 195 ? 43.746  -5.694  61.089  1.00 125.77 ? 195 ILE B CA    1 
ATOM   6062  C C     . ILE B 2 195 ? 45.231  -5.483  60.793  1.00 127.47 ? 195 ILE B C     1 
ATOM   6063  O O     . ILE B 2 195 ? 45.589  -4.666  59.939  1.00 125.05 ? 195 ILE B O     1 
ATOM   6064  C CB    . ILE B 2 195 ? 43.270  -4.693  62.183  1.00 128.94 ? 195 ILE B CB    1 
ATOM   6065  C CG1   . ILE B 2 195 ? 43.609  -3.249  61.777  1.00 124.81 ? 195 ILE B CG1   1 
ATOM   6066  C CG2   . ILE B 2 195 ? 43.859  -5.054  63.544  1.00 127.46 ? 195 ILE B CG2   1 
ATOM   6067  C CD1   . ILE B 2 195 ? 42.942  -2.186  62.627  1.00 119.53 ? 195 ILE B CD1   1 
ATOM   6068  N N     . GLY B 2 196 ? 46.088  -6.222  61.495  1.00 129.57 ? 196 GLY B N     1 
ATOM   6069  C CA    . GLY B 2 196 ? 47.522  -6.107  61.306  1.00 129.14 ? 196 GLY B CA    1 
ATOM   6070  C C     . GLY B 2 196 ? 47.912  -6.331  59.859  1.00 130.06 ? 196 GLY B C     1 
ATOM   6071  O O     . GLY B 2 196 ? 48.554  -5.482  59.238  1.00 129.64 ? 196 GLY B O     1 
ATOM   6072  N N     . GLN B 2 197 ? 47.510  -7.475  59.314  1.00 130.72 ? 197 GLN B N     1 
ATOM   6073  C CA    . GLN B 2 197 ? 47.808  -7.801  57.925  1.00 131.69 ? 197 GLN B CA    1 
ATOM   6074  C C     . GLN B 2 197 ? 46.939  -7.003  56.967  1.00 127.95 ? 197 GLN B C     1 
ATOM   6075  O O     . GLN B 2 197 ? 47.301  -6.829  55.803  1.00 129.05 ? 197 GLN B O     1 
ATOM   6076  C CB    . GLN B 2 197 ? 47.654  -9.302  57.671  1.00 136.02 ? 197 GLN B CB    1 
ATOM   6077  C CG    . GLN B 2 197 ? 48.780  -10.136 58.260  1.00 138.96 ? 197 GLN B CG    1 
ATOM   6078  C CD    . GLN B 2 197 ? 48.286  -11.428 58.875  1.00 143.63 ? 197 GLN B CD    1 
ATOM   6079  O OE1   . GLN B 2 197 ? 48.168  -11.540 60.096  1.00 143.71 ? 197 GLN B OE1   1 
ATOM   6080  N NE2   . GLN B 2 197 ? 47.990  -12.413 58.031  1.00 142.62 ? 197 GLN B NE2   1 
ATOM   6081  N N     . HIS B 2 198 ? 45.789  -6.533  57.450  1.00 125.43 ? 198 HIS B N     1 
ATOM   6082  C CA    . HIS B 2 198 ? 44.975  -5.625  56.654  1.00 118.88 ? 198 HIS B CA    1 
ATOM   6083  C C     . HIS B 2 198 ? 45.782  -4.363  56.424  1.00 120.21 ? 198 HIS B C     1 
ATOM   6084  O O     . HIS B 2 198 ? 46.081  -4.010  55.285  1.00 121.28 ? 198 HIS B O     1 
ATOM   6085  C CB    . HIS B 2 198 ? 43.641  -5.284  57.337  1.00 115.25 ? 198 HIS B CB    1 
ATOM   6086  C CG    . HIS B 2 198 ? 42.735  -4.418  56.505  1.00 108.34 ? 198 HIS B CG    1 
ATOM   6087  N ND1   . HIS B 2 198 ? 41.825  -4.935  55.604  1.00 96.96  ? 198 HIS B ND1   1 
ATOM   6088  C CD2   . HIS B 2 198 ? 42.606  -3.070  56.433  1.00 103.33 ? 198 HIS B CD2   1 
ATOM   6089  C CE1   . HIS B 2 198 ? 41.182  -3.945  55.012  1.00 87.27  ? 198 HIS B CE1   1 
ATOM   6090  N NE2   . HIS B 2 198 ? 41.636  -2.802  55.496  1.00 88.87  ? 198 HIS B NE2   1 
ATOM   6091  N N     . ARG B 2 199 ? 46.172  -3.703  57.510  1.00 122.73 ? 199 ARG B N     1 
ATOM   6092  C CA    . ARG B 2 199 ? 46.927  -2.465  57.386  1.00 125.14 ? 199 ARG B CA    1 
ATOM   6093  C C     . ARG B 2 199 ? 48.157  -2.701  56.507  1.00 126.85 ? 199 ARG B C     1 
ATOM   6094  O O     . ARG B 2 199 ? 48.590  -1.814  55.773  1.00 125.33 ? 199 ARG B O     1 
ATOM   6095  C CB    . ARG B 2 199 ? 47.302  -1.895  58.763  1.00 126.78 ? 199 ARG B CB    1 
ATOM   6096  C CG    . ARG B 2 199 ? 46.105  -1.665  59.692  1.00 124.59 ? 199 ARG B CG    1 
ATOM   6097  C CD    . ARG B 2 199 ? 46.319  -0.501  60.663  1.00 121.93 ? 199 ARG B CD    1 
ATOM   6098  N NE    . ARG B 2 199 ? 45.546  -0.674  61.895  1.00 122.31 ? 199 ARG B NE    1 
ATOM   6099  C CZ    . ARG B 2 199 ? 45.403  0.253   62.840  1.00 123.59 ? 199 ARG B CZ    1 
ATOM   6100  N NH1   . ARG B 2 199 ? 45.967  1.448   62.703  1.00 122.08 ? 199 ARG B NH1   1 
ATOM   6101  N NH2   . ARG B 2 199 ? 44.683  -0.012  63.924  1.00 122.17 ? 199 ARG B NH2   1 
ATOM   6102  N N     . THR B 2 200 ? 48.692  -3.917  56.562  1.00 129.18 ? 200 THR B N     1 
ATOM   6103  C CA    . THR B 2 200 ? 49.829  -4.292  55.730  1.00 129.71 ? 200 THR B CA    1 
ATOM   6104  C C     . THR B 2 200 ? 49.430  -4.450  54.266  1.00 130.25 ? 200 THR B C     1 
ATOM   6105  O O     . THR B 2 200 ? 50.133  -3.979  53.377  1.00 132.45 ? 200 THR B O     1 
ATOM   6106  C CB    . THR B 2 200 ? 50.488  -5.596  56.222  1.00 130.55 ? 200 THR B CB    1 
ATOM   6107  O OG1   . THR B 2 200 ? 51.216  -5.337  57.428  1.00 126.97 ? 200 THR B OG1   1 
ATOM   6108  C CG2   . THR B 2 200 ? 51.443  -6.141  55.170  1.00 132.04 ? 200 THR B CG2   1 
ATOM   6109  N N     . LYS B 2 201 ? 48.302  -5.113  54.023  1.00 128.40 ? 201 LYS B N     1 
ATOM   6110  C CA    . LYS B 2 201 ? 47.810  -5.331  52.667  1.00 127.20 ? 201 LYS B CA    1 
ATOM   6111  C C     . LYS B 2 201 ? 47.393  -4.024  51.994  1.00 127.43 ? 201 LYS B C     1 
ATOM   6112  O O     . LYS B 2 201 ? 47.343  -3.937  50.767  1.00 127.41 ? 201 LYS B O     1 
ATOM   6113  C CB    . LYS B 2 201 ? 46.631  -6.302  52.681  1.00 126.68 ? 201 LYS B CB    1 
ATOM   6114  C CG    . LYS B 2 201 ? 46.839  -7.581  51.880  1.00 134.61 ? 201 LYS B CG    1 
ATOM   6115  C CD    . LYS B 2 201 ? 47.563  -8.652  52.690  1.00 139.53 ? 201 LYS B CD    1 
ATOM   6116  C CE    . LYS B 2 201 ? 47.528  -10.010 51.986  1.00 139.48 ? 201 LYS B CE    1 
ATOM   6117  N NZ    . LYS B 2 201 ? 48.192  -9.991  50.648  1.00 137.40 ? 201 LYS B NZ    1 
ATOM   6118  N N     . ILE B 2 202 ? 47.087  -3.011  52.799  1.00 126.49 ? 202 ILE B N     1 
ATOM   6119  C CA    . ILE B 2 202 ? 46.716  -1.700  52.272  1.00 127.04 ? 202 ILE B CA    1 
ATOM   6120  C C     . ILE B 2 202 ? 47.958  -0.947  51.814  1.00 132.40 ? 202 ILE B C     1 
ATOM   6121  O O     . ILE B 2 202 ? 47.949  -0.283  50.777  1.00 133.28 ? 202 ILE B O     1 
ATOM   6122  C CB    . ILE B 2 202 ? 45.964  -0.846  53.318  1.00 120.71 ? 202 ILE B CB    1 
ATOM   6123  C CG1   . ILE B 2 202 ? 44.599  -1.462  53.648  1.00 111.49 ? 202 ILE B CG1   1 
ATOM   6124  C CG2   . ILE B 2 202 ? 45.809  0.592   52.829  1.00 115.54 ? 202 ILE B CG2   1 
ATOM   6125  C CD1   . ILE B 2 202 ? 43.591  -1.420  52.519  1.00 100.18 ? 202 ILE B CD1   1 
ATOM   6126  N N     . GLU B 2 203 ? 49.021  -1.052  52.607  1.00 135.25 ? 203 GLU B N     1 
ATOM   6127  C CA    . GLU B 2 203 ? 50.319  -0.488  52.254  1.00 136.89 ? 203 GLU B CA    1 
ATOM   6128  C C     . GLU B 2 203 ? 50.794  -1.147  50.966  1.00 139.58 ? 203 GLU B C     1 
ATOM   6129  O O     . GLU B 2 203 ? 51.297  -0.484  50.058  1.00 140.68 ? 203 GLU B O     1 
ATOM   6130  C CB    . GLU B 2 203 ? 51.329  -0.757  53.370  1.00 137.31 ? 203 GLU B CB    1 
ATOM   6131  C CG    . GLU B 2 203 ? 52.468  0.242   53.441  1.00 139.07 ? 203 GLU B CG    1 
ATOM   6132  C CD    . GLU B 2 203 ? 52.045  1.555   54.068  1.00 139.53 ? 203 GLU B CD    1 
ATOM   6133  O OE1   . GLU B 2 203 ? 52.101  1.665   55.312  1.00 137.02 ? 203 GLU B OE1   1 
ATOM   6134  O OE2   . GLU B 2 203 ? 51.651  2.475   53.318  1.00 139.06 ? 203 GLU B OE2   1 
ATOM   6135  N N     . GLU B 2 204 ? 50.626  -2.466  50.910  1.00 139.40 ? 204 GLU B N     1 
ATOM   6136  C CA    . GLU B 2 204 ? 50.899  -3.258  49.717  1.00 139.16 ? 204 GLU B CA    1 
ATOM   6137  C C     . GLU B 2 204 ? 50.154  -2.655  48.526  1.00 140.89 ? 204 GLU B C     1 
ATOM   6138  O O     . GLU B 2 204 ? 50.714  -2.508  47.439  1.00 143.07 ? 204 GLU B O     1 
ATOM   6139  C CB    . GLU B 2 204 ? 50.468  -4.713  49.958  1.00 139.08 ? 204 GLU B CB    1 
ATOM   6140  C CG    . GLU B 2 204 ? 50.989  -5.742  48.957  1.00 140.90 ? 204 GLU B CG    1 
ATOM   6141  C CD    . GLU B 2 204 ? 50.597  -7.172  49.327  1.00 141.24 ? 204 GLU B CD    1 
ATOM   6142  O OE1   . GLU B 2 204 ? 50.205  -7.937  48.417  1.00 142.86 ? 204 GLU B OE1   1 
ATOM   6143  O OE2   . GLU B 2 204 ? 50.684  -7.531  50.524  1.00 136.29 ? 204 GLU B OE2   1 
ATOM   6144  N N     . LEU B 2 205 ? 48.891  -2.295  48.744  1.00 139.20 ? 205 LEU B N     1 
ATOM   6145  C CA    . LEU B 2 205 ? 48.088  -1.635  47.719  1.00 138.82 ? 205 LEU B CA    1 
ATOM   6146  C C     . LEU B 2 205 ? 48.582  -0.216  47.467  1.00 139.31 ? 205 LEU B C     1 
ATOM   6147  O O     . LEU B 2 205 ? 48.475  0.299   46.358  1.00 138.84 ? 205 LEU B O     1 
ATOM   6148  C CB    . LEU B 2 205 ? 46.616  -1.607  48.128  1.00 136.67 ? 205 LEU B CB    1 
ATOM   6149  C CG    . LEU B 2 205 ? 45.642  -0.906  47.178  1.00 131.69 ? 205 LEU B CG    1 
ATOM   6150  C CD1   . LEU B 2 205 ? 45.813  -1.389  45.744  1.00 134.20 ? 205 LEU B CD1   1 
ATOM   6151  C CD2   . LEU B 2 205 ? 44.218  -1.127  47.647  1.00 118.53 ? 205 LEU B CD2   1 
ATOM   6152  N N     . ARG B 2 206 ? 49.122  0.410   48.505  1.00 140.35 ? 206 ARG B N     1 
ATOM   6153  C CA    . ARG B 2 206 ? 49.646  1.763   48.395  1.00 140.80 ? 206 ARG B CA    1 
ATOM   6154  C C     . ARG B 2 206 ? 50.856  1.793   47.461  1.00 145.22 ? 206 ARG B C     1 
ATOM   6155  O O     . ARG B 2 206 ? 50.992  2.701   46.642  1.00 146.85 ? 206 ARG B O     1 
ATOM   6156  C CB    . ARG B 2 206 ? 50.017  2.299   49.781  1.00 139.92 ? 206 ARG B CB    1 
ATOM   6157  C CG    . ARG B 2 206 ? 49.550  3.720   50.065  1.00 138.74 ? 206 ARG B CG    1 
ATOM   6158  C CD    . ARG B 2 206 ? 48.771  3.789   51.373  1.00 137.14 ? 206 ARG B CD    1 
ATOM   6159  N NE    . ARG B 2 206 ? 48.693  5.149   51.903  1.00 139.32 ? 206 ARG B NE    1 
ATOM   6160  C CZ    . ARG B 2 206 ? 47.931  5.509   52.932  1.00 139.24 ? 206 ARG B CZ    1 
ATOM   6161  N NH1   . ARG B 2 206 ? 47.168  4.609   53.541  1.00 133.56 ? 206 ARG B NH1   1 
ATOM   6162  N NH2   . ARG B 2 206 ? 47.926  6.772   53.348  1.00 140.53 ? 206 ARG B NH2   1 
ATOM   6163  N N     . GLN B 2 207 ? 51.722  0.788   47.576  1.00 146.96 ? 207 GLN B N     1 
ATOM   6164  C CA    . GLN B 2 207 ? 52.935  0.713   46.758  1.00 148.44 ? 207 GLN B CA    1 
ATOM   6165  C C     . GLN B 2 207 ? 52.623  0.585   45.269  1.00 149.69 ? 207 GLN B C     1 
ATOM   6166  O O     . GLN B 2 207 ? 53.220  1.277   44.449  1.00 151.75 ? 207 GLN B O     1 
ATOM   6167  C CB    . GLN B 2 207 ? 53.833  -0.448  47.201  1.00 147.71 ? 207 GLN B CB    1 
ATOM   6168  C CG    . GLN B 2 207 ? 54.132  -0.491  48.696  1.00 148.23 ? 207 GLN B CG    1 
ATOM   6169  C CD    . GLN B 2 207 ? 54.899  0.722   49.197  1.00 147.80 ? 207 GLN B CD    1 
ATOM   6170  O OE1   . GLN B 2 207 ? 55.406  1.527   48.411  1.00 148.45 ? 207 GLN B OE1   1 
ATOM   6171  N NE2   . GLN B 2 207 ? 54.988  0.856   50.516  1.00 141.87 ? 207 GLN B NE2   1 
ATOM   6172  N N     . HIS B 2 208 ? 51.695  -0.305  44.923  1.00 148.90 ? 208 HIS B N     1 
ATOM   6173  C CA    . HIS B 2 208 ? 51.282  -0.494  43.530  1.00 149.08 ? 208 HIS B CA    1 
ATOM   6174  C C     . HIS B 2 208 ? 50.992  0.834   42.843  1.00 150.34 ? 208 HIS B C     1 
ATOM   6175  O O     . HIS B 2 208 ? 51.626  1.179   41.848  1.00 152.41 ? 208 HIS B O     1 
ATOM   6176  C CB    . HIS B 2 208 ? 50.059  -1.405  43.431  1.00 146.61 ? 208 HIS B CB    1 
ATOM   6177  C CG    . HIS B 2 208 ? 50.390  -2.839  43.172  1.00 145.66 ? 208 HIS B CG    1 
ATOM   6178  N ND1   . HIS B 2 208 ? 51.168  -3.589  44.028  1.00 145.86 ? 208 HIS B ND1   1 
ATOM   6179  C CD2   . HIS B 2 208 ? 50.046  -3.665  42.156  1.00 143.79 ? 208 HIS B CD2   1 
ATOM   6180  C CE1   . HIS B 2 208 ? 51.291  -4.813  43.550  1.00 145.81 ? 208 HIS B CE1   1 
ATOM   6181  N NE2   . HIS B 2 208 ? 50.619  -4.886  42.414  1.00 145.41 ? 208 HIS B NE2   1 
ATOM   6182  N N     . LEU B 2 209 ? 50.005  1.559   43.359  1.00 149.50 ? 209 LEU B N     1 
ATOM   6183  C CA    . LEU B 2 209 ? 49.666  2.871   42.824  1.00 148.80 ? 209 LEU B CA    1 
ATOM   6184  C C     . LEU B 2 209 ? 50.822  3.850   43.003  1.00 150.80 ? 209 LEU B C     1 
ATOM   6185  O O     . LEU B 2 209 ? 50.906  4.853   42.299  1.00 150.94 ? 209 LEU B O     1 
ATOM   6186  C CB    . LEU B 2 209 ? 48.394  3.419   43.478  1.00 144.36 ? 209 LEU B CB    1 
ATOM   6187  C CG    . LEU B 2 209 ? 47.108  2.622   43.237  1.00 139.95 ? 209 LEU B CG    1 
ATOM   6188  C CD1   . LEU B 2 209 ? 47.022  1.435   44.177  1.00 139.58 ? 209 LEU B CD1   1 
ATOM   6189  C CD2   . LEU B 2 209 ? 45.878  3.503   43.390  1.00 126.96 ? 209 LEU B CD2   1 
ATOM   6190  N N     . LEU B 2 210 ? 51.708  3.553   43.949  1.00 152.48 ? 210 LEU B N     1 
ATOM   6191  C CA    . LEU B 2 210 ? 52.910  4.359   44.163  1.00 154.85 ? 210 LEU B CA    1 
ATOM   6192  C C     . LEU B 2 210 ? 53.892  4.207   42.993  1.00 157.85 ? 210 LEU B C     1 
ATOM   6193  O O     . LEU B 2 210 ? 54.496  5.187   42.544  1.00 156.62 ? 210 LEU B O     1 
ATOM   6194  C CB    . LEU B 2 210 ? 53.567  3.989   45.502  1.00 152.99 ? 210 LEU B CB    1 
ATOM   6195  C CG    . LEU B 2 210 ? 55.031  4.336   45.790  1.00 154.82 ? 210 LEU B CG    1 
ATOM   6196  C CD1   . LEU B 2 210 ? 55.263  4.468   47.288  1.00 152.13 ? 210 LEU B CD1   1 
ATOM   6197  C CD2   . LEU B 2 210 ? 55.971  3.295   45.195  1.00 154.72 ? 210 LEU B CD2   1 
ATOM   6198  N N     . ARG B 2 211 ? 54.034  2.977   42.501  1.00 157.99 ? 211 ARG B N     1 
ATOM   6199  C CA    . ARG B 2 211 ? 54.924  2.671   41.377  1.00 156.75 ? 211 ARG B CA    1 
ATOM   6200  C C     . ARG B 2 211 ? 54.278  2.883   39.996  1.00 157.53 ? 211 ARG B C     1 
ATOM   6201  O O     . ARG B 2 211 ? 54.975  2.912   38.982  1.00 159.07 ? 211 ARG B O     1 
ATOM   6202  C CB    . ARG B 2 211 ? 55.468  1.240   41.499  1.00 155.38 ? 211 ARG B CB    1 
ATOM   6203  C CG    . ARG B 2 211 ? 56.549  1.060   42.563  1.00 155.54 ? 211 ARG B CG    1 
ATOM   6204  C CD    . ARG B 2 211 ? 56.202  -0.050  43.557  1.00 155.92 ? 211 ARG B CD    1 
ATOM   6205  N NE    . ARG B 2 211 ? 55.978  -1.343  42.911  1.00 152.73 ? 211 ARG B NE    1 
ATOM   6206  C CZ    . ARG B 2 211 ? 55.626  -2.450  43.558  1.00 149.64 ? 211 ARG B CZ    1 
ATOM   6207  N NH1   . ARG B 2 211 ? 55.457  -2.427  44.874  1.00 148.71 ? 211 ARG B NH1   1 
ATOM   6208  N NH2   . ARG B 2 211 ? 55.442  -3.580  42.889  1.00 146.45 ? 211 ARG B NH2   1 
ATOM   6209  N N     . TRP B 2 212 ? 52.954  3.015   39.958  1.00 156.42 ? 212 TRP B N     1 
ATOM   6210  C CA    . TRP B 2 212 ? 52.226  3.324   38.719  1.00 154.27 ? 212 TRP B CA    1 
ATOM   6211  C C     . TRP B 2 212 ? 51.981  4.830   38.534  1.00 152.93 ? 212 TRP B C     1 
ATOM   6212  O O     . TRP B 2 212 ? 51.219  5.243   37.657  1.00 147.46 ? 212 TRP B O     1 
ATOM   6213  C CB    . TRP B 2 212 ? 50.939  2.496   38.562  1.00 152.17 ? 212 TRP B CB    1 
ATOM   6214  C CG    . TRP B 2 212 ? 51.156  1.119   37.924  1.00 153.61 ? 212 TRP B CG    1 
ATOM   6215  C CD1   . TRP B 2 212 ? 51.086  -0.100  38.549  1.00 150.23 ? 212 TRP B CD1   1 
ATOM   6216  C CD2   . TRP B 2 212 ? 51.478  0.840   36.545  1.00 156.19 ? 212 TRP B CD2   1 
ATOM   6217  N NE1   . TRP B 2 212 ? 51.338  -1.111  37.649  1.00 150.76 ? 212 TRP B NE1   1 
ATOM   6218  C CE2   . TRP B 2 212 ? 51.584  -0.564  36.416  1.00 153.96 ? 212 TRP B CE2   1 
ATOM   6219  C CE3   . TRP B 2 212 ? 51.686  1.639   35.413  1.00 155.33 ? 212 TRP B CE3   1 
ATOM   6220  C CZ2   . TRP B 2 212 ? 51.890  -1.183  35.201  1.00 151.69 ? 212 TRP B CZ2   1 
ATOM   6221  C CZ3   . TRP B 2 212 ? 51.991  1.020   34.207  1.00 153.94 ? 212 TRP B CZ3   1 
ATOM   6222  C CH2   . TRP B 2 212 ? 52.089  -0.377  34.113  1.00 152.40 ? 212 TRP B CH2   1 
ATOM   6223  N N     . GLY B 2 213 ? 52.636  5.633   39.376  1.00 154.50 ? 213 GLY B N     1 
ATOM   6224  C CA    . GLY B 2 213 ? 52.505  7.085   39.367  1.00 153.51 ? 213 GLY B CA    1 
ATOM   6225  C C     . GLY B 2 213 ? 51.325  7.734   40.080  1.00 153.10 ? 213 GLY B C     1 
ATOM   6226  O O     . GLY B 2 213 ? 50.630  8.574   39.502  1.00 146.99 ? 213 GLY B O     1 
ATOM   6227  N N     . LEU B 2 214 ? 51.101  7.343   41.338  1.00 152.28 ? 214 LEU B N     1 
ATOM   6228  C CA    . LEU B 2 214 ? 50.081  7.972   42.193  1.00 147.03 ? 214 LEU B CA    1 
ATOM   6229  C C     . LEU B 2 214 ? 50.562  8.251   43.638  1.00 145.77 ? 214 LEU B C     1 
ATOM   6230  O O     . LEU B 2 214 ? 51.436  7.548   44.157  1.00 145.84 ? 214 LEU B O     1 
ATOM   6231  C CB    . LEU B 2 214 ? 48.805  7.119   42.214  1.00 137.85 ? 214 LEU B CB    1 
ATOM   6232  C CG    . LEU B 2 214 ? 47.662  7.608   43.107  1.00 126.23 ? 214 LEU B CG    1 
ATOM   6233  C CD1   . LEU B 2 214 ? 47.346  9.060   42.810  1.00 114.24 ? 214 LEU B CD1   1 
ATOM   6234  C CD2   . LEU B 2 214 ? 46.428  6.741   42.940  1.00 114.81 ? 214 LEU B CD2   1 
ATOM   6235  N N     . THR B 2 215 ? 49.990  9.280   44.271  1.00 143.10 ? 215 THR B N     1 
ATOM   6236  C CA    . THR B 2 215 ? 50.264  9.602   45.682  1.00 144.52 ? 215 THR B CA    1 
ATOM   6237  C C     . THR B 2 215 ? 49.008  9.486   46.577  1.00 144.34 ? 215 THR B C     1 
ATOM   6238  O O     . THR B 2 215 ? 47.882  9.731   46.123  1.00 139.25 ? 215 THR B O     1 
ATOM   6239  C CB    . THR B 2 215 ? 50.920  11.006  45.856  1.00 143.01 ? 215 THR B CB    1 
ATOM   6240  O OG1   . THR B 2 215 ? 49.976  12.039  45.540  1.00 138.18 ? 215 THR B OG1   1 
ATOM   6241  C CG2   . THR B 2 215 ? 52.149  11.143  44.964  1.00 144.03 ? 215 THR B CG2   1 
ATOM   6242  N N     . THR B 2 216 ? 49.215  9.122   47.846  1.00 147.97 ? 216 THR B N     1 
ATOM   6243  C CA    . THR B 2 216 ? 48.111  8.778   48.753  1.00 147.55 ? 216 THR B CA    1 
ATOM   6244  C C     . THR B 2 216 ? 48.193  9.395   50.160  1.00 149.03 ? 216 THR B C     1 
ATOM   6245  O O     . THR B 2 216 ? 48.718  8.769   51.087  1.00 147.59 ? 216 THR B O     1 
ATOM   6246  C CB    . THR B 2 216 ? 47.994  7.243   48.929  1.00 142.56 ? 216 THR B CB    1 
ATOM   6247  O OG1   . THR B 2 216 ? 47.991  6.602   47.646  1.00 134.92 ? 216 THR B OG1   1 
ATOM   6248  C CG2   . THR B 2 216 ? 46.722  6.884   49.696  1.00 131.08 ? 216 THR B CG2   1 
ATOM   6249  N N     . PRO B 2 217 ? 47.673  10.624  50.326  1.00 152.05 ? 217 PRO B N     1 
ATOM   6250  C CA    . PRO B 2 217 ? 47.521  11.158  51.685  1.00 154.76 ? 217 PRO B CA    1 
ATOM   6251  C C     . PRO B 2 217 ? 46.220  10.679  52.344  1.00 148.86 ? 217 PRO B C     1 
ATOM   6252  O O     . PRO B 2 217 ? 45.882  9.491   52.271  1.00 140.55 ? 217 PRO B O     1 
ATOM   6253  C CB    . PRO B 2 217 ? 47.487  12.673  51.462  1.00 153.10 ? 217 PRO B CB    1 
ATOM   6254  C CG    . PRO B 2 217 ? 46.928  12.833  50.090  1.00 149.46 ? 217 PRO B CG    1 
ATOM   6255  C CD    . PRO B 2 217 ? 47.416  11.647  49.294  1.00 149.37 ? 217 PRO B CD    1 
ATOM   6256  N N     . GLY B 2 231 ? 41.528  4.121   62.322  1.00 106.66 ? 231 GLY B N     1 
ATOM   6257  C CA    . GLY B 2 231 ? 42.045  4.663   61.076  1.00 111.88 ? 231 GLY B CA    1 
ATOM   6258  C C     . GLY B 2 231 ? 41.003  4.759   59.967  1.00 111.16 ? 231 GLY B C     1 
ATOM   6259  O O     . GLY B 2 231 ? 39.793  4.634   60.231  1.00 103.68 ? 231 GLY B O     1 
ATOM   6260  N N     . TYR B 2 232 ? 41.474  4.908   58.720  1.00 110.07 ? 232 TYR B N     1 
ATOM   6261  C CA    . TYR B 2 232 ? 40.607  5.185   57.566  1.00 101.36 ? 232 TYR B CA    1 
ATOM   6262  C C     . TYR B 2 232 ? 39.512  4.143   57.565  1.00 91.77  ? 232 TYR B C     1 
ATOM   6263  O O     . TYR B 2 232 ? 38.542  4.247   56.830  1.00 85.00  ? 232 TYR B O     1 
ATOM   6264  C CB    . TYR B 2 232 ? 41.346  5.054   56.227  1.00 101.30 ? 232 TYR B CB    1 
ATOM   6265  C CG    . TYR B 2 232 ? 42.725  5.684   56.096  1.00 113.43 ? 232 TYR B CG    1 
ATOM   6266  C CD1   . TYR B 2 232 ? 42.967  6.674   55.142  1.00 116.47 ? 232 TYR B CD1   1 
ATOM   6267  C CD2   . TYR B 2 232 ? 43.797  5.250   56.875  1.00 119.75 ? 232 TYR B CD2   1 
ATOM   6268  C CE1   . TYR B 2 232 ? 44.228  7.239   54.991  1.00 125.78 ? 232 TYR B CE1   1 
ATOM   6269  C CE2   . TYR B 2 232 ? 45.063  5.811   56.733  1.00 128.32 ? 232 TYR B CE2   1 
ATOM   6270  C CZ    . TYR B 2 232 ? 45.272  6.806   55.789  1.00 132.46 ? 232 TYR B CZ    1 
ATOM   6271  O OH    . TYR B 2 232 ? 46.523  7.372   55.639  1.00 138.23 ? 232 TYR B OH    1 
ATOM   6272  N N     . GLU B 2 233 ? 39.731  3.105   58.363  1.00 92.83  ? 233 GLU B N     1 
ATOM   6273  C CA    . GLU B 2 233 ? 38.900  1.916   58.405  1.00 87.89  ? 233 GLU B CA    1 
ATOM   6274  C C     . GLU B 2 233 ? 37.456  2.158   58.804  1.00 81.16  ? 233 GLU B C     1 
ATOM   6275  O O     . GLU B 2 233 ? 37.170  2.990   59.660  1.00 82.53  ? 233 GLU B O     1 
ATOM   6276  C CB    . GLU B 2 233 ? 39.523  0.902   59.367  1.00 92.32  ? 233 GLU B CB    1 
ATOM   6277  C CG    . GLU B 2 233 ? 40.975  0.573   59.053  1.00 96.85  ? 233 GLU B CG    1 
ATOM   6278  C CD    . GLU B 2 233 ? 41.912  0.943   60.178  1.00 106.17 ? 233 GLU B CD    1 
ATOM   6279  O OE1   . GLU B 2 233 ? 42.816  1.775   59.948  1.00 108.22 ? 233 GLU B OE1   1 
ATOM   6280  O OE2   . GLU B 2 233 ? 41.748  0.395   61.290  1.00 110.85 ? 233 GLU B OE2   1 
ATOM   6281  N N     . LEU B 2 234 ? 36.561  1.406   58.168  1.00 72.74  ? 234 LEU B N     1 
ATOM   6282  C CA    . LEU B 2 234 ? 35.165  1.314   58.555  1.00 71.41  ? 234 LEU B CA    1 
ATOM   6283  C C     . LEU B 2 234 ? 34.995  -0.151  58.878  1.00 70.72  ? 234 LEU B C     1 
ATOM   6284  O O     . LEU B 2 234 ? 35.819  -0.951  58.484  1.00 73.80  ? 234 LEU B O     1 
ATOM   6285  C CB    . LEU B 2 234 ? 34.233  1.677   57.399  1.00 64.39  ? 234 LEU B CB    1 
ATOM   6286  C CG    . LEU B 2 234 ? 34.559  2.780   56.395  1.00 58.34  ? 234 LEU B CG    1 
ATOM   6287  C CD1   . LEU B 2 234 ? 33.628  2.637   55.209  1.00 58.43  ? 234 LEU B CD1   1 
ATOM   6288  C CD2   . LEU B 2 234 ? 34.464  4.164   56.990  1.00 54.42  ? 234 LEU B CD2   1 
ATOM   6289  N N     . HIS B 2 235 ? 33.948  -0.519  59.601  1.00 72.28  ? 235 HIS B N     1 
ATOM   6290  C CA    . HIS B 2 235 ? 33.799  -1.912  60.010  1.00 73.61  ? 235 HIS B CA    1 
ATOM   6291  C C     . HIS B 2 235 ? 32.404  -2.460  59.783  1.00 70.19  ? 235 HIS B C     1 
ATOM   6292  O O     . HIS B 2 235 ? 31.728  -2.892  60.711  1.00 71.66  ? 235 HIS B O     1 
ATOM   6293  C CB    . HIS B 2 235 ? 34.231  -2.076  61.462  1.00 80.13  ? 235 HIS B CB    1 
ATOM   6294  C CG    . HIS B 2 235 ? 35.710  -1.975  61.650  1.00 77.14  ? 235 HIS B CG    1 
ATOM   6295  N ND1   . HIS B 2 235 ? 36.406  -0.807  61.406  1.00 81.13  ? 235 HIS B ND1   1 
ATOM   6296  C CD2   . HIS B 2 235 ? 36.624  -2.891  62.019  1.00 79.80  ? 235 HIS B CD2   1 
ATOM   6297  C CE1   . HIS B 2 235 ? 37.687  -1.012  61.638  1.00 84.02  ? 235 HIS B CE1   1 
ATOM   6298  N NE2   . HIS B 2 235 ? 37.853  -2.265  62.011  1.00 86.88  ? 235 HIS B NE2   1 
ATOM   6299  N N     . PRO B 2 236 ? 31.992  -2.468  58.523  1.00 66.21  ? 236 PRO B N     1 
ATOM   6300  C CA    . PRO B 2 236 ? 30.624  -2.707  58.063  1.00 67.23  ? 236 PRO B CA    1 
ATOM   6301  C C     . PRO B 2 236 ? 29.966  -3.953  58.661  1.00 74.13  ? 236 PRO B C     1 
ATOM   6302  O O     . PRO B 2 236 ? 28.751  -3.955  58.853  1.00 76.88  ? 236 PRO B O     1 
ATOM   6303  C CB    . PRO B 2 236 ? 30.791  -2.846  56.552  1.00 65.89  ? 236 PRO B CB    1 
ATOM   6304  C CG    . PRO B 2 236 ? 32.000  -2.035  56.238  1.00 67.38  ? 236 PRO B CG    1 
ATOM   6305  C CD    . PRO B 2 236 ? 32.917  -2.207  57.409  1.00 68.52  ? 236 PRO B CD    1 
ATOM   6306  N N     . ASP B 2 237 ? 30.732  -4.996  58.948  1.00 76.76  ? 237 ASP B N     1 
ATOM   6307  C CA    . ASP B 2 237 ? 30.132  -6.191  59.526  1.00 79.75  ? 237 ASP B CA    1 
ATOM   6308  C C     . ASP B 2 237 ? 29.521  -5.853  60.892  1.00 79.61  ? 237 ASP B C     1 
ATOM   6309  O O     . ASP B 2 237 ? 28.642  -6.556  61.386  1.00 79.77  ? 237 ASP B O     1 
ATOM   6310  C CB    . ASP B 2 237 ? 31.155  -7.335  59.628  1.00 80.64  ? 237 ASP B CB    1 
ATOM   6311  C CG    . ASP B 2 237 ? 32.135  -7.155  60.783  1.00 85.84  ? 237 ASP B CG    1 
ATOM   6312  O OD1   . ASP B 2 237 ? 33.137  -6.415  60.620  1.00 83.75  ? 237 ASP B OD1   1 
ATOM   6313  O OD2   . ASP B 2 237 ? 31.904  -7.761  61.857  1.00 90.01  ? 237 ASP B OD2   1 
ATOM   6314  N N     . LYS B 2 238 ? 29.988  -4.762  61.488  1.00 78.77  ? 238 LYS B N     1 
ATOM   6315  C CA    . LYS B 2 238 ? 29.547  -4.371  62.820  1.00 83.20  ? 238 LYS B CA    1 
ATOM   6316  C C     . LYS B 2 238 ? 28.403  -3.357  62.809  1.00 85.37  ? 238 LYS B C     1 
ATOM   6317  O O     . LYS B 2 238 ? 27.870  -3.016  63.864  1.00 88.06  ? 238 LYS B O     1 
ATOM   6318  C CB    . LYS B 2 238 ? 30.725  -3.820  63.636  1.00 85.62  ? 238 LYS B CB    1 
ATOM   6319  C CG    . LYS B 2 238 ? 31.782  -4.861  63.983  1.00 91.45  ? 238 LYS B CG    1 
ATOM   6320  C CD    . LYS B 2 238 ? 32.944  -4.252  64.767  1.00 98.56  ? 238 LYS B CD    1 
ATOM   6321  C CE    . LYS B 2 238 ? 34.006  -5.303  65.109  1.00 105.93 ? 238 LYS B CE    1 
ATOM   6322  N NZ    . LYS B 2 238 ? 33.480  -6.413  65.974  1.00 103.49 ? 238 LYS B NZ    1 
ATOM   6323  N N     . TRP B 2 239 ? 28.019  -2.879  61.627  1.00 81.78  ? 239 TRP B N     1 
ATOM   6324  C CA    . TRP B 2 239 ? 26.995  -1.840  61.537  1.00 76.55  ? 239 TRP B CA    1 
ATOM   6325  C C     . TRP B 2 239 ? 25.631  -2.350  61.985  1.00 85.60  ? 239 TRP B C     1 
ATOM   6326  O O     . TRP B 2 239 ? 25.112  -3.346  61.454  1.00 84.48  ? 239 TRP B O     1 
ATOM   6327  C CB    . TRP B 2 239 ? 26.904  -1.266  60.124  1.00 68.47  ? 239 TRP B CB    1 
ATOM   6328  C CG    . TRP B 2 239 ? 28.058  -0.402  59.771  1.00 65.71  ? 239 TRP B CG    1 
ATOM   6329  C CD1   . TRP B 2 239 ? 29.047  0.031   60.607  1.00 62.49  ? 239 TRP B CD1   1 
ATOM   6330  C CD2   . TRP B 2 239 ? 28.363  0.128   58.478  1.00 60.55  ? 239 TRP B CD2   1 
ATOM   6331  N NE1   . TRP B 2 239 ? 29.948  0.801   59.912  1.00 60.23  ? 239 TRP B NE1   1 
ATOM   6332  C CE2   . TRP B 2 239 ? 29.552  0.876   58.604  1.00 58.09  ? 239 TRP B CE2   1 
ATOM   6333  C CE3   . TRP B 2 239 ? 27.747  0.041   57.228  1.00 53.12  ? 239 TRP B CE3   1 
ATOM   6334  C CZ2   . TRP B 2 239 ? 30.136  1.530   57.527  1.00 52.50  ? 239 TRP B CZ2   1 
ATOM   6335  C CZ3   . TRP B 2 239 ? 28.327  0.695   56.162  1.00 50.15  ? 239 TRP B CZ3   1 
ATOM   6336  C CH2   . TRP B 2 239 ? 29.511  1.432   56.319  1.00 50.06  ? 239 TRP B CH2   1 
ATOM   6337  N N     . THR B 2 240 ? 25.047  -1.630  62.944  1.00 87.55  ? 240 THR B N     1 
ATOM   6338  C CA    . THR B 2 240 ? 23.787  -2.023  63.563  1.00 85.49  ? 240 THR B CA    1 
ATOM   6339  C C     . THR B 2 240 ? 22.624  -1.206  63.043  1.00 80.43  ? 240 THR B C     1 
ATOM   6340  O O     . THR B 2 240 ? 22.768  -0.042  62.675  1.00 76.98  ? 240 THR B O     1 
ATOM   6341  C CB    . THR B 2 240 ? 23.822  -1.872  65.102  1.00 89.23  ? 240 THR B CB    1 
ATOM   6342  O OG1   . THR B 2 240 ? 24.823  -0.908  65.475  1.00 84.07  ? 240 THR B OG1   1 
ATOM   6343  C CG2   . THR B 2 240 ? 24.110  -3.225  65.770  1.00 92.64  ? 240 THR B CG2   1 
ATOM   6344  N N     . VAL B 2 241 ? 21.469  -1.849  62.995  1.00 79.98  ? 241 VAL B N     1 
ATOM   6345  C CA    . VAL B 2 241 ? 20.233  -1.172  62.670  1.00 75.63  ? 241 VAL B CA    1 
ATOM   6346  C C     . VAL B 2 241 ? 19.466  -0.907  63.979  1.00 74.30  ? 241 VAL B C     1 
ATOM   6347  O O     . VAL B 2 241 ? 19.350  -1.797  64.825  1.00 76.73  ? 241 VAL B O     1 
ATOM   6348  C CB    . VAL B 2 241 ? 19.409  -2.004  61.642  1.00 74.35  ? 241 VAL B CB    1 
ATOM   6349  C CG1   . VAL B 2 241 ? 17.991  -2.255  62.139  1.00 78.18  ? 241 VAL B CG1   1 
ATOM   6350  C CG2   . VAL B 2 241 ? 19.416  -1.333  60.258  1.00 60.85  ? 241 VAL B CG2   1 
ATOM   6351  N N     . GLN B 2 242 ? 18.967  0.322   64.140  1.00 70.07  ? 242 GLN B N     1 
ATOM   6352  C CA    . GLN B 2 242 ? 18.224  0.737   65.334  1.00 70.34  ? 242 GLN B CA    1 
ATOM   6353  C C     . GLN B 2 242 ? 16.729  0.415   65.214  1.00 70.42  ? 242 GLN B C     1 
ATOM   6354  O O     . GLN B 2 242 ? 16.004  1.096   64.483  1.00 67.43  ? 242 GLN B O     1 
ATOM   6355  C CB    . GLN B 2 242 ? 18.402  2.252   65.538  1.00 64.66  ? 242 GLN B CB    1 
ATOM   6356  C CG    . GLN B 2 242 ? 17.488  2.898   66.582  1.00 68.41  ? 242 GLN B CG    1 
ATOM   6357  C CD    . GLN B 2 242 ? 18.000  2.723   68.007  1.00 74.98  ? 242 GLN B CD    1 
ATOM   6358  O OE1   . GLN B 2 242 ? 18.809  3.515   68.490  1.00 69.87  ? 242 GLN B OE1   1 
ATOM   6359  N NE2   . GLN B 2 242 ? 17.524  1.683   68.688  1.00 79.56  ? 242 GLN B NE2   1 
ATOM   6360  N N     . PRO B 2 243 ? 16.258  -0.608  65.956  1.00 73.74  ? 243 PRO B N     1 
ATOM   6361  C CA    . PRO B 2 243 ? 14.847  -0.999  65.928  1.00 74.45  ? 243 PRO B CA    1 
ATOM   6362  C C     . PRO B 2 243 ? 13.983  -0.069  66.792  1.00 73.37  ? 243 PRO B C     1 
ATOM   6363  O O     . PRO B 2 243 ? 14.512  0.601   67.692  1.00 70.92  ? 243 PRO B O     1 
ATOM   6364  C CB    . PRO B 2 243 ? 14.877  -2.405  66.529  1.00 73.62  ? 243 PRO B CB    1 
ATOM   6365  C CG    . PRO B 2 243 ? 15.960  -2.323  67.538  1.00 76.17  ? 243 PRO B CG    1 
ATOM   6366  C CD    . PRO B 2 243 ? 17.022  -1.427  66.917  1.00 77.33  ? 243 PRO B CD    1 
ATOM   6367  N N     . ILE B 2 244 ? 12.681  -0.021  66.501  1.00 69.44  ? 244 ILE B N     1 
ATOM   6368  C CA    . ILE B 2 244 ? 11.724  0.674   67.352  1.00 68.55  ? 244 ILE B CA    1 
ATOM   6369  C C     . ILE B 2 244 ? 11.454  -0.164  68.594  1.00 67.33  ? 244 ILE B C     1 
ATOM   6370  O O     . ILE B 2 244 ? 11.261  -1.373  68.507  1.00 70.28  ? 244 ILE B O     1 
ATOM   6371  C CB    . ILE B 2 244 ? 10.390  0.936   66.636  1.00 66.71  ? 244 ILE B CB    1 
ATOM   6372  C CG1   . ILE B 2 244 ? 10.581  1.902   65.466  1.00 63.88  ? 244 ILE B CG1   1 
ATOM   6373  C CG2   . ILE B 2 244 ? 9.373   1.504   67.606  1.00 63.90  ? 244 ILE B CG2   1 
ATOM   6374  C CD1   . ILE B 2 244 ? 9.439   1.863   64.432  1.00 61.81  ? 244 ILE B CD1   1 
ATOM   6375  N N     . VAL B 2 245 ? 11.450  0.478   69.753  1.00 65.56  ? 245 VAL B N     1 
ATOM   6376  C CA    . VAL B 2 245 ? 11.202  -0.246  70.985  1.00 71.92  ? 245 VAL B CA    1 
ATOM   6377  C C     . VAL B 2 245 ? 10.303  0.499   71.980  1.00 72.84  ? 245 VAL B C     1 
ATOM   6378  O O     . VAL B 2 245 ? 10.475  1.688   72.247  1.00 72.04  ? 245 VAL B O     1 
ATOM   6379  C CB    . VAL B 2 245 ? 12.528  -0.761  71.626  1.00 76.14  ? 245 VAL B CB    1 
ATOM   6380  C CG1   . VAL B 2 245 ? 12.500  -0.656  73.152  1.00 77.38  ? 245 VAL B CG1   1 
ATOM   6381  C CG2   . VAL B 2 245 ? 12.804  -2.203  71.175  1.00 73.38  ? 245 VAL B CG2   1 
ATOM   6382  N N     . LEU B 2 246 ? 9.322   -0.230  72.498  1.00 72.11  ? 246 LEU B N     1 
ATOM   6383  C CA    . LEU B 2 246 ? 8.399   0.273   73.493  1.00 73.77  ? 246 LEU B CA    1 
ATOM   6384  C C     . LEU B 2 246 ? 9.038   0.163   74.865  1.00 78.83  ? 246 LEU B C     1 
ATOM   6385  O O     . LEU B 2 246 ? 9.716   -0.811  75.166  1.00 76.60  ? 246 LEU B O     1 
ATOM   6386  C CB    . LEU B 2 246 ? 7.119   -0.544  73.438  1.00 72.09  ? 246 LEU B CB    1 
ATOM   6387  C CG    . LEU B 2 246 ? 6.734   -0.827  71.990  1.00 66.70  ? 246 LEU B CG    1 
ATOM   6388  C CD1   . LEU B 2 246 ? 5.529   -1.729  71.891  1.00 70.27  ? 246 LEU B CD1   1 
ATOM   6389  C CD2   . LEU B 2 246 ? 6.469   0.472   71.288  1.00 65.15  ? 246 LEU B CD2   1 
ATOM   6390  N N     . PRO B 2 247 ? 8.828   1.175   75.706  1.00 84.23  ? 247 PRO B N     1 
ATOM   6391  C CA    . PRO B 2 247 ? 9.482   1.198   77.014  1.00 85.71  ? 247 PRO B CA    1 
ATOM   6392  C C     . PRO B 2 247 ? 9.101   0.004   77.885  1.00 89.61  ? 247 PRO B C     1 
ATOM   6393  O O     . PRO B 2 247 ? 8.068   -0.632  77.697  1.00 86.06  ? 247 PRO B O     1 
ATOM   6394  C CB    . PRO B 2 247 ? 8.961   2.493   77.639  1.00 86.25  ? 247 PRO B CB    1 
ATOM   6395  C CG    . PRO B 2 247 ? 7.684   2.771   76.927  1.00 83.37  ? 247 PRO B CG    1 
ATOM   6396  C CD    . PRO B 2 247 ? 7.902   2.304   75.525  1.00 80.25  ? 247 PRO B CD    1 
ATOM   6397  N N     . GLU B 2 248 ? 9.963   -0.302  78.841  1.00 97.82  ? 248 GLU B N     1 
ATOM   6398  C CA    . GLU B 2 248 ? 9.666   -1.321  79.826  1.00 102.59 ? 248 GLU B CA    1 
ATOM   6399  C C     . GLU B 2 248 ? 9.223   -0.590  81.076  1.00 98.01  ? 248 GLU B C     1 
ATOM   6400  O O     . GLU B 2 248 ? 9.996   0.173   81.654  1.00 96.74  ? 248 GLU B O     1 
ATOM   6401  C CB    . GLU B 2 248 ? 10.917  -2.148  80.124  1.00 110.65 ? 248 GLU B CB    1 
ATOM   6402  C CG    . GLU B 2 248 ? 10.672  -3.359  81.021  1.00 120.44 ? 248 GLU B CG    1 
ATOM   6403  C CD    . GLU B 2 248 ? 10.232  -4.599  80.244  1.00 127.48 ? 248 GLU B CD    1 
ATOM   6404  O OE1   . GLU B 2 248 ? 10.151  -4.531  78.994  1.00 121.54 ? 248 GLU B OE1   1 
ATOM   6405  O OE2   . GLU B 2 248 ? 9.974   -5.644  80.888  1.00 135.35 ? 248 GLU B OE2   1 
ATOM   6406  N N     . LYS B 2 249 ? 7.978   -0.796  81.485  1.00 95.88  ? 249 LYS B N     1 
ATOM   6407  C CA    . LYS B 2 249 ? 7.474   -0.094  82.660  1.00 98.01  ? 249 LYS B CA    1 
ATOM   6408  C C     . LYS B 2 249 ? 6.926   -1.039  83.720  1.00 97.12  ? 249 LYS B C     1 
ATOM   6409  O O     . LYS B 2 249 ? 6.213   -2.004  83.425  1.00 92.03  ? 249 LYS B O     1 
ATOM   6410  C CB    . LYS B 2 249 ? 6.415   0.967   82.295  1.00 92.20  ? 249 LYS B CB    1 
ATOM   6411  C CG    . LYS B 2 249 ? 6.800   1.912   81.151  1.00 90.02  ? 249 LYS B CG    1 
ATOM   6412  C CD    . LYS B 2 249 ? 6.536   3.373   81.489  1.00 77.53  ? 249 LYS B CD    1 
ATOM   6413  C CE    . LYS B 2 249 ? 7.753   4.017   82.122  1.00 76.43  ? 249 LYS B CE    1 
ATOM   6414  N NZ    . LYS B 2 249 ? 7.463   5.388   82.618  1.00 72.94  ? 249 LYS B NZ    1 
ATOM   6415  N N     . ASP B 2 250 ? 7.310   -0.755  84.955  1.00 99.84  ? 250 ASP B N     1 
ATOM   6416  C CA    . ASP B 2 250 ? 6.726   -1.365  86.134  1.00 104.24 ? 250 ASP B CA    1 
ATOM   6417  C C     . ASP B 2 250 ? 5.252   -0.979  86.299  1.00 100.54 ? 250 ASP B C     1 
ATOM   6418  O O     . ASP B 2 250 ? 4.357   -1.831  86.287  1.00 99.77  ? 250 ASP B O     1 
ATOM   6419  C CB    . ASP B 2 250 ? 7.515   -0.876  87.344  1.00 112.34 ? 250 ASP B CB    1 
ATOM   6420  C CG    . ASP B 2 250 ? 7.996   0.567   87.177  1.00 115.32 ? 250 ASP B CG    1 
ATOM   6421  O OD1   . ASP B 2 250 ? 7.267   1.494   87.609  1.00 115.06 ? 250 ASP B OD1   1 
ATOM   6422  O OD2   . ASP B 2 250 ? 9.094   0.769   86.600  1.00 116.30 ? 250 ASP B OD2   1 
ATOM   6423  N N     . SER B 2 251 ? 5.017   0.323   86.431  1.00 97.15  ? 251 SER B N     1 
ATOM   6424  C CA    . SER B 2 251 ? 3.686   0.871   86.633  1.00 88.83  ? 251 SER B CA    1 
ATOM   6425  C C     . SER B 2 251 ? 3.427   1.955   85.598  1.00 84.35  ? 251 SER B C     1 
ATOM   6426  O O     . SER B 2 251 ? 4.311   2.767   85.317  1.00 83.76  ? 251 SER B O     1 
ATOM   6427  C CB    . SER B 2 251 ? 3.577   1.465   88.031  1.00 90.66  ? 251 SER B CB    1 
ATOM   6428  O OG    . SER B 2 251 ? 2.285   1.991   88.249  1.00 84.92  ? 251 SER B OG    1 
ATOM   6429  N N     . TRP B 2 252 ? 2.215   1.972   85.046  1.00 77.78  ? 252 TRP B N     1 
ATOM   6430  C CA    . TRP B 2 252 ? 1.869   2.875   83.943  1.00 70.40  ? 252 TRP B CA    1 
ATOM   6431  C C     . TRP B 2 252 ? 0.899   4.012   84.303  1.00 65.46  ? 252 TRP B C     1 
ATOM   6432  O O     . TRP B 2 252 ? -0.201  3.766   84.789  1.00 68.91  ? 252 TRP B O     1 
ATOM   6433  C CB    . TRP B 2 252 ? 1.280   2.066   82.789  1.00 69.49  ? 252 TRP B CB    1 
ATOM   6434  C CG    . TRP B 2 252 ? 2.234   1.074   82.222  1.00 76.67  ? 252 TRP B CG    1 
ATOM   6435  C CD1   . TRP B 2 252 ? 2.637   -0.076  82.804  1.00 78.32  ? 252 TRP B CD1   1 
ATOM   6436  C CD2   . TRP B 2 252 ? 2.912   1.144   80.951  1.00 77.56  ? 252 TRP B CD2   1 
ATOM   6437  N NE1   . TRP B 2 252 ? 3.524   -0.728  81.989  1.00 82.72  ? 252 TRP B NE1   1 
ATOM   6438  C CE2   . TRP B 2 252 ? 3.707   -0.003  80.843  1.00 75.99  ? 252 TRP B CE2   1 
ATOM   6439  C CE3   . TRP B 2 252 ? 2.919   2.065   79.899  1.00 72.53  ? 252 TRP B CE3   1 
ATOM   6440  C CZ2   . TRP B 2 252 ? 4.498   -0.263  79.729  1.00 76.45  ? 252 TRP B CZ2   1 
ATOM   6441  C CZ3   . TRP B 2 252 ? 3.709   1.802   78.789  1.00 70.59  ? 252 TRP B CZ3   1 
ATOM   6442  C CH2   . TRP B 2 252 ? 4.484   0.649   78.716  1.00 72.17  ? 252 TRP B CH2   1 
ATOM   6443  N N     . THR B 2 253 ? 1.300   5.259   84.083  1.00 59.85  ? 253 THR B N     1 
ATOM   6444  C CA    . THR B 2 253 ? 0.337   6.358   84.189  1.00 56.48  ? 253 THR B CA    1 
ATOM   6445  C C     . THR B 2 253 ? -0.564  6.460   82.953  1.00 53.33  ? 253 THR B C     1 
ATOM   6446  O O     . THR B 2 253 ? -0.273  5.879   81.906  1.00 50.94  ? 253 THR B O     1 
ATOM   6447  C CB    . THR B 2 253 ? 0.978   7.732   84.567  1.00 52.86  ? 253 THR B CB    1 
ATOM   6448  O OG1   . THR B 2 253 ? 1.906   8.164   83.561  1.00 48.34  ? 253 THR B OG1   1 
ATOM   6449  C CG2   . THR B 2 253 ? 1.675   7.642   85.919  1.00 52.79  ? 253 THR B CG2   1 
ATOM   6450  N N     . VAL B 2 254 ? -1.684  7.157   83.101  1.00 52.54  ? 254 VAL B N     1 
ATOM   6451  C CA    . VAL B 2 254 ? -2.544  7.466   81.969  1.00 50.01  ? 254 VAL B CA    1 
ATOM   6452  C C     . VAL B 2 254 ? -1.679  8.034   80.847  1.00 48.08  ? 254 VAL B C     1 
ATOM   6453  O O     . VAL B 2 254 ? -1.728  7.558   79.706  1.00 44.65  ? 254 VAL B O     1 
ATOM   6454  C CB    . VAL B 2 254 ? -3.619  8.506   82.361  1.00 47.58  ? 254 VAL B CB    1 
ATOM   6455  C CG1   . VAL B 2 254 ? -4.331  9.024   81.137  1.00 46.41  ? 254 VAL B CG1   1 
ATOM   6456  C CG2   . VAL B 2 254 ? -4.614  7.913   83.342  1.00 49.63  ? 254 VAL B CG2   1 
ATOM   6457  N N     . ASN B 2 255 ? -0.877  9.039   81.207  1.00 45.09  ? 255 ASN B N     1 
ATOM   6458  C CA    . ASN B 2 255 ? 0.062   9.704   80.302  1.00 42.80  ? 255 ASN B CA    1 
ATOM   6459  C C     . ASN B 2 255 ? 1.021   8.766   79.582  1.00 42.51  ? 255 ASN B C     1 
ATOM   6460  O O     . ASN B 2 255 ? 1.250   8.922   78.400  1.00 40.83  ? 255 ASN B O     1 
ATOM   6461  C CB    . ASN B 2 255 ? 0.817   10.818  81.049  1.00 42.53  ? 255 ASN B CB    1 
ATOM   6462  C CG    . ASN B 2 255 ? 1.944   11.419  80.235  1.00 41.92  ? 255 ASN B CG    1 
ATOM   6463  O OD1   . ASN B 2 255 ? 3.094   11.338  80.629  1.00 43.27  ? 255 ASN B OD1   1 
ATOM   6464  N ND2   . ASN B 2 255 ? 1.618   12.015  79.094  1.00 40.38  ? 255 ASN B ND2   1 
ATOM   6465  N N     . ASP B 2 256 ? 1.568   7.793   80.308  1.00 47.29  ? 256 ASP B N     1 
ATOM   6466  C CA    . ASP B 2 256 ? 2.361   6.704   79.728  1.00 47.73  ? 256 ASP B CA    1 
ATOM   6467  C C     . ASP B 2 256 ? 1.565   5.892   78.711  1.00 46.50  ? 256 ASP B C     1 
ATOM   6468  O O     . ASP B 2 256 ? 2.007   5.676   77.587  1.00 44.97  ? 256 ASP B O     1 
ATOM   6469  C CB    . ASP B 2 256 ? 2.899   5.780   80.826  1.00 50.88  ? 256 ASP B CB    1 
ATOM   6470  C CG    . ASP B 2 256 ? 4.041   6.418   81.619  1.00 56.57  ? 256 ASP B CG    1 
ATOM   6471  O OD1   . ASP B 2 256 ? 4.854   7.150   81.002  1.00 57.12  ? 256 ASP B OD1   1 
ATOM   6472  O OD2   . ASP B 2 256 ? 4.133   6.187   82.851  1.00 55.13  ? 256 ASP B OD2   1 
ATOM   6473  N N     . ILE B 2 257 ? 0.382   5.450   79.105  1.00 46.71  ? 257 ILE B N     1 
ATOM   6474  C CA    . ILE B 2 257 ? -0.454  4.663   78.216  1.00 47.52  ? 257 ILE B CA    1 
ATOM   6475  C C     . ILE B 2 257 ? -0.791  5.473   76.975  1.00 47.32  ? 257 ILE B C     1 
ATOM   6476  O O     . ILE B 2 257 ? -0.985  4.928   75.883  1.00 44.70  ? 257 ILE B O     1 
ATOM   6477  C CB    . ILE B 2 257 ? -1.757  4.237   78.907  1.00 50.89  ? 257 ILE B CB    1 
ATOM   6478  C CG1   . ILE B 2 257 ? -1.473  3.645   80.291  1.00 53.31  ? 257 ILE B CG1   1 
ATOM   6479  C CG2   . ILE B 2 257 ? -2.518  3.263   78.034  1.00 54.15  ? 257 ILE B CG2   1 
ATOM   6480  C CD1   . ILE B 2 257 ? -0.728  2.347   80.249  1.00 60.56  ? 257 ILE B CD1   1 
ATOM   6481  N N     . GLN B 2 258 ? -0.860  6.787   77.153  1.00 46.25  ? 258 GLN B N     1 
ATOM   6482  C CA    . GLN B 2 258 ? -1.267  7.670   76.075  1.00 43.69  ? 258 GLN B CA    1 
ATOM   6483  C C     . GLN B 2 258 ? -0.152  7.824   75.079  1.00 43.48  ? 258 GLN B C     1 
ATOM   6484  O O     . GLN B 2 258 ? -0.380  7.743   73.874  1.00 42.78  ? 258 GLN B O     1 
ATOM   6485  C CB    . GLN B 2 258 ? -1.674  9.028   76.617  1.00 42.79  ? 258 GLN B CB    1 
ATOM   6486  C CG    . GLN B 2 258 ? -3.153  9.149   76.899  1.00 44.23  ? 258 GLN B CG    1 
ATOM   6487  C CD    . GLN B 2 258 ? -3.517  10.454  77.606  1.00 44.93  ? 258 GLN B CD    1 
ATOM   6488  O OE1   . GLN B 2 258 ? -2.758  11.420  77.594  1.00 40.52  ? 258 GLN B OE1   1 
ATOM   6489  N NE2   . GLN B 2 258 ? -4.683  10.470  78.241  1.00 47.71  ? 258 GLN B NE2   1 
ATOM   6490  N N     . LYS B 2 259 ? 1.055   8.046   75.594  1.00 43.27  ? 259 LYS B N     1 
ATOM   6491  C CA    . LYS B 2 259 ? 2.236   8.183   74.757  1.00 39.93  ? 259 LYS B CA    1 
ATOM   6492  C C     . LYS B 2 259 ? 2.517   6.856   74.046  1.00 44.76  ? 259 LYS B C     1 
ATOM   6493  O O     . LYS B 2 259 ? 2.913   6.825   72.862  1.00 43.59  ? 259 LYS B O     1 
ATOM   6494  C CB    . LYS B 2 259 ? 3.428   8.671   75.575  1.00 36.64  ? 259 LYS B CB    1 
ATOM   6495  C CG    . LYS B 2 259 ? 3.394   10.153  75.890  1.00 39.04  ? 259 LYS B CG    1 
ATOM   6496  C CD    . LYS B 2 259 ? 4.752   10.702  76.347  1.00 48.59  ? 259 LYS B CD    1 
ATOM   6497  C CE    . LYS B 2 259 ? 5.350   9.927   77.551  1.00 55.88  ? 259 LYS B CE    1 
ATOM   6498  N NZ    . LYS B 2 259 ? 6.382   10.678  78.356  1.00 50.72  ? 259 LYS B NZ    1 
ATOM   6499  N N     . LEU B 2 260 ? 2.274   5.759   74.759  1.00 44.66  ? 260 LEU B N     1 
ATOM   6500  C CA    . LEU B 2 260 ? 2.393   4.431   74.173  1.00 46.51  ? 260 LEU B CA    1 
ATOM   6501  C C     . LEU B 2 260 ? 1.437   4.239   72.988  1.00 46.62  ? 260 LEU B C     1 
ATOM   6502  O O     . LEU B 2 260 ? 1.874   3.931   71.888  1.00 48.09  ? 260 LEU B O     1 
ATOM   6503  C CB    . LEU B 2 260 ? 2.184   3.351   75.237  1.00 50.08  ? 260 LEU B CB    1 
ATOM   6504  C CG    . LEU B 2 260 ? 2.293   1.893   74.791  1.00 52.68  ? 260 LEU B CG    1 
ATOM   6505  C CD1   . LEU B 2 260 ? 3.634   1.657   74.136  1.00 53.04  ? 260 LEU B CD1   1 
ATOM   6506  C CD2   . LEU B 2 260 ? 2.071   0.956   75.968  1.00 54.87  ? 260 LEU B CD2   1 
ATOM   6507  N N     . VAL B 2 261 ? 0.142   4.442   73.202  1.00 45.90  ? 261 VAL B N     1 
ATOM   6508  C CA    . VAL B 2 261 ? -0.845  4.236   72.135  1.00 49.13  ? 261 VAL B CA    1 
ATOM   6509  C C     . VAL B 2 261 ? -0.562  5.092   70.915  1.00 46.26  ? 261 VAL B C     1 
ATOM   6510  O O     . VAL B 2 261 ? -0.830  4.703   69.780  1.00 46.69  ? 261 VAL B O     1 
ATOM   6511  C CB    . VAL B 2 261 ? -2.290  4.503   72.625  1.00 48.13  ? 261 VAL B CB    1 
ATOM   6512  C CG1   . VAL B 2 261 ? -3.273  4.424   71.485  1.00 43.08  ? 261 VAL B CG1   1 
ATOM   6513  C CG2   . VAL B 2 261 ? -2.659  3.503   73.692  1.00 55.89  ? 261 VAL B CG2   1 
ATOM   6514  N N     . GLY B 2 262 ? -0.010  6.267   71.149  1.00 44.72  ? 262 GLY B N     1 
ATOM   6515  C CA    . GLY B 2 262 ? 0.195   7.197   70.063  1.00 47.02  ? 262 GLY B CA    1 
ATOM   6516  C C     . GLY B 2 262 ? 1.357   6.764   69.214  1.00 48.65  ? 262 GLY B C     1 
ATOM   6517  O O     . GLY B 2 262 ? 1.282   6.832   67.985  1.00 47.64  ? 262 GLY B O     1 
ATOM   6518  N N     . LYS B 2 263 ? 2.425   6.331   69.893  1.00 48.19  ? 263 LYS B N     1 
ATOM   6519  C CA    . LYS B 2 263 ? 3.620   5.780   69.263  1.00 48.51  ? 263 LYS B CA    1 
ATOM   6520  C C     . LYS B 2 263 ? 3.265   4.556   68.443  1.00 49.69  ? 263 LYS B C     1 
ATOM   6521  O O     . LYS B 2 263 ? 3.543   4.512   67.254  1.00 49.69  ? 263 LYS B O     1 
ATOM   6522  C CB    . LYS B 2 263 ? 4.638   5.403   70.329  1.00 50.13  ? 263 LYS B CB    1 
ATOM   6523  C CG    . LYS B 2 263 ? 5.983   4.941   69.798  1.00 50.82  ? 263 LYS B CG    1 
ATOM   6524  C CD    . LYS B 2 263 ? 6.934   4.787   70.960  1.00 54.25  ? 263 LYS B CD    1 
ATOM   6525  C CE    . LYS B 2 263 ? 8.336   4.463   70.518  1.00 63.46  ? 263 LYS B CE    1 
ATOM   6526  N NZ    . LYS B 2 263 ? 9.247   4.524   71.694  1.00 74.98  ? 263 LYS B NZ    1 
ATOM   6527  N N     . LEU B 2 264 ? 2.633   3.574   69.089  1.00 49.39  ? 264 LEU B N     1 
ATOM   6528  C CA    . LEU B 2 264 ? 2.078   2.404   68.406  1.00 50.31  ? 264 LEU B CA    1 
ATOM   6529  C C     . LEU B 2 264 ? 1.187   2.752   67.206  1.00 51.93  ? 264 LEU B C     1 
ATOM   6530  O O     . LEU B 2 264 ? 1.253   2.088   66.182  1.00 52.40  ? 264 LEU B O     1 
ATOM   6531  C CB    . LEU B 2 264 ? 1.315   1.520   69.392  1.00 52.20  ? 264 LEU B CB    1 
ATOM   6532  C CG    . LEU B 2 264 ? 2.145   0.825   70.480  1.00 55.99  ? 264 LEU B CG    1 
ATOM   6533  C CD1   . LEU B 2 264 ? 1.310   0.527   71.724  1.00 55.45  ? 264 LEU B CD1   1 
ATOM   6534  C CD2   . LEU B 2 264 ? 2.806   -0.440  69.958  1.00 59.29  ? 264 LEU B CD2   1 
ATOM   6535  N N     . ASN B 2 265 ? 0.353   3.779   67.327  1.00 49.13  ? 265 ASN B N     1 
ATOM   6536  C CA    . ASN B 2 265 ? -0.479  4.175   66.211  1.00 49.33  ? 265 ASN B CA    1 
ATOM   6537  C C     . ASN B 2 265 ? 0.375   4.645   65.034  1.00 53.01  ? 265 ASN B C     1 
ATOM   6538  O O     . ASN B 2 265 ? -0.026  4.488   63.876  1.00 56.41  ? 265 ASN B O     1 
ATOM   6539  C CB    . ASN B 2 265 ? -1.512  5.245   66.618  1.00 52.52  ? 265 ASN B CB    1 
ATOM   6540  C CG    . ASN B 2 265 ? -2.539  5.561   65.489  1.00 55.32  ? 265 ASN B CG    1 
ATOM   6541  O OD1   . ASN B 2 265 ? -3.203  4.668   64.952  1.00 54.37  ? 265 ASN B OD1   1 
ATOM   6542  N ND2   . ASN B 2 265 ? -2.651  6.837   65.133  1.00 47.90  ? 265 ASN B ND2   1 
ATOM   6543  N N     . TRP B 2 266 ? 1.543   5.224   65.320  1.00 52.39  ? 266 TRP B N     1 
ATOM   6544  C CA    . TRP B 2 266 ? 2.433   5.727   64.261  1.00 53.98  ? 266 TRP B CA    1 
ATOM   6545  C C     . TRP B 2 266 ? 3.144   4.579   63.584  1.00 55.80  ? 266 TRP B C     1 
ATOM   6546  O O     . TRP B 2 266 ? 3.155   4.466   62.352  1.00 56.22  ? 266 TRP B O     1 
ATOM   6547  C CB    . TRP B 2 266 ? 3.481   6.701   64.822  1.00 52.66  ? 266 TRP B CB    1 
ATOM   6548  C CG    . TRP B 2 266 ? 4.734   6.772   63.984  1.00 56.25  ? 266 TRP B CG    1 
ATOM   6549  C CD1   . TRP B 2 266 ? 5.912   6.073   64.179  1.00 59.79  ? 266 TRP B CD1   1 
ATOM   6550  C CD2   . TRP B 2 266 ? 4.933   7.566   62.815  1.00 57.58  ? 266 TRP B CD2   1 
ATOM   6551  N NE1   . TRP B 2 266 ? 6.818   6.389   63.198  1.00 58.83  ? 266 TRP B NE1   1 
ATOM   6552  C CE2   . TRP B 2 266 ? 6.244   7.302   62.346  1.00 60.10  ? 266 TRP B CE2   1 
ATOM   6553  C CE3   . TRP B 2 266 ? 4.130   8.473   62.111  1.00 64.06  ? 266 TRP B CE3   1 
ATOM   6554  C CZ2   . TRP B 2 266 ? 6.771   7.923   61.207  1.00 66.31  ? 266 TRP B CZ2   1 
ATOM   6555  C CZ3   . TRP B 2 266 ? 4.652   9.090   60.973  1.00 70.11  ? 266 TRP B CZ3   1 
ATOM   6556  C CH2   . TRP B 2 266 ? 5.962   8.810   60.533  1.00 72.33  ? 266 TRP B CH2   1 
ATOM   6557  N N     . ALA B 2 267 ? 3.727   3.734   64.433  1.00 53.75  ? 267 ALA B N     1 
ATOM   6558  C CA    . ALA B 2 267 ? 4.495   2.575   64.042  1.00 52.10  ? 267 ALA B CA    1 
ATOM   6559  C C     . ALA B 2 267 ? 3.685   1.693   63.124  1.00 58.09  ? 267 ALA B C     1 
ATOM   6560  O O     . ALA B 2 267 ? 4.230   0.988   62.293  1.00 63.81  ? 267 ALA B O     1 
ATOM   6561  C CB    . ALA B 2 267 ? 4.902   1.812   65.260  1.00 50.19  ? 267 ALA B CB    1 
ATOM   6562  N N     . SER B 2 268 ? 2.371   1.740   63.266  1.00 58.35  ? 268 SER B N     1 
ATOM   6563  C CA    . SER B 2 268 ? 1.503   0.880   62.481  1.00 61.53  ? 268 SER B CA    1 
ATOM   6564  C C     . SER B 2 268 ? 1.416   1.276   61.017  1.00 60.91  ? 268 SER B C     1 
ATOM   6565  O O     . SER B 2 268 ? 0.799   0.576   60.226  1.00 66.16  ? 268 SER B O     1 
ATOM   6566  C CB    . SER B 2 268 ? 0.115   0.759   63.109  1.00 58.56  ? 268 SER B CB    1 
ATOM   6567  O OG    . SER B 2 268 ? -0.274  1.967   63.716  1.00 54.23  ? 268 SER B OG    1 
ATOM   6568  N N     . GLN B 2 269 ? 2.026   2.391   60.644  1.00 59.30  ? 269 GLN B N     1 
ATOM   6569  C CA    . GLN B 2 269 ? 2.126   2.696   59.221  1.00 65.69  ? 269 GLN B CA    1 
ATOM   6570  C C     . GLN B 2 269 ? 3.191   1.775   58.623  1.00 68.40  ? 269 GLN B C     1 
ATOM   6571  O O     . GLN B 2 269 ? 3.119   1.366   57.462  1.00 69.67  ? 269 GLN B O     1 
ATOM   6572  C CB    . GLN B 2 269 ? 2.464   4.166   58.991  1.00 61.12  ? 269 GLN B CB    1 
ATOM   6573  C CG    . GLN B 2 269 ? 1.563   5.097   59.756  1.00 62.65  ? 269 GLN B CG    1 
ATOM   6574  C CD    . GLN B 2 269 ? 1.714   6.542   59.344  1.00 62.73  ? 269 GLN B CD    1 
ATOM   6575  O OE1   . GLN B 2 269 ? 2.609   7.243   59.813  1.00 60.51  ? 269 GLN B OE1   1 
ATOM   6576  N NE2   . GLN B 2 269 ? 0.819   7.005   58.477  1.00 59.40  ? 269 GLN B NE2   1 
ATOM   6577  N N     . ILE B 2 270 ? 4.189   1.467   59.441  1.00 67.64  ? 270 ILE B N     1 
ATOM   6578  C CA    . ILE B 2 270 ? 5.253   0.551   59.071  1.00 68.47  ? 270 ILE B CA    1 
ATOM   6579  C C     . ILE B 2 270 ? 4.827   -0.913  59.189  1.00 70.94  ? 270 ILE B C     1 
ATOM   6580  O O     . ILE B 2 270 ? 4.928   -1.668  58.231  1.00 74.95  ? 270 ILE B O     1 
ATOM   6581  C CB    . ILE B 2 270 ? 6.504   0.824   59.924  1.00 68.62  ? 270 ILE B CB    1 
ATOM   6582  C CG1   . ILE B 2 270 ? 6.915   2.299   59.794  1.00 61.31  ? 270 ILE B CG1   1 
ATOM   6583  C CG2   . ILE B 2 270 ? 7.629   -0.092  59.509  1.00 73.79  ? 270 ILE B CG2   1 
ATOM   6584  C CD1   . ILE B 2 270 ? 7.483   2.892   61.047  1.00 53.82  ? 270 ILE B CD1   1 
ATOM   6585  N N     . TYR B 2 271 ? 4.303   -1.293  60.348  1.00 69.72  ? 271 TYR B N     1 
ATOM   6586  C CA    . TYR B 2 271 ? 3.842   -2.658  60.573  1.00 74.65  ? 271 TYR B CA    1 
ATOM   6587  C C     . TYR B 2 271 ? 2.323   -2.717  60.747  1.00 78.70  ? 271 TYR B C     1 
ATOM   6588  O O     . TYR B 2 271 ? 1.821   -2.377  61.819  1.00 79.29  ? 271 TYR B O     1 
ATOM   6589  C CB    . TYR B 2 271 ? 4.466   -3.198  61.853  1.00 76.33  ? 271 TYR B CB    1 
ATOM   6590  C CG    . TYR B 2 271 ? 5.945   -2.961  61.989  1.00 79.87  ? 271 TYR B CG    1 
ATOM   6591  C CD1   . TYR B 2 271 ? 6.849   -4.004  61.831  1.00 88.57  ? 271 TYR B CD1   1 
ATOM   6592  C CD2   . TYR B 2 271 ? 6.443   -1.707  62.298  1.00 77.72  ? 271 TYR B CD2   1 
ATOM   6593  C CE1   . TYR B 2 271 ? 8.213   -3.802  61.965  1.00 88.82  ? 271 TYR B CE1   1 
ATOM   6594  C CE2   . TYR B 2 271 ? 7.808   -1.492  62.435  1.00 81.30  ? 271 TYR B CE2   1 
ATOM   6595  C CZ    . TYR B 2 271 ? 8.687   -2.548  62.264  1.00 84.78  ? 271 TYR B CZ    1 
ATOM   6596  O OH    . TYR B 2 271 ? 10.039  -2.353  62.398  1.00 82.23  ? 271 TYR B OH    1 
ATOM   6597  N N     . PRO B 2 272 ? 1.587   -3.196  59.722  1.00 82.48  ? 272 PRO B N     1 
ATOM   6598  C CA    . PRO B 2 272 ? 0.109   -3.226  59.731  1.00 82.24  ? 272 PRO B CA    1 
ATOM   6599  C C     . PRO B 2 272 ? -0.547  -4.080  60.839  1.00 85.44  ? 272 PRO B C     1 
ATOM   6600  O O     . PRO B 2 272 ? -1.738  -3.919  61.114  1.00 85.03  ? 272 PRO B O     1 
ATOM   6601  C CB    . PRO B 2 272 ? -0.240  -3.784  58.345  1.00 82.86  ? 272 PRO B CB    1 
ATOM   6602  C CG    . PRO B 2 272 ? 0.942   -3.435  57.492  1.00 83.77  ? 272 PRO B CG    1 
ATOM   6603  C CD    . PRO B 2 272 ? 2.135   -3.564  58.402  1.00 82.17  ? 272 PRO B CD    1 
ATOM   6604  N N     . GLY B 2 273 ? 0.216   -4.969  61.466  1.00 86.30  ? 273 GLY B N     1 
ATOM   6605  C CA    . GLY B 2 273 ? -0.332  -5.838  62.492  1.00 86.83  ? 273 GLY B CA    1 
ATOM   6606  C C     . GLY B 2 273 ? -0.377  -5.253  63.892  1.00 85.87  ? 273 GLY B C     1 
ATOM   6607  O O     . GLY B 2 273 ? -0.842  -5.907  64.824  1.00 88.00  ? 273 GLY B O     1 
ATOM   6608  N N     . ILE B 2 274 ? 0.108   -4.028  64.056  1.00 82.82  ? 274 ILE B N     1 
ATOM   6609  C CA    . ILE B 2 274 ? 0.032   -3.377  65.355  1.00 82.76  ? 274 ILE B CA    1 
ATOM   6610  C C     . ILE B 2 274 ? -1.422  -3.075  65.664  1.00 82.44  ? 274 ILE B C     1 
ATOM   6611  O O     . ILE B 2 274 ? -2.190  -2.697  64.775  1.00 79.19  ? 274 ILE B O     1 
ATOM   6612  C CB    . ILE B 2 274 ? 0.816   -2.058  65.391  1.00 79.09  ? 274 ILE B CB    1 
ATOM   6613  C CG1   . ILE B 2 274 ? 2.214   -2.234  64.808  1.00 74.26  ? 274 ILE B CG1   1 
ATOM   6614  C CG2   . ILE B 2 274 ? 0.919   -1.532  66.826  1.00 74.35  ? 274 ILE B CG2   1 
ATOM   6615  C CD1   . ILE B 2 274 ? 3.307   -2.120  65.841  1.00 71.77  ? 274 ILE B CD1   1 
ATOM   6616  N N     . LYS B 2 275 ? -1.804  -3.252  66.922  1.00 82.02  ? 275 LYS B N     1 
ATOM   6617  C CA    . LYS B 2 275 ? -3.164  -2.948  67.339  1.00 87.94  ? 275 LYS B CA    1 
ATOM   6618  C C     . LYS B 2 275 ? -3.183  -2.195  68.663  1.00 87.35  ? 275 LYS B C     1 
ATOM   6619  O O     . LYS B 2 275 ? -2.438  -2.521  69.589  1.00 82.36  ? 275 LYS B O     1 
ATOM   6620  C CB    . LYS B 2 275 ? -4.019  -4.219  67.417  1.00 94.63  ? 275 LYS B CB    1 
ATOM   6621  C CG    . LYS B 2 275 ? -4.499  -4.732  66.060  1.00 98.08  ? 275 LYS B CG    1 
ATOM   6622  C CD    . LYS B 2 275 ? -3.853  -6.075  65.690  1.00 100.19 ? 275 LYS B CD    1 
ATOM   6623  C CE    . LYS B 2 275 ? -4.193  -6.485  64.251  1.00 101.35 ? 275 LYS B CE    1 
ATOM   6624  N NZ    . LYS B 2 275 ? -3.749  -7.873  63.923  1.00 101.20 ? 275 LYS B NZ    1 
ATOM   6625  N N     . VAL B 2 276 ? -3.985  -1.137  68.714  1.00 89.14  ? 276 VAL B N     1 
ATOM   6626  C CA    . VAL B 2 276 ? -4.162  -0.369  69.937  1.00 85.82  ? 276 VAL B CA    1 
ATOM   6627  C C     . VAL B 2 276 ? -5.454  -0.647  70.707  1.00 90.75  ? 276 VAL B C     1 
ATOM   6628  O O     . VAL B 2 276 ? -5.662  -0.083  71.782  1.00 88.28  ? 276 VAL B O     1 
ATOM   6629  C CB    . VAL B 2 276 ? -4.024  1.124   69.661  1.00 77.12  ? 276 VAL B CB    1 
ATOM   6630  C CG1   . VAL B 2 276 ? -2.570  1.504   69.700  1.00 65.18  ? 276 VAL B CG1   1 
ATOM   6631  C CG2   . VAL B 2 276 ? -4.637  1.469   68.313  1.00 79.01  ? 276 VAL B CG2   1 
ATOM   6632  N N     . ARG B 2 277 ? -6.305  -1.523  70.171  1.00 94.97  ? 277 ARG B N     1 
ATOM   6633  C CA    . ARG B 2 277 ? -7.678  -1.686  70.669  1.00 95.49  ? 277 ARG B CA    1 
ATOM   6634  C C     . ARG B 2 277 ? -7.808  -1.886  72.173  1.00 91.20  ? 277 ARG B C     1 
ATOM   6635  O O     . ARG B 2 277 ? -8.535  -1.150  72.828  1.00 92.27  ? 277 ARG B O     1 
ATOM   6636  C CB    . ARG B 2 277 ? -8.399  -2.839  69.957  1.00 103.73 ? 277 ARG B CB    1 
ATOM   6637  C CG    . ARG B 2 277 ? -8.601  -2.658  68.454  1.00 112.33 ? 277 ARG B CG    1 
ATOM   6638  C CD    . ARG B 2 277 ? -9.198  -1.299  68.106  1.00 114.49 ? 277 ARG B CD    1 
ATOM   6639  N NE    . ARG B 2 277 ? -8.196  -0.401  67.527  1.00 114.72 ? 277 ARG B NE    1 
ATOM   6640  C CZ    . ARG B 2 277 ? -7.872  -0.367  66.235  1.00 117.57 ? 277 ARG B CZ    1 
ATOM   6641  N NH1   . ARG B 2 277 ? -8.474  -1.183  65.373  1.00 118.56 ? 277 ARG B NH1   1 
ATOM   6642  N NH2   . ARG B 2 277 ? -6.946  0.485   65.802  1.00 111.46 ? 277 ARG B NH2   1 
ATOM   6643  N N     . GLN B 2 278 ? -7.127  -2.886  72.719  1.00 90.86  ? 278 GLN B N     1 
ATOM   6644  C CA    . GLN B 2 278 ? -7.270  -3.193  74.139  1.00 95.60  ? 278 GLN B CA    1 
ATOM   6645  C C     . GLN B 2 278 ? -6.489  -2.227  75.027  1.00 92.81  ? 278 GLN B C     1 
ATOM   6646  O O     . GLN B 2 278 ? -6.909  -1.912  76.141  1.00 92.12  ? 278 GLN B O     1 
ATOM   6647  C CB    . GLN B 2 278 ? -6.897  -4.651  74.441  1.00 102.30 ? 278 GLN B CB    1 
ATOM   6648  C CG    . GLN B 2 278 ? -8.035  -5.669  74.206  1.00 110.93 ? 278 GLN B CG    1 
ATOM   6649  C CD    . GLN B 2 278 ? -9.073  -5.733  75.347  1.00 121.12 ? 278 GLN B CD    1 
ATOM   6650  O OE1   . GLN B 2 278 ? -8.775  -5.423  76.507  1.00 120.28 ? 278 GLN B OE1   1 
ATOM   6651  N NE2   . GLN B 2 278 ? -10.295 -6.150  75.012  1.00 123.66 ? 278 GLN B NE2   1 
ATOM   6652  N N     . LEU B 2 279 ? -5.355  -1.753  74.532  1.00 91.47  ? 279 LEU B N     1 
ATOM   6653  C CA    . LEU B 2 279 ? -4.581  -0.763  75.260  1.00 85.50  ? 279 LEU B CA    1 
ATOM   6654  C C     . LEU B 2 279 ? -5.351  0.544   75.310  1.00 82.59  ? 279 LEU B C     1 
ATOM   6655  O O     . LEU B 2 279 ? -5.285  1.260   76.302  1.00 81.72  ? 279 LEU B O     1 
ATOM   6656  C CB    . LEU B 2 279 ? -3.199  -0.574  74.631  1.00 84.64  ? 279 LEU B CB    1 
ATOM   6657  C CG    . LEU B 2 279 ? -2.091  -1.403  75.282  1.00 80.66  ? 279 LEU B CG    1 
ATOM   6658  C CD1   . LEU B 2 279 ? -0.775  -1.293  74.541  1.00 78.76  ? 279 LEU B CD1   1 
ATOM   6659  C CD2   . LEU B 2 279 ? -1.928  -0.961  76.710  1.00 79.00  ? 279 LEU B CD2   1 
ATOM   6660  N N     . SER B 2 280 ? -6.089  0.835   74.241  1.00 83.11  ? 280 SER B N     1 
ATOM   6661  C CA    . SER B 2 280 ? -6.956  2.015   74.156  1.00 81.65  ? 280 SER B CA    1 
ATOM   6662  C C     . SER B 2 280 ? -8.087  2.013   75.190  1.00 84.76  ? 280 SER B C     1 
ATOM   6663  O O     . SER B 2 280 ? -8.324  3.006   75.877  1.00 81.78  ? 280 SER B O     1 
ATOM   6664  C CB    . SER B 2 280 ? -7.579  2.113   72.756  1.00 86.75  ? 280 SER B CB    1 
ATOM   6665  O OG    . SER B 2 280 ? -6.941  3.077   71.936  1.00 80.94  ? 280 SER B OG    1 
ATOM   6666  N N     . LYS B 2 281 ? -8.805  0.900   75.278  1.00 88.09  ? 281 LYS B N     1 
ATOM   6667  C CA    . LYS B 2 281 ? -9.927  0.803   76.194  1.00 90.50  ? 281 LYS B CA    1 
ATOM   6668  C C     . LYS B 2 281 ? -9.515  1.142   77.623  1.00 90.42  ? 281 LYS B C     1 
ATOM   6669  O O     . LYS B 2 281 ? -10.339 1.578   78.420  1.00 94.14  ? 281 LYS B O     1 
ATOM   6670  C CB    . LYS B 2 281 ? -10.543 -0.591  76.146  1.00 98.09  ? 281 LYS B CB    1 
ATOM   6671  C CG    . LYS B 2 281 ? -11.307 -0.906  74.873  1.00 103.86 ? 281 LYS B CG    1 
ATOM   6672  C CD    . LYS B 2 281 ? -12.353 -1.980  75.153  1.00 115.57 ? 281 LYS B CD    1 
ATOM   6673  C CE    . LYS B 2 281 ? -11.825 -3.017  76.149  1.00 116.41 ? 281 LYS B CE    1 
ATOM   6674  N NZ    . LYS B 2 281 ? -12.918 -3.800  76.799  1.00 115.98 ? 281 LYS B NZ    1 
ATOM   6675  N N     . LEU B 2 282 ? -8.244  0.926   77.946  1.00 86.26  ? 282 LEU B N     1 
ATOM   6676  C CA    . LEU B 2 282 ? -7.704  1.249   79.265  1.00 82.08  ? 282 LEU B CA    1 
ATOM   6677  C C     . LEU B 2 282 ? -7.856  2.724   79.662  1.00 80.08  ? 282 LEU B C     1 
ATOM   6678  O O     . LEU B 2 282 ? -7.875  3.060   80.843  1.00 79.04  ? 282 LEU B O     1 
ATOM   6679  C CB    . LEU B 2 282 ? -6.231  0.867   79.320  1.00 81.66  ? 282 LEU B CB    1 
ATOM   6680  C CG    . LEU B 2 282 ? -5.916  -0.571  79.684  1.00 82.21  ? 282 LEU B CG    1 
ATOM   6681  C CD1   . LEU B 2 282 ? -4.417  -0.751  79.747  1.00 82.37  ? 282 LEU B CD1   1 
ATOM   6682  C CD2   . LEU B 2 282 ? -6.548  -0.895  81.015  1.00 83.45  ? 282 LEU B CD2   1 
ATOM   6683  N N     . LEU B 2 283 ? -7.969  3.600   78.673  1.00 78.08  ? 283 LEU B N     1 
ATOM   6684  C CA    . LEU B 2 283 ? -7.983  5.040   78.910  1.00 76.81  ? 283 LEU B CA    1 
ATOM   6685  C C     . LEU B 2 283 ? -9.375  5.661   79.114  1.00 80.86  ? 283 LEU B C     1 
ATOM   6686  O O     . LEU B 2 283 ? -9.496  6.876   79.205  1.00 78.78  ? 283 LEU B O     1 
ATOM   6687  C CB    . LEU B 2 283 ? -7.253  5.761   77.772  1.00 73.37  ? 283 LEU B CB    1 
ATOM   6688  C CG    . LEU B 2 283 ? -5.731  5.599   77.662  1.00 65.30  ? 283 LEU B CG    1 
ATOM   6689  C CD1   . LEU B 2 283 ? -5.216  6.127   76.338  1.00 56.36  ? 283 LEU B CD1   1 
ATOM   6690  C CD2   . LEU B 2 283 ? -5.021  6.271   78.816  1.00 55.22  ? 283 LEU B CD2   1 
ATOM   6691  N N     . ARG B 2 284 ? -10.407 4.825   79.219  1.00 88.33  ? 284 ARG B N     1 
ATOM   6692  C CA    . ARG B 2 284 ? -11.813 5.196   78.939  1.00 89.85  ? 284 ARG B CA    1 
ATOM   6693  C C     . ARG B 2 284 ? -12.446 6.495   79.487  1.00 83.45  ? 284 ARG B C     1 
ATOM   6694  O O     . ARG B 2 284 ? -13.068 7.246   78.722  1.00 77.63  ? 284 ARG B O     1 
ATOM   6695  C CB    . ARG B 2 284 ? -12.737 4.015   79.257  1.00 94.60  ? 284 ARG B CB    1 
ATOM   6696  C CG    . ARG B 2 284 ? -12.931 3.071   78.089  1.00 100.87 ? 284 ARG B CG    1 
ATOM   6697  C CD    . ARG B 2 284 ? -13.363 3.823   76.834  1.00 106.46 ? 284 ARG B CD    1 
ATOM   6698  N NE    . ARG B 2 284 ? -13.633 2.901   75.734  1.00 116.24 ? 284 ARG B NE    1 
ATOM   6699  C CZ    . ARG B 2 284 ? -14.818 2.346   75.504  1.00 122.04 ? 284 ARG B CZ    1 
ATOM   6700  N NH1   . ARG B 2 284 ? -15.849 2.629   76.294  1.00 120.83 ? 284 ARG B NH1   1 
ATOM   6701  N NH2   . ARG B 2 284 ? -14.972 1.512   74.483  1.00 122.02 ? 284 ARG B NH2   1 
ATOM   6702  N N     . GLY B 2 285 ? -12.331 6.753   80.785  1.00 76.32  ? 285 GLY B N     1 
ATOM   6703  C CA    . GLY B 2 285 ? -12.941 7.958   81.334  1.00 73.92  ? 285 GLY B CA    1 
ATOM   6704  C C     . GLY B 2 285 ? -12.122 9.211   81.074  1.00 65.05  ? 285 GLY B C     1 
ATOM   6705  O O     . GLY B 2 285 ? -11.263 9.224   80.212  1.00 66.90  ? 285 GLY B O     1 
ATOM   6706  N N     . THR B 2 286 ? -12.378 10.275  81.820  1.00 59.63  ? 286 THR B N     1 
ATOM   6707  C CA    . THR B 2 286 ? -11.461 11.399  81.797  1.00 53.34  ? 286 THR B CA    1 
ATOM   6708  C C     . THR B 2 286 ? -10.615 11.384  83.056  1.00 49.94  ? 286 THR B C     1 
ATOM   6709  O O     . THR B 2 286 ? -11.037 11.894  84.083  1.00 48.91  ? 286 THR B O     1 
ATOM   6710  C CB    . THR B 2 286 ? -12.260 12.683  81.836  1.00 50.52  ? 286 THR B CB    1 
ATOM   6711  O OG1   . THR B 2 286 ? -12.879 12.888  80.566  1.00 60.79  ? 286 THR B OG1   1 
ATOM   6712  C CG2   . THR B 2 286 ? -11.374 13.841  82.140  1.00 46.91  ? 286 THR B CG2   1 
ATOM   6713  N N     . LYS B 2 287 ? -9.379  10.907  82.953  1.00 50.45  ? 287 LYS B N     1 
ATOM   6714  C CA    . LYS B 2 287 ? -8.583  10.642  84.146  1.00 48.97  ? 287 LYS B CA    1 
ATOM   6715  C C     . LYS B 2 287 ? -7.336  11.511  84.199  1.00 48.27  ? 287 LYS B C     1 
ATOM   6716  O O     . LYS B 2 287 ? -6.815  11.909  83.158  1.00 44.21  ? 287 LYS B O     1 
ATOM   6717  C CB    . LYS B 2 287 ? -8.163  9.183   84.194  1.00 50.53  ? 287 LYS B CB    1 
ATOM   6718  C CG    . LYS B 2 287 ? -9.089  8.247   83.515  1.00 56.20  ? 287 LYS B CG    1 
ATOM   6719  C CD    . LYS B 2 287 ? -8.976  6.906   84.178  1.00 63.06  ? 287 LYS B CD    1 
ATOM   6720  C CE    . LYS B 2 287 ? -9.507  5.819   83.277  1.00 77.39  ? 287 LYS B CE    1 
ATOM   6721  N NZ    . LYS B 2 287 ? -9.211  4.473   83.850  1.00 80.73  ? 287 LYS B NZ    1 
ATOM   6722  N N     . ALA B 2 288 ? -6.854  11.794  85.413  1.00 46.21  ? 288 ALA B N     1 
ATOM   6723  C CA    . ALA B 2 288 ? -5.630  12.571  85.577  1.00 42.95  ? 288 ALA B CA    1 
ATOM   6724  C C     . ALA B 2 288 ? -4.464  11.869  84.895  1.00 43.50  ? 288 ALA B C     1 
ATOM   6725  O O     . ALA B 2 288 ? -4.349  10.651  84.952  1.00 44.21  ? 288 ALA B O     1 
ATOM   6726  C CB    . ALA B 2 288 ? -5.333  12.820  87.045  1.00 39.62  ? 288 ALA B CB    1 
ATOM   6727  N N     . LEU B 2 289 ? -3.610  12.644  84.239  1.00 41.33  ? 289 LEU B N     1 
ATOM   6728  C CA    . LEU B 2 289 ? -2.495  12.084  83.501  1.00 42.67  ? 289 LEU B CA    1 
ATOM   6729  C C     . LEU B 2 289 ? -1.564  11.251  84.369  1.00 46.86  ? 289 LEU B C     1 
ATOM   6730  O O     . LEU B 2 289 ? -1.011  10.264  83.915  1.00 49.36  ? 289 LEU B O     1 
ATOM   6731  C CB    . LEU B 2 289 ? -1.691  13.196  82.869  1.00 40.85  ? 289 LEU B CB    1 
ATOM   6732  C CG    . LEU B 2 289 ? -2.295  13.862  81.664  1.00 35.99  ? 289 LEU B CG    1 
ATOM   6733  C CD1   . LEU B 2 289 ? -1.210  14.693  81.030  1.00 32.59  ? 289 LEU B CD1   1 
ATOM   6734  C CD2   . LEU B 2 289 ? -2.808  12.801  80.731  1.00 37.30  ? 289 LEU B CD2   1 
ATOM   6735  N N     . THR B 2 290 ? -1.395  11.670  85.615  1.00 47.01  ? 290 THR B N     1 
ATOM   6736  C CA    . THR B 2 290 ? -0.449  11.070  86.538  1.00 45.96  ? 290 THR B CA    1 
ATOM   6737  C C     . THR B 2 290 ? -1.111  10.011  87.371  1.00 49.94  ? 290 THR B C     1 
ATOM   6738  O O     . THR B 2 290 ? -0.499  9.505   88.306  1.00 53.81  ? 290 THR B O     1 
ATOM   6739  C CB    . THR B 2 290 ? 0.054   12.110  87.545  1.00 51.69  ? 290 THR B CB    1 
ATOM   6740  O OG1   . THR B 2 290 ? -1.041  12.953  87.933  1.00 52.25  ? 290 THR B OG1   1 
ATOM   6741  C CG2   . THR B 2 290 ? 1.146   12.973  86.946  1.00 47.47  ? 290 THR B CG2   1 
ATOM   6742  N N     . GLU B 2 291 ? -2.380  9.725   87.095  1.00 49.94  ? 291 GLU B N     1 
ATOM   6743  C CA    . GLU B 2 291 ? -3.073  8.653   87.809  1.00 57.14  ? 291 GLU B CA    1 
ATOM   6744  C C     . GLU B 2 291 ? -2.516  7.335   87.308  1.00 58.21  ? 291 GLU B C     1 
ATOM   6745  O O     . GLU B 2 291 ? -2.175  7.235   86.136  1.00 57.66  ? 291 GLU B O     1 
ATOM   6746  C CB    . GLU B 2 291 ? -4.592  8.701   87.593  1.00 56.40  ? 291 GLU B CB    1 
ATOM   6747  C CG    . GLU B 2 291 ? -5.340  7.538   88.265  1.00 63.30  ? 291 GLU B CG    1 
ATOM   6748  C CD    . GLU B 2 291 ? -6.825  7.496   87.933  1.00 67.81  ? 291 GLU B CD    1 
ATOM   6749  O OE1   . GLU B 2 291 ? -7.510  8.528   88.129  1.00 66.84  ? 291 GLU B OE1   1 
ATOM   6750  O OE2   . GLU B 2 291 ? -7.305  6.430   87.474  1.00 68.20  ? 291 GLU B OE2   1 
ATOM   6751  N N     . VAL B 2 292 ? -2.410  6.338   88.188  1.00 60.50  ? 292 VAL B N     1 
ATOM   6752  C CA    . VAL B 2 292 ? -1.789  5.058   87.825  1.00 66.43  ? 292 VAL B CA    1 
ATOM   6753  C C     . VAL B 2 292 ? -2.810  3.995   87.443  1.00 64.78  ? 292 VAL B C     1 
ATOM   6754  O O     . VAL B 2 292 ? -3.604  3.576   88.269  1.00 69.07  ? 292 VAL B O     1 
ATOM   6755  C CB    . VAL B 2 292 ? -0.932  4.489   88.964  1.00 66.61  ? 292 VAL B CB    1 
ATOM   6756  C CG1   . VAL B 2 292 ? -0.225  3.233   88.482  1.00 67.17  ? 292 VAL B CG1   1 
ATOM   6757  C CG2   . VAL B 2 292 ? 0.053   5.526   89.464  1.00 59.31  ? 292 VAL B CG2   1 
ATOM   6758  N N     . ILE B 2 293 ? -2.802  3.565   86.191  1.00 64.27  ? 293 ILE B N     1 
ATOM   6759  C CA    . ILE B 2 293 ? -3.781  2.580   85.755  1.00 70.90  ? 293 ILE B CA    1 
ATOM   6760  C C     . ILE B 2 293 ? -3.165  1.207   85.473  1.00 73.89  ? 293 ILE B C     1 
ATOM   6761  O O     . ILE B 2 293 ? -2.180  1.114   84.751  1.00 70.39  ? 293 ILE B O     1 
ATOM   6762  C CB    . ILE B 2 293 ? -4.631  3.092   84.580  1.00 68.19  ? 293 ILE B CB    1 
ATOM   6763  C CG1   . ILE B 2 293 ? -4.313  2.324   83.309  1.00 72.49  ? 293 ILE B CG1   1 
ATOM   6764  C CG2   . ILE B 2 293 ? -4.440  4.586   84.401  1.00 63.96  ? 293 ILE B CG2   1 
ATOM   6765  C CD1   . ILE B 2 293 ? -5.464  2.278   82.353  1.00 75.60  ? 293 ILE B CD1   1 
ATOM   6766  N N     . PRO B 2 294 ? -3.728  0.139   86.078  1.00 81.24  ? 294 PRO B N     1 
ATOM   6767  C CA    . PRO B 2 294 ? -3.159  -1.207  85.929  1.00 80.36  ? 294 PRO B CA    1 
ATOM   6768  C C     . PRO B 2 294 ? -3.482  -1.794  84.560  1.00 79.27  ? 294 PRO B C     1 
ATOM   6769  O O     . PRO B 2 294 ? -4.516  -1.482  83.972  1.00 75.84  ? 294 PRO B O     1 
ATOM   6770  C CB    . PRO B 2 294 ? -3.844  -1.998  87.046  1.00 78.99  ? 294 PRO B CB    1 
ATOM   6771  C CG    . PRO B 2 294 ? -5.191  -1.348  87.175  1.00 79.82  ? 294 PRO B CG    1 
ATOM   6772  C CD    . PRO B 2 294 ? -4.998  0.119   86.835  1.00 77.10  ? 294 PRO B CD    1 
ATOM   6773  N N     . LEU B 2 295 ? -2.590  -2.632  84.052  1.00 82.60  ? 295 LEU B N     1 
ATOM   6774  C CA    . LEU B 2 295 ? -2.754  -3.161  82.705  1.00 90.89  ? 295 LEU B CA    1 
ATOM   6775  C C     . LEU B 2 295 ? -3.581  -4.449  82.679  1.00 94.26  ? 295 LEU B C     1 
ATOM   6776  O O     . LEU B 2 295 ? -3.202  -5.456  83.282  1.00 95.32  ? 295 LEU B O     1 
ATOM   6777  C CB    . LEU B 2 295 ? -1.386  -3.370  82.036  1.00 92.55  ? 295 LEU B CB    1 
ATOM   6778  C CG    . LEU B 2 295 ? -0.583  -2.121  81.648  1.00 82.12  ? 295 LEU B CG    1 
ATOM   6779  C CD1   . LEU B 2 295 ? 0.831   -2.469  81.262  1.00 78.96  ? 295 LEU B CD1   1 
ATOM   6780  C CD2   . LEU B 2 295 ? -1.259  -1.396  80.513  1.00 82.12  ? 295 LEU B CD2   1 
ATOM   6781  N N     . THR B 2 296 ? -4.707  -4.408  81.969  1.00 94.63  ? 296 THR B N     1 
ATOM   6782  C CA    . THR B 2 296 ? -5.542  -5.589  81.794  1.00 103.05 ? 296 THR B CA    1 
ATOM   6783  C C     . THR B 2 296 ? -4.748  -6.626  81.010  1.00 109.81 ? 296 THR B C     1 
ATOM   6784  O O     . THR B 2 296 ? -3.765  -6.292  80.346  1.00 109.27 ? 296 THR B O     1 
ATOM   6785  C CB    . THR B 2 296 ? -6.894  -5.283  81.071  1.00 104.40 ? 296 THR B CB    1 
ATOM   6786  O OG1   . THR B 2 296 ? -6.695  -5.173  79.658  1.00 105.26 ? 296 THR B OG1   1 
ATOM   6787  C CG2   . THR B 2 296 ? -7.527  -4.003  81.591  1.00 97.78  ? 296 THR B CG2   1 
ATOM   6788  N N     . GLU B 2 297 ? -5.145  -7.890  81.117  1.00 113.58 ? 297 GLU B N     1 
ATOM   6789  C CA    . GLU B 2 297 ? -4.439  -8.949  80.407  1.00 117.21 ? 297 GLU B CA    1 
ATOM   6790  C C     . GLU B 2 297 ? -4.676  -8.867  78.908  1.00 117.61 ? 297 GLU B C     1 
ATOM   6791  O O     . GLU B 2 297 ? -3.735  -8.972  78.123  1.00 117.03 ? 297 GLU B O     1 
ATOM   6792  C CB    . GLU B 2 297 ? -4.809  -10.335 80.944  1.00 122.37 ? 297 GLU B CB    1 
ATOM   6793  C CG    . GLU B 2 297 ? -4.159  -10.660 82.286  1.00 125.70 ? 297 GLU B CG    1 
ATOM   6794  C CD    . GLU B 2 297 ? -2.701  -10.210 82.360  1.00 123.72 ? 297 GLU B CD    1 
ATOM   6795  O OE1   . GLU B 2 297 ? -1.976  -10.320 81.342  1.00 121.66 ? 297 GLU B OE1   1 
ATOM   6796  O OE2   . GLU B 2 297 ? -2.285  -9.736  83.439  1.00 120.89 ? 297 GLU B OE2   1 
ATOM   6797  N N     . GLU B 2 298 ? -5.930  -8.663  78.517  1.00 119.36 ? 298 GLU B N     1 
ATOM   6798  C CA    . GLU B 2 298 ? -6.278  -8.537  77.104  1.00 120.29 ? 298 GLU B CA    1 
ATOM   6799  C C     . GLU B 2 298 ? -5.454  -7.447  76.405  1.00 114.77 ? 298 GLU B C     1 
ATOM   6800  O O     . GLU B 2 298 ? -5.069  -7.595  75.244  1.00 112.94 ? 298 GLU B O     1 
ATOM   6801  C CB    . GLU B 2 298 ? -7.773  -8.276  76.948  1.00 122.41 ? 298 GLU B CB    1 
ATOM   6802  C CG    . GLU B 2 298 ? -8.641  -9.351  77.565  1.00 126.22 ? 298 GLU B CG    1 
ATOM   6803  C CD    . GLU B 2 298 ? -10.113 -9.113  77.317  1.00 133.01 ? 298 GLU B CD    1 
ATOM   6804  O OE1   . GLU B 2 298 ? -10.933 -9.881  77.863  1.00 136.78 ? 298 GLU B OE1   1 
ATOM   6805  O OE2   . GLU B 2 298 ? -10.450 -8.161  76.577  1.00 129.00 ? 298 GLU B OE2   1 
ATOM   6806  N N     . ALA B 2 299 ? -5.192  -6.353  77.115  1.00 113.32 ? 299 ALA B N     1 
ATOM   6807  C CA    . ALA B 2 299 ? -4.251  -5.343  76.645  1.00 106.50 ? 299 ALA B CA    1 
ATOM   6808  C C     . ALA B 2 299 ? -2.823  -5.837  76.858  1.00 107.12 ? 299 ALA B C     1 
ATOM   6809  O O     . ALA B 2 299 ? -1.998  -5.775  75.952  1.00 107.05 ? 299 ALA B O     1 
ATOM   6810  C CB    . ALA B 2 299 ? -4.474  -4.022  77.366  1.00 102.44 ? 299 ALA B CB    1 
ATOM   6811  N N     . GLU B 2 300 ? -2.541  -6.348  78.051  1.00 107.74 ? 300 GLU B N     1 
ATOM   6812  C CA    . GLU B 2 300 ? -1.226  -6.892  78.357  1.00 108.75 ? 300 GLU B CA    1 
ATOM   6813  C C     . GLU B 2 300 ? -0.761  -7.886  77.289  1.00 107.10 ? 300 GLU B C     1 
ATOM   6814  O O     . GLU B 2 300 ? 0.427   -7.976  76.974  1.00 101.87 ? 300 GLU B O     1 
ATOM   6815  C CB    . GLU B 2 300 ? -1.245  -7.564  79.729  1.00 112.87 ? 300 GLU B CB    1 
ATOM   6816  C CG    . GLU B 2 300 ? 0.072   -8.192  80.102  1.00 116.10 ? 300 GLU B CG    1 
ATOM   6817  C CD    . GLU B 2 300 ? 1.229   -7.240  79.889  1.00 112.77 ? 300 GLU B CD    1 
ATOM   6818  O OE1   . GLU B 2 300 ? 1.417   -6.349  80.747  1.00 108.76 ? 300 GLU B OE1   1 
ATOM   6819  O OE2   . GLU B 2 300 ? 1.938   -7.377  78.862  1.00 106.81 ? 300 GLU B OE2   1 
ATOM   6820  N N     . LEU B 2 301 ? -1.711  -8.633  76.736  1.00 110.27 ? 301 LEU B N     1 
ATOM   6821  C CA    . LEU B 2 301 ? -1.417  -9.590  75.676  1.00 111.18 ? 301 LEU B CA    1 
ATOM   6822  C C     . LEU B 2 301 ? -1.276  -8.880  74.328  1.00 105.75 ? 301 LEU B C     1 
ATOM   6823  O O     . LEU B 2 301 ? -0.547  -9.330  73.447  1.00 105.68 ? 301 LEU B O     1 
ATOM   6824  C CB    . LEU B 2 301 ? -2.501  -10.679 75.604  1.00 117.74 ? 301 LEU B CB    1 
ATOM   6825  C CG    . LEU B 2 301 ? -2.851  -11.460 76.887  1.00 124.28 ? 301 LEU B CG    1 
ATOM   6826  C CD1   . LEU B 2 301 ? -3.979  -12.475 76.650  1.00 122.59 ? 301 LEU B CD1   1 
ATOM   6827  C CD2   . LEU B 2 301 ? -1.626  -12.141 77.507  1.00 121.80 ? 301 LEU B CD2   1 
ATOM   6828  N N     . GLU B 2 302 ? -1.979  -7.766  74.174  1.00 102.20 ? 302 GLU B N     1 
ATOM   6829  C CA    . GLU B 2 302 ? -1.886  -6.977  72.960  1.00 96.53  ? 302 GLU B CA    1 
ATOM   6830  C C     . GLU B 2 302 ? -0.554  -6.251  72.900  1.00 94.91  ? 302 GLU B C     1 
ATOM   6831  O O     . GLU B 2 302 ? 0.053   -6.144  71.848  1.00 95.66  ? 302 GLU B O     1 
ATOM   6832  C CB    . GLU B 2 302 ? -3.011  -5.962  72.925  1.00 96.00  ? 302 GLU B CB    1 
ATOM   6833  C CG    . GLU B 2 302 ? -3.039  -5.126  71.681  1.00 92.27  ? 302 GLU B CG    1 
ATOM   6834  C CD    . GLU B 2 302 ? -3.870  -3.876  71.864  1.00 92.33  ? 302 GLU B CD    1 
ATOM   6835  O OE1   . GLU B 2 302 ? -3.416  -2.974  72.595  1.00 93.49  ? 302 GLU B OE1   1 
ATOM   6836  O OE2   . GLU B 2 302 ? -4.976  -3.793  71.287  1.00 92.76  ? 302 GLU B OE2   1 
ATOM   6837  N N     . LEU B 2 303 ? -0.107  -5.748  74.041  1.00 95.43  ? 303 LEU B N     1 
ATOM   6838  C CA    . LEU B 2 303 ? 1.158   -5.034  74.125  1.00 92.55  ? 303 LEU B CA    1 
ATOM   6839  C C     . LEU B 2 303 ? 2.318   -5.978  73.873  1.00 93.58  ? 303 LEU B C     1 
ATOM   6840  O O     . LEU B 2 303 ? 3.257   -5.640  73.158  1.00 92.61  ? 303 LEU B O     1 
ATOM   6841  C CB    . LEU B 2 303 ? 1.305   -4.366  75.499  1.00 92.53  ? 303 LEU B CB    1 
ATOM   6842  C CG    . LEU B 2 303 ? 2.688   -3.877  75.945  1.00 87.17  ? 303 LEU B CG    1 
ATOM   6843  C CD1   . LEU B 2 303 ? 3.230   -2.807  75.012  1.00 82.75  ? 303 LEU B CD1   1 
ATOM   6844  C CD2   . LEU B 2 303 ? 2.646   -3.368  77.370  1.00 83.02  ? 303 LEU B CD2   1 
ATOM   6845  N N     . ALA B 2 304 ? 2.249   -7.165  74.467  1.00 99.06  ? 304 ALA B N     1 
ATOM   6846  C CA    . ALA B 2 304 ? 3.296   -8.174  74.312  1.00 98.92  ? 304 ALA B CA    1 
ATOM   6847  C C     . ALA B 2 304 ? 3.341   -8.735  72.887  1.00 97.54  ? 304 ALA B C     1 
ATOM   6848  O O     . ALA B 2 304 ? 4.399   -9.122  72.398  1.00 95.63  ? 304 ALA B O     1 
ATOM   6849  C CB    . ALA B 2 304 ? 3.101   -9.297  75.328  1.00 100.62 ? 304 ALA B CB    1 
ATOM   6850  N N     . GLU B 2 305 ? 2.182   -8.769  72.231  1.00 99.14  ? 305 GLU B N     1 
ATOM   6851  C CA    . GLU B 2 305 ? 2.068   -9.241  70.856  1.00 99.89  ? 305 GLU B CA    1 
ATOM   6852  C C     . GLU B 2 305 ? 2.613   -8.201  69.877  1.00 99.81  ? 305 GLU B C     1 
ATOM   6853  O O     . GLU B 2 305 ? 3.134   -8.539  68.814  1.00 102.79 ? 305 GLU B O     1 
ATOM   6854  C CB    . GLU B 2 305 ? 0.607   -9.564  70.534  1.00 101.38 ? 305 GLU B CB    1 
ATOM   6855  C CG    . GLU B 2 305 ? 0.407   -10.822 69.692  1.00 109.76 ? 305 GLU B CG    1 
ATOM   6856  C CD    . GLU B 2 305 ? 0.498   -10.567 68.192  1.00 114.64 ? 305 GLU B CD    1 
ATOM   6857  O OE1   . GLU B 2 305 ? -0.490  -10.058 67.616  1.00 114.88 ? 305 GLU B OE1   1 
ATOM   6858  O OE2   . GLU B 2 305 ? 1.550   -10.887 67.587  1.00 113.58 ? 305 GLU B OE2   1 
ATOM   6859  N N     . ASN B 2 306 ? 2.489   -6.931  70.236  1.00 96.32  ? 306 ASN B N     1 
ATOM   6860  C CA    . ASN B 2 306 ? 3.054   -5.866  69.424  1.00 94.66  ? 306 ASN B CA    1 
ATOM   6861  C C     . ASN B 2 306 ? 4.575   -5.880  69.480  1.00 93.72  ? 306 ASN B C     1 
ATOM   6862  O O     . ASN B 2 306 ? 5.241   -5.852  68.447  1.00 93.15  ? 306 ASN B O     1 
ATOM   6863  C CB    . ASN B 2 306 ? 2.506   -4.504  69.855  1.00 88.13  ? 306 ASN B CB    1 
ATOM   6864  C CG    . ASN B 2 306 ? 1.122   -4.227  69.295  1.00 88.17  ? 306 ASN B CG    1 
ATOM   6865  O OD1   . ASN B 2 306 ? 0.818   -4.551  68.139  1.00 83.11  ? 306 ASN B OD1   1 
ATOM   6866  N ND2   . ASN B 2 306 ? 0.272   -3.616  70.115  1.00 89.17  ? 306 ASN B ND2   1 
ATOM   6867  N N     . ARG B 2 307 ? 5.118   -5.955  70.691  1.00 93.27  ? 307 ARG B N     1 
ATOM   6868  C CA    . ARG B 2 307 ? 6.557   -5.961  70.885  1.00 91.60  ? 307 ARG B CA    1 
ATOM   6869  C C     . ARG B 2 307 ? 7.161   -7.005  69.971  1.00 101.74 ? 307 ARG B C     1 
ATOM   6870  O O     . ARG B 2 307 ? 8.329   -6.904  69.591  1.00 103.77 ? 307 ARG B O     1 
ATOM   6871  C CB    . ARG B 2 307 ? 6.904   -6.320  72.327  1.00 94.85  ? 307 ARG B CB    1 
ATOM   6872  C CG    . ARG B 2 307 ? 6.860   -5.181  73.325  1.00 91.00  ? 307 ARG B CG    1 
ATOM   6873  C CD    . ARG B 2 307 ? 7.441   -5.658  74.628  1.00 89.73  ? 307 ARG B CD    1 
ATOM   6874  N NE    . ARG B 2 307 ? 7.712   -4.581  75.570  1.00 92.98  ? 307 ARG B NE    1 
ATOM   6875  C CZ    . ARG B 2 307 ? 6.967   -4.324  76.641  1.00 98.14  ? 307 ARG B CZ    1 
ATOM   6876  N NH1   . ARG B 2 307 ? 5.895   -5.067  76.894  1.00 96.87  ? 307 ARG B NH1   1 
ATOM   6877  N NH2   . ARG B 2 307 ? 7.294   -3.329  77.464  1.00 96.39  ? 307 ARG B NH2   1 
ATOM   6878  N N     . GLU B 2 308 ? 6.361   -8.022  69.644  1.00 104.45 ? 308 GLU B N     1 
ATOM   6879  C CA    . GLU B 2 308 ? 6.772   -9.086  68.728  1.00 106.05 ? 308 GLU B CA    1 
ATOM   6880  C C     . GLU B 2 308 ? 6.848   -8.591  67.287  1.00 104.65 ? 308 GLU B C     1 
ATOM   6881  O O     . GLU B 2 308 ? 7.885   -8.706  66.639  1.00 107.87 ? 308 GLU B O     1 
ATOM   6882  C CB    . GLU B 2 308 ? 5.815   -10.283 68.816  1.00 109.36 ? 308 GLU B CB    1 
ATOM   6883  C CG    . GLU B 2 308 ? 6.220   -11.483 67.942  1.00 118.61 ? 308 GLU B CG    1 
ATOM   6884  C CD    . GLU B 2 308 ? 5.147   -12.571 67.871  1.00 121.76 ? 308 GLU B CD    1 
ATOM   6885  O OE1   . GLU B 2 308 ? 3.944   -12.238 67.956  1.00 117.97 ? 308 GLU B OE1   1 
ATOM   6886  O OE2   . GLU B 2 308 ? 5.509   -13.761 67.727  1.00 122.07 ? 308 GLU B OE2   1 
ATOM   6887  N N     . ILE B 2 309 ? 5.757   -8.021  66.793  1.00 98.89  ? 309 ILE B N     1 
ATOM   6888  C CA    . ILE B 2 309 ? 5.716   -7.588  65.409  1.00 99.08  ? 309 ILE B CA    1 
ATOM   6889  C C     . ILE B 2 309 ? 6.806   -6.561  65.164  1.00 99.09  ? 309 ILE B C     1 
ATOM   6890  O O     . ILE B 2 309 ? 7.167   -6.280  64.022  1.00 99.56  ? 309 ILE B O     1 
ATOM   6891  C CB    . ILE B 2 309 ? 4.345   -7.008  65.049  1.00 97.63  ? 309 ILE B CB    1 
ATOM   6892  C CG1   . ILE B 2 309 ? 3.244   -7.911  65.612  1.00 99.12  ? 309 ILE B CG1   1 
ATOM   6893  C CG2   . ILE B 2 309 ? 4.213   -6.824  63.537  1.00 87.85  ? 309 ILE B CG2   1 
ATOM   6894  C CD1   . ILE B 2 309 ? 1.851   -7.388  65.397  1.00 96.40  ? 309 ILE B CD1   1 
ATOM   6895  N N     . LEU B 2 310 ? 7.337   -6.007  66.247  1.00 98.01  ? 310 LEU B N     1 
ATOM   6896  C CA    . LEU B 2 310 ? 8.399   -5.007  66.152  1.00 99.56  ? 310 LEU B CA    1 
ATOM   6897  C C     . LEU B 2 310 ? 9.796   -5.623  66.222  1.00 102.51 ? 310 LEU B C     1 
ATOM   6898  O O     . LEU B 2 310 ? 10.786  -4.899  66.207  1.00 102.18 ? 310 LEU B O     1 
ATOM   6899  C CB    . LEU B 2 310 ? 8.252   -3.912  67.229  1.00 98.21  ? 310 LEU B CB    1 
ATOM   6900  C CG    . LEU B 2 310 ? 7.193   -2.801  67.121  1.00 83.40  ? 310 LEU B CG    1 
ATOM   6901  C CD1   . LEU B 2 310 ? 7.207   -1.932  68.356  1.00 71.40  ? 310 LEU B CD1   1 
ATOM   6902  C CD2   . LEU B 2 310 ? 7.401   -1.955  65.890  1.00 80.41  ? 310 LEU B CD2   1 
ATOM   6903  N N     . LYS B 2 311 ? 9.884   -6.947  66.333  1.00 108.60 ? 311 LYS B N     1 
ATOM   6904  C CA    . LYS B 2 311 ? 11.167  -7.637  66.142  1.00 111.72 ? 311 LYS B CA    1 
ATOM   6905  C C     . LYS B 2 311 ? 11.302  -8.216  64.724  1.00 109.86 ? 311 LYS B C     1 
ATOM   6906  O O     . LYS B 2 311 ? 12.322  -8.809  64.373  1.00 108.47 ? 311 LYS B O     1 
ATOM   6907  C CB    . LYS B 2 311 ? 11.395  -8.726  67.200  1.00 110.67 ? 311 LYS B CB    1 
ATOM   6908  C CG    . LYS B 2 311 ? 11.655  -8.201  68.608  1.00 113.08 ? 311 LYS B CG    1 
ATOM   6909  C CD    . LYS B 2 311 ? 12.278  -9.279  69.494  1.00 119.52 ? 311 LYS B CD    1 
ATOM   6910  C CE    . LYS B 2 311 ? 11.687  -9.288  70.905  1.00 119.83 ? 311 LYS B CE    1 
ATOM   6911  N NZ    . LYS B 2 311 ? 10.294  -9.831  70.950  1.00 111.87 ? 311 LYS B NZ    1 
ATOM   6912  N N     . GLU B 2 312 ? 10.269  -8.028  63.911  1.00 108.74 ? 312 GLU B N     1 
ATOM   6913  C CA    . GLU B 2 312 ? 10.216  -8.633  62.588  1.00 110.31 ? 312 GLU B CA    1 
ATOM   6914  C C     . GLU B 2 312 ? 10.858  -7.739  61.530  1.00 108.66 ? 312 GLU B C     1 
ATOM   6915  O O     . GLU B 2 312 ? 11.281  -6.623  61.830  1.00 106.53 ? 312 GLU B O     1 
ATOM   6916  C CB    . GLU B 2 312 ? 8.757   -8.906  62.208  1.00 111.76 ? 312 GLU B CB    1 
ATOM   6917  C CG    . GLU B 2 312 ? 7.887   -9.444  63.346  1.00 113.43 ? 312 GLU B CG    1 
ATOM   6918  C CD    . GLU B 2 312 ? 8.281   -10.846 63.798  1.00 117.59 ? 312 GLU B CD    1 
ATOM   6919  O OE1   . GLU B 2 312 ? 9.300   -11.375 63.295  1.00 117.51 ? 312 GLU B OE1   1 
ATOM   6920  O OE2   . GLU B 2 312 ? 7.564   -11.416 64.658  1.00 117.11 ? 312 GLU B OE2   1 
ATOM   6921  N N     . PRO B 2 313 ? 10.937  -8.236  60.281  1.00 108.90 ? 313 PRO B N     1 
ATOM   6922  C CA    . PRO B 2 313 ? 11.328  -7.401  59.142  1.00 102.60 ? 313 PRO B CA    1 
ATOM   6923  C C     . PRO B 2 313 ? 10.084  -6.752  58.581  1.00 95.16  ? 313 PRO B C     1 
ATOM   6924  O O     . PRO B 2 313 ? 8.999   -6.994  59.092  1.00 96.53  ? 313 PRO B O     1 
ATOM   6925  C CB    . PRO B 2 313 ? 11.868  -8.421  58.139  1.00 102.88 ? 313 PRO B CB    1 
ATOM   6926  C CG    . PRO B 2 313 ? 11.080  -9.649  58.415  1.00 105.84 ? 313 PRO B CG    1 
ATOM   6927  C CD    . PRO B 2 313 ? 10.832  -9.660  59.905  1.00 108.59 ? 313 PRO B CD    1 
ATOM   6928  N N     . VAL B 2 314 ? 10.222  -5.956  57.537  1.00 89.12  ? 314 VAL B N     1 
ATOM   6929  C CA    . VAL B 2 314 ? 9.060   -5.304  56.974  1.00 83.50  ? 314 VAL B CA    1 
ATOM   6930  C C     . VAL B 2 314 ? 8.788   -5.866  55.587  1.00 84.25  ? 314 VAL B C     1 
ATOM   6931  O O     . VAL B 2 314 ? 9.656   -5.873  54.722  1.00 83.97  ? 314 VAL B O     1 
ATOM   6932  C CB    . VAL B 2 314 ? 9.255   -3.783  56.956  1.00 77.55  ? 314 VAL B CB    1 
ATOM   6933  C CG1   . VAL B 2 314 ? 8.023   -3.088  56.418  1.00 73.93  ? 314 VAL B CG1   1 
ATOM   6934  C CG2   . VAL B 2 314 ? 9.584   -3.296  58.353  1.00 72.90  ? 314 VAL B CG2   1 
ATOM   6935  N N     . HIS B 2 315 ? 7.581   -6.369  55.384  1.00 88.24  ? 315 HIS B N     1 
ATOM   6936  C CA    . HIS B 2 315 ? 7.237   -6.995  54.117  1.00 91.60  ? 315 HIS B CA    1 
ATOM   6937  C C     . HIS B 2 315 ? 7.562   -6.041  52.990  1.00 86.19  ? 315 HIS B C     1 
ATOM   6938  O O     . HIS B 2 315 ? 7.190   -4.877  53.052  1.00 84.06  ? 315 HIS B O     1 
ATOM   6939  C CB    . HIS B 2 315 ? 5.741   -7.350  54.090  1.00 99.22  ? 315 HIS B CB    1 
ATOM   6940  C CG    . HIS B 2 315 ? 5.247   -7.833  52.756  1.00 108.51 ? 315 HIS B CG    1 
ATOM   6941  N ND1   . HIS B 2 315 ? 5.865   -8.841  52.045  1.00 109.91 ? 315 HIS B ND1   1 
ATOM   6942  C CD2   . HIS B 2 315 ? 4.179   -7.450  52.007  1.00 107.82 ? 315 HIS B CD2   1 
ATOM   6943  C CE1   . HIS B 2 315 ? 5.207   -9.056  50.917  1.00 109.40 ? 315 HIS B CE1   1 
ATOM   6944  N NE2   . HIS B 2 315 ? 4.181   -8.222  50.872  1.00 110.07 ? 315 HIS B NE2   1 
ATOM   6945  N N     . GLY B 2 316 ? 8.273   -6.528  51.975  1.00 85.48  ? 316 GLY B N     1 
ATOM   6946  C CA    . GLY B 2 316 ? 8.405   -5.808  50.715  1.00 79.95  ? 316 GLY B CA    1 
ATOM   6947  C C     . GLY B 2 316 ? 9.345   -4.613  50.709  1.00 70.53  ? 316 GLY B C     1 
ATOM   6948  O O     . GLY B 2 316 ? 9.236   -3.729  49.848  1.00 64.30  ? 316 GLY B O     1 
ATOM   6949  N N     . VAL B 2 317 ? 10.268  -4.574  51.666  1.00 65.53  ? 317 VAL B N     1 
ATOM   6950  C CA    . VAL B 2 317 ? 11.271  -3.522  51.670  1.00 60.60  ? 317 VAL B CA    1 
ATOM   6951  C C     . VAL B 2 317 ? 12.531  -4.054  51.050  1.00 55.40  ? 317 VAL B C     1 
ATOM   6952  O O     . VAL B 2 317 ? 13.195  -4.914  51.636  1.00 57.39  ? 317 VAL B O     1 
ATOM   6953  C CB    . VAL B 2 317 ? 11.653  -3.061  53.088  1.00 61.31  ? 317 VAL B CB    1 
ATOM   6954  C CG1   . VAL B 2 317 ? 10.666  -2.046  53.611  1.00 57.10  ? 317 VAL B CG1   1 
ATOM   6955  C CG2   . VAL B 2 317 ? 11.797  -4.266  54.018  1.00 71.11  ? 317 VAL B CG2   1 
ATOM   6956  N N     . TYR B 2 318 ? 12.871  -3.538  49.874  1.00 49.35  ? 318 TYR B N     1 
ATOM   6957  C CA    . TYR B 2 318 ? 14.124  -3.895  49.225  1.00 45.04  ? 318 TYR B CA    1 
ATOM   6958  C C     . TYR B 2 318 ? 14.618  -2.738  48.389  1.00 42.18  ? 318 TYR B C     1 
ATOM   6959  O O     . TYR B 2 318 ? 13.833  -1.912  47.931  1.00 44.09  ? 318 TYR B O     1 
ATOM   6960  C CB    . TYR B 2 318 ? 13.975  -5.175  48.383  1.00 44.48  ? 318 TYR B CB    1 
ATOM   6961  C CG    . TYR B 2 318 ? 12.870  -5.136  47.361  1.00 43.03  ? 318 TYR B CG    1 
ATOM   6962  C CD1   . TYR B 2 318 ? 13.047  -4.508  46.136  1.00 45.57  ? 318 TYR B CD1   1 
ATOM   6963  C CD2   . TYR B 2 318 ? 11.665  -5.731  47.608  1.00 43.63  ? 318 TYR B CD2   1 
ATOM   6964  C CE1   . TYR B 2 318 ? 12.038  -4.469  45.201  1.00 42.69  ? 318 TYR B CE1   1 
ATOM   6965  C CE2   . TYR B 2 318 ? 10.659  -5.696  46.687  1.00 42.62  ? 318 TYR B CE2   1 
ATOM   6966  C CZ    . TYR B 2 318 ? 10.847  -5.069  45.486  1.00 40.57  ? 318 TYR B CZ    1 
ATOM   6967  O OH    . TYR B 2 318 ? 9.829   -5.051  44.569  1.00 41.27  ? 318 TYR B OH    1 
ATOM   6968  N N     . TYR B 2 319 ? 15.922  -2.668  48.195  1.00 40.53  ? 319 TYR B N     1 
ATOM   6969  C CA    . TYR B 2 319 ? 16.494  -1.566  47.433  1.00 41.70  ? 319 TYR B CA    1 
ATOM   6970  C C     . TYR B 2 319 ? 16.196  -1.717  45.932  1.00 44.59  ? 319 TYR B C     1 
ATOM   6971  O O     . TYR B 2 319 ? 16.300  -2.814  45.393  1.00 51.47  ? 319 TYR B O     1 
ATOM   6972  C CB    . TYR B 2 319 ? 17.991  -1.456  47.738  1.00 38.17  ? 319 TYR B CB    1 
ATOM   6973  C CG    . TYR B 2 319 ? 18.772  -0.633  46.765  1.00 40.64  ? 319 TYR B CG    1 
ATOM   6974  C CD1   . TYR B 2 319 ? 18.666  0.742   46.730  1.00 42.36  ? 319 TYR B CD1   1 
ATOM   6975  C CD2   . TYR B 2 319 ? 19.634  -1.231  45.890  1.00 44.16  ? 319 TYR B CD2   1 
ATOM   6976  C CE1   . TYR B 2 319 ? 19.391  1.486   45.829  1.00 42.33  ? 319 TYR B CE1   1 
ATOM   6977  C CE2   . TYR B 2 319 ? 20.354  -0.502  44.999  1.00 44.00  ? 319 TYR B CE2   1 
ATOM   6978  C CZ    . TYR B 2 319 ? 20.238  0.847   44.968  1.00 42.12  ? 319 TYR B CZ    1 
ATOM   6979  O OH    . TYR B 2 319 ? 20.979  1.529   44.042  1.00 44.46  ? 319 TYR B OH    1 
ATOM   6980  N N     . ASP B 2 320 ? 15.764  -0.641  45.280  1.00 41.74  ? 320 ASP B N     1 
ATOM   6981  C CA    . ASP B 2 320 ? 15.518  -0.640  43.844  1.00 40.73  ? 320 ASP B CA    1 
ATOM   6982  C C     . ASP B 2 320 ? 16.553  0.288   43.230  1.00 43.69  ? 320 ASP B C     1 
ATOM   6983  O O     . ASP B 2 320 ? 16.538  1.483   43.461  1.00 44.39  ? 320 ASP B O     1 
ATOM   6984  C CB    . ASP B 2 320 ? 14.077  -0.181  43.536  1.00 41.37  ? 320 ASP B CB    1 
ATOM   6985  C CG    . ASP B 2 320 ? 13.836  0.158   42.043  1.00 45.71  ? 320 ASP B CG    1 
ATOM   6986  O OD1   . ASP B 2 320 ? 14.797  0.350   41.267  1.00 44.89  ? 320 ASP B OD1   1 
ATOM   6987  O OD2   . ASP B 2 320 ? 12.660  0.268   41.639  1.00 44.84  ? 320 ASP B OD2   1 
ATOM   6988  N N     . PRO B 2 321 ? 17.488  -0.270  42.463  1.00 45.22  ? 321 PRO B N     1 
ATOM   6989  C CA    . PRO B 2 321 ? 18.545  0.522   41.843  1.00 44.62  ? 321 PRO B CA    1 
ATOM   6990  C C     . PRO B 2 321 ? 18.130  1.786   41.129  1.00 42.61  ? 321 PRO B C     1 
ATOM   6991  O O     . PRO B 2 321 ? 18.931  2.704   41.113  1.00 44.96  ? 321 PRO B O     1 
ATOM   6992  C CB    . PRO B 2 321 ? 19.150  -0.471  40.856  1.00 41.87  ? 321 PRO B CB    1 
ATOM   6993  C CG    . PRO B 2 321 ? 19.148  -1.727  41.649  1.00 43.68  ? 321 PRO B CG    1 
ATOM   6994  C CD    . PRO B 2 321 ? 17.841  -1.697  42.446  1.00 44.94  ? 321 PRO B CD    1 
ATOM   6995  N N     . SER B 2 322 ? 16.951  1.847   40.534  1.00 41.43  ? 322 SER B N     1 
ATOM   6996  C CA    . SER B 2 322 ? 16.644  2.997   39.697  1.00 42.71  ? 322 SER B CA    1 
ATOM   6997  C C     . SER B 2 322 ? 16.234  4.204   40.520  1.00 48.91  ? 322 SER B C     1 
ATOM   6998  O O     . SER B 2 322 ? 16.388  5.341   40.080  1.00 57.67  ? 322 SER B O     1 
ATOM   6999  C CB    . SER B 2 322 ? 15.522  2.685   38.742  1.00 43.87  ? 322 SER B CB    1 
ATOM   7000  O OG    . SER B 2 322 ? 14.316  2.623   39.474  1.00 50.38  ? 322 SER B OG    1 
ATOM   7001  N N     . LYS B 2 323 ? 15.685  3.959   41.702  1.00 45.24  ? 323 LYS B N     1 
ATOM   7002  C CA    . LYS B 2 323 ? 15.167  5.021   42.550  1.00 45.57  ? 323 LYS B CA    1 
ATOM   7003  C C     . LYS B 2 323 ? 16.267  5.660   43.395  1.00 43.63  ? 323 LYS B C     1 
ATOM   7004  O O     . LYS B 2 323 ? 17.220  4.984   43.761  1.00 42.52  ? 323 LYS B O     1 
ATOM   7005  C CB    . LYS B 2 323 ? 14.060  4.460   43.444  1.00 45.30  ? 323 LYS B CB    1 
ATOM   7006  C CG    . LYS B 2 323 ? 12.846  3.882   42.710  1.00 42.01  ? 323 LYS B CG    1 
ATOM   7007  C CD    . LYS B 2 323 ? 11.859  3.374   43.755  1.00 45.60  ? 323 LYS B CD    1 
ATOM   7008  C CE    . LYS B 2 323 ? 10.703  2.578   43.185  1.00 45.98  ? 323 LYS B CE    1 
ATOM   7009  N NZ    . LYS B 2 323 ? 10.180  1.637   44.234  1.00 52.84  ? 323 LYS B NZ    1 
ATOM   7010  N N     . ASP B 2 324 ? 16.140  6.959   43.694  1.00 48.54  ? 324 ASP B N     1 
ATOM   7011  C CA    . ASP B 2 324 ? 17.102  7.667   44.568  1.00 44.39  ? 324 ASP B CA    1 
ATOM   7012  C C     . ASP B 2 324 ? 16.885  7.329   46.019  1.00 41.30  ? 324 ASP B C     1 
ATOM   7013  O O     . ASP B 2 324 ? 15.755  7.060   46.438  1.00 39.54  ? 324 ASP B O     1 
ATOM   7014  C CB    . ASP B 2 324 ? 17.001  9.187   44.459  1.00 42.92  ? 324 ASP B CB    1 
ATOM   7015  C CG    . ASP B 2 324 ? 16.802  9.664   43.045  1.00 61.51  ? 324 ASP B CG    1 
ATOM   7016  O OD1   . ASP B 2 324 ? 17.607  10.520  42.600  1.00 63.46  ? 324 ASP B OD1   1 
ATOM   7017  O OD2   . ASP B 2 324 ? 15.826  9.198   42.391  1.00 68.18  ? 324 ASP B OD2   1 
ATOM   7018  N N     . LEU B 2 325 ? 17.978  7.357   46.778  1.00 38.70  ? 325 LEU B N     1 
ATOM   7019  C CA    . LEU B 2 325 ? 17.915  7.224   48.234  1.00 36.74  ? 325 LEU B CA    1 
ATOM   7020  C C     . LEU B 2 325 ? 17.608  8.568   48.937  1.00 36.50  ? 325 LEU B C     1 
ATOM   7021  O O     . LEU B 2 325 ? 17.982  9.655   48.464  1.00 34.21  ? 325 LEU B O     1 
ATOM   7022  C CB    . LEU B 2 325 ? 19.209  6.627   48.788  1.00 35.31  ? 325 LEU B CB    1 
ATOM   7023  C CG    . LEU B 2 325 ? 19.668  5.213   48.437  1.00 35.85  ? 325 LEU B CG    1 
ATOM   7024  C CD1   . LEU B 2 325 ? 21.124  5.088   48.783  1.00 36.92  ? 325 LEU B CD1   1 
ATOM   7025  C CD2   . LEU B 2 325 ? 18.887  4.178   49.181  1.00 37.31  ? 325 LEU B CD2   1 
ATOM   7026  N N     . ILE B 2 326 ? 16.912  8.475   50.064  1.00 33.39  ? 326 ILE B N     1 
ATOM   7027  C CA    . ILE B 2 326 ? 16.509  9.644   50.832  1.00 32.85  ? 326 ILE B CA    1 
ATOM   7028  C C     . ILE B 2 326 ? 16.831  9.407   52.297  1.00 34.31  ? 326 ILE B C     1 
ATOM   7029  O O     . ILE B 2 326 ? 16.522  8.352   52.846  1.00 38.27  ? 326 ILE B O     1 
ATOM   7030  C CB    . ILE B 2 326 ? 15.005  9.954   50.611  1.00 33.28  ? 326 ILE B CB    1 
ATOM   7031  C CG1   . ILE B 2 326 ? 14.824  10.535  49.209  1.00 33.04  ? 326 ILE B CG1   1 
ATOM   7032  C CG2   . ILE B 2 326 ? 14.475  10.892  51.665  1.00 30.92  ? 326 ILE B CG2   1 
ATOM   7033  C CD1   . ILE B 2 326 ? 13.483  11.124  48.961  1.00 35.48  ? 326 ILE B CD1   1 
ATOM   7034  N N     . ALA B 2 327 ? 17.497  10.362  52.928  1.00 32.55  ? 327 ALA B N     1 
ATOM   7035  C CA    . ALA B 2 327 ? 17.872  10.188  54.327  1.00 32.73  ? 327 ALA B CA    1 
ATOM   7036  C C     . ALA B 2 327 ? 17.286  11.280  55.211  1.00 35.50  ? 327 ALA B C     1 
ATOM   7037  O O     . ALA B 2 327 ? 17.365  12.485  54.893  1.00 35.89  ? 327 ALA B O     1 
ATOM   7038  C CB    . ALA B 2 327 ? 19.361  10.143  54.476  1.00 30.64  ? 327 ALA B CB    1 
ATOM   7039  N N     . GLU B 2 328 ? 16.697  10.844  56.318  1.00 32.72  ? 328 GLU B N     1 
ATOM   7040  C CA    . GLU B 2 328 ? 16.104  11.758  57.275  1.00 33.68  ? 328 GLU B CA    1 
ATOM   7041  C C     . GLU B 2 328 ? 16.834  11.719  58.617  1.00 36.08  ? 328 GLU B C     1 
ATOM   7042  O O     . GLU B 2 328 ? 17.158  10.644  59.129  1.00 36.49  ? 328 GLU B O     1 
ATOM   7043  C CB    . GLU B 2 328 ? 14.611  11.476  57.427  1.00 31.88  ? 328 GLU B CB    1 
ATOM   7044  C CG    . GLU B 2 328 ? 13.766  12.166  56.359  1.00 32.51  ? 328 GLU B CG    1 
ATOM   7045  C CD    . GLU B 2 328 ? 12.269  11.857  56.456  1.00 35.77  ? 328 GLU B CD    1 
ATOM   7046  O OE1   . GLU B 2 328 ? 11.538  12.211  55.506  1.00 35.87  ? 328 GLU B OE1   1 
ATOM   7047  O OE2   . GLU B 2 328 ? 11.817  11.260  57.462  1.00 34.29  ? 328 GLU B OE2   1 
ATOM   7048  N N     . ILE B 2 329 ? 17.104  12.903  59.169  1.00 32.87  ? 329 ILE B N     1 
ATOM   7049  C CA    . ILE B 2 329 ? 17.817  13.024  60.432  1.00 31.19  ? 329 ILE B CA    1 
ATOM   7050  C C     . ILE B 2 329 ? 16.969  13.762  61.463  1.00 30.24  ? 329 ILE B C     1 
ATOM   7051  O O     . ILE B 2 329 ? 16.451  14.818  61.168  1.00 32.33  ? 329 ILE B O     1 
ATOM   7052  C CB    . ILE B 2 329 ? 19.142  13.791  60.216  1.00 29.07  ? 329 ILE B CB    1 
ATOM   7053  C CG1   . ILE B 2 329 ? 20.005  13.049  59.206  1.00 29.14  ? 329 ILE B CG1   1 
ATOM   7054  C CG2   . ILE B 2 329 ? 19.889  14.025  61.544  1.00 27.71  ? 329 ILE B CG2   1 
ATOM   7055  C CD1   . ILE B 2 329 ? 21.234  13.751  58.848  1.00 28.86  ? 329 ILE B CD1   1 
ATOM   7056  N N     . GLN B 2 330 ? 16.819  13.201  62.661  1.00 29.73  ? 330 GLN B N     1 
ATOM   7057  C CA    . GLN B 2 330 ? 16.183  13.896  63.782  1.00 29.38  ? 330 GLN B CA    1 
ATOM   7058  C C     . GLN B 2 330 ? 17.171  14.132  64.917  1.00 31.47  ? 330 GLN B C     1 
ATOM   7059  O O     . GLN B 2 330 ? 17.936  13.239  65.271  1.00 32.02  ? 330 GLN B O     1 
ATOM   7060  C CB    . GLN B 2 330 ? 15.010  13.090  64.317  1.00 28.50  ? 330 GLN B CB    1 
ATOM   7061  C CG    . GLN B 2 330 ? 13.981  12.759  63.265  1.00 36.08  ? 330 GLN B CG    1 
ATOM   7062  C CD    . GLN B 2 330 ? 14.289  11.467  62.514  1.00 36.79  ? 330 GLN B CD    1 
ATOM   7063  O OE1   . GLN B 2 330 ? 14.932  10.571  63.045  1.00 35.34  ? 330 GLN B OE1   1 
ATOM   7064  N NE2   . GLN B 2 330 ? 13.832  11.381  61.275  1.00 33.51  ? 330 GLN B NE2   1 
ATOM   7065  N N     . LYS B 2 331 ? 17.132  15.329  65.496  1.00 28.22  ? 331 LYS B N     1 
ATOM   7066  C CA    . LYS B 2 331 ? 17.948  15.666  66.656  1.00 27.21  ? 331 LYS B CA    1 
ATOM   7067  C C     . LYS B 2 331 ? 17.251  15.238  67.952  1.00 30.49  ? 331 LYS B C     1 
ATOM   7068  O O     . LYS B 2 331 ? 16.201  15.732  68.290  1.00 36.76  ? 331 LYS B O     1 
ATOM   7069  C CB    . LYS B 2 331 ? 18.179  17.168  66.609  1.00 28.39  ? 331 LYS B CB    1 
ATOM   7070  C CG    . LYS B 2 331 ? 18.576  17.836  67.867  1.00 28.94  ? 331 LYS B CG    1 
ATOM   7071  C CD    . LYS B 2 331 ? 18.662  19.320  67.642  1.00 29.85  ? 331 LYS B CD    1 
ATOM   7072  C CE    . LYS B 2 331 ? 19.074  20.023  68.923  1.00 32.80  ? 331 LYS B CE    1 
ATOM   7073  N NZ    . LYS B 2 331 ? 18.867  21.484  68.902  1.00 33.19  ? 331 LYS B NZ    1 
ATOM   7074  N N     . GLN B 2 332 ? 17.827  14.296  68.677  1.00 32.63  ? 332 GLN B N     1 
ATOM   7075  C CA    . GLN B 2 332 ? 17.147  13.715  69.828  1.00 35.47  ? 332 GLN B CA    1 
ATOM   7076  C C     . GLN B 2 332 ? 17.545  14.327  71.160  1.00 37.90  ? 332 GLN B C     1 
ATOM   7077  O O     . GLN B 2 332 ? 17.006  13.958  72.200  1.00 41.10  ? 332 GLN B O     1 
ATOM   7078  C CB    . GLN B 2 332 ? 17.403  12.212  69.894  1.00 39.83  ? 332 GLN B CB    1 
ATOM   7079  C CG    . GLN B 2 332 ? 16.724  11.430  68.831  1.00 41.71  ? 332 GLN B CG    1 
ATOM   7080  C CD    . GLN B 2 332 ? 15.237  11.382  69.009  1.00 50.52  ? 332 GLN B CD    1 
ATOM   7081  O OE1   . GLN B 2 332 ? 14.717  11.639  70.098  1.00 58.63  ? 332 GLN B OE1   1 
ATOM   7082  N NE2   . GLN B 2 332 ? 14.533  11.043  67.942  1.00 52.36  ? 332 GLN B NE2   1 
ATOM   7083  N N     . GLY B 2 333 ? 18.495  15.251  71.130  1.00 37.83  ? 333 GLY B N     1 
ATOM   7084  C CA    . GLY B 2 333 ? 19.043  15.820  72.340  1.00 37.51  ? 333 GLY B CA    1 
ATOM   7085  C C     . GLY B 2 333 ? 20.172  15.013  72.973  1.00 45.52  ? 333 GLY B C     1 
ATOM   7086  O O     . GLY B 2 333 ? 20.318  13.793  72.770  1.00 40.18  ? 333 GLY B O     1 
ATOM   7087  N N     . GLN B 2 334 ? 20.975  15.727  73.756  1.00 45.90  ? 334 GLN B N     1 
ATOM   7088  C CA    . GLN B 2 334 ? 22.067  15.141  74.514  1.00 45.07  ? 334 GLN B CA    1 
ATOM   7089  C C     . GLN B 2 334 ? 22.968  14.268  73.660  1.00 41.32  ? 334 GLN B C     1 
ATOM   7090  O O     . GLN B 2 334 ? 23.273  13.113  73.991  1.00 43.51  ? 334 GLN B O     1 
ATOM   7091  C CB    . GLN B 2 334 ? 21.519  14.431  75.733  1.00 49.42  ? 334 GLN B CB    1 
ATOM   7092  C CG    . GLN B 2 334 ? 20.922  15.435  76.703  1.00 62.04  ? 334 GLN B CG    1 
ATOM   7093  C CD    . GLN B 2 334 ? 20.150  14.751  77.815  1.00 94.73  ? 334 GLN B CD    1 
ATOM   7094  O OE1   . GLN B 2 334 ? 19.650  13.626  77.642  1.00 92.36  ? 334 GLN B OE1   1 
ATOM   7095  N NE2   . GLN B 2 334 ? 20.052  15.416  78.971  1.00 100.72 ? 334 GLN B NE2   1 
ATOM   7096  N N     . GLY B 2 335 ? 23.386  14.862  72.548  1.00 38.06  ? 335 GLY B N     1 
ATOM   7097  C CA    . GLY B 2 335 ? 24.284  14.236  71.611  1.00 35.59  ? 335 GLY B CA    1 
ATOM   7098  C C     . GLY B 2 335 ? 23.729  13.128  70.742  1.00 37.99  ? 335 GLY B C     1 
ATOM   7099  O O     . GLY B 2 335 ? 24.463  12.594  69.928  1.00 36.28  ? 335 GLY B O     1 
ATOM   7100  N N     . GLN B 2 336 ? 22.459  12.764  70.877  1.00 37.80  ? 336 GLN B N     1 
ATOM   7101  C CA    . GLN B 2 336 ? 21.966  11.711  70.001  1.00 38.17  ? 336 GLN B CA    1 
ATOM   7102  C C     . GLN B 2 336 ? 21.297  12.276  68.786  1.00 35.36  ? 336 GLN B C     1 
ATOM   7103  O O     . GLN B 2 336 ? 20.645  13.307  68.864  1.00 33.76  ? 336 GLN B O     1 
ATOM   7104  C CB    . GLN B 2 336 ? 21.006  10.765  70.699  1.00 43.24  ? 336 GLN B CB    1 
ATOM   7105  C CG    . GLN B 2 336 ? 21.088  10.830  72.169  1.00 49.45  ? 336 GLN B CG    1 
ATOM   7106  C CD    . GLN B 2 336 ? 21.283  9.482   72.766  1.00 51.62  ? 336 GLN B CD    1 
ATOM   7107  O OE1   . GLN B 2 336 ? 22.202  8.759   72.388  1.00 54.10  ? 336 GLN B OE1   1 
ATOM   7108  N NE2   . GLN B 2 336 ? 20.424  9.125   73.713  1.00 52.46  ? 336 GLN B NE2   1 
ATOM   7109  N N     . TRP B 2 337 ? 21.495  11.586  67.664  1.00 34.30  ? 337 TRP B N     1 
ATOM   7110  C CA    . TRP B 2 337 ? 20.816  11.881  66.414  1.00 34.40  ? 337 TRP B CA    1 
ATOM   7111  C C     . TRP B 2 337 ? 20.315  10.568  65.792  1.00 35.74  ? 337 TRP B C     1 
ATOM   7112  O O     . TRP B 2 337 ? 21.034  9.605   65.725  1.00 36.65  ? 337 TRP B O     1 
ATOM   7113  C CB    . TRP B 2 337 ? 21.750  12.628  65.443  1.00 28.47  ? 337 TRP B CB    1 
ATOM   7114  C CG    . TRP B 2 337 ? 22.364  13.868  66.011  1.00 30.02  ? 337 TRP B CG    1 
ATOM   7115  C CD1   . TRP B 2 337 ? 23.348  13.927  66.955  1.00 30.55  ? 337 TRP B CD1   1 
ATOM   7116  C CD2   . TRP B 2 337 ? 22.052  15.233  65.678  1.00 27.75  ? 337 TRP B CD2   1 
ATOM   7117  N NE1   . TRP B 2 337 ? 23.665  15.231  67.235  1.00 29.35  ? 337 TRP B NE1   1 
ATOM   7118  C CE2   . TRP B 2 337 ? 22.887  16.055  66.469  1.00 29.24  ? 337 TRP B CE2   1 
ATOM   7119  C CE3   . TRP B 2 337 ? 21.154  15.835  64.798  1.00 25.96  ? 337 TRP B CE3   1 
ATOM   7120  C CZ2   . TRP B 2 337 ? 22.847  17.440  66.407  1.00 27.92  ? 337 TRP B CZ2   1 
ATOM   7121  C CZ3   . TRP B 2 337 ? 21.117  17.203  64.724  1.00 26.46  ? 337 TRP B CZ3   1 
ATOM   7122  C CH2   . TRP B 2 337 ? 21.954  17.997  65.528  1.00 31.65  ? 337 TRP B CH2   1 
ATOM   7123  N N     . THR B 2 338 ? 19.086  10.529  65.315  1.00 34.28  ? 338 THR B N     1 
ATOM   7124  C CA    . THR B 2 338 ? 18.617  9.329   64.651  1.00 33.53  ? 338 THR B CA    1 
ATOM   7125  C C     . THR B 2 338 ? 18.473  9.576   63.159  1.00 36.48  ? 338 THR B C     1 
ATOM   7126  O O     . THR B 2 338 ? 18.278  10.713  62.724  1.00 35.98  ? 338 THR B O     1 
ATOM   7127  C CB    . THR B 2 338 ? 17.292  8.849   65.238  1.00 38.02  ? 338 THR B CB    1 
ATOM   7128  O OG1   . THR B 2 338 ? 16.301  9.875   65.098  1.00 35.10  ? 338 THR B OG1   1 
ATOM   7129  C CG2   . THR B 2 338 ? 17.470  8.488   66.716  1.00 40.87  ? 338 THR B CG2   1 
ATOM   7130  N N     . TYR B 2 339 ? 18.609  8.524   62.359  1.00 36.50  ? 339 TYR B N     1 
ATOM   7131  C CA    . TYR B 2 339 ? 18.406  8.674   60.917  1.00 35.72  ? 339 TYR B CA    1 
ATOM   7132  C C     . TYR B 2 339 ? 17.671  7.491   60.304  1.00 38.26  ? 339 TYR B C     1 
ATOM   7133  O O     . TYR B 2 339 ? 17.618  6.401   60.890  1.00 40.10  ? 339 TYR B O     1 
ATOM   7134  C CB    . TYR B 2 339 ? 19.729  8.943   60.185  1.00 33.50  ? 339 TYR B CB    1 
ATOM   7135  C CG    . TYR B 2 339 ? 20.692  7.797   60.221  1.00 35.80  ? 339 TYR B CG    1 
ATOM   7136  C CD1   . TYR B 2 339 ? 20.744  6.878   59.178  1.00 39.83  ? 339 TYR B CD1   1 
ATOM   7137  C CD2   . TYR B 2 339 ? 21.541  7.616   61.295  1.00 35.92  ? 339 TYR B CD2   1 
ATOM   7138  C CE1   . TYR B 2 339 ? 21.622  5.799   59.212  1.00 41.80  ? 339 TYR B CE1   1 
ATOM   7139  C CE2   . TYR B 2 339 ? 22.420  6.553   61.339  1.00 39.76  ? 339 TYR B CE2   1 
ATOM   7140  C CZ    . TYR B 2 339 ? 22.459  5.641   60.299  1.00 41.31  ? 339 TYR B CZ    1 
ATOM   7141  O OH    . TYR B 2 339 ? 23.337  4.582   60.338  1.00 36.63  ? 339 TYR B OH    1 
ATOM   7142  N N     . GLN B 2 340 ? 17.069  7.724   59.139  1.00 36.91  ? 340 GLN B N     1 
ATOM   7143  C CA    . GLN B 2 340 ? 16.460  6.654   58.348  1.00 35.23  ? 340 GLN B CA    1 
ATOM   7144  C C     . GLN B 2 340 ? 16.727  6.858   56.867  1.00 37.15  ? 340 GLN B C     1 
ATOM   7145  O O     . GLN B 2 340 ? 16.486  7.938   56.339  1.00 38.62  ? 340 GLN B O     1 
ATOM   7146  C CB    . GLN B 2 340 ? 14.957  6.582   58.578  1.00 33.51  ? 340 GLN B CB    1 
ATOM   7147  C CG    . GLN B 2 340 ? 14.550  6.446   60.015  1.00 36.22  ? 340 GLN B CG    1 
ATOM   7148  C CD    . GLN B 2 340 ? 14.450  7.777   60.702  1.00 37.21  ? 340 GLN B CD    1 
ATOM   7149  O OE1   . GLN B 2 340 ? 14.086  8.775   60.089  1.00 39.46  ? 340 GLN B OE1   1 
ATOM   7150  N NE2   . GLN B 2 340 ? 14.773  7.805   61.980  1.00 37.07  ? 340 GLN B NE2   1 
ATOM   7151  N N     . ILE B 2 341 ? 17.242  5.828   56.201  1.00 37.83  ? 341 ILE B N     1 
ATOM   7152  C CA    . ILE B 2 341 ? 17.394  5.849   54.749  1.00 36.26  ? 341 ILE B CA    1 
ATOM   7153  C C     . ILE B 2 341 ? 16.310  4.975   54.135  1.00 37.99  ? 341 ILE B C     1 
ATOM   7154  O O     . ILE B 2 341 ? 16.083  3.819   54.565  1.00 40.02  ? 341 ILE B O     1 
ATOM   7155  C CB    . ILE B 2 341 ? 18.765  5.331   54.270  1.00 35.44  ? 341 ILE B CB    1 
ATOM   7156  C CG1   . ILE B 2 341 ? 19.908  5.858   55.137  1.00 34.35  ? 341 ILE B CG1   1 
ATOM   7157  C CG2   . ILE B 2 341 ? 18.985  5.703   52.817  1.00 34.70  ? 341 ILE B CG2   1 
ATOM   7158  C CD1   . ILE B 2 341 ? 21.206  5.142   54.878  1.00 31.74  ? 341 ILE B CD1   1 
ATOM   7159  N N     . TYR B 2 342 ? 15.654  5.542   53.130  1.00 35.66  ? 342 TYR B N     1 
ATOM   7160  C CA    . TYR B 2 342 ? 14.504  4.925   52.506  1.00 36.63  ? 342 TYR B CA    1 
ATOM   7161  C C     . TYR B 2 342 ? 14.372  5.432   51.091  1.00 38.10  ? 342 TYR B C     1 
ATOM   7162  O O     . TYR B 2 342 ? 14.895  6.499   50.792  1.00 38.02  ? 342 TYR B O     1 
ATOM   7163  C CB    . TYR B 2 342 ? 13.252  5.284   53.294  1.00 37.12  ? 342 TYR B CB    1 
ATOM   7164  C CG    . TYR B 2 342 ? 12.864  6.762   53.324  1.00 37.77  ? 342 TYR B CG    1 
ATOM   7165  C CD1   . TYR B 2 342 ? 12.161  7.333   52.278  1.00 34.98  ? 342 TYR B CD1   1 
ATOM   7166  C CD2   . TYR B 2 342 ? 13.149  7.567   54.441  1.00 37.74  ? 342 TYR B CD2   1 
ATOM   7167  C CE1   . TYR B 2 342 ? 11.776  8.642   52.319  1.00 37.59  ? 342 TYR B CE1   1 
ATOM   7168  C CE2   . TYR B 2 342 ? 12.762  8.894   54.494  1.00 32.61  ? 342 TYR B CE2   1 
ATOM   7169  C CZ    . TYR B 2 342 ? 12.073  9.427   53.425  1.00 37.13  ? 342 TYR B CZ    1 
ATOM   7170  O OH    . TYR B 2 342 ? 11.679  10.751  53.424  1.00 36.76  ? 342 TYR B OH    1 
ATOM   7171  N N     . GLN B 2 343 ? 13.753  4.654   50.197  1.00 38.82  ? 343 GLN B N     1 
ATOM   7172  C CA    . GLN B 2 343 ? 13.348  5.201   48.900  1.00 37.38  ? 343 GLN B CA    1 
ATOM   7173  C C     . GLN B 2 343 ? 11.873  5.550   48.766  1.00 39.87  ? 343 GLN B C     1 
ATOM   7174  O O     . GLN B 2 343 ? 11.484  6.287   47.857  1.00 37.28  ? 343 GLN B O     1 
ATOM   7175  C CB    . GLN B 2 343 ? 13.752  4.258   47.774  1.00 39.54  ? 343 GLN B CB    1 
ATOM   7176  C CG    . GLN B 2 343 ? 15.243  4.162   47.560  1.00 40.70  ? 343 GLN B CG    1 
ATOM   7177  C CD    . GLN B 2 343 ? 15.606  2.919   46.826  1.00 41.90  ? 343 GLN B CD    1 
ATOM   7178  O OE1   . GLN B 2 343 ? 15.805  1.871   47.426  1.00 41.56  ? 343 GLN B OE1   1 
ATOM   7179  N NE2   . GLN B 2 343 ? 15.666  3.012   45.516  1.00 42.71  ? 343 GLN B NE2   1 
ATOM   7180  N N     . GLU B 2 344 ? 11.062  5.019   49.676  1.00 41.70  ? 344 GLU B N     1 
ATOM   7181  C CA    . GLU B 2 344 ? 9.618   5.270   49.676  1.00 45.12  ? 344 GLU B CA    1 
ATOM   7182  C C     . GLU B 2 344 ? 9.111   5.332   51.124  1.00 45.97  ? 344 GLU B C     1 
ATOM   7183  O O     . GLU B 2 344 ? 9.499   4.514   51.960  1.00 41.82  ? 344 GLU B O     1 
ATOM   7184  C CB    . GLU B 2 344 ? 8.860   4.161   48.923  1.00 45.81  ? 344 GLU B CB    1 
ATOM   7185  C CG    . GLU B 2 344 ? 9.363   3.833   47.524  1.00 47.03  ? 344 GLU B CG    1 
ATOM   7186  C CD    . GLU B 2 344 ? 8.552   4.506   46.438  1.00 60.83  ? 344 GLU B CD    1 
ATOM   7187  O OE1   . GLU B 2 344 ? 7.529   5.146   46.787  1.00 65.56  ? 344 GLU B OE1   1 
ATOM   7188  O OE2   . GLU B 2 344 ? 8.936   4.403   45.241  1.00 59.91  ? 344 GLU B OE2   1 
ATOM   7189  N N     . PRO B 2 345 ? 8.181   6.250   51.406  1.00 44.80  ? 345 PRO B N     1 
ATOM   7190  C CA    . PRO B 2 345 ? 7.815   6.438   52.805  1.00 43.16  ? 345 PRO B CA    1 
ATOM   7191  C C     . PRO B 2 345 ? 7.524   5.124   53.526  1.00 44.78  ? 345 PRO B C     1 
ATOM   7192  O O     . PRO B 2 345 ? 6.912   4.232   52.997  1.00 44.29  ? 345 PRO B O     1 
ATOM   7193  C CB    . PRO B 2 345 ? 6.558   7.308   52.727  1.00 46.85  ? 345 PRO B CB    1 
ATOM   7194  C CG    . PRO B 2 345 ? 6.369   7.655   51.252  1.00 46.33  ? 345 PRO B CG    1 
ATOM   7195  C CD    . PRO B 2 345 ? 7.619   7.296   50.541  1.00 43.92  ? 345 PRO B CD    1 
ATOM   7196  N N     . PHE B 2 346 ? 8.030   5.009   54.742  1.00 51.91  ? 346 PHE B N     1 
ATOM   7197  C CA    . PHE B 2 346 ? 7.629   3.942   55.642  1.00 51.01  ? 346 PHE B CA    1 
ATOM   7198  C C     . PHE B 2 346 ? 8.269   2.609   55.307  1.00 47.47  ? 346 PHE B C     1 
ATOM   7199  O O     . PHE B 2 346 ? 8.206   1.655   56.090  1.00 48.04  ? 346 PHE B O     1 
ATOM   7200  C CB    . PHE B 2 346 ? 6.115   3.865   55.684  1.00 54.01  ? 346 PHE B CB    1 
ATOM   7201  C CG    . PHE B 2 346 ? 5.480   5.142   56.133  1.00 56.02  ? 346 PHE B CG    1 
ATOM   7202  C CD1   . PHE B 2 346 ? 5.480   5.489   57.482  1.00 58.76  ? 346 PHE B CD1   1 
ATOM   7203  C CD2   . PHE B 2 346 ? 4.905   6.012   55.209  1.00 53.36  ? 346 PHE B CD2   1 
ATOM   7204  C CE1   . PHE B 2 346 ? 4.900   6.676   57.904  1.00 62.50  ? 346 PHE B CE1   1 
ATOM   7205  C CE2   . PHE B 2 346 ? 4.321   7.197   55.617  1.00 54.53  ? 346 PHE B CE2   1 
ATOM   7206  C CZ    . PHE B 2 346 ? 4.315   7.531   56.969  1.00 62.11  ? 346 PHE B CZ    1 
ATOM   7207  N N     . LYS B 2 347 ? 8.923   2.561   54.155  1.00 45.75  ? 347 LYS B N     1 
ATOM   7208  C CA    . LYS B 2 347 ? 9.780   1.424   53.861  1.00 46.25  ? 347 LYS B CA    1 
ATOM   7209  C C     . LYS B 2 347 ? 11.257  1.798   54.035  1.00 43.28  ? 347 LYS B C     1 
ATOM   7210  O O     . LYS B 2 347 ? 11.904  2.297   53.110  1.00 42.36  ? 347 LYS B O     1 
ATOM   7211  C CB    . LYS B 2 347 ? 9.513   0.991   52.430  1.00 45.95  ? 347 LYS B CB    1 
ATOM   7212  C CG    . LYS B 2 347 ? 8.064   0.656   52.183  1.00 53.66  ? 347 LYS B CG    1 
ATOM   7213  C CD    . LYS B 2 347 ? 7.706   0.728   50.706  1.00 57.00  ? 347 LYS B CD    1 
ATOM   7214  C CE    . LYS B 2 347 ? 6.276   0.171   50.545  1.00 68.27  ? 347 LYS B CE    1 
ATOM   7215  N NZ    . LYS B 2 347 ? 5.927   -0.061  49.099  1.00 77.80  ? 347 LYS B NZ    1 
ATOM   7216  N N     . ASN B 2 348 ? 11.828  1.449   55.181  1.00 38.75  ? 348 ASN B N     1 
ATOM   7217  C CA    . ASN B 2 348 ? 13.176  1.912   55.459  1.00 39.56  ? 348 ASN B CA    1 
ATOM   7218  C C     . ASN B 2 348 ? 14.185  0.822   55.141  1.00 41.68  ? 348 ASN B C     1 
ATOM   7219  O O     . ASN B 2 348 ? 14.057  -0.322  55.611  1.00 44.11  ? 348 ASN B O     1 
ATOM   7220  C CB    . ASN B 2 348 ? 13.366  2.388   56.918  1.00 40.75  ? 348 ASN B CB    1 
ATOM   7221  C CG    . ASN B 2 348 ? 12.500  3.592   57.298  1.00 42.07  ? 348 ASN B CG    1 
ATOM   7222  O OD1   . ASN B 2 348 ? 12.466  4.625   56.615  1.00 41.85  ? 348 ASN B OD1   1 
ATOM   7223  N ND2   . ASN B 2 348 ? 11.815  3.462   58.425  1.00 40.49  ? 348 ASN B ND2   1 
ATOM   7224  N N     . LEU B 2 349 ? 15.183  1.181   54.343  1.00 37.08  ? 349 LEU B N     1 
ATOM   7225  C CA    . LEU B 2 349 ? 16.248  0.268   54.024  1.00 34.77  ? 349 LEU B CA    1 
ATOM   7226  C C     . LEU B 2 349 ? 17.190  0.184   55.210  1.00 38.66  ? 349 LEU B C     1 
ATOM   7227  O O     . LEU B 2 349 ? 17.831  -0.849  55.442  1.00 38.77  ? 349 LEU B O     1 
ATOM   7228  C CB    . LEU B 2 349 ? 16.977  0.721   52.772  1.00 35.00  ? 349 LEU B CB    1 
ATOM   7229  C CG    . LEU B 2 349 ? 16.084  0.857   51.538  1.00 39.49  ? 349 LEU B CG    1 
ATOM   7230  C CD1   . LEU B 2 349 ? 16.863  1.282   50.313  1.00 37.25  ? 349 LEU B CD1   1 
ATOM   7231  C CD2   . LEU B 2 349 ? 15.346  -0.424  51.270  1.00 39.54  ? 349 LEU B CD2   1 
ATOM   7232  N N     . LYS B 2 350 ? 17.303  1.283   55.947  1.00 38.91  ? 350 LYS B N     1 
ATOM   7233  C CA    . LYS B 2 350 ? 18.081  1.244   57.188  1.00 41.84  ? 350 LYS B CA    1 
ATOM   7234  C C     . LYS B 2 350 ? 17.629  2.333   58.152  1.00 42.05  ? 350 LYS B C     1 
ATOM   7235  O O     . LYS B 2 350 ? 17.208  3.389   57.718  1.00 40.22  ? 350 LYS B O     1 
ATOM   7236  C CB    . LYS B 2 350 ? 19.589  1.375   56.891  1.00 42.29  ? 350 LYS B CB    1 
ATOM   7237  C CG    . LYS B 2 350 ? 20.537  1.185   58.083  1.00 42.47  ? 350 LYS B CG    1 
ATOM   7238  C CD    . LYS B 2 350 ? 21.805  2.012   57.864  1.00 45.37  ? 350 LYS B CD    1 
ATOM   7239  C CE    . LYS B 2 350 ? 23.092  1.357   58.389  1.00 46.04  ? 350 LYS B CE    1 
ATOM   7240  N NZ    . LYS B 2 350 ? 23.107  1.133   59.856  1.00 48.42  ? 350 LYS B NZ    1 
ATOM   7241  N N     . THR B 2 351 ? 17.733  2.076   59.452  1.00 41.69  ? 351 THR B N     1 
ATOM   7242  C CA    . THR B 2 351 ? 17.456  3.083   60.469  1.00 42.71  ? 351 THR B CA    1 
ATOM   7243  C C     . THR B 2 351 ? 18.605  3.004   61.439  1.00 48.75  ? 351 THR B C     1 
ATOM   7244  O O     . THR B 2 351 ? 19.114  1.922   61.665  1.00 54.31  ? 351 THR B O     1 
ATOM   7245  C CB    . THR B 2 351 ? 16.166  2.792   61.235  1.00 43.28  ? 351 THR B CB    1 
ATOM   7246  O OG1   . THR B 2 351 ? 16.264  1.509   61.864  1.00 47.23  ? 351 THR B OG1   1 
ATOM   7247  C CG2   . THR B 2 351 ? 14.978  2.817   60.300  1.00 40.89  ? 351 THR B CG2   1 
ATOM   7248  N N     . GLY B 2 352 ? 19.017  4.130   62.015  1.00 42.60  ? 352 GLY B N     1 
ATOM   7249  C CA    . GLY B 2 352 ? 20.156  4.120   62.908  1.00 42.94  ? 352 GLY B CA    1 
ATOM   7250  C C     . GLY B 2 352 ? 20.223  5.263   63.898  1.00 42.75  ? 352 GLY B C     1 
ATOM   7251  O O     . GLY B 2 352 ? 19.383  6.145   63.888  1.00 46.42  ? 352 GLY B O     1 
ATOM   7252  N N     . LYS B 2 353 ? 21.233  5.246   64.757  1.00 42.99  ? 353 LYS B N     1 
ATOM   7253  C CA    . LYS B 2 353 ? 21.413  6.290   65.754  1.00 40.31  ? 353 LYS B CA    1 
ATOM   7254  C C     . LYS B 2 353 ? 22.901  6.577   65.976  1.00 40.56  ? 353 LYS B C     1 
ATOM   7255  O O     . LYS B 2 353 ? 23.726  5.669   65.952  1.00 42.43  ? 353 LYS B O     1 
ATOM   7256  C CB    . LYS B 2 353 ? 20.736  5.906   67.073  1.00 40.08  ? 353 LYS B CB    1 
ATOM   7257  C CG    . LYS B 2 353 ? 20.725  7.034   68.081  1.00 43.50  ? 353 LYS B CG    1 
ATOM   7258  C CD    . LYS B 2 353 ? 20.114  6.651   69.420  1.00 51.59  ? 353 LYS B CD    1 
ATOM   7259  C CE    . LYS B 2 353 ? 21.178  6.216   70.401  1.00 53.62  ? 353 LYS B CE    1 
ATOM   7260  N NZ    . LYS B 2 353 ? 20.592  6.061   71.748  1.00 58.24  ? 353 LYS B NZ    1 
ATOM   7261  N N     . TYR B 2 354 ? 23.230  7.847   66.180  1.00 35.65  ? 354 TYR B N     1 
ATOM   7262  C CA    . TYR B 2 354 ? 24.585  8.288   66.435  1.00 36.19  ? 354 TYR B CA    1 
ATOM   7263  C C     . TYR B 2 354 ? 24.648  9.040   67.756  1.00 40.46  ? 354 TYR B C     1 
ATOM   7264  O O     . TYR B 2 354 ? 23.693  9.713   68.138  1.00 41.16  ? 354 TYR B O     1 
ATOM   7265  C CB    . TYR B 2 354 ? 25.052  9.231   65.339  1.00 35.78  ? 354 TYR B CB    1 
ATOM   7266  C CG    . TYR B 2 354 ? 25.180  8.635   63.972  1.00 36.41  ? 354 TYR B CG    1 
ATOM   7267  C CD1   . TYR B 2 354 ? 25.357  7.274   63.795  1.00 38.07  ? 354 TYR B CD1   1 
ATOM   7268  C CD2   . TYR B 2 354 ? 25.126  9.445   62.845  1.00 40.05  ? 354 TYR B CD2   1 
ATOM   7269  C CE1   . TYR B 2 354 ? 25.484  6.724   62.529  1.00 39.24  ? 354 TYR B CE1   1 
ATOM   7270  C CE2   . TYR B 2 354 ? 25.244  8.911   61.563  1.00 42.02  ? 354 TYR B CE2   1 
ATOM   7271  C CZ    . TYR B 2 354 ? 25.427  7.547   61.416  1.00 42.03  ? 354 TYR B CZ    1 
ATOM   7272  O OH    . TYR B 2 354 ? 25.553  7.014   60.160  1.00 39.76  ? 354 TYR B OH    1 
ATOM   7273  N N     . ALA B 2 355 ? 25.782  8.945   68.444  1.00 39.06  ? 355 ALA B N     1 
ATOM   7274  C CA    . ALA B 2 355 ? 25.954  9.663   69.694  1.00 39.18  ? 355 ALA B CA    1 
ATOM   7275  C C     . ALA B 2 355 ? 27.425  10.054  69.947  1.00 44.51  ? 355 ALA B C     1 
ATOM   7276  O O     . ALA B 2 355 ? 28.346  9.452   69.380  1.00 45.99  ? 355 ALA B O     1 
ATOM   7277  C CB    . ALA B 2 355 ? 25.381  8.858   70.846  1.00 35.56  ? 355 ALA B CB    1 
ATOM   7278  N N     . ARG B 2 356 ? 27.628  11.080  70.780  1.00 42.15  ? 356 ARG B N     1 
ATOM   7279  C CA    . ARG B 2 356 ? 28.955  11.565  71.158  1.00 38.41  ? 356 ARG B CA    1 
ATOM   7280  C C     . ARG B 2 356 ? 29.880  11.739  69.968  1.00 41.02  ? 356 ARG B C     1 
ATOM   7281  O O     . ARG B 2 356 ? 31.070  11.424  70.029  1.00 46.26  ? 356 ARG B O     1 
ATOM   7282  C CB    . ARG B 2 356 ? 29.605  10.666  72.206  1.00 40.65  ? 356 ARG B CB    1 
ATOM   7283  C CG    . ARG B 2 356 ? 28.905  10.693  73.522  1.00 47.07  ? 356 ARG B CG    1 
ATOM   7284  C CD    . ARG B 2 356 ? 29.872  10.413  74.630  1.00 50.80  ? 356 ARG B CD    1 
ATOM   7285  N NE    . ARG B 2 356 ? 30.512  9.117   74.442  1.00 58.56  ? 356 ARG B NE    1 
ATOM   7286  C CZ    . ARG B 2 356 ? 30.643  8.200   75.400  1.00 61.59  ? 356 ARG B CZ    1 
ATOM   7287  N NH1   . ARG B 2 356 ? 30.176  8.440   76.631  1.00 57.93  ? 356 ARG B NH1   1 
ATOM   7288  N NH2   . ARG B 2 356 ? 31.245  7.044   75.125  1.00 59.40  ? 356 ARG B NH2   1 
ATOM   7289  N N     . MET B 2 357 ? 29.328  12.238  68.878  1.00 37.84  ? 357 MET B N     1 
ATOM   7290  C CA    . MET B 2 357 ? 30.138  12.665  67.761  1.00 34.46  ? 357 MET B CA    1 
ATOM   7291  C C     . MET B 2 357 ? 30.844  13.970  68.132  1.00 33.59  ? 357 MET B C     1 
ATOM   7292  O O     . MET B 2 357 ? 30.488  14.623  69.092  1.00 32.56  ? 357 MET B O     1 
ATOM   7293  C CB    . MET B 2 357 ? 29.255  12.848  66.544  1.00 33.84  ? 357 MET B CB    1 
ATOM   7294  C CG    . MET B 2 357 ? 28.419  11.638  66.214  1.00 35.49  ? 357 MET B CG    1 
ATOM   7295  S SD    . MET B 2 357 ? 27.584  11.874  64.637  1.00 43.06  ? 357 MET B SD    1 
ATOM   7296  C CE    . MET B 2 357 ? 26.230  12.885  65.164  1.00 35.13  ? 357 MET B CE    1 
ATOM   7297  N N     . ARG B 2 358 ? 31.876  14.345  67.405  1.00 33.06  ? 358 ARG B N     1 
ATOM   7298  C CA    . ARG B 2 358 ? 32.503  15.604  67.721  1.00 34.19  ? 358 ARG B CA    1 
ATOM   7299  C C     . ARG B 2 358 ? 31.418  16.703  67.754  1.00 34.26  ? 358 ARG B C     1 
ATOM   7300  O O     . ARG B 2 358 ? 30.475  16.675  66.968  1.00 34.18  ? 358 ARG B O     1 
ATOM   7301  C CB    . ARG B 2 358 ? 33.560  15.918  66.678  1.00 37.49  ? 358 ARG B CB    1 
ATOM   7302  C CG    . ARG B 2 358 ? 32.976  16.176  65.325  1.00 37.52  ? 358 ARG B CG    1 
ATOM   7303  C CD    . ARG B 2 358 ? 33.669  15.392  64.266  1.00 41.48  ? 358 ARG B CD    1 
ATOM   7304  N NE    . ARG B 2 358 ? 33.388  15.962  62.958  1.00 43.85  ? 358 ARG B NE    1 
ATOM   7305  C CZ    . ARG B 2 358 ? 33.998  17.038  62.461  1.00 46.82  ? 358 ARG B CZ    1 
ATOM   7306  N NH1   . ARG B 2 358 ? 34.951  17.669  63.177  1.00 45.64  ? 358 ARG B NH1   1 
ATOM   7307  N NH2   . ARG B 2 358 ? 33.647  17.480  61.247  1.00 40.32  ? 358 ARG B NH2   1 
ATOM   7308  N N     . GLY B 2 359 ? 31.549  17.653  68.678  1.00 32.21  ? 359 GLY B N     1 
ATOM   7309  C CA    . GLY B 2 359 ? 30.561  18.699  68.855  1.00 30.97  ? 359 GLY B CA    1 
ATOM   7310  C C     . GLY B 2 359 ? 29.445  18.376  69.847  1.00 29.70  ? 359 GLY B C     1 
ATOM   7311  O O     . GLY B 2 359 ? 28.632  19.231  70.164  1.00 29.33  ? 359 GLY B O     1 
ATOM   7312  N N     . ALA B 2 360 ? 29.398  17.150  70.342  1.00 27.66  ? 360 ALA B N     1 
ATOM   7313  C CA    . ALA B 2 360 ? 28.318  16.754  71.232  1.00 28.61  ? 360 ALA B CA    1 
ATOM   7314  C C     . ALA B 2 360 ? 28.333  17.619  72.450  1.00 28.87  ? 360 ALA B C     1 
ATOM   7315  O O     . ALA B 2 360 ? 29.350  17.737  73.089  1.00 36.33  ? 360 ALA B O     1 
ATOM   7316  C CB    . ALA B 2 360 ? 28.417  15.280  71.617  1.00 29.74  ? 360 ALA B CB    1 
ATOM   7317  N N     . HIS B 2 361 ? 27.202  18.228  72.769  1.00 30.55  ? 361 HIS B N     1 
ATOM   7318  C CA    . HIS B 2 361 ? 27.087  19.072  73.948  1.00 31.92  ? 361 HIS B CA    1 
ATOM   7319  C C     . HIS B 2 361 ? 27.587  20.508  73.745  1.00 34.51  ? 361 HIS B C     1 
ATOM   7320  O O     . HIS B 2 361 ? 27.584  21.313  74.664  1.00 44.12  ? 361 HIS B O     1 
ATOM   7321  C CB    . HIS B 2 361 ? 27.649  18.380  75.188  1.00 26.92  ? 361 HIS B CB    1 
ATOM   7322  C CG    . HIS B 2 361 ? 27.036  17.041  75.431  1.00 34.34  ? 361 HIS B CG    1 
ATOM   7323  N ND1   . HIS B 2 361 ? 25.795  16.880  75.995  1.00 39.36  ? 361 HIS B ND1   1 
ATOM   7324  C CD2   . HIS B 2 361 ? 27.477  15.788  75.141  1.00 37.94  ? 361 HIS B CD2   1 
ATOM   7325  C CE1   . HIS B 2 361 ? 25.500  15.592  76.067  1.00 39.56  ? 361 HIS B CE1   1 
ATOM   7326  N NE2   . HIS B 2 361 ? 26.511  14.911  75.558  1.00 38.72  ? 361 HIS B NE2   1 
ATOM   7327  N N     . THR B 2 362 ? 28.055  20.820  72.551  1.00 31.12  ? 362 THR B N     1 
ATOM   7328  C CA    . THR B 2 362 ? 28.475  22.186  72.254  1.00 35.64  ? 362 THR B CA    1 
ATOM   7329  C C     . THR B 2 362 ? 27.988  22.803  70.937  1.00 33.59  ? 362 THR B C     1 
ATOM   7330  O O     . THR B 2 362 ? 27.566  23.952  70.919  1.00 35.33  ? 362 THR B O     1 
ATOM   7331  C CB    . THR B 2 362 ? 29.984  22.425  72.464  1.00 39.05  ? 362 THR B CB    1 
ATOM   7332  O OG1   . THR B 2 362 ? 30.322  23.764  72.024  1.00 36.10  ? 362 THR B OG1   1 
ATOM   7333  C CG2   . THR B 2 362 ? 30.811  21.343  71.732  1.00 31.03  ? 362 THR B CG2   1 
ATOM   7334  N N     . ASN B 2 363 ? 28.229  22.106  69.828  1.00 30.16  ? 363 ASN B N     1 
ATOM   7335  C CA    . ASN B 2 363 ? 27.923  22.626  68.492  1.00 32.06  ? 363 ASN B CA    1 
ATOM   7336  C C     . ASN B 2 363 ? 27.039  21.643  67.664  1.00 34.98  ? 363 ASN B C     1 
ATOM   7337  O O     . ASN B 2 363 ? 27.509  20.585  67.256  1.00 33.14  ? 363 ASN B O     1 
ATOM   7338  C CB    . ASN B 2 363 ? 29.245  22.938  67.779  1.00 31.70  ? 363 ASN B CB    1 
ATOM   7339  C CG    . ASN B 2 363 ? 29.067  23.630  66.453  1.00 30.74  ? 363 ASN B CG    1 
ATOM   7340  O OD1   . ASN B 2 363 ? 28.053  23.469  65.805  1.00 33.34  ? 363 ASN B OD1   1 
ATOM   7341  N ND2   . ASN B 2 363 ? 30.071  24.380  66.029  1.00 26.38  ? 363 ASN B ND2   1 
ATOM   7342  N N     . ASP B 2 364 ? 25.773  22.021  67.413  1.00 33.38  ? 364 ASP B N     1 
ATOM   7343  C CA    . ASP B 2 364 ? 24.796  21.170  66.740  1.00 30.03  ? 364 ASP B CA    1 
ATOM   7344  C C     . ASP B 2 364 ? 25.223  20.963  65.301  1.00 32.95  ? 364 ASP B C     1 
ATOM   7345  O O     . ASP B 2 364 ? 25.126  19.855  64.778  1.00 33.18  ? 364 ASP B O     1 
ATOM   7346  C CB    . ASP B 2 364 ? 23.395  21.826  66.703  1.00 31.82  ? 364 ASP B CB    1 
ATOM   7347  C CG    . ASP B 2 364 ? 22.467  21.421  67.878  1.00 37.27  ? 364 ASP B CG    1 
ATOM   7348  O OD1   . ASP B 2 364 ? 22.691  20.408  68.608  1.00 36.23  ? 364 ASP B OD1   1 
ATOM   7349  O OD2   . ASP B 2 364 ? 21.471  22.161  68.051  1.00 34.53  ? 364 ASP B OD2   1 
ATOM   7350  N N     . VAL B 2 365 ? 25.647  22.049  64.650  1.00 31.32  ? 365 VAL B N     1 
ATOM   7351  C CA    . VAL B 2 365 ? 25.958  22.040  63.223  1.00 29.03  ? 365 VAL B CA    1 
ATOM   7352  C C     . VAL B 2 365 ? 27.142  21.121  62.947  1.00 33.41  ? 365 VAL B C     1 
ATOM   7353  O O     . VAL B 2 365 ? 27.182  20.410  61.939  1.00 34.53  ? 365 VAL B O     1 
ATOM   7354  C CB    . VAL B 2 365 ? 26.263  23.450  62.723  1.00 26.21  ? 365 VAL B CB    1 
ATOM   7355  C CG1   . VAL B 2 365 ? 26.613  23.449  61.242  1.00 26.42  ? 365 VAL B CG1   1 
ATOM   7356  C CG2   . VAL B 2 365 ? 25.084  24.339  62.986  1.00 29.45  ? 365 VAL B CG2   1 
ATOM   7357  N N     . LYS B 2 366 ? 28.105  21.126  63.852  1.00 32.59  ? 366 LYS B N     1 
ATOM   7358  C CA    . LYS B 2 366 ? 29.256  20.268  63.709  1.00 34.34  ? 366 LYS B CA    1 
ATOM   7359  C C     . LYS B 2 366 ? 28.765  18.822  63.764  1.00 31.67  ? 366 LYS B C     1 
ATOM   7360  O O     . LYS B 2 366 ? 29.055  18.023  62.895  1.00 32.54  ? 366 LYS B O     1 
ATOM   7361  C CB    . LYS B 2 366 ? 30.286  20.563  64.809  1.00 33.42  ? 366 LYS B CB    1 
ATOM   7362  C CG    . LYS B 2 366 ? 31.707  20.151  64.483  1.00 35.06  ? 366 LYS B CG    1 
ATOM   7363  C CD    . LYS B 2 366 ? 32.447  19.698  65.723  1.00 38.81  ? 366 LYS B CD    1 
ATOM   7364  C CE    . LYS B 2 366 ? 33.945  20.001  65.645  1.00 39.08  ? 366 LYS B CE    1 
ATOM   7365  N NZ    . LYS B 2 366 ? 34.279  21.366  66.146  1.00 33.65  ? 366 LYS B NZ    1 
ATOM   7366  N N     . GLN B 2 367 ? 27.997  18.500  64.787  1.00 29.63  ? 367 GLN B N     1 
ATOM   7367  C CA    . GLN B 2 367 ? 27.442  17.170  64.916  1.00 31.23  ? 367 GLN B CA    1 
ATOM   7368  C C     . GLN B 2 367 ? 26.586  16.690  63.728  1.00 32.51  ? 367 GLN B C     1 
ATOM   7369  O O     . GLN B 2 367 ? 26.626  15.521  63.388  1.00 32.92  ? 367 GLN B O     1 
ATOM   7370  C CB    . GLN B 2 367 ? 26.589  17.103  66.152  1.00 28.65  ? 367 GLN B CB    1 
ATOM   7371  C CG    . GLN B 2 367 ? 27.303  17.137  67.423  1.00 26.92  ? 367 GLN B CG    1 
ATOM   7372  C CD    . GLN B 2 367 ? 26.319  17.344  68.514  1.00 27.74  ? 367 GLN B CD    1 
ATOM   7373  O OE1   . GLN B 2 367 ? 25.937  16.410  69.196  1.00 25.26  ? 367 GLN B OE1   1 
ATOM   7374  N NE2   . GLN B 2 367 ? 25.845  18.574  68.652  1.00 29.02  ? 367 GLN B NE2   1 
ATOM   7375  N N     . LEU B 2 368 ? 25.790  17.577  63.137  1.00 29.55  ? 368 LEU B N     1 
ATOM   7376  C CA    . LEU B 2 368 ? 24.934  17.213  62.031  1.00 28.13  ? 368 LEU B CA    1 
ATOM   7377  C C     . LEU B 2 368 ? 25.803  16.959  60.822  1.00 29.99  ? 368 LEU B C     1 
ATOM   7378  O O     . LEU B 2 368 ? 25.585  16.014  60.049  1.00 30.90  ? 368 LEU B O     1 
ATOM   7379  C CB    . LEU B 2 368 ? 23.932  18.324  61.736  1.00 28.97  ? 368 LEU B CB    1 
ATOM   7380  C CG    . LEU B 2 368 ? 23.002  18.112  60.535  1.00 25.92  ? 368 LEU B CG    1 
ATOM   7381  C CD1   . LEU B 2 368 ? 22.214  16.829  60.721  1.00 23.93  ? 368 LEU B CD1   1 
ATOM   7382  C CD2   . LEU B 2 368 ? 22.106  19.317  60.295  1.00 22.64  ? 368 LEU B CD2   1 
ATOM   7383  N N     . THR B 2 369 ? 26.807  17.797  60.659  1.00 29.50  ? 369 THR B N     1 
ATOM   7384  C CA    . THR B 2 369 ? 27.763  17.568  59.589  1.00 30.92  ? 369 THR B CA    1 
ATOM   7385  C C     . THR B 2 369 ? 28.443  16.213  59.699  1.00 31.82  ? 369 THR B C     1 
ATOM   7386  O O     . THR B 2 369 ? 28.528  15.478  58.719  1.00 31.60  ? 369 THR B O     1 
ATOM   7387  C CB    . THR B 2 369 ? 28.799  18.634  59.573  1.00 30.20  ? 369 THR B CB    1 
ATOM   7388  O OG1   . THR B 2 369 ? 28.128  19.866  59.357  1.00 38.61  ? 369 THR B OG1   1 
ATOM   7389  C CG2   . THR B 2 369 ? 29.734  18.417  58.439  1.00 31.54  ? 369 THR B CG2   1 
ATOM   7390  N N     . GLU B 2 370 ? 28.920  15.896  60.896  1.00 30.42  ? 370 GLU B N     1 
ATOM   7391  C CA    . GLU B 2 370 ? 29.481  14.599  61.173  1.00 32.15  ? 370 GLU B CA    1 
ATOM   7392  C C     . GLU B 2 370 ? 28.506  13.489  60.787  1.00 34.68  ? 370 GLU B C     1 
ATOM   7393  O O     . GLU B 2 370 ? 28.892  12.505  60.165  1.00 33.43  ? 370 GLU B O     1 
ATOM   7394  C CB    . GLU B 2 370 ? 29.837  14.495  62.642  1.00 34.34  ? 370 GLU B CB    1 
ATOM   7395  C CG    . GLU B 2 370 ? 30.720  13.299  62.972  1.00 39.83  ? 370 GLU B CG    1 
ATOM   7396  C CD    . GLU B 2 370 ? 31.910  13.184  62.051  1.00 46.27  ? 370 GLU B CD    1 
ATOM   7397  O OE1   . GLU B 2 370 ? 32.311  14.220  61.453  1.00 46.55  ? 370 GLU B OE1   1 
ATOM   7398  O OE2   . GLU B 2 370 ? 32.425  12.050  61.901  1.00 52.25  ? 370 GLU B OE2   1 
ATOM   7399  N N     . ALA B 2 371 ? 27.239  13.676  61.150  1.00 33.31  ? 371 ALA B N     1 
ATOM   7400  C CA    . ALA B 2 371 ? 26.181  12.717  60.888  1.00 31.26  ? 371 ALA B CA    1 
ATOM   7401  C C     . ALA B 2 371 ? 25.954  12.512  59.384  1.00 34.16  ? 371 ALA B C     1 
ATOM   7402  O O     . ALA B 2 371 ? 25.883  11.372  58.911  1.00 31.78  ? 371 ALA B O     1 
ATOM   7403  C CB    . ALA B 2 371 ? 24.910  13.173  61.563  1.00 28.85  ? 371 ALA B CB    1 
ATOM   7404  N N     . VAL B 2 372 ? 25.825  13.615  58.644  1.00 30.85  ? 372 VAL B N     1 
ATOM   7405  C CA    . VAL B 2 372 ? 25.645  13.548  57.201  1.00 29.40  ? 372 VAL B CA    1 
ATOM   7406  C C     . VAL B 2 372 ? 26.801  12.797  56.529  1.00 32.48  ? 372 VAL B C     1 
ATOM   7407  O O     . VAL B 2 372 ? 26.609  12.112  55.520  1.00 34.55  ? 372 VAL B O     1 
ATOM   7408  C CB    . VAL B 2 372 ? 25.487  14.958  56.573  1.00 28.31  ? 372 VAL B CB    1 
ATOM   7409  C CG1   . VAL B 2 372 ? 25.554  14.900  55.031  1.00 24.48  ? 372 VAL B CG1   1 
ATOM   7410  C CG2   . VAL B 2 372 ? 24.199  15.618  57.051  1.00 27.46  ? 372 VAL B CG2   1 
ATOM   7411  N N     . GLN B 2 373 ? 28.006  12.917  57.074  1.00 32.45  ? 373 GLN B N     1 
ATOM   7412  C CA    . GLN B 2 373 ? 29.145  12.243  56.472  1.00 33.49  ? 373 GLN B CA    1 
ATOM   7413  C C     . GLN B 2 373 ? 29.110  10.746  56.785  1.00 33.40  ? 373 GLN B C     1 
ATOM   7414  O O     . GLN B 2 373 ? 29.296  9.933   55.899  1.00 36.82  ? 373 GLN B O     1 
ATOM   7415  C CB    . GLN B 2 373 ? 30.466  12.867  56.909  1.00 32.99  ? 373 GLN B CB    1 
ATOM   7416  C CG    . GLN B 2 373 ? 30.745  14.264  56.373  1.00 33.53  ? 373 GLN B CG    1 
ATOM   7417  C CD    . GLN B 2 373 ? 31.969  14.918  57.049  1.00 39.20  ? 373 GLN B CD    1 
ATOM   7418  O OE1   . GLN B 2 373 ? 32.426  15.973  56.621  1.00 37.24  ? 373 GLN B OE1   1 
ATOM   7419  N NE2   . GLN B 2 373 ? 32.494  14.284  58.111  1.00 37.86  ? 373 GLN B NE2   1 
ATOM   7420  N N     . LYS B 2 374 ? 28.861  10.374  58.030  1.00 29.31  ? 374 LYS B N     1 
ATOM   7421  C CA    . LYS B 2 374 ? 28.752  8.958   58.366  1.00 33.66  ? 374 LYS B CA    1 
ATOM   7422  C C     . LYS B 2 374 ? 27.614  8.262   57.601  1.00 37.34  ? 374 LYS B C     1 
ATOM   7423  O O     . LYS B 2 374 ? 27.762  7.136   57.126  1.00 36.38  ? 374 LYS B O     1 
ATOM   7424  C CB    . LYS B 2 374 ? 28.562  8.767   59.876  1.00 34.12  ? 374 LYS B CB    1 
ATOM   7425  C CG    . LYS B 2 374 ? 29.424  9.664   60.714  1.00 36.71  ? 374 LYS B CG    1 
ATOM   7426  C CD    . LYS B 2 374 ? 29.167  9.484   62.172  1.00 40.44  ? 374 LYS B CD    1 
ATOM   7427  C CE    . LYS B 2 374 ? 30.150  8.494   62.753  1.00 47.48  ? 374 LYS B CE    1 
ATOM   7428  N NZ    . LYS B 2 374 ? 29.494  7.711   63.848  1.00 50.84  ? 374 LYS B NZ    1 
ATOM   7429  N N     . ILE B 2 375 ? 26.472  8.938   57.507  1.00 37.77  ? 375 ILE B N     1 
ATOM   7430  C CA    . ILE B 2 375 ? 25.329  8.445   56.740  1.00 35.76  ? 375 ILE B CA    1 
ATOM   7431  C C     . ILE B 2 375 ? 25.730  8.306   55.268  1.00 36.56  ? 375 ILE B C     1 
ATOM   7432  O O     . ILE B 2 375 ? 25.528  7.233   54.685  1.00 36.44  ? 375 ILE B O     1 
ATOM   7433  C CB    . ILE B 2 375 ? 24.051  9.342   56.931  1.00 33.29  ? 375 ILE B CB    1 
ATOM   7434  C CG1   . ILE B 2 375 ? 23.435  9.112   58.303  1.00 37.49  ? 375 ILE B CG1   1 
ATOM   7435  C CG2   . ILE B 2 375 ? 22.999  9.016   55.936  1.00 30.67  ? 375 ILE B CG2   1 
ATOM   7436  C CD1   . ILE B 2 375 ? 22.693  10.336  58.859  1.00 34.73  ? 375 ILE B CD1   1 
ATOM   7437  N N     . THR B 2 376 ? 26.317  9.349   54.668  1.00 30.64  ? 376 THR B N     1 
ATOM   7438  C CA    . THR B 2 376 ? 26.690  9.237   53.257  1.00 33.12  ? 376 THR B CA    1 
ATOM   7439  C C     . THR B 2 376 ? 27.622  8.069   52.975  1.00 35.79  ? 376 THR B C     1 
ATOM   7440  O O     . THR B 2 376 ? 27.502  7.400   51.953  1.00 36.58  ? 376 THR B O     1 
ATOM   7441  C CB    . THR B 2 376 ? 27.349  10.489  52.691  1.00 32.93  ? 376 THR B CB    1 
ATOM   7442  O OG1   . THR B 2 376 ? 26.388  11.535  52.589  1.00 33.48  ? 376 THR B OG1   1 
ATOM   7443  C CG2   . THR B 2 376 ? 27.849  10.205  51.297  1.00 31.83  ? 376 THR B CG2   1 
ATOM   7444  N N     . THR B 2 377 ? 28.557  7.845   53.886  1.00 34.92  ? 377 THR B N     1 
ATOM   7445  C CA    . THR B 2 377 ? 29.540  6.788   53.761  1.00 35.95  ? 377 THR B CA    1 
ATOM   7446  C C     . THR B 2 377 ? 28.893  5.424   53.725  1.00 37.81  ? 377 THR B C     1 
ATOM   7447  O O     . THR B 2 377 ? 29.077  4.694   52.776  1.00 40.33  ? 377 THR B O     1 
ATOM   7448  C CB    . THR B 2 377 ? 30.543  6.819   54.929  1.00 38.22  ? 377 THR B CB    1 
ATOM   7449  O OG1   . THR B 2 377 ? 31.407  7.951   54.787  1.00 35.49  ? 377 THR B OG1   1 
ATOM   7450  C CG2   . THR B 2 377 ? 31.373  5.526   54.972  1.00 37.64  ? 377 THR B CG2   1 
ATOM   7451  N N     . GLU B 2 378 ? 28.134  5.083   54.762  1.00 38.84  ? 378 GLU B N     1 
ATOM   7452  C CA    . GLU B 2 378 ? 27.429  3.803   54.819  1.00 40.71  ? 378 GLU B CA    1 
ATOM   7453  C C     . GLU B 2 378 ? 26.579  3.622   53.573  1.00 42.03  ? 378 GLU B C     1 
ATOM   7454  O O     . GLU B 2 378 ? 26.251  2.517   53.171  1.00 44.93  ? 378 GLU B O     1 
ATOM   7455  C CB    . GLU B 2 378 ? 26.488  3.772   56.023  1.00 39.15  ? 378 GLU B CB    1 
ATOM   7456  C CG    . GLU B 2 378 ? 27.080  4.281   57.304  1.00 39.55  ? 378 GLU B CG    1 
ATOM   7457  C CD    . GLU B 2 378 ? 26.109  4.175   58.462  1.00 44.39  ? 378 GLU B CD    1 
ATOM   7458  O OE1   . GLU B 2 378 ? 26.542  4.319   59.622  1.00 44.66  ? 378 GLU B OE1   1 
ATOM   7459  O OE2   . GLU B 2 378 ? 24.903  3.947   58.210  1.00 45.03  ? 378 GLU B OE2   1 
ATOM   7460  N N     . SER B 2 379 ? 26.199  4.738   52.986  1.00 37.34  ? 379 SER B N     1 
ATOM   7461  C CA    . SER B 2 379 ? 25.270  4.738   51.909  1.00 36.32  ? 379 SER B CA    1 
ATOM   7462  C C     . SER B 2 379 ? 26.041  4.309   50.670  1.00 39.23  ? 379 SER B C     1 
ATOM   7463  O O     . SER B 2 379 ? 25.524  3.600   49.807  1.00 40.88  ? 379 SER B O     1 
ATOM   7464  C CB    . SER B 2 379 ? 24.698  6.153   51.782  1.00 37.20  ? 379 SER B CB    1 
ATOM   7465  O OG    . SER B 2 379 ? 23.483  6.188   51.060  1.00 36.52  ? 379 SER B OG    1 
ATOM   7466  N N     . ILE B 2 380 ? 27.291  4.736   50.581  1.00 39.20  ? 380 ILE B N     1 
ATOM   7467  C CA    . ILE B 2 380 ? 28.136  4.364   49.444  1.00 41.49  ? 380 ILE B CA    1 
ATOM   7468  C C     . ILE B 2 380 ? 28.634  2.912   49.561  1.00 41.35  ? 380 ILE B C     1 
ATOM   7469  O O     . ILE B 2 380 ? 28.527  2.147   48.623  1.00 45.36  ? 380 ILE B O     1 
ATOM   7470  C CB    . ILE B 2 380 ? 29.311  5.361   49.240  1.00 42.37  ? 380 ILE B CB    1 
ATOM   7471  C CG1   . ILE B 2 380 ? 28.797  6.785   49.069  1.00 38.86  ? 380 ILE B CG1   1 
ATOM   7472  C CG2   . ILE B 2 380 ? 30.076  5.028   48.004  1.00 48.96  ? 380 ILE B CG2   1 
ATOM   7473  C CD1   . ILE B 2 380 ? 29.883  7.832   49.189  1.00 39.05  ? 380 ILE B CD1   1 
ATOM   7474  N N     . VAL B 2 381 ? 29.144  2.531   50.720  1.00 39.25  ? 381 VAL B N     1 
ATOM   7475  C CA    . VAL B 2 381 ? 29.527  1.153   50.975  1.00 40.71  ? 381 VAL B CA    1 
ATOM   7476  C C     . VAL B 2 381 ? 28.388  0.143   50.759  1.00 44.89  ? 381 VAL B C     1 
ATOM   7477  O O     . VAL B 2 381 ? 28.628  -1.024  50.467  1.00 50.58  ? 381 VAL B O     1 
ATOM   7478  C CB    . VAL B 2 381 ? 30.064  0.998   52.420  1.00 44.93  ? 381 VAL B CB    1 
ATOM   7479  C CG1   . VAL B 2 381 ? 30.085  -0.479  52.856  1.00 45.27  ? 381 VAL B CG1   1 
ATOM   7480  C CG2   . VAL B 2 381 ? 31.442  1.650   52.568  1.00 43.21  ? 381 VAL B CG2   1 
ATOM   7481  N N     . ILE B 2 382 ? 27.150  0.578   50.918  1.00 42.03  ? 382 ILE B N     1 
ATOM   7482  C CA    . ILE B 2 382 ? 26.006  -0.340  50.885  1.00 44.07  ? 382 ILE B CA    1 
ATOM   7483  C C     . ILE B 2 382 ? 25.338  -0.427  49.526  1.00 43.10  ? 382 ILE B C     1 
ATOM   7484  O O     . ILE B 2 382 ? 25.109  -1.514  49.046  1.00 48.10  ? 382 ILE B O     1 
ATOM   7485  C CB    . ILE B 2 382 ? 24.951  -0.073  52.007  1.00 43.22  ? 382 ILE B CB    1 
ATOM   7486  C CG1   . ILE B 2 382 ? 25.435  -0.667  53.328  1.00 43.69  ? 382 ILE B CG1   1 
ATOM   7487  C CG2   . ILE B 2 382 ? 23.604  -0.676  51.639  1.00 39.26  ? 382 ILE B CG2   1 
ATOM   7488  C CD1   . ILE B 2 382 ? 24.580  -0.327  54.501  1.00 40.30  ? 382 ILE B CD1   1 
ATOM   7489  N N     . TRP B 2 383 ? 24.866  0.696   49.007  1.00 41.60  ? 383 TRP B N     1 
ATOM   7490  C CA    . TRP B 2 383 ? 24.318  0.759   47.665  1.00 39.55  ? 383 TRP B CA    1 
ATOM   7491  C C     . TRP B 2 383 ? 25.215  1.396   46.613  1.00 40.20  ? 383 TRP B C     1 
ATOM   7492  O O     . TRP B 2 383 ? 24.837  1.468   45.445  1.00 41.41  ? 383 TRP B O     1 
ATOM   7493  C CB    . TRP B 2 383 ? 22.947  1.429   47.681  1.00 42.23  ? 383 TRP B CB    1 
ATOM   7494  C CG    . TRP B 2 383 ? 22.050  0.883   48.734  1.00 42.15  ? 383 TRP B CG    1 
ATOM   7495  C CD1   . TRP B 2 383 ? 21.268  -0.214  48.639  1.00 41.76  ? 383 TRP B CD1   1 
ATOM   7496  C CD2   . TRP B 2 383 ? 21.844  1.417   50.054  1.00 43.60  ? 383 TRP B CD2   1 
ATOM   7497  N NE1   . TRP B 2 383 ? 20.583  -0.413  49.816  1.00 44.73  ? 383 TRP B NE1   1 
ATOM   7498  C CE2   . TRP B 2 383 ? 20.920  0.576   50.702  1.00 42.76  ? 383 TRP B CE2   1 
ATOM   7499  C CE3   . TRP B 2 383 ? 22.354  2.523   50.749  1.00 39.99  ? 383 TRP B CE3   1 
ATOM   7500  C CZ2   . TRP B 2 383 ? 20.497  0.797   52.018  1.00 38.96  ? 383 TRP B CZ2   1 
ATOM   7501  C CZ3   . TRP B 2 383 ? 21.928  2.745   52.047  1.00 40.21  ? 383 TRP B CZ3   1 
ATOM   7502  C CH2   . TRP B 2 383 ? 21.007  1.883   52.669  1.00 39.43  ? 383 TRP B CH2   1 
ATOM   7503  N N     . GLY B 2 384 ? 26.383  1.876   47.017  1.00 41.68  ? 384 GLY B N     1 
ATOM   7504  C CA    . GLY B 2 384 ? 27.283  2.567   46.099  1.00 42.13  ? 384 GLY B CA    1 
ATOM   7505  C C     . GLY B 2 384 ? 26.714  3.877   45.581  1.00 42.12  ? 384 GLY B C     1 
ATOM   7506  O O     . GLY B 2 384 ? 26.917  4.280   44.429  1.00 40.08  ? 384 GLY B O     1 
ATOM   7507  N N     . LYS B 2 385 ? 25.970  4.552   46.444  1.00 43.59  ? 385 LYS B N     1 
ATOM   7508  C CA    . LYS B 2 385 ? 25.266  5.768   46.045  1.00 43.51  ? 385 LYS B CA    1 
ATOM   7509  C C     . LYS B 2 385 ? 25.082  6.722   47.246  1.00 40.52  ? 385 LYS B C     1 
ATOM   7510  O O     . LYS B 2 385 ? 24.804  6.274   48.368  1.00 35.89  ? 385 LYS B O     1 
ATOM   7511  C CB    . LYS B 2 385 ? 23.920  5.373   45.421  1.00 35.68  ? 385 LYS B CB    1 
ATOM   7512  C CG    . LYS B 2 385 ? 23.323  6.429   44.597  1.00 37.78  ? 385 LYS B CG    1 
ATOM   7513  C CD    . LYS B 2 385 ? 21.853  6.123   44.389  1.00 50.49  ? 385 LYS B CD    1 
ATOM   7514  C CE    . LYS B 2 385 ? 21.574  4.998   43.389  1.00 43.80  ? 385 LYS B CE    1 
ATOM   7515  N NZ    . LYS B 2 385 ? 20.117  4.705   43.389  1.00 38.45  ? 385 LYS B NZ    1 
ATOM   7516  N N     . THR B 2 386 ? 25.213  8.029   47.017  1.00 37.21  ? 386 THR B N     1 
ATOM   7517  C CA    . THR B 2 386 ? 24.935  8.993   48.089  1.00 33.21  ? 386 THR B CA    1 
ATOM   7518  C C     . THR B 2 386 ? 23.460  9.407   48.129  1.00 31.46  ? 386 THR B C     1 
ATOM   7519  O O     . THR B 2 386 ? 22.837  9.590   47.086  1.00 31.03  ? 386 THR B O     1 
ATOM   7520  C CB    . THR B 2 386 ? 25.812  10.220  47.995  1.00 31.25  ? 386 THR B CB    1 
ATOM   7521  O OG1   . THR B 2 386 ? 25.416  11.000  46.874  1.00 33.63  ? 386 THR B OG1   1 
ATOM   7522  C CG2   . THR B 2 386 ? 27.249  9.818   47.828  1.00 34.57  ? 386 THR B CG2   1 
ATOM   7523  N N     . PRO B 2 387 ? 22.892  9.506   49.348  1.00 31.15  ? 387 PRO B N     1 
ATOM   7524  C CA    . PRO B 2 387 ? 21.474  9.813   49.598  1.00 31.68  ? 387 PRO B CA    1 
ATOM   7525  C C     . PRO B 2 387 ? 21.134  11.309  49.452  1.00 30.20  ? 387 PRO B C     1 
ATOM   7526  O O     . PRO B 2 387 ? 22.035  12.125  49.336  1.00 30.27  ? 387 PRO B O     1 
ATOM   7527  C CB    . PRO B 2 387 ? 21.263  9.308   51.016  1.00 28.65  ? 387 PRO B CB    1 
ATOM   7528  C CG    . PRO B 2 387 ? 22.603  9.498   51.656  1.00 28.03  ? 387 PRO B CG    1 
ATOM   7529  C CD    . PRO B 2 387 ? 23.652  9.376   50.606  1.00 28.74  ? 387 PRO B CD    1 
ATOM   7530  N N     . LYS B 2 388 ? 19.857  11.647  49.359  1.00 27.80  ? 388 LYS B N     1 
ATOM   7531  C CA    . LYS B 2 388 ? 19.451  13.043  49.424  1.00 30.10  ? 388 LYS B CA    1 
ATOM   7532  C C     . LYS B 2 388 ? 18.917  13.340  50.818  1.00 33.13  ? 388 LYS B C     1 
ATOM   7533  O O     . LYS B 2 388 ? 17.961  12.685  51.277  1.00 33.01  ? 388 LYS B O     1 
ATOM   7534  C CB    . LYS B 2 388 ? 18.401  13.374  48.365  1.00 32.54  ? 388 LYS B CB    1 
ATOM   7535  C CG    . LYS B 2 388 ? 17.522  14.582  48.719  1.00 37.02  ? 388 LYS B CG    1 
ATOM   7536  C CD    . LYS B 2 388 ? 17.489  15.565  47.534  1.00 45.80  ? 388 LYS B CD    1 
ATOM   7537  C CE    . LYS B 2 388 ? 16.607  16.787  47.780  1.00 42.56  ? 388 LYS B CE    1 
ATOM   7538  N NZ    . LYS B 2 388 ? 16.183  17.378  46.476  1.00 42.62  ? 388 LYS B NZ    1 
ATOM   7539  N N     . PHE B 2 389 ? 19.538  14.310  51.497  1.00 29.27  ? 389 PHE B N     1 
ATOM   7540  C CA    . PHE B 2 389 ? 19.253  14.538  52.921  1.00 29.98  ? 389 PHE B CA    1 
ATOM   7541  C C     . PHE B 2 389 ? 18.081  15.488  53.154  1.00 32.09  ? 389 PHE B C     1 
ATOM   7542  O O     . PHE B 2 389 ? 17.859  16.442  52.385  1.00 30.95  ? 389 PHE B O     1 
ATOM   7543  C CB    . PHE B 2 389 ? 20.494  15.048  53.671  1.00 27.76  ? 389 PHE B CB    1 
ATOM   7544  C CG    . PHE B 2 389 ? 21.523  14.011  53.887  1.00 27.74  ? 389 PHE B CG    1 
ATOM   7545  C CD1   . PHE B 2 389 ? 21.603  13.344  55.085  1.00 28.29  ? 389 PHE B CD1   1 
ATOM   7546  C CD2   . PHE B 2 389 ? 22.396  13.671  52.878  1.00 27.53  ? 389 PHE B CD2   1 
ATOM   7547  C CE1   . PHE B 2 389 ? 22.544  12.382  55.280  1.00 27.67  ? 389 PHE B CE1   1 
ATOM   7548  C CE2   . PHE B 2 389 ? 23.324  12.718  53.071  1.00 25.64  ? 389 PHE B CE2   1 
ATOM   7549  C CZ    . PHE B 2 389 ? 23.399  12.073  54.270  1.00 27.72  ? 389 PHE B CZ    1 
ATOM   7550  N N     . LYS B 2 390 ? 17.310  15.210  54.199  1.00 27.94  ? 390 LYS B N     1 
ATOM   7551  C CA    . LYS B 2 390 ? 16.401  16.220  54.686  1.00 30.14  ? 390 LYS B CA    1 
ATOM   7552  C C     . LYS B 2 390 ? 16.915  16.743  56.044  1.00 31.30  ? 390 LYS B C     1 
ATOM   7553  O O     . LYS B 2 390 ? 16.769  16.094  57.085  1.00 32.77  ? 390 LYS B O     1 
ATOM   7554  C CB    . LYS B 2 390 ? 14.999  15.641  54.777  1.00 28.38  ? 390 LYS B CB    1 
ATOM   7555  C CG    . LYS B 2 390 ? 14.382  15.392  53.444  1.00 30.83  ? 390 LYS B CG    1 
ATOM   7556  C CD    . LYS B 2 390 ? 13.158  14.524  53.616  1.00 37.60  ? 390 LYS B CD    1 
ATOM   7557  C CE    . LYS B 2 390 ? 12.248  14.544  52.416  1.00 42.39  ? 390 LYS B CE    1 
ATOM   7558  N NZ    . LYS B 2 390 ? 11.425  15.800  52.333  1.00 55.36  ? 390 LYS B NZ    1 
ATOM   7559  N N     . LEU B 2 391 ? 17.472  17.946  56.033  1.00 28.39  ? 391 LEU B N     1 
ATOM   7560  C CA    . LEU B 2 391 ? 18.240  18.436  57.182  1.00 29.87  ? 391 LEU B CA    1 
ATOM   7561  C C     . LEU B 2 391 ? 17.470  19.297  58.193  1.00 30.42  ? 391 LEU B C     1 
ATOM   7562  O O     . LEU B 2 391 ? 16.929  20.334  57.848  1.00 31.53  ? 391 LEU B O     1 
ATOM   7563  C CB    . LEU B 2 391 ? 19.458  19.201  56.689  1.00 27.45  ? 391 LEU B CB    1 
ATOM   7564  C CG    . LEU B 2 391 ? 20.413  18.371  55.868  1.00 27.30  ? 391 LEU B CG    1 
ATOM   7565  C CD1   . LEU B 2 391 ? 21.551  19.266  55.455  1.00 25.17  ? 391 LEU B CD1   1 
ATOM   7566  C CD2   . LEU B 2 391 ? 20.883  17.189  56.723  1.00 29.02  ? 391 LEU B CD2   1 
ATOM   7567  N N     . PRO B 2 392 ? 17.445  18.869  59.458  1.00 29.16  ? 392 PRO B N     1 
ATOM   7568  C CA    . PRO B 2 392 ? 16.689  19.605  60.470  1.00 28.16  ? 392 PRO B CA    1 
ATOM   7569  C C     . PRO B 2 392 ? 17.393  20.912  60.863  1.00 30.86  ? 392 PRO B C     1 
ATOM   7570  O O     . PRO B 2 392 ? 17.912  21.040  61.959  1.00 31.15  ? 392 PRO B O     1 
ATOM   7571  C CB    . PRO B 2 392 ? 16.640  18.613  61.636  1.00 25.63  ? 392 PRO B CB    1 
ATOM   7572  C CG    . PRO B 2 392 ? 17.777  17.697  61.436  1.00 22.77  ? 392 PRO B CG    1 
ATOM   7573  C CD    . PRO B 2 392 ? 18.119  17.675  60.002  1.00 25.59  ? 392 PRO B CD    1 
ATOM   7574  N N     . ILE B 2 393 ? 17.423  21.866  59.946  1.00 29.53  ? 393 ILE B N     1 
ATOM   7575  C CA    . ILE B 2 393 ? 18.226  23.064  60.118  1.00 30.96  ? 393 ILE B CA    1 
ATOM   7576  C C     . ILE B 2 393 ? 17.702  24.190  59.229  1.00 32.92  ? 393 ILE B C     1 
ATOM   7577  O O     . ILE B 2 393 ? 17.046  23.937  58.242  1.00 32.75  ? 393 ILE B O     1 
ATOM   7578  C CB    . ILE B 2 393 ? 19.715  22.752  59.798  1.00 28.84  ? 393 ILE B CB    1 
ATOM   7579  C CG1   . ILE B 2 393 ? 20.667  23.809  60.371  1.00 30.28  ? 393 ILE B CG1   1 
ATOM   7580  C CG2   . ILE B 2 393 ? 19.912  22.630  58.331  1.00 28.10  ? 393 ILE B CG2   1 
ATOM   7581  C CD1   . ILE B 2 393 ? 22.064  23.310  60.563  1.00 29.31  ? 393 ILE B CD1   1 
ATOM   7582  N N     . GLN B 2 394 ? 17.977  25.441  59.579  1.00 34.53  ? 394 GLN B N     1 
ATOM   7583  C CA    . GLN B 2 394 ? 17.548  26.550  58.743  1.00 33.76  ? 394 GLN B CA    1 
ATOM   7584  C C     . GLN B 2 394 ? 18.548  26.646  57.596  1.00 32.78  ? 394 GLN B C     1 
ATOM   7585  O O     . GLN B 2 394 ? 19.698  26.269  57.740  1.00 31.15  ? 394 GLN B O     1 
ATOM   7586  C CB    . GLN B 2 394 ? 17.408  27.853  59.551  1.00 36.30  ? 394 GLN B CB    1 
ATOM   7587  C CG    . GLN B 2 394 ? 16.122  28.658  59.291  1.00 46.02  ? 394 GLN B CG    1 
ATOM   7588  C CD    . GLN B 2 394 ? 14.799  27.875  59.623  1.00 60.26  ? 394 GLN B CD    1 
ATOM   7589  O OE1   . GLN B 2 394 ? 14.726  27.126  60.609  1.00 52.93  ? 394 GLN B OE1   1 
ATOM   7590  N NE2   . GLN B 2 394 ? 13.757  28.060  58.785  1.00 67.59  ? 394 GLN B NE2   1 
ATOM   7591  N N     . LYS B 2 395 ? 18.096  27.102  56.438  1.00 35.49  ? 395 LYS B N     1 
ATOM   7592  C CA    . LYS B 2 395 ? 18.925  27.046  55.244  1.00 32.94  ? 395 LYS B CA    1 
ATOM   7593  C C     . LYS B 2 395 ? 20.207  27.816  55.487  1.00 33.75  ? 395 LYS B C     1 
ATOM   7594  O O     . LYS B 2 395 ? 21.305  27.396  55.104  1.00 31.46  ? 395 LYS B O     1 
ATOM   7595  C CB    . LYS B 2 395 ? 18.183  27.608  54.025  1.00 27.93  ? 395 LYS B CB    1 
ATOM   7596  C CG    . LYS B 2 395 ? 19.083  27.801  52.832  1.00 32.18  ? 395 LYS B CG    1 
ATOM   7597  C CD    . LYS B 2 395 ? 18.315  27.990  51.548  1.00 40.51  ? 395 LYS B CD    1 
ATOM   7598  C CE    . LYS B 2 395 ? 18.740  29.249  50.811  1.00 46.04  ? 395 LYS B CE    1 
ATOM   7599  N NZ    . LYS B 2 395 ? 19.788  28.995  49.781  1.00 38.42  ? 395 LYS B NZ    1 
ATOM   7600  N N     . GLU B 2 396 ? 20.049  28.957  56.144  1.00 33.96  ? 396 GLU B N     1 
ATOM   7601  C CA    . GLU B 2 396 ? 21.128  29.913  56.239  1.00 35.24  ? 396 GLU B CA    1 
ATOM   7602  C C     . GLU B 2 396 ? 22.114  29.434  57.279  1.00 32.01  ? 396 GLU B C     1 
ATOM   7603  O O     . GLU B 2 396 ? 23.316  29.433  57.040  1.00 29.37  ? 396 GLU B O     1 
ATOM   7604  C CB    . GLU B 2 396 ? 20.592  31.310  56.545  1.00 34.42  ? 396 GLU B CB    1 
ATOM   7605  C CG    . GLU B 2 396 ? 19.702  31.897  55.467  1.00 39.82  ? 396 GLU B CG    1 
ATOM   7606  C CD    . GLU B 2 396 ? 18.313  31.312  55.483  1.00 44.02  ? 396 GLU B CD    1 
ATOM   7607  O OE1   . GLU B 2 396 ? 17.546  31.532  54.520  1.00 48.67  ? 396 GLU B OE1   1 
ATOM   7608  O OE2   . GLU B 2 396 ? 17.989  30.625  56.469  1.00 44.44  ? 396 GLU B OE2   1 
ATOM   7609  N N     . THR B 2 397 ? 21.605  28.998  58.420  1.00 29.05  ? 397 THR B N     1 
ATOM   7610  C CA    . THR B 2 397 ? 22.464  28.375  59.415  1.00 31.73  ? 397 THR B CA    1 
ATOM   7611  C C     . THR B 2 397 ? 23.421  27.328  58.814  1.00 32.36  ? 397 THR B C     1 
ATOM   7612  O O     . THR B 2 397 ? 24.636  27.456  58.939  1.00 31.34  ? 397 THR B O     1 
ATOM   7613  C CB    . THR B 2 397 ? 21.658  27.719  60.496  1.00 33.50  ? 397 THR B CB    1 
ATOM   7614  O OG1   . THR B 2 397 ? 20.771  28.679  61.071  1.00 28.33  ? 397 THR B OG1   1 
ATOM   7615  C CG2   . THR B 2 397 ? 22.594  27.130  61.553  1.00 34.40  ? 397 THR B CG2   1 
ATOM   7616  N N     . TRP B 2 398 ? 22.868  26.281  58.194  1.00 30.87  ? 398 TRP B N     1 
ATOM   7617  C CA    . TRP B 2 398 ? 23.673  25.249  57.513  1.00 30.14  ? 398 TRP B CA    1 
ATOM   7618  C C     . TRP B 2 398 ? 24.690  25.813  56.540  1.00 29.77  ? 398 TRP B C     1 
ATOM   7619  O O     . TRP B 2 398 ? 25.883  25.488  56.614  1.00 28.59  ? 398 TRP B O     1 
ATOM   7620  C CB    . TRP B 2 398 ? 22.779  24.268  56.753  1.00 29.41  ? 398 TRP B CB    1 
ATOM   7621  C CG    . TRP B 2 398 ? 23.521  23.161  56.030  1.00 28.75  ? 398 TRP B CG    1 
ATOM   7622  C CD1   . TRP B 2 398 ? 23.751  23.052  54.674  1.00 28.12  ? 398 TRP B CD1   1 
ATOM   7623  C CD2   . TRP B 2 398 ? 24.140  22.032  56.626  1.00 25.50  ? 398 TRP B CD2   1 
ATOM   7624  N NE1   . TRP B 2 398 ? 24.475  21.928  54.410  1.00 26.55  ? 398 TRP B NE1   1 
ATOM   7625  C CE2   . TRP B 2 398 ? 24.721  21.276  55.587  1.00 26.74  ? 398 TRP B CE2   1 
ATOM   7626  C CE3   . TRP B 2 398 ? 24.259  21.581  57.937  1.00 25.88  ? 398 TRP B CE3   1 
ATOM   7627  C CZ2   . TRP B 2 398 ? 25.396  20.089  55.823  1.00 27.19  ? 398 TRP B CZ2   1 
ATOM   7628  C CZ3   . TRP B 2 398 ? 24.923  20.396  58.168  1.00 27.81  ? 398 TRP B CZ3   1 
ATOM   7629  C CH2   . TRP B 2 398 ? 25.491  19.665  57.121  1.00 27.31  ? 398 TRP B CH2   1 
ATOM   7630  N N     . GLU B 2 399 ? 24.200  26.626  55.609  1.00 29.63  ? 399 GLU B N     1 
ATOM   7631  C CA    . GLU B 2 399 ? 25.052  27.242  54.594  1.00 29.85  ? 399 GLU B CA    1 
ATOM   7632  C C     . GLU B 2 399 ? 26.176  28.092  55.167  1.00 30.04  ? 399 GLU B C     1 
ATOM   7633  O O     . GLU B 2 399 ? 27.288  28.053  54.669  1.00 32.75  ? 399 GLU B O     1 
ATOM   7634  C CB    . GLU B 2 399 ? 24.225  28.090  53.663  1.00 27.63  ? 399 GLU B CB    1 
ATOM   7635  C CG    . GLU B 2 399 ? 23.971  27.453  52.370  1.00 27.99  ? 399 GLU B CG    1 
ATOM   7636  C CD    . GLU B 2 399 ? 22.709  27.957  51.739  1.00 34.95  ? 399 GLU B CD    1 
ATOM   7637  O OE1   . GLU B 2 399 ? 22.541  29.195  51.649  1.00 37.36  ? 399 GLU B OE1   1 
ATOM   7638  O OE2   . GLU B 2 399 ? 21.883  27.108  51.351  1.00 35.47  ? 399 GLU B OE2   1 
ATOM   7639  N N     . THR B 2 400 ? 25.896  28.852  56.216  1.00 29.75  ? 400 THR B N     1 
ATOM   7640  C CA    . THR B 2 400 ? 26.920  29.683  56.842  1.00 31.66  ? 400 THR B CA    1 
ATOM   7641  C C     . THR B 2 400 ? 28.060  28.833  57.426  1.00 33.34  ? 400 THR B C     1 
ATOM   7642  O O     . THR B 2 400 ? 29.228  29.160  57.266  1.00 32.77  ? 400 THR B O     1 
ATOM   7643  C CB    . THR B 2 400 ? 26.320  30.571  57.960  1.00 35.08  ? 400 THR B CB    1 
ATOM   7644  O OG1   . THR B 2 400 ? 25.456  31.574  57.397  1.00 29.25  ? 400 THR B OG1   1 
ATOM   7645  C CG2   . THR B 2 400 ? 27.442  31.227  58.789  1.00 35.00  ? 400 THR B CG2   1 
ATOM   7646  N N     . TRP B 2 401 ? 27.722  27.765  58.139  1.00 32.87  ? 401 TRP B N     1 
ATOM   7647  C CA    . TRP B 2 401 ? 28.757  26.931  58.750  1.00 34.14  ? 401 TRP B CA    1 
ATOM   7648  C C     . TRP B 2 401 ? 29.204  25.556  58.223  1.00 32.42  ? 401 TRP B C     1 
ATOM   7649  O O     . TRP B 2 401 ? 30.209  25.068  58.708  1.00 32.66  ? 401 TRP B O     1 
ATOM   7650  C CB    . TRP B 2 401 ? 28.496  26.826  60.261  1.00 33.63  ? 401 TRP B CB    1 
ATOM   7651  C CG    . TRP B 2 401 ? 28.689  28.122  60.904  1.00 34.96  ? 401 TRP B CG    1 
ATOM   7652  C CD1   . TRP B 2 401 ? 29.873  28.799  61.061  1.00 38.67  ? 401 TRP B CD1   1 
ATOM   7653  C CD2   . TRP B 2 401 ? 27.683  28.949  61.443  1.00 33.06  ? 401 TRP B CD2   1 
ATOM   7654  N NE1   . TRP B 2 401 ? 29.655  30.005  61.682  1.00 38.43  ? 401 TRP B NE1   1 
ATOM   7655  C CE2   . TRP B 2 401 ? 28.313  30.116  61.936  1.00 36.41  ? 401 TRP B CE2   1 
ATOM   7656  C CE3   . TRP B 2 401 ? 26.309  28.817  61.584  1.00 38.04  ? 401 TRP B CE3   1 
ATOM   7657  C CZ2   . TRP B 2 401 ? 27.608  31.142  62.555  1.00 37.19  ? 401 TRP B CZ2   1 
ATOM   7658  C CZ3   . TRP B 2 401 ? 25.598  29.853  62.201  1.00 43.94  ? 401 TRP B CZ3   1 
ATOM   7659  C CH2   . TRP B 2 401 ? 26.254  30.999  62.677  1.00 40.68  ? 401 TRP B CH2   1 
ATOM   7660  N N     . TRP B 2 402 ? 28.544  24.929  57.252  1.00 32.61  ? 402 TRP B N     1 
ATOM   7661  C CA    . TRP B 2 402 ? 28.812  23.474  57.053  1.00 34.08  ? 402 TRP B CA    1 
ATOM   7662  C C     . TRP B 2 402 ? 30.250  23.237  56.557  1.00 34.06  ? 402 TRP B C     1 
ATOM   7663  O O     . TRP B 2 402 ? 30.932  22.288  56.948  1.00 33.35  ? 402 TRP B O     1 
ATOM   7664  C CB    . TRP B 2 402 ? 27.760  22.778  56.145  1.00 32.18  ? 402 TRP B CB    1 
ATOM   7665  C CG    . TRP B 2 402 ? 27.938  23.062  54.664  1.00 30.17  ? 402 TRP B CG    1 
ATOM   7666  C CD1   . TRP B 2 402 ? 27.438  24.117  53.982  1.00 30.73  ? 402 TRP B CD1   1 
ATOM   7667  C CD2   . TRP B 2 402 ? 28.696  22.295  53.718  1.00 29.05  ? 402 TRP B CD2   1 
ATOM   7668  N NE1   . TRP B 2 402 ? 27.842  24.075  52.673  1.00 32.78  ? 402 TRP B NE1   1 
ATOM   7669  C CE2   . TRP B 2 402 ? 28.615  22.965  52.482  1.00 29.76  ? 402 TRP B CE2   1 
ATOM   7670  C CE3   . TRP B 2 402 ? 29.424  21.104  53.792  1.00 28.78  ? 402 TRP B CE3   1 
ATOM   7671  C CZ2   . TRP B 2 402 ? 29.221  22.477  51.324  1.00 28.24  ? 402 TRP B CZ2   1 
ATOM   7672  C CZ3   . TRP B 2 402 ? 30.038  20.630  52.647  1.00 28.55  ? 402 TRP B CZ3   1 
ATOM   7673  C CH2   . TRP B 2 402 ? 29.935  21.315  51.434  1.00 29.07  ? 402 TRP B CH2   1 
ATOM   7674  N N     . THR B 2 403 ? 30.691  24.162  55.719  1.00 34.54  ? 403 THR B N     1 
ATOM   7675  C CA    . THR B 2 403 ? 32.039  24.213  55.159  1.00 38.47  ? 403 THR B CA    1 
ATOM   7676  C C     . THR B 2 403 ? 33.174  24.177  56.203  1.00 40.28  ? 403 THR B C     1 
ATOM   7677  O O     . THR B 2 403 ? 34.316  23.906  55.869  1.00 45.55  ? 403 THR B O     1 
ATOM   7678  C CB    . THR B 2 403 ? 32.180  25.517  54.368  1.00 36.08  ? 403 THR B CB    1 
ATOM   7679  O OG1   . THR B 2 403 ? 30.969  26.280  54.541  1.00 42.47  ? 403 THR B OG1   1 
ATOM   7680  C CG2   . THR B 2 403 ? 32.340  25.217  52.920  1.00 36.60  ? 403 THR B CG2   1 
ATOM   7681  N N     . GLU B 2 404 ? 32.871  24.478  57.456  1.00 37.25  ? 404 GLU B N     1 
ATOM   7682  C CA    . GLU B 2 404 ? 33.864  24.400  58.506  1.00 35.74  ? 404 GLU B CA    1 
ATOM   7683  C C     . GLU B 2 404 ? 34.074  23.002  59.023  1.00 34.21  ? 404 GLU B C     1 
ATOM   7684  O O     . GLU B 2 404 ? 35.114  22.686  59.543  1.00 37.71  ? 404 GLU B O     1 
ATOM   7685  C CB    . GLU B 2 404 ? 33.418  25.256  59.657  1.00 37.72  ? 404 GLU B CB    1 
ATOM   7686  C CG    . GLU B 2 404 ? 33.345  26.696  59.280  1.00 43.82  ? 404 GLU B CG    1 
ATOM   7687  C CD    . GLU B 2 404 ? 34.704  27.307  59.224  1.00 48.65  ? 404 GLU B CD    1 
ATOM   7688  O OE1   . GLU B 2 404 ? 35.590  26.820  59.962  1.00 48.25  ? 404 GLU B OE1   1 
ATOM   7689  O OE2   . GLU B 2 404 ? 34.872  28.269  58.450  1.00 55.79  ? 404 GLU B OE2   1 
ATOM   7690  N N     . TYR B 2 405 ? 33.043  22.191  58.999  1.00 34.19  ? 405 TYR B N     1 
ATOM   7691  C CA    . TYR B 2 405 ? 33.154  20.877  59.597  1.00 34.22  ? 405 TYR B CA    1 
ATOM   7692  C C     . TYR B 2 405 ? 33.353  19.779  58.566  1.00 34.33  ? 405 TYR B C     1 
ATOM   7693  O O     . TYR B 2 405 ? 33.390  18.605  58.906  1.00 35.73  ? 405 TYR B O     1 
ATOM   7694  C CB    . TYR B 2 405 ? 32.023  20.653  60.609  1.00 35.77  ? 405 TYR B CB    1 
ATOM   7695  C CG    . TYR B 2 405 ? 31.835  21.924  61.416  1.00 36.70  ? 405 TYR B CG    1 
ATOM   7696  C CD1   . TYR B 2 405 ? 32.738  22.277  62.414  1.00 34.17  ? 405 TYR B CD1   1 
ATOM   7697  C CD2   . TYR B 2 405 ? 30.809  22.805  61.129  1.00 36.06  ? 405 TYR B CD2   1 
ATOM   7698  C CE1   . TYR B 2 405 ? 32.604  23.433  63.114  1.00 33.04  ? 405 TYR B CE1   1 
ATOM   7699  C CE2   . TYR B 2 405 ? 30.676  23.977  61.818  1.00 35.92  ? 405 TYR B CE2   1 
ATOM   7700  C CZ    . TYR B 2 405 ? 31.577  24.291  62.806  1.00 37.48  ? 405 TYR B CZ    1 
ATOM   7701  O OH    . TYR B 2 405 ? 31.432  25.475  63.497  1.00 38.37  ? 405 TYR B OH    1 
ATOM   7702  N N     . TRP B 2 406 ? 33.506  20.173  57.304  1.00 34.06  ? 406 TRP B N     1 
ATOM   7703  C CA    . TRP B 2 406 ? 33.493  19.199  56.221  1.00 34.23  ? 406 TRP B CA    1 
ATOM   7704  C C     . TRP B 2 406 ? 34.823  18.509  55.981  1.00 34.03  ? 406 TRP B C     1 
ATOM   7705  O O     . TRP B 2 406 ? 35.805  19.137  55.614  1.00 35.13  ? 406 TRP B O     1 
ATOM   7706  C CB    . TRP B 2 406 ? 32.995  19.836  54.920  1.00 32.01  ? 406 TRP B CB    1 
ATOM   7707  C CG    . TRP B 2 406 ? 32.433  18.816  53.983  1.00 31.38  ? 406 TRP B CG    1 
ATOM   7708  C CD1   . TRP B 2 406 ? 32.985  18.376  52.819  1.00 32.10  ? 406 TRP B CD1   1 
ATOM   7709  C CD2   . TRP B 2 406 ? 31.212  18.076  54.151  1.00 32.05  ? 406 TRP B CD2   1 
ATOM   7710  N NE1   . TRP B 2 406 ? 32.173  17.426  52.233  1.00 32.13  ? 406 TRP B NE1   1 
ATOM   7711  C CE2   . TRP B 2 406 ? 31.083  17.220  53.037  1.00 32.83  ? 406 TRP B CE2   1 
ATOM   7712  C CE3   . TRP B 2 406 ? 30.213  18.055  55.133  1.00 30.49  ? 406 TRP B CE3   1 
ATOM   7713  C CZ2   . TRP B 2 406 ? 29.996  16.367  52.878  1.00 30.64  ? 406 TRP B CZ2   1 
ATOM   7714  C CZ3   . TRP B 2 406 ? 29.139  17.192  54.969  1.00 29.05  ? 406 TRP B CZ3   1 
ATOM   7715  C CH2   . TRP B 2 406 ? 29.038  16.375  53.855  1.00 29.55  ? 406 TRP B CH2   1 
ATOM   7716  N N     . GLN B 2 407 ? 34.842  17.207  56.237  1.00 34.93  ? 407 GLN B N     1 
ATOM   7717  C CA    . GLN B 2 407 ? 36.039  16.386  56.060  1.00 37.61  ? 407 GLN B CA    1 
ATOM   7718  C C     . GLN B 2 407 ? 36.066  15.435  54.856  1.00 37.11  ? 407 GLN B C     1 
ATOM   7719  O O     . GLN B 2 407 ? 36.984  14.627  54.724  1.00 38.39  ? 407 GLN B O     1 
ATOM   7720  C CB    . GLN B 2 407 ? 36.414  15.692  57.374  1.00 37.29  ? 407 GLN B CB    1 
ATOM   7721  C CG    . GLN B 2 407 ? 36.649  16.656  58.537  1.00 36.05  ? 407 GLN B CG    1 
ATOM   7722  C CD    . GLN B 2 407 ? 36.492  15.973  59.869  1.00 43.02  ? 407 GLN B CD    1 
ATOM   7723  O OE1   . GLN B 2 407 ? 35.727  15.025  59.995  1.00 45.60  ? 407 GLN B OE1   1 
ATOM   7724  N NE2   . GLN B 2 407 ? 37.228  16.430  60.868  1.00 44.11  ? 407 GLN B NE2   1 
ATOM   7725  N N     . ALA B 2 408 ? 35.039  15.503  54.015  1.00 35.22  ? 408 ALA B N     1 
ATOM   7726  C CA    . ALA B 2 408 ? 34.852  14.523  52.936  1.00 34.34  ? 408 ALA B CA    1 
ATOM   7727  C C     . ALA B 2 408 ? 35.137  15.098  51.554  1.00 33.54  ? 408 ALA B C     1 
ATOM   7728  O O     . ALA B 2 408 ? 35.079  16.315  51.350  1.00 33.03  ? 408 ALA B O     1 
ATOM   7729  C CB    . ALA B 2 408 ? 33.463  13.938  52.977  1.00 33.69  ? 408 ALA B CB    1 
ATOM   7730  N N     . THR B 2 409 ? 35.494  14.228  50.613  1.00 33.46  ? 409 THR B N     1 
ATOM   7731  C CA    . THR B 2 409 ? 35.801  14.702  49.263  1.00 35.71  ? 409 THR B CA    1 
ATOM   7732  C C     . THR B 2 409 ? 34.594  14.784  48.306  1.00 36.71  ? 409 THR B C     1 
ATOM   7733  O O     . THR B 2 409 ? 34.692  15.427  47.260  1.00 35.96  ? 409 THR B O     1 
ATOM   7734  C CB    . THR B 2 409 ? 36.970  13.932  48.620  1.00 38.45  ? 409 THR B CB    1 
ATOM   7735  O OG1   . THR B 2 409 ? 36.598  12.567  48.425  1.00 40.32  ? 409 THR B OG1   1 
ATOM   7736  C CG2   . THR B 2 409 ? 38.205  14.013  49.500  1.00 41.53  ? 409 THR B CG2   1 
ATOM   7737  N N     . TRP B 2 410 ? 33.472  14.154  48.679  1.00 31.82  ? 410 TRP B N     1 
ATOM   7738  C CA    . TRP B 2 410 ? 32.202  14.321  47.980  1.00 28.88  ? 410 TRP B CA    1 
ATOM   7739  C C     . TRP B 2 410 ? 31.227  15.284  48.684  1.00 32.07  ? 410 TRP B C     1 
ATOM   7740  O O     . TRP B 2 410 ? 31.463  15.743  49.806  1.00 32.93  ? 410 TRP B O     1 
ATOM   7741  C CB    . TRP B 2 410 ? 31.509  12.967  47.815  1.00 28.65  ? 410 TRP B CB    1 
ATOM   7742  C CG    . TRP B 2 410 ? 31.837  11.953  48.870  1.00 31.49  ? 410 TRP B CG    1 
ATOM   7743  C CD1   . TRP B 2 410 ? 32.628  10.868  48.716  1.00 34.47  ? 410 TRP B CD1   1 
ATOM   7744  C CD2   . TRP B 2 410 ? 31.374  11.917  50.230  1.00 31.54  ? 410 TRP B CD2   1 
ATOM   7745  N NE1   . TRP B 2 410 ? 32.700  10.153  49.878  1.00 35.21  ? 410 TRP B NE1   1 
ATOM   7746  C CE2   . TRP B 2 410 ? 31.943  10.775  50.831  1.00 35.32  ? 410 TRP B CE2   1 
ATOM   7747  C CE3   . TRP B 2 410 ? 30.542  12.734  50.996  1.00 30.22  ? 410 TRP B CE3   1 
ATOM   7748  C CZ2   . TRP B 2 410 ? 31.707  10.424  52.170  1.00 35.21  ? 410 TRP B CZ2   1 
ATOM   7749  C CZ3   . TRP B 2 410 ? 30.305  12.385  52.319  1.00 34.87  ? 410 TRP B CZ3   1 
ATOM   7750  C CH2   . TRP B 2 410 ? 30.888  11.235  52.894  1.00 33.56  ? 410 TRP B CH2   1 
ATOM   7751  N N     . ILE B 2 411 ? 30.120  15.575  48.014  1.00 27.76  ? 411 ILE B N     1 
ATOM   7752  C CA    . ILE B 2 411 ? 29.095  16.458  48.557  1.00 29.64  ? 411 ILE B CA    1 
ATOM   7753  C C     . ILE B 2 411 ? 27.678  15.969  48.279  1.00 29.66  ? 411 ILE B C     1 
ATOM   7754  O O     . ILE B 2 411 ? 27.192  16.113  47.157  1.00 30.27  ? 411 ILE B O     1 
ATOM   7755  C CB    . ILE B 2 411 ? 29.198  17.946  48.111  1.00 28.50  ? 411 ILE B CB    1 
ATOM   7756  C CG1   . ILE B 2 411 ? 30.587  18.514  48.291  1.00 23.63  ? 411 ILE B CG1   1 
ATOM   7757  C CG2   . ILE B 2 411 ? 28.267  18.757  48.935  1.00 28.72  ? 411 ILE B CG2   1 
ATOM   7758  C CD1   . ILE B 2 411 ? 30.703  19.876  47.698  1.00 30.82  ? 411 ILE B CD1   1 
ATOM   7759  N N     . PRO B 2 412 ? 27.019  15.351  49.262  1.00 28.79  ? 412 PRO B N     1 
ATOM   7760  C CA    . PRO B 2 412 ? 25.662  14.900  48.948  1.00 26.85  ? 412 PRO B CA    1 
ATOM   7761  C C     . PRO B 2 412 ? 24.724  16.040  48.602  1.00 28.05  ? 412 PRO B C     1 
ATOM   7762  O O     . PRO B 2 412 ? 25.072  17.205  48.716  1.00 33.46  ? 412 PRO B O     1 
ATOM   7763  C CB    . PRO B 2 412 ? 25.217  14.267  50.257  1.00 27.32  ? 412 PRO B CB    1 
ATOM   7764  C CG    . PRO B 2 412 ? 25.957  15.022  51.285  1.00 27.61  ? 412 PRO B CG    1 
ATOM   7765  C CD    . PRO B 2 412 ? 27.309  15.266  50.700  1.00 28.92  ? 412 PRO B CD    1 
ATOM   7766  N N     . GLU B 2 413 ? 23.519  15.678  48.206  1.00 26.89  ? 413 GLU B N     1 
ATOM   7767  C CA    . GLU B 2 413 ? 22.456  16.596  47.849  1.00 27.85  ? 413 GLU B CA    1 
ATOM   7768  C C     . GLU B 2 413 ? 21.603  16.808  49.111  1.00 30.70  ? 413 GLU B C     1 
ATOM   7769  O O     . GLU B 2 413 ? 21.372  15.859  49.873  1.00 29.28  ? 413 GLU B O     1 
ATOM   7770  C CB    . GLU B 2 413 ? 21.631  15.918  46.758  1.00 29.70  ? 413 GLU B CB    1 
ATOM   7771  C CG    . GLU B 2 413 ? 20.787  16.804  45.906  1.00 36.57  ? 413 GLU B CG    1 
ATOM   7772  C CD    . GLU B 2 413 ? 21.578  17.442  44.794  1.00 44.89  ? 413 GLU B CD    1 
ATOM   7773  O OE1   . GLU B 2 413 ? 22.738  17.024  44.549  1.00 40.23  ? 413 GLU B OE1   1 
ATOM   7774  O OE2   . GLU B 2 413 ? 21.024  18.374  44.168  1.00 51.00  ? 413 GLU B OE2   1 
ATOM   7775  N N     . TRP B 2 414 ? 21.148  18.034  49.378  1.00 30.07  ? 414 TRP B N     1 
ATOM   7776  C CA    . TRP B 2 414 ? 20.361  18.244  50.616  1.00 28.81  ? 414 TRP B CA    1 
ATOM   7777  C C     . TRP B 2 414 ? 19.273  19.288  50.453  1.00 28.90  ? 414 TRP B C     1 
ATOM   7778  O O     . TRP B 2 414 ? 19.372  20.156  49.599  1.00 31.50  ? 414 TRP B O     1 
ATOM   7779  C CB    . TRP B 2 414 ? 21.250  18.585  51.827  1.00 24.97  ? 414 TRP B CB    1 
ATOM   7780  C CG    . TRP B 2 414 ? 22.101  19.774  51.564  1.00 28.62  ? 414 TRP B CG    1 
ATOM   7781  C CD1   . TRP B 2 414 ? 21.679  21.019  51.174  1.00 28.00  ? 414 TRP B CD1   1 
ATOM   7782  C CD2   . TRP B 2 414 ? 23.515  19.840  51.635  1.00 27.92  ? 414 TRP B CD2   1 
ATOM   7783  N NE1   . TRP B 2 414 ? 22.742  21.847  50.990  1.00 26.73  ? 414 TRP B NE1   1 
ATOM   7784  C CE2   . TRP B 2 414 ? 23.888  21.156  51.267  1.00 28.29  ? 414 TRP B CE2   1 
ATOM   7785  C CE3   . TRP B 2 414 ? 24.511  18.924  51.983  1.00 27.50  ? 414 TRP B CE3   1 
ATOM   7786  C CZ2   . TRP B 2 414 ? 25.213  21.574  51.236  1.00 27.66  ? 414 TRP B CZ2   1 
ATOM   7787  C CZ3   . TRP B 2 414 ? 25.834  19.346  51.965  1.00 28.76  ? 414 TRP B CZ3   1 
ATOM   7788  C CH2   . TRP B 2 414 ? 26.169  20.659  51.589  1.00 28.35  ? 414 TRP B CH2   1 
ATOM   7789  N N     . GLU B 2 415 ? 18.233  19.178  51.270  1.00 28.73  ? 415 GLU B N     1 
ATOM   7790  C CA    . GLU B 2 415 ? 17.198  20.188  51.363  1.00 28.44  ? 415 GLU B CA    1 
ATOM   7791  C C     . GLU B 2 415 ? 16.844  20.346  52.829  1.00 30.50  ? 415 GLU B C     1 
ATOM   7792  O O     . GLU B 2 415 ? 17.107  19.471  53.638  1.00 30.58  ? 415 GLU B O     1 
ATOM   7793  C CB    . GLU B 2 415 ? 15.969  19.793  50.546  1.00 29.91  ? 415 GLU B CB    1 
ATOM   7794  C CG    . GLU B 2 415 ? 15.147  18.676  51.164  1.00 36.12  ? 415 GLU B CG    1 
ATOM   7795  C CD    . GLU B 2 415 ? 14.126  18.089  50.204  1.00 45.26  ? 415 GLU B CD    1 
ATOM   7796  O OE1   . GLU B 2 415 ? 14.235  18.358  48.984  1.00 50.74  ? 415 GLU B OE1   1 
ATOM   7797  O OE2   . GLU B 2 415 ? 13.217  17.361  50.666  1.00 43.17  ? 415 GLU B OE2   1 
ATOM   7798  N N     . PHE B 2 416 ? 16.220  21.467  53.162  1.00 32.14  ? 416 PHE B N     1 
ATOM   7799  C CA    . PHE B 2 416 ? 16.004  21.859  54.547  1.00 29.21  ? 416 PHE B CA    1 
ATOM   7800  C C     . PHE B 2 416 ? 14.602  21.635  55.059  1.00 32.59  ? 416 PHE B C     1 
ATOM   7801  O O     . PHE B 2 416 ? 13.621  21.905  54.396  1.00 39.47  ? 416 PHE B O     1 
ATOM   7802  C CB    . PHE B 2 416 ? 16.400  23.312  54.679  1.00 28.86  ? 416 PHE B CB    1 
ATOM   7803  C CG    . PHE B 2 416 ? 17.779  23.562  54.201  1.00 30.30  ? 416 PHE B CG    1 
ATOM   7804  C CD1   . PHE B 2 416 ? 18.853  23.027  54.882  1.00 29.68  ? 416 PHE B CD1   1 
ATOM   7805  C CD2   . PHE B 2 416 ? 18.005  24.255  53.040  1.00 28.14  ? 416 PHE B CD2   1 
ATOM   7806  C CE1   . PHE B 2 416 ? 20.111  23.214  54.431  1.00 29.78  ? 416 PHE B CE1   1 
ATOM   7807  C CE2   . PHE B 2 416 ? 19.264  24.452  52.590  1.00 29.42  ? 416 PHE B CE2   1 
ATOM   7808  C CZ    . PHE B 2 416 ? 20.322  23.928  53.284  1.00 32.10  ? 416 PHE B CZ    1 
ATOM   7809  N N     . VAL B 2 417 ? 14.510  21.178  56.281  1.00 33.02  ? 417 VAL B N     1 
ATOM   7810  C CA    . VAL B 2 417 ? 13.252  20.701  56.798  1.00 40.14  ? 417 VAL B CA    1 
ATOM   7811  C C     . VAL B 2 417 ? 12.863  21.412  58.086  1.00 47.35  ? 417 VAL B C     1 
ATOM   7812  O O     . VAL B 2 417 ? 13.719  21.759  58.898  1.00 45.95  ? 417 VAL B O     1 
ATOM   7813  C CB    . VAL B 2 417 ? 13.379  19.180  57.047  1.00 36.58  ? 417 VAL B CB    1 
ATOM   7814  C CG1   . VAL B 2 417 ? 12.439  18.712  58.090  1.00 37.62  ? 417 VAL B CG1   1 
ATOM   7815  C CG2   . VAL B 2 417 ? 13.159  18.466  55.755  1.00 40.17  ? 417 VAL B CG2   1 
ATOM   7816  N N     . ASN B 2 418 ? 11.573  21.675  58.260  1.00 54.32  ? 418 ASN B N     1 
ATOM   7817  C CA    . ASN B 2 418 ? 11.072  21.946  59.608  1.00 59.42  ? 418 ASN B CA    1 
ATOM   7818  C C     . ASN B 2 418 ? 9.934   21.010  60.047  1.00 61.27  ? 418 ASN B C     1 
ATOM   7819  O O     . ASN B 2 418 ? 8.772   21.175  59.630  1.00 59.31  ? 418 ASN B O     1 
ATOM   7820  C CB    . ASN B 2 418 ? 10.721  23.441  59.790  1.00 59.93  ? 418 ASN B CB    1 
ATOM   7821  C CG    . ASN B 2 418 ? 10.012  24.030  58.585  1.00 64.03  ? 418 ASN B CG    1 
ATOM   7822  O OD1   . ASN B 2 418 ? 8.781   24.134  58.583  1.00 63.79  ? 418 ASN B OD1   1 
ATOM   7823  N ND2   . ASN B 2 418 ? 10.782  24.415  57.546  1.00 59.50  ? 418 ASN B ND2   1 
ATOM   7824  N N     . THR B 2 419 ? 10.281  20.082  60.946  1.00 62.13  ? 419 THR B N     1 
ATOM   7825  C CA    . THR B 2 419 ? 9.390   18.988  61.357  1.00 72.13  ? 419 THR B CA    1 
ATOM   7826  C C     . THR B 2 419 ? 9.339   18.817  62.849  1.00 71.41  ? 419 THR B C     1 
ATOM   7827  O O     . THR B 2 419 ? 9.820   17.812  63.407  1.00 69.34  ? 419 THR B O     1 
ATOM   7828  C CB    . THR B 2 419 ? 9.786   17.599  60.807  1.00 80.34  ? 419 THR B CB    1 
ATOM   7829  O OG1   . THR B 2 419 ? 9.781   17.607  59.370  1.00 80.13  ? 419 THR B OG1   1 
ATOM   7830  C CG2   . THR B 2 419 ? 8.770   16.540  61.321  1.00 81.56  ? 419 THR B CG2   1 
ATOM   7831  N N     . PRO B 2 420 ? 8.699   19.775  63.501  1.00 70.34  ? 420 PRO B N     1 
ATOM   7832  C CA    . PRO B 2 420 ? 8.551   19.716  64.955  1.00 76.29  ? 420 PRO B CA    1 
ATOM   7833  C C     . PRO B 2 420 ? 8.123   18.293  65.411  1.00 87.26  ? 420 PRO B C     1 
ATOM   7834  O O     . PRO B 2 420 ? 7.423   17.549  64.689  1.00 87.37  ? 420 PRO B O     1 
ATOM   7835  C CB    . PRO B 2 420 ? 7.479   20.775  65.233  1.00 67.16  ? 420 PRO B CB    1 
ATOM   7836  C CG    . PRO B 2 420 ? 7.655   21.767  64.107  1.00 64.52  ? 420 PRO B CG    1 
ATOM   7837  C CD    . PRO B 2 420 ? 8.170   21.018  62.915  1.00 61.67  ? 420 PRO B CD    1 
ATOM   7838  N N     . PRO B 2 421 ? 8.582   17.908  66.613  1.00 86.28  ? 421 PRO B N     1 
ATOM   7839  C CA    . PRO B 2 421 ? 8.752   16.511  67.032  1.00 90.74  ? 421 PRO B CA    1 
ATOM   7840  C C     . PRO B 2 421 ? 7.491   15.684  67.293  1.00 86.72  ? 421 PRO B C     1 
ATOM   7841  O O     . PRO B 2 421 ? 7.093   15.594  68.458  1.00 89.27  ? 421 PRO B O     1 
ATOM   7842  C CB    . PRO B 2 421 ? 9.545   16.636  68.360  1.00 88.93  ? 421 PRO B CB    1 
ATOM   7843  C CG    . PRO B 2 421 ? 9.991   18.080  68.453  1.00 81.03  ? 421 PRO B CG    1 
ATOM   7844  C CD    . PRO B 2 421 ? 8.963   18.848  67.683  1.00 80.59  ? 421 PRO B CD    1 
ATOM   7845  N N     . LEU B 2 422 ? 6.822   15.147  66.280  1.00 78.70  ? 422 LEU B N     1 
ATOM   7846  C CA    . LEU B 2 422 ? 6.152   13.873  66.550  1.00 83.06  ? 422 LEU B CA    1 
ATOM   7847  C C     . LEU B 2 422 ? 6.800   12.642  65.905  1.00 83.94  ? 422 LEU B C     1 
ATOM   7848  O O     . LEU B 2 422 ? 6.402   11.499  66.138  1.00 81.84  ? 422 LEU B O     1 
ATOM   7849  C CB    . LEU B 2 422 ? 4.642   13.946  66.369  1.00 84.56  ? 422 LEU B CB    1 
ATOM   7850  C CG    . LEU B 2 422 ? 3.979   14.460  67.654  1.00 74.99  ? 422 LEU B CG    1 
ATOM   7851  C CD1   . LEU B 2 422 ? 2.487   14.209  67.558  1.00 59.53  ? 422 LEU B CD1   1 
ATOM   7852  C CD2   . LEU B 2 422 ? 4.595   13.824  68.922  1.00 62.72  ? 422 LEU B CD2   1 
ATOM   7853  N N     . VAL B 2 423 ? 7.808   12.899  65.089  1.00 86.37  ? 423 VAL B N     1 
ATOM   7854  C CA    . VAL B 2 423 ? 8.590   11.836  64.474  1.00 82.33  ? 423 VAL B CA    1 
ATOM   7855  C C     . VAL B 2 423 ? 9.840   11.637  65.332  1.00 81.54  ? 423 VAL B C     1 
ATOM   7856  O O     . VAL B 2 423 ? 10.701  10.807  65.021  1.00 75.65  ? 423 VAL B O     1 
ATOM   7857  C CB    . VAL B 2 423 ? 8.958   12.182  62.994  1.00 83.92  ? 423 VAL B CB    1 
ATOM   7858  C CG1   . VAL B 2 423 ? 10.071  11.289  62.456  1.00 65.59  ? 423 VAL B CG1   1 
ATOM   7859  C CG2   . VAL B 2 423 ? 7.726   12.105  62.097  1.00 89.29  ? 423 VAL B CG2   1 
ATOM   7860  N N     . LYS B 2 424 ? 9.927   12.392  66.428  1.00 84.50  ? 424 LYS B N     1 
ATOM   7861  C CA    . LYS B 2 424 ? 11.065  12.300  67.338  1.00 78.55  ? 424 LYS B CA    1 
ATOM   7862  C C     . LYS B 2 424 ? 11.093  10.882  67.958  1.00 81.30  ? 424 LYS B C     1 
ATOM   7863  O O     . LYS B 2 424 ? 12.020  10.518  68.691  1.00 78.89  ? 424 LYS B O     1 
ATOM   7864  C CB    . LYS B 2 424 ? 11.029  13.416  68.395  1.00 78.39  ? 424 LYS B CB    1 
ATOM   7865  C CG    . LYS B 2 424 ? 12.392  14.103  68.622  1.00 76.56  ? 424 LYS B CG    1 
ATOM   7866  C CD    . LYS B 2 424 ? 12.377  15.135  69.785  1.00 82.42  ? 424 LYS B CD    1 
ATOM   7867  C CE    . LYS B 2 424 ? 13.816  15.442  70.324  1.00 73.04  ? 424 LYS B CE    1 
ATOM   7868  N NZ    . LYS B 2 424 ? 14.016  16.742  71.121  1.00 69.70  ? 424 LYS B NZ    1 
ATOM   7869  N N     . LEU B 2 425 ? 10.082  10.080  67.608  1.00 81.89  ? 425 LEU B N     1 
ATOM   7870  C CA    . LEU B 2 425 ? 9.839   8.740   68.173  1.00 74.85  ? 425 LEU B CA    1 
ATOM   7871  C C     . LEU B 2 425 ? 10.569  7.522   67.545  1.00 69.02  ? 425 LEU B C     1 
ATOM   7872  O O     . LEU B 2 425 ? 10.202  6.375   67.770  1.00 61.20  ? 425 LEU B O     1 
ATOM   7873  C CB    . LEU B 2 425 ? 8.353   8.513   68.366  1.00 73.39  ? 425 LEU B CB    1 
ATOM   7874  C CG    . LEU B 2 425 ? 8.051   9.312   69.636  1.00 82.97  ? 425 LEU B CG    1 
ATOM   7875  C CD1   . LEU B 2 425 ? 8.996   8.811   70.711  1.00 81.46  ? 425 LEU B CD1   1 
ATOM   7876  C CD2   . LEU B 2 425 ? 8.187   10.857  69.465  1.00 80.46  ? 425 LEU B CD2   1 
ATOM   7877  N N     . TRP B 2 426 ? 11.564  7.798   66.709  1.00 66.53  ? 426 TRP B N     1 
ATOM   7878  C CA    . TRP B 2 426 ? 12.612  6.829   66.398  1.00 59.80  ? 426 TRP B CA    1 
ATOM   7879  C C     . TRP B 2 426 ? 13.615  6.589   67.536  1.00 63.71  ? 426 TRP B C     1 
ATOM   7880  O O     . TRP B 2 426 ? 14.570  5.824   67.379  1.00 66.46  ? 426 TRP B O     1 
ATOM   7881  C CB    . TRP B 2 426 ? 13.368  7.250   65.165  1.00 51.37  ? 426 TRP B CB    1 
ATOM   7882  C CG    . TRP B 2 426 ? 12.501  7.399   64.008  1.00 51.27  ? 426 TRP B CG    1 
ATOM   7883  C CD1   . TRP B 2 426 ? 11.906  8.547   63.576  1.00 51.16  ? 426 TRP B CD1   1 
ATOM   7884  C CD2   . TRP B 2 426 ? 12.110  6.369   63.098  1.00 49.06  ? 426 TRP B CD2   1 
ATOM   7885  N NE1   . TRP B 2 426 ? 11.172  8.302   62.440  1.00 51.53  ? 426 TRP B NE1   1 
ATOM   7886  C CE2   . TRP B 2 426 ? 11.276  6.974   62.119  1.00 50.07  ? 426 TRP B CE2   1 
ATOM   7887  C CE3   . TRP B 2 426 ? 12.382  4.997   63.011  1.00 44.05  ? 426 TRP B CE3   1 
ATOM   7888  C CZ2   . TRP B 2 426 ? 10.715  6.259   61.059  1.00 47.54  ? 426 TRP B CZ2   1 
ATOM   7889  C CZ3   . TRP B 2 426 ? 11.825  4.282   61.974  1.00 48.66  ? 426 TRP B CZ3   1 
ATOM   7890  C CH2   . TRP B 2 426 ? 10.994  4.918   61.001  1.00 53.59  ? 426 TRP B CH2   1 
ATOM   7891  N N     . TYR B 2 427 ? 13.452  7.297   68.644  1.00 63.58  ? 427 TYR B N     1 
ATOM   7892  C CA    . TYR B 2 427 ? 14.229  7.034   69.845  1.00 66.16  ? 427 TYR B CA    1 
ATOM   7893  C C     . TYR B 2 427 ? 13.349  7.487   70.981  1.00 75.08  ? 427 TYR B C     1 
ATOM   7894  O O     . TYR B 2 427 ? 12.569  8.427   70.819  1.00 74.54  ? 427 TYR B O     1 
ATOM   7895  C CB    . TYR B 2 427 ? 15.547  7.816   69.788  1.00 67.78  ? 427 TYR B CB    1 
ATOM   7896  C CG    . TYR B 2 427 ? 16.249  8.131   71.104  1.00 69.07  ? 427 TYR B CG    1 
ATOM   7897  C CD1   . TYR B 2 427 ? 17.460  7.529   71.429  1.00 68.68  ? 427 TYR B CD1   1 
ATOM   7898  C CD2   . TYR B 2 427 ? 15.736  9.077   71.984  1.00 71.88  ? 427 TYR B CD2   1 
ATOM   7899  C CE1   . TYR B 2 427 ? 18.117  7.830   72.610  1.00 72.27  ? 427 TYR B CE1   1 
ATOM   7900  C CE2   . TYR B 2 427 ? 16.382  9.389   73.168  1.00 73.70  ? 427 TYR B CE2   1 
ATOM   7901  C CZ    . TYR B 2 427 ? 17.574  8.765   73.483  1.00 76.71  ? 427 TYR B CZ    1 
ATOM   7902  O OH    . TYR B 2 427 ? 18.223  9.079   74.670  1.00 75.00  ? 427 TYR B OH    1 
ATOM   7903  N N     . GLN B 2 428 ? 13.456  6.818   72.122  1.00 81.60  ? 428 GLN B N     1 
ATOM   7904  C CA    . GLN B 2 428 ? 12.594  7.115   73.272  1.00 94.00  ? 428 GLN B CA    1 
ATOM   7905  C C     . GLN B 2 428 ? 12.194  8.611   73.422  1.00 97.91  ? 428 GLN B C     1 
ATOM   7906  O O     . GLN B 2 428 ? 12.822  9.531   72.868  1.00 87.61  ? 428 GLN B O     1 
ATOM   7907  C CB    . GLN B 2 428 ? 13.223  6.569   74.568  1.00 96.35  ? 428 GLN B CB    1 
ATOM   7908  C CG    . GLN B 2 428 ? 13.489  5.053   74.553  1.00 98.74  ? 428 GLN B CG    1 
ATOM   7909  C CD    . GLN B 2 428 ? 12.214  4.208   74.617  1.00 98.78  ? 428 GLN B CD    1 
ATOM   7910  O OE1   . GLN B 2 428 ? 11.183  4.556   74.028  1.00 96.49  ? 428 GLN B OE1   1 
ATOM   7911  N NE2   . GLN B 2 428 ? 12.284  3.092   75.343  1.00 96.13  ? 428 GLN B NE2   1 
ATOM   7912  O OXT   . GLN B 2 428 ? 11.204  8.942   74.099  1.00 100.58 ? 428 GLN B OXT   1 
ATOM   7913  N N     . VAL C 1 2   ? 35.871  -26.397 -30.961 1.00 94.61  ? 0   VAL C N     1 
ATOM   7914  C CA    . VAL C 1 2   ? 36.502  -26.033 -29.695 1.00 95.48  ? 0   VAL C CA    1 
ATOM   7915  C C     . VAL C 1 2   ? 35.767  -24.890 -28.956 1.00 93.77  ? 0   VAL C C     1 
ATOM   7916  O O     . VAL C 1 2   ? 35.903  -23.716 -29.324 1.00 89.58  ? 0   VAL C O     1 
ATOM   7917  C CB    . VAL C 1 2   ? 38.008  -25.689 -29.915 1.00 83.52  ? 0   VAL C CB    1 
ATOM   7918  N N     . PRO C 1 3   ? 34.967  -25.239 -27.923 1.00 90.14  ? 1   PRO C N     1 
ATOM   7919  C CA    . PRO C 1 3   ? 34.380  -24.283 -26.974 1.00 81.12  ? 1   PRO C CA    1 
ATOM   7920  C C     . PRO C 1 3   ? 35.453  -23.780 -26.022 1.00 79.34  ? 1   PRO C C     1 
ATOM   7921  O O     . PRO C 1 3   ? 36.562  -24.292 -26.024 1.00 81.31  ? 1   PRO C O     1 
ATOM   7922  C CB    . PRO C 1 3   ? 33.353  -25.125 -26.219 1.00 79.11  ? 1   PRO C CB    1 
ATOM   7923  C CG    . PRO C 1 3   ? 33.865  -26.500 -26.298 1.00 83.08  ? 1   PRO C CG    1 
ATOM   7924  C CD    . PRO C 1 3   ? 34.541  -26.620 -27.632 1.00 87.71  ? 1   PRO C CD    1 
ATOM   7925  N N     . ILE C 1 4   ? 35.155  -22.745 -25.263 1.00 76.15  ? 2   ILE C N     1 
ATOM   7926  C CA    . ILE C 1 4   ? 36.128  -22.216 -24.314 1.00 77.09  ? 2   ILE C CA    1 
ATOM   7927  C C     . ILE C 1 4   ? 35.827  -22.545 -22.828 1.00 81.41  ? 2   ILE C C     1 
ATOM   7928  O O     . ILE C 1 4   ? 34.964  -23.376 -22.545 1.00 79.76  ? 2   ILE C O     1 
ATOM   7929  C CB    . ILE C 1 4   ? 36.402  -20.741 -24.559 1.00 77.66  ? 2   ILE C CB    1 
ATOM   7930  C CG1   . ILE C 1 4   ? 36.109  -20.375 -26.021 1.00 73.33  ? 2   ILE C CG1   1 
ATOM   7931  C CG2   . ILE C 1 4   ? 37.839  -20.430 -24.186 1.00 74.39  ? 2   ILE C CG2   1 
ATOM   7932  C CD1   . ILE C 1 4   ? 34.653  -20.470 -26.440 1.00 71.78  ? 2   ILE C CD1   1 
ATOM   7933  N N     . SER C 1 5   ? 36.577  -21.943 -21.896 1.00 80.63  ? 3   SER C N     1 
ATOM   7934  C CA    . SER C 1 5   ? 36.591  -22.377 -20.482 1.00 82.14  ? 3   SER C CA    1 
ATOM   7935  C C     . SER C 1 5   ? 36.594  -21.292 -19.341 1.00 81.25  ? 3   SER C C     1 
ATOM   7936  O O     . SER C 1 5   ? 37.654  -20.843 -18.909 1.00 84.76  ? 3   SER C O     1 
ATOM   7937  C CB    . SER C 1 5   ? 37.767  -23.344 -20.311 1.00 80.34  ? 3   SER C CB    1 
ATOM   7938  O OG    . SER C 1 5   ? 38.619  -23.296 -21.444 1.00 69.56  ? 3   SER C OG    1 
ATOM   7939  N N     . PRO C 1 6   ? 35.417  -20.863 -18.862 1.00 75.41  ? 4   PRO C N     1 
ATOM   7940  C CA    . PRO C 1 6   ? 35.341  -19.619 -18.060 1.00 68.06  ? 4   PRO C CA    1 
ATOM   7941  C C     . PRO C 1 6   ? 35.947  -19.500 -16.644 1.00 67.93  ? 4   PRO C C     1 
ATOM   7942  O O     . PRO C 1 6   ? 36.836  -18.668 -16.459 1.00 63.59  ? 4   PRO C O     1 
ATOM   7943  C CB    . PRO C 1 6   ? 33.839  -19.404 -17.947 1.00 68.79  ? 4   PRO C CB    1 
ATOM   7944  C CG    . PRO C 1 6   ? 33.268  -20.809 -17.964 1.00 73.64  ? 4   PRO C CG    1 
ATOM   7945  C CD    . PRO C 1 6   ? 34.160  -21.631 -18.854 1.00 74.51  ? 4   PRO C CD    1 
ATOM   7946  N N     . ILE C 1 7   ? 35.505  -20.353 -15.707 1.00 76.54  ? 5   ILE C N     1 
ATOM   7947  C CA    . ILE C 1 7   ? 35.812  -20.285 -14.247 1.00 70.58  ? 5   ILE C CA    1 
ATOM   7948  C C     . ILE C 1 7   ? 35.995  -21.682 -13.674 1.00 69.38  ? 5   ILE C C     1 
ATOM   7949  O O     . ILE C 1 7   ? 35.274  -22.609 -14.049 1.00 69.38  ? 5   ILE C O     1 
ATOM   7950  C CB    . ILE C 1 7   ? 34.662  -19.677 -13.351 1.00 68.38  ? 5   ILE C CB    1 
ATOM   7951  C CG1   . ILE C 1 7   ? 33.318  -20.340 -13.631 1.00 67.63  ? 5   ILE C CG1   1 
ATOM   7952  C CG2   . ILE C 1 7   ? 34.538  -18.171 -13.466 1.00 68.20  ? 5   ILE C CG2   1 
ATOM   7953  C CD1   . ILE C 1 7   ? 32.167  -19.650 -12.958 1.00 66.30  ? 5   ILE C CD1   1 
ATOM   7954  N N     . GLU C 1 8   ? 36.902  -21.811 -12.713 1.00 69.85  ? 6   GLU C N     1 
ATOM   7955  C CA    . GLU C 1 8   ? 37.375  -23.117 -12.250 1.00 68.79  ? 6   GLU C CA    1 
ATOM   7956  C C     . GLU C 1 8   ? 36.307  -24.118 -11.841 1.00 67.92  ? 6   GLU C C     1 
ATOM   7957  O O     . GLU C 1 8   ? 35.425  -23.827 -11.047 1.00 69.80  ? 6   GLU C O     1 
ATOM   7958  C CB    . GLU C 1 8   ? 38.352  -22.946 -11.115 1.00 67.30  ? 6   GLU C CB    1 
ATOM   7959  C CG    . GLU C 1 8   ? 38.863  -24.245 -10.607 1.00 76.41  ? 6   GLU C CG    1 
ATOM   7960  C CD    . GLU C 1 8   ? 40.069  -24.028 -9.736  1.00 94.12  ? 6   GLU C CD    1 
ATOM   7961  O OE1   . GLU C 1 8   ? 40.460  -22.846 -9.596  1.00 95.73  ? 6   GLU C OE1   1 
ATOM   7962  O OE2   . GLU C 1 8   ? 40.626  -25.017 -9.202  1.00 100.60 ? 6   GLU C OE2   1 
ATOM   7963  N N     . THR C 1 9   ? 36.421  -25.319 -12.382 1.00 67.68  ? 7   THR C N     1 
ATOM   7964  C CA    . THR C 1 9   ? 35.396  -26.339 -12.236 1.00 70.27  ? 7   THR C CA    1 
ATOM   7965  C C     . THR C 1 9   ? 35.506  -27.079 -10.886 1.00 67.77  ? 7   THR C C     1 
ATOM   7966  O O     . THR C 1 9   ? 36.578  -27.123 -10.273 1.00 64.86  ? 7   THR C O     1 
ATOM   7967  C CB    . THR C 1 9   ? 35.440  -27.307 -13.461 1.00 75.50  ? 7   THR C CB    1 
ATOM   7968  O OG1   . THR C 1 9   ? 34.288  -28.169 -13.490 1.00 75.23  ? 7   THR C OG1   1 
ATOM   7969  C CG2   . THR C 1 9   ? 36.750  -28.116 -13.473 1.00 77.77  ? 7   THR C CG2   1 
ATOM   7970  N N     . VAL C 1 10  ? 34.385  -27.630 -10.422 1.00 64.40  ? 8   VAL C N     1 
ATOM   7971  C CA    . VAL C 1 10  ? 34.328  -28.374 -9.158  1.00 65.35  ? 8   VAL C CA    1 
ATOM   7972  C C     . VAL C 1 10  ? 33.969  -29.852 -9.367  1.00 63.84  ? 8   VAL C C     1 
ATOM   7973  O O     . VAL C 1 10  ? 32.890  -30.163 -9.873  1.00 62.18  ? 8   VAL C O     1 
ATOM   7974  C CB    . VAL C 1 10  ? 33.372  -27.686 -8.114  1.00 64.33  ? 8   VAL C CB    1 
ATOM   7975  C CG1   . VAL C 1 10  ? 32.542  -28.697 -7.338  1.00 60.38  ? 8   VAL C CG1   1 
ATOM   7976  C CG2   . VAL C 1 10  ? 34.163  -26.808 -7.166  1.00 63.91  ? 8   VAL C CG2   1 
ATOM   7977  N N     . PRO C 1 11  ? 34.888  -30.764 -8.979  1.00 63.52  ? 9   PRO C N     1 
ATOM   7978  C CA    . PRO C 1 11  ? 34.782  -32.221 -9.137  1.00 60.23  ? 9   PRO C CA    1 
ATOM   7979  C C     . PRO C 1 11  ? 33.468  -32.781 -8.632  1.00 61.53  ? 9   PRO C C     1 
ATOM   7980  O O     . PRO C 1 11  ? 32.999  -32.316 -7.627  1.00 68.14  ? 9   PRO C O     1 
ATOM   7981  C CB    . PRO C 1 11  ? 35.929  -32.730 -8.269  1.00 57.24  ? 9   PRO C CB    1 
ATOM   7982  C CG    . PRO C 1 11  ? 36.954  -31.677 -8.379  1.00 55.30  ? 9   PRO C CG    1 
ATOM   7983  C CD    . PRO C 1 11  ? 36.190  -30.383 -8.397  1.00 59.35  ? 9   PRO C CD    1 
ATOM   7984  N N     . VAL C 1 12  ? 32.880  -33.760 -9.306  1.00 68.73  ? 10  VAL C N     1 
ATOM   7985  C CA    . VAL C 1 12  ? 31.625  -34.363 -8.839  1.00 74.76  ? 10  VAL C CA    1 
ATOM   7986  C C     . VAL C 1 12  ? 31.626  -35.887 -9.026  1.00 77.56  ? 10  VAL C C     1 
ATOM   7987  O O     . VAL C 1 12  ? 32.506  -36.433 -9.689  1.00 78.89  ? 10  VAL C O     1 
ATOM   7988  C CB    . VAL C 1 12  ? 30.404  -33.745 -9.549  1.00 72.17  ? 10  VAL C CB    1 
ATOM   7989  C CG1   . VAL C 1 12  ? 29.119  -34.074 -8.806  1.00 70.84  ? 10  VAL C CG1   1 
ATOM   7990  C CG2   . VAL C 1 12  ? 30.579  -32.245 -9.667  1.00 69.01  ? 10  VAL C CG2   1 
ATOM   7991  N N     . LYS C 1 13  ? 30.656  -36.567 -8.421  1.00 76.30  ? 11  LYS C N     1 
ATOM   7992  C CA    . LYS C 1 13  ? 30.517  -38.011 -8.547  1.00 78.65  ? 11  LYS C CA    1 
ATOM   7993  C C     . LYS C 1 13  ? 29.080  -38.389 -8.290  1.00 84.47  ? 11  LYS C C     1 
ATOM   7994  O O     . LYS C 1 13  ? 28.238  -37.529 -8.089  1.00 85.54  ? 11  LYS C O     1 
ATOM   7995  C CB    . LYS C 1 13  ? 31.413  -38.737 -7.547  1.00 81.04  ? 11  LYS C CB    1 
ATOM   7996  C CG    . LYS C 1 13  ? 32.891  -38.553 -7.800  1.00 81.85  ? 11  LYS C CG    1 
ATOM   7997  C CD    . LYS C 1 13  ? 33.706  -38.888 -6.579  1.00 84.66  ? 11  LYS C CD    1 
ATOM   7998  C CE    . LYS C 1 13  ? 35.154  -38.457 -6.770  1.00 94.58  ? 11  LYS C CE    1 
ATOM   7999  N NZ    . LYS C 1 13  ? 35.952  -38.585 -5.509  1.00 100.69 ? 11  LYS C NZ    1 
ATOM   8000  N N     . LEU C 1 14  ? 28.800  -39.683 -8.303  1.00 95.53  ? 12  LEU C N     1 
ATOM   8001  C CA    . LEU C 1 14  ? 27.491  -40.183 -7.903  1.00 102.65 ? 12  LEU C CA    1 
ATOM   8002  C C     . LEU C 1 14  ? 27.700  -41.124 -6.733  1.00 103.44 ? 12  LEU C C     1 
ATOM   8003  O O     . LEU C 1 14  ? 28.789  -41.675 -6.573  1.00 101.96 ? 12  LEU C O     1 
ATOM   8004  C CB    . LEU C 1 14  ? 26.832  -40.950 -9.043  1.00 108.73 ? 12  LEU C CB    1 
ATOM   8005  C CG    . LEU C 1 14  ? 26.668  -40.268 -10.394 1.00 103.90 ? 12  LEU C CG    1 
ATOM   8006  C CD1   . LEU C 1 14  ? 27.047  -41.241 -11.489 1.00 110.91 ? 12  LEU C CD1   1 
ATOM   8007  C CD2   . LEU C 1 14  ? 25.242  -39.777 -10.570 1.00 103.85 ? 12  LEU C CD2   1 
ATOM   8008  N N     . LYS C 1 15  ? 26.662  -41.315 -5.924  1.00 105.79 ? 13  LYS C N     1 
ATOM   8009  C CA    . LYS C 1 15  ? 26.768  -42.221 -4.789  1.00 115.13 ? 13  LYS C CA    1 
ATOM   8010  C C     . LYS C 1 15  ? 27.304  -43.540 -5.327  1.00 123.96 ? 13  LYS C C     1 
ATOM   8011  O O     . LYS C 1 15  ? 26.703  -44.132 -6.227  1.00 124.65 ? 13  LYS C O     1 
ATOM   8012  C CB    . LYS C 1 15  ? 25.410  -42.415 -4.107  1.00 116.04 ? 13  LYS C CB    1 
ATOM   8013  C CG    . LYS C 1 15  ? 24.914  -41.196 -3.327  1.00 111.11 ? 13  LYS C CG    1 
ATOM   8014  C CD    . LYS C 1 15  ? 23.451  -41.346 -2.898  1.00 112.38 ? 13  LYS C CD    1 
ATOM   8015  C CE    . LYS C 1 15  ? 22.918  -40.073 -2.239  1.00 108.38 ? 13  LYS C CE    1 
ATOM   8016  N NZ    . LYS C 1 15  ? 21.444  -40.106 -1.997  1.00 107.98 ? 13  LYS C NZ    1 
ATOM   8017  N N     . PRO C 1 16  ? 28.433  -44.010 -4.766  1.00 125.68 ? 14  PRO C N     1 
ATOM   8018  C CA    . PRO C 1 16  ? 29.252  -45.042 -5.415  1.00 127.88 ? 14  PRO C CA    1 
ATOM   8019  C C     . PRO C 1 16  ? 28.414  -46.227 -5.892  1.00 132.08 ? 14  PRO C C     1 
ATOM   8020  O O     . PRO C 1 16  ? 27.526  -46.685 -5.171  1.00 131.52 ? 14  PRO C O     1 
ATOM   8021  C CB    . PRO C 1 16  ? 30.214  -45.468 -4.304  1.00 126.81 ? 14  PRO C CB    1 
ATOM   8022  C CG    . PRO C 1 16  ? 30.294  -44.279 -3.403  1.00 122.40 ? 14  PRO C CG    1 
ATOM   8023  C CD    . PRO C 1 16  ? 28.926  -43.677 -3.418  1.00 118.86 ? 14  PRO C CD    1 
ATOM   8024  N N     . GLY C 1 17  ? 28.687  -46.703 -7.105  1.00 133.14 ? 15  GLY C N     1 
ATOM   8025  C CA    . GLY C 1 17  ? 27.903  -47.773 -7.696  1.00 133.71 ? 15  GLY C CA    1 
ATOM   8026  C C     . GLY C 1 17  ? 26.462  -47.390 -7.998  1.00 134.37 ? 15  GLY C C     1 
ATOM   8027  O O     . GLY C 1 17  ? 25.530  -48.028 -7.507  1.00 132.49 ? 15  GLY C O     1 
ATOM   8028  N N     . MET C 1 18  ? 26.276  -46.339 -8.794  1.00 134.51 ? 16  MET C N     1 
ATOM   8029  C CA    . MET C 1 18  ? 24.942  -45.911 -9.217  1.00 134.53 ? 16  MET C CA    1 
ATOM   8030  C C     . MET C 1 18  ? 25.035  -45.128 -10.535 1.00 134.11 ? 16  MET C C     1 
ATOM   8031  O O     . MET C 1 18  ? 26.106  -44.630 -10.888 1.00 129.01 ? 16  MET C O     1 
ATOM   8032  C CB    . MET C 1 18  ? 24.278  -45.073 -8.117  1.00 131.26 ? 16  MET C CB    1 
ATOM   8033  C CG    . MET C 1 18  ? 22.765  -45.257 -8.000  1.00 133.37 ? 16  MET C CG    1 
ATOM   8034  S SD    . MET C 1 18  ? 22.087  -44.584 -6.461  1.00 126.34 ? 16  MET C SD    1 
ATOM   8035  C CE    . MET C 1 18  ? 20.366  -45.079 -6.577  1.00 128.76 ? 16  MET C CE    1 
ATOM   8036  N N     . ASP C 1 19  ? 23.927  -45.026 -11.265 1.00 134.68 ? 17  ASP C N     1 
ATOM   8037  C CA    . ASP C 1 19  ? 23.945  -44.342 -12.558 1.00 134.93 ? 17  ASP C CA    1 
ATOM   8038  C C     . ASP C 1 19  ? 22.698  -43.489 -12.800 1.00 137.18 ? 17  ASP C C     1 
ATOM   8039  O O     . ASP C 1 19  ? 21.707  -43.608 -12.080 1.00 136.61 ? 17  ASP C O     1 
ATOM   8040  C CB    . ASP C 1 19  ? 24.130  -45.350 -13.696 1.00 135.26 ? 17  ASP C CB    1 
ATOM   8041  C CG    . ASP C 1 19  ? 25.066  -44.842 -14.779 1.00 135.14 ? 17  ASP C CG    1 
ATOM   8042  O OD1   . ASP C 1 19  ? 25.957  -44.028 -14.460 1.00 133.73 ? 17  ASP C OD1   1 
ATOM   8043  O OD2   . ASP C 1 19  ? 24.917  -45.258 -15.947 1.00 133.36 ? 17  ASP C OD2   1 
ATOM   8044  N N     . GLY C 1 20  ? 22.764  -42.634 -13.821 1.00 137.59 ? 18  GLY C N     1 
ATOM   8045  C CA    . GLY C 1 20  ? 21.666  -41.747 -14.181 1.00 142.83 ? 18  GLY C CA    1 
ATOM   8046  C C     . GLY C 1 20  ? 20.412  -42.460 -14.660 1.00 150.96 ? 18  GLY C C     1 
ATOM   8047  O O     . GLY C 1 20  ? 20.489  -43.570 -15.187 1.00 152.28 ? 18  GLY C O     1 
ATOM   8048  N N     . PRO C 1 21  ? 19.245  -41.809 -14.501 1.00 154.02 ? 19  PRO C N     1 
ATOM   8049  C CA    . PRO C 1 21  ? 17.909  -42.411 -14.648 1.00 157.94 ? 19  PRO C CA    1 
ATOM   8050  C C     . PRO C 1 21  ? 17.274  -42.392 -16.052 1.00 164.06 ? 19  PRO C C     1 
ATOM   8051  O O     . PRO C 1 21  ? 17.846  -41.856 -17.005 1.00 163.57 ? 19  PRO C O     1 
ATOM   8052  C CB    . PRO C 1 21  ? 17.065  -41.558 -13.704 1.00 152.98 ? 19  PRO C CB    1 
ATOM   8053  C CG    . PRO C 1 21  ? 17.688  -40.194 -13.813 1.00 151.68 ? 19  PRO C CG    1 
ATOM   8054  C CD    . PRO C 1 21  ? 19.170  -40.414 -14.028 1.00 147.96 ? 19  PRO C CD    1 
ATOM   8055  N N     . LYS C 1 22  ? 16.085  -42.992 -16.154 1.00 165.28 ? 20  LYS C N     1 
ATOM   8056  C CA    . LYS C 1 22  ? 15.300  -43.017 -17.389 1.00 168.59 ? 20  LYS C CA    1 
ATOM   8057  C C     . LYS C 1 22  ? 13.819  -42.761 -17.110 1.00 170.20 ? 20  LYS C C     1 
ATOM   8058  O O     . LYS C 1 22  ? 13.180  -43.530 -16.395 1.00 168.88 ? 20  LYS C O     1 
ATOM   8059  C CB    . LYS C 1 22  ? 15.454  -44.367 -18.083 1.00 169.01 ? 20  LYS C CB    1 
ATOM   8060  C CG    . LYS C 1 22  ? 16.894  -44.777 -18.314 1.00 169.69 ? 20  LYS C CG    1 
ATOM   8061  C CD    . LYS C 1 22  ? 16.982  -46.204 -18.825 1.00 173.03 ? 20  LYS C CD    1 
ATOM   8062  C CE    . LYS C 1 22  ? 18.429  -46.625 -19.029 1.00 173.29 ? 20  LYS C CE    1 
ATOM   8063  N NZ    . LYS C 1 22  ? 18.549  -48.041 -19.477 1.00 170.48 ? 20  LYS C NZ    1 
ATOM   8064  N N     . VAL C 1 23  ? 13.272  -41.696 -17.691 1.00 172.71 ? 21  VAL C N     1 
ATOM   8065  C CA    . VAL C 1 23  ? 11.879  -41.305 -17.467 1.00 175.35 ? 21  VAL C CA    1 
ATOM   8066  C C     . VAL C 1 23  ? 11.160  -40.988 -18.787 1.00 177.07 ? 21  VAL C C     1 
ATOM   8067  O O     . VAL C 1 23  ? 11.719  -41.185 -19.868 1.00 176.30 ? 21  VAL C O     1 
ATOM   8068  C CB    . VAL C 1 23  ? 11.783  -40.084 -16.524 1.00 176.56 ? 21  VAL C CB    1 
ATOM   8069  C CG1   . VAL C 1 23  ? 10.412  -40.020 -15.863 1.00 177.54 ? 21  VAL C CG1   1 
ATOM   8070  C CG2   . VAL C 1 23  ? 12.868  -40.147 -15.465 1.00 173.27 ? 21  VAL C CG2   1 
ATOM   8071  N N     . LYS C 1 24  ? 9.920   -40.508 -18.694 1.00 179.32 ? 22  LYS C N     1 
ATOM   8072  C CA    . LYS C 1 24  ? 9.127   -40.165 -19.877 1.00 180.00 ? 22  LYS C CA    1 
ATOM   8073  C C     . LYS C 1 24  ? 8.541   -38.749 -19.825 1.00 182.70 ? 22  LYS C C     1 
ATOM   8074  O O     . LYS C 1 24  ? 8.928   -37.888 -20.621 1.00 181.64 ? 22  LYS C O     1 
ATOM   8075  C CB    . LYS C 1 24  ? 8.017   -41.196 -20.105 1.00 178.64 ? 22  LYS C CB    1 
ATOM   8076  C CG    . LYS C 1 24  ? 8.532   -42.606 -20.352 1.00 176.08 ? 22  LYS C CG    1 
ATOM   8077  C CD    . LYS C 1 24  ? 9.615   -42.610 -21.416 1.00 174.01 ? 22  LYS C CD    1 
ATOM   8078  C CE    . LYS C 1 24  ? 10.406  -43.903 -21.395 1.00 170.13 ? 22  LYS C CE    1 
ATOM   8079  N NZ    . LYS C 1 24  ? 11.701  -43.759 -22.114 1.00 169.43 ? 22  LYS C NZ    1 
ATOM   8080  N N     . GLN C 1 25  ? 7.608   -38.515 -18.900 1.00 185.04 ? 23  GLN C N     1 
ATOM   8081  C CA    . GLN C 1 25  ? 6.982   -37.197 -18.757 1.00 187.29 ? 23  GLN C CA    1 
ATOM   8082  C C     . GLN C 1 25  ? 5.883   -37.158 -17.688 1.00 188.36 ? 23  GLN C C     1 
ATOM   8083  O O     . GLN C 1 25  ? 5.401   -38.199 -17.239 1.00 188.09 ? 23  GLN C O     1 
ATOM   8084  C CB    . GLN C 1 25  ? 6.400   -36.751 -20.098 1.00 185.17 ? 23  GLN C CB    1 
ATOM   8085  C CG    . GLN C 1 25  ? 6.562   -35.277 -20.391 1.00 185.80 ? 23  GLN C CG    1 
ATOM   8086  C CD    . GLN C 1 25  ? 6.058   -34.917 -21.770 1.00 185.02 ? 23  GLN C CD    1 
ATOM   8087  O OE1   . GLN C 1 25  ? 5.342   -35.693 -22.404 1.00 179.86 ? 23  GLN C OE1   1 
ATOM   8088  N NE2   . GLN C 1 25  ? 6.433   -33.739 -22.246 1.00 187.39 ? 23  GLN C NE2   1 
ATOM   8089  N N     . TRP C 1 26  ? 5.497   -35.950 -17.283 1.00 189.34 ? 24  TRP C N     1 
ATOM   8090  C CA    . TRP C 1 26  ? 4.310   -35.756 -16.446 1.00 192.15 ? 24  TRP C CA    1 
ATOM   8091  C C     . TRP C 1 26  ? 3.592   -34.464 -16.865 1.00 193.76 ? 24  TRP C C     1 
ATOM   8092  O O     . TRP C 1 26  ? 4.244   -33.491 -17.247 1.00 193.68 ? 24  TRP C O     1 
ATOM   8093  C CB    . TRP C 1 26  ? 4.671   -35.760 -14.954 1.00 191.91 ? 24  TRP C CB    1 
ATOM   8094  C CG    . TRP C 1 26  ? 3.488   -36.012 -14.039 1.00 193.43 ? 24  TRP C CG    1 
ATOM   8095  C CD1   . TRP C 1 26  ? 3.006   -35.176 -13.072 1.00 192.43 ? 24  TRP C CD1   1 
ATOM   8096  C CD2   . TRP C 1 26  ? 2.635   -37.171 -14.025 1.00 193.12 ? 24  TRP C CD2   1 
ATOM   8097  N NE1   . TRP C 1 26  ? 1.914   -35.742 -12.455 1.00 191.86 ? 24  TRP C NE1   1 
ATOM   8098  C CE2   . TRP C 1 26  ? 1.663   -36.965 -13.023 1.00 191.90 ? 24  TRP C CE2   1 
ATOM   8099  C CE3   . TRP C 1 26  ? 2.596   -38.359 -14.766 1.00 191.49 ? 24  TRP C CE3   1 
ATOM   8100  C CZ2   . TRP C 1 26  ? 0.670   -37.902 -12.738 1.00 189.23 ? 24  TRP C CZ2   1 
ATOM   8101  C CZ3   . TRP C 1 26  ? 1.607   -39.288 -14.481 1.00 190.04 ? 24  TRP C CZ3   1 
ATOM   8102  C CH2   . TRP C 1 26  ? 0.659   -39.054 -13.476 1.00 189.33 ? 24  TRP C CH2   1 
ATOM   8103  N N     . PRO C 1 27  ? 2.245   -34.454 -16.779 1.00 195.06 ? 25  PRO C N     1 
ATOM   8104  C CA    . PRO C 1 27  ? 1.337   -33.474 -17.403 1.00 197.11 ? 25  PRO C CA    1 
ATOM   8105  C C     . PRO C 1 27  ? 1.330   -32.034 -16.856 1.00 198.01 ? 25  PRO C C     1 
ATOM   8106  O O     . PRO C 1 27  ? 0.477   -31.694 -16.031 1.00 196.61 ? 25  PRO C O     1 
ATOM   8107  C CB    . PRO C 1 27  ? -0.051  -34.105 -17.197 1.00 194.12 ? 25  PRO C CB    1 
ATOM   8108  C CG    . PRO C 1 27  ? 0.209   -35.552 -17.026 1.00 190.43 ? 25  PRO C CG    1 
ATOM   8109  C CD    . PRO C 1 27  ? 1.498   -35.618 -16.273 1.00 192.60 ? 25  PRO C CD    1 
ATOM   8110  N N     . LEU C 1 28  ? 2.275   -31.210 -17.309 1.00 198.51 ? 26  LEU C N     1 
ATOM   8111  C CA    . LEU C 1 28  ? 2.198   -29.760 -17.108 1.00 197.92 ? 26  LEU C CA    1 
ATOM   8112  C C     . LEU C 1 28  ? 1.059   -29.161 -17.947 1.00 198.09 ? 26  LEU C C     1 
ATOM   8113  O O     . LEU C 1 28  ? 0.811   -29.608 -19.070 1.00 197.04 ? 26  LEU C O     1 
ATOM   8114  C CB    . LEU C 1 28  ? 3.533   -29.079 -17.464 1.00 197.74 ? 26  LEU C CB    1 
ATOM   8115  C CG    . LEU C 1 28  ? 3.985   -28.955 -18.930 1.00 194.37 ? 26  LEU C CG    1 
ATOM   8116  C CD1   . LEU C 1 28  ? 5.004   -27.829 -19.099 1.00 189.24 ? 26  LEU C CD1   1 
ATOM   8117  C CD2   . LEU C 1 28  ? 4.539   -30.270 -19.470 1.00 192.26 ? 26  LEU C CD2   1 
ATOM   8118  N N     . THR C 1 29  ? 0.376   -28.150 -17.409 1.00 198.34 ? 27  THR C N     1 
ATOM   8119  C CA    . THR C 1 29  ? -0.756  -27.516 -18.103 1.00 197.14 ? 27  THR C CA    1 
ATOM   8120  C C     . THR C 1 29  ? -0.333  -26.750 -19.369 1.00 196.61 ? 27  THR C C     1 
ATOM   8121  O O     . THR C 1 29  ? 0.843   -26.423 -19.541 1.00 196.37 ? 27  THR C O     1 
ATOM   8122  C CB    . THR C 1 29  ? -1.590  -26.601 -17.159 1.00 194.36 ? 27  THR C CB    1 
ATOM   8123  O OG1   . THR C 1 29  ? -0.729  -25.679 -16.478 1.00 192.40 ? 27  THR C OG1   1 
ATOM   8124  C CG2   . THR C 1 29  ? -2.343  -27.436 -16.131 1.00 191.13 ? 27  THR C CG2   1 
ATOM   8125  N N     . GLU C 1 30  ? -1.295  -26.484 -20.254 1.00 195.95 ? 28  GLU C N     1 
ATOM   8126  C CA    . GLU C 1 30  ? -1.020  -25.902 -21.577 1.00 194.80 ? 28  GLU C CA    1 
ATOM   8127  C C     . GLU C 1 30  ? -0.535  -24.443 -21.580 1.00 195.25 ? 28  GLU C C     1 
ATOM   8128  O O     . GLU C 1 30  ? -0.148  -23.919 -22.628 1.00 192.80 ? 28  GLU C O     1 
ATOM   8129  C CB    . GLU C 1 30  ? -2.240  -26.040 -22.497 1.00 193.01 ? 28  GLU C CB    1 
ATOM   8130  C CG    . GLU C 1 30  ? -2.688  -27.472 -22.744 1.00 191.84 ? 28  GLU C CG    1 
ATOM   8131  C CD    . GLU C 1 30  ? -3.832  -27.893 -21.839 1.00 191.16 ? 28  GLU C CD    1 
ATOM   8132  O OE1   . GLU C 1 30  ? -4.283  -27.062 -21.021 1.00 190.70 ? 28  GLU C OE1   1 
ATOM   8133  O OE2   . GLU C 1 30  ? -4.282  -29.053 -21.951 1.00 188.28 ? 28  GLU C OE2   1 
ATOM   8134  N N     . GLU C 1 31  ? -0.574  -23.791 -20.419 1.00 196.51 ? 29  GLU C N     1 
ATOM   8135  C CA    . GLU C 1 31  ? -0.070  -22.421 -20.274 1.00 195.54 ? 29  GLU C CA    1 
ATOM   8136  C C     . GLU C 1 31  ? 1.461   -22.369 -20.343 1.00 195.17 ? 29  GLU C C     1 
ATOM   8137  O O     . GLU C 1 31  ? 2.048   -21.345 -20.706 1.00 193.06 ? 29  GLU C O     1 
ATOM   8138  C CB    . GLU C 1 31  ? -0.566  -21.806 -18.956 1.00 193.33 ? 29  GLU C CB    1 
ATOM   8139  C CG    . GLU C 1 31  ? 0.107   -20.492 -18.558 1.00 191.67 ? 29  GLU C CG    1 
ATOM   8140  C CD    . GLU C 1 31  ? -0.255  -19.335 -19.472 1.00 190.80 ? 29  GLU C CD    1 
ATOM   8141  O OE1   . GLU C 1 31  ? -0.887  -19.574 -20.522 1.00 190.71 ? 29  GLU C OE1   1 
ATOM   8142  O OE2   . GLU C 1 31  ? 0.087   -18.183 -19.136 1.00 188.70 ? 29  GLU C OE2   1 
ATOM   8143  N N     . LYS C 1 32  ? 2.096   -23.479 -19.977 1.00 195.85 ? 30  LYS C N     1 
ATOM   8144  C CA    . LYS C 1 32  ? 3.552   -23.585 -19.974 1.00 194.52 ? 30  LYS C CA    1 
ATOM   8145  C C     . LYS C 1 32  ? 4.127   -24.278 -21.222 1.00 194.85 ? 30  LYS C C     1 
ATOM   8146  O O     . LYS C 1 32  ? 5.346   -24.396 -21.356 1.00 194.56 ? 30  LYS C O     1 
ATOM   8147  C CB    . LYS C 1 32  ? 4.028   -24.293 -18.697 1.00 191.68 ? 30  LYS C CB    1 
ATOM   8148  C CG    . LYS C 1 32  ? 3.675   -23.560 -17.397 1.00 190.05 ? 30  LYS C CG    1 
ATOM   8149  C CD    . LYS C 1 32  ? 2.171   -23.574 -17.104 1.00 191.07 ? 30  LYS C CD    1 
ATOM   8150  C CE    . LYS C 1 32  ? 1.813   -22.680 -15.918 1.00 187.91 ? 30  LYS C CE    1 
ATOM   8151  N NZ    . LYS C 1 32  ? 0.347   -22.640 -15.644 1.00 181.62 ? 30  LYS C NZ    1 
ATOM   8152  N N     . ILE C 1 33  ? 3.255   -24.734 -22.124 1.00 194.53 ? 31  ILE C N     1 
ATOM   8153  C CA    . ILE C 1 33  ? 3.693   -25.480 -23.313 1.00 193.68 ? 31  ILE C CA    1 
ATOM   8154  C C     . ILE C 1 33  ? 4.028   -24.610 -24.534 1.00 193.54 ? 31  ILE C C     1 
ATOM   8155  O O     . ILE C 1 33  ? 4.624   -25.096 -25.500 1.00 193.20 ? 31  ILE C O     1 
ATOM   8156  C CB    . ILE C 1 33  ? 2.669   -26.570 -23.737 1.00 191.35 ? 31  ILE C CB    1 
ATOM   8157  C CG1   . ILE C 1 33  ? 1.396   -25.937 -24.300 1.00 189.44 ? 31  ILE C CG1   1 
ATOM   8158  C CG2   . ILE C 1 33  ? 2.356   -27.503 -22.574 1.00 190.77 ? 31  ILE C CG2   1 
ATOM   8159  C CD1   . ILE C 1 33  ? 0.379   -26.946 -24.775 1.00 187.82 ? 31  ILE C CD1   1 
ATOM   8160  N N     . LYS C 1 34  ? 3.638   -23.338 -24.495 1.00 191.93 ? 32  LYS C N     1 
ATOM   8161  C CA    . LYS C 1 34  ? 3.911   -22.417 -25.601 1.00 190.08 ? 32  LYS C CA    1 
ATOM   8162  C C     . LYS C 1 34  ? 5.332   -21.841 -25.569 1.00 190.09 ? 32  LYS C C     1 
ATOM   8163  O O     . LYS C 1 34  ? 5.916   -21.553 -26.617 1.00 188.92 ? 32  LYS C O     1 
ATOM   8164  C CB    . LYS C 1 34  ? 2.879   -21.283 -25.631 1.00 186.33 ? 32  LYS C CB    1 
ATOM   8165  C CG    . LYS C 1 34  ? 3.018   -20.331 -26.815 1.00 182.72 ? 32  LYS C CG    1 
ATOM   8166  C CD    . LYS C 1 34  ? 2.825   -21.052 -28.139 1.00 179.19 ? 32  LYS C CD    1 
ATOM   8167  C CE    . LYS C 1 34  ? 2.872   -20.081 -29.304 1.00 175.28 ? 32  LYS C CE    1 
ATOM   8168  N NZ    . LYS C 1 34  ? 4.153   -19.331 -29.338 1.00 175.21 ? 32  LYS C NZ    1 
ATOM   8169  N N     . ALA C 1 35  ? 5.879   -21.681 -24.366 1.00 190.29 ? 33  ALA C N     1 
ATOM   8170  C CA    . ALA C 1 35  ? 7.172   -21.021 -24.179 1.00 189.66 ? 33  ALA C CA    1 
ATOM   8171  C C     . ALA C 1 35  ? 8.374   -21.888 -24.567 1.00 189.37 ? 33  ALA C C     1 
ATOM   8172  O O     . ALA C 1 35  ? 9.405   -21.368 -25.001 1.00 186.73 ? 33  ALA C O     1 
ATOM   8173  C CB    . ALA C 1 35  ? 7.315   -20.524 -22.735 1.00 186.09 ? 33  ALA C CB    1 
ATOM   8174  N N     . LEU C 1 36  ? 8.234   -23.204 -24.419 1.00 190.59 ? 34  LEU C N     1 
ATOM   8175  C CA    . LEU C 1 36  ? 9.362   -24.130 -24.561 1.00 189.01 ? 34  LEU C CA    1 
ATOM   8176  C C     . LEU C 1 36  ? 9.759   -24.463 -26.008 1.00 186.14 ? 34  LEU C C     1 
ATOM   8177  O O     . LEU C 1 36  ? 10.942  -24.641 -26.307 1.00 182.80 ? 34  LEU C O     1 
ATOM   8178  C CB    . LEU C 1 36  ? 9.096   -25.425 -23.777 1.00 188.55 ? 34  LEU C CB    1 
ATOM   8179  C CG    . LEU C 1 36  ? 8.574   -25.297 -22.340 1.00 189.25 ? 34  LEU C CG    1 
ATOM   8180  C CD1   . LEU C 1 36  ? 8.551   -26.656 -21.643 1.00 186.16 ? 34  LEU C CD1   1 
ATOM   8181  C CD2   . LEU C 1 36  ? 9.387   -24.290 -21.533 1.00 186.48 ? 34  LEU C CD2   1 
ATOM   8182  N N     . VAL C 1 37  ? 8.774   -24.549 -26.898 1.00 186.97 ? 35  VAL C N     1 
ATOM   8183  C CA    . VAL C 1 37  ? 9.019   -24.989 -28.273 1.00 186.42 ? 35  VAL C CA    1 
ATOM   8184  C C     . VAL C 1 37  ? 10.160  -24.249 -28.986 1.00 184.34 ? 35  VAL C C     1 
ATOM   8185  O O     . VAL C 1 37  ? 11.016  -24.882 -29.601 1.00 181.72 ? 35  VAL C O     1 
ATOM   8186  C CB    . VAL C 1 37  ? 7.727   -24.955 -29.133 1.00 186.51 ? 35  VAL C CB    1 
ATOM   8187  C CG1   . VAL C 1 37  ? 6.961   -23.657 -28.910 1.00 186.79 ? 35  VAL C CG1   1 
ATOM   8188  C CG2   . VAL C 1 37  ? 8.055   -25.159 -30.609 1.00 182.42 ? 35  VAL C CG2   1 
ATOM   8189  N N     . GLU C 1 38  ? 10.162  -22.918 -28.923 1.00 184.24 ? 36  GLU C N     1 
ATOM   8190  C CA    . GLU C 1 38  ? 11.213  -22.128 -29.571 1.00 182.10 ? 36  GLU C CA    1 
ATOM   8191  C C     . GLU C 1 38  ? 12.515  -22.065 -28.773 1.00 178.47 ? 36  GLU C C     1 
ATOM   8192  O O     . GLU C 1 38  ? 13.597  -22.295 -29.315 1.00 174.77 ? 36  GLU C O     1 
ATOM   8193  C CB    . GLU C 1 38  ? 10.731  -20.702 -29.873 1.00 182.43 ? 36  GLU C CB    1 
ATOM   8194  C CG    . GLU C 1 38  ? 9.638   -20.602 -30.926 1.00 182.53 ? 36  GLU C CG    1 
ATOM   8195  C CD    . GLU C 1 38  ? 8.247   -20.775 -30.344 1.00 186.13 ? 36  GLU C CD    1 
ATOM   8196  O OE1   . GLU C 1 38  ? 8.070   -20.515 -29.134 1.00 185.88 ? 36  GLU C OE1   1 
ATOM   8197  O OE2   . GLU C 1 38  ? 7.331   -21.171 -31.096 1.00 186.09 ? 36  GLU C OE2   1 
ATOM   8198  N N     . ILE C 1 39  ? 12.403  -21.761 -27.483 1.00 179.08 ? 37  ILE C N     1 
ATOM   8199  C CA    . ILE C 1 39  ? 13.577  -21.503 -26.650 1.00 177.74 ? 37  ILE C CA    1 
ATOM   8200  C C     . ILE C 1 39  ? 14.443  -22.748 -26.476 1.00 175.15 ? 37  ILE C C     1 
ATOM   8201  O O     . ILE C 1 39  ? 15.567  -22.679 -25.974 1.00 171.88 ? 37  ILE C O     1 
ATOM   8202  C CB    . ILE C 1 39  ? 13.185  -20.906 -25.276 1.00 176.63 ? 37  ILE C CB    1 
ATOM   8203  C CG1   . ILE C 1 39  ? 12.371  -19.623 -25.472 1.00 176.25 ? 37  ILE C CG1   1 
ATOM   8204  C CG2   . ILE C 1 39  ? 14.420  -20.634 -24.426 1.00 172.87 ? 37  ILE C CG2   1 
ATOM   8205  C CD1   . ILE C 1 39  ? 12.703  -18.520 -24.488 1.00 172.71 ? 37  ILE C CD1   1 
ATOM   8206  N N     . CYS C 1 40  ? 13.917  -23.886 -26.910 1.00 175.78 ? 38  CYS C N     1 
ATOM   8207  C CA    . CYS C 1 40  ? 14.679  -25.123 -26.893 1.00 175.49 ? 38  CYS C CA    1 
ATOM   8208  C C     . CYS C 1 40  ? 16.048  -24.931 -27.554 1.00 173.75 ? 38  CYS C C     1 
ATOM   8209  O O     . CYS C 1 40  ? 17.082  -25.278 -26.977 1.00 169.76 ? 38  CYS C O     1 
ATOM   8210  C CB    . CYS C 1 40  ? 13.892  -26.243 -27.587 1.00 176.08 ? 38  CYS C CB    1 
ATOM   8211  S SG    . CYS C 1 40  ? 13.419  -25.912 -29.311 1.00 172.47 ? 38  CYS C SG    1 
ATOM   8212  N N     . THR C 1 41  ? 16.046  -24.354 -28.754 1.00 173.84 ? 39  THR C N     1 
ATOM   8213  C CA    . THR C 1 41  ? 17.257  -24.241 -29.569 1.00 171.32 ? 39  THR C CA    1 
ATOM   8214  C C     . THR C 1 41  ? 18.054  -22.953 -29.339 1.00 169.34 ? 39  THR C C     1 
ATOM   8215  O O     . THR C 1 41  ? 19.041  -22.697 -30.031 1.00 166.15 ? 39  THR C O     1 
ATOM   8216  C CB    . THR C 1 41  ? 16.946  -24.393 -31.075 1.00 166.50 ? 39  THR C CB    1 
ATOM   8217  O OG1   . THR C 1 41  ? 15.682  -23.786 -31.364 1.00 165.47 ? 39  THR C OG1   1 
ATOM   8218  C CG2   . THR C 1 41  ? 16.892  -25.864 -31.465 1.00 160.42 ? 39  THR C CG2   1 
ATOM   8219  N N     . GLU C 1 42  ? 17.627  -22.147 -28.374 1.00 168.91 ? 40  GLU C N     1 
ATOM   8220  C CA    . GLU C 1 42  ? 18.294  -20.878 -28.101 1.00 167.89 ? 40  GLU C CA    1 
ATOM   8221  C C     . GLU C 1 42  ? 19.616  -21.062 -27.369 1.00 162.62 ? 40  GLU C C     1 
ATOM   8222  O O     . GLU C 1 42  ? 20.627  -20.460 -27.729 1.00 159.79 ? 40  GLU C O     1 
ATOM   8223  C CB    . GLU C 1 42  ? 17.386  -19.963 -27.280 1.00 170.07 ? 40  GLU C CB    1 
ATOM   8224  C CG    . GLU C 1 42  ? 16.114  -19.545 -27.993 1.00 173.55 ? 40  GLU C CG    1 
ATOM   8225  C CD    . GLU C 1 42  ? 15.230  -18.657 -27.135 1.00 177.57 ? 40  GLU C CD    1 
ATOM   8226  O OE1   . GLU C 1 42  ? 15.661  -18.273 -26.027 1.00 177.02 ? 40  GLU C OE1   1 
ATOM   8227  O OE2   . GLU C 1 42  ? 14.100  -18.346 -27.566 1.00 178.77 ? 40  GLU C OE2   1 
ATOM   8228  N N     . MET C 1 43  ? 19.599  -21.902 -26.341 1.00 163.10 ? 41  MET C N     1 
ATOM   8229  C CA    . MET C 1 43  ? 20.729  -22.032 -25.426 1.00 160.53 ? 41  MET C CA    1 
ATOM   8230  C C     . MET C 1 43  ? 22.045  -22.429 -26.096 1.00 157.49 ? 41  MET C C     1 
ATOM   8231  O O     . MET C 1 43  ? 23.118  -22.037 -25.639 1.00 153.44 ? 41  MET C O     1 
ATOM   8232  C CB    . MET C 1 43  ? 20.383  -23.007 -24.294 1.00 156.56 ? 41  MET C CB    1 
ATOM   8233  C CG    . MET C 1 43  ? 19.281  -22.496 -23.373 1.00 157.15 ? 41  MET C CG    1 
ATOM   8234  S SD    . MET C 1 43  ? 18.564  -23.751 -22.293 1.00 151.87 ? 41  MET C SD    1 
ATOM   8235  C CE    . MET C 1 43  ? 17.391  -22.768 -21.361 1.00 153.98 ? 41  MET C CE    1 
ATOM   8236  N N     . GLU C 1 44  ? 21.964  -23.192 -27.180 1.00 158.85 ? 42  GLU C N     1 
ATOM   8237  C CA    . GLU C 1 44  ? 23.169  -23.701 -27.831 1.00 157.53 ? 42  GLU C CA    1 
ATOM   8238  C C     . GLU C 1 44  ? 24.073  -22.593 -28.365 1.00 155.24 ? 42  GLU C C     1 
ATOM   8239  O O     . GLU C 1 44  ? 25.257  -22.818 -28.609 1.00 153.53 ? 42  GLU C O     1 
ATOM   8240  C CB    . GLU C 1 44  ? 22.819  -24.692 -28.944 1.00 159.67 ? 42  GLU C CB    1 
ATOM   8241  C CG    . GLU C 1 44  ? 22.048  -25.910 -28.461 1.00 161.51 ? 42  GLU C CG    1 
ATOM   8242  C CD    . GLU C 1 44  ? 20.602  -25.587 -28.152 1.00 165.55 ? 42  GLU C CD    1 
ATOM   8243  O OE1   . GLU C 1 44  ? 19.991  -24.848 -28.948 1.00 167.69 ? 42  GLU C OE1   1 
ATOM   8244  O OE2   . GLU C 1 44  ? 20.080  -26.058 -27.119 1.00 163.95 ? 42  GLU C OE2   1 
ATOM   8245  N N     . LYS C 1 45  ? 23.515  -21.400 -28.546 1.00 155.17 ? 43  LYS C N     1 
ATOM   8246  C CA    . LYS C 1 45  ? 24.307  -20.257 -28.988 1.00 154.19 ? 43  LYS C CA    1 
ATOM   8247  C C     . LYS C 1 45  ? 25.496  -20.023 -28.064 1.00 152.17 ? 43  LYS C C     1 
ATOM   8248  O O     . LYS C 1 45  ? 26.652  -20.143 -28.474 1.00 146.72 ? 43  LYS C O     1 
ATOM   8249  C CB    . LYS C 1 45  ? 23.454  -18.985 -29.050 1.00 155.98 ? 43  LYS C CB    1 
ATOM   8250  C CG    . LYS C 1 45  ? 22.481  -18.925 -30.214 1.00 155.24 ? 43  LYS C CG    1 
ATOM   8251  C CD    . LYS C 1 45  ? 21.981  -17.504 -30.441 1.00 152.55 ? 43  LYS C CD    1 
ATOM   8252  C CE    . LYS C 1 45  ? 21.231  -16.976 -29.231 1.00 153.68 ? 43  LYS C CE    1 
ATOM   8253  N NZ    . LYS C 1 45  ? 20.029  -17.800 -28.930 1.00 156.86 ? 43  LYS C NZ    1 
ATOM   8254  N N     . GLU C 1 46  ? 25.198  -19.687 -26.813 1.00 153.35 ? 44  GLU C N     1 
ATOM   8255  C CA    . GLU C 1 46  ? 26.224  -19.324 -25.843 1.00 151.73 ? 44  GLU C CA    1 
ATOM   8256  C C     . GLU C 1 46  ? 26.939  -20.544 -25.261 1.00 148.86 ? 44  GLU C C     1 
ATOM   8257  O O     . GLU C 1 46  ? 27.932  -20.400 -24.550 1.00 145.47 ? 44  GLU C O     1 
ATOM   8258  C CB    . GLU C 1 46  ? 25.627  -18.475 -24.715 1.00 148.77 ? 44  GLU C CB    1 
ATOM   8259  C CG    . GLU C 1 46  ? 24.739  -17.332 -25.187 1.00 149.99 ? 44  GLU C CG    1 
ATOM   8260  C CD    . GLU C 1 46  ? 23.364  -17.802 -25.626 1.00 151.97 ? 44  GLU C CD    1 
ATOM   8261  O OE1   . GLU C 1 46  ? 22.609  -16.987 -26.198 1.00 153.10 ? 44  GLU C OE1   1 
ATOM   8262  O OE2   . GLU C 1 46  ? 23.038  -18.987 -25.399 1.00 149.72 ? 44  GLU C OE2   1 
ATOM   8263  N N     . GLY C 1 47  ? 26.432  -21.738 -25.565 1.00 148.90 ? 45  GLY C N     1 
ATOM   8264  C CA    . GLY C 1 47  ? 27.064  -22.973 -25.125 1.00 146.01 ? 45  GLY C CA    1 
ATOM   8265  C C     . GLY C 1 47  ? 26.568  -23.515 -23.795 1.00 138.94 ? 45  GLY C C     1 
ATOM   8266  O O     . GLY C 1 47  ? 27.261  -24.276 -23.119 1.00 131.39 ? 45  GLY C O     1 
ATOM   8267  N N     . LYS C 1 48  ? 25.357  -23.125 -23.422 1.00 141.50 ? 46  LYS C N     1 
ATOM   8268  C CA    . LYS C 1 48  ? 24.779  -23.548 -22.156 1.00 134.43 ? 46  LYS C CA    1 
ATOM   8269  C C     . LYS C 1 48  ? 24.183  -24.942 -22.269 1.00 133.45 ? 46  LYS C C     1 
ATOM   8270  O O     . LYS C 1 48  ? 23.733  -25.513 -21.280 1.00 127.65 ? 46  LYS C O     1 
ATOM   8271  C CB    . LYS C 1 48  ? 23.737  -22.535 -21.679 1.00 132.56 ? 46  LYS C CB    1 
ATOM   8272  C CG    . LYS C 1 48  ? 24.331  -21.149 -21.479 1.00 129.56 ? 46  LYS C CG    1 
ATOM   8273  C CD    . LYS C 1 48  ? 23.319  -20.134 -20.994 1.00 122.38 ? 46  LYS C CD    1 
ATOM   8274  C CE    . LYS C 1 48  ? 23.957  -18.752 -20.917 1.00 122.37 ? 46  LYS C CE    1 
ATOM   8275  N NZ    . LYS C 1 48  ? 23.009  -17.705 -20.444 1.00 117.06 ? 46  LYS C NZ    1 
ATOM   8276  N N     . ILE C 1 49  ? 24.183  -25.487 -23.480 1.00 138.98 ? 47  ILE C N     1 
ATOM   8277  C CA    . ILE C 1 49  ? 23.758  -26.864 -23.701 1.00 138.22 ? 47  ILE C CA    1 
ATOM   8278  C C     . ILE C 1 49  ? 24.573  -27.467 -24.850 1.00 140.30 ? 47  ILE C C     1 
ATOM   8279  O O     . ILE C 1 49  ? 25.343  -26.761 -25.503 1.00 141.83 ? 47  ILE C O     1 
ATOM   8280  C CB    . ILE C 1 49  ? 22.239  -26.922 -24.034 1.00 145.21 ? 47  ILE C CB    1 
ATOM   8281  C CG1   . ILE C 1 49  ? 21.399  -26.494 -22.829 1.00 142.36 ? 47  ILE C CG1   1 
ATOM   8282  C CG2   . ILE C 1 49  ? 21.815  -28.312 -24.464 1.00 148.50 ? 47  ILE C CG2   1 
ATOM   8283  C CD1   . ILE C 1 49  ? 19.915  -26.787 -22.976 1.00 142.60 ? 47  ILE C CD1   1 
ATOM   8284  N N     . SER C 1 50  ? 24.408  -28.768 -25.087 1.00 141.71 ? 48  SER C N     1 
ATOM   8285  C CA    . SER C 1 50  ? 24.977  -29.442 -26.254 1.00 142.28 ? 48  SER C CA    1 
ATOM   8286  C C     . SER C 1 50  ? 24.047  -30.556 -26.730 1.00 146.72 ? 48  SER C C     1 
ATOM   8287  O O     . SER C 1 50  ? 23.570  -31.354 -25.923 1.00 145.88 ? 48  SER C O     1 
ATOM   8288  C CB    . SER C 1 50  ? 26.361  -30.020 -25.933 1.00 133.99 ? 48  SER C CB    1 
ATOM   8289  O OG    . SER C 1 50  ? 27.359  -29.013 -25.931 1.00 124.95 ? 48  SER C OG    1 
ATOM   8290  N N     . LYS C 1 51  ? 23.800  -30.625 -28.035 1.00 150.26 ? 49  LYS C N     1 
ATOM   8291  C CA    . LYS C 1 51  ? 23.012  -31.724 -28.586 1.00 153.59 ? 49  LYS C CA    1 
ATOM   8292  C C     . LYS C 1 51  ? 23.880  -32.983 -28.626 1.00 154.13 ? 49  LYS C C     1 
ATOM   8293  O O     . LYS C 1 51  ? 25.005  -32.959 -29.130 1.00 153.22 ? 49  LYS C O     1 
ATOM   8294  C CB    . LYS C 1 51  ? 22.456  -31.376 -29.976 1.00 153.39 ? 49  LYS C CB    1 
ATOM   8295  C CG    . LYS C 1 51  ? 23.512  -31.201 -31.059 1.00 154.20 ? 49  LYS C CG    1 
ATOM   8296  C CD    . LYS C 1 51  ? 22.916  -30.730 -32.378 1.00 148.44 ? 49  LYS C CD    1 
ATOM   8297  C CE    . LYS C 1 51  ? 23.991  -30.657 -33.452 1.00 143.98 ? 49  LYS C CE    1 
ATOM   8298  N NZ    . LYS C 1 51  ? 23.568  -29.855 -34.629 1.00 143.20 ? 49  LYS C NZ    1 
ATOM   8299  N N     . ILE C 1 52  ? 23.366  -34.077 -28.074 1.00 154.20 ? 50  ILE C N     1 
ATOM   8300  C CA    . ILE C 1 52  ? 24.157  -35.297 -27.949 1.00 155.21 ? 50  ILE C CA    1 
ATOM   8301  C C     . ILE C 1 52  ? 23.382  -36.545 -28.364 1.00 159.15 ? 50  ILE C C     1 
ATOM   8302  O O     . ILE C 1 52  ? 22.167  -36.622 -28.178 1.00 161.65 ? 50  ILE C O     1 
ATOM   8303  C CB    . ILE C 1 52  ? 24.714  -35.461 -26.520 1.00 150.96 ? 50  ILE C CB    1 
ATOM   8304  C CG1   . ILE C 1 52  ? 26.161  -34.952 -26.449 1.00 145.63 ? 50  ILE C CG1   1 
ATOM   8305  C CG2   . ILE C 1 52  ? 24.640  -36.915 -26.076 1.00 152.12 ? 50  ILE C CG2   1 
ATOM   8306  C CD1   . ILE C 1 52  ? 26.321  -33.455 -26.654 1.00 139.56 ? 50  ILE C CD1   1 
ATOM   8307  N N     . GLY C 1 53  ? 24.103  -37.521 -28.913 1.00 160.76 ? 51  GLY C N     1 
ATOM   8308  C CA    . GLY C 1 53  ? 23.503  -38.682 -29.547 1.00 163.45 ? 51  GLY C CA    1 
ATOM   8309  C C     . GLY C 1 53  ? 22.918  -39.744 -28.636 1.00 165.86 ? 51  GLY C C     1 
ATOM   8310  O O     . GLY C 1 53  ? 22.773  -39.532 -27.431 1.00 165.38 ? 51  GLY C O     1 
ATOM   8311  N N     . PRO C 1 54  ? 22.579  -40.905 -29.222 1.00 168.18 ? 52  PRO C N     1 
ATOM   8312  C CA    . PRO C 1 54  ? 21.902  -42.046 -28.592 1.00 169.19 ? 52  PRO C CA    1 
ATOM   8313  C C     . PRO C 1 54  ? 22.806  -42.747 -27.592 1.00 168.58 ? 52  PRO C C     1 
ATOM   8314  O O     . PRO C 1 54  ? 22.339  -43.544 -26.777 1.00 166.03 ? 52  PRO C O     1 
ATOM   8315  C CB    . PRO C 1 54  ? 21.630  -42.975 -29.775 1.00 168.31 ? 52  PRO C CB    1 
ATOM   8316  C CG    . PRO C 1 54  ? 22.756  -42.703 -30.706 1.00 168.13 ? 52  PRO C CG    1 
ATOM   8317  C CD    . PRO C 1 54  ? 23.021  -41.224 -30.592 1.00 167.46 ? 52  PRO C CD    1 
ATOM   8318  N N     . GLU C 1 55  ? 24.096  -42.445 -27.680 1.00 169.22 ? 53  GLU C N     1 
ATOM   8319  C CA    . GLU C 1 55  ? 25.130  -43.127 -26.910 1.00 167.78 ? 53  GLU C CA    1 
ATOM   8320  C C     . GLU C 1 55  ? 24.867  -43.233 -25.400 1.00 167.74 ? 53  GLU C C     1 
ATOM   8321  O O     . GLU C 1 55  ? 25.133  -44.275 -24.801 1.00 167.98 ? 53  GLU C O     1 
ATOM   8322  C CB    . GLU C 1 55  ? 26.493  -42.489 -27.196 1.00 167.18 ? 53  GLU C CB    1 
ATOM   8323  C CG    . GLU C 1 55  ? 26.836  -42.472 -28.679 1.00 168.38 ? 53  GLU C CG    1 
ATOM   8324  C CD    . GLU C 1 55  ? 28.189  -41.859 -28.966 1.00 170.26 ? 53  GLU C CD    1 
ATOM   8325  O OE1   . GLU C 1 55  ? 28.745  -41.195 -28.067 1.00 170.23 ? 53  GLU C OE1   1 
ATOM   8326  O OE2   . GLU C 1 55  ? 28.698  -42.044 -30.092 1.00 169.69 ? 53  GLU C OE2   1 
ATOM   8327  N N     . ASN C 1 56  ? 24.354  -42.173 -24.779 1.00 166.82 ? 54  ASN C N     1 
ATOM   8328  C CA    . ASN C 1 56  ? 24.028  -42.236 -23.352 1.00 162.64 ? 54  ASN C CA    1 
ATOM   8329  C C     . ASN C 1 56  ? 22.539  -42.121 -23.062 1.00 162.88 ? 54  ASN C C     1 
ATOM   8330  O O     . ASN C 1 56  ? 21.968  -41.031 -23.154 1.00 161.58 ? 54  ASN C O     1 
ATOM   8331  C CB    . ASN C 1 56  ? 24.779  -41.152 -22.578 1.00 157.57 ? 54  ASN C CB    1 
ATOM   8332  C CG    . ASN C 1 56  ? 26.198  -41.556 -22.244 1.00 154.30 ? 54  ASN C CG    1 
ATOM   8333  O OD1   . ASN C 1 56  ? 26.506  -42.742 -22.124 1.00 156.13 ? 54  ASN C OD1   1 
ATOM   8334  N ND2   . ASN C 1 56  ? 27.073  -40.569 -22.088 1.00 147.88 ? 54  ASN C ND2   1 
ATOM   8335  N N     . PRO C 1 57  ? 21.897  -43.250 -22.713 1.00 164.19 ? 55  PRO C N     1 
ATOM   8336  C CA    . PRO C 1 57  ? 20.484  -43.139 -22.349 1.00 166.03 ? 55  PRO C CA    1 
ATOM   8337  C C     . PRO C 1 57  ? 20.319  -42.470 -20.990 1.00 164.04 ? 55  PRO C C     1 
ATOM   8338  O O     . PRO C 1 57  ? 20.850  -42.976 -20.003 1.00 162.19 ? 55  PRO C O     1 
ATOM   8339  C CB    . PRO C 1 57  ? 20.041  -44.601 -22.263 1.00 165.14 ? 55  PRO C CB    1 
ATOM   8340  C CG    . PRO C 1 57  ? 21.277  -45.332 -21.843 1.00 162.49 ? 55  PRO C CG    1 
ATOM   8341  C CD    . PRO C 1 57  ? 22.426  -44.610 -22.503 1.00 162.62 ? 55  PRO C CD    1 
ATOM   8342  N N     . TYR C 1 58  ? 19.563  -41.379 -20.936 1.00 164.53 ? 56  TYR C N     1 
ATOM   8343  C CA    . TYR C 1 58  ? 19.110  -40.809 -19.673 1.00 163.85 ? 56  TYR C CA    1 
ATOM   8344  C C     . TYR C 1 58  ? 17.839  -40.002 -19.940 1.00 166.26 ? 56  TYR C C     1 
ATOM   8345  O O     . TYR C 1 58  ? 17.733  -39.349 -20.978 1.00 167.23 ? 56  TYR C O     1 
ATOM   8346  C CB    . TYR C 1 58  ? 20.206  -39.951 -19.034 1.00 157.86 ? 56  TYR C CB    1 
ATOM   8347  C CG    . TYR C 1 58  ? 21.501  -40.695 -18.711 1.00 154.90 ? 56  TYR C CG    1 
ATOM   8348  C CD1   . TYR C 1 58  ? 21.623  -41.473 -17.558 1.00 150.05 ? 56  TYR C CD1   1 
ATOM   8349  C CD2   . TYR C 1 58  ? 22.609  -40.605 -19.553 1.00 153.20 ? 56  TYR C CD2   1 
ATOM   8350  C CE1   . TYR C 1 58  ? 22.815  -42.148 -17.260 1.00 145.57 ? 56  TYR C CE1   1 
ATOM   8351  C CE2   . TYR C 1 58  ? 23.804  -41.275 -19.260 1.00 149.88 ? 56  TYR C CE2   1 
ATOM   8352  C CZ    . TYR C 1 58  ? 23.902  -42.043 -18.116 1.00 143.26 ? 56  TYR C CZ    1 
ATOM   8353  O OH    . TYR C 1 58  ? 25.085  -42.700 -17.835 1.00 133.25 ? 56  TYR C OH    1 
ATOM   8354  N N     . ASN C 1 59  ? 16.884  -40.027 -19.015 1.00 168.24 ? 57  ASN C N     1 
ATOM   8355  C CA    . ASN C 1 59  ? 15.623  -39.319 -19.231 1.00 171.04 ? 57  ASN C CA    1 
ATOM   8356  C C     . ASN C 1 59  ? 15.151  -38.538 -18.013 1.00 171.35 ? 57  ASN C C     1 
ATOM   8357  O O     . ASN C 1 59  ? 15.313  -38.990 -16.882 1.00 170.86 ? 57  ASN C O     1 
ATOM   8358  C CB    . ASN C 1 59  ? 14.510  -40.286 -19.646 1.00 172.57 ? 57  ASN C CB    1 
ATOM   8359  C CG    . ASN C 1 59  ? 14.909  -41.203 -20.785 1.00 172.90 ? 57  ASN C CG    1 
ATOM   8360  O OD1   . ASN C 1 59  ? 14.824  -42.429 -20.669 1.00 169.61 ? 57  ASN C OD1   1 
ATOM   8361  N ND2   . ASN C 1 59  ? 15.328  -40.615 -21.900 1.00 175.52 ? 57  ASN C ND2   1 
ATOM   8362  N N     . THR C 1 60  ? 14.571  -37.365 -18.253 1.00 173.50 ? 58  THR C N     1 
ATOM   8363  C CA    . THR C 1 60  ? 13.910  -36.587 -17.204 1.00 176.71 ? 58  THR C CA    1 
ATOM   8364  C C     . THR C 1 60  ? 12.697  -35.813 -17.770 1.00 180.67 ? 58  THR C C     1 
ATOM   8365  O O     . THR C 1 60  ? 12.721  -35.375 -18.921 1.00 180.70 ? 58  THR C O     1 
ATOM   8366  C CB    . THR C 1 60  ? 14.902  -35.626 -16.496 1.00 175.58 ? 58  THR C CB    1 
ATOM   8367  O OG1   . THR C 1 60  ? 15.235  -34.542 -17.367 1.00 176.97 ? 58  THR C OG1   1 
ATOM   8368  C CG2   . THR C 1 60  ? 16.186  -36.355 -16.101 1.00 170.08 ? 58  THR C CG2   1 
ATOM   8369  N N     . PRO C 1 61  ? 11.632  -35.646 -16.960 1.00 182.44 ? 59  PRO C N     1 
ATOM   8370  C CA    . PRO C 1 61  ? 10.354  -35.040 -17.383 1.00 187.17 ? 59  PRO C CA    1 
ATOM   8371  C C     . PRO C 1 61  ? 10.322  -33.501 -17.403 1.00 188.75 ? 59  PRO C C     1 
ATOM   8372  O O     . PRO C 1 61  ? 11.370  -32.862 -17.283 1.00 185.48 ? 59  PRO C O     1 
ATOM   8373  C CB    . PRO C 1 61  ? 9.360   -35.575 -16.344 1.00 185.72 ? 59  PRO C CB    1 
ATOM   8374  C CG    . PRO C 1 61  ? 10.183  -35.763 -15.118 1.00 180.91 ? 59  PRO C CG    1 
ATOM   8375  C CD    . PRO C 1 61  ? 11.556  -36.182 -15.588 1.00 179.83 ? 59  PRO C CD    1 
ATOM   8376  N N     . VAL C 1 62  ? 9.130   -32.925 -17.591 1.00 192.57 ? 60  VAL C N     1 
ATOM   8377  C CA    . VAL C 1 62  ? 8.945   -31.467 -17.502 1.00 195.79 ? 60  VAL C CA    1 
ATOM   8378  C C     . VAL C 1 62  ? 7.730   -31.009 -16.658 1.00 195.95 ? 60  VAL C C     1 
ATOM   8379  O O     . VAL C 1 62  ? 6.577   -31.283 -17.004 1.00 195.88 ? 60  VAL C O     1 
ATOM   8380  C CB    . VAL C 1 62  ? 8.908   -30.806 -18.910 1.00 192.57 ? 60  VAL C CB    1 
ATOM   8381  C CG1   . VAL C 1 62  ? 8.061   -29.539 -18.900 1.00 192.01 ? 60  VAL C CG1   1 
ATOM   8382  C CG2   . VAL C 1 62  ? 10.318  -30.504 -19.386 1.00 187.73 ? 60  VAL C CG2   1 
ATOM   8383  N N     . PHE C 1 63  ? 8.021   -30.328 -15.544 1.00 194.47 ? 61  PHE C N     1 
ATOM   8384  C CA    . PHE C 1 63  ? 7.031   -29.637 -14.700 1.00 194.78 ? 61  PHE C CA    1 
ATOM   8385  C C     . PHE C 1 63  ? 7.765   -28.586 -13.842 1.00 195.21 ? 61  PHE C C     1 
ATOM   8386  O O     . PHE C 1 63  ? 8.989   -28.653 -13.704 1.00 191.36 ? 61  PHE C O     1 
ATOM   8387  C CB    . PHE C 1 63  ? 6.239   -30.626 -13.826 1.00 194.04 ? 61  PHE C CB    1 
ATOM   8388  C CG    . PHE C 1 63  ? 5.005   -30.027 -13.180 1.00 194.30 ? 61  PHE C CG    1 
ATOM   8389  C CD1   . PHE C 1 63  ? 3.852   -29.805 -13.922 1.00 192.56 ? 61  PHE C CD1   1 
ATOM   8390  C CD2   . PHE C 1 63  ? 4.996   -29.698 -11.831 1.00 192.40 ? 61  PHE C CD2   1 
ATOM   8391  C CE1   . PHE C 1 63  ? 2.722   -29.258 -13.333 1.00 189.64 ? 61  PHE C CE1   1 
ATOM   8392  C CE2   . PHE C 1 63  ? 3.866   -29.152 -11.238 1.00 188.68 ? 61  PHE C CE2   1 
ATOM   8393  C CZ    . PHE C 1 63  ? 2.730   -28.933 -11.990 1.00 186.87 ? 61  PHE C CZ    1 
ATOM   8394  N N     . ALA C 1 64  ? 7.035   -27.619 -13.277 1.00 197.58 ? 62  ALA C N     1 
ATOM   8395  C CA    . ALA C 1 64  ? 7.667   -26.506 -12.540 1.00 194.06 ? 62  ALA C CA    1 
ATOM   8396  C C     . ALA C 1 64  ? 6.948   -26.032 -11.262 1.00 191.29 ? 62  ALA C C     1 
ATOM   8397  O O     . ALA C 1 64  ? 5.815   -26.427 -10.983 1.00 191.06 ? 62  ALA C O     1 
ATOM   8398  C CB    . ALA C 1 64  ? 7.916   -25.320 -13.476 1.00 191.35 ? 62  ALA C CB    1 
ATOM   8399  N N     . ILE C 1 65  ? 7.634   -25.184 -10.494 1.00 189.02 ? 63  ILE C N     1 
ATOM   8400  C CA    . ILE C 1 65  ? 7.065   -24.536 -9.309  1.00 189.83 ? 63  ILE C CA    1 
ATOM   8401  C C     . ILE C 1 65  ? 6.660   -23.092 -9.649  1.00 191.92 ? 63  ILE C C     1 
ATOM   8402  O O     . ILE C 1 65  ? 7.318   -22.439 -10.463 1.00 190.56 ? 63  ILE C O     1 
ATOM   8403  C CB    . ILE C 1 65  ? 8.076   -24.519 -8.132  1.00 185.44 ? 63  ILE C CB    1 
ATOM   8404  C CG1   . ILE C 1 65  ? 8.728   -25.890 -7.952  1.00 180.29 ? 63  ILE C CG1   1 
ATOM   8405  C CG2   . ILE C 1 65  ? 7.403   -24.066 -6.840  1.00 182.27 ? 63  ILE C CG2   1 
ATOM   8406  C CD1   . ILE C 1 65  ? 9.746   -25.932 -6.838  1.00 170.96 ? 63  ILE C CD1   1 
ATOM   8407  N N     . LYS C 1 66  ? 5.579   -22.599 -9.038  1.00 192.40 ? 64  LYS C N     1 
ATOM   8408  C CA    . LYS C 1 66  ? 5.079   -21.244 -9.324  1.00 189.72 ? 64  LYS C CA    1 
ATOM   8409  C C     . LYS C 1 66  ? 5.082   -20.301 -8.105  1.00 189.09 ? 64  LYS C C     1 
ATOM   8410  O O     . LYS C 1 66  ? 4.741   -20.707 -6.990  1.00 187.31 ? 64  LYS C O     1 
ATOM   8411  C CB    . LYS C 1 66  ? 3.678   -21.296 -9.958  1.00 182.47 ? 64  LYS C CB    1 
ATOM   8412  C CG    . LYS C 1 66  ? 3.200   -19.962 -10.530 1.00 176.49 ? 64  LYS C CG    1 
ATOM   8413  C CD    . LYS C 1 66  ? 1.869   -20.091 -11.262 1.00 167.57 ? 64  LYS C CD    1 
ATOM   8414  C CE    . LYS C 1 66  ? 1.476   -18.777 -11.930 1.00 154.90 ? 64  LYS C CE    1 
ATOM   8415  N NZ    . LYS C 1 66  ? 0.168   -18.860 -12.637 1.00 141.96 ? 64  LYS C NZ    1 
ATOM   8416  N N     . LYS C 1 67  ? 5.466   -19.044 -8.340  1.00 189.38 ? 65  LYS C N     1 
ATOM   8417  C CA    . LYS C 1 67  ? 5.527   -18.009 -7.300  1.00 188.52 ? 65  LYS C CA    1 
ATOM   8418  C C     . LYS C 1 67  ? 5.175   -16.625 -7.859  1.00 187.87 ? 65  LYS C C     1 
ATOM   8419  O O     . LYS C 1 67  ? 5.474   -16.322 -9.016  1.00 188.24 ? 65  LYS C O     1 
ATOM   8420  C CB    . LYS C 1 67  ? 6.923   -17.961 -6.664  1.00 187.43 ? 65  LYS C CB    1 
ATOM   8421  C CG    . LYS C 1 67  ? 7.151   -16.771 -5.728  1.00 184.58 ? 65  LYS C CG    1 
ATOM   8422  C CD    . LYS C 1 67  ? 8.462   -16.053 -6.037  1.00 182.71 ? 65  LYS C CD    1 
ATOM   8423  C CE    . LYS C 1 67  ? 8.649   -14.828 -5.153  1.00 173.78 ? 65  LYS C CE    1 
ATOM   8424  N NZ    . LYS C 1 67  ? 9.859   -14.049 -5.533  1.00 171.03 ? 65  LYS C NZ    1 
ATOM   8425  N N     . LYS C 1 68  ? 4.554   -15.785 -7.031  1.00 186.49 ? 66  LYS C N     1 
ATOM   8426  C CA    . LYS C 1 68  ? 4.200   -14.420 -7.429  1.00 184.49 ? 66  LYS C CA    1 
ATOM   8427  C C     . LYS C 1 68  ? 5.432   -13.508 -7.420  1.00 186.66 ? 66  LYS C C     1 
ATOM   8428  O O     . LYS C 1 68  ? 6.561   -13.977 -7.249  1.00 187.36 ? 66  LYS C O     1 
ATOM   8429  C CB    . LYS C 1 68  ? 3.111   -13.846 -6.511  1.00 178.03 ? 66  LYS C CB    1 
ATOM   8430  C CG    . LYS C 1 68  ? 1.772   -14.579 -6.558  1.00 170.33 ? 66  LYS C CG    1 
ATOM   8431  C CD    . LYS C 1 68  ? 0.769   -13.973 -5.576  1.00 162.85 ? 66  LYS C CD    1 
ATOM   8432  C CE    . LYS C 1 68  ? -0.568  -14.705 -5.606  1.00 154.45 ? 66  LYS C CE    1 
ATOM   8433  N NZ    . LYS C 1 68  ? -1.541  -14.148 -4.624  1.00 143.75 ? 66  LYS C NZ    1 
ATOM   8434  N N     . ASP C 1 69  ? 5.207   -12.211 -7.618  1.00 185.91 ? 67  ASP C N     1 
ATOM   8435  C CA    . ASP C 1 69  ? 6.283   -11.213 -7.614  1.00 186.52 ? 67  ASP C CA    1 
ATOM   8436  C C     . ASP C 1 69  ? 7.317   -11.409 -8.732  1.00 186.00 ? 67  ASP C C     1 
ATOM   8437  O O     . ASP C 1 69  ? 8.475   -11.001 -8.603  1.00 184.09 ? 67  ASP C O     1 
ATOM   8438  C CB    . ASP C 1 69  ? 6.972   -11.149 -6.244  1.00 185.21 ? 67  ASP C CB    1 
ATOM   8439  C CG    . ASP C 1 69  ? 6.124   -10.449 -5.195  1.00 181.14 ? 67  ASP C CG    1 
ATOM   8440  O OD1   . ASP C 1 69  ? 5.217   -9.681  -5.578  1.00 178.92 ? 67  ASP C OD1   1 
ATOM   8441  O OD2   . ASP C 1 69  ? 6.372   -10.660 -3.989  1.00 177.77 ? 67  ASP C OD2   1 
ATOM   8442  N N     . SER C 1 70  ? 6.890   -12.036 -9.824  1.00 185.79 ? 68  SER C N     1 
ATOM   8443  C CA    . SER C 1 70  ? 7.713   -12.141 -11.024 1.00 183.99 ? 68  SER C CA    1 
ATOM   8444  C C     . SER C 1 70  ? 6.843   -11.926 -12.261 1.00 183.72 ? 68  SER C C     1 
ATOM   8445  O O     . SER C 1 70  ? 5.779   -12.530 -12.393 1.00 182.91 ? 68  SER C O     1 
ATOM   8446  C CB    . SER C 1 70  ? 8.435   -13.493 -11.085 1.00 182.66 ? 68  SER C CB    1 
ATOM   8447  O OG    . SER C 1 70  ? 7.522   -14.569 -11.181 1.00 181.86 ? 68  SER C OG    1 
ATOM   8448  N N     . THR C 1 71  ? 7.290   -11.050 -13.155 1.00 183.82 ? 69  THR C N     1 
ATOM   8449  C CA    . THR C 1 71  ? 6.522   -10.712 -14.352 1.00 182.85 ? 69  THR C CA    1 
ATOM   8450  C C     . THR C 1 71  ? 6.915   -11.503 -15.616 1.00 182.75 ? 69  THR C C     1 
ATOM   8451  O O     . THR C 1 71  ? 6.380   -11.253 -16.697 1.00 180.44 ? 69  THR C O     1 
ATOM   8452  C CB    . THR C 1 71  ? 6.528   -9.186  -14.625 1.00 179.66 ? 69  THR C CB    1 
ATOM   8453  O OG1   . THR C 1 71  ? 7.869   -8.687  -14.562 1.00 178.03 ? 69  THR C OG1   1 
ATOM   8454  C CG2   . THR C 1 71  ? 5.682   -8.459  -13.589 1.00 174.54 ? 69  THR C CG2   1 
ATOM   8455  N N     . LYS C 1 72  ? 7.847   -12.448 -15.482 1.00 184.29 ? 70  LYS C N     1 
ATOM   8456  C CA    . LYS C 1 72  ? 8.191   -13.347 -16.593 1.00 185.62 ? 70  LYS C CA    1 
ATOM   8457  C C     . LYS C 1 72  ? 8.126   -14.832 -16.197 1.00 187.58 ? 70  LYS C C     1 
ATOM   8458  O O     . LYS C 1 72  ? 7.840   -15.164 -15.043 1.00 186.82 ? 70  LYS C O     1 
ATOM   8459  C CB    . LYS C 1 72  ? 9.561   -13.000 -17.196 1.00 183.10 ? 70  LYS C CB    1 
ATOM   8460  C CG    . LYS C 1 72  ? 10.764  -13.465 -16.384 1.00 179.65 ? 70  LYS C CG    1 
ATOM   8461  C CD    . LYS C 1 72  ? 12.066  -13.232 -17.142 1.00 172.54 ? 70  LYS C CD    1 
ATOM   8462  C CE    . LYS C 1 72  ? 12.079  -13.984 -18.464 1.00 168.04 ? 70  LYS C CE    1 
ATOM   8463  N NZ    . LYS C 1 72  ? 13.334  -13.753 -19.229 1.00 157.86 ? 70  LYS C NZ    1 
ATOM   8464  N N     . TRP C 1 73  ? 8.399   -15.713 -17.161 1.00 188.58 ? 71  TRP C N     1 
ATOM   8465  C CA    . TRP C 1 73  ? 8.237   -17.165 -16.984 1.00 192.13 ? 71  TRP C CA    1 
ATOM   8466  C C     . TRP C 1 73  ? 9.378   -17.858 -16.211 1.00 192.87 ? 71  TRP C C     1 
ATOM   8467  O O     . TRP C 1 73  ? 10.508  -17.365 -16.186 1.00 191.47 ? 71  TRP C O     1 
ATOM   8468  C CB    . TRP C 1 73  ? 8.044   -17.849 -18.348 1.00 192.57 ? 71  TRP C CB    1 
ATOM   8469  C CG    . TRP C 1 73  ? 6.883   -17.324 -19.155 1.00 191.95 ? 71  TRP C CG    1 
ATOM   8470  C CD1   . TRP C 1 73  ? 6.946   -16.519 -20.256 1.00 191.77 ? 71  TRP C CD1   1 
ATOM   8471  C CD2   . TRP C 1 73  ? 5.489   -17.573 -18.921 1.00 192.01 ? 71  TRP C CD2   1 
ATOM   8472  N NE1   . TRP C 1 73  ? 5.680   -16.251 -20.722 1.00 191.72 ? 71  TRP C NE1   1 
ATOM   8473  C CE2   . TRP C 1 73  ? 4.769   -16.885 -19.919 1.00 192.49 ? 71  TRP C CE2   1 
ATOM   8474  C CE3   . TRP C 1 73  ? 4.781   -18.309 -17.964 1.00 189.00 ? 71  TRP C CE3   1 
ATOM   8475  C CZ2   . TRP C 1 73  ? 3.377   -16.912 -19.987 1.00 190.82 ? 71  TRP C CZ2   1 
ATOM   8476  C CZ3   . TRP C 1 73  ? 3.401   -18.334 -18.034 1.00 189.12 ? 71  TRP C CZ3   1 
ATOM   8477  C CH2   . TRP C 1 73  ? 2.714   -17.639 -19.038 1.00 190.51 ? 71  TRP C CH2   1 
ATOM   8478  N N     . ARG C 1 74  ? 9.069   -19.001 -15.587 1.00 193.62 ? 72  ARG C N     1 
ATOM   8479  C CA    . ARG C 1 74  ? 10.069  -19.825 -14.883 1.00 193.81 ? 72  ARG C CA    1 
ATOM   8480  C C     . ARG C 1 74  ? 9.892   -21.341 -15.120 1.00 192.15 ? 72  ARG C C     1 
ATOM   8481  O O     . ARG C 1 74  ? 8.808   -21.885 -14.901 1.00 190.80 ? 72  ARG C O     1 
ATOM   8482  C CB    . ARG C 1 74  ? 10.061  -19.525 -13.373 1.00 193.79 ? 72  ARG C CB    1 
ATOM   8483  C CG    . ARG C 1 74  ? 8.779   -19.927 -12.635 1.00 191.47 ? 72  ARG C CG    1 
ATOM   8484  C CD    . ARG C 1 74  ? 8.926   -19.798 -11.118 1.00 188.72 ? 72  ARG C CD    1 
ATOM   8485  N NE    . ARG C 1 74  ? 9.015   -18.406 -10.676 1.00 189.95 ? 72  ARG C NE    1 
ATOM   8486  C CZ    . ARG C 1 74  ? 9.241   -18.031 -9.419  1.00 187.55 ? 72  ARG C CZ    1 
ATOM   8487  N NH1   . ARG C 1 74  ? 9.409   -18.944 -8.471  1.00 186.07 ? 72  ARG C NH1   1 
ATOM   8488  N NH2   . ARG C 1 74  ? 9.304   -16.741 -9.110  1.00 183.91 ? 72  ARG C NH2   1 
ATOM   8489  N N     . LYS C 1 75  ? 10.959  -22.020 -15.551 1.00 191.53 ? 73  LYS C N     1 
ATOM   8490  C CA    . LYS C 1 75  ? 10.897  -23.468 -15.813 1.00 190.09 ? 73  LYS C CA    1 
ATOM   8491  C C     . LYS C 1 75  ? 11.940  -24.308 -15.058 1.00 187.93 ? 73  LYS C C     1 
ATOM   8492  O O     . LYS C 1 75  ? 13.008  -23.816 -14.685 1.00 184.56 ? 73  LYS C O     1 
ATOM   8493  C CB    . LYS C 1 75  ? 10.995  -23.776 -17.316 1.00 188.41 ? 73  LYS C CB    1 
ATOM   8494  C CG    . LYS C 1 75  ? 10.896  -25.272 -17.619 1.00 186.76 ? 73  LYS C CG    1 
ATOM   8495  C CD    . LYS C 1 75  ? 11.222  -25.631 -19.057 1.00 186.69 ? 73  LYS C CD    1 
ATOM   8496  C CE    . LYS C 1 75  ? 11.197  -27.147 -19.233 1.00 188.11 ? 73  LYS C CE    1 
ATOM   8497  N NZ    . LYS C 1 75  ? 11.383  -27.582 -20.645 1.00 187.95 ? 73  LYS C NZ    1 
ATOM   8498  N N     . LEU C 1 76  ? 11.614  -25.585 -14.855 1.00 187.45 ? 74  LEU C N     1 
ATOM   8499  C CA    . LEU C 1 76  ? 12.514  -26.546 -14.220 1.00 182.21 ? 74  LEU C CA    1 
ATOM   8500  C C     . LEU C 1 76  ? 12.504  -27.882 -14.978 1.00 180.22 ? 74  LEU C C     1 
ATOM   8501  O O     . LEU C 1 76  ? 11.847  -28.021 -16.014 1.00 180.53 ? 74  LEU C O     1 
ATOM   8502  C CB    . LEU C 1 76  ? 12.105  -26.778 -12.757 1.00 179.78 ? 74  LEU C CB    1 
ATOM   8503  C CG    . LEU C 1 76  ? 12.064  -25.594 -11.781 1.00 178.41 ? 74  LEU C CG    1 
ATOM   8504  C CD1   . LEU C 1 76  ? 11.201  -25.921 -10.564 1.00 179.30 ? 74  LEU C CD1   1 
ATOM   8505  C CD2   . LEU C 1 76  ? 13.466  -25.168 -11.356 1.00 163.68 ? 74  LEU C CD2   1 
ATOM   8506  N N     . VAL C 1 77  ? 13.249  -28.854 -14.459 1.00 176.88 ? 75  VAL C N     1 
ATOM   8507  C CA    . VAL C 1 77  ? 13.198  -30.226 -14.961 1.00 175.86 ? 75  VAL C CA    1 
ATOM   8508  C C     . VAL C 1 77  ? 13.079  -31.201 -13.785 1.00 171.00 ? 75  VAL C C     1 
ATOM   8509  O O     . VAL C 1 77  ? 13.982  -31.312 -12.955 1.00 165.32 ? 75  VAL C O     1 
ATOM   8510  C CB    . VAL C 1 77  ? 14.410  -30.566 -15.845 1.00 171.86 ? 75  VAL C CB    1 
ATOM   8511  C CG1   . VAL C 1 77  ? 14.342  -32.009 -16.278 1.00 171.53 ? 75  VAL C CG1   1 
ATOM   8512  C CG2   . VAL C 1 77  ? 14.447  -29.650 -17.063 1.00 172.35 ? 75  VAL C CG2   1 
ATOM   8513  N N     . ASP C 1 78  ? 11.969  -31.930 -13.755 1.00 173.36 ? 76  ASP C N     1 
ATOM   8514  C CA    . ASP C 1 78  ? 11.451  -32.550 -12.533 1.00 173.00 ? 76  ASP C CA    1 
ATOM   8515  C C     . ASP C 1 78  ? 12.253  -33.722 -11.970 1.00 169.45 ? 76  ASP C C     1 
ATOM   8516  O O     . ASP C 1 78  ? 11.892  -34.267 -10.925 1.00 168.14 ? 76  ASP C O     1 
ATOM   8517  C CB    . ASP C 1 78  ? 9.985   -32.967 -12.728 1.00 179.02 ? 76  ASP C CB    1 
ATOM   8518  C CG    . ASP C 1 78  ? 9.195   -32.988 -11.422 1.00 179.85 ? 76  ASP C CG    1 
ATOM   8519  O OD1   . ASP C 1 78  ? 9.726   -33.465 -10.396 1.00 174.72 ? 76  ASP C OD1   1 
ATOM   8520  O OD2   . ASP C 1 78  ? 8.034   -32.521 -11.422 1.00 183.18 ? 76  ASP C OD2   1 
ATOM   8521  N N     . PHE C 1 79  ? 13.322  -34.131 -12.645 1.00 166.23 ? 77  PHE C N     1 
ATOM   8522  C CA    . PHE C 1 79  ? 13.997  -35.353 -12.227 1.00 162.41 ? 77  PHE C CA    1 
ATOM   8523  C C     . PHE C 1 79  ? 14.406  -35.300 -10.757 1.00 155.02 ? 77  PHE C C     1 
ATOM   8524  O O     . PHE C 1 79  ? 15.203  -34.456 -10.348 1.00 149.38 ? 77  PHE C O     1 
ATOM   8525  C CB    . PHE C 1 79  ? 15.243  -35.574 -13.081 1.00 160.34 ? 77  PHE C CB    1 
ATOM   8526  C CG    . PHE C 1 79  ? 16.206  -34.418 -13.058 1.00 157.75 ? 77  PHE C CG    1 
ATOM   8527  C CD1   . PHE C 1 79  ? 15.995  -33.308 -13.856 1.00 161.05 ? 77  PHE C CD1   1 
ATOM   8528  C CD2   . PHE C 1 79  ? 17.321  -34.443 -12.240 1.00 146.15 ? 77  PHE C CD2   1 
ATOM   8529  C CE1   . PHE C 1 79  ? 16.875  -32.245 -13.839 1.00 156.01 ? 77  PHE C CE1   1 
ATOM   8530  C CE2   . PHE C 1 79  ? 18.203  -33.385 -12.221 1.00 138.13 ? 77  PHE C CE2   1 
ATOM   8531  C CZ    . PHE C 1 79  ? 17.979  -32.284 -13.023 1.00 138.94 ? 77  PHE C CZ    1 
ATOM   8532  N N     . ARG C 1 80  ? 13.865  -36.229 -9.975  1.00 153.17 ? 78  ARG C N     1 
ATOM   8533  C CA    . ARG C 1 80  ? 14.306  -36.443 -8.609  1.00 148.41 ? 78  ARG C CA    1 
ATOM   8534  C C     . ARG C 1 80  ? 15.315  -37.569 -8.624  1.00 143.73 ? 78  ARG C C     1 
ATOM   8535  O O     . ARG C 1 80  ? 16.004  -37.819 -7.634  1.00 140.87 ? 78  ARG C O     1 
ATOM   8536  C CB    . ARG C 1 80  ? 13.131  -36.850 -7.726  1.00 152.54 ? 78  ARG C CB    1 
ATOM   8537  C CG    . ARG C 1 80  ? 11.913  -35.965 -7.840  1.00 158.02 ? 78  ARG C CG    1 
ATOM   8538  C CD    . ARG C 1 80  ? 10.850  -36.419 -6.862  1.00 164.54 ? 78  ARG C CD    1 
ATOM   8539  N NE    . ARG C 1 80  ? 9.716   -35.504 -6.816  1.00 173.11 ? 78  ARG C NE    1 
ATOM   8540  C CZ    . ARG C 1 80  ? 8.720   -35.599 -5.942  1.00 177.90 ? 78  ARG C CZ    1 
ATOM   8541  N NH1   . ARG C 1 80  ? 8.724   -36.569 -5.039  1.00 177.95 ? 78  ARG C NH1   1 
ATOM   8542  N NH2   . ARG C 1 80  ? 7.724   -34.724 -5.968  1.00 180.43 ? 78  ARG C NH2   1 
ATOM   8543  N N     . GLU C 1 81  ? 15.386  -38.253 -9.762  1.00 144.08 ? 79  GLU C N     1 
ATOM   8544  C CA    . GLU C 1 81  ? 16.196  -39.457 -9.883  1.00 140.85 ? 79  GLU C CA    1 
ATOM   8545  C C     . GLU C 1 81  ? 17.667  -39.136 -10.064 1.00 134.31 ? 79  GLU C C     1 
ATOM   8546  O O     . GLU C 1 81  ? 18.512  -39.707 -9.383  1.00 132.47 ? 79  GLU C O     1 
ATOM   8547  C CB    . GLU C 1 81  ? 15.685  -40.355 -11.013 1.00 142.55 ? 79  GLU C CB    1 
ATOM   8548  C CG    . GLU C 1 81  ? 14.584  -41.322 -10.593 1.00 138.12 ? 79  GLU C CG    1 
ATOM   8549  C CD    . GLU C 1 81  ? 15.074  -42.382 -9.628  1.00 137.13 ? 79  GLU C CD    1 
ATOM   8550  O OE1   . GLU C 1 81  ? 16.096  -43.041 -9.922  1.00 135.62 ? 79  GLU C OE1   1 
ATOM   8551  O OE2   . GLU C 1 81  ? 14.437  -42.552 -8.569  1.00 138.82 ? 79  GLU C OE2   1 
ATOM   8552  N N     . LEU C 1 82  ? 17.981  -38.217 -10.970 1.00 134.14 ? 80  LEU C N     1 
ATOM   8553  C CA    . LEU C 1 82  ? 19.360  -37.788 -11.096 1.00 127.66 ? 80  LEU C CA    1 
ATOM   8554  C C     . LEU C 1 82  ? 19.805  -37.334 -9.723  1.00 126.61 ? 80  LEU C C     1 
ATOM   8555  O O     . LEU C 1 82  ? 20.902  -37.660 -9.275  1.00 122.82 ? 80  LEU C O     1 
ATOM   8556  C CB    . LEU C 1 82  ? 19.504  -36.647 -12.090 1.00 126.45 ? 80  LEU C CB    1 
ATOM   8557  C CG    . LEU C 1 82  ? 20.869  -35.963 -12.036 1.00 119.29 ? 80  LEU C CG    1 
ATOM   8558  C CD1   . LEU C 1 82  ? 22.000  -36.982 -12.093 1.00 112.81 ? 80  LEU C CD1   1 
ATOM   8559  C CD2   . LEU C 1 82  ? 20.999  -34.944 -13.153 1.00 121.40 ? 80  LEU C CD2   1 
ATOM   8560  N N     . ASN C 1 83  ? 18.935  -36.590 -9.047  1.00 129.34 ? 81  ASN C N     1 
ATOM   8561  C CA    . ASN C 1 83  ? 19.235  -36.110 -7.706  1.00 123.39 ? 81  ASN C CA    1 
ATOM   8562  C C     . ASN C 1 83  ? 19.577  -37.241 -6.753  1.00 121.11 ? 81  ASN C C     1 
ATOM   8563  O O     . ASN C 1 83  ? 20.733  -37.421 -6.387  1.00 118.71 ? 81  ASN C O     1 
ATOM   8564  C CB    . ASN C 1 83  ? 18.074  -35.286 -7.152  1.00 124.34 ? 81  ASN C CB    1 
ATOM   8565  C CG    . ASN C 1 83  ? 17.906  -33.966 -7.872  1.00 123.38 ? 81  ASN C CG    1 
ATOM   8566  O OD1   . ASN C 1 83  ? 18.779  -33.544 -8.629  1.00 118.05 ? 81  ASN C OD1   1 
ATOM   8567  N ND2   . ASN C 1 83  ? 16.785  -33.300 -7.632  1.00 127.03 ? 81  ASN C ND2   1 
ATOM   8568  N N     . LYS C 1 84  ? 18.577  -38.032 -6.390  1.00 126.17 ? 82  LYS C N     1 
ATOM   8569  C CA    . LYS C 1 84  ? 18.759  -39.062 -5.373  1.00 128.04 ? 82  LYS C CA    1 
ATOM   8570  C C     . LYS C 1 84  ? 19.936  -39.995 -5.679  1.00 121.74 ? 82  LYS C C     1 
ATOM   8571  O O     . LYS C 1 84  ? 20.485  -40.624 -4.776  1.00 119.31 ? 82  LYS C O     1 
ATOM   8572  C CB    . LYS C 1 84  ? 17.462  -39.854 -5.172  1.00 132.50 ? 82  LYS C CB    1 
ATOM   8573  C CG    . LYS C 1 84  ? 16.334  -39.040 -4.540  1.00 138.24 ? 82  LYS C CG    1 
ATOM   8574  C CD    . LYS C 1 84  ? 14.959  -39.560 -4.951  1.00 144.74 ? 82  LYS C CD    1 
ATOM   8575  C CE    . LYS C 1 84  ? 13.838  -38.755 -4.300  1.00 146.78 ? 82  LYS C CE    1 
ATOM   8576  N NZ    . LYS C 1 84  ? 13.950  -37.295 -4.580  1.00 148.02 ? 82  LYS C NZ    1 
ATOM   8577  N N     . ARG C 1 85  ? 20.319  -40.083 -6.948  1.00 120.57 ? 83  ARG C N     1 
ATOM   8578  C CA    . ARG C 1 85  ? 21.449  -40.917 -7.343  1.00 118.61 ? 83  ARG C CA    1 
ATOM   8579  C C     . ARG C 1 85  ? 22.774  -40.157 -7.283  1.00 113.87 ? 83  ARG C C     1 
ATOM   8580  O O     . ARG C 1 85  ? 23.851  -40.752 -7.355  1.00 112.80 ? 83  ARG C O     1 
ATOM   8581  C CB    . ARG C 1 85  ? 21.218  -41.500 -8.741  1.00 125.44 ? 83  ARG C CB    1 
ATOM   8582  C CG    . ARG C 1 85  ? 19.991  -42.410 -8.831  1.00 132.00 ? 83  ARG C CG    1 
ATOM   8583  C CD    . ARG C 1 85  ? 19.681  -42.846 -10.259 1.00 135.69 ? 83  ARG C CD    1 
ATOM   8584  N NE    . ARG C 1 85  ? 18.585  -43.805 -10.291 1.00 135.03 ? 83  ARG C NE    1 
ATOM   8585  C CZ    . ARG C 1 85  ? 18.747  -45.118 -10.176 1.00 136.29 ? 83  ARG C CZ    1 
ATOM   8586  N NH1   . ARG C 1 85  ? 19.964  -45.625 -10.029 1.00 133.82 ? 83  ARG C NH1   1 
ATOM   8587  N NH2   . ARG C 1 85  ? 17.695  -45.923 -10.209 1.00 137.86 ? 83  ARG C NH2   1 
ATOM   8588  N N     . THR C 1 86  ? 22.682  -38.838 -7.165  1.00 112.65 ? 84  THR C N     1 
ATOM   8589  C CA    . THR C 1 86  ? 23.857  -37.979 -7.063  1.00 105.81 ? 84  THR C CA    1 
ATOM   8590  C C     . THR C 1 86  ? 24.414  -37.929 -5.643  1.00 103.53 ? 84  THR C C     1 
ATOM   8591  O O     . THR C 1 86  ? 23.696  -38.191 -4.680  1.00 104.86 ? 84  THR C O     1 
ATOM   8592  C CB    . THR C 1 86  ? 23.547  -36.547 -7.527  1.00 104.84 ? 84  THR C CB    1 
ATOM   8593  O OG1   . THR C 1 86  ? 22.830  -36.590 -8.764  1.00 110.66 ? 84  THR C OG1   1 
ATOM   8594  C CG2   . THR C 1 86  ? 24.829  -35.753 -7.711  1.00 97.59  ? 84  THR C CG2   1 
ATOM   8595  N N     . GLN C 1 87  ? 25.693  -37.584 -5.520  1.00 99.29  ? 85  GLN C N     1 
ATOM   8596  C CA    . GLN C 1 87  ? 26.340  -37.455 -4.219  1.00 92.38  ? 85  GLN C CA    1 
ATOM   8597  C C     . GLN C 1 87  ? 25.782  -36.294 -3.417  1.00 91.52  ? 85  GLN C C     1 
ATOM   8598  O O     . GLN C 1 87  ? 25.193  -35.362 -3.966  1.00 88.48  ? 85  GLN C O     1 
ATOM   8599  C CB    . GLN C 1 87  ? 27.839  -37.232 -4.387  1.00 88.56  ? 85  GLN C CB    1 
ATOM   8600  C CG    . GLN C 1 87  ? 28.182  -35.848 -4.902  1.00 83.90  ? 85  GLN C CG    1 
ATOM   8601  C CD    . GLN C 1 87  ? 29.617  -35.454 -4.617  1.00 81.55  ? 85  GLN C CD    1 
ATOM   8602  O OE1   . GLN C 1 87  ? 30.555  -35.983 -5.213  1.00 75.31  ? 85  GLN C OE1   1 
ATOM   8603  N NE2   . GLN C 1 87  ? 29.794  -34.516 -3.695  1.00 85.26  ? 85  GLN C NE2   1 
ATOM   8604  N N     . ASP C 1 88  ? 25.969  -36.366 -2.106  1.00 90.89  ? 86  ASP C N     1 
ATOM   8605  C CA    . ASP C 1 88  ? 25.658  -35.253 -1.228  1.00 87.71  ? 86  ASP C CA    1 
ATOM   8606  C C     . ASP C 1 88  ? 26.792  -34.235 -1.259  1.00 86.73  ? 86  ASP C C     1 
ATOM   8607  O O     . ASP C 1 88  ? 27.930  -34.574 -1.588  1.00 81.04  ? 86  ASP C O     1 
ATOM   8608  C CB    . ASP C 1 88  ? 25.425  -35.739 0.198   1.00 90.03  ? 86  ASP C CB    1 
ATOM   8609  C CG    . ASP C 1 88  ? 24.362  -36.808 0.280   1.00 93.88  ? 86  ASP C CG    1 
ATOM   8610  O OD1   . ASP C 1 88  ? 23.162  -36.470 0.176   1.00 94.63  ? 86  ASP C OD1   1 
ATOM   8611  O OD2   . ASP C 1 88  ? 24.731  -37.988 0.454   1.00 93.93  ? 86  ASP C OD2   1 
ATOM   8612  N N     . PHE C 1 89  ? 26.460  -32.990 -0.921  1.00 87.07  ? 87  PHE C N     1 
ATOM   8613  C CA    . PHE C 1 89  ? 27.421  -31.894 -0.824  1.00 83.28  ? 87  PHE C CA    1 
ATOM   8614  C C     . PHE C 1 89  ? 27.343  -31.325 0.584   1.00 83.97  ? 87  PHE C C     1 
ATOM   8615  O O     . PHE C 1 89  ? 26.403  -31.621 1.309   1.00 86.94  ? 87  PHE C O     1 
ATOM   8616  C CB    . PHE C 1 89  ? 27.066  -30.799 -1.824  1.00 83.86  ? 87  PHE C CB    1 
ATOM   8617  C CG    . PHE C 1 89  ? 27.013  -31.272 -3.240  1.00 85.10  ? 87  PHE C CG    1 
ATOM   8618  C CD1   . PHE C 1 89  ? 28.136  -31.205 -4.048  1.00 82.20  ? 87  PHE C CD1   1 
ATOM   8619  C CD2   . PHE C 1 89  ? 25.844  -31.797 -3.762  1.00 86.35  ? 87  PHE C CD2   1 
ATOM   8620  C CE1   . PHE C 1 89  ? 28.094  -31.646 -5.341  1.00 80.36  ? 87  PHE C CE1   1 
ATOM   8621  C CE2   . PHE C 1 89  ? 25.798  -32.240 -5.059  1.00 86.94  ? 87  PHE C CE2   1 
ATOM   8622  C CZ    . PHE C 1 89  ? 26.924  -32.163 -5.851  1.00 83.84  ? 87  PHE C CZ    1 
ATOM   8623  N N     . TRP C 1 90  ? 28.319  -30.522 0.993   1.00 83.20  ? 88  TRP C N     1 
ATOM   8624  C CA    . TRP C 1 90  ? 28.160  -29.840 2.261   1.00 80.76  ? 88  TRP C CA    1 
ATOM   8625  C C     . TRP C 1 90  ? 27.175  -28.719 2.044   1.00 86.12  ? 88  TRP C C     1 
ATOM   8626  O O     . TRP C 1 90  ? 27.422  -27.815 1.259   1.00 90.15  ? 88  TRP C O     1 
ATOM   8627  C CB    . TRP C 1 90  ? 29.485  -29.287 2.775   1.00 81.69  ? 88  TRP C CB    1 
ATOM   8628  C CG    . TRP C 1 90  ? 29.475  -29.000 4.281   1.00 86.88  ? 88  TRP C CG    1 
ATOM   8629  C CD1   . TRP C 1 90  ? 29.961  -27.882 4.911   1.00 80.14  ? 88  TRP C CD1   1 
ATOM   8630  C CD2   . TRP C 1 90  ? 28.944  -29.847 5.325   1.00 81.77  ? 88  TRP C CD2   1 
ATOM   8631  N NE1   . TRP C 1 90  ? 29.769  -27.987 6.273   1.00 78.42  ? 88  TRP C NE1   1 
ATOM   8632  C CE2   . TRP C 1 90  ? 29.145  -29.177 6.551   1.00 77.10  ? 88  TRP C CE2   1 
ATOM   8633  C CE3   . TRP C 1 90  ? 28.312  -31.096 5.338   1.00 78.19  ? 88  TRP C CE3   1 
ATOM   8634  C CZ2   . TRP C 1 90  ? 28.736  -29.715 7.775   1.00 73.70  ? 88  TRP C CZ2   1 
ATOM   8635  C CZ3   . TRP C 1 90  ? 27.909  -31.628 6.555   1.00 77.88  ? 88  TRP C CZ3   1 
ATOM   8636  C CH2   . TRP C 1 90  ? 28.125  -30.939 7.756   1.00 73.80  ? 88  TRP C CH2   1 
ATOM   8637  N N     . GLU C 1 91  ? 26.062  -28.780 2.763   1.00 89.49  ? 89  GLU C N     1 
ATOM   8638  C CA    . GLU C 1 91  ? 25.004  -27.797 2.642   1.00 96.79  ? 89  GLU C CA    1 
ATOM   8639  C C     . GLU C 1 91  ? 25.624  -26.418 2.786   1.00 99.74  ? 89  GLU C C     1 
ATOM   8640  O O     . GLU C 1 91  ? 26.464  -26.202 3.661   1.00 96.15  ? 89  GLU C O     1 
ATOM   8641  C CB    . GLU C 1 91  ? 23.964  -28.045 3.739   1.00 104.06 ? 89  GLU C CB    1 
ATOM   8642  C CG    . GLU C 1 91  ? 23.061  -26.863 4.072   1.00 111.55 ? 89  GLU C CG    1 
ATOM   8643  C CD    . GLU C 1 91  ? 21.997  -26.612 3.018   1.00 113.32 ? 89  GLU C CD    1 
ATOM   8644  O OE1   . GLU C 1 91  ? 22.013  -27.318 1.985   1.00 114.68 ? 89  GLU C OE1   1 
ATOM   8645  O OE2   . GLU C 1 91  ? 21.149  -25.711 3.228   1.00 112.27 ? 89  GLU C OE2   1 
ATOM   8646  N N     . VAL C 1 92  ? 25.256  -25.499 1.897   1.00 102.58 ? 90  VAL C N     1 
ATOM   8647  C CA    . VAL C 1 92  ? 25.788  -24.130 1.953   1.00 108.60 ? 90  VAL C CA    1 
ATOM   8648  C C     . VAL C 1 92  ? 25.094  -23.184 2.928   1.00 109.92 ? 90  VAL C C     1 
ATOM   8649  O O     . VAL C 1 92  ? 25.755  -22.344 3.550   1.00 101.75 ? 90  VAL C O     1 
ATOM   8650  C CB    . VAL C 1 92  ? 25.795  -23.452 0.583   1.00 103.12 ? 90  VAL C CB    1 
ATOM   8651  C CG1   . VAL C 1 92  ? 26.978  -23.958 -0.243  1.00 95.69  ? 90  VAL C CG1   1 
ATOM   8652  C CG2   . VAL C 1 92  ? 24.441  -23.644 -0.110  1.00 98.54  ? 90  VAL C CG2   1 
ATOM   8653  N N     . GLN C 1 93  ? 23.769  -23.305 3.043   1.00 111.45 ? 91  GLN C N     1 
ATOM   8654  C CA    . GLN C 1 93  ? 23.031  -22.435 3.948   1.00 110.61 ? 91  GLN C CA    1 
ATOM   8655  C C     . GLN C 1 93  ? 22.882  -23.088 5.301   1.00 108.34 ? 91  GLN C C     1 
ATOM   8656  O O     . GLN C 1 93  ? 22.036  -23.959 5.521   1.00 110.64 ? 91  GLN C O     1 
ATOM   8657  C CB    . GLN C 1 93  ? 21.647  -22.104 3.391   1.00 112.31 ? 91  GLN C CB    1 
ATOM   8658  C CG    . GLN C 1 93  ? 21.691  -21.306 2.101   1.00 119.30 ? 91  GLN C CG    1 
ATOM   8659  C CD    . GLN C 1 93  ? 22.606  -20.084 2.186   1.00 122.41 ? 91  GLN C CD    1 
ATOM   8660  O OE1   . GLN C 1 93  ? 23.110  -19.603 1.166   1.00 123.91 ? 91  GLN C OE1   1 
ATOM   8661  N NE2   . GLN C 1 93  ? 22.818  -19.574 3.401   1.00 116.24 ? 91  GLN C NE2   1 
ATOM   8662  N N     . LEU C 1 94  ? 23.682  -22.578 6.222   1.00 105.52 ? 92  LEU C N     1 
ATOM   8663  C CA    . LEU C 1 94  ? 23.733  -23.069 7.577   1.00 103.79 ? 92  LEU C CA    1 
ATOM   8664  C C     . LEU C 1 94  ? 22.840  -22.153 8.388   1.00 100.65 ? 92  LEU C C     1 
ATOM   8665  O O     . LEU C 1 94  ? 22.715  -22.286 9.607   1.00 96.43  ? 92  LEU C O     1 
ATOM   8666  C CB    . LEU C 1 94  ? 25.177  -23.026 8.067   1.00 101.54 ? 92  LEU C CB    1 
ATOM   8667  C CG    . LEU C 1 94  ? 26.121  -23.766 7.112   1.00 100.94 ? 92  LEU C CG    1 
ATOM   8668  C CD1   . LEU C 1 94  ? 27.591  -23.611 7.517   1.00 89.07  ? 92  LEU C CD1   1 
ATOM   8669  C CD2   . LEU C 1 94  ? 25.719  -25.239 6.994   1.00 97.29  ? 92  LEU C CD2   1 
ATOM   8670  N N     . GLY C 1 95  ? 22.245  -21.196 7.683   1.00 99.95  ? 93  GLY C N     1 
ATOM   8671  C CA    . GLY C 1 95  ? 21.307  -20.265 8.269   1.00 90.59  ? 93  GLY C CA    1 
ATOM   8672  C C     . GLY C 1 95  ? 21.424  -18.925 7.583   1.00 83.71  ? 93  GLY C C     1 
ATOM   8673  O O     . GLY C 1 95  ? 22.224  -18.745 6.671   1.00 84.01  ? 93  GLY C O     1 
ATOM   8674  N N     . ILE C 1 96  ? 20.657  -17.964 8.072   1.00 83.29  ? 94  ILE C N     1 
ATOM   8675  C CA    . ILE C 1 96  ? 20.599  -16.641 7.482   1.00 76.70  ? 94  ILE C CA    1 
ATOM   8676  C C     . ILE C 1 96  ? 20.999  -15.622 8.537   1.00 74.67  ? 94  ILE C C     1 
ATOM   8677  O O     . ILE C 1 96  ? 20.630  -15.752 9.702   1.00 75.97  ? 94  ILE C O     1 
ATOM   8678  C CB    . ILE C 1 96  ? 19.170  -16.324 7.057   1.00 73.73  ? 94  ILE C CB    1 
ATOM   8679  C CG1   . ILE C 1 96  ? 18.556  -17.508 6.315   1.00 80.75  ? 94  ILE C CG1   1 
ATOM   8680  C CG2   . ILE C 1 96  ? 19.147  -15.128 6.189   1.00 76.76  ? 94  ILE C CG2   1 
ATOM   8681  C CD1   . ILE C 1 96  ? 17.584  -18.321 7.148   1.00 86.92  ? 94  ILE C CD1   1 
ATOM   8682  N N     . PRO C 1 97  ? 21.743  -14.590 8.137   1.00 70.04  ? 95  PRO C N     1 
ATOM   8683  C CA    . PRO C 1 97  ? 22.119  -13.524 9.070   1.00 65.94  ? 95  PRO C CA    1 
ATOM   8684  C C     . PRO C 1 97  ? 20.879  -12.786 9.569   1.00 65.94  ? 95  PRO C C     1 
ATOM   8685  O O     . PRO C 1 97  ? 19.968  -12.585 8.768   1.00 68.73  ? 95  PRO C O     1 
ATOM   8686  C CB    . PRO C 1 97  ? 22.951  -12.595 8.194   1.00 63.85  ? 95  PRO C CB    1 
ATOM   8687  C CG    . PRO C 1 97  ? 22.446  -12.832 6.830   1.00 66.12  ? 95  PRO C CG    1 
ATOM   8688  C CD    . PRO C 1 97  ? 22.149  -14.284 6.760   1.00 69.07  ? 95  PRO C CD    1 
ATOM   8689  N N     . HIS C 1 98  ? 20.824  -12.404 10.844  1.00 59.12  ? 96  HIS C N     1 
ATOM   8690  C CA    . HIS C 1 98  ? 19.687  -11.629 11.335  1.00 55.29  ? 96  HIS C CA    1 
ATOM   8691  C C     . HIS C 1 98  ? 19.973  -10.162 11.159  1.00 54.70  ? 96  HIS C C     1 
ATOM   8692  O O     . HIS C 1 98  ? 21.078  -9.709  11.445  1.00 53.21  ? 96  HIS C O     1 
ATOM   8693  C CB    . HIS C 1 98  ? 19.393  -11.907 12.810  1.00 57.69  ? 96  HIS C CB    1 
ATOM   8694  C CG    . HIS C 1 98  ? 18.016  -11.486 13.250  1.00 56.48  ? 96  HIS C CG    1 
ATOM   8695  N ND1   . HIS C 1 98  ? 17.768  -10.281 13.875  1.00 53.41  ? 96  HIS C ND1   1 
ATOM   8696  C CD2   . HIS C 1 98  ? 16.823  -12.118 13.171  1.00 54.03  ? 96  HIS C CD2   1 
ATOM   8697  C CE1   . HIS C 1 98  ? 16.481  -10.189 14.150  1.00 53.55  ? 96  HIS C CE1   1 
ATOM   8698  N NE2   . HIS C 1 98  ? 15.882  -11.289 13.736  1.00 52.59  ? 96  HIS C NE2   1 
ATOM   8699  N N     . PRO C 1 99  ? 18.965  -9.410  10.690  1.00 58.36  ? 97  PRO C N     1 
ATOM   8700  C CA    . PRO C 1 99  ? 19.111  -7.975  10.444  1.00 55.02  ? 97  PRO C CA    1 
ATOM   8701  C C     . PRO C 1 99  ? 19.714  -7.287  11.658  1.00 53.58  ? 97  PRO C C     1 
ATOM   8702  O O     . PRO C 1 99  ? 20.491  -6.356  11.510  1.00 54.63  ? 97  PRO C O     1 
ATOM   8703  C CB    . PRO C 1 99  ? 17.676  -7.523  10.232  1.00 56.18  ? 97  PRO C CB    1 
ATOM   8704  C CG    . PRO C 1 99  ? 16.989  -8.725  9.719   1.00 58.81  ? 97  PRO C CG    1 
ATOM   8705  C CD    . PRO C 1 99  ? 17.600  -9.884  10.399  1.00 56.40  ? 97  PRO C CD    1 
ATOM   8706  N N     . ALA C 1 100 ? 19.380  -7.776  12.845  1.00 51.45  ? 98  ALA C N     1 
ATOM   8707  C CA    . ALA C 1 100 ? 19.846  -7.191  14.092  1.00 50.20  ? 98  ALA C CA    1 
ATOM   8708  C C     . ALA C 1 100 ? 21.349  -7.300  14.322  1.00 51.41  ? 98  ALA C C     1 
ATOM   8709  O O     . ALA C 1 100 ? 21.875  -6.722  15.272  1.00 49.66  ? 98  ALA C O     1 
ATOM   8710  C CB    . ALA C 1 100 ? 19.111  -7.799  15.242  1.00 52.00  ? 98  ALA C CB    1 
ATOM   8711  N N     . GLY C 1 101 ? 22.039  -8.045  13.464  1.00 52.73  ? 99  GLY C N     1 
ATOM   8712  C CA    . GLY C 1 101 ? 23.462  -8.278  13.650  1.00 54.79  ? 99  GLY C CA    1 
ATOM   8713  C C     . GLY C 1 101 ? 24.389  -7.532  12.712  1.00 56.61  ? 99  GLY C C     1 
ATOM   8714  O O     . GLY C 1 101 ? 25.619  -7.685  12.793  1.00 55.41  ? 99  GLY C O     1 
ATOM   8715  N N     . LEU C 1 102 ? 23.789  -6.736  11.824  1.00 56.86  ? 100 LEU C N     1 
ATOM   8716  C CA    . LEU C 1 102 ? 24.506  -5.963  10.818  1.00 56.82  ? 100 LEU C CA    1 
ATOM   8717  C C     . LEU C 1 102 ? 25.005  -4.672  11.424  1.00 59.33  ? 100 LEU C C     1 
ATOM   8718  O O     . LEU C 1 102 ? 24.285  -4.049  12.187  1.00 63.35  ? 100 LEU C O     1 
ATOM   8719  C CB    . LEU C 1 102 ? 23.569  -5.621  9.663   1.00 59.07  ? 100 LEU C CB    1 
ATOM   8720  C CG    . LEU C 1 102 ? 22.722  -6.767  9.130   1.00 58.58  ? 100 LEU C CG    1 
ATOM   8721  C CD1   . LEU C 1 102 ? 22.020  -6.404  7.848   1.00 62.39  ? 100 LEU C CD1   1 
ATOM   8722  C CD2   . LEU C 1 102 ? 23.611  -7.949  8.914   1.00 61.88  ? 100 LEU C CD2   1 
ATOM   8723  N N     . LYS C 1 103 ? 26.231  -4.271  11.104  1.00 59.22  ? 101 LYS C N     1 
ATOM   8724  C CA    . LYS C 1 103 ? 26.722  -2.961  11.506  1.00 61.50  ? 101 LYS C CA    1 
ATOM   8725  C C     . LYS C 1 103 ? 26.066  -1.914  10.615  1.00 68.09  ? 101 LYS C C     1 
ATOM   8726  O O     . LYS C 1 103 ? 25.574  -2.241  9.534   1.00 69.04  ? 101 LYS C O     1 
ATOM   8727  C CB    . LYS C 1 103 ? 28.244  -2.877  11.402  1.00 61.87  ? 101 LYS C CB    1 
ATOM   8728  C CG    . LYS C 1 103 ? 29.004  -3.554  12.531  1.00 62.97  ? 101 LYS C CG    1 
ATOM   8729  C CD    . LYS C 1 103 ? 28.690  -5.039  12.613  1.00 65.50  ? 101 LYS C CD    1 
ATOM   8730  C CE    . LYS C 1 103 ? 29.960  -5.888  12.650  1.00 70.35  ? 101 LYS C CE    1 
ATOM   8731  N NZ    . LYS C 1 103 ? 29.663  -7.356  12.541  1.00 72.64  ? 101 LYS C NZ    1 
ATOM   8732  N N     . LYS C 1 104 ? 26.035  -0.665  11.073  1.00 73.99  ? 102 LYS C N     1 
ATOM   8733  C CA    . LYS C 1 104 ? 25.467  0.419   10.269  1.00 79.22  ? 102 LYS C CA    1 
ATOM   8734  C C     . LYS C 1 104 ? 26.439  0.882   9.196   1.00 79.84  ? 102 LYS C C     1 
ATOM   8735  O O     . LYS C 1 104 ? 27.601  1.195   9.464   1.00 78.19  ? 102 LYS C O     1 
ATOM   8736  C CB    . LYS C 1 104 ? 25.029  1.611   11.129  1.00 81.77  ? 102 LYS C CB    1 
ATOM   8737  C CG    . LYS C 1 104 ? 24.258  2.680   10.347  1.00 85.51  ? 102 LYS C CG    1 
ATOM   8738  C CD    . LYS C 1 104 ? 23.778  3.827   11.238  1.00 92.64  ? 102 LYS C CD    1 
ATOM   8739  C CE    . LYS C 1 104 ? 24.940  4.624   11.835  1.00 94.73  ? 102 LYS C CE    1 
ATOM   8740  N NZ    . LYS C 1 104 ? 24.469  5.729   12.725  1.00 93.48  ? 102 LYS C NZ    1 
ATOM   8741  N N     . LYS C 1 105 ? 25.944  0.921   7.969   1.00 84.65  ? 103 LYS C N     1 
ATOM   8742  C CA    . LYS C 1 105 ? 26.756  1.333   6.841   1.00 88.94  ? 103 LYS C CA    1 
ATOM   8743  C C     . LYS C 1 105 ? 26.198  2.626   6.235   1.00 92.18  ? 103 LYS C C     1 
ATOM   8744  O O     . LYS C 1 105 ? 24.978  2.810   6.133   1.00 90.44  ? 103 LYS C O     1 
ATOM   8745  C CB    . LYS C 1 105 ? 26.851  0.200   5.800   1.00 85.12  ? 103 LYS C CB    1 
ATOM   8746  C CG    . LYS C 1 105 ? 27.612  -1.033  6.283   1.00 77.35  ? 103 LYS C CG    1 
ATOM   8747  C CD    . LYS C 1 105 ? 28.892  -0.614  6.978   1.00 76.86  ? 103 LYS C CD    1 
ATOM   8748  C CE    . LYS C 1 105 ? 29.600  -1.782  7.600   1.00 72.35  ? 103 LYS C CE    1 
ATOM   8749  N NZ    . LYS C 1 105 ? 30.752  -1.325  8.409   1.00 70.52  ? 103 LYS C NZ    1 
ATOM   8750  N N     . LYS C 1 106 ? 27.104  3.525   5.858   1.00 94.22  ? 104 LYS C N     1 
ATOM   8751  C CA    . LYS C 1 106 ? 26.729  4.797   5.267   1.00 93.69  ? 104 LYS C CA    1 
ATOM   8752  C C     . LYS C 1 106 ? 26.012  4.545   3.964   1.00 91.50  ? 104 LYS C C     1 
ATOM   8753  O O     . LYS C 1 106 ? 24.974  5.140   3.691   1.00 88.56  ? 104 LYS C O     1 
ATOM   8754  C CB    . LYS C 1 106 ? 27.974  5.636   5.012   1.00 102.07 ? 104 LYS C CB    1 
ATOM   8755  C CG    . LYS C 1 106 ? 27.707  7.115   4.813   1.00 109.83 ? 104 LYS C CG    1 
ATOM   8756  C CD    . LYS C 1 106 ? 29.011  7.910   4.900   1.00 118.74 ? 104 LYS C CD    1 
ATOM   8757  C CE    . LYS C 1 106 ? 29.767  7.611   6.197   1.00 114.42 ? 104 LYS C CE    1 
ATOM   8758  N NZ    . LYS C 1 106 ? 31.091  8.304   6.263   1.00 120.40 ? 104 LYS C NZ    1 
ATOM   8759  N N     . SER C 1 107 ? 26.572  3.643   3.163   1.00 95.56  ? 105 SER C N     1 
ATOM   8760  C CA    . SER C 1 107 ? 25.998  3.329   1.857   1.00 96.09  ? 105 SER C CA    1 
ATOM   8761  C C     . SER C 1 107 ? 25.878  1.813   1.664   1.00 88.51  ? 105 SER C C     1 
ATOM   8762  O O     . SER C 1 107 ? 26.826  1.074   1.961   1.00 85.20  ? 105 SER C O     1 
ATOM   8763  C CB    . SER C 1 107 ? 26.850  3.948   0.729   1.00 103.18 ? 105 SER C CB    1 
ATOM   8764  O OG    . SER C 1 107 ? 27.439  5.194   1.096   1.00 105.18 ? 105 SER C OG    1 
ATOM   8765  N N     . VAL C 1 108 ? 24.716  1.365   1.173   1.00 86.47  ? 106 VAL C N     1 
ATOM   8766  C CA    . VAL C 1 108 ? 24.445  -0.061  0.942   1.00 87.38  ? 106 VAL C CA    1 
ATOM   8767  C C     . VAL C 1 108 ? 23.753  -0.391  -0.388  1.00 90.74  ? 106 VAL C C     1 
ATOM   8768  O O     . VAL C 1 108 ? 22.596  -0.015  -0.617  1.00 94.17  ? 106 VAL C O     1 
ATOM   8769  C CB    . VAL C 1 108 ? 23.604  -0.666  2.088   1.00 89.34  ? 106 VAL C CB    1 
ATOM   8770  C CG1   . VAL C 1 108 ? 22.913  -1.950  1.632   1.00 87.59  ? 106 VAL C CG1   1 
ATOM   8771  C CG2   . VAL C 1 108 ? 24.471  -0.914  3.317   1.00 84.55  ? 106 VAL C CG2   1 
ATOM   8772  N N     . THR C 1 109 ? 24.457  -1.160  -1.220  1.00 91.77  ? 107 THR C N     1 
ATOM   8773  C CA    . THR C 1 109 ? 24.069  -1.472  -2.601  1.00 99.06  ? 107 THR C CA    1 
ATOM   8774  C C     . THR C 1 109 ? 23.706  -2.946  -2.837  1.00 92.35  ? 107 THR C C     1 
ATOM   8775  O O     . THR C 1 109 ? 24.224  -3.831  -2.169  1.00 83.81  ? 107 THR C O     1 
ATOM   8776  C CB    . THR C 1 109 ? 25.222  -1.128  -3.573  1.00 97.52  ? 107 THR C CB    1 
ATOM   8777  O OG1   . THR C 1 109 ? 25.868  0.087   -3.162  1.00 93.23  ? 107 THR C OG1   1 
ATOM   8778  C CG2   . THR C 1 109 ? 24.704  -0.992  -4.999  1.00 104.67 ? 107 THR C CG2   1 
ATOM   8779  N N     . VAL C 1 110 ? 22.832  -3.201  -3.806  1.00 97.17  ? 108 VAL C N     1 
ATOM   8780  C CA    . VAL C 1 110 ? 22.477  -4.569  -4.179  1.00 93.55  ? 108 VAL C CA    1 
ATOM   8781  C C     . VAL C 1 110 ? 22.675  -4.852  -5.663  1.00 102.33 ? 108 VAL C C     1 
ATOM   8782  O O     . VAL C 1 110 ? 21.971  -4.287  -6.497  1.00 113.28 ? 108 VAL C O     1 
ATOM   8783  C CB    . VAL C 1 110 ? 21.017  -4.848  -3.882  1.00 91.90  ? 108 VAL C CB    1 
ATOM   8784  C CG1   . VAL C 1 110 ? 20.628  -6.215  -4.397  1.00 88.09  ? 108 VAL C CG1   1 
ATOM   8785  C CG2   . VAL C 1 110 ? 20.779  -4.747  -2.410  1.00 98.73  ? 108 VAL C CG2   1 
ATOM   8786  N N     . LEU C 1 111 ? 23.611  -5.742  -5.992  1.00 98.31  ? 109 LEU C N     1 
ATOM   8787  C CA    . LEU C 1 111 ? 23.835  -6.149  -7.381  1.00 94.91  ? 109 LEU C CA    1 
ATOM   8788  C C     . LEU C 1 111 ? 23.312  -7.566  -7.597  1.00 96.17  ? 109 LEU C C     1 
ATOM   8789  O O     . LEU C 1 111 ? 23.658  -8.480  -6.850  1.00 98.49  ? 109 LEU C O     1 
ATOM   8790  C CB    . LEU C 1 111 ? 25.323  -6.122  -7.707  1.00 94.48  ? 109 LEU C CB    1 
ATOM   8791  C CG    . LEU C 1 111 ? 26.158  -4.936  -7.235  1.00 96.31  ? 109 LEU C CG    1 
ATOM   8792  C CD1   . LEU C 1 111 ? 27.644  -5.254  -7.361  1.00 89.88  ? 109 LEU C CD1   1 
ATOM   8793  C CD2   . LEU C 1 111 ? 25.795  -3.693  -8.017  1.00 105.66 ? 109 LEU C CD2   1 
ATOM   8794  N N     . ASP C 1 112 ? 22.484  -7.765  -8.612  1.00 97.98  ? 110 ASP C N     1 
ATOM   8795  C CA    . ASP C 1 112 ? 21.946  -9.095  -8.864  1.00 100.81 ? 110 ASP C CA    1 
ATOM   8796  C C     . ASP C 1 112 ? 22.702  -9.784  -9.991  1.00 105.02 ? 110 ASP C C     1 
ATOM   8797  O O     . ASP C 1 112 ? 22.842  -9.226  -11.073 1.00 112.07 ? 110 ASP C O     1 
ATOM   8798  C CB    . ASP C 1 112 ? 20.463  -9.011  -9.212  1.00 104.94 ? 110 ASP C CB    1 
ATOM   8799  C CG    . ASP C 1 112 ? 19.817  -10.377 -9.322  1.00 111.46 ? 110 ASP C CG    1 
ATOM   8800  O OD1   . ASP C 1 112 ? 19.128  -10.792 -8.363  1.00 112.94 ? 110 ASP C OD1   1 
ATOM   8801  O OD2   . ASP C 1 112 ? 20.005  -11.044 -10.363 1.00 115.24 ? 110 ASP C OD2   1 
ATOM   8802  N N     . VAL C 1 113 ? 23.192  -10.994 -9.751  1.00 102.90 ? 111 VAL C N     1 
ATOM   8803  C CA    . VAL C 1 113 ? 23.889  -11.719 -10.807 1.00 102.63 ? 111 VAL C CA    1 
ATOM   8804  C C     . VAL C 1 113 ? 22.912  -12.308 -11.817 1.00 104.07 ? 111 VAL C C     1 
ATOM   8805  O O     . VAL C 1 113 ? 22.014  -13.068 -11.461 1.00 102.76 ? 111 VAL C O     1 
ATOM   8806  C CB    . VAL C 1 113 ? 24.780  -12.835 -10.257 1.00 101.71 ? 111 VAL C CB    1 
ATOM   8807  C CG1   . VAL C 1 113 ? 25.137  -13.805 -11.369 1.00 100.78 ? 111 VAL C CG1   1 
ATOM   8808  C CG2   . VAL C 1 113 ? 26.034  -12.250 -9.627  1.00 98.90  ? 111 VAL C CG2   1 
ATOM   8809  N N     . GLY C 1 114 ? 23.090  -11.933 -13.079 1.00 108.38 ? 112 GLY C N     1 
ATOM   8810  C CA    . GLY C 1 114 ? 22.237  -12.405 -14.153 1.00 105.51 ? 112 GLY C CA    1 
ATOM   8811  C C     . GLY C 1 114 ? 22.662  -13.741 -14.722 1.00 103.74 ? 112 GLY C C     1 
ATOM   8812  O O     . GLY C 1 114 ? 23.859  -14.016 -14.860 1.00 101.77 ? 112 GLY C O     1 
ATOM   8813  N N     . ASP C 1 115 ? 21.669  -14.555 -15.078 1.00 105.06 ? 113 ASP C N     1 
ATOM   8814  C CA    . ASP C 1 115 ? 21.903  -15.916 -15.552 1.00 108.10 ? 113 ASP C CA    1 
ATOM   8815  C C     . ASP C 1 115 ? 22.927  -16.589 -14.653 1.00 105.67 ? 113 ASP C C     1 
ATOM   8816  O O     . ASP C 1 115 ? 23.920  -17.152 -15.123 1.00 105.30 ? 113 ASP C O     1 
ATOM   8817  C CB    . ASP C 1 115 ? 22.344  -15.935 -17.017 1.00 114.04 ? 113 ASP C CB    1 
ATOM   8818  C CG    . ASP C 1 115 ? 21.218  -16.344 -17.957 1.00 119.40 ? 113 ASP C CG    1 
ATOM   8819  O OD1   . ASP C 1 115 ? 20.334  -17.119 -17.522 1.00 115.66 ? 113 ASP C OD1   1 
ATOM   8820  O OD2   . ASP C 1 115 ? 21.219  -15.892 -19.124 1.00 122.86 ? 113 ASP C OD2   1 
ATOM   8821  N N     . ALA C 1 116 ? 22.664  -16.509 -13.351 1.00 103.80 ? 114 ALA C N     1 
ATOM   8822  C CA    . ALA C 1 116 ? 23.630  -16.852 -12.315 1.00 96.64  ? 114 ALA C CA    1 
ATOM   8823  C C     . ALA C 1 116 ? 24.140  -18.289 -12.382 1.00 94.60  ? 114 ALA C C     1 
ATOM   8824  O O     . ALA C 1 116 ? 25.348  -18.515 -12.399 1.00 90.60  ? 114 ALA C O     1 
ATOM   8825  C CB    . ALA C 1 116 ? 23.045  -16.558 -10.958 1.00 97.88  ? 114 ALA C CB    1 
ATOM   8826  N N     . TYR C 1 117 ? 23.227  -19.256 -12.415 1.00 96.15  ? 115 TYR C N     1 
ATOM   8827  C CA    . TYR C 1 117 ? 23.620  -20.660 -12.499 1.00 95.12  ? 115 TYR C CA    1 
ATOM   8828  C C     . TYR C 1 117 ? 24.213  -20.996 -13.861 1.00 95.61  ? 115 TYR C C     1 
ATOM   8829  O O     . TYR C 1 117 ? 25.141  -21.802 -13.960 1.00 92.94  ? 115 TYR C O     1 
ATOM   8830  C CB    . TYR C 1 117 ? 22.440  -21.595 -12.216 1.00 96.88  ? 115 TYR C CB    1 
ATOM   8831  C CG    . TYR C 1 117 ? 22.076  -21.749 -10.751 1.00 95.15  ? 115 TYR C CG    1 
ATOM   8832  C CD1   . TYR C 1 117 ? 22.859  -21.191 -9.745  1.00 89.53  ? 115 TYR C CD1   1 
ATOM   8833  C CD2   . TYR C 1 117 ? 20.947  -22.466 -10.378 1.00 99.67  ? 115 TYR C CD2   1 
ATOM   8834  C CE1   . TYR C 1 117 ? 22.515  -21.337 -8.411  1.00 86.17  ? 115 TYR C CE1   1 
ATOM   8835  C CE2   . TYR C 1 117 ? 20.596  -22.616 -9.052  1.00 95.33  ? 115 TYR C CE2   1 
ATOM   8836  C CZ    . TYR C 1 117 ? 21.379  -22.051 -8.073  1.00 88.71  ? 115 TYR C CZ    1 
ATOM   8837  O OH    . TYR C 1 117 ? 21.008  -22.210 -6.757  1.00 87.84  ? 115 TYR C OH    1 
ATOM   8838  N N     . PHE C 1 118 ? 23.680  -20.378 -14.910 1.00 99.05  ? 116 PHE C N     1 
ATOM   8839  C CA    . PHE C 1 118 ? 24.113  -20.694 -16.263 1.00 96.00  ? 116 PHE C CA    1 
ATOM   8840  C C     . PHE C 1 118 ? 25.375  -19.947 -16.615 1.00 91.04  ? 116 PHE C C     1 
ATOM   8841  O O     . PHE C 1 118 ? 25.894  -20.108 -17.706 1.00 93.83  ? 116 PHE C O     1 
ATOM   8842  C CB    . PHE C 1 118 ? 23.018  -20.383 -17.272 1.00 105.27 ? 116 PHE C CB    1 
ATOM   8843  C CG    . PHE C 1 118 ? 21.686  -20.949 -16.897 1.00 109.42 ? 116 PHE C CG    1 
ATOM   8844  C CD1   . PHE C 1 118 ? 21.318  -22.219 -17.314 1.00 108.52 ? 116 PHE C CD1   1 
ATOM   8845  C CD2   . PHE C 1 118 ? 20.805  -20.216 -16.109 1.00 110.44 ? 116 PHE C CD2   1 
ATOM   8846  C CE1   . PHE C 1 118 ? 20.089  -22.747 -16.965 1.00 112.51 ? 116 PHE C CE1   1 
ATOM   8847  C CE2   . PHE C 1 118 ? 19.574  -20.735 -15.755 1.00 115.51 ? 116 PHE C CE2   1 
ATOM   8848  C CZ    . PHE C 1 118 ? 19.214  -22.003 -16.183 1.00 118.46 ? 116 PHE C CZ    1 
ATOM   8849  N N     . SER C 1 119 ? 25.860  -19.127 -15.686 1.00 92.10  ? 117 SER C N     1 
ATOM   8850  C CA    . SER C 1 119 ? 27.186  -18.515 -15.796 1.00 90.88  ? 117 SER C CA    1 
ATOM   8851  C C     . SER C 1 119 ? 28.277  -19.462 -15.260 1.00 82.88  ? 117 SER C C     1 
ATOM   8852  O O     . SER C 1 119 ? 29.464  -19.139 -15.307 1.00 75.36  ? 117 SER C O     1 
ATOM   8853  C CB    . SER C 1 119 ? 27.243  -17.173 -15.043 1.00 88.61  ? 117 SER C CB    1 
ATOM   8854  O OG    . SER C 1 119 ? 26.452  -16.170 -15.659 1.00 86.73  ? 117 SER C OG    1 
ATOM   8855  N N     . VAL C 1 120 ? 27.865  -20.623 -14.750 1.00 82.36  ? 118 VAL C N     1 
ATOM   8856  C CA    . VAL C 1 120 ? 28.783  -21.555 -14.085 1.00 80.37  ? 118 VAL C CA    1 
ATOM   8857  C C     . VAL C 1 120 ? 28.959  -22.912 -14.775 1.00 77.10  ? 118 VAL C C     1 
ATOM   8858  O O     . VAL C 1 120 ? 28.012  -23.688 -14.910 1.00 76.91  ? 118 VAL C O     1 
ATOM   8859  C CB    . VAL C 1 120 ? 28.434  -21.750 -12.574 1.00 83.31  ? 118 VAL C CB    1 
ATOM   8860  C CG1   . VAL C 1 120 ? 28.875  -23.103 -12.084 1.00 82.67  ? 118 VAL C CG1   1 
ATOM   8861  C CG2   . VAL C 1 120 ? 29.095  -20.672 -11.726 1.00 81.02  ? 118 VAL C CG2   1 
ATOM   8862  N N     . PRO C 1 121 ? 30.198  -23.199 -15.187 1.00 72.87  ? 119 PRO C N     1 
ATOM   8863  C CA    . PRO C 1 121 ? 30.633  -24.411 -15.874 1.00 73.79  ? 119 PRO C CA    1 
ATOM   8864  C C     . PRO C 1 121 ? 30.308  -25.644 -15.073 1.00 75.18  ? 119 PRO C C     1 
ATOM   8865  O O     . PRO C 1 121 ? 30.658  -25.660 -13.917 1.00 81.67  ? 119 PRO C O     1 
ATOM   8866  C CB    . PRO C 1 121 ? 32.153  -24.252 -15.901 1.00 69.69  ? 119 PRO C CB    1 
ATOM   8867  C CG    . PRO C 1 121 ? 32.471  -23.268 -14.873 1.00 65.82  ? 119 PRO C CG    1 
ATOM   8868  C CD    . PRO C 1 121 ? 31.335  -22.335 -14.849 1.00 68.83  ? 119 PRO C CD    1 
ATOM   8869  N N     . LEU C 1 122 ? 29.693  -26.661 -15.662 1.00 77.94  ? 120 LEU C N     1 
ATOM   8870  C CA    . LEU C 1 122 ? 29.486  -27.924 -14.956 1.00 77.97  ? 120 LEU C CA    1 
ATOM   8871  C C     . LEU C 1 122 ? 30.779  -28.738 -14.919 1.00 80.09  ? 120 LEU C C     1 
ATOM   8872  O O     . LEU C 1 122 ? 31.855  -28.235 -15.228 1.00 80.50  ? 120 LEU C O     1 
ATOM   8873  C CB    . LEU C 1 122 ? 28.345  -28.730 -15.576 1.00 81.44  ? 120 LEU C CB    1 
ATOM   8874  C CG    . LEU C 1 122 ? 27.978  -30.092 -14.981 1.00 82.03  ? 120 LEU C CG    1 
ATOM   8875  C CD1   . LEU C 1 122 ? 27.810  -29.985 -13.492 1.00 87.56  ? 120 LEU C CD1   1 
ATOM   8876  C CD2   . LEU C 1 122 ? 26.716  -30.643 -15.604 1.00 84.75  ? 120 LEU C CD2   1 
ATOM   8877  N N     . ASP C 1 123 ? 30.688  -29.988 -14.491 1.00 83.71  ? 121 ASP C N     1 
ATOM   8878  C CA    . ASP C 1 123 ? 31.868  -30.836 -14.436 1.00 88.74  ? 121 ASP C CA    1 
ATOM   8879  C C     . ASP C 1 123 ? 32.016  -31.631 -15.726 1.00 91.79  ? 121 ASP C C     1 
ATOM   8880  O O     . ASP C 1 123 ? 31.064  -32.287 -16.169 1.00 89.88  ? 121 ASP C O     1 
ATOM   8881  C CB    . ASP C 1 123 ? 31.782  -31.801 -13.255 1.00 87.09  ? 121 ASP C CB    1 
ATOM   8882  C CG    . ASP C 1 123 ? 33.052  -32.622 -13.081 1.00 84.53  ? 121 ASP C CG    1 
ATOM   8883  O OD1   . ASP C 1 123 ? 34.158  -32.029 -13.171 1.00 79.44  ? 121 ASP C OD1   1 
ATOM   8884  O OD2   . ASP C 1 123 ? 32.940  -33.853 -12.860 1.00 80.68  ? 121 ASP C OD2   1 
ATOM   8885  N N     . GLU C 1 124 ? 33.213  -31.608 -16.308 1.00 90.30  ? 122 GLU C N     1 
ATOM   8886  C CA    . GLU C 1 124 ? 33.420  -32.302 -17.563 1.00 92.08  ? 122 GLU C CA    1 
ATOM   8887  C C     . GLU C 1 124 ? 32.735  -33.641 -17.419 1.00 91.87  ? 122 GLU C C     1 
ATOM   8888  O O     . GLU C 1 124 ? 31.660  -33.874 -17.970 1.00 91.92  ? 122 GLU C O     1 
ATOM   8889  C CB    . GLU C 1 124 ? 34.912  -32.549 -17.817 1.00 97.64  ? 122 GLU C CB    1 
ATOM   8890  C CG    . GLU C 1 124 ? 35.804  -31.327 -17.681 1.00 102.74 ? 122 GLU C CG    1 
ATOM   8891  C CD    . GLU C 1 124 ? 36.205  -31.051 -16.239 1.00 96.70  ? 122 GLU C CD    1 
ATOM   8892  O OE1   . GLU C 1 124 ? 36.280  -32.023 -15.457 1.00 95.60  ? 122 GLU C OE1   1 
ATOM   8893  O OE2   . GLU C 1 124 ? 36.438  -29.869 -15.893 1.00 95.08  ? 122 GLU C OE2   1 
ATOM   8894  N N     . ASP C 1 125 ? 33.333  -34.487 -16.594 1.00 89.41  ? 123 ASP C N     1 
ATOM   8895  C CA    . ASP C 1 125 ? 32.951  -35.884 -16.500 1.00 91.70  ? 123 ASP C CA    1 
ATOM   8896  C C     . ASP C 1 125 ? 31.531  -36.146 -15.996 1.00 92.07  ? 123 ASP C C     1 
ATOM   8897  O O     . ASP C 1 125 ? 31.012  -37.252 -16.137 1.00 94.28  ? 123 ASP C O     1 
ATOM   8898  C CB    . ASP C 1 125 ? 33.978  -36.595 -15.640 1.00 89.16  ? 123 ASP C CB    1 
ATOM   8899  C CG    . ASP C 1 125 ? 35.378  -36.126 -15.944 1.00 92.99  ? 123 ASP C CG    1 
ATOM   8900  O OD1   . ASP C 1 125 ? 35.921  -35.290 -15.188 1.00 87.13  ? 123 ASP C OD1   1 
ATOM   8901  O OD2   . ASP C 1 125 ? 35.922  -36.571 -16.972 1.00 101.83 ? 123 ASP C OD2   1 
ATOM   8902  N N     . PHE C 1 126 ? 30.899  -35.147 -15.399 1.00 90.21  ? 124 PHE C N     1 
ATOM   8903  C CA    . PHE C 1 126 ? 29.563  -35.374 -14.878 1.00 92.51  ? 124 PHE C CA    1 
ATOM   8904  C C     . PHE C 1 126 ? 28.470  -35.029 -15.881 1.00 98.08  ? 124 PHE C C     1 
ATOM   8905  O O     . PHE C 1 126 ? 27.317  -35.427 -15.707 1.00 99.49  ? 124 PHE C O     1 
ATOM   8906  C CB    . PHE C 1 126 ? 29.345  -34.614 -13.566 1.00 90.19  ? 124 PHE C CB    1 
ATOM   8907  C CG    . PHE C 1 126 ? 28.120  -35.050 -12.818 1.00 86.98  ? 124 PHE C CG    1 
ATOM   8908  C CD1   . PHE C 1 126 ? 28.193  -36.058 -11.879 1.00 83.06  ? 124 PHE C CD1   1 
ATOM   8909  C CD2   . PHE C 1 126 ? 26.891  -34.463 -13.065 1.00 90.69  ? 124 PHE C CD2   1 
ATOM   8910  C CE1   . PHE C 1 126 ? 27.066  -36.470 -11.201 1.00 88.62  ? 124 PHE C CE1   1 
ATOM   8911  C CE2   . PHE C 1 126 ? 25.755  -34.875 -12.386 1.00 94.34  ? 124 PHE C CE2   1 
ATOM   8912  C CZ    . PHE C 1 126 ? 25.844  -35.877 -11.454 1.00 91.42  ? 124 PHE C CZ    1 
ATOM   8913  N N     . ARG C 1 127 ? 28.838  -34.324 -16.948 1.00 99.48  ? 125 ARG C N     1 
ATOM   8914  C CA    . ARG C 1 127 ? 27.840  -33.764 -17.867 1.00 101.77 ? 125 ARG C CA    1 
ATOM   8915  C C     . ARG C 1 127 ? 26.814  -34.794 -18.352 1.00 104.97 ? 125 ARG C C     1 
ATOM   8916  O O     . ARG C 1 127 ? 25.627  -34.490 -18.501 1.00 103.56 ? 125 ARG C O     1 
ATOM   8917  C CB    . ARG C 1 127 ? 28.528  -33.056 -19.046 1.00 96.20  ? 125 ARG C CB    1 
ATOM   8918  C CG    . ARG C 1 127 ? 28.834  -31.577 -18.790 1.00 91.79  ? 125 ARG C CG    1 
ATOM   8919  C CD    . ARG C 1 127 ? 30.114  -31.090 -19.455 1.00 91.72  ? 125 ARG C CD    1 
ATOM   8920  N NE    . ARG C 1 127 ? 30.277  -29.639 -19.346 1.00 86.90  ? 125 ARG C NE    1 
ATOM   8921  C CZ    . ARG C 1 127 ? 31.418  -28.993 -19.572 1.00 87.75  ? 125 ARG C CZ    1 
ATOM   8922  N NH1   . ARG C 1 127 ? 32.511  -29.665 -19.914 1.00 89.96  ? 125 ARG C NH1   1 
ATOM   8923  N NH2   . ARG C 1 127 ? 31.472  -27.676 -19.450 1.00 84.88  ? 125 ARG C NH2   1 
ATOM   8924  N N     . LYS C 1 128 ? 27.280  -36.024 -18.535 1.00 107.23 ? 126 LYS C N     1 
ATOM   8925  C CA    . LYS C 1 128 ? 26.512  -37.051 -19.232 1.00 111.95 ? 126 LYS C CA    1 
ATOM   8926  C C     . LYS C 1 128 ? 25.220  -37.545 -18.582 1.00 118.69 ? 126 LYS C C     1 
ATOM   8927  O O     . LYS C 1 128 ? 24.490  -38.304 -19.204 1.00 129.64 ? 126 LYS C O     1 
ATOM   8928  C CB    . LYS C 1 128 ? 27.400  -38.248 -19.622 1.00 113.05 ? 126 LYS C CB    1 
ATOM   8929  C CG    . LYS C 1 128 ? 28.283  -38.816 -18.526 1.00 110.50 ? 126 LYS C CG    1 
ATOM   8930  C CD    . LYS C 1 128 ? 29.011  -40.064 -19.026 1.00 115.12 ? 126 LYS C CD    1 
ATOM   8931  C CE    . LYS C 1 128 ? 30.156  -40.489 -18.111 1.00 110.54 ? 126 LYS C CE    1 
ATOM   8932  N NZ    . LYS C 1 128 ? 31.315  -39.558 -18.173 1.00 103.68 ? 126 LYS C NZ    1 
ATOM   8933  N N     . TYR C 1 129 ? 24.923  -37.147 -17.353 1.00 115.73 ? 127 TYR C N     1 
ATOM   8934  C CA    . TYR C 1 129 ? 23.760  -37.724 -16.675 1.00 120.53 ? 127 TYR C CA    1 
ATOM   8935  C C     . TYR C 1 129 ? 22.505  -36.877 -16.836 1.00 121.56 ? 127 TYR C C     1 
ATOM   8936  O O     . TYR C 1 129 ? 21.466  -37.144 -16.234 1.00 120.47 ? 127 TYR C O     1 
ATOM   8937  C CB    . TYR C 1 129 ? 24.078  -38.050 -15.216 1.00 116.54 ? 127 TYR C CB    1 
ATOM   8938  C CG    . TYR C 1 129 ? 25.293  -38.943 -15.084 1.00 111.82 ? 127 TYR C CG    1 
ATOM   8939  C CD1   . TYR C 1 129 ? 25.163  -40.309 -14.882 1.00 115.87 ? 127 TYR C CD1   1 
ATOM   8940  C CD2   . TYR C 1 129 ? 26.572  -38.416 -15.195 1.00 106.53 ? 127 TYR C CD2   1 
ATOM   8941  C CE1   . TYR C 1 129 ? 26.275  -41.118 -14.775 1.00 116.97 ? 127 TYR C CE1   1 
ATOM   8942  C CE2   . TYR C 1 129 ? 27.687  -39.215 -15.088 1.00 107.01 ? 127 TYR C CE2   1 
ATOM   8943  C CZ    . TYR C 1 129 ? 27.537  -40.563 -14.879 1.00 112.65 ? 127 TYR C CZ    1 
ATOM   8944  O OH    . TYR C 1 129 ? 28.663  -41.348 -14.775 1.00 110.50 ? 127 TYR C OH    1 
ATOM   8945  N N     . THR C 1 130 ? 22.628  -35.857 -17.673 1.00 123.25 ? 128 THR C N     1 
ATOM   8946  C CA    . THR C 1 130 ? 21.634  -34.799 -17.781 1.00 131.32 ? 128 THR C CA    1 
ATOM   8947  C C     . THR C 1 130 ? 20.555  -34.903 -18.894 1.00 147.40 ? 128 THR C C     1 
ATOM   8948  O O     . THR C 1 130 ? 19.744  -33.989 -19.039 1.00 152.89 ? 128 THR C O     1 
ATOM   8949  C CB    . THR C 1 130 ? 22.356  -33.443 -17.885 1.00 122.20 ? 128 THR C CB    1 
ATOM   8950  O OG1   . THR C 1 130 ? 23.415  -33.551 -18.840 1.00 122.94 ? 128 THR C OG1   1 
ATOM   8951  C CG2   . THR C 1 130 ? 22.972  -33.081 -16.557 1.00 120.85 ? 128 THR C CG2   1 
ATOM   8952  N N     . ALA C 1 131 ? 20.531  -35.992 -19.666 1.00 150.63 ? 129 ALA C N     1 
ATOM   8953  C CA    . ALA C 1 131 ? 19.613  -36.114 -20.820 1.00 159.14 ? 129 ALA C CA    1 
ATOM   8954  C C     . ALA C 1 131 ? 18.104  -36.165 -20.484 1.00 167.32 ? 129 ALA C C     1 
ATOM   8955  O O     . ALA C 1 131 ? 17.713  -36.670 -19.425 1.00 165.81 ? 129 ALA C O     1 
ATOM   8956  C CB    . ALA C 1 131 ? 20.006  -37.318 -21.678 1.00 160.49 ? 129 ALA C CB    1 
ATOM   8957  N N     . PHE C 1 132 ? 17.262  -35.647 -21.387 1.00 169.41 ? 130 PHE C N     1 
ATOM   8958  C CA    . PHE C 1 132 ? 15.802  -35.721 -21.195 1.00 175.19 ? 130 PHE C CA    1 
ATOM   8959  C C     . PHE C 1 132 ? 14.928  -35.649 -22.467 1.00 179.06 ? 130 PHE C C     1 
ATOM   8960  O O     . PHE C 1 132 ? 15.444  -35.493 -23.576 1.00 176.04 ? 130 PHE C O     1 
ATOM   8961  C CB    . PHE C 1 132 ? 15.338  -34.717 -20.124 1.00 175.38 ? 130 PHE C CB    1 
ATOM   8962  C CG    . PHE C 1 132 ? 14.690  -33.465 -20.668 1.00 177.58 ? 130 PHE C CG    1 
ATOM   8963  C CD1   . PHE C 1 132 ? 13.633  -32.877 -19.985 1.00 179.08 ? 130 PHE C CD1   1 
ATOM   8964  C CD2   . PHE C 1 132 ? 15.147  -32.860 -21.826 1.00 175.28 ? 130 PHE C CD2   1 
ATOM   8965  C CE1   . PHE C 1 132 ? 13.035  -31.726 -20.456 1.00 180.91 ? 130 PHE C CE1   1 
ATOM   8966  C CE2   . PHE C 1 132 ? 14.549  -31.706 -22.303 1.00 176.02 ? 130 PHE C CE2   1 
ATOM   8967  C CZ    . PHE C 1 132 ? 13.492  -31.139 -21.616 1.00 179.78 ? 130 PHE C CZ    1 
ATOM   8968  N N     . THR C 1 133 ? 13.608  -35.773 -22.286 1.00 182.48 ? 131 THR C N     1 
ATOM   8969  C CA    . THR C 1 133 ? 12.661  -35.887 -23.407 1.00 184.75 ? 131 THR C CA    1 
ATOM   8970  C C     . THR C 1 133 ? 11.359  -35.068 -23.277 1.00 186.99 ? 131 THR C C     1 
ATOM   8971  O O     . THR C 1 133 ? 10.576  -35.288 -22.345 1.00 185.71 ? 131 THR C O     1 
ATOM   8972  C CB    . THR C 1 133 ? 12.252  -37.366 -23.634 1.00 184.47 ? 131 THR C CB    1 
ATOM   8973  O OG1   . THR C 1 133 ? 11.372  -37.794 -22.584 1.00 181.73 ? 131 THR C OG1   1 
ATOM   8974  C CG2   . THR C 1 133 ? 13.482  -38.272 -23.679 1.00 180.67 ? 131 THR C CG2   1 
ATOM   8975  N N     . ILE C 1 134 ? 11.131  -34.142 -24.217 1.00 190.24 ? 132 ILE C N     1 
ATOM   8976  C CA    . ILE C 1 134 ? 9.831   -33.457 -24.370 1.00 193.35 ? 132 ILE C CA    1 
ATOM   8977  C C     . ILE C 1 134 ? 9.481   -33.082 -25.831 1.00 193.75 ? 132 ILE C C     1 
ATOM   8978  O O     . ILE C 1 134 ? 10.376  -32.793 -26.634 1.00 190.71 ? 132 ILE C O     1 
ATOM   8979  C CB    . ILE C 1 134 ? 9.712   -32.177 -23.478 1.00 192.36 ? 132 ILE C CB    1 
ATOM   8980  C CG1   . ILE C 1 134 ? 10.523  -31.013 -24.065 1.00 190.32 ? 132 ILE C CG1   1 
ATOM   8981  C CG2   . ILE C 1 134 ? 10.099  -32.471 -22.028 1.00 189.23 ? 132 ILE C CG2   1 
ATOM   8982  C CD1   . ILE C 1 134 ? 10.273  -29.676 -23.376 1.00 186.25 ? 132 ILE C CD1   1 
ATOM   8983  N N     . PRO C 1 135 ? 8.175   -33.112 -26.180 1.00 195.70 ? 133 PRO C N     1 
ATOM   8984  C CA    . PRO C 1 135 ? 7.603   -32.564 -27.424 1.00 196.08 ? 133 PRO C CA    1 
ATOM   8985  C C     . PRO C 1 135 ? 7.370   -31.045 -27.365 1.00 194.51 ? 133 PRO C C     1 
ATOM   8986  O O     . PRO C 1 135 ? 7.231   -30.498 -26.269 1.00 194.08 ? 133 PRO C O     1 
ATOM   8987  C CB    . PRO C 1 135 ? 6.259   -33.289 -27.533 1.00 193.96 ? 133 PRO C CB    1 
ATOM   8988  C CG    . PRO C 1 135 ? 5.864   -33.526 -26.117 1.00 192.74 ? 133 PRO C CG    1 
ATOM   8989  C CD    . PRO C 1 135 ? 7.151   -33.803 -25.371 1.00 192.90 ? 133 PRO C CD    1 
ATOM   8990  N N     . SER C 1 136 ? 7.309   -30.376 -28.516 1.00 191.31 ? 134 SER C N     1 
ATOM   8991  C CA    . SER C 1 136 ? 7.029   -28.941 -28.524 1.00 189.13 ? 134 SER C CA    1 
ATOM   8992  C C     . SER C 1 136 ? 5.655   -28.671 -27.921 1.00 189.47 ? 134 SER C C     1 
ATOM   8993  O O     . SER C 1 136 ? 5.528   -27.967 -26.917 1.00 187.84 ? 134 SER C O     1 
ATOM   8994  C CB    . SER C 1 136 ? 7.092   -28.381 -29.948 1.00 184.73 ? 134 SER C CB    1 
ATOM   8995  O OG    . SER C 1 136 ? 8.430   -28.177 -30.362 1.00 179.77 ? 134 SER C OG    1 
ATOM   8996  N N     . ILE C 1 137 ? 4.628   -29.228 -28.550 1.00 188.54 ? 135 ILE C N     1 
ATOM   8997  C CA    . ILE C 1 137 ? 3.271   -29.177 -28.021 1.00 186.95 ? 135 ILE C CA    1 
ATOM   8998  C C     . ILE C 1 137 ? 2.574   -30.545 -28.068 1.00 187.63 ? 135 ILE C C     1 
ATOM   8999  O O     . ILE C 1 137 ? 2.190   -31.093 -27.035 1.00 185.24 ? 135 ILE C O     1 
ATOM   9000  C CB    . ILE C 1 137 ? 2.423   -28.061 -28.683 1.00 186.41 ? 135 ILE C CB    1 
ATOM   9001  C CG1   . ILE C 1 137 ? 1.051   -27.959 -28.011 1.00 184.68 ? 135 ILE C CG1   1 
ATOM   9002  C CG2   . ILE C 1 137 ? 2.310   -28.277 -30.185 1.00 185.83 ? 135 ILE C CG2   1 
ATOM   9003  C CD1   . ILE C 1 137 ? 0.181   -26.846 -28.557 1.00 179.48 ? 135 ILE C CD1   1 
ATOM   9004  N N     . ASN C 1 138 ? 2.433   -31.080 -29.282 1.00 189.63 ? 136 ASN C N     1 
ATOM   9005  C CA    . ASN C 1 138 ? 1.523   -32.191 -29.608 1.00 190.03 ? 136 ASN C CA    1 
ATOM   9006  C C     . ASN C 1 138 ? 2.182   -33.533 -29.999 1.00 189.98 ? 136 ASN C C     1 
ATOM   9007  O O     . ASN C 1 138 ? 3.392   -33.717 -29.845 1.00 190.17 ? 136 ASN C O     1 
ATOM   9008  C CB    . ASN C 1 138 ? 0.528   -31.766 -30.699 1.00 189.93 ? 136 ASN C CB    1 
ATOM   9009  C CG    . ASN C 1 138 ? -0.349  -30.595 -30.276 1.00 188.90 ? 136 ASN C CG    1 
ATOM   9010  O OD1   . ASN C 1 138 ? -0.456  -30.278 -29.091 1.00 189.41 ? 136 ASN C OD1   1 
ATOM   9011  N ND2   . ASN C 1 138 ? -0.990  -29.955 -31.248 1.00 186.39 ? 136 ASN C ND2   1 
ATOM   9012  N N     . ASN C 1 139 ? 1.356   -34.460 -30.496 1.00 188.99 ? 137 ASN C N     1 
ATOM   9013  C CA    . ASN C 1 139 ? 1.730   -35.859 -30.765 1.00 187.97 ? 137 ASN C CA    1 
ATOM   9014  C C     . ASN C 1 139 ? 2.868   -36.064 -31.774 1.00 187.08 ? 137 ASN C C     1 
ATOM   9015  O O     . ASN C 1 139 ? 3.318   -37.192 -31.990 1.00 184.05 ? 137 ASN C O     1 
ATOM   9016  C CB    . ASN C 1 139 ? 0.509   -36.650 -31.270 1.00 184.90 ? 137 ASN C CB    1 
ATOM   9017  C CG    . ASN C 1 139 ? -0.558  -36.845 -30.207 1.00 182.00 ? 137 ASN C CG    1 
ATOM   9018  O OD1   . ASN C 1 139 ? -0.282  -36.792 -29.011 1.00 182.97 ? 137 ASN C OD1   1 
ATOM   9019  N ND2   . ASN C 1 139 ? -1.788  -37.089 -30.646 1.00 177.84 ? 137 ASN C ND2   1 
ATOM   9020  N N     . GLU C 1 140 ? 3.333   -34.978 -32.382 1.00 187.98 ? 138 GLU C N     1 
ATOM   9021  C CA    . GLU C 1 140 ? 4.190   -35.046 -33.568 1.00 186.86 ? 138 GLU C CA    1 
ATOM   9022  C C     . GLU C 1 140 ? 5.628   -35.503 -33.270 1.00 184.41 ? 138 GLU C C     1 
ATOM   9023  O O     . GLU C 1 140 ? 5.913   -35.991 -32.176 1.00 183.43 ? 138 GLU C O     1 
ATOM   9024  C CB    . GLU C 1 140 ? 4.139   -33.715 -34.333 1.00 186.98 ? 138 GLU C CB    1 
ATOM   9025  C CG    . GLU C 1 140 ? 2.728   -33.100 -34.342 1.00 187.17 ? 138 GLU C CG    1 
ATOM   9026  C CD    . GLU C 1 140 ? 2.356   -32.422 -35.651 1.00 185.02 ? 138 GLU C CD    1 
ATOM   9027  O OE1   . GLU C 1 140 ? 3.263   -32.127 -36.460 1.00 187.32 ? 138 GLU C OE1   1 
ATOM   9028  O OE2   . GLU C 1 140 ? 1.147   -32.185 -35.870 1.00 177.89 ? 138 GLU C OE2   1 
ATOM   9029  N N     . THR C 1 141 ? 6.519   -35.360 -34.249 1.00 185.35 ? 139 THR C N     1 
ATOM   9030  C CA    . THR C 1 141 ? 7.761   -36.142 -34.307 1.00 187.38 ? 139 THR C CA    1 
ATOM   9031  C C     . THR C 1 141 ? 8.699   -35.962 -33.093 1.00 187.89 ? 139 THR C C     1 
ATOM   9032  O O     . THR C 1 141 ? 8.403   -35.172 -32.195 1.00 186.44 ? 139 THR C O     1 
ATOM   9033  C CB    . THR C 1 141 ? 8.520   -35.850 -35.633 1.00 186.24 ? 139 THR C CB    1 
ATOM   9034  O OG1   . THR C 1 141 ? 8.679   -34.436 -35.801 1.00 187.78 ? 139 THR C OG1   1 
ATOM   9035  C CG2   . THR C 1 141 ? 7.763   -36.421 -36.825 1.00 181.04 ? 139 THR C CG2   1 
ATOM   9036  N N     . PRO C 1 142 ? 9.836   -36.698 -33.073 1.00 189.30 ? 140 PRO C N     1 
ATOM   9037  C CA    . PRO C 1 142 ? 10.652  -36.917 -31.863 1.00 189.20 ? 140 PRO C CA    1 
ATOM   9038  C C     . PRO C 1 142 ? 11.089  -35.721 -30.983 1.00 189.02 ? 140 PRO C C     1 
ATOM   9039  O O     . PRO C 1 142 ? 10.901  -35.819 -29.768 1.00 186.53 ? 140 PRO C O     1 
ATOM   9040  C CB    . PRO C 1 142 ? 11.885  -37.642 -32.417 1.00 185.72 ? 140 PRO C CB    1 
ATOM   9041  C CG    . PRO C 1 142 ? 11.347  -38.437 -33.544 1.00 183.43 ? 140 PRO C CG    1 
ATOM   9042  C CD    . PRO C 1 142 ? 10.281  -37.576 -34.175 1.00 185.90 ? 140 PRO C CD    1 
ATOM   9043  N N     . GLY C 1 143 ? 11.617  -34.631 -31.538 1.00 189.44 ? 141 GLY C N     1 
ATOM   9044  C CA    . GLY C 1 143 ? 12.171  -33.579 -30.692 1.00 186.64 ? 141 GLY C CA    1 
ATOM   9045  C C     . GLY C 1 143 ? 13.466  -33.928 -29.957 1.00 183.96 ? 141 GLY C C     1 
ATOM   9046  O O     . GLY C 1 143 ? 13.513  -33.913 -28.726 1.00 183.10 ? 141 GLY C O     1 
ATOM   9047  N N     . ILE C 1 144 ? 14.516  -34.229 -30.721 1.00 179.95 ? 142 ILE C N     1 
ATOM   9048  C CA    . ILE C 1 144 ? 15.776  -34.819 -30.232 1.00 177.46 ? 142 ILE C CA    1 
ATOM   9049  C C     . ILE C 1 144 ? 16.441  -34.176 -28.989 1.00 174.45 ? 142 ILE C C     1 
ATOM   9050  O O     . ILE C 1 144 ? 16.439  -32.956 -28.828 1.00 173.70 ? 142 ILE C O     1 
ATOM   9051  C CB    . ILE C 1 144 ? 16.802  -34.905 -31.400 1.00 175.82 ? 142 ILE C CB    1 
ATOM   9052  C CG1   . ILE C 1 144 ? 18.242  -34.844 -30.885 1.00 173.09 ? 142 ILE C CG1   1 
ATOM   9053  C CG2   . ILE C 1 144 ? 16.553  -33.790 -32.408 1.00 173.88 ? 142 ILE C CG2   1 
ATOM   9054  C CD1   . ILE C 1 144 ? 19.284  -34.795 -31.987 1.00 165.16 ? 142 ILE C CD1   1 
ATOM   9055  N N     . ARG C 1 145 ? 16.997  -35.028 -28.119 1.00 171.94 ? 143 ARG C N     1 
ATOM   9056  C CA    . ARG C 1 145 ? 17.525  -34.641 -26.797 1.00 167.40 ? 143 ARG C CA    1 
ATOM   9057  C C     . ARG C 1 145 ? 19.001  -34.193 -26.733 1.00 163.26 ? 143 ARG C C     1 
ATOM   9058  O O     . ARG C 1 145 ? 19.648  -33.990 -27.759 1.00 161.61 ? 143 ARG C O     1 
ATOM   9059  C CB    . ARG C 1 145 ? 17.298  -35.772 -25.792 1.00 167.98 ? 143 ARG C CB    1 
ATOM   9060  C CG    . ARG C 1 145 ? 18.020  -37.058 -26.145 1.00 167.86 ? 143 ARG C CG    1 
ATOM   9061  C CD    . ARG C 1 145 ? 18.166  -37.961 -24.934 1.00 170.65 ? 143 ARG C CD    1 
ATOM   9062  N NE    . ARG C 1 145 ? 18.936  -39.161 -25.244 1.00 168.95 ? 143 ARG C NE    1 
ATOM   9063  C CZ    . ARG C 1 145 ? 18.395  -40.345 -25.507 1.00 168.73 ? 143 ARG C CZ    1 
ATOM   9064  N NH1   . ARG C 1 145 ? 17.077  -40.490 -25.489 1.00 169.19 ? 143 ARG C NH1   1 
ATOM   9065  N NH2   . ARG C 1 145 ? 19.172  -41.384 -25.780 1.00 167.65 ? 143 ARG C NH2   1 
ATOM   9066  N N     . TYR C 1 146 ? 19.523  -34.066 -25.509 1.00 161.63 ? 144 TYR C N     1 
ATOM   9067  C CA    . TYR C 1 146 ? 20.760  -33.314 -25.253 1.00 156.42 ? 144 TYR C CA    1 
ATOM   9068  C C     . TYR C 1 146 ? 21.502  -33.656 -23.944 1.00 154.31 ? 144 TYR C C     1 
ATOM   9069  O O     . TYR C 1 146 ? 21.127  -34.588 -23.227 1.00 156.26 ? 144 TYR C O     1 
ATOM   9070  C CB    . TYR C 1 146 ? 20.421  -31.825 -25.203 1.00 154.88 ? 144 TYR C CB    1 
ATOM   9071  C CG    . TYR C 1 146 ? 19.493  -31.466 -24.056 1.00 155.43 ? 144 TYR C CG    1 
ATOM   9072  C CD1   . TYR C 1 146 ? 19.318  -30.146 -23.664 1.00 154.28 ? 144 TYR C CD1   1 
ATOM   9073  C CD2   . TYR C 1 146 ? 18.793  -32.452 -23.364 1.00 157.26 ? 144 TYR C CD2   1 
ATOM   9074  C CE1   . TYR C 1 146 ? 18.473  -29.815 -22.623 1.00 153.39 ? 144 TYR C CE1   1 
ATOM   9075  C CE2   . TYR C 1 146 ? 17.952  -32.132 -22.324 1.00 160.29 ? 144 TYR C CE2   1 
ATOM   9076  C CZ    . TYR C 1 146 ? 17.791  -30.811 -21.958 1.00 158.53 ? 144 TYR C CZ    1 
ATOM   9077  O OH    . TYR C 1 146 ? 16.949  -30.476 -20.924 1.00 157.89 ? 144 TYR C OH    1 
ATOM   9078  N N     . GLN C 1 147 ? 22.550  -32.872 -23.651 1.00 147.63 ? 145 GLN C N     1 
ATOM   9079  C CA    . GLN C 1 147 ? 23.274  -32.895 -22.363 1.00 132.54 ? 145 GLN C CA    1 
ATOM   9080  C C     . GLN C 1 147 ? 23.364  -31.476 -21.754 1.00 132.30 ? 145 GLN C C     1 
ATOM   9081  O O     . GLN C 1 147 ? 22.792  -30.533 -22.308 1.00 137.78 ? 145 GLN C O     1 
ATOM   9082  C CB    . GLN C 1 147 ? 24.675  -33.523 -22.507 1.00 121.69 ? 145 GLN C CB    1 
ATOM   9083  C CG    . GLN C 1 147 ? 25.776  -32.593 -23.015 1.00 117.10 ? 145 GLN C CG    1 
ATOM   9084  C CD    . GLN C 1 147 ? 27.148  -33.245 -22.979 1.00 104.21 ? 145 GLN C CD    1 
ATOM   9085  O OE1   . GLN C 1 147 ? 27.262  -34.457 -22.835 1.00 96.27  ? 145 GLN C OE1   1 
ATOM   9086  N NE2   . GLN C 1 147 ? 28.195  -32.440 -23.103 1.00 98.71  ? 145 GLN C NE2   1 
ATOM   9087  N N     . TYR C 1 148 ? 24.064  -31.325 -20.622 1.00 125.21 ? 146 TYR C N     1 
ATOM   9088  C CA    . TYR C 1 148 ? 24.202  -30.021 -19.946 1.00 112.95 ? 146 TYR C CA    1 
ATOM   9089  C C     . TYR C 1 148 ? 25.647  -29.587 -19.766 1.00 104.22 ? 146 TYR C C     1 
ATOM   9090  O O     . TYR C 1 148 ? 26.470  -30.357 -19.292 1.00 100.76 ? 146 TYR C O     1 
ATOM   9091  C CB    . TYR C 1 148 ? 23.540  -30.046 -18.578 1.00 106.13 ? 146 TYR C CB    1 
ATOM   9092  C CG    . TYR C 1 148 ? 22.272  -29.244 -18.502 1.00 106.96 ? 146 TYR C CG    1 
ATOM   9093  C CD1   . TYR C 1 148 ? 22.298  -27.856 -18.530 1.00 104.17 ? 146 TYR C CD1   1 
ATOM   9094  C CD2   . TYR C 1 148 ? 21.044  -29.876 -18.387 1.00 113.47 ? 146 TYR C CD2   1 
ATOM   9095  C CE1   . TYR C 1 148 ? 21.128  -27.124 -18.453 1.00 104.53 ? 146 TYR C CE1   1 
ATOM   9096  C CE2   . TYR C 1 148 ? 19.875  -29.158 -18.310 1.00 110.25 ? 146 TYR C CE2   1 
ATOM   9097  C CZ    . TYR C 1 148 ? 19.920  -27.787 -18.342 1.00 107.63 ? 146 TYR C CZ    1 
ATOM   9098  O OH    . TYR C 1 148 ? 18.740  -27.093 -18.261 1.00 109.20 ? 146 TYR C OH    1 
ATOM   9099  N N     . ASN C 1 149 ? 25.952  -28.358 -20.168 1.00 103.96 ? 147 ASN C N     1 
ATOM   9100  C CA    . ASN C 1 149 ? 27.297  -27.800 -20.023 1.00 101.67 ? 147 ASN C CA    1 
ATOM   9101  C C     . ASN C 1 149 ? 27.502  -26.854 -18.837 1.00 92.93  ? 147 ASN C C     1 
ATOM   9102  O O     . ASN C 1 149 ? 28.591  -26.306 -18.648 1.00 85.18  ? 147 ASN C O     1 
ATOM   9103  C CB    . ASN C 1 149 ? 27.718  -27.126 -21.325 1.00 113.82 ? 147 ASN C CB    1 
ATOM   9104  C CG    . ASN C 1 149 ? 27.703  -28.083 -22.493 1.00 118.99 ? 147 ASN C CG    1 
ATOM   9105  O OD1   . ASN C 1 149 ? 26.638  -28.431 -23.009 1.00 123.97 ? 147 ASN C OD1   1 
ATOM   9106  N ND2   . ASN C 1 149 ? 28.886  -28.531 -22.909 1.00 115.08 ? 147 ASN C ND2   1 
ATOM   9107  N N     . VAL C 1 150 ? 26.441  -26.663 -18.056 1.00 94.28  ? 148 VAL C N     1 
ATOM   9108  C CA    . VAL C 1 150 ? 26.448  -25.765 -16.905 1.00 89.65  ? 148 VAL C CA    1 
ATOM   9109  C C     . VAL C 1 150 ? 25.554  -26.292 -15.784 1.00 89.78  ? 148 VAL C C     1 
ATOM   9110  O O     . VAL C 1 150 ? 25.141  -27.456 -15.786 1.00 87.51  ? 148 VAL C O     1 
ATOM   9111  C CB    . VAL C 1 150 ? 25.978  -24.340 -17.271 1.00 91.62  ? 148 VAL C CB    1 
ATOM   9112  C CG1   . VAL C 1 150 ? 27.037  -23.612 -18.087 1.00 92.45  ? 148 VAL C CG1   1 
ATOM   9113  C CG2   . VAL C 1 150 ? 24.636  -24.379 -17.996 1.00 96.82  ? 148 VAL C CG2   1 
ATOM   9114  N N     . LEU C 1 151 ? 25.280  -25.430 -14.811 1.00 88.18  ? 149 LEU C N     1 
ATOM   9115  C CA    . LEU C 1 151 ? 24.421  -25.804 -13.703 1.00 89.74  ? 149 LEU C CA    1 
ATOM   9116  C C     . LEU C 1 151 ? 22.938  -25.612 -14.020 1.00 90.50  ? 149 LEU C C     1 
ATOM   9117  O O     . LEU C 1 151 ? 22.471  -24.490 -14.212 1.00 92.22  ? 149 LEU C O     1 
ATOM   9118  C CB    . LEU C 1 151 ? 24.816  -25.042 -12.436 1.00 90.82  ? 149 LEU C CB    1 
ATOM   9119  C CG    . LEU C 1 151 ? 26.251  -25.195 -11.917 1.00 84.23  ? 149 LEU C CG    1 
ATOM   9120  C CD1   . LEU C 1 151 ? 26.378  -24.483 -10.612 1.00 80.32  ? 149 LEU C CD1   1 
ATOM   9121  C CD2   . LEU C 1 151 ? 26.647  -26.639 -11.734 1.00 84.03  ? 149 LEU C CD2   1 
ATOM   9122  N N     . PRO C 1 152 ? 22.200  -26.727 -14.068 1.00 89.77  ? 150 PRO C N     1 
ATOM   9123  C CA    . PRO C 1 152 ? 20.761  -26.899 -14.298 1.00 98.27  ? 150 PRO C CA    1 
ATOM   9124  C C     . PRO C 1 152 ? 19.899  -26.248 -13.225 1.00 106.95 ? 150 PRO C C     1 
ATOM   9125  O O     . PRO C 1 152 ? 20.423  -25.542 -12.377 1.00 111.33 ? 150 PRO C O     1 
ATOM   9126  C CB    . PRO C 1 152 ? 20.586  -28.414 -14.223 1.00 99.86  ? 150 PRO C CB    1 
ATOM   9127  C CG    . PRO C 1 152 ? 21.901  -28.959 -14.580 1.00 94.57  ? 150 PRO C CG    1 
ATOM   9128  C CD    . PRO C 1 152 ? 22.896  -28.018 -14.012 1.00 89.46  ? 150 PRO C CD    1 
ATOM   9129  N N     . GLN C 1 153 ? 18.588  -26.463 -13.287 1.00 111.85 ? 151 GLN C N     1 
ATOM   9130  C CA    . GLN C 1 153 ? 17.655  -25.954 -12.280 1.00 123.91 ? 151 GLN C CA    1 
ATOM   9131  C C     . GLN C 1 153 ? 16.913  -27.116 -11.620 1.00 132.29 ? 151 GLN C C     1 
ATOM   9132  O O     . GLN C 1 153 ? 16.201  -27.865 -12.291 1.00 143.33 ? 151 GLN C O     1 
ATOM   9133  C CB    . GLN C 1 153 ? 16.631  -25.009 -12.919 1.00 134.46 ? 151 GLN C CB    1 
ATOM   9134  C CG    . GLN C 1 153 ? 17.216  -23.766 -13.574 1.00 130.70 ? 151 GLN C CG    1 
ATOM   9135  C CD    . GLN C 1 153 ? 17.406  -22.623 -12.596 1.00 128.05 ? 151 GLN C CD    1 
ATOM   9136  O OE1   . GLN C 1 153 ? 17.068  -22.737 -11.416 1.00 128.76 ? 151 GLN C OE1   1 
ATOM   9137  N NE2   . GLN C 1 153 ? 17.946  -21.508 -13.084 1.00 120.52 ? 151 GLN C NE2   1 
ATOM   9138  N N     . GLY C 1 154 ? 17.068  -27.265 -10.308 1.00 129.10 ? 152 GLY C N     1 
ATOM   9139  C CA    . GLY C 1 154 ? 16.461  -28.382 -9.603  1.00 127.84 ? 152 GLY C CA    1 
ATOM   9140  C C     . GLY C 1 154 ? 17.436  -29.510 -9.296  1.00 124.66 ? 152 GLY C C     1 
ATOM   9141  O O     . GLY C 1 154 ? 17.092  -30.450 -8.574  1.00 122.29 ? 152 GLY C O     1 
ATOM   9142  N N     . TRP C 1 155 ? 18.647  -29.430 -9.851  1.00 118.08 ? 153 TRP C N     1 
ATOM   9143  C CA    . TRP C 1 155 ? 19.706  -30.371 -9.498  1.00 109.37 ? 153 TRP C CA    1 
ATOM   9144  C C     . TRP C 1 155 ? 20.068  -30.154 -8.037  1.00 108.81 ? 153 TRP C C     1 
ATOM   9145  O O     . TRP C 1 155 ? 19.912  -29.052 -7.513  1.00 108.82 ? 153 TRP C O     1 
ATOM   9146  C CB    . TRP C 1 155 ? 20.950  -30.173 -10.368 1.00 101.98 ? 153 TRP C CB    1 
ATOM   9147  C CG    . TRP C 1 155 ? 21.944  -31.305 -10.257 1.00 98.14  ? 153 TRP C CG    1 
ATOM   9148  C CD1   . TRP C 1 155 ? 21.659  -32.636 -10.168 1.00 99.15  ? 153 TRP C CD1   1 
ATOM   9149  C CD2   . TRP C 1 155 ? 23.374  -31.198 -10.204 1.00 93.08  ? 153 TRP C CD2   1 
ATOM   9150  N NE1   . TRP C 1 155 ? 22.818  -33.365 -10.077 1.00 93.72  ? 153 TRP C NE1   1 
ATOM   9151  C CE2   . TRP C 1 155 ? 23.886  -32.508 -10.095 1.00 90.18  ? 153 TRP C CE2   1 
ATOM   9152  C CE3   . TRP C 1 155 ? 24.272  -30.124 -10.240 1.00 88.01  ? 153 TRP C CE3   1 
ATOM   9153  C CZ2   . TRP C 1 155 ? 25.250  -32.775 -10.019 1.00 83.71  ? 153 TRP C CZ2   1 
ATOM   9154  C CZ3   . TRP C 1 155 ? 25.628  -30.390 -10.166 1.00 85.05  ? 153 TRP C CZ3   1 
ATOM   9155  C CH2   . TRP C 1 155 ? 26.104  -31.706 -10.056 1.00 84.67  ? 153 TRP C CH2   1 
ATOM   9156  N N     . LYS C 1 156 ? 20.549  -31.201 -7.378  1.00 108.77 ? 154 LYS C N     1 
ATOM   9157  C CA    . LYS C 1 156 ? 20.900  -31.105 -5.968  1.00 101.38 ? 154 LYS C CA    1 
ATOM   9158  C C     . LYS C 1 156 ? 22.075  -30.160 -5.770  1.00 94.83  ? 154 LYS C C     1 
ATOM   9159  O O     . LYS C 1 156 ? 22.023  -29.283 -4.912  1.00 97.51  ? 154 LYS C O     1 
ATOM   9160  C CB    . LYS C 1 156 ? 21.230  -32.486 -5.397  1.00 104.15 ? 154 LYS C CB    1 
ATOM   9161  C CG    . LYS C 1 156 ? 20.461  -32.843 -4.127  1.00 105.94 ? 154 LYS C CG    1 
ATOM   9162  C CD    . LYS C 1 156 ? 20.796  -34.251 -3.640  1.00 103.37 ? 154 LYS C CD    1 
ATOM   9163  C CE    . LYS C 1 156 ? 22.289  -34.427 -3.400  1.00 96.70  ? 154 LYS C CE    1 
ATOM   9164  N NZ    . LYS C 1 156 ? 22.592  -35.835 -3.037  1.00 96.87  ? 154 LYS C NZ    1 
ATOM   9165  N N     . GLY C 1 157 ? 23.117  -30.321 -6.581  1.00 87.12  ? 155 GLY C N     1 
ATOM   9166  C CA    . GLY C 1 157 ? 24.374  -29.630 -6.349  1.00 87.11  ? 155 GLY C CA    1 
ATOM   9167  C C     . GLY C 1 157 ? 24.524  -28.204 -6.857  1.00 84.21  ? 155 GLY C C     1 
ATOM   9168  O O     . GLY C 1 157 ? 25.610  -27.624 -6.798  1.00 77.74  ? 155 GLY C O     1 
ATOM   9169  N N     . SER C 1 158 ? 23.445  -27.627 -7.363  1.00 87.00  ? 156 SER C N     1 
ATOM   9170  C CA    . SER C 1 158 ? 23.541  -26.321 -8.010  1.00 86.24  ? 156 SER C CA    1 
ATOM   9171  C C     . SER C 1 158 ? 23.839  -25.162 -7.054  1.00 79.69  ? 156 SER C C     1 
ATOM   9172  O O     . SER C 1 158 ? 24.791  -24.405 -7.260  1.00 73.51  ? 156 SER C O     1 
ATOM   9173  C CB    . SER C 1 158 ? 22.279  -26.038 -8.841  1.00 93.10  ? 156 SER C CB    1 
ATOM   9174  O OG    . SER C 1 158 ? 22.074  -27.036 -9.833  1.00 95.30  ? 156 SER C OG    1 
ATOM   9175  N N     . PRO C 1 159 ? 23.018  -25.017 -6.007  1.00 79.40  ? 157 PRO C N     1 
ATOM   9176  C CA    . PRO C 1 159 ? 23.198  -23.888 -5.097  1.00 77.65  ? 157 PRO C CA    1 
ATOM   9177  C C     . PRO C 1 159 ? 24.527  -23.976 -4.357  1.00 76.44  ? 157 PRO C C     1 
ATOM   9178  O O     . PRO C 1 159 ? 25.199  -22.960 -4.160  1.00 75.05  ? 157 PRO C O     1 
ATOM   9179  C CB    . PRO C 1 159 ? 22.020  -24.034 -4.134  1.00 80.01  ? 157 PRO C CB    1 
ATOM   9180  C CG    . PRO C 1 159 ? 21.009  -24.836 -4.888  1.00 80.55  ? 157 PRO C CG    1 
ATOM   9181  C CD    . PRO C 1 159 ? 21.825  -25.807 -5.666  1.00 81.33  ? 157 PRO C CD    1 
ATOM   9182  N N     . ALA C 1 160 ? 24.907  -25.187 -3.967  1.00 75.29  ? 158 ALA C N     1 
ATOM   9183  C CA    . ALA C 1 160 ? 26.168  -25.398 -3.273  1.00 72.55  ? 158 ALA C CA    1 
ATOM   9184  C C     . ALA C 1 160 ? 27.364  -25.061 -4.148  1.00 70.06  ? 158 ALA C C     1 
ATOM   9185  O O     . ALA C 1 160 ? 28.305  -24.416 -3.694  1.00 67.04  ? 158 ALA C O     1 
ATOM   9186  C CB    . ALA C 1 160 ? 26.263  -26.819 -2.764  1.00 77.34  ? 158 ALA C CB    1 
ATOM   9187  N N     . ILE C 1 161 ? 27.322  -25.491 -5.407  1.00 72.97  ? 159 ILE C N     1 
ATOM   9188  C CA    . ILE C 1 161 ? 28.456  -25.292 -6.303  1.00 72.05  ? 159 ILE C CA    1 
ATOM   9189  C C     . ILE C 1 161 ? 28.590  -23.838 -6.736  1.00 71.84  ? 159 ILE C C     1 
ATOM   9190  O O     . ILE C 1 161 ? 29.700  -23.304 -6.824  1.00 70.44  ? 159 ILE C O     1 
ATOM   9191  C CB    . ILE C 1 161 ? 28.421  -26.228 -7.513  1.00 68.98  ? 159 ILE C CB    1 
ATOM   9192  C CG1   . ILE C 1 161 ? 28.162  -27.656 -7.048  1.00 70.99  ? 159 ILE C CG1   1 
ATOM   9193  C CG2   . ILE C 1 161 ? 29.744  -26.161 -8.240  1.00 69.03  ? 159 ILE C CG2   1 
ATOM   9194  C CD1   . ILE C 1 161 ? 28.307  -28.708 -8.104  1.00 71.21  ? 159 ILE C CD1   1 
ATOM   9195  N N     . PHE C 1 162 ? 27.458  -23.191 -6.982  1.00 71.97  ? 160 PHE C N     1 
ATOM   9196  C CA    . PHE C 1 162 ? 27.470  -21.755 -7.220  1.00 72.15  ? 160 PHE C CA    1 
ATOM   9197  C C     . PHE C 1 162 ? 28.179  -21.017 -6.087  1.00 73.06  ? 160 PHE C C     1 
ATOM   9198  O O     . PHE C 1 162 ? 29.244  -20.430 -6.298  1.00 71.37  ? 160 PHE C O     1 
ATOM   9199  C CB    . PHE C 1 162 ? 26.053  -21.212 -7.403  1.00 72.98  ? 160 PHE C CB    1 
ATOM   9200  C CG    . PHE C 1 162 ? 26.003  -19.739 -7.683  1.00 73.42  ? 160 PHE C CG    1 
ATOM   9201  C CD1   . PHE C 1 162 ? 24.837  -19.144 -8.096  1.00 78.70  ? 160 PHE C CD1   1 
ATOM   9202  C CD2   . PHE C 1 162 ? 27.130  -18.944 -7.527  1.00 76.53  ? 160 PHE C CD2   1 
ATOM   9203  C CE1   . PHE C 1 162 ? 24.798  -17.784 -8.345  1.00 86.91  ? 160 PHE C CE1   1 
ATOM   9204  C CE2   . PHE C 1 162 ? 27.099  -17.582 -7.781  1.00 74.29  ? 160 PHE C CE2   1 
ATOM   9205  C CZ    . PHE C 1 162 ? 25.937  -17.003 -8.190  1.00 80.67  ? 160 PHE C CZ    1 
ATOM   9206  N N     . GLN C 1 163 ? 27.592  -21.060 -4.891  1.00 74.55  ? 161 GLN C N     1 
ATOM   9207  C CA    . GLN C 1 163 ? 28.062  -20.260 -3.756  1.00 74.72  ? 161 GLN C CA    1 
ATOM   9208  C C     . GLN C 1 163 ? 29.559  -20.361 -3.491  1.00 71.04  ? 161 GLN C C     1 
ATOM   9209  O O     . GLN C 1 163 ? 30.196  -19.391 -3.074  1.00 68.46  ? 161 GLN C O     1 
ATOM   9210  C CB    . GLN C 1 163 ? 27.309  -20.645 -2.490  1.00 80.86  ? 161 GLN C CB    1 
ATOM   9211  C CG    . GLN C 1 163 ? 25.975  -19.964 -2.334  1.00 90.56  ? 161 GLN C CG    1 
ATOM   9212  C CD    . GLN C 1 163 ? 25.555  -19.866 -0.879  1.00 104.65 ? 161 GLN C CD    1 
ATOM   9213  O OE1   . GLN C 1 163 ? 26.045  -20.619 -0.026  1.00 103.35 ? 161 GLN C OE1   1 
ATOM   9214  N NE2   . GLN C 1 163 ? 24.653  -18.923 -0.582  1.00 103.91 ? 161 GLN C NE2   1 
ATOM   9215  N N     . SER C 1 164 ? 30.108  -21.543 -3.731  1.00 69.93  ? 162 SER C N     1 
ATOM   9216  C CA    . SER C 1 164 ? 31.512  -21.822 -3.476  1.00 70.92  ? 162 SER C CA    1 
ATOM   9217  C C     . SER C 1 164 ? 32.416  -21.097 -4.465  1.00 69.46  ? 162 SER C C     1 
ATOM   9218  O O     . SER C 1 164 ? 33.448  -20.531 -4.100  1.00 64.14  ? 162 SER C O     1 
ATOM   9219  C CB    . SER C 1 164 ? 31.739  -23.323 -3.589  1.00 73.45  ? 162 SER C CB    1 
ATOM   9220  O OG    . SER C 1 164 ? 31.030  -23.820 -4.711  1.00 74.07  ? 162 SER C OG    1 
ATOM   9221  N N     . SER C 1 165 ? 32.022  -21.146 -5.732  1.00 74.36  ? 163 SER C N     1 
ATOM   9222  C CA    . SER C 1 165 ? 32.761  -20.486 -6.801  1.00 74.74  ? 163 SER C CA    1 
ATOM   9223  C C     . SER C 1 165 ? 32.673  -18.985 -6.580  1.00 68.97  ? 163 SER C C     1 
ATOM   9224  O O     . SER C 1 165 ? 33.686  -18.282 -6.549  1.00 64.22  ? 163 SER C O     1 
ATOM   9225  C CB    . SER C 1 165 ? 32.150  -20.870 -8.147  1.00 70.66  ? 163 SER C CB    1 
ATOM   9226  O OG    . SER C 1 165 ? 31.159  -21.866 -7.957  1.00 68.10  ? 163 SER C OG    1 
ATOM   9227  N N     . MET C 1 166 ? 31.444  -18.513 -6.396  1.00 67.44  ? 164 MET C N     1 
ATOM   9228  C CA    . MET C 1 166 ? 31.195  -17.112 -6.130  1.00 68.66  ? 164 MET C CA    1 
ATOM   9229  C C     . MET C 1 166 ? 32.109  -16.585 -5.021  1.00 68.58  ? 164 MET C C     1 
ATOM   9230  O O     . MET C 1 166 ? 32.715  -15.518 -5.156  1.00 66.26  ? 164 MET C O     1 
ATOM   9231  C CB    . MET C 1 166 ? 29.735  -16.910 -5.751  1.00 68.31  ? 164 MET C CB    1 
ATOM   9232  C CG    . MET C 1 166 ? 29.355  -15.443 -5.652  1.00 75.76  ? 164 MET C CG    1 
ATOM   9233  S SD    . MET C 1 166 ? 28.983  -14.690 -7.248  1.00 79.40  ? 164 MET C SD    1 
ATOM   9234  C CE    . MET C 1 166 ? 29.869  -13.147 -7.094  1.00 76.85  ? 164 MET C CE    1 
ATOM   9235  N N     . THR C 1 167 ? 32.196  -17.345 -3.930  1.00 66.30  ? 165 THR C N     1 
ATOM   9236  C CA    . THR C 1 167 ? 33.059  -17.013 -2.800  1.00 64.99  ? 165 THR C CA    1 
ATOM   9237  C C     . THR C 1 167 ? 34.523  -16.909 -3.222  1.00 65.26  ? 165 THR C C     1 
ATOM   9238  O O     . THR C 1 167 ? 35.222  -15.963 -2.847  1.00 62.33  ? 165 THR C O     1 
ATOM   9239  C CB    . THR C 1 167 ? 32.946  -18.064 -1.666  1.00 61.32  ? 165 THR C CB    1 
ATOM   9240  O OG1   . THR C 1 167 ? 31.587  -18.172 -1.228  1.00 55.21  ? 165 THR C OG1   1 
ATOM   9241  C CG2   . THR C 1 167 ? 33.834  -17.678 -0.494  1.00 55.27  ? 165 THR C CG2   1 
ATOM   9242  N N     . LYS C 1 168 ? 34.974  -17.898 -3.994  1.00 68.25  ? 166 LYS C N     1 
ATOM   9243  C CA    . LYS C 1 168 ? 36.359  -17.973 -4.467  1.00 68.04  ? 166 LYS C CA    1 
ATOM   9244  C C     . LYS C 1 168 ? 36.694  -16.748 -5.308  1.00 66.04  ? 166 LYS C C     1 
ATOM   9245  O O     . LYS C 1 168 ? 37.750  -16.152 -5.144  1.00 63.47  ? 166 LYS C O     1 
ATOM   9246  C CB    . LYS C 1 168 ? 36.590  -19.257 -5.285  1.00 69.68  ? 166 LYS C CB    1 
ATOM   9247  C CG    . LYS C 1 168 ? 37.122  -20.475 -4.519  1.00 67.42  ? 166 LYS C CG    1 
ATOM   9248  C CD    . LYS C 1 168 ? 37.175  -21.741 -5.405  1.00 74.03  ? 166 LYS C CD    1 
ATOM   9249  C CE    . LYS C 1 168 ? 35.761  -22.231 -5.819  1.00 75.53  ? 166 LYS C CE    1 
ATOM   9250  N NZ    . LYS C 1 168 ? 35.729  -23.209 -6.966  1.00 69.29  ? 166 LYS C NZ    1 
ATOM   9251  N N     . ILE C 1 169 ? 35.779  -16.389 -6.207  1.00 65.85  ? 167 ILE C N     1 
ATOM   9252  C CA    . ILE C 1 169 ? 35.911  -15.195 -7.029  1.00 67.02  ? 167 ILE C CA    1 
ATOM   9253  C C     . ILE C 1 169 ? 36.054  -13.918 -6.201  1.00 68.45  ? 167 ILE C C     1 
ATOM   9254  O O     . ILE C 1 169 ? 36.963  -13.125 -6.426  1.00 68.75  ? 167 ILE C O     1 
ATOM   9255  C CB    . ILE C 1 169 ? 34.699  -15.033 -7.947  1.00 65.35  ? 167 ILE C CB    1 
ATOM   9256  C CG1   . ILE C 1 169 ? 34.609  -16.207 -8.917  1.00 65.11  ? 167 ILE C CG1   1 
ATOM   9257  C CG2   . ILE C 1 169 ? 34.770  -13.703 -8.688  1.00 65.91  ? 167 ILE C CG2   1 
ATOM   9258  C CD1   . ILE C 1 169 ? 33.273  -16.307 -9.647  1.00 63.71  ? 167 ILE C CD1   1 
ATOM   9259  N N     . LEU C 1 170 ? 35.144  -13.726 -5.250  1.00 68.14  ? 168 LEU C N     1 
ATOM   9260  C CA    . LEU C 1 170 ? 35.118  -12.522 -4.425  1.00 68.98  ? 168 LEU C CA    1 
ATOM   9261  C C     . LEU C 1 170 ? 36.331  -12.418 -3.522  1.00 72.53  ? 168 LEU C C     1 
ATOM   9262  O O     . LEU C 1 170 ? 36.771  -11.325 -3.194  1.00 74.18  ? 168 LEU C O     1 
ATOM   9263  C CB    . LEU C 1 170 ? 33.866  -12.494 -3.552  1.00 67.54  ? 168 LEU C CB    1 
ATOM   9264  C CG    . LEU C 1 170 ? 32.573  -11.834 -4.022  1.00 68.65  ? 168 LEU C CG    1 
ATOM   9265  C CD1   . LEU C 1 170 ? 32.159  -12.324 -5.379  1.00 71.45  ? 168 LEU C CD1   1 
ATOM   9266  C CD2   . LEU C 1 170 ? 31.481  -12.117 -3.015  1.00 70.12  ? 168 LEU C CD2   1 
ATOM   9267  N N     . GLU C 1 171 ? 36.862  -13.560 -3.106  1.00 74.73  ? 169 GLU C N     1 
ATOM   9268  C CA    . GLU C 1 171 ? 37.940  -13.568 -2.123  1.00 79.08  ? 169 GLU C CA    1 
ATOM   9269  C C     . GLU C 1 171 ? 39.024  -12.532 -2.422  1.00 82.91  ? 169 GLU C C     1 
ATOM   9270  O O     . GLU C 1 171 ? 39.293  -11.675 -1.585  1.00 83.31  ? 169 GLU C O     1 
ATOM   9271  C CB    . GLU C 1 171 ? 38.532  -14.979 -1.964  1.00 80.66  ? 169 GLU C CB    1 
ATOM   9272  C CG    . GLU C 1 171 ? 40.016  -15.040 -1.572  1.00 89.46  ? 169 GLU C CG    1 
ATOM   9273  C CD    . GLU C 1 171 ? 40.297  -14.547 -0.156  1.00 97.94  ? 169 GLU C CD    1 
ATOM   9274  O OE1   . GLU C 1 171 ? 39.377  -13.982 0.481   1.00 98.61  ? 169 GLU C OE1   1 
ATOM   9275  O OE2   . GLU C 1 171 ? 41.444  -14.723 0.320   1.00 98.35  ? 169 GLU C OE2   1 
ATOM   9276  N N     . PRO C 1 172 ? 39.619  -12.584 -3.628  1.00 83.38  ? 170 PRO C N     1 
ATOM   9277  C CA    . PRO C 1 172 ? 40.774  -11.740 -3.958  1.00 85.84  ? 170 PRO C CA    1 
ATOM   9278  C C     . PRO C 1 172 ? 40.453  -10.242 -3.950  1.00 86.00  ? 170 PRO C C     1 
ATOM   9279  O O     . PRO C 1 172 ? 41.317  -9.435  -3.591  1.00 87.69  ? 170 PRO C O     1 
ATOM   9280  C CB    . PRO C 1 172 ? 41.151  -12.211 -5.360  1.00 83.93  ? 170 PRO C CB    1 
ATOM   9281  C CG    . PRO C 1 172 ? 39.892  -12.758 -5.916  1.00 79.07  ? 170 PRO C CG    1 
ATOM   9282  C CD    . PRO C 1 172 ? 39.199  -13.401 -4.778  1.00 77.69  ? 170 PRO C CD    1 
ATOM   9283  N N     . PHE C 1 173 ? 39.232  -9.885  -4.344  1.00 83.03  ? 171 PHE C N     1 
ATOM   9284  C CA    . PHE C 1 173 ? 38.753  -8.514  -4.217  1.00 85.35  ? 171 PHE C CA    1 
ATOM   9285  C C     . PHE C 1 173 ? 38.794  -8.095  -2.755  1.00 91.09  ? 171 PHE C C     1 
ATOM   9286  O O     . PHE C 1 173 ? 39.467  -7.130  -2.387  1.00 93.18  ? 171 PHE C O     1 
ATOM   9287  C CB    . PHE C 1 173 ? 37.312  -8.405  -4.726  1.00 84.40  ? 171 PHE C CB    1 
ATOM   9288  C CG    . PHE C 1 173 ? 36.726  -7.020  -4.610  1.00 89.25  ? 171 PHE C CG    1 
ATOM   9289  C CD1   . PHE C 1 173 ? 36.408  -6.290  -5.742  1.00 91.31  ? 171 PHE C CD1   1 
ATOM   9290  C CD2   . PHE C 1 173 ? 36.500  -6.443  -3.370  1.00 93.00  ? 171 PHE C CD2   1 
ATOM   9291  C CE1   . PHE C 1 173 ? 35.879  -5.009  -5.640  1.00 94.31  ? 171 PHE C CE1   1 
ATOM   9292  C CE2   . PHE C 1 173 ? 35.964  -5.163  -3.266  1.00 94.04  ? 171 PHE C CE2   1 
ATOM   9293  C CZ    . PHE C 1 173 ? 35.655  -4.448  -4.403  1.00 93.23  ? 171 PHE C CZ    1 
ATOM   9294  N N     . LYS C 1 174 ? 38.132  -8.843  -1.891  1.00 90.43  ? 172 LYS C N     1 
ATOM   9295  C CA    . LYS C 1 174 ? 38.005  -8.414  -0.517  1.00 88.79  ? 172 LYS C CA    1 
ATOM   9296  C C     . LYS C 1 174 ? 39.348  -8.283  0.167   1.00 93.59  ? 172 LYS C C     1 
ATOM   9297  O O     . LYS C 1 174 ? 39.502  -7.480  1.070   1.00 97.66  ? 172 LYS C O     1 
ATOM   9298  C CB    . LYS C 1 174 ? 37.207  -9.428  0.304   1.00 91.52  ? 172 LYS C CB    1 
ATOM   9299  C CG    . LYS C 1 174 ? 35.753  -9.627  -0.103  1.00 93.43  ? 172 LYS C CG    1 
ATOM   9300  C CD    . LYS C 1 174 ? 35.000  -10.374 0.994   1.00 94.78  ? 172 LYS C CD    1 
ATOM   9301  C CE    . LYS C 1 174 ? 33.673  -10.949 0.526   1.00 93.65  ? 172 LYS C CE    1 
ATOM   9302  N NZ    . LYS C 1 174 ? 32.992  -11.767 1.568   1.00 92.36  ? 172 LYS C NZ    1 
ATOM   9303  N N     . LYS C 1 175 ? 40.334  -9.053  -0.255  1.00 94.24  ? 173 LYS C N     1 
ATOM   9304  C CA    . LYS C 1 175 ? 41.639  -8.942  0.392   1.00 97.32  ? 173 LYS C CA    1 
ATOM   9305  C C     . LYS C 1 175 ? 42.132  -7.514  0.220   1.00 98.10  ? 173 LYS C C     1 
ATOM   9306  O O     . LYS C 1 175 ? 42.778  -6.947  1.101   1.00 97.05  ? 173 LYS C O     1 
ATOM   9307  C CB    . LYS C 1 175 ? 42.636  -9.911  -0.249  1.00 99.79  ? 173 LYS C CB    1 
ATOM   9308  C CG    . LYS C 1 175 ? 42.664  -11.307 0.372   1.00 101.76 ? 173 LYS C CG    1 
ATOM   9309  C CD    . LYS C 1 175 ? 43.266  -11.309 1.781   1.00 107.42 ? 173 LYS C CD    1 
ATOM   9310  C CE    . LYS C 1 175 ? 44.732  -10.864 1.792   1.00 109.00 ? 173 LYS C CE    1 
ATOM   9311  N NZ    . LYS C 1 175 ? 44.897  -9.377  1.830   1.00 106.37 ? 173 LYS C NZ    1 
ATOM   9312  N N     . GLN C 1 176 ? 41.828  -6.939  -0.933  1.00 97.71  ? 174 GLN C N     1 
ATOM   9313  C CA    . GLN C 1 176 ? 42.319  -5.611  -1.248  1.00 104.64 ? 174 GLN C CA    1 
ATOM   9314  C C     . GLN C 1 176 ? 41.302  -4.506  -0.934  1.00 102.45 ? 174 GLN C C     1 
ATOM   9315  O O     . GLN C 1 176 ? 41.550  -3.328  -1.194  1.00 103.16 ? 174 GLN C O     1 
ATOM   9316  C CB    . GLN C 1 176 ? 42.832  -5.556  -2.697  1.00 110.98 ? 174 GLN C CB    1 
ATOM   9317  C CG    . GLN C 1 176 ? 43.952  -6.578  -2.981  1.00 114.79 ? 174 GLN C CG    1 
ATOM   9318  C CD    . GLN C 1 176 ? 44.701  -6.325  -4.288  1.00 123.78 ? 174 GLN C CD    1 
ATOM   9319  O OE1   . GLN C 1 176 ? 44.186  -5.678  -5.200  1.00 125.22 ? 174 GLN C OE1   1 
ATOM   9320  N NE2   . GLN C 1 176 ? 45.927  -6.839  -4.377  1.00 122.96 ? 174 GLN C NE2   1 
ATOM   9321  N N     . ASN C 1 177 ? 40.159  -4.888  -0.371  1.00 100.80 ? 175 ASN C N     1 
ATOM   9322  C CA    . ASN C 1 177 ? 39.189  -3.907  0.115   1.00 99.02  ? 175 ASN C CA    1 
ATOM   9323  C C     . ASN C 1 177 ? 38.666  -4.244  1.511   1.00 95.62  ? 175 ASN C C     1 
ATOM   9324  O O     . ASN C 1 177 ? 37.457  -4.340  1.716   1.00 92.29  ? 175 ASN C O     1 
ATOM   9325  C CB    . ASN C 1 177 ? 38.005  -3.793  -0.855  1.00 98.65  ? 175 ASN C CB    1 
ATOM   9326  C CG    . ASN C 1 177 ? 38.424  -3.378  -2.260  1.00 99.75  ? 175 ASN C CG    1 
ATOM   9327  O OD1   . ASN C 1 177 ? 38.567  -4.215  -3.150  1.00 94.43  ? 175 ASN C OD1   1 
ATOM   9328  N ND2   . ASN C 1 177 ? 38.609  -2.078  -2.464  1.00 103.33 ? 175 ASN C ND2   1 
ATOM   9329  N N     . PRO C 1 178 ? 39.576  -4.376  2.489   1.00 98.67  ? 176 PRO C N     1 
ATOM   9330  C CA    . PRO C 1 178 ? 39.188  -4.825  3.828   1.00 98.07  ? 176 PRO C CA    1 
ATOM   9331  C C     . PRO C 1 178 ? 37.972  -4.102  4.386   1.00 95.71  ? 176 PRO C C     1 
ATOM   9332  O O     . PRO C 1 178 ? 37.211  -4.706  5.125   1.00 99.39  ? 176 PRO C O     1 
ATOM   9333  C CB    . PRO C 1 178 ? 40.420  -4.498  4.666   1.00 99.58  ? 176 PRO C CB    1 
ATOM   9334  C CG    . PRO C 1 178 ? 41.545  -4.680  3.712   1.00 102.38 ? 176 PRO C CG    1 
ATOM   9335  C CD    . PRO C 1 178 ? 41.034  -4.196  2.378   1.00 100.65 ? 176 PRO C CD    1 
ATOM   9336  N N     . ASP C 1 179 ? 37.780  -2.839  4.043   1.00 95.05  ? 177 ASP C N     1 
ATOM   9337  C CA    . ASP C 1 179 ? 36.692  -2.081  4.645   1.00 93.29  ? 177 ASP C CA    1 
ATOM   9338  C C     . ASP C 1 179 ? 35.334  -2.261  3.978   1.00 88.57  ? 177 ASP C C     1 
ATOM   9339  O O     . ASP C 1 179 ? 34.306  -1.928  4.565   1.00 87.44  ? 177 ASP C O     1 
ATOM   9340  C CB    . ASP C 1 179 ? 37.057  -0.603  4.724   1.00 101.27 ? 177 ASP C CB    1 
ATOM   9341  C CG    . ASP C 1 179 ? 38.265  -0.358  5.600   1.00 109.21 ? 177 ASP C CG    1 
ATOM   9342  O OD1   . ASP C 1 179 ? 38.540  -1.209  6.479   1.00 106.89 ? 177 ASP C OD1   1 
ATOM   9343  O OD2   . ASP C 1 179 ? 38.940  0.679   5.407   1.00 115.02 ? 177 ASP C OD2   1 
ATOM   9344  N N     . ILE C 1 180 ? 35.314  -2.777  2.758   1.00 84.92  ? 178 ILE C N     1 
ATOM   9345  C CA    . ILE C 1 180 ? 34.034  -3.036  2.122   1.00 80.05  ? 178 ILE C CA    1 
ATOM   9346  C C     . ILE C 1 180 ? 33.472  -4.312  2.741   1.00 77.93  ? 178 ILE C C     1 
ATOM   9347  O O     . ILE C 1 180 ? 34.213  -5.119  3.293   1.00 77.50  ? 178 ILE C O     1 
ATOM   9348  C CB    . ILE C 1 180 ? 34.131  -3.113  0.579   1.00 77.11  ? 178 ILE C CB    1 
ATOM   9349  C CG1   . ILE C 1 180 ? 34.471  -1.746  -0.017  1.00 85.37  ? 178 ILE C CG1   1 
ATOM   9350  C CG2   . ILE C 1 180 ? 32.811  -3.522  -0.016  1.00 70.14  ? 178 ILE C CG2   1 
ATOM   9351  C CD1   . ILE C 1 180 ? 35.785  -1.133  0.442   1.00 93.56  ? 178 ILE C CD1   1 
ATOM   9352  N N     . VAL C 1 181 ? 32.157  -4.471  2.685   1.00 75.16  ? 179 VAL C N     1 
ATOM   9353  C CA    . VAL C 1 181 ? 31.490  -5.618  3.282   1.00 70.84  ? 179 VAL C CA    1 
ATOM   9354  C C     . VAL C 1 181 ? 30.501  -6.207  2.283   1.00 68.42  ? 179 VAL C C     1 
ATOM   9355  O O     . VAL C 1 181 ? 29.640  -5.498  1.749   1.00 65.26  ? 179 VAL C O     1 
ATOM   9356  C CB    . VAL C 1 181 ? 30.747  -5.224  4.598   1.00 70.82  ? 179 VAL C CB    1 
ATOM   9357  C CG1   . VAL C 1 181 ? 29.565  -6.148  4.872   1.00 61.85  ? 179 VAL C CG1   1 
ATOM   9358  C CG2   . VAL C 1 181 ? 31.710  -5.187  5.783   1.00 68.96  ? 179 VAL C CG2   1 
ATOM   9359  N N     . ILE C 1 182 ? 30.628  -7.504  2.021   1.00 66.70  ? 180 ILE C N     1 
ATOM   9360  C CA    . ILE C 1 182 ? 29.707  -8.157  1.100   1.00 68.85  ? 180 ILE C CA    1 
ATOM   9361  C C     . ILE C 1 182 ? 28.986  -9.305  1.774   1.00 67.86  ? 180 ILE C C     1 
ATOM   9362  O O     . ILE C 1 182 ? 29.525  -9.923  2.690   1.00 67.10  ? 180 ILE C O     1 
ATOM   9363  C CB    . ILE C 1 182 ? 30.420  -8.716  -0.145  1.00 67.90  ? 180 ILE C CB    1 
ATOM   9364  C CG1   . ILE C 1 182 ? 31.456  -7.735  -0.670  1.00 66.41  ? 180 ILE C CG1   1 
ATOM   9365  C CG2   . ILE C 1 182 ? 29.415  -9.022  -1.231  1.00 69.18  ? 180 ILE C CG2   1 
ATOM   9366  C CD1   . ILE C 1 182 ? 32.289  -8.318  -1.729  1.00 66.45  ? 180 ILE C CD1   1 
ATOM   9367  N N     . TYR C 1 183 ? 27.763  -9.567  1.318   1.00 63.95  ? 181 TYR C N     1 
ATOM   9368  C CA    . TYR C 1 183 ? 27.003  -10.731 1.732   1.00 65.08  ? 181 TYR C CA    1 
ATOM   9369  C C     . TYR C 1 183 ? 26.335  -11.347 0.522   1.00 69.90  ? 181 TYR C C     1 
ATOM   9370  O O     . TYR C 1 183 ? 25.602  -10.664 -0.188  1.00 72.85  ? 181 TYR C O     1 
ATOM   9371  C CB    . TYR C 1 183 ? 25.929  -10.384 2.774   1.00 66.39  ? 181 TYR C CB    1 
ATOM   9372  C CG    . TYR C 1 183 ? 24.943  -11.521 2.974   1.00 68.39  ? 181 TYR C CG    1 
ATOM   9373  C CD1   . TYR C 1 183 ? 25.334  -12.706 3.595   1.00 68.29  ? 181 TYR C CD1   1 
ATOM   9374  C CD2   . TYR C 1 183 ? 23.641  -11.434 2.510   1.00 69.76  ? 181 TYR C CD2   1 
ATOM   9375  C CE1   . TYR C 1 183 ? 24.453  -13.759 3.756   1.00 67.60  ? 181 TYR C CE1   1 
ATOM   9376  C CE2   . TYR C 1 183 ? 22.748  -12.489 2.676   1.00 72.76  ? 181 TYR C CE2   1 
ATOM   9377  C CZ    . TYR C 1 183 ? 23.164  -13.646 3.295   1.00 70.98  ? 181 TYR C CZ    1 
ATOM   9378  O OH    . TYR C 1 183 ? 22.292  -14.696 3.453   1.00 76.66  ? 181 TYR C OH    1 
ATOM   9379  N N     . GLN C 1 184 ? 26.570  -12.640 0.298   1.00 69.01  ? 182 GLN C N     1 
ATOM   9380  C CA    . GLN C 1 184 ? 25.980  -13.341 -0.836  1.00 69.61  ? 182 GLN C CA    1 
ATOM   9381  C C     . GLN C 1 184 ? 24.758  -14.128 -0.432  1.00 71.99  ? 182 GLN C C     1 
ATOM   9382  O O     . GLN C 1 184 ? 24.841  -15.006 0.416   1.00 74.22  ? 182 GLN C O     1 
ATOM   9383  C CB    . GLN C 1 184 ? 26.999  -14.297 -1.445  1.00 71.81  ? 182 GLN C CB    1 
ATOM   9384  C CG    . GLN C 1 184 ? 28.328  -14.278 -0.711  1.00 72.13  ? 182 GLN C CG    1 
ATOM   9385  C CD    . GLN C 1 184 ? 29.262  -15.378 -1.153  1.00 63.79  ? 182 GLN C CD    1 
ATOM   9386  O OE1   . GLN C 1 184 ? 28.860  -16.294 -1.879  1.00 61.21  ? 182 GLN C OE1   1 
ATOM   9387  N NE2   . GLN C 1 184 ? 30.519  -15.303 -0.703  1.00 56.14  ? 182 GLN C NE2   1 
ATOM   9388  N N     . TYR C 1 185 ? 23.620  -13.825 -1.041  1.00 78.50  ? 183 TYR C N     1 
ATOM   9389  C CA    . TYR C 1 185 ? 22.442  -14.663 -0.832  1.00 87.23  ? 183 TYR C CA    1 
ATOM   9390  C C     . TYR C 1 185 ? 21.883  -15.086 -2.185  1.00 93.59  ? 183 TYR C C     1 
ATOM   9391  O O     . TYR C 1 185 ? 21.400  -14.256 -2.953  1.00 94.64  ? 183 TYR C O     1 
ATOM   9392  C CB    . TYR C 1 185 ? 21.379  -13.946 0.023   1.00 89.32  ? 183 TYR C CB    1 
ATOM   9393  C CG    . TYR C 1 185 ? 20.025  -14.643 0.076   1.00 92.49  ? 183 TYR C CG    1 
ATOM   9394  C CD1   . TYR C 1 185 ? 19.850  -15.821 0.798   1.00 90.56  ? 183 TYR C CD1   1 
ATOM   9395  C CD2   . TYR C 1 185 ? 18.923  -14.116 -0.595  1.00 93.56  ? 183 TYR C CD2   1 
ATOM   9396  C CE1   . TYR C 1 185 ? 18.622  -16.457 0.840   1.00 93.15  ? 183 TYR C CE1   1 
ATOM   9397  C CE2   . TYR C 1 185 ? 17.694  -14.745 -0.556  1.00 96.17  ? 183 TYR C CE2   1 
ATOM   9398  C CZ    . TYR C 1 185 ? 17.548  -15.913 0.163   1.00 99.09  ? 183 TYR C CZ    1 
ATOM   9399  O OH    . TYR C 1 185 ? 16.324  -16.541 0.196   1.00 106.02 ? 183 TYR C OH    1 
ATOM   9400  N N     . MET C 1 186 ? 21.957  -16.378 -2.481  1.00 94.45  ? 184 MET C N     1 
ATOM   9401  C CA    . MET C 1 186 ? 21.577  -16.850 -3.800  1.00 100.09 ? 184 MET C CA    1 
ATOM   9402  C C     . MET C 1 186 ? 22.302  -16.006 -4.850  1.00 102.35 ? 184 MET C C     1 
ATOM   9403  O O     . MET C 1 186 ? 23.502  -15.729 -4.725  1.00 97.54  ? 184 MET C O     1 
ATOM   9404  C CB    . MET C 1 186 ? 20.063  -16.730 -3.995  1.00 102.91 ? 184 MET C CB    1 
ATOM   9405  C CG    . MET C 1 186 ? 19.227  -17.336 -2.871  1.00 107.42 ? 184 MET C CG    1 
ATOM   9406  S SD    . MET C 1 186 ? 19.128  -19.147 -2.868  1.00 124.15 ? 184 MET C SD    1 
ATOM   9407  C CE    . MET C 1 186 ? 18.154  -19.462 -1.392  1.00 114.27 ? 184 MET C CE    1 
ATOM   9408  N N     . ASP C 1 187 ? 21.558  -15.578 -5.865  1.00 103.21 ? 185 ASP C N     1 
ATOM   9409  C CA    . ASP C 1 187 ? 22.111  -14.794 -6.964  1.00 99.60  ? 185 ASP C CA    1 
ATOM   9410  C C     . ASP C 1 187 ? 22.392  -13.342 -6.588  1.00 101.79 ? 185 ASP C C     1 
ATOM   9411  O O     . ASP C 1 187 ? 23.139  -12.652 -7.275  1.00 104.28 ? 185 ASP C O     1 
ATOM   9412  C CB    . ASP C 1 187 ? 21.179  -14.850 -8.179  1.00 104.60 ? 185 ASP C CB    1 
ATOM   9413  C CG    . ASP C 1 187 ? 19.726  -14.563 -7.826  1.00 108.34 ? 185 ASP C CG    1 
ATOM   9414  O OD1   . ASP C 1 187 ? 19.298  -14.888 -6.695  1.00 109.07 ? 185 ASP C OD1   1 
ATOM   9415  O OD2   . ASP C 1 187 ? 19.005  -14.018 -8.691  1.00 107.50 ? 185 ASP C OD2   1 
ATOM   9416  N N     . ASP C 1 188 ? 21.788  -12.883 -5.497  1.00 101.90 ? 186 ASP C N     1 
ATOM   9417  C CA    . ASP C 1 188 ? 21.920  -11.494 -5.064  1.00 98.07  ? 186 ASP C CA    1 
ATOM   9418  C C     . ASP C 1 188 ? 23.204  -11.266 -4.261  1.00 88.45  ? 186 ASP C C     1 
ATOM   9419  O O     . ASP C 1 188 ? 23.672  -12.161 -3.547  1.00 87.08  ? 186 ASP C O     1 
ATOM   9420  C CB    . ASP C 1 188 ? 20.694  -11.067 -4.238  1.00 98.44  ? 186 ASP C CB    1 
ATOM   9421  C CG    . ASP C 1 188 ? 19.388  -11.111 -5.037  1.00 100.97 ? 186 ASP C CG    1 
ATOM   9422  O OD1   . ASP C 1 188 ? 18.731  -12.178 -5.107  1.00 99.29  ? 186 ASP C OD1   1 
ATOM   9423  O OD2   . ASP C 1 188 ? 19.007  -10.057 -5.580  1.00 105.45 ? 186 ASP C OD2   1 
ATOM   9424  N N     . LEU C 1 189 ? 23.759  -10.063 -4.386  1.00 84.29  ? 187 LEU C N     1 
ATOM   9425  C CA    . LEU C 1 189 ? 24.942  -9.653  -3.631  1.00 80.95  ? 187 LEU C CA    1 
ATOM   9426  C C     . LEU C 1 189 ? 24.736  -8.296  -2.968  1.00 80.69  ? 187 LEU C C     1 
ATOM   9427  O O     . LEU C 1 189 ? 24.386  -7.328  -3.629  1.00 86.87  ? 187 LEU C O     1 
ATOM   9428  C CB    . LEU C 1 189 ? 26.138  -9.542  -4.561  1.00 83.27  ? 187 LEU C CB    1 
ATOM   9429  C CG    . LEU C 1 189 ? 27.043  -10.743 -4.790  1.00 82.50  ? 187 LEU C CG    1 
ATOM   9430  C CD1   . LEU C 1 189 ? 27.656  -10.678 -6.189  1.00 81.41  ? 187 LEU C CD1   1 
ATOM   9431  C CD2   . LEU C 1 189 ? 28.122  -10.780 -3.723  1.00 78.12  ? 187 LEU C CD2   1 
ATOM   9432  N N     . TYR C 1 190 ? 24.971  -8.211  -1.669  1.00 73.80  ? 188 TYR C N     1 
ATOM   9433  C CA    . TYR C 1 190 ? 24.755  -6.958  -0.973  1.00 71.45  ? 188 TYR C CA    1 
ATOM   9434  C C     . TYR C 1 190 ? 26.099  -6.393  -0.487  1.00 74.87  ? 188 TYR C C     1 
ATOM   9435  O O     . TYR C 1 190 ? 26.827  -7.050  0.253   1.00 71.22  ? 188 TYR C O     1 
ATOM   9436  C CB    . TYR C 1 190 ? 23.776  -7.154  0.192   1.00 71.13  ? 188 TYR C CB    1 
ATOM   9437  C CG    . TYR C 1 190 ? 22.382  -7.674  -0.174  1.00 75.61  ? 188 TYR C CG    1 
ATOM   9438  C CD1   . TYR C 1 190 ? 21.256  -6.862  -0.065  1.00 78.22  ? 188 TYR C CD1   1 
ATOM   9439  C CD2   . TYR C 1 190 ? 22.187  -8.981  -0.593  1.00 78.93  ? 188 TYR C CD2   1 
ATOM   9440  C CE1   . TYR C 1 190 ? 19.987  -7.333  -0.382  1.00 74.51  ? 188 TYR C CE1   1 
ATOM   9441  C CE2   . TYR C 1 190 ? 20.920  -9.457  -0.912  1.00 80.39  ? 188 TYR C CE2   1 
ATOM   9442  C CZ    . TYR C 1 190 ? 19.828  -8.629  -0.803  1.00 78.07  ? 188 TYR C CZ    1 
ATOM   9443  O OH    . TYR C 1 190 ? 18.578  -9.112  -1.120  1.00 80.24  ? 188 TYR C OH    1 
ATOM   9444  N N     . VAL C 1 191 ? 26.434  -5.178  -0.918  1.00 77.92  ? 189 VAL C N     1 
ATOM   9445  C CA    . VAL C 1 191 ? 27.712  -4.550  -0.566  1.00 76.06  ? 189 VAL C CA    1 
ATOM   9446  C C     . VAL C 1 191 ? 27.493  -3.295  0.246   1.00 76.71  ? 189 VAL C C     1 
ATOM   9447  O O     . VAL C 1 191 ? 26.539  -2.580  0.024   1.00 79.15  ? 189 VAL C O     1 
ATOM   9448  C CB    . VAL C 1 191 ? 28.495  -4.114  -1.826  1.00 78.03  ? 189 VAL C CB    1 
ATOM   9449  C CG1   . VAL C 1 191 ? 29.870  -3.544  -1.448  1.00 73.61  ? 189 VAL C CG1   1 
ATOM   9450  C CG2   . VAL C 1 191 ? 28.628  -5.267  -2.810  1.00 74.41  ? 189 VAL C CG2   1 
ATOM   9451  N N     . GLY C 1 192 ? 28.385  -2.992  1.171   1.00 75.24  ? 190 GLY C N     1 
ATOM   9452  C CA    . GLY C 1 192 ? 28.229  -1.749  1.893   1.00 78.56  ? 190 GLY C CA    1 
ATOM   9453  C C     . GLY C 1 192 ? 29.522  -1.196  2.433   1.00 82.26  ? 190 GLY C C     1 
ATOM   9454  O O     . GLY C 1 192 ? 30.461  -1.945  2.697   1.00 77.21  ? 190 GLY C O     1 
ATOM   9455  N N     . SER C 1 193 ? 29.559  0.125   2.612   1.00 92.46  ? 191 SER C N     1 
ATOM   9456  C CA    . SER C 1 193 ? 30.728  0.773   3.204   1.00 93.53  ? 191 SER C CA    1 
ATOM   9457  C C     . SER C 1 193 ? 30.399  2.092   3.870   1.00 93.57  ? 191 SER C C     1 
ATOM   9458  O O     . SER C 1 193 ? 29.255  2.571   3.851   1.00 92.20  ? 191 SER C O     1 
ATOM   9459  C CB    . SER C 1 193 ? 31.809  1.027   2.154   1.00 95.73  ? 191 SER C CB    1 
ATOM   9460  O OG    . SER C 1 193 ? 31.467  2.133   1.336   1.00 100.30 ? 191 SER C OG    1 
ATOM   9461  N N     . ASP C 1 194 ? 31.432  2.655   4.478   1.00 96.93  ? 192 ASP C N     1 
ATOM   9462  C CA    . ASP C 1 194 ? 31.371  3.981   5.062   1.00 107.06 ? 192 ASP C CA    1 
ATOM   9463  C C     . ASP C 1 194 ? 31.978  5.083   4.172   1.00 114.07 ? 192 ASP C C     1 
ATOM   9464  O O     . ASP C 1 194 ? 32.130  6.227   4.605   1.00 117.00 ? 192 ASP C O     1 
ATOM   9465  C CB    . ASP C 1 194 ? 31.932  3.971   6.484   1.00 107.76 ? 192 ASP C CB    1 
ATOM   9466  C CG    . ASP C 1 194 ? 31.036  3.204   7.456   1.00 100.46 ? 192 ASP C CG    1 
ATOM   9467  O OD1   . ASP C 1 194 ? 29.843  2.987   7.147   1.00 91.57  ? 192 ASP C OD1   1 
ATOM   9468  O OD2   . ASP C 1 194 ? 31.526  2.821   8.537   1.00 104.02 ? 192 ASP C OD2   1 
ATOM   9469  N N     . LEU C 1 195 ? 32.357  4.723   2.946   1.00 116.40 ? 193 LEU C N     1 
ATOM   9470  C CA    . LEU C 1 195 ? 32.849  5.697   1.968   1.00 118.27 ? 193 LEU C CA    1 
ATOM   9471  C C     . LEU C 1 195 ? 31.747  6.678   1.545   1.00 123.53 ? 193 LEU C C     1 
ATOM   9472  O O     . LEU C 1 195 ? 30.549  6.384   1.677   1.00 118.25 ? 193 LEU C O     1 
ATOM   9473  C CB    . LEU C 1 195 ? 33.406  4.995   0.722   1.00 116.19 ? 193 LEU C CB    1 
ATOM   9474  C CG    . LEU C 1 195 ? 34.455  3.887   0.840   1.00 111.79 ? 193 LEU C CG    1 
ATOM   9475  C CD1   . LEU C 1 195 ? 34.918  3.485   -0.547  1.00 110.38 ? 193 LEU C CD1   1 
ATOM   9476  C CD2   . LEU C 1 195 ? 35.638  4.312   1.693   1.00 108.21 ? 193 LEU C CD2   1 
ATOM   9477  N N     . GLU C 1 196 ? 32.166  7.837   1.034   1.00 127.99 ? 194 GLU C N     1 
ATOM   9478  C CA    . GLU C 1 196 ? 31.251  8.866   0.535   1.00 129.97 ? 194 GLU C CA    1 
ATOM   9479  C C     . GLU C 1 196 ? 30.516  8.392   -0.713  1.00 128.36 ? 194 GLU C C     1 
ATOM   9480  O O     . GLU C 1 196 ? 31.122  7.785   -1.594  1.00 128.79 ? 194 GLU C O     1 
ATOM   9481  C CB    . GLU C 1 196 ? 32.017  10.155  0.243   1.00 132.65 ? 194 GLU C CB    1 
ATOM   9482  C CG    . GLU C 1 196 ? 32.746  10.712  1.458   1.00 136.01 ? 194 GLU C CG    1 
ATOM   9483  C CD    . GLU C 1 196 ? 31.805  11.019  2.616   1.00 139.94 ? 194 GLU C CD    1 
ATOM   9484  O OE1   . GLU C 1 196 ? 30.579  11.121  2.384   1.00 139.36 ? 194 GLU C OE1   1 
ATOM   9485  O OE2   . GLU C 1 196 ? 32.292  11.158  3.761   1.00 141.69 ? 194 GLU C OE2   1 
ATOM   9486  N N     . ILE C 1 197 ? 29.225  8.704   -0.802  1.00 127.84 ? 195 ILE C N     1 
ATOM   9487  C CA    . ILE C 1 197 ? 28.324  8.050   -1.760  1.00 128.76 ? 195 ILE C CA    1 
ATOM   9488  C C     . ILE C 1 197 ? 28.873  7.967   -3.188  1.00 129.26 ? 195 ILE C C     1 
ATOM   9489  O O     . ILE C 1 197 ? 28.569  7.026   -3.924  1.00 126.06 ? 195 ILE C O     1 
ATOM   9490  C CB    . ILE C 1 197 ? 26.926  8.700   -1.767  1.00 130.24 ? 195 ILE C CB    1 
ATOM   9491  C CG1   . ILE C 1 197 ? 25.976  7.916   -2.675  1.00 136.27 ? 195 ILE C CG1   1 
ATOM   9492  C CG2   . ILE C 1 197 ? 27.013  10.152  -2.204  1.00 130.66 ? 195 ILE C CG2   1 
ATOM   9493  C CD1   . ILE C 1 197 ? 24.577  8.482   -2.716  1.00 144.11 ? 195 ILE C CD1   1 
ATOM   9494  N N     . GLY C 1 198 ? 29.667  8.957   -3.578  1.00 131.43 ? 196 GLY C N     1 
ATOM   9495  C CA    . GLY C 1 198 ? 30.329  8.930   -4.868  1.00 129.11 ? 196 GLY C CA    1 
ATOM   9496  C C     . GLY C 1 198 ? 31.465  7.923   -4.909  1.00 124.16 ? 196 GLY C C     1 
ATOM   9497  O O     . GLY C 1 198 ? 31.564  7.133   -5.845  1.00 121.86 ? 196 GLY C O     1 
ATOM   9498  N N     . GLN C 1 199 ? 32.320  7.952   -3.887  1.00 124.41 ? 197 GLN C N     1 
ATOM   9499  C CA    . GLN C 1 199 ? 33.454  7.034   -3.788  1.00 123.23 ? 197 GLN C CA    1 
ATOM   9500  C C     . GLN C 1 199 ? 33.007  5.601   -3.556  1.00 119.13 ? 197 GLN C C     1 
ATOM   9501  O O     . GLN C 1 199 ? 33.756  4.655   -3.787  1.00 114.63 ? 197 GLN C O     1 
ATOM   9502  C CB    . GLN C 1 199 ? 34.354  7.449   -2.640  1.00 123.63 ? 197 GLN C CB    1 
ATOM   9503  C CG    . GLN C 1 199 ? 34.458  8.932   -2.473  1.00 128.01 ? 197 GLN C CG    1 
ATOM   9504  C CD    . GLN C 1 199 ? 35.659  9.295   -1.651  1.00 135.66 ? 197 GLN C CD    1 
ATOM   9505  O OE1   . GLN C 1 199 ? 36.452  8.424   -1.281  1.00 134.01 ? 197 GLN C OE1   1 
ATOM   9506  N NE2   . GLN C 1 199 ? 35.814  10.581  -1.359  1.00 138.12 ? 197 GLN C NE2   1 
ATOM   9507  N N     . HIS C 1 200 ? 31.785  5.459   -3.064  1.00 120.40 ? 198 HIS C N     1 
ATOM   9508  C CA    . HIS C 1 200 ? 31.169  4.160   -2.881  1.00 115.19 ? 198 HIS C CA    1 
ATOM   9509  C C     . HIS C 1 200 ? 30.814  3.573   -4.245  1.00 112.27 ? 198 HIS C C     1 
ATOM   9510  O O     . HIS C 1 200 ? 31.131  2.424   -4.537  1.00 110.31 ? 198 HIS C O     1 
ATOM   9511  C CB    . HIS C 1 200 ? 29.920  4.295   -2.002  1.00 115.16 ? 198 HIS C CB    1 
ATOM   9512  C CG    . HIS C 1 200 ? 29.124  3.033   -1.879  1.00 105.03 ? 198 HIS C CG    1 
ATOM   9513  N ND1   . HIS C 1 200 ? 29.374  2.087   -0.907  1.00 95.26  ? 198 HIS C ND1   1 
ATOM   9514  C CD2   . HIS C 1 200 ? 28.090  2.561   -2.611  1.00 101.77 ? 198 HIS C CD2   1 
ATOM   9515  C CE1   . HIS C 1 200 ? 28.526  1.086   -1.050  1.00 94.63  ? 198 HIS C CE1   1 
ATOM   9516  N NE2   . HIS C 1 200 ? 27.736  1.346   -2.075  1.00 96.09  ? 198 HIS C NE2   1 
ATOM   9517  N N     . ARG C 1 201 ? 30.169  4.374   -5.084  1.00 114.59 ? 199 ARG C N     1 
ATOM   9518  C CA    . ARG C 1 201 ? 29.776  3.933   -6.416  1.00 114.11 ? 199 ARG C CA    1 
ATOM   9519  C C     . ARG C 1 201 ? 30.988  3.665   -7.302  1.00 112.72 ? 199 ARG C C     1 
ATOM   9520  O O     . ARG C 1 201 ? 30.887  2.949   -8.297  1.00 108.83 ? 199 ARG C O     1 
ATOM   9521  C CB    . ARG C 1 201 ? 28.871  4.974   -7.057  1.00 120.48 ? 199 ARG C CB    1 
ATOM   9522  C CG    . ARG C 1 201 ? 27.701  5.335   -6.183  1.00 125.50 ? 199 ARG C CG    1 
ATOM   9523  C CD    . ARG C 1 201 ? 27.021  6.595   -6.660  1.00 135.27 ? 199 ARG C CD    1 
ATOM   9524  N NE    . ARG C 1 201 ? 25.766  6.822   -5.950  1.00 144.71 ? 199 ARG C NE    1 
ATOM   9525  C CZ    . ARG C 1 201 ? 24.892  7.771   -6.267  1.00 148.88 ? 199 ARG C CZ    1 
ATOM   9526  N NH1   . ARG C 1 201 ? 25.138  8.584   -7.287  1.00 150.85 ? 199 ARG C NH1   1 
ATOM   9527  N NH2   . ARG C 1 201 ? 23.772  7.907   -5.570  1.00 150.73 ? 199 ARG C NH2   1 
ATOM   9528  N N     . THR C 1 202 ? 32.127  4.255   -6.938  1.00 114.50 ? 200 THR C N     1 
ATOM   9529  C CA    . THR C 1 202 ? 33.409  3.951   -7.573  1.00 112.56 ? 200 THR C CA    1 
ATOM   9530  C C     . THR C 1 202 ? 33.710  2.471   -7.398  1.00 110.17 ? 200 THR C C     1 
ATOM   9531  O O     . THR C 1 202 ? 33.971  1.751   -8.367  1.00 107.11 ? 200 THR C O     1 
ATOM   9532  C CB    . THR C 1 202 ? 34.573  4.752   -6.928  1.00 115.92 ? 200 THR C CB    1 
ATOM   9533  O OG1   . THR C 1 202 ? 34.512  6.126   -7.335  1.00 117.79 ? 200 THR C OG1   1 
ATOM   9534  C CG2   . THR C 1 202 ? 35.925  4.168   -7.328  1.00 110.91 ? 200 THR C CG2   1 
ATOM   9535  N N     . LYS C 1 203 ? 33.665  2.032   -6.142  1.00 112.45 ? 201 LYS C N     1 
ATOM   9536  C CA    . LYS C 1 203 ? 33.932  0.648   -5.772  1.00 106.83 ? 201 LYS C CA    1 
ATOM   9537  C C     . LYS C 1 203 ? 32.852  -0.318  -6.248  1.00 99.73  ? 201 LYS C C     1 
ATOM   9538  O O     . LYS C 1 203 ? 33.137  -1.474  -6.510  1.00 98.11  ? 201 LYS C O     1 
ATOM   9539  C CB    . LYS C 1 203 ? 34.097  0.534   -4.260  1.00 104.12 ? 201 LYS C CB    1 
ATOM   9540  C CG    . LYS C 1 203 ? 35.275  1.295   -3.705  1.00 106.82 ? 201 LYS C CG    1 
ATOM   9541  C CD    . LYS C 1 203 ? 36.563  0.564   -3.978  1.00 109.15 ? 201 LYS C CD    1 
ATOM   9542  C CE    . LYS C 1 203 ? 37.719  1.211   -3.240  1.00 112.45 ? 201 LYS C CE    1 
ATOM   9543  N NZ    . LYS C 1 203 ? 39.007  0.542   -3.576  1.00 115.91 ? 201 LYS C NZ    1 
ATOM   9544  N N     . ILE C 1 204 ? 31.614  0.144   -6.351  1.00 99.64  ? 202 ILE C N     1 
ATOM   9545  C CA    . ILE C 1 204 ? 30.542  -0.714  -6.845  1.00 101.82 ? 202 ILE C CA    1 
ATOM   9546  C C     . ILE C 1 204 ? 30.745  -1.014  -8.322  1.00 104.46 ? 202 ILE C C     1 
ATOM   9547  O O     . ILE C 1 204 ? 30.349  -2.070  -8.817  1.00 101.18 ? 202 ILE C O     1 
ATOM   9548  C CB    . ILE C 1 204 ? 29.152  -0.087  -6.633  1.00 105.15 ? 202 ILE C CB    1 
ATOM   9549  C CG1   . ILE C 1 204 ? 28.833  0.004   -5.138  1.00 104.81 ? 202 ILE C CG1   1 
ATOM   9550  C CG2   . ILE C 1 204 ? 28.075  -0.888  -7.363  1.00 102.18 ? 202 ILE C CG2   1 
ATOM   9551  C CD1   . ILE C 1 204 ? 28.745  -1.336  -4.442  1.00 97.02  ? 202 ILE C CD1   1 
ATOM   9552  N N     . GLU C 1 205 ? 31.354  -0.066  -9.028  1.00 109.99 ? 203 GLU C N     1 
ATOM   9553  C CA    . GLU C 1 205 ? 31.703  -0.261  -10.430 1.00 109.13 ? 203 GLU C CA    1 
ATOM   9554  C C     . GLU C 1 205 ? 32.974  -1.104  -10.544 1.00 102.83 ? 203 GLU C C     1 
ATOM   9555  O O     . GLU C 1 205 ? 33.029  -2.070  -11.300 1.00 102.51 ? 203 GLU C O     1 
ATOM   9556  C CB    . GLU C 1 205 ? 31.868  1.092   -11.133 1.00 109.74 ? 203 GLU C CB    1 
ATOM   9557  C CG    . GLU C 1 205 ? 31.708  1.021   -12.640 1.00 111.93 ? 203 GLU C CG    1 
ATOM   9558  C CD    . GLU C 1 205 ? 30.550  0.130   -13.052 1.00 115.78 ? 203 GLU C CD    1 
ATOM   9559  O OE1   . GLU C 1 205 ? 29.530  0.090   -12.330 1.00 113.29 ? 203 GLU C OE1   1 
ATOM   9560  O OE2   . GLU C 1 205 ? 30.666  -0.542  -14.096 1.00 118.70 ? 203 GLU C OE2   1 
ATOM   9561  N N     . GLU C 1 206 ? 33.982  -0.738  -9.764  1.00 99.29  ? 204 GLU C N     1 
ATOM   9562  C CA    . GLU C 1 206 ? 35.237  -1.468  -9.723  1.00 99.80  ? 204 GLU C CA    1 
ATOM   9563  C C     . GLU C 1 206 ? 35.049  -2.961  -9.427  1.00 99.97  ? 204 GLU C C     1 
ATOM   9564  O O     . GLU C 1 206 ? 35.763  -3.801  -9.972  1.00 99.41  ? 204 GLU C O     1 
ATOM   9565  C CB    . GLU C 1 206 ? 36.150  -0.824  -8.689  1.00 99.63  ? 204 GLU C CB    1 
ATOM   9566  C CG    . GLU C 1 206 ? 37.489  -1.485  -8.524  1.00 102.30 ? 204 GLU C CG    1 
ATOM   9567  C CD    . GLU C 1 206 ? 38.367  -0.705  -7.571  1.00 113.36 ? 204 GLU C CD    1 
ATOM   9568  O OE1   . GLU C 1 206 ? 38.115  0.510   -7.408  1.00 113.61 ? 204 GLU C OE1   1 
ATOM   9569  O OE2   . GLU C 1 206 ? 39.296  -1.300  -6.977  1.00 114.44 ? 204 GLU C OE2   1 
ATOM   9570  N N     . LEU C 1 207 ? 34.099  -3.281  -8.551  1.00 99.00  ? 205 LEU C N     1 
ATOM   9571  C CA    . LEU C 1 207 ? 33.732  -4.667  -8.252  1.00 95.91  ? 205 LEU C CA    1 
ATOM   9572  C C     . LEU C 1 207 ? 32.795  -5.224  -9.305  1.00 95.89  ? 205 LEU C C     1 
ATOM   9573  O O     . LEU C 1 207 ? 32.732  -6.430  -9.518  1.00 93.79  ? 205 LEU C O     1 
ATOM   9574  C CB    . LEU C 1 207 ? 33.053  -4.778  -6.877  1.00 98.84  ? 205 LEU C CB    1 
ATOM   9575  C CG    . LEU C 1 207 ? 32.415  -6.126  -6.498  1.00 93.40  ? 205 LEU C CG    1 
ATOM   9576  C CD1   . LEU C 1 207 ? 33.032  -6.653  -5.227  1.00 87.13  ? 205 LEU C CD1   1 
ATOM   9577  C CD2   . LEU C 1 207 ? 30.893  -6.041  -6.360  1.00 86.36  ? 205 LEU C CD2   1 
ATOM   9578  N N     . ARG C 1 208 ? 32.034  -4.339  -9.935  1.00 100.43 ? 206 ARG C N     1 
ATOM   9579  C CA    . ARG C 1 208 ? 31.115  -4.743  -10.979 1.00 99.85  ? 206 ARG C CA    1 
ATOM   9580  C C     . ARG C 1 208 ? 31.973  -5.360  -12.068 1.00 97.69  ? 206 ARG C C     1 
ATOM   9581  O O     . ARG C 1 208 ? 31.529  -6.250  -12.794 1.00 96.65  ? 206 ARG C O     1 
ATOM   9582  C CB    . ARG C 1 208 ? 30.364  -3.522  -11.508 1.00 106.17 ? 206 ARG C CB    1 
ATOM   9583  C CG    . ARG C 1 208 ? 28.942  -3.785  -11.960 1.00 111.67 ? 206 ARG C CG    1 
ATOM   9584  C CD    . ARG C 1 208 ? 28.387  -2.585  -12.718 1.00 118.56 ? 206 ARG C CD    1 
ATOM   9585  N NE    . ARG C 1 208 ? 26.953  -2.688  -12.985 1.00 130.00 ? 206 ARG C NE    1 
ATOM   9586  C CZ    . ARG C 1 208 ? 26.202  -1.679  -13.422 1.00 135.11 ? 206 ARG C CZ    1 
ATOM   9587  N NH1   . ARG C 1 208 ? 26.746  -0.489  -13.641 1.00 134.27 ? 206 ARG C NH1   1 
ATOM   9588  N NH2   . ARG C 1 208 ? 24.907  -1.855  -13.636 1.00 138.00 ? 206 ARG C NH2   1 
ATOM   9589  N N     . GLN C 1 209 ? 33.214  -4.883  -12.156 1.00 94.65  ? 207 GLN C N     1 
ATOM   9590  C CA    . GLN C 1 209 ? 34.170  -5.329  -13.165 1.00 96.17  ? 207 GLN C CA    1 
ATOM   9591  C C     . GLN C 1 209 ? 34.770  -6.696  -12.875 1.00 91.38  ? 207 GLN C C     1 
ATOM   9592  O O     . GLN C 1 209 ? 34.796  -7.571  -13.734 1.00 89.61  ? 207 GLN C O     1 
ATOM   9593  C CB    . GLN C 1 209 ? 35.297  -4.304  -13.325 1.00 100.09 ? 207 GLN C CB    1 
ATOM   9594  C CG    . GLN C 1 209 ? 34.875  -3.026  -14.040 1.00 108.18 ? 207 GLN C CG    1 
ATOM   9595  C CD    . GLN C 1 209 ? 34.045  -3.288  -15.307 1.00 116.07 ? 207 GLN C CD    1 
ATOM   9596  O OE1   . GLN C 1 209 ? 34.258  -4.276  -16.026 1.00 112.76 ? 207 GLN C OE1   1 
ATOM   9597  N NE2   . GLN C 1 209 ? 33.088  -2.399  -15.576 1.00 116.60 ? 207 GLN C NE2   1 
ATOM   9598  N N     . HIS C 1 210 ? 35.249  -6.864  -11.652 1.00 90.27  ? 208 HIS C N     1 
ATOM   9599  C CA    . HIS C 1 210 ? 35.845  -8.106  -11.201 1.00 85.26  ? 208 HIS C CA    1 
ATOM   9600  C C     . HIS C 1 210 ? 34.968  -9.282  -11.595 1.00 83.56  ? 208 HIS C C     1 
ATOM   9601  O O     . HIS C 1 210 ? 35.467  -10.303 -12.050 1.00 80.02  ? 208 HIS C O     1 
ATOM   9602  C CB    . HIS C 1 210 ? 35.952  -8.057  -9.683  1.00 88.05  ? 208 HIS C CB    1 
ATOM   9603  C CG    . HIS C 1 210 ? 37.027  -8.919  -9.116  1.00 85.13  ? 208 HIS C CG    1 
ATOM   9604  N ND1   . HIS C 1 210 ? 38.364  -8.597  -9.201  1.00 86.67  ? 208 HIS C ND1   1 
ATOM   9605  C CD2   . HIS C 1 210 ? 36.964  -10.084 -8.420  1.00 79.40  ? 208 HIS C CD2   1 
ATOM   9606  C CE1   . HIS C 1 210 ? 39.081  -9.530  -8.600  1.00 87.39  ? 208 HIS C CE1   1 
ATOM   9607  N NE2   . HIS C 1 210 ? 38.249  -10.443 -8.119  1.00 84.16  ? 208 HIS C NE2   1 
ATOM   9608  N N     . LEU C 1 211 ? 33.659  -9.123  -11.418 1.00 86.09  ? 209 LEU C N     1 
ATOM   9609  C CA    . LEU C 1 211 ? 32.680  -10.178 -11.695 1.00 88.08  ? 209 LEU C CA    1 
ATOM   9610  C C     . LEU C 1 211 ? 32.507  -10.471 -13.183 1.00 87.16  ? 209 LEU C C     1 
ATOM   9611  O O     . LEU C 1 211 ? 32.154  -11.588 -13.565 1.00 84.49  ? 209 LEU C O     1 
ATOM   9612  C CB    . LEU C 1 211 ? 31.312  -9.822  -11.103 1.00 89.74  ? 209 LEU C CB    1 
ATOM   9613  C CG    . LEU C 1 211 ? 31.159  -9.722  -9.591  1.00 86.12  ? 209 LEU C CG    1 
ATOM   9614  C CD1   . LEU C 1 211 ? 29.685  -9.726  -9.240  1.00 87.62  ? 209 LEU C CD1   1 
ATOM   9615  C CD2   . LEU C 1 211 ? 31.868  -10.882 -8.930  1.00 86.85  ? 209 LEU C CD2   1 
ATOM   9616  N N     . LEU C 1 212 ? 32.720  -9.452  -14.012 1.00 90.74  ? 210 LEU C N     1 
ATOM   9617  C CA    . LEU C 1 212 ? 32.739  -9.623  -15.463 1.00 90.74  ? 210 LEU C CA    1 
ATOM   9618  C C     . LEU C 1 212 ? 33.913  -10.509 -15.874 1.00 86.39  ? 210 LEU C C     1 
ATOM   9619  O O     . LEU C 1 212 ? 33.772  -11.454 -16.653 1.00 81.04  ? 210 LEU C O     1 
ATOM   9620  C CB    . LEU C 1 212 ? 32.918  -8.264  -16.152 1.00 93.22  ? 210 LEU C CB    1 
ATOM   9621  C CG    . LEU C 1 212 ? 32.746  -8.218  -17.674 1.00 99.62  ? 210 LEU C CG    1 
ATOM   9622  C CD1   . LEU C 1 212 ? 31.274  -8.417  -18.044 1.00 96.57  ? 210 LEU C CD1   1 
ATOM   9623  C CD2   . LEU C 1 212 ? 33.296  -6.913  -18.261 1.00 100.04 ? 210 LEU C CD2   1 
ATOM   9624  N N     . ARG C 1 213 ? 35.061  -10.227 -15.273 1.00 85.28  ? 211 ARG C N     1 
ATOM   9625  C CA    . ARG C 1 213 ? 36.303  -10.879 -15.618 1.00 79.64  ? 211 ARG C CA    1 
ATOM   9626  C C     . ARG C 1 213 ? 36.124  -12.381 -15.473 1.00 77.07  ? 211 ARG C C     1 
ATOM   9627  O O     . ARG C 1 213 ? 36.884  -13.158 -16.038 1.00 79.48  ? 211 ARG C O     1 
ATOM   9628  C CB    . ARG C 1 213 ? 37.404  -10.399 -14.678 1.00 77.72  ? 211 ARG C CB    1 
ATOM   9629  C CG    . ARG C 1 213 ? 38.712  -10.174 -15.361 1.00 81.86  ? 211 ARG C CG    1 
ATOM   9630  C CD    . ARG C 1 213 ? 39.852  -10.678 -14.532 1.00 83.28  ? 211 ARG C CD    1 
ATOM   9631  N NE    . ARG C 1 213 ? 40.153  -9.790  -13.422 1.00 87.90  ? 211 ARG C NE    1 
ATOM   9632  C CZ    . ARG C 1 213 ? 41.315  -9.796  -12.780 1.00 98.49  ? 211 ARG C CZ    1 
ATOM   9633  N NH1   . ARG C 1 213 ? 42.268  -10.645 -13.154 1.00 97.04  ? 211 ARG C NH1   1 
ATOM   9634  N NH2   . ARG C 1 213 ? 41.526  -8.957  -11.770 1.00 104.05 ? 211 ARG C NH2   1 
ATOM   9635  N N     . TRP C 1 214 ? 35.157  -12.784 -14.662 1.00 77.31  ? 212 TRP C N     1 
ATOM   9636  C CA    . TRP C 1 214 ? 34.762  -14.182 -14.565 1.00 76.37  ? 212 TRP C CA    1 
ATOM   9637  C C     . TRP C 1 214 ? 33.490  -14.500 -15.371 1.00 79.33  ? 212 TRP C C     1 
ATOM   9638  O O     . TRP C 1 214 ? 32.977  -15.621 -15.331 1.00 74.18  ? 212 TRP C O     1 
ATOM   9639  C CB    . TRP C 1 214 ? 34.678  -14.632 -13.102 1.00 72.26  ? 212 TRP C CB    1 
ATOM   9640  C CG    . TRP C 1 214 ? 36.016  -15.037 -12.520 1.00 67.54  ? 212 TRP C CG    1 
ATOM   9641  C CD1   . TRP C 1 214 ? 36.523  -16.298 -12.444 1.00 66.39  ? 212 TRP C CD1   1 
ATOM   9642  C CD2   . TRP C 1 214 ? 37.009  -14.175 -11.937 1.00 68.38  ? 212 TRP C CD2   1 
ATOM   9643  N NE1   . TRP C 1 214 ? 37.768  -16.282 -11.857 1.00 67.29  ? 212 TRP C NE1   1 
ATOM   9644  C CE2   . TRP C 1 214 ? 38.087  -14.992 -11.534 1.00 68.48  ? 212 TRP C CE2   1 
ATOM   9645  C CE3   . TRP C 1 214 ? 37.090  -12.800 -11.716 1.00 69.02  ? 212 TRP C CE3   1 
ATOM   9646  C CZ2   . TRP C 1 214 ? 39.224  -14.478 -10.925 1.00 69.23  ? 212 TRP C CZ2   1 
ATOM   9647  C CZ3   . TRP C 1 214 ? 38.221  -12.294 -11.109 1.00 73.43  ? 212 TRP C CZ3   1 
ATOM   9648  C CH2   . TRP C 1 214 ? 39.273  -13.130 -10.720 1.00 73.34  ? 212 TRP C CH2   1 
ATOM   9649  N N     . GLY C 1 215 ? 32.981  -13.507 -16.095 1.00 80.47  ? 213 GLY C N     1 
ATOM   9650  C CA    . GLY C 1 215 ? 31.800  -13.700 -16.922 1.00 81.67  ? 213 GLY C CA    1 
ATOM   9651  C C     . GLY C 1 215 ? 30.508  -13.685 -16.133 1.00 85.84  ? 213 GLY C C     1 
ATOM   9652  O O     . GLY C 1 215 ? 29.595  -14.476 -16.387 1.00 85.48  ? 213 GLY C O     1 
ATOM   9653  N N     . LEU C 1 216 ? 30.447  -12.777 -15.163 1.00 88.15  ? 214 LEU C N     1 
ATOM   9654  C CA    . LEU C 1 216 ? 29.280  -12.606 -14.314 1.00 88.10  ? 214 LEU C CA    1 
ATOM   9655  C C     . LEU C 1 216 ? 28.710  -11.208 -14.533 1.00 95.88  ? 214 LEU C C     1 
ATOM   9656  O O     . LEU C 1 216 ? 29.427  -10.207 -14.490 1.00 94.47  ? 214 LEU C O     1 
ATOM   9657  C CB    . LEU C 1 216 ? 29.646  -12.835 -12.846 1.00 88.62  ? 214 LEU C CB    1 
ATOM   9658  C CG    . LEU C 1 216 ? 30.038  -14.264 -12.448 1.00 83.10  ? 214 LEU C CG    1 
ATOM   9659  C CD1   . LEU C 1 216 ? 30.683  -14.299 -11.079 1.00 77.48  ? 214 LEU C CD1   1 
ATOM   9660  C CD2   . LEU C 1 216 ? 28.834  -15.189 -12.493 1.00 83.47  ? 214 LEU C CD2   1 
ATOM   9661  N N     . THR C 1 217 ? 27.406  -11.155 -14.761 1.00 100.20 ? 215 THR C N     1 
ATOM   9662  C CA    . THR C 1 217 ? 26.752  -9.973  -15.289 1.00 102.86 ? 215 THR C CA    1 
ATOM   9663  C C     . THR C 1 217 ? 25.993  -9.204  -14.219 1.00 108.78 ? 215 THR C C     1 
ATOM   9664  O O     . THR C 1 217 ? 25.120  -9.758  -13.562 1.00 109.83 ? 215 THR C O     1 
ATOM   9665  C CB    . THR C 1 217 ? 25.766  -10.417 -16.354 1.00 105.15 ? 215 THR C CB    1 
ATOM   9666  O OG1   . THR C 1 217 ? 25.261  -11.710 -15.993 1.00 102.44 ? 215 THR C OG1   1 
ATOM   9667  C CG2   . THR C 1 217 ? 26.464  -10.534 -17.697 1.00 102.62 ? 215 THR C CG2   1 
ATOM   9668  N N     . THR C 1 218 ? 26.332  -7.933  -14.034 1.00 113.47 ? 216 THR C N     1 
ATOM   9669  C CA    . THR C 1 218 ? 25.635  -7.095  -13.055 1.00 119.76 ? 216 THR C CA    1 
ATOM   9670  C C     . THR C 1 218 ? 24.914  -5.886  -13.670 1.00 129.27 ? 216 THR C C     1 
ATOM   9671  O O     . THR C 1 218 ? 25.557  -4.907  -14.049 1.00 131.01 ? 216 THR C O     1 
ATOM   9672  C CB    . THR C 1 218 ? 26.615  -6.597  -11.989 1.00 115.35 ? 216 THR C CB    1 
ATOM   9673  O OG1   . THR C 1 218 ? 27.775  -6.064  -12.632 1.00 116.61 ? 216 THR C OG1   1 
ATOM   9674  C CG2   . THR C 1 218 ? 27.050  -7.744  -11.104 1.00 111.74 ? 216 THR C CG2   1 
ATOM   9675  N N     . PRO C 1 219 ? 23.571  -5.938  -13.739 1.00 135.51 ? 217 PRO C N     1 
ATOM   9676  C CA    . PRO C 1 219 ? 22.727  -4.888  -14.338 1.00 142.92 ? 217 PRO C CA    1 
ATOM   9677  C C     . PRO C 1 219 ? 22.671  -3.558  -13.565 1.00 146.65 ? 217 PRO C C     1 
ATOM   9678  O O     . PRO C 1 219 ? 23.035  -3.507  -12.388 1.00 141.28 ? 217 PRO C O     1 
ATOM   9679  C CB    . PRO C 1 219 ? 21.331  -5.531  -14.361 1.00 143.21 ? 217 PRO C CB    1 
ATOM   9680  C CG    . PRO C 1 219 ? 21.584  -7.002  -14.332 1.00 134.63 ? 217 PRO C CG    1 
ATOM   9681  C CD    . PRO C 1 219 ? 22.804  -7.169  -13.472 1.00 131.62 ? 217 PRO C CD    1 
ATOM   9682  N N     . ASP C 1 220 ? 22.238  -2.496  -14.251 1.00 150.82 ? 218 ASP C N     1 
ATOM   9683  C CA    . ASP C 1 220 ? 21.939  -1.200  -13.626 1.00 153.67 ? 218 ASP C CA    1 
ATOM   9684  C C     . ASP C 1 220 ? 20.440  -1.055  -13.337 1.00 156.70 ? 218 ASP C C     1 
ATOM   9685  O O     . ASP C 1 220 ? 19.986  -0.036  -12.807 1.00 155.66 ? 218 ASP C O     1 
ATOM   9686  C CB    . ASP C 1 220 ? 22.417  -0.040  -14.507 1.00 150.87 ? 218 ASP C CB    1 
ATOM   9687  C CG    . ASP C 1 220 ? 22.140  1.321   -13.884 1.00 150.76 ? 218 ASP C CG    1 
ATOM   9688  O OD1   . ASP C 1 220 ? 21.044  1.878   -14.111 1.00 148.87 ? 218 ASP C OD1   1 
ATOM   9689  O OD2   . ASP C 1 220 ? 23.016  1.832   -13.156 1.00 149.09 ? 218 ASP C OD2   1 
ATOM   9690  N N     . LYS C 1 221 ? 19.684  -2.090  -13.696 1.00 159.48 ? 219 LYS C N     1 
ATOM   9691  C CA    . LYS C 1 221 ? 18.237  -2.145  -13.487 1.00 162.07 ? 219 LYS C CA    1 
ATOM   9692  C C     . LYS C 1 221 ? 17.894  -2.182  -11.994 1.00 161.62 ? 219 LYS C C     1 
ATOM   9693  O O     . LYS C 1 221 ? 16.723  -2.129  -11.610 1.00 161.00 ? 219 LYS C O     1 
ATOM   9694  C CB    . LYS C 1 221 ? 17.655  -3.372  -14.207 1.00 163.90 ? 219 LYS C CB    1 
ATOM   9695  C CG    . LYS C 1 221 ? 16.134  -3.421  -14.294 1.00 164.74 ? 219 LYS C CG    1 
ATOM   9696  C CD    . LYS C 1 221 ? 15.669  -4.577  -15.177 1.00 163.45 ? 219 LYS C CD    1 
ATOM   9697  C CE    . LYS C 1 221 ? 16.059  -5.928  -14.595 1.00 160.05 ? 219 LYS C CE    1 
ATOM   9698  N NZ    . LYS C 1 221 ? 15.341  -6.217  -13.323 1.00 156.77 ? 219 LYS C NZ    1 
ATOM   9699  N N     . LYS C 1 222 ? 18.930  -2.269  -11.162 1.00 158.21 ? 220 LYS C N     1 
ATOM   9700  C CA    . LYS C 1 222 ? 18.788  -2.477  -9.723  1.00 155.73 ? 220 LYS C CA    1 
ATOM   9701  C C     . LYS C 1 222 ? 18.253  -1.258  -8.989  1.00 157.70 ? 220 LYS C C     1 
ATOM   9702  O O     . LYS C 1 222 ? 18.045  -0.198  -9.583  1.00 157.24 ? 220 LYS C O     1 
ATOM   9703  C CB    . LYS C 1 222 ? 20.160  -2.793  -9.127  1.00 151.04 ? 220 LYS C CB    1 
ATOM   9704  C CG    . LYS C 1 222 ? 21.179  -1.661  -9.322  1.00 149.36 ? 220 LYS C CG    1 
ATOM   9705  C CD    . LYS C 1 222 ? 22.441  -1.882  -8.499  1.00 137.91 ? 220 LYS C CD    1 
ATOM   9706  C CE    . LYS C 1 222 ? 23.472  -0.780  -8.713  1.00 137.25 ? 220 LYS C CE    1 
ATOM   9707  N NZ    . LYS C 1 222 ? 23.997  -0.769  -10.100 1.00 141.28 ? 220 LYS C NZ    1 
ATOM   9708  N N     . HIS C 1 223 ? 18.061  -1.413  -7.680  1.00 156.41 ? 221 HIS C N     1 
ATOM   9709  C CA    . HIS C 1 223 ? 17.909  -0.265  -6.806  1.00 155.38 ? 221 HIS C CA    1 
ATOM   9710  C C     . HIS C 1 223 ? 19.333  -0.005  -6.361  1.00 153.05 ? 221 HIS C C     1 
ATOM   9711  O O     . HIS C 1 223 ? 19.883  -0.755  -5.549  1.00 143.20 ? 221 HIS C O     1 
ATOM   9712  C CB    . HIS C 1 223 ? 17.044  -0.608  -5.592  1.00 153.58 ? 221 HIS C CB    1 
ATOM   9713  C CG    . HIS C 1 223 ? 15.571  -0.612  -5.870  1.00 160.00 ? 221 HIS C CG    1 
ATOM   9714  N ND1   . HIS C 1 223 ? 14.934  -1.653  -6.513  1.00 162.08 ? 221 HIS C ND1   1 
ATOM   9715  C CD2   . HIS C 1 223 ? 14.607  0.295   -5.581  1.00 160.96 ? 221 HIS C CD2   1 
ATOM   9716  C CE1   . HIS C 1 223 ? 13.644  -1.384  -6.613  1.00 161.64 ? 221 HIS C CE1   1 
ATOM   9717  N NE2   . HIS C 1 223 ? 13.420  -0.208  -6.056  1.00 163.12 ? 221 HIS C NE2   1 
ATOM   9718  N N     . GLN C 1 224 ? 19.921  1.072   -6.879  1.00 156.87 ? 222 GLN C N     1 
ATOM   9719  C CA    . GLN C 1 224 ? 21.366  1.271   -6.775  1.00 154.80 ? 222 GLN C CA    1 
ATOM   9720  C C     . GLN C 1 224 ? 21.746  1.740   -5.371  1.00 150.34 ? 222 GLN C C     1 
ATOM   9721  O O     . GLN C 1 224 ? 22.298  0.970   -4.579  1.00 136.41 ? 222 GLN C O     1 
ATOM   9722  C CB    . GLN C 1 224 ? 21.866  2.254   -7.857  1.00 154.30 ? 222 GLN C CB    1 
ATOM   9723  C CG    . GLN C 1 224 ? 21.487  1.864   -9.306  1.00 155.29 ? 222 GLN C CG    1 
ATOM   9724  C CD    . GLN C 1 224 ? 22.137  2.745   -10.388 1.00 153.59 ? 222 GLN C CD    1 
ATOM   9725  O OE1   . GLN C 1 224 ? 23.164  3.388   -10.161 1.00 148.52 ? 222 GLN C OE1   1 
ATOM   9726  N NE2   . GLN C 1 224 ? 21.530  2.764   -11.572 1.00 150.58 ? 222 GLN C NE2   1 
ATOM   9727  N N     . LYS C 1 225 ? 21.429  2.995   -5.061  1.00 157.98 ? 223 LYS C N     1 
ATOM   9728  C CA    . LYS C 1 225 ? 21.551  3.505   -3.700  1.00 156.45 ? 223 LYS C CA    1 
ATOM   9729  C C     . LYS C 1 225 ? 20.194  3.455   -3.006  1.00 156.44 ? 223 LYS C C     1 
ATOM   9730  O O     . LYS C 1 225 ? 20.065  3.879   -1.857  1.00 155.90 ? 223 LYS C O     1 
ATOM   9731  C CB    . LYS C 1 225 ? 22.096  4.941   -3.682  1.00 155.91 ? 223 LYS C CB    1 
ATOM   9732  C CG    . LYS C 1 225 ? 21.100  6.010   -4.129  1.00 157.15 ? 223 LYS C CG    1 
ATOM   9733  C CD    . LYS C 1 225 ? 21.550  7.395   -3.695  1.00 153.54 ? 223 LYS C CD    1 
ATOM   9734  C CE    . LYS C 1 225 ? 20.745  8.488   -4.370  1.00 151.04 ? 223 LYS C CE    1 
ATOM   9735  N NZ    . LYS C 1 225 ? 21.367  9.818   -4.134  1.00 146.48 ? 223 LYS C NZ    1 
ATOM   9736  N N     . GLU C 1 226 ? 19.186  2.935   -3.707  1.00 156.03 ? 224 GLU C N     1 
ATOM   9737  C CA    . GLU C 1 226 ? 17.802  3.081   -3.262  1.00 155.74 ? 224 GLU C CA    1 
ATOM   9738  C C     . GLU C 1 226 ? 17.283  1.899   -2.430  1.00 147.85 ? 224 GLU C C     1 
ATOM   9739  O O     . GLU C 1 226 ? 16.939  0.847   -2.973  1.00 145.33 ? 224 GLU C O     1 
ATOM   9740  C CB    . GLU C 1 226 ? 16.885  3.310   -4.475  1.00 159.23 ? 224 GLU C CB    1 
ATOM   9741  C CG    . GLU C 1 226 ? 17.540  4.042   -5.659  1.00 160.28 ? 224 GLU C CG    1 
ATOM   9742  C CD    . GLU C 1 226 ? 17.832  5.516   -5.386  1.00 162.60 ? 224 GLU C CD    1 
ATOM   9743  O OE1   . GLU C 1 226 ? 17.407  6.032   -4.329  1.00 159.61 ? 224 GLU C OE1   1 
ATOM   9744  O OE2   . GLU C 1 226 ? 18.488  6.162   -6.235  1.00 163.94 ? 224 GLU C OE2   1 
ATOM   9745  N N     . PRO C 1 227 ? 17.200  2.096   -1.103  1.00 142.18 ? 225 PRO C N     1 
ATOM   9746  C CA    . PRO C 1 227 ? 16.593  1.206   -0.112  1.00 133.71 ? 225 PRO C CA    1 
ATOM   9747  C C     . PRO C 1 227 ? 15.127  1.589   0.093   1.00 132.50 ? 225 PRO C C     1 
ATOM   9748  O O     . PRO C 1 227 ? 14.619  2.439   -0.639  1.00 137.22 ? 225 PRO C O     1 
ATOM   9749  C CB    . PRO C 1 227 ? 17.409  1.500   1.159   1.00 130.22 ? 225 PRO C CB    1 
ATOM   9750  C CG    . PRO C 1 227 ? 18.241  2.752   0.851   1.00 139.07 ? 225 PRO C CG    1 
ATOM   9751  C CD    . PRO C 1 227 ? 17.742  3.296   -0.450  1.00 144.40 ? 225 PRO C CD    1 
ATOM   9752  N N     . PRO C 1 228 ? 14.444  0.961   1.060   1.00 125.18 ? 226 PRO C N     1 
ATOM   9753  C CA    . PRO C 1 228 ? 14.887  -0.216  1.815   1.00 116.52 ? 226 PRO C CA    1 
ATOM   9754  C C     . PRO C 1 228 ? 14.729  -1.493  0.992   1.00 114.86 ? 226 PRO C C     1 
ATOM   9755  O O     . PRO C 1 228 ? 13.781  -1.581  0.207   1.00 115.94 ? 226 PRO C O     1 
ATOM   9756  C CB    . PRO C 1 228 ? 13.942  -0.229  3.021   1.00 114.32 ? 226 PRO C CB    1 
ATOM   9757  C CG    . PRO C 1 228 ? 12.713  0.473   2.550   1.00 117.41 ? 226 PRO C CG    1 
ATOM   9758  C CD    . PRO C 1 228 ? 13.192  1.527   1.597   1.00 121.77 ? 226 PRO C CD    1 
ATOM   9759  N N     . PHE C 1 229 ? 15.621  -2.467  1.165   1.00 109.35 ? 227 PHE C N     1 
ATOM   9760  C CA    . PHE C 1 229 ? 15.486  -3.719  0.416   1.00 105.24 ? 227 PHE C CA    1 
ATOM   9761  C C     . PHE C 1 229 ? 14.627  -4.744  1.156   1.00 101.90 ? 227 PHE C C     1 
ATOM   9762  O O     . PHE C 1 229 ? 14.711  -4.866  2.383   1.00 99.70  ? 227 PHE C O     1 
ATOM   9763  C CB    . PHE C 1 229 ? 16.848  -4.319  0.085   1.00 102.77 ? 227 PHE C CB    1 
ATOM   9764  C CG    . PHE C 1 229 ? 17.779  -3.370  -0.611  1.00 106.92 ? 227 PHE C CG    1 
ATOM   9765  C CD1   . PHE C 1 229 ? 17.654  -3.123  -1.966  1.00 109.26 ? 227 PHE C CD1   1 
ATOM   9766  C CD2   . PHE C 1 229 ? 18.798  -2.737  0.091   1.00 109.39 ? 227 PHE C CD2   1 
ATOM   9767  C CE1   . PHE C 1 229 ? 18.523  -2.252  -2.612  1.00 118.32 ? 227 PHE C CE1   1 
ATOM   9768  C CE2   . PHE C 1 229 ? 19.675  -1.865  -0.548  1.00 111.46 ? 227 PHE C CE2   1 
ATOM   9769  C CZ    . PHE C 1 229 ? 19.537  -1.622  -1.899  1.00 117.11 ? 227 PHE C CZ    1 
ATOM   9770  N N     . LEU C 1 230 ? 13.793  -5.464  0.405   1.00 100.51 ? 228 LEU C N     1 
ATOM   9771  C CA    . LEU C 1 230 ? 12.941  -6.507  0.973   1.00 99.86  ? 228 LEU C CA    1 
ATOM   9772  C C     . LEU C 1 230 ? 13.571  -7.889  0.813   1.00 102.83 ? 228 LEU C C     1 
ATOM   9773  O O     . LEU C 1 230 ? 13.575  -8.457  -0.282  1.00 102.43 ? 228 LEU C O     1 
ATOM   9774  C CB    . LEU C 1 230 ? 11.574  -6.511  0.292   1.00 100.24 ? 228 LEU C CB    1 
ATOM   9775  C CG    . LEU C 1 230 ? 10.553  -5.443  0.682   1.00 104.97 ? 228 LEU C CG    1 
ATOM   9776  C CD1   . LEU C 1 230 ? 11.033  -4.048  0.287   1.00 107.85 ? 228 LEU C CD1   1 
ATOM   9777  C CD2   . LEU C 1 230 ? 9.203   -5.764  0.047   1.00 101.97 ? 228 LEU C CD2   1 
ATOM   9778  N N     . TRP C 1 231 ? 14.051  -8.444  1.926   1.00 103.14 ? 229 TRP C N     1 
ATOM   9779  C CA    . TRP C 1 231 ? 14.829  -9.683  1.918   1.00 97.78  ? 229 TRP C CA    1 
ATOM   9780  C C     . TRP C 1 231 ? 14.467  -10.644 3.045   1.00 92.25  ? 229 TRP C C     1 
ATOM   9781  O O     . TRP C 1 231 ? 14.601  -10.306 4.215   1.00 88.53  ? 229 TRP C O     1 
ATOM   9782  C CB    . TRP C 1 231 ? 16.320  -9.358  1.990   1.00 92.84  ? 229 TRP C CB    1 
ATOM   9783  C CG    . TRP C 1 231 ? 17.170  -10.545 2.281   1.00 91.71  ? 229 TRP C CG    1 
ATOM   9784  C CD1   . TRP C 1 231 ? 17.515  -11.539 1.417   1.00 93.35  ? 229 TRP C CD1   1 
ATOM   9785  C CD2   . TRP C 1 231 ? 17.793  -10.860 3.524   1.00 88.76  ? 229 TRP C CD2   1 
ATOM   9786  N NE1   . TRP C 1 231 ? 18.313  -12.459 2.049   1.00 90.92  ? 229 TRP C NE1   1 
ATOM   9787  C CE2   . TRP C 1 231 ? 18.499  -12.061 3.344   1.00 86.10  ? 229 TRP C CE2   1 
ATOM   9788  C CE3   . TRP C 1 231 ? 17.823  -10.241 4.775   1.00 89.45  ? 229 TRP C CE3   1 
ATOM   9789  C CZ2   . TRP C 1 231 ? 19.228  -12.651 4.360   1.00 85.71  ? 229 TRP C CZ2   1 
ATOM   9790  C CZ3   . TRP C 1 231 ? 18.548  -10.832 5.790   1.00 83.43  ? 229 TRP C CZ3   1 
ATOM   9791  C CH2   . TRP C 1 231 ? 19.240  -12.024 5.578   1.00 82.68  ? 229 TRP C CH2   1 
ATOM   9792  N N     . MET C 1 232 ? 14.028  -11.848 2.688   1.00 95.02  ? 230 MET C N     1 
ATOM   9793  C CA    . MET C 1 232 ? 13.715  -12.871 3.680   1.00 94.68  ? 230 MET C CA    1 
ATOM   9794  C C     . MET C 1 232 ? 12.628  -12.406 4.651   1.00 93.16  ? 230 MET C C     1 
ATOM   9795  O O     . MET C 1 232 ? 12.516  -12.915 5.766   1.00 89.87  ? 230 MET C O     1 
ATOM   9796  C CB    . MET C 1 232 ? 14.980  -13.262 4.457   1.00 93.77  ? 230 MET C CB    1 
ATOM   9797  C CG    . MET C 1 232 ? 15.837  -14.318 3.779   1.00 91.50  ? 230 MET C CG    1 
ATOM   9798  S SD    . MET C 1 232 ? 14.838  -15.747 3.315   1.00 94.08  ? 230 MET C SD    1 
ATOM   9799  C CE    . MET C 1 232 ? 14.043  -16.149 4.867   1.00 97.50  ? 230 MET C CE    1 
ATOM   9800  N N     . GLY C 1 233 ? 11.823  -11.441 4.216   1.00 95.91  ? 231 GLY C N     1 
ATOM   9801  C CA    . GLY C 1 233 ? 10.749  -10.906 5.031   1.00 90.30  ? 231 GLY C CA    1 
ATOM   9802  C C     . GLY C 1 233 ? 11.077  -9.601  5.735   1.00 87.80  ? 231 GLY C C     1 
ATOM   9803  O O     . GLY C 1 233 ? 10.315  -9.161  6.585   1.00 87.96  ? 231 GLY C O     1 
ATOM   9804  N N     . TYR C 1 234 ? 12.184  -8.961  5.369   1.00 87.90  ? 232 TYR C N     1 
ATOM   9805  C CA    . TYR C 1 234 ? 12.642  -7.755  6.064   1.00 87.67  ? 232 TYR C CA    1 
ATOM   9806  C C     . TYR C 1 234 ? 12.626  -6.506  5.179   1.00 95.14  ? 232 TYR C C     1 
ATOM   9807  O O     . TYR C 1 234 ? 12.589  -6.595  3.956   1.00 101.63 ? 232 TYR C O     1 
ATOM   9808  C CB    . TYR C 1 234 ? 14.056  -7.945  6.651   1.00 85.86  ? 232 TYR C CB    1 
ATOM   9809  C CG    . TYR C 1 234 ? 14.149  -8.994  7.739   1.00 77.27  ? 232 TYR C CG    1 
ATOM   9810  C CD1   . TYR C 1 234 ? 14.830  -10.181 7.533   1.00 76.75  ? 232 TYR C CD1   1 
ATOM   9811  C CD2   . TYR C 1 234 ? 13.548  -8.796  8.969   1.00 74.27  ? 232 TYR C CD2   1 
ATOM   9812  C CE1   . TYR C 1 234 ? 14.909  -11.135 8.520   1.00 72.75  ? 232 TYR C CE1   1 
ATOM   9813  C CE2   . TYR C 1 234 ? 13.616  -9.748  9.958   1.00 70.43  ? 232 TYR C CE2   1 
ATOM   9814  C CZ    . TYR C 1 234 ? 14.299  -10.914 9.729   1.00 69.33  ? 232 TYR C CZ    1 
ATOM   9815  O OH    . TYR C 1 234 ? 14.362  -11.863 10.718  1.00 67.03  ? 232 TYR C OH    1 
ATOM   9816  N N     . GLU C 1 235 ? 12.612  -5.346  5.822   1.00 92.27  ? 233 GLU C N     1 
ATOM   9817  C CA    . GLU C 1 235 ? 12.809  -4.061  5.177   1.00 95.04  ? 233 GLU C CA    1 
ATOM   9818  C C     . GLU C 1 235 ? 14.098  -3.490  5.723   1.00 93.41  ? 233 GLU C C     1 
ATOM   9819  O O     . GLU C 1 235 ? 14.195  -3.211  6.930   1.00 93.07  ? 233 GLU C O     1 
ATOM   9820  C CB    . GLU C 1 235 ? 11.679  -3.103  5.535   1.00 99.41  ? 233 GLU C CB    1 
ATOM   9821  C CG    . GLU C 1 235 ? 10.522  -3.060  4.564   1.00 104.70 ? 233 GLU C CG    1 
ATOM   9822  C CD    . GLU C 1 235 ? 9.750   -1.758  4.678   1.00 115.49 ? 233 GLU C CD    1 
ATOM   9823  O OE1   . GLU C 1 235 ? 10.269  -0.812  5.325   1.00 112.83 ? 233 GLU C OE1   1 
ATOM   9824  O OE2   . GLU C 1 235 ? 8.631   -1.680  4.123   1.00 119.41 ? 233 GLU C OE2   1 
ATOM   9825  N N     . LEU C 1 236 ? 15.080  -3.304  4.847   1.00 95.42  ? 234 LEU C N     1 
ATOM   9826  C CA    . LEU C 1 236 ? 16.399  -2.867  5.291   1.00 94.80  ? 234 LEU C CA    1 
ATOM   9827  C C     . LEU C 1 236 ? 16.859  -1.518  4.745   1.00 96.57  ? 234 LEU C C     1 
ATOM   9828  O O     . LEU C 1 236 ? 17.001  -1.330  3.533   1.00 102.81 ? 234 LEU C O     1 
ATOM   9829  C CB    . LEU C 1 236 ? 17.443  -3.949  4.999   1.00 93.88  ? 234 LEU C CB    1 
ATOM   9830  C CG    . LEU C 1 236 ? 17.257  -5.251  5.787   1.00 90.42  ? 234 LEU C CG    1 
ATOM   9831  C CD1   . LEU C 1 236 ? 18.098  -6.382  5.238   1.00 86.85  ? 234 LEU C CD1   1 
ATOM   9832  C CD2   . LEU C 1 236 ? 17.605  -5.018  7.238   1.00 88.17  ? 234 LEU C CD2   1 
ATOM   9833  N N     . HIS C 1 237 ? 17.102  -0.598  5.674   1.00 95.65  ? 235 HIS C N     1 
ATOM   9834  C CA    . HIS C 1 237 ? 17.700  0.698   5.395   1.00 96.45  ? 235 HIS C CA    1 
ATOM   9835  C C     . HIS C 1 237 ? 19.080  0.616   6.048   1.00 90.89  ? 235 HIS C C     1 
ATOM   9836  O O     . HIS C 1 237 ? 19.268  -0.147  6.993   1.00 86.33  ? 235 HIS C O     1 
ATOM   9837  C CB    . HIS C 1 237 ? 16.906  1.848   6.048   1.00 94.46  ? 235 HIS C CB    1 
ATOM   9838  C CG    . HIS C 1 237 ? 15.410  1.707   5.972   1.00 99.17  ? 235 HIS C CG    1 
ATOM   9839  N ND1   . HIS C 1 237 ? 14.629  2.475   5.133   1.00 104.83 ? 235 HIS C ND1   1 
ATOM   9840  C CD2   . HIS C 1 237 ? 14.548  0.924   6.665   1.00 99.38  ? 235 HIS C CD2   1 
ATOM   9841  C CE1   . HIS C 1 237 ? 13.358  2.152   5.293   1.00 105.03 ? 235 HIS C CE1   1 
ATOM   9842  N NE2   . HIS C 1 237 ? 13.280  1.212   6.217   1.00 101.31 ? 235 HIS C NE2   1 
ATOM   9843  N N     . PRO C 1 238 ? 20.058  1.375   5.532   1.00 92.72  ? 236 PRO C N     1 
ATOM   9844  C CA    . PRO C 1 238 ? 21.429  1.371   6.069   1.00 91.46  ? 236 PRO C CA    1 
ATOM   9845  C C     . PRO C 1 238 ? 21.564  1.694   7.566   1.00 89.86  ? 236 PRO C C     1 
ATOM   9846  O O     . PRO C 1 238 ? 22.478  1.165   8.202   1.00 86.07  ? 236 PRO C O     1 
ATOM   9847  C CB    . PRO C 1 238 ? 22.131  2.439   5.223   1.00 91.77  ? 236 PRO C CB    1 
ATOM   9848  C CG    . PRO C 1 238 ? 21.432  2.360   3.908   1.00 93.85  ? 236 PRO C CG    1 
ATOM   9849  C CD    . PRO C 1 238 ? 19.983  2.069   4.234   1.00 96.71  ? 236 PRO C CD    1 
ATOM   9850  N N     . ASP C 1 239 ? 20.749  2.611   8.082   1.00 89.54  ? 237 ASP C N     1 
ATOM   9851  C CA    . ASP C 1 239 ? 20.657  2.882   9.526   1.00 86.61  ? 237 ASP C CA    1 
ATOM   9852  C C     . ASP C 1 239 ? 19.672  2.021   10.373  1.00 85.30  ? 237 ASP C C     1 
ATOM   9853  O O     . ASP C 1 239 ? 19.931  1.738   11.549  1.00 76.13  ? 237 ASP C O     1 
ATOM   9854  C CB    . ASP C 1 239 ? 20.430  4.374   9.757   1.00 90.37  ? 237 ASP C CB    1 
ATOM   9855  C CG    . ASP C 1 239 ? 19.312  4.922   8.907   1.00 95.12  ? 237 ASP C CG    1 
ATOM   9856  O OD1   . ASP C 1 239 ? 18.991  4.297   7.867   1.00 93.64  ? 237 ASP C OD1   1 
ATOM   9857  O OD2   . ASP C 1 239 ? 18.754  5.974   9.283   1.00 98.49  ? 237 ASP C OD2   1 
ATOM   9858  N N     . LYS C 1 240 ? 18.533  1.644   9.789   1.00 86.64  ? 238 LYS C N     1 
ATOM   9859  C CA    . LYS C 1 240 ? 17.477  0.954   10.538  1.00 81.50  ? 238 LYS C CA    1 
ATOM   9860  C C     . LYS C 1 240 ? 16.843  -0.241  9.789   1.00 80.57  ? 238 LYS C C     1 
ATOM   9861  O O     . LYS C 1 240 ? 16.996  -0.374  8.580   1.00 84.06  ? 238 LYS C O     1 
ATOM   9862  C CB    . LYS C 1 240 ? 16.395  1.956   10.945  1.00 82.04  ? 238 LYS C CB    1 
ATOM   9863  C CG    . LYS C 1 240 ? 15.151  1.886   10.088  1.00 88.93  ? 238 LYS C CG    1 
ATOM   9864  C CD    . LYS C 1 240 ? 14.066  2.811   10.590  1.00 97.50  ? 238 LYS C CD    1 
ATOM   9865  C CE    . LYS C 1 240 ? 12.809  2.689   9.738   1.00 100.29 ? 238 LYS C CE    1 
ATOM   9866  N NZ    . LYS C 1 240 ? 11.726  3.553   10.290  1.00 109.99 ? 238 LYS C NZ    1 
ATOM   9867  N N     . TRP C 1 241 ? 16.135  -1.107  10.513  1.00 76.49  ? 239 TRP C N     1 
ATOM   9868  C CA    . TRP C 1 241 ? 15.499  -2.289  9.921   1.00 73.85  ? 239 TRP C CA    1 
ATOM   9869  C C     . TRP C 1 241 ? 14.170  -2.613  10.584  1.00 74.77  ? 239 TRP C C     1 
ATOM   9870  O O     . TRP C 1 241 ? 13.959  -2.312  11.759  1.00 72.14  ? 239 TRP C O     1 
ATOM   9871  C CB    . TRP C 1 241 ? 16.403  -3.528  10.036  1.00 72.62  ? 239 TRP C CB    1 
ATOM   9872  C CG    . TRP C 1 241 ? 16.462  -4.146  11.425  1.00 65.27  ? 239 TRP C CG    1 
ATOM   9873  C CD1   . TRP C 1 241 ? 17.372  -3.863  12.404  1.00 63.26  ? 239 TRP C CD1   1 
ATOM   9874  C CD2   . TRP C 1 241 ? 15.583  -5.141  11.974  1.00 62.30  ? 239 TRP C CD2   1 
ATOM   9875  N NE1   . TRP C 1 241 ? 17.112  -4.610  13.524  1.00 60.37  ? 239 TRP C NE1   1 
ATOM   9876  C CE2   . TRP C 1 241 ? 16.022  -5.403  13.290  1.00 60.30  ? 239 TRP C CE2   1 
ATOM   9877  C CE3   . TRP C 1 241 ? 14.471  -5.828  11.487  1.00 65.63  ? 239 TRP C CE3   1 
ATOM   9878  C CZ2   . TRP C 1 241 ? 15.388  -6.328  14.122  1.00 55.96  ? 239 TRP C CZ2   1 
ATOM   9879  C CZ3   . TRP C 1 241 ? 13.845  -6.752  12.317  1.00 64.57  ? 239 TRP C CZ3   1 
ATOM   9880  C CH2   . TRP C 1 241 ? 14.308  -6.992  13.617  1.00 57.84  ? 239 TRP C CH2   1 
ATOM   9881  N N     . THR C 1 242 ? 13.284  -3.259  9.833   1.00 79.67  ? 240 THR C N     1 
ATOM   9882  C CA    . THR C 1 242 ? 12.010  -3.705  10.399  1.00 79.37  ? 240 THR C CA    1 
ATOM   9883  C C     . THR C 1 242 ? 11.465  -4.887  9.636   1.00 78.92  ? 240 THR C C     1 
ATOM   9884  O O     . THR C 1 242 ? 11.890  -5.145  8.537   1.00 83.16  ? 240 THR C O     1 
ATOM   9885  C CB    . THR C 1 242 ? 10.946  -2.608  10.329  1.00 83.99  ? 240 THR C CB    1 
ATOM   9886  O OG1   . THR C 1 242 ? 9.671   -3.162  10.678  1.00 84.99  ? 240 THR C OG1   1 
ATOM   9887  C CG2   . THR C 1 242 ? 10.867  -2.038  8.922   1.00 86.95  ? 240 THR C CG2   1 
ATOM   9888  N N     . VAL C 1 243 ? 10.515  -5.608  10.205  1.00 79.42  ? 241 VAL C N     1 
ATOM   9889  C CA    . VAL C 1 243 ? 9.846   -6.646  9.438   1.00 81.26  ? 241 VAL C CA    1 
ATOM   9890  C C     . VAL C 1 243 ? 8.968   -5.986  8.397   1.00 85.83  ? 241 VAL C C     1 
ATOM   9891  O O     . VAL C 1 243 ? 8.619   -4.812  8.522   1.00 87.89  ? 241 VAL C O     1 
ATOM   9892  C CB    . VAL C 1 243 ? 8.953   -7.539  10.315  1.00 79.36  ? 241 VAL C CB    1 
ATOM   9893  C CG1   . VAL C 1 243 ? 9.784   -8.277  11.346  1.00 73.44  ? 241 VAL C CG1   1 
ATOM   9894  C CG2   . VAL C 1 243 ? 7.859   -6.715  10.978  1.00 78.91  ? 241 VAL C CG2   1 
ATOM   9895  N N     . GLN C 1 244 ? 8.617   -6.736  7.362   1.00 87.06  ? 242 GLN C N     1 
ATOM   9896  C CA    . GLN C 1 244 ? 7.599   -6.285  6.431   1.00 92.23  ? 242 GLN C CA    1 
ATOM   9897  C C     . GLN C 1 244 ? 6.246   -6.390  7.118   1.00 92.65  ? 242 GLN C C     1 
ATOM   9898  O O     . GLN C 1 244 ? 5.993   -7.342  7.854   1.00 89.97  ? 242 GLN C O     1 
ATOM   9899  C CB    . GLN C 1 244 ? 7.643   -7.100  5.142   1.00 92.27  ? 242 GLN C CB    1 
ATOM   9900  C CG    . GLN C 1 244 ? 8.848   -6.764  4.283   1.00 94.48  ? 242 GLN C CG    1 
ATOM   9901  C CD    . GLN C 1 244 ? 9.208   -7.865  3.308   1.00 96.65  ? 242 GLN C CD    1 
ATOM   9902  O OE1   . GLN C 1 244 ? 8.378   -8.711  2.960   1.00 95.01  ? 242 GLN C OE1   1 
ATOM   9903  N NE2   . GLN C 1 244 ? 10.461  -7.864  2.865   1.00 95.97  ? 242 GLN C NE2   1 
ATOM   9904  N N     . PRO C 1 245 ? 5.377   -5.401  6.884   1.00 94.04  ? 243 PRO C N     1 
ATOM   9905  C CA    . PRO C 1 245 ? 4.131   -5.230  7.637   1.00 96.46  ? 243 PRO C CA    1 
ATOM   9906  C C     . PRO C 1 245 ? 3.307   -6.511  7.687   1.00 95.52  ? 243 PRO C C     1 
ATOM   9907  O O     . PRO C 1 245 ? 3.258   -7.260  6.706   1.00 88.21  ? 243 PRO C O     1 
ATOM   9908  C CB    . PRO C 1 245 ? 3.395   -4.136  6.857   1.00 99.75  ? 243 PRO C CB    1 
ATOM   9909  C CG    . PRO C 1 245 ? 4.031   -4.135  5.499   1.00 98.89  ? 243 PRO C CG    1 
ATOM   9910  C CD    . PRO C 1 245 ? 5.459   -4.485  5.738   1.00 94.85  ? 243 PRO C CD    1 
ATOM   9911  N N     . ILE C 1 246 ? 2.662   -6.741  8.828   1.00 98.56  ? 244 ILE C N     1 
ATOM   9912  C CA    . ILE C 1 246 ? 2.004   -8.015  9.109   1.00 102.37 ? 244 ILE C CA    1 
ATOM   9913  C C     . ILE C 1 246 ? 0.484   -7.916  9.106   1.00 101.88 ? 244 ILE C C     1 
ATOM   9914  O O     . ILE C 1 246 ? -0.097  -7.096  9.810   1.00 102.06 ? 244 ILE C O     1 
ATOM   9915  C CB    . ILE C 1 246 ? 2.463   -8.582  10.471  1.00 99.38  ? 244 ILE C CB    1 
ATOM   9916  C CG1   . ILE C 1 246 ? 3.980   -8.767  10.491  1.00 88.98  ? 244 ILE C CG1   1 
ATOM   9917  C CG2   . ILE C 1 246 ? 1.772   -9.898  10.762  1.00 99.81  ? 244 ILE C CG2   1 
ATOM   9918  C CD1   . ILE C 1 246 ? 4.559   -8.737  11.871  1.00 85.46  ? 244 ILE C CD1   1 
ATOM   9919  N N     . VAL C 1 247 ? -0.160  -8.768  8.320   1.00 104.34 ? 245 VAL C N     1 
ATOM   9920  C CA    . VAL C 1 247 ? -1.606  -8.744  8.240   1.00 113.05 ? 245 VAL C CA    1 
ATOM   9921  C C     . VAL C 1 247 ? -2.176  -9.739  9.217   1.00 115.41 ? 245 VAL C C     1 
ATOM   9922  O O     . VAL C 1 247 ? -2.076  -10.944 9.011   1.00 114.63 ? 245 VAL C O     1 
ATOM   9923  C CB    . VAL C 1 247 ? -2.104  -9.156  6.844   1.00 119.62 ? 245 VAL C CB    1 
ATOM   9924  C CG1   . VAL C 1 247 ? -3.602  -8.877  6.716   1.00 121.90 ? 245 VAL C CG1   1 
ATOM   9925  C CG2   . VAL C 1 247 ? -1.313  -8.442  5.750   1.00 113.96 ? 245 VAL C CG2   1 
ATOM   9926  N N     . LEU C 1 248 ? -2.797  -9.238  10.274  1.00 119.28 ? 246 LEU C N     1 
ATOM   9927  C CA    . LEU C 1 248 ? -3.502  -10.120 11.183  1.00 127.03 ? 246 LEU C CA    1 
ATOM   9928  C C     . LEU C 1 248 ? -4.931  -10.266 10.690  1.00 134.59 ? 246 LEU C C     1 
ATOM   9929  O O     . LEU C 1 248 ? -5.717  -9.316  10.744  1.00 137.16 ? 246 LEU C O     1 
ATOM   9930  C CB    . LEU C 1 248 ? -3.447  -9.610  12.627  1.00 128.13 ? 246 LEU C CB    1 
ATOM   9931  C CG    . LEU C 1 248 ? -2.178  -9.937  13.432  1.00 120.40 ? 246 LEU C CG    1 
ATOM   9932  C CD1   . LEU C 1 248 ? -2.438  -9.832  14.926  1.00 112.35 ? 246 LEU C CD1   1 
ATOM   9933  C CD2   . LEU C 1 248 ? -1.660  -11.327 13.102  1.00 113.48 ? 246 LEU C CD2   1 
ATOM   9934  N N     . PRO C 1 249 ? -5.264  -11.465 10.192  1.00 139.40 ? 247 PRO C N     1 
ATOM   9935  C CA    . PRO C 1 249 ? -6.547  -11.778 9.557   1.00 147.61 ? 247 PRO C CA    1 
ATOM   9936  C C     . PRO C 1 249 ? -7.693  -11.720 10.551  1.00 156.40 ? 247 PRO C C     1 
ATOM   9937  O O     . PRO C 1 249 ? -7.547  -12.196 11.677  1.00 156.47 ? 247 PRO C O     1 
ATOM   9938  C CB    . PRO C 1 249 ? -6.362  -13.225 9.079   1.00 148.24 ? 247 PRO C CB    1 
ATOM   9939  C CG    . PRO C 1 249 ? -4.884  -13.468 9.100   1.00 141.39 ? 247 PRO C CG    1 
ATOM   9940  C CD    . PRO C 1 249 ? -4.367  -12.631 10.221  1.00 136.08 ? 247 PRO C CD    1 
ATOM   9941  N N     . GLU C 1 250 ? -8.817  -11.142 10.144  1.00 161.66 ? 248 GLU C N     1 
ATOM   9942  C CA    . GLU C 1 250 ? -10.003 -11.145 10.990  1.00 167.28 ? 248 GLU C CA    1 
ATOM   9943  C C     . GLU C 1 250 ? -11.169 -11.845 10.294  1.00 172.33 ? 248 GLU C C     1 
ATOM   9944  O O     . GLU C 1 250 ? -11.720 -11.336 9.317   1.00 173.52 ? 248 GLU C O     1 
ATOM   9945  C CB    . GLU C 1 250 ? -10.385 -9.716  11.380  1.00 165.10 ? 248 GLU C CB    1 
ATOM   9946  C CG    . GLU C 1 250 ? -11.141 -9.615  12.693  1.00 164.68 ? 248 GLU C CG    1 
ATOM   9947  C CD    . GLU C 1 250 ? -11.172 -8.199  13.228  1.00 161.82 ? 248 GLU C CD    1 
ATOM   9948  O OE1   . GLU C 1 250 ? -11.091 -7.256  12.414  1.00 158.01 ? 248 GLU C OE1   1 
ATOM   9949  O OE2   . GLU C 1 250 ? -11.264 -8.030  14.462  1.00 160.75 ? 248 GLU C OE2   1 
ATOM   9950  N N     . LYS C 1 251 ? -11.535 -13.017 10.805  1.00 174.02 ? 249 LYS C N     1 
ATOM   9951  C CA    . LYS C 1 251 ? -12.688 -13.755 10.309  1.00 176.37 ? 249 LYS C CA    1 
ATOM   9952  C C     . LYS C 1 251 ? -13.525 -14.152 11.508  1.00 179.15 ? 249 LYS C C     1 
ATOM   9953  O O     . LYS C 1 251 ? -13.069 -14.919 12.349  1.00 180.06 ? 249 LYS C O     1 
ATOM   9954  C CB    . LYS C 1 251 ? -12.261 -15.029 9.573   1.00 174.09 ? 249 LYS C CB    1 
ATOM   9955  C CG    . LYS C 1 251 ? -10.883 -14.985 8.944   1.00 169.90 ? 249 LYS C CG    1 
ATOM   9956  C CD    . LYS C 1 251 ? -10.842 -14.056 7.750   1.00 167.02 ? 249 LYS C CD    1 
ATOM   9957  C CE    . LYS C 1 251 ? -9.450  -14.013 7.151   1.00 161.63 ? 249 LYS C CE    1 
ATOM   9958  N NZ    . LYS C 1 251 ? -9.355  -13.015 6.058   1.00 161.32 ? 249 LYS C NZ    1 
ATOM   9959  N N     . ASP C 1 252 ? -14.746 -13.642 11.592  1.00 181.88 ? 250 ASP C N     1 
ATOM   9960  C CA    . ASP C 1 252 ? -15.638 -14.028 12.677  1.00 182.87 ? 250 ASP C CA    1 
ATOM   9961  C C     . ASP C 1 252 ? -15.695 -15.555 12.744  1.00 180.47 ? 250 ASP C C     1 
ATOM   9962  O O     . ASP C 1 252 ? -15.833 -16.140 13.820  1.00 175.75 ? 250 ASP C O     1 
ATOM   9963  C CB    . ASP C 1 252 ? -17.031 -13.434 12.461  1.00 185.67 ? 250 ASP C CB    1 
ATOM   9964  C CG    . ASP C 1 252 ? -16.993 -11.934 12.204  1.00 184.87 ? 250 ASP C CG    1 
ATOM   9965  O OD1   . ASP C 1 252 ? -16.149 -11.242 12.814  1.00 183.78 ? 250 ASP C OD1   1 
ATOM   9966  O OD2   . ASP C 1 252 ? -17.804 -11.449 11.385  1.00 183.28 ? 250 ASP C OD2   1 
ATOM   9967  N N     . SER C 1 253 ? -15.573 -16.187 11.578  1.00 182.11 ? 251 SER C N     1 
ATOM   9968  C CA    . SER C 1 253 ? -15.485 -17.639 11.477  1.00 180.82 ? 251 SER C CA    1 
ATOM   9969  C C     . SER C 1 253 ? -14.019 -18.064 11.474  1.00 179.08 ? 251 SER C C     1 
ATOM   9970  O O     . SER C 1 253 ? -13.292 -17.799 10.512  1.00 177.73 ? 251 SER C O     1 
ATOM   9971  C CB    . SER C 1 253 ? -16.153 -18.126 10.186  1.00 177.81 ? 251 SER C CB    1 
ATOM   9972  O OG    . SER C 1 253 ? -17.469 -17.619 10.055  1.00 176.27 ? 251 SER C OG    1 
ATOM   9973  N N     . TRP C 1 254 ? -13.589 -18.731 12.544  1.00 176.96 ? 252 TRP C N     1 
ATOM   9974  C CA    . TRP C 1 254 ? -12.204 -19.189 12.656  1.00 174.24 ? 252 TRP C CA    1 
ATOM   9975  C C     . TRP C 1 254 ? -12.097 -20.714 12.646  1.00 167.68 ? 252 TRP C C     1 
ATOM   9976  O O     . TRP C 1 254 ? -12.621 -21.386 13.538  1.00 166.34 ? 252 TRP C O     1 
ATOM   9977  C CB    . TRP C 1 254 ? -11.550 -18.678 13.947  1.00 175.81 ? 252 TRP C CB    1 
ATOM   9978  C CG    . TRP C 1 254 ? -11.808 -17.238 14.302  1.00 180.74 ? 252 TRP C CG    1 
ATOM   9979  C CD1   . TRP C 1 254 ? -12.920 -16.732 14.917  1.00 181.87 ? 252 TRP C CD1   1 
ATOM   9980  C CD2   . TRP C 1 254 ? -10.917 -16.127 14.107  1.00 181.49 ? 252 TRP C CD2   1 
ATOM   9981  N NE1   . TRP C 1 254 ? -12.785 -15.375 15.099  1.00 182.86 ? 252 TRP C NE1   1 
ATOM   9982  C CE2   . TRP C 1 254 ? -11.567 -14.979 14.614  1.00 183.50 ? 252 TRP C CE2   1 
ATOM   9983  C CE3   . TRP C 1 254 ? -9.642  -15.990 13.545  1.00 176.07 ? 252 TRP C CE3   1 
ATOM   9984  C CZ2   . TRP C 1 254 ? -10.982 -13.709 14.571  1.00 179.99 ? 252 TRP C CZ2   1 
ATOM   9985  C CZ3   . TRP C 1 254 ? -9.063  -14.728 13.507  1.00 174.51 ? 252 TRP C CZ3   1 
ATOM   9986  C CH2   . TRP C 1 254 ? -9.734  -13.605 14.017  1.00 175.22 ? 252 TRP C CH2   1 
ATOM   9987  N N     . THR C 1 255 ? -11.416 -21.256 11.640  1.00 164.31 ? 253 THR C N     1 
ATOM   9988  C CA    . THR C 1 255 ? -11.052 -22.672 11.643  1.00 161.63 ? 253 THR C CA    1 
ATOM   9989  C C     . THR C 1 255 ? -9.802  -22.873 12.508  1.00 157.73 ? 253 THR C C     1 
ATOM   9990  O O     . THR C 1 255 ? -9.018  -21.940 12.697  1.00 153.33 ? 253 THR C O     1 
ATOM   9991  C CB    . THR C 1 255 ? -10.832 -23.229 10.200  1.00 159.52 ? 253 THR C CB    1 
ATOM   9992  O OG1   . THR C 1 255 ? -10.715 -24.658 10.236  1.00 160.49 ? 253 THR C OG1   1 
ATOM   9993  C CG2   . THR C 1 255 ? -9.586  -22.638 9.557   1.00 153.39 ? 253 THR C CG2   1 
ATOM   9994  N N     . VAL C 1 256 ? -9.632  -24.076 13.054  1.00 157.43 ? 254 VAL C N     1 
ATOM   9995  C CA    . VAL C 1 256 ? -8.418  -24.407 13.794  1.00 151.46 ? 254 VAL C CA    1 
ATOM   9996  C C     . VAL C 1 256 ? -7.192  -24.027 12.965  1.00 147.89 ? 254 VAL C C     1 
ATOM   9997  O O     . VAL C 1 256 ? -6.243  -23.435 13.477  1.00 140.74 ? 254 VAL C O     1 
ATOM   9998  C CB    . VAL C 1 256 ? -8.357  -25.910 14.152  1.00 154.47 ? 254 VAL C CB    1 
ATOM   9999  C CG1   . VAL C 1 256 ? -6.937  -26.321 14.516  1.00 150.55 ? 254 VAL C CG1   1 
ATOM   10000 C CG2   . VAL C 1 256 ? -9.322  -26.234 15.283  1.00 153.52 ? 254 VAL C CG2   1 
ATOM   10001 N N     . ASN C 1 257 ? -7.231  -24.361 11.678  1.00 151.88 ? 255 ASN C N     1 
ATOM   10002 C CA    . ASN C 1 257 ? -6.158  -24.022 10.747  1.00 147.92 ? 255 ASN C CA    1 
ATOM   10003 C C     . ASN C 1 257 ? -5.740  -22.554 10.814  1.00 141.56 ? 255 ASN C C     1 
ATOM   10004 O O     . ASN C 1 257 ? -4.552  -22.243 10.836  1.00 136.85 ? 255 ASN C O     1 
ATOM   10005 C CB    . ASN C 1 257 ? -6.561  -24.387 9.314   1.00 150.38 ? 255 ASN C CB    1 
ATOM   10006 C CG    . ASN C 1 257 ? -5.554  -23.911 8.285   1.00 147.72 ? 255 ASN C CG    1 
ATOM   10007 O OD1   . ASN C 1 257 ? -4.555  -24.581 8.020   1.00 145.92 ? 255 ASN C OD1   1 
ATOM   10008 N ND2   . ASN C 1 257 ? -5.813  -22.748 7.697   1.00 145.58 ? 255 ASN C ND2   1 
ATOM   10009 N N     . ASP C 1 258 ? -6.721  -21.655 10.846  1.00 146.15 ? 256 ASP C N     1 
ATOM   10010 C CA    . ASP C 1 258 ? -6.450  -20.219 10.873  1.00 141.49 ? 256 ASP C CA    1 
ATOM   10011 C C     . ASP C 1 258 ? -5.615  -19.821 12.091  1.00 129.08 ? 256 ASP C C     1 
ATOM   10012 O O     . ASP C 1 258 ? -4.792  -18.908 12.020  1.00 121.64 ? 256 ASP C O     1 
ATOM   10013 C CB    . ASP C 1 258 ? -7.759  -19.415 10.853  1.00 151.38 ? 256 ASP C CB    1 
ATOM   10014 C CG    . ASP C 1 258 ? -8.586  -19.654 9.594   1.00 154.24 ? 256 ASP C CG    1 
ATOM   10015 O OD1   . ASP C 1 258 ? -8.040  -20.194 8.605   1.00 152.79 ? 256 ASP C OD1   1 
ATOM   10016 O OD2   . ASP C 1 258 ? -9.785  -19.292 9.597   1.00 158.19 ? 256 ASP C OD2   1 
ATOM   10017 N N     . ILE C 1 259 ? -5.838  -20.507 13.208  1.00 130.94 ? 257 ILE C N     1 
ATOM   10018 C CA    . ILE C 1 259 ? -5.120  -20.208 14.443  1.00 124.67 ? 257 ILE C CA    1 
ATOM   10019 C C     . ILE C 1 259 ? -3.622  -20.314 14.237  1.00 114.97 ? 257 ILE C C     1 
ATOM   10020 O O     . ILE C 1 259 ? -2.892  -19.363 14.479  1.00 110.45 ? 257 ILE C O     1 
ATOM   10021 C CB    . ILE C 1 259 ? -5.524  -21.146 15.592  1.00 127.34 ? 257 ILE C CB    1 
ATOM   10022 C CG1   . ILE C 1 259 ? -6.986  -20.920 15.984  1.00 127.04 ? 257 ILE C CG1   1 
ATOM   10023 C CG2   . ILE C 1 259 ? -4.620  -20.923 16.789  1.00 118.24 ? 257 ILE C CG2   1 
ATOM   10024 C CD1   . ILE C 1 259 ? -7.278  -19.518 16.469  1.00 122.05 ? 257 ILE C CD1   1 
ATOM   10025 N N     . CYS C 1 260 ? -3.171  -21.475 13.778  1.00 117.75 ? 258 CYS C N     1 
ATOM   10026 C CA    . CYS C 1 260 ? -1.758  -21.692 13.507  1.00 113.14 ? 258 CYS C CA    1 
ATOM   10027 C C     . CYS C 1 260 ? -1.205  -20.533 12.705  1.00 108.02 ? 258 CYS C C     1 
ATOM   10028 O O     . CYS C 1 260 ? -0.161  -19.982 13.038  1.00 102.94 ? 258 CYS C O     1 
ATOM   10029 C CB    . CYS C 1 260 ? -1.563  -22.986 12.727  1.00 113.18 ? 258 CYS C CB    1 
ATOM   10030 S SG    . CYS C 1 260 ? -2.324  -24.398 13.512  1.00 116.31 ? 258 CYS C SG    1 
ATOM   10031 N N     . LYS C 1 261 ? -1.917  -20.171 11.645  1.00 110.83 ? 259 LYS C N     1 
ATOM   10032 C CA    . LYS C 1 261 ? -1.541  -19.045 10.807  1.00 108.21 ? 259 LYS C CA    1 
ATOM   10033 C C     . LYS C 1 261 ? -1.373  -17.794 11.667  1.00 101.49 ? 259 LYS C C     1 
ATOM   10034 O O     . LYS C 1 261 ? -0.417  -17.039 11.500  1.00 96.89  ? 259 LYS C O     1 
ATOM   10035 C CB    . LYS C 1 261 ? -2.606  -18.826 9.722   1.00 115.51 ? 259 LYS C CB    1 
ATOM   10036 C CG    . LYS C 1 261 ? -2.182  -17.932 8.552   1.00 118.83 ? 259 LYS C CG    1 
ATOM   10037 C CD    . LYS C 1 261 ? -3.275  -17.853 7.472   1.00 125.68 ? 259 LYS C CD    1 
ATOM   10038 C CE    . LYS C 1 261 ? -2.865  -16.959 6.296   1.00 127.32 ? 259 LYS C CE    1 
ATOM   10039 N NZ    . LYS C 1 261 ? -3.875  -16.955 5.194   1.00 123.15 ? 259 LYS C NZ    1 
ATOM   10040 N N     . LEU C 1 262 ? -2.303  -17.595 12.598  1.00 104.03 ? 260 LEU C N     1 
ATOM   10041 C CA    . LEU C 1 262 ? -2.326  -16.408 13.452  1.00 100.91 ? 260 LEU C CA    1 
ATOM   10042 C C     . LEU C 1 262 ? -1.126  -16.351 14.398  1.00 93.12  ? 260 LEU C C     1 
ATOM   10043 O O     . LEU C 1 262 ? -0.386  -15.370 14.440  1.00 88.10  ? 260 LEU C O     1 
ATOM   10044 C CB    . LEU C 1 262 ? -3.636  -16.376 14.242  1.00 101.32 ? 260 LEU C CB    1 
ATOM   10045 C CG    . LEU C 1 262 ? -3.865  -15.182 15.166  1.00 103.00 ? 260 LEU C CG    1 
ATOM   10046 C CD1   . LEU C 1 262 ? -3.422  -13.889 14.499  1.00 105.83 ? 260 LEU C CD1   1 
ATOM   10047 C CD2   . LEU C 1 262 ? -5.327  -15.107 15.589  1.00 113.20 ? 260 LEU C CD2   1 
ATOM   10048 N N     . VAL C 1 263 ? -0.957  -17.417 15.167  1.00 95.90  ? 261 VAL C N     1 
ATOM   10049 C CA    . VAL C 1 263 ? 0.227   -17.617 15.978  1.00 88.36  ? 261 VAL C CA    1 
ATOM   10050 C C     . VAL C 1 263 ? 1.471   -17.391 15.141  1.00 85.38  ? 261 VAL C C     1 
ATOM   10051 O O     . VAL C 1 263 ? 2.203   -16.442 15.362  1.00 83.43  ? 261 VAL C O     1 
ATOM   10052 C CB    . VAL C 1 263 ? 0.253   -19.041 16.528  1.00 88.31  ? 261 VAL C CB    1 
ATOM   10053 C CG1   . VAL C 1 263 ? 1.598   -19.362 17.127  1.00 84.47  ? 261 VAL C CG1   1 
ATOM   10054 C CG2   . VAL C 1 263 ? -0.847  -19.214 17.543  1.00 91.59  ? 261 VAL C CG2   1 
ATOM   10055 N N     . GLY C 1 264 ? 1.681   -18.245 14.148  1.00 89.52  ? 262 GLY C N     1 
ATOM   10056 C CA    . GLY C 1 264 ? 2.872   -18.183 13.326  1.00 85.11  ? 262 GLY C CA    1 
ATOM   10057 C C     . GLY C 1 264 ? 3.194   -16.771 12.899  1.00 80.28  ? 262 GLY C C     1 
ATOM   10058 O O     . GLY C 1 264 ? 4.350   -16.401 12.806  1.00 78.50  ? 262 GLY C O     1 
ATOM   10059 N N     . LYS C 1 265 ? 2.174   -15.974 12.634  1.00 84.97  ? 263 LYS C N     1 
ATOM   10060 C CA    . LYS C 1 265 ? 2.396   -14.573 12.310  1.00 83.80  ? 263 LYS C CA    1 
ATOM   10061 C C     . LYS C 1 265 ? 2.855   -13.787 13.536  1.00 77.44  ? 263 LYS C C     1 
ATOM   10062 O O     . LYS C 1 265 ? 3.850   -13.065 13.483  1.00 74.14  ? 263 LYS C O     1 
ATOM   10063 C CB    . LYS C 1 265 ? 1.140   -13.952 11.693  1.00 89.92  ? 263 LYS C CB    1 
ATOM   10064 C CG    . LYS C 1 265 ? 0.997   -14.212 10.195  1.00 94.32  ? 263 LYS C CG    1 
ATOM   10065 C CD    . LYS C 1 265 ? -0.349  -13.732 9.672   1.00 107.99 ? 263 LYS C CD    1 
ATOM   10066 C CE    . LYS C 1 265 ? -0.327  -13.504 8.168   1.00 109.43 ? 263 LYS C CE    1 
ATOM   10067 N NZ    . LYS C 1 265 ? 0.437   -12.277 7.813   1.00 103.16 ? 263 LYS C NZ    1 
ATOM   10068 N N     . LEU C 1 266 ? 2.132   -13.938 14.640  1.00 79.32  ? 264 LEU C N     1 
ATOM   10069 C CA    . LEU C 1 266 ? 2.509   -13.307 15.904  1.00 77.84  ? 264 LEU C CA    1 
ATOM   10070 C C     . LEU C 1 266 ? 3.912   -13.720 16.391  1.00 72.37  ? 264 LEU C C     1 
ATOM   10071 O O     . LEU C 1 266 ? 4.691   -12.881 16.834  1.00 68.39  ? 264 LEU C O     1 
ATOM   10072 C CB    . LEU C 1 266 ? 1.458   -13.617 16.967  1.00 78.38  ? 264 LEU C CB    1 
ATOM   10073 C CG    . LEU C 1 266 ? 0.137   -12.905 16.735  1.00 81.78  ? 264 LEU C CG    1 
ATOM   10074 C CD1   . LEU C 1 266 ? -0.962  -13.508 17.584  1.00 85.64  ? 264 LEU C CD1   1 
ATOM   10075 C CD2   . LEU C 1 266 ? 0.319   -11.436 17.031  1.00 85.42  ? 264 LEU C CD2   1 
ATOM   10076 N N     . ASN C 1 267 ? 4.215   -15.013 16.323  1.00 70.62  ? 265 ASN C N     1 
ATOM   10077 C CA    . ASN C 1 267 ? 5.543   -15.510 16.623  1.00 65.19  ? 265 ASN C CA    1 
ATOM   10078 C C     . ASN C 1 267 ? 6.578   -14.777 15.786  1.00 66.11  ? 265 ASN C C     1 
ATOM   10079 O O     . ASN C 1 267 ? 7.608   -14.347 16.303  1.00 65.55  ? 265 ASN C O     1 
ATOM   10080 C CB    . ASN C 1 267 ? 5.629   -17.021 16.377  1.00 70.50  ? 265 ASN C CB    1 
ATOM   10081 C CG    . ASN C 1 267 ? 5.533   -17.845 17.665  1.00 71.75  ? 265 ASN C CG    1 
ATOM   10082 O OD1   . ASN C 1 267 ? 5.850   -17.370 18.754  1.00 72.80  ? 265 ASN C OD1   1 
ATOM   10083 N ND2   . ASN C 1 267 ? 5.105   -19.088 17.533  1.00 71.06  ? 265 ASN C ND2   1 
ATOM   10084 N N     . TRP C 1 268 ? 6.302   -14.622 14.494  1.00 68.42  ? 266 TRP C N     1 
ATOM   10085 C CA    . TRP C 1 268 ? 7.191   -13.870 13.604  1.00 66.72  ? 266 TRP C CA    1 
ATOM   10086 C C     . TRP C 1 268 ? 7.336   -12.434 14.078  1.00 66.45  ? 266 TRP C C     1 
ATOM   10087 O O     . TRP C 1 268 ? 8.440   -11.886 14.084  1.00 64.18  ? 266 TRP C O     1 
ATOM   10088 C CB    . TRP C 1 268 ? 6.694   -13.906 12.147  1.00 72.88  ? 266 TRP C CB    1 
ATOM   10089 C CG    . TRP C 1 268 ? 7.467   -13.004 11.177  1.00 72.35  ? 266 TRP C CG    1 
ATOM   10090 C CD1   . TRP C 1 268 ? 7.059   -11.801 10.673  1.00 68.25  ? 266 TRP C CD1   1 
ATOM   10091 C CD2   . TRP C 1 268 ? 8.762   -13.251 10.611  1.00 72.05  ? 266 TRP C CD2   1 
ATOM   10092 N NE1   . TRP C 1 268 ? 8.015   -11.286 9.844   1.00 66.37  ? 266 TRP C NE1   1 
ATOM   10093 C CE2   . TRP C 1 268 ? 9.072   -12.154 9.787   1.00 70.57  ? 266 TRP C CE2   1 
ATOM   10094 C CE3   . TRP C 1 268 ? 9.690   -14.291 10.726  1.00 72.49  ? 266 TRP C CE3   1 
ATOM   10095 C CZ2   . TRP C 1 268 ? 10.274  -12.062 9.086   1.00 71.93  ? 266 TRP C CZ2   1 
ATOM   10096 C CZ3   . TRP C 1 268 ? 10.881  -14.196 10.026  1.00 72.39  ? 266 TRP C CZ3   1 
ATOM   10097 C CH2   . TRP C 1 268 ? 11.162  -13.091 9.218   1.00 71.56  ? 266 TRP C CH2   1 
ATOM   10098 N N     . ALA C 1 269 ? 6.219   -11.832 14.479  1.00 65.36  ? 267 ALA C N     1 
ATOM   10099 C CA    . ALA C 1 269 ? 6.222   -10.452 14.947  1.00 64.91  ? 267 ALA C CA    1 
ATOM   10100 C C     . ALA C 1 269 ? 7.107   -10.234 16.184  1.00 62.30  ? 267 ALA C C     1 
ATOM   10101 O O     . ALA C 1 269 ? 7.649   -9.150  16.389  1.00 61.91  ? 267 ALA C O     1 
ATOM   10102 C CB    . ALA C 1 269 ? 4.808   -9.994  15.218  1.00 65.50  ? 267 ALA C CB    1 
ATOM   10103 N N     . SER C 1 270 ? 7.271   -11.271 16.992  1.00 58.79  ? 268 SER C N     1 
ATOM   10104 C CA    . SER C 1 270 ? 7.875   -11.118 18.307  1.00 57.29  ? 268 SER C CA    1 
ATOM   10105 C C     . SER C 1 270 ? 9.378   -10.824 18.322  1.00 55.61  ? 268 SER C C     1 
ATOM   10106 O O     . SER C 1 270 ? 9.946   -10.635 19.384  1.00 52.16  ? 268 SER C O     1 
ATOM   10107 C CB    . SER C 1 270 ? 7.553   -12.320 19.187  1.00 55.61  ? 268 SER C CB    1 
ATOM   10108 O OG    . SER C 1 270 ? 7.889   -13.517 18.534  1.00 57.95  ? 268 SER C OG    1 
ATOM   10109 N N     . GLN C 1 271 ? 10.020  -10.803 17.157  1.00 55.52  ? 269 GLN C N     1 
ATOM   10110 C CA    . GLN C 1 271 ? 11.452  -10.528 17.076  1.00 51.97  ? 269 GLN C CA    1 
ATOM   10111 C C     . GLN C 1 271 ? 11.759  -9.023  17.132  1.00 57.37  ? 269 GLN C C     1 
ATOM   10112 O O     . GLN C 1 271 ? 12.911  -8.598  17.361  1.00 53.96  ? 269 GLN C O     1 
ATOM   10113 C CB    . GLN C 1 271 ? 12.033  -11.135 15.805  1.00 51.46  ? 269 GLN C CB    1 
ATOM   10114 C CG    . GLN C 1 271 ? 11.452  -10.556 14.526  1.00 59.28  ? 269 GLN C CG    1 
ATOM   10115 C CD    . GLN C 1 271 ? 11.873  -11.308 13.275  1.00 59.96  ? 269 GLN C CD    1 
ATOM   10116 O OE1   . GLN C 1 271 ? 13.057  -11.377 12.938  1.00 58.00  ? 269 GLN C OE1   1 
ATOM   10117 N NE2   . GLN C 1 271 ? 10.896  -11.873 12.579  1.00 58.84  ? 269 GLN C NE2   1 
ATOM   10118 N N     . ILE C 1 272 ? 10.713  -8.228  16.918  1.00 57.70  ? 270 ILE C N     1 
ATOM   10119 C CA    . ILE C 1 272 ? 10.809  -6.774  16.900  1.00 55.31  ? 270 ILE C CA    1 
ATOM   10120 C C     . ILE C 1 272 ? 9.767   -6.108  17.806  1.00 57.22  ? 270 ILE C C     1 
ATOM   10121 O O     . ILE C 1 272 ? 10.117  -5.298  18.657  1.00 58.89  ? 270 ILE C O     1 
ATOM   10122 C CB    . ILE C 1 272 ? 10.849  -6.196  15.466  1.00 57.08  ? 270 ILE C CB    1 
ATOM   10123 C CG1   . ILE C 1 272 ? 11.534  -4.832  15.476  1.00 58.51  ? 270 ILE C CG1   1 
ATOM   10124 C CG2   . ILE C 1 272 ? 9.465   -6.146  14.844  1.00 62.63  ? 270 ILE C CG2   1 
ATOM   10125 C CD1   . ILE C 1 272 ? 12.675  -4.743  16.446  1.00 57.80  ? 270 ILE C CD1   1 
ATOM   10126 N N     . TYR C 1 273 ? 8.489   -6.386  17.567  1.00 59.25  ? 271 TYR C N     1 
ATOM   10127 C CA    . TYR C 1 273 ? 7.418   -5.871  18.413  1.00 61.55  ? 271 TYR C CA    1 
ATOM   10128 C C     . TYR C 1 273 ? 7.463   -6.513  19.796  1.00 61.30  ? 271 TYR C C     1 
ATOM   10129 O O     . TYR C 1 273 ? 7.232   -7.712  19.925  1.00 60.90  ? 271 TYR C O     1 
ATOM   10130 C CB    . TYR C 1 273 ? 6.054   -6.166  17.779  1.00 70.24  ? 271 TYR C CB    1 
ATOM   10131 C CG    . TYR C 1 273 ? 5.736   -5.358  16.539  1.00 77.96  ? 271 TYR C CG    1 
ATOM   10132 C CD1   . TYR C 1 273 ? 5.730   -3.971  16.576  1.00 81.81  ? 271 TYR C CD1   1 
ATOM   10133 C CD2   . TYR C 1 273 ? 5.422   -5.980  15.338  1.00 78.61  ? 271 TYR C CD2   1 
ATOM   10134 C CE1   . TYR C 1 273 ? 5.439   -3.223  15.452  1.00 85.63  ? 271 TYR C CE1   1 
ATOM   10135 C CE2   . TYR C 1 273 ? 5.121   -5.237  14.210  1.00 81.10  ? 271 TYR C CE2   1 
ATOM   10136 C CZ    . TYR C 1 273 ? 5.135   -3.857  14.276  1.00 85.19  ? 271 TYR C CZ    1 
ATOM   10137 O OH    . TYR C 1 273 ? 4.845   -3.098  13.167  1.00 90.04  ? 271 TYR C OH    1 
ATOM   10138 N N     . PRO C 1 274 ? 7.732   -5.719  20.846  1.00 61.92  ? 272 PRO C N     1 
ATOM   10139 C CA    . PRO C 1 274 ? 7.835   -6.319  22.180  1.00 61.15  ? 272 PRO C CA    1 
ATOM   10140 C C     . PRO C 1 274 ? 6.493   -6.712  22.776  1.00 62.20  ? 272 PRO C C     1 
ATOM   10141 O O     . PRO C 1 274 ? 5.489   -6.041  22.557  1.00 64.98  ? 272 PRO C O     1 
ATOM   10142 C CB    . PRO C 1 274 ? 8.455   -5.197  23.015  1.00 54.88  ? 272 PRO C CB    1 
ATOM   10143 C CG    . PRO C 1 274 ? 8.024   -3.969  22.356  1.00 58.85  ? 272 PRO C CG    1 
ATOM   10144 C CD    . PRO C 1 274 ? 8.015   -4.275  20.881  1.00 61.88  ? 272 PRO C CD    1 
ATOM   10145 N N     . GLY C 1 275 ? 6.490   -7.806  23.524  1.00 62.00  ? 273 GLY C N     1 
ATOM   10146 C CA    . GLY C 1 275 ? 5.382   -8.126  24.397  1.00 65.56  ? 273 GLY C CA    1 
ATOM   10147 C C     . GLY C 1 275 ? 4.343   -9.068  23.841  1.00 73.14  ? 273 GLY C C     1 
ATOM   10148 O O     . GLY C 1 275 ? 3.341   -9.330  24.506  1.00 77.57  ? 273 GLY C O     1 
ATOM   10149 N N     . ILE C 1 276 ? 4.566   -9.575  22.632  1.00 73.12  ? 274 ILE C N     1 
ATOM   10150 C CA    . ILE C 1 276 ? 3.626   -10.517 22.034  1.00 76.36  ? 274 ILE C CA    1 
ATOM   10151 C C     . ILE C 1 276 ? 3.500   -11.789 22.881  1.00 77.11  ? 274 ILE C C     1 
ATOM   10152 O O     . ILE C 1 276 ? 4.493   -12.330 23.368  1.00 70.78  ? 274 ILE C O     1 
ATOM   10153 C CB    . ILE C 1 276 ? 3.984   -10.859 20.564  1.00 74.04  ? 274 ILE C CB    1 
ATOM   10154 C CG1   . ILE C 1 276 ? 3.486   -9.764  19.628  1.00 74.26  ? 274 ILE C CG1   1 
ATOM   10155 C CG2   . ILE C 1 276 ? 3.340   -12.167 20.134  1.00 74.94  ? 274 ILE C CG2   1 
ATOM   10156 C CD1   . ILE C 1 276 ? 4.235   -8.488  19.734  1.00 71.31  ? 274 ILE C CD1   1 
ATOM   10157 N N     . LYS C 1 277 ? 2.262   -12.239 23.063  1.00 80.82  ? 275 LYS C N     1 
ATOM   10158 C CA    . LYS C 1 277 ? 1.962   -13.429 23.845  1.00 81.99  ? 275 LYS C CA    1 
ATOM   10159 C C     . LYS C 1 277 ? 1.114   -14.392 23.027  1.00 82.99  ? 275 LYS C C     1 
ATOM   10160 O O     . LYS C 1 277 ? 0.046   -14.039 22.531  1.00 83.07  ? 275 LYS C O     1 
ATOM   10161 C CB    . LYS C 1 277 ? 1.211   -13.054 25.119  1.00 83.86  ? 275 LYS C CB    1 
ATOM   10162 C CG    . LYS C 1 277 ? 2.063   -12.474 26.211  1.00 78.01  ? 275 LYS C CG    1 
ATOM   10163 C CD    . LYS C 1 277 ? 1.206   -12.046 27.386  1.00 81.38  ? 275 LYS C CD    1 
ATOM   10164 C CE    . LYS C 1 277 ? 0.536   -10.707 27.116  1.00 93.62  ? 275 LYS C CE    1 
ATOM   10165 N NZ    . LYS C 1 277 ? 0.422   -9.873  28.355  1.00 97.95  ? 275 LYS C NZ    1 
ATOM   10166 N N     . VAL C 1 278 ? 1.632   -15.590 22.827  1.00 83.01  ? 276 VAL C N     1 
ATOM   10167 C CA    . VAL C 1 278 ? 0.885   -16.628 22.134  1.00 86.47  ? 276 VAL C CA    1 
ATOM   10168 C C     . VAL C 1 278 ? 0.265   -17.736 23.013  1.00 87.09  ? 276 VAL C C     1 
ATOM   10169 O O     . VAL C 1 278 ? -0.331  -18.668 22.488  1.00 86.68  ? 276 VAL C O     1 
ATOM   10170 C CB    . VAL C 1 278 ? 1.733   -17.238 21.015  1.00 86.26  ? 276 VAL C CB    1 
ATOM   10171 C CG1   . VAL C 1 278 ? 2.705   -18.269 21.590  1.00 88.99  ? 276 VAL C CG1   1 
ATOM   10172 C CG2   . VAL C 1 278 ? 0.845   -17.845 19.972  1.00 87.40  ? 276 VAL C CG2   1 
ATOM   10173 N N     . ARG C 1 279 ? 0.423   -17.648 24.333  1.00 87.98  ? 277 ARG C N     1 
ATOM   10174 C CA    . ARG C 1 279 ? 0.107   -18.766 25.243  1.00 86.89  ? 277 ARG C CA    1 
ATOM   10175 C C     . ARG C 1 279 ? -1.318  -19.327 25.215  1.00 89.97  ? 277 ARG C C     1 
ATOM   10176 O O     . ARG C 1 279 ? -1.507  -20.538 25.081  1.00 91.71  ? 277 ARG C O     1 
ATOM   10177 C CB    . ARG C 1 279 ? 0.480   -18.413 26.688  1.00 85.25  ? 277 ARG C CB    1 
ATOM   10178 C CG    . ARG C 1 279 ? -0.245  -19.226 27.763  1.00 85.27  ? 277 ARG C CG    1 
ATOM   10179 C CD    . ARG C 1 279 ? -0.015  -20.704 27.578  1.00 85.60  ? 277 ARG C CD    1 
ATOM   10180 N NE    . ARG C 1 279 ? 1.405   -21.016 27.601  1.00 82.89  ? 277 ARG C NE    1 
ATOM   10181 C CZ    . ARG C 1 279 ? 2.052   -21.353 28.708  1.00 83.32  ? 277 ARG C CZ    1 
ATOM   10182 N NH1   . ARG C 1 279 ? 1.379   -21.418 29.853  1.00 82.87  ? 277 ARG C NH1   1 
ATOM   10183 N NH2   . ARG C 1 279 ? 3.355   -21.629 28.676  1.00 73.35  ? 277 ARG C NH2   1 
ATOM   10184 N N     . GLN C 1 280 ? -2.312  -18.463 25.382  1.00 91.62  ? 278 GLN C N     1 
ATOM   10185 C CA    . GLN C 1 280 ? -3.691  -18.919 25.528  1.00 94.62  ? 278 GLN C CA    1 
ATOM   10186 C C     . GLN C 1 280 ? -4.315  -19.282 24.179  1.00 94.93  ? 278 GLN C C     1 
ATOM   10187 O O     . GLN C 1 280 ? -5.278  -20.042 24.111  1.00 95.79  ? 278 GLN C O     1 
ATOM   10188 C CB    . GLN C 1 280 ? -4.539  -17.874 26.270  1.00 102.58 ? 278 GLN C CB    1 
ATOM   10189 C CG    . GLN C 1 280 ? -4.051  -17.518 27.681  1.00 98.65  ? 278 GLN C CG    1 
ATOM   10190 C CD    . GLN C 1 280 ? -4.351  -18.596 28.697  1.00 102.05 ? 278 GLN C CD    1 
ATOM   10191 O OE1   . GLN C 1 280 ? -5.321  -19.337 28.560  1.00 106.71 ? 278 GLN C OE1   1 
ATOM   10192 N NE2   . GLN C 1 280 ? -3.515  -18.693 29.724  1.00 101.26 ? 278 GLN C NE2   1 
ATOM   10193 N N     . LEU C 1 281 ? -3.759  -18.734 23.107  1.00 92.57  ? 279 LEU C N     1 
ATOM   10194 C CA    . LEU C 1 281 ? -4.185  -19.089 21.767  1.00 90.63  ? 279 LEU C CA    1 
ATOM   10195 C C     . LEU C 1 281 ? -3.733  -20.500 21.432  1.00 91.47  ? 279 LEU C C     1 
ATOM   10196 O O     . LEU C 1 281 ? -4.486  -21.280 20.873  1.00 98.24  ? 279 LEU C O     1 
ATOM   10197 C CB    . LEU C 1 281 ? -3.614  -18.102 20.759  1.00 89.18  ? 279 LEU C CB    1 
ATOM   10198 C CG    . LEU C 1 281 ? -4.086  -16.668 20.963  1.00 86.69  ? 279 LEU C CG    1 
ATOM   10199 C CD1   . LEU C 1 281 ? -3.332  -15.717 20.066  1.00 91.25  ? 279 LEU C CD1   1 
ATOM   10200 C CD2   . LEU C 1 281 ? -5.556  -16.586 20.696  1.00 91.99  ? 279 LEU C CD2   1 
ATOM   10201 N N     . SER C 1 282 ? -2.499  -20.826 21.786  1.00 90.90  ? 280 SER C N     1 
ATOM   10202 C CA    . SER C 1 282 ? -1.944  -22.149 21.519  1.00 94.72  ? 280 SER C CA    1 
ATOM   10203 C C     . SER C 1 282 ? -2.630  -23.233 22.334  1.00 98.71  ? 280 SER C C     1 
ATOM   10204 O O     . SER C 1 282 ? -2.409  -24.421 22.104  1.00 99.75  ? 280 SER C O     1 
ATOM   10205 C CB    . SER C 1 282 ? -0.450  -22.173 21.828  1.00 90.93  ? 280 SER C CB    1 
ATOM   10206 O OG    . SER C 1 282 ? 0.178   -21.000 21.359  1.00 88.00  ? 280 SER C OG    1 
ATOM   10207 N N     . LYS C 1 283 ? -3.438  -22.819 23.305  1.00 98.91  ? 281 LYS C N     1 
ATOM   10208 C CA    . LYS C 1 283 ? -4.231  -23.756 24.086  1.00 103.09 ? 281 LYS C CA    1 
ATOM   10209 C C     . LYS C 1 283 ? -5.265  -24.419 23.184  1.00 107.49 ? 281 LYS C C     1 
ATOM   10210 O O     . LYS C 1 283 ? -5.485  -25.629 23.252  1.00 108.71 ? 281 LYS C O     1 
ATOM   10211 C CB    . LYS C 1 283 ? -4.939  -23.027 25.229  1.00 103.68 ? 281 LYS C CB    1 
ATOM   10212 C CG    . LYS C 1 283 ? -4.170  -22.963 26.540  1.00 104.08 ? 281 LYS C CG    1 
ATOM   10213 C CD    . LYS C 1 283 ? -4.912  -22.086 27.548  1.00 108.31 ? 281 LYS C CD    1 
ATOM   10214 C CE    . LYS C 1 283 ? -4.623  -22.477 28.997  1.00 115.82 ? 281 LYS C CE    1 
ATOM   10215 N NZ    . LYS C 1 283 ? -5.598  -23.479 29.532  1.00 110.08 ? 281 LYS C NZ    1 
ATOM   10216 N N     . LEU C 1 284 ? -5.882  -23.606 22.329  1.00 106.90 ? 282 LEU C N     1 
ATOM   10217 C CA    . LEU C 1 284 ? -6.971  -24.033 21.457  1.00 107.65 ? 282 LEU C CA    1 
ATOM   10218 C C     . LEU C 1 284 ? -6.594  -25.228 20.590  1.00 111.08 ? 282 LEU C C     1 
ATOM   10219 O O     . LEU C 1 284 ? -7.455  -25.979 20.138  1.00 118.02 ? 282 LEU C O     1 
ATOM   10220 C CB    . LEU C 1 284 ? -7.400  -22.871 20.557  1.00 108.10 ? 282 LEU C CB    1 
ATOM   10221 C CG    . LEU C 1 284 ? -7.555  -21.505 21.228  1.00 105.12 ? 282 LEU C CG    1 
ATOM   10222 C CD1   . LEU C 1 284 ? -7.909  -20.434 20.218  1.00 103.64 ? 282 LEU C CD1   1 
ATOM   10223 C CD2   . LEU C 1 284 ? -8.594  -21.563 22.321  1.00 110.01 ? 282 LEU C CD2   1 
ATOM   10224 N N     . LEU C 1 285 ? -5.300  -25.400 20.368  1.00 111.57 ? 283 LEU C N     1 
ATOM   10225 C CA    . LEU C 1 285 ? -4.805  -26.392 19.424  1.00 114.44 ? 283 LEU C CA    1 
ATOM   10226 C C     . LEU C 1 285 ? -4.482  -27.734 20.053  1.00 118.74 ? 283 LEU C C     1 
ATOM   10227 O O     . LEU C 1 285 ? -3.948  -28.616 19.384  1.00 120.82 ? 283 LEU C O     1 
ATOM   10228 C CB    . LEU C 1 285 ? -3.574  -25.860 18.692  1.00 113.42 ? 283 LEU C CB    1 
ATOM   10229 C CG    . LEU C 1 285 ? -3.883  -24.964 17.491  1.00 119.29 ? 283 LEU C CG    1 
ATOM   10230 C CD1   . LEU C 1 285 ? -5.074  -24.064 17.777  1.00 119.39 ? 283 LEU C CD1   1 
ATOM   10231 C CD2   . LEU C 1 285 ? -2.670  -24.145 17.093  1.00 117.98 ? 283 LEU C CD2   1 
ATOM   10232 N N     . ARG C 1 286 ? -4.785  -27.894 21.336  1.00 119.13 ? 284 ARG C N     1 
ATOM   10233 C CA    . ARG C 1 286 ? -4.447  -29.139 22.009  1.00 120.67 ? 284 ARG C CA    1 
ATOM   10234 C C     . ARG C 1 286 ? -5.321  -30.296 21.521  1.00 128.70 ? 284 ARG C C     1 
ATOM   10235 O O     . ARG C 1 286 ? -6.544  -30.257 21.646  1.00 130.72 ? 284 ARG C O     1 
ATOM   10236 C CB    . ARG C 1 286 ? -4.564  -28.972 23.525  1.00 119.42 ? 284 ARG C CB    1 
ATOM   10237 C CG    . ARG C 1 286 ? -3.729  -27.825 24.069  1.00 114.45 ? 284 ARG C CG    1 
ATOM   10238 C CD    . ARG C 1 286 ? -3.225  -28.094 25.478  1.00 113.77 ? 284 ARG C CD    1 
ATOM   10239 N NE    . ARG C 1 286 ? -2.059  -27.265 25.784  1.00 112.16 ? 284 ARG C NE    1 
ATOM   10240 C CZ    . ARG C 1 286 ? -2.089  -26.169 26.536  1.00 110.80 ? 284 ARG C CZ    1 
ATOM   10241 N NH1   . ARG C 1 286 ? -3.228  -25.765 27.087  1.00 109.05 ? 284 ARG C NH1   1 
ATOM   10242 N NH2   . ARG C 1 286 ? -0.973  -25.482 26.747  1.00 103.27 ? 284 ARG C NH2   1 
ATOM   10243 N N     . GLY C 1 287 ? -4.670  -31.324 20.974  1.00 129.95 ? 285 GLY C N     1 
ATOM   10244 C CA    . GLY C 1 287 ? -5.315  -32.560 20.555  1.00 133.95 ? 285 GLY C CA    1 
ATOM   10245 C C     . GLY C 1 287 ? -6.568  -32.490 19.690  1.00 145.74 ? 285 GLY C C     1 
ATOM   10246 O O     . GLY C 1 287 ? -7.538  -33.205 19.955  1.00 146.51 ? 285 GLY C O     1 
ATOM   10247 N N     . THR C 1 288 ? -6.557  -31.653 18.654  1.00 146.81 ? 286 THR C N     1 
ATOM   10248 C CA    . THR C 1 288 ? -7.713  -31.526 17.758  1.00 151.02 ? 286 THR C CA    1 
ATOM   10249 C C     . THR C 1 288 ? -7.664  -32.505 16.578  1.00 154.49 ? 286 THR C C     1 
ATOM   10250 O O     . THR C 1 288 ? -6.594  -32.780 16.032  1.00 153.76 ? 286 THR C O     1 
ATOM   10251 C CB    . THR C 1 288 ? -7.881  -30.080 17.241  1.00 150.67 ? 286 THR C CB    1 
ATOM   10252 O OG1   . THR C 1 288 ? -8.303  -29.232 18.317  1.00 144.37 ? 286 THR C OG1   1 
ATOM   10253 C CG2   . THR C 1 288 ? -8.918  -30.023 16.133  1.00 154.04 ? 286 THR C CG2   1 
ATOM   10254 N N     . LYS C 1 289 ? -8.829  -33.031 16.201  1.00 157.70 ? 287 LYS C N     1 
ATOM   10255 C CA    . LYS C 1 289 ? -8.931  -34.036 15.136  1.00 161.50 ? 287 LYS C CA    1 
ATOM   10256 C C     . LYS C 1 289 ? -8.496  -33.563 13.741  1.00 162.11 ? 287 LYS C C     1 
ATOM   10257 O O     . LYS C 1 289 ? -7.571  -34.126 13.149  1.00 160.65 ? 287 LYS C O     1 
ATOM   10258 C CB    . LYS C 1 289 ? -10.356 -34.605 15.073  1.00 159.79 ? 287 LYS C CB    1 
ATOM   10259 C CG    . LYS C 1 289 ? -10.701 -35.291 13.753  1.00 159.98 ? 287 LYS C CG    1 
ATOM   10260 C CD    . LYS C 1 289 ? -9.783  -36.473 13.466  1.00 160.16 ? 287 LYS C CD    1 
ATOM   10261 C CE    . LYS C 1 289 ? -9.927  -36.944 12.026  1.00 157.76 ? 287 LYS C CE    1 
ATOM   10262 N NZ    . LYS C 1 289 ? -8.978  -38.043 11.693  1.00 154.04 ? 287 LYS C NZ    1 
ATOM   10263 N N     . ALA C 1 290 ? -9.156  -32.531 13.221  1.00 161.64 ? 288 ALA C N     1 
ATOM   10264 C CA    . ALA C 1 290 ? -8.903  -32.075 11.857  1.00 158.85 ? 288 ALA C CA    1 
ATOM   10265 C C     . ALA C 1 290 ? -8.400  -30.639 11.826  1.00 156.17 ? 288 ALA C C     1 
ATOM   10266 O O     . ALA C 1 290 ? -8.762  -29.829 12.675  1.00 155.65 ? 288 ALA C O     1 
ATOM   10267 C CB    . ALA C 1 290 ? -10.160 -32.215 11.007  1.00 158.03 ? 288 ALA C CB    1 
ATOM   10268 N N     . LEU C 1 291 ? -7.561  -30.333 10.842  1.00 155.65 ? 289 LEU C N     1 
ATOM   10269 C CA    . LEU C 1 291 ? -7.044  -28.980 10.671  1.00 155.98 ? 289 LEU C CA    1 
ATOM   10270 C C     . LEU C 1 291 ? -8.122  -28.069 10.086  1.00 156.47 ? 289 LEU C C     1 
ATOM   10271 O O     . LEU C 1 291 ? -8.036  -26.845 10.178  1.00 153.31 ? 289 LEU C O     1 
ATOM   10272 C CB    . LEU C 1 291 ? -5.799  -28.993 9.777   1.00 155.31 ? 289 LEU C CB    1 
ATOM   10273 C CG    . LEU C 1 291 ? -4.999  -27.691 9.648   1.00 153.15 ? 289 LEU C CG    1 
ATOM   10274 C CD1   . LEU C 1 291 ? -4.652  -27.131 11.014  1.00 150.29 ? 289 LEU C CD1   1 
ATOM   10275 C CD2   . LEU C 1 291 ? -3.736  -27.904 8.825   1.00 148.69 ? 289 LEU C CD2   1 
ATOM   10276 N N     . THR C 1 292 ? -9.137  -28.679 9.481   1.00 159.81 ? 290 THR C N     1 
ATOM   10277 C CA    . THR C 1 292 ? -10.266 -27.939 8.926   1.00 160.66 ? 290 THR C CA    1 
ATOM   10278 C C     . THR C 1 292 ? -11.348 -27.711 9.978   1.00 160.22 ? 290 THR C C     1 
ATOM   10279 O O     . THR C 1 292 ? -12.266 -26.915 9.777   1.00 159.64 ? 290 THR C O     1 
ATOM   10280 C CB    . THR C 1 292 ? -10.887 -28.674 7.720   1.00 160.33 ? 290 THR C CB    1 
ATOM   10281 O OG1   . THR C 1 292 ? -12.010 -27.930 7.228   1.00 158.92 ? 290 THR C OG1   1 
ATOM   10282 C CG2   . THR C 1 292 ? -11.341 -30.074 8.120   1.00 157.36 ? 290 THR C CG2   1 
ATOM   10283 N N     . GLU C 1 293 ? -11.225 -28.418 11.099  1.00 160.98 ? 291 GLU C N     1 
ATOM   10284 C CA    . GLU C 1 293 ? -12.186 -28.337 12.199  1.00 160.81 ? 291 GLU C CA    1 
ATOM   10285 C C     . GLU C 1 293 ? -12.280 -26.916 12.751  1.00 160.39 ? 291 GLU C C     1 
ATOM   10286 O O     . GLU C 1 293 ? -11.310 -26.163 12.698  1.00 159.96 ? 291 GLU C O     1 
ATOM   10287 C CB    . GLU C 1 293 ? -11.794 -29.318 13.312  1.00 159.61 ? 291 GLU C CB    1 
ATOM   10288 C CG    . GLU C 1 293 ? -12.601 -29.189 14.595  1.00 158.75 ? 291 GLU C CG    1 
ATOM   10289 C CD    . GLU C 1 293 ? -12.094 -30.103 15.698  1.00 158.47 ? 291 GLU C CD    1 
ATOM   10290 O OE1   . GLU C 1 293 ? -11.839 -31.293 15.417  1.00 157.97 ? 291 GLU C OE1   1 
ATOM   10291 O OE2   . GLU C 1 293 ? -11.939 -29.628 16.844  1.00 157.78 ? 291 GLU C OE2   1 
ATOM   10292 N N     . VAL C 1 294 ? -13.451 -26.548 13.265  1.00 161.21 ? 292 VAL C N     1 
ATOM   10293 C CA    . VAL C 1 294 ? -13.642 -25.223 13.855  1.00 162.14 ? 292 VAL C CA    1 
ATOM   10294 C C     . VAL C 1 294 ? -13.633 -25.269 15.387  1.00 160.75 ? 292 VAL C C     1 
ATOM   10295 O O     . VAL C 1 294 ? -14.269 -26.130 16.000  1.00 158.86 ? 292 VAL C O     1 
ATOM   10296 C CB    . VAL C 1 294 ? -14.943 -24.551 13.356  1.00 162.87 ? 292 VAL C CB    1 
ATOM   10297 C CG1   . VAL C 1 294 ? -16.150 -25.433 13.648  1.00 162.41 ? 292 VAL C CG1   1 
ATOM   10298 C CG2   . VAL C 1 294 ? -15.109 -23.174 13.987  1.00 161.16 ? 292 VAL C CG2   1 
ATOM   10299 N N     . ILE C 1 295 ? -12.906 -24.335 15.995  1.00 158.46 ? 293 ILE C N     1 
ATOM   10300 C CA    . ILE C 1 295 ? -12.792 -24.267 17.447  1.00 154.00 ? 293 ILE C CA    1 
ATOM   10301 C C     . ILE C 1 295 ? -13.348 -22.937 17.943  1.00 151.42 ? 293 ILE C C     1 
ATOM   10302 O O     . ILE C 1