data_3V9G
# 
_entry.id   3V9G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V9G         
RCSB  RCSB069762   
WWPDB D_1000069762 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3V9H 'human 1-pyrroline-5-carboxylate dehydrogenase mutant S352A'                         unspecified 
PDB 3V9I 'human 1-pyrroline-5-carboxylate dehydrogenase mutant S352L'                         unspecified 
PDB 3V9J 'mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with sulfate ion'           unspecified 
PDB 3V9K 'mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with the product glutamate' unspecified 
PDB 3V9L 'mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with NAD+'                  unspecified 
# 
_pdbx_database_status.entry_id                        3V9G 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-27 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tanner, J.J.'   1 
'Srivastava, D.' 2 
# 
_citation.id                        primary 
_citation.title                     'The Three-Dimensional Structural Basis of Type II Hyperprolinemia.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            420 
_citation.page_first                176 
_citation.page_last                 189 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22516612 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.04.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Srivastava, D.' 1 
primary 'Singh, R.K.'    2 
primary 'Moxley, M.A.'   3 
primary 'Henzl, M.T.'    4 
primary 'Becker, D.F.'   5 
primary 'Tanner, J.J.'   6 
# 
_cell.length_a           150.717 
_cell.length_b           150.717 
_cell.length_c           191.980 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3V9G 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3V9G 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial' 
_entity.formula_weight             62019.188 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    1.5.1.12 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 18-563' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'1-pyrroline-5-carboxylate dehydrogenase, P5C dehydrogenase, Aldehyde dehydrogenase family 4 member A1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSD
VQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQ
AEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDT
AMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGG
KNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSF
ARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYG
LTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDW
SYAYMQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSD
VQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQ
AEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDT
AMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGG
KNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSF
ARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYG
LTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDW
SYAYMQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  THR n 
1 22  GLY n 
1 23  ALA n 
1 24  GLY n 
1 25  LEU n 
1 26  ARG n 
1 27  TRP n 
1 28  LYS n 
1 29  HIS n 
1 30  THR n 
1 31  SER n 
1 32  SER n 
1 33  LEU n 
1 34  LYS n 
1 35  VAL n 
1 36  ALA n 
1 37  ASN n 
1 38  GLU n 
1 39  PRO n 
1 40  VAL n 
1 41  LEU n 
1 42  ALA n 
1 43  PHE n 
1 44  THR n 
1 45  GLN n 
1 46  GLY n 
1 47  SER n 
1 48  PRO n 
1 49  GLU n 
1 50  ARG n 
1 51  ASP n 
1 52  ALA n 
1 53  LEU n 
1 54  GLN n 
1 55  LYS n 
1 56  ALA n 
1 57  LEU n 
1 58  LYS n 
1 59  ASP n 
1 60  LEU n 
1 61  LYS n 
1 62  GLY n 
1 63  ARG n 
1 64  MET n 
1 65  GLU n 
1 66  ALA n 
1 67  ILE n 
1 68  PRO n 
1 69  CYS n 
1 70  VAL n 
1 71  VAL n 
1 72  GLY n 
1 73  ASP n 
1 74  GLU n 
1 75  GLU n 
1 76  VAL n 
1 77  TRP n 
1 78  THR n 
1 79  SER n 
1 80  ASP n 
1 81  VAL n 
1 82  GLN n 
1 83  TYR n 
1 84  GLN n 
1 85  VAL n 
1 86  SER n 
1 87  PRO n 
1 88  PHE n 
1 89  ASN n 
1 90  HIS n 
1 91  GLY n 
1 92  HIS n 
1 93  LYS n 
1 94  VAL n 
1 95  ALA n 
1 96  LYS n 
1 97  PHE n 
1 98  CYS n 
1 99  TYR n 
1 100 ALA n 
1 101 ASP n 
1 102 LYS n 
1 103 SER n 
1 104 LEU n 
1 105 LEU n 
1 106 ASN n 
1 107 LYS n 
1 108 ALA n 
1 109 ILE n 
1 110 GLU n 
1 111 ALA n 
1 112 ALA n 
1 113 LEU n 
1 114 ALA n 
1 115 ALA n 
1 116 ARG n 
1 117 LYS n 
1 118 GLU n 
1 119 TRP n 
1 120 ASP n 
1 121 LEU n 
1 122 LYS n 
1 123 PRO n 
1 124 ILE n 
1 125 ALA n 
1 126 ASP n 
1 127 ARG n 
1 128 ALA n 
1 129 GLN n 
1 130 ILE n 
1 131 PHE n 
1 132 LEU n 
1 133 LYS n 
1 134 ALA n 
1 135 ALA n 
1 136 ASP n 
1 137 MET n 
1 138 LEU n 
1 139 SER n 
1 140 GLY n 
1 141 PRO n 
1 142 ARG n 
1 143 ARG n 
1 144 ALA n 
1 145 GLU n 
1 146 ILE n 
1 147 LEU n 
1 148 ALA n 
1 149 LYS n 
1 150 THR n 
1 151 MET n 
1 152 VAL n 
1 153 GLY n 
1 154 GLN n 
1 155 GLY n 
1 156 LYS n 
1 157 THR n 
1 158 VAL n 
1 159 ILE n 
1 160 GLN n 
1 161 ALA n 
1 162 GLU n 
1 163 ILE n 
1 164 ASP n 
1 165 ALA n 
1 166 ALA n 
1 167 ALA n 
1 168 GLU n 
1 169 LEU n 
1 170 ILE n 
1 171 ASP n 
1 172 PHE n 
1 173 PHE n 
1 174 ARG n 
1 175 PHE n 
1 176 ASN n 
1 177 ALA n 
1 178 LYS n 
1 179 TYR n 
1 180 ALA n 
1 181 VAL n 
1 182 GLU n 
1 183 LEU n 
1 184 GLU n 
1 185 GLY n 
1 186 GLN n 
1 187 GLN n 
1 188 PRO n 
1 189 ILE n 
1 190 SER n 
1 191 VAL n 
1 192 PRO n 
1 193 PRO n 
1 194 SER n 
1 195 THR n 
1 196 ASN n 
1 197 SER n 
1 198 THR n 
1 199 VAL n 
1 200 TYR n 
1 201 ARG n 
1 202 GLY n 
1 203 LEU n 
1 204 GLU n 
1 205 GLY n 
1 206 PHE n 
1 207 VAL n 
1 208 ALA n 
1 209 ALA n 
1 210 ILE n 
1 211 SER n 
1 212 PRO n 
1 213 PHE n 
1 214 ASN n 
1 215 PHE n 
1 216 THR n 
1 217 ALA n 
1 218 ILE n 
1 219 GLY n 
1 220 GLY n 
1 221 ASN n 
1 222 LEU n 
1 223 ALA n 
1 224 GLY n 
1 225 ALA n 
1 226 PRO n 
1 227 ALA n 
1 228 LEU n 
1 229 MET n 
1 230 GLY n 
1 231 ASN n 
1 232 VAL n 
1 233 VAL n 
1 234 LEU n 
1 235 TRP n 
1 236 LYS n 
1 237 PRO n 
1 238 SER n 
1 239 ASP n 
1 240 THR n 
1 241 ALA n 
1 242 MET n 
1 243 LEU n 
1 244 ALA n 
1 245 SER n 
1 246 TYR n 
1 247 ALA n 
1 248 VAL n 
1 249 TYR n 
1 250 ARG n 
1 251 ILE n 
1 252 LEU n 
1 253 ARG n 
1 254 GLU n 
1 255 ALA n 
1 256 GLY n 
1 257 LEU n 
1 258 PRO n 
1 259 PRO n 
1 260 ASN n 
1 261 ILE n 
1 262 ILE n 
1 263 GLN n 
1 264 PHE n 
1 265 VAL n 
1 266 PRO n 
1 267 ALA n 
1 268 ASP n 
1 269 GLY n 
1 270 PRO n 
1 271 LEU n 
1 272 PHE n 
1 273 GLY n 
1 274 ASP n 
1 275 THR n 
1 276 VAL n 
1 277 THR n 
1 278 SER n 
1 279 SER n 
1 280 GLU n 
1 281 HIS n 
1 282 LEU n 
1 283 CYS n 
1 284 GLY n 
1 285 ILE n 
1 286 ASN n 
1 287 PHE n 
1 288 THR n 
1 289 GLY n 
1 290 SER n 
1 291 VAL n 
1 292 PRO n 
1 293 THR n 
1 294 PHE n 
1 295 LYS n 
1 296 HIS n 
1 297 LEU n 
1 298 TRP n 
1 299 LYS n 
1 300 GLN n 
1 301 VAL n 
1 302 ALA n 
1 303 GLN n 
1 304 ASN n 
1 305 LEU n 
1 306 ASP n 
1 307 ARG n 
1 308 PHE n 
1 309 HIS n 
1 310 THR n 
1 311 PHE n 
1 312 PRO n 
1 313 ARG n 
1 314 LEU n 
1 315 ALA n 
1 316 GLY n 
1 317 GLU n 
1 318 CYS n 
1 319 GLY n 
1 320 GLY n 
1 321 LYS n 
1 322 ASN n 
1 323 PHE n 
1 324 HIS n 
1 325 PHE n 
1 326 VAL n 
1 327 HIS n 
1 328 ARG n 
1 329 SER n 
1 330 ALA n 
1 331 ASP n 
1 332 VAL n 
1 333 GLU n 
1 334 SER n 
1 335 VAL n 
1 336 VAL n 
1 337 SER n 
1 338 GLY n 
1 339 THR n 
1 340 LEU n 
1 341 ARG n 
1 342 SER n 
1 343 ALA n 
1 344 PHE n 
1 345 GLU n 
1 346 TYR n 
1 347 GLY n 
1 348 GLY n 
1 349 GLN n 
1 350 LYS n 
1 351 CYS n 
1 352 SER n 
1 353 ALA n 
1 354 CYS n 
1 355 SER n 
1 356 ARG n 
1 357 LEU n 
1 358 TYR n 
1 359 VAL n 
1 360 PRO n 
1 361 HIS n 
1 362 SER n 
1 363 LEU n 
1 364 TRP n 
1 365 PRO n 
1 366 GLN n 
1 367 ILE n 
1 368 LYS n 
1 369 GLY n 
1 370 ARG n 
1 371 LEU n 
1 372 LEU n 
1 373 GLU n 
1 374 GLU n 
1 375 HIS n 
1 376 SER n 
1 377 ARG n 
1 378 ILE n 
1 379 LYS n 
1 380 VAL n 
1 381 GLY n 
1 382 ASP n 
1 383 PRO n 
1 384 ALA n 
1 385 GLU n 
1 386 ASP n 
1 387 PHE n 
1 388 GLY n 
1 389 THR n 
1 390 PHE n 
1 391 PHE n 
1 392 SER n 
1 393 ALA n 
1 394 VAL n 
1 395 ILE n 
1 396 ASP n 
1 397 ALA n 
1 398 LYS n 
1 399 SER n 
1 400 PHE n 
1 401 ALA n 
1 402 ARG n 
1 403 ILE n 
1 404 LYS n 
1 405 LYS n 
1 406 TRP n 
1 407 LEU n 
1 408 GLU n 
1 409 HIS n 
1 410 ALA n 
1 411 ARG n 
1 412 SER n 
1 413 SER n 
1 414 PRO n 
1 415 SER n 
1 416 LEU n 
1 417 THR n 
1 418 ILE n 
1 419 LEU n 
1 420 ALA n 
1 421 GLY n 
1 422 GLY n 
1 423 LYS n 
1 424 CYS n 
1 425 ASP n 
1 426 ASP n 
1 427 SER n 
1 428 VAL n 
1 429 GLY n 
1 430 TYR n 
1 431 PHE n 
1 432 VAL n 
1 433 GLU n 
1 434 PRO n 
1 435 CYS n 
1 436 ILE n 
1 437 VAL n 
1 438 GLU n 
1 439 SER n 
1 440 LYS n 
1 441 ASP n 
1 442 PRO n 
1 443 GLN n 
1 444 GLU n 
1 445 PRO n 
1 446 ILE n 
1 447 MET n 
1 448 LYS n 
1 449 GLU n 
1 450 GLU n 
1 451 ILE n 
1 452 PHE n 
1 453 GLY n 
1 454 PRO n 
1 455 VAL n 
1 456 LEU n 
1 457 SER n 
1 458 VAL n 
1 459 TYR n 
1 460 VAL n 
1 461 TYR n 
1 462 PRO n 
1 463 ASP n 
1 464 ASP n 
1 465 LYS n 
1 466 TYR n 
1 467 LYS n 
1 468 GLU n 
1 469 THR n 
1 470 LEU n 
1 471 GLN n 
1 472 LEU n 
1 473 VAL n 
1 474 ASP n 
1 475 SER n 
1 476 THR n 
1 477 THR n 
1 478 SER n 
1 479 TYR n 
1 480 GLY n 
1 481 LEU n 
1 482 THR n 
1 483 GLY n 
1 484 ALA n 
1 485 VAL n 
1 486 PHE n 
1 487 SER n 
1 488 GLN n 
1 489 ASP n 
1 490 LYS n 
1 491 ASP n 
1 492 VAL n 
1 493 VAL n 
1 494 GLN n 
1 495 GLU n 
1 496 ALA n 
1 497 THR n 
1 498 LYS n 
1 499 VAL n 
1 500 LEU n 
1 501 ARG n 
1 502 ASN n 
1 503 ALA n 
1 504 ALA n 
1 505 GLY n 
1 506 ASN n 
1 507 PHE n 
1 508 TYR n 
1 509 ILE n 
1 510 ASN n 
1 511 ASP n 
1 512 LYS n 
1 513 SER n 
1 514 THR n 
1 515 GLY n 
1 516 SER n 
1 517 ILE n 
1 518 VAL n 
1 519 GLY n 
1 520 GLN n 
1 521 GLN n 
1 522 PRO n 
1 523 PHE n 
1 524 GLY n 
1 525 GLY n 
1 526 ALA n 
1 527 ARG n 
1 528 ALA n 
1 529 SER n 
1 530 GLY n 
1 531 THR n 
1 532 ASN n 
1 533 ASP n 
1 534 LYS n 
1 535 PRO n 
1 536 GLY n 
1 537 GLY n 
1 538 PRO n 
1 539 HIS n 
1 540 TYR n 
1 541 ILE n 
1 542 LEU n 
1 543 ARG n 
1 544 TRP n 
1 545 THR n 
1 546 SER n 
1 547 PRO n 
1 548 GLN n 
1 549 VAL n 
1 550 ILE n 
1 551 LYS n 
1 552 GLU n 
1 553 THR n 
1 554 HIS n 
1 555 LYS n 
1 556 PRO n 
1 557 LEU n 
1 558 GLY n 
1 559 ASP n 
1 560 TRP n 
1 561 SER n 
1 562 TYR n 
1 563 ALA n 
1 564 TYR n 
1 565 MET n 
1 566 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ALDH4, ALDH4A1, P5CDH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AL4A1_HUMAN 
_struct_ref.pdbx_db_accession          P30038 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYA
DKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYA
VELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPN
IIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTL
RSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILA
GGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVL
RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
;
_struct_ref.pdbx_align_begin           18 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3V9G A 21 ? 566 ? P30038 18 ? 563 ? 18 563 
2 1 3V9G B 21 ? 566 ? P30038 18 ? 563 ? 18 563 
3 1 3V9G C 21 ? 566 ? P30038 18 ? 563 ? 18 563 
4 1 3V9G D 21 ? 566 ? P30038 18 ? 563 ? 18 563 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3V9G MET A 1  ? UNP P30038 ? ? 'EXPRESSION TAG' -2 1  
1 3V9G GLY A 2  ? UNP P30038 ? ? 'EXPRESSION TAG' -1 2  
1 3V9G SER A 3  ? UNP P30038 ? ? 'EXPRESSION TAG' 0  3  
1 3V9G SER A 4  ? UNP P30038 ? ? 'EXPRESSION TAG' 1  4  
1 3V9G HIS A 5  ? UNP P30038 ? ? 'EXPRESSION TAG' 2  5  
1 3V9G HIS A 6  ? UNP P30038 ? ? 'EXPRESSION TAG' 3  6  
1 3V9G HIS A 7  ? UNP P30038 ? ? 'EXPRESSION TAG' 4  7  
1 3V9G HIS A 8  ? UNP P30038 ? ? 'EXPRESSION TAG' 5  8  
1 3V9G HIS A 9  ? UNP P30038 ? ? 'EXPRESSION TAG' 6  9  
1 3V9G HIS A 10 ? UNP P30038 ? ? 'EXPRESSION TAG' 7  10 
1 3V9G SER A 11 ? UNP P30038 ? ? 'EXPRESSION TAG' 8  11 
1 3V9G SER A 12 ? UNP P30038 ? ? 'EXPRESSION TAG' 9  12 
1 3V9G GLY A 13 ? UNP P30038 ? ? 'EXPRESSION TAG' 10 13 
1 3V9G LEU A 14 ? UNP P30038 ? ? 'EXPRESSION TAG' 11 14 
1 3V9G VAL A 15 ? UNP P30038 ? ? 'EXPRESSION TAG' 12 15 
1 3V9G PRO A 16 ? UNP P30038 ? ? 'EXPRESSION TAG' 13 16 
1 3V9G ARG A 17 ? UNP P30038 ? ? 'EXPRESSION TAG' 14 17 
1 3V9G GLY A 18 ? UNP P30038 ? ? 'EXPRESSION TAG' 15 18 
1 3V9G SER A 19 ? UNP P30038 ? ? 'EXPRESSION TAG' 16 19 
1 3V9G HIS A 20 ? UNP P30038 ? ? 'EXPRESSION TAG' 17 20 
2 3V9G MET B 1  ? UNP P30038 ? ? 'EXPRESSION TAG' -2 21 
2 3V9G GLY B 2  ? UNP P30038 ? ? 'EXPRESSION TAG' -1 22 
2 3V9G SER B 3  ? UNP P30038 ? ? 'EXPRESSION TAG' 0  23 
2 3V9G SER B 4  ? UNP P30038 ? ? 'EXPRESSION TAG' 1  24 
2 3V9G HIS B 5  ? UNP P30038 ? ? 'EXPRESSION TAG' 2  25 
2 3V9G HIS B 6  ? UNP P30038 ? ? 'EXPRESSION TAG' 3  26 
2 3V9G HIS B 7  ? UNP P30038 ? ? 'EXPRESSION TAG' 4  27 
2 3V9G HIS B 8  ? UNP P30038 ? ? 'EXPRESSION TAG' 5  28 
2 3V9G HIS B 9  ? UNP P30038 ? ? 'EXPRESSION TAG' 6  29 
2 3V9G HIS B 10 ? UNP P30038 ? ? 'EXPRESSION TAG' 7  30 
2 3V9G SER B 11 ? UNP P30038 ? ? 'EXPRESSION TAG' 8  31 
2 3V9G SER B 12 ? UNP P30038 ? ? 'EXPRESSION TAG' 9  32 
2 3V9G GLY B 13 ? UNP P30038 ? ? 'EXPRESSION TAG' 10 33 
2 3V9G LEU B 14 ? UNP P30038 ? ? 'EXPRESSION TAG' 11 34 
2 3V9G VAL B 15 ? UNP P30038 ? ? 'EXPRESSION TAG' 12 35 
2 3V9G PRO B 16 ? UNP P30038 ? ? 'EXPRESSION TAG' 13 36 
2 3V9G ARG B 17 ? UNP P30038 ? ? 'EXPRESSION TAG' 14 37 
2 3V9G GLY B 18 ? UNP P30038 ? ? 'EXPRESSION TAG' 15 38 
2 3V9G SER B 19 ? UNP P30038 ? ? 'EXPRESSION TAG' 16 39 
2 3V9G HIS B 20 ? UNP P30038 ? ? 'EXPRESSION TAG' 17 40 
3 3V9G MET C 1  ? UNP P30038 ? ? 'EXPRESSION TAG' -2 41 
3 3V9G GLY C 2  ? UNP P30038 ? ? 'EXPRESSION TAG' -1 42 
3 3V9G SER C 3  ? UNP P30038 ? ? 'EXPRESSION TAG' 0  43 
3 3V9G SER C 4  ? UNP P30038 ? ? 'EXPRESSION TAG' 1  44 
3 3V9G HIS C 5  ? UNP P30038 ? ? 'EXPRESSION TAG' 2  45 
3 3V9G HIS C 6  ? UNP P30038 ? ? 'EXPRESSION TAG' 3  46 
3 3V9G HIS C 7  ? UNP P30038 ? ? 'EXPRESSION TAG' 4  47 
3 3V9G HIS C 8  ? UNP P30038 ? ? 'EXPRESSION TAG' 5  48 
3 3V9G HIS C 9  ? UNP P30038 ? ? 'EXPRESSION TAG' 6  49 
3 3V9G HIS C 10 ? UNP P30038 ? ? 'EXPRESSION TAG' 7  50 
3 3V9G SER C 11 ? UNP P30038 ? ? 'EXPRESSION TAG' 8  51 
3 3V9G SER C 12 ? UNP P30038 ? ? 'EXPRESSION TAG' 9  52 
3 3V9G GLY C 13 ? UNP P30038 ? ? 'EXPRESSION TAG' 10 53 
3 3V9G LEU C 14 ? UNP P30038 ? ? 'EXPRESSION TAG' 11 54 
3 3V9G VAL C 15 ? UNP P30038 ? ? 'EXPRESSION TAG' 12 55 
3 3V9G PRO C 16 ? UNP P30038 ? ? 'EXPRESSION TAG' 13 56 
3 3V9G ARG C 17 ? UNP P30038 ? ? 'EXPRESSION TAG' 14 57 
3 3V9G GLY C 18 ? UNP P30038 ? ? 'EXPRESSION TAG' 15 58 
3 3V9G SER C 19 ? UNP P30038 ? ? 'EXPRESSION TAG' 16 59 
3 3V9G HIS C 20 ? UNP P30038 ? ? 'EXPRESSION TAG' 17 60 
4 3V9G MET D 1  ? UNP P30038 ? ? 'EXPRESSION TAG' -2 61 
4 3V9G GLY D 2  ? UNP P30038 ? ? 'EXPRESSION TAG' -1 62 
4 3V9G SER D 3  ? UNP P30038 ? ? 'EXPRESSION TAG' 0  63 
4 3V9G SER D 4  ? UNP P30038 ? ? 'EXPRESSION TAG' 1  64 
4 3V9G HIS D 5  ? UNP P30038 ? ? 'EXPRESSION TAG' 2  65 
4 3V9G HIS D 6  ? UNP P30038 ? ? 'EXPRESSION TAG' 3  66 
4 3V9G HIS D 7  ? UNP P30038 ? ? 'EXPRESSION TAG' 4  67 
4 3V9G HIS D 8  ? UNP P30038 ? ? 'EXPRESSION TAG' 5  68 
4 3V9G HIS D 9  ? UNP P30038 ? ? 'EXPRESSION TAG' 6  69 
4 3V9G HIS D 10 ? UNP P30038 ? ? 'EXPRESSION TAG' 7  70 
4 3V9G SER D 11 ? UNP P30038 ? ? 'EXPRESSION TAG' 8  71 
4 3V9G SER D 12 ? UNP P30038 ? ? 'EXPRESSION TAG' 9  72 
4 3V9G GLY D 13 ? UNP P30038 ? ? 'EXPRESSION TAG' 10 73 
4 3V9G LEU D 14 ? UNP P30038 ? ? 'EXPRESSION TAG' 11 74 
4 3V9G VAL D 15 ? UNP P30038 ? ? 'EXPRESSION TAG' 12 75 
4 3V9G PRO D 16 ? UNP P30038 ? ? 'EXPRESSION TAG' 13 76 
4 3V9G ARG D 17 ? UNP P30038 ? ? 'EXPRESSION TAG' 14 77 
4 3V9G GLY D 18 ? UNP P30038 ? ? 'EXPRESSION TAG' 15 78 
4 3V9G SER D 19 ? UNP P30038 ? ? 'EXPRESSION TAG' 16 79 
4 3V9G HIS D 20 ? UNP P30038 ? ? 'EXPRESSION TAG' 17 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3V9G 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
;reservoir: 22.5% PEG3350, 0.2 M ammonium sulfate, 0.1 M HEPES, cryoprotectant: 25% PEG3350, 0.2 M ammonium sulfate, 0.1 M HEPES, 25% glycerol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-02-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979181 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength_list        0.979181 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3V9G 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             50.0 
_reflns.number_obs                   84960 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_netI_over_sigmaI        14.6 
_reflns.pdbx_chi_squared             1.566 
_reflns.pdbx_redundancy              3.8 
_reflns.percent_possible_obs         99.7 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.500 2.590  ? ? ? 0.539 ? ? 1.487 3.8 ? 8498 100.0 1  1 
2.590 2.690  ? ? ? 0.393 ? ? 1.526 3.8 ? 8478 100.0 2  1 
2.690 2.820  ? ? ? 0.283 ? ? 1.515 3.8 ? 8485 100.0 3  1 
2.820 2.960  ? ? ? 0.184 ? ? 1.524 3.8 ? 8504 100.0 4  1 
2.960 3.150  ? ? ? 0.130 ? ? 1.503 3.8 ? 8498 100.0 5  1 
3.150 3.390  ? ? ? 0.088 ? ? 1.485 3.8 ? 8511 100.0 6  1 
3.390 3.730  ? ? ? 0.063 ? ? 1.352 3.8 ? 8481 100.0 7  1 
3.730 4.270  ? ? ? 0.057 ? ? 1.495 3.8 ? 8556 99.9  8  1 
4.270 5.380  ? ? ? 0.059 ? ? 1.821 3.7 ? 8529 99.7  9  1 
5.380 50.000 ? ? ? 0.055 ? ? 1.982 3.7 ? 8420 97.7  10 1 
# 
_refine.entry_id                                 3V9G 
_refine.ls_d_res_high                            2.500 
_refine.ls_d_res_low                             38.665 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.68 
_refine.ls_number_reflns_obs                     84851 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2048 
_refine.ls_R_factor_R_work                       0.2039 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2385 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.36 
_refine.ls_number_reflns_R_free                  2005 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               63.5665 
_refine.solvent_model_param_bsol                 40.7200 
_refine.solvent_model_param_ksol                 0.3350 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            3.3239 
_refine.aniso_B[2][2]                            3.3239 
_refine.aniso_B[3][3]                            -6.6478 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4000 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.0000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.7200 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7801 
_refine.B_iso_max                                151.620 
_refine.B_iso_min                                16.650 
_refine.pdbx_overall_phase_error                 28.6400 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16032 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16032 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        38.665 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           16458 0.009  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          22493 1.222  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     2530  0.077  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      2940  0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 5633  13.620 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1 1 POSITIONAL A 3923 0.076 ? 1 ? ? ? 
'X-RAY DIFFRACTION' 1 2 POSITIONAL B 3923 0.076 ? 2 ? ? ? 
'X-RAY DIFFRACTION' 1 3 POSITIONAL C 3891 0.073 ? 3 ? ? ? 
'X-RAY DIFFRACTION' 1 4 POSITIONAL D 3878 0.071 ? 4 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.500  2.5898  10 100.0 8293 . 0.3057 0.3672 . 198 . 8491 8293 . 'X-RAY DIFFRACTION' 
2.5898 2.6934  10 100.0 8260 . 0.2970 0.3523 . 200 . 8460 8260 . 'X-RAY DIFFRACTION' 
2.6934 2.8160  10 100.0 8282 . 0.2809 0.3380 . 198 . 8480 8282 . 'X-RAY DIFFRACTION' 
2.8160 2.9644  10 100.0 8304 . 0.2686 0.3603 . 197 . 8501 8304 . 'X-RAY DIFFRACTION' 
2.9644 3.1500  10 100.0 8284 . 0.2516 0.3340 . 202 . 8486 8284 . 'X-RAY DIFFRACTION' 
3.1500 3.3931  10 100.0 8296 . 0.2411 0.2828 . 205 . 8501 8296 . 'X-RAY DIFFRACTION' 
3.3931 3.7343  10 100.0 8283 . 0.2102 0.2277 . 197 . 8480 8283 . 'X-RAY DIFFRACTION' 
3.7343 4.2741  10 100.0 8327 . 0.1745 0.2223 . 208 . 8535 8327 . 'X-RAY DIFFRACTION' 
4.2741 5.3826  10 100.0 8305 . 0.1545 0.1780 . 202 . 8507 8305 . 'X-RAY DIFFRACTION' 
5.3826 38.6696 10 98.0  8212 . 0.1734 0.1773 . 198 . 8410 8212 . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.737825  0.674660  -0.021190 0.674629  -0.738094 -0.009664 -0.022161 -0.007165 -0.999729 -32.675900 90.122498  
179.835999 
2 given ? -0.712684 -0.684883 -0.151711 -0.644305 0.553575  0.527660  -0.277402 0.473804  -0.835798 132.535995 7.314510   
146.136993 
3 given ? -0.952182 -0.133579 0.274785  -0.015441 -0.877177 -0.479918 0.305142  -0.461212 0.833169  64.931900  173.207993 
30.421400  
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 35 A 562 'chain A and (resseq 35:562)' ? ? ? ? ? ? ? ? 
1 2 1 ? B 35 B 562 'chain B and (resseq 35:562)' ? ? ? ? ? ? ? ? 
1 3 1 ? C 35 C 562 'chain C and (resseq 35:562)' ? ? ? ? ? ? ? ? 
1 4 1 ? D 35 D 562 'chain D and (resseq 35:562)' ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3V9G 
_struct.title                     'Crystal structure of human 1-pyrroline-5-carboxylate dehydrogenase' 
_struct.pdbx_descriptor           'Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (E.C.1.5.1.12)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V9G 
_struct_keywords.text            
;aldehyde dehydrogenase, Rossmann fold, nucleotide binding, acting on aldehyde or oxo group of donors, NAD or NADP as acceptor, mitochondria, OXIDOREDUCTASE
;
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 47  ? ASP A 59  ? SER A 44  ASP A 56  1 ? 13 
HELX_P HELX_P2  2  ASP A 101 ? LYS A 122 ? ASP A 98  LYS A 119 1 ? 22 
HELX_P HELX_P3  3  PRO A 123 ? GLY A 140 ? PRO A 120 GLY A 137 1 ? 18 
HELX_P HELX_P4  4  ARG A 142 ? GLY A 155 ? ARG A 139 GLY A 152 1 ? 14 
HELX_P HELX_P5  5  THR A 157 ? ALA A 165 ? THR A 154 ALA A 162 1 ? 9  
HELX_P HELX_P6  6  ALA A 166 ? GLU A 184 ? ALA A 163 GLU A 181 1 ? 19 
HELX_P HELX_P7  7  PHE A 215 ? MET A 229 ? PHE A 212 MET A 226 1 ? 15 
HELX_P HELX_P8  8  SER A 238 ? THR A 240 ? SER A 235 THR A 237 5 ? 3  
HELX_P HELX_P9  9  ALA A 241 ? ALA A 255 ? ALA A 238 ALA A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 268 ? THR A 277 ? ASP A 265 THR A 274 1 ? 10 
HELX_P HELX_P11 11 SER A 290 ? ASN A 304 ? SER A 287 ASN A 301 1 ? 15 
HELX_P HELX_P12 12 LEU A 305 ? PHE A 308 ? LEU A 302 PHE A 305 5 ? 4  
HELX_P HELX_P13 13 ASP A 331 ? GLU A 345 ? ASP A 328 GLU A 342 1 ? 15 
HELX_P HELX_P14 14 TYR A 346 ? GLN A 349 ? TYR A 343 GLN A 346 5 ? 4  
HELX_P HELX_P15 15 LEU A 363 ? SER A 376 ? LEU A 360 SER A 373 1 ? 14 
HELX_P HELX_P16 16 ASP A 396 ? SER A 413 ? ASP A 393 SER A 410 1 ? 18 
HELX_P HELX_P17 17 GLU A 444 ? GLU A 449 ? GLU A 441 GLU A 446 1 ? 6  
HELX_P HELX_P18 18 PRO A 462 ? ASP A 464 ? PRO A 459 ASP A 461 5 ? 3  
HELX_P HELX_P19 19 LYS A 465 ? THR A 477 ? LYS A 462 THR A 474 1 ? 13 
HELX_P HELX_P20 20 ASP A 489 ? LEU A 500 ? ASP A 486 LEU A 497 1 ? 12 
HELX_P HELX_P21 21 HIS A 539 ? ARG A 543 ? HIS A 536 ARG A 540 5 ? 5  
HELX_P HELX_P22 22 TYR A 562 ? GLN A 566 ? TYR A 559 GLN A 563 5 ? 5  
HELX_P HELX_P23 23 SER B 47  ? ASP B 59  ? SER B 44  ASP B 56  1 ? 13 
HELX_P HELX_P24 24 ASP B 101 ? LYS B 122 ? ASP B 98  LYS B 119 1 ? 22 
HELX_P HELX_P25 25 PRO B 123 ? GLY B 140 ? PRO B 120 GLY B 137 1 ? 18 
HELX_P HELX_P26 26 ARG B 142 ? GLY B 155 ? ARG B 139 GLY B 152 1 ? 14 
HELX_P HELX_P27 27 THR B 157 ? ALA B 166 ? THR B 154 ALA B 163 1 ? 10 
HELX_P HELX_P28 28 ALA B 166 ? GLU B 184 ? ALA B 163 GLU B 181 1 ? 19 
HELX_P HELX_P29 29 PHE B 215 ? MET B 229 ? PHE B 212 MET B 226 1 ? 15 
HELX_P HELX_P30 30 SER B 238 ? THR B 240 ? SER B 235 THR B 237 5 ? 3  
HELX_P HELX_P31 31 ALA B 241 ? ALA B 255 ? ALA B 238 ALA B 252 1 ? 15 
HELX_P HELX_P32 32 ASP B 268 ? THR B 277 ? ASP B 265 THR B 274 1 ? 10 
HELX_P HELX_P33 33 SER B 290 ? ASN B 304 ? SER B 287 ASN B 301 1 ? 15 
HELX_P HELX_P34 34 LEU B 305 ? PHE B 308 ? LEU B 302 PHE B 305 5 ? 4  
HELX_P HELX_P35 35 ASP B 331 ? GLU B 345 ? ASP B 328 GLU B 342 1 ? 15 
HELX_P HELX_P36 36 TYR B 346 ? GLN B 349 ? TYR B 343 GLN B 346 5 ? 4  
HELX_P HELX_P37 37 LEU B 363 ? SER B 376 ? LEU B 360 SER B 373 1 ? 14 
HELX_P HELX_P38 38 ASP B 396 ? SER B 413 ? ASP B 393 SER B 410 1 ? 18 
HELX_P HELX_P39 39 GLU B 444 ? GLU B 449 ? GLU B 441 GLU B 446 1 ? 6  
HELX_P HELX_P40 40 PRO B 462 ? ASP B 464 ? PRO B 459 ASP B 461 5 ? 3  
HELX_P HELX_P41 41 LYS B 465 ? THR B 477 ? LYS B 462 THR B 474 1 ? 13 
HELX_P HELX_P42 42 ASP B 489 ? LEU B 500 ? ASP B 486 LEU B 497 1 ? 12 
HELX_P HELX_P43 43 HIS B 539 ? ARG B 543 ? HIS B 536 ARG B 540 5 ? 5  
HELX_P HELX_P44 44 TYR B 562 ? GLN B 566 ? TYR B 559 GLN B 563 5 ? 5  
HELX_P HELX_P45 45 SER C 47  ? ASP C 59  ? SER C 44  ASP C 56  1 ? 13 
HELX_P HELX_P46 46 ASP C 101 ? LYS C 122 ? ASP C 98  LYS C 119 1 ? 22 
HELX_P HELX_P47 47 PRO C 123 ? GLY C 140 ? PRO C 120 GLY C 137 1 ? 18 
HELX_P HELX_P48 48 ARG C 142 ? GLY C 155 ? ARG C 139 GLY C 152 1 ? 14 
HELX_P HELX_P49 49 THR C 157 ? ALA C 166 ? THR C 154 ALA C 163 1 ? 10 
HELX_P HELX_P50 50 ALA C 166 ? GLU C 184 ? ALA C 163 GLU C 181 1 ? 19 
HELX_P HELX_P51 51 PHE C 215 ? MET C 229 ? PHE C 212 MET C 226 1 ? 15 
HELX_P HELX_P52 52 SER C 238 ? THR C 240 ? SER C 235 THR C 237 5 ? 3  
HELX_P HELX_P53 53 ALA C 241 ? ALA C 255 ? ALA C 238 ALA C 252 1 ? 15 
HELX_P HELX_P54 54 ASP C 268 ? THR C 277 ? ASP C 265 THR C 274 1 ? 10 
HELX_P HELX_P55 55 SER C 290 ? ASN C 304 ? SER C 287 ASN C 301 1 ? 15 
HELX_P HELX_P56 56 LEU C 305 ? PHE C 308 ? LEU C 302 PHE C 305 5 ? 4  
HELX_P HELX_P57 57 ASP C 331 ? GLU C 345 ? ASP C 328 GLU C 342 1 ? 15 
HELX_P HELX_P58 58 TYR C 346 ? GLN C 349 ? TYR C 343 GLN C 346 5 ? 4  
HELX_P HELX_P59 59 LEU C 363 ? SER C 376 ? LEU C 360 SER C 373 1 ? 14 
HELX_P HELX_P60 60 ASP C 396 ? SER C 413 ? ASP C 393 SER C 410 1 ? 18 
HELX_P HELX_P61 61 GLU C 444 ? GLU C 449 ? GLU C 441 GLU C 446 1 ? 6  
HELX_P HELX_P62 62 PRO C 462 ? ASP C 464 ? PRO C 459 ASP C 461 5 ? 3  
HELX_P HELX_P63 63 LYS C 465 ? THR C 477 ? LYS C 462 THR C 474 1 ? 13 
HELX_P HELX_P64 64 ASP C 489 ? LEU C 500 ? ASP C 486 LEU C 497 1 ? 12 
HELX_P HELX_P65 65 HIS C 539 ? ARG C 543 ? HIS C 536 ARG C 540 5 ? 5  
HELX_P HELX_P66 66 SER D 47  ? ASP D 59  ? SER D 44  ASP D 56  1 ? 13 
HELX_P HELX_P67 67 ASP D 101 ? LYS D 122 ? ASP D 98  LYS D 119 1 ? 22 
HELX_P HELX_P68 68 PRO D 123 ? GLY D 140 ? PRO D 120 GLY D 137 1 ? 18 
HELX_P HELX_P69 69 ARG D 142 ? GLY D 155 ? ARG D 139 GLY D 152 1 ? 14 
HELX_P HELX_P70 70 THR D 157 ? ALA D 165 ? THR D 154 ALA D 162 1 ? 9  
HELX_P HELX_P71 71 ALA D 166 ? GLU D 184 ? ALA D 163 GLU D 181 1 ? 19 
HELX_P HELX_P72 72 PHE D 215 ? MET D 229 ? PHE D 212 MET D 226 1 ? 15 
HELX_P HELX_P73 73 SER D 238 ? THR D 240 ? SER D 235 THR D 237 5 ? 3  
HELX_P HELX_P74 74 ALA D 241 ? ALA D 255 ? ALA D 238 ALA D 252 1 ? 15 
HELX_P HELX_P75 75 ASP D 268 ? THR D 277 ? ASP D 265 THR D 274 1 ? 10 
HELX_P HELX_P76 76 SER D 290 ? ASN D 304 ? SER D 287 ASN D 301 1 ? 15 
HELX_P HELX_P77 77 LEU D 305 ? PHE D 308 ? LEU D 302 PHE D 305 5 ? 4  
HELX_P HELX_P78 78 ASP D 331 ? GLU D 345 ? ASP D 328 GLU D 342 1 ? 15 
HELX_P HELX_P79 79 TYR D 346 ? GLN D 349 ? TYR D 343 GLN D 346 5 ? 4  
HELX_P HELX_P80 80 LEU D 363 ? SER D 376 ? LEU D 360 SER D 373 1 ? 14 
HELX_P HELX_P81 81 ASP D 396 ? SER D 413 ? ASP D 393 SER D 410 1 ? 18 
HELX_P HELX_P82 82 GLU D 444 ? GLU D 449 ? GLU D 441 GLU D 446 1 ? 6  
HELX_P HELX_P83 83 PRO D 462 ? ASP D 464 ? PRO D 459 ASP D 461 5 ? 3  
HELX_P HELX_P84 84 LYS D 465 ? THR D 477 ? LYS D 462 THR D 474 1 ? 13 
HELX_P HELX_P85 85 ASP D 489 ? LEU D 500 ? ASP D 486 LEU D 497 1 ? 12 
HELX_P HELX_P86 86 ALA D 526 ? GLY D 530 ? ALA D 523 GLY D 527 5 ? 5  
HELX_P HELX_P87 87 HIS D 539 ? ARG D 543 ? HIS D 536 ARG D 540 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 192 A . ? PRO 189 A PRO 193 A ? PRO 190 A 1 7.36 
2 PRO 192 B . ? PRO 189 B PRO 193 B ? PRO 190 B 1 6.49 
3 PRO 192 C . ? PRO 189 C PRO 193 C ? PRO 190 C 1 7.77 
4 PRO 192 D . ? PRO 189 D PRO 193 D ? PRO 190 D 1 8.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 9 ? 
E ? 5 ? 
F ? 9 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 5 ? 
M ? 2 ? 
N ? 2 ? 
O ? 3 ? 
P ? 2 ? 
Q ? 9 ? 
R ? 5 ? 
S ? 9 ? 
T ? 2 ? 
U ? 2 ? 
V ? 3 ? 
W ? 2 ? 
X ? 5 ? 
Y ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? parallel      
D 8 9 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? parallel      
F 7 8 ? parallel      
F 8 9 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? parallel      
Q 6 7 ? parallel      
Q 7 8 ? parallel      
Q 8 9 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? parallel      
R 3 4 ? parallel      
R 4 5 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? parallel      
S 3 4 ? parallel      
S 4 5 ? parallel      
S 5 6 ? parallel      
S 6 7 ? parallel      
S 7 8 ? parallel      
S 8 9 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? parallel      
V 2 3 ? anti-parallel 
W 1 2 ? anti-parallel 
X 1 2 ? parallel      
X 2 3 ? parallel      
X 3 4 ? parallel      
X 4 5 ? parallel      
Y 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 27  ? LEU A 33  ? TRP A 24  LEU A 30  
A 2 TRP C 27  ? LEU C 33  ? TRP C 24  LEU C 30  
B 1 GLU A 65  ? ILE A 67  ? GLU A 62  ILE A 64  
B 2 ASN A 89  ? CYS A 98  ? ASN A 86  CYS A 95  
B 3 VAL A 81  ? SER A 86  ? VAL A 78  SER A 83  
C 1 CYS A 69  ? VAL A 71  ? CYS A 66  VAL A 68  
C 2 GLU A 74  ? VAL A 76  ? GLU A 71  VAL A 73  
D 1 SER A 194 ? GLY A 202 ? SER A 191 GLY A 199 
D 2 THR A 545 ? THR A 553 ? THR A 542 THR A 550 
D 3 ASN B 506 ? ILE B 509 ? ASN B 503 ILE B 506 
D 4 THR B 482 ? PHE B 486 ? THR B 479 PHE B 483 
D 5 ASN B 322 ? VAL B 326 ? ASN B 319 VAL B 323 
D 6 CYS B 354 ? PRO B 360 ? CYS B 351 PRO B 357 
D 7 VAL B 455 ? TYR B 461 ? VAL B 452 TYR B 458 
D 8 CYS B 435 ? SER B 439 ? CYS B 432 SER B 436 
D 9 LEU B 416 ? ALA B 420 ? LEU B 413 ALA B 417 
E 1 ILE A 262 ? PHE A 264 ? ILE A 259 PHE A 261 
E 2 VAL A 232 ? LYS A 236 ? VAL A 229 LYS A 233 
E 3 PHE A 206 ? ILE A 210 ? PHE A 203 ILE A 207 
E 4 LEU A 282 ? THR A 288 ? LEU A 279 THR A 285 
E 5 ARG A 313 ? GLU A 317 ? ARG A 310 GLU A 314 
F 1 LEU A 416 ? ALA A 420 ? LEU A 413 ALA A 417 
F 2 CYS A 435 ? SER A 439 ? CYS A 432 SER A 436 
F 3 VAL A 455 ? TYR A 461 ? VAL A 452 TYR A 458 
F 4 CYS A 354 ? PRO A 360 ? CYS A 351 PRO A 357 
F 5 ASN A 322 ? VAL A 326 ? ASN A 319 VAL A 323 
F 6 THR A 482 ? PHE A 486 ? THR A 479 PHE A 483 
F 7 ASN A 506 ? ILE A 509 ? ASN A 503 ILE A 506 
F 8 THR B 545 ? THR B 553 ? THR B 542 THR B 550 
F 9 SER B 194 ? GLY B 202 ? SER B 191 GLY B 199 
G 1 CYS A 424 ? ASP A 425 ? CYS A 421 ASP A 422 
G 2 PHE A 431 ? VAL A 432 ? PHE A 428 VAL A 429 
H 1 TYR A 479 ? GLY A 480 ? TYR A 476 GLY A 477 
H 2 ALA A 526 ? ARG A 527 ? ALA A 523 ARG A 524 
I 1 TRP B 27  ? VAL B 35  ? TRP B 24  VAL B 32  
I 2 TRP D 27  ? VAL D 35  ? TRP D 24  VAL D 32  
J 1 GLU B 65  ? ILE B 67  ? GLU B 62  ILE B 64  
J 2 LYS B 93  ? CYS B 98  ? LYS B 90  CYS B 95  
J 3 VAL B 81  ? VAL B 85  ? VAL B 78  VAL B 82  
K 1 CYS B 69  ? VAL B 71  ? CYS B 66  VAL B 68  
K 2 GLU B 74  ? VAL B 76  ? GLU B 71  VAL B 73  
L 1 ILE B 262 ? PHE B 264 ? ILE B 259 PHE B 261 
L 2 VAL B 232 ? LYS B 236 ? VAL B 229 LYS B 233 
L 3 PHE B 206 ? ILE B 210 ? PHE B 203 ILE B 207 
L 4 LEU B 282 ? THR B 288 ? LEU B 279 THR B 285 
L 5 ARG B 313 ? GLU B 317 ? ARG B 310 GLU B 314 
M 1 CYS B 424 ? ASP B 425 ? CYS B 421 ASP B 422 
M 2 PHE B 431 ? VAL B 432 ? PHE B 428 VAL B 429 
N 1 TYR B 479 ? GLY B 480 ? TYR B 476 GLY B 477 
N 2 ALA B 526 ? ARG B 527 ? ALA B 523 ARG B 524 
O 1 GLU C 65  ? ALA C 66  ? GLU C 62  ALA C 63  
O 2 ASN C 89  ? CYS C 98  ? ASN C 86  CYS C 95  
O 3 VAL C 81  ? SER C 86  ? VAL C 78  SER C 83  
P 1 CYS C 69  ? VAL C 71  ? CYS C 66  VAL C 68  
P 2 GLU C 74  ? VAL C 76  ? GLU C 71  VAL C 73  
Q 1 SER C 194 ? GLY C 202 ? SER C 191 GLY C 199 
Q 2 THR C 545 ? THR C 553 ? THR C 542 THR C 550 
Q 3 ASN D 506 ? ILE D 509 ? ASN D 503 ILE D 506 
Q 4 THR D 482 ? PHE D 486 ? THR D 479 PHE D 483 
Q 5 ASN D 322 ? VAL D 326 ? ASN D 319 VAL D 323 
Q 6 CYS D 354 ? PRO D 360 ? CYS D 351 PRO D 357 
Q 7 VAL D 455 ? TYR D 461 ? VAL D 452 TYR D 458 
Q 8 CYS D 435 ? SER D 439 ? CYS D 432 SER D 436 
Q 9 LEU D 416 ? ALA D 420 ? LEU D 413 ALA D 417 
R 1 ILE C 262 ? PHE C 264 ? ILE C 259 PHE C 261 
R 2 VAL C 232 ? LYS C 236 ? VAL C 229 LYS C 233 
R 3 PHE C 206 ? ILE C 210 ? PHE C 203 ILE C 207 
R 4 LEU C 282 ? THR C 288 ? LEU C 279 THR C 285 
R 5 ARG C 313 ? GLU C 317 ? ARG C 310 GLU C 314 
S 1 LEU C 416 ? ALA C 420 ? LEU C 413 ALA C 417 
S 2 CYS C 435 ? SER C 439 ? CYS C 432 SER C 436 
S 3 VAL C 455 ? TYR C 461 ? VAL C 452 TYR C 458 
S 4 CYS C 354 ? PRO C 360 ? CYS C 351 PRO C 357 
S 5 ASN C 322 ? VAL C 326 ? ASN C 319 VAL C 323 
S 6 THR C 482 ? PHE C 486 ? THR C 479 PHE C 483 
S 7 ASN C 506 ? ILE C 509 ? ASN C 503 ILE C 506 
S 8 THR D 545 ? THR D 553 ? THR D 542 THR D 550 
S 9 SER D 194 ? GLY D 202 ? SER D 191 GLY D 199 
T 1 CYS C 424 ? ASP C 425 ? CYS C 421 ASP C 422 
T 2 PHE C 431 ? VAL C 432 ? PHE C 428 VAL C 429 
U 1 TYR C 479 ? GLY C 480 ? TYR C 476 GLY C 477 
U 2 ALA C 526 ? ARG C 527 ? ALA C 523 ARG C 524 
V 1 GLU D 65  ? ALA D 66  ? GLU D 62  ALA D 63  
V 2 ASN D 89  ? CYS D 98  ? ASN D 86  CYS D 95  
V 3 VAL D 81  ? SER D 86  ? VAL D 78  SER D 83  
W 1 CYS D 69  ? VAL D 71  ? CYS D 66  VAL D 68  
W 2 GLU D 74  ? VAL D 76  ? GLU D 71  VAL D 73  
X 1 ILE D 262 ? PHE D 264 ? ILE D 259 PHE D 261 
X 2 VAL D 232 ? LYS D 236 ? VAL D 229 LYS D 233 
X 3 PHE D 206 ? ILE D 210 ? PHE D 203 ILE D 207 
X 4 LEU D 282 ? THR D 288 ? LEU D 279 THR D 285 
X 5 ARG D 313 ? GLU D 317 ? ARG D 310 GLU D 314 
Y 1 CYS D 424 ? ASP D 425 ? CYS D 421 ASP D 422 
Y 2 PHE D 431 ? VAL D 432 ? PHE D 428 VAL D 429 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 30  ? N THR A 27  O THR C 30  ? O THR C 27  
B 1 2 N ILE A 67  ? N ILE A 64  O LYS A 96  ? O LYS A 93  
B 2 3 O PHE A 97  ? O PHE A 94  N GLN A 82  ? N GLN A 79  
C 1 2 N CYS A 69  ? N CYS A 66  O VAL A 76  ? O VAL A 73  
D 1 2 N SER A 197 ? N SER A 194 O ILE A 550 ? O ILE A 547 
D 2 3 N LYS A 551 ? N LYS A 548 O ILE B 509 ? O ILE B 506 
D 3 4 O TYR B 508 ? O TYR B 505 N VAL B 485 ? N VAL B 482 
D 4 5 O ALA B 484 ? O ALA B 481 N PHE B 325 ? N PHE B 322 
D 5 6 N VAL B 326 ? N VAL B 323 O TYR B 358 ? O TYR B 355 
D 6 7 N VAL B 359 ? N VAL B 356 O TYR B 461 ? O TYR B 458 
D 7 8 O VAL B 458 ? O VAL B 455 N SER B 439 ? N SER B 436 
D 8 9 O ILE B 436 ? O ILE B 433 N LEU B 419 ? N LEU B 416 
E 1 2 O GLN A 263 ? O GLN A 260 N VAL A 233 ? N VAL A 230 
E 2 3 O VAL A 232 ? O VAL A 229 N VAL A 207 ? N VAL A 204 
E 3 4 N ALA A 208 ? N ALA A 205 O ASN A 286 ? O ASN A 283 
E 4 5 N PHE A 287 ? N PHE A 284 O ALA A 315 ? O ALA A 312 
F 1 2 N LEU A 419 ? N LEU A 416 O ILE A 436 ? O ILE A 433 
F 2 3 N SER A 439 ? N SER A 436 O VAL A 458 ? O VAL A 455 
F 3 4 O TYR A 461 ? O TYR A 458 N VAL A 359 ? N VAL A 356 
F 4 5 O TYR A 358 ? O TYR A 355 N HIS A 324 ? N HIS A 321 
F 5 6 N PHE A 325 ? N PHE A 322 O ALA A 484 ? O ALA A 481 
F 6 7 N VAL A 485 ? N VAL A 482 O TYR A 508 ? O TYR A 505 
F 7 8 N ILE A 509 ? N ILE A 506 O LYS B 551 ? O LYS B 548 
F 8 9 O ILE B 550 ? O ILE B 547 N SER B 197 ? N SER B 194 
G 1 2 N ASP A 425 ? N ASP A 422 O PHE A 431 ? O PHE A 428 
H 1 2 N GLY A 480 ? N GLY A 477 O ALA A 526 ? O ALA A 523 
I 1 2 N LYS B 28  ? N LYS B 25  O LYS D 34  ? O LYS D 31  
J 1 2 N ILE B 67  ? N ILE B 64  O LYS B 96  ? O LYS B 93  
J 2 3 O PHE B 97  ? O PHE B 94  N GLN B 82  ? N GLN B 79  
K 1 2 N CYS B 69  ? N CYS B 66  O VAL B 76  ? O VAL B 73  
L 1 2 O GLN B 263 ? O GLN B 260 N VAL B 233 ? N VAL B 230 
L 2 3 O LYS B 236 ? O LYS B 233 N ALA B 209 ? N ALA B 206 
L 3 4 N ALA B 208 ? N ALA B 205 O GLY B 284 ? O GLY B 281 
L 4 5 N ILE B 285 ? N ILE B 282 O ALA B 315 ? O ALA B 312 
M 1 2 N ASP B 425 ? N ASP B 422 O PHE B 431 ? O PHE B 428 
N 1 2 N GLY B 480 ? N GLY B 477 O ALA B 526 ? O ALA B 523 
O 1 2 N GLU C 65  ? N GLU C 62  O LYS C 96  ? O LYS C 93  
O 2 3 O PHE C 97  ? O PHE C 94  N GLN C 82  ? N GLN C 79  
P 1 2 N CYS C 69  ? N CYS C 66  O VAL C 76  ? O VAL C 73  
Q 1 2 N VAL C 199 ? N VAL C 196 O GLN C 548 ? O GLN C 545 
Q 2 3 N LYS C 551 ? N LYS C 548 O ILE D 509 ? O ILE D 506 
Q 3 4 O TYR D 508 ? O TYR D 505 N VAL D 485 ? N VAL D 482 
Q 4 5 O ALA D 484 ? O ALA D 481 N PHE D 325 ? N PHE D 322 
Q 5 6 N VAL D 326 ? N VAL D 323 O TYR D 358 ? O TYR D 355 
Q 6 7 N VAL D 359 ? N VAL D 356 O TYR D 461 ? O TYR D 458 
Q 7 8 O VAL D 458 ? O VAL D 455 N SER D 439 ? N SER D 436 
Q 8 9 O ILE D 436 ? O ILE D 433 N LEU D 419 ? N LEU D 416 
R 1 2 O GLN C 263 ? O GLN C 260 N VAL C 233 ? N VAL C 230 
R 2 3 O LYS C 236 ? O LYS C 233 N ALA C 209 ? N ALA C 206 
R 3 4 N ALA C 208 ? N ALA C 205 O ASN C 286 ? O ASN C 283 
R 4 5 N PHE C 287 ? N PHE C 284 O ALA C 315 ? O ALA C 312 
S 1 2 N LEU C 419 ? N LEU C 416 O ILE C 436 ? O ILE C 433 
S 2 3 N SER C 439 ? N SER C 436 O VAL C 458 ? O VAL C 455 
S 3 4 O TYR C 461 ? O TYR C 458 N VAL C 359 ? N VAL C 356 
S 4 5 O TYR C 358 ? O TYR C 355 N HIS C 324 ? N HIS C 321 
S 5 6 N PHE C 325 ? N PHE C 322 O ALA C 484 ? O ALA C 481 
S 6 7 N VAL C 485 ? N VAL C 482 O TYR C 508 ? O TYR C 505 
S 7 8 N ILE C 509 ? N ILE C 506 O LYS D 551 ? O LYS D 548 
S 8 9 O GLN D 548 ? O GLN D 545 N VAL D 199 ? N VAL D 196 
T 1 2 N ASP C 425 ? N ASP C 422 O PHE C 431 ? O PHE C 428 
U 1 2 N GLY C 480 ? N GLY C 477 O ALA C 526 ? O ALA C 523 
V 1 2 N GLU D 65  ? N GLU D 62  O LYS D 96  ? O LYS D 93  
V 2 3 O PHE D 97  ? O PHE D 94  N GLN D 82  ? N GLN D 79  
W 1 2 N CYS D 69  ? N CYS D 66  O VAL D 76  ? O VAL D 73  
X 1 2 O GLN D 263 ? O GLN D 260 N VAL D 233 ? N VAL D 230 
X 2 3 O LYS D 236 ? O LYS D 233 N ALA D 209 ? N ALA D 206 
X 3 4 N ALA D 208 ? N ALA D 205 O ASN D 286 ? O ASN D 283 
X 4 5 N PHE D 287 ? N PHE D 284 O ALA D 315 ? O ALA D 312 
Y 1 2 N ASP D 425 ? N ASP D 422 O PHE D 431 ? O PHE D 428 
# 
_atom_sites.entry_id                    3V9G 
_atom_sites.fract_transf_matrix[1][1]   0.006635 
_atom_sites.fract_transf_matrix[1][2]   0.003831 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007661 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005209 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ARG A 1 26  ? 47.976  53.808  100.951 1.00 61.78  ? 23  ARG A N   1 
ATOM 2     C CA  . ARG A 1 26  ? 49.319  54.104  100.445 1.00 67.67  ? 23  ARG A CA  1 
ATOM 3     C C   . ARG A 1 26  ? 49.240  54.996  99.184  1.00 97.51  ? 23  ARG A C   1 
ATOM 4     O O   . ARG A 1 26  ? 49.201  56.224  99.284  1.00 88.73  ? 23  ARG A O   1 
ATOM 5     C CB  . ARG A 1 26  ? 50.071  52.800  100.156 1.00 57.48  ? 23  ARG A CB  1 
ATOM 6     N N   . TRP A 1 27  ? 49.204  54.377  98.005  1.00 72.46  ? 24  TRP A N   1 
ATOM 7     C CA  . TRP A 1 27  ? 49.029  55.095  96.738  1.00 55.31  ? 24  TRP A CA  1 
ATOM 8     C C   . TRP A 1 27  ? 47.588  55.037  96.201  1.00 75.31  ? 24  TRP A C   1 
ATOM 9     O O   . TRP A 1 27  ? 46.863  54.081  96.456  1.00 98.00  ? 24  TRP A O   1 
ATOM 10    C CB  . TRP A 1 27  ? 49.920  54.477  95.665  1.00 32.29  ? 24  TRP A CB  1 
ATOM 11    C CG  . TRP A 1 27  ? 51.361  54.373  96.026  1.00 46.97  ? 24  TRP A CG  1 
ATOM 12    C CD1 . TRP A 1 27  ? 51.906  53.581  96.994  1.00 65.38  ? 24  TRP A CD1 1 
ATOM 13    C CD2 . TRP A 1 27  ? 52.459  55.092  95.426  1.00 52.98  ? 24  TRP A CD2 1 
ATOM 14    N NE1 . TRP A 1 27  ? 53.277  53.756  97.033  1.00 70.41  ? 24  TRP A NE1 1 
ATOM 15    C CE2 . TRP A 1 27  ? 53.640  54.679  96.086  1.00 35.85  ? 24  TRP A CE2 1 
ATOM 16    C CE3 . TRP A 1 27  ? 52.557  56.041  94.399  1.00 78.01  ? 24  TRP A CE3 1 
ATOM 17    C CZ2 . TRP A 1 27  ? 54.909  55.171  95.737  1.00 48.60  ? 24  TRP A CZ2 1 
ATOM 18    C CZ3 . TRP A 1 27  ? 53.821  56.533  94.058  1.00 67.86  ? 24  TRP A CZ3 1 
ATOM 19    C CH2 . TRP A 1 27  ? 54.976  56.098  94.726  1.00 51.26  ? 24  TRP A CH2 1 
ATOM 20    N N   . LYS A 1 28  ? 47.180  56.062  95.456  1.00 56.44  ? 25  LYS A N   1 
ATOM 21    C CA  . LYS A 1 28  ? 46.023  55.950  94.567  1.00 73.12  ? 25  LYS A CA  1 
ATOM 22    C C   . LYS A 1 28  ? 46.481  56.176  93.126  1.00 74.43  ? 25  LYS A C   1 
ATOM 23    O O   . LYS A 1 28  ? 47.048  57.220  92.796  1.00 65.60  ? 25  LYS A O   1 
ATOM 24    C CB  . LYS A 1 28  ? 44.889  56.926  94.937  1.00 39.45  ? 25  LYS A CB  1 
ATOM 25    N N   . HIS A 1 29  ? 46.264  55.181  92.276  1.00 60.76  ? 26  HIS A N   1 
ATOM 26    C CA  . HIS A 1 29  ? 46.504  55.356  90.850  1.00 66.33  ? 26  HIS A CA  1 
ATOM 27    C C   . HIS A 1 29  ? 45.201  55.666  90.120  1.00 66.87  ? 26  HIS A C   1 
ATOM 28    O O   . HIS A 1 29  ? 44.180  55.025  90.363  1.00 84.64  ? 26  HIS A O   1 
ATOM 29    C CB  . HIS A 1 29  ? 47.129  54.107  90.262  1.00 42.65  ? 26  HIS A CB  1 
ATOM 30    C CG  . HIS A 1 29  ? 48.351  53.644  90.989  1.00 72.71  ? 26  HIS A CG  1 
ATOM 31    N ND1 . HIS A 1 29  ? 49.617  54.120  90.708  1.00 52.64  ? 26  HIS A ND1 1 
ATOM 32    C CD2 . HIS A 1 29  ? 48.504  52.729  91.975  1.00 59.72  ? 26  HIS A CD2 1 
ATOM 33    C CE1 . HIS A 1 29  ? 50.495  53.523  91.494  1.00 68.24  ? 26  HIS A CE1 1 
ATOM 34    N NE2 . HIS A 1 29  ? 49.847  52.673  92.271  1.00 86.20  ? 26  HIS A NE2 1 
ATOM 35    N N   . THR A 1 30  ? 45.234  56.647  89.224  1.00 61.72  ? 27  THR A N   1 
ATOM 36    C CA  . THR A 1 30  ? 44.013  57.117  88.577  1.00 34.30  ? 27  THR A CA  1 
ATOM 37    C C   . THR A 1 30  ? 44.194  57.358  87.062  1.00 54.46  ? 27  THR A C   1 
ATOM 38    O O   . THR A 1 30  ? 45.196  57.935  86.648  1.00 83.36  ? 27  THR A O   1 
ATOM 39    C CB  . THR A 1 30  ? 43.440  58.365  89.323  1.00 54.69  ? 27  THR A CB  1 
ATOM 40    O OG1 . THR A 1 30  ? 43.453  59.494  88.457  1.00 57.13  ? 27  THR A OG1 1 
ATOM 41    C CG2 . THR A 1 30  ? 44.264  58.691  90.570  1.00 72.84  ? 27  THR A CG2 1 
ATOM 42    N N   . SER A 1 31  ? 43.237  56.890  86.249  1.00 76.18  ? 28  SER A N   1 
ATOM 43    C CA  . SER A 1 31  ? 43.310  56.965  84.771  1.00 69.09  ? 28  SER A CA  1 
ATOM 44    C C   . SER A 1 31  ? 42.356  57.993  84.146  1.00 52.57  ? 28  SER A C   1 
ATOM 45    O O   . SER A 1 31  ? 41.240  58.199  84.616  1.00 72.22  ? 28  SER A O   1 
ATOM 46    C CB  . SER A 1 31  ? 43.019  55.604  84.120  1.00 39.62  ? 28  SER A CB  1 
ATOM 47    O OG  . SER A 1 31  ? 43.760  54.542  84.700  1.00 66.13  ? 28  SER A OG  1 
ATOM 48    N N   . SER A 1 32  ? 42.793  58.619  83.062  1.00 77.66  ? 29  SER A N   1 
ATOM 49    C CA  . SER A 1 32  ? 41.950  59.566  82.332  1.00 48.79  ? 29  SER A CA  1 
ATOM 50    C C   . SER A 1 32  ? 41.896  59.183  80.845  1.00 63.12  ? 29  SER A C   1 
ATOM 51    O O   . SER A 1 32  ? 42.611  58.289  80.392  1.00 69.48  ? 29  SER A O   1 
ATOM 52    C CB  . SER A 1 32  ? 42.476  61.004  82.516  1.00 41.61  ? 29  SER A CB  1 
ATOM 53    O OG  . SER A 1 32  ? 41.942  61.900  81.567  1.00 90.23  ? 29  SER A OG  1 
ATOM 54    N N   . LEU A 1 33  ? 41.033  59.851  80.092  1.00 49.34  ? 30  LEU A N   1 
ATOM 55    C CA  . LEU A 1 33  ? 40.918  59.608  78.667  1.00 59.46  ? 30  LEU A CA  1 
ATOM 56    C C   . LEU A 1 33  ? 40.766  60.923  77.902  1.00 80.03  ? 30  LEU A C   1 
ATOM 57    O O   . LEU A 1 33  ? 39.857  61.707  78.181  1.00 60.04  ? 30  LEU A O   1 
ATOM 58    C CB  . LEU A 1 33  ? 39.743  58.684  78.412  1.00 53.63  ? 30  LEU A CB  1 
ATOM 59    C CG  . LEU A 1 33  ? 39.691  58.058  77.029  1.00 55.58  ? 30  LEU A CG  1 
ATOM 60    C CD1 . LEU A 1 33  ? 41.071  57.623  76.633  1.00 73.81  ? 30  LEU A CD1 1 
ATOM 61    C CD2 . LEU A 1 33  ? 38.737  56.886  77.043  1.00 48.96  ? 30  LEU A CD2 1 
ATOM 62    N N   . LYS A 1 34  ? 41.664  61.174  76.950  1.00 71.90  ? 31  LYS A N   1 
ATOM 63    C CA  . LYS A 1 34  ? 41.575  62.388  76.147  1.00 79.89  ? 31  LYS A CA  1 
ATOM 64    C C   . LYS A 1 34  ? 40.730  62.088  74.917  1.00 81.47  ? 31  LYS A C   1 
ATOM 65    O O   . LYS A 1 34  ? 41.149  61.328  74.045  1.00 96.71  ? 31  LYS A O   1 
ATOM 66    C CB  . LYS A 1 34  ? 42.966  62.885  75.753  1.00 60.99  ? 31  LYS A CB  1 
ATOM 67    N N   . VAL A 1 35  ? 39.525  62.656  74.864  1.00 54.06  ? 32  VAL A N   1 
ATOM 68    C CA  . VAL A 1 35  ? 38.630  62.435  73.733  1.00 50.35  ? 32  VAL A CA  1 
ATOM 69    C C   . VAL A 1 35  ? 38.284  63.747  73.065  1.00 76.18  ? 32  VAL A C   1 
ATOM 70    O O   . VAL A 1 35  ? 38.161  64.791  73.720  1.00 52.37  ? 32  VAL A O   1 
ATOM 71    C CB  . VAL A 1 35  ? 37.291  61.763  74.138  1.00 46.33  ? 32  VAL A CB  1 
ATOM 72    C CG1 . VAL A 1 35  ? 37.465  60.272  74.347  1.00 48.64  ? 32  VAL A CG1 1 
ATOM 73    C CG2 . VAL A 1 35  ? 36.737  62.409  75.380  1.00 85.40  ? 32  VAL A CG2 1 
ATOM 74    N N   . ALA A 1 36  ? 38.113  63.697  71.752  1.00 55.09  ? 33  ALA A N   1 
ATOM 75    C CA  . ALA A 1 36  ? 37.601  64.858  71.057  1.00 48.99  ? 33  ALA A CA  1 
ATOM 76    C C   . ALA A 1 36  ? 36.323  64.457  70.376  1.00 32.98  ? 33  ALA A C   1 
ATOM 77    O O   . ALA A 1 36  ? 36.083  63.275  70.132  1.00 46.22  ? 33  ALA A O   1 
ATOM 78    C CB  . ALA A 1 36  ? 38.604  65.364  70.056  1.00 58.78  ? 33  ALA A CB  1 
ATOM 79    N N   . ASN A 1 37  ? 35.490  65.450  70.107  1.00 49.25  ? 34  ASN A N   1 
ATOM 80    C CA  . ASN A 1 37  ? 34.301  65.265  69.295  1.00 26.78  ? 34  ASN A CA  1 
ATOM 81    C C   . ASN A 1 37  ? 34.689  64.821  67.864  1.00 67.31  ? 34  ASN A C   1 
ATOM 82    O O   . ASN A 1 37  ? 35.659  65.321  67.264  1.00 33.37  ? 34  ASN A O   1 
ATOM 83    C CB  . ASN A 1 37  ? 33.552  66.591  69.217  1.00 32.14  ? 34  ASN A CB  1 
ATOM 84    C CG  . ASN A 1 37  ? 32.744  66.893  70.469  1.00 37.41  ? 34  ASN A CG  1 
ATOM 85    O OD1 . ASN A 1 37  ? 33.006  67.867  71.191  1.00 41.76  ? 34  ASN A OD1 1 
ATOM 86    N ND2 . ASN A 1 37  ? 31.737  66.078  70.711  1.00 38.64  ? 34  ASN A ND2 1 
ATOM 87    N N   . GLU A 1 38  ? 33.928  63.881  67.319  1.00 42.34  ? 35  GLU A N   1 
ATOM 88    C CA  . GLU A 1 38  ? 34.141  63.436  65.957  1.00 57.70  ? 35  GLU A CA  1 
ATOM 89    C C   . GLU A 1 38  ? 33.886  64.607  64.997  1.00 66.31  ? 35  GLU A C   1 
ATOM 90    O O   . GLU A 1 38  ? 32.847  65.255  65.056  1.00 58.47  ? 35  GLU A O   1 
ATOM 91    C CB  . GLU A 1 38  ? 33.214  62.272  65.637  1.00 50.06  ? 35  GLU A CB  1 
ATOM 92    C CG  . GLU A 1 38  ? 33.333  61.772  64.212  1.00 50.99  ? 35  GLU A CG  1 
ATOM 93    C CD  . GLU A 1 38  ? 34.695  61.181  63.909  1.00 56.43  ? 35  GLU A CD  1 
ATOM 94    O OE1 . GLU A 1 38  ? 35.351  60.675  64.839  1.00 56.94  ? 35  GLU A OE1 1 
ATOM 95    O OE2 . GLU A 1 38  ? 35.112  61.223  62.731  1.00 90.14  ? 35  GLU A OE2 1 
ATOM 96    N N   . PRO A 1 39  ? 34.856  64.904  64.126  1.00 49.66  ? 36  PRO A N   1 
ATOM 97    C CA  . PRO A 1 39  ? 34.696  65.996  63.162  1.00 69.03  ? 36  PRO A CA  1 
ATOM 98    C C   . PRO A 1 39  ? 33.572  65.698  62.175  1.00 52.55  ? 36  PRO A C   1 
ATOM 99    O O   . PRO A 1 39  ? 33.430  64.591  61.673  1.00 44.50  ? 36  PRO A O   1 
ATOM 100   C CB  . PRO A 1 39  ? 36.046  66.023  62.428  1.00 61.00  ? 36  PRO A CB  1 
ATOM 101   C CG  . PRO A 1 39  ? 37.003  65.339  63.351  1.00 63.30  ? 36  PRO A CG  1 
ATOM 102   C CD  . PRO A 1 39  ? 36.182  64.274  64.035  1.00 51.58  ? 36  PRO A CD  1 
ATOM 103   N N   . VAL A 1 40  ? 32.751  66.696  61.921  1.00 43.16  ? 37  VAL A N   1 
ATOM 104   C CA  . VAL A 1 40  ? 31.666  66.547  60.979  1.00 50.14  ? 37  VAL A CA  1 
ATOM 105   C C   . VAL A 1 40  ? 32.187  66.867  59.559  1.00 55.24  ? 37  VAL A C   1 
ATOM 106   O O   . VAL A 1 40  ? 32.602  67.984  59.267  1.00 52.70  ? 37  VAL A O   1 
ATOM 107   C CB  . VAL A 1 40  ? 30.491  67.454  61.403  1.00 57.61  ? 37  VAL A CB  1 
ATOM 108   C CG1 . VAL A 1 40  ? 29.343  67.329  60.467  1.00 37.49  ? 37  VAL A CG1 1 
ATOM 109   C CG2 . VAL A 1 40  ? 30.050  67.093  62.823  1.00 53.83  ? 37  VAL A CG2 1 
ATOM 110   N N   . LEU A 1 41  ? 32.202  65.857  58.698  1.00 49.32  ? 38  LEU A N   1 
ATOM 111   C CA  . LEU A 1 41  ? 32.627  66.016  57.315  1.00 65.55  ? 38  LEU A CA  1 
ATOM 112   C C   . LEU A 1 41  ? 31.694  66.908  56.497  1.00 60.77  ? 38  LEU A C   1 
ATOM 113   O O   . LEU A 1 41  ? 30.501  67.006  56.791  1.00 65.50  ? 38  LEU A O   1 
ATOM 114   C CB  . LEU A 1 41  ? 32.733  64.643  56.666  1.00 57.61  ? 38  LEU A CB  1 
ATOM 115   C CG  . LEU A 1 41  ? 33.692  63.745  57.438  1.00 65.43  ? 38  LEU A CG  1 
ATOM 116   C CD1 . LEU A 1 41  ? 33.832  62.408  56.724  1.00 52.89  ? 38  LEU A CD1 1 
ATOM 117   C CD2 . LEU A 1 41  ? 35.053  64.442  57.612  1.00 56.58  ? 38  LEU A CD2 1 
ATOM 118   N N   . ALA A 1 42  ? 32.241  67.551  55.466  1.00 71.86  ? 39  ALA A N   1 
ATOM 119   C CA  . ALA A 1 42  ? 31.495  68.533  54.665  1.00 59.80  ? 39  ALA A CA  1 
ATOM 120   C C   . ALA A 1 42  ? 30.784  67.950  53.443  1.00 63.68  ? 39  ALA A C   1 
ATOM 121   O O   . ALA A 1 42  ? 29.795  68.521  52.967  1.00 52.80  ? 39  ALA A O   1 
ATOM 122   C CB  . ALA A 1 42  ? 32.398  69.678  54.247  1.00 66.09  ? 39  ALA A CB  1 
ATOM 123   N N   . PHE A 1 43  ? 31.293  66.827  52.939  1.00 53.97  ? 40  PHE A N   1 
ATOM 124   C CA  . PHE A 1 43  ? 30.653  66.100  51.834  1.00 62.91  ? 40  PHE A CA  1 
ATOM 125   C C   . PHE A 1 43  ? 30.502  66.915  50.542  1.00 68.85  ? 40  PHE A C   1 
ATOM 126   O O   . PHE A 1 43  ? 29.510  66.786  49.836  1.00 50.75  ? 40  PHE A O   1 
ATOM 127   C CB  . PHE A 1 43  ? 29.283  65.539  52.267  1.00 34.13  ? 40  PHE A CB  1 
ATOM 128   C CG  . PHE A 1 43  ? 29.371  64.363  53.193  1.00 54.90  ? 40  PHE A CG  1 
ATOM 129   C CD1 . PHE A 1 43  ? 29.553  63.079  52.692  1.00 63.62  ? 40  PHE A CD1 1 
ATOM 130   C CD2 . PHE A 1 43  ? 29.276  64.535  54.571  1.00 44.92  ? 40  PHE A CD2 1 
ATOM 131   C CE1 . PHE A 1 43  ? 29.634  61.991  53.542  1.00 51.94  ? 40  PHE A CE1 1 
ATOM 132   C CE2 . PHE A 1 43  ? 29.363  63.453  55.422  1.00 44.35  ? 40  PHE A CE2 1 
ATOM 133   C CZ  . PHE A 1 43  ? 29.541  62.182  54.912  1.00 53.36  ? 40  PHE A CZ  1 
ATOM 134   N N   . THR A 1 44  ? 31.485  67.747  50.227  1.00 64.14  ? 41  THR A N   1 
ATOM 135   C CA  . THR A 1 44  ? 31.410  68.574  49.022  1.00 82.47  ? 41  THR A CA  1 
ATOM 136   C C   . THR A 1 44  ? 31.815  67.792  47.782  1.00 82.19  ? 41  THR A C   1 
ATOM 137   O O   . THR A 1 44  ? 32.342  66.684  47.893  1.00 65.59  ? 41  THR A O   1 
ATOM 138   C CB  . THR A 1 44  ? 32.297  69.820  49.124  1.00 80.02  ? 41  THR A CB  1 
ATOM 139   O OG1 . THR A 1 44  ? 33.672  69.424  49.245  1.00 76.69  ? 41  THR A OG1 1 
ATOM 140   C CG2 . THR A 1 44  ? 31.871  70.681  50.317  1.00 50.05  ? 41  THR A CG2 1 
ATOM 141   N N   . GLN A 1 45  ? 31.569  68.375  46.608  1.00 82.85  ? 42  GLN A N   1 
ATOM 142   C CA  . GLN A 1 45  ? 31.885  67.716  45.338  1.00 99.84  ? 42  GLN A CA  1 
ATOM 143   C C   . GLN A 1 45  ? 33.338  67.252  45.288  1.00 78.12  ? 42  GLN A C   1 
ATOM 144   O O   . GLN A 1 45  ? 34.251  68.032  45.521  1.00 65.09  ? 42  GLN A O   1 
ATOM 145   C CB  . GLN A 1 45  ? 31.593  68.640  44.143  1.00 89.59  ? 42  GLN A CB  1 
ATOM 146   C CG  . GLN A 1 45  ? 30.152  68.676  43.665  1.00 84.28  ? 42  GLN A CG  1 
ATOM 147   C CD  . GLN A 1 45  ? 29.724  67.375  43.013  1.00 104.50 ? 42  GLN A CD  1 
ATOM 148   O OE1 . GLN A 1 45  ? 30.490  66.400  42.963  1.00 73.45  ? 42  GLN A OE1 1 
ATOM 149   N NE2 . GLN A 1 45  ? 28.492  67.349  42.512  1.00 97.22  ? 42  GLN A NE2 1 
ATOM 150   N N   . GLY A 1 46  ? 33.544  65.974  45.002  1.00 59.96  ? 43  GLY A N   1 
ATOM 151   C CA  . GLY A 1 46  ? 34.890  65.462  44.830  1.00 67.92  ? 43  GLY A CA  1 
ATOM 152   C C   . GLY A 1 46  ? 35.567  64.992  46.093  1.00 82.07  ? 43  GLY A C   1 
ATOM 153   O O   . GLY A 1 46  ? 36.593  64.312  46.038  1.00 70.72  ? 43  GLY A O   1 
ATOM 154   N N   . SER A 1 47  ? 35.004  65.355  47.238  1.00 77.15  ? 44  SER A N   1 
ATOM 155   C CA  . SER A 1 47  ? 35.564  64.906  48.499  1.00 73.03  ? 44  SER A CA  1 
ATOM 156   C C   . SER A 1 47  ? 35.448  63.383  48.561  1.00 51.00  ? 44  SER A C   1 
ATOM 157   O O   . SER A 1 47  ? 34.538  62.806  47.965  1.00 62.81  ? 44  SER A O   1 
ATOM 158   C CB  . SER A 1 47  ? 34.854  65.577  49.680  1.00 73.18  ? 44  SER A CB  1 
ATOM 159   O OG  . SER A 1 47  ? 33.553  65.046  49.884  1.00 69.81  ? 44  SER A OG  1 
ATOM 160   N N   . PRO A 1 48  ? 36.393  62.728  49.258  1.00 61.93  ? 45  PRO A N   1 
ATOM 161   C CA  . PRO A 1 48  ? 36.457  61.269  49.433  1.00 71.22  ? 45  PRO A CA  1 
ATOM 162   C C   . PRO A 1 48  ? 35.222  60.704  50.137  1.00 85.00  ? 45  PRO A C   1 
ATOM 163   O O   . PRO A 1 48  ? 34.770  59.613  49.773  1.00 65.09  ? 45  PRO A O   1 
ATOM 164   C CB  . PRO A 1 48  ? 37.685  61.074  50.331  1.00 63.11  ? 45  PRO A CB  1 
ATOM 165   C CG  . PRO A 1 48  ? 38.496  62.297  50.158  1.00 72.65  ? 45  PRO A CG  1 
ATOM 166   C CD  . PRO A 1 48  ? 37.521  63.412  49.915  1.00 66.01  ? 45  PRO A CD  1 
ATOM 167   N N   . GLU A 1 49  ? 34.702  61.433  51.128  1.00 52.59  ? 46  GLU A N   1 
ATOM 168   C CA  . GLU A 1 49  ? 33.550  60.979  51.900  1.00 73.63  ? 46  GLU A CA  1 
ATOM 169   C C   . GLU A 1 49  ? 32.287  60.967  51.045  1.00 69.16  ? 46  GLU A C   1 
ATOM 170   O O   . GLU A 1 49  ? 31.450  60.075  51.171  1.00 63.84  ? 46  GLU A O   1 
ATOM 171   C CB  . GLU A 1 49  ? 33.351  61.824  53.178  1.00 49.06  ? 46  GLU A CB  1 
ATOM 172   C CG  . GLU A 1 49  ? 32.978  63.298  52.968  1.00 55.26  ? 46  GLU A CG  1 
ATOM 173   C CD  . GLU A 1 49  ? 34.177  64.253  53.033  1.00 73.28  ? 46  GLU A CD  1 
ATOM 174   O OE1 . GLU A 1 49  ? 33.953  65.476  53.200  1.00 56.46  ? 46  GLU A OE1 1 
ATOM 175   O OE2 . GLU A 1 49  ? 35.334  63.792  52.892  1.00 67.65  ? 46  GLU A OE2 1 
ATOM 176   N N   . ARG A 1 50  ? 32.152  61.959  50.172  1.00 37.82  ? 47  ARG A N   1 
ATOM 177   C CA  . ARG A 1 50  ? 31.015  62.003  49.262  1.00 67.18  ? 47  ARG A CA  1 
ATOM 178   C C   . ARG A 1 50  ? 31.052  60.893  48.205  1.00 69.98  ? 47  ARG A C   1 
ATOM 179   O O   . ARG A 1 50  ? 30.004  60.373  47.836  1.00 62.50  ? 47  ARG A O   1 
ATOM 180   C CB  . ARG A 1 50  ? 30.912  63.370  48.596  1.00 65.40  ? 47  ARG A CB  1 
ATOM 181   C CG  . ARG A 1 50  ? 29.635  63.583  47.803  1.00 41.91  ? 47  ARG A CG  1 
ATOM 182   C CD  . ARG A 1 50  ? 29.732  64.914  47.068  1.00 59.36  ? 47  ARG A CD  1 
ATOM 183   N NE  . ARG A 1 50  ? 28.582  65.207  46.222  1.00 49.00  ? 47  ARG A NE  1 
ATOM 184   C CZ  . ARG A 1 50  ? 27.786  66.260  46.370  1.00 69.87  ? 47  ARG A CZ  1 
ATOM 185   N NH1 . ARG A 1 50  ? 28.010  67.127  47.354  1.00 48.02  ? 47  ARG A NH1 1 
ATOM 186   N NH2 . ARG A 1 50  ? 26.767  66.446  45.526  1.00 39.66  ? 47  ARG A NH2 1 
ATOM 187   N N   . ASP A 1 51  ? 32.243  60.535  47.715  1.00 47.11  ? 48  ASP A N   1 
ATOM 188   C CA  . ASP A 1 51  ? 32.373  59.404  46.795  1.00 65.68  ? 48  ASP A CA  1 
ATOM 189   C C   . ASP A 1 51  ? 32.063  58.093  47.520  1.00 54.68  ? 48  ASP A C   1 
ATOM 190   O O   . ASP A 1 51  ? 31.309  57.268  47.021  1.00 56.83  ? 48  ASP A O   1 
ATOM 191   C CB  . ASP A 1 51  ? 33.757  59.376  46.098  1.00 50.07  ? 48  ASP A CB  1 
ATOM 192   N N   . ALA A 1 52  ? 32.631  57.918  48.712  1.00 65.86  ? 49  ALA A N   1 
ATOM 193   C CA  . ALA A 1 52  ? 32.376  56.731  49.525  1.00 51.19  ? 49  ALA A CA  1 
ATOM 194   C C   . ALA A 1 52  ? 30.890  56.534  49.789  1.00 49.64  ? 49  ALA A C   1 
ATOM 195   O O   . ALA A 1 52  ? 30.376  55.408  49.733  1.00 52.71  ? 49  ALA A O   1 
ATOM 196   C CB  . ALA A 1 52  ? 33.118  56.826  50.828  1.00 54.40  ? 49  ALA A CB  1 
ATOM 197   N N   . LEU A 1 53  ? 30.199  57.638  50.061  1.00 47.22  ? 50  LEU A N   1 
ATOM 198   C CA  . LEU A 1 53  ? 28.792  57.591  50.464  1.00 65.44  ? 50  LEU A CA  1 
ATOM 199   C C   . LEU A 1 53  ? 27.899  57.272  49.284  1.00 68.58  ? 50  LEU A C   1 
ATOM 200   O O   . LEU A 1 53  ? 26.888  56.579  49.424  1.00 63.27  ? 50  LEU A O   1 
ATOM 201   C CB  . LEU A 1 53  ? 28.360  58.911  51.108  1.00 37.63  ? 50  LEU A CB  1 
ATOM 202   C CG  . LEU A 1 53  ? 26.854  59.097  51.300  1.00 51.94  ? 50  LEU A CG  1 
ATOM 203   C CD1 . LEU A 1 53  ? 26.248  58.015  52.189  1.00 45.86  ? 50  LEU A CD1 1 
ATOM 204   C CD2 . LEU A 1 53  ? 26.553  60.483  51.847  1.00 50.69  ? 50  LEU A CD2 1 
ATOM 205   N N   . GLN A 1 54  ? 28.276  57.780  48.117  1.00 68.50  ? 51  GLN A N   1 
ATOM 206   C CA  . GLN A 1 54  ? 27.514  57.497  46.906  1.00 71.24  ? 51  GLN A CA  1 
ATOM 207   C C   . GLN A 1 54  ? 27.646  56.046  46.464  1.00 68.13  ? 51  GLN A C   1 
ATOM 208   O O   . GLN A 1 54  ? 26.679  55.472  45.982  1.00 61.00  ? 51  GLN A O   1 
ATOM 209   C CB  . GLN A 1 54  ? 27.868  58.463  45.779  1.00 69.12  ? 51  GLN A CB  1 
ATOM 210   C CG  . GLN A 1 54  ? 26.698  59.358  45.388  1.00 67.53  ? 51  GLN A CG  1 
ATOM 211   C CD  . GLN A 1 54  ? 27.133  60.754  45.002  1.00 92.95  ? 51  GLN A CD  1 
ATOM 212   O OE1 . GLN A 1 54  ? 26.306  61.654  44.873  1.00 89.71  ? 51  GLN A OE1 1 
ATOM 213   N NE2 . GLN A 1 54  ? 28.436  60.944  44.813  1.00 92.32  ? 51  GLN A NE2 1 
ATOM 214   N N   . LYS A 1 55  ? 28.827  55.449  46.646  1.00 52.28  ? 52  LYS A N   1 
ATOM 215   C CA  . LYS A 1 55  ? 28.992  54.011  46.404  1.00 55.18  ? 52  LYS A CA  1 
ATOM 216   C C   . LYS A 1 55  ? 28.153  53.199  47.390  1.00 58.44  ? 52  LYS A C   1 
ATOM 217   O O   . LYS A 1 55  ? 27.568  52.191  47.015  1.00 58.84  ? 52  LYS A O   1 
ATOM 218   C CB  . LYS A 1 55  ? 30.467  53.578  46.473  1.00 47.41  ? 52  LYS A CB  1 
ATOM 219   N N   . ALA A 1 56  ? 28.089  53.646  48.644  1.00 48.57  ? 53  ALA A N   1 
ATOM 220   C CA  . ALA A 1 56  ? 27.323  52.937  49.680  1.00 53.74  ? 53  ALA A CA  1 
ATOM 221   C C   . ALA A 1 56  ? 25.820  53.007  49.432  1.00 62.53  ? 53  ALA A C   1 
ATOM 222   O O   . ALA A 1 56  ? 25.092  52.044  49.688  1.00 51.89  ? 53  ALA A O   1 
ATOM 223   C CB  . ALA A 1 56  ? 27.665  53.478  51.079  1.00 57.13  ? 53  ALA A CB  1 
ATOM 224   N N   . LEU A 1 57  ? 25.358  54.152  48.938  1.00 45.37  ? 54  LEU A N   1 
ATOM 225   C CA  . LEU A 1 57  ? 23.976  54.281  48.502  1.00 60.59  ? 54  LEU A CA  1 
ATOM 226   C C   . LEU A 1 57  ? 23.628  53.360  47.314  1.00 67.67  ? 54  LEU A C   1 
ATOM 227   O O   . LEU A 1 57  ? 22.601  52.683  47.333  1.00 51.27  ? 54  LEU A O   1 
ATOM 228   C CB  . LEU A 1 57  ? 23.661  55.734  48.168  1.00 41.92  ? 54  LEU A CB  1 
ATOM 229   C CG  . LEU A 1 57  ? 23.607  56.632  49.390  1.00 55.59  ? 54  LEU A CG  1 
ATOM 230   C CD1 . LEU A 1 57  ? 23.538  58.112  48.990  1.00 46.40  ? 54  LEU A CD1 1 
ATOM 231   C CD2 . LEU A 1 57  ? 22.420  56.192  50.237  1.00 39.47  ? 54  LEU A CD2 1 
ATOM 232   N N   . LYS A 1 58  ? 24.483  53.330  46.292  1.00 63.72  ? 55  LYS A N   1 
ATOM 233   C CA  . LYS A 1 58  ? 24.260  52.483  45.115  1.00 74.19  ? 55  LYS A CA  1 
ATOM 234   C C   . LYS A 1 58  ? 24.221  51.011  45.500  1.00 72.61  ? 55  LYS A C   1 
ATOM 235   O O   . LYS A 1 58  ? 23.386  50.266  45.007  1.00 66.38  ? 55  LYS A O   1 
ATOM 236   C CB  . LYS A 1 58  ? 25.332  52.711  44.036  1.00 51.70  ? 55  LYS A CB  1 
ATOM 237   N N   . ASP A 1 59  ? 25.115  50.598  46.391  1.00 63.86  ? 56  ASP A N   1 
ATOM 238   C CA  . ASP A 1 59  ? 25.160  49.209  46.847  1.00 63.90  ? 56  ASP A CA  1 
ATOM 239   C C   . ASP A 1 59  ? 23.886  48.808  47.606  1.00 65.39  ? 56  ASP A C   1 
ATOM 240   O O   . ASP A 1 59  ? 23.726  47.646  47.984  1.00 63.80  ? 56  ASP A O   1 
ATOM 241   C CB  . ASP A 1 59  ? 26.426  48.941  47.691  1.00 39.90  ? 56  ASP A CB  1 
ATOM 242   N N   . LEU A 1 60  ? 22.983  49.767  47.806  1.00 62.90  ? 57  LEU A N   1 
ATOM 243   C CA  . LEU A 1 60  ? 21.728  49.536  48.527  1.00 69.32  ? 57  LEU A CA  1 
ATOM 244   C C   . LEU A 1 60  ? 20.487  49.553  47.628  1.00 79.74  ? 57  LEU A C   1 
ATOM 245   O O   . LEU A 1 60  ? 19.472  48.947  47.973  1.00 62.57  ? 57  LEU A O   1 
ATOM 246   C CB  . LEU A 1 60  ? 21.531  50.591  49.626  1.00 76.04  ? 57  LEU A CB  1 
ATOM 247   C CG  . LEU A 1 60  ? 22.214  50.485  50.985  1.00 67.98  ? 57  LEU A CG  1 
ATOM 248   C CD1 . LEU A 1 60  ? 21.776  51.657  51.864  1.00 67.12  ? 57  LEU A CD1 1 
ATOM 249   C CD2 . LEU A 1 60  ? 21.886  49.162  51.640  1.00 51.28  ? 57  LEU A CD2 1 
ATOM 250   N N   . LYS A 1 61  ? 20.552  50.274  46.506  1.00 81.76  ? 58  LYS A N   1 
ATOM 251   C CA  . LYS A 1 61  ? 19.397  50.395  45.610  1.00 82.75  ? 58  LYS A CA  1 
ATOM 252   C C   . LYS A 1 61  ? 18.943  48.998  45.168  1.00 82.87  ? 58  LYS A C   1 
ATOM 253   O O   . LYS A 1 61  ? 19.752  48.183  44.731  1.00 67.28  ? 58  LYS A O   1 
ATOM 254   C CB  . LYS A 1 61  ? 19.700  51.314  44.403  1.00 41.47  ? 58  LYS A CB  1 
ATOM 255   N N   . GLY A 1 62  ? 17.658  48.702  45.333  1.00 75.09  ? 59  GLY A N   1 
ATOM 256   C CA  . GLY A 1 62  ? 17.096  47.439  44.881  1.00 72.34  ? 59  GLY A CA  1 
ATOM 257   C C   . GLY A 1 62  ? 17.382  46.204  45.724  1.00 91.75  ? 59  GLY A C   1 
ATOM 258   O O   . GLY A 1 62  ? 16.908  45.107  45.409  1.00 81.01  ? 59  GLY A O   1 
ATOM 259   N N   . ARG A 1 63  ? 18.157  46.364  46.790  1.00 66.69  ? 60  ARG A N   1 
ATOM 260   C CA  . ARG A 1 63  ? 18.454  45.246  47.679  1.00 70.48  ? 60  ARG A CA  1 
ATOM 261   C C   . ARG A 1 63  ? 17.648  45.332  48.997  1.00 67.85  ? 60  ARG A C   1 
ATOM 262   O O   . ARG A 1 63  ? 17.331  46.423  49.478  1.00 77.26  ? 60  ARG A O   1 
ATOM 263   C CB  . ARG A 1 63  ? 19.974  45.135  47.918  1.00 53.02  ? 60  ARG A CB  1 
ATOM 264   N N   . MET A 1 64  ? 17.289  44.176  49.553  1.00 68.93  ? 61  MET A N   1 
ATOM 265   C CA  . MET A 1 64  ? 16.506  44.098  50.792  1.00 70.94  ? 61  MET A CA  1 
ATOM 266   C C   . MET A 1 64  ? 17.214  43.215  51.812  1.00 55.43  ? 61  MET A C   1 
ATOM 267   O O   . MET A 1 64  ? 17.312  42.023  51.611  1.00 53.62  ? 61  MET A O   1 
ATOM 268   C CB  . MET A 1 64  ? 15.100  43.521  50.530  1.00 50.61  ? 61  MET A CB  1 
ATOM 269   C CG  . MET A 1 64  ? 14.221  43.414  51.783  1.00 59.62  ? 61  MET A CG  1 
ATOM 270   S SD  . MET A 1 64  ? 12.559  42.688  51.567  1.00 45.50  ? 61  MET A SD  1 
ATOM 271   C CE  . MET A 1 64  ? 13.031  41.025  51.197  1.00 51.20  ? 61  MET A CE  1 
ATOM 272   N N   . GLU A 1 65  ? 17.692  43.789  52.912  1.00 64.51  ? 62  GLU A N   1 
ATOM 273   C CA  . GLU A 1 65  ? 18.443  43.007  53.890  1.00 34.74  ? 62  GLU A CA  1 
ATOM 274   C C   . GLU A 1 65  ? 17.517  42.161  54.752  1.00 53.70  ? 62  GLU A C   1 
ATOM 275   O O   . GLU A 1 65  ? 16.488  42.643  55.210  1.00 77.82  ? 62  GLU A O   1 
ATOM 276   C CB  . GLU A 1 65  ? 19.338  43.907  54.752  1.00 46.92  ? 62  GLU A CB  1 
ATOM 277   C CG  . GLU A 1 65  ? 20.136  43.138  55.801  1.00 68.68  ? 62  GLU A CG  1 
ATOM 278   C CD  . GLU A 1 65  ? 21.263  43.946  56.423  1.00 77.79  ? 62  GLU A CD  1 
ATOM 279   O OE1 . GLU A 1 65  ? 21.425  45.122  56.044  1.00 100.56 ? 62  GLU A OE1 1 
ATOM 280   O OE2 . GLU A 1 65  ? 21.991  43.398  57.288  1.00 62.74  ? 62  GLU A OE2 1 
ATOM 281   N N   . ALA A 1 66  ? 17.872  40.897  54.962  1.00 54.44  ? 63  ALA A N   1 
ATOM 282   C CA  . ALA A 1 66  ? 17.123  40.045  55.893  1.00 72.20  ? 63  ALA A CA  1 
ATOM 283   C C   . ALA A 1 66  ? 17.755  40.092  57.287  1.00 75.32  ? 63  ALA A C   1 
ATOM 284   O O   . ALA A 1 66  ? 18.919  39.710  57.477  1.00 49.50  ? 63  ALA A O   1 
ATOM 285   C CB  . ALA A 1 66  ? 17.025  38.602  55.384  1.00 44.81  ? 63  ALA A CB  1 
ATOM 286   N N   . ILE A 1 67  ? 16.978  40.583  58.250  1.00 54.25  ? 64  ILE A N   1 
ATOM 287   C CA  . ILE A 1 67  ? 17.475  40.855  59.590  1.00 54.65  ? 64  ILE A CA  1 
ATOM 288   C C   . ILE A 1 67  ? 16.770  39.991  60.634  1.00 56.21  ? 64  ILE A C   1 
ATOM 289   O O   . ILE A 1 67  ? 15.565  40.140  60.868  1.00 52.73  ? 64  ILE A O   1 
ATOM 290   C CB  . ILE A 1 67  ? 17.335  42.352  59.943  1.00 51.17  ? 64  ILE A CB  1 
ATOM 291   C CG1 . ILE A 1 67  ? 18.161  43.196  58.976  1.00 39.92  ? 64  ILE A CG1 1 
ATOM 292   C CG2 . ILE A 1 67  ? 17.795  42.609  61.354  1.00 42.95  ? 64  ILE A CG2 1 
ATOM 293   C CD1 . ILE A 1 67  ? 17.967  44.712  59.090  1.00 38.76  ? 64  ILE A CD1 1 
ATOM 294   N N   . PRO A 1 68  ? 17.528  39.073  61.257  1.00 61.34  ? 65  PRO A N   1 
ATOM 295   C CA  . PRO A 1 68  ? 16.987  38.124  62.235  1.00 55.24  ? 65  PRO A CA  1 
ATOM 296   C C   . PRO A 1 68  ? 17.020  38.730  63.617  1.00 63.29  ? 65  PRO A C   1 
ATOM 297   O O   . PRO A 1 68  ? 17.680  39.741  63.815  1.00 54.18  ? 65  PRO A O   1 
ATOM 298   C CB  . PRO A 1 68  ? 18.004  36.974  62.186  1.00 56.99  ? 65  PRO A CB  1 
ATOM 299   C CG  . PRO A 1 68  ? 19.314  37.672  61.957  1.00 52.43  ? 65  PRO A CG  1 
ATOM 300   C CD  . PRO A 1 68  ? 18.974  38.874  61.039  1.00 50.04  ? 65  PRO A CD  1 
ATOM 301   N N   . CYS A 1 69  ? 16.333  38.122  64.572  1.00 59.59  ? 66  CYS A N   1 
ATOM 302   C CA  . CYS A 1 69  ? 16.620  38.428  65.956  1.00 46.53  ? 66  CYS A CA  1 
ATOM 303   C C   . CYS A 1 69  ? 17.946  37.771  66.281  1.00 62.04  ? 66  CYS A C   1 
ATOM 304   O O   . CYS A 1 69  ? 18.262  36.719  65.734  1.00 63.69  ? 66  CYS A O   1 
ATOM 305   C CB  . CYS A 1 69  ? 15.525  37.906  66.873  1.00 57.49  ? 66  CYS A CB  1 
ATOM 306   S SG  . CYS A 1 69  ? 13.967  38.722  66.608  1.00 56.31  ? 66  CYS A SG  1 
ATOM 307   N N   . VAL A 1 70  ? 18.736  38.405  67.139  1.00 47.46  ? 67  VAL A N   1 
ATOM 308   C CA  . VAL A 1 70  ? 19.989  37.819  67.577  1.00 57.16  ? 67  VAL A CA  1 
ATOM 309   C C   . VAL A 1 70  ? 19.983  37.624  69.083  1.00 56.58  ? 67  VAL A C   1 
ATOM 310   O O   . VAL A 1 70  ? 19.936  38.585  69.837  1.00 57.23  ? 67  VAL A O   1 
ATOM 311   C CB  . VAL A 1 70  ? 21.193  38.675  67.175  1.00 46.76  ? 67  VAL A CB  1 
ATOM 312   C CG1 . VAL A 1 70  ? 22.486  38.020  67.631  1.00 43.33  ? 67  VAL A CG1 1 
ATOM 313   C CG2 . VAL A 1 70  ? 21.218  38.866  65.685  1.00 55.02  ? 67  VAL A CG2 1 
ATOM 314   N N   . VAL A 1 71  ? 20.006  36.369  69.508  1.00 47.34  ? 68  VAL A N   1 
ATOM 315   C CA  . VAL A 1 71  ? 20.082  36.024  70.915  1.00 50.74  ? 68  VAL A CA  1 
ATOM 316   C C   . VAL A 1 71  ? 21.363  35.241  71.115  1.00 64.36  ? 68  VAL A C   1 
ATOM 317   O O   . VAL A 1 71  ? 21.558  34.196  70.494  1.00 68.87  ? 68  VAL A O   1 
ATOM 318   C CB  . VAL A 1 71  ? 18.878  35.184  71.360  1.00 55.59  ? 68  VAL A CB  1 
ATOM 319   C CG1 . VAL A 1 71  ? 18.960  34.849  72.863  1.00 47.41  ? 68  VAL A CG1 1 
ATOM 320   C CG2 . VAL A 1 71  ? 17.603  35.925  71.054  1.00 63.86  ? 68  VAL A CG2 1 
ATOM 321   N N   . GLY A 1 72  ? 22.243  35.752  71.971  1.00 59.18  ? 69  GLY A N   1 
ATOM 322   C CA  . GLY A 1 72  ? 23.583  35.210  72.084  1.00 49.60  ? 69  GLY A CA  1 
ATOM 323   C C   . GLY A 1 72  ? 24.305  35.369  70.754  1.00 66.34  ? 69  GLY A C   1 
ATOM 324   O O   . GLY A 1 72  ? 24.599  36.486  70.337  1.00 65.98  ? 69  GLY A O   1 
ATOM 325   N N   . ASP A 1 73  ? 24.570  34.255  70.079  1.00 68.36  ? 70  ASP A N   1 
ATOM 326   C CA  . ASP A 1 73  ? 25.150  34.283  68.738  1.00 55.86  ? 70  ASP A CA  1 
ATOM 327   C C   . ASP A 1 73  ? 24.213  33.655  67.714  1.00 63.18  ? 70  ASP A C   1 
ATOM 328   O O   . ASP A 1 73  ? 24.462  33.734  66.517  1.00 65.35  ? 70  ASP A O   1 
ATOM 329   C CB  . ASP A 1 73  ? 26.490  33.560  68.719  1.00 43.14  ? 70  ASP A CB  1 
ATOM 330   C CG  . ASP A 1 73  ? 27.615  34.407  69.251  1.00 77.65  ? 70  ASP A CG  1 
ATOM 331   O OD1 . ASP A 1 73  ? 27.578  35.630  69.036  1.00 78.13  ? 70  ASP A OD1 1 
ATOM 332   O OD2 . ASP A 1 73  ? 28.544  33.854  69.878  1.00 83.68  ? 70  ASP A OD2 1 
ATOM 333   N N   . GLU A 1 74  ? 23.135  33.039  68.200  1.00 57.83  ? 71  GLU A N   1 
ATOM 334   C CA  . GLU A 1 74  ? 22.135  32.404  67.344  1.00 70.04  ? 71  GLU A CA  1 
ATOM 335   C C   . GLU A 1 74  ? 21.253  33.439  66.644  1.00 74.19  ? 71  GLU A C   1 
ATOM 336   O O   . GLU A 1 74  ? 20.651  34.298  67.283  1.00 69.69  ? 71  GLU A O   1 
ATOM 337   C CB  . GLU A 1 74  ? 21.274  31.441  68.172  1.00 51.83  ? 71  GLU A CB  1 
ATOM 338   C CG  . GLU A 1 74  ? 20.138  30.767  67.426  1.00 84.00  ? 71  GLU A CG  1 
ATOM 339   C CD  . GLU A 1 74  ? 19.281  29.902  68.337  1.00 99.47  ? 71  GLU A CD  1 
ATOM 340   O OE1 . GLU A 1 74  ? 19.556  29.882  69.561  1.00 75.35  ? 71  GLU A OE1 1 
ATOM 341   O OE2 . GLU A 1 74  ? 18.337  29.244  67.829  1.00 72.84  ? 71  GLU A OE2 1 
ATOM 342   N N   . GLU A 1 75  ? 21.207  33.367  65.321  1.00 76.39  ? 72  GLU A N   1 
ATOM 343   C CA  . GLU A 1 75  ? 20.255  34.144  64.544  1.00 62.51  ? 72  GLU A CA  1 
ATOM 344   C C   . GLU A 1 75  ? 18.920  33.437  64.593  1.00 56.91  ? 72  GLU A C   1 
ATOM 345   O O   . GLU A 1 75  ? 18.817  32.267  64.246  1.00 71.10  ? 72  GLU A O   1 
ATOM 346   C CB  . GLU A 1 75  ? 20.709  34.265  63.090  1.00 39.32  ? 72  GLU A CB  1 
ATOM 347   C CG  . GLU A 1 75  ? 21.956  35.128  62.886  1.00 63.45  ? 72  GLU A CG  1 
ATOM 348   C CD  . GLU A 1 75  ? 22.394  35.187  61.424  1.00 97.24  ? 72  GLU A CD  1 
ATOM 349   O OE1 . GLU A 1 75  ? 21.629  34.734  60.542  1.00 95.04  ? 72  GLU A OE1 1 
ATOM 350   O OE2 . GLU A 1 75  ? 23.508  35.684  61.154  1.00 84.64  ? 72  GLU A OE2 1 
ATOM 351   N N   . VAL A 1 76  ? 17.892  34.147  65.028  1.00 64.26  ? 73  VAL A N   1 
ATOM 352   C CA  . VAL A 1 76  ? 16.595  33.526  65.189  1.00 63.53  ? 73  VAL A CA  1 
ATOM 353   C C   . VAL A 1 76  ? 15.511  34.194  64.345  1.00 68.95  ? 73  VAL A C   1 
ATOM 354   O O   . VAL A 1 76  ? 15.424  35.413  64.274  1.00 66.01  ? 73  VAL A O   1 
ATOM 355   C CB  . VAL A 1 76  ? 16.180  33.475  66.671  1.00 52.77  ? 73  VAL A CB  1 
ATOM 356   C CG1 . VAL A 1 76  ? 14.831  32.776  66.824  1.00 44.77  ? 73  VAL A CG1 1 
ATOM 357   C CG2 . VAL A 1 76  ? 17.224  32.762  67.473  1.00 54.68  ? 73  VAL A CG2 1 
ATOM 358   N N   . TRP A 1 77  ? 14.695  33.371  63.701  1.00 70.96  ? 74  TRP A N   1 
ATOM 359   C CA  . TRP A 1 77  ? 13.557  33.845  62.931  1.00 50.11  ? 74  TRP A CA  1 
ATOM 360   C C   . TRP A 1 77  ? 12.249  33.336  63.528  1.00 63.20  ? 74  TRP A C   1 
ATOM 361   O O   . TRP A 1 77  ? 12.154  32.185  63.940  1.00 74.59  ? 74  TRP A O   1 
ATOM 362   C CB  . TRP A 1 77  ? 13.687  33.381  61.480  1.00 52.16  ? 74  TRP A CB  1 
ATOM 363   C CG  . TRP A 1 77  ? 14.670  34.194  60.703  1.00 63.15  ? 74  TRP A CG  1 
ATOM 364   C CD1 . TRP A 1 77  ? 15.988  33.909  60.478  1.00 56.60  ? 74  TRP A CD1 1 
ATOM 365   C CD2 . TRP A 1 77  ? 14.415  35.452  60.061  1.00 50.86  ? 74  TRP A CD2 1 
ATOM 366   N NE1 . TRP A 1 77  ? 16.568  34.910  59.724  1.00 62.48  ? 74  TRP A NE1 1 
ATOM 367   C CE2 . TRP A 1 77  ? 15.624  35.869  59.459  1.00 52.33  ? 74  TRP A CE2 1 
ATOM 368   C CE3 . TRP A 1 77  ? 13.281  36.266  59.938  1.00 54.81  ? 74  TRP A CE3 1 
ATOM 369   C CZ2 . TRP A 1 77  ? 15.733  37.070  58.755  1.00 47.49  ? 74  TRP A CZ2 1 
ATOM 370   C CZ3 . TRP A 1 77  ? 13.388  37.457  59.221  1.00 68.41  ? 74  TRP A CZ3 1 
ATOM 371   C CH2 . TRP A 1 77  ? 14.608  37.848  58.642  1.00 49.76  ? 74  TRP A CH2 1 
ATOM 372   N N   . THR A 1 78  ? 11.243  34.199  63.599  1.00 54.15  ? 75  THR A N   1 
ATOM 373   C CA  . THR A 1 78  ? 9.911   33.761  63.998  1.00 47.05  ? 75  THR A CA  1 
ATOM 374   C C   . THR A 1 78  ? 8.978   33.901  62.806  1.00 59.07  ? 75  THR A C   1 
ATOM 375   O O   . THR A 1 78  ? 9.366   34.442  61.773  1.00 75.70  ? 75  THR A O   1 
ATOM 376   C CB  . THR A 1 78  ? 9.341   34.567  65.181  1.00 63.49  ? 75  THR A CB  1 
ATOM 377   O OG1 . THR A 1 78  ? 8.950   35.867  64.734  1.00 59.29  ? 75  THR A OG1 1 
ATOM 378   C CG2 . THR A 1 78  ? 10.367  34.709  66.291  1.00 63.17  ? 75  THR A CG2 1 
ATOM 379   N N   . SER A 1 79  ? 7.754   33.405  62.944  1.00 62.49  ? 76  SER A N   1 
ATOM 380   C CA  . SER A 1 79  ? 6.794   33.441  61.846  1.00 69.75  ? 76  SER A CA  1 
ATOM 381   C C   . SER A 1 79  ? 6.214   34.842  61.643  1.00 77.81  ? 76  SER A C   1 
ATOM 382   O O   . SER A 1 79  ? 5.540   35.094  60.652  1.00 83.58  ? 76  SER A O   1 
ATOM 383   C CB  . SER A 1 79  ? 5.670   32.432  62.091  1.00 71.64  ? 76  SER A CB  1 
ATOM 384   O OG  . SER A 1 79  ? 5.019   32.685  63.330  1.00 88.42  ? 76  SER A OG  1 
ATOM 385   N N   . ASP A 1 80  ? 6.495   35.750  62.576  1.00 75.98  ? 77  ASP A N   1 
ATOM 386   C CA  . ASP A 1 80  ? 5.939   37.104  62.547  1.00 67.84  ? 77  ASP A CA  1 
ATOM 387   C C   . ASP A 1 80  ? 6.841   38.079  61.765  1.00 78.49  ? 77  ASP A C   1 
ATOM 388   O O   . ASP A 1 80  ? 7.458   38.985  62.332  1.00 76.01  ? 77  ASP A O   1 
ATOM 389   C CB  . ASP A 1 80  ? 5.689   37.588  63.989  1.00 52.89  ? 77  ASP A CB  1 
ATOM 390   C CG  . ASP A 1 80  ? 4.695   38.739  64.067  1.00 77.83  ? 77  ASP A CG  1 
ATOM 391   O OD1 . ASP A 1 80  ? 4.366   39.329  63.011  1.00 80.79  ? 77  ASP A OD1 1 
ATOM 392   O OD2 . ASP A 1 80  ? 4.248   39.058  65.192  1.00 69.58  ? 77  ASP A OD2 1 
ATOM 393   N N   . VAL A 1 81  ? 6.904   37.884  60.452  1.00 68.81  ? 78  VAL A N   1 
ATOM 394   C CA  . VAL A 1 81  ? 7.774   38.673  59.585  1.00 52.35  ? 78  VAL A CA  1 
ATOM 395   C C   . VAL A 1 81  ? 7.255   40.103  59.390  1.00 65.87  ? 78  VAL A C   1 
ATOM 396   O O   . VAL A 1 81  ? 6.057   40.323  59.249  1.00 57.72  ? 78  VAL A O   1 
ATOM 397   C CB  . VAL A 1 81  ? 7.962   37.962  58.227  1.00 61.08  ? 78  VAL A CB  1 
ATOM 398   C CG1 . VAL A 1 81  ? 8.841   38.775  57.300  1.00 67.79  ? 78  VAL A CG1 1 
ATOM 399   C CG2 . VAL A 1 81  ? 8.554   36.584  58.445  1.00 44.47  ? 78  VAL A CG2 1 
ATOM 400   N N   . GLN A 1 82  ? 8.170   41.071  59.396  1.00 56.01  ? 79  GLN A N   1 
ATOM 401   C CA  . GLN A 1 82  ? 7.832   42.477  59.201  1.00 51.63  ? 79  GLN A CA  1 
ATOM 402   C C   . GLN A 1 82  ? 8.762   43.110  58.168  1.00 57.12  ? 79  GLN A C   1 
ATOM 403   O O   . GLN A 1 82  ? 9.863   42.624  57.946  1.00 59.53  ? 79  GLN A O   1 
ATOM 404   C CB  . GLN A 1 82  ? 7.985   43.227  60.516  1.00 62.97  ? 79  GLN A CB  1 
ATOM 405   C CG  . GLN A 1 82  ? 7.232   42.623  61.680  1.00 60.60  ? 79  GLN A CG  1 
ATOM 406   C CD  . GLN A 1 82  ? 5.761   42.874  61.569  1.00 54.42  ? 79  GLN A CD  1 
ATOM 407   O OE1 . GLN A 1 82  ? 5.340   43.869  60.990  1.00 63.13  ? 79  GLN A OE1 1 
ATOM 408   N NE2 . GLN A 1 82  ? 4.962   41.968  62.105  1.00 52.50  ? 79  GLN A NE2 1 
ATOM 409   N N   . TYR A 1 83  ? 8.340   44.212  57.561  1.00 50.62  ? 80  TYR A N   1 
ATOM 410   C CA  . TYR A 1 83  ? 9.194   44.892  56.596  1.00 50.15  ? 80  TYR A CA  1 
ATOM 411   C C   . TYR A 1 83  ? 9.411   46.351  56.919  1.00 53.03  ? 80  TYR A C   1 
ATOM 412   O O   . TYR A 1 83  ? 8.529   47.014  57.436  1.00 60.57  ? 80  TYR A O   1 
ATOM 413   C CB  . TYR A 1 83  ? 8.609   44.778  55.196  1.00 53.20  ? 80  TYR A CB  1 
ATOM 414   C CG  . TYR A 1 83  ? 8.479   43.353  54.716  1.00 62.90  ? 80  TYR A CG  1 
ATOM 415   C CD1 . TYR A 1 83  ? 7.333   42.619  54.981  1.00 57.90  ? 80  TYR A CD1 1 
ATOM 416   C CD2 . TYR A 1 83  ? 9.513   42.733  54.015  1.00 48.93  ? 80  TYR A CD2 1 
ATOM 417   C CE1 . TYR A 1 83  ? 7.209   41.319  54.554  1.00 70.14  ? 80  TYR A CE1 1 
ATOM 418   C CE2 . TYR A 1 83  ? 9.397   41.427  53.579  1.00 55.57  ? 80  TYR A CE2 1 
ATOM 419   C CZ  . TYR A 1 83  ? 8.238   40.725  53.850  1.00 77.30  ? 80  TYR A CZ  1 
ATOM 420   O OH  . TYR A 1 83  ? 8.089   39.424  53.428  1.00 85.87  ? 80  TYR A OH  1 
ATOM 421   N N   . GLN A 1 84  ? 10.598  46.844  56.595  1.00 47.91  ? 81  GLN A N   1 
ATOM 422   C CA  . GLN A 1 84  ? 10.917  48.253  56.731  1.00 61.03  ? 81  GLN A CA  1 
ATOM 423   C C   . GLN A 1 84  ? 11.032  48.844  55.321  1.00 64.33  ? 81  GLN A C   1 
ATOM 424   O O   . GLN A 1 84  ? 11.757  48.321  54.483  1.00 56.53  ? 81  GLN A O   1 
ATOM 425   C CB  . GLN A 1 84  ? 12.214  48.439  57.541  1.00 51.78  ? 81  GLN A CB  1 
ATOM 426   C CG  . GLN A 1 84  ? 12.556  49.887  57.858  1.00 33.00  ? 81  GLN A CG  1 
ATOM 427   C CD  . GLN A 1 84  ? 14.024  50.112  58.043  1.00 45.92  ? 81  GLN A CD  1 
ATOM 428   O OE1 . GLN A 1 84  ? 14.799  49.167  58.175  1.00 48.68  ? 81  GLN A OE1 1 
ATOM 429   N NE2 . GLN A 1 84  ? 14.428  51.367  58.021  1.00 32.28  ? 81  GLN A NE2 1 
ATOM 430   N N   . VAL A 1 85  ? 10.296  49.919  55.057  1.00 59.57  ? 82  VAL A N   1 
ATOM 431   C CA  . VAL A 1 85  ? 10.278  50.524  53.731  1.00 48.00  ? 82  VAL A CA  1 
ATOM 432   C C   . VAL A 1 85  ? 10.917  51.905  53.758  1.00 56.04  ? 82  VAL A C   1 
ATOM 433   O O   . VAL A 1 85  ? 10.879  52.590  54.773  1.00 57.72  ? 82  VAL A O   1 
ATOM 434   C CB  . VAL A 1 85  ? 8.840   50.626  53.164  1.00 47.83  ? 82  VAL A CB  1 
ATOM 435   C CG1 . VAL A 1 85  ? 8.135   49.287  53.281  1.00 33.58  ? 82  VAL A CG1 1 
ATOM 436   C CG2 . VAL A 1 85  ? 8.048   51.679  53.902  1.00 35.14  ? 82  VAL A CG2 1 
ATOM 437   N N   . SER A 1 86  ? 11.512  52.297  52.636  1.00 56.78  ? 83  SER A N   1 
ATOM 438   C CA  . SER A 1 86  ? 12.109  53.613  52.496  1.00 51.79  ? 83  SER A CA  1 
ATOM 439   C C   . SER A 1 86  ? 11.006  54.671  52.518  1.00 47.32  ? 83  SER A C   1 
ATOM 440   O O   . SER A 1 86  ? 10.093  54.593  51.719  1.00 39.24  ? 83  SER A O   1 
ATOM 441   C CB  . SER A 1 86  ? 12.901  53.663  51.188  1.00 31.11  ? 83  SER A CB  1 
ATOM 442   O OG  . SER A 1 86  ? 13.539  54.911  51.001  1.00 61.60  ? 83  SER A OG  1 
ATOM 443   N N   . PRO A 1 87  ? 11.075  55.651  53.451  1.00 54.70  ? 84  PRO A N   1 
ATOM 444   C CA  . PRO A 1 87  ? 10.017  56.657  53.646  1.00 41.72  ? 84  PRO A CA  1 
ATOM 445   C C   . PRO A 1 87  ? 9.688   57.519  52.403  1.00 44.59  ? 84  PRO A C   1 
ATOM 446   O O   . PRO A 1 87  ? 8.532   57.892  52.231  1.00 37.41  ? 84  PRO A O   1 
ATOM 447   C CB  . PRO A 1 87  ? 10.581  57.551  54.763  1.00 39.39  ? 84  PRO A CB  1 
ATOM 448   C CG  . PRO A 1 87  ? 11.565  56.733  55.452  1.00 49.42  ? 84  PRO A CG  1 
ATOM 449   C CD  . PRO A 1 87  ? 12.161  55.812  54.430  1.00 47.77  ? 84  PRO A CD  1 
ATOM 450   N N   . PHE A 1 88  ? 10.684  57.837  51.580  1.00 30.01  ? 85  PHE A N   1 
ATOM 451   C CA  . PHE A 1 88  ? 10.479  58.652  50.375  1.00 50.70  ? 85  PHE A CA  1 
ATOM 452   C C   . PHE A 1 88  ? 10.112  57.820  49.142  1.00 49.86  ? 85  PHE A C   1 
ATOM 453   O O   . PHE A 1 88  ? 9.921   58.343  48.042  1.00 69.85  ? 85  PHE A O   1 
ATOM 454   C CB  . PHE A 1 88  ? 11.730  59.475  50.084  1.00 35.46  ? 85  PHE A CB  1 
ATOM 455   C CG  . PHE A 1 88  ? 12.995  58.671  50.081  1.00 61.04  ? 85  PHE A CG  1 
ATOM 456   C CD1 . PHE A 1 88  ? 13.424  58.035  48.922  1.00 47.87  ? 85  PHE A CD1 1 
ATOM 457   C CD2 . PHE A 1 88  ? 13.757  58.539  51.237  1.00 32.80  ? 85  PHE A CD2 1 
ATOM 458   C CE1 . PHE A 1 88  ? 14.591  57.298  48.913  1.00 40.73  ? 85  PHE A CE1 1 
ATOM 459   C CE2 . PHE A 1 88  ? 14.941  57.798  51.230  1.00 35.96  ? 85  PHE A CE2 1 
ATOM 460   C CZ  . PHE A 1 88  ? 15.356  57.181  50.067  1.00 56.82  ? 85  PHE A CZ  1 
ATOM 461   N N   . ASN A 1 89  ? 10.037  56.513  49.334  1.00 55.21  ? 86  ASN A N   1 
ATOM 462   C CA  . ASN A 1 89  ? 9.669   55.592  48.276  1.00 52.34  ? 86  ASN A CA  1 
ATOM 463   C C   . ASN A 1 89  ? 9.165   54.303  48.894  1.00 49.97  ? 86  ASN A C   1 
ATOM 464   O O   . ASN A 1 89  ? 9.853   53.286  48.879  1.00 43.77  ? 86  ASN A O   1 
ATOM 465   C CB  . ASN A 1 89  ? 10.857  55.316  47.367  1.00 51.07  ? 86  ASN A CB  1 
ATOM 466   C CG  . ASN A 1 89  ? 10.520  54.350  46.253  1.00 74.57  ? 86  ASN A CG  1 
ATOM 467   O OD1 . ASN A 1 89  ? 11.404  53.689  45.695  1.00 55.37  ? 86  ASN A OD1 1 
ATOM 468   N ND2 . ASN A 1 89  ? 9.226   54.249  45.932  1.00 51.63  ? 86  ASN A ND2 1 
ATOM 469   N N   . HIS A 1 90  ? 7.956   54.355  49.443  1.00 35.70  ? 87  HIS A N   1 
ATOM 470   C CA  . HIS A 1 90  ? 7.468   53.278  50.289  1.00 56.23  ? 87  HIS A CA  1 
ATOM 471   C C   . HIS A 1 90  ? 7.163   51.984  49.559  1.00 62.33  ? 87  HIS A C   1 
ATOM 472   O O   . HIS A 1 90  ? 6.694   51.029  50.174  1.00 61.31  ? 87  HIS A O   1 
ATOM 473   C CB  . HIS A 1 90  ? 6.254   53.734  51.081  1.00 68.20  ? 87  HIS A CB  1 
ATOM 474   C CG  . HIS A 1 90  ? 5.316   54.594  50.302  1.00 70.00  ? 87  HIS A CG  1 
ATOM 475   N ND1 . HIS A 1 90  ? 4.797   54.215  49.086  1.00 81.25  ? 87  HIS A ND1 1 
ATOM 476   C CD2 . HIS A 1 90  ? 4.797   55.812  50.571  1.00 58.16  ? 87  HIS A CD2 1 
ATOM 477   C CE1 . HIS A 1 90  ? 3.997   55.164  48.638  1.00 76.01  ? 87  HIS A CE1 1 
ATOM 478   N NE2 . HIS A 1 90  ? 3.982   56.147  49.519  1.00 68.92  ? 87  HIS A NE2 1 
ATOM 479   N N   . GLY A 1 91  ? 7.431   51.952  48.258  1.00 60.87  ? 88  GLY A N   1 
ATOM 480   C CA  . GLY A 1 91  ? 7.327   50.723  47.501  1.00 49.52  ? 88  GLY A CA  1 
ATOM 481   C C   . GLY A 1 91  ? 8.561   49.850  47.616  1.00 59.72  ? 88  GLY A C   1 
ATOM 482   O O   . GLY A 1 91  ? 8.496   48.649  47.362  1.00 76.12  ? 88  GLY A O   1 
ATOM 483   N N   . HIS A 1 92  ? 9.689   50.456  47.981  1.00 54.08  ? 89  HIS A N   1 
ATOM 484   C CA  . HIS A 1 92  ? 10.948  49.734  48.208  1.00 39.95  ? 89  HIS A CA  1 
ATOM 485   C C   . HIS A 1 92  ? 11.000  49.209  49.657  1.00 58.10  ? 89  HIS A C   1 
ATOM 486   O O   . HIS A 1 92  ? 11.050  49.972  50.621  1.00 48.92  ? 89  HIS A O   1 
ATOM 487   C CB  . HIS A 1 92  ? 12.135  50.671  47.936  1.00 62.46  ? 89  HIS A CB  1 
ATOM 488   C CG  . HIS A 1 92  ? 13.476  50.021  48.071  1.00 63.49  ? 89  HIS A CG  1 
ATOM 489   N ND1 . HIS A 1 92  ? 14.612  50.738  48.409  1.00 71.50  ? 89  HIS A ND1 1 
ATOM 490   C CD2 . HIS A 1 92  ? 13.878  48.747  47.889  1.00 68.98  ? 89  HIS A CD2 1 
ATOM 491   C CE1 . HIS A 1 92  ? 15.649  49.915  48.449  1.00 78.88  ? 89  HIS A CE1 1 
ATOM 492   N NE2 . HIS A 1 92  ? 15.223  48.701  48.158  1.00 92.98  ? 89  HIS A NE2 1 
ATOM 493   N N   . LYS A 1 93  ? 10.969  47.896  49.805  1.00 58.56  ? 90  LYS A N   1 
ATOM 494   C CA  . LYS A 1 93  ? 11.225  47.282  51.081  1.00 51.47  ? 90  LYS A CA  1 
ATOM 495   C C   . LYS A 1 93  ? 12.744  47.227  51.260  1.00 61.78  ? 90  LYS A C   1 
ATOM 496   O O   . LYS A 1 93  ? 13.419  46.525  50.517  1.00 59.53  ? 90  LYS A O   1 
ATOM 497   C CB  . LYS A 1 93  ? 10.634  45.869  51.130  1.00 47.56  ? 90  LYS A CB  1 
ATOM 498   C CG  . LYS A 1 93  ? 9.129   45.777  50.992  1.00 52.32  ? 90  LYS A CG  1 
ATOM 499   C CD  . LYS A 1 93  ? 8.692   44.326  51.203  1.00 53.93  ? 90  LYS A CD  1 
ATOM 500   C CE  . LYS A 1 93  ? 7.238   44.085  50.800  1.00 56.75  ? 90  LYS A CE  1 
ATOM 501   N N   . VAL A 1 94  ? 13.282  47.975  52.228  1.00 66.36  ? 91  VAL A N   1 
ATOM 502   C CA  . VAL A 1 94  ? 14.729  47.999  52.482  1.00 54.23  ? 91  VAL A CA  1 
ATOM 503   C C   . VAL A 1 94  ? 15.205  46.899  53.437  1.00 66.06  ? 91  VAL A C   1 
ATOM 504   O O   . VAL A 1 94  ? 16.381  46.546  53.424  1.00 48.20  ? 91  VAL A O   1 
ATOM 505   C CB  . VAL A 1 94  ? 15.229  49.364  53.032  1.00 64.04  ? 91  VAL A CB  1 
ATOM 506   C CG1 . VAL A 1 94  ? 14.789  50.504  52.137  1.00 49.69  ? 91  VAL A CG1 1 
ATOM 507   C CG2 . VAL A 1 94  ? 14.746  49.583  54.471  1.00 61.09  ? 91  VAL A CG2 1 
ATOM 508   N N   . ALA A 1 95  ? 14.308  46.378  54.274  1.00 42.17  ? 92  ALA A N   1 
ATOM 509   C CA  . ALA A 1 95  ? 14.668  45.283  55.175  1.00 51.15  ? 92  ALA A CA  1 
ATOM 510   C C   . ALA A 1 95  ? 13.485  44.391  55.498  1.00 44.39  ? 92  ALA A C   1 
ATOM 511   O O   . ALA A 1 95  ? 12.336  44.826  55.507  1.00 44.80  ? 92  ALA A O   1 
ATOM 512   C CB  . ALA A 1 95  ? 15.301  45.805  56.460  1.00 34.83  ? 92  ALA A CB  1 
ATOM 513   N N   . LYS A 1 96  ? 13.787  43.131  55.760  1.00 38.58  ? 93  LYS A N   1 
ATOM 514   C CA  . LYS A 1 96  ? 12.804  42.168  56.242  1.00 63.42  ? 93  LYS A CA  1 
ATOM 515   C C   . LYS A 1 96  ? 13.329  41.640  57.558  1.00 54.75  ? 93  LYS A C   1 
ATOM 516   O O   . LYS A 1 96  ? 14.475  41.216  57.641  1.00 56.78  ? 93  LYS A O   1 
ATOM 517   C CB  . LYS A 1 96  ? 12.602  41.031  55.228  1.00 63.12  ? 93  LYS A CB  1 
ATOM 518   C CG  . LYS A 1 96  ? 12.071  39.705  55.793  1.00 60.64  ? 93  LYS A CG  1 
ATOM 519   C CD  . LYS A 1 96  ? 11.668  38.775  54.654  1.00 72.34  ? 93  LYS A CD  1 
ATOM 520   C CE  . LYS A 1 96  ? 11.722  37.293  55.012  1.00 82.75  ? 93  LYS A CE  1 
ATOM 521   N NZ  . LYS A 1 96  ? 11.466  36.419  53.805  1.00 74.71  ? 93  LYS A NZ  1 
ATOM 522   N N   . PHE A 1 97  ? 12.501  41.698  58.592  1.00 57.27  ? 94  PHE A N   1 
ATOM 523   C CA  . PHE A 1 97  ? 12.905  41.244  59.924  1.00 67.75  ? 94  PHE A CA  1 
ATOM 524   C C   . PHE A 1 97  ? 11.738  40.539  60.586  1.00 34.79  ? 94  PHE A C   1 
ATOM 525   O O   . PHE A 1 97  ? 10.729  40.269  59.938  1.00 62.72  ? 94  PHE A O   1 
ATOM 526   C CB  . PHE A 1 97  ? 13.417  42.418  60.786  1.00 54.01  ? 94  PHE A CB  1 
ATOM 527   C CG  . PHE A 1 97  ? 12.370  43.481  61.087  1.00 54.49  ? 94  PHE A CG  1 
ATOM 528   C CD1 . PHE A 1 97  ? 11.723  43.521  62.318  1.00 47.15  ? 94  PHE A CD1 1 
ATOM 529   C CD2 . PHE A 1 97  ? 12.053  44.453  60.147  1.00 44.65  ? 94  PHE A CD2 1 
ATOM 530   C CE1 . PHE A 1 97  ? 10.773  44.513  62.601  1.00 57.47  ? 94  PHE A CE1 1 
ATOM 531   C CE2 . PHE A 1 97  ? 11.096  45.434  60.417  1.00 39.44  ? 94  PHE A CE2 1 
ATOM 532   C CZ  . PHE A 1 97  ? 10.462  45.469  61.645  1.00 42.54  ? 94  PHE A CZ  1 
ATOM 533   N N   . CYS A 1 98  ? 11.849  40.261  61.877  1.00 53.80  ? 95  CYS A N   1 
ATOM 534   C CA  . CYS A 1 98  ? 10.741  39.618  62.557  1.00 53.40  ? 95  CYS A CA  1 
ATOM 535   C C   . CYS A 1 98  ? 10.631  40.030  64.014  1.00 56.31  ? 95  CYS A C   1 
ATOM 536   O O   . CYS A 1 98  ? 11.583  40.526  64.604  1.00 70.55  ? 95  CYS A O   1 
ATOM 537   C CB  . CYS A 1 98  ? 10.880  38.108  62.444  1.00 51.49  ? 95  CYS A CB  1 
ATOM 538   S SG  . CYS A 1 98  ? 12.335  37.513  63.251  1.00 69.90  ? 95  CYS A SG  1 
ATOM 539   N N   . TYR A 1 99  ? 9.449   39.812  64.575  1.00 60.64  ? 96  TYR A N   1 
ATOM 540   C CA  . TYR A 1 99  ? 9.161   40.066  65.981  1.00 52.61  ? 96  TYR A CA  1 
ATOM 541   C C   . TYR A 1 99  ? 9.444   38.861  66.890  1.00 54.34  ? 96  TYR A C   1 
ATOM 542   O O   . TYR A 1 99  ? 8.961   37.761  66.634  1.00 68.81  ? 96  TYR A O   1 
ATOM 543   C CB  . TYR A 1 99  ? 7.680   40.384  66.126  1.00 53.42  ? 96  TYR A CB  1 
ATOM 544   C CG  . TYR A 1 99  ? 7.273   41.770  65.723  1.00 50.61  ? 96  TYR A CG  1 
ATOM 545   C CD1 . TYR A 1 99  ? 8.218   42.749  65.476  1.00 48.24  ? 96  TYR A CD1 1 
ATOM 546   C CD2 . TYR A 1 99  ? 5.926   42.112  65.614  1.00 54.29  ? 96  TYR A CD2 1 
ATOM 547   C CE1 . TYR A 1 99  ? 7.831   44.033  65.115  1.00 44.61  ? 96  TYR A CE1 1 
ATOM 548   C CE2 . TYR A 1 99  ? 5.534   43.387  65.259  1.00 41.29  ? 96  TYR A CE2 1 
ATOM 549   C CZ  . TYR A 1 99  ? 6.491   44.343  65.006  1.00 49.73  ? 96  TYR A CZ  1 
ATOM 550   O OH  . TYR A 1 99  ? 6.093   45.610  64.648  1.00 47.70  ? 96  TYR A OH  1 
ATOM 551   N N   . ALA A 1 100 ? 10.190  39.076  67.965  1.00 62.93  ? 97  ALA A N   1 
ATOM 552   C CA  . ALA A 1 100 ? 10.328  38.072  69.016  1.00 55.17  ? 97  ALA A CA  1 
ATOM 553   C C   . ALA A 1 100 ? 8.983   37.806  69.676  1.00 47.42  ? 97  ALA A C   1 
ATOM 554   O O   . ALA A 1 100 ? 8.212   38.728  69.906  1.00 69.99  ? 97  ALA A O   1 
ATOM 555   C CB  . ALA A 1 100 ? 11.319  38.539  70.063  1.00 49.30  ? 97  ALA A CB  1 
ATOM 556   N N   . ASP A 1 101 ? 8.703   36.545  69.982  1.00 65.28  ? 98  ASP A N   1 
ATOM 557   C CA  . ASP A 1 101 ? 7.538   36.188  70.784  1.00 65.73  ? 98  ASP A CA  1 
ATOM 558   C C   . ASP A 1 101 ? 7.898   36.164  72.276  1.00 72.16  ? 98  ASP A C   1 
ATOM 559   O O   . ASP A 1 101 ? 9.056   36.371  72.640  1.00 52.43  ? 98  ASP A O   1 
ATOM 560   C CB  . ASP A 1 101 ? 6.938   34.846  70.329  1.00 69.18  ? 98  ASP A CB  1 
ATOM 561   C CG  . ASP A 1 101 ? 7.994   33.791  70.004  1.00 83.57  ? 98  ASP A CG  1 
ATOM 562   O OD1 . ASP A 1 101 ? 9.057   33.769  70.658  1.00 77.33  ? 98  ASP A OD1 1 
ATOM 563   O OD2 . ASP A 1 101 ? 7.749   32.966  69.093  1.00 88.02  ? 98  ASP A OD2 1 
ATOM 564   N N   . LYS A 1 102 ? 6.910   35.936  73.136  1.00 55.24  ? 99  LYS A N   1 
ATOM 565   C CA  . LYS A 1 102 ? 7.164   35.812  74.567  1.00 66.08  ? 99  LYS A CA  1 
ATOM 566   C C   . LYS A 1 102 ? 8.262   34.767  74.824  1.00 67.59  ? 99  LYS A C   1 
ATOM 567   O O   . LYS A 1 102 ? 9.201   34.978  75.593  1.00 57.83  ? 99  LYS A O   1 
ATOM 568   C CB  . LYS A 1 102 ? 5.874   35.449  75.321  1.00 48.23  ? 99  LYS A CB  1 
ATOM 569   N N   . SER A 1 103 ? 8.150   33.636  74.150  1.00 67.24  ? 100 SER A N   1 
ATOM 570   C CA  . SER A 1 103 ? 9.120   32.572  74.305  1.00 56.84  ? 100 SER A CA  1 
ATOM 571   C C   . SER A 1 103 ? 10.562  33.029  74.044  1.00 63.41  ? 100 SER A C   1 
ATOM 572   O O   . SER A 1 103 ? 11.458  32.805  74.867  1.00 62.73  ? 100 SER A O   1 
ATOM 573   C CB  . SER A 1 103 ? 8.745   31.415  73.385  1.00 61.94  ? 100 SER A CB  1 
ATOM 574   O OG  . SER A 1 103 ? 9.838   30.535  73.217  1.00 79.40  ? 100 SER A OG  1 
ATOM 575   N N   . LEU A 1 104 ? 10.782  33.651  72.890  1.00 56.56  ? 101 LEU A N   1 
ATOM 576   C CA  . LEU A 1 104 ? 12.110  34.116  72.497  1.00 47.23  ? 101 LEU A CA  1 
ATOM 577   C C   . LEU A 1 104 ? 12.640  35.206  73.429  1.00 47.21  ? 101 LEU A C   1 
ATOM 578   O O   . LEU A 1 104 ? 13.806  35.200  73.802  1.00 56.76  ? 101 LEU A O   1 
ATOM 579   C CB  . LEU A 1 104 ? 12.092  34.614  71.055  1.00 51.01  ? 101 LEU A CB  1 
ATOM 580   C CG  . LEU A 1 104 ? 13.420  35.116  70.476  1.00 60.91  ? 101 LEU A CG  1 
ATOM 581   C CD1 . LEU A 1 104 ? 14.524  34.096  70.645  1.00 45.20  ? 101 LEU A CD1 1 
ATOM 582   C CD2 . LEU A 1 104 ? 13.260  35.480  69.018  1.00 44.44  ? 101 LEU A CD2 1 
ATOM 583   N N   . LEU A 1 105 ? 11.775  36.127  73.827  1.00 46.05  ? 102 LEU A N   1 
ATOM 584   C CA  . LEU A 1 105 ? 12.165  37.168  74.771  1.00 57.08  ? 102 LEU A CA  1 
ATOM 585   C C   . LEU A 1 105 ? 12.636  36.590  76.096  1.00 53.38  ? 102 LEU A C   1 
ATOM 586   O O   . LEU A 1 105 ? 13.612  37.063  76.662  1.00 48.20  ? 102 LEU A O   1 
ATOM 587   C CB  . LEU A 1 105 ? 11.020  38.163  75.000  1.00 54.09  ? 102 LEU A CB  1 
ATOM 588   C CG  . LEU A 1 105 ? 10.663  39.011  73.785  1.00 53.72  ? 102 LEU A CG  1 
ATOM 589   C CD1 . LEU A 1 105 ? 9.441   39.856  74.085  1.00 62.38  ? 102 LEU A CD1 1 
ATOM 590   C CD2 . LEU A 1 105 ? 11.854  39.864  73.371  1.00 36.52  ? 102 LEU A CD2 1 
ATOM 591   N N   . ASN A 1 106 ? 11.951  35.567  76.594  1.00 56.16  ? 103 ASN A N   1 
ATOM 592   C CA  . ASN A 1 106 ? 12.394  34.935  77.834  1.00 60.05  ? 103 ASN A CA  1 
ATOM 593   C C   . ASN A 1 106 ? 13.666  34.114  77.670  1.00 49.89  ? 103 ASN A C   1 
ATOM 594   O O   . ASN A 1 106 ? 14.491  34.081  78.570  1.00 62.18  ? 103 ASN A O   1 
ATOM 595   C CB  . ASN A 1 106 ? 11.286  34.099  78.464  1.00 63.49  ? 103 ASN A CB  1 
ATOM 596   C CG  . ASN A 1 106 ? 10.159  34.942  79.000  1.00 65.90  ? 103 ASN A CG  1 
ATOM 597   O OD1 . ASN A 1 106 ? 8.993   34.655  78.763  1.00 63.92  ? 103 ASN A OD1 1 
ATOM 598   N ND2 . ASN A 1 106 ? 10.501  35.992  79.727  1.00 56.30  ? 103 ASN A ND2 1 
ATOM 599   N N   . LYS A 1 107 ? 13.830  33.462  76.523  1.00 43.65  ? 104 LYS A N   1 
ATOM 600   C CA  . LYS A 1 107 ? 15.096  32.798  76.230  1.00 65.97  ? 104 LYS A CA  1 
ATOM 601   C C   . LYS A 1 107 ? 16.220  33.840  76.285  1.00 58.24  ? 104 LYS A C   1 
ATOM 602   O O   . LYS A 1 107 ? 17.306  33.585  76.815  1.00 50.82  ? 104 LYS A O   1 
ATOM 603   C CB  . LYS A 1 107 ? 15.057  32.071  74.864  1.00 48.18  ? 104 LYS A CB  1 
ATOM 604   N N   . ALA A 1 108 ? 15.935  35.026  75.750  1.00 55.72  ? 105 ALA A N   1 
ATOM 605   C CA  . ALA A 1 108 ? 16.915  36.112  75.673  1.00 53.60  ? 105 ALA A CA  1 
ATOM 606   C C   . ALA A 1 108 ? 17.291  36.661  77.044  1.00 57.05  ? 105 ALA A C   1 
ATOM 607   O O   . ALA A 1 108 ? 18.459  36.969  77.305  1.00 54.40  ? 105 ALA A O   1 
ATOM 608   C CB  . ALA A 1 108 ? 16.398  37.226  74.770  1.00 45.40  ? 105 ALA A CB  1 
ATOM 609   N N   . ILE A 1 109 ? 16.288  36.791  77.907  1.00 54.14  ? 106 ILE A N   1 
ATOM 610   C CA  . ILE A 1 109 ? 16.479  37.179  79.301  1.00 46.55  ? 106 ILE A CA  1 
ATOM 611   C C   . ILE A 1 109 ? 17.311  36.172  80.058  1.00 45.49  ? 106 ILE A C   1 
ATOM 612   O O   . ILE A 1 109 ? 18.284  36.551  80.689  1.00 48.40  ? 106 ILE A O   1 
ATOM 613   C CB  . ILE A 1 109 ? 15.133  37.338  80.023  1.00 59.77  ? 106 ILE A CB  1 
ATOM 614   C CG1 . ILE A 1 109 ? 14.371  38.527  79.445  1.00 45.80  ? 106 ILE A CG1 1 
ATOM 615   C CG2 . ILE A 1 109 ? 15.341  37.514  81.501  1.00 43.82  ? 106 ILE A CG2 1 
ATOM 616   C CD1 . ILE A 1 109 ? 13.019  38.729  80.044  1.00 47.31  ? 106 ILE A CD1 1 
ATOM 617   N N   . GLU A 1 110 ? 16.938  34.892  79.982  1.00 45.27  ? 107 GLU A N   1 
ATOM 618   C CA  . GLU A 1 110 ? 17.679  33.833  80.671  1.00 45.43  ? 107 GLU A CA  1 
ATOM 619   C C   . GLU A 1 110 ? 19.150  33.832  80.263  1.00 49.62  ? 107 GLU A C   1 
ATOM 620   O O   . GLU A 1 110 ? 20.037  33.682  81.107  1.00 71.45  ? 107 GLU A O   1 
ATOM 621   C CB  . GLU A 1 110 ? 17.035  32.443  80.473  1.00 39.67  ? 107 GLU A CB  1 
ATOM 622   N N   . ALA A 1 111 ? 19.409  34.031  78.975  1.00 48.32  ? 108 ALA A N   1 
ATOM 623   C CA  . ALA A 1 111 ? 20.765  33.916  78.452  1.00 52.38  ? 108 ALA A CA  1 
ATOM 624   C C   . ALA A 1 111 ? 21.606  35.129  78.807  1.00 46.01  ? 108 ALA A C   1 
ATOM 625   O O   . ALA A 1 111 ? 22.794  35.006  79.104  1.00 62.52  ? 108 ALA A O   1 
ATOM 626   C CB  . ALA A 1 111 ? 20.738  33.704  76.950  1.00 46.06  ? 108 ALA A CB  1 
ATOM 627   N N   . ALA A 1 112 ? 20.975  36.296  78.775  1.00 52.26  ? 109 ALA A N   1 
ATOM 628   C CA  . ALA A 1 112 ? 21.610  37.538  79.192  1.00 48.23  ? 109 ALA A CA  1 
ATOM 629   C C   . ALA A 1 112 ? 22.023  37.477  80.654  1.00 53.96  ? 109 ALA A C   1 
ATOM 630   O O   . ALA A 1 112 ? 23.148  37.855  80.987  1.00 45.03  ? 109 ALA A O   1 
ATOM 631   C CB  . ALA A 1 112 ? 20.682  38.705  78.960  1.00 39.60  ? 109 ALA A CB  1 
ATOM 632   N N   . LEU A 1 113 ? 21.113  37.006  81.514  1.00 43.50  ? 110 LEU A N   1 
ATOM 633   C CA  . LEU A 1 113 ? 21.384  36.853  82.957  1.00 47.68  ? 110 LEU A CA  1 
ATOM 634   C C   . LEU A 1 113 ? 22.552  35.917  83.253  1.00 49.00  ? 110 LEU A C   1 
ATOM 635   O O   . LEU A 1 113 ? 23.323  36.149  84.172  1.00 55.28  ? 110 LEU A O   1 
ATOM 636   C CB  . LEU A 1 113 ? 20.132  36.368  83.703  1.00 33.43  ? 110 LEU A CB  1 
ATOM 637   C CG  . LEU A 1 113 ? 19.006  37.398  83.748  1.00 47.83  ? 110 LEU A CG  1 
ATOM 638   C CD1 . LEU A 1 113 ? 17.809  36.827  84.428  1.00 48.14  ? 110 LEU A CD1 1 
ATOM 639   C CD2 . LEU A 1 113 ? 19.448  38.678  84.427  1.00 31.39  ? 110 LEU A CD2 1 
ATOM 640   N N   . ALA A 1 114 ? 22.689  34.862  82.459  1.00 55.85  ? 111 ALA A N   1 
ATOM 641   C CA  . ALA A 1 114 ? 23.755  33.899  82.676  1.00 55.70  ? 111 ALA A CA  1 
ATOM 642   C C   . ALA A 1 114 ? 25.102  34.421  82.205  1.00 53.00  ? 111 ALA A C   1 
ATOM 643   O O   . ALA A 1 114 ? 26.131  33.871  82.550  1.00 63.33  ? 111 ALA A O   1 
ATOM 644   C CB  . ALA A 1 114 ? 23.426  32.584  82.012  1.00 43.60  ? 111 ALA A CB  1 
ATOM 645   N N   . ALA A 1 115 ? 25.090  35.486  81.414  1.00 52.14  ? 112 ALA A N   1 
ATOM 646   C CA  . ALA A 1 115 ? 26.335  36.094  80.938  1.00 51.09  ? 112 ALA A CA  1 
ATOM 647   C C   . ALA A 1 115 ? 26.764  37.307  81.774  1.00 32.01  ? 112 ALA A C   1 
ATOM 648   O O   . ALA A 1 115 ? 27.868  37.808  81.617  1.00 56.96  ? 112 ALA A O   1 
ATOM 649   C CB  . ALA A 1 115 ? 26.205  36.485  79.455  1.00 42.70  ? 112 ALA A CB  1 
ATOM 650   N N   . ARG A 1 116 ? 25.882  37.767  82.654  1.00 54.23  ? 113 ARG A N   1 
ATOM 651   C CA  . ARG A 1 116 ? 26.057  39.045  83.342  1.00 48.13  ? 113 ARG A CA  1 
ATOM 652   C C   . ARG A 1 116 ? 27.207  39.121  84.337  1.00 43.40  ? 113 ARG A C   1 
ATOM 653   O O   . ARG A 1 116 ? 27.962  40.084  84.298  1.00 49.66  ? 113 ARG A O   1 
ATOM 654   C CB  . ARG A 1 116 ? 24.755  39.472  84.035  1.00 48.72  ? 113 ARG A CB  1 
ATOM 655   C CG  . ARG A 1 116 ? 24.732  40.938  84.467  1.00 33.05  ? 113 ARG A CG  1 
ATOM 656   C CD  . ARG A 1 116 ? 23.584  41.207  85.417  1.00 46.74  ? 113 ARG A CD  1 
ATOM 657   N NE  . ARG A 1 116 ? 23.607  40.364  86.622  1.00 51.24  ? 113 ARG A NE  1 
ATOM 658   C CZ  . ARG A 1 116 ? 24.386  40.591  87.677  1.00 49.58  ? 113 ARG A CZ  1 
ATOM 659   N NH1 . ARG A 1 116 ? 25.246  41.606  87.676  1.00 42.37  ? 113 ARG A NH1 1 
ATOM 660   N NH2 . ARG A 1 116 ? 24.318  39.794  88.729  1.00 53.53  ? 113 ARG A NH2 1 
ATOM 661   N N   . LYS A 1 117 ? 27.336  38.134  85.230  1.00 47.72  ? 114 LYS A N   1 
ATOM 662   C CA  . LYS A 1 117 ? 28.318  38.232  86.313  1.00 59.15  ? 114 LYS A CA  1 
ATOM 663   C C   . LYS A 1 117 ? 29.737  38.381  85.765  1.00 50.77  ? 114 LYS A C   1 
ATOM 664   O O   . LYS A 1 117 ? 30.476  39.242  86.232  1.00 55.93  ? 114 LYS A O   1 
ATOM 665   C CB  . LYS A 1 117 ? 28.185  37.099  87.357  1.00 40.92  ? 114 LYS A CB  1 
ATOM 666   N N   . GLU A 1 118 ? 30.102  37.585  84.753  1.00 44.95  ? 115 GLU A N   1 
ATOM 667   C CA  . GLU A 1 118 ? 31.447  37.677  84.142  1.00 46.48  ? 115 GLU A CA  1 
ATOM 668   C C   . GLU A 1 118 ? 31.658  39.022  83.458  1.00 57.55  ? 115 GLU A C   1 
ATOM 669   O O   . GLU A 1 118 ? 32.740  39.589  83.497  1.00 47.10  ? 115 GLU A O   1 
ATOM 670   C CB  . GLU A 1 118 ? 31.717  36.545  83.125  1.00 37.47  ? 115 GLU A CB  1 
ATOM 671   N N   . TRP A 1 119 ? 30.609  39.528  82.822  1.00 45.40  ? 116 TRP A N   1 
ATOM 672   C CA  . TRP A 1 119 ? 30.668  40.808  82.140  1.00 42.31  ? 116 TRP A CA  1 
ATOM 673   C C   . TRP A 1 119 ? 30.795  41.950  83.156  1.00 49.18  ? 116 TRP A C   1 
ATOM 674   O O   . TRP A 1 119 ? 31.661  42.813  83.022  1.00 36.45  ? 116 TRP A O   1 
ATOM 675   C CB  . TRP A 1 119 ? 29.439  40.965  81.228  1.00 33.78  ? 116 TRP A CB  1 
ATOM 676   C CG  . TRP A 1 119 ? 29.278  42.310  80.579  1.00 59.08  ? 116 TRP A CG  1 
ATOM 677   C CD1 . TRP A 1 119 ? 28.313  43.250  80.864  1.00 51.86  ? 116 TRP A CD1 1 
ATOM 678   C CD2 . TRP A 1 119 ? 30.099  42.880  79.543  1.00 39.34  ? 116 TRP A CD2 1 
ATOM 679   N NE1 . TRP A 1 119 ? 28.488  44.356  80.068  1.00 50.49  ? 116 TRP A NE1 1 
ATOM 680   C CE2 . TRP A 1 119 ? 29.574  44.153  79.250  1.00 36.69  ? 116 TRP A CE2 1 
ATOM 681   C CE3 . TRP A 1 119 ? 31.222  42.436  78.835  1.00 51.41  ? 116 TRP A CE3 1 
ATOM 682   C CZ2 . TRP A 1 119 ? 30.132  44.983  78.277  1.00 48.12  ? 116 TRP A CZ2 1 
ATOM 683   C CZ3 . TRP A 1 119 ? 31.773  43.270  77.867  1.00 44.48  ? 116 TRP A CZ3 1 
ATOM 684   C CH2 . TRP A 1 119 ? 31.229  44.526  77.604  1.00 39.19  ? 116 TRP A CH2 1 
ATOM 685   N N   . ASP A 1 120 ? 29.947  41.945  84.179  1.00 35.02  ? 117 ASP A N   1 
ATOM 686   C CA  . ASP A 1 120 ? 30.043  42.921  85.250  1.00 31.09  ? 117 ASP A CA  1 
ATOM 687   C C   . ASP A 1 120 ? 31.431  42.905  85.903  1.00 47.15  ? 117 ASP A C   1 
ATOM 688   O O   . ASP A 1 120 ? 31.935  43.947  86.329  1.00 46.66  ? 117 ASP A O   1 
ATOM 689   C CB  . ASP A 1 120 ? 28.929  42.683  86.297  1.00 30.66  ? 117 ASP A CB  1 
ATOM 690   C CG  . ASP A 1 120 ? 29.013  43.638  87.470  1.00 50.55  ? 117 ASP A CG  1 
ATOM 691   O OD1 . ASP A 1 120 ? 29.497  44.781  87.272  1.00 65.49  ? 117 ASP A OD1 1 
ATOM 692   O OD2 . ASP A 1 120 ? 28.589  43.246  88.584  1.00 64.47  ? 117 ASP A OD2 1 
ATOM 693   N N   . LEU A 1 121 ? 32.049  41.724  85.973  1.00 47.74  ? 118 LEU A N   1 
ATOM 694   C CA  . LEU A 1 121 ? 33.362  41.572  86.614  1.00 43.91  ? 118 LEU A CA  1 
ATOM 695   C C   . LEU A 1 121 ? 34.524  41.997  85.730  1.00 38.67  ? 118 LEU A C   1 
ATOM 696   O O   . LEU A 1 121 ? 35.589  42.343  86.231  1.00 60.86  ? 118 LEU A O   1 
ATOM 697   C CB  . LEU A 1 121 ? 33.576  40.134  87.096  1.00 39.12  ? 118 LEU A CB  1 
ATOM 698   C CG  . LEU A 1 121 ? 32.959  39.819  88.451  1.00 54.21  ? 118 LEU A CG  1 
ATOM 699   C CD1 . LEU A 1 121 ? 32.785  38.332  88.626  1.00 38.41  ? 118 LEU A CD1 1 
ATOM 700   C CD2 . LEU A 1 121 ? 33.833  40.403  89.546  1.00 42.30  ? 118 LEU A CD2 1 
ATOM 701   N N   . LYS A 1 122 ? 34.328  41.956  84.421  1.00 38.45  ? 119 LYS A N   1 
ATOM 702   C CA  . LYS A 1 122 ? 35.334  42.446  83.483  1.00 50.16  ? 119 LYS A CA  1 
ATOM 703   C C   . LYS A 1 122 ? 35.590  43.925  83.798  1.00 42.20  ? 119 LYS A C   1 
ATOM 704   O O   . LYS A 1 122 ? 34.651  44.678  83.978  1.00 71.70  ? 119 LYS A O   1 
ATOM 705   C CB  . LYS A 1 122 ? 34.847  42.222  82.032  1.00 33.24  ? 119 LYS A CB  1 
ATOM 706   C CG  . LYS A 1 122 ? 35.771  42.714  80.915  1.00 49.69  ? 119 LYS A CG  1 
ATOM 707   C CD  . LYS A 1 122 ? 35.233  42.330  79.536  1.00 50.87  ? 119 LYS A CD  1 
ATOM 708   C CE  . LYS A 1 122 ? 34.818  40.871  79.478  1.00 70.92  ? 119 LYS A CE  1 
ATOM 709   N NZ  . LYS A 1 122 ? 35.953  40.008  79.059  1.00 57.38  ? 119 LYS A NZ  1 
ATOM 710   N N   . PRO A 1 123 ? 36.867  44.336  83.901  1.00 59.84  ? 120 PRO A N   1 
ATOM 711   C CA  . PRO A 1 123 ? 37.256  45.713  84.255  1.00 51.04  ? 120 PRO A CA  1 
ATOM 712   C C   . PRO A 1 123 ? 36.702  46.723  83.270  1.00 52.74  ? 120 PRO A C   1 
ATOM 713   O O   . PRO A 1 123 ? 36.542  46.389  82.105  1.00 62.59  ? 120 PRO A O   1 
ATOM 714   C CB  . PRO A 1 123 ? 38.793  45.699  84.122  1.00 41.74  ? 120 PRO A CB  1 
ATOM 715   C CG  . PRO A 1 123 ? 39.170  44.289  84.265  1.00 54.76  ? 120 PRO A CG  1 
ATOM 716   C CD  . PRO A 1 123 ? 38.043  43.493  83.645  1.00 55.27  ? 120 PRO A CD  1 
ATOM 717   N N   . ILE A 1 124 ? 36.441  47.944  83.728  1.00 48.91  ? 121 ILE A N   1 
ATOM 718   C CA  . ILE A 1 124 ? 35.769  48.954  82.904  1.00 38.39  ? 121 ILE A CA  1 
ATOM 719   C C   . ILE A 1 124 ? 36.621  49.307  81.700  1.00 52.26  ? 121 ILE A C   1 
ATOM 720   O O   . ILE A 1 124 ? 36.099  49.632  80.637  1.00 62.34  ? 121 ILE A O   1 
ATOM 721   C CB  . ILE A 1 124 ? 35.401  50.231  83.717  1.00 40.03  ? 121 ILE A CB  1 
ATOM 722   C CG1 . ILE A 1 124 ? 34.690  51.295  82.863  1.00 41.78  ? 121 ILE A CG1 1 
ATOM 723   C CG2 . ILE A 1 124 ? 36.643  50.850  84.323  1.00 47.19  ? 121 ILE A CG2 1 
ATOM 724   C CD1 . ILE A 1 124 ? 33.387  50.856  82.242  1.00 34.86  ? 121 ILE A CD1 1 
ATOM 725   N N   . ALA A 1 125 ? 37.934  49.217  81.853  1.00 49.63  ? 122 ALA A N   1 
ATOM 726   C CA  . ALA A 1 125 ? 38.830  49.498  80.732  1.00 50.54  ? 122 ALA A CA  1 
ATOM 727   C C   . ALA A 1 125 ? 38.681  48.508  79.574  1.00 56.94  ? 122 ALA A C   1 
ATOM 728   O O   . ALA A 1 125 ? 38.812  48.880  78.407  1.00 59.61  ? 122 ALA A O   1 
ATOM 729   C CB  . ALA A 1 125 ? 40.254  49.542  81.191  1.00 28.02  ? 122 ALA A CB  1 
ATOM 730   N N   . ASP A 1 126 ? 38.419  47.247  79.892  1.00 57.37  ? 123 ASP A N   1 
ATOM 731   C CA  . ASP A 1 126 ? 38.201  46.239  78.854  1.00 43.43  ? 123 ASP A CA  1 
ATOM 732   C C   . ASP A 1 126 ? 36.859  46.455  78.148  1.00 67.31  ? 123 ASP A C   1 
ATOM 733   O O   . ASP A 1 126 ? 36.751  46.267  76.933  1.00 66.07  ? 123 ASP A O   1 
ATOM 734   C CB  . ASP A 1 126 ? 38.265  44.819  79.438  1.00 63.92  ? 123 ASP A CB  1 
ATOM 735   C CG  . ASP A 1 126 ? 39.652  44.451  79.968  1.00 85.50  ? 123 ASP A CG  1 
ATOM 736   O OD1 . ASP A 1 126 ? 40.620  45.170  79.641  1.00 73.48  ? 123 ASP A OD1 1 
ATOM 737   O OD2 . ASP A 1 126 ? 39.774  43.440  80.704  1.00 75.20  ? 123 ASP A OD2 1 
ATOM 738   N N   . ARG A 1 127 ? 35.844  46.861  78.910  1.00 43.92  ? 124 ARG A N   1 
ATOM 739   C CA  . ARG A 1 127 ? 34.535  47.143  78.338  1.00 52.39  ? 124 ARG A CA  1 
ATOM 740   C C   . ARG A 1 127 ? 34.584  48.405  77.484  1.00 53.46  ? 124 ARG A C   1 
ATOM 741   O O   . ARG A 1 127 ? 34.059  48.442  76.382  1.00 45.65  ? 124 ARG A O   1 
ATOM 742   C CB  . ARG A 1 127 ? 33.468  47.256  79.429  1.00 35.75  ? 124 ARG A CB  1 
ATOM 743   C CG  . ARG A 1 127 ? 33.343  45.987  80.279  1.00 43.88  ? 124 ARG A CG  1 
ATOM 744   C CD  . ARG A 1 127 ? 32.010  45.943  81.012  1.00 41.32  ? 124 ARG A CD  1 
ATOM 745   N NE  . ARG A 1 127 ? 31.857  47.050  81.942  1.00 52.99  ? 124 ARG A NE  1 
ATOM 746   C CZ  . ARG A 1 127 ? 31.908  46.924  83.258  1.00 48.00  ? 124 ARG A CZ  1 
ATOM 747   N NH1 . ARG A 1 127 ? 32.104  45.728  83.791  1.00 59.92  ? 124 ARG A NH1 1 
ATOM 748   N NH2 . ARG A 1 127 ? 31.752  47.988  84.036  1.00 39.80  ? 124 ARG A NH2 1 
ATOM 749   N N   . ALA A 1 128 ? 35.225  49.439  77.998  1.00 46.29  ? 125 ALA A N   1 
ATOM 750   C CA  . ALA A 1 128 ? 35.350  50.674  77.262  1.00 49.43  ? 125 ALA A CA  1 
ATOM 751   C C   . ALA A 1 128 ? 36.040  50.417  75.921  1.00 53.46  ? 125 ALA A C   1 
ATOM 752   O O   . ALA A 1 128 ? 35.665  50.990  74.905  1.00 63.17  ? 125 ALA A O   1 
ATOM 753   C CB  . ALA A 1 128 ? 36.116  51.692  78.074  1.00 30.96  ? 125 ALA A CB  1 
ATOM 754   N N   . GLN A 1 129 ? 37.036  49.540  75.923  1.00 47.27  ? 126 GLN A N   1 
ATOM 755   C CA  . GLN A 1 129 ? 37.828  49.262  74.725  1.00 62.08  ? 126 GLN A CA  1 
ATOM 756   C C   . GLN A 1 129 ? 36.981  48.808  73.537  1.00 47.08  ? 126 GLN A C   1 
ATOM 757   O O   . GLN A 1 129 ? 37.250  49.184  72.411  1.00 47.11  ? 126 GLN A O   1 
ATOM 758   C CB  . GLN A 1 129 ? 38.926  48.238  75.019  1.00 51.00  ? 126 GLN A CB  1 
ATOM 759   C CG  . GLN A 1 129 ? 40.182  48.448  74.203  1.00 66.64  ? 126 GLN A CG  1 
ATOM 760   C CD  . GLN A 1 129 ? 40.647  49.890  74.253  1.00 105.21 ? 126 GLN A CD  1 
ATOM 761   O OE1 . GLN A 1 129 ? 40.773  50.475  75.329  1.00 99.89  ? 126 GLN A OE1 1 
ATOM 762   N NE2 . GLN A 1 129 ? 40.886  50.479  73.083  1.00 103.38 ? 126 GLN A NE2 1 
ATOM 763   N N   . ILE A 1 130 ? 35.956  48.007  73.802  1.00 43.69  ? 127 ILE A N   1 
ATOM 764   C CA  . ILE A 1 130 ? 35.009  47.567  72.780  1.00 39.37  ? 127 ILE A CA  1 
ATOM 765   C C   . ILE A 1 130 ? 34.280  48.750  72.115  1.00 53.94  ? 127 ILE A C   1 
ATOM 766   O O   . ILE A 1 130 ? 34.183  48.832  70.890  1.00 55.20  ? 127 ILE A O   1 
ATOM 767   C CB  . ILE A 1 130 ? 34.008  46.568  73.397  1.00 53.27  ? 127 ILE A CB  1 
ATOM 768   C CG1 . ILE A 1 130 ? 34.776  45.362  73.949  1.00 38.52  ? 127 ILE A CG1 1 
ATOM 769   C CG2 . ILE A 1 130 ? 32.911  46.170  72.410  1.00 38.03  ? 127 ILE A CG2 1 
ATOM 770   C CD1 . ILE A 1 130 ? 33.915  44.360  74.678  1.00 41.47  ? 127 ILE A CD1 1 
ATOM 771   N N   . PHE A 1 131 ? 33.791  49.674  72.930  1.00 39.81  ? 128 PHE A N   1 
ATOM 772   C CA  . PHE A 1 131 ? 33.087  50.847  72.432  1.00 49.42  ? 128 PHE A CA  1 
ATOM 773   C C   . PHE A 1 131 ? 34.021  51.841  71.743  1.00 52.72  ? 128 PHE A C   1 
ATOM 774   O O   . PHE A 1 131 ? 33.612  52.568  70.843  1.00 58.71  ? 128 PHE A O   1 
ATOM 775   C CB  . PHE A 1 131 ? 32.256  51.501  73.561  1.00 28.41  ? 128 PHE A CB  1 
ATOM 776   C CG  . PHE A 1 131 ? 31.154  50.610  74.071  1.00 40.02  ? 128 PHE A CG  1 
ATOM 777   C CD1 . PHE A 1 131 ? 31.411  49.667  75.048  1.00 46.50  ? 128 PHE A CD1 1 
ATOM 778   C CD2 . PHE A 1 131 ? 29.886  50.673  73.537  1.00 38.76  ? 128 PHE A CD2 1 
ATOM 779   C CE1 . PHE A 1 131 ? 30.423  48.834  75.499  1.00 55.35  ? 128 PHE A CE1 1 
ATOM 780   C CE2 . PHE A 1 131 ? 28.891  49.828  73.989  1.00 36.63  ? 128 PHE A CE2 1 
ATOM 781   C CZ  . PHE A 1 131 ? 29.156  48.916  74.964  1.00 44.43  ? 128 PHE A CZ  1 
ATOM 782   N N   . LEU A 1 132 ? 35.282  51.863  72.147  1.00 40.79  ? 129 LEU A N   1 
ATOM 783   C CA  . LEU A 1 132 ? 36.237  52.735  71.484  1.00 52.30  ? 129 LEU A CA  1 
ATOM 784   C C   . LEU A 1 132 ? 36.536  52.213  70.087  1.00 50.20  ? 129 LEU A C   1 
ATOM 785   O O   . LEU A 1 132 ? 36.658  52.994  69.140  1.00 46.73  ? 129 LEU A O   1 
ATOM 786   C CB  . LEU A 1 132 ? 37.520  52.905  72.311  1.00 36.89  ? 129 LEU A CB  1 
ATOM 787   C CG  . LEU A 1 132 ? 37.311  53.748  73.578  1.00 43.57  ? 129 LEU A CG  1 
ATOM 788   C CD1 . LEU A 1 132 ? 38.557  53.803  74.430  1.00 45.43  ? 129 LEU A CD1 1 
ATOM 789   C CD2 . LEU A 1 132 ? 36.888  55.152  73.216  1.00 43.40  ? 129 LEU A CD2 1 
ATOM 790   N N   . LYS A 1 133 ? 36.643  50.892  69.969  1.00 53.20  ? 130 LYS A N   1 
ATOM 791   C CA  . LYS A 1 133 ? 36.893  50.240  68.681  1.00 57.55  ? 130 LYS A CA  1 
ATOM 792   C C   . LYS A 1 133 ? 35.680  50.370  67.778  1.00 55.99  ? 130 LYS A C   1 
ATOM 793   O O   . LYS A 1 133 ? 35.820  50.594  66.590  1.00 68.60  ? 130 LYS A O   1 
ATOM 794   C CB  . LYS A 1 133 ? 37.289  48.764  68.845  1.00 49.75  ? 130 LYS A CB  1 
ATOM 795   N N   . ALA A 1 134 ? 34.484  50.246  68.338  1.00 56.17  ? 131 ALA A N   1 
ATOM 796   C CA  . ALA A 1 134 ? 33.290  50.400  67.529  1.00 31.46  ? 131 ALA A CA  1 
ATOM 797   C C   . ALA A 1 134 ? 33.188  51.844  67.019  1.00 53.37  ? 131 ALA A C   1 
ATOM 798   O O   . ALA A 1 134 ? 32.788  52.078  65.872  1.00 47.10  ? 131 ALA A O   1 
ATOM 799   C CB  . ALA A 1 134 ? 32.064  50.001  68.291  1.00 35.28  ? 131 ALA A CB  1 
ATOM 800   N N   . ALA A 1 135 ? 33.566  52.806  67.860  1.00 40.63  ? 132 ALA A N   1 
ATOM 801   C CA  . ALA A 1 135 ? 33.572  54.216  67.465  1.00 46.31  ? 132 ALA A CA  1 
ATOM 802   C C   . ALA A 1 135 ? 34.520  54.454  66.296  1.00 51.31  ? 132 ALA A C   1 
ATOM 803   O O   . ALA A 1 135 ? 34.205  55.189  65.365  1.00 70.73  ? 132 ALA A O   1 
ATOM 804   C CB  . ALA A 1 135 ? 33.954  55.106  68.635  1.00 42.53  ? 132 ALA A CB  1 
ATOM 805   N N   . ASP A 1 136 ? 35.689  53.826  66.351  1.00 62.17  ? 133 ASP A N   1 
ATOM 806   C CA  . ASP A 1 136 ? 36.672  53.945  65.279  1.00 60.40  ? 133 ASP A CA  1 
ATOM 807   C C   . ASP A 1 136 ? 36.216  53.271  63.986  1.00 62.89  ? 133 ASP A C   1 
ATOM 808   O O   . ASP A 1 136 ? 36.483  53.782  62.909  1.00 52.49  ? 133 ASP A O   1 
ATOM 809   C CB  . ASP A 1 136 ? 38.031  53.393  65.707  1.00 60.40  ? 133 ASP A CB  1 
ATOM 810   C CG  . ASP A 1 136 ? 38.782  54.325  66.660  1.00 80.99  ? 133 ASP A CG  1 
ATOM 811   O OD1 . ASP A 1 136 ? 38.336  55.476  66.858  1.00 82.64  ? 133 ASP A OD1 1 
ATOM 812   O OD2 . ASP A 1 136 ? 39.832  53.902  67.196  1.00 58.16  ? 133 ASP A OD2 1 
ATOM 813   N N   . MET A 1 137 ? 35.535  52.132  64.099  1.00 58.75  ? 134 MET A N   1 
ATOM 814   C CA  . MET A 1 137 ? 34.918  51.492  62.943  1.00 39.28  ? 134 MET A CA  1 
ATOM 815   C C   . MET A 1 137 ? 33.878  52.415  62.295  1.00 49.70  ? 134 MET A C   1 
ATOM 816   O O   . MET A 1 137 ? 33.864  52.596  61.078  1.00 56.37  ? 134 MET A O   1 
ATOM 817   C CB  . MET A 1 137 ? 34.294  50.135  63.324  1.00 45.81  ? 134 MET A CB  1 
ATOM 818   C CG  . MET A 1 137 ? 35.304  49.025  63.639  1.00 44.78  ? 134 MET A CG  1 
ATOM 819   S SD  . MET A 1 137 ? 34.619  47.573  64.483  1.00 44.04  ? 134 MET A SD  1 
ATOM 820   C CE  . MET A 1 137 ? 33.619  46.887  63.186  1.00 58.84  ? 134 MET A CE  1 
ATOM 821   N N   . LEU A 1 138 ? 33.014  53.008  63.109  1.00 62.78  ? 135 LEU A N   1 
ATOM 822   C CA  . LEU A 1 138 ? 32.008  53.937  62.601  1.00 49.02  ? 135 LEU A CA  1 
ATOM 823   C C   . LEU A 1 138 ? 32.623  55.188  61.990  1.00 58.42  ? 135 LEU A C   1 
ATOM 824   O O   . LEU A 1 138 ? 32.091  55.749  61.037  1.00 48.76  ? 135 LEU A O   1 
ATOM 825   C CB  . LEU A 1 138 ? 31.058  54.350  63.714  1.00 41.42  ? 135 LEU A CB  1 
ATOM 826   C CG  . LEU A 1 138 ? 30.098  53.274  64.192  1.00 47.58  ? 135 LEU A CG  1 
ATOM 827   C CD1 . LEU A 1 138 ? 29.468  53.706  65.496  1.00 49.26  ? 135 LEU A CD1 1 
ATOM 828   C CD2 . LEU A 1 138 ? 29.044  53.049  63.131  1.00 41.38  ? 135 LEU A CD2 1 
ATOM 829   N N   . SER A 1 139 ? 33.733  55.634  62.558  1.00 56.27  ? 136 SER A N   1 
ATOM 830   C CA  . SER A 1 139 ? 34.376  56.858  62.119  1.00 41.06  ? 136 SER A CA  1 
ATOM 831   C C   . SER A 1 139 ? 34.979  56.745  60.714  1.00 57.13  ? 136 SER A C   1 
ATOM 832   O O   . SER A 1 139 ? 34.949  57.692  59.936  1.00 49.17  ? 136 SER A O   1 
ATOM 833   C CB  . SER A 1 139 ? 35.483  57.232  63.096  1.00 44.84  ? 136 SER A CB  1 
ATOM 834   O OG  . SER A 1 139 ? 36.157  58.388  62.637  1.00 45.55  ? 136 SER A OG  1 
ATOM 835   N N   . GLY A 1 140 ? 35.541  55.584  60.405  1.00 48.36  ? 137 GLY A N   1 
ATOM 836   C CA  . GLY A 1 140 ? 36.229  55.376  59.144  1.00 51.63  ? 137 GLY A CA  1 
ATOM 837   C C   . GLY A 1 140 ? 35.481  54.445  58.208  1.00 54.51  ? 137 GLY A C   1 
ATOM 838   O O   . GLY A 1 140 ? 34.553  54.877  57.527  1.00 62.01  ? 137 GLY A O   1 
ATOM 839   N N   . PRO A 1 141 ? 35.858  53.154  58.207  1.00 44.39  ? 138 PRO A N   1 
ATOM 840   C CA  . PRO A 1 141 ? 35.425  52.087  57.286  1.00 40.60  ? 138 PRO A CA  1 
ATOM 841   C C   . PRO A 1 141 ? 33.910  51.921  57.177  1.00 69.82  ? 138 PRO A C   1 
ATOM 842   O O   . PRO A 1 141 ? 33.404  51.662  56.081  1.00 59.35  ? 138 PRO A O   1 
ATOM 843   C CB  . PRO A 1 141 ? 36.020  50.811  57.890  1.00 39.31  ? 138 PRO A CB  1 
ATOM 844   C CG  . PRO A 1 141 ? 36.993  51.249  58.925  1.00 34.61  ? 138 PRO A CG  1 
ATOM 845   C CD  . PRO A 1 141 ? 36.727  52.658  59.291  1.00 48.25  ? 138 PRO A CD  1 
ATOM 846   N N   . ARG A 1 142 ? 33.191  52.052  58.290  1.00 64.99  ? 139 ARG A N   1 
ATOM 847   C CA  . ARG A 1 142 ? 31.755  51.784  58.269  1.00 40.61  ? 139 ARG A CA  1 
ATOM 848   C C   . ARG A 1 142 ? 30.924  53.055  58.143  1.00 44.35  ? 139 ARG A C   1 
ATOM 849   O O   . ARG A 1 142 ? 29.697  52.978  58.048  1.00 52.30  ? 139 ARG A O   1 
ATOM 850   C CB  . ARG A 1 142 ? 31.341  50.958  59.492  1.00 58.64  ? 139 ARG A CB  1 
ATOM 851   C CG  . ARG A 1 142 ? 32.267  49.784  59.788  1.00 54.27  ? 139 ARG A CG  1 
ATOM 852   C CD  . ARG A 1 142 ? 32.226  48.676  58.727  1.00 55.93  ? 139 ARG A CD  1 
ATOM 853   N NE  . ARG A 1 142 ? 31.054  47.843  58.896  1.00 61.79  ? 139 ARG A NE  1 
ATOM 854   C CZ  . ARG A 1 142 ? 30.950  46.683  59.547  1.00 66.26  ? 139 ARG A CZ  1 
ATOM 855   N NH1 . ARG A 1 142 ? 29.759  46.117  59.603  1.00 71.03  ? 139 ARG A NH1 1 
ATOM 856   N NH2 . ARG A 1 142 ? 31.974  46.081  60.131  1.00 77.60  ? 139 ARG A NH2 1 
ATOM 857   N N   . ARG A 1 143 ? 31.589  54.218  58.110  1.00 32.77  ? 140 ARG A N   1 
ATOM 858   C CA  . ARG A 1 143 ? 30.874  55.485  58.112  1.00 47.92  ? 140 ARG A CA  1 
ATOM 859   C C   . ARG A 1 143 ? 29.881  55.525  56.964  1.00 48.15  ? 140 ARG A C   1 
ATOM 860   O O   . ARG A 1 143 ? 28.680  55.675  57.180  1.00 56.82  ? 140 ARG A O   1 
ATOM 861   C CB  . ARG A 1 143 ? 31.809  56.714  58.052  1.00 31.16  ? 140 ARG A CB  1 
ATOM 862   C CG  . ARG A 1 143 ? 31.085  58.055  58.463  1.00 44.49  ? 140 ARG A CG  1 
ATOM 863   C CD  . ARG A 1 143 ? 31.757  59.386  58.095  1.00 46.49  ? 140 ARG A CD  1 
ATOM 864   N NE  . ARG A 1 143 ? 32.541  59.775  59.201  1.00 64.39  ? 140 ARG A NE  1 
ATOM 865   C CZ  . ARG A 1 143 ? 32.461  60.702  60.141  1.00 63.42  ? 140 ARG A CZ  1 
ATOM 866   N NH1 . ARG A 1 143 ? 31.631  61.736  60.276  1.00 49.18  ? 140 ARG A NH1 1 
ATOM 867   N NH2 . ARG A 1 143 ? 33.404  60.501  61.006  1.00 74.16  ? 140 ARG A NH2 1 
ATOM 868   N N   . ALA A 1 144 ? 30.373  55.388  55.743  1.00 49.60  ? 141 ALA A N   1 
ATOM 869   C CA  . ALA A 1 144 ? 29.493  55.553  54.587  1.00 71.70  ? 141 ALA A CA  1 
ATOM 870   C C   . ALA A 1 144 ? 28.333  54.561  54.633  1.00 44.96  ? 141 ALA A C   1 
ATOM 871   O O   . ALA A 1 144 ? 27.201  54.908  54.331  1.00 46.88  ? 141 ALA A O   1 
ATOM 872   C CB  . ALA A 1 144 ? 30.252  55.448  53.292  1.00 37.31  ? 141 ALA A CB  1 
ATOM 873   N N   . GLU A 1 145 ? 28.613  53.329  55.026  1.00 42.28  ? 142 GLU A N   1 
ATOM 874   C CA  . GLU A 1 145 ? 27.565  52.321  55.152  1.00 46.71  ? 142 GLU A CA  1 
ATOM 875   C C   . GLU A 1 145 ? 26.472  52.744  56.156  1.00 72.92  ? 142 GLU A C   1 
ATOM 876   O O   . GLU A 1 145 ? 25.275  52.687  55.854  1.00 47.18  ? 142 GLU A O   1 
ATOM 877   C CB  . GLU A 1 145 ? 28.147  50.971  55.586  1.00 42.10  ? 142 GLU A CB  1 
ATOM 878   C CG  . GLU A 1 145 ? 27.105  50.073  56.232  1.00 56.42  ? 142 GLU A CG  1 
ATOM 879   C CD  . GLU A 1 145 ? 27.692  48.876  56.951  1.00 68.76  ? 142 GLU A CD  1 
ATOM 880   O OE1 . GLU A 1 145 ? 28.936  48.711  56.945  1.00 62.75  ? 142 GLU A OE1 1 
ATOM 881   O OE2 . GLU A 1 145 ? 26.889  48.100  57.527  1.00 49.64  ? 142 GLU A OE2 1 
ATOM 882   N N   . ILE A 1 146 ? 26.885  53.167  57.351  1.00 48.91  ? 143 ILE A N   1 
ATOM 883   C CA  . ILE A 1 146 ? 25.930  53.581  58.374  1.00 44.23  ? 143 ILE A CA  1 
ATOM 884   C C   . ILE A 1 146 ? 25.137  54.864  57.994  1.00 61.94  ? 143 ILE A C   1 
ATOM 885   O O   . ILE A 1 146 ? 23.938  54.945  58.262  1.00 41.37  ? 143 ILE A O   1 
ATOM 886   C CB  . ILE A 1 146 ? 26.613  53.665  59.761  1.00 46.26  ? 143 ILE A CB  1 
ATOM 887   C CG1 . ILE A 1 146 ? 25.735  53.017  60.833  1.00 38.25  ? 143 ILE A CG1 1 
ATOM 888   C CG2 . ILE A 1 146 ? 26.996  55.096  60.111  1.00 34.83  ? 143 ILE A CG2 1 
ATOM 889   C CD1 . ILE A 1 146 ? 24.555  53.859  61.213  1.00 72.86  ? 143 ILE A CD1 1 
ATOM 890   N N   . LEU A 1 147 ? 25.801  55.838  57.362  1.00 32.97  ? 144 LEU A N   1 
ATOM 891   C CA  . LEU A 1 147 ? 25.140  56.999  56.779  1.00 33.51  ? 144 LEU A CA  1 
ATOM 892   C C   . LEU A 1 147 ? 24.094  56.566  55.748  1.00 58.55  ? 144 LEU A C   1 
ATOM 893   O O   . LEU A 1 147 ? 22.936  57.009  55.773  1.00 43.40  ? 144 LEU A O   1 
ATOM 894   C CB  . LEU A 1 147 ? 26.168  57.931  56.119  1.00 42.11  ? 144 LEU A CB  1 
ATOM 895   C CG  . LEU A 1 147 ? 26.644  59.176  56.876  1.00 56.81  ? 144 LEU A CG  1 
ATOM 896   C CD1 . LEU A 1 147 ? 26.558  58.986  58.378  1.00 49.99  ? 144 LEU A CD1 1 
ATOM 897   C CD2 . LEU A 1 147 ? 28.060  59.530  56.473  1.00 39.67  ? 144 LEU A CD2 1 
ATOM 898   N N   . ALA A 1 148 ? 24.504  55.682  54.848  1.00 51.75  ? 145 ALA A N   1 
ATOM 899   C CA  . ALA A 1 148 ? 23.638  55.258  53.756  1.00 48.13  ? 145 ALA A CA  1 
ATOM 900   C C   . ALA A 1 148 ? 22.380  54.540  54.241  1.00 33.95  ? 145 ALA A C   1 
ATOM 901   O O   . ALA A 1 148 ? 21.292  54.767  53.711  1.00 46.23  ? 145 ALA A O   1 
ATOM 902   C CB  . ALA A 1 148 ? 24.408  54.389  52.754  1.00 40.74  ? 145 ALA A CB  1 
ATOM 903   N N   . LYS A 1 149 ? 22.523  53.669  55.237  1.00 46.42  ? 146 LYS A N   1 
ATOM 904   C CA  . LYS A 1 149 ? 21.378  52.931  55.778  1.00 50.80  ? 146 LYS A CA  1 
ATOM 905   C C   . LYS A 1 149 ? 20.406  53.815  56.567  1.00 39.94  ? 146 LYS A C   1 
ATOM 906   O O   . LYS A 1 149 ? 19.222  53.522  56.655  1.00 41.24  ? 146 LYS A O   1 
ATOM 907   C CB  . LYS A 1 149 ? 21.841  51.772  56.650  1.00 46.26  ? 146 LYS A CB  1 
ATOM 908   C CG  . LYS A 1 149 ? 22.473  50.655  55.877  1.00 47.44  ? 146 LYS A CG  1 
ATOM 909   C CD  . LYS A 1 149 ? 23.069  49.631  56.815  1.00 48.98  ? 146 LYS A CD  1 
ATOM 910   C CE  . LYS A 1 149 ? 23.608  48.439  56.034  1.00 56.57  ? 146 LYS A CE  1 
ATOM 911   N NZ  . LYS A 1 149 ? 24.260  47.428  56.918  1.00 61.88  ? 146 LYS A NZ  1 
ATOM 912   N N   . THR A 1 150 ? 20.930  54.894  57.136  1.00 55.93  ? 147 THR A N   1 
ATOM 913   C CA  . THR A 1 150 ? 20.123  55.871  57.845  1.00 36.64  ? 147 THR A CA  1 
ATOM 914   C C   . THR A 1 150 ? 19.384  56.741  56.828  1.00 52.04  ? 147 THR A C   1 
ATOM 915   O O   . THR A 1 150 ? 18.201  57.002  56.989  1.00 43.26  ? 147 THR A O   1 
ATOM 916   C CB  . THR A 1 150 ? 20.999  56.739  58.784  1.00 49.64  ? 147 THR A CB  1 
ATOM 917   O OG1 . THR A 1 150 ? 21.754  55.885  59.652  1.00 48.60  ? 147 THR A OG1 1 
ATOM 918   C CG2 . THR A 1 150 ? 20.151  57.657  59.629  1.00 30.80  ? 147 THR A CG2 1 
ATOM 919   N N   . MET A 1 151 ? 20.077  57.175  55.772  1.00 37.83  ? 148 MET A N   1 
ATOM 920   C CA  . MET A 1 151 ? 19.428  57.939  54.708  1.00 35.38  ? 148 MET A CA  1 
ATOM 921   C C   . MET A 1 151 ? 18.282  57.135  54.081  1.00 47.43  ? 148 MET A C   1 
ATOM 922   O O   . MET A 1 151 ? 17.147  57.600  53.988  1.00 42.09  ? 148 MET A O   1 
ATOM 923   C CB  . MET A 1 151 ? 20.442  58.370  53.650  1.00 37.17  ? 148 MET A CB  1 
ATOM 924   C CG  . MET A 1 151 ? 21.547  59.219  54.187  1.00 48.08  ? 148 MET A CG  1 
ATOM 925   S SD  . MET A 1 151 ? 22.673  59.720  52.926  1.00 25.48  ? 148 MET A SD  1 
ATOM 926   C CE  . MET A 1 151 ? 21.526  60.516  51.833  1.00 30.66  ? 148 MET A CE  1 
ATOM 927   N N   . VAL A 1 152 ? 18.575  55.903  53.698  1.00 26.74  ? 149 VAL A N   1 
ATOM 928   C CA  . VAL A 1 152 ? 17.629  55.088  52.964  1.00 45.98  ? 149 VAL A CA  1 
ATOM 929   C C   . VAL A 1 152 ? 16.513  54.537  53.834  1.00 41.37  ? 149 VAL A C   1 
ATOM 930   O O   . VAL A 1 152 ? 15.374  54.478  53.399  1.00 47.49  ? 149 VAL A O   1 
ATOM 931   C CB  . VAL A 1 152 ? 18.344  53.922  52.244  1.00 58.26  ? 149 VAL A CB  1 
ATOM 932   C CG1 . VAL A 1 152 ? 17.367  52.862  51.871  1.00 51.68  ? 149 VAL A CG1 1 
ATOM 933   C CG2 . VAL A 1 152 ? 19.035  54.418  51.015  1.00 30.39  ? 149 VAL A CG2 1 
ATOM 934   N N   . GLY A 1 153 ? 16.834  54.107  55.053  1.00 43.12  ? 150 GLY A N   1 
ATOM 935   C CA  . GLY A 1 153 ? 15.832  53.508  55.925  1.00 32.55  ? 150 GLY A CA  1 
ATOM 936   C C   . GLY A 1 153 ? 14.958  54.473  56.739  1.00 44.88  ? 150 GLY A C   1 
ATOM 937   O O   . GLY A 1 153 ? 13.806  54.170  57.028  1.00 39.64  ? 150 GLY A O   1 
ATOM 938   N N   . GLN A 1 154 ? 15.510  55.623  57.118  1.00 35.59  ? 151 GLN A N   1 
ATOM 939   C CA  . GLN A 1 154 ? 14.783  56.627  57.908  1.00 49.84  ? 151 GLN A CA  1 
ATOM 940   C C   . GLN A 1 154 ? 14.436  57.929  57.163  1.00 52.15  ? 151 GLN A C   1 
ATOM 941   O O   . GLN A 1 154 ? 13.614  58.698  57.636  1.00 51.40  ? 151 GLN A O   1 
ATOM 942   C CB  . GLN A 1 154 ? 15.564  56.942  59.180  1.00 30.82  ? 151 GLN A CB  1 
ATOM 943   C CG  . GLN A 1 154 ? 15.589  55.789  60.181  1.00 29.67  ? 151 GLN A CG  1 
ATOM 944   C CD  . GLN A 1 154 ? 16.970  55.531  60.743  1.00 34.52  ? 151 GLN A CD  1 
ATOM 945   O OE1 . GLN A 1 154 ? 17.739  54.744  60.196  1.00 50.66  ? 151 GLN A OE1 1 
ATOM 946   N NE2 . GLN A 1 154 ? 17.296  56.210  61.837  1.00 35.39  ? 151 GLN A NE2 1 
ATOM 947   N N   . GLY A 1 155 ? 15.064  58.169  56.011  1.00 41.63  ? 152 GLY A N   1 
ATOM 948   C CA  . GLY A 1 155 ? 14.712  59.297  55.173  1.00 43.74  ? 152 GLY A CA  1 
ATOM 949   C C   . GLY A 1 155 ? 15.508  60.547  55.469  1.00 35.64  ? 152 GLY A C   1 
ATOM 950   O O   . GLY A 1 155 ? 15.041  61.659  55.219  1.00 53.08  ? 152 GLY A O   1 
ATOM 951   N N   . LYS A 1 156 ? 16.711  60.364  56.003  1.00 44.83  ? 153 LYS A N   1 
ATOM 952   C CA  . LYS A 1 156 ? 17.553  61.480  56.421  1.00 52.08  ? 153 LYS A CA  1 
ATOM 953   C C   . LYS A 1 156 ? 18.369  61.984  55.237  1.00 50.62  ? 153 LYS A C   1 
ATOM 954   O O   . LYS A 1 156 ? 18.775  61.203  54.395  1.00 45.13  ? 153 LYS A O   1 
ATOM 955   C CB  . LYS A 1 156 ? 18.463  61.052  57.588  1.00 38.53  ? 153 LYS A CB  1 
ATOM 956   C CG  . LYS A 1 156 ? 17.778  61.111  58.965  1.00 54.70  ? 153 LYS A CG  1 
ATOM 957   C CD  . LYS A 1 156 ? 18.744  60.818  60.101  1.00 33.14  ? 153 LYS A CD  1 
ATOM 958   C CE  . LYS A 1 156 ? 18.144  61.144  61.498  1.00 46.25  ? 153 LYS A CE  1 
ATOM 959   N NZ  . LYS A 1 156 ? 18.878  62.283  62.152  1.00 66.06  ? 153 LYS A NZ  1 
ATOM 960   N N   . THR A 1 157 ? 18.592  63.287  55.159  1.00 44.91  ? 154 THR A N   1 
ATOM 961   C CA  . THR A 1 157 ? 19.542  63.822  54.195  1.00 22.31  ? 154 THR A CA  1 
ATOM 962   C C   . THR A 1 157 ? 20.978  63.545  54.633  1.00 56.12  ? 154 THR A C   1 
ATOM 963   O O   . THR A 1 157 ? 21.233  63.145  55.777  1.00 49.94  ? 154 THR A O   1 
ATOM 964   C CB  . THR A 1 157 ? 19.365  65.347  53.979  1.00 58.81  ? 154 THR A CB  1 
ATOM 965   O OG1 . THR A 1 157 ? 19.615  66.064  55.203  1.00 41.60  ? 154 THR A OG1 1 
ATOM 966   C CG2 . THR A 1 157 ? 17.964  65.644  53.485  1.00 24.87  ? 154 THR A CG2 1 
ATOM 967   N N   . VAL A 1 158 ? 21.914  63.783  53.723  1.00 44.24  ? 155 VAL A N   1 
ATOM 968   C CA  . VAL A 1 158 ? 23.318  63.525  53.991  1.00 46.56  ? 155 VAL A CA  1 
ATOM 969   C C   . VAL A 1 158 ? 23.745  64.104  55.335  1.00 51.50  ? 155 VAL A C   1 
ATOM 970   O O   . VAL A 1 158 ? 24.277  63.390  56.158  1.00 43.04  ? 155 VAL A O   1 
ATOM 971   C CB  . VAL A 1 158 ? 24.220  64.110  52.884  1.00 52.77  ? 155 VAL A CB  1 
ATOM 972   C CG1 . VAL A 1 158 ? 25.683  64.038  53.291  1.00 42.30  ? 155 VAL A CG1 1 
ATOM 973   C CG2 . VAL A 1 158 ? 23.973  63.404  51.560  1.00 57.23  ? 155 VAL A CG2 1 
ATOM 974   N N   . ILE A 1 159 ? 23.499  65.392  55.557  1.00 33.45  ? 156 ILE A N   1 
ATOM 975   C CA  . ILE A 1 159 ? 24.021  66.078  56.734  1.00 43.00  ? 156 ILE A CA  1 
ATOM 976   C C   . ILE A 1 159 ? 23.320  65.656  58.029  1.00 55.96  ? 156 ILE A C   1 
ATOM 977   O O   . ILE A 1 159 ? 23.946  65.620  59.079  1.00 52.54  ? 156 ILE A O   1 
ATOM 978   C CB  . ILE A 1 159 ? 24.027  67.623  56.588  1.00 45.51  ? 156 ILE A CB  1 
ATOM 979   C CG1 . ILE A 1 159 ? 24.797  68.257  57.753  1.00 54.80  ? 156 ILE A CG1 1 
ATOM 980   C CG2 . ILE A 1 159 ? 22.603  68.176  56.488  1.00 31.42  ? 156 ILE A CG2 1 
ATOM 981   C CD1 . ILE A 1 159 ? 26.212  67.771  57.893  1.00 51.48  ? 156 ILE A CD1 1 
ATOM 982   N N   . GLN A 1 160 ? 22.038  65.318  57.950  1.00 45.81  ? 157 GLN A N   1 
ATOM 983   C CA  . GLN A 1 160 ? 21.330  64.797  59.118  1.00 39.89  ? 157 GLN A CA  1 
ATOM 984   C C   . GLN A 1 160 ? 21.821  63.412  59.516  1.00 45.69  ? 157 GLN A C   1 
ATOM 985   O O   . GLN A 1 160 ? 21.868  63.082  60.694  1.00 54.57  ? 157 GLN A O   1 
ATOM 986   C CB  . GLN A 1 160 ? 19.825  64.739  58.893  1.00 23.57  ? 157 GLN A CB  1 
ATOM 987   C CG  . GLN A 1 160 ? 19.116  66.071  58.915  1.00 49.39  ? 157 GLN A CG  1 
ATOM 988   C CD  . GLN A 1 160 ? 19.528  66.925  60.074  1.00 32.84  ? 157 GLN A CD  1 
ATOM 989   O OE1 . GLN A 1 160 ? 19.261  66.596  61.229  1.00 58.85  ? 157 GLN A OE1 1 
ATOM 990   N NE2 . GLN A 1 160 ? 20.221  68.013  59.784  1.00 43.35  ? 157 GLN A NE2 1 
ATOM 991   N N   . ALA A 1 161 ? 22.171  62.600  58.531  1.00 38.33  ? 158 ALA A N   1 
ATOM 992   C CA  . ALA A 1 161 ? 22.669  61.263  58.812  1.00 47.30  ? 158 ALA A CA  1 
ATOM 993   C C   . ALA A 1 161 ? 24.057  61.386  59.386  1.00 47.77  ? 158 ALA A C   1 
ATOM 994   O O   . ALA A 1 161 ? 24.450  60.611  60.225  1.00 41.27  ? 158 ALA A O   1 
ATOM 995   C CB  . ALA A 1 161 ? 22.701  60.394  57.528  1.00 31.43  ? 158 ALA A CB  1 
ATOM 996   N N   . GLU A 1 162 ? 24.804  62.372  58.910  1.00 40.81  ? 159 GLU A N   1 
ATOM 997   C CA  . GLU A 1 162 ? 26.181  62.556  59.331  1.00 47.88  ? 159 GLU A CA  1 
ATOM 998   C C   . GLU A 1 162 ? 26.306  63.028  60.789  1.00 50.46  ? 159 GLU A C   1 
ATOM 999   O O   . GLU A 1 162 ? 27.169  62.538  61.511  1.00 56.19  ? 159 GLU A O   1 
ATOM 1000  C CB  . GLU A 1 162 ? 26.920  63.509  58.376  1.00 33.12  ? 159 GLU A CB  1 
ATOM 1001  C CG  . GLU A 1 162 ? 28.133  64.219  58.975  1.00 66.96  ? 159 GLU A CG  1 
ATOM 1002  C CD  . GLU A 1 162 ? 29.390  63.357  59.005  1.00 71.36  ? 159 GLU A CD  1 
ATOM 1003  O OE1 . GLU A 1 162 ? 29.299  62.142  58.731  1.00 59.28  ? 159 GLU A OE1 1 
ATOM 1004  O OE2 . GLU A 1 162 ? 30.477  63.904  59.291  1.00 52.52  ? 159 GLU A OE2 1 
ATOM 1005  N N   . ILE A 1 163 ? 25.458  63.964  61.216  1.00 34.56  ? 160 ILE A N   1 
ATOM 1006  C CA  . ILE A 1 163 ? 25.521  64.471  62.583  1.00 52.67  ? 160 ILE A CA  1 
ATOM 1007  C C   . ILE A 1 163 ? 24.929  63.475  63.569  1.00 50.10  ? 160 ILE A C   1 
ATOM 1008  O O   . ILE A 1 163 ? 25.212  63.528  64.762  1.00 67.14  ? 160 ILE A O   1 
ATOM 1009  C CB  . ILE A 1 163 ? 24.818  65.837  62.744  1.00 48.32  ? 160 ILE A CB  1 
ATOM 1010  C CG1 . ILE A 1 163 ? 23.300  65.681  62.714  1.00 48.69  ? 160 ILE A CG1 1 
ATOM 1011  C CG2 . ILE A 1 163 ? 25.298  66.819  61.684  1.00 35.27  ? 160 ILE A CG2 1 
ATOM 1012  C CD1 . ILE A 1 163 ? 22.572  67.003  62.835  1.00 49.34  ? 160 ILE A CD1 1 
ATOM 1013  N N   . ASP A 1 164 ? 24.115  62.563  63.052  1.00 37.32  ? 161 ASP A N   1 
ATOM 1014  C CA  . ASP A 1 164 ? 23.458  61.544  63.859  1.00 32.24  ? 161 ASP A CA  1 
ATOM 1015  C C   . ASP A 1 164 ? 24.202  60.208  63.865  1.00 37.27  ? 161 ASP A C   1 
ATOM 1016  O O   . ASP A 1 164 ? 24.883  59.862  64.827  1.00 51.23  ? 161 ASP A O   1 
ATOM 1017  C CB  . ASP A 1 164 ? 22.024  61.366  63.368  1.00 34.19  ? 161 ASP A CB  1 
ATOM 1018  C CG  . ASP A 1 164 ? 21.392  60.076  63.833  1.00 63.78  ? 161 ASP A CG  1 
ATOM 1019  O OD1 . ASP A 1 164 ? 21.787  59.555  64.896  1.00 44.57  ? 161 ASP A OD1 1 
ATOM 1020  O OD2 . ASP A 1 164 ? 20.470  59.599  63.141  1.00 44.02  ? 161 ASP A OD2 1 
ATOM 1021  N N   . ALA A 1 165 ? 24.063  59.459  62.788  1.00 48.97  ? 162 ALA A N   1 
ATOM 1022  C CA  . ALA A 1 165 ? 24.561  58.096  62.737  1.00 53.63  ? 162 ALA A CA  1 
ATOM 1023  C C   . ALA A 1 165 ? 26.075  58.004  62.834  1.00 63.52  ? 162 ALA A C   1 
ATOM 1024  O O   . ALA A 1 165 ? 26.616  56.951  63.172  1.00 57.63  ? 162 ALA A O   1 
ATOM 1025  C CB  . ALA A 1 165 ? 24.065  57.397  61.484  1.00 44.77  ? 162 ALA A CB  1 
ATOM 1026  N N   . ALA A 1 166 ? 26.767  59.095  62.539  1.00 54.03  ? 163 ALA A N   1 
ATOM 1027  C CA  . ALA A 1 166 ? 28.211  59.099  62.689  1.00 53.71  ? 163 ALA A CA  1 
ATOM 1028  C C   . ALA A 1 166 ? 28.628  59.889  63.924  1.00 53.15  ? 163 ALA A C   1 
ATOM 1029  O O   . ALA A 1 166 ? 28.981  59.307  64.936  1.00 80.93  ? 163 ALA A O   1 
ATOM 1030  C CB  . ALA A 1 166 ? 28.891  59.638  61.428  1.00 40.57  ? 163 ALA A CB  1 
ATOM 1031  N N   . ALA A 1 167 ? 28.564  61.213  63.849  1.00 32.22  ? 164 ALA A N   1 
ATOM 1032  C CA  . ALA A 1 167 ? 29.137  62.073  64.879  1.00 55.11  ? 164 ALA A CA  1 
ATOM 1033  C C   . ALA A 1 167 ? 28.591  61.852  66.310  1.00 58.45  ? 164 ALA A C   1 
ATOM 1034  O O   . ALA A 1 167 ? 29.366  61.664  67.242  1.00 57.79  ? 164 ALA A O   1 
ATOM 1035  C CB  . ALA A 1 167 ? 29.029  63.531  64.465  1.00 27.62  ? 164 ALA A CB  1 
ATOM 1036  N N   . GLU A 1 168 ? 27.273  61.860  66.477  1.00 31.85  ? 165 GLU A N   1 
ATOM 1037  C CA  . GLU A 1 168 ? 26.663  61.701  67.787  1.00 40.95  ? 165 GLU A CA  1 
ATOM 1038  C C   . GLU A 1 168 ? 26.844  60.289  68.351  1.00 45.00  ? 165 GLU A C   1 
ATOM 1039  O O   . GLU A 1 168 ? 27.183  60.143  69.509  1.00 49.17  ? 165 GLU A O   1 
ATOM 1040  C CB  . GLU A 1 168 ? 25.186  62.084  67.729  1.00 39.44  ? 165 GLU A CB  1 
ATOM 1041  C CG  . GLU A 1 168 ? 24.542  62.267  69.079  1.00 63.45  ? 165 GLU A CG  1 
ATOM 1042  C CD  . GLU A 1 168 ? 23.053  62.557  68.984  1.00 79.92  ? 165 GLU A CD  1 
ATOM 1043  O OE1 . GLU A 1 168 ? 22.400  62.026  68.067  1.00 110.49 ? 165 GLU A OE1 1 
ATOM 1044  O OE2 . GLU A 1 168 ? 22.532  63.318  69.820  1.00 68.76  ? 165 GLU A OE2 1 
ATOM 1045  N N   . LEU A 1 169 ? 26.630  59.263  67.528  1.00 41.10  ? 166 LEU A N   1 
ATOM 1046  C CA  . LEU A 1 169 ? 26.840  57.863  67.930  1.00 44.00  ? 166 LEU A CA  1 
ATOM 1047  C C   . LEU A 1 169 ? 28.294  57.545  68.320  1.00 54.85  ? 166 LEU A C   1 
ATOM 1048  O O   . LEU A 1 169 ? 28.542  56.905  69.339  1.00 50.84  ? 166 LEU A O   1 
ATOM 1049  C CB  . LEU A 1 169 ? 26.399  56.916  66.813  1.00 40.21  ? 166 LEU A CB  1 
ATOM 1050  C CG  . LEU A 1 169 ? 26.571  55.430  67.116  1.00 54.49  ? 166 LEU A CG  1 
ATOM 1051  C CD1 . LEU A 1 169 ? 25.929  55.093  68.458  1.00 54.07  ? 166 LEU A CD1 1 
ATOM 1052  C CD2 . LEU A 1 169 ? 25.990  54.585  65.993  1.00 51.22  ? 166 LEU A CD2 1 
ATOM 1053  N N   . ILE A 1 170 ? 29.238  57.961  67.479  1.00 38.93  ? 167 ILE A N   1 
ATOM 1054  C CA  . ILE A 1 170 ? 30.670  57.915  67.778  1.00 35.44  ? 167 ILE A CA  1 
ATOM 1055  C C   . ILE A 1 170 ? 31.019  58.665  69.087  1.00 51.39  ? 167 ILE A C   1 
ATOM 1056  O O   . ILE A 1 170 ? 31.772  58.165  69.916  1.00 44.71  ? 167 ILE A O   1 
ATOM 1057  C CB  . ILE A 1 170 ? 31.474  58.517  66.600  1.00 40.36  ? 167 ILE A CB  1 
ATOM 1058  C CG1 . ILE A 1 170 ? 31.437  57.568  65.407  1.00 45.79  ? 167 ILE A CG1 1 
ATOM 1059  C CG2 . ILE A 1 170 ? 32.923  58.861  67.000  1.00 24.57  ? 167 ILE A CG2 1 
ATOM 1060  C CD1 . ILE A 1 170 ? 31.761  58.244  64.094  1.00 44.56  ? 167 ILE A CD1 1 
ATOM 1061  N N   . ASP A 1 171 ? 30.465  59.863  69.267  1.00 41.54  ? 168 ASP A N   1 
ATOM 1062  C CA  . ASP A 1 171 ? 30.702  60.662  70.468  1.00 32.89  ? 168 ASP A CA  1 
ATOM 1063  C C   . ASP A 1 171 ? 30.122  60.024  71.730  1.00 54.51  ? 168 ASP A C   1 
ATOM 1064  O O   . ASP A 1 171 ? 30.771  60.013  72.754  1.00 34.42  ? 168 ASP A O   1 
ATOM 1065  C CB  . ASP A 1 171 ? 30.195  62.095  70.281  1.00 37.03  ? 168 ASP A CB  1 
ATOM 1066  C CG  . ASP A 1 171 ? 31.105  62.913  69.373  1.00 50.69  ? 168 ASP A CG  1 
ATOM 1067  O OD1 . ASP A 1 171 ? 32.274  62.501  69.178  1.00 50.04  ? 168 ASP A OD1 1 
ATOM 1068  O OD2 . ASP A 1 171 ? 30.662  63.961  68.864  1.00 61.83  ? 168 ASP A OD2 1 
ATOM 1069  N N   . PHE A 1 172 ? 28.910  59.481  71.648  1.00 40.93  ? 169 PHE A N   1 
ATOM 1070  C CA  . PHE A 1 172 ? 28.358  58.697  72.747  1.00 42.64  ? 169 PHE A CA  1 
ATOM 1071  C C   . PHE A 1 172 ? 29.316  57.592  73.180  1.00 50.70  ? 169 PHE A C   1 
ATOM 1072  O O   . PHE A 1 172 ? 29.598  57.460  74.362  1.00 46.82  ? 169 PHE A O   1 
ATOM 1073  C CB  . PHE A 1 172 ? 27.006  58.088  72.364  1.00 37.35  ? 169 PHE A CB  1 
ATOM 1074  C CG  . PHE A 1 172 ? 25.846  58.995  72.603  1.00 53.00  ? 169 PHE A CG  1 
ATOM 1075  C CD1 . PHE A 1 172 ? 25.752  59.724  73.784  1.00 51.05  ? 169 PHE A CD1 1 
ATOM 1076  C CD2 . PHE A 1 172 ? 24.845  59.121  71.650  1.00 48.05  ? 169 PHE A CD2 1 
ATOM 1077  C CE1 . PHE A 1 172 ? 24.676  60.572  74.022  1.00 53.87  ? 169 PHE A CE1 1 
ATOM 1078  C CE2 . PHE A 1 172 ? 23.770  59.966  71.869  1.00 52.17  ? 169 PHE A CE2 1 
ATOM 1079  C CZ  . PHE A 1 172 ? 23.684  60.697  73.069  1.00 64.82  ? 169 PHE A CZ  1 
ATOM 1080  N N   . PHE A 1 173 ? 29.808  56.796  72.227  1.00 38.41  ? 170 PHE A N   1 
ATOM 1081  C CA  . PHE A 1 173 ? 30.710  55.701  72.551  1.00 39.49  ? 170 PHE A CA  1 
ATOM 1082  C C   . PHE A 1 173 ? 32.010  56.178  73.210  1.00 47.31  ? 170 PHE A C   1 
ATOM 1083  O O   . PHE A 1 173 ? 32.468  55.615  74.201  1.00 60.44  ? 170 PHE A O   1 
ATOM 1084  C CB  . PHE A 1 173 ? 31.022  54.855  71.321  1.00 40.13  ? 170 PHE A CB  1 
ATOM 1085  C CG  . PHE A 1 173 ? 29.896  53.942  70.913  1.00 60.25  ? 170 PHE A CG  1 
ATOM 1086  C CD1 . PHE A 1 173 ? 28.737  53.867  71.660  1.00 40.37  ? 170 PHE A CD1 1 
ATOM 1087  C CD2 . PHE A 1 173 ? 30.000  53.158  69.774  1.00 53.01  ? 170 PHE A CD2 1 
ATOM 1088  C CE1 . PHE A 1 173 ? 27.705  53.018  71.284  1.00 55.14  ? 170 PHE A CE1 1 
ATOM 1089  C CE2 . PHE A 1 173 ? 28.976  52.319  69.395  1.00 45.70  ? 170 PHE A CE2 1 
ATOM 1090  C CZ  . PHE A 1 173 ? 27.828  52.244  70.143  1.00 42.12  ? 170 PHE A CZ  1 
ATOM 1091  N N   . ARG A 1 174 ? 32.596  57.227  72.665  1.00 40.23  ? 171 ARG A N   1 
ATOM 1092  C CA  . ARG A 1 174 ? 33.860  57.732  73.181  1.00 49.88  ? 171 ARG A CA  1 
ATOM 1093  C C   . ARG A 1 174 ? 33.716  58.476  74.516  1.00 48.23  ? 171 ARG A C   1 
ATOM 1094  O O   . ARG A 1 174 ? 34.422  58.209  75.480  1.00 44.50  ? 171 ARG A O   1 
ATOM 1095  C CB  . ARG A 1 174 ? 34.535  58.640  72.152  1.00 32.29  ? 171 ARG A CB  1 
ATOM 1096  C CG  . ARG A 1 174 ? 34.964  57.925  70.900  1.00 47.34  ? 171 ARG A CG  1 
ATOM 1097  C CD  . ARG A 1 174 ? 36.150  58.641  70.272  1.00 40.03  ? 171 ARG A CD  1 
ATOM 1098  N NE  . ARG A 1 174 ? 36.564  58.017  69.010  1.00 71.29  ? 171 ARG A NE  1 
ATOM 1099  C CZ  . ARG A 1 174 ? 36.397  58.564  67.806  1.00 46.22  ? 171 ARG A CZ  1 
ATOM 1100  N NH1 . ARG A 1 174 ? 35.802  59.746  67.674  1.00 51.06  ? 171 ARG A NH1 1 
ATOM 1101  N NH2 . ARG A 1 174 ? 36.815  57.922  66.729  1.00 55.98  ? 171 ARG A NH2 1 
ATOM 1102  N N   . PHE A 1 175 ? 32.817  59.434  74.569  1.00 31.36  ? 172 PHE A N   1 
ATOM 1103  C CA  . PHE A 1 175 ? 32.631  60.197  75.780  1.00 35.24  ? 172 PHE A CA  1 
ATOM 1104  C C   . PHE A 1 175 ? 32.080  59.369  76.960  1.00 38.80  ? 172 PHE A C   1 
ATOM 1105  O O   . PHE A 1 175 ? 32.487  59.562  78.083  1.00 36.15  ? 172 PHE A O   1 
ATOM 1106  C CB  . PHE A 1 175 ? 31.736  61.398  75.509  1.00 42.57  ? 172 PHE A CB  1 
ATOM 1107  C CG  . PHE A 1 175 ? 32.438  62.538  74.836  1.00 49.21  ? 172 PHE A CG  1 
ATOM 1108  C CD1 . PHE A 1 175 ? 32.911  63.608  75.578  1.00 43.89  ? 172 PHE A CD1 1 
ATOM 1109  C CD2 . PHE A 1 175 ? 32.600  62.560  73.465  1.00 53.37  ? 172 PHE A CD2 1 
ATOM 1110  C CE1 . PHE A 1 175 ? 33.546  64.677  74.969  1.00 32.99  ? 172 PHE A CE1 1 
ATOM 1111  C CE2 . PHE A 1 175 ? 33.242  63.620  72.856  1.00 47.41  ? 172 PHE A CE2 1 
ATOM 1112  C CZ  . PHE A 1 175 ? 33.720  64.676  73.615  1.00 57.38  ? 172 PHE A CZ  1 
ATOM 1113  N N   . ASN A 1 176 ? 31.162  58.449  76.716  1.00 36.87  ? 173 ASN A N   1 
ATOM 1114  C CA  . ASN A 1 176 ? 30.700  57.594  77.789  1.00 31.85  ? 173 ASN A CA  1 
ATOM 1115  C C   . ASN A 1 176 ? 31.809  56.673  78.293  1.00 52.29  ? 173 ASN A C   1 
ATOM 1116  O O   . ASN A 1 176 ? 31.848  56.333  79.465  1.00 48.15  ? 173 ASN A O   1 
ATOM 1117  C CB  . ASN A 1 176 ? 29.494  56.786  77.337  1.00 27.62  ? 173 ASN A CB  1 
ATOM 1118  C CG  . ASN A 1 176 ? 28.210  57.577  77.411  1.00 36.91  ? 173 ASN A CG  1 
ATOM 1119  O OD1 . ASN A 1 176 ? 27.238  57.240  76.759  1.00 50.38  ? 173 ASN A OD1 1 
ATOM 1120  N ND2 . ASN A 1 176 ? 28.200  58.624  78.217  1.00 40.51  ? 173 ASN A ND2 1 
ATOM 1121  N N   . ALA A 1 177 ? 32.710  56.267  77.401  1.00 38.96  ? 174 ALA A N   1 
ATOM 1122  C CA  . ALA A 1 177 ? 33.858  55.467  77.816  1.00 53.70  ? 174 ALA A CA  1 
ATOM 1123  C C   . ALA A 1 177 ? 34.812  56.301  78.684  1.00 43.98  ? 174 ALA A C   1 
ATOM 1124  O O   . ALA A 1 177 ? 35.357  55.832  79.677  1.00 42.70  ? 174 ALA A O   1 
ATOM 1125  C CB  . ALA A 1 177 ? 34.593  54.905  76.613  1.00 34.89  ? 174 ALA A CB  1 
ATOM 1126  N N   . LYS A 1 178 ? 35.020  57.547  78.295  1.00 45.95  ? 175 LYS A N   1 
ATOM 1127  C CA  . LYS A 1 178 ? 35.843  58.453  79.076  1.00 46.22  ? 175 LYS A CA  1 
ATOM 1128  C C   . LYS A 1 178 ? 35.267  58.662  80.472  1.00 49.25  ? 175 LYS A C   1 
ATOM 1129  O O   . LYS A 1 178 ? 35.992  58.694  81.443  1.00 38.27  ? 175 LYS A O   1 
ATOM 1130  C CB  . LYS A 1 178 ? 35.916  59.804  78.379  1.00 30.97  ? 175 LYS A CB  1 
ATOM 1131  C CG  . LYS A 1 178 ? 36.456  60.917  79.256  1.00 38.29  ? 175 LYS A CG  1 
ATOM 1132  C CD  . LYS A 1 178 ? 35.918  62.254  78.786  1.00 54.75  ? 175 LYS A CD  1 
ATOM 1133  C CE  . LYS A 1 178 ? 37.012  63.305  78.706  1.00 69.10  ? 175 LYS A CE  1 
ATOM 1134  N NZ  . LYS A 1 178 ? 37.744  63.456  79.974  1.00 56.35  ? 175 LYS A NZ  1 
ATOM 1135  N N   . TYR A 1 179 ? 33.952  58.825  80.548  1.00 38.75  ? 176 TYR A N   1 
ATOM 1136  C CA  . TYR A 1 179 ? 33.280  59.145  81.786  1.00 28.92  ? 176 TYR A CA  1 
ATOM 1137  C C   . TYR A 1 179 ? 33.292  57.940  82.733  1.00 53.29  ? 176 TYR A C   1 
ATOM 1138  O O   . TYR A 1 179 ? 33.446  58.099  83.944  1.00 57.89  ? 176 TYR A O   1 
ATOM 1139  C CB  . TYR A 1 179 ? 31.850  59.555  81.501  1.00 37.90  ? 176 TYR A CB  1 
ATOM 1140  C CG  . TYR A 1 179 ? 31.676  60.866  80.747  1.00 47.73  ? 176 TYR A CG  1 
ATOM 1141  C CD1 . TYR A 1 179 ? 32.527  61.938  80.942  1.00 47.74  ? 176 TYR A CD1 1 
ATOM 1142  C CD2 . TYR A 1 179 ? 30.626  61.029  79.851  1.00 44.80  ? 176 TYR A CD2 1 
ATOM 1143  C CE1 . TYR A 1 179 ? 32.341  63.147  80.243  1.00 27.10  ? 176 TYR A CE1 1 
ATOM 1144  C CE2 . TYR A 1 179 ? 30.429  62.210  79.178  1.00 39.48  ? 176 TYR A CE2 1 
ATOM 1145  C CZ  . TYR A 1 179 ? 31.279  63.270  79.375  1.00 50.09  ? 176 TYR A CZ  1 
ATOM 1146  O OH  . TYR A 1 179 ? 31.048  64.443  78.676  1.00 54.18  ? 176 TYR A OH  1 
ATOM 1147  N N   . ALA A 1 180 ? 33.139  56.742  82.173  1.00 30.15  ? 177 ALA A N   1 
ATOM 1148  C CA  . ALA A 1 180 ? 33.092  55.515  82.960  1.00 36.74  ? 177 ALA A CA  1 
ATOM 1149  C C   . ALA A 1 180 ? 34.459  55.201  83.547  1.00 49.39  ? 177 ALA A C   1 
ATOM 1150  O O   . ALA A 1 180 ? 34.570  54.722  84.677  1.00 50.17  ? 177 ALA A O   1 
ATOM 1151  C CB  . ALA A 1 180 ? 32.612  54.349  82.101  1.00 38.55  ? 177 ALA A CB  1 
ATOM 1152  N N   . VAL A 1 181 ? 35.493  55.472  82.758  1.00 42.00  ? 178 VAL A N   1 
ATOM 1153  C CA  . VAL A 1 181 ? 36.870  55.225  83.156  1.00 48.42  ? 178 VAL A CA  1 
ATOM 1154  C C   . VAL A 1 181 ? 37.298  56.174  84.275  1.00 57.37  ? 178 VAL A C   1 
ATOM 1155  O O   . VAL A 1 181 ? 37.980  55.795  85.227  1.00 48.64  ? 178 VAL A O   1 
ATOM 1156  C CB  . VAL A 1 181 ? 37.806  55.355  81.948  1.00 43.10  ? 178 VAL A CB  1 
ATOM 1157  C CG1 . VAL A 1 181 ? 39.243  55.560  82.392  1.00 28.34  ? 178 VAL A CG1 1 
ATOM 1158  C CG2 . VAL A 1 181 ? 37.676  54.116  81.050  1.00 50.72  ? 178 VAL A CG2 1 
ATOM 1159  N N   . GLU A 1 182 ? 36.850  57.411  84.172  1.00 39.21  ? 179 GLU A N   1 
ATOM 1160  C CA  . GLU A 1 182 ? 37.219  58.433  85.130  1.00 56.23  ? 179 GLU A CA  1 
ATOM 1161  C C   . GLU A 1 182 ? 36.365  58.355  86.387  1.00 52.80  ? 179 GLU A C   1 
ATOM 1162  O O   . GLU A 1 182 ? 36.724  58.891  87.425  1.00 57.22  ? 179 GLU A O   1 
ATOM 1163  C CB  . GLU A 1 182 ? 37.163  59.815  84.458  1.00 44.94  ? 179 GLU A CB  1 
ATOM 1164  C CG  . GLU A 1 182 ? 37.987  59.799  83.144  1.00 93.31  ? 179 GLU A CG  1 
ATOM 1165  C CD  . GLU A 1 182 ? 38.278  61.168  82.518  1.00 82.79  ? 179 GLU A CD  1 
ATOM 1166  O OE1 . GLU A 1 182 ? 37.636  62.176  82.860  1.00 55.59  ? 179 GLU A OE1 1 
ATOM 1167  O OE2 . GLU A 1 182 ? 39.172  61.240  81.651  1.00 93.41  ? 179 GLU A OE2 1 
ATOM 1168  N N   . LEU A 1 183 ? 35.236  57.671  86.290  1.00 52.64  ? 180 LEU A N   1 
ATOM 1169  C CA  . LEU A 1 183 ? 34.383  57.457  87.447  1.00 53.45  ? 180 LEU A CA  1 
ATOM 1170  C C   . LEU A 1 183 ? 35.078  56.534  88.451  1.00 59.60  ? 180 LEU A C   1 
ATOM 1171  O O   . LEU A 1 183 ? 34.922  56.704  89.651  1.00 49.66  ? 180 LEU A O   1 
ATOM 1172  C CB  . LEU A 1 183 ? 33.032  56.871  87.028  1.00 27.22  ? 180 LEU A CB  1 
ATOM 1173  C CG  . LEU A 1 183 ? 32.102  56.481  88.169  1.00 46.72  ? 180 LEU A CG  1 
ATOM 1174  C CD1 . LEU A 1 183 ? 31.749  57.707  88.967  1.00 35.00  ? 180 LEU A CD1 1 
ATOM 1175  C CD2 . LEU A 1 183 ? 30.853  55.823  87.673  1.00 31.54  ? 180 LEU A CD2 1 
ATOM 1176  N N   . GLU A 1 184 ? 35.841  55.564  87.954  1.00 45.25  ? 181 GLU A N   1 
ATOM 1177  C CA  . GLU A 1 184 ? 36.580  54.645  88.816  1.00 52.49  ? 181 GLU A CA  1 
ATOM 1178  C C   . GLU A 1 184 ? 37.516  55.369  89.757  1.00 30.24  ? 181 GLU A C   1 
ATOM 1179  O O   . GLU A 1 184 ? 37.830  54.870  90.827  1.00 58.64  ? 181 GLU A O   1 
ATOM 1180  C CB  . GLU A 1 184 ? 37.399  53.683  87.982  1.00 39.95  ? 181 GLU A CB  1 
ATOM 1181  C CG  . GLU A 1 184 ? 36.560  52.755  87.192  1.00 86.14  ? 181 GLU A CG  1 
ATOM 1182  C CD  . GLU A 1 184 ? 36.020  51.661  88.046  1.00 84.74  ? 181 GLU A CD  1 
ATOM 1183  O OE1 . GLU A 1 184 ? 36.759  51.221  88.954  1.00 85.16  ? 181 GLU A OE1 1 
ATOM 1184  O OE2 . GLU A 1 184 ? 34.867  51.247  87.808  1.00 86.64  ? 181 GLU A OE2 1 
ATOM 1185  N N   . GLY A 1 185 ? 37.952  56.554  89.356  1.00 50.46  ? 182 GLY A N   1 
ATOM 1186  C CA  . GLY A 1 185 ? 38.884  57.318  90.164  1.00 35.81  ? 182 GLY A CA  1 
ATOM 1187  C C   . GLY A 1 185 ? 38.225  58.077  91.296  1.00 47.96  ? 182 GLY A C   1 
ATOM 1188  O O   . GLY A 1 185 ? 38.914  58.594  92.173  1.00 63.90  ? 182 GLY A O   1 
ATOM 1189  N N   . GLN A 1 186 ? 36.894  58.164  91.264  1.00 51.50  ? 183 GLN A N   1 
ATOM 1190  C CA  . GLN A 1 186 ? 36.130  58.733  92.371  1.00 61.90  ? 183 GLN A CA  1 
ATOM 1191  C C   . GLN A 1 186 ? 36.036  57.701  93.483  1.00 53.74  ? 183 GLN A C   1 
ATOM 1192  O O   . GLN A 1 186 ? 35.223  56.780  93.438  1.00 42.61  ? 183 GLN A O   1 
ATOM 1193  C CB  . GLN A 1 186 ? 34.743  59.179  91.916  1.00 46.56  ? 183 GLN A CB  1 
ATOM 1194  C CG  . GLN A 1 186 ? 34.783  60.141  90.733  1.00 78.52  ? 183 GLN A CG  1 
ATOM 1195  C CD  . GLN A 1 186 ? 33.555  61.030  90.643  1.00 90.85  ? 183 GLN A CD  1 
ATOM 1196  O OE1 . GLN A 1 186 ? 33.138  61.638  91.633  1.00 90.83  ? 183 GLN A OE1 1 
ATOM 1197  N NE2 . GLN A 1 186 ? 32.975  61.122  89.449  1.00 65.87  ? 183 GLN A NE2 1 
ATOM 1198  N N   . GLN A 1 187 ? 36.918  57.849  94.458  1.00 45.84  ? 184 GLN A N   1 
ATOM 1199  C CA  . GLN A 1 187 ? 37.064  56.866  95.515  1.00 57.81  ? 184 GLN A CA  1 
ATOM 1200  C C   . GLN A 1 187 ? 36.937  57.532  96.879  1.00 52.73  ? 184 GLN A C   1 
ATOM 1201  O O   . GLN A 1 187 ? 37.281  58.702  97.047  1.00 41.77  ? 184 GLN A O   1 
ATOM 1202  C CB  . GLN A 1 187 ? 38.402  56.151  95.364  1.00 35.66  ? 184 GLN A CB  1 
ATOM 1203  C CG  . GLN A 1 187 ? 38.434  55.229  94.158  1.00 39.41  ? 184 GLN A CG  1 
ATOM 1204  C CD  . GLN A 1 187 ? 37.582  53.991  94.351  1.00 49.16  ? 184 GLN A CD  1 
ATOM 1205  O OE1 . GLN A 1 187 ? 37.608  53.385  95.413  1.00 56.89  ? 184 GLN A OE1 1 
ATOM 1206  N NE2 . GLN A 1 187 ? 36.824  53.609  93.329  1.00 37.03  ? 184 GLN A NE2 1 
ATOM 1207  N N   . PRO A 1 188 ? 36.417  56.798  97.865  1.00 46.21  ? 185 PRO A N   1 
ATOM 1208  C CA  . PRO A 1 188 ? 36.259  57.454  99.173  1.00 45.93  ? 185 PRO A CA  1 
ATOM 1209  C C   . PRO A 1 188 ? 37.573  57.664  99.961  1.00 52.78  ? 185 PRO A C   1 
ATOM 1210  O O   . PRO A 1 188 ? 38.656  57.225  99.556  1.00 51.57  ? 185 PRO A O   1 
ATOM 1211  C CB  . PRO A 1 188 ? 35.296  56.526  99.920  1.00 37.74  ? 185 PRO A CB  1 
ATOM 1212  C CG  . PRO A 1 188 ? 35.413  55.185  99.233  1.00 46.64  ? 185 PRO A CG  1 
ATOM 1213  C CD  . PRO A 1 188 ? 36.139  55.352  97.919  1.00 45.61  ? 185 PRO A CD  1 
ATOM 1214  N N   . ILE A 1 189 ? 37.454  58.371  101.077 1.00 54.81  ? 186 ILE A N   1 
ATOM 1215  C CA  . ILE A 1 189 ? 38.577  58.694  101.940 1.00 53.39  ? 186 ILE A CA  1 
ATOM 1216  C C   . ILE A 1 189 ? 38.982  57.449  102.712 1.00 62.06  ? 186 ILE A C   1 
ATOM 1217  O O   . ILE A 1 189 ? 38.125  56.698  103.171 1.00 68.73  ? 186 ILE A O   1 
ATOM 1218  C CB  . ILE A 1 189 ? 38.158  59.805  102.922 1.00 72.49  ? 186 ILE A CB  1 
ATOM 1219  C CG1 . ILE A 1 189 ? 38.030  61.143  102.180 1.00 63.52  ? 186 ILE A CG1 1 
ATOM 1220  C CG2 . ILE A 1 189 ? 39.121  59.891  104.096 1.00 60.04  ? 186 ILE A CG2 1 
ATOM 1221  C CD1 . ILE A 1 189 ? 37.262  62.225  102.948 1.00 55.04  ? 186 ILE A CD1 1 
ATOM 1222  N N   . SER A 1 190 ? 40.280  57.204  102.835 1.00 67.06  ? 187 SER A N   1 
ATOM 1223  C CA  . SER A 1 190 ? 40.744  56.099  103.674 1.00 72.76  ? 187 SER A CA  1 
ATOM 1224  C C   . SER A 1 190 ? 41.397  56.605  104.950 1.00 71.45  ? 187 SER A C   1 
ATOM 1225  O O   . SER A 1 190 ? 42.208  57.531  104.931 1.00 72.30  ? 187 SER A O   1 
ATOM 1226  C CB  . SER A 1 190 ? 41.706  55.182  102.920 1.00 56.99  ? 187 SER A CB  1 
ATOM 1227  O OG  . SER A 1 190 ? 41.003  54.264  102.111 1.00 73.41  ? 187 SER A OG  1 
ATOM 1228  N N   . VAL A 1 191 ? 41.040  55.992  106.065 1.00 63.56  ? 188 VAL A N   1 
ATOM 1229  C CA  . VAL A 1 191 ? 41.648  56.356  107.338 1.00 82.40  ? 188 VAL A CA  1 
ATOM 1230  C C   . VAL A 1 191 ? 42.101  55.116  108.092 1.00 80.52  ? 188 VAL A C   1 
ATOM 1231  O O   . VAL A 1 191 ? 41.298  54.227  108.378 1.00 70.92  ? 188 VAL A O   1 
ATOM 1232  C CB  . VAL A 1 191 ? 40.692  57.191  108.212 1.00 73.12  ? 188 VAL A CB  1 
ATOM 1233  C CG1 . VAL A 1 191 ? 41.101  57.113  109.671 1.00 55.74  ? 188 VAL A CG1 1 
ATOM 1234  C CG2 . VAL A 1 191 ? 40.653  58.641  107.729 1.00 49.85  ? 188 VAL A CG2 1 
ATOM 1235  N N   . PRO A 1 192 ? 43.401  55.052  108.408 1.00 89.30  ? 189 PRO A N   1 
ATOM 1236  C CA  . PRO A 1 192 ? 44.034  53.976  109.183 1.00 67.49  ? 189 PRO A CA  1 
ATOM 1237  C C   . PRO A 1 192 ? 43.229  53.657  110.436 1.00 61.89  ? 189 PRO A C   1 
ATOM 1238  O O   . PRO A 1 192 ? 42.799  54.584  111.132 1.00 62.01  ? 189 PRO A O   1 
ATOM 1239  C CB  . PRO A 1 192 ? 45.366  54.590  109.581 1.00 59.26  ? 189 PRO A CB  1 
ATOM 1240  C CG  . PRO A 1 192 ? 45.677  55.526  108.452 1.00 78.89  ? 189 PRO A CG  1 
ATOM 1241  C CD  . PRO A 1 192 ? 44.358  56.112  108.050 1.00 89.31  ? 189 PRO A CD  1 
ATOM 1242  N N   . PRO A 1 193 ? 43.043  52.364  110.745 1.00 60.47  ? 190 PRO A N   1 
ATOM 1243  C CA  . PRO A 1 193 ? 43.639  51.183  110.112 1.00 78.90  ? 190 PRO A CA  1 
ATOM 1244  C C   . PRO A 1 193 ? 42.741  50.560  109.039 1.00 73.23  ? 190 PRO A C   1 
ATOM 1245  O O   . PRO A 1 193 ? 42.692  49.337  108.907 1.00 63.94  ? 190 PRO A O   1 
ATOM 1246  C CB  . PRO A 1 193 ? 43.721  50.208  111.279 1.00 74.66  ? 190 PRO A CB  1 
ATOM 1247  C CG  . PRO A 1 193 ? 42.441  50.475  112.014 1.00 60.55  ? 190 PRO A CG  1 
ATOM 1248  C CD  . PRO A 1 193 ? 42.178  51.973  111.874 1.00 56.14  ? 190 PRO A CD  1 
ATOM 1249  N N   . SER A 1 194 ? 42.033  51.387  108.284 1.00 70.61  ? 191 SER A N   1 
ATOM 1250  C CA  . SER A 1 194 ? 41.117  50.883  107.272 1.00 57.01  ? 191 SER A CA  1 
ATOM 1251  C C   . SER A 1 194 ? 41.321  51.523  105.903 1.00 50.74  ? 191 SER A C   1 
ATOM 1252  O O   . SER A 1 194 ? 41.698  52.693  105.781 1.00 58.19  ? 191 SER A O   1 
ATOM 1253  C CB  . SER A 1 194 ? 39.678  51.075  107.734 1.00 60.83  ? 191 SER A CB  1 
ATOM 1254  O OG  . SER A 1 194 ? 39.398  50.218  108.831 1.00 58.90  ? 191 SER A OG  1 
ATOM 1255  N N   . THR A 1 195 ? 41.095  50.733  104.868 1.00 50.11  ? 192 THR A N   1 
ATOM 1256  C CA  . THR A 1 195 ? 41.135  51.248  103.507 1.00 66.83  ? 192 THR A CA  1 
ATOM 1257  C C   . THR A 1 195 ? 39.755  51.097  102.867 1.00 65.22  ? 192 THR A C   1 
ATOM 1258  O O   . THR A 1 195 ? 39.105  50.051  102.963 1.00 42.11  ? 192 THR A O   1 
ATOM 1259  C CB  . THR A 1 195 ? 42.234  50.574  102.660 1.00 72.32  ? 192 THR A CB  1 
ATOM 1260  O OG1 . THR A 1 195 ? 42.078  49.151  102.713 1.00 71.02  ? 192 THR A OG1 1 
ATOM 1261  C CG2 . THR A 1 195 ? 43.636  50.961  103.178 1.00 61.05  ? 192 THR A CG2 1 
ATOM 1262  N N   . ASN A 1 196 ? 39.286  52.165  102.245 1.00 59.90  ? 193 ASN A N   1 
ATOM 1263  C CA  . ASN A 1 196 ? 37.974  52.142  101.613 1.00 47.23  ? 193 ASN A CA  1 
ATOM 1264  C C   . ASN A 1 196 ? 38.034  52.230  100.087 1.00 46.01  ? 193 ASN A C   1 
ATOM 1265  O O   . ASN A 1 196 ? 38.891  52.904  99.510  1.00 54.51  ? 193 ASN A O   1 
ATOM 1266  C CB  . ASN A 1 196 ? 37.108  53.265  102.169 1.00 44.23  ? 193 ASN A CB  1 
ATOM 1267  C CG  . ASN A 1 196 ? 36.940  53.177  103.672 1.00 64.59  ? 193 ASN A CG  1 
ATOM 1268  O OD1 . ASN A 1 196 ? 36.336  52.232  104.184 1.00 45.79  ? 193 ASN A OD1 1 
ATOM 1269  N ND2 . ASN A 1 196 ? 37.452  54.177  104.389 1.00 39.63  ? 193 ASN A ND2 1 
ATOM 1270  N N   . SER A 1 197 ? 37.106  51.546  99.437  1.00 37.58  ? 194 SER A N   1 
ATOM 1271  C CA  . SER A 1 197 ? 37.075  51.546  97.997  1.00 48.39  ? 194 SER A CA  1 
ATOM 1272  C C   . SER A 1 197 ? 35.654  51.436  97.523  1.00 46.52  ? 194 SER A C   1 
ATOM 1273  O O   . SER A 1 197 ? 34.829  50.826  98.179  1.00 46.78  ? 194 SER A O   1 
ATOM 1274  C CB  . SER A 1 197 ? 37.935  50.405  97.441  1.00 35.90  ? 194 SER A CB  1 
ATOM 1275  O OG  . SER A 1 197 ? 37.339  49.147  97.618  1.00 62.52  ? 194 SER A OG  1 
ATOM 1276  N N   . THR A 1 198 ? 35.370  52.059  96.390  1.00 43.66  ? 195 THR A N   1 
ATOM 1277  C CA  . THR A 1 198 ? 34.068  51.972  95.768  1.00 32.90  ? 195 THR A CA  1 
ATOM 1278  C C   . THR A 1 198 ? 34.180  51.127  94.499  1.00 43.45  ? 195 THR A C   1 
ATOM 1279  O O   . THR A 1 198 ? 35.060  51.327  93.676  1.00 37.47  ? 195 THR A O   1 
ATOM 1280  C CB  . THR A 1 198 ? 33.535  53.367  95.396  1.00 43.78  ? 195 THR A CB  1 
ATOM 1281  O OG1 . THR A 1 198 ? 33.433  54.175  96.573  1.00 44.74  ? 195 THR A OG1 1 
ATOM 1282  C CG2 . THR A 1 198 ? 32.191  53.263  94.742  1.00 32.79  ? 195 THR A CG2 1 
ATOM 1283  N N   . VAL A 1 199 ? 33.273  50.183  94.356  1.00 42.25  ? 196 VAL A N   1 
ATOM 1284  C CA  . VAL A 1 199 ? 33.223  49.323  93.196  1.00 30.63  ? 196 VAL A CA  1 
ATOM 1285  C C   . VAL A 1 199 ? 31.939  49.624  92.429  1.00 44.40  ? 196 VAL A C   1 
ATOM 1286  O O   . VAL A 1 199 ? 30.853  49.473  92.964  1.00 38.70  ? 196 VAL A O   1 
ATOM 1287  C CB  . VAL A 1 199 ? 33.178  47.870  93.631  1.00 46.35  ? 196 VAL A CB  1 
ATOM 1288  C CG1 . VAL A 1 199 ? 32.994  46.982  92.448  1.00 42.09  ? 196 VAL A CG1 1 
ATOM 1289  C CG2 . VAL A 1 199 ? 34.418  47.526  94.385  1.00 45.71  ? 196 VAL A CG2 1 
ATOM 1290  N N   . TYR A 1 200 ? 32.060  50.070  91.185  1.00 51.07  ? 197 TYR A N   1 
ATOM 1291  C CA  . TYR A 1 200 ? 30.887  50.471  90.408  1.00 36.52  ? 197 TYR A CA  1 
ATOM 1292  C C   . TYR A 1 200 ? 30.197  49.290  89.703  1.00 29.93  ? 197 TYR A C   1 
ATOM 1293  O O   . TYR A 1 200 ? 30.461  48.987  88.544  1.00 48.37  ? 197 TYR A O   1 
ATOM 1294  C CB  . TYR A 1 200 ? 31.250  51.612  89.446  1.00 27.74  ? 197 TYR A CB  1 
ATOM 1295  C CG  . TYR A 1 200 ? 31.634  52.856  90.218  1.00 48.29  ? 197 TYR A CG  1 
ATOM 1296  C CD1 . TYR A 1 200 ? 30.665  53.710  90.715  1.00 35.48  ? 197 TYR A CD1 1 
ATOM 1297  C CD2 . TYR A 1 200 ? 32.960  53.155  90.490  1.00 23.91  ? 197 TYR A CD2 1 
ATOM 1298  C CE1 . TYR A 1 200 ? 31.006  54.825  91.450  1.00 38.08  ? 197 TYR A CE1 1 
ATOM 1299  C CE2 . TYR A 1 200 ? 33.305  54.276  91.222  1.00 30.36  ? 197 TYR A CE2 1 
ATOM 1300  C CZ  . TYR A 1 200 ? 32.325  55.102  91.704  1.00 41.00  ? 197 TYR A CZ  1 
ATOM 1301  O OH  . TYR A 1 200 ? 32.660  56.218  92.435  1.00 35.35  ? 197 TYR A OH  1 
ATOM 1302  N N   . ARG A 1 201 ? 29.304  48.632  90.438  1.00 36.20  ? 198 ARG A N   1 
ATOM 1303  C CA  . ARG A 1 201 ? 28.614  47.450  89.947  1.00 30.08  ? 198 ARG A CA  1 
ATOM 1304  C C   . ARG A 1 201 ? 27.572  47.804  88.907  1.00 43.20  ? 198 ARG A C   1 
ATOM 1305  O O   . ARG A 1 201 ? 26.964  48.860  88.968  1.00 39.08  ? 198 ARG A O   1 
ATOM 1306  C CB  . ARG A 1 201 ? 27.894  46.744  91.081  1.00 36.27  ? 198 ARG A CB  1 
ATOM 1307  C CG  . ARG A 1 201 ? 28.730  46.415  92.298  1.00 48.20  ? 198 ARG A CG  1 
ATOM 1308  C CD  . ARG A 1 201 ? 27.842  45.731  93.340  1.00 28.42  ? 198 ARG A CD  1 
ATOM 1309  N NE  . ARG A 1 201 ? 26.783  46.634  93.746  1.00 38.49  ? 198 ARG A NE  1 
ATOM 1310  C CZ  . ARG A 1 201 ? 26.016  46.491  94.823  1.00 45.29  ? 198 ARG A CZ  1 
ATOM 1311  N NH1 . ARG A 1 201 ? 26.194  45.461  95.642  1.00 55.33  ? 198 ARG A NH1 1 
ATOM 1312  N NH2 . ARG A 1 201 ? 25.068  47.397  95.080  1.00 35.57  ? 198 ARG A NH2 1 
ATOM 1313  N N   . GLY A 1 202 ? 27.346  46.910  87.958  1.00 43.86  ? 199 GLY A N   1 
ATOM 1314  C CA  . GLY A 1 202 ? 26.187  47.047  87.106  1.00 45.71  ? 199 GLY A CA  1 
ATOM 1315  C C   . GLY A 1 202 ? 24.960  46.707  87.918  1.00 37.50  ? 199 GLY A C   1 
ATOM 1316  O O   . GLY A 1 202 ? 25.059  46.105  88.982  1.00 42.42  ? 199 GLY A O   1 
ATOM 1317  N N   . LEU A 1 203 ? 23.798  47.092  87.417  1.00 46.19  ? 200 LEU A N   1 
ATOM 1318  C CA  . LEU A 1 203 ? 22.558  46.704  88.054  1.00 34.37  ? 200 LEU A CA  1 
ATOM 1319  C C   . LEU A 1 203 ? 22.380  45.185  87.996  1.00 34.78  ? 200 LEU A C   1 
ATOM 1320  O O   . LEU A 1 203 ? 22.751  44.534  87.033  1.00 44.58  ? 200 LEU A O   1 
ATOM 1321  C CB  . LEU A 1 203 ? 21.367  47.413  87.406  1.00 39.51  ? 200 LEU A CB  1 
ATOM 1322  C CG  . LEU A 1 203 ? 21.552  48.902  87.115  1.00 38.45  ? 200 LEU A CG  1 
ATOM 1323  C CD1 . LEU A 1 203 ? 20.279  49.491  86.586  1.00 41.79  ? 200 LEU A CD1 1 
ATOM 1324  C CD2 . LEU A 1 203 ? 21.958  49.630  88.358  1.00 32.68  ? 200 LEU A CD2 1 
ATOM 1325  N N   . GLU A 1 204 ? 21.801  44.636  89.053  1.00 62.49  ? 201 GLU A N   1 
ATOM 1326  C CA  . GLU A 1 204 ? 21.564  43.219  89.127  1.00 50.80  ? 201 GLU A CA  1 
ATOM 1327  C C   . GLU A 1 204 ? 20.225  42.880  88.453  1.00 52.19  ? 201 GLU A C   1 
ATOM 1328  O O   . GLU A 1 204 ? 19.134  43.171  88.973  1.00 62.06  ? 201 GLU A O   1 
ATOM 1329  C CB  . GLU A 1 204 ? 21.615  42.746  90.587  1.00 44.58  ? 201 GLU A CB  1 
ATOM 1330  C CG  . GLU A 1 204 ? 21.788  41.247  90.735  1.00 67.43  ? 201 GLU A CG  1 
ATOM 1331  C CD  . GLU A 1 204 ? 21.577  40.763  92.152  1.00 72.30  ? 201 GLU A CD  1 
ATOM 1332  O OE1 . GLU A 1 204 ? 21.140  41.574  92.989  1.00 63.77  ? 201 GLU A OE1 1 
ATOM 1333  O OE2 . GLU A 1 204 ? 21.833  39.567  92.419  1.00 57.81  ? 201 GLU A OE2 1 
ATOM 1334  N N   . GLY A 1 205 ? 20.337  42.265  87.282  1.00 39.75  ? 202 GLY A N   1 
ATOM 1335  C CA  . GLY A 1 205 ? 19.208  41.904  86.447  1.00 36.28  ? 202 GLY A CA  1 
ATOM 1336  C C   . GLY A 1 205 ? 19.530  42.195  84.985  1.00 53.81  ? 202 GLY A C   1 
ATOM 1337  O O   . GLY A 1 205 ? 20.695  42.243  84.587  1.00 43.25  ? 202 GLY A O   1 
ATOM 1338  N N   . PHE A 1 206 ? 18.494  42.384  84.178  1.00 35.49  ? 203 PHE A N   1 
ATOM 1339  C CA  . PHE A 1 206 ? 18.686  42.849  82.815  1.00 51.97  ? 203 PHE A CA  1 
ATOM 1340  C C   . PHE A 1 206 ? 18.006  44.199  82.620  1.00 42.51  ? 203 PHE A C   1 
ATOM 1341  O O   . PHE A 1 206 ? 17.047  44.522  83.316  1.00 51.14  ? 203 PHE A O   1 
ATOM 1342  C CB  . PHE A 1 206 ? 18.126  41.847  81.813  1.00 38.80  ? 203 PHE A CB  1 
ATOM 1343  C CG  . PHE A 1 206 ? 16.626  41.867  81.707  1.00 45.36  ? 203 PHE A CG  1 
ATOM 1344  C CD1 . PHE A 1 206 ? 15.837  41.113  82.571  1.00 46.07  ? 203 PHE A CD1 1 
ATOM 1345  C CD2 . PHE A 1 206 ? 16.003  42.639  80.747  1.00 36.58  ? 203 PHE A CD2 1 
ATOM 1346  C CE1 . PHE A 1 206 ? 14.454  41.126  82.468  1.00 39.74  ? 203 PHE A CE1 1 
ATOM 1347  C CE2 . PHE A 1 206 ? 14.617  42.671  80.646  1.00 45.62  ? 203 PHE A CE2 1 
ATOM 1348  C CZ  . PHE A 1 206 ? 13.841  41.911  81.501  1.00 50.51  ? 203 PHE A CZ  1 
ATOM 1349  N N   . VAL A 1 207 ? 18.515  44.973  81.666  1.00 48.15  ? 204 VAL A N   1 
ATOM 1350  C CA  . VAL A 1 207 ? 17.962  46.270  81.296  1.00 37.49  ? 204 VAL A CA  1 
ATOM 1351  C C   . VAL A 1 207 ? 17.236  46.139  79.959  1.00 42.42  ? 204 VAL A C   1 
ATOM 1352  O O   . VAL A 1 207 ? 17.736  45.503  79.036  1.00 52.00  ? 204 VAL A O   1 
ATOM 1353  C CB  . VAL A 1 207 ? 19.078  47.315  81.156  1.00 39.19  ? 204 VAL A CB  1 
ATOM 1354  C CG1 . VAL A 1 207 ? 18.539  48.609  80.603  1.00 27.04  ? 204 VAL A CG1 1 
ATOM 1355  C CG2 . VAL A 1 207 ? 19.747  47.552  82.491  1.00 42.11  ? 204 VAL A CG2 1 
ATOM 1356  N N   . ALA A 1 208 ? 16.047  46.721  79.856  1.00 39.35  ? 205 ALA A N   1 
ATOM 1357  C CA  . ALA A 1 208 ? 15.339  46.784  78.567  1.00 35.23  ? 205 ALA A CA  1 
ATOM 1358  C C   . ALA A 1 208 ? 15.558  48.146  77.891  1.00 42.58  ? 205 ALA A C   1 
ATOM 1359  O O   . ALA A 1 208 ? 15.247  49.194  78.454  1.00 44.36  ? 205 ALA A O   1 
ATOM 1360  C CB  . ALA A 1 208 ? 13.859  46.528  78.760  1.00 30.65  ? 205 ALA A CB  1 
ATOM 1361  N N   . ALA A 1 209 ? 16.130  48.132  76.698  1.00 36.84  ? 206 ALA A N   1 
ATOM 1362  C CA  . ALA A 1 209 ? 16.349  49.366  75.935  1.00 36.09  ? 206 ALA A CA  1 
ATOM 1363  C C   . ALA A 1 209 ? 15.350  49.467  74.803  1.00 42.82  ? 206 ALA A C   1 
ATOM 1364  O O   . ALA A 1 209 ? 15.278  48.585  73.943  1.00 33.05  ? 206 ALA A O   1 
ATOM 1365  C CB  . ALA A 1 209 ? 17.757  49.420  75.392  1.00 30.70  ? 206 ALA A CB  1 
ATOM 1366  N N   . ILE A 1 210 ? 14.551  50.525  74.825  1.00 52.07  ? 207 ILE A N   1 
ATOM 1367  C CA  . ILE A 1 210 ? 13.499  50.720  73.830  1.00 27.40  ? 207 ILE A CA  1 
ATOM 1368  C C   . ILE A 1 210 ? 13.757  52.008  73.046  1.00 53.95  ? 207 ILE A C   1 
ATOM 1369  O O   . ILE A 1 210 ? 13.531  53.095  73.557  1.00 41.86  ? 207 ILE A O   1 
ATOM 1370  C CB  . ILE A 1 210 ? 12.170  50.844  74.508  1.00 41.73  ? 207 ILE A CB  1 
ATOM 1371  C CG1 . ILE A 1 210 ? 11.894  49.564  75.298  1.00 42.68  ? 207 ILE A CG1 1 
ATOM 1372  C CG2 . ILE A 1 210 ? 11.075  51.203  73.474  1.00 28.53  ? 207 ILE A CG2 1 
ATOM 1373  C CD1 . ILE A 1 210 ? 10.752  49.702  76.272  1.00 37.28  ? 207 ILE A CD1 1 
ATOM 1374  N N   . SER A 1 211 ? 14.235  51.885  71.812  1.00 45.31  ? 208 SER A N   1 
ATOM 1375  C CA  . SER A 1 211 ? 14.640  53.045  71.029  1.00 52.08  ? 208 SER A CA  1 
ATOM 1376  C C   . SER A 1 211 ? 13.635  53.431  69.933  1.00 43.14  ? 208 SER A C   1 
ATOM 1377  O O   . SER A 1 211 ? 12.838  52.599  69.492  1.00 70.05  ? 208 SER A O   1 
ATOM 1378  C CB  . SER A 1 211 ? 16.062  52.850  70.461  1.00 35.95  ? 208 SER A CB  1 
ATOM 1379  O OG  . SER A 1 211 ? 16.193  51.651  69.727  1.00 52.13  ? 208 SER A OG  1 
ATOM 1380  N N   . PRO A 1 212 ? 13.662  54.710  69.514  1.00 61.79  ? 209 PRO A N   1 
ATOM 1381  C CA  . PRO A 1 212 ? 12.745  55.313  68.541  1.00 70.47  ? 209 PRO A CA  1 
ATOM 1382  C C   . PRO A 1 212 ? 13.382  55.435  67.146  1.00 62.45  ? 209 PRO A C   1 
ATOM 1383  O O   . PRO A 1 212 ? 14.576  55.178  66.989  1.00 42.84  ? 209 PRO A O   1 
ATOM 1384  C CB  . PRO A 1 212 ? 12.549  56.702  69.127  1.00 40.76  ? 209 PRO A CB  1 
ATOM 1385  C CG  . PRO A 1 212 ? 13.961  57.055  69.602  1.00 47.17  ? 209 PRO A CG  1 
ATOM 1386  C CD  . PRO A 1 212 ? 14.560  55.732  70.095  1.00 67.58  ? 209 PRO A CD  1 
ATOM 1387  N N   . PHE A 1 213 ? 12.601  55.858  66.158  1.00 44.01  ? 210 PHE A N   1 
ATOM 1388  C CA  . PHE A 1 213 ? 13.065  55.905  64.764  1.00 58.63  ? 210 PHE A CA  1 
ATOM 1389  C C   . PHE A 1 213 ? 14.000  57.081  64.457  1.00 56.77  ? 210 PHE A C   1 
ATOM 1390  O O   . PHE A 1 213 ? 14.896  56.968  63.626  1.00 55.92  ? 210 PHE A O   1 
ATOM 1391  C CB  . PHE A 1 213 ? 11.868  55.957  63.803  1.00 44.75  ? 210 PHE A CB  1 
ATOM 1392  C CG  . PHE A 1 213 ? 11.222  57.319  63.712  1.00 53.72  ? 210 PHE A CG  1 
ATOM 1393  C CD1 . PHE A 1 213 ? 11.692  58.275  62.813  1.00 37.55  ? 210 PHE A CD1 1 
ATOM 1394  C CD2 . PHE A 1 213 ? 10.159  57.654  64.529  1.00 41.84  ? 210 PHE A CD2 1 
ATOM 1395  C CE1 . PHE A 1 213 ? 11.114  59.542  62.738  1.00 54.32  ? 210 PHE A CE1 1 
ATOM 1396  C CE2 . PHE A 1 213 ? 9.567   58.919  64.450  1.00 55.38  ? 210 PHE A CE2 1 
ATOM 1397  C CZ  . PHE A 1 213 ? 10.051  59.862  63.551  1.00 39.55  ? 210 PHE A CZ  1 
ATOM 1398  N N   . ASN A 1 214 ? 13.785  58.208  65.125  1.00 52.79  ? 211 ASN A N   1 
ATOM 1399  C CA  . ASN A 1 214 ? 14.335  59.479  64.662  1.00 50.89  ? 211 ASN A CA  1 
ATOM 1400  C C   . ASN A 1 214 ? 15.859  59.612  64.724  1.00 53.61  ? 211 ASN A C   1 
ATOM 1401  O O   . ASN A 1 214 ? 16.431  60.393  63.965  1.00 56.73  ? 211 ASN A O   1 
ATOM 1402  C CB  . ASN A 1 214 ? 13.626  60.680  65.333  1.00 66.92  ? 211 ASN A CB  1 
ATOM 1403  C CG  . ASN A 1 214 ? 13.678  60.630  66.845  1.00 48.30  ? 211 ASN A CG  1 
ATOM 1404  O OD1 . ASN A 1 214 ? 13.682  59.553  67.442  1.00 92.55  ? 211 ASN A OD1 1 
ATOM 1405  N ND2 . ASN A 1 214 ? 13.707  61.799  67.474  1.00 80.27  ? 211 ASN A ND2 1 
ATOM 1406  N N   . PHE A 1 215 ? 16.513  58.874  65.623  1.00 37.67  ? 212 PHE A N   1 
ATOM 1407  C CA  . PHE A 1 215 ? 17.983  58.882  65.680  1.00 43.60  ? 212 PHE A CA  1 
ATOM 1408  C C   . PHE A 1 215 ? 18.568  57.500  65.786  1.00 46.03  ? 212 PHE A C   1 
ATOM 1409  O O   . PHE A 1 215 ? 18.155  56.691  66.633  1.00 74.10  ? 212 PHE A O   1 
ATOM 1410  C CB  . PHE A 1 215 ? 18.541  59.775  66.804  1.00 40.43  ? 212 PHE A CB  1 
ATOM 1411  C CG  . PHE A 1 215 ? 18.424  61.248  66.530  1.00 48.74  ? 212 PHE A CG  1 
ATOM 1412  C CD1 . PHE A 1 215 ? 17.276  61.947  66.884  1.00 66.22  ? 212 PHE A CD1 1 
ATOM 1413  C CD2 . PHE A 1 215 ? 19.464  61.940  65.928  1.00 66.84  ? 212 PHE A CD2 1 
ATOM 1414  C CE1 . PHE A 1 215 ? 17.162  63.308  66.631  1.00 73.79  ? 212 PHE A CE1 1 
ATOM 1415  C CE2 . PHE A 1 215 ? 19.364  63.301  65.672  1.00 65.65  ? 212 PHE A CE2 1 
ATOM 1416  C CZ  . PHE A 1 215 ? 18.209  63.986  66.021  1.00 85.28  ? 212 PHE A CZ  1 
ATOM 1417  N N   . THR A 1 216 ? 19.530  57.237  64.906  1.00 58.49  ? 213 THR A N   1 
ATOM 1418  C CA  . THR A 1 216 ? 20.268  55.976  64.894  1.00 61.11  ? 213 THR A CA  1 
ATOM 1419  C C   . THR A 1 216 ? 21.175  55.930  66.115  1.00 63.56  ? 213 THR A C   1 
ATOM 1420  O O   . THR A 1 216 ? 21.385  54.866  66.700  1.00 39.35  ? 213 THR A O   1 
ATOM 1421  C CB  . THR A 1 216 ? 21.134  55.839  63.608  1.00 54.97  ? 213 THR A CB  1 
ATOM 1422  O OG1 . THR A 1 216 ? 20.292  55.856  62.450  1.00 52.03  ? 213 THR A OG1 1 
ATOM 1423  C CG2 . THR A 1 216 ? 21.949  54.550  63.620  1.00 30.66  ? 213 THR A CG2 1 
ATOM 1424  N N   . ALA A 1 217 ? 21.711  57.095  66.483  1.00 41.83  ? 214 ALA A N   1 
ATOM 1425  C CA  . ALA A 1 217 ? 22.616  57.223  67.616  1.00 41.18  ? 214 ALA A CA  1 
ATOM 1426  C C   . ALA A 1 217 ? 21.923  56.874  68.924  1.00 49.70  ? 214 ALA A C   1 
ATOM 1427  O O   . ALA A 1 217 ? 22.566  56.389  69.838  1.00 56.02  ? 214 ALA A O   1 
ATOM 1428  C CB  . ALA A 1 217 ? 23.170  58.624  67.689  1.00 28.54  ? 214 ALA A CB  1 
ATOM 1429  N N   . ILE A 1 218 ? 20.620  57.135  69.015  1.00 63.79  ? 215 ILE A N   1 
ATOM 1430  C CA  . ILE A 1 218 ? 19.890  56.960  70.273  1.00 68.97  ? 215 ILE A CA  1 
ATOM 1431  C C   . ILE A 1 218 ? 19.737  55.483  70.623  1.00 79.48  ? 215 ILE A C   1 
ATOM 1432  O O   . ILE A 1 218 ? 19.867  55.088  71.780  1.00 58.41  ? 215 ILE A O   1 
ATOM 1433  C CB  . ILE A 1 218 ? 18.521  57.690  70.270  1.00 69.67  ? 215 ILE A CB  1 
ATOM 1434  C CG1 . ILE A 1 218 ? 18.733  59.206  70.394  1.00 64.19  ? 215 ILE A CG1 1 
ATOM 1435  C CG2 . ILE A 1 218 ? 17.647  57.201  71.410  1.00 48.57  ? 215 ILE A CG2 1 
ATOM 1436  C CD1 . ILE A 1 218 ? 17.455  60.009  70.401  1.00 75.98  ? 215 ILE A CD1 1 
ATOM 1437  N N   . GLY A 1 219 ? 19.487  54.654  69.621  1.00 52.35  ? 216 GLY A N   1 
ATOM 1438  C CA  . GLY A 1 219 ? 19.466  53.233  69.867  1.00 49.58  ? 216 GLY A CA  1 
ATOM 1439  C C   . GLY A 1 219 ? 20.808  52.784  70.406  1.00 58.89  ? 216 GLY A C   1 
ATOM 1440  O O   . GLY A 1 219 ? 20.901  52.035  71.375  1.00 55.78  ? 216 GLY A O   1 
ATOM 1441  N N   . GLY A 1 220 ? 21.865  53.250  69.768  1.00 45.62  ? 217 GLY A N   1 
ATOM 1442  C CA  . GLY A 1 220 ? 23.203  52.888  70.172  1.00 46.74  ? 217 GLY A CA  1 
ATOM 1443  C C   . GLY A 1 220 ? 23.490  53.237  71.617  1.00 50.15  ? 217 GLY A C   1 
ATOM 1444  O O   . GLY A 1 220 ? 24.114  52.468  72.340  1.00 59.04  ? 217 GLY A O   1 
ATOM 1445  N N   . ASN A 1 221 ? 23.037  54.403  72.047  1.00 43.75  ? 218 ASN A N   1 
ATOM 1446  C CA  . ASN A 1 221 ? 23.304  54.845  73.406  1.00 49.00  ? 218 ASN A CA  1 
ATOM 1447  C C   . ASN A 1 221 ? 22.358  54.242  74.465  1.00 44.11  ? 218 ASN A C   1 
ATOM 1448  O O   . ASN A 1 221 ? 22.769  53.999  75.599  1.00 39.66  ? 218 ASN A O   1 
ATOM 1449  C CB  . ASN A 1 221 ? 23.318  56.372  73.459  1.00 38.81  ? 218 ASN A CB  1 
ATOM 1450  C CG  . ASN A 1 221 ? 23.615  56.911  74.849  1.00 49.90  ? 218 ASN A CG  1 
ATOM 1451  O OD1 . ASN A 1 221 ? 22.755  57.505  75.493  1.00 64.44  ? 218 ASN A OD1 1 
ATOM 1452  N ND2 . ASN A 1 221 ? 24.837  56.699  75.316  1.00 48.29  ? 218 ASN A ND2 1 
ATOM 1453  N N   . LEU A 1 222 ? 21.106  53.989  74.083  1.00 52.10  ? 219 LEU A N   1 
ATOM 1454  C CA  . LEU A 1 222 ? 20.125  53.394  74.996  1.00 47.08  ? 219 LEU A CA  1 
ATOM 1455  C C   . LEU A 1 222 ? 20.560  52.010  75.448  1.00 41.37  ? 219 LEU A C   1 
ATOM 1456  O O   . LEU A 1 222 ? 20.413  51.665  76.613  1.00 36.21  ? 219 LEU A O   1 
ATOM 1457  C CB  . LEU A 1 222 ? 18.723  53.330  74.369  1.00 32.18  ? 219 LEU A CB  1 
ATOM 1458  C CG  . LEU A 1 222 ? 18.014  54.668  74.175  1.00 47.36  ? 219 LEU A CG  1 
ATOM 1459  C CD1 . LEU A 1 222 ? 16.575  54.469  73.732  1.00 44.83  ? 219 LEU A CD1 1 
ATOM 1460  C CD2 . LEU A 1 222 ? 18.080  55.486  75.448  1.00 25.74  ? 219 LEU A CD2 1 
ATOM 1461  N N   . ALA A 1 223 ? 21.121  51.241  74.518  1.00 38.09  ? 220 ALA A N   1 
ATOM 1462  C CA  . ALA A 1 223 ? 21.605  49.888  74.780  1.00 42.39  ? 220 ALA A CA  1 
ATOM 1463  C C   . ALA A 1 223 ? 23.081  49.890  75.151  1.00 56.43  ? 220 ALA A C   1 
ATOM 1464  O O   . ALA A 1 223 ? 23.529  49.078  75.970  1.00 43.53  ? 220 ALA A O   1 
ATOM 1465  C CB  . ALA A 1 223 ? 21.364  48.980  73.555  1.00 36.20  ? 220 ALA A CB  1 
ATOM 1466  N N   . GLY A 1 224 ? 23.829  50.813  74.550  1.00 41.11  ? 221 GLY A N   1 
ATOM 1467  C CA  . GLY A 1 224 ? 25.270  50.880  74.738  1.00 27.22  ? 221 GLY A CA  1 
ATOM 1468  C C   . GLY A 1 224 ? 25.754  51.388  76.091  1.00 45.46  ? 221 GLY A C   1 
ATOM 1469  O O   . GLY A 1 224 ? 26.652  50.801  76.694  1.00 42.62  ? 221 GLY A O   1 
ATOM 1470  N N   . ALA A 1 225 ? 25.164  52.479  76.577  1.00 34.20  ? 222 ALA A N   1 
ATOM 1471  C CA  . ALA A 1 225 ? 25.582  53.047  77.855  1.00 46.07  ? 222 ALA A CA  1 
ATOM 1472  C C   . ALA A 1 225 ? 25.367  52.076  79.037  1.00 33.54  ? 222 ALA A C   1 
ATOM 1473  O O   . ALA A 1 225 ? 26.269  51.868  79.847  1.00 44.55  ? 222 ALA A O   1 
ATOM 1474  C CB  . ALA A 1 225 ? 24.901  54.405  78.098  1.00 32.97  ? 222 ALA A CB  1 
ATOM 1475  N N   . PRO A 1 226 ? 24.181  51.464  79.127  1.00 33.29  ? 223 PRO A N   1 
ATOM 1476  C CA  . PRO A 1 226 ? 24.021  50.454  80.181  1.00 44.10  ? 223 PRO A CA  1 
ATOM 1477  C C   . PRO A 1 226 ? 24.964  49.251  80.012  1.00 45.97  ? 223 PRO A C   1 
ATOM 1478  O O   . PRO A 1 226 ? 25.493  48.772  81.017  1.00 51.66  ? 223 PRO A O   1 
ATOM 1479  C CB  . PRO A 1 226 ? 22.556  50.029  80.048  1.00 25.98  ? 223 PRO A CB  1 
ATOM 1480  C CG  . PRO A 1 226 ? 21.893  51.150  79.318  1.00 35.24  ? 223 PRO A CG  1 
ATOM 1481  C CD  . PRO A 1 226 ? 22.925  51.703  78.391  1.00 39.68  ? 223 PRO A CD  1 
ATOM 1482  N N   . ALA A 1 227 ? 25.176  48.780  78.781  1.00 46.64  ? 224 ALA A N   1 
ATOM 1483  C CA  . ALA A 1 227 ? 26.087  47.657  78.538  1.00 34.49  ? 224 ALA A CA  1 
ATOM 1484  C C   . ALA A 1 227 ? 27.499  48.014  78.979  1.00 43.30  ? 224 ALA A C   1 
ATOM 1485  O O   . ALA A 1 227 ? 28.181  47.227  79.614  1.00 43.62  ? 224 ALA A O   1 
ATOM 1486  C CB  . ALA A 1 227 ? 26.076  47.241  77.083  1.00 38.36  ? 224 ALA A CB  1 
ATOM 1487  N N   . LEU A 1 228 ? 27.934  49.218  78.639  1.00 51.42  ? 225 LEU A N   1 
ATOM 1488  C CA  . LEU A 1 228 ? 29.242  49.696  79.046  1.00 26.81  ? 225 LEU A CA  1 
ATOM 1489  C C   . LEU A 1 228 ? 29.423  49.639  80.551  1.00 42.90  ? 225 LEU A C   1 
ATOM 1490  O O   . LEU A 1 228 ? 30.520  49.356  81.017  1.00 49.38  ? 225 LEU A O   1 
ATOM 1491  C CB  . LEU A 1 228 ? 29.473  51.125  78.560  1.00 34.10  ? 225 LEU A CB  1 
ATOM 1492  C CG  . LEU A 1 228 ? 30.655  51.865  79.203  1.00 42.36  ? 225 LEU A CG  1 
ATOM 1493  C CD1 . LEU A 1 228 ? 31.987  51.363  78.684  1.00 40.29  ? 225 LEU A CD1 1 
ATOM 1494  C CD2 . LEU A 1 228 ? 30.525  53.357  79.005  1.00 31.19  ? 225 LEU A CD2 1 
ATOM 1495  N N   . MET A 1 229 ? 28.353  49.908  81.303  1.00 47.86  ? 226 MET A N   1 
ATOM 1496  C CA  . MET A 1 229 ? 28.431  49.967  82.764  1.00 45.88  ? 226 MET A CA  1 
ATOM 1497  C C   . MET A 1 229 ? 28.273  48.609  83.459  1.00 49.45  ? 226 MET A C   1 
ATOM 1498  O O   . MET A 1 229 ? 28.151  48.538  84.681  1.00 50.97  ? 226 MET A O   1 
ATOM 1499  C CB  . MET A 1 229 ? 27.467  51.010  83.347  1.00 29.76  ? 226 MET A CB  1 
ATOM 1500  C CG  . MET A 1 229 ? 27.741  52.466  82.875  1.00 35.41  ? 226 MET A CG  1 
ATOM 1501  S SD  . MET A 1 229 ? 29.439  53.028  83.073  1.00 23.55  ? 226 MET A SD  1 
ATOM 1502  C CE  . MET A 1 229 ? 29.504  53.279  84.862  1.00 29.45  ? 226 MET A CE  1 
ATOM 1503  N N   . GLY A 1 230 ? 28.289  47.532  82.684  1.00 42.19  ? 227 GLY A N   1 
ATOM 1504  C CA  . GLY A 1 230 ? 28.291  46.187  83.253  1.00 45.81  ? 227 GLY A CA  1 
ATOM 1505  C C   . GLY A 1 230 ? 26.941  45.489  83.263  1.00 48.47  ? 227 GLY A C   1 
ATOM 1506  O O   . GLY A 1 230 ? 26.777  44.449  83.894  1.00 50.39  ? 227 GLY A O   1 
ATOM 1507  N N   . ASN A 1 231 ? 25.978  46.060  82.548  1.00 41.68  ? 228 ASN A N   1 
ATOM 1508  C CA  . ASN A 1 231 ? 24.649  45.488  82.424  1.00 34.77  ? 228 ASN A CA  1 
ATOM 1509  C C   . ASN A 1 231 ? 24.495  44.613  81.195  1.00 48.89  ? 228 ASN A C   1 
ATOM 1510  O O   . ASN A 1 231 ? 25.285  44.719  80.250  1.00 36.15  ? 228 ASN A O   1 
ATOM 1511  C CB  . ASN A 1 231 ? 23.626  46.613  82.386  1.00 37.37  ? 228 ASN A CB  1 
ATOM 1512  C CG  . ASN A 1 231 ? 23.583  47.386  83.691  1.00 50.35  ? 228 ASN A CG  1 
ATOM 1513  O OD1 . ASN A 1 231 ? 23.116  46.876  84.706  1.00 46.53  ? 228 ASN A OD1 1 
ATOM 1514  N ND2 . ASN A 1 231 ? 24.093  48.618  83.677  1.00 33.66  ? 228 ASN A ND2 1 
ATOM 1515  N N   . VAL A 1 232 ? 23.495  43.733  81.226  1.00 45.41  ? 229 VAL A N   1 
ATOM 1516  C CA  . VAL A 1 232 ? 23.084  42.971  80.048  1.00 44.09  ? 229 VAL A CA  1 
ATOM 1517  C C   . VAL A 1 232 ? 21.759  43.569  79.553  1.00 42.77  ? 229 VAL A C   1 
ATOM 1518  O O   . VAL A 1 232 ? 20.968  44.061  80.348  1.00 47.28  ? 229 VAL A O   1 
ATOM 1519  C CB  . VAL A 1 232 ? 22.985  41.445  80.327  1.00 35.44  ? 229 VAL A CB  1 
ATOM 1520  C CG1 . VAL A 1 232 ? 24.330  40.899  80.778  1.00 53.36  ? 229 VAL A CG1 1 
ATOM 1521  C CG2 . VAL A 1 232 ? 21.928  41.137  81.362  1.00 37.77  ? 229 VAL A CG2 1 
ATOM 1522  N N   . VAL A 1 233 ? 21.530  43.573  78.249  1.00 40.80  ? 230 VAL A N   1 
ATOM 1523  C CA  . VAL A 1 233 ? 20.445  44.389  77.691  1.00 42.87  ? 230 VAL A CA  1 
ATOM 1524  C C   . VAL A 1 233 ? 19.589  43.652  76.662  1.00 40.01  ? 230 VAL A C   1 
ATOM 1525  O O   . VAL A 1 233 ? 20.113  42.972  75.791  1.00 45.98  ? 230 VAL A O   1 
ATOM 1526  C CB  . VAL A 1 233 ? 21.017  45.652  77.016  1.00 44.95  ? 230 VAL A CB  1 
ATOM 1527  C CG1 . VAL A 1 233 ? 19.913  46.456  76.339  1.00 46.96  ? 230 VAL A CG1 1 
ATOM 1528  C CG2 . VAL A 1 233 ? 21.800  46.506  78.011  1.00 30.29  ? 230 VAL A CG2 1 
ATOM 1529  N N   . LEU A 1 234 ? 18.274  43.782  76.781  1.00 33.36  ? 231 LEU A N   1 
ATOM 1530  C CA  . LEU A 1 234 ? 17.367  43.407  75.693  1.00 46.29  ? 231 LEU A CA  1 
ATOM 1531  C C   . LEU A 1 234 ? 16.995  44.647  74.891  1.00 44.04  ? 231 LEU A C   1 
ATOM 1532  O O   . LEU A 1 234 ? 16.236  45.492  75.358  1.00 47.99  ? 231 LEU A O   1 
ATOM 1533  C CB  . LEU A 1 234 ? 16.088  42.743  76.221  1.00 34.79  ? 231 LEU A CB  1 
ATOM 1534  C CG  . LEU A 1 234 ? 16.048  41.213  76.157  1.00 51.12  ? 231 LEU A CG  1 
ATOM 1535  C CD1 . LEU A 1 234 ? 17.075  40.608  77.106  1.00 38.60  ? 231 LEU A CD1 1 
ATOM 1536  C CD2 . LEU A 1 234 ? 14.655  40.719  76.490  1.00 48.82  ? 231 LEU A CD2 1 
ATOM 1537  N N   . TRP A 1 235 ? 17.521  44.753  73.683  1.00 38.62  ? 232 TRP A N   1 
ATOM 1538  C CA  . TRP A 1 235 ? 17.282  45.918  72.846  1.00 44.50  ? 232 TRP A CA  1 
ATOM 1539  C C   . TRP A 1 235 ? 16.143  45.725  71.826  1.00 61.03  ? 232 TRP A C   1 
ATOM 1540  O O   . TRP A 1 235 ? 16.279  44.943  70.899  1.00 52.58  ? 232 TRP A O   1 
ATOM 1541  C CB  . TRP A 1 235 ? 18.567  46.256  72.110  1.00 37.35  ? 232 TRP A CB  1 
ATOM 1542  C CG  . TRP A 1 235 ? 18.485  47.484  71.299  1.00 55.99  ? 232 TRP A CG  1 
ATOM 1543  C CD1 . TRP A 1 235 ? 17.538  48.459  71.375  1.00 39.27  ? 232 TRP A CD1 1 
ATOM 1544  C CD2 . TRP A 1 235 ? 19.387  47.878  70.265  1.00 38.25  ? 232 TRP A CD2 1 
ATOM 1545  N NE1 . TRP A 1 235 ? 17.794  49.434  70.450  1.00 37.71  ? 232 TRP A NE1 1 
ATOM 1546  C CE2 . TRP A 1 235 ? 18.931  49.103  69.760  1.00 37.12  ? 232 TRP A CE2 1 
ATOM 1547  C CE3 . TRP A 1 235 ? 20.549  47.320  69.730  1.00 28.57  ? 232 TRP A CE3 1 
ATOM 1548  C CZ2 . TRP A 1 235 ? 19.587  49.772  68.730  1.00 30.67  ? 232 TRP A CZ2 1 
ATOM 1549  C CZ3 . TRP A 1 235 ? 21.208  47.997  68.721  1.00 33.54  ? 232 TRP A CZ3 1 
ATOM 1550  C CH2 . TRP A 1 235 ? 20.725  49.208  68.236  1.00 25.15  ? 232 TRP A CH2 1 
ATOM 1551  N N   . LYS A 1 236 ? 15.028  46.441  72.000  1.00 35.82  ? 233 LYS A N   1 
ATOM 1552  C CA  . LYS A 1 236 ? 13.961  46.495  71.004  1.00 45.30  ? 233 LYS A CA  1 
ATOM 1553  C C   . LYS A 1 236 ? 14.128  47.749  70.148  1.00 39.91  ? 233 LYS A C   1 
ATOM 1554  O O   . LYS A 1 236 ? 13.753  48.847  70.568  1.00 45.95  ? 233 LYS A O   1 
ATOM 1555  C CB  . LYS A 1 236 ? 12.547  46.496  71.647  1.00 26.16  ? 233 LYS A CB  1 
ATOM 1556  C CG  . LYS A 1 236 ? 11.404  46.575  70.591  1.00 26.51  ? 233 LYS A CG  1 
ATOM 1557  C CD  . LYS A 1 236 ? 10.131  47.317  71.103  1.00 35.54  ? 233 LYS A CD  1 
ATOM 1558  C CE  . LYS A 1 236 ? 9.699   48.455  70.182  1.00 49.50  ? 233 LYS A CE  1 
ATOM 1559  N NZ  . LYS A 1 236 ? 9.418   48.067  68.759  1.00 68.05  ? 233 LYS A NZ  1 
ATOM 1560  N N   . PRO A 1 237 ? 14.668  47.595  68.932  1.00 48.32  ? 234 PRO A N   1 
ATOM 1561  C CA  . PRO A 1 237 ? 14.860  48.762  68.058  1.00 43.85  ? 234 PRO A CA  1 
ATOM 1562  C C   . PRO A 1 237 ? 13.576  49.151  67.344  1.00 28.43  ? 234 PRO A C   1 
ATOM 1563  O O   . PRO A 1 237 ? 12.643  48.351  67.255  1.00 55.41  ? 234 PRO A O   1 
ATOM 1564  C CB  . PRO A 1 237 ? 15.890  48.284  67.034  1.00 33.80  ? 234 PRO A CB  1 
ATOM 1565  C CG  . PRO A 1 237 ? 16.273  46.861  67.440  1.00 39.67  ? 234 PRO A CG  1 
ATOM 1566  C CD  . PRO A 1 237 ? 15.161  46.360  68.310  1.00 56.01  ? 234 PRO A CD  1 
ATOM 1567  N N   . SER A 1 238 ? 13.529  50.386  66.867  1.00 46.27  ? 235 SER A N   1 
ATOM 1568  C CA  . SER A 1 238 ? 12.351  50.879  66.175  1.00 44.82  ? 235 SER A CA  1 
ATOM 1569  C C   . SER A 1 238 ? 12.242  50.178  64.829  1.00 66.04  ? 235 SER A C   1 
ATOM 1570  O O   . SER A 1 238 ? 13.224  50.062  64.084  1.00 46.57  ? 235 SER A O   1 
ATOM 1571  C CB  . SER A 1 238 ? 12.427  52.397  65.970  1.00 27.20  ? 235 SER A CB  1 
ATOM 1572  O OG  . SER A 1 238 ? 11.189  52.924  65.543  1.00 79.37  ? 235 SER A OG  1 
ATOM 1573  N N   . ASP A 1 239 ? 11.041  49.704  64.530  1.00 45.25  ? 236 ASP A N   1 
ATOM 1574  C CA  . ASP A 1 239 ? 10.779  49.007  63.286  1.00 52.52  ? 236 ASP A CA  1 
ATOM 1575  C C   . ASP A 1 239 ? 11.155  49.844  62.075  1.00 47.96  ? 236 ASP A C   1 
ATOM 1576  O O   . ASP A 1 239 ? 11.558  49.303  61.046  1.00 44.35  ? 236 ASP A O   1 
ATOM 1577  C CB  . ASP A 1 239 ? 9.310   48.614  63.206  1.00 51.33  ? 236 ASP A CB  1 
ATOM 1578  C CG  . ASP A 1 239 ? 8.897   47.684  64.329  1.00 62.39  ? 236 ASP A CG  1 
ATOM 1579  O OD1 . ASP A 1 239 ? 9.755   47.272  65.140  1.00 86.49  ? 236 ASP A OD1 1 
ATOM 1580  O OD2 . ASP A 1 239 ? 7.701   47.357  64.383  1.00 60.39  ? 236 ASP A OD2 1 
ATOM 1581  N N   . THR A 1 240 ? 11.044  51.164  62.202  1.00 51.75  ? 237 THR A N   1 
ATOM 1582  C CA  . THR A 1 240 ? 11.344  52.047  61.081  1.00 35.37  ? 237 THR A CA  1 
ATOM 1583  C C   . THR A 1 240 ? 12.807  52.501  61.011  1.00 44.06  ? 237 THR A C   1 
ATOM 1584  O O   . THR A 1 240 ? 13.169  53.304  60.161  1.00 50.22  ? 237 THR A O   1 
ATOM 1585  C CB  . THR A 1 240 ? 10.378  53.247  61.013  1.00 44.57  ? 237 THR A CB  1 
ATOM 1586  O OG1 . THR A 1 240 ? 10.403  53.950  62.250  1.00 51.83  ? 237 THR A OG1 1 
ATOM 1587  C CG2 . THR A 1 240 ? 8.950   52.775  60.724  1.00 16.65  ? 237 THR A CG2 1 
ATOM 1588  N N   . ALA A 1 241 ? 13.646  51.963  61.888  1.00 48.92  ? 238 ALA A N   1 
ATOM 1589  C CA  . ALA A 1 241 ? 15.086  52.228  61.835  1.00 42.21  ? 238 ALA A CA  1 
ATOM 1590  C C   . ALA A 1 241 ? 15.896  50.930  61.855  1.00 50.54  ? 238 ALA A C   1 
ATOM 1591  O O   . ALA A 1 241 ? 17.079  50.948  62.190  1.00 46.30  ? 238 ALA A O   1 
ATOM 1592  C CB  . ALA A 1 241 ? 15.503  53.118  63.005  1.00 36.12  ? 238 ALA A CB  1 
ATOM 1593  N N   . MET A 1 242 ? 15.260  49.817  61.491  1.00 42.20  ? 239 MET A N   1 
ATOM 1594  C CA  . MET A 1 242 ? 15.824  48.485  61.694  1.00 46.34  ? 239 MET A CA  1 
ATOM 1595  C C   . MET A 1 242 ? 17.117  48.306  60.925  1.00 45.71  ? 239 MET A C   1 
ATOM 1596  O O   . MET A 1 242 ? 18.100  47.809  61.463  1.00 55.72  ? 239 MET A O   1 
ATOM 1597  C CB  . MET A 1 242 ? 14.797  47.422  61.296  1.00 44.89  ? 239 MET A CB  1 
ATOM 1598  C CG  . MET A 1 242 ? 15.145  45.998  61.680  1.00 59.17  ? 239 MET A CG  1 
ATOM 1599  S SD  . MET A 1 242 ? 15.228  45.733  63.437  1.00 37.59  ? 239 MET A SD  1 
ATOM 1600  C CE  . MET A 1 242 ? 13.890  46.760  64.021  1.00 37.41  ? 239 MET A CE  1 
ATOM 1601  N N   . LEU A 1 243 ? 17.119  48.724  59.665  1.00 44.25  ? 240 LEU A N   1 
ATOM 1602  C CA  . LEU A 1 243 ? 18.298  48.586  58.816  1.00 46.51  ? 240 LEU A CA  1 
ATOM 1603  C C   . LEU A 1 243 ? 19.571  49.162  59.446  1.00 42.98  ? 240 LEU A C   1 
ATOM 1604  O O   . LEU A 1 243 ? 20.571  48.462  59.588  1.00 46.70  ? 240 LEU A O   1 
ATOM 1605  C CB  . LEU A 1 243 ? 18.039  49.215  57.450  1.00 31.35  ? 240 LEU A CB  1 
ATOM 1606  C CG  . LEU A 1 243 ? 19.134  48.992  56.392  1.00 49.78  ? 240 LEU A CG  1 
ATOM 1607  C CD1 . LEU A 1 243 ? 19.203  47.531  55.998  1.00 52.54  ? 240 LEU A CD1 1 
ATOM 1608  C CD2 . LEU A 1 243 ? 18.888  49.825  55.166  1.00 49.75  ? 240 LEU A CD2 1 
ATOM 1609  N N   . ALA A 1 244 ? 19.527  50.439  59.822  1.00 47.25  ? 241 ALA A N   1 
ATOM 1610  C CA  . ALA A 1 244 ? 20.678  51.080  60.450  1.00 43.29  ? 241 ALA A CA  1 
ATOM 1611  C C   . ALA A 1 244 ? 20.940  50.567  61.887  1.00 51.65  ? 241 ALA A C   1 
ATOM 1612  O O   . ALA A 1 244 ? 22.087  50.429  62.281  1.00 35.02  ? 241 ALA A O   1 
ATOM 1613  C CB  . ALA A 1 244 ? 20.561  52.622  60.399  1.00 33.48  ? 241 ALA A CB  1 
ATOM 1614  N N   . SER A 1 245 ? 19.892  50.253  62.653  1.00 36.70  ? 242 SER A N   1 
ATOM 1615  C CA  . SER A 1 245 ? 20.074  49.745  64.032  1.00 41.93  ? 242 SER A CA  1 
ATOM 1616  C C   . SER A 1 245 ? 20.832  48.416  64.064  1.00 48.80  ? 242 SER A C   1 
ATOM 1617  O O   . SER A 1 245 ? 21.668  48.195  64.931  1.00 46.16  ? 242 SER A O   1 
ATOM 1618  C CB  . SER A 1 245 ? 18.740  49.598  64.766  1.00 32.02  ? 242 SER A CB  1 
ATOM 1619  O OG  . SER A 1 245 ? 18.023  50.817  64.758  1.00 38.40  ? 242 SER A OG  1 
ATOM 1620  N N   . TYR A 1 246 ? 20.544  47.538  63.109  1.00 47.67  ? 243 TYR A N   1 
ATOM 1621  C CA  . TYR A 1 246 ? 21.209  46.248  63.038  1.00 43.47  ? 243 TYR A CA  1 
ATOM 1622  C C   . TYR A 1 246 ? 22.647  46.411  62.564  1.00 38.44  ? 243 TYR A C   1 
ATOM 1623  O O   . TYR A 1 246 ? 23.524  45.625  62.891  1.00 57.17  ? 243 TYR A O   1 
ATOM 1624  C CB  . TYR A 1 246 ? 20.458  45.330  62.098  1.00 46.87  ? 243 TYR A CB  1 
ATOM 1625  C CG  . TYR A 1 246 ? 21.019  43.943  62.045  1.00 58.43  ? 243 TYR A CG  1 
ATOM 1626  C CD1 . TYR A 1 246 ? 21.546  43.430  60.863  1.00 67.03  ? 243 TYR A CD1 1 
ATOM 1627  C CD2 . TYR A 1 246 ? 21.030  43.135  63.178  1.00 43.33  ? 243 TYR A CD2 1 
ATOM 1628  C CE1 . TYR A 1 246 ? 22.072  42.145  60.810  1.00 57.03  ? 243 TYR A CE1 1 
ATOM 1629  C CE2 . TYR A 1 246 ? 21.546  41.850  63.138  1.00 61.71  ? 243 TYR A CE2 1 
ATOM 1630  C CZ  . TYR A 1 246 ? 22.065  41.362  61.950  1.00 65.90  ? 243 TYR A CZ  1 
ATOM 1631  O OH  . TYR A 1 246 ? 22.573  40.093  61.903  1.00 56.04  ? 243 TYR A OH  1 
ATOM 1632  N N   . ALA A 1 247 ? 22.883  47.459  61.799  1.00 42.08  ? 244 ALA A N   1 
ATOM 1633  C CA  . ALA A 1 247 ? 24.225  47.776  61.348  1.00 44.17  ? 244 ALA A CA  1 
ATOM 1634  C C   . ALA A 1 247 ? 25.046  48.256  62.532  1.00 59.28  ? 244 ALA A C   1 
ATOM 1635  O O   . ALA A 1 247 ? 26.226  47.943  62.632  1.00 50.72  ? 244 ALA A O   1 
ATOM 1636  C CB  . ALA A 1 247 ? 24.175  48.838  60.246  1.00 31.91  ? 244 ALA A CB  1 
ATOM 1637  N N   . VAL A 1 248 ? 24.412  49.013  63.433  1.00 40.67  ? 245 VAL A N   1 
ATOM 1638  C CA  . VAL A 1 248 ? 25.065  49.406  64.668  1.00 41.86  ? 245 VAL A CA  1 
ATOM 1639  C C   . VAL A 1 248 ? 25.342  48.171  65.517  1.00 43.34  ? 245 VAL A C   1 
ATOM 1640  O O   . VAL A 1 248 ? 26.447  48.005  66.022  1.00 43.85  ? 245 VAL A O   1 
ATOM 1641  C CB  . VAL A 1 248 ? 24.250  50.453  65.473  1.00 45.00  ? 245 VAL A CB  1 
ATOM 1642  C CG1 . VAL A 1 248 ? 24.890  50.677  66.814  1.00 28.46  ? 245 VAL A CG1 1 
ATOM 1643  C CG2 . VAL A 1 248 ? 24.174  51.770  64.718  1.00 36.69  ? 245 VAL A CG2 1 
ATOM 1644  N N   . TYR A 1 249 ? 24.352  47.288  65.631  1.00 41.38  ? 246 TYR A N   1 
ATOM 1645  C CA  . TYR A 1 249 ? 24.514  46.074  66.426  1.00 33.21  ? 246 TYR A CA  1 
ATOM 1646  C C   . TYR A 1 249 ? 25.642  45.173  65.918  1.00 50.21  ? 246 TYR A C   1 
ATOM 1647  O O   . TYR A 1 249 ? 26.447  44.701  66.706  1.00 48.08  ? 246 TYR A O   1 
ATOM 1648  C CB  . TYR A 1 249 ? 23.203  45.304  66.532  1.00 28.79  ? 246 TYR A CB  1 
ATOM 1649  C CG  . TYR A 1 249 ? 23.339  44.027  67.320  1.00 50.53  ? 246 TYR A CG  1 
ATOM 1650  C CD1 . TYR A 1 249 ? 23.355  44.058  68.697  1.00 44.66  ? 246 TYR A CD1 1 
ATOM 1651  C CD2 . TYR A 1 249 ? 23.473  42.789  66.689  1.00 36.43  ? 246 TYR A CD2 1 
ATOM 1652  C CE1 . TYR A 1 249 ? 23.490  42.911  69.440  1.00 46.02  ? 246 TYR A CE1 1 
ATOM 1653  C CE2 . TYR A 1 249 ? 23.613  41.626  67.435  1.00 66.24  ? 246 TYR A CE2 1 
ATOM 1654  C CZ  . TYR A 1 249 ? 23.620  41.704  68.817  1.00 58.26  ? 246 TYR A CZ  1 
ATOM 1655  O OH  . TYR A 1 249 ? 23.754  40.581  69.589  1.00 47.98  ? 246 TYR A OH  1 
ATOM 1656  N N   . ARG A 1 250 ? 25.709  44.950  64.608  1.00 52.15  ? 247 ARG A N   1 
ATOM 1657  C CA  . ARG A 1 250 ? 26.733  44.087  64.031  1.00 47.99  ? 247 ARG A CA  1 
ATOM 1658  C C   . ARG A 1 250 ? 28.123  44.678  64.268  1.00 46.92  ? 247 ARG A C   1 
ATOM 1659  O O   . ARG A 1 250 ? 29.074  43.956  64.515  1.00 49.02  ? 247 ARG A O   1 
ATOM 1660  C CB  . ARG A 1 250 ? 26.468  43.852  62.536  1.00 27.63  ? 247 ARG A CB  1 
ATOM 1661  N N   . ILE A 1 251 ? 28.232  46.001  64.227  1.00 50.70  ? 248 ILE A N   1 
ATOM 1662  C CA  . ILE A 1 251 ? 29.512  46.665  64.445  1.00 39.25  ? 248 ILE A CA  1 
ATOM 1663  C C   . ILE A 1 251 ? 30.030  46.457  65.864  1.00 58.19  ? 248 ILE A C   1 
ATOM 1664  O O   . ILE A 1 251 ? 31.207  46.180  66.067  1.00 44.78  ? 248 ILE A O   1 
ATOM 1665  C CB  . ILE A 1 251 ? 29.429  48.165  64.113  1.00 48.07  ? 248 ILE A CB  1 
ATOM 1666  C CG1 . ILE A 1 251 ? 29.436  48.355  62.593  1.00 54.14  ? 248 ILE A CG1 1 
ATOM 1667  C CG2 . ILE A 1 251 ? 30.592  48.923  64.735  1.00 42.28  ? 248 ILE A CG2 1 
ATOM 1668  C CD1 . ILE A 1 251 ? 29.045  49.749  62.129  1.00 44.52  ? 248 ILE A CD1 1 
ATOM 1669  N N   . LEU A 1 252 ? 29.136  46.567  66.841  1.00 57.09  ? 249 LEU A N   1 
ATOM 1670  C CA  . LEU A 1 252 ? 29.487  46.348  68.239  1.00 50.97  ? 249 LEU A CA  1 
ATOM 1671  C C   . LEU A 1 252 ? 29.953  44.926  68.473  1.00 47.63  ? 249 LEU A C   1 
ATOM 1672  O O   . LEU A 1 252 ? 30.912  44.695  69.205  1.00 51.01  ? 249 LEU A O   1 
ATOM 1673  C CB  . LEU A 1 252 ? 28.298  46.650  69.152  1.00 48.01  ? 249 LEU A CB  1 
ATOM 1674  C CG  . LEU A 1 252 ? 28.179  48.103  69.571  1.00 57.85  ? 249 LEU A CG  1 
ATOM 1675  C CD1 . LEU A 1 252 ? 26.875  48.312  70.304  1.00 48.56  ? 249 LEU A CD1 1 
ATOM 1676  C CD2 . LEU A 1 252 ? 29.366  48.490  70.423  1.00 41.25  ? 249 LEU A CD2 1 
ATOM 1677  N N   . ARG A 1 253 ? 29.257  43.972  67.862  1.00 42.55  ? 250 ARG A N   1 
ATOM 1678  C CA  . ARG A 1 253 ? 29.633  42.570  67.983  1.00 47.08  ? 250 ARG A CA  1 
ATOM 1679  C C   . ARG A 1 253 ? 31.024  42.344  67.392  1.00 66.72  ? 250 ARG A C   1 
ATOM 1680  O O   . ARG A 1 253 ? 31.855  41.668  67.992  1.00 71.28  ? 250 ARG A O   1 
ATOM 1681  C CB  . ARG A 1 253 ? 28.608  41.660  67.316  1.00 30.04  ? 250 ARG A CB  1 
ATOM 1682  C CG  . ARG A 1 253 ? 27.215  41.666  67.965  1.00 43.11  ? 250 ARG A CG  1 
ATOM 1683  C CD  . ARG A 1 253 ? 27.321  41.522  69.471  1.00 40.06  ? 250 ARG A CD  1 
ATOM 1684  N NE  . ARG A 1 253 ? 28.130  40.362  69.790  1.00 40.82  ? 250 ARG A NE  1 
ATOM 1685  C CZ  . ARG A 1 253 ? 27.642  39.132  69.813  1.00 53.72  ? 250 ARG A CZ  1 
ATOM 1686  N NH1 . ARG A 1 253 ? 26.360  38.947  69.539  1.00 43.57  ? 250 ARG A NH1 1 
ATOM 1687  N NH2 . ARG A 1 253 ? 28.428  38.101  70.092  1.00 48.06  ? 250 ARG A NH2 1 
ATOM 1688  N N   . GLU A 1 254 ? 31.290  42.935  66.231  1.00 56.90  ? 251 GLU A N   1 
ATOM 1689  C CA  . GLU A 1 254 ? 32.602  42.785  65.598  1.00 63.66  ? 251 GLU A CA  1 
ATOM 1690  C C   . GLU A 1 254 ? 33.681  43.511  66.379  1.00 57.75  ? 251 GLU A C   1 
ATOM 1691  O O   . GLU A 1 254 ? 34.825  43.080  66.399  1.00 51.99  ? 251 GLU A O   1 
ATOM 1692  C CB  . GLU A 1 254 ? 32.598  43.271  64.145  1.00 44.96  ? 251 GLU A CB  1 
ATOM 1693  C CG  . GLU A 1 254 ? 31.732  42.450  63.219  1.00 70.77  ? 251 GLU A CG  1 
ATOM 1694  C CD  . GLU A 1 254 ? 31.595  43.084  61.844  1.00 90.45  ? 251 GLU A CD  1 
ATOM 1695  O OE1 . GLU A 1 254 ? 32.483  43.885  61.478  1.00 65.46  ? 251 GLU A OE1 1 
ATOM 1696  O OE2 . GLU A 1 254 ? 30.598  42.794  61.139  1.00 78.55  ? 251 GLU A OE2 1 
ATOM 1697  N N   . ALA A 1 255 ? 33.317  44.619  67.014  1.00 48.83  ? 252 ALA A N   1 
ATOM 1698  C CA  . ALA A 1 255 ? 34.263  45.348  67.846  1.00 43.51  ? 252 ALA A CA  1 
ATOM 1699  C C   . ALA A 1 255 ? 34.668  44.550  69.085  1.00 56.29  ? 252 ALA A C   1 
ATOM 1700  O O   . ALA A 1 255 ? 35.621  44.921  69.761  1.00 51.90  ? 252 ALA A O   1 
ATOM 1701  C CB  . ALA A 1 255 ? 33.708  46.707  68.240  1.00 46.81  ? 252 ALA A CB  1 
ATOM 1702  N N   . GLY A 1 256 ? 33.939  43.469  69.382  1.00 49.61  ? 253 GLY A N   1 
ATOM 1703  C CA  . GLY A 1 256 ? 34.293  42.583  70.483  1.00 42.44  ? 253 GLY A CA  1 
ATOM 1704  C C   . GLY A 1 256 ? 33.257  42.335  71.573  1.00 55.24  ? 253 GLY A C   1 
ATOM 1705  O O   . GLY A 1 256 ? 33.514  41.578  72.492  1.00 64.58  ? 253 GLY A O   1 
ATOM 1706  N N   . LEU A 1 257 ? 32.092  42.962  71.483  1.00 53.59  ? 254 LEU A N   1 
ATOM 1707  C CA  . LEU A 1 257 ? 31.038  42.736  72.463  1.00 59.69  ? 254 LEU A CA  1 
ATOM 1708  C C   . LEU A 1 257 ? 30.696  41.257  72.514  1.00 56.65  ? 254 LEU A C   1 
ATOM 1709  O O   . LEU A 1 257 ? 30.313  40.675  71.503  1.00 51.31  ? 254 LEU A O   1 
ATOM 1710  C CB  . LEU A 1 257 ? 29.775  43.541  72.117  1.00 52.44  ? 254 LEU A CB  1 
ATOM 1711  C CG  . LEU A 1 257 ? 28.701  43.602  73.219  1.00 54.89  ? 254 LEU A CG  1 
ATOM 1712  C CD1 . LEU A 1 257 ? 29.120  44.582  74.293  1.00 42.29  ? 254 LEU A CD1 1 
ATOM 1713  C CD2 . LEU A 1 257 ? 27.340  43.999  72.677  1.00 49.87  ? 254 LEU A CD2 1 
ATOM 1714  N N   . PRO A 1 258 ? 30.830  40.644  73.695  1.00 50.52  ? 255 PRO A N   1 
ATOM 1715  C CA  . PRO A 1 258 ? 30.515  39.223  73.842  1.00 42.37  ? 255 PRO A CA  1 
ATOM 1716  C C   . PRO A 1 258 ? 29.022  38.950  73.654  1.00 53.84  ? 255 PRO A C   1 
ATOM 1717  O O   . PRO A 1 258 ? 28.203  39.854  73.808  1.00 68.04  ? 255 PRO A O   1 
ATOM 1718  C CB  . PRO A 1 258 ? 30.927  38.918  75.290  1.00 41.35  ? 255 PRO A CB  1 
ATOM 1719  C CG  . PRO A 1 258 ? 31.900  39.997  75.658  1.00 42.97  ? 255 PRO A CG  1 
ATOM 1720  C CD  . PRO A 1 258 ? 31.446  41.215  74.903  1.00 53.54  ? 255 PRO A CD  1 
ATOM 1721  N N   . PRO A 1 259 ? 28.677  37.697  73.320  1.00 69.62  ? 256 PRO A N   1 
ATOM 1722  C CA  . PRO A 1 259 ? 27.296  37.210  73.180  1.00 64.38  ? 256 PRO A CA  1 
ATOM 1723  C C   . PRO A 1 259 ? 26.473  37.419  74.438  1.00 53.77  ? 256 PRO A C   1 
ATOM 1724  O O   . PRO A 1 259 ? 27.022  37.380  75.527  1.00 54.07  ? 256 PRO A O   1 
ATOM 1725  C CB  . PRO A 1 259 ? 27.473  35.704  72.952  1.00 60.29  ? 256 PRO A CB  1 
ATOM 1726  C CG  . PRO A 1 259 ? 28.886  35.394  73.419  1.00 41.92  ? 256 PRO A CG  1 
ATOM 1727  C CD  . PRO A 1 259 ? 29.661  36.632  73.059  1.00 43.89  ? 256 PRO A CD  1 
ATOM 1728  N N   . ASN A 1 260 ? 25.172  37.637  74.284  1.00 58.04  ? 257 ASN A N   1 
ATOM 1729  C CA  . ASN A 1 260 ? 24.287  37.744  75.436  1.00 57.34  ? 257 ASN A CA  1 
ATOM 1730  C C   . ASN A 1 260 ? 24.502  38.989  76.307  1.00 51.12  ? 257 ASN A C   1 
ATOM 1731  O O   . ASN A 1 260 ? 23.874  39.126  77.345  1.00 58.07  ? 257 ASN A O   1 
ATOM 1732  C CB  . ASN A 1 260 ? 24.383  36.481  76.289  1.00 49.54  ? 257 ASN A CB  1 
ATOM 1733  C CG  . ASN A 1 260 ? 23.996  35.245  75.526  1.00 64.15  ? 257 ASN A CG  1 
ATOM 1734  O OD1 . ASN A 1 260 ? 22.896  35.168  74.980  1.00 53.30  ? 257 ASN A OD1 1 
ATOM 1735  N ND2 . ASN A 1 260 ? 24.911  34.265  75.464  1.00 48.65  ? 257 ASN A ND2 1 
ATOM 1736  N N   . ILE A 1 261 ? 25.399  39.880  75.901  1.00 47.05  ? 258 ILE A N   1 
ATOM 1737  C CA  . ILE A 1 261 ? 25.488  41.185  76.542  1.00 52.20  ? 258 ILE A CA  1 
ATOM 1738  C C   . ILE A 1 261 ? 24.443  42.147  75.972  1.00 50.44  ? 258 ILE A C   1 
ATOM 1739  O O   . ILE A 1 261 ? 23.802  42.883  76.716  1.00 56.41  ? 258 ILE A O   1 
ATOM 1740  C CB  . ILE A 1 261 ? 26.863  41.808  76.419  1.00 46.68  ? 258 ILE A CB  1 
ATOM 1741  C CG1 . ILE A 1 261 ? 27.929  40.822  76.921  1.00 60.46  ? 258 ILE A CG1 1 
ATOM 1742  C CG2 . ILE A 1 261 ? 26.900  43.132  77.181  1.00 40.30  ? 258 ILE A CG2 1 
ATOM 1743  C CD1 . ILE A 1 261 ? 27.687  40.263  78.322  1.00 41.55  ? 258 ILE A CD1 1 
ATOM 1744  N N   . ILE A 1 262 ? 24.266  42.144  74.657  1.00 64.23  ? 259 ILE A N   1 
ATOM 1745  C CA  . ILE A 1 262 ? 23.109  42.822  74.072  1.00 47.31  ? 259 ILE A CA  1 
ATOM 1746  C C   . ILE A 1 262 ? 22.362  41.877  73.143  1.00 42.52  ? 259 ILE A C   1 
ATOM 1747  O O   . ILE A 1 262 ? 22.922  41.347  72.192  1.00 51.31  ? 259 ILE A O   1 
ATOM 1748  C CB  . ILE A 1 262 ? 23.486  44.106  73.319  1.00 46.41  ? 259 ILE A CB  1 
ATOM 1749  C CG1 . ILE A 1 262 ? 24.159  45.096  74.253  1.00 44.09  ? 259 ILE A CG1 1 
ATOM 1750  C CG2 . ILE A 1 262 ? 22.252  44.764  72.721  1.00 33.22  ? 259 ILE A CG2 1 
ATOM 1751  C CD1 . ILE A 1 262 ? 24.551  46.376  73.566  1.00 43.64  ? 259 ILE A CD1 1 
ATOM 1752  N N   . GLN A 1 263 ? 21.100  41.642  73.460  1.00 44.41  ? 260 GLN A N   1 
ATOM 1753  C CA  . GLN A 1 263 ? 20.235  40.835  72.625  1.00 47.06  ? 260 GLN A CA  1 
ATOM 1754  C C   . GLN A 1 263 ? 19.491  41.759  71.647  1.00 62.47  ? 260 GLN A C   1 
ATOM 1755  O O   . GLN A 1 263 ? 18.918  42.785  72.032  1.00 43.46  ? 260 GLN A O   1 
ATOM 1756  C CB  . GLN A 1 263 ? 19.238  40.045  73.493  1.00 48.34  ? 260 GLN A CB  1 
ATOM 1757  C CG  . GLN A 1 263 ? 19.829  39.318  74.709  1.00 46.36  ? 260 GLN A CG  1 
ATOM 1758  C CD  . GLN A 1 263 ? 20.793  38.188  74.328  1.00 65.10  ? 260 GLN A CD  1 
ATOM 1759  O OE1 . GLN A 1 263 ? 21.503  38.260  73.326  1.00 55.06  ? 260 GLN A OE1 1 
ATOM 1760  N NE2 . GLN A 1 263 ? 20.809  37.139  75.130  1.00 41.19  ? 260 GLN A NE2 1 
ATOM 1761  N N   . PHE A 1 264 ? 19.517  41.400  70.376  1.00 44.63  ? 261 PHE A N   1 
ATOM 1762  C CA  . PHE A 1 264 ? 18.839  42.177  69.357  1.00 43.15  ? 261 PHE A CA  1 
ATOM 1763  C C   . PHE A 1 264 ? 17.476  41.547  69.159  1.00 58.61  ? 261 PHE A C   1 
ATOM 1764  O O   . PHE A 1 264 ? 17.357  40.520  68.509  1.00 49.35  ? 261 PHE A O   1 
ATOM 1765  C CB  . PHE A 1 264 ? 19.643  42.156  68.053  1.00 46.58  ? 261 PHE A CB  1 
ATOM 1766  C CG  . PHE A 1 264 ? 19.271  43.252  67.067  1.00 57.80  ? 261 PHE A CG  1 
ATOM 1767  C CD1 . PHE A 1 264 ? 19.781  44.537  67.196  1.00 55.48  ? 261 PHE A CD1 1 
ATOM 1768  C CD2 . PHE A 1 264 ? 18.447  42.984  65.991  1.00 40.70  ? 261 PHE A CD2 1 
ATOM 1769  C CE1 . PHE A 1 264 ? 19.455  45.537  66.283  1.00 48.30  ? 261 PHE A CE1 1 
ATOM 1770  C CE2 . PHE A 1 264 ? 18.102  43.981  65.087  1.00 37.73  ? 261 PHE A CE2 1 
ATOM 1771  C CZ  . PHE A 1 264 ? 18.613  45.257  65.232  1.00 45.74  ? 261 PHE A CZ  1 
ATOM 1772  N N   . VAL A 1 265 ? 16.443  42.168  69.714  1.00 40.12  ? 262 VAL A N   1 
ATOM 1773  C CA  . VAL A 1 265 ? 15.123  41.565  69.707  1.00 45.16  ? 262 VAL A CA  1 
ATOM 1774  C C   . VAL A 1 265 ? 14.023  42.534  69.311  1.00 40.29  ? 262 VAL A C   1 
ATOM 1775  O O   . VAL A 1 265 ? 13.297  43.011  70.172  1.00 62.21  ? 262 VAL A O   1 
ATOM 1776  C CB  . VAL A 1 265 ? 14.800  40.961  71.093  1.00 49.18  ? 262 VAL A CB  1 
ATOM 1777  C CG1 . VAL A 1 265 ? 15.528  39.631  71.263  1.00 38.37  ? 262 VAL A CG1 1 
ATOM 1778  C CG2 . VAL A 1 265 ? 15.178  41.955  72.228  1.00 27.70  ? 262 VAL A CG2 1 
ATOM 1779  N N   . PRO A 1 266 ? 13.893  42.829  68.007  1.00 48.72  ? 263 PRO A N   1 
ATOM 1780  C CA  . PRO A 1 266 ? 12.743  43.612  67.544  1.00 36.20  ? 263 PRO A CA  1 
ATOM 1781  C C   . PRO A 1 266 ? 11.452  42.927  67.995  1.00 43.59  ? 263 PRO A C   1 
ATOM 1782  O O   . PRO A 1 266 ? 11.431  41.709  68.125  1.00 43.96  ? 263 PRO A O   1 
ATOM 1783  C CB  . PRO A 1 266 ? 12.857  43.541  66.012  1.00 43.72  ? 263 PRO A CB  1 
ATOM 1784  C CG  . PRO A 1 266 ? 14.244  43.195  65.736  1.00 45.68  ? 263 PRO A CG  1 
ATOM 1785  C CD  . PRO A 1 266 ? 14.731  42.367  66.893  1.00 39.63  ? 263 PRO A CD  1 
ATOM 1786  N N   . ALA A 1 267 ? 10.392  43.685  68.241  1.00 49.17  ? 264 ALA A N   1 
ATOM 1787  C CA  . ALA A 1 267 ? 9.167   43.080  68.739  1.00 47.94  ? 264 ALA A CA  1 
ATOM 1788  C C   . ALA A 1 267 ? 8.009   44.053  68.652  1.00 50.78  ? 264 ALA A C   1 
ATOM 1789  O O   . ALA A 1 267 ? 8.215   45.252  68.496  1.00 62.37  ? 264 ALA A O   1 
ATOM 1790  C CB  . ALA A 1 267 ? 9.347   42.592  70.188  1.00 37.66  ? 264 ALA A CB  1 
ATOM 1791  N N   . ASP A 1 268 ? 6.791   43.523  68.729  1.00 43.02  ? 265 ASP A N   1 
ATOM 1792  C CA  . ASP A 1 268 ? 5.627   44.359  68.949  1.00 54.28  ? 265 ASP A CA  1 
ATOM 1793  C C   . ASP A 1 268 ? 5.828   45.129  70.262  1.00 44.97  ? 265 ASP A C   1 
ATOM 1794  O O   . ASP A 1 268 ? 6.213   44.548  71.282  1.00 46.31  ? 265 ASP A O   1 
ATOM 1795  C CB  . ASP A 1 268 ? 4.352   43.510  68.983  1.00 55.40  ? 265 ASP A CB  1 
ATOM 1796  C CG  . ASP A 1 268 ? 3.097   44.332  69.267  1.00 78.65  ? 265 ASP A CG  1 
ATOM 1797  O OD1 . ASP A 1 268 ? 2.692   45.125  68.390  1.00 76.53  ? 265 ASP A OD1 1 
ATOM 1798  O OD2 . ASP A 1 268 ? 2.506   44.163  70.356  1.00 73.84  ? 265 ASP A OD2 1 
ATOM 1799  N N   . GLY A 1 269 ? 5.567   46.434  70.222  1.00 60.27  ? 266 GLY A N   1 
ATOM 1800  C CA  . GLY A 1 269 ? 5.769   47.307  71.366  1.00 37.84  ? 266 GLY A CA  1 
ATOM 1801  C C   . GLY A 1 269 ? 5.153   46.808  72.657  1.00 60.94  ? 266 GLY A C   1 
ATOM 1802  O O   . GLY A 1 269 ? 5.860   46.585  73.636  1.00 54.53  ? 266 GLY A O   1 
ATOM 1803  N N   . PRO A 1 270 ? 3.823   46.648  72.666  1.00 53.90  ? 267 PRO A N   1 
ATOM 1804  C CA  . PRO A 1 270 ? 3.078   46.186  73.844  1.00 47.29  ? 267 PRO A CA  1 
ATOM 1805  C C   . PRO A 1 270 ? 3.534   44.821  74.359  1.00 57.81  ? 267 PRO A C   1 
ATOM 1806  O O   . PRO A 1 270 ? 3.720   44.676  75.566  1.00 61.98  ? 267 PRO A O   1 
ATOM 1807  C CB  . PRO A 1 270 ? 1.636   46.128  73.337  1.00 51.93  ? 267 PRO A CB  1 
ATOM 1808  C CG  . PRO A 1 270 ? 1.572   47.203  72.305  1.00 33.37  ? 267 PRO A CG  1 
ATOM 1809  C CD  . PRO A 1 270 ? 2.927   47.128  71.600  1.00 44.13  ? 267 PRO A CD  1 
ATOM 1810  N N   . LEU A 1 271 ? 3.733   43.854  73.464  1.00 45.38  ? 268 LEU A N   1 
ATOM 1811  C CA  . LEU A 1 271 ? 4.199   42.539  73.872  1.00 51.97  ? 268 LEU A CA  1 
ATOM 1812  C C   . LEU A 1 271 ? 5.563   42.618  74.568  1.00 55.53  ? 268 LEU A C   1 
ATOM 1813  O O   . LEU A 1 271 ? 5.760   42.004  75.609  1.00 49.33  ? 268 LEU A O   1 
ATOM 1814  C CB  . LEU A 1 271 ? 4.222   41.574  72.682  1.00 53.54  ? 268 LEU A CB  1 
ATOM 1815  C CG  . LEU A 1 271 ? 4.516   40.091  72.973  1.00 49.95  ? 268 LEU A CG  1 
ATOM 1816  C CD1 . LEU A 1 271 ? 6.014   39.832  73.000  1.00 44.25  ? 268 LEU A CD1 1 
ATOM 1817  C CD2 . LEU A 1 271 ? 3.877   39.671  74.291  1.00 63.22  ? 268 LEU A CD2 1 
ATOM 1818  N N   . PHE A 1 272 ? 6.491   43.385  74.001  1.00 55.52  ? 269 PHE A N   1 
ATOM 1819  C CA  . PHE A 1 272 ? 7.805   43.575  74.610  1.00 47.73  ? 269 PHE A CA  1 
ATOM 1820  C C   . PHE A 1 272 ? 7.639   44.218  75.984  1.00 47.38  ? 269 PHE A C   1 
ATOM 1821  O O   . PHE A 1 272 ? 8.165   43.735  76.976  1.00 49.48  ? 269 PHE A O   1 
ATOM 1822  C CB  . PHE A 1 272 ? 8.692   44.441  73.709  1.00 44.62  ? 269 PHE A CB  1 
ATOM 1823  C CG  . PHE A 1 272 ? 10.091  44.622  74.222  1.00 53.18  ? 269 PHE A CG  1 
ATOM 1824  C CD1 . PHE A 1 272 ? 11.067  43.682  73.939  1.00 45.56  ? 269 PHE A CD1 1 
ATOM 1825  C CD2 . PHE A 1 272 ? 10.440  45.746  74.979  1.00 31.81  ? 269 PHE A CD2 1 
ATOM 1826  C CE1 . PHE A 1 272 ? 12.372  43.850  74.411  1.00 61.35  ? 269 PHE A CE1 1 
ATOM 1827  C CE2 . PHE A 1 272 ? 11.737  45.919  75.461  1.00 31.45  ? 269 PHE A CE2 1 
ATOM 1828  C CZ  . PHE A 1 272 ? 12.707  44.964  75.170  1.00 45.54  ? 269 PHE A CZ  1 
ATOM 1829  N N   . GLY A 1 273 ? 6.888   45.308  76.038  1.00 45.96  ? 270 GLY A N   1 
ATOM 1830  C CA  . GLY A 1 273 ? 6.661   46.008  77.291  1.00 38.50  ? 270 GLY A CA  1 
ATOM 1831  C C   . GLY A 1 273 ? 6.057   45.096  78.335  1.00 56.57  ? 270 GLY A C   1 
ATOM 1832  O O   . GLY A 1 273 ? 6.478   45.103  79.485  1.00 49.29  ? 270 GLY A O   1 
ATOM 1833  N N   . ASP A 1 274 ? 5.076   44.298  77.928  1.00 35.99  ? 271 ASP A N   1 
ATOM 1834  C CA  . ASP A 1 274 ? 4.398   43.371  78.830  1.00 48.11  ? 271 ASP A CA  1 
ATOM 1835  C C   . ASP A 1 274 ? 5.347   42.316  79.387  1.00 43.25  ? 271 ASP A C   1 
ATOM 1836  O O   . ASP A 1 274 ? 5.327   42.025  80.572  1.00 49.26  ? 271 ASP A O   1 
ATOM 1837  C CB  . ASP A 1 274 ? 3.219   42.686  78.121  1.00 48.24  ? 271 ASP A CB  1 
ATOM 1838  C CG  . ASP A 1 274 ? 2.069   43.641  77.816  1.00 70.08  ? 271 ASP A CG  1 
ATOM 1839  O OD1 . ASP A 1 274 ? 2.179   44.866  78.088  1.00 80.07  ? 271 ASP A OD1 1 
ATOM 1840  O OD2 . ASP A 1 274 ? 1.061   43.151  77.276  1.00 60.28  ? 271 ASP A OD2 1 
ATOM 1841  N N   . THR A 1 275 ? 6.190   41.766  78.524  1.00 40.29  ? 272 THR A N   1 
ATOM 1842  C CA  . THR A 1 275 ? 7.091   40.704  78.904  1.00 39.14  ? 272 THR A CA  1 
ATOM 1843  C C   . THR A 1 275 ? 8.180   41.149  79.866  1.00 63.21  ? 272 THR A C   1 
ATOM 1844  O O   . THR A 1 275 ? 8.436   40.480  80.874  1.00 59.74  ? 272 THR A O   1 
ATOM 1845  C CB  . THR A 1 275 ? 7.769   40.068  77.696  1.00 42.55  ? 272 THR A CB  1 
ATOM 1846  O OG1 . THR A 1 275 ? 6.780   39.603  76.788  1.00 50.73  ? 272 THR A OG1 1 
ATOM 1847  C CG2 . THR A 1 275 ? 8.589   38.882  78.140  1.00 41.85  ? 272 THR A CG2 1 
ATOM 1848  N N   . VAL A 1 276 ? 8.836   42.259  79.553  1.00 42.85  ? 273 VAL A N   1 
ATOM 1849  C CA  . VAL A 1 276 ? 9.943   42.717  80.398  1.00 52.08  ? 273 VAL A CA  1 
ATOM 1850  C C   . VAL A 1 276 ? 9.484   43.289  81.742  1.00 48.44  ? 273 VAL A C   1 
ATOM 1851  O O   . VAL A 1 276 ? 10.158  43.103  82.749  1.00 44.82  ? 273 VAL A O   1 
ATOM 1852  C CB  . VAL A 1 276 ? 10.910  43.703  79.680  1.00 48.21  ? 273 VAL A CB  1 
ATOM 1853  C CG1 . VAL A 1 276 ? 11.472  43.088  78.403  1.00 45.76  ? 273 VAL A CG1 1 
ATOM 1854  C CG2 . VAL A 1 276 ? 10.212  45.036  79.414  1.00 41.60  ? 273 VAL A CG2 1 
ATOM 1855  N N   . THR A 1 277 ? 8.340   43.961  81.774  1.00 43.87  ? 274 THR A N   1 
ATOM 1856  C CA  . THR A 1 277 ? 7.807   44.431  83.053  1.00 45.46  ? 274 THR A CA  1 
ATOM 1857  C C   . THR A 1 277 ? 7.169   43.297  83.867  1.00 59.10  ? 274 THR A C   1 
ATOM 1858  O O   . THR A 1 277 ? 6.705   43.520  84.968  1.00 51.55  ? 274 THR A O   1 
ATOM 1859  C CB  . THR A 1 277 ? 6.810   45.588  82.897  1.00 48.69  ? 274 THR A CB  1 
ATOM 1860  O OG1 . THR A 1 277 ? 5.688   45.159  82.124  1.00 45.36  ? 274 THR A OG1 1 
ATOM 1861  C CG2 . THR A 1 277 ? 7.467   46.740  82.206  1.00 37.40  ? 274 THR A CG2 1 
ATOM 1862  N N   . SER A 1 278 ? 7.147   42.088  83.313  1.00 42.04  ? 275 SER A N   1 
ATOM 1863  C CA  . SER A 1 278 ? 6.674   40.904  84.033  1.00 60.87  ? 275 SER A CA  1 
ATOM 1864  C C   . SER A 1 278 ? 7.799   40.024  84.568  1.00 61.65  ? 275 SER A C   1 
ATOM 1865  O O   . SER A 1 278 ? 7.554   39.149  85.393  1.00 61.16  ? 275 SER A O   1 
ATOM 1866  C CB  . SER A 1 278 ? 5.760   40.062  83.146  1.00 58.38  ? 275 SER A CB  1 
ATOM 1867  O OG  . SER A 1 278 ? 4.540   40.732  82.908  1.00 60.55  ? 275 SER A OG  1 
ATOM 1868  N N   . SER A 1 279 ? 9.019   40.245  84.085  1.00 49.11  ? 276 SER A N   1 
ATOM 1869  C CA  . SER A 1 279 ? 10.180  39.510  84.580  1.00 52.41  ? 276 SER A CA  1 
ATOM 1870  C C   . SER A 1 279 ? 10.635  40.030  85.942  1.00 46.02  ? 276 SER A C   1 
ATOM 1871  O O   . SER A 1 279 ? 10.790  41.229  86.144  1.00 49.79  ? 276 SER A O   1 
ATOM 1872  C CB  . SER A 1 279 ? 11.341  39.556  83.578  1.00 46.72  ? 276 SER A CB  1 
ATOM 1873  O OG  . SER A 1 279 ? 12.469  38.856  84.067  1.00 44.80  ? 276 SER A OG  1 
ATOM 1874  N N   . GLU A 1 280 ? 10.833  39.104  86.869  1.00 48.13  ? 277 GLU A N   1 
ATOM 1875  C CA  . GLU A 1 280 ? 11.333  39.406  88.209  1.00 53.28  ? 277 GLU A CA  1 
ATOM 1876  C C   . GLU A 1 280 ? 12.753  39.976  88.133  1.00 47.06  ? 277 GLU A C   1 
ATOM 1877  O O   . GLU A 1 280 ? 13.278  40.521  89.103  1.00 58.60  ? 277 GLU A O   1 
ATOM 1878  C CB  . GLU A 1 280 ? 11.325  38.122  89.033  1.00 47.01  ? 277 GLU A CB  1 
ATOM 1879  C CG  . GLU A 1 280 ? 12.006  36.958  88.309  1.00 77.46  ? 277 GLU A CG  1 
ATOM 1880  C CD  . GLU A 1 280 ? 11.893  35.627  89.040  1.00 88.74  ? 277 GLU A CD  1 
ATOM 1881  O OE1 . GLU A 1 280 ? 11.170  34.744  88.546  1.00 76.56  ? 277 GLU A OE1 1 
ATOM 1882  O OE2 . GLU A 1 280 ? 12.539  35.447  90.095  1.00 92.65  ? 277 GLU A OE2 1 
ATOM 1883  N N   . HIS A 1 281 ? 13.360  39.860  86.954  1.00 48.89  ? 278 HIS A N   1 
ATOM 1884  C CA  . HIS A 1 281 ? 14.764  40.197  86.774  1.00 33.12  ? 278 HIS A CA  1 
ATOM 1885  C C   . HIS A 1 281 ? 14.980  41.558  86.185  1.00 53.33  ? 278 HIS A C   1 
ATOM 1886  O O   . HIS A 1 281 ? 16.110  41.983  86.025  1.00 42.30  ? 278 HIS A O   1 
ATOM 1887  C CB  . HIS A 1 281 ? 15.459  39.149  85.912  1.00 39.76  ? 278 HIS A CB  1 
ATOM 1888  C CG  . HIS A 1 281 ? 15.442  37.780  86.518  1.00 69.53  ? 278 HIS A CG  1 
ATOM 1889  N ND1 . HIS A 1 281 ? 16.129  37.467  87.670  1.00 55.87  ? 278 HIS A ND1 1 
ATOM 1890  C CD2 . HIS A 1 281 ? 14.808  36.647  86.137  1.00 48.69  ? 278 HIS A CD2 1 
ATOM 1891  C CE1 . HIS A 1 281 ? 15.916  36.199  87.973  1.00 66.07  ? 278 HIS A CE1 1 
ATOM 1892  N NE2 . HIS A 1 281 ? 15.121  35.679  87.056  1.00 46.78  ? 278 HIS A NE2 1 
ATOM 1893  N N   . LEU A 1 282 ? 13.895  42.235  85.834  1.00 53.99  ? 279 LEU A N   1 
ATOM 1894  C CA  . LEU A 1 282 ? 14.007  43.589  85.331  1.00 43.17  ? 279 LEU A CA  1 
ATOM 1895  C C   . LEU A 1 282 ? 14.657  44.487  86.372  1.00 39.69  ? 279 LEU A C   1 
ATOM 1896  O O   . LEU A 1 282 ? 14.177  44.580  87.490  1.00 53.30  ? 279 LEU A O   1 
ATOM 1897  C CB  . LEU A 1 282 ? 12.633  44.131  84.959  1.00 36.43  ? 279 LEU A CB  1 
ATOM 1898  C CG  . LEU A 1 282 ? 12.649  45.489  84.263  1.00 46.62  ? 279 LEU A CG  1 
ATOM 1899  C CD1 . LEU A 1 282 ? 13.165  45.336  82.839  1.00 37.95  ? 279 LEU A CD1 1 
ATOM 1900  C CD2 . LEU A 1 282 ? 11.263  46.101  84.294  1.00 37.56  ? 279 LEU A CD2 1 
ATOM 1901  N N   . CYS A 1 283 ? 15.757  45.139  86.005  1.00 41.76  ? 280 CYS A N   1 
ATOM 1902  C CA  . CYS A 1 283 ? 16.384  46.120  86.884  1.00 36.22  ? 280 CYS A CA  1 
ATOM 1903  C C   . CYS A 1 283 ? 16.413  47.529  86.256  1.00 51.08  ? 280 CYS A C   1 
ATOM 1904  O O   . CYS A 1 283 ? 16.752  48.504  86.921  1.00 46.77  ? 280 CYS A O   1 
ATOM 1905  C CB  . CYS A 1 283 ? 17.791  45.692  87.285  1.00 41.16  ? 280 CYS A CB  1 
ATOM 1906  S SG  . CYS A 1 283 ? 18.910  45.533  85.849  1.00 52.52  ? 280 CYS A SG  1 
ATOM 1907  N N   . GLY A 1 284 ? 16.045  47.641  84.985  1.00 36.74  ? 281 GLY A N   1 
ATOM 1908  C CA  . GLY A 1 284 ? 15.934  48.951  84.375  1.00 28.56  ? 281 GLY A CA  1 
ATOM 1909  C C   . GLY A 1 284 ? 15.228  48.993  83.037  1.00 38.03  ? 281 GLY A C   1 
ATOM 1910  O O   . GLY A 1 284 ? 15.179  48.000  82.301  1.00 44.64  ? 281 GLY A O   1 
ATOM 1911  N N   . ILE A 1 285 ? 14.675  50.162  82.728  1.00 39.82  ? 282 ILE A N   1 
ATOM 1912  C CA  . ILE A 1 285 ? 14.150  50.462  81.393  1.00 29.85  ? 282 ILE A CA  1 
ATOM 1913  C C   . ILE A 1 285 ? 14.725  51.777  80.890  1.00 35.88  ? 282 ILE A C   1 
ATOM 1914  O O   . ILE A 1 285 ? 14.569  52.808  81.526  1.00 45.80  ? 282 ILE A O   1 
ATOM 1915  C CB  . ILE A 1 285 ? 12.631  50.577  81.364  1.00 46.45  ? 282 ILE A CB  1 
ATOM 1916  C CG1 . ILE A 1 285 ? 11.989  49.302  81.892  1.00 37.62  ? 282 ILE A CG1 1 
ATOM 1917  C CG2 . ILE A 1 285 ? 12.167  50.909  79.951  1.00 39.35  ? 282 ILE A CG2 1 
ATOM 1918  C CD1 . ILE A 1 285 ? 10.481  49.357  81.876  1.00 47.95  ? 282 ILE A CD1 1 
ATOM 1919  N N   . ASN A 1 286 ? 15.399  51.719  79.747  1.00 41.51  ? 283 ASN A N   1 
ATOM 1920  C CA  . ASN A 1 286 ? 15.984  52.886  79.111  1.00 41.76  ? 283 ASN A CA  1 
ATOM 1921  C C   . ASN A 1 286 ? 15.168  53.211  77.856  1.00 46.20  ? 283 ASN A C   1 
ATOM 1922  O O   . ASN A 1 286 ? 15.281  52.543  76.840  1.00 37.62  ? 283 ASN A O   1 
ATOM 1923  C CB  . ASN A 1 286 ? 17.450  52.620  78.755  1.00 27.68  ? 283 ASN A CB  1 
ATOM 1924  C CG  . ASN A 1 286 ? 18.275  53.887  78.719  1.00 46.34  ? 283 ASN A CG  1 
ATOM 1925  O OD1 . ASN A 1 286 ? 17.821  54.956  79.129  1.00 38.80  ? 283 ASN A OD1 1 
ATOM 1926  N ND2 . ASN A 1 286 ? 19.507  53.767  78.257  1.00 38.02  ? 283 ASN A ND2 1 
ATOM 1927  N N   . PHE A 1 287 ? 14.335  54.236  77.954  1.00 40.28  ? 284 PHE A N   1 
ATOM 1928  C CA  . PHE A 1 287 ? 13.284  54.488  76.994  1.00 35.57  ? 284 PHE A CA  1 
ATOM 1929  C C   . PHE A 1 287 ? 13.444  55.841  76.348  1.00 47.65  ? 284 PHE A C   1 
ATOM 1930  O O   . PHE A 1 287 ? 13.768  56.838  77.009  1.00 54.84  ? 284 PHE A O   1 
ATOM 1931  C CB  . PHE A 1 287 ? 11.910  54.433  77.690  1.00 41.17  ? 284 PHE A CB  1 
ATOM 1932  C CG  . PHE A 1 287 ? 10.763  54.805  76.794  1.00 41.45  ? 284 PHE A CG  1 
ATOM 1933  C CD1 . PHE A 1 287 ? 10.292  56.106  76.752  1.00 38.62  ? 284 PHE A CD1 1 
ATOM 1934  C CD2 . PHE A 1 287 ? 10.170  53.860  75.976  1.00 43.16  ? 284 PHE A CD2 1 
ATOM 1935  C CE1 . PHE A 1 287 ? 9.249   56.450  75.921  1.00 48.64  ? 284 PHE A CE1 1 
ATOM 1936  C CE2 . PHE A 1 287 ? 9.118   54.202  75.141  1.00 54.90  ? 284 PHE A CE2 1 
ATOM 1937  C CZ  . PHE A 1 287 ? 8.661   55.499  75.112  1.00 64.41  ? 284 PHE A CZ  1 
ATOM 1938  N N   . THR A 1 288 ? 13.218  55.871  75.043  1.00 41.39  ? 285 THR A N   1 
ATOM 1939  C CA  . THR A 1 288 ? 13.026  57.127  74.310  1.00 42.55  ? 285 THR A CA  1 
ATOM 1940  C C   . THR A 1 288 ? 11.831  56.995  73.380  1.00 36.71  ? 285 THR A C   1 
ATOM 1941  O O   . THR A 1 288 ? 11.680  55.992  72.694  1.00 61.59  ? 285 THR A O   1 
ATOM 1942  C CB  . THR A 1 288 ? 14.256  57.529  73.511  1.00 51.90  ? 285 THR A CB  1 
ATOM 1943  O OG1 . THR A 1 288 ? 15.364  57.697  74.404  1.00 52.30  ? 285 THR A OG1 1 
ATOM 1944  C CG2 . THR A 1 288 ? 13.998  58.847  72.790  1.00 42.65  ? 285 THR A CG2 1 
ATOM 1945  N N   . GLY A 1 289 ? 10.973  58.001  73.373  1.00 38.56  ? 286 GLY A N   1 
ATOM 1946  C CA  . GLY A 1 289 ? 9.741   57.945  72.607  1.00 27.95  ? 286 GLY A CA  1 
ATOM 1947  C C   . GLY A 1 289 ? 8.638   58.791  73.223  1.00 46.72  ? 286 GLY A C   1 
ATOM 1948  O O   . GLY A 1 289 ? 8.904   59.876  73.722  1.00 53.47  ? 286 GLY A O   1 
ATOM 1949  N N   . SER A 1 290 ? 7.407   58.294  73.207  1.00 44.39  ? 287 SER A N   1 
ATOM 1950  C CA  . SER A 1 290 ? 6.258   59.104  73.590  1.00 51.00  ? 287 SER A CA  1 
ATOM 1951  C C   . SER A 1 290 ? 5.955   59.053  75.080  1.00 46.57  ? 287 SER A C   1 
ATOM 1952  O O   . SER A 1 290 ? 6.137   58.028  75.716  1.00 59.91  ? 287 SER A O   1 
ATOM 1953  C CB  . SER A 1 290 ? 5.019   58.702  72.776  1.00 51.64  ? 287 SER A CB  1 
ATOM 1954  O OG  . SER A 1 290 ? 4.567   57.400  73.078  1.00 50.24  ? 287 SER A OG  1 
ATOM 1955  N N   . VAL A 1 291 ? 5.495   60.177  75.626  1.00 45.11  ? 288 VAL A N   1 
ATOM 1956  C CA  . VAL A 1 291 ? 5.114   60.279  77.033  1.00 54.23  ? 288 VAL A CA  1 
ATOM 1957  C C   . VAL A 1 291 ? 4.138   59.181  77.494  1.00 58.56  ? 288 VAL A C   1 
ATOM 1958  O O   . VAL A 1 291 ? 4.367   58.568  78.527  1.00 66.47  ? 288 VAL A O   1 
ATOM 1959  C CB  . VAL A 1 291 ? 4.489   61.653  77.347  1.00 60.29  ? 288 VAL A CB  1 
ATOM 1960  C CG1 . VAL A 1 291 ? 4.487   61.898  78.832  1.00 63.80  ? 288 VAL A CG1 1 
ATOM 1961  C CG2 . VAL A 1 291 ? 5.242   62.744  76.640  1.00 74.53  ? 288 VAL A CG2 1 
ATOM 1962  N N   . PRO A 1 292 ? 3.053   58.929  76.729  1.00 60.33  ? 289 PRO A N   1 
ATOM 1963  C CA  . PRO A 1 292 ? 2.053   57.929  77.139  1.00 55.66  ? 289 PRO A CA  1 
ATOM 1964  C C   . PRO A 1 292 ? 2.603   56.510  77.256  1.00 64.73  ? 289 PRO A C   1 
ATOM 1965  O O   . PRO A 1 292 ? 2.210   55.761  78.157  1.00 57.42  ? 289 PRO A O   1 
ATOM 1966  C CB  . PRO A 1 292 ? 1.009   57.987  76.013  1.00 58.15  ? 289 PRO A CB  1 
ATOM 1967  C CG  . PRO A 1 292 ? 1.217   59.325  75.356  1.00 52.32  ? 289 PRO A CG  1 
ATOM 1968  C CD  . PRO A 1 292 ? 2.676   59.599  75.469  1.00 52.93  ? 289 PRO A CD  1 
ATOM 1969  N N   . THR A 1 293 ? 3.488   56.136  76.337  1.00 47.94  ? 290 THR A N   1 
ATOM 1970  C CA  . THR A 1 293 ? 4.114   54.824  76.388  1.00 52.12  ? 290 THR A CA  1 
ATOM 1971  C C   . THR A 1 293 ? 5.037   54.719  77.596  1.00 47.52  ? 290 THR A C   1 
ATOM 1972  O O   . THR A 1 293 ? 5.054   53.701  78.293  1.00 54.73  ? 290 THR A O   1 
ATOM 1973  C CB  . THR A 1 293 ? 4.908   54.518  75.108  1.00 51.77  ? 290 THR A CB  1 
ATOM 1974  O OG1 . THR A 1 293 ? 4.042   54.631  73.974  1.00 60.28  ? 290 THR A OG1 1 
ATOM 1975  C CG2 . THR A 1 293 ? 5.490   53.088  75.164  1.00 28.61  ? 290 THR A CG2 1 
ATOM 1976  N N   . PHE A 1 294 ? 5.807   55.775  77.842  1.00 31.75  ? 291 PHE A N   1 
ATOM 1977  C CA  . PHE A 1 294 ? 6.658   55.814  79.031  1.00 50.83  ? 291 PHE A CA  1 
ATOM 1978  C C   . PHE A 1 294 ? 5.873   55.742  80.346  1.00 29.57  ? 291 PHE A C   1 
ATOM 1979  O O   . PHE A 1 294 ? 6.239   54.972  81.242  1.00 59.32  ? 291 PHE A O   1 
ATOM 1980  C CB  . PHE A 1 294 ? 7.562   57.031  79.021  1.00 31.35  ? 291 PHE A CB  1 
ATOM 1981  C CG  . PHE A 1 294 ? 8.563   57.041  80.138  1.00 45.77  ? 291 PHE A CG  1 
ATOM 1982  C CD1 . PHE A 1 294 ? 9.495   56.019  80.266  1.00 36.90  ? 291 PHE A CD1 1 
ATOM 1983  C CD2 . PHE A 1 294 ? 8.571   58.072  81.072  1.00 44.65  ? 291 PHE A CD2 1 
ATOM 1984  C CE1 . PHE A 1 294 ? 10.430  56.028  81.307  1.00 37.23  ? 291 PHE A CE1 1 
ATOM 1985  C CE2 . PHE A 1 294 ? 9.494   58.089  82.101  1.00 47.12  ? 291 PHE A CE2 1 
ATOM 1986  C CZ  . PHE A 1 294 ? 10.431  57.067  82.215  1.00 44.13  ? 291 PHE A CZ  1 
ATOM 1987  N N   . LYS A 1 295 ? 4.792   56.515  80.459  1.00 38.15  ? 292 LYS A N   1 
ATOM 1988  C CA  . LYS A 1 295 ? 3.927   56.466  81.652  1.00 44.02  ? 292 LYS A CA  1 
ATOM 1989  C C   . LYS A 1 295 ? 3.313   55.080  81.827  1.00 37.27  ? 292 LYS A C   1 
ATOM 1990  O O   . LYS A 1 295 ? 3.202   54.566  82.937  1.00 55.45  ? 292 LYS A O   1 
ATOM 1991  C CB  . LYS A 1 295 ? 2.814   57.511  81.589  1.00 41.73  ? 292 LYS A CB  1 
ATOM 1992  C CG  . LYS A 1 295 ? 3.249   58.962  81.788  1.00 35.20  ? 292 LYS A CG  1 
ATOM 1993  C CD  . LYS A 1 295 ? 2.120   59.891  81.345  1.00 45.02  ? 292 LYS A CD  1 
ATOM 1994  C CE  . LYS A 1 295 ? 2.251   61.265  81.965  1.00 81.06  ? 292 LYS A CE  1 
ATOM 1995  N NZ  . LYS A 1 295 ? 1.177   62.188  81.496  1.00 86.04  ? 292 LYS A NZ  1 
ATOM 1996  N N   . HIS A 1 296 ? 2.951   54.462  80.713  1.00 46.72  ? 293 HIS A N   1 
ATOM 1997  C CA  . HIS A 1 296 ? 2.390   53.128  80.757  1.00 53.23  ? 293 HIS A CA  1 
ATOM 1998  C C   . HIS A 1 296 ? 3.375   52.086  81.299  1.00 36.67  ? 293 HIS A C   1 
ATOM 1999  O O   . HIS A 1 296 ? 2.999   51.237  82.090  1.00 38.95  ? 293 HIS A O   1 
ATOM 2000  C CB  . HIS A 1 296 ? 1.873   52.710  79.386  1.00 37.65  ? 293 HIS A CB  1 
ATOM 2001  C CG  . HIS A 1 296 ? 1.231   51.368  79.394  1.00 51.60  ? 293 HIS A CG  1 
ATOM 2002  N ND1 . HIS A 1 296 ? 1.711   50.314  78.655  1.00 40.55  ? 293 HIS A ND1 1 
ATOM 2003  C CD2 . HIS A 1 296 ? 0.174   50.893  80.094  1.00 59.72  ? 293 HIS A CD2 1 
ATOM 2004  C CE1 . HIS A 1 296 ? 0.963   49.249  78.881  1.00 53.45  ? 293 HIS A CE1 1 
ATOM 2005  N NE2 . HIS A 1 296 ? 0.026   49.573  79.752  1.00 61.68  ? 293 HIS A NE2 1 
ATOM 2006  N N   . LEU A 1 297 ? 4.634   52.166  80.873  1.00 34.86  ? 294 LEU A N   1 
ATOM 2007  C CA  . LEU A 1 297 ? 5.669   51.235  81.330  1.00 46.07  ? 294 LEU A CA  1 
ATOM 2008  C C   . LEU A 1 297 ? 5.914   51.446  82.811  1.00 37.45  ? 294 LEU A C   1 
ATOM 2009  O O   . LEU A 1 297 ? 6.051   50.498  83.571  1.00 51.41  ? 294 LEU A O   1 
ATOM 2010  C CB  . LEU A 1 297 ? 6.969   51.425  80.538  1.00 33.68  ? 294 LEU A CB  1 
ATOM 2011  C CG  . LEU A 1 297 ? 6.895   50.960  79.084  1.00 50.33  ? 294 LEU A CG  1 
ATOM 2012  C CD1 . LEU A 1 297 ? 8.054   51.513  78.287  1.00 31.30  ? 294 LEU A CD1 1 
ATOM 2013  C CD2 . LEU A 1 297 ? 6.862   49.437  79.004  1.00 33.90  ? 294 LEU A CD2 1 
ATOM 2014  N N   . TRP A 1 298 ? 5.938   52.711  83.206  1.00 44.89  ? 295 TRP A N   1 
ATOM 2015  C CA  . TRP A 1 298 ? 6.102   53.107  84.591  1.00 47.68  ? 295 TRP A CA  1 
ATOM 2016  C C   . TRP A 1 298 ? 4.991   52.547  85.489  1.00 51.14  ? 295 TRP A C   1 
ATOM 2017  O O   . TRP A 1 298 ? 5.244   52.112  86.618  1.00 53.88  ? 295 TRP A O   1 
ATOM 2018  C CB  . TRP A 1 298 ? 6.128   54.625  84.654  1.00 31.44  ? 295 TRP A CB  1 
ATOM 2019  C CG  . TRP A 1 298 ? 6.344   55.243  86.022  1.00 48.10  ? 295 TRP A CG  1 
ATOM 2020  C CD1 . TRP A 1 298 ? 5.609   55.028  87.163  1.00 47.34  ? 295 TRP A CD1 1 
ATOM 2021  C CD2 . TRP A 1 298 ? 7.313   56.237  86.355  1.00 49.49  ? 295 TRP A CD2 1 
ATOM 2022  N NE1 . TRP A 1 298 ? 6.078   55.809  88.182  1.00 42.42  ? 295 TRP A NE1 1 
ATOM 2023  C CE2 . TRP A 1 298 ? 7.125   56.562  87.721  1.00 38.28  ? 295 TRP A CE2 1 
ATOM 2024  C CE3 . TRP A 1 298 ? 8.329   56.888  85.630  1.00 26.81  ? 295 TRP A CE3 1 
ATOM 2025  C CZ2 . TRP A 1 298 ? 7.938   57.494  88.394  1.00 41.01  ? 295 TRP A CZ2 1 
ATOM 2026  C CZ3 . TRP A 1 298 ? 9.142   57.815  86.303  1.00 48.70  ? 295 TRP A CZ3 1 
ATOM 2027  C CH2 . TRP A 1 298 ? 8.939   58.101  87.676  1.00 48.49  ? 295 TRP A CH2 1 
ATOM 2028  N N   . LYS A 1 299 ? 3.766   52.551  84.979  1.00 51.68  ? 296 LYS A N   1 
ATOM 2029  C CA  . LYS A 1 299 ? 2.629   52.027  85.724  1.00 51.23  ? 296 LYS A CA  1 
ATOM 2030  C C   . LYS A 1 299 ? 2.654   50.524  85.819  1.00 51.69  ? 296 LYS A C   1 
ATOM 2031  O O   . LYS A 1 299 ? 2.307   49.966  86.874  1.00 38.92  ? 296 LYS A O   1 
ATOM 2032  C CB  . LYS A 1 299 ? 1.315   52.485  85.106  1.00 44.15  ? 296 LYS A CB  1 
ATOM 2033  C CG  . LYS A 1 299 ? 1.011   53.950  85.353  1.00 38.25  ? 296 LYS A CG  1 
ATOM 2034  C CD  . LYS A 1 299 ? -0.247  54.417  84.646  1.00 42.32  ? 296 LYS A CD  1 
ATOM 2035  C CE  . LYS A 1 299 ? -0.709  55.751  85.206  1.00 61.14  ? 296 LYS A CE  1 
ATOM 2036  N NZ  . LYS A 1 299 ? -1.828  56.299  84.414  1.00 76.07  ? 296 LYS A NZ  1 
ATOM 2037  N N   . GLN A 1 300 ? 3.065   49.876  84.727  1.00 34.70  ? 297 GLN A N   1 
ATOM 2038  C CA  . GLN A 1 300 ? 3.253   48.417  84.730  1.00 48.03  ? 297 GLN A CA  1 
ATOM 2039  C C   . GLN A 1 300 ? 4.294   47.959  85.747  1.00 41.85  ? 297 GLN A C   1 
ATOM 2040  O O   . GLN A 1 300 ? 4.077   46.999  86.490  1.00 56.02  ? 297 GLN A O   1 
ATOM 2041  C CB  . GLN A 1 300 ? 3.624   47.897  83.344  1.00 41.30  ? 297 GLN A CB  1 
ATOM 2042  C CG  . GLN A 1 300 ? 2.454   47.838  82.381  1.00 56.48  ? 297 GLN A CG  1 
ATOM 2043  C CD  . GLN A 1 300 ? 2.824   47.261  81.011  1.00 65.80  ? 297 GLN A CD  1 
ATOM 2044  O OE1 . GLN A 1 300 ? 3.728   47.738  80.333  1.00 56.46  ? 297 GLN A OE1 1 
ATOM 2045  N NE2 . GLN A 1 300 ? 2.104   46.232  80.604  1.00 76.03  ? 297 GLN A NE2 1 
ATOM 2046  N N   . VAL A 1 301 ? 5.426   48.647  85.778  1.00 38.79  ? 298 VAL A N   1 
ATOM 2047  C CA  . VAL A 1 301 ? 6.468   48.294  86.717  1.00 45.47  ? 298 VAL A CA  1 
ATOM 2048  C C   . VAL A 1 301 ? 5.949   48.448  88.141  1.00 47.32  ? 298 VAL A C   1 
ATOM 2049  O O   . VAL A 1 301 ? 6.216   47.608  88.989  1.00 50.98  ? 298 VAL A O   1 
ATOM 2050  C CB  . VAL A 1 301 ? 7.746   49.126  86.481  1.00 37.98  ? 298 VAL A CB  1 
ATOM 2051  C CG1 . VAL A 1 301 ? 8.636   49.170  87.738  1.00 28.51  ? 298 VAL A CG1 1 
ATOM 2052  C CG2 . VAL A 1 301 ? 8.507   48.574  85.287  1.00 40.44  ? 298 VAL A CG2 1 
ATOM 2053  N N   . ALA A 1 302 ? 5.205   49.521  88.399  1.00 40.22  ? 299 ALA A N   1 
ATOM 2054  C CA  . ALA A 1 302 ? 4.649   49.769  89.731  1.00 47.60  ? 299 ALA A CA  1 
ATOM 2055  C C   . ALA A 1 302 ? 3.634   48.697  90.155  1.00 51.43  ? 299 ALA A C   1 
ATOM 2056  O O   . ALA A 1 302 ? 3.666   48.197  91.277  1.00 61.54  ? 299 ALA A O   1 
ATOM 2057  C CB  . ALA A 1 302 ? 4.021   51.127  89.773  1.00 27.12  ? 299 ALA A CB  1 
ATOM 2058  N N   . GLN A 1 303 ? 2.750   48.337  89.235  1.00 45.43  ? 300 GLN A N   1 
ATOM 2059  C CA  . GLN A 1 303 ? 1.781   47.275  89.461  1.00 68.94  ? 300 GLN A CA  1 
ATOM 2060  C C   . GLN A 1 303 ? 2.463   45.964  89.857  1.00 49.70  ? 300 GLN A C   1 
ATOM 2061  O O   . GLN A 1 303 ? 1.895   45.159  90.571  1.00 51.17  ? 300 GLN A O   1 
ATOM 2062  C CB  . GLN A 1 303 ? 0.925   47.063  88.210  1.00 53.27  ? 300 GLN A CB  1 
ATOM 2063  C CG  . GLN A 1 303 ? -0.389  46.373  88.454  1.00 93.46  ? 300 GLN A CG  1 
ATOM 2064  C CD  . GLN A 1 303 ? -1.489  47.361  88.732  1.00 108.63 ? 300 GLN A CD  1 
ATOM 2065  O OE1 . GLN A 1 303 ? -1.616  48.365  88.032  1.00 96.88  ? 300 GLN A OE1 1 
ATOM 2066  N NE2 . GLN A 1 303 ? -2.287  47.094  89.762  1.00 107.20 ? 300 GLN A NE2 1 
ATOM 2067  N N   . ASN A 1 304 ? 3.685   45.763  89.395  1.00 49.07  ? 301 ASN A N   1 
ATOM 2068  C CA  . ASN A 1 304 ? 4.403   44.520  89.653  1.00 46.66  ? 301 ASN A CA  1 
ATOM 2069  C C   . ASN A 1 304 ? 5.559   44.652  90.638  1.00 34.67  ? 301 ASN A C   1 
ATOM 2070  O O   . ASN A 1 304 ? 6.376   43.744  90.749  1.00 47.35  ? 301 ASN A O   1 
ATOM 2071  C CB  . ASN A 1 304 ? 4.917   43.907  88.338  1.00 51.62  ? 301 ASN A CB  1 
ATOM 2072  C CG  . ASN A 1 304 ? 3.790   43.482  87.413  1.00 61.47  ? 301 ASN A CG  1 
ATOM 2073  O OD1 . ASN A 1 304 ? 2.729   43.087  87.871  1.00 85.06  ? 301 ASN A OD1 1 
ATOM 2074  N ND2 . ASN A 1 304 ? 4.015   43.561  86.115  1.00 57.43  ? 301 ASN A ND2 1 
ATOM 2075  N N   . LEU A 1 305 ? 5.624   45.765  91.360  1.00 45.62  ? 302 LEU A N   1 
ATOM 2076  C CA  . LEU A 1 305 ? 6.761   46.029  92.244  1.00 48.85  ? 302 LEU A CA  1 
ATOM 2077  C C   . LEU A 1 305 ? 7.153   44.859  93.148  1.00 44.77  ? 302 LEU A C   1 
ATOM 2078  O O   . LEU A 1 305 ? 8.340   44.654  93.411  1.00 61.44  ? 302 LEU A O   1 
ATOM 2079  C CB  . LEU A 1 305 ? 6.488   47.249  93.104  1.00 33.56  ? 302 LEU A CB  1 
ATOM 2080  C CG  . LEU A 1 305 ? 7.331   48.488  92.861  1.00 44.74  ? 302 LEU A CG  1 
ATOM 2081  C CD1 . LEU A 1 305 ? 7.344   49.323  94.119  1.00 43.45  ? 302 LEU A CD1 1 
ATOM 2082  C CD2 . LEU A 1 305 ? 8.720   48.140  92.450  1.00 34.10  ? 302 LEU A CD2 1 
ATOM 2083  N N   . ASP A 1 306 ? 6.162   44.102  93.627  1.00 49.40  ? 303 ASP A N   1 
ATOM 2084  C CA  . ASP A 1 306 ? 6.409   43.018  94.600  1.00 45.75  ? 303 ASP A CA  1 
ATOM 2085  C C   . ASP A 1 306 ? 7.249   41.873  94.062  1.00 54.30  ? 303 ASP A C   1 
ATOM 2086  O O   . ASP A 1 306 ? 7.986   41.235  94.810  1.00 66.38  ? 303 ASP A O   1 
ATOM 2087  C CB  . ASP A 1 306 ? 5.089   42.480  95.158  1.00 57.12  ? 303 ASP A CB  1 
ATOM 2088  C CG  . ASP A 1 306 ? 4.318   43.529  95.934  1.00 83.47  ? 303 ASP A CG  1 
ATOM 2089  O OD1 . ASP A 1 306 ? 4.914   44.152  96.832  1.00 69.59  ? 303 ASP A OD1 1 
ATOM 2090  O OD2 . ASP A 1 306 ? 3.126   43.741  95.635  1.00 82.43  ? 303 ASP A OD2 1 
ATOM 2091  N N   . ARG A 1 307 ? 7.154   41.627  92.762  1.00 39.18  ? 304 ARG A N   1 
ATOM 2092  C CA  . ARG A 1 307 ? 7.904   40.531  92.169  1.00 46.86  ? 304 ARG A CA  1 
ATOM 2093  C C   . ARG A 1 307 ? 9.365   40.804  91.799  1.00 52.76  ? 304 ARG A C   1 
ATOM 2094  O O   . ARG A 1 307 ? 10.132  39.858  91.671  1.00 67.43  ? 304 ARG A O   1 
ATOM 2095  C CB  . ARG A 1 307 ? 7.161   39.939  90.984  1.00 48.88  ? 304 ARG A CB  1 
ATOM 2096  C CG  . ARG A 1 307 ? 6.917   40.872  89.846  1.00 85.58  ? 304 ARG A CG  1 
ATOM 2097  C CD  . ARG A 1 307 ? 6.633   39.959  88.704  1.00 74.54  ? 304 ARG A CD  1 
ATOM 2098  N NE  . ARG A 1 307 ? 5.423   40.271  88.020  1.00 76.97  ? 304 ARG A NE  1 
ATOM 2099  C CZ  . ARG A 1 307 ? 4.267   39.633  87.949  1.00 79.88  ? 304 ARG A CZ  1 
ATOM 2100  N NH1 . ARG A 1 307 ? 3.385   40.215  87.184  1.00 109.99 ? 304 ARG A NH1 1 
ATOM 2101  N NH2 . ARG A 1 307 ? 3.955   38.504  88.574  1.00 125.13 ? 304 ARG A NH2 1 
ATOM 2102  N N   . PHE A 1 308 ? 9.761   42.066  91.644  1.00 47.29  ? 305 PHE A N   1 
ATOM 2103  C CA  . PHE A 1 308 ? 11.149  42.370  91.252  1.00 43.87  ? 305 PHE A CA  1 
ATOM 2104  C C   . PHE A 1 308 ? 12.109  42.135  92.405  1.00 38.75  ? 305 PHE A C   1 
ATOM 2105  O O   . PHE A 1 308 ? 11.775  42.424  93.552  1.00 47.58  ? 305 PHE A O   1 
ATOM 2106  C CB  . PHE A 1 308 ? 11.303  43.815  90.731  1.00 44.29  ? 305 PHE A CB  1 
ATOM 2107  C CG  . PHE A 1 308 ? 10.351  44.164  89.610  1.00 57.57  ? 305 PHE A CG  1 
ATOM 2108  C CD1 . PHE A 1 308 ? 10.422  43.512  88.379  1.00 40.43  ? 305 PHE A CD1 1 
ATOM 2109  C CD2 . PHE A 1 308 ? 9.377   45.138  89.790  1.00 39.63  ? 305 PHE A CD2 1 
ATOM 2110  C CE1 . PHE A 1 308 ? 9.532   43.834  87.345  1.00 45.89  ? 305 PHE A CE1 1 
ATOM 2111  C CE2 . PHE A 1 308 ? 8.480   45.455  88.773  1.00 43.80  ? 305 PHE A CE2 1 
ATOM 2112  C CZ  . PHE A 1 308 ? 8.560   44.804  87.543  1.00 34.28  ? 305 PHE A CZ  1 
ATOM 2113  N N   . HIS A 1 309 ? 13.293  41.611  92.093  1.00 41.17  ? 306 HIS A N   1 
ATOM 2114  C CA  . HIS A 1 309 ? 14.339  41.393  93.094  1.00 34.02  ? 306 HIS A CA  1 
ATOM 2115  C C   . HIS A 1 309 ? 14.976  42.684  93.579  1.00 54.52  ? 306 HIS A C   1 
ATOM 2116  O O   . HIS A 1 309 ? 15.485  42.745  94.702  1.00 59.82  ? 306 HIS A O   1 
ATOM 2117  C CB  . HIS A 1 309 ? 15.395  40.402  92.582  1.00 37.01  ? 306 HIS A CB  1 
ATOM 2118  C CG  . HIS A 1 309 ? 14.852  39.025  92.338  1.00 49.76  ? 306 HIS A CG  1 
ATOM 2119  N ND1 . HIS A 1 309 ? 14.065  38.366  93.258  1.00 60.69  ? 306 HIS A ND1 1 
ATOM 2120  C CD2 . HIS A 1 309 ? 14.967  38.193  91.281  1.00 56.53  ? 306 HIS A CD2 1 
ATOM 2121  C CE1 . HIS A 1 309 ? 13.718  37.190  92.778  1.00 53.23  ? 306 HIS A CE1 1 
ATOM 2122  N NE2 . HIS A 1 309 ? 14.253  37.058  91.580  1.00 67.41  ? 306 HIS A NE2 1 
ATOM 2123  N N   . THR A 1 310 ? 14.967  43.702  92.720  1.00 65.31  ? 307 THR A N   1 
ATOM 2124  C CA  . THR A 1 310 ? 15.300  45.055  93.145  1.00 62.94  ? 307 THR A CA  1 
ATOM 2125  C C   . THR A 1 310 ? 14.362  46.075  92.488  1.00 52.54  ? 307 THR A C   1 
ATOM 2126  O O   . THR A 1 310 ? 13.523  45.723  91.661  1.00 52.29  ? 307 THR A O   1 
ATOM 2127  C CB  . THR A 1 310 ? 16.784  45.401  92.913  1.00 61.29  ? 307 THR A CB  1 
ATOM 2128  O OG1 . THR A 1 310 ? 17.055  46.711  93.439  1.00 62.17  ? 307 THR A OG1 1 
ATOM 2129  C CG2 . THR A 1 310 ? 17.134  45.335  91.436  1.00 42.40  ? 307 THR A CG2 1 
ATOM 2130  N N   . PHE A 1 311 ? 14.483  47.327  92.897  1.00 41.08  ? 308 PHE A N   1 
ATOM 2131  C CA  . PHE A 1 311 ? 13.703  48.403  92.306  1.00 50.02  ? 308 PHE A CA  1 
ATOM 2132  C C   . PHE A 1 311 ? 14.233  48.826  90.933  1.00 48.01  ? 308 PHE A C   1 
ATOM 2133  O O   . PHE A 1 311 ? 15.365  49.299  90.811  1.00 44.43  ? 308 PHE A O   1 
ATOM 2134  C CB  . PHE A 1 311 ? 13.682  49.600  93.251  1.00 47.97  ? 308 PHE A CB  1 
ATOM 2135  C CG  . PHE A 1 311 ? 13.093  49.288  94.577  1.00 60.41  ? 308 PHE A CG  1 
ATOM 2136  C CD1 . PHE A 1 311 ? 13.895  48.891  95.617  1.00 56.73  ? 308 PHE A CD1 1 
ATOM 2137  C CD2 . PHE A 1 311 ? 11.727  49.359  94.778  1.00 49.88  ? 308 PHE A CD2 1 
ATOM 2138  C CE1 . PHE A 1 311 ? 13.344  48.580  96.832  1.00 63.79  ? 308 PHE A CE1 1 
ATOM 2139  C CE2 . PHE A 1 311 ? 11.183  49.054  95.988  1.00 50.68  ? 308 PHE A CE2 1 
ATOM 2140  C CZ  . PHE A 1 311 ? 11.980  48.663  97.011  1.00 54.57  ? 308 PHE A CZ  1 
ATOM 2141  N N   . PRO A 1 312 ? 13.415  48.632  89.889  1.00 46.29  ? 309 PRO A N   1 
ATOM 2142  C CA  . PRO A 1 312 ? 13.805  48.953  88.514  1.00 45.07  ? 309 PRO A CA  1 
ATOM 2143  C C   . PRO A 1 312 ? 13.983  50.447  88.293  1.00 33.86  ? 309 PRO A C   1 
ATOM 2144  O O   . PRO A 1 312 ? 13.174  51.248  88.727  1.00 45.47  ? 309 PRO A O   1 
ATOM 2145  C CB  . PRO A 1 312 ? 12.629  48.424  87.694  1.00 38.99  ? 309 PRO A CB  1 
ATOM 2146  C CG  . PRO A 1 312 ? 12.049  47.353  88.557  1.00 33.09  ? 309 PRO A CG  1 
ATOM 2147  C CD  . PRO A 1 312 ? 12.128  47.930  89.926  1.00 46.34  ? 309 PRO A CD  1 
ATOM 2148  N N   . ARG A 1 313 ? 15.070  50.810  87.627  1.00 44.03  ? 310 ARG A N   1 
ATOM 2149  C CA  . ARG A 1 313 ? 15.322  52.197  87.276  1.00 40.70  ? 310 ARG A CA  1 
ATOM 2150  C C   . ARG A 1 313 ? 14.769  52.502  85.880  1.00 38.75  ? 310 ARG A C   1 
ATOM 2151  O O   . ARG A 1 313 ? 15.142  51.867  84.907  1.00 47.91  ? 310 ARG A O   1 
ATOM 2152  C CB  . ARG A 1 313 ? 16.807  52.501  87.350  1.00 35.17  ? 310 ARG A CB  1 
ATOM 2153  C CG  . ARG A 1 313 ? 17.407  52.284  88.736  1.00 37.13  ? 310 ARG A CG  1 
ATOM 2154  C CD  . ARG A 1 313 ? 18.870  52.703  88.800  1.00 34.92  ? 310 ARG A CD  1 
ATOM 2155  N NE  . ARG A 1 313 ? 19.454  52.463  90.119  1.00 43.93  ? 310 ARG A NE  1 
ATOM 2156  C CZ  . ARG A 1 313 ? 20.696  52.788  90.441  1.00 41.54  ? 310 ARG A CZ  1 
ATOM 2157  N NH1 . ARG A 1 313 ? 21.473  53.368  89.534  1.00 32.70  ? 310 ARG A NH1 1 
ATOM 2158  N NH2 . ARG A 1 313 ? 21.155  52.551  91.659  1.00 45.13  ? 310 ARG A NH2 1 
ATOM 2159  N N   . LEU A 1 314 ? 13.845  53.455  85.810  1.00 30.62  ? 311 LEU A N   1 
ATOM 2160  C CA  . LEU A 1 314 ? 13.241  53.912  84.564  1.00 37.04  ? 311 LEU A CA  1 
ATOM 2161  C C   . LEU A 1 314 ? 13.834  55.238  84.146  1.00 34.10  ? 311 LEU A C   1 
ATOM 2162  O O   . LEU A 1 314 ? 13.799  56.183  84.900  1.00 37.91  ? 311 LEU A O   1 
ATOM 2163  C CB  . LEU A 1 314 ? 11.719  54.061  84.709  1.00 34.48  ? 311 LEU A CB  1 
ATOM 2164  C CG  . LEU A 1 314 ? 10.932  52.755  84.500  1.00 62.78  ? 311 LEU A CG  1 
ATOM 2165  C CD1 . LEU A 1 314 ? 11.316  51.670  85.498  1.00 52.10  ? 311 LEU A CD1 1 
ATOM 2166  C CD2 . LEU A 1 314 ? 9.446   53.008  84.571  1.00 57.20  ? 311 LEU A CD2 1 
ATOM 2167  N N   . ALA A 1 315 ? 14.420  55.279  82.950  1.00 37.63  ? 312 ALA A N   1 
ATOM 2168  C CA  . ALA A 1 315 ? 14.884  56.525  82.339  1.00 31.26  ? 312 ALA A CA  1 
ATOM 2169  C C   . ALA A 1 315 ? 14.091  56.779  81.072  1.00 52.20  ? 312 ALA A C   1 
ATOM 2170  O O   . ALA A 1 315 ? 13.907  55.892  80.249  1.00 38.12  ? 312 ALA A O   1 
ATOM 2171  C CB  . ALA A 1 315 ? 16.359  56.464  82.018  1.00 21.98  ? 312 ALA A CB  1 
ATOM 2172  N N   . GLY A 1 316 ? 13.614  58.000  80.916  1.00 40.87  ? 313 GLY A N   1 
ATOM 2173  C CA  . GLY A 1 316 ? 12.717  58.318  79.821  1.00 36.09  ? 313 GLY A CA  1 
ATOM 2174  C C   . GLY A 1 316 ? 13.042  59.662  79.196  1.00 35.56  ? 313 GLY A C   1 
ATOM 2175  O O   . GLY A 1 316 ? 13.046  60.708  79.851  1.00 55.97  ? 313 GLY A O   1 
ATOM 2176  N N   . GLU A 1 317 ? 13.356  59.629  77.918  1.00 39.62  ? 314 GLU A N   1 
ATOM 2177  C CA  . GLU A 1 317 ? 13.456  60.860  77.163  1.00 58.28  ? 314 GLU A CA  1 
ATOM 2178  C C   . GLU A 1 317 ? 12.233  60.884  76.248  1.00 38.95  ? 314 GLU A C   1 
ATOM 2179  O O   . GLU A 1 317 ? 12.073  60.024  75.398  1.00 50.25  ? 314 GLU A O   1 
ATOM 2180  C CB  . GLU A 1 317 ? 14.767  60.908  76.393  1.00 27.50  ? 314 GLU A CB  1 
ATOM 2181  N N   . CYS A 1 318 ? 11.328  61.821  76.496  1.00 42.58  ? 315 CYS A N   1 
ATOM 2182  C CA  . CYS A 1 318 ? 10.097  61.930  75.720  1.00 43.22  ? 315 CYS A CA  1 
ATOM 2183  C C   . CYS A 1 318 ? 10.116  63.204  74.849  1.00 75.99  ? 315 CYS A C   1 
ATOM 2184  O O   . CYS A 1 318 ? 11.176  63.789  74.593  1.00 60.01  ? 315 CYS A O   1 
ATOM 2185  C CB  . CYS A 1 318 ? 8.877   61.885  76.643  1.00 52.21  ? 315 CYS A CB  1 
ATOM 2186  S SG  . CYS A 1 318 ? 8.892   60.439  77.747  1.00 46.76  ? 315 CYS A SG  1 
ATOM 2187  N N   . GLY A 1 319 ? 8.960   63.640  74.374  1.00 52.01  ? 316 GLY A N   1 
ATOM 2188  C CA  . GLY A 1 319 ? 8.956   64.731  73.421  1.00 49.60  ? 316 GLY A CA  1 
ATOM 2189  C C   . GLY A 1 319 ? 9.039   66.137  73.997  1.00 64.15  ? 316 GLY A C   1 
ATOM 2190  O O   . GLY A 1 319 ? 9.223   66.332  75.193  1.00 57.15  ? 316 GLY A O   1 
ATOM 2191  N N   . GLY A 1 320 ? 8.910   67.125  73.121  1.00 44.49  ? 317 GLY A N   1 
ATOM 2192  C CA  . GLY A 1 320 ? 8.782   68.505  73.521  1.00 41.27  ? 317 GLY A CA  1 
ATOM 2193  C C   . GLY A 1 320 ? 7.802   69.274  72.643  1.00 32.10  ? 317 GLY A C   1 
ATOM 2194  O O   . GLY A 1 320 ? 7.418   68.819  71.577  1.00 49.68  ? 317 GLY A O   1 
ATOM 2195  N N   . LYS A 1 321 ? 7.375   70.435  73.119  1.00 38.44  ? 318 LYS A N   1 
ATOM 2196  C CA  . LYS A 1 321 ? 6.763   71.452  72.270  1.00 25.53  ? 318 LYS A CA  1 
ATOM 2197  C C   . LYS A 1 321 ? 7.623   72.702  72.353  1.00 28.04  ? 318 LYS A C   1 
ATOM 2198  O O   . LYS A 1 321 ? 7.326   73.632  73.095  1.00 46.09  ? 318 LYS A O   1 
ATOM 2199  C CB  . LYS A 1 321 ? 5.332   71.773  72.673  1.00 38.32  ? 318 LYS A CB  1 
ATOM 2200  C CG  . LYS A 1 321 ? 4.589   72.659  71.668  1.00 38.14  ? 318 LYS A CG  1 
ATOM 2201  C CD  . LYS A 1 321 ? 4.183   71.875  70.443  1.00 38.77  ? 318 LYS A CD  1 
ATOM 2202  C CE  . LYS A 1 321 ? 3.498   72.736  69.393  1.00 30.80  ? 318 LYS A CE  1 
ATOM 2203  N NZ  . LYS A 1 321 ? 3.342   71.984  68.105  1.00 55.12  ? 318 LYS A NZ  1 
ATOM 2204  N N   . ASN A 1 322 ? 8.703   72.704  71.582  1.00 29.85  ? 319 ASN A N   1 
ATOM 2205  C CA  . ASN A 1 322 ? 9.777   73.678  71.736  1.00 24.53  ? 319 ASN A CA  1 
ATOM 2206  C C   . ASN A 1 322 ? 9.594   75.013  71.038  1.00 49.96  ? 319 ASN A C   1 
ATOM 2207  O O   . ASN A 1 322 ? 8.899   75.122  70.039  1.00 46.72  ? 319 ASN A O   1 
ATOM 2208  C CB  . ASN A 1 322 ? 11.082  73.012  71.321  1.00 34.60  ? 319 ASN A CB  1 
ATOM 2209  C CG  . ASN A 1 322 ? 11.159  71.601  71.820  1.00 45.42  ? 319 ASN A CG  1 
ATOM 2210  O OD1 . ASN A 1 322 ? 11.266  71.357  73.035  1.00 43.34  ? 319 ASN A OD1 1 
ATOM 2211  N ND2 . ASN A 1 322 ? 11.045  70.654  70.905  1.00 34.70  ? 319 ASN A ND2 1 
ATOM 2212  N N   . PHE A 1 323 ? 10.244  76.027  71.583  1.00 32.73  ? 320 PHE A N   1 
ATOM 2213  C CA  . PHE A 1 323 ? 9.982   77.381  71.186  1.00 33.68  ? 320 PHE A CA  1 
ATOM 2214  C C   . PHE A 1 323 ? 11.223  78.091  70.676  1.00 48.28  ? 320 PHE A C   1 
ATOM 2215  O O   . PHE A 1 323 ? 12.321  77.742  71.086  1.00 34.74  ? 320 PHE A O   1 
ATOM 2216  C CB  . PHE A 1 323 ? 9.391   78.161  72.374  1.00 36.17  ? 320 PHE A CB  1 
ATOM 2217  C CG  . PHE A 1 323 ? 10.324  78.301  73.565  1.00 44.95  ? 320 PHE A CG  1 
ATOM 2218  C CD1 . PHE A 1 323 ? 11.225  79.347  73.652  1.00 35.17  ? 320 PHE A CD1 1 
ATOM 2219  C CD2 . PHE A 1 323 ? 10.266  77.399  74.617  1.00 46.51  ? 320 PHE A CD2 1 
ATOM 2220  C CE1 . PHE A 1 323 ? 12.066  79.472  74.756  1.00 40.60  ? 320 PHE A CE1 1 
ATOM 2221  C CE2 . PHE A 1 323 ? 11.109  77.517  75.713  1.00 26.38  ? 320 PHE A CE2 1 
ATOM 2222  C CZ  . PHE A 1 323 ? 12.005  78.557  75.781  1.00 42.27  ? 320 PHE A CZ  1 
ATOM 2223  N N   . HIS A 1 324 ? 11.024  79.053  69.760  1.00 54.47  ? 321 HIS A N   1 
ATOM 2224  C CA  . HIS A 1 324 ? 11.962  80.162  69.506  1.00 34.17  ? 321 HIS A CA  1 
ATOM 2225  C C   . HIS A 1 324 ? 11.262  81.458  69.876  1.00 30.78  ? 321 HIS A C   1 
ATOM 2226  O O   . HIS A 1 324 ? 10.291  81.843  69.225  1.00 39.20  ? 321 HIS A O   1 
ATOM 2227  C CB  . HIS A 1 324 ? 12.408  80.257  68.036  1.00 31.31  ? 321 HIS A CB  1 
ATOM 2228  C CG  . HIS A 1 324 ? 13.422  79.236  67.632  1.00 42.90  ? 321 HIS A CG  1 
ATOM 2229  N ND1 . HIS A 1 324 ? 14.181  79.356  66.493  1.00 35.90  ? 321 HIS A ND1 1 
ATOM 2230  C CD2 . HIS A 1 324 ? 13.802  78.077  68.219  1.00 40.96  ? 321 HIS A CD2 1 
ATOM 2231  C CE1 . HIS A 1 324 ? 14.984  78.313  66.391  1.00 59.91  ? 321 HIS A CE1 1 
ATOM 2232  N NE2 . HIS A 1 324 ? 14.785  77.531  67.435  1.00 46.40  ? 321 HIS A NE2 1 
ATOM 2233  N N   . PHE A 1 325 ? 11.749  82.129  70.919  1.00 25.78  ? 322 PHE A N   1 
ATOM 2234  C CA  . PHE A 1 325 ? 11.195  83.411  71.333  1.00 26.53  ? 322 PHE A CA  1 
ATOM 2235  C C   . PHE A 1 325 ? 12.064  84.533  70.790  1.00 33.37  ? 322 PHE A C   1 
ATOM 2236  O O   . PHE A 1 325 ? 13.268  84.523  70.990  1.00 39.84  ? 322 PHE A O   1 
ATOM 2237  C CB  . PHE A 1 325 ? 11.118  83.519  72.869  1.00 37.79  ? 322 PHE A CB  1 
ATOM 2238  C CG  . PHE A 1 325 ? 10.620  84.843  73.344  1.00 38.93  ? 322 PHE A CG  1 
ATOM 2239  C CD1 . PHE A 1 325 ? 9.269   85.059  73.546  1.00 45.14  ? 322 PHE A CD1 1 
ATOM 2240  C CD2 . PHE A 1 325 ? 11.489  85.889  73.538  1.00 41.13  ? 322 PHE A CD2 1 
ATOM 2241  C CE1 . PHE A 1 325 ? 8.795   86.292  73.953  1.00 35.95  ? 322 PHE A CE1 1 
ATOM 2242  C CE2 . PHE A 1 325 ? 11.025  87.127  73.936  1.00 39.45  ? 322 PHE A CE2 1 
ATOM 2243  C CZ  . PHE A 1 325 ? 9.674   87.325  74.150  1.00 55.78  ? 322 PHE A CZ  1 
ATOM 2244  N N   . VAL A 1 326 ? 11.446  85.516  70.139  1.00 42.13  ? 323 VAL A N   1 
ATOM 2245  C CA  . VAL A 1 326 ? 12.182  86.628  69.527  1.00 35.55  ? 323 VAL A CA  1 
ATOM 2246  C C   . VAL A 1 326 ? 11.883  87.995  70.150  1.00 35.12  ? 323 VAL A C   1 
ATOM 2247  O O   . VAL A 1 326 ? 10.737  88.435  70.242  1.00 40.80  ? 323 VAL A O   1 
ATOM 2248  C CB  . VAL A 1 326 ? 11.896  86.710  67.990  1.00 38.37  ? 323 VAL A CB  1 
ATOM 2249  C CG1 . VAL A 1 326 ? 12.819  87.704  67.332  1.00 31.25  ? 323 VAL A CG1 1 
ATOM 2250  C CG2 . VAL A 1 326 ? 12.073  85.366  67.342  1.00 24.22  ? 323 VAL A CG2 1 
ATOM 2251  N N   . HIS A 1 327 ? 12.929  88.688  70.552  1.00 40.59  ? 324 HIS A N   1 
ATOM 2252  C CA  . HIS A 1 327 ? 12.780  90.030  71.106  1.00 71.67  ? 324 HIS A CA  1 
ATOM 2253  C C   . HIS A 1 327 ? 12.962  91.022  69.974  1.00 75.03  ? 324 HIS A C   1 
ATOM 2254  O O   . HIS A 1 327 ? 13.559  90.662  68.958  1.00 63.74  ? 324 HIS A O   1 
ATOM 2255  C CB  . HIS A 1 327 ? 13.823  90.263  72.203  1.00 36.37  ? 324 HIS A CB  1 
ATOM 2256  C CG  . HIS A 1 327 ? 13.796  91.640  72.779  1.00 57.23  ? 324 HIS A CG  1 
ATOM 2257  N ND1 . HIS A 1 327 ? 14.738  92.590  72.462  1.00 56.11  ? 324 HIS A ND1 1 
ATOM 2258  C CD2 . HIS A 1 327 ? 12.950  92.227  73.659  1.00 45.87  ? 324 HIS A CD2 1 
ATOM 2259  C CE1 . HIS A 1 327 ? 14.473  93.704  73.118  1.00 55.48  ? 324 HIS A CE1 1 
ATOM 2260  N NE2 . HIS A 1 327 ? 13.391  93.511  73.849  1.00 61.82  ? 324 HIS A NE2 1 
ATOM 2261  N N   . ARG A 1 328 ? 12.459  92.252  70.132  1.00 66.68  ? 325 ARG A N   1 
ATOM 2262  C CA  . ARG A 1 328 ? 12.551  93.255  69.050  1.00 64.07  ? 325 ARG A CA  1 
ATOM 2263  C C   . ARG A 1 328 ? 13.988  93.559  68.598  1.00 64.70  ? 325 ARG A C   1 
ATOM 2264  O O   . ARG A 1 328 ? 14.196  93.983  67.474  1.00 49.85  ? 325 ARG A O   1 
ATOM 2265  C CB  . ARG A 1 328 ? 11.774  94.541  69.372  1.00 57.09  ? 325 ARG A CB  1 
ATOM 2266  C CG  . ARG A 1 328 ? 12.401  95.457  70.409  1.00 68.03  ? 325 ARG A CG  1 
ATOM 2267  C CD  . ARG A 1 328 ? 11.475  96.621  70.747  1.00 55.60  ? 325 ARG A CD  1 
ATOM 2268  N N   . SER A 1 329 ? 14.966  93.294  69.461  1.00 63.02  ? 326 SER A N   1 
ATOM 2269  C CA  . SER A 1 329 ? 16.383  93.529  69.167  1.00 57.41  ? 326 SER A CA  1 
ATOM 2270  C C   . SER A 1 329 ? 17.086  92.415  68.361  1.00 73.16  ? 326 SER A C   1 
ATOM 2271  O O   . SER A 1 329 ? 18.265  92.534  68.036  1.00 51.96  ? 326 SER A O   1 
ATOM 2272  C CB  . SER A 1 329 ? 17.154  93.736  70.468  1.00 48.23  ? 326 SER A CB  1 
ATOM 2273  O OG  . SER A 1 329 ? 17.142  92.562  71.260  1.00 72.94  ? 326 SER A OG  1 
ATOM 2274  N N   . ALA A 1 330 ? 16.377  91.338  68.042  1.00 47.72  ? 327 ALA A N   1 
ATOM 2275  C CA  . ALA A 1 330 ? 17.013  90.173  67.439  1.00 64.99  ? 327 ALA A CA  1 
ATOM 2276  C C   . ALA A 1 330 ? 17.629  90.482  66.077  1.00 62.32  ? 327 ALA A C   1 
ATOM 2277  O O   . ALA A 1 330 ? 17.133  91.331  65.353  1.00 56.24  ? 327 ALA A O   1 
ATOM 2278  C CB  . ALA A 1 330 ? 16.011  89.030  67.321  1.00 43.04  ? 327 ALA A CB  1 
ATOM 2279  N N   . ASP A 1 331 ? 18.713  89.788  65.738  1.00 56.16  ? 328 ASP A N   1 
ATOM 2280  C CA  . ASP A 1 331 ? 19.210  89.730  64.365  1.00 44.58  ? 328 ASP A CA  1 
ATOM 2281  C C   . ASP A 1 331 ? 18.238  88.898  63.515  1.00 73.82  ? 328 ASP A C   1 
ATOM 2282  O O   . ASP A 1 331 ? 18.154  87.670  63.646  1.00 52.10  ? 328 ASP A O   1 
ATOM 2283  C CB  . ASP A 1 331 ? 20.620  89.122  64.325  1.00 62.49  ? 328 ASP A CB  1 
ATOM 2284  C CG  . ASP A 1 331 ? 21.056  88.710  62.919  1.00 88.97  ? 328 ASP A CG  1 
ATOM 2285  O OD1 . ASP A 1 331 ? 20.198  88.413  62.065  1.00 120.86 ? 328 ASP A OD1 1 
ATOM 2286  O OD2 . ASP A 1 331 ? 22.274  88.658  62.670  1.00 85.92  ? 328 ASP A OD2 1 
ATOM 2287  N N   . VAL A 1 332 ? 17.501  89.572  62.642  1.00 45.82  ? 329 VAL A N   1 
ATOM 2288  C CA  . VAL A 1 332 ? 16.453  88.931  61.849  1.00 36.37  ? 329 VAL A CA  1 
ATOM 2289  C C   . VAL A 1 332 ? 16.931  87.772  60.954  1.00 71.62  ? 329 VAL A C   1 
ATOM 2290  O O   . VAL A 1 332 ? 16.214  86.787  60.784  1.00 46.29  ? 329 VAL A O   1 
ATOM 2291  C CB  . VAL A 1 332 ? 15.700  89.959  61.007  1.00 63.11  ? 329 VAL A CB  1 
ATOM 2292  C CG1 . VAL A 1 332 ? 14.790  89.263  59.996  1.00 64.12  ? 329 VAL A CG1 1 
ATOM 2293  C CG2 . VAL A 1 332 ? 14.905  90.869  61.912  1.00 53.54  ? 329 VAL A CG2 1 
ATOM 2294  N N   . GLU A 1 333 ? 18.126  87.880  60.383  1.00 66.45  ? 330 GLU A N   1 
ATOM 2295  C CA  . GLU A 1 333 ? 18.636  86.813  59.525  1.00 52.82  ? 330 GLU A CA  1 
ATOM 2296  C C   . GLU A 1 333 ? 18.917  85.537  60.292  1.00 57.46  ? 330 GLU A C   1 
ATOM 2297  O O   . GLU A 1 333 ? 18.620  84.456  59.799  1.00 65.71  ? 330 GLU A O   1 
ATOM 2298  C CB  . GLU A 1 333 ? 19.876  87.262  58.735  1.00 39.21  ? 330 GLU A CB  1 
ATOM 2299  C CG  . GLU A 1 333 ? 19.552  88.271  57.640  1.00 66.11  ? 330 GLU A CG  1 
ATOM 2300  C CD  . GLU A 1 333 ? 18.479  87.757  56.691  1.00 74.65  ? 330 GLU A CD  1 
ATOM 2301  O OE1 . GLU A 1 333 ? 18.547  86.575  56.308  1.00 58.43  ? 330 GLU A OE1 1 
ATOM 2302  O OE2 . GLU A 1 333 ? 17.557  88.522  56.339  1.00 49.05  ? 330 GLU A OE2 1 
ATOM 2303  N N   . SER A 1 334 ? 19.494  85.663  61.487  1.00 52.57  ? 331 SER A N   1 
ATOM 2304  C CA  . SER A 1 334 ? 19.740  84.512  62.347  1.00 49.78  ? 331 SER A CA  1 
ATOM 2305  C C   . SER A 1 334 ? 18.419  83.860  62.775  1.00 56.15  ? 331 SER A C   1 
ATOM 2306  O O   . SER A 1 334 ? 18.280  82.635  62.749  1.00 34.56  ? 331 SER A O   1 
ATOM 2307  C CB  . SER A 1 334 ? 20.565  84.915  63.569  1.00 56.61  ? 331 SER A CB  1 
ATOM 2308  O OG  . SER A 1 334 ? 21.895  85.252  63.203  1.00 48.52  ? 331 SER A OG  1 
ATOM 2309  N N   . VAL A 1 335 ? 17.452  84.681  63.170  1.00 46.50  ? 332 VAL A N   1 
ATOM 2310  C CA  . VAL A 1 335 ? 16.123  84.178  63.495  1.00 49.59  ? 332 VAL A CA  1 
ATOM 2311  C C   . VAL A 1 335 ? 15.584  83.373  62.328  1.00 46.44  ? 332 VAL A C   1 
ATOM 2312  O O   . VAL A 1 335 ? 15.111  82.253  62.493  1.00 38.68  ? 332 VAL A O   1 
ATOM 2313  C CB  . VAL A 1 335 ? 15.128  85.311  63.789  1.00 36.56  ? 332 VAL A CB  1 
ATOM 2314  C CG1 . VAL A 1 335 ? 13.726  84.756  63.967  1.00 26.14  ? 332 VAL A CG1 1 
ATOM 2315  C CG2 . VAL A 1 335 ? 15.556  86.101  64.995  1.00 38.53  ? 332 VAL A CG2 1 
ATOM 2316  N N   . VAL A 1 336 ? 15.670  83.937  61.133  1.00 63.43  ? 333 VAL A N   1 
ATOM 2317  C CA  . VAL A 1 336 ? 15.118  83.273  59.960  1.00 40.23  ? 333 VAL A CA  1 
ATOM 2318  C C   . VAL A 1 336 ? 15.775  81.934  59.626  1.00 36.82  ? 333 VAL A C   1 
ATOM 2319  O O   . VAL A 1 336 ? 15.081  80.934  59.469  1.00 40.49  ? 333 VAL A O   1 
ATOM 2320  C CB  . VAL A 1 336 ? 15.109  84.186  58.751  1.00 58.31  ? 333 VAL A CB  1 
ATOM 2321  C CG1 . VAL A 1 336 ? 14.824  83.375  57.465  1.00 44.94  ? 333 VAL A CG1 1 
ATOM 2322  C CG2 . VAL A 1 336 ? 14.079  85.246  58.971  1.00 36.96  ? 333 VAL A CG2 1 
ATOM 2323  N N   . SER A 1 337 ? 17.102  81.902  59.528  1.00 38.66  ? 334 SER A N   1 
ATOM 2324  C CA  . SER A 1 337 ? 17.774  80.673  59.114  1.00 50.21  ? 334 SER A CA  1 
ATOM 2325  C C   . SER A 1 337 ? 17.767  79.667  60.247  1.00 53.55  ? 334 SER A C   1 
ATOM 2326  O O   . SER A 1 337 ? 17.634  78.472  60.018  1.00 44.40  ? 334 SER A O   1 
ATOM 2327  C CB  . SER A 1 337 ? 19.197  80.942  58.601  1.00 25.65  ? 334 SER A CB  1 
ATOM 2328  O OG  . SER A 1 337 ? 20.017  81.440  59.627  1.00 77.84  ? 334 SER A OG  1 
ATOM 2329  N N   . GLY A 1 338 ? 17.889  80.162  61.474  1.00 50.45  ? 335 GLY A N   1 
ATOM 2330  C CA  . GLY A 1 338 ? 17.847  79.307  62.639  1.00 39.01  ? 335 GLY A CA  1 
ATOM 2331  C C   . GLY A 1 338 ? 16.502  78.635  62.825  1.00 47.85  ? 335 GLY A C   1 
ATOM 2332  O O   . GLY A 1 338 ? 16.441  77.466  63.169  1.00 29.27  ? 335 GLY A O   1 
ATOM 2333  N N   . THR A 1 339 ? 15.419  79.368  62.589  1.00 36.31  ? 336 THR A N   1 
ATOM 2334  C CA  . THR A 1 339 ? 14.073  78.813  62.751  1.00 34.24  ? 336 THR A CA  1 
ATOM 2335  C C   . THR A 1 339 ? 13.708  77.839  61.626  1.00 50.00  ? 336 THR A C   1 
ATOM 2336  O O   . THR A 1 339 ? 13.038  76.844  61.861  1.00 41.72  ? 336 THR A O   1 
ATOM 2337  C CB  . THR A 1 339 ? 13.023  79.917  62.814  1.00 37.04  ? 336 THR A CB  1 
ATOM 2338  O OG1 . THR A 1 339 ? 13.355  80.809  63.872  1.00 32.97  ? 336 THR A OG1 1 
ATOM 2339  C CG2 . THR A 1 339 ? 11.664  79.335  63.068  1.00 36.24  ? 336 THR A CG2 1 
ATOM 2340  N N   . LEU A 1 340 ? 14.155  78.130  60.405  1.00 42.67  ? 337 LEU A N   1 
ATOM 2341  C CA  . LEU A 1 340 ? 13.908  77.248  59.271  1.00 47.87  ? 337 LEU A CA  1 
ATOM 2342  C C   . LEU A 1 340 ? 14.614  75.911  59.483  1.00 47.48  ? 337 LEU A C   1 
ATOM 2343  O O   . LEU A 1 340 ? 14.029  74.853  59.283  1.00 39.00  ? 337 LEU A O   1 
ATOM 2344  C CB  . LEU A 1 340 ? 14.415  77.871  57.987  1.00 39.72  ? 337 LEU A CB  1 
ATOM 2345  C CG  . LEU A 1 340 ? 13.571  78.610  56.962  1.00 44.00  ? 337 LEU A CG  1 
ATOM 2346  C CD1 . LEU A 1 340 ? 12.094  78.350  56.928  1.00 51.06  ? 337 LEU A CD1 1 
ATOM 2347  C CD2 . LEU A 1 340 ? 13.999  80.036  56.650  1.00 82.50  ? 337 LEU A CD2 1 
ATOM 2348  N N   . ARG A 1 341 ? 15.879  75.957  59.885  1.00 35.66  ? 338 ARG A N   1 
ATOM 2349  C CA  . ARG A 1 341 ? 16.598  74.733  60.207  1.00 47.93  ? 338 ARG A CA  1 
ATOM 2350  C C   . ARG A 1 341 ? 15.937  73.949  61.343  1.00 43.40  ? 338 ARG A C   1 
ATOM 2351  O O   . ARG A 1 341 ? 15.681  72.765  61.203  1.00 38.44  ? 338 ARG A O   1 
ATOM 2352  C CB  . ARG A 1 341 ? 18.050  75.028  60.540  1.00 43.47  ? 338 ARG A CB  1 
ATOM 2353  C CG  . ARG A 1 341 ? 18.950  75.136  59.337  1.00 43.14  ? 338 ARG A CG  1 
ATOM 2354  C CD  . ARG A 1 341 ? 20.404  75.314  59.759  1.00 36.38  ? 338 ARG A CD  1 
ATOM 2355  N NE  . ARG A 1 341 ? 21.329  75.276  58.630  1.00 52.17  ? 338 ARG A NE  1 
ATOM 2356  C CZ  . ARG A 1 341 ? 22.653  75.304  58.740  1.00 62.04  ? 338 ARG A CZ  1 
ATOM 2357  N NH1 . ARG A 1 341 ? 23.219  75.352  59.931  1.00 41.30  ? 338 ARG A NH1 1 
ATOM 2358  N NH2 . ARG A 1 341 ? 23.414  75.280  57.657  1.00 39.98  ? 338 ARG A NH2 1 
ATOM 2359  N N   . SER A 1 342 ? 15.633  74.611  62.449  1.00 44.39  ? 339 SER A N   1 
ATOM 2360  C CA  . SER A 1 342 ? 15.081  73.921  63.606  1.00 45.65  ? 339 SER A CA  1 
ATOM 2361  C C   . SER A 1 342 ? 13.715  73.319  63.321  1.00 45.50  ? 339 SER A C   1 
ATOM 2362  O O   . SER A 1 342 ? 13.459  72.187  63.709  1.00 39.43  ? 339 SER A O   1 
ATOM 2363  C CB  . SER A 1 342 ? 15.011  74.857  64.813  1.00 39.69  ? 339 SER A CB  1 
ATOM 2364  O OG  . SER A 1 342 ? 14.397  74.213  65.897  1.00 36.67  ? 339 SER A OG  1 
ATOM 2365  N N   . ALA A 1 343 ? 12.845  74.078  62.651  1.00 35.50  ? 340 ALA A N   1 
ATOM 2366  C CA  . ALA A 1 343 ? 11.465  73.629  62.371  1.00 44.05  ? 340 ALA A CA  1 
ATOM 2367  C C   . ALA A 1 343 ? 11.371  72.528  61.326  1.00 35.70  ? 340 ALA A C   1 
ATOM 2368  O O   . ALA A 1 343 ? 10.512  71.656  61.403  1.00 39.83  ? 340 ALA A O   1 
ATOM 2369  C CB  . ALA A 1 343 ? 10.586  74.790  61.926  1.00 27.11  ? 340 ALA A CB  1 
ATOM 2370  N N   . PHE A 1 344 ? 12.256  72.573  60.346  1.00 33.99  ? 341 PHE A N   1 
ATOM 2371  C CA  . PHE A 1 344 ? 12.063  71.783  59.133  1.00 52.10  ? 341 PHE A CA  1 
ATOM 2372  C C   . PHE A 1 344 ? 13.157  70.760  58.821  1.00 45.46  ? 341 PHE A C   1 
ATOM 2373  O O   . PHE A 1 344 ? 12.907  69.844  58.076  1.00 30.78  ? 341 PHE A O   1 
ATOM 2374  C CB  . PHE A 1 344 ? 11.816  72.684  57.917  1.00 36.67  ? 341 PHE A CB  1 
ATOM 2375  C CG  . PHE A 1 344 ? 10.610  73.563  58.050  1.00 33.75  ? 341 PHE A CG  1 
ATOM 2376  C CD1 . PHE A 1 344 ? 9.426   73.054  58.520  1.00 40.72  ? 341 PHE A CD1 1 
ATOM 2377  C CD2 . PHE A 1 344 ? 10.669  74.897  57.713  1.00 41.48  ? 341 PHE A CD2 1 
ATOM 2378  C CE1 . PHE A 1 344 ? 8.325   73.859  58.655  1.00 55.21  ? 341 PHE A CE1 1 
ATOM 2379  C CE2 . PHE A 1 344 ? 9.573   75.699  57.847  1.00 34.67  ? 341 PHE A CE2 1 
ATOM 2380  C CZ  . PHE A 1 344 ? 8.406   75.186  58.319  1.00 37.69  ? 341 PHE A CZ  1 
ATOM 2381  N N   . GLU A 1 345 ? 14.348  70.875  59.399  1.00 32.84  ? 342 GLU A N   1 
ATOM 2382  C CA  . GLU A 1 345 ? 15.341  69.840  59.147  1.00 39.55  ? 342 GLU A CA  1 
ATOM 2383  C C   . GLU A 1 345 ? 14.818  68.486  59.581  1.00 42.63  ? 342 GLU A C   1 
ATOM 2384  O O   . GLU A 1 345 ? 14.115  68.383  60.588  1.00 37.16  ? 342 GLU A O   1 
ATOM 2385  C CB  . GLU A 1 345 ? 16.663  70.133  59.824  1.00 23.62  ? 342 GLU A CB  1 
ATOM 2386  C CG  . GLU A 1 345 ? 17.396  71.290  59.231  1.00 38.31  ? 342 GLU A CG  1 
ATOM 2387  C CD  . GLU A 1 345 ? 18.827  71.320  59.653  1.00 56.03  ? 342 GLU A CD  1 
ATOM 2388  O OE1 . GLU A 1 345 ? 19.073  71.524  60.865  1.00 83.32  ? 342 GLU A OE1 1 
ATOM 2389  O OE2 . GLU A 1 345 ? 19.695  71.125  58.769  1.00 66.80  ? 342 GLU A OE2 1 
ATOM 2390  N N   . TYR A 1 346 ? 15.161  67.460  58.814  1.00 35.41  ? 343 TYR A N   1 
ATOM 2391  C CA  . TYR A 1 346 ? 14.584  66.139  58.991  1.00 33.42  ? 343 TYR A CA  1 
ATOM 2392  C C   . TYR A 1 346 ? 13.047  66.143  59.160  1.00 38.13  ? 343 TYR A C   1 
ATOM 2393  O O   . TYR A 1 346 ? 12.478  65.303  59.859  1.00 55.13  ? 343 TYR A O   1 
ATOM 2394  C CB  . TYR A 1 346 ? 15.277  65.391  60.139  1.00 28.33  ? 343 TYR A CB  1 
ATOM 2395  C CG  . TYR A 1 346 ? 14.898  63.939  60.226  1.00 34.26  ? 343 TYR A CG  1 
ATOM 2396  C CD1 . TYR A 1 346 ? 14.806  63.148  59.072  1.00 25.52  ? 343 TYR A CD1 1 
ATOM 2397  C CD2 . TYR A 1 346 ? 14.616  63.344  61.460  1.00 39.02  ? 343 TYR A CD2 1 
ATOM 2398  C CE1 . TYR A 1 346 ? 14.434  61.805  59.147  1.00 45.23  ? 343 TYR A CE1 1 
ATOM 2399  C CE2 . TYR A 1 346 ? 14.251  62.008  61.551  1.00 19.40  ? 343 TYR A CE2 1 
ATOM 2400  C CZ  . TYR A 1 346 ? 14.167  61.244  60.390  1.00 59.34  ? 343 TYR A CZ  1 
ATOM 2401  O OH  . TYR A 1 346 ? 13.820  59.921  60.478  1.00 33.54  ? 343 TYR A OH  1 
ATOM 2402  N N   . GLY A 1 347 ? 12.371  67.078  58.508  1.00 40.50  ? 344 GLY A N   1 
ATOM 2403  C CA  . GLY A 1 347 ? 10.919  67.114  58.557  1.00 33.26  ? 344 GLY A CA  1 
ATOM 2404  C C   . GLY A 1 347 ? 10.329  67.453  59.922  1.00 52.60  ? 344 GLY A C   1 
ATOM 2405  O O   . GLY A 1 347 ? 9.183   67.116  60.241  1.00 32.79  ? 344 GLY A O   1 
ATOM 2406  N N   . GLY A 1 348 ? 11.104  68.133  60.753  1.00 48.41  ? 345 GLY A N   1 
ATOM 2407  C CA  . GLY A 1 348 ? 10.604  68.519  62.057  1.00 29.15  ? 345 GLY A CA  1 
ATOM 2408  C C   . GLY A 1 348 ? 10.429  67.334  63.005  1.00 51.15  ? 345 GLY A C   1 
ATOM 2409  O O   . GLY A 1 348 ? 9.765   67.436  64.043  1.00 42.10  ? 345 GLY A O   1 
ATOM 2410  N N   . GLN A 1 349 ? 11.039  66.205  62.653  1.00 26.57  ? 346 GLN A N   1 
ATOM 2411  C CA  . GLN A 1 349 ? 10.912  64.959  63.419  1.00 47.86  ? 346 GLN A CA  1 
ATOM 2412  C C   . GLN A 1 349 ? 11.996  64.794  64.495  1.00 30.49  ? 346 GLN A C   1 
ATOM 2413  O O   . GLN A 1 349 ? 12.684  63.800  64.580  1.00 34.54  ? 346 GLN A O   1 
ATOM 2414  C CB  . GLN A 1 349 ? 10.939  63.775  62.463  1.00 31.88  ? 346 GLN A CB  1 
ATOM 2415  C CG  . GLN A 1 349 ? 9.923   63.892  61.344  1.00 32.92  ? 346 GLN A CG  1 
ATOM 2416  C CD  . GLN A 1 349 ? 9.736   62.596  60.602  1.00 47.25  ? 346 GLN A CD  1 
ATOM 2417  O OE1 . GLN A 1 349 ? 8.765   61.871  60.820  1.00 48.40  ? 346 GLN A OE1 1 
ATOM 2418  N NE2 . GLN A 1 349 ? 10.677  62.290  59.724  1.00 33.06  ? 346 GLN A NE2 1 
ATOM 2419  N N   . LYS A 1 350 ? 12.167  65.821  65.295  1.00 47.03  ? 347 LYS A N   1 
ATOM 2420  C CA  . LYS A 1 350 ? 13.123  65.768  66.366  1.00 29.41  ? 347 LYS A CA  1 
ATOM 2421  C C   . LYS A 1 350 ? 12.404  66.228  67.639  1.00 54.68  ? 347 LYS A C   1 
ATOM 2422  O O   . LYS A 1 350 ? 11.559  67.128  67.616  1.00 48.72  ? 347 LYS A O   1 
ATOM 2423  C CB  . LYS A 1 350 ? 14.323  66.672  66.081  1.00 32.49  ? 347 LYS A CB  1 
ATOM 2424  C CG  . LYS A 1 350 ? 15.141  66.322  64.860  1.00 37.91  ? 347 LYS A CG  1 
ATOM 2425  C CD  . LYS A 1 350 ? 16.244  67.337  64.684  1.00 35.98  ? 347 LYS A CD  1 
ATOM 2426  C CE  . LYS A 1 350 ? 17.122  67.043  63.514  1.00 35.55  ? 347 LYS A CE  1 
ATOM 2427  N NZ  . LYS A 1 350 ? 18.147  68.108  63.367  1.00 50.48  ? 347 LYS A NZ  1 
ATOM 2428  N N   . CYS A 1 351 ? 12.738  65.584  68.745  1.00 46.34  ? 348 CYS A N   1 
ATOM 2429  C CA  . CYS A 1 351 ? 12.232  65.942  70.059  1.00 43.28  ? 348 CYS A CA  1 
ATOM 2430  C C   . CYS A 1 351 ? 12.543  67.421  70.333  1.00 26.76  ? 348 CYS A C   1 
ATOM 2431  O O   . CYS A 1 351 ? 11.830  68.097  71.069  1.00 43.48  ? 348 CYS A O   1 
ATOM 2432  C CB  . CYS A 1 351 ? 12.886  65.024  71.118  1.00 46.21  ? 348 CYS A CB  1 
ATOM 2433  S SG  . CYS A 1 351 ? 12.821  63.221  70.701  1.00 90.72  ? 348 CYS A SG  1 
ATOM 2434  N N   . SER A 1 352 ? 13.611  67.920  69.729  1.00 39.77  ? 349 SER A N   1 
ATOM 2435  C CA  . SER A 1 352 ? 14.072  69.286  69.954  1.00 38.34  ? 349 SER A CA  1 
ATOM 2436  C C   . SER A 1 352 ? 13.594  70.319  68.937  1.00 40.72  ? 349 SER A C   1 
ATOM 2437  O O   . SER A 1 352 ? 13.851  71.499  69.121  1.00 36.79  ? 349 SER A O   1 
ATOM 2438  C CB  . SER A 1 352 ? 15.594  69.311  69.985  1.00 31.94  ? 349 SER A CB  1 
ATOM 2439  O OG  . SER A 1 352 ? 16.116  68.623  68.870  1.00 42.70  ? 349 SER A OG  1 
ATOM 2440  N N   . ALA A 1 353 ? 12.932  69.886  67.860  1.00 49.64  ? 350 ALA A N   1 
ATOM 2441  C CA  . ALA A 1 353 ? 12.497  70.803  66.803  1.00 33.83  ? 350 ALA A CA  1 
ATOM 2442  C C   . ALA A 1 353 ? 11.623  71.934  67.318  1.00 40.96  ? 350 ALA A C   1 
ATOM 2443  O O   . ALA A 1 353 ? 10.729  71.728  68.141  1.00 39.55  ? 350 ALA A O   1 
ATOM 2444  C CB  . ALA A 1 353 ? 11.770  70.054  65.703  1.00 35.09  ? 350 ALA A CB  1 
ATOM 2445  N N   . CYS A 1 354 ? 11.896  73.135  66.821  1.00 42.60  ? 351 CYS A N   1 
ATOM 2446  C CA  . CYS A 1 354 ? 11.052  74.299  67.068  1.00 48.28  ? 351 CYS A CA  1 
ATOM 2447  C C   . CYS A 1 354 ? 9.707   74.182  66.337  1.00 57.01  ? 351 CYS A C   1 
ATOM 2448  O O   . CYS A 1 354 ? 9.681   73.953  65.130  1.00 61.87  ? 351 CYS A O   1 
ATOM 2449  C CB  . CYS A 1 354 ? 11.769  75.553  66.583  1.00 31.87  ? 351 CYS A CB  1 
ATOM 2450  S SG  . CYS A 1 354 ? 10.699  76.989  66.550  1.00 44.10  ? 351 CYS A SG  1 
ATOM 2451  N N   . SER A 1 355 ? 8.599   74.344  67.063  1.00 29.96  ? 352 SER A N   1 
ATOM 2452  C CA  . SER A 1 355 ? 7.263   74.281  66.474  1.00 33.49  ? 352 SER A CA  1 
ATOM 2453  C C   . SER A 1 355 ? 6.343   75.413  66.936  1.00 39.13  ? 352 SER A C   1 
ATOM 2454  O O   . SER A 1 355 ? 5.200   75.538  66.480  1.00 41.75  ? 352 SER A O   1 
ATOM 2455  C CB  . SER A 1 355 ? 6.607   72.936  66.741  1.00 42.28  ? 352 SER A CB  1 
ATOM 2456  O OG  . SER A 1 355 ? 6.283   72.782  68.101  1.00 48.41  ? 352 SER A OG  1 
ATOM 2457  N N   . ARG A 1 356 ? 6.847   76.225  67.856  1.00 35.80  ? 353 ARG A N   1 
ATOM 2458  C CA  . ARG A 1 356 ? 6.190   77.459  68.249  1.00 40.97  ? 353 ARG A CA  1 
ATOM 2459  C C   . ARG A 1 356 ? 7.171   78.605  68.257  1.00 43.04  ? 353 ARG A C   1 
ATOM 2460  O O   . ARG A 1 356 ? 8.177   78.563  68.944  1.00 40.71  ? 353 ARG A O   1 
ATOM 2461  C CB  . ARG A 1 356 ? 5.449   77.349  69.583  1.00 31.04  ? 353 ARG A CB  1 
ATOM 2462  C CG  . ARG A 1 356 ? 6.114   76.572  70.669  1.00 42.99  ? 353 ARG A CG  1 
ATOM 2463  C CD  . ARG A 1 356 ? 5.242   76.531  71.916  1.00 28.93  ? 353 ARG A CD  1 
ATOM 2464  N NE  . ARG A 1 356 ? 6.001   76.964  73.055  1.00 78.26  ? 353 ARG A NE  1 
ATOM 2465  C CZ  . ARG A 1 356 ? 6.224   76.432  74.254  1.00 28.73  ? 353 ARG A CZ  1 
ATOM 2466  N NH1 . ARG A 1 356 ? 5.718   75.316  74.720  1.00 91.65  ? 353 ARG A NH1 1 
ATOM 2467  N NH2 . ARG A 1 356 ? 7.010   77.135  75.024  1.00 78.50  ? 353 ARG A NH2 1 
ATOM 2468  N N   . LEU A 1 357 ? 6.887   79.606  67.432  1.00 24.94  ? 354 LEU A N   1 
ATOM 2469  C CA  . LEU A 1 357 ? 7.735   80.783  67.282  1.00 43.77  ? 354 LEU A CA  1 
ATOM 2470  C C   . LEU A 1 357 ? 6.987   82.031  67.752  1.00 51.76  ? 354 LEU A C   1 
ATOM 2471  O O   . LEU A 1 357 ? 5.867   82.276  67.330  1.00 41.84  ? 354 LEU A O   1 
ATOM 2472  C CB  . LEU A 1 357 ? 8.127   80.949  65.813  1.00 39.45  ? 354 LEU A CB  1 
ATOM 2473  C CG  . LEU A 1 357 ? 8.809   82.247  65.373  1.00 30.40  ? 354 LEU A CG  1 
ATOM 2474  C CD1 . LEU A 1 357 ? 10.193  82.364  65.952  1.00 43.15  ? 354 LEU A CD1 1 
ATOM 2475  C CD2 . LEU A 1 357 ? 8.880   82.316  63.867  1.00 45.05  ? 354 LEU A CD2 1 
ATOM 2476  N N   . TYR A 1 358 ? 7.609   82.825  68.613  1.00 40.78  ? 355 TYR A N   1 
ATOM 2477  C CA  . TYR A 1 358 ? 6.964   84.028  69.142  1.00 36.81  ? 355 TYR A CA  1 
ATOM 2478  C C   . TYR A 1 358 ? 7.695   85.245  68.598  1.00 47.77  ? 355 TYR A C   1 
ATOM 2479  O O   . TYR A 1 358 ? 8.906   85.391  68.796  1.00 50.54  ? 355 TYR A O   1 
ATOM 2480  C CB  . TYR A 1 358 ? 6.965   84.037  70.699  1.00 24.53  ? 355 TYR A CB  1 
ATOM 2481  C CG  . TYR A 1 358 ? 6.187   82.918  71.361  1.00 42.78  ? 355 TYR A CG  1 
ATOM 2482  C CD1 . TYR A 1 358 ? 4.901   83.126  71.841  1.00 40.29  ? 355 TYR A CD1 1 
ATOM 2483  C CD2 . TYR A 1 358 ? 6.741   81.658  71.523  1.00 34.44  ? 355 TYR A CD2 1 
ATOM 2484  C CE1 . TYR A 1 358 ? 4.188   82.110  72.465  1.00 52.47  ? 355 TYR A CE1 1 
ATOM 2485  C CE2 . TYR A 1 358 ? 6.023   80.630  72.149  1.00 45.20  ? 355 TYR A CE2 1 
ATOM 2486  C CZ  . TYR A 1 358 ? 4.754   80.865  72.613  1.00 44.69  ? 355 TYR A CZ  1 
ATOM 2487  O OH  . TYR A 1 358 ? 4.034   79.872  73.227  1.00 43.40  ? 355 TYR A OH  1 
ATOM 2488  N N   . VAL A 1 359 ? 6.954   86.113  67.912  1.00 60.60  ? 356 VAL A N   1 
ATOM 2489  C CA  . VAL A 1 359 ? 7.527   87.251  67.194  1.00 63.56  ? 356 VAL A CA  1 
ATOM 2490  C C   . VAL A 1 359 ? 6.881   88.571  67.619  1.00 67.01  ? 356 VAL A C   1 
ATOM 2491  O O   . VAL A 1 359 ? 5.656   88.655  67.757  1.00 39.32  ? 356 VAL A O   1 
ATOM 2492  C CB  . VAL A 1 359 ? 7.351   87.092  65.664  1.00 56.50  ? 356 VAL A CB  1 
ATOM 2493  C CG1 . VAL A 1 359 ? 8.190   88.105  64.940  1.00 69.18  ? 356 VAL A CG1 1 
ATOM 2494  C CG2 . VAL A 1 359 ? 7.749   85.708  65.229  1.00 43.47  ? 356 VAL A CG2 1 
ATOM 2495  N N   . PRO A 1 360 ? 7.706   89.613  67.828  1.00 44.52  ? 357 PRO A N   1 
ATOM 2496  C CA  . PRO A 1 360 ? 7.201   90.951  68.155  1.00 49.67  ? 357 PRO A CA  1 
ATOM 2497  C C   . PRO A 1 360 ? 6.472   91.586  66.959  1.00 67.09  ? 357 PRO A C   1 
ATOM 2498  O O   . PRO A 1 360 ? 6.893   91.402  65.824  1.00 50.58  ? 357 PRO A O   1 
ATOM 2499  C CB  . PRO A 1 360 ? 8.479   91.747  68.449  1.00 35.64  ? 357 PRO A CB  1 
ATOM 2500  C CG  . PRO A 1 360 ? 9.599   90.778  68.410  1.00 52.83  ? 357 PRO A CG  1 
ATOM 2501  C CD  . PRO A 1 360 ? 9.167   89.605  67.643  1.00 49.61  ? 357 PRO A CD  1 
ATOM 2502  N N   . HIS A 1 361 ? 5.400   92.326  67.213  1.00 71.01  ? 358 HIS A N   1 
ATOM 2503  C CA  . HIS A 1 361 ? 4.673   93.014  66.155  1.00 53.98  ? 358 HIS A CA  1 
ATOM 2504  C C   . HIS A 1 361 ? 5.612   93.852  65.271  1.00 62.13  ? 358 HIS A C   1 
ATOM 2505  O O   . HIS A 1 361 ? 5.548   93.788  64.049  1.00 50.46  ? 358 HIS A O   1 
ATOM 2506  C CB  . HIS A 1 361 ? 3.576   93.891  66.759  1.00 69.50  ? 358 HIS A CB  1 
ATOM 2507  C CG  . HIS A 1 361 ? 2.760   94.631  65.745  1.00 98.10  ? 358 HIS A CG  1 
ATOM 2508  N ND1 . HIS A 1 361 ? 1.798   94.019  64.973  1.00 104.82 ? 358 HIS A ND1 1 
ATOM 2509  C CD2 . HIS A 1 361 ? 2.761   95.936  65.382  1.00 81.85  ? 358 HIS A CD2 1 
ATOM 2510  C CE1 . HIS A 1 361 ? 1.243   94.913  64.176  1.00 109.20 ? 358 HIS A CE1 1 
ATOM 2511  N NE2 . HIS A 1 361 ? 1.807   96.084  64.406  1.00 86.43  ? 358 HIS A NE2 1 
ATOM 2512  N N   . SER A 1 362 ? 6.496   94.618  65.894  1.00 71.22  ? 359 SER A N   1 
ATOM 2513  C CA  . SER A 1 362 ? 7.436   95.471  65.160  1.00 70.47  ? 359 SER A CA  1 
ATOM 2514  C C   . SER A 1 362 ? 8.257   94.737  64.087  1.00 63.12  ? 359 SER A C   1 
ATOM 2515  O O   . SER A 1 362 ? 8.533   95.281  63.022  1.00 77.40  ? 359 SER A O   1 
ATOM 2516  C CB  . SER A 1 362 ? 8.358   96.235  66.136  1.00 61.60  ? 359 SER A CB  1 
ATOM 2517  O OG  . SER A 1 362 ? 9.321   95.401  66.752  1.00 77.01  ? 359 SER A OG  1 
ATOM 2518  N N   . LEU A 1 363 ? 8.638   93.502  64.376  1.00 76.81  ? 360 LEU A N   1 
ATOM 2519  C CA  . LEU A 1 363 ? 9.534   92.748  63.525  1.00 48.69  ? 360 LEU A CA  1 
ATOM 2520  C C   . LEU A 1 363 ? 8.782   91.823  62.563  1.00 41.08  ? 360 LEU A C   1 
ATOM 2521  O O   . LEU A 1 363 ? 9.377   91.291  61.627  1.00 58.47  ? 360 LEU A O   1 
ATOM 2522  C CB  . LEU A 1 363 ? 10.438  91.916  64.413  1.00 45.55  ? 360 LEU A CB  1 
ATOM 2523  C CG  . LEU A 1 363 ? 11.927  92.130  64.609  1.00 65.25  ? 360 LEU A CG  1 
ATOM 2524  C CD1 . LEU A 1 363 ? 12.587  93.240  63.831  1.00 63.77  ? 360 LEU A CD1 1 
ATOM 2525  C CD2 . LEU A 1 363 ? 12.414  91.969  66.039  1.00 76.33  ? 360 LEU A CD2 1 
ATOM 2526  N N   . TRP A 1 364 ? 7.486   91.622  62.793  1.00 41.50  ? 361 TRP A N   1 
ATOM 2527  C CA  . TRP A 1 364 ? 6.725   90.601  62.055  1.00 48.81  ? 361 TRP A CA  1 
ATOM 2528  C C   . TRP A 1 364 ? 6.738   90.769  60.536  1.00 70.58  ? 361 TRP A C   1 
ATOM 2529  O O   . TRP A 1 364 ? 7.020   89.812  59.825  1.00 52.77  ? 361 TRP A O   1 
ATOM 2530  C CB  . TRP A 1 364 ? 5.288   90.494  62.563  1.00 35.47  ? 361 TRP A CB  1 
ATOM 2531  C CG  . TRP A 1 364 ? 4.438   89.434  61.868  1.00 59.47  ? 361 TRP A CG  1 
ATOM 2532  C CD1 . TRP A 1 364 ? 3.143   89.571  61.449  1.00 54.90  ? 361 TRP A CD1 1 
ATOM 2533  C CD2 . TRP A 1 364 ? 4.822   88.091  61.529  1.00 33.25  ? 361 TRP A CD2 1 
ATOM 2534  N NE1 . TRP A 1 364 ? 2.703   88.406  60.869  1.00 52.84  ? 361 TRP A NE1 1 
ATOM 2535  C CE2 . TRP A 1 364 ? 3.712   87.482  60.907  1.00 54.08  ? 361 TRP A CE2 1 
ATOM 2536  C CE3 . TRP A 1 364 ? 5.994   87.344  61.695  1.00 61.10  ? 361 TRP A CE3 1 
ATOM 2537  C CZ2 . TRP A 1 364 ? 3.737   86.164  60.452  1.00 57.26  ? 361 TRP A CZ2 1 
ATOM 2538  C CZ3 . TRP A 1 364 ? 6.019   86.037  61.240  1.00 52.71  ? 361 TRP A CZ3 1 
ATOM 2539  C CH2 . TRP A 1 364 ? 4.896   85.460  60.627  1.00 43.83  ? 361 TRP A CH2 1 
ATOM 2540  N N   . PRO A 1 365 ? 6.429   91.980  60.031  1.00 78.02  ? 362 PRO A N   1 
ATOM 2541  C CA  . PRO A 1 365 ? 6.412   92.161  58.572  1.00 64.40  ? 362 PRO A CA  1 
ATOM 2542  C C   . PRO A 1 365 ? 7.722   91.723  57.911  1.00 46.30  ? 362 PRO A C   1 
ATOM 2543  O O   . PRO A 1 365 ? 7.706   90.976  56.935  1.00 52.45  ? 362 PRO A O   1 
ATOM 2544  C CB  . PRO A 1 365 ? 6.200   93.667  58.407  1.00 62.76  ? 362 PRO A CB  1 
ATOM 2545  C CG  . PRO A 1 365 ? 5.521   94.089  59.681  1.00 60.83  ? 362 PRO A CG  1 
ATOM 2546  C CD  . PRO A 1 365 ? 6.128   93.234  60.744  1.00 62.68  ? 362 PRO A CD  1 
ATOM 2547  N N   . GLN A 1 366 ? 8.844   92.170  58.449  1.00 45.82  ? 363 GLN A N   1 
ATOM 2548  C CA  . GLN A 1 366 ? 10.158  91.747  57.968  1.00 62.19  ? 363 GLN A CA  1 
ATOM 2549  C C   . GLN A 1 366 ? 10.402  90.241  58.065  1.00 74.89  ? 363 GLN A C   1 
ATOM 2550  O O   . GLN A 1 366 ? 10.911  89.619  57.138  1.00 54.20  ? 363 GLN A O   1 
ATOM 2551  C CB  . GLN A 1 366 ? 11.256  92.477  58.735  1.00 54.66  ? 363 GLN A CB  1 
ATOM 2552  C CG  . GLN A 1 366 ? 12.641  92.057  58.334  1.00 49.82  ? 363 GLN A CG  1 
ATOM 2553  C CD  . GLN A 1 366 ? 13.686  92.982  58.871  1.00 53.33  ? 363 GLN A CD  1 
ATOM 2554  O OE1 . GLN A 1 366 ? 14.743  92.564  59.255  1.00 66.77  ? 363 GLN A OE1 1 
ATOM 2555  N NE2 . GLN A 1 366 ? 13.392  94.252  58.884  1.00 97.32  ? 363 GLN A NE2 1 
ATOM 2556  N N   . ILE A 1 367 ? 10.049  89.659  59.201  1.00 59.74  ? 364 ILE A N   1 
ATOM 2557  C CA  . ILE A 1 367 ? 10.313  88.248  59.438  1.00 61.67  ? 364 ILE A CA  1 
ATOM 2558  C C   . ILE A 1 367 ? 9.377   87.375  58.614  1.00 69.67  ? 364 ILE A C   1 
ATOM 2559  O O   . ILE A 1 367 ? 9.797   86.373  58.053  1.00 41.92  ? 364 ILE A O   1 
ATOM 2560  C CB  . ILE A 1 367 ? 10.235  87.901  60.954  1.00 59.50  ? 364 ILE A CB  1 
ATOM 2561  C CG1 . ILE A 1 367 ? 11.419  88.531  61.689  1.00 56.51  ? 364 ILE A CG1 1 
ATOM 2562  C CG2 . ILE A 1 367 ? 10.239  86.407  61.175  1.00 42.02  ? 364 ILE A CG2 1 
ATOM 2563  C CD1 . ILE A 1 367 ? 11.367  88.401  63.149  1.00 58.84  ? 364 ILE A CD1 1 
ATOM 2564  N N   . LYS A 1 368 ? 8.109   87.760  58.538  1.00 43.56  ? 365 LYS A N   1 
ATOM 2565  C CA  . LYS A 1 368 ? 7.150   87.045  57.705  1.00 46.12  ? 365 LYS A CA  1 
ATOM 2566  C C   . LYS A 1 368 ? 7.576   87.006  56.233  1.00 63.67  ? 365 LYS A C   1 
ATOM 2567  O O   . LYS A 1 368 ? 7.389   86.000  55.554  1.00 42.81  ? 365 LYS A O   1 
ATOM 2568  C CB  . LYS A 1 368 ? 5.771   87.691  57.810  1.00 62.91  ? 365 LYS A CB  1 
ATOM 2569  C CG  . LYS A 1 368 ? 4.725   87.114  56.856  1.00 44.51  ? 365 LYS A CG  1 
ATOM 2570  C CD  . LYS A 1 368 ? 3.385   87.815  57.063  1.00 61.11  ? 365 LYS A CD  1 
ATOM 2571  C CE  . LYS A 1 368 ? 2.264   87.114  56.327  1.00 72.97  ? 365 LYS A CE  1 
ATOM 2572  N NZ  . LYS A 1 368 ? 0.955   87.708  56.694  1.00 49.03  ? 365 LYS A NZ  1 
ATOM 2573  N N   . GLY A 1 369 ? 8.140   88.111  55.753  1.00 57.11  ? 366 GLY A N   1 
ATOM 2574  C CA  . GLY A 1 369 ? 8.541   88.245  54.368  1.00 47.44  ? 366 GLY A CA  1 
ATOM 2575  C C   . GLY A 1 369 ? 9.757   87.416  54.046  1.00 59.97  ? 366 GLY A C   1 
ATOM 2576  O O   . GLY A 1 369 ? 9.767   86.714  53.036  1.00 49.52  ? 366 GLY A O   1 
ATOM 2577  N N   . ARG A 1 370 ? 10.775  87.506  54.900  1.00 47.14  ? 367 ARG A N   1 
ATOM 2578  C CA  . ARG A 1 370 ? 11.989  86.701  54.760  1.00 61.33  ? 367 ARG A CA  1 
ATOM 2579  C C   . ARG A 1 370 ? 11.694  85.204  54.882  1.00 64.75  ? 367 ARG A C   1 
ATOM 2580  O O   . ARG A 1 370 ? 12.269  84.376  54.179  1.00 63.35  ? 367 ARG A O   1 
ATOM 2581  C CB  . ARG A 1 370 ? 13.024  87.052  55.825  1.00 40.54  ? 367 ARG A CB  1 
ATOM 2582  C CG  . ARG A 1 370 ? 13.551  88.425  55.788  1.00 63.08  ? 367 ARG A CG  1 
ATOM 2583  C CD  . ARG A 1 370 ? 14.462  88.780  54.650  1.00 47.97  ? 367 ARG A CD  1 
ATOM 2584  N NE  . ARG A 1 370 ? 15.068  87.887  53.665  1.00 56.96  ? 367 ARG A NE  1 
ATOM 2585  C CZ  . ARG A 1 370 ? 15.601  86.662  53.637  1.00 45.44  ? 367 ARG A CZ  1 
ATOM 2586  N NH1 . ARG A 1 370 ? 15.638  85.752  54.604  1.00 104.83 ? 367 ARG A NH1 1 
ATOM 2587  N NH2 . ARG A 1 370 ? 16.090  86.345  52.462  1.00 77.57  ? 367 ARG A NH2 1 
ATOM 2588  N N   . LEU A 1 371 ? 10.806  84.851  55.794  1.00 50.61  ? 368 LEU A N   1 
ATOM 2589  C CA  . LEU A 1 371 ? 10.459  83.462  55.988  1.00 57.92  ? 368 LEU A CA  1 
ATOM 2590  C C   . LEU A 1 371 ? 9.777   82.917  54.766  1.00 61.27  ? 368 LEU A C   1 
ATOM 2591  O O   . LEU A 1 371 ? 10.142  81.854  54.291  1.00 48.56  ? 368 LEU A O   1 
ATOM 2592  C CB  . LEU A 1 371 ? 9.531   83.292  57.182  1.00 62.69  ? 368 LEU A CB  1 
ATOM 2593  C CG  . LEU A 1 371 ? 10.212  83.160  58.536  1.00 69.28  ? 368 LEU A CG  1 
ATOM 2594  C CD1 . LEU A 1 371 ? 9.182   82.968  59.632  1.00 46.40  ? 368 LEU A CD1 1 
ATOM 2595  C CD2 . LEU A 1 371 ? 11.186  82.002  58.513  1.00 49.55  ? 368 LEU A CD2 1 
ATOM 2596  N N   . LEU A 1 372 ? 8.767   83.633  54.282  1.00 63.65  ? 369 LEU A N   1 
ATOM 2597  C CA  . LEU A 1 372 ? 8.033   83.214  53.101  1.00 43.48  ? 369 LEU A CA  1 
ATOM 2598  C C   . LEU A 1 372 ? 8.949   83.142  51.878  1.00 52.21  ? 369 LEU A C   1 
ATOM 2599  O O   . LEU A 1 372 ? 8.835   82.214  51.090  1.00 49.12  ? 369 LEU A O   1 
ATOM 2600  C CB  . LEU A 1 372 ? 6.846   84.142  52.855  1.00 53.61  ? 369 LEU A CB  1 
ATOM 2601  C CG  . LEU A 1 372 ? 5.531   83.677  53.469  1.00 51.40  ? 369 LEU A CG  1 
ATOM 2602  C CD1 . LEU A 1 372 ? 5.763   83.080  54.797  1.00 46.71  ? 369 LEU A CD1 1 
ATOM 2603  C CD2 . LEU A 1 372 ? 4.548   84.818  53.574  1.00 48.51  ? 369 LEU A CD2 1 
ATOM 2604  N N   . GLU A 1 373 ? 9.865   84.098  51.722  1.00 56.78  ? 370 GLU A N   1 
ATOM 2605  C CA  . GLU A 1 373 ? 10.788  84.053  50.584  1.00 71.59  ? 370 GLU A CA  1 
ATOM 2606  C C   . GLU A 1 373 ? 11.683  82.818  50.667  1.00 62.36  ? 370 GLU A C   1 
ATOM 2607  O O   . GLU A 1 373 ? 11.855  82.110  49.695  1.00 45.30  ? 370 GLU A O   1 
ATOM 2608  C CB  . GLU A 1 373 ? 11.645  85.319  50.458  1.00 38.87  ? 370 GLU A CB  1 
ATOM 2609  C CG  . GLU A 1 373 ? 12.492  85.347  49.146  1.00 46.74  ? 370 GLU A CG  1 
ATOM 2610  N N   . GLU A 1 374 ? 12.243  82.550  51.838  1.00 60.13  ? 371 GLU A N   1 
ATOM 2611  C CA  . GLU A 1 374 ? 13.157  81.426  51.981  1.00 57.09  ? 371 GLU A CA  1 
ATOM 2612  C C   . GLU A 1 374 ? 12.430  80.088  51.933  1.00 60.32  ? 371 GLU A C   1 
ATOM 2613  O O   . GLU A 1 374 ? 12.933  79.130  51.370  1.00 46.46  ? 371 GLU A O   1 
ATOM 2614  C CB  . GLU A 1 374 ? 13.968  81.544  53.268  1.00 54.24  ? 371 GLU A CB  1 
ATOM 2615  C CG  . GLU A 1 374 ? 14.933  82.729  53.290  1.00 69.26  ? 371 GLU A CG  1 
ATOM 2616  C CD  . GLU A 1 374 ? 15.886  82.773  52.096  1.00 77.44  ? 371 GLU A CD  1 
ATOM 2617  O OE1 . GLU A 1 374 ? 16.298  81.703  51.616  1.00 72.46  ? 371 GLU A OE1 1 
ATOM 2618  O OE2 . GLU A 1 374 ? 16.224  83.883  51.630  1.00 66.32  ? 371 GLU A OE2 1 
ATOM 2619  N N   . HIS A 1 375 ? 11.247  80.025  52.533  1.00 52.63  ? 372 HIS A N   1 
ATOM 2620  C CA  . HIS A 1 375 ? 10.398  78.847  52.426  1.00 60.02  ? 372 HIS A CA  1 
ATOM 2621  C C   . HIS A 1 375 ? 10.217  78.375  50.986  1.00 69.40  ? 372 HIS A C   1 
ATOM 2622  O O   . HIS A 1 375 ? 10.239  77.172  50.721  1.00 52.16  ? 372 HIS A O   1 
ATOM 2623  C CB  . HIS A 1 375 ? 9.029   79.119  53.047  1.00 46.40  ? 372 HIS A CB  1 
ATOM 2624  C CG  . HIS A 1 375 ? 8.048   78.004  52.860  1.00 57.78  ? 372 HIS A CG  1 
ATOM 2625  N ND1 . HIS A 1 375 ? 7.402   77.767  51.666  1.00 67.31  ? 372 HIS A ND1 1 
ATOM 2626  C CD2 . HIS A 1 375 ? 7.593   77.069  53.724  1.00 63.45  ? 372 HIS A CD2 1 
ATOM 2627  C CE1 . HIS A 1 375 ? 6.595   76.730  51.804  1.00 55.29  ? 372 HIS A CE1 1 
ATOM 2628  N NE2 . HIS A 1 375 ? 6.695   76.286  53.042  1.00 58.65  ? 372 HIS A NE2 1 
ATOM 2629  N N   . SER A 1 376 ? 10.031  79.326  50.070  1.00 60.26  ? 373 SER A N   1 
ATOM 2630  C CA  . SER A 1 376 ? 9.780   79.009  48.668  1.00 76.55  ? 373 SER A CA  1 
ATOM 2631  C C   . SER A 1 376 ? 10.998  78.387  47.994  1.00 65.17  ? 373 SER A C   1 
ATOM 2632  O O   . SER A 1 376 ? 10.861  77.758  46.953  1.00 54.78  ? 373 SER A O   1 
ATOM 2633  C CB  . SER A 1 376 ? 9.285   80.239  47.893  1.00 68.66  ? 373 SER A CB  1 
ATOM 2634  O OG  . SER A 1 376 ? 10.327  81.158  47.630  1.00 58.07  ? 373 SER A OG  1 
ATOM 2635  N N   . ARG A 1 377 ? 12.172  78.540  48.608  1.00 48.98  ? 374 ARG A N   1 
ATOM 2636  C CA  . ARG A 1 377 ? 13.420  78.001  48.069  1.00 60.09  ? 374 ARG A CA  1 
ATOM 2637  C C   . ARG A 1 377 ? 13.746  76.612  48.641  1.00 66.66  ? 374 ARG A C   1 
ATOM 2638  O O   . ARG A 1 377 ? 14.756  76.003  48.272  1.00 47.16  ? 374 ARG A O   1 
ATOM 2639  C CB  . ARG A 1 377 ? 14.586  78.988  48.287  1.00 43.55  ? 374 ARG A CB  1 
ATOM 2640  N N   . ILE A 1 378 ? 12.882  76.105  49.523  1.00 55.41  ? 375 ILE A N   1 
ATOM 2641  C CA  . ILE A 1 378 ? 13.115  74.813  50.191  1.00 54.39  ? 375 ILE A CA  1 
ATOM 2642  C C   . ILE A 1 378 ? 12.750  73.614  49.315  1.00 69.68  ? 375 ILE A C   1 
ATOM 2643  O O   . ILE A 1 378 ? 11.580  73.450  48.960  1.00 56.99  ? 375 ILE A O   1 
ATOM 2644  C CB  . ILE A 1 378 ? 12.313  74.706  51.511  1.00 57.45  ? 375 ILE A CB  1 
ATOM 2645  C CG1 . ILE A 1 378 ? 12.927  75.576  52.587  1.00 49.05  ? 375 ILE A CG1 1 
ATOM 2646  C CG2 . ILE A 1 378 ? 12.282  73.283  52.032  1.00 29.52  ? 375 ILE A CG2 1 
ATOM 2647  C CD1 . ILE A 1 378 ? 12.095  75.623  53.820  1.00 38.59  ? 375 ILE A CD1 1 
ATOM 2648  N N   . LYS A 1 379 ? 13.733  72.774  48.980  1.00 45.19  ? 376 LYS A N   1 
ATOM 2649  C CA  . LYS A 1 379 ? 13.467  71.609  48.139  1.00 67.39  ? 376 LYS A CA  1 
ATOM 2650  C C   . LYS A 1 379 ? 13.230  70.364  48.987  1.00 60.27  ? 376 LYS A C   1 
ATOM 2651  O O   . LYS A 1 379 ? 14.066  69.992  49.790  1.00 46.43  ? 376 LYS A O   1 
ATOM 2652  C CB  . LYS A 1 379 ? 14.595  71.372  47.118  1.00 54.25  ? 376 LYS A CB  1 
ATOM 2653  N N   . VAL A 1 380 ? 12.064  69.750  48.816  1.00 45.09  ? 377 VAL A N   1 
ATOM 2654  C CA  . VAL A 1 380 ? 11.710  68.484  49.442  1.00 38.47  ? 377 VAL A CA  1 
ATOM 2655  C C   . VAL A 1 380 ? 11.714  67.369  48.388  1.00 55.71  ? 377 VAL A C   1 
ATOM 2656  O O   . VAL A 1 380 ? 11.078  67.485  47.341  1.00 84.34  ? 377 VAL A O   1 
ATOM 2657  C CB  . VAL A 1 380 ? 10.301  68.542  50.064  1.00 37.06  ? 377 VAL A CB  1 
ATOM 2658  C CG1 . VAL A 1 380 ? 9.941   67.215  50.729  1.00 51.41  ? 377 VAL A CG1 1 
ATOM 2659  C CG2 . VAL A 1 380 ? 10.201  69.673  51.074  1.00 47.66  ? 377 VAL A CG2 1 
ATOM 2660  N N   . GLY A 1 381 ? 12.432  66.291  48.659  1.00 54.09  ? 378 GLY A N   1 
ATOM 2661  C CA  . GLY A 1 381 ? 12.478  65.178  47.734  1.00 42.74  ? 378 GLY A CA  1 
ATOM 2662  C C   . GLY A 1 381 ? 13.319  64.000  48.196  1.00 67.07  ? 378 GLY A C   1 
ATOM 2663  O O   . GLY A 1 381 ? 13.502  63.768  49.394  1.00 56.18  ? 378 GLY A O   1 
ATOM 2664  N N   . ASP A 1 382 ? 13.821  63.258  47.216  1.00 52.56  ? 379 ASP A N   1 
ATOM 2665  C CA  . ASP A 1 382 ? 14.611  62.057  47.424  1.00 42.82  ? 379 ASP A CA  1 
ATOM 2666  C C   . ASP A 1 382 ? 16.044  62.453  47.751  1.00 61.33  ? 379 ASP A C   1 
ATOM 2667  O O   . ASP A 1 382 ? 16.727  63.057  46.929  1.00 60.82  ? 379 ASP A O   1 
ATOM 2668  C CB  . ASP A 1 382 ? 14.538  61.164  46.170  1.00 57.09  ? 379 ASP A CB  1 
ATOM 2669  C CG  . ASP A 1 382 ? 15.275  59.845  46.333  1.00 64.35  ? 379 ASP A CG  1 
ATOM 2670  O OD1 . ASP A 1 382 ? 16.400  59.865  46.868  1.00 68.45  ? 379 ASP A OD1 1 
ATOM 2671  O OD2 . ASP A 1 382 ? 14.736  58.792  45.908  1.00 70.00  ? 379 ASP A OD2 1 
ATOM 2672  N N   . PRO A 1 383 ? 16.501  62.110  48.968  1.00 50.33  ? 380 PRO A N   1 
ATOM 2673  C CA  . PRO A 1 383 ? 17.784  62.550  49.533  1.00 46.21  ? 380 PRO A CA  1 
ATOM 2674  C C   . PRO A 1 383 ? 18.993  61.767  49.024  1.00 59.14  ? 380 PRO A C   1 
ATOM 2675  O O   . PRO A 1 383 ? 20.124  62.254  49.121  1.00 47.77  ? 380 PRO A O   1 
ATOM 2676  C CB  . PRO A 1 383 ? 17.601  62.287  51.027  1.00 53.79  ? 380 PRO A CB  1 
ATOM 2677  C CG  . PRO A 1 383 ? 16.707  61.087  51.071  1.00 54.90  ? 380 PRO A CG  1 
ATOM 2678  C CD  . PRO A 1 383 ? 15.752  61.251  49.906  1.00 33.31  ? 380 PRO A CD  1 
ATOM 2679  N N   . ALA A 1 384 ? 18.753  60.560  48.519  1.00 47.27  ? 381 ALA A N   1 
ATOM 2680  C CA  . ALA A 1 384 ? 19.798  59.758  47.888  1.00 54.89  ? 381 ALA A CA  1 
ATOM 2681  C C   . ALA A 1 384 ? 20.060  60.156  46.423  1.00 64.82  ? 381 ALA A C   1 
ATOM 2682  O O   . ALA A 1 384 ? 21.206  60.192  45.982  1.00 74.21  ? 381 ALA A O   1 
ATOM 2683  C CB  . ALA A 1 384 ? 19.455  58.292  47.987  1.00 43.16  ? 381 ALA A CB  1 
ATOM 2684  N N   . GLU A 1 385 ? 18.998  60.464  45.682  1.00 54.08  ? 382 GLU A N   1 
ATOM 2685  C CA  . GLU A 1 385 ? 19.110  60.823  44.269  1.00 70.34  ? 382 GLU A CA  1 
ATOM 2686  C C   . GLU A 1 385 ? 19.487  62.286  44.085  1.00 77.12  ? 382 GLU A C   1 
ATOM 2687  O O   . GLU A 1 385 ? 20.172  62.637  43.127  1.00 70.15  ? 382 GLU A O   1 
ATOM 2688  C CB  . GLU A 1 385 ? 17.796  60.535  43.533  1.00 57.21  ? 382 GLU A CB  1 
ATOM 2689  C CG  . GLU A 1 385 ? 17.315  59.117  43.687  1.00 84.45  ? 382 GLU A CG  1 
ATOM 2690  C CD  . GLU A 1 385 ? 18.357  58.110  43.241  1.00 108.97 ? 382 GLU A CD  1 
ATOM 2691  O OE1 . GLU A 1 385 ? 18.806  58.207  42.075  1.00 95.71  ? 382 GLU A OE1 1 
ATOM 2692  O OE2 . GLU A 1 385 ? 18.728  57.231  44.056  1.00 100.89 ? 382 GLU A OE2 1 
ATOM 2693  N N   . ASP A 1 386 ? 19.030  63.131  45.008  1.00 64.09  ? 383 ASP A N   1 
ATOM 2694  C CA  . ASP A 1 386 ? 19.238  64.576  44.923  1.00 51.78  ? 383 ASP A CA  1 
ATOM 2695  C C   . ASP A 1 386 ? 19.787  65.156  46.244  1.00 65.21  ? 383 ASP A C   1 
ATOM 2696  O O   . ASP A 1 386 ? 19.070  65.290  47.238  1.00 49.28  ? 383 ASP A O   1 
ATOM 2697  C CB  . ASP A 1 386 ? 17.930  65.267  44.493  1.00 32.01  ? 383 ASP A CB  1 
ATOM 2698  C CG  . ASP A 1 386 ? 18.087  66.766  44.283  1.00 70.56  ? 383 ASP A CG  1 
ATOM 2699  O OD1 . ASP A 1 386 ? 19.235  67.266  44.248  1.00 72.97  ? 383 ASP A OD1 1 
ATOM 2700  O OD2 . ASP A 1 386 ? 17.044  67.440  44.137  1.00 61.30  ? 383 ASP A OD2 1 
ATOM 2701  N N   . PHE A 1 387 ? 21.069  65.490  46.253  1.00 58.14  ? 384 PHE A N   1 
ATOM 2702  C CA  . PHE A 1 387 ? 21.702  66.028  47.444  1.00 32.91  ? 384 PHE A CA  1 
ATOM 2703  C C   . PHE A 1 387 ? 21.344  67.485  47.703  1.00 48.48  ? 384 PHE A C   1 
ATOM 2704  O O   . PHE A 1 387 ? 21.761  68.061  48.704  1.00 52.50  ? 384 PHE A O   1 
ATOM 2705  C CB  . PHE A 1 387 ? 23.219  65.856  47.382  1.00 47.87  ? 384 PHE A CB  1 
ATOM 2706  C CG  . PHE A 1 387 ? 23.694  64.448  47.664  1.00 43.38  ? 384 PHE A CG  1 
ATOM 2707  C CD1 . PHE A 1 387 ? 22.792  63.400  47.776  1.00 49.62  ? 384 PHE A CD1 1 
ATOM 2708  C CD2 . PHE A 1 387 ? 25.047  64.176  47.828  1.00 42.62  ? 384 PHE A CD2 1 
ATOM 2709  C CE1 . PHE A 1 387 ? 23.234  62.105  48.044  1.00 42.28  ? 384 PHE A CE1 1 
ATOM 2710  C CE2 . PHE A 1 387 ? 25.486  62.890  48.088  1.00 36.05  ? 384 PHE A CE2 1 
ATOM 2711  C CZ  . PHE A 1 387 ? 24.581  61.858  48.200  1.00 31.13  ? 384 PHE A CZ  1 
ATOM 2712  N N   . GLY A 1 388 ? 20.573  68.075  46.794  1.00 54.20  ? 385 GLY A N   1 
ATOM 2713  C CA  . GLY A 1 388 ? 20.069  69.427  46.971  1.00 51.86  ? 385 GLY A CA  1 
ATOM 2714  C C   . GLY A 1 388 ? 18.839  69.452  47.863  1.00 58.88  ? 385 GLY A C   1 
ATOM 2715  O O   . GLY A 1 388 ? 18.327  70.513  48.218  1.00 51.22  ? 385 GLY A O   1 
ATOM 2716  N N   . THR A 1 389 ? 18.364  68.261  48.212  1.00 45.49  ? 386 THR A N   1 
ATOM 2717  C CA  . THR A 1 389 ? 17.239  68.092  49.118  1.00 55.05  ? 386 THR A CA  1 
ATOM 2718  C C   . THR A 1 389 ? 17.560  68.616  50.526  1.00 65.10  ? 386 THR A C   1 
ATOM 2719  O O   . THR A 1 389 ? 18.566  68.239  51.138  1.00 40.89  ? 386 THR A O   1 
ATOM 2720  C CB  . THR A 1 389 ? 16.863  66.607  49.238  1.00 59.55  ? 386 THR A CB  1 
ATOM 2721  O OG1 . THR A 1 389 ? 16.507  66.092  47.952  1.00 48.58  ? 386 THR A OG1 1 
ATOM 2722  C CG2 . THR A 1 389 ? 15.708  66.422  50.185  1.00 44.52  ? 386 THR A CG2 1 
ATOM 2723  N N   . PHE A 1 390 ? 16.695  69.477  51.041  1.00 31.18  ? 387 PHE A N   1 
ATOM 2724  C CA  . PHE A 1 390 ? 16.852  70.020  52.379  1.00 53.31  ? 387 PHE A CA  1 
ATOM 2725  C C   . PHE A 1 390 ? 16.367  69.005  53.389  1.00 61.93  ? 387 PHE A C   1 
ATOM 2726  O O   . PHE A 1 390 ? 17.128  68.610  54.276  1.00 45.39  ? 387 PHE A O   1 
ATOM 2727  C CB  . PHE A 1 390 ? 16.083  71.321  52.538  1.00 36.87  ? 387 PHE A CB  1 
ATOM 2728  C CG  . PHE A 1 390 ? 16.386  72.047  53.819  1.00 53.17  ? 387 PHE A CG  1 
ATOM 2729  C CD1 . PHE A 1 390 ? 17.691  72.310  54.191  1.00 54.49  ? 387 PHE A CD1 1 
ATOM 2730  C CD2 . PHE A 1 390 ? 15.362  72.466  54.647  1.00 31.46  ? 387 PHE A CD2 1 
ATOM 2731  C CE1 . PHE A 1 390 ? 17.968  72.982  55.360  1.00 53.49  ? 387 PHE A CE1 1 
ATOM 2732  C CE2 . PHE A 1 390 ? 15.633  73.148  55.810  1.00 47.22  ? 387 PHE A CE2 1 
ATOM 2733  C CZ  . PHE A 1 390 ? 16.938  73.411  56.168  1.00 37.07  ? 387 PHE A CZ  1 
ATOM 2734  N N   . PHE A 1 391 ? 15.103  68.600  53.241  1.00 31.04  ? 388 PHE A N   1 
ATOM 2735  C CA  . PHE A 1 391 ? 14.525  67.436  53.936  1.00 50.04  ? 388 PHE A CA  1 
ATOM 2736  C C   . PHE A 1 391 ? 13.619  66.604  53.026  1.00 43.15  ? 388 PHE A C   1 
ATOM 2737  O O   . PHE A 1 391 ? 13.267  67.036  51.926  1.00 43.78  ? 388 PHE A O   1 
ATOM 2738  C CB  . PHE A 1 391 ? 13.793  67.825  55.243  1.00 33.57  ? 388 PHE A CB  1 
ATOM 2739  C CG  . PHE A 1 391 ? 12.450  68.492  55.047  1.00 41.60  ? 388 PHE A CG  1 
ATOM 2740  C CD1 . PHE A 1 391 ? 12.356  69.867  54.871  1.00 38.26  ? 388 PHE A CD1 1 
ATOM 2741  C CD2 . PHE A 1 391 ? 11.277  67.746  55.083  1.00 32.89  ? 388 PHE A CD2 1 
ATOM 2742  C CE1 . PHE A 1 391 ? 11.119  70.486  54.705  1.00 40.49  ? 388 PHE A CE1 1 
ATOM 2743  C CE2 . PHE A 1 391 ? 10.034  68.352  54.924  1.00 28.70  ? 388 PHE A CE2 1 
ATOM 2744  C CZ  . PHE A 1 391 ? 9.957   69.725  54.740  1.00 35.97  ? 388 PHE A CZ  1 
ATOM 2745  N N   . SER A 1 392 ? 13.249  65.418  53.504  1.00 29.85  ? 389 SER A N   1 
ATOM 2746  C CA  . SER A 1 392 ? 12.490  64.433  52.741  1.00 28.96  ? 389 SER A CA  1 
ATOM 2747  C C   . SER A 1 392 ? 11.126  64.054  53.366  1.00 42.01  ? 389 SER A C   1 
ATOM 2748  O O   . SER A 1 392 ? 10.533  64.819  54.127  1.00 48.36  ? 389 SER A O   1 
ATOM 2749  C CB  . SER A 1 392 ? 13.359  63.181  52.498  1.00 35.07  ? 389 SER A CB  1 
ATOM 2750  O OG  . SER A 1 392 ? 12.690  62.212  51.698  1.00 38.57  ? 389 SER A OG  1 
ATOM 2751  N N   . ALA A 1 393 ? 10.626  62.877  53.021  1.00 48.51  ? 390 ALA A N   1 
ATOM 2752  C CA  . ALA A 1 393 ? 9.360   62.390  53.542  1.00 42.59  ? 390 ALA A CA  1 
ATOM 2753  C C   . ALA A 1 393 ? 9.424   62.155  55.049  1.00 43.77  ? 390 ALA A C   1 
ATOM 2754  O O   . ALA A 1 393 ? 10.501  61.939  55.579  1.00 51.61  ? 390 ALA A O   1 
ATOM 2755  C CB  . ALA A 1 393 ? 8.979   61.106  52.841  1.00 47.35  ? 390 ALA A CB  1 
ATOM 2756  N N   . VAL A 1 394 ? 8.270   62.231  55.722  1.00 38.10  ? 391 VAL A N   1 
ATOM 2757  C CA  . VAL A 1 394 ? 8.142   61.798  57.099  1.00 42.42  ? 391 VAL A CA  1 
ATOM 2758  C C   . VAL A 1 394 ? 8.178   60.277  57.144  1.00 49.11  ? 391 VAL A C   1 
ATOM 2759  O O   . VAL A 1 394 ? 8.027   59.620  56.117  1.00 45.87  ? 391 VAL A O   1 
ATOM 2760  C CB  . VAL A 1 394 ? 6.875   62.349  57.788  1.00 40.02  ? 391 VAL A CB  1 
ATOM 2761  C CG1 . VAL A 1 394 ? 6.868   63.842  57.713  1.00 38.56  ? 391 VAL A CG1 1 
ATOM 2762  C CG2 . VAL A 1 394 ? 5.634   61.786  57.178  1.00 47.80  ? 391 VAL A CG2 1 
ATOM 2763  N N   . ILE A 1 395 ? 8.371   59.728  58.336  1.00 40.26  ? 392 ILE A N   1 
ATOM 2764  C CA  . ILE A 1 395 ? 8.845   58.356  58.507  1.00 32.73  ? 392 ILE A CA  1 
ATOM 2765  C C   . ILE A 1 395 ? 7.889   57.253  58.036  1.00 34.25  ? 392 ILE A C   1 
ATOM 2766  O O   . ILE A 1 395 ? 8.310   56.285  57.424  1.00 46.39  ? 392 ILE A O   1 
ATOM 2767  C CB  . ILE A 1 395 ? 9.295   58.088  59.977  1.00 48.42  ? 392 ILE A CB  1 
ATOM 2768  C CG1 . ILE A 1 395 ? 9.991   56.740  60.078  1.00 35.61  ? 392 ILE A CG1 1 
ATOM 2769  C CG2 . ILE A 1 395 ? 8.107   58.212  60.972  1.00 26.06  ? 392 ILE A CG2 1 
ATOM 2770  C CD1 . ILE A 1 395 ? 11.385  56.700  59.463  1.00 33.39  ? 392 ILE A CD1 1 
ATOM 2771  N N   . ASP A 1 396 ? 6.605   57.387  58.333  1.00 45.26  ? 393 ASP A N   1 
ATOM 2772  C CA  . ASP A 1 396 ? 5.649   56.332  57.992  1.00 42.73  ? 393 ASP A CA  1 
ATOM 2773  C C   . ASP A 1 396 ? 4.229   56.838  57.808  1.00 54.28  ? 393 ASP A C   1 
ATOM 2774  O O   . ASP A 1 396 ? 3.940   58.015  58.019  1.00 46.47  ? 393 ASP A O   1 
ATOM 2775  C CB  . ASP A 1 396 ? 5.684   55.161  59.004  1.00 38.59  ? 393 ASP A CB  1 
ATOM 2776  C CG  . ASP A 1 396 ? 5.265   55.567  60.436  1.00 64.29  ? 393 ASP A CG  1 
ATOM 2777  O OD1 . ASP A 1 396 ? 4.791   56.697  60.651  1.00 46.20  ? 393 ASP A OD1 1 
ATOM 2778  O OD2 . ASP A 1 396 ? 5.401   54.736  61.368  1.00 63.60  ? 393 ASP A OD2 1 
ATOM 2779  N N   . ALA A 1 397 ? 3.345   55.925  57.434  1.00 53.21  ? 394 ALA A N   1 
ATOM 2780  C CA  . ALA A 1 397 ? 1.977   56.275  57.085  1.00 57.83  ? 394 ALA A CA  1 
ATOM 2781  C C   . ALA A 1 397 ? 1.200   56.813  58.267  1.00 53.39  ? 394 ALA A C   1 
ATOM 2782  O O   . ALA A 1 397 ? 0.460   57.787  58.125  1.00 69.28  ? 394 ALA A O   1 
ATOM 2783  C CB  . ALA A 1 397 ? 1.257   55.079  56.477  1.00 36.29  ? 394 ALA A CB  1 
ATOM 2784  N N   . LYS A 1 398 ? 1.364   56.186  59.429  1.00 51.76  ? 395 LYS A N   1 
ATOM 2785  C CA  . LYS A 1 398 ? 0.644   56.629  60.620  1.00 52.65  ? 395 LYS A CA  1 
ATOM 2786  C C   . LYS A 1 398 ? 1.026   58.071  60.952  1.00 61.71  ? 395 LYS A C   1 
ATOM 2787  O O   . LYS A 1 398 ? 0.157   58.884  61.301  1.00 49.34  ? 395 LYS A O   1 
ATOM 2788  C CB  . LYS A 1 398 ? 0.868   55.679  61.804  1.00 42.05  ? 395 LYS A CB  1 
ATOM 2789  N N   . SER A 1 399 ? 2.313   58.389  60.795  1.00 48.37  ? 396 SER A N   1 
ATOM 2790  C CA  . SER A 1 399 ? 2.829   59.754  61.002  1.00 52.62  ? 396 SER A CA  1 
ATOM 2791  C C   . SER A 1 399 ? 2.282   60.722  59.949  1.00 67.47  ? 396 SER A C   1 
ATOM 2792  O O   . SER A 1 399 ? 1.872   61.842  60.268  1.00 52.58  ? 396 SER A O   1 
ATOM 2793  C CB  . SER A 1 399 ? 4.374   59.766  61.025  1.00 37.89  ? 396 SER A CB  1 
ATOM 2794  O OG  . SER A 1 399 ? 4.916   61.066  61.212  1.00 54.82  ? 396 SER A OG  1 
ATOM 2795  N N   . PHE A 1 400 ? 2.263   60.273  58.695  1.00 48.25  ? 397 PHE A N   1 
ATOM 2796  C CA  . PHE A 1 400 ? 1.746   61.072  57.593  1.00 56.76  ? 397 PHE A CA  1 
ATOM 2797  C C   . PHE A 1 400 ? 0.284   61.432  57.821  1.00 50.31  ? 397 PHE A C   1 
ATOM 2798  O O   . PHE A 1 400 ? -0.128  62.560  57.596  1.00 49.56  ? 397 PHE A O   1 
ATOM 2799  C CB  . PHE A 1 400 ? 1.907   60.301  56.282  1.00 60.06  ? 397 PHE A CB  1 
ATOM 2800  C CG  . PHE A 1 400 ? 1.460   61.052  55.078  1.00 51.78  ? 397 PHE A CG  1 
ATOM 2801  C CD1 . PHE A 1 400 ? 0.168   60.931  54.621  1.00 53.51  ? 397 PHE A CD1 1 
ATOM 2802  C CD2 . PHE A 1 400 ? 2.337   61.877  54.390  1.00 63.80  ? 397 PHE A CD2 1 
ATOM 2803  C CE1 . PHE A 1 400 ? -0.252  61.632  53.495  1.00 53.35  ? 397 PHE A CE1 1 
ATOM 2804  C CE2 . PHE A 1 400 ? 1.924   62.578  53.265  1.00 58.40  ? 397 PHE A CE2 1 
ATOM 2805  C CZ  . PHE A 1 400 ? 0.628   62.462  52.825  1.00 53.05  ? 397 PHE A CZ  1 
ATOM 2806  N N   . ALA A 1 401 ? -0.493  60.464  58.280  1.00 40.79  ? 398 ALA A N   1 
ATOM 2807  C CA  . ALA A 1 401 ? -1.918  60.668  58.542  1.00 63.10  ? 398 ALA A CA  1 
ATOM 2808  C C   . ALA A 1 401 ? -2.152  61.695  59.635  1.00 63.26  ? 398 ALA A C   1 
ATOM 2809  O O   . ALA A 1 401 ? -2.903  62.652  59.453  1.00 62.97  ? 398 ALA A O   1 
ATOM 2810  C CB  . ALA A 1 401 ? -2.593  59.347  58.914  1.00 37.95  ? 398 ALA A CB  1 
ATOM 2811  N N   . ARG A 1 402 ? -1.511  61.473  60.778  1.00 50.57  ? 399 ARG A N   1 
ATOM 2812  C CA  . ARG A 1 402 ? -1.566  62.394  61.914  1.00 44.38  ? 399 ARG A CA  1 
ATOM 2813  C C   . ARG A 1 402 ? -1.251  63.823  61.483  1.00 60.90  ? 399 ARG A C   1 
ATOM 2814  O O   . ARG A 1 402 ? -1.926  64.757  61.910  1.00 51.13  ? 399 ARG A O   1 
ATOM 2815  C CB  . ARG A 1 402 ? -0.590  61.924  62.990  1.00 39.90  ? 399 ARG A CB  1 
ATOM 2816  C CG  . ARG A 1 402 ? -0.808  62.372  64.444  1.00 85.04  ? 399 ARG A CG  1 
ATOM 2817  C CD  . ARG A 1 402 ? 0.274   61.688  65.321  1.00 92.36  ? 399 ARG A CD  1 
ATOM 2818  N NE  . ARG A 1 402 ? 1.317   61.455  64.371  1.00 117.88 ? 399 ARG A NE  1 
ATOM 2819  C CZ  . ARG A 1 402 ? 2.591   61.809  64.309  1.00 118.90 ? 399 ARG A CZ  1 
ATOM 2820  N NH1 . ARG A 1 402 ? 3.168   61.505  63.175  1.00 124.76 ? 399 ARG A NH1 1 
ATOM 2821  N NH2 . ARG A 1 402 ? 3.299   62.373  65.271  1.00 131.58 ? 399 ARG A NH2 1 
ATOM 2822  N N   . ILE A 1 403 ? -0.242  63.995  60.626  1.00 47.85  ? 400 ILE A N   1 
ATOM 2823  C CA  . ILE A 1 403 ? 0.141   65.335  60.177  1.00 39.10  ? 400 ILE A CA  1 
ATOM 2824  C C   . ILE A 1 403 ? -0.917  65.953  59.256  1.00 59.73  ? 400 ILE A C   1 
ATOM 2825  O O   . ILE A 1 403 ? -1.203  67.145  59.377  1.00 54.92  ? 400 ILE A O   1 
ATOM 2826  C CB  . ILE A 1 403 ? 1.549   65.361  59.536  1.00 40.98  ? 400 ILE A CB  1 
ATOM 2827  C CG1 . ILE A 1 403 ? 2.608   64.891  60.546  1.00 44.83  ? 400 ILE A CG1 1 
ATOM 2828  C CG2 . ILE A 1 403 ? 1.894   66.751  59.052  1.00 36.10  ? 400 ILE A CG2 1 
ATOM 2829  C CD1 . ILE A 1 403 ? 4.026   64.583  59.966  1.00 33.55  ? 400 ILE A CD1 1 
ATOM 2830  N N   . LYS A 1 404 ? -1.518  65.151  58.369  1.00 36.75  ? 401 LYS A N   1 
ATOM 2831  C CA  . LYS A 1 404 ? -2.577  65.654  57.491  1.00 57.23  ? 401 LYS A CA  1 
ATOM 2832  C C   . LYS A 1 404 ? -3.770  66.146  58.320  1.00 59.16  ? 401 LYS A C   1 
ATOM 2833  O O   . LYS A 1 404 ? -4.345  67.200  58.027  1.00 50.97  ? 401 LYS A O   1 
ATOM 2834  C CB  . LYS A 1 404 ? -3.013  64.618  56.427  1.00 37.03  ? 401 LYS A CB  1 
ATOM 2835  N N   . LYS A 1 405 ? -4.126  65.406  59.371  1.00 40.27  ? 402 LYS A N   1 
ATOM 2836  C CA  . LYS A 1 405 ? -5.235  65.817  60.232  1.00 50.42  ? 402 LYS A CA  1 
ATOM 2837  C C   . LYS A 1 405 ? -4.948  67.171  60.873  1.00 54.22  ? 402 LYS A C   1 
ATOM 2838  O O   . LYS A 1 405 ? -5.862  67.959  61.076  1.00 60.78  ? 402 LYS A O   1 
ATOM 2839  C CB  . LYS A 1 405 ? -5.612  64.753  61.274  1.00 38.67  ? 402 LYS A CB  1 
ATOM 2840  N N   . TRP A 1 406 ? -3.675  67.452  61.143  1.00 42.49  ? 403 TRP A N   1 
ATOM 2841  C CA  . TRP A 1 406 ? -3.254  68.757  61.647  1.00 42.07  ? 403 TRP A CA  1 
ATOM 2842  C C   . TRP A 1 406 ? -3.327  69.837  60.590  1.00 52.52  ? 403 TRP A C   1 
ATOM 2843  O O   . TRP A 1 406 ? -3.746  70.950  60.878  1.00 50.46  ? 403 TRP A O   1 
ATOM 2844  C CB  . TRP A 1 406 ? -1.830  68.722  62.249  1.00 42.43  ? 403 TRP A CB  1 
ATOM 2845  C CG  . TRP A 1 406 ? -1.781  68.261  63.665  1.00 47.30  ? 403 TRP A CG  1 
ATOM 2846  C CD1 . TRP A 1 406 ? -1.329  67.067  64.109  1.00 49.21  ? 403 TRP A CD1 1 
ATOM 2847  C CD2 . TRP A 1 406 ? -2.231  68.976  64.827  1.00 44.95  ? 403 TRP A CD2 1 
ATOM 2848  N NE1 . TRP A 1 406 ? -1.460  66.988  65.469  1.00 34.45  ? 403 TRP A NE1 1 
ATOM 2849  C CE2 . TRP A 1 406 ? -2.014  68.146  65.938  1.00 63.12  ? 403 TRP A CE2 1 
ATOM 2850  C CE3 . TRP A 1 406 ? -2.788  70.237  65.035  1.00 53.11  ? 403 TRP A CE3 1 
ATOM 2851  C CZ2 . TRP A 1 406 ? -2.343  68.532  67.247  1.00 47.97  ? 403 TRP A CZ2 1 
ATOM 2852  C CZ3 . TRP A 1 406 ? -3.111  70.621  66.317  1.00 42.65  ? 403 TRP A CZ3 1 
ATOM 2853  C CH2 . TRP A 1 406 ? -2.889  69.770  67.412  1.00 58.43  ? 403 TRP A CH2 1 
ATOM 2854  N N   . LEU A 1 407 ? -2.890  69.519  59.378  1.00 57.47  ? 404 LEU A N   1 
ATOM 2855  C CA  . LEU A 1 407 ? -3.040  70.430  58.255  1.00 60.72  ? 404 LEU A CA  1 
ATOM 2856  C C   . LEU A 1 407 ? -4.508  70.785  58.049  1.00 53.43  ? 404 LEU A C   1 
ATOM 2857  O O   . LEU A 1 407 ? -4.841  71.953  57.912  1.00 54.03  ? 404 LEU A O   1 
ATOM 2858  C CB  . LEU A 1 407 ? -2.424  69.835  56.989  1.00 51.75  ? 404 LEU A CB  1 
ATOM 2859  C CG  . LEU A 1 407 ? -0.908  69.649  57.087  1.00 56.78  ? 404 LEU A CG  1 
ATOM 2860  C CD1 . LEU A 1 407 ? -0.339  69.022  55.832  1.00 54.48  ? 404 LEU A CD1 1 
ATOM 2861  C CD2 . LEU A 1 407 ? -0.237  70.974  57.376  1.00 53.68  ? 404 LEU A CD2 1 
ATOM 2862  N N   . GLU A 1 408 ? -5.388  69.785  58.056  1.00 49.80  ? 405 GLU A N   1 
ATOM 2863  C CA  . GLU A 1 408 ? -6.825  70.049  57.933  1.00 68.80  ? 405 GLU A CA  1 
ATOM 2864  C C   . GLU A 1 408 ? -7.306  70.926  59.095  1.00 74.58  ? 405 GLU A C   1 
ATOM 2865  O O   . GLU A 1 408 ? -8.160  71.795  58.926  1.00 62.04  ? 405 GLU A O   1 
ATOM 2866  C CB  . GLU A 1 408 ? -7.641  68.751  57.847  1.00 41.74  ? 405 GLU A CB  1 
ATOM 2867  N N   . HIS A 1 409 ? -6.731  70.714  60.274  1.00 62.99  ? 406 HIS A N   1 
ATOM 2868  C CA  . HIS A 1 409 ? -7.067  71.519  61.439  1.00 44.18  ? 406 HIS A CA  1 
ATOM 2869  C C   . HIS A 1 409 ? -6.614  72.971  61.306  1.00 67.45  ? 406 HIS A C   1 
ATOM 2870  O O   . HIS A 1 409 ? -7.264  73.876  61.815  1.00 44.73  ? 406 HIS A O   1 
ATOM 2871  C CB  . HIS A 1 409 ? -6.492  70.908  62.723  1.00 59.99  ? 406 HIS A CB  1 
ATOM 2872  C CG  . HIS A 1 409 ? -6.622  71.790  63.930  1.00 66.63  ? 406 HIS A CG  1 
ATOM 2873  N ND1 . HIS A 1 409 ? -7.737  71.792  64.739  1.00 65.94  ? 406 HIS A ND1 1 
ATOM 2874  C CD2 . HIS A 1 409 ? -5.778  72.706  64.459  1.00 63.62  ? 406 HIS A CD2 1 
ATOM 2875  C CE1 . HIS A 1 409 ? -7.575  72.668  65.712  1.00 58.69  ? 406 HIS A CE1 1 
ATOM 2876  N NE2 . HIS A 1 409 ? -6.391  73.230  65.570  1.00 47.00  ? 406 HIS A NE2 1 
ATOM 2877  N N   . ALA A 1 410 ? -5.493  73.188  60.636  1.00 47.47  ? 407 ALA A N   1 
ATOM 2878  C CA  . ALA A 1 410 ? -5.004  74.537  60.386  1.00 64.34  ? 407 ALA A CA  1 
ATOM 2879  C C   . ALA A 1 410 ? -5.880  75.361  59.398  1.00 42.74  ? 407 ALA A C   1 
ATOM 2880  O O   . ALA A 1 410 ? -5.949  76.584  59.481  1.00 61.83  ? 407 ALA A O   1 
ATOM 2881  C CB  . ALA A 1 410 ? -3.556  74.476  59.939  1.00 36.24  ? 407 ALA A CB  1 
ATOM 2882  N N   . ARG A 1 411 ? -6.574  74.692  58.491  1.00 44.96  ? 408 ARG A N   1 
ATOM 2883  C CA  . ARG A 1 411 ? -7.532  75.374  57.606  1.00 65.91  ? 408 ARG A CA  1 
ATOM 2884  C C   . ARG A 1 411 ? -8.844  75.627  58.336  1.00 65.77  ? 408 ARG A C   1 
ATOM 2885  O O   . ARG A 1 411 ? -9.353  76.747  58.351  1.00 89.00  ? 408 ARG A O   1 
ATOM 2886  C CB  . ARG A 1 411 ? -7.770  74.557  56.326  1.00 53.24  ? 408 ARG A CB  1 
ATOM 2887  C CG  . ARG A 1 411 ? -6.515  74.448  55.452  1.00 62.82  ? 408 ARG A CG  1 
ATOM 2888  C CD  . ARG A 1 411 ? -6.621  73.625  54.141  1.00 74.37  ? 408 ARG A CD  1 
ATOM 2889  N NE  . ARG A 1 411 ? -6.455  72.252  54.450  1.00 94.18  ? 408 ARG A NE  1 
ATOM 2890  C CZ  . ARG A 1 411 ? -5.478  71.374  54.287  1.00 102.43 ? 408 ARG A CZ  1 
ATOM 2891  N NH1 . ARG A 1 411 ? -5.766  70.215  54.823  1.00 104.87 ? 408 ARG A NH1 1 
ATOM 2892  N NH2 . ARG A 1 411 ? -4.328  71.534  53.641  1.00 98.51  ? 408 ARG A NH2 1 
ATOM 2893  N N   . SER A 1 412 ? -9.346  74.578  58.979  1.00 68.59  ? 409 SER A N   1 
ATOM 2894  C CA  . SER A 1 412 ? -10.617 74.589  59.704  1.00 73.25  ? 409 SER A CA  1 
ATOM 2895  C C   . SER A 1 412 ? -10.676 75.596  60.839  1.00 80.05  ? 409 SER A C   1 
ATOM 2896  O O   . SER A 1 412 ? -11.680 76.282  61.014  1.00 101.39 ? 409 SER A O   1 
ATOM 2897  C CB  . SER A 1 412 ? -10.909 73.210  60.288  1.00 78.33  ? 409 SER A CB  1 
ATOM 2898  O OG  . SER A 1 412 ? -10.575 72.190  59.372  1.00 117.40 ? 409 SER A OG  1 
ATOM 2899  N N   . SER A 1 413 ? -9.612  75.675  61.623  1.00 62.48  ? 410 SER A N   1 
ATOM 2900  C CA  . SER A 1 413 ? -9.596  76.583  62.761  1.00 66.10  ? 410 SER A CA  1 
ATOM 2901  C C   . SER A 1 413 ? -9.602  78.045  62.321  1.00 64.84  ? 410 SER A C   1 
ATOM 2902  O O   . SER A 1 413 ? -8.887  78.435  61.385  1.00 89.85  ? 410 SER A O   1 
ATOM 2903  C CB  . SER A 1 413 ? -8.391  76.303  63.666  1.00 89.13  ? 410 SER A CB  1 
ATOM 2904  O OG  . SER A 1 413 ? -8.510  76.973  64.911  1.00 82.60  ? 410 SER A OG  1 
ATOM 2905  N N   . PRO A 1 414 ? -10.438 78.853  62.987  1.00 74.00  ? 411 PRO A N   1 
ATOM 2906  C CA  . PRO A 1 414 ? -10.626 80.288  62.745  1.00 85.24  ? 411 PRO A CA  1 
ATOM 2907  C C   . PRO A 1 414 ? -9.439  81.095  63.250  1.00 93.23  ? 411 PRO A C   1 
ATOM 2908  O O   . PRO A 1 414 ? -9.022  82.084  62.628  1.00 61.67  ? 411 PRO A O   1 
ATOM 2909  C CB  . PRO A 1 414 ? -11.868 80.626  63.572  1.00 82.50  ? 411 PRO A CB  1 
ATOM 2910  C CG  . PRO A 1 414 ? -12.471 79.312  63.955  1.00 89.85  ? 411 PRO A CG  1 
ATOM 2911  C CD  . PRO A 1 414 ? -11.356 78.345  64.016  1.00 54.97  ? 411 PRO A CD  1 
ATOM 2912  N N   . SER A 1 415 ? -8.894  80.660  64.380  1.00 90.18  ? 412 SER A N   1 
ATOM 2913  C CA  . SER A 1 415 ? -7.715  81.295  64.953  1.00 68.81  ? 412 SER A CA  1 
ATOM 2914  C C   . SER A 1 415 ? -6.465  81.037  64.116  1.00 67.65  ? 412 SER A C   1 
ATOM 2915  O O   . SER A 1 415 ? -5.450  81.694  64.320  1.00 50.86  ? 412 SER A O   1 
ATOM 2916  C CB  . SER A 1 415 ? -7.477  80.808  66.377  1.00 54.97  ? 412 SER A CB  1 
ATOM 2917  O OG  . SER A 1 415 ? -8.642  80.903  67.172  1.00 81.20  ? 412 SER A OG  1 
ATOM 2918  N N   . LEU A 1 416 ? -6.546  80.077  63.187  1.00 39.93  ? 413 LEU A N   1 
ATOM 2919  C CA  . LEU A 1 416 ? -5.406  79.671  62.371  1.00 39.87  ? 413 LEU A CA  1 
ATOM 2920  C C   . LEU A 1 416 ? -5.548  79.952  60.873  1.00 62.03  ? 413 LEU A C   1 
ATOM 2921  O O   . LEU A 1 416 ? -6.604  79.732  60.265  1.00 66.88  ? 413 LEU A O   1 
ATOM 2922  C CB  . LEU A 1 416 ? -5.097  78.184  62.588  1.00 38.72  ? 413 LEU A CB  1 
ATOM 2923  C CG  . LEU A 1 416 ? -4.916  77.655  64.015  1.00 59.23  ? 413 LEU A CG  1 
ATOM 2924  C CD1 . LEU A 1 416 ? -4.602  76.167  63.991  1.00 44.74  ? 413 LEU A CD1 1 
ATOM 2925  C CD2 . LEU A 1 416 ? -3.830  78.405  64.754  1.00 42.35  ? 413 LEU A CD2 1 
ATOM 2926  N N   . THR A 1 417 ? -4.456  80.431  60.291  1.00 55.84  ? 414 THR A N   1 
ATOM 2927  C CA  . THR A 1 417 ? -4.322  80.532  58.854  1.00 71.38  ? 414 THR A CA  1 
ATOM 2928  C C   . THR A 1 417 ? -2.946  80.016  58.422  1.00 58.28  ? 414 THR A C   1 
ATOM 2929  O O   . THR A 1 417 ? -1.929  80.339  59.026  1.00 41.59  ? 414 THR A O   1 
ATOM 2930  C CB  . THR A 1 417 ? -4.551  81.983  58.354  1.00 73.73  ? 414 THR A CB  1 
ATOM 2931  O OG1 . THR A 1 417 ? -3.533  82.843  58.870  1.00 75.01  ? 414 THR A OG1 1 
ATOM 2932  C CG2 . THR A 1 417 ? -5.922  82.503  58.785  1.00 71.25  ? 414 THR A CG2 1 
ATOM 2933  N N   . ILE A 1 418 ? -2.929  79.200  57.374  1.00 60.17  ? 415 ILE A N   1 
ATOM 2934  C CA  . ILE A 1 418 ? -1.694  78.728  56.766  1.00 47.25  ? 415 ILE A CA  1 
ATOM 2935  C C   . ILE A 1 418 ? -1.044  79.850  55.968  1.00 54.14  ? 415 ILE A C   1 
ATOM 2936  O O   . ILE A 1 418 ? -1.658  80.395  55.065  1.00 73.78  ? 415 ILE A O   1 
ATOM 2937  C CB  . ILE A 1 418 ? -1.974  77.520  55.842  1.00 44.21  ? 415 ILE A CB  1 
ATOM 2938  C CG1 . ILE A 1 418 ? -2.678  76.411  56.624  1.00 40.97  ? 415 ILE A CG1 1 
ATOM 2939  C CG2 . ILE A 1 418 ? -0.691  76.998  55.203  1.00 31.86  ? 415 ILE A CG2 1 
ATOM 2940  C CD1 . ILE A 1 418 ? -2.873  75.137  55.848  1.00 42.99  ? 415 ILE A CD1 1 
ATOM 2941  N N   . LEU A 1 419 ? 0.186   80.212  56.311  1.00 49.00  ? 416 LEU A N   1 
ATOM 2942  C CA  . LEU A 1 419 ? 0.892   81.249  55.580  1.00 45.78  ? 416 LEU A CA  1 
ATOM 2943  C C   . LEU A 1 419 ? 1.724   80.640  54.447  1.00 68.92  ? 416 LEU A C   1 
ATOM 2944  O O   . LEU A 1 419 ? 2.082   81.316  53.494  1.00 49.83  ? 416 LEU A O   1 
ATOM 2945  C CB  . LEU A 1 419 ? 1.795   82.057  56.507  1.00 54.97  ? 416 LEU A CB  1 
ATOM 2946  C CG  . LEU A 1 419 ? 1.123   82.715  57.704  1.00 56.65  ? 416 LEU A CG  1 
ATOM 2947  C CD1 . LEU A 1 419 ? 2.142   83.512  58.488  1.00 46.29  ? 416 LEU A CD1 1 
ATOM 2948  C CD2 . LEU A 1 419 ? -0.001  83.603  57.230  1.00 48.58  ? 416 LEU A CD2 1 
ATOM 2949  N N   . ALA A 1 420 ? 2.032   79.356  54.550  1.00 54.96  ? 417 ALA A N   1 
ATOM 2950  C CA  . ALA A 1 420 ? 2.881   78.714  53.557  1.00 45.20  ? 417 ALA A CA  1 
ATOM 2951  C C   . ALA A 1 420 ? 2.786   77.225  53.658  1.00 48.14  ? 417 ALA A C   1 
ATOM 2952  O O   . ALA A 1 420 ? 2.584   76.688  54.746  1.00 51.36  ? 417 ALA A O   1 
ATOM 2953  C CB  . ALA A 1 420 ? 4.330   79.153  53.700  1.00 47.36  ? 417 ALA A CB  1 
ATOM 2954  N N   . GLY A 1 421 ? 2.937   76.558  52.514  1.00 53.08  ? 418 GLY A N   1 
ATOM 2955  C CA  . GLY A 1 421 ? 2.823   75.109  52.437  1.00 33.35  ? 418 GLY A CA  1 
ATOM 2956  C C   . GLY A 1 421 ? 1.407   74.658  52.708  1.00 49.05  ? 418 GLY A C   1 
ATOM 2957  O O   . GLY A 1 421 ? 0.459   75.407  52.477  1.00 52.95  ? 418 GLY A O   1 
ATOM 2958  N N   . GLY A 1 422 ? 1.250   73.440  53.202  1.00 62.95  ? 419 GLY A N   1 
ATOM 2959  C CA  . GLY A 1 422 ? -0.075  72.941  53.502  1.00 40.71  ? 419 GLY A CA  1 
ATOM 2960  C C   . GLY A 1 422 ? -0.451  71.745  52.658  1.00 71.70  ? 419 GLY A C   1 
ATOM 2961  O O   . GLY A 1 422 ? -1.463  71.101  52.918  1.00 47.34  ? 419 GLY A O   1 
ATOM 2962  N N   . LYS A 1 423 ? 0.357   71.453  51.643  1.00 61.40  ? 420 LYS A N   1 
ATOM 2963  C CA  . LYS A 1 423 ? 0.105   70.309  50.779  1.00 78.84  ? 420 LYS A CA  1 
ATOM 2964  C C   . LYS A 1 423 ? 0.899   69.103  51.273  1.00 66.33  ? 420 LYS A C   1 
ATOM 2965  O O   . LYS A 1 423 ? 1.952   69.255  51.875  1.00 69.09  ? 420 LYS A O   1 
ATOM 2966  C CB  . LYS A 1 423 ? 0.453   70.636  49.317  1.00 62.48  ? 420 LYS A CB  1 
ATOM 2967  N N   . CYS A 1 424 ? 0.375   67.907  51.031  1.00 55.19  ? 421 CYS A N   1 
ATOM 2968  C CA  . CYS A 1 424 ? 1.099   66.674  51.302  1.00 68.02  ? 421 CYS A CA  1 
ATOM 2969  C C   . CYS A 1 424 ? 0.707   65.603  50.290  1.00 60.83  ? 421 CYS A C   1 
ATOM 2970  O O   . CYS A 1 424 ? -0.428  65.567  49.845  1.00 64.56  ? 421 CYS A O   1 
ATOM 2971  C CB  . CYS A 1 424 ? 0.856   66.191  52.734  1.00 88.63  ? 421 CYS A CB  1 
ATOM 2972  S SG  . CYS A 1 424 ? -0.845  65.752  53.140  1.00 54.51  ? 421 CYS A SG  1 
ATOM 2973  N N   . ASP A 1 425 ? 1.648   64.739  49.922  1.00 78.20  ? 422 ASP A N   1 
ATOM 2974  C CA  . ASP A 1 425 ? 1.427   63.761  48.856  1.00 56.95  ? 422 ASP A CA  1 
ATOM 2975  C C   . ASP A 1 425 ? 2.083   62.411  49.145  1.00 65.99  ? 422 ASP A C   1 
ATOM 2976  O O   . ASP A 1 425 ? 3.300   62.257  49.060  1.00 68.68  ? 422 ASP A O   1 
ATOM 2977  C CB  . ASP A 1 425 ? 1.928   64.324  47.526  1.00 55.21  ? 422 ASP A CB  1 
ATOM 2978  C CG  . ASP A 1 425 ? 1.748   63.356  46.367  1.00 73.94  ? 422 ASP A CG  1 
ATOM 2979  O OD1 . ASP A 1 425 ? 0.974   62.380  46.496  1.00 50.02  ? 422 ASP A OD1 1 
ATOM 2980  O OD2 . ASP A 1 425 ? 2.388   63.578  45.320  1.00 60.68  ? 422 ASP A OD2 1 
ATOM 2981  N N   . ASP A 1 426 ? 1.265   61.424  49.481  1.00 36.95  ? 423 ASP A N   1 
ATOM 2982  C CA  . ASP A 1 426 ? 1.781   60.106  49.809  1.00 52.99  ? 423 ASP A CA  1 
ATOM 2983  C C   . ASP A 1 426 ? 1.738   59.100  48.660  1.00 68.03  ? 423 ASP A C   1 
ATOM 2984  O O   . ASP A 1 426 ? 1.718   57.899  48.899  1.00 45.56  ? 423 ASP A O   1 
ATOM 2985  C CB  . ASP A 1 426 ? 1.021   59.538  50.994  1.00 62.86  ? 423 ASP A CB  1 
ATOM 2986  C CG  . ASP A 1 426 ? -0.408  59.196  50.660  1.00 47.07  ? 423 ASP A CG  1 
ATOM 2987  O OD1 . ASP A 1 426 ? -0.923  59.709  49.655  1.00 70.96  ? 423 ASP A OD1 1 
ATOM 2988  O OD2 . ASP A 1 426 ? -1.019  58.409  51.412  1.00 61.04  ? 423 ASP A OD2 1 
ATOM 2989  N N   . SER A 1 427 ? 1.744   59.570  47.418  1.00 58.93  ? 424 SER A N   1 
ATOM 2990  C CA  . SER A 1 427 ? 1.660   58.648  46.281  1.00 72.37  ? 424 SER A CA  1 
ATOM 2991  C C   . SER A 1 427 ? 2.948   57.842  46.076  1.00 67.21  ? 424 SER A C   1 
ATOM 2992  O O   . SER A 1 427 ? 2.895   56.673  45.708  1.00 45.90  ? 424 SER A O   1 
ATOM 2993  C CB  . SER A 1 427 ? 1.235   59.370  44.992  1.00 46.92  ? 424 SER A CB  1 
ATOM 2994  O OG  . SER A 1 427 ? 2.096   60.442  44.674  1.00 72.07  ? 424 SER A OG  1 
ATOM 2995  N N   . VAL A 1 428 ? 4.095   58.458  46.346  1.00 69.95  ? 425 VAL A N   1 
ATOM 2996  C CA  . VAL A 1 428 ? 5.388   57.797  46.178  1.00 60.01  ? 425 VAL A CA  1 
ATOM 2997  C C   . VAL A 1 428 ? 6.106   57.624  47.523  1.00 68.99  ? 425 VAL A C   1 
ATOM 2998  O O   . VAL A 1 428 ? 6.599   56.543  47.854  1.00 53.94  ? 425 VAL A O   1 
ATOM 2999  C CB  . VAL A 1 428 ? 6.271   58.588  45.224  1.00 48.72  ? 425 VAL A CB  1 
ATOM 3000  C CG1 . VAL A 1 428 ? 7.634   57.950  45.112  1.00 37.92  ? 425 VAL A CG1 1 
ATOM 3001  C CG2 . VAL A 1 428 ? 5.611   58.676  43.861  1.00 54.89  ? 425 VAL A CG2 1 
ATOM 3002  N N   . GLY A 1 429 ? 6.166   58.709  48.284  1.00 68.72  ? 426 GLY A N   1 
ATOM 3003  C CA  . GLY A 1 429 ? 6.705   58.689  49.626  1.00 46.98  ? 426 GLY A CA  1 
ATOM 3004  C C   . GLY A 1 429 ? 5.758   59.464  50.514  1.00 51.40  ? 426 GLY A C   1 
ATOM 3005  O O   . GLY A 1 429 ? 4.780   60.023  50.031  1.00 61.95  ? 426 GLY A O   1 
ATOM 3006  N N   . TYR A 1 430 ? 6.031   59.490  51.811  1.00 57.29  ? 427 TYR A N   1 
ATOM 3007  C CA  . TYR A 1 430 ? 5.182   60.221  52.734  1.00 43.34  ? 427 TYR A CA  1 
ATOM 3008  C C   . TYR A 1 430 ? 5.584   61.692  52.767  1.00 47.27  ? 427 TYR A C   1 
ATOM 3009  O O   . TYR A 1 430 ? 6.050   62.185  53.781  1.00 45.67  ? 427 TYR A O   1 
ATOM 3010  C CB  . TYR A 1 430 ? 5.260   59.599  54.122  1.00 41.79  ? 427 TYR A CB  1 
ATOM 3011  C CG  . TYR A 1 430 ? 4.986   58.124  54.114  1.00 47.11  ? 427 TYR A CG  1 
ATOM 3012  C CD1 . TYR A 1 430 ? 3.704   57.647  53.902  1.00 58.18  ? 427 TYR A CD1 1 
ATOM 3013  C CD2 . TYR A 1 430 ? 6.001   57.203  54.317  1.00 53.57  ? 427 TYR A CD2 1 
ATOM 3014  C CE1 . TYR A 1 430 ? 3.430   56.294  53.891  1.00 42.84  ? 427 TYR A CE1 1 
ATOM 3015  C CE2 . TYR A 1 430 ? 5.736   55.841  54.309  1.00 47.55  ? 427 TYR A CE2 1 
ATOM 3016  C CZ  . TYR A 1 430 ? 4.441   55.399  54.089  1.00 49.60  ? 427 TYR A CZ  1 
ATOM 3017  O OH  . TYR A 1 430 ? 4.133   54.066  54.065  1.00 54.11  ? 427 TYR A OH  1 
ATOM 3018  N N   . PHE A 1 431 ? 5.387   62.390  51.652  1.00 39.04  ? 428 PHE A N   1 
ATOM 3019  C CA  . PHE A 1 431 ? 5.904   63.742  51.493  1.00 46.22  ? 428 PHE A CA  1 
ATOM 3020  C C   . PHE A 1 431 ? 4.963   64.819  52.025  1.00 35.29  ? 428 PHE A C   1 
ATOM 3021  O O   . PHE A 1 431 ? 3.799   64.865  51.662  1.00 64.18  ? 428 PHE A O   1 
ATOM 3022  C CB  . PHE A 1 431 ? 6.254   64.002  50.026  1.00 30.63  ? 428 PHE A CB  1 
ATOM 3023  C CG  . PHE A 1 431 ? 7.516   63.334  49.588  1.00 50.58  ? 428 PHE A CG  1 
ATOM 3024  C CD1 . PHE A 1 431 ? 8.747   63.877  49.917  1.00 37.87  ? 428 PHE A CD1 1 
ATOM 3025  C CD2 . PHE A 1 431 ? 7.474   62.161  48.852  1.00 42.34  ? 428 PHE A CD2 1 
ATOM 3026  C CE1 . PHE A 1 431 ? 9.909   63.269  49.527  1.00 38.84  ? 428 PHE A CE1 1 
ATOM 3027  C CE2 . PHE A 1 431 ? 8.630   61.553  48.450  1.00 56.43  ? 428 PHE A CE2 1 
ATOM 3028  C CZ  . PHE A 1 431 ? 9.851   62.104  48.786  1.00 49.81  ? 428 PHE A CZ  1 
ATOM 3029  N N   . VAL A 1 432 ? 5.481   65.666  52.905  1.00 48.31  ? 429 VAL A N   1 
ATOM 3030  C CA  . VAL A 1 432 ? 4.727   66.781  53.446  1.00 33.96  ? 429 VAL A CA  1 
ATOM 3031  C C   . VAL A 1 432 ? 5.508   68.036  53.154  1.00 44.15  ? 429 VAL A C   1 
ATOM 3032  O O   . VAL A 1 432 ? 6.712   68.088  53.407  1.00 52.80  ? 429 VAL A O   1 
ATOM 3033  C CB  . VAL A 1 432 ? 4.545   66.673  54.972  1.00 45.82  ? 429 VAL A CB  1 
ATOM 3034  C CG1 . VAL A 1 432 ? 3.686   67.846  55.495  1.00 32.15  ? 429 VAL A CG1 1 
ATOM 3035  C CG2 . VAL A 1 432 ? 3.913   65.348  55.342  1.00 22.30  ? 429 VAL A CG2 1 
ATOM 3036  N N   . GLU A 1 433 ? 4.834   69.042  52.603  1.00 51.31  ? 430 GLU A N   1 
ATOM 3037  C CA  . GLU A 1 433 ? 5.464   70.340  52.386  1.00 68.23  ? 430 GLU A CA  1 
ATOM 3038  C C   . GLU A 1 433 ? 5.709   71.014  53.732  1.00 56.62  ? 430 GLU A C   1 
ATOM 3039  O O   . GLU A 1 433 ? 4.895   70.893  54.637  1.00 33.76  ? 430 GLU A O   1 
ATOM 3040  C CB  . GLU A 1 433 ? 4.588   71.234  51.511  1.00 43.61  ? 430 GLU A CB  1 
ATOM 3041  C CG  . GLU A 1 433 ? 4.785   71.082  50.027  1.00 70.80  ? 430 GLU A CG  1 
ATOM 3042  C CD  . GLU A 1 433 ? 3.815   71.938  49.229  1.00 97.30  ? 430 GLU A CD  1 
ATOM 3043  O OE1 . GLU A 1 433 ? 2.904   72.536  49.834  1.00 57.56  ? 430 GLU A OE1 1 
ATOM 3044  O OE2 . GLU A 1 433 ? 3.962   72.008  47.992  1.00 130.32 ? 430 GLU A OE2 1 
ATOM 3045  N N   . PRO A 1 434 ? 6.842   71.713  53.867  1.00 39.16  ? 431 PRO A N   1 
ATOM 3046  C CA  . PRO A 1 434 ? 7.070   72.512  55.069  1.00 41.60  ? 431 PRO A CA  1 
ATOM 3047  C C   . PRO A 1 434 ? 5.919   73.491  55.185  1.00 52.47  ? 431 PRO A C   1 
ATOM 3048  O O   . PRO A 1 434 ? 5.574   74.143  54.205  1.00 48.17  ? 431 PRO A O   1 
ATOM 3049  C CB  . PRO A 1 434 ? 8.372   73.251  54.755  1.00 43.14  ? 431 PRO A CB  1 
ATOM 3050  C CG  . PRO A 1 434 ? 8.445   73.258  53.243  1.00 35.15  ? 431 PRO A CG  1 
ATOM 3051  C CD  . PRO A 1 434 ? 7.903   71.914  52.867  1.00 33.70  ? 431 PRO A CD  1 
ATOM 3052  N N   . CYS A 1 435 ? 5.326   73.587  56.365  1.00 33.50  ? 432 CYS A N   1 
ATOM 3053  C CA  . CYS A 1 435 ? 4.135   74.398  56.568  1.00 38.82  ? 432 CYS A CA  1 
ATOM 3054  C C   . CYS A 1 435 ? 4.316   75.465  57.647  1.00 43.51  ? 432 CYS A C   1 
ATOM 3055  O O   . CYS A 1 435 ? 4.865   75.197  58.705  1.00 47.66  ? 432 CYS A O   1 
ATOM 3056  C CB  . CYS A 1 435 ? 2.972   73.493  56.947  1.00 21.32  ? 432 CYS A CB  1 
ATOM 3057  S SG  . CYS A 1 435 ? 1.398   74.404  57.063  1.00 48.47  ? 432 CYS A SG  1 
ATOM 3058  N N   . ILE A 1 436 ? 3.865   76.678  57.371  1.00 51.81  ? 433 ILE A N   1 
ATOM 3059  C CA  . ILE A 1 436 ? 3.929   77.755  58.352  1.00 37.99  ? 433 ILE A CA  1 
ATOM 3060  C C   . ILE A 1 436 ? 2.534   78.267  58.649  1.00 30.79  ? 433 ILE A C   1 
ATOM 3061  O O   . ILE A 1 436 ? 1.847   78.753  57.769  1.00 60.70  ? 433 ILE A O   1 
ATOM 3062  C CB  . ILE A 1 436 ? 4.812   78.935  57.891  1.00 52.52  ? 433 ILE A CB  1 
ATOM 3063  C CG1 . ILE A 1 436 ? 6.191   78.437  57.464  1.00 51.77  ? 433 ILE A CG1 1 
ATOM 3064  C CG2 . ILE A 1 436 ? 4.961   79.982  59.019  1.00 28.54  ? 433 ILE A CG2 1 
ATOM 3065  C CD1 . ILE A 1 436 ? 7.113   79.539  57.028  1.00 44.77  ? 433 ILE A CD1 1 
ATOM 3066  N N   . VAL A 1 437 ? 2.129   78.157  59.902  1.00 51.29  ? 434 VAL A N   1 
ATOM 3067  C CA  . VAL A 1 437 ? 0.803   78.541  60.339  1.00 49.53  ? 434 VAL A CA  1 
ATOM 3068  C C   . VAL A 1 437 ? 0.897   79.707  61.313  1.00 52.96  ? 434 VAL A C   1 
ATOM 3069  O O   . VAL A 1 437 ? 1.748   79.717  62.189  1.00 54.22  ? 434 VAL A O   1 
ATOM 3070  C CB  . VAL A 1 437 ? 0.154   77.369  61.065  1.00 46.49  ? 434 VAL A CB  1 
ATOM 3071  C CG1 . VAL A 1 437 ? -1.259  77.672  61.426  1.00 48.81  ? 434 VAL A CG1 1 
ATOM 3072  C CG2 . VAL A 1 437 ? 0.237   76.112  60.200  1.00 31.78  ? 434 VAL A CG2 1 
ATOM 3073  N N   . GLU A 1 438 ? 0.034   80.700  61.150  1.00 45.03  ? 435 GLU A N   1 
ATOM 3074  C CA  . GLU A 1 438 ? -0.038  81.796  62.105  1.00 50.32  ? 435 GLU A CA  1 
ATOM 3075  C C   . GLU A 1 438 ? -1.230  81.597  63.035  1.00 57.68  ? 435 GLU A C   1 
ATOM 3076  O O   . GLU A 1 438 ? -2.327  81.259  62.594  1.00 54.25  ? 435 GLU A O   1 
ATOM 3077  C CB  . GLU A 1 438 ? -0.132  83.154  61.413  1.00 52.89  ? 435 GLU A CB  1 
ATOM 3078  C CG  . GLU A 1 438 ? -0.527  84.263  62.367  1.00 57.98  ? 435 GLU A CG  1 
ATOM 3079  C CD  . GLU A 1 438 ? -0.256  85.655  61.828  1.00 87.58  ? 435 GLU A CD  1 
ATOM 3080  O OE1 . GLU A 1 438 ? -0.036  85.804  60.601  1.00 88.55  ? 435 GLU A OE1 1 
ATOM 3081  O OE2 . GLU A 1 438 ? -0.265  86.599  62.651  1.00 56.76  ? 435 GLU A OE2 1 
ATOM 3082  N N   . SER A 1 439 ? -1.005  81.783  64.330  1.00 44.87  ? 436 SER A N   1 
ATOM 3083  C CA  . SER A 1 439 ? -2.081  81.677  65.305  1.00 45.22  ? 436 SER A CA  1 
ATOM 3084  C C   . SER A 1 439 ? -2.389  83.020  65.943  1.00 54.03  ? 436 SER A C   1 
ATOM 3085  O O   . SER A 1 439 ? -1.488  83.778  66.304  1.00 49.61  ? 436 SER A O   1 
ATOM 3086  C CB  . SER A 1 439 ? -1.733  80.661  66.376  1.00 50.55  ? 436 SER A CB  1 
ATOM 3087  O OG  . SER A 1 439 ? -2.869  80.351  67.147  1.00 33.13  ? 436 SER A OG  1 
ATOM 3088  N N   . LYS A 1 440 ? -3.673  83.329  66.043  1.00 62.04  ? 437 LYS A N   1 
ATOM 3089  C CA  . LYS A 1 440 ? -4.100  84.532  66.725  1.00 79.80  ? 437 LYS A CA  1 
ATOM 3090  C C   . LYS A 1 440 ? -4.290  84.204  68.193  1.00 69.96  ? 437 LYS A C   1 
ATOM 3091  O O   . LYS A 1 440 ? -4.357  85.096  69.025  1.00 58.00  ? 437 LYS A O   1 
ATOM 3092  C CB  . LYS A 1 440 ? -5.410  85.042  66.133  1.00 71.46  ? 437 LYS A CB  1 
ATOM 3093  C CG  . LYS A 1 440 ? -5.324  85.338  64.667  1.00 51.13  ? 437 LYS A CG  1 
ATOM 3094  C CD  . LYS A 1 440 ? -4.260  86.379  64.423  1.00 48.26  ? 437 LYS A CD  1 
ATOM 3095  C CE  . LYS A 1 440 ? -4.196  86.757  62.955  1.00 61.91  ? 437 LYS A CE  1 
ATOM 3096  N NZ  . LYS A 1 440 ? -3.015  87.633  62.708  1.00 85.29  ? 437 LYS A NZ  1 
ATOM 3097  N N   . ASP A 1 441 ? -4.377  82.911  68.490  1.00 58.39  ? 438 ASP A N   1 
ATOM 3098  C CA  . ASP A 1 441 ? -4.582  82.411  69.847  1.00 59.37  ? 438 ASP A CA  1 
ATOM 3099  C C   . ASP A 1 441 ? -3.347  81.661  70.310  1.00 66.39  ? 438 ASP A C   1 
ATOM 3100  O O   . ASP A 1 441 ? -3.018  80.595  69.782  1.00 46.21  ? 438 ASP A O   1 
ATOM 3101  C CB  . ASP A 1 441 ? -5.794  81.480  69.873  1.00 43.16  ? 438 ASP A CB  1 
ATOM 3102  C CG  . ASP A 1 441 ? -6.058  80.873  71.223  1.00 70.17  ? 438 ASP A CG  1 
ATOM 3103  O OD1 . ASP A 1 441 ? -5.582  81.400  72.254  1.00 62.85  ? 438 ASP A OD1 1 
ATOM 3104  O OD2 . ASP A 1 441 ? -6.779  79.857  71.247  1.00 68.24  ? 438 ASP A OD2 1 
ATOM 3105  N N   . PRO A 1 442 ? -2.666  82.208  71.320  1.00 42.69  ? 439 PRO A N   1 
ATOM 3106  C CA  . PRO A 1 442 ? -1.413  81.625  71.817  1.00 47.58  ? 439 PRO A CA  1 
ATOM 3107  C C   . PRO A 1 442 ? -1.611  80.331  72.630  1.00 53.21  ? 439 PRO A C   1 
ATOM 3108  O O   . PRO A 1 442 ? -0.634  79.677  72.974  1.00 57.75  ? 439 PRO A O   1 
ATOM 3109  C CB  . PRO A 1 442 ? -0.817  82.754  72.655  1.00 42.18  ? 439 PRO A CB  1 
ATOM 3110  C CG  . PRO A 1 442 ? -2.003  83.553  73.117  1.00 43.00  ? 439 PRO A CG  1 
ATOM 3111  C CD  . PRO A 1 442 ? -3.083  83.401  72.076  1.00 34.78  ? 439 PRO A CD  1 
ATOM 3112  N N   . GLN A 1 443 ? -2.865  79.974  72.901  1.00 48.71  ? 440 GLN A N   1 
ATOM 3113  C CA  . GLN A 1 443 ? -3.214  78.754  73.619  1.00 62.54  ? 440 GLN A CA  1 
ATOM 3114  C C   . GLN A 1 443 ? -3.934  77.753  72.727  1.00 39.95  ? 440 GLN A C   1 
ATOM 3115  O O   . GLN A 1 443 ? -4.550  76.818  73.221  1.00 58.01  ? 440 GLN A O   1 
ATOM 3116  C CB  . GLN A 1 443 ? -4.127  79.080  74.804  1.00 61.89  ? 440 GLN A CB  1 
ATOM 3117  C CG  . GLN A 1 443 ? -3.616  80.168  75.704  1.00 76.27  ? 440 GLN A CG  1 
ATOM 3118  C CD  . GLN A 1 443 ? -2.626  79.664  76.715  1.00 74.95  ? 440 GLN A CD  1 
ATOM 3119  O OE1 . GLN A 1 443 ? -2.318  78.474  76.763  1.00 98.47  ? 440 GLN A OE1 1 
ATOM 3120  N NE2 . GLN A 1 443 ? -2.125  80.566  77.540  1.00 63.81  ? 440 GLN A NE2 1 
ATOM 3121  N N   . GLU A 1 444 ? -3.866  77.950  71.417  1.00 50.13  ? 441 GLU A N   1 
ATOM 3122  C CA  . GLU A 1 444 ? -4.470  77.009  70.478  1.00 58.08  ? 441 GLU A CA  1 
ATOM 3123  C C   . GLU A 1 444 ? -3.770  75.650  70.588  1.00 44.53  ? 441 GLU A C   1 
ATOM 3124  O O   . GLU A 1 444 ? -2.566  75.602  70.814  1.00 55.84  ? 441 GLU A O   1 
ATOM 3125  C CB  . GLU A 1 444 ? -4.380  77.561  69.052  1.00 46.14  ? 441 GLU A CB  1 
ATOM 3126  C CG  . GLU A 1 444 ? -5.698  77.571  68.268  1.00 66.69  ? 441 GLU A CG  1 
ATOM 3127  C CD  . GLU A 1 444 ? -5.977  76.270  67.520  1.00 59.46  ? 441 GLU A CD  1 
ATOM 3128  O OE1 . GLU A 1 444 ? -5.055  75.456  67.358  1.00 56.34  ? 441 GLU A OE1 1 
ATOM 3129  O OE2 . GLU A 1 444 ? -7.129  76.056  67.093  1.00 66.52  ? 441 GLU A OE2 1 
ATOM 3130  N N   . PRO A 1 445 ? -4.528  74.547  70.458  1.00 54.39  ? 442 PRO A N   1 
ATOM 3131  C CA  . PRO A 1 445 ? -3.978  73.178  70.463  1.00 52.05  ? 442 PRO A CA  1 
ATOM 3132  C C   . PRO A 1 445 ? -2.728  72.983  69.603  1.00 51.43  ? 442 PRO A C   1 
ATOM 3133  O O   . PRO A 1 445 ? -1.926  72.127  69.937  1.00 44.61  ? 442 PRO A O   1 
ATOM 3134  C CB  . PRO A 1 445 ? -5.129  72.335  69.907  1.00 39.85  ? 442 PRO A CB  1 
ATOM 3135  C CG  . PRO A 1 445 ? -6.371  73.082  70.355  1.00 50.01  ? 442 PRO A CG  1 
ATOM 3136  C CD  . PRO A 1 445 ? -6.003  74.551  70.402  1.00 42.90  ? 442 PRO A CD  1 
ATOM 3137  N N   . ILE A 1 446 ? -2.566  73.757  68.530  1.00 45.05  ? 443 ILE A N   1 
ATOM 3138  C CA  . ILE A 1 446 ? -1.412  73.613  67.663  1.00 58.67  ? 443 ILE A CA  1 
ATOM 3139  C C   . ILE A 1 446 ? -0.190  74.288  68.294  1.00 43.18  ? 443 ILE A C   1 
ATOM 3140  O O   . ILE A 1 446 ? 0.941   73.982  67.951  1.00 44.09  ? 443 ILE A O   1 
ATOM 3141  C CB  . ILE A 1 446 ? -1.694  74.129  66.220  1.00 44.32  ? 443 ILE A CB  1 
ATOM 3142  C CG1 . ILE A 1 446 ? -0.683  73.551  65.234  1.00 44.38  ? 443 ILE A CG1 1 
ATOM 3143  C CG2 . ILE A 1 446 ? -1.633  75.623  66.162  1.00 29.21  ? 443 ILE A CG2 1 
ATOM 3144  C CD1 . ILE A 1 446 ? -0.957  73.912  63.795  1.00 40.49  ? 443 ILE A CD1 1 
ATOM 3145  N N   . MET A 1 447 ? -0.424  75.195  69.230  1.00 56.69  ? 444 MET A N   1 
ATOM 3146  C CA  . MET A 1 447 ? 0.659   75.806  69.997  1.00 41.89  ? 444 MET A CA  1 
ATOM 3147  C C   . MET A 1 447 ? 1.043   74.923  71.192  1.00 46.83  ? 444 MET A C   1 
ATOM 3148  O O   . MET A 1 447 ? 2.070   75.142  71.803  1.00 45.06  ? 444 MET A O   1 
ATOM 3149  C CB  . MET A 1 447 ? 0.276   77.219  70.479  1.00 33.21  ? 444 MET A CB  1 
ATOM 3150  C CG  . MET A 1 447 ? 0.058   78.271  69.362  1.00 33.98  ? 444 MET A CG  1 
ATOM 3151  S SD  . MET A 1 447 ? 1.573   78.889  68.637  1.00 28.87  ? 444 MET A SD  1 
ATOM 3152  C CE  . MET A 1 447 ? 2.202   79.862  69.976  1.00 35.06  ? 444 MET A CE  1 
ATOM 3153  N N   . LYS A 1 448 ? 0.240   73.904  71.498  1.00 43.76  ? 445 LYS A N   1 
ATOM 3154  C CA  . LYS A 1 448 ? 0.455   73.069  72.689  1.00 47.32  ? 445 LYS A CA  1 
ATOM 3155  C C   . LYS A 1 448 ? 0.791   71.594  72.436  1.00 60.47  ? 445 LYS A C   1 
ATOM 3156  O O   . LYS A 1 448 ? 1.543   71.003  73.195  1.00 44.00  ? 445 LYS A O   1 
ATOM 3157  C CB  . LYS A 1 448 ? -0.750  73.148  73.639  1.00 34.15  ? 445 LYS A CB  1 
ATOM 3158  C CG  . LYS A 1 448 ? -1.124  74.570  74.019  1.00 67.28  ? 445 LYS A CG  1 
ATOM 3159  C CD  . LYS A 1 448 ? -1.836  74.652  75.337  1.00 63.11  ? 445 LYS A CD  1 
ATOM 3160  C CE  . LYS A 1 448 ? -3.235  74.133  75.291  1.00 66.06  ? 445 LYS A CE  1 
ATOM 3161  N NZ  . LYS A 1 448 ? -3.919  74.591  76.531  1.00 87.56  ? 445 LYS A NZ  1 
ATOM 3162  N N   . GLU A 1 449 ? 0.230   70.999  71.388  1.00 61.49  ? 446 GLU A N   1 
ATOM 3163  C CA  . GLU A 1 449 ? 0.373   69.562  71.150  1.00 47.81  ? 446 GLU A CA  1 
ATOM 3164  C C   . GLU A 1 449 ? 1.506   69.230  70.126  1.00 44.76  ? 446 GLU A C   1 
ATOM 3165  O O   . GLU A 1 449 ? 1.671   69.906  69.120  1.00 47.36  ? 446 GLU A O   1 
ATOM 3166  C CB  . GLU A 1 449 ? -0.996  68.973  70.762  1.00 38.17  ? 446 GLU A CB  1 
ATOM 3167  N N   . GLU A 1 450 ? 2.306   68.205  70.404  1.00 49.39  ? 447 GLU A N   1 
ATOM 3168  C CA  . GLU A 1 450 ? 3.468   67.869  69.563  1.00 38.04  ? 447 GLU A CA  1 
ATOM 3169  C C   . GLU A 1 450 ? 3.126   67.159  68.238  1.00 51.28  ? 447 GLU A C   1 
ATOM 3170  O O   . GLU A 1 450 ? 2.529   66.097  68.247  1.00 40.58  ? 447 GLU A O   1 
ATOM 3171  C CB  . GLU A 1 450 ? 4.447   67.005  70.351  1.00 40.26  ? 447 GLU A CB  1 
ATOM 3172  C CG  . GLU A 1 450 ? 5.756   66.717  69.629  1.00 54.88  ? 447 GLU A CG  1 
ATOM 3173  C CD  . GLU A 1 450 ? 6.624   65.690  70.345  1.00 82.26  ? 447 GLU A CD  1 
ATOM 3174  O OE1 . GLU A 1 450 ? 6.061   64.726  70.924  1.00 63.53  ? 447 GLU A OE1 1 
ATOM 3175  O OE2 . GLU A 1 450 ? 7.872   65.859  70.331  1.00 48.39  ? 447 GLU A OE2 1 
ATOM 3176  N N   . ILE A 1 451 ? 3.522   67.742  67.109  1.00 34.77  ? 448 ILE A N   1 
ATOM 3177  C CA  . ILE A 1 451 ? 3.113   67.237  65.801  1.00 43.23  ? 448 ILE A CA  1 
ATOM 3178  C C   . ILE A 1 451 ? 4.111   66.223  65.215  1.00 56.75  ? 448 ILE A C   1 
ATOM 3179  O O   . ILE A 1 451 ? 3.735   65.281  64.531  1.00 40.68  ? 448 ILE A O   1 
ATOM 3180  C CB  . ILE A 1 451 ? 2.874   68.400  64.795  1.00 39.53  ? 448 ILE A CB  1 
ATOM 3181  C CG1 . ILE A 1 451 ? 1.779   69.340  65.311  1.00 33.34  ? 448 ILE A CG1 1 
ATOM 3182  C CG2 . ILE A 1 451 ? 2.471   67.872  63.425  1.00 38.59  ? 448 ILE A CG2 1 
ATOM 3183  C CD1 . ILE A 1 451 ? 1.578   70.560  64.448  1.00 44.74  ? 448 ILE A CD1 1 
ATOM 3184  N N   . PHE A 1 452 ? 5.388   66.417  65.505  1.00 25.04  ? 449 PHE A N   1 
ATOM 3185  C CA  . PHE A 1 452 ? 6.442   65.605  64.919  1.00 55.01  ? 449 PHE A CA  1 
ATOM 3186  C C   . PHE A 1 452 ? 6.413   65.567  63.384  1.00 25.73  ? 449 PHE A C   1 
ATOM 3187  O O   . PHE A 1 452 ? 6.633   64.533  62.774  1.00 42.47  ? 449 PHE A O   1 
ATOM 3188  C CB  . PHE A 1 452 ? 6.438   64.205  65.542  1.00 40.02  ? 449 PHE A CB  1 
ATOM 3189  C CG  . PHE A 1 452 ? 7.775   63.790  66.076  1.00 56.86  ? 449 PHE A CG  1 
ATOM 3190  C CD1 . PHE A 1 452 ? 8.516   62.793  65.454  1.00 45.25  ? 449 PHE A CD1 1 
ATOM 3191  C CD2 . PHE A 1 452 ? 8.314   64.424  67.185  1.00 58.32  ? 449 PHE A CD2 1 
ATOM 3192  C CE1 . PHE A 1 452 ? 9.761   62.415  65.937  1.00 52.84  ? 449 PHE A CE1 1 
ATOM 3193  C CE2 . PHE A 1 452 ? 9.567   64.050  67.686  1.00 47.52  ? 449 PHE A CE2 1 
ATOM 3194  C CZ  . PHE A 1 452 ? 10.286  63.041  67.057  1.00 59.65  ? 449 PHE A CZ  1 
ATOM 3195  N N   . GLY A 1 453 ? 6.102   66.715  62.792  1.00 38.04  ? 450 GLY A N   1 
ATOM 3196  C CA  . GLY A 1 453 ? 6.155   66.926  61.360  1.00 47.03  ? 450 GLY A CA  1 
ATOM 3197  C C   . GLY A 1 453 ? 6.633   68.338  61.094  1.00 43.44  ? 450 GLY A C   1 
ATOM 3198  O O   . GLY A 1 453 ? 6.892   69.076  62.025  1.00 48.58  ? 450 GLY A O   1 
ATOM 3199  N N   . PRO A 1 454 ? 6.759   68.723  59.819  1.00 52.72  ? 451 PRO A N   1 
ATOM 3200  C CA  . PRO A 1 454 ? 7.324   70.025  59.462  1.00 43.79  ? 451 PRO A CA  1 
ATOM 3201  C C   . PRO A 1 454 ? 6.284   71.139  59.538  1.00 58.04  ? 451 PRO A C   1 
ATOM 3202  O O   . PRO A 1 454 ? 5.959   71.760  58.537  1.00 33.59  ? 451 PRO A O   1 
ATOM 3203  C CB  . PRO A 1 454 ? 7.777   69.808  58.025  1.00 31.57  ? 451 PRO A CB  1 
ATOM 3204  C CG  . PRO A 1 454 ? 6.833   68.805  57.496  1.00 40.08  ? 451 PRO A CG  1 
ATOM 3205  C CD  . PRO A 1 454 ? 6.424   67.927  58.632  1.00 25.33  ? 451 PRO A CD  1 
ATOM 3206  N N   . VAL A 1 455 ? 5.780   71.399  60.735  1.00 44.02  ? 452 VAL A N   1 
ATOM 3207  C CA  . VAL A 1 455 ? 4.723   72.375  60.927  1.00 36.91  ? 452 VAL A CA  1 
ATOM 3208  C C   . VAL A 1 455 ? 5.093   73.419  61.990  1.00 36.32  ? 452 VAL A C   1 
ATOM 3209  O O   . VAL A 1 455 ? 5.091   73.136  63.179  1.00 48.61  ? 452 VAL A O   1 
ATOM 3210  C CB  . VAL A 1 455 ? 3.427   71.676  61.326  1.00 43.87  ? 452 VAL A CB  1 
ATOM 3211  C CG1 . VAL A 1 455 ? 2.295   72.662  61.406  1.00 34.07  ? 452 VAL A CG1 1 
ATOM 3212  C CG2 . VAL A 1 455 ? 3.110   70.580  60.337  1.00 39.12  ? 452 VAL A CG2 1 
ATOM 3213  N N   . LEU A 1 456 ? 5.401   74.629  61.533  1.00 52.42  ? 453 LEU A N   1 
ATOM 3214  C CA  . LEU A 1 456 ? 5.779   75.736  62.394  1.00 39.45  ? 453 LEU A CA  1 
ATOM 3215  C C   . LEU A 1 456 ? 4.633   76.714  62.692  1.00 50.54  ? 453 LEU A C   1 
ATOM 3216  O O   . LEU A 1 456 ? 4.090   77.339  61.786  1.00 61.12  ? 453 LEU A O   1 
ATOM 3217  C CB  . LEU A 1 456 ? 6.942   76.500  61.776  1.00 29.03  ? 453 LEU A CB  1 
ATOM 3218  C CG  . LEU A 1 456 ? 7.284   77.775  62.545  1.00 44.41  ? 453 LEU A CG  1 
ATOM 3219  C CD1 . LEU A 1 456 ? 7.839   77.446  63.923  1.00 50.65  ? 453 LEU A CD1 1 
ATOM 3220  C CD2 . LEU A 1 456 ? 8.289   78.566  61.786  1.00 34.79  ? 453 LEU A CD2 1 
ATOM 3221  N N   . SER A 1 457 ? 4.290   76.864  63.971  1.00 32.42  ? 454 SER A N   1 
ATOM 3222  C CA  . SER A 1 457 ? 3.215   77.763  64.396  1.00 34.78  ? 454 SER A CA  1 
ATOM 3223  C C   . SER A 1 457 ? 3.787   79.079  64.888  1.00 35.01  ? 454 SER A C   1 
ATOM 3224  O O   . SER A 1 457 ? 4.715   79.096  65.687  1.00 46.13  ? 454 SER A O   1 
ATOM 3225  C CB  . SER A 1 457 ? 2.384   77.128  65.500  1.00 41.23  ? 454 SER A CB  1 
ATOM 3226  O OG  . SER A 1 457 ? 1.826   75.905  65.076  1.00 45.61  ? 454 SER A OG  1 
ATOM 3227  N N   . VAL A 1 458 ? 3.224   80.184  64.419  1.00 42.49  ? 455 VAL A N   1 
ATOM 3228  C CA  . VAL A 1 458 ? 3.715   81.510  64.774  1.00 36.82  ? 455 VAL A CA  1 
ATOM 3229  C C   . VAL A 1 458 ? 2.680   82.307  65.565  1.00 45.09  ? 455 VAL A C   1 
ATOM 3230  O O   . VAL A 1 458 ? 1.506   82.340  65.226  1.00 39.97  ? 455 VAL A O   1 
ATOM 3231  C CB  . VAL A 1 458 ? 4.072   82.309  63.513  1.00 49.18  ? 455 VAL A CB  1 
ATOM 3232  C CG1 . VAL A 1 458 ? 4.783   83.621  63.882  1.00 31.91  ? 455 VAL A CG1 1 
ATOM 3233  C CG2 . VAL A 1 458 ? 4.922   81.464  62.583  1.00 34.13  ? 455 VAL A CG2 1 
ATOM 3234  N N   . TYR A 1 459 ? 3.117   82.948  66.633  1.00 39.70  ? 456 TYR A N   1 
ATOM 3235  C CA  . TYR A 1 459 ? 2.265   83.875  67.345  1.00 40.47  ? 456 TYR A CA  1 
ATOM 3236  C C   . TYR A 1 459 ? 2.928   85.243  67.405  1.00 48.50  ? 456 TYR A C   1 
ATOM 3237  O O   . TYR A 1 459 ? 4.056   85.377  67.861  1.00 49.97  ? 456 TYR A O   1 
ATOM 3238  C CB  . TYR A 1 459 ? 1.959   83.375  68.756  1.00 31.31  ? 456 TYR A CB  1 
ATOM 3239  C CG  . TYR A 1 459 ? 1.207   84.377  69.597  1.00 52.44  ? 456 TYR A CG  1 
ATOM 3240  C CD1 . TYR A 1 459 ? -0.138  84.645  69.355  1.00 42.66  ? 456 TYR A CD1 1 
ATOM 3241  C CD2 . TYR A 1 459 ? 1.836   85.052  70.637  1.00 30.19  ? 456 TYR A CD2 1 
ATOM 3242  C CE1 . TYR A 1 459 ? -0.833  85.563  70.107  1.00 45.96  ? 456 TYR A CE1 1 
ATOM 3243  C CE2 . TYR A 1 459 ? 1.138   85.979  71.416  1.00 32.39  ? 456 TYR A CE2 1 
ATOM 3244  C CZ  . TYR A 1 459 ? -0.194  86.228  71.138  1.00 63.15  ? 456 TYR A CZ  1 
ATOM 3245  O OH  . TYR A 1 459 ? -0.886  87.145  71.882  1.00 45.06  ? 456 TYR A OH  1 
ATOM 3246  N N   . VAL A 1 460 ? 2.219   86.257  66.939  1.00 40.33  ? 457 VAL A N   1 
ATOM 3247  C CA  . VAL A 1 460 ? 2.741   87.610  66.927  1.00 54.70  ? 457 VAL A CA  1 
ATOM 3248  C C   . VAL A 1 460 ? 2.246   88.353  68.165  1.00 65.58  ? 457 VAL A C   1 
ATOM 3249  O O   . VAL A 1 460 ? 1.046   88.398  68.452  1.00 43.26  ? 457 VAL A O   1 
ATOM 3250  C CB  . VAL A 1 460 ? 2.347   88.344  65.628  1.00 45.43  ? 457 VAL A CB  1 
ATOM 3251  C CG1 . VAL A 1 460 ? 2.942   89.732  65.593  1.00 49.64  ? 457 VAL A CG1 1 
ATOM 3252  C CG2 . VAL A 1 460 ? 2.815   87.535  64.415  1.00 33.87  ? 457 VAL A CG2 1 
ATOM 3253  N N   . TYR A 1 461 ? 3.183   88.923  68.909  1.00 36.65  ? 458 TYR A N   1 
ATOM 3254  C CA  . TYR A 1 461 ? 2.856   89.529  70.192  1.00 56.72  ? 458 TYR A CA  1 
ATOM 3255  C C   . TYR A 1 461 ? 3.183   91.018  70.195  1.00 55.90  ? 458 TYR A C   1 
ATOM 3256  O O   . TYR A 1 461 ? 4.088   91.460  69.496  1.00 51.72  ? 458 TYR A O   1 
ATOM 3257  C CB  . TYR A 1 461 ? 3.575   88.786  71.336  1.00 35.13  ? 458 TYR A CB  1 
ATOM 3258  C CG  . TYR A 1 461 ? 5.074   89.049  71.450  1.00 35.93  ? 458 TYR A CG  1 
ATOM 3259  C CD1 . TYR A 1 461 ? 5.554   90.154  72.137  1.00 35.47  ? 458 TYR A CD1 1 
ATOM 3260  C CD2 . TYR A 1 461 ? 6.003   88.181  70.890  1.00 26.53  ? 458 TYR A CD2 1 
ATOM 3261  C CE1 . TYR A 1 461 ? 6.900   90.395  72.263  1.00 53.90  ? 458 TYR A CE1 1 
ATOM 3262  C CE2 . TYR A 1 461 ? 7.370   88.418  71.015  1.00 38.52  ? 458 TYR A CE2 1 
ATOM 3263  C CZ  . TYR A 1 461 ? 7.801   89.532  71.706  1.00 45.41  ? 458 TYR A CZ  1 
ATOM 3264  O OH  . TYR A 1 461 ? 9.130   89.799  71.837  1.00 46.33  ? 458 TYR A OH  1 
ATOM 3265  N N   . PRO A 1 462 ? 2.435   91.801  70.975  1.00 55.92  ? 459 PRO A N   1 
ATOM 3266  C CA  . PRO A 1 462 ? 2.692   93.245  71.061  1.00 42.25  ? 459 PRO A CA  1 
ATOM 3267  C C   . PRO A 1 462 ? 3.985   93.546  71.811  1.00 71.31  ? 459 PRO A C   1 
ATOM 3268  O O   . PRO A 1 462 ? 4.196   93.001  72.902  1.00 61.02  ? 459 PRO A O   1 
ATOM 3269  C CB  . PRO A 1 462 ? 1.483   93.765  71.837  1.00 46.15  ? 459 PRO A CB  1 
ATOM 3270  C CG  . PRO A 1 462 ? 0.438   92.652  71.741  1.00 55.91  ? 459 PRO A CG  1 
ATOM 3271  C CD  . PRO A 1 462 ? 1.240   91.401  71.732  1.00 54.56  ? 459 PRO A CD  1 
ATOM 3272  N N   . ASP A 1 463 ? 4.845   94.378  71.226  1.00 56.90  ? 460 ASP A N   1 
ATOM 3273  C CA  . ASP A 1 463 ? 6.131   94.736  71.838  1.00 64.04  ? 460 ASP A CA  1 
ATOM 3274  C C   . ASP A 1 463 ? 6.014   95.124  73.309  1.00 68.10  ? 460 ASP A C   1 
ATOM 3275  O O   . ASP A 1 463 ? 6.820   94.691  74.125  1.00 76.05  ? 460 ASP A O   1 
ATOM 3276  C CB  . ASP A 1 463 ? 6.800   95.891  71.082  1.00 66.61  ? 460 ASP A CB  1 
ATOM 3277  C CG  . ASP A 1 463 ? 7.311   95.491  69.705  1.00 89.56  ? 460 ASP A CG  1 
ATOM 3278  O OD1 . ASP A 1 463 ? 6.483   95.209  68.808  1.00 66.76  ? 460 ASP A OD1 1 
ATOM 3279  O OD2 . ASP A 1 463 ? 8.546   95.495  69.510  1.00 81.03  ? 460 ASP A OD2 1 
ATOM 3280  N N   . ASP A 1 464 ? 5.016   95.947  73.631  1.00 84.21  ? 461 ASP A N   1 
ATOM 3281  C CA  . ASP A 1 464 ? 4.812   96.445  74.990  1.00 93.96  ? 461 ASP A CA  1 
ATOM 3282  C C   . ASP A 1 464 ? 4.471   95.317  75.974  1.00 85.67  ? 461 ASP A C   1 
ATOM 3283  O O   . ASP A 1 464 ? 4.591   95.484  77.181  1.00 72.55  ? 461 ASP A O   1 
ATOM 3284  C CB  . ASP A 1 464 ? 3.722   97.530  75.003  1.00 58.25  ? 461 ASP A CB  1 
ATOM 3285  N N   . LYS A 1 465 ? 4.064   94.170  75.443  1.00 47.38  ? 462 LYS A N   1 
ATOM 3286  C CA  . LYS A 1 465 ? 3.604   93.064  76.248  1.00 66.02  ? 462 LYS A CA  1 
ATOM 3287  C C   . LYS A 1 465 ? 4.583   91.865  76.199  1.00 81.68  ? 462 LYS A C   1 
ATOM 3288  O O   . LYS A 1 465 ? 4.194   90.703  76.371  1.00 49.70  ? 462 LYS A O   1 
ATOM 3289  C CB  . LYS A 1 465 ? 2.177   92.677  75.825  1.00 53.78  ? 462 LYS A CB  1 
ATOM 3290  N N   . TYR A 1 466 ? 5.866   92.147  75.998  1.00 46.30  ? 463 TYR A N   1 
ATOM 3291  C CA  . TYR A 1 466 ? 6.854   91.071  75.892  1.00 58.75  ? 463 TYR A CA  1 
ATOM 3292  C C   . TYR A 1 466 ? 7.146   90.359  77.213  1.00 67.39  ? 463 TYR A C   1 
ATOM 3293  O O   . TYR A 1 466 ? 7.452   89.175  77.205  1.00 45.07  ? 463 TYR A O   1 
ATOM 3294  C CB  . TYR A 1 466 ? 8.164   91.548  75.248  1.00 32.66  ? 463 TYR A CB  1 
ATOM 3295  C CG  . TYR A 1 466 ? 9.247   91.928  76.241  1.00 66.00  ? 463 TYR A CG  1 
ATOM 3296  C CD1 . TYR A 1 466 ? 10.113  90.972  76.756  1.00 51.55  ? 463 TYR A CD1 1 
ATOM 3297  C CD2 . TYR A 1 466 ? 9.405   93.244  76.657  1.00 52.20  ? 463 TYR A CD2 1 
ATOM 3298  C CE1 . TYR A 1 466 ? 11.100  91.314  77.659  1.00 58.41  ? 463 TYR A CE1 1 
ATOM 3299  C CE2 . TYR A 1 466 ? 10.398  93.600  77.556  1.00 64.60  ? 463 TYR A CE2 1 
ATOM 3300  C CZ  . TYR A 1 466 ? 11.238  92.633  78.061  1.00 88.64  ? 463 TYR A CZ  1 
ATOM 3301  O OH  . TYR A 1 466 ? 12.219  92.993  78.963  1.00 57.31  ? 463 TYR A OH  1 
ATOM 3302  N N   . LYS A 1 467 ? 7.072   91.067  78.337  1.00 81.27  ? 464 LYS A N   1 
ATOM 3303  C CA  . LYS A 1 467 ? 7.297   90.419  79.626  1.00 55.50  ? 464 LYS A CA  1 
ATOM 3304  C C   . LYS A 1 467 ? 6.234   89.358  79.893  1.00 46.79  ? 464 LYS A C   1 
ATOM 3305  O O   . LYS A 1 467 ? 6.553   88.263  80.336  1.00 57.94  ? 464 LYS A O   1 
ATOM 3306  C CB  . LYS A 1 467 ? 7.338   91.438  80.757  1.00 51.95  ? 464 LYS A CB  1 
ATOM 3307  C CG  . LYS A 1 467 ? 8.570   92.319  80.756  1.00 72.30  ? 464 LYS A CG  1 
ATOM 3308  C CD  . LYS A 1 467 ? 8.371   93.511  81.680  1.00 61.21  ? 464 LYS A CD  1 
ATOM 3309  C CE  . LYS A 1 467 ? 9.637   94.313  81.812  1.00 73.04  ? 464 LYS A CE  1 
ATOM 3310  N NZ  . LYS A 1 467 ? 10.689  93.504  82.469  1.00 69.55  ? 464 LYS A NZ  1 
ATOM 3311  N N   . GLU A 1 468 ? 4.978   89.694  79.613  1.00 49.78  ? 465 GLU A N   1 
ATOM 3312  C CA  . GLU A 1 468 ? 3.851   88.781  79.799  1.00 70.25  ? 465 GLU A CA  1 
ATOM 3313  C C   . GLU A 1 468 ? 3.887   87.629  78.804  1.00 75.51  ? 465 GLU A C   1 
ATOM 3314  O O   . GLU A 1 468 ? 3.400   86.531  79.101  1.00 54.29  ? 465 GLU A O   1 
ATOM 3315  C CB  . GLU A 1 468 ? 2.496   89.523  79.730  1.00 47.54  ? 465 GLU A CB  1 
ATOM 3316  C CG  . GLU A 1 468 ? 2.515   90.834  78.969  1.00 94.41  ? 465 GLU A CG  1 
ATOM 3317  C CD  . GLU A 1 468 ? 2.921   92.032  79.831  1.00 105.90 ? 465 GLU A CD  1 
ATOM 3318  O OE1 . GLU A 1 468 ? 2.135   92.398  80.732  1.00 107.69 ? 465 GLU A OE1 1 
ATOM 3319  O OE2 . GLU A 1 468 ? 4.014   92.616  79.605  1.00 84.29  ? 465 GLU A OE2 1 
ATOM 3320  N N   . THR A 1 469 ? 4.462   87.886  77.629  1.00 56.11  ? 466 THR A N   1 
ATOM 3321  C CA  . THR A 1 469 ? 4.584   86.875  76.582  1.00 46.77  ? 466 THR A CA  1 
ATOM 3322  C C   . THR A 1 469 ? 5.668   85.857  76.947  1.00 52.67  ? 466 THR A C   1 
ATOM 3323  O O   . THR A 1 469 ? 5.528   84.673  76.694  1.00 34.15  ? 466 THR A O   1 
ATOM 3324  C CB  . THR A 1 469 ? 4.861   87.513  75.200  1.00 56.07  ? 466 THR A CB  1 
ATOM 3325  O OG1 . THR A 1 469 ? 3.773   88.374  74.847  1.00 46.75  ? 466 THR A OG1 1 
ATOM 3326  C CG2 . THR A 1 469 ? 5.022   86.452  74.129  1.00 20.99  ? 466 THR A CG2 1 
ATOM 3327  N N   . LEU A 1 470 ? 6.751   86.320  77.546  1.00 40.11  ? 467 LEU A N   1 
ATOM 3328  C CA  . LEU A 1 470 ? 7.704   85.427  78.210  1.00 46.99  ? 467 LEU A CA  1 
ATOM 3329  C C   . LEU A 1 470 ? 7.002   84.423  79.147  1.00 51.25  ? 467 LEU A C   1 
ATOM 3330  O O   . LEU A 1 470 ? 7.245   83.230  79.058  1.00 43.49  ? 467 LEU A O   1 
ATOM 3331  C CB  . LEU A 1 470 ? 8.698   86.265  78.980  1.00 48.35  ? 467 LEU A CB  1 
ATOM 3332  C CG  . LEU A 1 470 ? 10.151  86.283  78.548  1.00 54.66  ? 467 LEU A CG  1 
ATOM 3333  C CD1 . LEU A 1 470 ? 10.431  85.895  77.165  1.00 44.11  ? 467 LEU A CD1 1 
ATOM 3334  C CD2 . LEU A 1 470 ? 11.012  87.410  79.085  1.00 60.44  ? 467 LEU A CD2 1 
ATOM 3335  N N   . GLN A 1 471 ? 6.112   84.903  80.016  1.00 42.63  ? 468 GLN A N   1 
ATOM 3336  C CA  . GLN A 1 471 ? 5.303   84.027  80.875  1.00 43.46  ? 468 GLN A CA  1 
ATOM 3337  C C   . GLN A 1 471 ? 4.451   83.025  80.109  1.00 48.15  ? 468 GLN A C   1 
ATOM 3338  O O   . GLN A 1 471 ? 4.284   81.898  80.557  1.00 52.16  ? 468 GLN A O   1 
ATOM 3339  C CB  . GLN A 1 471 ? 4.400   84.851  81.792  1.00 51.63  ? 468 GLN A CB  1 
ATOM 3340  C CG  . GLN A 1 471 ? 5.135   85.830  82.684  1.00 61.18  ? 468 GLN A CG  1 
ATOM 3341  C CD  . GLN A 1 471 ? 5.985   85.134  83.716  1.00 81.19  ? 468 GLN A CD  1 
ATOM 3342  O OE1 . GLN A 1 471 ? 5.795   83.952  84.000  1.00 78.04  ? 468 GLN A OE1 1 
ATOM 3343  N NE2 . GLN A 1 471 ? 6.934   85.861  84.282  1.00 61.61  ? 468 GLN A NE2 1 
ATOM 3344  N N   . LEU A 1 472 ? 3.913   83.441  78.963  1.00 49.74  ? 469 LEU A N   1 
ATOM 3345  C CA  . LEU A 1 472 ? 3.116   82.559  78.109  1.00 45.83  ? 469 LEU A CA  1 
ATOM 3346  C C   . LEU A 1 472 ? 3.928   81.397  77.599  1.00 47.33  ? 469 LEU A C   1 
ATOM 3347  O O   . LEU A 1 472 ? 3.436   80.284  77.557  1.00 38.43  ? 469 LEU A O   1 
ATOM 3348  C CB  . LEU A 1 472 ? 2.538   83.294  76.898  1.00 61.35  ? 469 LEU A CB  1 
ATOM 3349  C CG  . LEU A 1 472 ? 1.160   83.920  77.060  1.00 77.86  ? 469 LEU A CG  1 
ATOM 3350  C CD1 . LEU A 1 472 ? 0.517   84.039  75.702  1.00 70.25  ? 469 LEU A CD1 1 
ATOM 3351  C CD2 . LEU A 1 472 ? 0.301   83.084  77.984  1.00 78.20  ? 469 LEU A CD2 1 
ATOM 3352  N N   . VAL A 1 473 ? 5.167   81.662  77.200  1.00 31.47  ? 470 VAL A N   1 
ATOM 3353  C CA  . VAL A 1 473 ? 6.050   80.620  76.707  1.00 48.39  ? 470 VAL A CA  1 
ATOM 3354  C C   . VAL A 1 473 ? 6.203   79.552  77.781  1.00 41.31  ? 470 VAL A C   1 
ATOM 3355  O O   . VAL A 1 473 ? 6.010   78.361  77.535  1.00 54.35  ? 470 VAL A O   1 
ATOM 3356  C CB  . VAL A 1 473 ? 7.427   81.189  76.329  1.00 38.51  ? 470 VAL A CB  1 
ATOM 3357  C CG1 . VAL A 1 473 ? 8.382   80.063  75.973  1.00 42.11  ? 470 VAL A CG1 1 
ATOM 3358  C CG2 . VAL A 1 473 ? 7.300   82.151  75.171  1.00 33.11  ? 470 VAL A CG2 1 
ATOM 3359  N N   . ASP A 1 474 ? 6.524   80.005  78.988  1.00 43.78  ? 471 ASP A N   1 
ATOM 3360  C CA  . ASP A 1 474 ? 6.719   79.117  80.125  1.00 48.84  ? 471 ASP A CA  1 
ATOM 3361  C C   . ASP A 1 474 ? 5.431   78.374  80.506  1.00 36.63  ? 471 ASP A C   1 
ATOM 3362  O O   . ASP A 1 474 ? 5.475   77.220  80.906  1.00 35.91  ? 471 ASP A O   1 
ATOM 3363  C CB  . ASP A 1 474 ? 7.295   79.915  81.306  1.00 49.94  ? 471 ASP A CB  1 
ATOM 3364  C CG  . ASP A 1 474 ? 7.472   79.079  82.574  1.00 46.26  ? 471 ASP A CG  1 
ATOM 3365  O OD1 . ASP A 1 474 ? 8.533   78.429  82.738  1.00 54.54  ? 471 ASP A OD1 1 
ATOM 3366  O OD2 . ASP A 1 474 ? 6.558   79.120  83.424  1.00 50.32  ? 471 ASP A OD2 1 
ATOM 3367  N N   . SER A 1 475 ? 4.282   79.018  80.346  1.00 35.14  ? 472 SER A N   1 
ATOM 3368  C CA  . SER A 1 475 ? 3.048   78.462  80.894  1.00 51.77  ? 472 SER A CA  1 
ATOM 3369  C C   . SER A 1 475 ? 2.173   77.687  79.912  1.00 38.66  ? 472 SER A C   1 
ATOM 3370  O O   . SER A 1 475 ? 1.253   76.989  80.325  1.00 45.47  ? 472 SER A O   1 
ATOM 3371  C CB  . SER A 1 475 ? 2.224   79.558  81.576  1.00 35.43  ? 472 SER A CB  1 
ATOM 3372  O OG  . SER A 1 475 ? 1.455   80.289  80.637  1.00 51.15  ? 472 SER A OG  1 
ATOM 3373  N N   . THR A 1 476 ? 2.456   77.798  78.618  1.00 55.09  ? 473 THR A N   1 
ATOM 3374  C CA  . THR A 1 476 ? 1.525   77.291  77.607  1.00 44.04  ? 473 THR A CA  1 
ATOM 3375  C C   . THR A 1 476 ? 1.479   75.772  77.491  1.00 37.69  ? 473 THR A C   1 
ATOM 3376  O O   . THR A 1 476 ? 0.397   75.202  77.376  1.00 53.36  ? 473 THR A O   1 
ATOM 3377  C CB  . THR A 1 476 ? 1.716   77.963  76.209  1.00 36.61  ? 473 THR A CB  1 
ATOM 3378  O OG1 . THR A 1 476 ? 1.297   79.329  76.270  1.00 55.43  ? 473 THR A OG1 1 
ATOM 3379  C CG2 . THR A 1 476 ? 0.871   77.270  75.154  1.00 36.34  ? 473 THR A CG2 1 
ATOM 3380  N N   . THR A 1 477 ? 2.624   75.107  77.531  1.00 46.79  ? 474 THR A N   1 
ATOM 3381  C CA  . THR A 1 477 ? 2.608   73.660  77.344  1.00 47.89  ? 474 THR A CA  1 
ATOM 3382  C C   . THR A 1 477 ? 3.036   72.856  78.564  1.00 60.24  ? 474 THR A C   1 
ATOM 3383  O O   . THR A 1 477 ? 3.374   73.409  79.607  1.00 46.64  ? 474 THR A O   1 
ATOM 3384  C CB  . THR A 1 477 ? 3.499   73.233  76.189  1.00 55.25  ? 474 THR A CB  1 
ATOM 3385  O OG1 . THR A 1 477 ? 4.854   73.258  76.621  1.00 39.88  ? 474 THR A OG1 1 
ATOM 3386  C CG2 . THR A 1 477 ? 3.328   74.165  75.007  1.00 46.21  ? 474 THR A CG2 1 
ATOM 3387  N N   . SER A 1 478 ? 3.043   71.539  78.387  1.00 42.29  ? 475 SER A N   1 
ATOM 3388  C CA  . SER A 1 478 ? 3.331   70.584  79.442  1.00 43.35  ? 475 SER A CA  1 
ATOM 3389  C C   . SER A 1 478 ? 4.806   70.192  79.447  1.00 52.67  ? 475 SER A C   1 
ATOM 3390  O O   . SER A 1 478 ? 5.304   69.551  80.386  1.00 46.88  ? 475 SER A O   1 
ATOM 3391  C CB  . SER A 1 478 ? 2.478   69.325  79.240  1.00 52.82  ? 475 SER A CB  1 
ATOM 3392  O OG  . SER A 1 478 ? 1.097   69.614  79.340  1.00 68.54  ? 475 SER A OG  1 
ATOM 3393  N N   . TYR A 1 479 ? 5.495   70.603  78.390  1.00 23.78  ? 476 TYR A N   1 
ATOM 3394  C CA  . TYR A 1 479 ? 6.852   70.158  78.096  1.00 42.82  ? 476 TYR A CA  1 
ATOM 3395  C C   . TYR A 1 479 ? 7.942   71.111  78.590  1.00 37.05  ? 476 TYR A C   1 
ATOM 3396  O O   . TYR A 1 479 ? 7.697   72.286  78.843  1.00 32.43  ? 476 TYR A O   1 
ATOM 3397  C CB  . TYR A 1 479 ? 6.995   69.948  76.584  1.00 51.36  ? 476 TYR A CB  1 
ATOM 3398  C CG  . TYR A 1 479 ? 6.062   68.899  76.047  1.00 41.42  ? 476 TYR A CG  1 
ATOM 3399  C CD1 . TYR A 1 479 ? 6.334   67.560  76.226  1.00 41.02  ? 476 TYR A CD1 1 
ATOM 3400  C CD2 . TYR A 1 479 ? 4.896   69.246  75.376  1.00 52.08  ? 476 TYR A CD2 1 
ATOM 3401  C CE1 . TYR A 1 479 ? 5.487   66.586  75.742  1.00 49.39  ? 476 TYR A CE1 1 
ATOM 3402  C CE2 . TYR A 1 479 ? 4.031   68.273  74.892  1.00 43.47  ? 476 TYR A CE2 1 
ATOM 3403  C CZ  . TYR A 1 479 ? 4.341   66.945  75.077  1.00 46.63  ? 476 TYR A CZ  1 
ATOM 3404  O OH  . TYR A 1 479 ? 3.514   65.956  74.605  1.00 44.63  ? 476 TYR A OH  1 
ATOM 3405  N N   . GLY A 1 480 ? 9.156   70.603  78.714  1.00 32.17  ? 477 GLY A N   1 
ATOM 3406  C CA  . GLY A 1 480 ? 10.281  71.452  79.039  1.00 22.03  ? 477 GLY A CA  1 
ATOM 3407  C C   . GLY A 1 480 ? 11.555  71.004  78.372  1.00 37.84  ? 477 GLY A C   1 
ATOM 3408  O O   . GLY A 1 480 ? 12.611  70.972  78.996  1.00 26.97  ? 477 GLY A O   1 
ATOM 3409  N N   . LEU A 1 481 ? 11.468  70.636  77.101  1.00 31.62  ? 478 LEU A N   1 
ATOM 3410  C CA  . LEU A 1 481 ? 12.636  70.059  76.420  1.00 39.12  ? 478 LEU A CA  1 
ATOM 3411  C C   . LEU A 1 481 ? 13.656  71.111  75.905  1.00 45.90  ? 478 LEU A C   1 
ATOM 3412  O O   . LEU A 1 481 ? 14.692  71.318  76.527  1.00 35.48  ? 478 LEU A O   1 
ATOM 3413  C CB  . LEU A 1 481 ? 12.213  69.054  75.348  1.00 38.08  ? 478 LEU A CB  1 
ATOM 3414  C CG  . LEU A 1 481 ? 13.327  68.150  74.824  1.00 47.40  ? 478 LEU A CG  1 
ATOM 3415  C CD1 . LEU A 1 481 ? 14.245  67.849  75.926  1.00 32.64  ? 478 LEU A CD1 1 
ATOM 3416  C CD2 . LEU A 1 481 ? 12.774  66.875  74.252  1.00 48.46  ? 478 LEU A CD2 1 
ATOM 3417  N N   . THR A 1 482 ? 13.372  71.787  74.797  1.00 35.96  ? 479 THR A N   1 
ATOM 3418  C CA  . THR A 1 482 ? 14.298  72.813  74.296  1.00 41.06  ? 479 THR A CA  1 
ATOM 3419  C C   . THR A 1 482 ? 13.612  74.130  74.049  1.00 29.36  ? 479 THR A C   1 
ATOM 3420  O O   . THR A 1 482 ? 12.382  74.215  73.990  1.00 33.08  ? 479 THR A O   1 
ATOM 3421  C CB  . THR A 1 482 ? 15.044  72.392  73.005  1.00 26.39  ? 479 THR A CB  1 
ATOM 3422  O OG1 . THR A 1 482 ? 14.126  72.362  71.912  1.00 33.24  ? 479 THR A OG1 1 
ATOM 3423  C CG2 . THR A 1 482 ? 15.647  71.012  73.184  1.00 27.85  ? 479 THR A CG2 1 
ATOM 3424  N N   . GLY A 1 483 ? 14.424  75.167  73.917  1.00 26.39  ? 480 GLY A N   1 
ATOM 3425  C CA  . GLY A 1 483 ? 13.909  76.507  73.754  1.00 31.36  ? 480 GLY A CA  1 
ATOM 3426  C C   . GLY A 1 483 ? 15.019  77.463  73.396  1.00 36.54  ? 480 GLY A C   1 
ATOM 3427  O O   . GLY A 1 483 ? 16.168  77.243  73.760  1.00 36.05  ? 480 GLY A O   1 
ATOM 3428  N N   . ALA A 1 484 ? 14.675  78.526  72.677  1.00 29.71  ? 481 ALA A N   1 
ATOM 3429  C CA  . ALA A 1 484 ? 15.655  79.533  72.265  1.00 46.71  ? 481 ALA A CA  1 
ATOM 3430  C C   . ALA A 1 484 ? 15.170  80.975  72.422  1.00 49.18  ? 481 ALA A C   1 
ATOM 3431  O O   . ALA A 1 484 ? 13.983  81.286  72.264  1.00 43.35  ? 481 ALA A O   1 
ATOM 3432  C CB  . ALA A 1 484 ? 16.115  79.286  70.831  1.00 32.01  ? 481 ALA A CB  1 
ATOM 3433  N N   . VAL A 1 485 ? 16.110  81.852  72.738  1.00 34.27  ? 482 VAL A N   1 
ATOM 3434  C CA  . VAL A 1 485 ? 15.846  83.275  72.804  1.00 57.99  ? 482 VAL A CA  1 
ATOM 3435  C C   . VAL A 1 485 ? 16.753  84.006  71.806  1.00 33.27  ? 482 VAL A C   1 
ATOM 3436  O O   . VAL A 1 485 ? 17.970  83.828  71.829  1.00 44.24  ? 482 VAL A O   1 
ATOM 3437  C CB  . VAL A 1 485 ? 16.050  83.823  74.236  1.00 25.91  ? 482 VAL A CB  1 
ATOM 3438  C CG1 . VAL A 1 485 ? 16.065  85.357  74.208  1.00 40.75  ? 482 VAL A CG1 1 
ATOM 3439  C CG2 . VAL A 1 485 ? 14.937  83.358  75.107  1.00 57.30  ? 482 VAL A CG2 1 
ATOM 3440  N N   . PHE A 1 486 ? 16.158  84.812  70.927  1.00 47.61  ? 483 PHE A N   1 
ATOM 3441  C CA  . PHE A 1 486 ? 16.918  85.686  70.010  1.00 33.06  ? 483 PHE A CA  1 
ATOM 3442  C C   . PHE A 1 486 ? 16.780  87.151  70.445  1.00 53.92  ? 483 PHE A C   1 
ATOM 3443  O O   . PHE A 1 486 ? 15.691  87.724  70.411  1.00 44.74  ? 483 PHE A O   1 
ATOM 3444  C CB  . PHE A 1 486 ? 16.446  85.496  68.571  1.00 44.29  ? 483 PHE A CB  1 
ATOM 3445  C CG  . PHE A 1 486 ? 16.808  84.164  67.980  1.00 43.64  ? 483 PHE A CG  1 
ATOM 3446  C CD1 . PHE A 1 486 ? 15.995  83.064  68.177  1.00 52.11  ? 483 PHE A CD1 1 
ATOM 3447  C CD2 . PHE A 1 486 ? 17.961  84.010  67.227  1.00 44.98  ? 483 PHE A CD2 1 
ATOM 3448  C CE1 . PHE A 1 486 ? 16.326  81.816  67.641  1.00 34.39  ? 483 PHE A CE1 1 
ATOM 3449  C CE2 . PHE A 1 486 ? 18.300  82.769  66.673  1.00 36.86  ? 483 PHE A CE2 1 
ATOM 3450  C CZ  . PHE A 1 486 ? 17.476  81.676  66.879  1.00 44.32  ? 483 PHE A CZ  1 
ATOM 3451  N N   . SER A 1 487 ? 17.892  87.740  70.867  1.00 38.30  ? 484 SER A N   1 
ATOM 3452  C CA  . SER A 1 487 ? 17.906  89.089  71.418  1.00 52.29  ? 484 SER A CA  1 
ATOM 3453  C C   . SER A 1 487 ? 19.331  89.600  71.389  1.00 51.56  ? 484 SER A C   1 
ATOM 3454  O O   . SER A 1 487 ? 20.257  88.888  71.767  1.00 47.97  ? 484 SER A O   1 
ATOM 3455  C CB  . SER A 1 487 ? 17.353  89.109  72.851  1.00 45.87  ? 484 SER A CB  1 
ATOM 3456  O OG  . SER A 1 487 ? 17.476  90.384  73.453  1.00 52.63  ? 484 SER A OG  1 
ATOM 3457  N N   . GLN A 1 488 ? 19.511  90.821  70.899  1.00 53.69  ? 485 GLN A N   1 
ATOM 3458  C CA  . GLN A 1 488 ? 20.815  91.467  70.958  1.00 56.28  ? 485 GLN A CA  1 
ATOM 3459  C C   . GLN A 1 488 ? 20.925  92.281  72.237  1.00 70.63  ? 485 GLN A C   1 
ATOM 3460  O O   . GLN A 1 488 ? 22.016  92.621  72.661  1.00 54.82  ? 485 GLN A O   1 
ATOM 3461  C CB  . GLN A 1 488 ? 21.059  92.343  69.733  1.00 75.90  ? 485 GLN A CB  1 
ATOM 3462  C CG  . GLN A 1 488 ? 21.084  91.572  68.416  1.00 98.68  ? 485 GLN A CG  1 
ATOM 3463  C CD  . GLN A 1 488 ? 21.970  90.346  68.481  1.00 109.62 ? 485 GLN A CD  1 
ATOM 3464  O OE1 . GLN A 1 488 ? 23.085  90.406  68.984  1.00 93.01  ? 485 GLN A OE1 1 
ATOM 3465  N NE2 . GLN A 1 488 ? 21.472  89.222  67.978  1.00 133.37 ? 485 GLN A NE2 1 
ATOM 3466  N N   . ASP A 1 489 ? 19.780  92.580  72.842  1.00 66.41  ? 486 ASP A N   1 
ATOM 3467  C CA  . ASP A 1 489 ? 19.724  93.236  74.137  1.00 55.67  ? 486 ASP A CA  1 
ATOM 3468  C C   . ASP A 1 489 ? 20.155  92.248  75.225  1.00 80.53  ? 486 ASP A C   1 
ATOM 3469  O O   . ASP A 1 489 ? 19.442  91.280  75.528  1.00 47.60  ? 486 ASP A O   1 
ATOM 3470  C CB  . ASP A 1 489 ? 18.300  93.751  74.381  1.00 63.51  ? 486 ASP A CB  1 
ATOM 3471  C CG  . ASP A 1 489 ? 18.157  94.510  75.687  1.00 92.73  ? 486 ASP A CG  1 
ATOM 3472  O OD1 . ASP A 1 489 ? 18.818  94.145  76.681  1.00 101.77 ? 486 ASP A OD1 1 
ATOM 3473  O OD2 . ASP A 1 489 ? 17.363  95.471  75.721  1.00 84.76  ? 486 ASP A OD2 1 
ATOM 3474  N N   . LYS A 1 490 ? 21.328  92.492  75.804  1.00 81.24  ? 487 LYS A N   1 
ATOM 3475  C CA  . LYS A 1 490 ? 21.911  91.574  76.781  1.00 70.75  ? 487 LYS A CA  1 
ATOM 3476  C C   . LYS A 1 490 ? 21.130  91.494  78.112  1.00 70.70  ? 487 LYS A C   1 
ATOM 3477  O O   . LYS A 1 490 ? 21.120  90.454  78.769  1.00 63.14  ? 487 LYS A O   1 
ATOM 3478  C CB  . LYS A 1 490 ? 23.388  91.902  77.008  1.00 52.31  ? 487 LYS A CB  1 
ATOM 3479  N N   . ASP A 1 491 ? 20.452  92.571  78.491  1.00 63.18  ? 488 ASP A N   1 
ATOM 3480  C CA  . ASP A 1 491 ? 19.662  92.571  79.722  1.00 78.26  ? 488 ASP A CA  1 
ATOM 3481  C C   . ASP A 1 491 ? 18.378  91.749  79.565  1.00 76.54  ? 488 ASP A C   1 
ATOM 3482  O O   . ASP A 1 491 ? 17.917  91.120  80.512  1.00 68.38  ? 488 ASP A O   1 
ATOM 3483  C CB  . ASP A 1 491 ? 19.366  94.009  80.194  1.00 47.86  ? 488 ASP A CB  1 
ATOM 3484  N N   . VAL A 1 492 ? 17.808  91.755  78.365  1.00 74.68  ? 489 VAL A N   1 
ATOM 3485  C CA  . VAL A 1 492 ? 16.622  90.956  78.067  1.00 52.19  ? 489 VAL A CA  1 
ATOM 3486  C C   . VAL A 1 492 ? 16.941  89.462  78.032  1.00 57.88  ? 489 VAL A C   1 
ATOM 3487  O O   . VAL A 1 492 ? 16.138  88.639  78.445  1.00 50.42  ? 489 VAL A O   1 
ATOM 3488  C CB  . VAL A 1 492 ? 15.993  91.360  76.737  1.00 67.48  ? 489 VAL A CB  1 
ATOM 3489  C CG1 . VAL A 1 492 ? 15.109  90.236  76.205  1.00 60.51  ? 489 VAL A CG1 1 
ATOM 3490  C CG2 . VAL A 1 492 ? 15.203  92.634  76.907  1.00 61.91  ? 489 VAL A CG2 1 
ATOM 3491  N N   . VAL A 1 493 ? 18.118  89.120  77.533  1.00 54.15  ? 490 VAL A N   1 
ATOM 3492  C CA  . VAL A 1 493 ? 18.607  87.751  77.588  1.00 65.92  ? 490 VAL A CA  1 
ATOM 3493  C C   . VAL A 1 493 ? 18.689  87.244  79.036  1.00 71.76  ? 490 VAL A C   1 
ATOM 3494  O O   . VAL A 1 493 ? 18.166  86.167  79.356  1.00 57.80  ? 490 VAL A O   1 
ATOM 3495  C CB  . VAL A 1 493 ? 19.984  87.613  76.884  1.00 47.09  ? 490 VAL A CB  1 
ATOM 3496  C CG1 . VAL A 1 493 ? 20.630  86.286  77.212  1.00 40.48  ? 490 VAL A CG1 1 
ATOM 3497  C CG2 . VAL A 1 493 ? 19.831  87.751  75.402  1.00 48.06  ? 490 VAL A CG2 1 
ATOM 3498  N N   . GLN A 1 494 ? 19.342  88.018  79.901  1.00 51.99  ? 491 GLN A N   1 
ATOM 3499  C CA  . GLN A 1 494 ? 19.480  87.660  81.313  1.00 61.71  ? 491 GLN A CA  1 
ATOM 3500  C C   . GLN A 1 494 ? 18.106  87.467  81.963  1.00 60.33  ? 491 GLN A C   1 
ATOM 3501  O O   . GLN A 1 494 ? 17.909  86.542  82.747  1.00 60.34  ? 491 GLN A O   1 
ATOM 3502  C CB  . GLN A 1 494 ? 20.336  88.696  82.064  1.00 31.14  ? 491 GLN A CB  1 
ATOM 3503  N N   . GLU A 1 495 ? 17.154  88.323  81.606  1.00 60.35  ? 492 GLU A N   1 
ATOM 3504  C CA  . GLU A 1 495 ? 15.785  88.233  82.123  1.00 62.13  ? 492 GLU A CA  1 
ATOM 3505  C C   . GLU A 1 495 ? 15.036  86.977  81.658  1.00 53.57  ? 492 GLU A C   1 
ATOM 3506  O O   . GLU A 1 495 ? 14.404  86.294  82.450  1.00 55.17  ? 492 GLU A O   1 
ATOM 3507  C CB  . GLU A 1 495 ? 14.989  89.497  81.757  1.00 32.00  ? 492 GLU A CB  1 
ATOM 3508  C CG  . GLU A 1 495 ? 13.518  89.451  82.123  1.00 73.39  ? 492 GLU A CG  1 
ATOM 3509  C CD  . GLU A 1 495 ? 12.720  90.633  81.563  1.00 95.09  ? 492 GLU A CD  1 
ATOM 3510  O OE1 . GLU A 1 495 ? 13.258  91.388  80.718  1.00 60.18  ? 492 GLU A OE1 1 
ATOM 3511  O OE2 . GLU A 1 495 ? 11.545  90.805  81.971  1.00 85.80  ? 492 GLU A OE2 1 
ATOM 3512  N N   . ALA A 1 496 ? 15.095  86.687  80.365  1.00 57.76  ? 493 ALA A N   1 
ATOM 3513  C CA  . ALA A 1 496 ? 14.397  85.537  79.807  1.00 41.15  ? 493 ALA A CA  1 
ATOM 3514  C C   . ALA A 1 496 ? 15.000  84.237  80.303  1.00 50.35  ? 493 ALA A C   1 
ATOM 3515  O O   . ALA A 1 496 ? 14.296  83.251  80.508  1.00 61.63  ? 493 ALA A O   1 
ATOM 3516  C CB  . ALA A 1 496 ? 14.451  85.586  78.301  1.00 52.30  ? 493 ALA A CB  1 
ATOM 3517  N N   . THR A 1 497 ? 16.315  84.239  80.475  1.00 42.77  ? 494 THR A N   1 
ATOM 3518  C CA  . THR A 1 497 ? 17.022  83.123  81.070  1.00 33.47  ? 494 THR A CA  1 
ATOM 3519  C C   . THR A 1 497 ? 16.451  82.746  82.448  1.00 52.59  ? 494 THR A C   1 
ATOM 3520  O O   . THR A 1 497 ? 16.251  81.568  82.727  1.00 43.44  ? 494 THR A O   1 
ATOM 3521  C CB  . THR A 1 497 ? 18.510  83.429  81.238  1.00 38.07  ? 494 THR A CB  1 
ATOM 3522  O OG1 . THR A 1 497 ? 19.102  83.629  79.958  1.00 44.33  ? 494 THR A OG1 1 
ATOM 3523  C CG2 . THR A 1 497 ? 19.206  82.291  81.922  1.00 21.36  ? 494 THR A CG2 1 
ATOM 3524  N N   . LYS A 1 498 ? 16.206  83.745  83.298  1.00 40.30  ? 495 LYS A N   1 
ATOM 3525  C CA  . LYS A 1 498 ? 15.551  83.543  84.590  1.00 34.71  ? 495 LYS A CA  1 
ATOM 3526  C C   . LYS A 1 498 ? 14.123  83.063  84.420  1.00 34.44  ? 495 LYS A C   1 
ATOM 3527  O O   . LYS A 1 498 ? 13.763  82.017  84.936  1.00 44.23  ? 495 LYS A O   1 
ATOM 3528  C CB  . LYS A 1 498 ? 15.585  84.823  85.438  1.00 41.02  ? 495 LYS A CB  1 
ATOM 3529  N N   . VAL A 1 499 ? 13.304  83.809  83.679  1.00 45.44  ? 496 VAL A N   1 
ATOM 3530  C CA  . VAL A 1 499 ? 11.891  83.434  83.481  1.00 30.63  ? 496 VAL A CA  1 
ATOM 3531  C C   . VAL A 1 499 ? 11.665  82.017  82.913  1.00 52.18  ? 496 VAL A C   1 
ATOM 3532  O O   . VAL A 1 499 ? 10.727  81.314  83.299  1.00 46.66  ? 496 VAL A O   1 
ATOM 3533  C CB  . VAL A 1 499 ? 11.157  84.476  82.636  1.00 38.96  ? 496 VAL A CB  1 
ATOM 3534  C CG1 . VAL A 1 499 ? 9.755   83.991  82.277  1.00 33.46  ? 496 VAL A CG1 1 
ATOM 3535  C CG2 . VAL A 1 499 ? 11.094  85.788  83.382  1.00 30.98  ? 496 VAL A CG2 1 
ATOM 3536  N N   . LEU A 1 500 ? 12.546  81.603  82.010  1.00 40.65  ? 497 LEU A N   1 
ATOM 3537  C CA  . LEU A 1 500 ? 12.377  80.365  81.279  1.00 47.92  ? 497 LEU A CA  1 
ATOM 3538  C C   . LEU A 1 500 ? 13.210  79.213  81.843  1.00 36.96  ? 497 LEU A C   1 
ATOM 3539  O O   . LEU A 1 500 ? 13.319  78.165  81.242  1.00 36.41  ? 497 LEU A O   1 
ATOM 3540  C CB  . LEU A 1 500 ? 12.720  80.596  79.807  1.00 41.08  ? 497 LEU A CB  1 
ATOM 3541  C CG  . LEU A 1 500 ? 11.832  81.618  79.119  1.00 36.38  ? 497 LEU A CG  1 
ATOM 3542  C CD1 . LEU A 1 500 ? 12.324  81.920  77.720  1.00 38.51  ? 497 LEU A CD1 1 
ATOM 3543  C CD2 . LEU A 1 500 ? 10.408  81.119  79.094  1.00 39.18  ? 497 LEU A CD2 1 
ATOM 3544  N N   . ARG A 1 501 ? 13.789  79.426  83.002  1.00 32.68  ? 498 ARG A N   1 
ATOM 3545  C CA  . ARG A 1 501 ? 14.639  78.457  83.674  1.00 38.83  ? 498 ARG A CA  1 
ATOM 3546  C C   . ARG A 1 501 ? 14.141  77.008  83.620  1.00 24.48  ? 498 ARG A C   1 
ATOM 3547  O O   . ARG A 1 501 ? 14.917  76.079  83.438  1.00 29.33  ? 498 ARG A O   1 
ATOM 3548  C CB  . ARG A 1 501 ? 14.820  78.924  85.118  1.00 35.63  ? 498 ARG A CB  1 
ATOM 3549  C CG  . ARG A 1 501 ? 15.659  78.065  85.931  1.00 53.11  ? 498 ARG A CG  1 
ATOM 3550  C CD  . ARG A 1 501 ? 15.807  78.568  87.381  1.00 36.45  ? 498 ARG A CD  1 
ATOM 3551  N NE  . ARG A 1 501 ? 16.994  77.847  87.648  1.00 48.50  ? 498 ARG A NE  1 
ATOM 3552  C CZ  . ARG A 1 501 ? 18.099  78.101  88.300  1.00 39.11  ? 498 ARG A CZ  1 
ATOM 3553  N NH1 . ARG A 1 501 ? 18.279  78.974  89.237  1.00 81.58  ? 498 ARG A NH1 1 
ATOM 3554  N NH2 . ARG A 1 501 ? 19.016  77.228  88.123  1.00 87.70  ? 498 ARG A NH2 1 
ATOM 3555  N N   . ASN A 1 502 ? 12.843  76.810  83.763  1.00 34.32  ? 499 ASN A N   1 
ATOM 3556  C CA  . ASN A 1 502 ? 12.294  75.461  83.713  1.00 40.16  ? 499 ASN A CA  1 
ATOM 3557  C C   . ASN A 1 502 ? 11.481  75.155  82.458  1.00 44.14  ? 499 ASN A C   1 
ATOM 3558  O O   . ASN A 1 502 ? 10.880  74.092  82.364  1.00 40.92  ? 499 ASN A O   1 
ATOM 3559  C CB  . ASN A 1 502 ? 11.454  75.166  84.959  1.00 28.99  ? 499 ASN A CB  1 
ATOM 3560  C CG  . ASN A 1 502 ? 12.303  74.734  86.144  1.00 49.02  ? 499 ASN A CG  1 
ATOM 3561  O OD1 . ASN A 1 502 ? 12.394  75.450  87.134  1.00 47.53  ? 499 ASN A OD1 1 
ATOM 3562  N ND2 . ASN A 1 502 ? 12.930  73.558  86.044  1.00 43.16  ? 499 ASN A ND2 1 
ATOM 3563  N N   . ALA A 1 503 ? 11.456  76.079  81.503  1.00 39.45  ? 500 ALA A N   1 
ATOM 3564  C CA  . ALA A 1 503 ? 10.723  75.841  80.265  1.00 50.67  ? 500 ALA A CA  1 
ATOM 3565  C C   . ALA A 1 503 ? 11.568  75.063  79.256  1.00 43.18  ? 500 ALA A C   1 
ATOM 3566  O O   . ALA A 1 503 ? 11.062  74.590  78.238  1.00 61.42  ? 500 ALA A O   1 
ATOM 3567  C CB  . ALA A 1 503 ? 10.245  77.143  79.681  1.00 36.56  ? 500 ALA A CB  1 
ATOM 3568  N N   . ALA A 1 504 ? 12.856  74.926  79.548  1.00 36.83  ? 501 ALA A N   1 
ATOM 3569  C CA  . ALA A 1 504 ? 13.749  74.228  78.640  1.00 48.29  ? 501 ALA A CA  1 
ATOM 3570  C C   . ALA A 1 504 ? 14.990  73.669  79.333  1.00 42.18  ? 501 ALA A C   1 
ATOM 3571  O O   . ALA A 1 504 ? 15.762  74.414  79.920  1.00 47.63  ? 501 ALA A O   1 
ATOM 3572  C CB  . ALA A 1 504 ? 14.149  75.156  77.490  1.00 24.94  ? 501 ALA A CB  1 
ATOM 3573  N N   . GLY A 1 505 ? 15.169  72.355  79.252  1.00 34.07  ? 502 GLY A N   1 
ATOM 3574  C CA  . GLY A 1 505 ? 16.371  71.689  79.730  1.00 26.58  ? 502 GLY A CA  1 
ATOM 3575  C C   . GLY A 1 505 ? 17.584  71.982  78.860  1.00 40.76  ? 502 GLY A C   1 
ATOM 3576  O O   . GLY A 1 505 ? 18.704  71.946  79.325  1.00 39.18  ? 502 GLY A O   1 
ATOM 3577  N N   . ASN A 1 506 ? 17.363  72.238  77.577  1.00 32.21  ? 503 ASN A N   1 
ATOM 3578  C CA  . ASN A 1 506 ? 18.408  72.771  76.712  1.00 34.28  ? 503 ASN A CA  1 
ATOM 3579  C C   . ASN A 1 506 ? 17.961  74.119  76.185  1.00 35.26  ? 503 ASN A C   1 
ATOM 3580  O O   . ASN A 1 506 ? 16.962  74.243  75.483  1.00 42.76  ? 503 ASN A O   1 
ATOM 3581  C CB  . ASN A 1 506 ? 18.734  71.812  75.579  1.00 24.23  ? 503 ASN A CB  1 
ATOM 3582  C CG  . ASN A 1 506 ? 19.616  70.677  76.032  1.00 31.46  ? 503 ASN A CG  1 
ATOM 3583  O OD1 . ASN A 1 506 ? 19.138  69.708  76.599  1.00 34.87  ? 503 ASN A OD1 1 
ATOM 3584  N ND2 . ASN A 1 506 ? 20.913  70.792  75.789  1.00 36.27  ? 503 ASN A ND2 1 
ATOM 3585  N N   . PHE A 1 507 ? 18.691  75.141  76.578  1.00 36.82  ? 504 PHE A N   1 
ATOM 3586  C CA  . PHE A 1 507 ? 18.270  76.506  76.351  1.00 35.35  ? 504 PHE A CA  1 
ATOM 3587  C C   . PHE A 1 507 ? 19.326  77.132  75.483  1.00 47.70  ? 504 PHE A C   1 
ATOM 3588  O O   . PHE A 1 507 ? 20.512  76.966  75.727  1.00 38.42  ? 504 PHE A O   1 
ATOM 3589  C CB  . PHE A 1 507 ? 18.150  77.245  77.687  1.00 32.48  ? 504 PHE A CB  1 
ATOM 3590  C CG  . PHE A 1 507 ? 17.585  78.625  77.574  1.00 34.63  ? 504 PHE A CG  1 
ATOM 3591  C CD1 . PHE A 1 507 ? 16.284  78.826  77.127  1.00 21.53  ? 504 PHE A CD1 1 
ATOM 3592  C CD2 . PHE A 1 507 ? 18.346  79.727  77.940  1.00 36.45  ? 504 PHE A CD2 1 
ATOM 3593  C CE1 . PHE A 1 507 ? 15.757  80.107  77.010  1.00 29.86  ? 504 PHE A CE1 1 
ATOM 3594  C CE2 . PHE A 1 507 ? 17.833  81.009  77.843  1.00 33.02  ? 504 PHE A CE2 1 
ATOM 3595  C CZ  . PHE A 1 507 ? 16.528  81.204  77.375  1.00 30.84  ? 504 PHE A CZ  1 
ATOM 3596  N N   . TYR A 1 508 ? 18.896  77.841  74.454  1.00 32.05  ? 505 TYR A N   1 
ATOM 3597  C CA  . TYR A 1 508 ? 19.824  78.382  73.480  1.00 36.57  ? 505 TYR A CA  1 
ATOM 3598  C C   . TYR A 1 508 ? 19.664  79.889  73.357  1.00 37.28  ? 505 TYR A C   1 
ATOM 3599  O O   . TYR A 1 508 ? 18.551  80.405  73.287  1.00 41.39  ? 505 TYR A O   1 
ATOM 3600  C CB  . TYR A 1 508 ? 19.599  77.696  72.125  1.00 30.91  ? 505 TYR A CB  1 
ATOM 3601  C CG  . TYR A 1 508 ? 19.853  76.197  72.135  1.00 30.96  ? 505 TYR A CG  1 
ATOM 3602  C CD1 . TYR A 1 508 ? 18.833  75.301  72.455  1.00 23.66  ? 505 TYR A CD1 1 
ATOM 3603  C CD2 . TYR A 1 508 ? 21.107  75.675  71.837  1.00 31.90  ? 505 TYR A CD2 1 
ATOM 3604  C CE1 . TYR A 1 508 ? 19.052  73.933  72.457  1.00 30.33  ? 505 TYR A CE1 1 
ATOM 3605  C CE2 . TYR A 1 508 ? 21.330  74.293  71.832  1.00 28.79  ? 505 TYR A CE2 1 
ATOM 3606  C CZ  . TYR A 1 508 ? 20.295  73.429  72.140  1.00 31.04  ? 505 TYR A CZ  1 
ATOM 3607  O OH  . TYR A 1 508 ? 20.484  72.065  72.147  1.00 49.89  ? 505 TYR A OH  1 
ATOM 3608  N N   . ILE A 1 509 ? 20.783  80.599  73.359  1.00 34.60  ? 506 ILE A N   1 
ATOM 3609  C CA  . ILE A 1 509 ? 20.753  82.061  73.223  1.00 46.08  ? 506 ILE A CA  1 
ATOM 3610  C C   . ILE A 1 509 ? 21.333  82.483  71.871  1.00 56.45  ? 506 ILE A C   1 
ATOM 3611  O O   . ILE A 1 509 ? 22.518  82.295  71.589  1.00 36.98  ? 506 ILE A O   1 
ATOM 3612  C CB  . ILE A 1 509 ? 21.490  82.755  74.381  1.00 48.49  ? 506 ILE A CB  1 
ATOM 3613  C CG1 . ILE A 1 509 ? 20.783  82.450  75.707  1.00 43.94  ? 506 ILE A CG1 1 
ATOM 3614  C CG2 . ILE A 1 509 ? 21.594  84.269  74.155  1.00 36.16  ? 506 ILE A CG2 1 
ATOM 3615  C CD1 . ILE A 1 509 ? 21.616  82.817  76.914  1.00 43.59  ? 506 ILE A CD1 1 
ATOM 3616  N N   . ASN A 1 510 ? 20.478  83.033  71.022  1.00 32.75  ? 507 ASN A N   1 
ATOM 3617  C CA  . ASN A 1 510 ? 20.855  83.297  69.633  1.00 51.85  ? 507 ASN A CA  1 
ATOM 3618  C C   . ASN A 1 510 ? 21.378  82.061  68.895  1.00 51.89  ? 507 ASN A C   1 
ATOM 3619  O O   . ASN A 1 510 ? 22.390  82.120  68.213  1.00 30.80  ? 507 ASN A O   1 
ATOM 3620  C CB  . ASN A 1 510 ? 21.846  84.452  69.545  1.00 28.26  ? 507 ASN A CB  1 
ATOM 3621  C CG  . ASN A 1 510 ? 21.270  85.748  70.106  1.00 53.80  ? 507 ASN A CG  1 
ATOM 3622  O OD1 . ASN A 1 510 ? 20.148  86.139  69.787  1.00 47.22  ? 507 ASN A OD1 1 
ATOM 3623  N ND2 . ASN A 1 510 ? 22.025  86.396  70.967  1.00 38.54  ? 507 ASN A ND2 1 
ATOM 3624  N N   . ASP A 1 511 ? 20.693  80.932  69.062  1.00 38.33  ? 508 ASP A N   1 
ATOM 3625  C CA  . ASP A 1 511 ? 20.940  79.771  68.224  1.00 40.56  ? 508 ASP A CA  1 
ATOM 3626  C C   . ASP A 1 511 ? 19.677  78.925  68.133  1.00 37.62  ? 508 ASP A C   1 
ATOM 3627  O O   . ASP A 1 511 ? 18.747  79.112  68.909  1.00 52.30  ? 508 ASP A O   1 
ATOM 3628  C CB  . ASP A 1 511 ? 22.121  78.945  68.724  1.00 47.71  ? 508 ASP A CB  1 
ATOM 3629  C CG  . ASP A 1 511 ? 22.884  78.283  67.594  1.00 58.29  ? 508 ASP A CG  1 
ATOM 3630  O OD1 . ASP A 1 511 ? 22.258  77.930  66.575  1.00 57.09  ? 508 ASP A OD1 1 
ATOM 3631  O OD2 . ASP A 1 511 ? 24.111  78.117  67.713  1.00 58.82  ? 508 ASP A OD2 1 
ATOM 3632  N N   . LYS A 1 512 ? 19.638  78.023  67.160  1.00 36.33  ? 509 LYS A N   1 
ATOM 3633  C CA  . LYS A 1 512 ? 18.479  77.174  66.948  1.00 52.56  ? 509 LYS A CA  1 
ATOM 3634  C C   . LYS A 1 512 ? 18.343  76.181  68.102  1.00 50.19  ? 509 LYS A C   1 
ATOM 3635  O O   . LYS A 1 512 ? 19.311  75.890  68.805  1.00 59.68  ? 509 LYS A O   1 
ATOM 3636  C CB  . LYS A 1 512 ? 18.555  76.468  65.580  1.00 40.08  ? 509 LYS A CB  1 
ATOM 3637  C CG  . LYS A 1 512 ? 19.799  75.636  65.364  1.00 30.77  ? 509 LYS A CG  1 
ATOM 3638  C CD  . LYS A 1 512 ? 19.711  74.865  64.058  1.00 53.20  ? 509 LYS A CD  1 
ATOM 3639  C CE  . LYS A 1 512 ? 20.950  74.024  63.799  1.00 31.43  ? 509 LYS A CE  1 
ATOM 3640  N NZ  . LYS A 1 512 ? 20.956  72.781  64.579  1.00 49.24  ? 509 LYS A NZ  1 
ATOM 3641  N N   . SER A 1 513 ? 17.136  75.666  68.291  1.00 36.98  ? 510 SER A N   1 
ATOM 3642  C CA  . SER A 1 513 ? 16.828  74.809  69.431  1.00 41.49  ? 510 SER A CA  1 
ATOM 3643  C C   . SER A 1 513 ? 17.167  73.333  69.204  1.00 36.06  ? 510 SER A C   1 
ATOM 3644  O O   . SER A 1 513 ? 16.856  72.486  70.038  1.00 47.03  ? 510 SER A O   1 
ATOM 3645  C CB  . SER A 1 513 ? 15.359  74.967  69.814  1.00 36.45  ? 510 SER A CB  1 
ATOM 3646  O OG  . SER A 1 513 ? 14.532  74.386  68.828  1.00 38.34  ? 510 SER A OG  1 
ATOM 3647  N N   . THR A 1 514 ? 17.812  73.039  68.075  1.00 48.26  ? 511 THR A N   1 
ATOM 3648  C CA  . THR A 1 514 ? 18.245  71.678  67.737  1.00 35.45  ? 511 THR A CA  1 
ATOM 3649  C C   . THR A 1 514 ? 19.773  71.557  67.759  1.00 42.39  ? 511 THR A C   1 
ATOM 3650  O O   . THR A 1 514 ? 20.484  72.545  67.937  1.00 49.91  ? 511 THR A O   1 
ATOM 3651  C CB  . THR A 1 514 ? 17.720  71.207  66.341  1.00 44.31  ? 511 THR A CB  1 
ATOM 3652  O OG1 . THR A 1 514 ? 18.069  72.161  65.326  1.00 44.56  ? 511 THR A OG1 1 
ATOM 3653  C CG2 . THR A 1 514 ? 16.201  70.982  66.333  1.00 17.90  ? 511 THR A CG2 1 
ATOM 3654  N N   . GLY A 1 515 ? 20.273  70.335  67.603  1.00 41.86  ? 512 GLY A N   1 
ATOM 3655  C CA  . GLY A 1 515 ? 21.696  70.126  67.379  1.00 61.01  ? 512 GLY A CA  1 
ATOM 3656  C C   . GLY A 1 515 ? 22.563  70.116  68.615  1.00 65.59  ? 512 GLY A C   1 
ATOM 3657  O O   . GLY A 1 515 ? 23.580  70.813  68.706  1.00 76.02  ? 512 GLY A O   1 
ATOM 3658  N N   . SER A 1 516 ? 22.154  69.320  69.588  1.00 47.74  ? 513 SER A N   1 
ATOM 3659  C CA  . SER A 1 516 ? 22.955  69.167  70.775  1.00 53.34  ? 513 SER A CA  1 
ATOM 3660  C C   . SER A 1 516 ? 24.143  68.285  70.411  1.00 57.87  ? 513 SER A C   1 
ATOM 3661  O O   . SER A 1 516 ? 23.994  67.239  69.793  1.00 57.87  ? 513 SER A O   1 
ATOM 3662  C CB  . SER A 1 516 ? 22.128  68.553  71.901  1.00 36.74  ? 513 SER A CB  1 
ATOM 3663  O OG  . SER A 1 516 ? 21.785  67.209  71.615  1.00 59.24  ? 513 SER A OG  1 
ATOM 3664  N N   . ILE A 1 517 ? 25.331  68.728  70.777  1.00 43.43  ? 514 ILE A N   1 
ATOM 3665  C CA  . ILE A 1 517 ? 26.534  67.963  70.538  1.00 41.18  ? 514 ILE A CA  1 
ATOM 3666  C C   . ILE A 1 517 ? 27.024  67.329  71.845  1.00 62.62  ? 514 ILE A C   1 
ATOM 3667  O O   . ILE A 1 517 ? 27.073  67.996  72.883  1.00 39.39  ? 514 ILE A O   1 
ATOM 3668  C CB  . ILE A 1 517 ? 27.612  68.871  69.951  1.00 45.05  ? 514 ILE A CB  1 
ATOM 3669  C CG1 . ILE A 1 517 ? 27.171  69.349  68.565  1.00 46.73  ? 514 ILE A CG1 1 
ATOM 3670  C CG2 . ILE A 1 517 ? 28.983  68.162  69.878  1.00 26.78  ? 514 ILE A CG2 1 
ATOM 3671  C CD1 . ILE A 1 517 ? 27.954  70.551  68.074  1.00 37.09  ? 514 ILE A CD1 1 
ATOM 3672  N N   . VAL A 1 518 ? 27.382  66.045  71.793  1.00 41.22  ? 515 VAL A N   1 
ATOM 3673  C CA  . VAL A 1 518 ? 27.843  65.318  72.978  1.00 43.78  ? 515 VAL A CA  1 
ATOM 3674  C C   . VAL A 1 518 ? 29.033  65.996  73.648  1.00 49.94  ? 515 VAL A C   1 
ATOM 3675  O O   . VAL A 1 518 ? 29.961  66.456  72.991  1.00 54.48  ? 515 VAL A O   1 
ATOM 3676  C CB  . VAL A 1 518 ? 28.180  63.843  72.668  1.00 43.17  ? 515 VAL A CB  1 
ATOM 3677  C CG1 . VAL A 1 518 ? 28.893  63.201  73.845  1.00 44.17  ? 515 VAL A CG1 1 
ATOM 3678  C CG2 . VAL A 1 518 ? 26.914  63.080  72.322  1.00 34.53  ? 515 VAL A CG2 1 
ATOM 3679  N N   . GLY A 1 519 ? 28.984  66.074  74.967  1.00 46.02  ? 516 GLY A N   1 
ATOM 3680  C CA  . GLY A 1 519 ? 30.039  66.715  75.729  1.00 37.20  ? 516 GLY A CA  1 
ATOM 3681  C C   . GLY A 1 519 ? 29.986  68.228  75.699  1.00 55.96  ? 516 GLY A C   1 
ATOM 3682  O O   . GLY A 1 519 ? 30.759  68.877  76.385  1.00 35.81  ? 516 GLY A O   1 
ATOM 3683  N N   . GLN A 1 520 ? 29.085  68.791  74.897  1.00 47.87  ? 517 GLN A N   1 
ATOM 3684  C CA  . GLN A 1 520 ? 28.955  70.243  74.793  1.00 47.65  ? 517 GLN A CA  1 
ATOM 3685  C C   . GLN A 1 520 ? 27.569  70.722  75.238  1.00 43.07  ? 517 GLN A C   1 
ATOM 3686  O O   . GLN A 1 520 ? 27.457  71.649  76.024  1.00 51.29  ? 517 GLN A O   1 
ATOM 3687  C CB  . GLN A 1 520 ? 29.277  70.718  73.376  1.00 47.05  ? 517 GLN A CB  1 
ATOM 3688  C CG  . GLN A 1 520 ? 30.743  70.636  73.030  1.00 50.20  ? 517 GLN A CG  1 
ATOM 3689  C CD  . GLN A 1 520 ? 31.022  70.932  71.559  1.00 67.85  ? 517 GLN A CD  1 
ATOM 3690  O OE1 . GLN A 1 520 ? 30.385  71.793  70.948  1.00 54.60  ? 517 GLN A OE1 1 
ATOM 3691  N NE2 . GLN A 1 520 ? 31.976  70.206  70.986  1.00 36.98  ? 517 GLN A NE2 1 
ATOM 3692  N N   . GLN A 1 521 ? 26.517  70.091  74.727  1.00 48.76  ? 518 GLN A N   1 
ATOM 3693  C CA  . GLN A 1 521 ? 25.178  70.286  75.264  1.00 47.45  ? 518 GLN A CA  1 
ATOM 3694  C C   . GLN A 1 521 ? 24.583  68.944  75.631  1.00 58.50  ? 518 GLN A C   1 
ATOM 3695  O O   . GLN A 1 521 ? 23.911  68.339  74.813  1.00 28.81  ? 518 GLN A O   1 
ATOM 3696  C CB  . GLN A 1 521 ? 24.265  70.995  74.268  1.00 41.15  ? 518 GLN A CB  1 
ATOM 3697  C CG  . GLN A 1 521 ? 24.776  72.343  73.807  1.00 37.51  ? 518 GLN A CG  1 
ATOM 3698  C CD  . GLN A 1 521 ? 25.755  72.233  72.628  1.00 41.36  ? 518 GLN A CD  1 
ATOM 3699  O OE1 . GLN A 1 521 ? 25.673  71.305  71.841  1.00 33.53  ? 518 GLN A OE1 1 
ATOM 3700  N NE2 . GLN A 1 521 ? 26.694  73.167  72.530  1.00 30.53  ? 518 GLN A NE2 1 
ATOM 3701  N N   . PRO A 1 522 ? 24.863  68.457  76.856  1.00 60.48  ? 519 PRO A N   1 
ATOM 3702  C CA  . PRO A 1 522 ? 24.177  67.273  77.393  1.00 50.99  ? 519 PRO A CA  1 
ATOM 3703  C C   . PRO A 1 522 ? 22.675  67.485  77.271  1.00 48.58  ? 519 PRO A C   1 
ATOM 3704  O O   . PRO A 1 522 ? 22.199  68.582  77.488  1.00 35.15  ? 519 PRO A O   1 
ATOM 3705  C CB  . PRO A 1 522 ? 24.614  67.256  78.856  1.00 54.37  ? 519 PRO A CB  1 
ATOM 3706  C CG  . PRO A 1 522 ? 25.984  67.888  78.822  1.00 42.92  ? 519 PRO A CG  1 
ATOM 3707  C CD  . PRO A 1 522 ? 25.884  68.974  77.785  1.00 50.31  ? 519 PRO A CD  1 
ATOM 3708  N N   . PHE A 1 523 ? 21.929  66.463  76.905  1.00 41.64  ? 520 PHE A N   1 
ATOM 3709  C CA  . PHE A 1 523 ? 20.604  66.725  76.384  1.00 53.80  ? 520 PHE A CA  1 
ATOM 3710  C C   . PHE A 1 523 ? 19.488  66.098  77.213  1.00 52.99  ? 520 PHE A C   1 
ATOM 3711  O O   . PHE A 1 523 ? 19.591  64.971  77.680  1.00 45.70  ? 520 PHE A O   1 
ATOM 3712  C CB  . PHE A 1 523 ? 20.529  66.293  74.915  1.00 23.11  ? 520 PHE A CB  1 
ATOM 3713  C CG  . PHE A 1 523 ? 19.180  66.490  74.284  1.00 45.95  ? 520 PHE A CG  1 
ATOM 3714  C CD1 . PHE A 1 523 ? 18.257  65.443  74.247  1.00 23.60  ? 520 PHE A CD1 1 
ATOM 3715  C CD2 . PHE A 1 523 ? 18.830  67.719  73.709  1.00 20.25  ? 520 PHE A CD2 1 
ATOM 3716  C CE1 . PHE A 1 523 ? 16.999  65.630  73.649  1.00 47.58  ? 520 PHE A CE1 1 
ATOM 3717  C CE2 . PHE A 1 523 ? 17.583  67.908  73.112  1.00 32.02  ? 520 PHE A CE2 1 
ATOM 3718  C CZ  . PHE A 1 523 ? 16.668  66.871  73.079  1.00 50.54  ? 520 PHE A CZ  1 
ATOM 3719  N N   . GLY A 1 524 ? 18.413  66.858  77.382  1.00 43.00  ? 521 GLY A N   1 
ATOM 3720  C CA  . GLY A 1 524 ? 17.214  66.362  78.027  1.00 26.54  ? 521 GLY A CA  1 
ATOM 3721  C C   . GLY A 1 524 ? 16.548  67.463  78.821  1.00 43.93  ? 521 GLY A C   1 
ATOM 3722  O O   . GLY A 1 524 ? 17.136  68.507  79.079  1.00 33.74  ? 521 GLY A O   1 
ATOM 3723  N N   . GLY A 1 525 ? 15.310  67.230  79.220  1.00 31.60  ? 522 GLY A N   1 
ATOM 3724  C CA  . GLY A 1 525 ? 14.585  68.213  79.979  1.00 26.50  ? 522 GLY A CA  1 
ATOM 3725  C C   . GLY A 1 525 ? 13.534  67.618  80.884  1.00 37.87  ? 522 GLY A C   1 
ATOM 3726  O O   . GLY A 1 525 ? 13.196  66.455  80.770  1.00 34.59  ? 522 GLY A O   1 
ATOM 3727  N N   . ALA A 1 526 ? 12.993  68.431  81.780  1.00 36.24  ? 523 ALA A N   1 
ATOM 3728  C CA  . ALA A 1 526 ? 12.057  67.905  82.751  1.00 31.35  ? 523 ALA A CA  1 
ATOM 3729  C C   . ALA A 1 526 ? 10.621  68.192  82.328  1.00 43.53  ? 523 ALA A C   1 
ATOM 3730  O O   . ALA A 1 526 ? 10.301  68.093  81.144  1.00 44.35  ? 523 ALA A O   1 
ATOM 3731  C CB  . ALA A 1 526 ? 12.370  68.437  84.158  1.00 23.53  ? 523 ALA A CB  1 
ATOM 3732  N N   . ARG A 1 527 ? 9.769   68.546  83.291  1.00 48.52  ? 524 ARG A N   1 
ATOM 3733  C CA  . ARG A 1 527 ? 8.320   68.545  83.081  1.00 33.14  ? 524 ARG A CA  1 
ATOM 3734  C C   . ARG A 1 527 ? 7.883   67.260  82.375  1.00 45.51  ? 524 ARG A C   1 
ATOM 3735  O O   . ARG A 1 527 ? 8.373   66.191  82.705  1.00 40.31  ? 524 ARG A O   1 
ATOM 3736  C CB  . ARG A 1 527 ? 7.864   69.794  82.344  1.00 39.51  ? 524 ARG A CB  1 
ATOM 3737  C CG  . ARG A 1 527 ? 7.839   70.996  83.248  1.00 27.75  ? 524 ARG A CG  1 
ATOM 3738  C CD  . ARG A 1 527 ? 7.754   72.243  82.488  1.00 30.65  ? 524 ARG A CD  1 
ATOM 3739  N NE  . ARG A 1 527 ? 8.073   73.415  83.254  1.00 37.37  ? 524 ARG A NE  1 
ATOM 3740  C CZ  . ARG A 1 527 ? 7.610   74.646  83.064  1.00 60.53  ? 524 ARG A CZ  1 
ATOM 3741  N NH1 . ARG A 1 527 ? 6.719   74.937  82.115  1.00 68.96  ? 524 ARG A NH1 1 
ATOM 3742  N NH2 . ARG A 1 527 ? 8.049   75.589  83.886  1.00 27.98  ? 524 ARG A NH2 1 
ATOM 3743  N N   . ALA A 1 528 ? 6.975   67.345  81.412  1.00 26.53  ? 525 ALA A N   1 
ATOM 3744  C CA  . ALA A 1 528 ? 6.498   66.133  80.745  1.00 36.36  ? 525 ALA A CA  1 
ATOM 3745  C C   . ALA A 1 528 ? 7.499   65.539  79.758  1.00 43.35  ? 525 ALA A C   1 
ATOM 3746  O O   . ALA A 1 528 ? 7.265   64.466  79.227  1.00 43.33  ? 525 ALA A O   1 
ATOM 3747  C CB  . ALA A 1 528 ? 5.198   66.394  80.055  1.00 30.48  ? 525 ALA A CB  1 
ATOM 3748  N N   . SER A 1 529 ? 8.609   66.234  79.523  1.00 40.96  ? 526 SER A N   1 
ATOM 3749  C CA  . SER A 1 529 ? 9.600   65.791  78.537  1.00 47.35  ? 526 SER A CA  1 
ATOM 3750  C C   . SER A 1 529 ? 10.497  64.645  79.019  1.00 56.87  ? 526 SER A C   1 
ATOM 3751  O O   . SER A 1 529 ? 11.328  64.155  78.265  1.00 43.62  ? 526 SER A O   1 
ATOM 3752  C CB  . SER A 1 529 ? 10.467  66.968  78.053  1.00 34.16  ? 526 SER A CB  1 
ATOM 3753  O OG  . SER A 1 529 ? 9.699   67.937  77.363  1.00 36.26  ? 526 SER A OG  1 
ATOM 3754  N N   . GLY A 1 530 ? 10.353  64.231  80.274  1.00 47.03  ? 527 GLY A N   1 
ATOM 3755  C CA  . GLY A 1 530 ? 11.083  63.067  80.756  1.00 47.43  ? 527 GLY A CA  1 
ATOM 3756  C C   . GLY A 1 530 ? 11.791  63.178  82.086  1.00 44.69  ? 527 GLY A C   1 
ATOM 3757  O O   . GLY A 1 530 ? 11.546  64.094  82.869  1.00 41.60  ? 527 GLY A O   1 
ATOM 3758  N N   . THR A 1 531 ? 12.683  62.232  82.342  1.00 33.97  ? 528 THR A N   1 
ATOM 3759  C CA  . THR A 1 531 ? 13.354  62.173  83.641  1.00 39.02  ? 528 THR A CA  1 
ATOM 3760  C C   . THR A 1 531 ? 14.631  63.024  83.701  1.00 45.74  ? 528 THR A C   1 
ATOM 3761  O O   . THR A 1 531 ? 15.231  63.180  84.769  1.00 30.78  ? 528 THR A O   1 
ATOM 3762  C CB  . THR A 1 531 ? 13.672  60.719  84.048  1.00 41.28  ? 528 THR A CB  1 
ATOM 3763  O OG1 . THR A 1 531 ? 14.374  60.088  82.980  1.00 31.43  ? 528 THR A OG1 1 
ATOM 3764  C CG2 . THR A 1 531 ? 12.395  59.923  84.356  1.00 27.25  ? 528 THR A CG2 1 
ATOM 3765  N N   . ASN A 1 532 ? 15.028  63.580  82.556  1.00 38.86  ? 529 ASN A N   1 
ATOM 3766  C CA  . ASN A 1 532 ? 16.201  64.468  82.454  1.00 26.89  ? 529 ASN A CA  1 
ATOM 3767  C C   . ASN A 1 532 ? 17.484  63.900  83.075  1.00 31.29  ? 529 ASN A C   1 
ATOM 3768  O O   . ASN A 1 532 ? 18.070  64.493  83.967  1.00 42.37  ? 529 ASN A O   1 
ATOM 3769  C CB  . ASN A 1 532 ? 15.912  65.830  83.064  1.00 30.79  ? 529 ASN A CB  1 
ATOM 3770  C CG  . ASN A 1 532 ? 16.953  66.837  82.714  1.00 48.92  ? 529 ASN A CG  1 
ATOM 3771  O OD1 . ASN A 1 532 ? 17.697  66.676  81.743  1.00 53.20  ? 529 ASN A OD1 1 
ATOM 3772  N ND2 . ASN A 1 532 ? 17.012  67.903  83.491  1.00 49.64  ? 529 ASN A ND2 1 
ATOM 3773  N N   . ASP A 1 533 ? 17.912  62.755  82.575  1.00 35.21  ? 530 ASP A N   1 
ATOM 3774  C CA  . ASP A 1 533 ? 19.171  62.166  82.984  1.00 32.38  ? 530 ASP A CA  1 
ATOM 3775  C C   . ASP A 1 533 ? 20.388  62.687  82.202  1.00 42.07  ? 530 ASP A C   1 
ATOM 3776  O O   . ASP A 1 533 ? 21.522  62.314  82.514  1.00 45.10  ? 530 ASP A O   1 
ATOM 3777  C CB  . ASP A 1 533 ? 19.067  60.634  82.940  1.00 30.11  ? 530 ASP A CB  1 
ATOM 3778  C CG  . ASP A 1 533 ? 17.993  60.101  83.881  1.00 51.63  ? 530 ASP A CG  1 
ATOM 3779  O OD1 . ASP A 1 533 ? 17.986  60.489  85.076  1.00 54.58  ? 530 ASP A OD1 1 
ATOM 3780  O OD2 . ASP A 1 533 ? 17.142  59.319  83.414  1.00 55.85  ? 530 ASP A OD2 1 
ATOM 3781  N N   . LYS A 1 534 ? 20.149  63.545  81.203  1.00 40.21  ? 531 LYS A N   1 
ATOM 3782  C CA  . LYS A 1 534 ? 21.221  64.216  80.463  1.00 38.59  ? 531 LYS A CA  1 
ATOM 3783  C C   . LYS A 1 534 ? 22.241  63.291  79.742  1.00 37.79  ? 531 LYS A C   1 
ATOM 3784  O O   . LYS A 1 534 ? 23.455  63.387  79.988  1.00 29.12  ? 531 LYS A O   1 
ATOM 3785  C CB  . LYS A 1 534 ? 21.983  65.183  81.395  1.00 27.17  ? 531 LYS A CB  1 
ATOM 3786  C CG  . LYS A 1 534 ? 21.261  66.474  81.691  1.00 42.92  ? 531 LYS A CG  1 
ATOM 3787  C CD  . LYS A 1 534 ? 20.674  67.079  80.423  1.00 36.70  ? 531 LYS A CD  1 
ATOM 3788  C CE  . LYS A 1 534 ? 20.492  68.554  80.605  1.00 32.84  ? 531 LYS A CE  1 
ATOM 3789  N NZ  . LYS A 1 534 ? 19.791  69.186  79.476  1.00 32.22  ? 531 LYS A NZ  1 
ATOM 3790  N N   . PRO A 1 535 ? 21.769  62.398  78.858  1.00 31.45  ? 532 PRO A N   1 
ATOM 3791  C CA  . PRO A 1 535 ? 22.751  61.692  78.019  1.00 32.88  ? 532 PRO A CA  1 
ATOM 3792  C C   . PRO A 1 535 ? 23.651  62.695  77.275  1.00 41.27  ? 532 PRO A C   1 
ATOM 3793  O O   . PRO A 1 535 ? 23.208  63.771  76.889  1.00 31.27  ? 532 PRO A O   1 
ATOM 3794  C CB  . PRO A 1 535 ? 21.874  60.913  77.025  1.00 35.37  ? 532 PRO A CB  1 
ATOM 3795  C CG  . PRO A 1 535 ? 20.505  61.567  77.116  1.00 36.71  ? 532 PRO A CG  1 
ATOM 3796  C CD  . PRO A 1 535 ? 20.387  62.007  78.535  1.00 38.41  ? 532 PRO A CD  1 
ATOM 3797  N N   . GLY A 1 536 ? 24.917  62.358  77.103  1.00 33.22  ? 533 GLY A N   1 
ATOM 3798  C CA  . GLY A 1 536 ? 25.856  63.282  76.513  1.00 44.38  ? 533 GLY A CA  1 
ATOM 3799  C C   . GLY A 1 536 ? 26.634  64.046  77.558  1.00 59.56  ? 533 GLY A C   1 
ATOM 3800  O O   . GLY A 1 536 ? 27.527  64.833  77.227  1.00 48.11  ? 533 GLY A O   1 
ATOM 3801  N N   . GLY A 1 537 ? 26.298  63.803  78.822  1.00 44.34  ? 534 GLY A N   1 
ATOM 3802  C CA  . GLY A 1 537 ? 27.032  64.362  79.941  1.00 29.19  ? 534 GLY A CA  1 
ATOM 3803  C C   . GLY A 1 537 ? 27.691  63.304  80.827  1.00 41.45  ? 534 GLY A C   1 
ATOM 3804  O O   . GLY A 1 537 ? 27.481  62.098  80.659  1.00 55.32  ? 534 GLY A O   1 
ATOM 3805  N N   . PRO A 1 538 ? 28.478  63.759  81.812  1.00 58.87  ? 535 PRO A N   1 
ATOM 3806  C CA  . PRO A 1 538 ? 29.258  62.882  82.699  1.00 54.41  ? 535 PRO A CA  1 
ATOM 3807  C C   . PRO A 1 538 ? 28.452  62.110  83.751  1.00 41.25  ? 535 PRO A C   1 
ATOM 3808  O O   . PRO A 1 538 ? 28.966  61.150  84.317  1.00 74.78  ? 535 PRO A O   1 
ATOM 3809  C CB  . PRO A 1 538 ? 30.233  63.848  83.386  1.00 44.26  ? 535 PRO A CB  1 
ATOM 3810  C CG  . PRO A 1 538 ? 29.741  65.233  83.096  1.00 44.09  ? 535 PRO A CG  1 
ATOM 3811  C CD  . PRO A 1 538 ? 28.526  65.168  82.230  1.00 41.69  ? 535 PRO A CD  1 
ATOM 3812  N N   . HIS A 1 539 ? 27.210  62.513  83.988  1.00 34.54  ? 536 HIS A N   1 
ATOM 3813  C CA  . HIS A 1 539 ? 26.402  61.959  85.059  1.00 44.36  ? 536 HIS A CA  1 
ATOM 3814  C C   . HIS A 1 539 ? 25.413  60.913  84.594  1.00 33.00  ? 536 HIS A C   1 
ATOM 3815  O O   . HIS A 1 539 ? 24.934  60.103  85.392  1.00 49.65  ? 536 HIS A O   1 
ATOM 3816  C CB  . HIS A 1 539 ? 25.690  63.097  85.794  1.00 29.94  ? 536 HIS A CB  1 
ATOM 3817  C CG  . HIS A 1 539 ? 26.633  64.104  86.375  1.00 52.38  ? 536 HIS A CG  1 
ATOM 3818  N ND1 . HIS A 1 539 ? 26.441  65.463  86.244  1.00 41.63  ? 536 HIS A ND1 1 
ATOM 3819  C CD2 . HIS A 1 539 ? 27.794  63.952  87.064  1.00 39.36  ? 536 HIS A CD2 1 
ATOM 3820  C CE1 . HIS A 1 539 ? 27.435  66.105  86.833  1.00 55.29  ? 536 HIS A CE1 1 
ATOM 3821  N NE2 . HIS A 1 539 ? 28.269  65.213  87.342  1.00 41.37  ? 536 HIS A NE2 1 
ATOM 3822  N N   . TYR A 1 540 ? 25.126  60.913  83.298  1.00 38.98  ? 537 TYR A N   1 
ATOM 3823  C CA  . TYR A 1 540 ? 24.175  59.971  82.726  1.00 33.95  ? 537 TYR A CA  1 
ATOM 3824  C C   . TYR A 1 540 ? 24.461  58.526  83.131  1.00 37.79  ? 537 TYR A C   1 
ATOM 3825  O O   . TYR A 1 540 ? 23.548  57.812  83.517  1.00 37.89  ? 537 TYR A O   1 
ATOM 3826  C CB  . TYR A 1 540 ? 24.185  60.084  81.202  1.00 30.87  ? 537 TYR A CB  1 
ATOM 3827  C CG  . TYR A 1 540 ? 23.275  59.111  80.488  1.00 35.41  ? 537 TYR A CG  1 
ATOM 3828  C CD1 . TYR A 1 540 ? 21.904  59.226  80.588  1.00 31.91  ? 537 TYR A CD1 1 
ATOM 3829  C CD2 . TYR A 1 540 ? 23.789  58.091  79.696  1.00 27.72  ? 537 TYR A CD2 1 
ATOM 3830  C CE1 . TYR A 1 540 ? 21.059  58.346  79.941  1.00 33.87  ? 537 TYR A CE1 1 
ATOM 3831  C CE2 . TYR A 1 540 ? 22.942  57.225  79.010  1.00 46.26  ? 537 TYR A CE2 1 
ATOM 3832  C CZ  . TYR A 1 540 ? 21.575  57.363  79.148  1.00 46.31  ? 537 TYR A CZ  1 
ATOM 3833  O OH  . TYR A 1 540 ? 20.706  56.527  78.498  1.00 52.44  ? 537 TYR A OH  1 
ATOM 3834  N N   . ILE A 1 541 ? 25.717  58.093  82.993  1.00 38.57  ? 538 ILE A N   1 
ATOM 3835  C CA  . ILE A 1 541 ? 26.087  56.716  83.258  1.00 41.08  ? 538 ILE A CA  1 
ATOM 3836  C C   . ILE A 1 541 ? 25.817  56.297  84.720  1.00 45.27  ? 538 ILE A C   1 
ATOM 3837  O O   . ILE A 1 541 ? 25.663  55.125  84.984  1.00 43.27  ? 538 ILE A O   1 
ATOM 3838  C CB  . ILE A 1 541 ? 27.555  56.457  82.902  1.00 38.40  ? 538 ILE A CB  1 
ATOM 3839  C CG1 . ILE A 1 541 ? 28.434  57.521  83.561  1.00 38.22  ? 538 ILE A CG1 1 
ATOM 3840  C CG2 . ILE A 1 541 ? 27.738  56.461  81.400  1.00 33.08  ? 538 ILE A CG2 1 
ATOM 3841  C CD1 . ILE A 1 541 ? 29.862  57.114  83.789  1.00 38.14  ? 538 ILE A CD1 1 
ATOM 3842  N N   . LEU A 1 542 ? 25.757  57.242  85.660  1.00 29.37  ? 539 LEU A N   1 
ATOM 3843  C CA  . LEU A 1 542 ? 25.428  56.896  87.062  1.00 41.12  ? 539 LEU A CA  1 
ATOM 3844  C C   . LEU A 1 542 ? 24.087  56.181  87.252  1.00 40.90  ? 539 LEU A C   1 
ATOM 3845  O O   . LEU A 1 542 ? 23.920  55.424  88.201  1.00 45.07  ? 539 LEU A O   1 
ATOM 3846  C CB  . LEU A 1 542 ? 25.474  58.112  87.993  1.00 23.51  ? 539 LEU A CB  1 
ATOM 3847  C CG  . LEU A 1 542 ? 26.825  58.812  88.051  1.00 43.18  ? 539 LEU A CG  1 
ATOM 3848  C CD1 . LEU A 1 542 ? 26.745  60.040  88.880  1.00 43.51  ? 539 LEU A CD1 1 
ATOM 3849  C CD2 . LEU A 1 542 ? 27.853  57.903  88.602  1.00 35.27  ? 539 LEU A CD2 1 
ATOM 3850  N N   . ARG A 1 543 ? 23.131  56.412  86.359  1.00 32.18  ? 540 ARG A N   1 
ATOM 3851  C CA  . ARG A 1 543 ? 21.864  55.711  86.455  1.00 29.12  ? 540 ARG A CA  1 
ATOM 3852  C C   . ARG A 1 543 ? 22.038  54.211  86.262  1.00 41.71  ? 540 ARG A C   1 
ATOM 3853  O O   . ARG A 1 543 ? 21.190  53.438  86.708  1.00 41.14  ? 540 ARG A O   1 
ATOM 3854  C CB  . ARG A 1 543 ? 20.829  56.266  85.474  1.00 29.54  ? 540 ARG A CB  1 
ATOM 3855  C CG  . ARG A 1 543 ? 20.483  57.727  85.697  1.00 54.77  ? 540 ARG A CG  1 
ATOM 3856  C CD  . ARG A 1 543 ? 19.866  57.992  87.074  1.00 36.10  ? 540 ARG A CD  1 
ATOM 3857  N NE  . ARG A 1 543 ? 18.553  57.368  87.246  1.00 60.33  ? 540 ARG A NE  1 
ATOM 3858  C CZ  . ARG A 1 543 ? 18.184  56.693  88.332  1.00 59.00  ? 540 ARG A CZ  1 
ATOM 3859  N NH1 . ARG A 1 543 ? 19.028  56.545  89.344  1.00 38.01  ? 540 ARG A NH1 1 
ATOM 3860  N NH2 . ARG A 1 543 ? 16.965  56.179  88.413  1.00 44.30  ? 540 ARG A NH2 1 
ATOM 3861  N N   . TRP A 1 544 ? 23.146  53.805  85.632  1.00 25.84  ? 541 TRP A N   1 
ATOM 3862  C CA  . TRP A 1 544 ? 23.334  52.406  85.212  1.00 40.59  ? 541 TRP A CA  1 
ATOM 3863  C C   . TRP A 1 544 ? 24.325  51.612  86.067  1.00 47.35  ? 541 TRP A C   1 
ATOM 3864  O O   . TRP A 1 544 ? 24.695  50.481  85.739  1.00 50.10  ? 541 TRP A O   1 
ATOM 3865  C CB  . TRP A 1 544 ? 23.662  52.327  83.701  1.00 39.48  ? 541 TRP A CB  1 
ATOM 3866  C CG  . TRP A 1 544 ? 22.647  53.084  82.937  1.00 34.50  ? 541 TRP A CG  1 
ATOM 3867  C CD1 . TRP A 1 544 ? 22.848  54.198  82.177  1.00 52.46  ? 541 TRP A CD1 1 
ATOM 3868  C CD2 . TRP A 1 544 ? 21.231  52.835  82.920  1.00 45.07  ? 541 TRP A CD2 1 
ATOM 3869  N NE1 . TRP A 1 544 ? 21.650  54.648  81.670  1.00 33.37  ? 541 TRP A NE1 1 
ATOM 3870  C CE2 . TRP A 1 544 ? 20.644  53.828  82.114  1.00 33.80  ? 541 TRP A CE2 1 
ATOM 3871  C CE3 . TRP A 1 544 ? 20.410  51.853  83.487  1.00 33.95  ? 541 TRP A CE3 1 
ATOM 3872  C CZ2 . TRP A 1 544 ? 19.278  53.878  81.877  1.00 33.91  ? 541 TRP A CZ2 1 
ATOM 3873  C CZ3 . TRP A 1 544 ? 19.048  51.900  83.243  1.00 34.97  ? 541 TRP A CZ3 1 
ATOM 3874  C CH2 . TRP A 1 544 ? 18.497  52.906  82.450  1.00 42.04  ? 541 TRP A CH2 1 
ATOM 3875  N N   . THR A 1 545 ? 24.741  52.213  87.170  1.00 33.74  ? 542 THR A N   1 
ATOM 3876  C CA  . THR A 1 545 ? 25.567  51.525  88.148  1.00 52.14  ? 542 THR A CA  1 
ATOM 3877  C C   . THR A 1 545 ? 24.924  51.572  89.541  1.00 49.95  ? 542 THR A C   1 
ATOM 3878  O O   . THR A 1 545 ? 24.254  52.540  89.871  1.00 39.24  ? 542 THR A O   1 
ATOM 3879  C CB  . THR A 1 545 ? 26.969  52.136  88.205  1.00 37.42  ? 542 THR A CB  1 
ATOM 3880  O OG1 . THR A 1 545 ? 27.711  51.542  89.272  1.00 41.94  ? 542 THR A OG1 1 
ATOM 3881  C CG2 . THR A 1 545 ? 26.885  53.625  88.441  1.00 21.22  ? 542 THR A CG2 1 
ATOM 3882  N N   . SER A 1 546 ? 25.121  50.508  90.327  1.00 44.59  ? 543 SER A N   1 
ATOM 3883  C CA  . SER A 1 546 ? 24.731  50.446  91.740  1.00 49.81  ? 543 SER A CA  1 
ATOM 3884  C C   . SER A 1 546 ? 25.991  50.220  92.571  1.00 31.56  ? 543 SER A C   1 
ATOM 3885  O O   . SER A 1 546 ? 26.396  49.085  92.774  1.00 51.75  ? 543 SER A O   1 
ATOM 3886  C CB  . SER A 1 546 ? 23.755  49.289  91.973  1.00 26.73  ? 543 SER A CB  1 
ATOM 3887  O OG  . SER A 1 546 ? 23.026  49.465  93.159  1.00 57.98  ? 543 SER A OG  1 
ATOM 3888  N N   . PRO A 1 547 ? 26.621  51.302  93.039  1.00 38.67  ? 544 PRO A N   1 
ATOM 3889  C CA  . PRO A 1 547 ? 27.942  51.221  93.674  1.00 32.14  ? 544 PRO A CA  1 
ATOM 3890  C C   . PRO A 1 547 ? 27.936  50.407  94.973  1.00 49.50  ? 544 PRO A C   1 
ATOM 3891  O O   . PRO A 1 547 ? 26.974  50.441  95.733  1.00 42.35  ? 544 PRO A O   1 
ATOM 3892  C CB  . PRO A 1 547 ? 28.279  52.687  93.987  1.00 37.62  ? 544 PRO A CB  1 
ATOM 3893  C CG  . PRO A 1 547 ? 27.300  53.504  93.149  1.00 44.66  ? 544 PRO A CG  1 
ATOM 3894  C CD  . PRO A 1 547 ? 26.071  52.668  93.074  1.00 33.65  ? 544 PRO A CD  1 
ATOM 3895  N N   . GLN A 1 548 ? 29.020  49.670  95.195  1.00 49.91  ? 545 GLN A N   1 
ATOM 3896  C CA  . GLN A 1 548 ? 29.280  48.967  96.442  1.00 40.26  ? 545 GLN A CA  1 
ATOM 3897  C C   . GLN A 1 548 ? 30.466  49.652  97.104  1.00 43.22  ? 545 GLN A C   1 
ATOM 3898  O O   . GLN A 1 548 ? 31.406  50.053  96.422  1.00 47.62  ? 545 GLN A O   1 
ATOM 3899  C CB  . GLN A 1 548 ? 29.619  47.518  96.138  1.00 44.14  ? 545 GLN A CB  1 
ATOM 3900  C CG  . GLN A 1 548 ? 30.062  46.724  97.315  1.00 44.18  ? 545 GLN A CG  1 
ATOM 3901  C CD  . GLN A 1 548 ? 30.580  45.353  96.930  1.00 53.20  ? 545 GLN A CD  1 
ATOM 3902  O OE1 . GLN A 1 548 ? 31.455  45.231  96.072  1.00 61.27  ? 545 GLN A OE1 1 
ATOM 3903  N NE2 . GLN A 1 548 ? 30.042  44.309  97.565  1.00 41.20  ? 545 GLN A NE2 1 
ATOM 3904  N N   . VAL A 1 549 ? 30.412  49.832  98.418  1.00 36.93  ? 546 VAL A N   1 
ATOM 3905  C CA  . VAL A 1 549 ? 31.573  50.334  99.133  1.00 45.56  ? 546 VAL A CA  1 
ATOM 3906  C C   . VAL A 1 549 ? 32.186  49.198  99.922  1.00 44.66  ? 546 VAL A C   1 
ATOM 3907  O O   . VAL A 1 549 ? 31.479  48.455  100.584 1.00 53.70  ? 546 VAL A O   1 
ATOM 3908  C CB  . VAL A 1 549 ? 31.231  51.506  100.054 1.00 39.09  ? 546 VAL A CB  1 
ATOM 3909  C CG1 . VAL A 1 549 ? 32.476  51.958  100.824 1.00 38.21  ? 546 VAL A CG1 1 
ATOM 3910  C CG2 . VAL A 1 549 ? 30.712  52.649  99.224  1.00 54.69  ? 546 VAL A CG2 1 
ATOM 3911  N N   . ILE A 1 550 ? 33.499  49.048  99.829  1.00 42.39  ? 547 ILE A N   1 
ATOM 3912  C CA  . ILE A 1 550 ? 34.199  48.021  100.588 1.00 44.33  ? 547 ILE A CA  1 
ATOM 3913  C C   . ILE A 1 550 ? 35.183  48.630  101.568 1.00 49.22  ? 547 ILE A C   1 
ATOM 3914  O O   . ILE A 1 550 ? 36.096  49.364  101.166 1.00 56.40  ? 547 ILE A O   1 
ATOM 3915  C CB  . ILE A 1 550 ? 34.954  47.069  99.669  1.00 37.43  ? 547 ILE A CB  1 
ATOM 3916  C CG1 . ILE A 1 550 ? 33.982  46.337  98.753  1.00 34.25  ? 547 ILE A CG1 1 
ATOM 3917  C CG2 . ILE A 1 550 ? 35.776  46.062  100.483 1.00 34.36  ? 547 ILE A CG2 1 
ATOM 3918  C CD1 . ILE A 1 550 ? 34.725  45.532  97.664  1.00 39.87  ? 547 ILE A CD1 1 
ATOM 3919  N N   . LYS A 1 551 ? 34.983  48.328  102.856 1.00 43.23  ? 548 LYS A N   1 
ATOM 3920  C CA  . LYS A 1 551 ? 35.927  48.720  103.888 1.00 53.19  ? 548 LYS A CA  1 
ATOM 3921  C C   . LYS A 1 551 ? 36.745  47.524  104.408 1.00 63.94  ? 548 LYS A C   1 
ATOM 3922  O O   . LYS A 1 551 ? 36.196  46.540  104.907 1.00 47.01  ? 548 LYS A O   1 
ATOM 3923  C CB  . LYS A 1 551 ? 35.188  49.391  105.040 1.00 34.86  ? 548 LYS A CB  1 
ATOM 3924  C CG  . LYS A 1 551 ? 36.046  49.540  106.320 1.00 43.44  ? 548 LYS A CG  1 
ATOM 3925  C CD  . LYS A 1 551 ? 35.197  50.080  107.454 1.00 43.72  ? 548 LYS A CD  1 
ATOM 3926  C CE  . LYS A 1 551 ? 36.006  50.366  108.690 1.00 42.74  ? 548 LYS A CE  1 
ATOM 3927  N NZ  . LYS A 1 551 ? 35.154  50.877  109.776 1.00 41.23  ? 548 LYS A NZ  1 
ATOM 3928  N N   . GLU A 1 552 ? 38.061  47.602  104.289 1.00 51.50  ? 549 GLU A N   1 
ATOM 3929  C CA  . GLU A 1 552 ? 38.906  46.558  104.854 1.00 49.19  ? 549 GLU A CA  1 
ATOM 3930  C C   . GLU A 1 552 ? 39.709  47.105  106.018 1.00 52.93  ? 549 GLU A C   1 
ATOM 3931  O O   . GLU A 1 552 ? 40.369  48.142  105.905 1.00 43.38  ? 549 GLU A O   1 
ATOM 3932  C CB  . GLU A 1 552 ? 39.832  45.972  103.798 1.00 47.92  ? 549 GLU A CB  1 
ATOM 3933  C CG  . GLU A 1 552 ? 40.759  44.909  104.336 1.00 54.89  ? 549 GLU A CG  1 
ATOM 3934  C CD  . GLU A 1 552 ? 41.513  44.156  103.244 1.00 84.69  ? 549 GLU A CD  1 
ATOM 3935  O OE1 . GLU A 1 552 ? 41.380  44.491  102.044 1.00 62.69  ? 549 GLU A OE1 1 
ATOM 3936  O OE2 . GLU A 1 552 ? 42.243  43.208  103.596 1.00 82.72  ? 549 GLU A OE2 1 
ATOM 3937  N N   . THR A 1 553 ? 39.628  46.407  107.146 1.00 44.91  ? 550 THR A N   1 
ATOM 3938  C CA  . THR A 1 553 ? 40.332  46.818  108.349 1.00 53.87  ? 550 THR A CA  1 
ATOM 3939  C C   . THR A 1 553 ? 41.543  45.919  108.526 1.00 54.63  ? 550 THR A C   1 
ATOM 3940  O O   . THR A 1 553 ? 41.439  44.706  108.371 1.00 51.27  ? 550 THR A O   1 
ATOM 3941  C CB  . THR A 1 553 ? 39.400  46.770  109.578 1.00 72.35  ? 550 THR A CB  1 
ATOM 3942  O OG1 . THR A 1 553 ? 38.343  47.718  109.393 1.00 53.98  ? 550 THR A OG1 1 
ATOM 3943  C CG2 . THR A 1 553 ? 40.155  47.102  110.879 1.00 51.22  ? 550 THR A CG2 1 
ATOM 3944  N N   . HIS A 1 554 ? 42.693  46.516  108.814 1.00 61.06  ? 551 HIS A N   1 
ATOM 3945  C CA  . HIS A 1 554 ? 43.949  45.774  108.793 1.00 75.84  ? 551 HIS A CA  1 
ATOM 3946  C C   . HIS A 1 554 ? 44.497  45.425  110.173 1.00 73.86  ? 551 HIS A C   1 
ATOM 3947  O O   . HIS A 1 554 ? 45.418  44.625  110.280 1.00 63.61  ? 551 HIS A O   1 
ATOM 3948  C CB  . HIS A 1 554 ? 45.005  46.546  108.006 1.00 54.17  ? 551 HIS A CB  1 
ATOM 3949  C CG  . HIS A 1 554 ? 44.545  46.986  106.659 1.00 66.80  ? 551 HIS A CG  1 
ATOM 3950  N ND1 . HIS A 1 554 ? 44.305  46.098  105.632 1.00 56.57  ? 551 HIS A ND1 1 
ATOM 3951  C CD2 . HIS A 1 554 ? 44.278  48.219  106.167 1.00 72.95  ? 551 HIS A CD2 1 
ATOM 3952  C CE1 . HIS A 1 554 ? 43.920  46.767  104.562 1.00 54.85  ? 551 HIS A CE1 1 
ATOM 3953  N NE2 . HIS A 1 554 ? 43.894  48.054  104.860 1.00 77.01  ? 551 HIS A NE2 1 
ATOM 3954  N N   . LYS A 1 555 ? 43.949  46.032  111.219 1.00 79.20  ? 552 LYS A N   1 
ATOM 3955  C CA  . LYS A 1 555 ? 44.383  45.737  112.584 1.00 78.81  ? 552 LYS A CA  1 
ATOM 3956  C C   . LYS A 1 555 ? 43.207  45.126  113.349 1.00 77.88  ? 552 LYS A C   1 
ATOM 3957  O O   . LYS A 1 555 ? 42.052  45.439  113.057 1.00 76.20  ? 552 LYS A O   1 
ATOM 3958  C CB  . LYS A 1 555 ? 44.938  47.002  113.274 1.00 50.66  ? 552 LYS A CB  1 
ATOM 3959  N N   . PRO A 1 556 ? 43.497  44.231  114.308 1.00 83.71  ? 553 PRO A N   1 
ATOM 3960  C CA  . PRO A 1 556 ? 42.493  43.567  115.155 1.00 73.30  ? 553 PRO A CA  1 
ATOM 3961  C C   . PRO A 1 556 ? 41.558  44.557  115.844 1.00 69.19  ? 553 PRO A C   1 
ATOM 3962  O O   . PRO A 1 556 ? 41.959  45.675  116.189 1.00 70.37  ? 553 PRO A O   1 
ATOM 3963  C CB  . PRO A 1 556 ? 43.342  42.846  116.202 1.00 72.37  ? 553 PRO A CB  1 
ATOM 3964  C CG  . PRO A 1 556 ? 44.640  42.595  115.511 1.00 85.37  ? 553 PRO A CG  1 
ATOM 3965  C CD  . PRO A 1 556 ? 44.865  43.778  114.617 1.00 90.02  ? 553 PRO A CD  1 
ATOM 3966  N N   . LEU A 1 557 ? 40.322  44.132  116.068 1.00 47.17  ? 554 LEU A N   1 
ATOM 3967  C CA  . LEU A 1 557 ? 39.254  45.057  116.495 1.00 86.26  ? 554 LEU A CA  1 
ATOM 3968  C C   . LEU A 1 557 ? 39.350  45.695  117.901 1.00 88.10  ? 554 LEU A C   1 
ATOM 3969  O O   . LEU A 1 557 ? 39.284  46.919  118.038 1.00 89.34  ? 554 LEU A O   1 
ATOM 3970  C CB  . LEU A 1 557 ? 37.867  44.432  116.262 1.00 63.30  ? 554 LEU A CB  1 
ATOM 3971  C CG  . LEU A 1 557 ? 37.494  44.298  114.781 1.00 61.02  ? 554 LEU A CG  1 
ATOM 3972  C CD1 . LEU A 1 557 ? 36.037  43.905  114.619 1.00 52.40  ? 554 LEU A CD1 1 
ATOM 3973  C CD2 . LEU A 1 557 ? 37.765  45.608  114.043 1.00 47.91  ? 554 LEU A CD2 1 
ATOM 3974  N N   . GLY A 1 558 ? 39.491  44.881  118.940 1.00 76.53  ? 555 GLY A N   1 
ATOM 3975  C CA  . GLY A 1 558 ? 39.562  45.419  120.289 1.00 65.80  ? 555 GLY A CA  1 
ATOM 3976  C C   . GLY A 1 558 ? 38.309  45.156  121.102 1.00 64.30  ? 555 GLY A C   1 
ATOM 3977  O O   . GLY A 1 558 ? 37.386  44.496  120.628 1.00 68.34  ? 555 GLY A O   1 
ATOM 3978  N N   . ASP A 1 559 ? 38.274  45.663  122.335 1.00 83.79  ? 556 ASP A N   1 
ATOM 3979  C CA  . ASP A 1 559 ? 37.160  45.370  123.228 1.00 80.75  ? 556 ASP A CA  1 
ATOM 3980  C C   . ASP A 1 559 ? 35.889  45.959  122.648 1.00 78.73  ? 556 ASP A C   1 
ATOM 3981  O O   . ASP A 1 559 ? 35.925  46.986  121.963 1.00 79.47  ? 556 ASP A O   1 
ATOM 3982  C CB  . ASP A 1 559 ? 37.413  45.902  124.645 1.00 81.01  ? 556 ASP A CB  1 
ATOM 3983  N N   . TRP A 1 560 ? 34.766  45.298  122.905 1.00 74.36  ? 557 TRP A N   1 
ATOM 3984  C CA  . TRP A 1 560 ? 33.470  45.803  122.466 1.00 60.84  ? 557 TRP A CA  1 
ATOM 3985  C C   . TRP A 1 560 ? 32.971  46.938  123.348 1.00 73.89  ? 557 TRP A C   1 
ATOM 3986  O O   . TRP A 1 560 ? 32.074  47.682  122.957 1.00 76.57  ? 557 TRP A O   1 
ATOM 3987  C CB  . TRP A 1 560 ? 32.441  44.686  122.435 1.00 68.83  ? 557 TRP A CB  1 
ATOM 3988  C CG  . TRP A 1 560 ? 32.369  43.918  123.709 1.00 86.72  ? 557 TRP A CG  1 
ATOM 3989  C CD1 . TRP A 1 560 ? 33.016  42.754  123.993 1.00 85.36  ? 557 TRP A CD1 1 
ATOM 3990  C CD2 . TRP A 1 560 ? 31.606  44.251  124.882 1.00 89.87  ? 557 TRP A CD2 1 
ATOM 3991  N NE1 . TRP A 1 560 ? 32.701  42.338  125.260 1.00 79.83  ? 557 TRP A NE1 1 
ATOM 3992  C CE2 . TRP A 1 560 ? 31.840  43.239  125.830 1.00 83.64  ? 557 TRP A CE2 1 
ATOM 3993  C CE3 . TRP A 1 560 ? 30.751  45.308  125.222 1.00 85.34  ? 557 TRP A CE3 1 
ATOM 3994  C CZ2 . TRP A 1 560 ? 31.249  43.249  127.104 1.00 71.69  ? 557 TRP A CZ2 1 
ATOM 3995  C CZ3 . TRP A 1 560 ? 30.164  45.317  126.491 1.00 93.27  ? 557 TRP A CZ3 1 
ATOM 3996  C CH2 . TRP A 1 560 ? 30.421  44.293  127.415 1.00 77.20  ? 557 TRP A CH2 1 
ATOM 3997  N N   . SER A 1 561 ? 33.547  47.056  124.538 1.00 83.62  ? 558 SER A N   1 
ATOM 3998  C CA  . SER A 1 561 ? 33.189  48.119  125.464 1.00 81.76  ? 558 SER A CA  1 
ATOM 3999  C C   . SER A 1 561 ? 33.856  49.415  125.006 1.00 57.86  ? 558 SER A C   1 
ATOM 4000  O O   . SER A 1 561 ? 34.798  49.387  124.214 1.00 68.17  ? 558 SER A O   1 
ATOM 4001  C CB  . SER A 1 561 ? 33.641  47.738  126.884 1.00 70.09  ? 558 SER A CB  1 
ATOM 4002  O OG  . SER A 1 561 ? 33.405  48.783  127.815 1.00 98.14  ? 558 SER A OG  1 
ATOM 4003  N N   . TYR A 1 562 ? 33.380  50.549  125.506 1.00 53.69  ? 559 TYR A N   1 
ATOM 4004  C CA  . TYR A 1 562 ? 34.033  51.837  125.259 1.00 54.11  ? 559 TYR A CA  1 
ATOM 4005  C C   . TYR A 1 562 ? 34.610  52.417  126.547 1.00 78.53  ? 559 TYR A C   1 
ATOM 4006  O O   . TYR A 1 562 ? 34.131  52.091  127.638 1.00 74.92  ? 559 TYR A O   1 
ATOM 4007  C CB  . TYR A 1 562 ? 33.021  52.822  124.667 1.00 65.21  ? 559 TYR A CB  1 
ATOM 4008  C CG  . TYR A 1 562 ? 32.472  52.409  123.316 1.00 59.40  ? 559 TYR A CG  1 
ATOM 4009  C CD1 . TYR A 1 562 ? 32.944  52.995  122.151 1.00 77.66  ? 559 TYR A CD1 1 
ATOM 4010  C CD2 . TYR A 1 562 ? 31.486  51.433  123.205 1.00 60.76  ? 559 TYR A CD2 1 
ATOM 4011  C CE1 . TYR A 1 562 ? 32.457  52.622  120.912 1.00 65.21  ? 559 TYR A CE1 1 
ATOM 4012  C CE2 . TYR A 1 562 ? 30.995  51.054  121.971 1.00 91.34  ? 559 TYR A CE2 1 
ATOM 4013  C CZ  . TYR A 1 562 ? 31.482  51.652  120.830 1.00 81.23  ? 559 TYR A CZ  1 
ATOM 4014  O OH  . TYR A 1 562 ? 30.986  51.271  119.609 1.00 61.53  ? 559 TYR A OH  1 
ATOM 4015  N N   . ALA A 1 563 ? 35.618  53.286  126.426 1.00 83.52  ? 560 ALA A N   1 
ATOM 4016  C CA  . ALA A 1 563 ? 36.297  53.851  127.607 1.00 64.29  ? 560 ALA A CA  1 
ATOM 4017  C C   . ALA A 1 563 ? 35.361  54.637  128.522 1.00 66.68  ? 560 ALA A C   1 
ATOM 4018  O O   . ALA A 1 563 ? 35.396  54.473  129.739 1.00 74.60  ? 560 ALA A O   1 
ATOM 4019  C CB  . ALA A 1 563 ? 37.498  54.713  127.204 1.00 44.77  ? 560 ALA A CB  1 
ATOM 4020  N N   . TYR A 1 564 ? 34.537  55.500  127.939 1.00 74.62  ? 561 TYR A N   1 
ATOM 4021  C CA  . TYR A 1 564 ? 33.578  56.284  128.713 1.00 76.45  ? 561 TYR A CA  1 
ATOM 4022  C C   . TYR A 1 564 ? 32.684  55.393  129.610 1.00 71.74  ? 561 TYR A C   1 
ATOM 4023  O O   . TYR A 1 564 ? 32.119  55.869  130.592 1.00 54.69  ? 561 TYR A O   1 
ATOM 4024  C CB  . TYR A 1 564 ? 32.719  57.159  127.782 1.00 62.07  ? 561 TYR A CB  1 
ATOM 4025  C CG  . TYR A 1 564 ? 31.466  56.467  127.280 1.00 61.14  ? 561 TYR A CG  1 
ATOM 4026  C CD1 . TYR A 1 564 ? 31.509  55.598  126.194 1.00 56.56  ? 561 TYR A CD1 1 
ATOM 4027  C CD2 . TYR A 1 564 ? 30.240  56.680  127.898 1.00 41.99  ? 561 TYR A CD2 1 
ATOM 4028  C CE1 . TYR A 1 564 ? 30.358  54.955  125.741 1.00 69.78  ? 561 TYR A CE1 1 
ATOM 4029  C CE2 . TYR A 1 564 ? 29.081  56.039  127.455 1.00 67.51  ? 561 TYR A CE2 1 
ATOM 4030  C CZ  . TYR A 1 564 ? 29.141  55.179  126.375 1.00 73.52  ? 561 TYR A CZ  1 
ATOM 4031  O OH  . TYR A 1 564 ? 27.991  54.541  125.927 1.00 65.39  ? 561 TYR A OH  1 
ATOM 4032  N N   . MET A 1 565 ? 32.547  54.111  129.260 1.00 61.65  ? 562 MET A N   1 
ATOM 4033  C CA  . MET A 1 565 ? 31.741  53.150  130.036 1.00 73.87  ? 562 MET A CA  1 
ATOM 4034  C C   . MET A 1 565 ? 32.520  52.575  131.235 1.00 86.10  ? 562 MET A C   1 
ATOM 4035  O O   . MET A 1 565 ? 31.934  52.218  132.253 1.00 74.57  ? 562 MET A O   1 
ATOM 4036  C CB  . MET A 1 565 ? 31.276  51.975  129.155 1.00 46.46  ? 562 MET A CB  1 
ATOM 4037  C CG  . MET A 1 565 ? 30.168  52.282  128.122 1.00 61.76  ? 562 MET A CG  1 
ATOM 4038  S SD  . MET A 1 565 ? 29.892  51.020  126.811 1.00 47.96  ? 562 MET A SD  1 
ATOM 4039  C CE  . MET A 1 565 ? 29.771  49.550  127.800 1.00 68.66  ? 562 MET A CE  1 
ATOM 4040  N N   . GLN A 1 566 ? 33.830  52.411  131.077 1.00 78.82  ? 563 GLN A N   1 
ATOM 4041  C CA  . GLN A 1 566 ? 34.709  52.019  132.172 1.00 93.74  ? 563 GLN A CA  1 
ATOM 4042  C C   . GLN A 1 566 ? 34.896  53.229  133.079 1.00 113.81 ? 563 GLN A C   1 
ATOM 4043  O O   . GLN A 1 566 ? 33.919  53.876  133.492 1.00 106.23 ? 563 GLN A O   1 
ATOM 4044  C CB  . GLN A 1 566 ? 36.070  51.548  131.622 1.00 57.65  ? 563 GLN A CB  1 
ATOM 4045  O OXT . GLN A 1 566 ? 36.025  53.619  133.398 1.00 104.31 ? 563 GLN A OXT 1 
ATOM 4046  N N   . ARG B 1 26  ? 36.962  84.549  77.690  1.00 62.29  ? 23  ARG B N   1 
ATOM 4047  C CA  . ARG B 1 26  ? 36.292  84.919  78.942  1.00 85.66  ? 23  ARG B CA  1 
ATOM 4048  C C   . ARG B 1 26  ? 36.857  84.141  80.160  1.00 98.62  ? 23  ARG B C   1 
ATOM 4049  O O   . ARG B 1 26  ? 37.731  83.270  80.020  1.00 59.06  ? 23  ARG B O   1 
ATOM 4050  C CB  . ARG B 1 26  ? 34.753  84.788  78.824  1.00 46.25  ? 23  ARG B CB  1 
ATOM 4051  N N   . TRP B 1 27  ? 36.355  84.473  81.350  1.00 108.27 ? 24  TRP B N   1 
ATOM 4052  C CA  . TRP B 1 27  ? 36.866  83.941  82.618  1.00 66.63  ? 24  TRP B CA  1 
ATOM 4053  C C   . TRP B 1 27  ? 35.773  83.978  83.679  1.00 67.68  ? 24  TRP B C   1 
ATOM 4054  O O   . TRP B 1 27  ? 34.949  84.893  83.693  1.00 73.09  ? 24  TRP B O   1 
ATOM 4055  C CB  . TRP B 1 27  ? 38.028  84.804  83.107  1.00 50.18  ? 24  TRP B CB  1 
ATOM 4056  C CG  . TRP B 1 27  ? 37.648  86.246  83.210  1.00 62.43  ? 24  TRP B CG  1 
ATOM 4057  C CD1 . TRP B 1 27  ? 37.668  87.164  82.205  1.00 62.80  ? 24  TRP B CD1 1 
ATOM 4058  C CD2 . TRP B 1 27  ? 37.157  86.933  84.369  1.00 58.13  ? 24  TRP B CD2 1 
ATOM 4059  N NE1 . TRP B 1 27  ? 37.236  88.381  82.664  1.00 94.97  ? 24  TRP B NE1 1 
ATOM 4060  C CE2 . TRP B 1 27  ? 36.912  88.268  83.990  1.00 88.74  ? 24  TRP B CE2 1 
ATOM 4061  C CE3 . TRP B 1 27  ? 36.904  86.553  85.688  1.00 68.03  ? 24  TRP B CE3 1 
ATOM 4062  C CZ2 . TRP B 1 27  ? 36.430  89.226  84.883  1.00 80.21  ? 24  TRP B CZ2 1 
ATOM 4063  C CZ3 . TRP B 1 27  ? 36.417  87.507  86.573  1.00 71.99  ? 24  TRP B CZ3 1 
ATOM 4064  C CH2 . TRP B 1 27  ? 36.188  88.825  86.167  1.00 79.65  ? 24  TRP B CH2 1 
ATOM 4065  N N   . LYS B 1 28  ? 35.770  83.009  84.589  1.00 70.21  ? 25  LYS B N   1 
ATOM 4066  C CA  . LYS B 1 28  ? 34.760  82.999  85.644  1.00 78.27  ? 25  LYS B CA  1 
ATOM 4067  C C   . LYS B 1 28  ? 35.395  82.806  87.017  1.00 78.38  ? 25  LYS B C   1 
ATOM 4068  O O   . LYS B 1 28  ? 36.388  82.091  87.140  1.00 52.78  ? 25  LYS B O   1 
ATOM 4069  C CB  . LYS B 1 28  ? 33.703  81.916  85.375  1.00 51.75  ? 25  LYS B CB  1 
ATOM 4070  N N   . HIS B 1 29  ? 34.818  83.461  88.027  1.00 77.90  ? 26  HIS B N   1 
ATOM 4071  C CA  . HIS B 1 29  ? 35.182  83.275  89.437  1.00 88.41  ? 26  HIS B CA  1 
ATOM 4072  C C   . HIS B 1 29  ? 34.512  82.039  90.028  1.00 87.95  ? 26  HIS B C   1 
ATOM 4073  O O   . HIS B 1 29  ? 33.293  82.009  90.206  1.00 84.86  ? 26  HIS B O   1 
ATOM 4074  C CB  . HIS B 1 29  ? 34.745  84.480  90.271  1.00 98.64  ? 26  HIS B CB  1 
ATOM 4075  C CG  . HIS B 1 29  ? 35.660  85.658  90.173  1.00 112.01 ? 26  HIS B CG  1 
ATOM 4076  N ND1 . HIS B 1 29  ? 37.021  85.563  90.372  1.00 102.53 ? 26  HIS B ND1 1 
ATOM 4077  C CD2 . HIS B 1 29  ? 35.406  86.964  89.920  1.00 103.64 ? 26  HIS B CD2 1 
ATOM 4078  C CE1 . HIS B 1 29  ? 37.568  86.758  90.233  1.00 90.83  ? 26  HIS B CE1 1 
ATOM 4079  N NE2 . HIS B 1 29  ? 36.609  87.627  89.962  1.00 95.44  ? 26  HIS B NE2 1 
ATOM 4080  N N   . THR B 1 30  ? 35.307  81.030  90.355  1.00 76.68  ? 27  THR B N   1 
ATOM 4081  C CA  . THR B 1 30  ? 34.763  79.784  90.871  1.00 74.69  ? 27  THR B CA  1 
ATOM 4082  C C   . THR B 1 30  ? 35.257  79.554  92.294  1.00 91.07  ? 27  THR B C   1 
ATOM 4083  O O   . THR B 1 30  ? 35.953  80.408  92.848  1.00 97.00  ? 27  THR B O   1 
ATOM 4084  C CB  . THR B 1 30  ? 35.131  78.593  89.970  1.00 84.55  ? 27  THR B CB  1 
ATOM 4085  O OG1 . THR B 1 30  ? 36.549  78.416  89.962  1.00 74.23  ? 27  THR B OG1 1 
ATOM 4086  C CG2 . THR B 1 30  ? 34.651  78.840  88.541  1.00 68.50  ? 27  THR B CG2 1 
ATOM 4087  N N   . SER B 1 31  ? 34.883  78.419  92.887  1.00 76.06  ? 28  SER B N   1 
ATOM 4088  C CA  . SER B 1 31  ? 35.264  78.120  94.272  1.00 68.22  ? 28  SER B CA  1 
ATOM 4089  C C   . SER B 1 31  ? 35.184  76.642  94.612  1.00 62.14  ? 28  SER B C   1 
ATOM 4090  O O   . SER B 1 31  ? 34.502  75.860  93.931  1.00 51.89  ? 28  SER B O   1 
ATOM 4091  C CB  . SER B 1 31  ? 34.405  78.898  95.260  1.00 61.66  ? 28  SER B CB  1 
ATOM 4092  O OG  . SER B 1 31  ? 33.261  78.145  95.610  1.00 74.18  ? 28  SER B OG  1 
ATOM 4093  N N   . SER B 1 32  ? 35.902  76.266  95.665  1.00 53.94  ? 29  SER B N   1 
ATOM 4094  C CA  . SER B 1 32  ? 35.875  74.891  96.165  1.00 62.33  ? 29  SER B CA  1 
ATOM 4095  C C   . SER B 1 32  ? 35.879  74.855  97.688  1.00 67.93  ? 29  SER B C   1 
ATOM 4096  O O   . SER B 1 32  ? 36.123  75.859  98.357  1.00 48.11  ? 29  SER B O   1 
ATOM 4097  C CB  . SER B 1 32  ? 37.043  74.057  95.624  1.00 59.96  ? 29  SER B CB  1 
ATOM 4098  O OG  . SER B 1 32  ? 38.248  74.335  96.321  1.00 77.09  ? 29  SER B OG  1 
ATOM 4099  N N   . LEU B 1 33  ? 35.625  73.675  98.228  1.00 58.77  ? 30  LEU B N   1 
ATOM 4100  C CA  . LEU B 1 33  ? 35.434  73.533  99.649  1.00 34.95  ? 30  LEU B CA  1 
ATOM 4101  C C   . LEU B 1 33  ? 36.195  72.318  100.142 1.00 60.56  ? 30  LEU B C   1 
ATOM 4102  O O   . LEU B 1 33  ? 35.979  71.197  99.678  1.00 73.50  ? 30  LEU B O   1 
ATOM 4103  C CB  . LEU B 1 33  ? 33.940  73.380  99.935  1.00 56.96  ? 30  LEU B CB  1 
ATOM 4104  C CG  . LEU B 1 33  ? 33.368  73.648  101.315 1.00 56.23  ? 30  LEU B CG  1 
ATOM 4105  C CD1 . LEU B 1 33  ? 33.767  75.030  101.808 1.00 48.53  ? 30  LEU B CD1 1 
ATOM 4106  C CD2 . LEU B 1 33  ? 31.854  73.522  101.215 1.00 53.83  ? 30  LEU B CD2 1 
ATOM 4107  N N   . LYS B 1 34  ? 37.111  72.546  101.071 1.00 49.10  ? 31  LYS B N   1 
ATOM 4108  C CA  . LYS B 1 34  ? 37.827  71.445  101.668 1.00 56.83  ? 31  LYS B CA  1 
ATOM 4109  C C   . LYS B 1 34  ? 37.152  71.252  103.028 1.00 66.26  ? 31  LYS B C   1 
ATOM 4110  O O   . LYS B 1 34  ? 36.881  72.235  103.718 1.00 57.51  ? 31  LYS B O   1 
ATOM 4111  C CB  . LYS B 1 34  ? 39.327  71.769  101.749 1.00 44.06  ? 31  LYS B CB  1 
ATOM 4112  N N   . VAL B 1 35  ? 36.788  70.011  103.363 1.00 54.79  ? 32  VAL B N   1 
ATOM 4113  C CA  . VAL B 1 35  ? 36.165  69.719  104.658 1.00 48.91  ? 32  VAL B CA  1 
ATOM 4114  C C   . VAL B 1 35  ? 36.782  68.518  105.332 1.00 46.46  ? 32  VAL B C   1 
ATOM 4115  O O   . VAL B 1 35  ? 37.392  67.666  104.683 1.00 52.95  ? 32  VAL B O   1 
ATOM 4116  C CB  . VAL B 1 35  ? 34.617  69.434  104.594 1.00 58.31  ? 32  VAL B CB  1 
ATOM 4117  C CG1 . VAL B 1 35  ? 33.820  70.679  104.267 1.00 53.11  ? 32  VAL B CG1 1 
ATOM 4118  C CG2 . VAL B 1 35  ? 34.306  68.302  103.642 1.00 67.95  ? 32  VAL B CG2 1 
ATOM 4119  N N   . ALA B 1 36  ? 36.568  68.419  106.639 1.00 66.76  ? 33  ALA B N   1 
ATOM 4120  C CA  . ALA B 1 36  ? 37.062  67.278  107.391 1.00 49.75  ? 33  ALA B CA  1 
ATOM 4121  C C   . ALA B 1 36  ? 35.939  66.637  108.214 1.00 49.49  ? 33  ALA B C   1 
ATOM 4122  O O   . ALA B 1 36  ? 35.003  67.323  108.624 1.00 60.83  ? 33  ALA B O   1 
ATOM 4123  C CB  . ALA B 1 36  ? 38.188  67.718  108.280 1.00 61.18  ? 33  ALA B CB  1 
ATOM 4124  N N   . ASN B 1 37  ? 36.026  65.323  108.438 1.00 30.88  ? 34  ASN B N   1 
ATOM 4125  C CA  . ASN B 1 37  ? 35.045  64.634  109.271 1.00 49.66  ? 34  ASN B CA  1 
ATOM 4126  C C   . ASN B 1 37  ? 35.032  65.246  110.661 1.00 39.93  ? 34  ASN B C   1 
ATOM 4127  O O   . ASN B 1 37  ? 36.033  65.792  111.123 1.00 55.53  ? 34  ASN B O   1 
ATOM 4128  C CB  . ASN B 1 37  ? 35.365  63.145  109.395 1.00 39.47  ? 34  ASN B CB  1 
ATOM 4129  C CG  . ASN B 1 37  ? 35.087  62.375  108.117 1.00 61.92  ? 34  ASN B CG  1 
ATOM 4130  O OD1 . ASN B 1 37  ? 35.982  62.147  107.296 1.00 42.98  ? 34  ASN B OD1 1 
ATOM 4131  N ND2 . ASN B 1 37  ? 33.842  61.956  107.950 1.00 43.64  ? 34  ASN B ND2 1 
ATOM 4132  N N   . GLU B 1 38  ? 33.896  65.160  111.323 1.00 48.28  ? 35  GLU B N   1 
ATOM 4133  C CA  . GLU B 1 38  ? 33.799  65.628  112.694 1.00 60.35  ? 35  GLU B CA  1 
ATOM 4134  C C   . GLU B 1 38  ? 34.436  64.600  113.638 1.00 56.63  ? 35  GLU B C   1 
ATOM 4135  O O   . GLU B 1 38  ? 34.137  63.410  113.570 1.00 55.07  ? 35  GLU B O   1 
ATOM 4136  C CB  . GLU B 1 38  ? 32.338  65.867  113.048 1.00 39.82  ? 35  GLU B CB  1 
ATOM 4137  C CG  . GLU B 1 38  ? 32.109  66.327  114.478 1.00 58.55  ? 35  GLU B CG  1 
ATOM 4138  C CD  . GLU B 1 38  ? 32.734  67.685  114.776 1.00 63.96  ? 35  GLU B CD  1 
ATOM 4139  O OE1 . GLU B 1 38  ? 32.896  68.505  113.852 1.00 60.52  ? 35  GLU B OE1 1 
ATOM 4140  O OE2 . GLU B 1 38  ? 33.085  67.927  115.945 1.00 89.19  ? 35  GLU B OE2 1 
ATOM 4141  N N   . PRO B 1 39  ? 35.362  65.051  114.484 1.00 62.83  ? 36  PRO B N   1 
ATOM 4142  C CA  . PRO B 1 39  ? 36.019  64.138  115.428 1.00 70.06  ? 36  PRO B CA  1 
ATOM 4143  C C   . PRO B 1 39  ? 35.013  63.602  116.431 1.00 57.63  ? 36  PRO B C   1 
ATOM 4144  O O   . PRO B 1 39  ? 34.194  64.368  116.945 1.00 64.30  ? 36  PRO B O   1 
ATOM 4145  C CB  . PRO B 1 39  ? 37.030  65.036  116.136 1.00 54.28  ? 36  PRO B CB  1 
ATOM 4146  C CG  . PRO B 1 39  ? 37.263  66.162  115.185 1.00 60.64  ? 36  PRO B CG  1 
ATOM 4147  C CD  . PRO B 1 39  ? 35.958  66.395  114.496 1.00 46.68  ? 36  PRO B CD  1 
ATOM 4148  N N   . VAL B 1 40  ? 35.061  62.299  116.678 1.00 55.84  ? 37  VAL B N   1 
ATOM 4149  C CA  . VAL B 1 40  ? 34.203  61.650  117.668 1.00 64.17  ? 37  VAL B CA  1 
ATOM 4150  C C   . VAL B 1 40  ? 34.826  61.744  119.065 1.00 51.64  ? 37  VAL B C   1 
ATOM 4151  O O   . VAL B 1 40  ? 35.891  61.180  119.316 1.00 70.67  ? 37  VAL B O   1 
ATOM 4152  C CB  . VAL B 1 40  ? 33.967  60.185  117.283 1.00 58.89  ? 37  VAL B CB  1 
ATOM 4153  C CG1 . VAL B 1 40  ? 33.099  59.510  118.301 1.00 53.64  ? 37  VAL B CG1 1 
ATOM 4154  C CG2 . VAL B 1 40  ? 33.326  60.116  115.888 1.00 56.78  ? 37  VAL B CG2 1 
ATOM 4155  N N   . LEU B 1 41  ? 34.170  62.493  119.946 1.00 65.00  ? 38  LEU B N   1 
ATOM 4156  C CA  . LEU B 1 41  ? 34.627  62.713  121.316 1.00 71.11  ? 38  LEU B CA  1 
ATOM 4157  C C   . LEU B 1 41  ? 34.556  61.441  122.147 1.00 63.59  ? 38  LEU B C   1 
ATOM 4158  O O   . LEU B 1 41  ? 33.732  60.571  121.869 1.00 70.77  ? 38  LEU B O   1 
ATOM 4159  C CB  . LEU B 1 41  ? 33.794  63.811  121.970 1.00 65.06  ? 38  LEU B CB  1 
ATOM 4160  C CG  . LEU B 1 41  ? 33.906  65.142  121.233 1.00 58.21  ? 38  LEU B CG  1 
ATOM 4161  C CD1 . LEU B 1 41  ? 33.120  66.232  121.923 1.00 57.37  ? 38  LEU B CD1 1 
ATOM 4162  C CD2 . LEU B 1 41  ? 35.343  65.555  121.092 1.00 39.95  ? 38  LEU B CD2 1 
ATOM 4163  N N   . ALA B 1 42  ? 35.421  61.344  123.161 1.00 83.96  ? 39  ALA B N   1 
ATOM 4164  C CA  . ALA B 1 42  ? 35.570  60.124  123.974 1.00 81.08  ? 39  ALA B CA  1 
ATOM 4165  C C   . ALA B 1 42  ? 34.701  60.085  125.228 1.00 66.42  ? 39  ALA B C   1 
ATOM 4166  O O   . ALA B 1 42  ? 34.432  59.006  125.746 1.00 60.69  ? 39  ALA B O   1 
ATOM 4167  C CB  . ALA B 1 42  ? 37.027  59.904  124.350 1.00 80.35  ? 39  ALA B CB  1 
ATOM 4168  N N   . PHE B 1 43  ? 34.293  61.262  125.707 1.00 66.01  ? 40  PHE B N   1 
ATOM 4169  C CA  . PHE B 1 43  ? 33.370  61.388  126.835 1.00 71.39  ? 40  PHE B CA  1 
ATOM 4170  C C   . PHE B 1 43  ? 33.823  60.664  128.113 1.00 81.96  ? 40  PHE B C   1 
ATOM 4171  O O   . PHE B 1 43  ? 33.010  60.055  128.801 1.00 71.45  ? 40  PHE B O   1 
ATOM 4172  C CB  . PHE B 1 43  ? 31.983  60.879  126.439 1.00 59.69  ? 40  PHE B CB  1 
ATOM 4173  C CG  . PHE B 1 43  ? 31.236  61.794  125.546 1.00 54.78  ? 40  PHE B CG  1 
ATOM 4174  C CD1 . PHE B 1 43  ? 30.521  62.865  126.064 1.00 66.10  ? 40  PHE B CD1 1 
ATOM 4175  C CD2 . PHE B 1 43  ? 31.230  61.583  124.175 1.00 73.89  ? 40  PHE B CD2 1 
ATOM 4176  C CE1 . PHE B 1 43  ? 29.812  63.721  125.226 1.00 62.26  ? 40  PHE B CE1 1 
ATOM 4177  C CE2 . PHE B 1 43  ? 30.532  62.434  123.324 1.00 64.28  ? 40  PHE B CE2 1 
ATOM 4178  C CZ  . PHE B 1 43  ? 29.822  63.505  123.848 1.00 66.85  ? 40  PHE B CZ  1 
ATOM 4179  N N   . THR B 1 44  ? 35.110  60.743  128.435 1.00 81.76  ? 41  THR B N   1 
ATOM 4180  C CA  . THR B 1 44  ? 35.648  60.080  129.622 1.00 92.70  ? 41  THR B CA  1 
ATOM 4181  C C   . THR B 1 44  ? 35.444  60.946  130.862 1.00 92.50  ? 41  THR B C   1 
ATOM 4182  O O   . THR B 1 44  ? 35.091  62.126  130.743 1.00 70.79  ? 41  THR B O   1 
ATOM 4183  C CB  . THR B 1 44  ? 37.146  59.774  129.456 1.00 96.19  ? 41  THR B CB  1 
ATOM 4184  O OG1 . THR B 1 44  ? 37.872  61.002  129.270 1.00 85.45  ? 41  THR B OG1 1 
ATOM 4185  C CG2 . THR B 1 44  ? 37.373  58.842  128.255 1.00 61.44  ? 41  THR B CG2 1 
ATOM 4186  N N   . GLN B 1 45  ? 35.681  60.370  132.043 1.00 82.14  ? 42  GLN B N   1 
ATOM 4187  C CA  . GLN B 1 45  ? 35.463  61.085  133.306 1.00 100.55 ? 42  GLN B CA  1 
ATOM 4188  C C   . GLN B 1 45  ? 36.236  62.405  133.350 1.00 93.43  ? 42  GLN B C   1 
ATOM 4189  O O   . GLN B 1 45  ? 37.436  62.441  133.069 1.00 67.61  ? 42  GLN B O   1 
ATOM 4190  C CB  . GLN B 1 45  ? 35.812  60.209  134.520 1.00 81.08  ? 42  GLN B CB  1 
ATOM 4191  N N   . GLY B 1 46  ? 35.537  63.489  133.682 1.00 77.43  ? 43  GLY B N   1 
ATOM 4192  C CA  . GLY B 1 46  ? 36.168  64.794  133.805 1.00 76.96  ? 43  GLY B CA  1 
ATOM 4193  C C   . GLY B 1 46  ? 36.357  65.579  132.518 1.00 93.82  ? 43  GLY B C   1 
ATOM 4194  O O   . GLY B 1 46  ? 36.662  66.774  132.557 1.00 80.19  ? 43  GLY B O   1 
ATOM 4195  N N   . SER B 1 47  ? 36.184  64.919  131.376 1.00 93.60  ? 44  SER B N   1 
ATOM 4196  C CA  . SER B 1 47  ? 36.260  65.608  130.092 1.00 82.49  ? 44  SER B CA  1 
ATOM 4197  C C   . SER B 1 47  ? 35.140  66.639  130.008 1.00 71.54  ? 44  SER B C   1 
ATOM 4198  O O   . SER B 1 47  ? 34.071  66.453  130.590 1.00 82.50  ? 44  SER B O   1 
ATOM 4199  C CB  . SER B 1 47  ? 36.166  64.619  128.926 1.00 70.74  ? 44  SER B CB  1 
ATOM 4200  O OG  . SER B 1 47  ? 34.845  64.135  128.769 1.00 77.62  ? 44  SER B OG  1 
ATOM 4201  N N   . PRO B 1 48  ? 35.395  67.745  129.300 1.00 66.65  ? 45  PRO B N   1 
ATOM 4202  C CA  . PRO B 1 48  ? 34.453  68.869  129.156 1.00 73.31  ? 45  PRO B CA  1 
ATOM 4203  C C   . PRO B 1 48  ? 33.143  68.456  128.514 1.00 74.79  ? 45  PRO B C   1 
ATOM 4204  O O   . PRO B 1 48  ? 32.091  68.958  128.902 1.00 72.74  ? 45  PRO B O   1 
ATOM 4205  C CB  . PRO B 1 48  ? 35.191  69.834  128.230 1.00 58.38  ? 45  PRO B CB  1 
ATOM 4206  C CG  . PRO B 1 48  ? 36.642  69.471  128.366 1.00 74.51  ? 45  PRO B CG  1 
ATOM 4207  C CD  . PRO B 1 48  ? 36.684  67.995  128.632 1.00 57.00  ? 45  PRO B CD  1 
ATOM 4208  N N   . GLU B 1 49  ? 33.220  67.549  127.545 1.00 67.38  ? 46  GLU B N   1 
ATOM 4209  C CA  . GLU B 1 49  ? 32.050  67.119  126.789 1.00 78.89  ? 46  GLU B CA  1 
ATOM 4210  C C   . GLU B 1 49  ? 31.126  66.293  127.662 1.00 71.81  ? 46  GLU B C   1 
ATOM 4211  O O   . GLU B 1 49  ? 29.907  66.403  127.547 1.00 70.35  ? 46  GLU B O   1 
ATOM 4212  C CB  . GLU B 1 49  ? 32.445  66.351  125.512 1.00 61.69  ? 46  GLU B CB  1 
ATOM 4213  C CG  . GLU B 1 49  ? 33.176  65.005  125.733 1.00 66.70  ? 46  GLU B CG  1 
ATOM 4214  C CD  . GLU B 1 49  ? 34.690  65.097  125.580 1.00 79.10  ? 46  GLU B CD  1 
ATOM 4215  O OE1 . GLU B 1 49  ? 35.319  64.033  125.383 1.00 61.46  ? 46  GLU B OE1 1 
ATOM 4216  O OE2 . GLU B 1 49  ? 35.247  66.220  125.665 1.00 68.89  ? 46  GLU B OE2 1 
ATOM 4217  N N   . ARG B 1 50  ? 31.708  65.480  128.542 1.00 63.72  ? 47  ARG B N   1 
ATOM 4218  C CA  . ARG B 1 50  ? 30.917  64.670  129.471 1.00 80.41  ? 47  ARG B CA  1 
ATOM 4219  C C   . ARG B 1 50  ? 30.212  65.530  130.536 1.00 74.41  ? 47  ARG B C   1 
ATOM 4220  O O   . ARG B 1 50  ? 29.089  65.236  130.939 1.00 60.31  ? 47  ARG B O   1 
ATOM 4221  C CB  . ARG B 1 50  ? 31.778  63.590  130.117 1.00 58.54  ? 47  ARG B CB  1 
ATOM 4222  C CG  . ARG B 1 50  ? 31.017  62.603  130.969 1.00 58.76  ? 47  ARG B CG  1 
ATOM 4223  C CD  . ARG B 1 50  ? 31.986  61.678  131.697 1.00 71.97  ? 47  ARG B CD  1 
ATOM 4224  N NE  . ARG B 1 50  ? 31.340  60.666  132.540 1.00 59.75  ? 47  ARG B NE  1 
ATOM 4225  C CZ  . ARG B 1 50  ? 31.470  59.352  132.366 1.00 75.34  ? 47  ARG B CZ  1 
ATOM 4226  N NH1 . ARG B 1 50  ? 32.210  58.882  131.370 1.00 63.29  ? 47  ARG B NH1 1 
ATOM 4227  N NH2 . ARG B 1 50  ? 30.869  58.501  133.188 1.00 68.28  ? 47  ARG B NH2 1 
ATOM 4228  N N   . ASP B 1 51  ? 30.851  66.611  130.970 1.00 55.06  ? 48  ASP B N   1 
ATOM 4229  C CA  . ASP B 1 51  ? 30.197  67.516  131.916 1.00 75.46  ? 48  ASP B CA  1 
ATOM 4230  C C   . ASP B 1 51  ? 29.070  68.293  131.216 1.00 74.62  ? 48  ASP B C   1 
ATOM 4231  O O   . ASP B 1 51  ? 27.952  68.373  131.730 1.00 68.87  ? 48  ASP B O   1 
ATOM 4232  C CB  . ASP B 1 51  ? 31.209  68.445  132.625 1.00 68.17  ? 48  ASP B CB  1 
ATOM 4233  N N   . ALA B 1 52  ? 29.352  68.835  130.029 1.00 74.64  ? 49  ALA B N   1 
ATOM 4234  C CA  . ALA B 1 52  ? 28.322  69.506  129.217 1.00 68.59  ? 49  ALA B CA  1 
ATOM 4235  C C   . ALA B 1 52  ? 27.078  68.633  128.988 1.00 69.75  ? 49  ALA B C   1 
ATOM 4236  O O   . ALA B 1 52  ? 25.931  69.108  129.080 1.00 48.49  ? 49  ALA B O   1 
ATOM 4237  C CB  . ALA B 1 52  ? 28.898  69.956  127.860 1.00 63.22  ? 49  ALA B CB  1 
ATOM 4238  N N   . LEU B 1 53  ? 27.318  67.359  128.677 1.00 60.92  ? 50  LEU B N   1 
ATOM 4239  C CA  . LEU B 1 53  ? 26.250  66.424  128.334 1.00 64.12  ? 50  LEU B CA  1 
ATOM 4240  C C   . LEU B 1 53  ? 25.409  66.062  129.541 1.00 71.49  ? 50  LEU B C   1 
ATOM 4241  O O   . LEU B 1 53  ? 24.197  65.873  129.423 1.00 61.02  ? 50  LEU B O   1 
ATOM 4242  C CB  . LEU B 1 53  ? 26.820  65.158  127.677 1.00 52.02  ? 50  LEU B CB  1 
ATOM 4243  C CG  . LEU B 1 53  ? 25.849  63.983  127.521 1.00 58.74  ? 50  LEU B CG  1 
ATOM 4244  C CD1 . LEU B 1 53  ? 24.672  64.366  126.646 1.00 53.54  ? 50  LEU B CD1 1 
ATOM 4245  C CD2 . LEU B 1 53  ? 26.549  62.758  126.963 1.00 55.89  ? 50  LEU B CD2 1 
ATOM 4246  N N   . GLN B 1 54  ? 26.057  65.958  130.701 1.00 82.63  ? 51  GLN B N   1 
ATOM 4247  C CA  . GLN B 1 54  ? 25.342  65.635  131.925 1.00 72.72  ? 51  GLN B CA  1 
ATOM 4248  C C   . GLN B 1 54  ? 24.464  66.805  132.364 1.00 70.58  ? 51  GLN B C   1 
ATOM 4249  O O   . GLN B 1 54  ? 23.347  66.579  132.824 1.00 51.39  ? 51  GLN B O   1 
ATOM 4250  C CB  . GLN B 1 54  ? 26.288  65.171  133.034 1.00 77.73  ? 51  GLN B CB  1 
ATOM 4251  C CG  . GLN B 1 54  ? 26.025  63.738  133.476 1.00 80.22  ? 51  GLN B CG  1 
ATOM 4252  C CD  . GLN B 1 54  ? 27.295  63.005  133.843 1.00 103.95 ? 51  GLN B CD  1 
ATOM 4253  O OE1 . GLN B 1 54  ? 27.291  61.785  134.011 1.00 101.36 ? 51  GLN B OE1 1 
ATOM 4254  N NE2 . GLN B 1 54  ? 28.397  63.746  133.968 1.00 91.52  ? 51  GLN B NE2 1 
ATOM 4255  N N   . LYS B 1 55  ? 24.944  68.041  132.185 1.00 42.01  ? 52  LYS B N   1 
ATOM 4256  C CA  . LYS B 1 55  ? 24.112  69.228  132.428 1.00 51.23  ? 52  LYS B CA  1 
ATOM 4257  C C   . LYS B 1 55  ? 22.916  69.263  131.474 1.00 66.87  ? 52  LYS B C   1 
ATOM 4258  O O   . LYS B 1 55  ? 21.812  69.621  131.875 1.00 75.99  ? 52  LYS B O   1 
ATOM 4259  C CB  . LYS B 1 55  ? 24.924  70.531  132.315 1.00 46.90  ? 52  LYS B CB  1 
ATOM 4260  N N   . ALA B 1 56  ? 23.134  68.879  130.215 1.00 77.60  ? 53  ALA B N   1 
ATOM 4261  C CA  . ALA B 1 56  ? 22.062  68.866  129.208 1.00 64.54  ? 53  ALA B CA  1 
ATOM 4262  C C   . ALA B 1 56  ? 21.019  67.783  129.486 1.00 65.87  ? 53  ALA B C   1 
ATOM 4263  O O   . ALA B 1 56  ? 19.832  67.978  129.226 1.00 61.03  ? 53  ALA B O   1 
ATOM 4264  C CB  . ALA B 1 56  ? 22.637  68.703  127.795 1.00 60.04  ? 53  ALA B CB  1 
ATOM 4265  N N   . LEU B 1 57  ? 21.462  66.642  130.008 1.00 56.65  ? 54  LEU B N   1 
ATOM 4266  C CA  . LEU B 1 57  ? 20.533  65.598  130.438 1.00 74.05  ? 54  LEU B CA  1 
ATOM 4267  C C   . LEU B 1 57  ? 19.689  66.023  131.642 1.00 71.73  ? 54  LEU B C   1 
ATOM 4268  O O   . LEU B 1 57  ? 18.487  65.759  131.687 1.00 53.33  ? 54  LEU B O   1 
ATOM 4269  C CB  . LEU B 1 57  ? 21.282  64.304  130.748 1.00 65.27  ? 54  LEU B CB  1 
ATOM 4270  C CG  . LEU B 1 57  ? 21.852  63.598  129.522 1.00 56.10  ? 54  LEU B CG  1 
ATOM 4271  C CD1 . LEU B 1 57  ? 22.810  62.497  129.921 1.00 56.18  ? 54  LEU B CD1 1 
ATOM 4272  C CD2 . LEU B 1 57  ? 20.704  63.039  128.724 1.00 54.27  ? 54  LEU B CD2 1 
ATOM 4273  N N   . LYS B 1 58  ? 20.320  66.673  132.619 1.00 74.50  ? 55  LYS B N   1 
ATOM 4274  C CA  . LYS B 1 58  ? 19.606  67.125  133.817 1.00 77.76  ? 55  LYS B CA  1 
ATOM 4275  C C   . LYS B 1 58  ? 18.571  68.179  133.438 1.00 84.64  ? 55  LYS B C   1 
ATOM 4276  O O   . LYS B 1 58  ? 17.441  68.146  133.927 1.00 73.21  ? 55  LYS B O   1 
ATOM 4277  C CB  . LYS B 1 58  ? 20.568  67.655  134.892 1.00 53.19  ? 55  LYS B CB  1 
ATOM 4278  N N   . ASP B 1 59  ? 18.950  69.094  132.547 1.00 70.71  ? 56  ASP B N   1 
ATOM 4279  C CA  . ASP B 1 59  ? 18.042  70.145  132.090 1.00 76.31  ? 56  ASP B CA  1 
ATOM 4280  C C   . ASP B 1 59  ? 16.806  69.559  131.373 1.00 79.36  ? 56  ASP B C   1 
ATOM 4281  O O   . ASP B 1 59  ? 15.888  70.295  130.999 1.00 75.40  ? 56  ASP B O   1 
ATOM 4282  C CB  . ASP B 1 59  ? 18.785  71.158  131.198 1.00 50.12  ? 56  ASP B CB  1 
ATOM 4283  N N   . LEU B 1 60  ? 16.776  68.232  131.214 1.00 70.06  ? 57  LEU B N   1 
ATOM 4284  C CA  . LEU B 1 60  ? 15.686  67.538  130.513 1.00 67.55  ? 57  LEU B CA  1 
ATOM 4285  C C   . LEU B 1 60  ? 14.809  66.677  131.408 1.00 72.43  ? 57  LEU B C   1 
ATOM 4286  O O   . LEU B 1 60  ? 13.646  66.449  131.087 1.00 63.64  ? 57  LEU B O   1 
ATOM 4287  C CB  . LEU B 1 60  ? 16.223  66.641  129.388 1.00 80.31  ? 57  LEU B CB  1 
ATOM 4288  C CG  . LEU B 1 60  ? 16.589  67.198  128.015 1.00 67.28  ? 57  LEU B CG  1 
ATOM 4289  C CD1 . LEU B 1 60  ? 17.043  66.076  127.104 1.00 69.84  ? 57  LEU B CD1 1 
ATOM 4290  C CD2 . LEU B 1 60  ? 15.414  67.924  127.409 1.00 50.74  ? 57  LEU B CD2 1 
ATOM 4291  N N   . LYS B 1 61  ? 15.362  66.179  132.512 1.00 86.44  ? 58  LYS B N   1 
ATOM 4292  C CA  . LYS B 1 61  ? 14.586  65.342  133.428 1.00 79.78  ? 58  LYS B CA  1 
ATOM 4293  C C   . LYS B 1 61  ? 13.330  66.066  133.914 1.00 78.82  ? 58  LYS B C   1 
ATOM 4294  O O   . LYS B 1 61  ? 13.403  67.192  134.425 1.00 51.20  ? 58  LYS B O   1 
ATOM 4295  C CB  . LYS B 1 61  ? 15.434  64.886  134.617 1.00 64.36  ? 58  LYS B CB  1 
ATOM 4296  N N   . GLY B 1 62  ? 12.180  65.419  133.727 1.00 51.72  ? 59  GLY B N   1 
ATOM 4297  C CA  . GLY B 1 62  ? 10.910  65.946  134.195 1.00 72.98  ? 59  GLY B CA  1 
ATOM 4298  C C   . GLY B 1 62  ? 10.295  67.077  133.394 1.00 101.55 ? 59  GLY B C   1 
ATOM 4299  O O   . GLY B 1 62  ? 9.216   67.586  133.755 1.00 96.88  ? 59  GLY B O   1 
ATOM 4300  N N   . ARG B 1 63  ? 10.963  67.481  132.314 1.00 71.91  ? 60  ARG B N   1 
ATOM 4301  C CA  . ARG B 1 63  ? 10.411  68.521  131.463 1.00 69.66  ? 60  ARG B CA  1 
ATOM 4302  C C   . ARG B 1 63  ? 9.832   67.918  130.168 1.00 70.28  ? 60  ARG B C   1 
ATOM 4303  O O   . ARG B 1 63  ? 10.308  66.895  129.692 1.00 67.98  ? 60  ARG B O   1 
ATOM 4304  C CB  . ARG B 1 63  ? 11.455  69.603  131.210 1.00 56.28  ? 60  ARG B CB  1 
ATOM 4305  N N   . MET B 1 64  ? 8.777   68.532  129.632 1.00 84.01  ? 61  MET B N   1 
ATOM 4306  C CA  . MET B 1 64  ? 8.134   68.065  128.401 1.00 58.03  ? 61  MET B CA  1 
ATOM 4307  C C   . MET B 1 64  ? 8.061   69.215  127.419 1.00 55.52  ? 61  MET B C   1 
ATOM 4308  O O   . MET B 1 64  ? 7.395   70.209  127.685 1.00 68.95  ? 61  MET B O   1 
ATOM 4309  C CB  . MET B 1 64  ? 6.710   67.549  128.680 1.00 50.31  ? 61  MET B CB  1 
ATOM 4310  C CG  . MET B 1 64  ? 5.975   66.968  127.460 1.00 64.31  ? 61  MET B CG  1 
ATOM 4311  S SD  . MET B 1 64  ? 4.280   66.403  127.772 1.00 44.56  ? 61  MET B SD  1 
ATOM 4312  C CE  . MET B 1 64  ? 3.516   67.989  128.019 1.00 29.18  ? 61  MET B CE  1 
ATOM 4313  N N   . GLU B 1 65  ? 8.730   69.088  126.277 1.00 68.00  ? 62  GLU B N   1 
ATOM 4314  C CA  . GLU B 1 65  ? 8.717   70.164  125.288 1.00 41.98  ? 62  GLU B CA  1 
ATOM 4315  C C   . GLU B 1 65  ? 7.430   70.136  124.447 1.00 64.16  ? 62  GLU B C   1 
ATOM 4316  O O   . GLU B 1 65  ? 7.014   69.080  123.964 1.00 58.36  ? 62  GLU B O   1 
ATOM 4317  C CB  . GLU B 1 65  ? 9.966   70.109  124.403 1.00 54.53  ? 62  GLU B CB  1 
ATOM 4318  C CG  . GLU B 1 65  ? 9.995   71.185  123.321 1.00 69.99  ? 62  GLU B CG  1 
ATOM 4319  C CD  . GLU B 1 65  ? 11.355  71.347  122.666 1.00 77.80  ? 62  GLU B CD  1 
ATOM 4320  O OE1 . GLU B 1 65  ? 12.282  70.584  123.011 1.00 103.25 ? 62  GLU B OE1 1 
ATOM 4321  O OE2 . GLU B 1 65  ? 11.487  72.252  121.811 1.00 72.38  ? 62  GLU B OE2 1 
ATOM 4322  N N   . ALA B 1 66  ? 6.783   71.292  124.297 1.00 48.15  ? 63  ALA B N   1 
ATOM 4323  C CA  . ALA B 1 66  ? 5.655   71.403  123.378 1.00 66.86  ? 63  ALA B CA  1 
ATOM 4324  C C   . ALA B 1 66  ? 6.111   71.820  121.965 1.00 69.58  ? 63  ALA B C   1 
ATOM 4325  O O   . ALA B 1 66  ? 6.655   72.911  121.770 1.00 50.81  ? 63  ALA B O   1 
ATOM 4326  C CB  . ALA B 1 66  ? 4.592   72.349  123.934 1.00 34.05  ? 63  ALA B CB  1 
ATOM 4327  N N   . ILE B 1 67  ? 5.886   70.928  121.000 1.00 55.76  ? 64  ILE B N   1 
ATOM 4328  C CA  . ILE B 1 67  ? 6.409   71.070  119.638 1.00 59.37  ? 64  ILE B CA  1 
ATOM 4329  C C   . ILE B 1 67  ? 5.296   71.239  118.598 1.00 41.22  ? 64  ILE B C   1 
ATOM 4330  O O   . ILE B 1 67  ? 4.516   70.314  118.337 1.00 42.83  ? 64  ILE B O   1 
ATOM 4331  C CB  . ILE B 1 67  ? 7.313   69.876  119.260 1.00 57.04  ? 64  ILE B CB  1 
ATOM 4332  C CG1 . ILE B 1 67  ? 8.514   69.800  120.203 1.00 50.63  ? 64  ILE B CG1 1 
ATOM 4333  C CG2 . ILE B 1 67  ? 7.792   70.011  117.827 1.00 48.90  ? 64  ILE B CG2 1 
ATOM 4334  C CD1 . ILE B 1 67  ? 9.362   68.538  120.041 1.00 40.19  ? 64  ILE B CD1 1 
ATOM 4335  N N   . PRO B 1 68  ? 5.218   72.434  117.998 1.00 51.25  ? 65  PRO B N   1 
ATOM 4336  C CA  . PRO B 1 68  ? 4.170   72.753  117.030 1.00 42.84  ? 65  PRO B CA  1 
ATOM 4337  C C   . PRO B 1 68  ? 4.573   72.293  115.648 1.00 52.66  ? 65  PRO B C   1 
ATOM 4338  O O   . PRO B 1 68  ? 5.737   71.971  115.452 1.00 48.30  ? 65  PRO B O   1 
ATOM 4339  C CB  . PRO B 1 68  ? 4.161   74.275  117.050 1.00 48.83  ? 65  PRO B CB  1 
ATOM 4340  C CG  . PRO B 1 68  ? 5.603   74.627  117.252 1.00 41.53  ? 65  PRO B CG  1 
ATOM 4341  C CD  . PRO B 1 68  ? 6.160   73.555  118.171 1.00 46.30  ? 65  PRO B CD  1 
ATOM 4342  N N   . CYS B 1 69  ? 3.637   72.257  114.707 1.00 57.70  ? 66  CYS B N   1 
ATOM 4343  C CA  . CYS B 1 69  ? 4.016   72.226  113.297 1.00 51.45  ? 66  CYS B CA  1 
ATOM 4344  C C   . CYS B 1 69  ? 4.537   73.604  112.964 1.00 59.72  ? 66  CYS B C   1 
ATOM 4345  O O   . CYS B 1 69  ? 4.064   74.594  113.525 1.00 52.61  ? 66  CYS B O   1 
ATOM 4346  C CB  . CYS B 1 69  ? 2.829   71.898  112.409 1.00 34.89  ? 66  CYS B CB  1 
ATOM 4347  S SG  . CYS B 1 69  ? 2.261   70.240  112.662 1.00 44.81  ? 66  CYS B SG  1 
ATOM 4348  N N   . VAL B 1 70  ? 5.527   73.669  112.081 1.00 45.34  ? 67  VAL B N   1 
ATOM 4349  C CA  . VAL B 1 70  ? 6.037   74.948  111.627 1.00 43.37  ? 67  VAL B CA  1 
ATOM 4350  C C   . VAL B 1 70  ? 5.856   75.060  110.118 1.00 51.83  ? 67  VAL B C   1 
ATOM 4351  O O   . VAL B 1 70  ? 6.465   74.330  109.340 1.00 53.30  ? 67  VAL B O   1 
ATOM 4352  C CB  . VAL B 1 70  ? 7.508   75.145  112.016 1.00 30.86  ? 67  VAL B CB  1 
ATOM 4353  C CG1 . VAL B 1 70  ? 8.004   76.488  111.523 1.00 24.74  ? 67  VAL B CG1 1 
ATOM 4354  C CG2 . VAL B 1 70  ? 7.669   75.037  113.496 1.00 34.59  ? 67  VAL B CG2 1 
ATOM 4355  N N   . VAL B 1 71  ? 4.989   75.967  109.715 1.00 33.64  ? 68  VAL B N   1 
ATOM 4356  C CA  . VAL B 1 71  ? 4.801   76.283  108.319 1.00 37.02  ? 68  VAL B CA  1 
ATOM 4357  C C   . VAL B 1 71  ? 5.237   77.728  108.086 1.00 50.77  ? 68  VAL B C   1 
ATOM 4358  O O   . VAL B 1 71  ? 4.674   78.646  108.672 1.00 44.25  ? 68  VAL B O   1 
ATOM 4359  C CB  . VAL B 1 71  ? 3.353   76.078  107.911 1.00 45.41  ? 68  VAL B CB  1 
ATOM 4360  C CG1 . VAL B 1 71  ? 3.171   76.355  106.403 1.00 51.94  ? 68  VAL B CG1 1 
ATOM 4361  C CG2 . VAL B 1 71  ? 2.942   74.672  108.242 1.00 40.78  ? 68  VAL B CG2 1 
ATOM 4362  N N   . GLY B 1 72  ? 6.242   77.926  107.236 1.00 42.89  ? 69  GLY B N   1 
ATOM 4363  C CA  . GLY B 1 72  ? 6.837   79.237  107.094 1.00 42.72  ? 69  GLY B CA  1 
ATOM 4364  C C   . GLY B 1 72  ? 7.515   79.621  108.398 1.00 56.23  ? 69  GLY B C   1 
ATOM 4365  O O   . GLY B 1 72  ? 8.520   79.029  108.789 1.00 52.06  ? 69  GLY B O   1 
ATOM 4366  N N   . ASP B 1 73  ? 6.972   80.632  109.063 1.00 54.80  ? 70  ASP B N   1 
ATOM 4367  C CA  . ASP B 1 73  ? 7.439   81.015  110.392 1.00 50.17  ? 70  ASP B CA  1 
ATOM 4368  C C   . ASP B 1 73  ? 6.330   80.862  111.440 1.00 52.42  ? 70  ASP B C   1 
ATOM 4369  O O   . ASP B 1 73  ? 6.575   81.034  112.626 1.00 60.22  ? 70  ASP B O   1 
ATOM 4370  C CB  . ASP B 1 73  ? 7.956   82.452  110.393 1.00 41.78  ? 70  ASP B CB  1 
ATOM 4371  C CG  . ASP B 1 73  ? 9.336   82.579  109.803 1.00 68.12  ? 70  ASP B CG  1 
ATOM 4372  O OD1 . ASP B 1 73  ? 10.135  81.642  110.003 1.00 59.78  ? 70  ASP B OD1 1 
ATOM 4373  O OD2 . ASP B 1 73  ? 9.615   83.614  109.154 1.00 61.02  ? 70  ASP B OD2 1 
ATOM 4374  N N   . GLU B 1 74  ? 5.111   80.559  110.990 1.00 45.86  ? 71  GLU B N   1 
ATOM 4375  C CA  . GLU B 1 74  ? 3.970   80.378  111.881 1.00 63.57  ? 71  GLU B CA  1 
ATOM 4376  C C   . GLU B 1 74  ? 4.066   79.034  112.576 1.00 60.34  ? 71  GLU B C   1 
ATOM 4377  O O   . GLU B 1 74  ? 4.216   78.006  111.927 1.00 61.30  ? 71  GLU B O   1 
ATOM 4378  C CB  . GLU B 1 74  ? 2.615   80.503  111.136 1.00 37.65  ? 71  GLU B CB  1 
ATOM 4379  N N   . GLU B 1 75  ? 4.004   79.053  113.905 1.00 56.88  ? 72  GLU B N   1 
ATOM 4380  C CA  . GLU B 1 75  ? 3.843   77.837  114.687 1.00 51.72  ? 72  GLU B CA  1 
ATOM 4381  C C   . GLU B 1 75  ? 2.380   77.464  114.643 1.00 50.94  ? 72  GLU B C   1 
ATOM 4382  O O   . GLU B 1 75  ? 1.521   78.280  114.939 1.00 78.51  ? 72  GLU B O   1 
ATOM 4383  C CB  . GLU B 1 75  ? 4.276   78.055  116.131 1.00 43.85  ? 72  GLU B CB  1 
ATOM 4384  C CG  . GLU B 1 75  ? 5.770   78.266  116.299 1.00 65.53  ? 72  GLU B CG  1 
ATOM 4385  C CD  . GLU B 1 75  ? 6.164   78.550  117.740 1.00 92.13  ? 72  GLU B CD  1 
ATOM 4386  O OE1 . GLU B 1 75  ? 5.310   78.404  118.645 1.00 82.43  ? 72  GLU B OE1 1 
ATOM 4387  O OE2 . GLU B 1 75  ? 7.334   78.922  117.966 1.00 85.96  ? 72  GLU B OE2 1 
ATOM 4388  N N   . VAL B 1 76  ? 2.083   76.232  114.267 1.00 56.23  ? 73  VAL B N   1 
ATOM 4389  C CA  . VAL B 1 76  ? 0.693   75.843  114.109 1.00 42.50  ? 73  VAL B CA  1 
ATOM 4390  C C   . VAL B 1 76  ? 0.366   74.623  114.945 1.00 64.28  ? 73  VAL B C   1 
ATOM 4391  O O   . VAL B 1 76  ? 1.129   73.660  114.989 1.00 54.61  ? 73  VAL B O   1 
ATOM 4392  C CB  . VAL B 1 76  ? 0.324   75.590  112.623 1.00 53.38  ? 73  VAL B CB  1 
ATOM 4393  C CG1 . VAL B 1 76  ? -1.123  75.188  112.475 1.00 31.80  ? 73  VAL B CG1 1 
ATOM 4394  C CG2 . VAL B 1 76  ? 0.552   76.837  111.825 1.00 44.10  ? 73  VAL B CG2 1 
ATOM 4395  N N   . TRP B 1 77  ? -0.776  74.685  115.619 1.00 53.35  ? 74  TRP B N   1 
ATOM 4396  C CA  . TRP B 1 77  ? -1.246  73.581  116.423 1.00 42.30  ? 74  TRP B CA  1 
ATOM 4397  C C   . TRP B 1 77  ? -2.547  73.068  115.838 1.00 47.30  ? 74  TRP B C   1 
ATOM 4398  O O   . TRP B 1 77  ? -3.366  73.856  115.376 1.00 61.53  ? 74  TRP B O   1 
ATOM 4399  C CB  . TRP B 1 77  ? -1.435  74.039  117.879 1.00 50.18  ? 74  TRP B CB  1 
ATOM 4400  C CG  . TRP B 1 77  ? -0.151  74.105  118.638 1.00 27.86  ? 74  TRP B CG  1 
ATOM 4401  C CD1 . TRP B 1 77  ? 0.651   75.204  118.821 1.00 49.04  ? 74  TRP B CD1 1 
ATOM 4402  C CD2 . TRP B 1 77  ? 0.494   73.023  119.303 1.00 29.28  ? 74  TRP B CD2 1 
ATOM 4403  N NE1 . TRP B 1 77  ? 1.770   74.861  119.566 1.00 37.61  ? 74  TRP B NE1 1 
ATOM 4404  C CE2 . TRP B 1 77  ? 1.696   73.525  119.862 1.00 36.45  ? 74  TRP B CE2 1 
ATOM 4405  C CE3 . TRP B 1 77  ? 0.180   71.671  119.479 1.00 41.53  ? 74  TRP B CE3 1 
ATOM 4406  C CZ2 . TRP B 1 77  ? 2.568   72.726  120.582 1.00 39.31  ? 74  TRP B CZ2 1 
ATOM 4407  C CZ3 . TRP B 1 77  ? 1.052   70.877  120.198 1.00 44.08  ? 74  TRP B CZ3 1 
ATOM 4408  C CH2 . TRP B 1 77  ? 2.235   71.407  120.740 1.00 35.66  ? 74  TRP B CH2 1 
ATOM 4409  N N   . THR B 1 78  ? -2.737  71.752  115.842 1.00 42.04  ? 75  THR B N   1 
ATOM 4410  C CA  . THR B 1 78  ? -4.034  71.174  115.487 1.00 44.83  ? 75  THR B CA  1 
ATOM 4411  C C   . THR B 1 78  ? -4.614  70.439  116.685 1.00 56.33  ? 75  THR B C   1 
ATOM 4412  O O   . THR B 1 78  ? -3.948  70.272  117.700 1.00 67.05  ? 75  THR B O   1 
ATOM 4413  C CB  . THR B 1 78  ? -3.956  70.181  114.302 1.00 63.27  ? 75  THR B CB  1 
ATOM 4414  O OG1 . THR B 1 78  ? -3.371  68.953  114.742 1.00 42.77  ? 75  THR B OG1 1 
ATOM 4415  C CG2 . THR B 1 78  ? -3.162  70.759  113.141 1.00 57.43  ? 75  THR B CG2 1 
ATOM 4416  N N   . SER B 1 79  ? -5.855  69.988  116.568 1.00 63.03  ? 76  SER B N   1 
ATOM 4417  C CA  . SER B 1 79  ? -6.507  69.286  117.668 1.00 55.84  ? 76  SER B CA  1 
ATOM 4418  C C   . SER B 1 79  ? -5.972  67.868  117.890 1.00 68.24  ? 76  SER B C   1 
ATOM 4419  O O   . SER B 1 79  ? -6.299  67.224  118.889 1.00 70.09  ? 76  SER B O   1 
ATOM 4420  C CB  . SER B 1 79  ? -8.021  69.247  117.451 1.00 56.86  ? 76  SER B CB  1 
ATOM 4421  O OG  . SER B 1 79  ? -8.361  68.606  116.235 1.00 66.27  ? 76  SER B OG  1 
ATOM 4422  N N   . ASP B 1 80  ? -5.153  67.387  116.958 1.00 74.25  ? 77  ASP B N   1 
ATOM 4423  C CA  . ASP B 1 80  ? -4.663  66.007  116.974 1.00 61.87  ? 77  ASP B CA  1 
ATOM 4424  C C   . ASP B 1 80  ? -3.323  65.902  117.722 1.00 80.54  ? 77  ASP B C   1 
ATOM 4425  O O   . ASP B 1 80  ? -2.267  65.637  117.128 1.00 52.68  ? 77  ASP B O   1 
ATOM 4426  C CB  . ASP B 1 80  ? -4.525  65.485  115.538 1.00 46.95  ? 77  ASP B CB  1 
ATOM 4427  C CG  . ASP B 1 80  ? -4.489  63.959  115.451 1.00 64.71  ? 77  ASP B CG  1 
ATOM 4428  O OD1 . ASP B 1 80  ? -4.337  63.287  116.489 1.00 66.97  ? 77  ASP B OD1 1 
ATOM 4429  O OD2 . ASP B 1 80  ? -4.616  63.434  114.322 1.00 67.93  ? 77  ASP B OD2 1 
ATOM 4430  N N   . VAL B 1 81  ? -3.384  66.105  119.035 1.00 61.10  ? 78  VAL B N   1 
ATOM 4431  C CA  . VAL B 1 81  ? -2.207  66.117  119.891 1.00 51.83  ? 78  VAL B CA  1 
ATOM 4432  C C   . VAL B 1 81  ? -1.642  64.714  120.108 1.00 56.45  ? 78  VAL B C   1 
ATOM 4433  O O   . VAL B 1 81  ? -2.388  63.755  120.254 1.00 51.90  ? 78  VAL B O   1 
ATOM 4434  C CB  . VAL B 1 81  ? -2.513  66.784  121.244 1.00 64.62  ? 78  VAL B CB  1 
ATOM 4435  C CG1 . VAL B 1 81  ? -1.293  66.763  122.122 1.00 67.76  ? 78  VAL B CG1 1 
ATOM 4436  C CG2 . VAL B 1 81  ? -3.007  68.219  121.042 1.00 61.05  ? 78  VAL B CG2 1 
ATOM 4437  N N   . GLN B 1 82  ? -0.315  64.610  120.106 1.00 41.01  ? 79  GLN B N   1 
ATOM 4438  C CA  . GLN B 1 82  ? 0.395   63.332  120.240 1.00 46.52  ? 79  GLN B CA  1 
ATOM 4439  C C   . GLN B 1 82  ? 1.544   63.505  121.226 1.00 50.55  ? 79  GLN B C   1 
ATOM 4440  O O   . GLN B 1 82  ? 2.017   64.622  121.451 1.00 64.30  ? 79  GLN B O   1 
ATOM 4441  C CB  . GLN B 1 82  ? 0.995   62.897  118.891 1.00 68.48  ? 79  GLN B CB  1 
ATOM 4442  C CG  . GLN B 1 82  ? 0.026   62.824  117.723 1.00 55.11  ? 79  GLN B CG  1 
ATOM 4443  C CD  . GLN B 1 82  ? -0.884  61.640  117.838 1.00 67.70  ? 79  GLN B CD  1 
ATOM 4444  O OE1 . GLN B 1 82  ? -0.485  60.603  118.348 1.00 61.09  ? 79  GLN B OE1 1 
ATOM 4445  N NE2 . GLN B 1 82  ? -2.122  61.786  117.382 1.00 64.75  ? 79  GLN B NE2 1 
ATOM 4446  N N   . TYR B 1 83  ? 2.014   62.403  121.798 1.00 54.36  ? 80  TYR B N   1 
ATOM 4447  C CA  . TYR B 1 83  ? 3.113   62.477  122.757 1.00 56.69  ? 80  TYR B CA  1 
ATOM 4448  C C   . TYR B 1 83  ? 4.270   61.574  122.372 1.00 57.66  ? 80  TYR B C   1 
ATOM 4449  O O   . TYR B 1 83  ? 4.079   60.501  121.804 1.00 64.16  ? 80  TYR B O   1 
ATOM 4450  C CB  . TYR B 1 83  ? 2.637   62.156  124.190 1.00 52.79  ? 80  TYR B CB  1 
ATOM 4451  C CG  . TYR B 1 83  ? 1.596   63.121  124.712 1.00 54.88  ? 80  TYR B CG  1 
ATOM 4452  C CD1 . TYR B 1 83  ? 0.243   62.897  124.476 1.00 43.23  ? 80  TYR B CD1 1 
ATOM 4453  C CD2 . TYR B 1 83  ? 1.963   64.268  125.428 1.00 49.69  ? 80  TYR B CD2 1 
ATOM 4454  C CE1 . TYR B 1 83  ? -0.727  63.795  124.924 1.00 58.55  ? 80  TYR B CE1 1 
ATOM 4455  C CE2 . TYR B 1 83  ? 0.999   65.172  125.882 1.00 55.52  ? 80  TYR B CE2 1 
ATOM 4456  C CZ  . TYR B 1 83  ? -0.347  64.926  125.628 1.00 71.22  ? 80  TYR B CZ  1 
ATOM 4457  O OH  . TYR B 1 83  ? -1.319  65.805  126.072 1.00 79.23  ? 80  TYR B OH  1 
ATOM 4458  N N   . GLN B 1 84  ? 5.477   62.023  122.684 1.00 51.06  ? 81  GLN B N   1 
ATOM 4459  C CA  . GLN B 1 84  ? 6.648   61.185  122.547 1.00 58.50  ? 81  GLN B CA  1 
ATOM 4460  C C   . GLN B 1 84  ? 7.148   60.843  123.942 1.00 63.41  ? 81  GLN B C   1 
ATOM 4461  O O   . GLN B 1 84  ? 7.337   61.725  124.771 1.00 65.80  ? 81  GLN B O   1 
ATOM 4462  C CB  . GLN B 1 84  ? 7.730   61.910  121.747 1.00 63.36  ? 81  GLN B CB  1 
ATOM 4463  C CG  . GLN B 1 84  ? 8.964   61.063  121.449 1.00 52.17  ? 81  GLN B CG  1 
ATOM 4464  C CD  . GLN B 1 84  ? 10.185  61.911  121.147 1.00 56.18  ? 81  GLN B CD  1 
ATOM 4465  O OE1 . GLN B 1 84  ? 10.088  63.123  121.020 1.00 44.42  ? 81  GLN B OE1 1 
ATOM 4466  N NE2 . GLN B 1 84  ? 11.338  61.278  121.041 1.00 44.23  ? 81  GLN B NE2 1 
ATOM 4467  N N   . VAL B 1 85  ? 7.353   59.557  124.202 1.00 55.60  ? 82  VAL B N   1 
ATOM 4468  C CA  . VAL B 1 85  ? 7.799   59.105  125.518 1.00 56.17  ? 82  VAL B CA  1 
ATOM 4469  C C   . VAL B 1 85  ? 9.209   58.506  125.484 1.00 64.35  ? 82  VAL B C   1 
ATOM 4470  O O   . VAL B 1 85  ? 9.625   57.920  124.495 1.00 57.04  ? 82  VAL B O   1 
ATOM 4471  C CB  . VAL B 1 85  ? 6.805   58.072  126.164 1.00 60.60  ? 82  VAL B CB  1 
ATOM 4472  C CG1 . VAL B 1 85  ? 5.383   58.590  126.136 1.00 48.54  ? 82  VAL B CG1 1 
ATOM 4473  C CG2 . VAL B 1 85  ? 6.878   56.721  125.469 1.00 41.11  ? 82  VAL B CG2 1 
ATOM 4474  N N   . SER B 1 86  ? 9.941   58.655  126.581 1.00 66.99  ? 83  SER B N   1 
ATOM 4475  C CA  . SER B 1 86  ? 11.263  58.058  126.708 1.00 60.45  ? 83  SER B CA  1 
ATOM 4476  C C   . SER B 1 86  ? 11.169  56.527  126.705 1.00 55.60  ? 83  SER B C   1 
ATOM 4477  O O   . SER B 1 86  ? 10.454  55.964  127.515 1.00 58.55  ? 83  SER B O   1 
ATOM 4478  C CB  . SER B 1 86  ? 11.918  58.571  127.987 1.00 39.31  ? 83  SER B CB  1 
ATOM 4479  O OG  . SER B 1 86  ? 13.218  58.059  128.142 1.00 60.62  ? 83  SER B OG  1 
ATOM 4480  N N   . PRO B 1 87  ? 11.844  55.852  125.754 1.00 72.80  ? 84  PRO B N   1 
ATOM 4481  C CA  . PRO B 1 87  ? 11.744  54.389  125.569 1.00 55.50  ? 84  PRO B CA  1 
ATOM 4482  C C   . PRO B 1 87  ? 12.099  53.547  126.820 1.00 60.37  ? 84  PRO B C   1 
ATOM 4483  O O   . PRO B 1 87  ? 11.510  52.492  127.027 1.00 66.76  ? 84  PRO B O   1 
ATOM 4484  C CB  . PRO B 1 87  ? 12.772  54.103  124.454 1.00 51.01  ? 84  PRO B CB  1 
ATOM 4485  C CG  . PRO B 1 87  ? 12.951  55.355  123.768 1.00 45.52  ? 84  PRO B CG  1 
ATOM 4486  C CD  . PRO B 1 87  ? 12.731  56.468  124.754 1.00 57.31  ? 84  PRO B CD  1 
ATOM 4487  N N   . PHE B 1 88  ? 13.065  53.995  127.621 1.00 56.88  ? 85  PHE B N   1 
ATOM 4488  C CA  . PHE B 1 88  ? 13.499  53.266  128.817 1.00 63.19  ? 85  PHE B CA  1 
ATOM 4489  C C   . PHE B 1 88  ? 12.695  53.668  130.061 1.00 61.74  ? 85  PHE B C   1 
ATOM 4490  O O   . PHE B 1 88  ? 12.912  53.156  131.157 1.00 77.37  ? 85  PHE B O   1 
ATOM 4491  C CB  . PHE B 1 88  ? 15.000  53.494  129.061 1.00 61.28  ? 85  PHE B CB  1 
ATOM 4492  C CG  . PHE B 1 88  ? 15.398  54.942  129.062 1.00 75.22  ? 85  PHE B CG  1 
ATOM 4493  C CD1 . PHE B 1 88  ? 15.297  55.709  130.222 1.00 70.72  ? 85  PHE B CD1 1 
ATOM 4494  C CD2 . PHE B 1 88  ? 15.854  55.545  127.903 1.00 51.41  ? 85  PHE B CD2 1 
ATOM 4495  C CE1 . PHE B 1 88  ? 15.650  57.053  130.232 1.00 55.11  ? 85  PHE B CE1 1 
ATOM 4496  C CE2 . PHE B 1 88  ? 16.217  56.888  127.898 1.00 52.88  ? 85  PHE B CE2 1 
ATOM 4497  C CZ  . PHE B 1 88  ? 16.117  57.643  129.070 1.00 77.10  ? 85  PHE B CZ  1 
ATOM 4498  N N   . ASN B 1 89  ? 11.762  54.593  129.877 1.00 70.42  ? 86  ASN B N   1 
ATOM 4499  C CA  . ASN B 1 89  ? 10.884  55.032  130.945 1.00 64.93  ? 86  ASN B CA  1 
ATOM 4500  C C   . ASN B 1 89  ? 9.606   55.625  130.388 1.00 56.86  ? 86  ASN B C   1 
ATOM 4501  O O   . ASN B 1 89  ? 9.409   56.848  130.406 1.00 47.37  ? 86  ASN B O   1 
ATOM 4502  C CB  . ASN B 1 89  ? 11.583  56.057  131.830 1.00 54.03  ? 86  ASN B CB  1 
ATOM 4503  C CG  . ASN B 1 89  ? 10.699  56.523  132.975 1.00 81.32  ? 86  ASN B CG  1 
ATOM 4504  O OD1 . ASN B 1 89  ? 10.915  57.590  133.552 1.00 69.11  ? 86  ASN B OD1 1 
ATOM 4505  N ND2 . ASN B 1 89  ? 9.678   55.727  133.293 1.00 60.95  ? 86  ASN B ND2 1 
ATOM 4506  N N   . HIS B 1 90  ? 8.727   54.757  129.905 1.00 51.16  ? 87  HIS B N   1 
ATOM 4507  C CA  . HIS B 1 90  ? 7.629   55.211  129.048 1.00 65.05  ? 87  HIS B CA  1 
ATOM 4508  C C   . HIS B 1 90  ? 6.558   55.999  129.783 1.00 67.98  ? 87  HIS B C   1 
ATOM 4509  O O   . HIS B 1 90  ? 5.559   56.418  129.192 1.00 75.97  ? 87  HIS B O   1 
ATOM 4510  C CB  . HIS B 1 90  ? 7.022   54.047  128.262 1.00 78.77  ? 87  HIS B CB  1 
ATOM 4511  C CG  . HIS B 1 90  ? 6.920   52.782  129.046 1.00 86.65  ? 87  HIS B CG  1 
ATOM 4512  N ND1 . HIS B 1 90  ? 6.303   52.719  130.277 1.00 89.23  ? 87  HIS B ND1 1 
ATOM 4513  C CD2 . HIS B 1 90  ? 7.362   51.530  128.779 1.00 80.54  ? 87  HIS B CD2 1 
ATOM 4514  C CE1 . HIS B 1 90  ? 6.375   51.483  130.738 1.00 84.38  ? 87  HIS B CE1 1 
ATOM 4515  N NE2 . HIS B 1 90  ? 7.010   50.741  129.848 1.00 92.72  ? 87  HIS B NE2 1 
ATOM 4516  N N   . GLY B 1 91  ? 6.772   56.206  131.074 1.00 71.68  ? 88  GLY B N   1 
ATOM 4517  C CA  . GLY B 1 91  ? 5.877   57.033  131.860 1.00 49.79  ? 88  GLY B CA  1 
ATOM 4518  C C   . GLY B 1 91  ? 6.223   58.509  131.735 1.00 70.51  ? 88  GLY B C   1 
ATOM 4519  O O   . GLY B 1 91  ? 5.395   59.372  132.026 1.00 75.20  ? 88  GLY B O   1 
ATOM 4520  N N   . HIS B 1 92  ? 7.452   58.792  131.298 1.00 61.75  ? 89  HIS B N   1 
ATOM 4521  C CA  . HIS B 1 92  ? 7.910   60.162  131.029 1.00 60.91  ? 89  HIS B CA  1 
ATOM 4522  C C   . HIS B 1 92  ? 7.563   60.624  129.603 1.00 73.89  ? 89  HIS B C   1 
ATOM 4523  O O   . HIS B 1 92  ? 8.119   60.130  128.629 1.00 65.29  ? 89  HIS B O   1 
ATOM 4524  C CB  . HIS B 1 92  ? 9.433   60.257  131.217 1.00 67.53  ? 89  HIS B CB  1 
ATOM 4525  C CG  . HIS B 1 92  ? 9.981   61.642  131.040 1.00 82.90  ? 89  HIS B CG  1 
ATOM 4526  N ND1 . HIS B 1 92  ? 11.283  61.879  130.629 1.00 61.14  ? 89  HIS B ND1 1 
ATOM 4527  C CD2 . HIS B 1 92  ? 9.435   62.854  131.280 1.00 83.63  ? 89  HIS B CD2 1 
ATOM 4528  C CE1 . HIS B 1 92  ? 11.485  63.183  130.578 1.00 67.30  ? 89  HIS B CE1 1 
ATOM 4529  N NE2 . HIS B 1 92  ? 10.379  63.798  130.960 1.00 88.46  ? 89  HIS B NE2 1 
ATOM 4530  N N   . LYS B 1 93  ? 6.624   61.551  129.479 1.00 77.58  ? 90  LYS B N   1 
ATOM 4531  C CA  . LYS B 1 93  ? 6.335   62.151  128.187 1.00 67.46  ? 90  LYS B CA  1 
ATOM 4532  C C   . LYS B 1 93  ? 7.388   63.246  127.942 1.00 78.20  ? 90  LYS B C   1 
ATOM 4533  O O   . LYS B 1 93  ? 7.396   64.265  128.634 1.00 60.76  ? 90  LYS B O   1 
ATOM 4534  C CB  . LYS B 1 93  ? 4.901   62.715  128.164 1.00 54.09  ? 90  LYS B CB  1 
ATOM 4535  N N   . VAL B 1 94  ? 8.293   63.022  126.981 1.00 72.07  ? 91  VAL B N   1 
ATOM 4536  C CA  . VAL B 1 94  ? 9.363   63.991  126.689 1.00 52.07  ? 91  VAL B CA  1 
ATOM 4537  C C   . VAL B 1 94  ? 8.939   65.121  125.747 1.00 68.60  ? 91  VAL B C   1 
ATOM 4538  O O   . VAL B 1 94  ? 9.531   66.207  125.766 1.00 50.00  ? 91  VAL B O   1 
ATOM 4539  C CB  . VAL B 1 94  ? 10.643  63.335  126.115 1.00 64.94  ? 91  VAL B CB  1 
ATOM 4540  C CG1 . VAL B 1 94  ? 11.114  62.194  126.998 1.00 60.53  ? 91  VAL B CG1 1 
ATOM 4541  C CG2 . VAL B 1 94  ? 10.419  62.862  124.679 1.00 63.10  ? 91  VAL B CG2 1 
ATOM 4542  N N   . ALA B 1 95  ? 7.920   64.869  124.926 1.00 33.01  ? 92  ALA B N   1 
ATOM 4543  C CA  . ALA B 1 95  ? 7.418   65.895  124.007 1.00 57.63  ? 92  ALA B CA  1 
ATOM 4544  C C   . ALA B 1 95  ? 5.946   65.762  123.735 1.00 52.83  ? 92  ALA B C   1 
ATOM 4545  O O   . ALA B 1 95  ? 5.407   64.661  123.683 1.00 54.05  ? 92  ALA B O   1 
ATOM 4546  C CB  . ALA B 1 95  ? 8.181   65.874  122.667 1.00 38.26  ? 92  ALA B CB  1 
ATOM 4547  N N   . LYS B 1 96  ? 5.307   66.903  123.538 1.00 45.86  ? 93  LYS B N   1 
ATOM 4548  C CA  . LYS B 1 96  ? 3.936   66.944  123.073 1.00 59.83  ? 93  LYS B CA  1 
ATOM 4549  C C   . LYS B 1 96  ? 3.942   67.688  121.743 1.00 51.14  ? 93  LYS B C   1 
ATOM 4550  O O   . LYS B 1 96  ? 4.475   68.793  121.632 1.00 56.34  ? 93  LYS B O   1 
ATOM 4551  C CB  . LYS B 1 96  ? 3.032   67.629  124.109 1.00 56.49  ? 93  LYS B CB  1 
ATOM 4552  C CG  . LYS B 1 96  ? 1.709   68.206  123.578 1.00 52.00  ? 93  LYS B CG  1 
ATOM 4553  C CD  . LYS B 1 96  ? 0.831   68.628  124.748 1.00 71.86  ? 93  LYS B CD  1 
ATOM 4554  C CE  . LYS B 1 96  ? -0.082  69.778  124.431 1.00 84.00  ? 93  LYS B CE  1 
ATOM 4555  N NZ  . LYS B 1 96  ? -0.810  70.248  125.634 1.00 70.64  ? 93  LYS B NZ  1 
ATOM 4556  N N   . PHE B 1 97  ? 3.372   67.058  120.729 1.00 47.71  ? 94  PHE B N   1 
ATOM 4557  C CA  . PHE B 1 97  ? 3.311   67.652  119.389 1.00 62.86  ? 94  PHE B CA  1 
ATOM 4558  C C   . PHE B 1 97  ? 1.954   67.368  118.750 1.00 51.15  ? 94  PHE B C   1 
ATOM 4559  O O   . PHE B 1 97  ? 1.041   66.893  119.420 1.00 67.73  ? 94  PHE B O   1 
ATOM 4560  C CB  . PHE B 1 97  ? 4.453   67.141  118.507 1.00 44.03  ? 94  PHE B CB  1 
ATOM 4561  C CG  . PHE B 1 97  ? 4.411   65.649  118.230 1.00 50.27  ? 94  PHE B CG  1 
ATOM 4562  C CD1 . PHE B 1 97  ? 3.910   65.166  117.034 1.00 46.40  ? 94  PHE B CD1 1 
ATOM 4563  C CD2 . PHE B 1 97  ? 4.887   64.737  119.158 1.00 45.34  ? 94  PHE B CD2 1 
ATOM 4564  C CE1 . PHE B 1 97  ? 3.885   63.802  116.759 1.00 47.04  ? 94  PHE B CE1 1 
ATOM 4565  C CE2 . PHE B 1 97  ? 4.859   63.372  118.897 1.00 43.05  ? 94  PHE B CE2 1 
ATOM 4566  C CZ  . PHE B 1 97  ? 4.355   62.907  117.681 1.00 47.14  ? 94  PHE B CZ  1 
ATOM 4567  N N   . CYS B 1 98  ? 1.811   67.661  117.463 1.00 60.50  ? 95  CYS B N   1 
ATOM 4568  C CA  . CYS B 1 98  ? 0.540   67.406  116.804 1.00 51.47  ? 95  CYS B CA  1 
ATOM 4569  C C   . CYS B 1 98  ? 0.706   67.031  115.349 1.00 59.65  ? 95  CYS B C   1 
ATOM 4570  O O   . CYS B 1 98  ? 1.735   67.303  114.742 1.00 63.43  ? 95  CYS B O   1 
ATOM 4571  C CB  . CYS B 1 98  ? -0.381  68.618  116.914 1.00 38.65  ? 95  CYS B CB  1 
ATOM 4572  S SG  . CYS B 1 98  ? 0.225   70.049  116.079 1.00 70.62  ? 95  CYS B SG  1 
ATOM 4573  N N   . TYR B 1 99  ? -0.338  66.417  114.806 1.00 61.60  ? 96  TYR B N   1 
ATOM 4574  C CA  . TYR B 1 99  ? -0.403  66.002  113.412 1.00 54.34  ? 96  TYR B CA  1 
ATOM 4575  C C   . TYR B 1 99  ? -1.020  67.063  112.499 1.00 63.11  ? 96  TYR B C   1 
ATOM 4576  O O   . TYR B 1 99  ? -2.116  67.553  112.767 1.00 51.20  ? 96  TYR B O   1 
ATOM 4577  C CB  . TYR B 1 99  ? -1.267  64.755  113.283 1.00 46.98  ? 96  TYR B CB  1 
ATOM 4578  C CG  . TYR B 1 99  ? -0.605  63.467  113.669 1.00 41.39  ? 96  TYR B CG  1 
ATOM 4579  C CD1 . TYR B 1 99  ? 0.752   63.406  113.924 1.00 40.99  ? 96  TYR B CD1 1 
ATOM 4580  C CD2 . TYR B 1 99  ? -1.347  62.296  113.766 1.00 43.46  ? 96  TYR B CD2 1 
ATOM 4581  C CE1 . TYR B 1 99  ? 1.360   62.205  114.273 1.00 35.48  ? 96  TYR B CE1 1 
ATOM 4582  C CE2 . TYR B 1 99  ? -0.756  61.103  114.117 1.00 41.38  ? 96  TYR B CE2 1 
ATOM 4583  C CZ  . TYR B 1 99  ? 0.596   61.062  114.368 1.00 57.33  ? 96  TYR B CZ  1 
ATOM 4584  O OH  . TYR B 1 99  ? 1.185   59.874  114.709 1.00 46.50  ? 96  TYR B OH  1 
ATOM 4585  N N   . ALA B 1 100 ? -0.339  67.381  111.399 1.00 63.80  ? 97  ALA B N   1 
ATOM 4586  C CA  . ALA B 1 100 ? -0.930  68.224  110.378 1.00 46.00  ? 97  ALA B CA  1 
ATOM 4587  C C   . ALA B 1 100 ? -2.113  67.490  109.746 1.00 49.79  ? 97  ALA B C   1 
ATOM 4588  O O   . ALA B 1 100 ? -2.068  66.271  109.550 1.00 39.15  ? 97  ALA B O   1 
ATOM 4589  C CB  . ALA B 1 100 ? 0.086   68.555  109.339 1.00 52.53  ? 97  ALA B CB  1 
ATOM 4590  N N   . ASP B 1 101 ? -3.180  68.225  109.457 1.00 50.90  ? 98  ASP B N   1 
ATOM 4591  C CA  . ASP B 1 101 ? -4.306  67.688  108.705 1.00 56.91  ? 98  ASP B CA  1 
ATOM 4592  C C   . ASP B 1 101 ? -4.098  67.967  107.208 1.00 70.98  ? 98  ASP B C   1 
ATOM 4593  O O   . ASP B 1 101 ? -3.121  68.636  106.837 1.00 40.04  ? 98  ASP B O   1 
ATOM 4594  C CB  . ASP B 1 101 ? -5.640  68.279  109.206 1.00 67.06  ? 98  ASP B CB  1 
ATOM 4595  C CG  . ASP B 1 101 ? -5.563  69.782  109.524 1.00 74.81  ? 98  ASP B CG  1 
ATOM 4596  O OD1 . ASP B 1 101 ? -4.803  70.536  108.880 1.00 65.55  ? 98  ASP B OD1 1 
ATOM 4597  O OD2 . ASP B 1 101 ? -6.297  70.216  110.431 1.00 72.11  ? 98  ASP B OD2 1 
ATOM 4598  N N   . LYS B 1 102 ? -4.993  67.455  106.357 1.00 46.72  ? 99  LYS B N   1 
ATOM 4599  C CA  . LYS B 1 102 ? -4.900  67.707  104.915 1.00 61.16  ? 99  LYS B CA  1 
ATOM 4600  C C   . LYS B 1 102 ? -4.793  69.215  104.650 1.00 49.85  ? 99  LYS B C   1 
ATOM 4601  O O   . LYS B 1 102 ? -3.948  69.672  103.894 1.00 53.46  ? 99  LYS B O   1 
ATOM 4602  C CB  . LYS B 1 102 ? -6.093  67.094  104.165 1.00 43.52  ? 99  LYS B CB  1 
ATOM 4603  N N   . SER B 1 103 ? -5.643  69.980  105.309 1.00 47.79  ? 100 SER B N   1 
ATOM 4604  C CA  . SER B 1 103 ? -5.650  71.425  105.182 1.00 56.62  ? 100 SER B CA  1 
ATOM 4605  C C   . SER B 1 103 ? -4.287  72.078  105.424 1.00 54.43  ? 100 SER B C   1 
ATOM 4606  O O   . SER B 1 103 ? -3.829  72.895  104.630 1.00 57.06  ? 100 SER B O   1 
ATOM 4607  C CB  . SER B 1 103 ? -6.694  72.016  106.137 1.00 56.09  ? 100 SER B CB  1 
ATOM 4608  O OG  . SER B 1 103 ? -6.500  73.412  106.301 1.00 77.90  ? 100 SER B OG  1 
ATOM 4609  N N   . LEU B 1 104 ? -3.652  71.737  106.536 1.00 54.34  ? 101 LEU B N   1 
ATOM 4610  C CA  . LEU B 1 104 ? -2.356  72.310  106.885 1.00 45.31  ? 101 LEU B CA  1 
ATOM 4611  C C   . LEU B 1 104 ? -1.255  71.870  105.930 1.00 42.44  ? 101 LEU B C   1 
ATOM 4612  O O   . LEU B 1 104 ? -0.402  72.670  105.549 1.00 54.04  ? 101 LEU B O   1 
ATOM 4613  C CB  . LEU B 1 104 ? -1.981  71.976  108.329 1.00 49.86  ? 101 LEU B CB  1 
ATOM 4614  C CG  . LEU B 1 104 ? -0.636  72.474  108.869 1.00 40.71  ? 101 LEU B CG  1 
ATOM 4615  C CD1 . LEU B 1 104 ? -0.520  73.969  108.725 1.00 31.74  ? 101 LEU B CD1 1 
ATOM 4616  C CD2 . LEU B 1 104 ? -0.481  72.066  110.308 1.00 39.76  ? 101 LEU B CD2 1 
ATOM 4617  N N   . LEU B 1 105 ? -1.281  70.604  105.538 1.00 44.23  ? 102 LEU B N   1 
ATOM 4618  C CA  . LEU B 1 105 ? -0.303  70.085  104.586 1.00 49.67  ? 102 LEU B CA  1 
ATOM 4619  C C   . LEU B 1 105 ? -0.390  70.844  103.263 1.00 54.95  ? 102 LEU B C   1 
ATOM 4620  O O   . LEU B 1 105 ? 0.622   71.234  102.688 1.00 39.89  ? 102 LEU B O   1 
ATOM 4621  C CB  . LEU B 1 105 ? -0.478  68.579  104.369 1.00 32.73  ? 102 LEU B CB  1 
ATOM 4622  C CG  . LEU B 1 105 ? -0.116  67.696  105.568 1.00 44.62  ? 102 LEU B CG  1 
ATOM 4623  C CD1 . LEU B 1 105 ? -0.465  66.273  105.278 1.00 43.75  ? 102 LEU B CD1 1 
ATOM 4624  C CD2 . LEU B 1 105 ? 1.373   67.801  105.934 1.00 31.66  ? 102 LEU B CD2 1 
ATOM 4625  N N   . ASN B 1 106 ? -1.600  71.085  102.786 1.00 45.31  ? 103 ASN B N   1 
ATOM 4626  C CA  . ASN B 1 106 ? -1.749  71.875  101.567 1.00 56.29  ? 103 ASN B CA  1 
ATOM 4627  C C   . ASN B 1 106 ? -1.345  73.340  101.683 1.00 38.31  ? 103 ASN B C   1 
ATOM 4628  O O   . ASN B 1 106 ? -0.763  73.889  100.746 1.00 48.54  ? 103 ASN B O   1 
ATOM 4629  C CB  . ASN B 1 106 ? -3.146  71.729  100.980 1.00 36.80  ? 103 ASN B CB  1 
ATOM 4630  C CG  . ASN B 1 106 ? -3.387  70.339  100.425 1.00 59.22  ? 103 ASN B CG  1 
ATOM 4631  O OD1 . ASN B 1 106 ? -4.415  69.729  100.676 1.00 42.60  ? 103 ASN B OD1 1 
ATOM 4632  N ND2 . ASN B 1 106 ? -2.422  69.826  99.685  1.00 44.85  ? 103 ASN B ND2 1 
ATOM 4633  N N   . LYS B 1 107 ? -1.628  73.965  102.823 1.00 35.40  ? 104 LYS B N   1 
ATOM 4634  C CA  . LYS B 1 107 ? -1.139  75.318  103.081 1.00 46.27  ? 104 LYS B CA  1 
ATOM 4635  C C   . LYS B 1 107 ? 0.394   75.285  103.010 1.00 44.61  ? 104 LYS B C   1 
ATOM 4636  O O   . LYS B 1 107 ? 1.002   76.178  102.437 1.00 44.03  ? 104 LYS B O   1 
ATOM 4637  C CB  . LYS B 1 107 ? -1.657  75.888  104.430 1.00 32.03  ? 104 LYS B CB  1 
ATOM 4638  N N   . ALA B 1 108 ? 1.005   74.229  103.553 1.00 41.72  ? 105 ALA B N   1 
ATOM 4639  C CA  . ALA B 1 108 ? 2.469   74.094  103.601 1.00 51.20  ? 105 ALA B CA  1 
ATOM 4640  C C   . ALA B 1 108 ? 3.082   73.896  102.222 1.00 48.18  ? 105 ALA B C   1 
ATOM 4641  O O   . ALA B 1 108 ? 4.173   74.392  101.950 1.00 39.20  ? 105 ALA B O   1 
ATOM 4642  C CB  . ALA B 1 108 ? 2.886   72.943  104.532 1.00 25.81  ? 105 ALA B CB  1 
ATOM 4643  N N   . ILE B 1 109 ? 2.384   73.142  101.377 1.00 43.69  ? 106 ILE B N   1 
ATOM 4644  C CA  . ILE B 1 109 ? 2.745   72.969  99.974  1.00 44.43  ? 106 ILE B CA  1 
ATOM 4645  C C   . ILE B 1 109 ? 2.661   74.296  99.219  1.00 54.62  ? 106 ILE B C   1 
ATOM 4646  O O   . ILE B 1 109 ? 3.631   74.698  98.566  1.00 43.29  ? 106 ILE B O   1 
ATOM 4647  C CB  . ILE B 1 109 ? 1.860   71.912  99.274  1.00 40.29  ? 106 ILE B CB  1 
ATOM 4648  C CG1 . ILE B 1 109 ? 2.148   70.524  99.831  1.00 41.91  ? 106 ILE B CG1 1 
ATOM 4649  C CG2 . ILE B 1 109 ? 2.067   71.923  97.771  1.00 37.22  ? 106 ILE B CG2 1 
ATOM 4650  C CD1 . ILE B 1 109 ? 1.253   69.446  99.265  1.00 31.00  ? 106 ILE B CD1 1 
ATOM 4651  N N   . GLU B 1 110 ? 1.520   74.986  99.317  1.00 32.51  ? 107 GLU B N   1 
ATOM 4652  C CA  . GLU B 1 110 ? 1.358   76.252  98.591  1.00 38.61  ? 107 GLU B CA  1 
ATOM 4653  C C   . GLU B 1 110 ? 2.453   77.249  98.977  1.00 25.81  ? 107 GLU B C   1 
ATOM 4654  O O   . GLU B 1 110 ? 3.035   77.909  98.113  1.00 55.77  ? 107 GLU B O   1 
ATOM 4655  C CB  . GLU B 1 110 ? -0.058  76.854  98.723  1.00 20.28  ? 107 GLU B CB  1 
ATOM 4656  N N   . ALA B 1 111 ? 2.789   77.300  100.258 1.00 42.44  ? 108 ALA B N   1 
ATOM 4657  C CA  . ALA B 1 111 ? 3.757   78.277  100.768 1.00 39.60  ? 108 ALA B CA  1 
ATOM 4658  C C   . ALA B 1 111 ? 5.200   77.932  100.394 1.00 33.57  ? 108 ALA B C   1 
ATOM 4659  O O   . ALA B 1 111 ? 6.001   78.826  100.095 1.00 51.94  ? 108 ALA B O   1 
ATOM 4660  C CB  . ALA B 1 111 ? 3.606   78.447  102.280 1.00 23.76  ? 108 ALA B CB  1 
ATOM 4661  N N   . ALA B 1 112 ? 5.517   76.640  100.400 1.00 39.79  ? 109 ALA B N   1 
ATOM 4662  C CA  . ALA B 1 112 ? 6.822   76.154  99.953  1.00 40.53  ? 109 ALA B CA  1 
ATOM 4663  C C   . ALA B 1 112 ? 7.033   76.491  98.481  1.00 35.17  ? 109 ALA B C   1 
ATOM 4664  O O   . ALA B 1 112 ? 8.056   77.037  98.104  1.00 34.10  ? 109 ALA B O   1 
ATOM 4665  C CB  . ALA B 1 112 ? 6.928   74.660  100.162 1.00 31.47  ? 109 ALA B CB  1 
ATOM 4666  N N   . LEU B 1 113 ? 6.050   76.156  97.655  1.00 41.45  ? 110 LEU B N   1 
ATOM 4667  C CA  . LEU B 1 113 ? 6.087   76.473  96.227  1.00 42.65  ? 110 LEU B CA  1 
ATOM 4668  C C   . LEU B 1 113 ? 6.293   77.966  95.920  1.00 50.26  ? 110 LEU B C   1 
ATOM 4669  O O   . LEU B 1 113 ? 6.984   78.315  94.965  1.00 40.05  ? 110 LEU B O   1 
ATOM 4670  C CB  . LEU B 1 113 ? 4.813   75.973  95.540  1.00 23.83  ? 110 LEU B CB  1 
ATOM 4671  C CG  . LEU B 1 113 ? 4.656   74.453  95.487  1.00 32.11  ? 110 LEU B CG  1 
ATOM 4672  C CD1 . LEU B 1 113 ? 3.410   74.085  94.770  1.00 38.75  ? 110 LEU B CD1 1 
ATOM 4673  C CD2 . LEU B 1 113 ? 5.832   73.800  94.813  1.00 23.78  ? 110 LEU B CD2 1 
ATOM 4674  N N   . ALA B 1 114 ? 5.701   78.848  96.726  1.00 36.43  ? 111 ALA B N   1 
ATOM 4675  C CA  . ALA B 1 114 ? 5.851   80.282  96.490  1.00 36.65  ? 111 ALA B CA  1 
ATOM 4676  C C   . ALA B 1 114 ? 7.207   80.793  96.911  1.00 45.67  ? 111 ALA B C   1 
ATOM 4677  O O   . ALA B 1 114 ? 7.592   81.894  96.537  1.00 48.54  ? 111 ALA B O   1 
ATOM 4678  C CB  . ALA B 1 114 ? 4.765   81.070  97.153  1.00 23.33  ? 111 ALA B CB  1 
ATOM 4679  N N   . ALA B 1 115 ? 7.941   79.983  97.668  1.00 28.90  ? 112 ALA B N   1 
ATOM 4680  C CA  . ALA B 1 115 ? 9.269   80.393  98.106  1.00 39.51  ? 112 ALA B CA  1 
ATOM 4681  C C   . ALA B 1 115 ? 10.382  79.762  97.247  1.00 37.88  ? 112 ALA B C   1 
ATOM 4682  O O   . ALA B 1 115 ? 11.545  80.162  97.316  1.00 46.61  ? 112 ALA B O   1 
ATOM 4683  C CB  . ALA B 1 115 ? 9.466   80.090  99.590  1.00 21.73  ? 112 ALA B CB  1 
ATOM 4684  N N   . ARG B 1 116 ? 10.009  78.795  96.421  1.00 33.72  ? 113 ARG B N   1 
ATOM 4685  C CA  . ARG B 1 116 ? 10.989  77.992  95.705  1.00 36.04  ? 113 ARG B CA  1 
ATOM 4686  C C   . ARG B 1 116 ? 11.888  78.720  94.701  1.00 42.77  ? 113 ARG B C   1 
ATOM 4687  O O   . ARG B 1 116 ? 13.111  78.541  94.745  1.00 41.31  ? 113 ARG B O   1 
ATOM 4688  C CB  . ARG B 1 116 ? 10.307  76.834  95.005  1.00 26.67  ? 113 ARG B CB  1 
ATOM 4689  C CG  . ARG B 1 116 ? 11.279  75.772  94.532  1.00 33.08  ? 113 ARG B CG  1 
ATOM 4690  C CD  . ARG B 1 116 ? 10.590  74.745  93.669  1.00 38.97  ? 113 ARG B CD  1 
ATOM 4691  N NE  . ARG B 1 116 ? 10.023  75.356  92.464  1.00 53.49  ? 113 ARG B NE  1 
ATOM 4692  C CZ  . ARG B 1 116 ? 10.743  75.716  91.401  1.00 58.79  ? 113 ARG B CZ  1 
ATOM 4693  N NH1 . ARG B 1 116 ? 12.062  75.551  91.386  1.00 27.10  ? 113 ARG B NH1 1 
ATOM 4694  N NH2 . ARG B 1 116 ? 10.147  76.257  90.357  1.00 32.83  ? 113 ARG B NH2 1 
ATOM 4695  N N   . LYS B 1 117 ? 11.301  79.517  93.799  1.00 35.59  ? 114 LYS B N   1 
ATOM 4696  C CA  . LYS B 1 117 ? 12.072  80.140  92.711  1.00 44.41  ? 114 LYS B CA  1 
ATOM 4697  C C   . LYS B 1 117 ? 13.245  80.967  93.253  1.00 34.34  ? 114 LYS B C   1 
ATOM 4698  O O   . LYS B 1 117 ? 14.387  80.786  92.817  1.00 46.15  ? 114 LYS B O   1 
ATOM 4699  C CB  . LYS B 1 117 ? 11.182  80.937  91.719  1.00 30.24  ? 114 LYS B CB  1 
ATOM 4700  N N   . GLU B 1 118 ? 12.974  81.844  94.219  1.00 38.67  ? 115 GLU B N   1 
ATOM 4701  C CA  . GLU B 1 118 ? 14.016  82.689  94.812  1.00 36.32  ? 115 GLU B CA  1 
ATOM 4702  C C   . GLU B 1 118 ? 15.100  81.861  95.485  1.00 47.80  ? 115 GLU B C   1 
ATOM 4703  O O   . GLU B 1 118 ? 16.292  82.188  95.388  1.00 47.84  ? 115 GLU B O   1 
ATOM 4704  C CB  . GLU B 1 118 ? 13.425  83.704  95.810  1.00 28.27  ? 115 GLU B CB  1 
ATOM 4705  N N   . TRP B 1 119 ? 14.678  80.787  96.158  1.00 28.61  ? 116 TRP B N   1 
ATOM 4706  C CA  . TRP B 1 119 ? 15.599  79.861  96.805  1.00 31.96  ? 116 TRP B CA  1 
ATOM 4707  C C   . TRP B 1 119 ? 16.440  79.089  95.786  1.00 29.09  ? 116 TRP B C   1 
ATOM 4708  O O   . TRP B 1 119 ? 17.661  79.018  95.928  1.00 41.40  ? 116 TRP B O   1 
ATOM 4709  C CB  . TRP B 1 119 ? 14.838  78.933  97.770  1.00 28.02  ? 116 TRP B CB  1 
ATOM 4710  C CG  . TRP B 1 119 ? 15.646  77.810  98.392  1.00 40.46  ? 116 TRP B CG  1 
ATOM 4711  C CD1 . TRP B 1 119 ? 15.539  76.469  98.119  1.00 24.73  ? 116 TRP B CD1 1 
ATOM 4712  C CD2 . TRP B 1 119 ? 16.670  77.932  99.395  1.00 38.82  ? 116 TRP B CD2 1 
ATOM 4713  N NE1 . TRP B 1 119 ? 16.427  75.753  98.905  1.00 41.23  ? 116 TRP B NE1 1 
ATOM 4714  C CE2 . TRP B 1 119 ? 17.131  76.627  99.692  1.00 40.65  ? 116 TRP B CE2 1 
ATOM 4715  C CE3 . TRP B 1 119 ? 17.238  79.015  100.071 1.00 43.48  ? 116 TRP B CE3 1 
ATOM 4716  C CZ2 . TRP B 1 119 ? 18.133  76.381  100.644 1.00 44.60  ? 116 TRP B CZ2 1 
ATOM 4717  C CZ3 . TRP B 1 119 ? 18.234  78.770  101.017 1.00 38.40  ? 116 TRP B CZ3 1 
ATOM 4718  C CH2 . TRP B 1 119 ? 18.677  77.465  101.284 1.00 33.29  ? 116 TRP B CH2 1 
ATOM 4719  N N   . ASP B 1 120 ? 15.795  78.518  94.763  1.00 36.05  ? 117 ASP B N   1 
ATOM 4720  C CA  . ASP B 1 120 ? 16.525  77.837  93.680  1.00 30.34  ? 117 ASP B CA  1 
ATOM 4721  C C   . ASP B 1 120 ? 17.526  78.795  93.022  1.00 28.58  ? 117 ASP B C   1 
ATOM 4722  O O   . ASP B 1 120 ? 18.618  78.401  92.637  1.00 26.49  ? 117 ASP B O   1 
ATOM 4723  C CB  . ASP B 1 120 ? 15.530  77.276  92.658  1.00 35.05  ? 117 ASP B CB  1 
ATOM 4724  C CG  . ASP B 1 120 ? 16.194  76.572  91.501  1.00 38.39  ? 117 ASP B CG  1 
ATOM 4725  O OD1 . ASP B 1 120 ? 17.303  76.015  91.688  1.00 40.55  ? 117 ASP B OD1 1 
ATOM 4726  O OD2 . ASP B 1 120 ? 15.571  76.548  90.402  1.00 57.35  ? 117 ASP B OD2 1 
ATOM 4727  N N   . LEU B 1 121 ? 17.156  80.069  92.923  1.00 43.55  ? 118 LEU B N   1 
ATOM 4728  C CA  . LEU B 1 121 ? 18.014  81.083  92.288  1.00 41.39  ? 118 LEU B CA  1 
ATOM 4729  C C   . LEU B 1 121 ? 19.165  81.570  93.151  1.00 45.33  ? 118 LEU B C   1 
ATOM 4730  O O   . LEU B 1 121 ? 20.158  82.060  92.630  1.00 48.06  ? 118 LEU B O   1 
ATOM 4731  C CB  . LEU B 1 121 ? 17.182  82.284  91.838  1.00 27.70  ? 118 LEU B CB  1 
ATOM 4732  C CG  . LEU B 1 121 ? 16.496  82.066  90.486  1.00 44.04  ? 118 LEU B CG  1 
ATOM 4733  C CD1 . LEU B 1 121 ? 15.408  83.086  90.316  1.00 35.44  ? 118 LEU B CD1 1 
ATOM 4734  C CD2 . LEU B 1 121 ? 17.494  82.169  89.345  1.00 22.52  ? 118 LEU B CD2 1 
ATOM 4735  N N   . LYS B 1 122 ? 19.029  81.448  94.468  1.00 31.80  ? 119 LYS B N   1 
ATOM 4736  C CA  . LYS B 1 122 ? 20.119  81.776  95.364  1.00 38.29  ? 119 LYS B CA  1 
ATOM 4737  C C   . LYS B 1 122 ? 21.295  80.854  95.013  1.00 42.32  ? 119 LYS B C   1 
ATOM 4738  O O   . LYS B 1 122 ? 21.101  79.654  94.851  1.00 66.44  ? 119 LYS B O   1 
ATOM 4739  C CB  . LYS B 1 122 ? 19.644  81.626  96.827  1.00 29.96  ? 119 LYS B CB  1 
ATOM 4740  C CG  . LYS B 1 122 ? 20.693  81.837  97.909  1.00 59.65  ? 119 LYS B CG  1 
ATOM 4741  C CD  . LYS B 1 122 ? 20.041  81.891  99.299  1.00 52.78  ? 119 LYS B CD  1 
ATOM 4742  N N   . PRO B 1 123 ? 22.513  81.417  94.873  1.00 49.24  ? 120 PRO B N   1 
ATOM 4743  C CA  . PRO B 1 123 ? 23.721  80.651  94.523  1.00 27.94  ? 120 PRO B CA  1 
ATOM 4744  C C   . PRO B 1 123 ? 24.026  79.537  95.510  1.00 33.90  ? 120 PRO B C   1 
ATOM 4745  O O   . PRO B 1 123 ? 23.744  79.688  96.691  1.00 61.16  ? 120 PRO B O   1 
ATOM 4746  C CB  . PRO B 1 123 ? 24.838  81.701  94.604  1.00 40.53  ? 120 PRO B CB  1 
ATOM 4747  C CG  . PRO B 1 123 ? 24.135  83.009  94.430  1.00 39.17  ? 120 PRO B CG  1 
ATOM 4748  C CD  . PRO B 1 123 ? 22.820  82.837  95.106  1.00 35.98  ? 120 PRO B CD  1 
ATOM 4749  N N   . ILE B 1 124 ? 24.618  78.448  95.028  1.00 37.85  ? 121 ILE B N   1 
ATOM 4750  C CA  . ILE B 1 124 ? 24.859  77.275  95.851  1.00 44.71  ? 121 ILE B CA  1 
ATOM 4751  C C   . ILE B 1 124 ? 25.765  77.594  97.037  1.00 50.89  ? 121 ILE B C   1 
ATOM 4752  O O   . ILE B 1 124 ? 25.642  76.987  98.088  1.00 57.12  ? 121 ILE B O   1 
ATOM 4753  C CB  . ILE B 1 124 ? 25.423  76.085  95.027  1.00 35.71  ? 121 ILE B CB  1 
ATOM 4754  C CG1 . ILE B 1 124 ? 25.625  74.840  95.904  1.00 41.87  ? 121 ILE B CG1 1 
ATOM 4755  C CG2 . ILE B 1 124 ? 26.726  76.454  94.393  1.00 31.80  ? 121 ILE B CG2 1 
ATOM 4756  C CD1 . ILE B 1 124 ? 24.360  74.294  96.492  1.00 40.49  ? 121 ILE B CD1 1 
ATOM 4757  N N   . ALA B 1 125 ? 26.654  78.564  96.874  1.00 50.43  ? 122 ALA B N   1 
ATOM 4758  C CA  . ALA B 1 125 ? 27.548  78.940  97.960  1.00 55.22  ? 122 ALA B CA  1 
ATOM 4759  C C   . ALA B 1 125 ? 26.787  79.567  99.120  1.00 53.65  ? 122 ALA B C   1 
ATOM 4760  O O   . ALA B 1 125 ? 27.170  79.409  100.273 1.00 57.40  ? 122 ALA B O   1 
ATOM 4761  C CB  . ALA B 1 125 ? 28.596  79.886  97.475  1.00 32.05  ? 122 ALA B CB  1 
ATOM 4762  N N   . ASP B 1 126 ? 25.720  80.292  98.813  1.00 49.03  ? 123 ASP B N   1 
ATOM 4763  C CA  . ASP B 1 126 ? 24.925  80.921  99.854  1.00 45.72  ? 123 ASP B CA  1 
ATOM 4764  C C   . ASP B 1 126 ? 24.094  79.871  100.590 1.00 69.69  ? 123 ASP B C   1 
ATOM 4765  O O   . ASP B 1 126 ? 23.925  79.942  101.806 1.00 64.96  ? 123 ASP B O   1 
ATOM 4766  C CB  . ASP B 1 126 ? 24.008  82.009  99.270  1.00 59.29  ? 123 ASP B CB  1 
ATOM 4767  C CG  . ASP B 1 126 ? 24.783  83.215  98.738  1.00 88.37  ? 123 ASP B CG  1 
ATOM 4768  O OD1 . ASP B 1 126 ? 25.981  83.349  99.085  1.00 71.25  ? 123 ASP B OD1 1 
ATOM 4769  O OD2 . ASP B 1 126 ? 24.197  84.034  97.982  1.00 81.01  ? 123 ASP B OD2 1 
ATOM 4770  N N   . ARG B 1 127 ? 23.574  78.896  99.849  1.00 47.05  ? 124 ARG B N   1 
ATOM 4771  C CA  . ARG B 1 127 ? 22.822  77.822  100.472 1.00 42.36  ? 124 ARG B CA  1 
ATOM 4772  C C   . ARG B 1 127 ? 23.736  76.921  101.295 1.00 47.50  ? 124 ARG B C   1 
ATOM 4773  O O   . ARG B 1 127 ? 23.378  76.539  102.394 1.00 38.50  ? 124 ARG B O   1 
ATOM 4774  C CB  . ARG B 1 127 ? 22.052  77.010  99.450  1.00 38.40  ? 124 ARG B CB  1 
ATOM 4775  C CG  . ARG B 1 127 ? 21.138  77.840  98.577  1.00 41.45  ? 124 ARG B CG  1 
ATOM 4776  C CD  . ARG B 1 127 ? 20.147  76.954  97.856  1.00 34.77  ? 124 ARG B CD  1 
ATOM 4777  N NE  . ARG B 1 127 ? 20.760  76.028  96.908  1.00 46.47  ? 124 ARG B NE  1 
ATOM 4778  C CZ  . ARG B 1 127 ? 20.677  76.169  95.594  1.00 41.96  ? 124 ARG B CZ  1 
ATOM 4779  N NH1 . ARG B 1 127 ? 20.021  77.199  95.094  1.00 38.48  ? 124 ARG B NH1 1 
ATOM 4780  N NH2 . ARG B 1 127 ? 21.239  75.289  94.787  1.00 41.18  ? 124 ARG B NH2 1 
ATOM 4781  N N   . ALA B 1 128 ? 24.913  76.596  100.766 1.00 37.23  ? 125 ALA B N   1 
ATOM 4782  C CA  . ALA B 1 128 ? 25.869  75.767  101.479 1.00 43.49  ? 125 ALA B CA  1 
ATOM 4783  C C   . ALA B 1 128 ? 26.232  76.412  102.808 1.00 59.80  ? 125 ALA B C   1 
ATOM 4784  O O   . ALA B 1 128 ? 26.402  75.704  103.801 1.00 54.72  ? 125 ALA B O   1 
ATOM 4785  C CB  . ALA B 1 128 ? 27.120  75.554  100.652 1.00 23.72  ? 125 ALA B CB  1 
ATOM 4786  N N   . GLN B 1 129 ? 26.339  77.746  102.819 1.00 39.67  ? 126 GLN B N   1 
ATOM 4787  C CA  . GLN B 1 129 ? 26.792  78.487  104.001 1.00 64.07  ? 126 GLN B CA  1 
ATOM 4788  C C   . GLN B 1 129 ? 25.893  78.278  105.215 1.00 59.99  ? 126 GLN B C   1 
ATOM 4789  O O   . GLN B 1 129 ? 26.379  78.225  106.340 1.00 45.02  ? 126 GLN B O   1 
ATOM 4790  C CB  . GLN B 1 129 ? 26.940  79.991  103.717 1.00 49.44  ? 126 GLN B CB  1 
ATOM 4791  N N   . ILE B 1 130 ? 24.587  78.180  104.977 1.00 44.90  ? 127 ILE B N   1 
ATOM 4792  C CA  . ILE B 1 130 ? 23.596  77.841  106.004 1.00 42.34  ? 127 ILE B CA  1 
ATOM 4793  C C   . ILE B 1 130 ? 23.862  76.489  106.678 1.00 52.50  ? 127 ILE B C   1 
ATOM 4794  O O   . ILE B 1 130 ? 23.876  76.383  107.902 1.00 48.58  ? 127 ILE B O   1 
ATOM 4795  C CB  . ILE B 1 130 ? 22.178  77.875  105.391 1.00 34.65  ? 127 ILE B CB  1 
ATOM 4796  C CG1 . ILE B 1 130 ? 21.905  79.277  104.833 1.00 37.59  ? 127 ILE B CG1 1 
ATOM 4797  C CG2 . ILE B 1 130 ? 21.137  77.443  106.389 1.00 35.62  ? 127 ILE B CG2 1 
ATOM 4798  C CD1 . ILE B 1 130 ? 20.605  79.437  104.169 1.00 37.36  ? 127 ILE B CD1 1 
ATOM 4799  N N   . PHE B 1 131 ? 24.090  75.466  105.866 1.00 33.72  ? 128 PHE B N   1 
ATOM 4800  C CA  . PHE B 1 131 ? 24.381  74.125  106.371 1.00 56.21  ? 128 PHE B CA  1 
ATOM 4801  C C   . PHE B 1 131 ? 25.759  74.028  107.016 1.00 44.35  ? 128 PHE B C   1 
ATOM 4802  O O   . PHE B 1 131 ? 25.967  73.240  107.924 1.00 47.44  ? 128 PHE B O   1 
ATOM 4803  C CB  . PHE B 1 131 ? 24.185  73.060  105.267 1.00 39.32  ? 128 PHE B CB  1 
ATOM 4804  C CG  . PHE B 1 131 ? 22.777  72.979  104.777 1.00 40.03  ? 128 PHE B CG  1 
ATOM 4805  C CD1 . PHE B 1 131 ? 22.313  73.863  103.806 1.00 32.84  ? 128 PHE B CD1 1 
ATOM 4806  C CD2 . PHE B 1 131 ? 21.899  72.069  105.325 1.00 38.03  ? 128 PHE B CD2 1 
ATOM 4807  C CE1 . PHE B 1 131 ? 21.004  73.821  103.381 1.00 46.48  ? 128 PHE B CE1 1 
ATOM 4808  C CE2 . PHE B 1 131 ? 20.577  72.012  104.896 1.00 43.74  ? 128 PHE B CE2 1 
ATOM 4809  C CZ  . PHE B 1 131 ? 20.131  72.889  103.927 1.00 44.60  ? 128 PHE B CZ  1 
ATOM 4810  N N   . LEU B 1 132 ? 26.706  74.832  106.555 1.00 47.30  ? 129 LEU B N   1 
ATOM 4811  C CA  . LEU B 1 132 ? 28.006  74.861  107.210 1.00 54.53  ? 129 LEU B CA  1 
ATOM 4812  C C   . LEU B 1 132 ? 27.903  75.470  108.613 1.00 44.60  ? 129 LEU B C   1 
ATOM 4813  O O   . LEU B 1 132 ? 28.528  74.986  109.548 1.00 47.42  ? 129 LEU B O   1 
ATOM 4814  C CB  . LEU B 1 132 ? 29.022  75.602  106.360 1.00 36.57  ? 129 LEU B CB  1 
ATOM 4815  C CG  . LEU B 1 132 ? 29.413  74.842  105.102 1.00 49.14  ? 129 LEU B CG  1 
ATOM 4816  C CD1 . LEU B 1 132 ? 30.356  75.681  104.250 1.00 32.48  ? 129 LEU B CD1 1 
ATOM 4817  C CD2 . LEU B 1 132 ? 30.043  73.528  105.477 1.00 37.36  ? 129 LEU B CD2 1 
ATOM 4818  N N   . LYS B 1 133 ? 27.088  76.516  108.747 1.00 46.86  ? 130 LYS B N   1 
ATOM 4819  C CA  . LYS B 1 133 ? 26.867  77.173  110.027 1.00 43.49  ? 130 LYS B CA  1 
ATOM 4820  C C   . LYS B 1 133 ? 26.058  76.284  110.965 1.00 60.82  ? 130 LYS B C   1 
ATOM 4821  O O   . LYS B 1 133 ? 26.335  76.231  112.160 1.00 68.41  ? 130 LYS B O   1 
ATOM 4822  C CB  . LYS B 1 133 ? 26.185  78.532  109.862 1.00 30.40  ? 130 LYS B CB  1 
ATOM 4823  N N   . ALA B 1 134 ? 25.071  75.571  110.433 1.00 44.65  ? 131 ALA B N   1 
ATOM 4824  C CA  . ALA B 1 134 ? 24.329  74.609  111.247 1.00 38.29  ? 131 ALA B CA  1 
ATOM 4825  C C   . ALA B 1 134 ? 25.224  73.473  111.748 1.00 50.72  ? 131 ALA B C   1 
ATOM 4826  O O   . ALA B 1 134 ? 25.070  73.016  112.878 1.00 51.11  ? 131 ALA B O   1 
ATOM 4827  C CB  . ALA B 1 134 ? 23.137  74.056  110.481 1.00 45.05  ? 131 ALA B CB  1 
ATOM 4828  N N   . ALA B 1 135 ? 26.156  73.019  110.907 1.00 55.20  ? 132 ALA B N   1 
ATOM 4829  C CA  . ALA B 1 135 ? 27.117  71.985  111.296 1.00 60.68  ? 132 ALA B CA  1 
ATOM 4830  C C   . ALA B 1 135 ? 28.007  72.464  112.438 1.00 48.70  ? 132 ALA B C   1 
ATOM 4831  O O   . ALA B 1 135 ? 28.304  71.710  113.351 1.00 63.52  ? 132 ALA B O   1 
ATOM 4832  C CB  . ALA B 1 135 ? 27.975  71.540  110.092 1.00 35.59  ? 132 ALA B CB  1 
ATOM 4833  N N   . ASP B 1 136 ? 28.438  73.719  112.367 1.00 50.22  ? 133 ASP B N   1 
ATOM 4834  C CA  . ASP B 1 136 ? 29.291  74.295  113.404 1.00 59.79  ? 133 ASP B CA  1 
ATOM 4835  C C   . ASP B 1 136 ? 28.530  74.496  114.713 1.00 55.44  ? 133 ASP B C   1 
ATOM 4836  O O   . ASP B 1 136 ? 29.083  74.291  115.789 1.00 65.99  ? 133 ASP B O   1 
ATOM 4837  C CB  . ASP B 1 136 ? 29.918  75.616  112.937 1.00 41.95  ? 133 ASP B CB  1 
ATOM 4838  C CG  . ASP B 1 136 ? 31.064  75.411  111.938 1.00 71.42  ? 133 ASP B CG  1 
ATOM 4839  O OD1 . ASP B 1 136 ? 31.566  74.274  111.779 1.00 59.75  ? 133 ASP B OD1 1 
ATOM 4840  O OD2 . ASP B 1 136 ? 31.471  76.413  111.315 1.00 67.09  ? 133 ASP B OD2 1 
ATOM 4841  N N   . MET B 1 137 ? 27.264  74.894  114.623 1.00 58.68  ? 134 MET B N   1 
ATOM 4842  C CA  . MET B 1 137 ? 26.402  74.958  115.802 1.00 43.16  ? 134 MET B CA  1 
ATOM 4843  C C   . MET B 1 137 ? 26.298  73.569  116.456 1.00 49.20  ? 134 MET B C   1 
ATOM 4844  O O   . MET B 1 137 ? 26.496  73.423  117.657 1.00 55.60  ? 134 MET B O   1 
ATOM 4845  C CB  . MET B 1 137 ? 25.013  75.520  115.452 1.00 41.56  ? 134 MET B CB  1 
ATOM 4846  C CG  . MET B 1 137 ? 25.005  76.996  115.074 1.00 44.46  ? 134 MET B CG  1 
ATOM 4847  S SD  . MET B 1 137 ? 23.486  77.578  114.274 1.00 39.95  ? 134 MET B SD  1 
ATOM 4848  C CE  . MET B 1 137 ? 22.344  77.485  115.641 1.00 48.95  ? 134 MET B CE  1 
ATOM 4849  N N   . LEU B 1 138 ? 26.002  72.548  115.660 1.00 68.97  ? 135 LEU B N   1 
ATOM 4850  C CA  . LEU B 1 138 ? 25.908  71.185  116.176 1.00 57.37  ? 135 LEU B CA  1 
ATOM 4851  C C   . LEU B 1 138 ? 27.211  70.712  116.767 1.00 58.99  ? 135 LEU B C   1 
ATOM 4852  O O   . LEU B 1 138 ? 27.209  69.950  117.731 1.00 49.77  ? 135 LEU B O   1 
ATOM 4853  C CB  . LEU B 1 138 ? 25.490  70.210  115.078 1.00 42.84  ? 135 LEU B CB  1 
ATOM 4854  C CG  . LEU B 1 138 ? 24.038  70.355  114.627 1.00 54.44  ? 135 LEU B CG  1 
ATOM 4855  C CD1 . LEU B 1 138 ? 23.814  69.624  113.319 1.00 42.16  ? 135 LEU B CD1 1 
ATOM 4856  C CD2 . LEU B 1 138 ? 23.111  69.838  115.711 1.00 42.19  ? 135 LEU B CD2 1 
ATOM 4857  N N   . SER B 1 139 ? 28.319  71.148  116.175 1.00 53.05  ? 136 SER B N   1 
ATOM 4858  C CA  . SER B 1 139 ? 29.630  70.668  116.577 1.00 38.96  ? 136 SER B CA  1 
ATOM 4859  C C   . SER B 1 139 ? 30.028  71.143  117.977 1.00 59.83  ? 136 SER B C   1 
ATOM 4860  O O   . SER B 1 139 ? 30.606  70.386  118.756 1.00 55.16  ? 136 SER B O   1 
ATOM 4861  C CB  . SER B 1 139 ? 30.682  71.128  115.593 1.00 40.83  ? 136 SER B CB  1 
ATOM 4862  O OG  . SER B 1 139 ? 31.957  70.643  115.977 1.00 60.22  ? 136 SER B OG  1 
ATOM 4863  N N   . GLY B 1 140 ? 29.734  72.407  118.269 1.00 53.27  ? 137 GLY B N   1 
ATOM 4864  C CA  . GLY B 1 140 ? 30.102  73.025  119.528 1.00 45.43  ? 137 GLY B CA  1 
ATOM 4865  C C   . GLY B 1 140 ? 28.942  73.197  120.509 1.00 52.56  ? 137 GLY B C   1 
ATOM 4866  O O   . GLY B 1 140 ? 28.569  72.255  121.217 1.00 51.46  ? 137 GLY B O   1 
ATOM 4867  N N   . PRO B 1 141 ? 28.338  74.394  120.517 1.00 47.64  ? 138 PRO B N   1 
ATOM 4868  C CA  . PRO B 1 141 ? 27.298  74.899  121.438 1.00 46.83  ? 138 PRO B CA  1 
ATOM 4869  C C   . PRO B 1 141 ? 26.084  74.002  121.582 1.00 67.20  ? 138 PRO B C   1 
ATOM 4870  O O   . PRO B 1 141 ? 25.569  73.856  122.693 1.00 71.42  ? 138 PRO B O   1 
ATOM 4871  C CB  . PRO B 1 141 ? 26.848  76.204  120.798 1.00 46.62  ? 138 PRO B CB  1 
ATOM 4872  C CG  . PRO B 1 141 ? 27.900  76.568  119.818 1.00 48.37  ? 138 PRO B CG  1 
ATOM 4873  C CD  . PRO B 1 141 ? 28.643  75.339  119.430 1.00 48.93  ? 138 PRO B CD  1 
ATOM 4874  N N   . ARG B 1 142 ? 25.619  73.424  120.478 1.00 54.06  ? 139 ARG B N   1 
ATOM 4875  C CA  . ARG B 1 142 ? 24.384  72.652  120.519 1.00 42.68  ? 139 ARG B CA  1 
ATOM 4876  C C   . ARG B 1 142 ? 24.621  71.157  120.633 1.00 44.88  ? 139 ARG B C   1 
ATOM 4877  O O   . ARG B 1 142 ? 23.672  70.383  120.761 1.00 59.12  ? 139 ARG B O   1 
ATOM 4878  C CB  . ARG B 1 142 ? 23.500  72.968  119.317 1.00 48.98  ? 139 ARG B CB  1 
ATOM 4879  C CG  . ARG B 1 142 ? 23.348  74.461  119.042 1.00 47.74  ? 139 ARG B CG  1 
ATOM 4880  C CD  . ARG B 1 142 ? 22.589  75.256  120.121 1.00 55.68  ? 139 ARG B CD  1 
ATOM 4881  N NE  . ARG B 1 142 ? 21.160  75.093  119.970 1.00 57.58  ? 139 ARG B NE  1 
ATOM 4882  C CZ  . ARG B 1 142 ? 20.289  75.880  119.335 1.00 63.53  ? 139 ARG B CZ  1 
ATOM 4883  N NH1 . ARG B 1 142 ? 19.028  75.482  119.300 1.00 62.14  ? 139 ARG B NH1 1 
ATOM 4884  N NH2 . ARG B 1 142 ? 20.624  77.023  118.755 1.00 63.83  ? 139 ARG B NH2 1 
ATOM 4885  N N   . ARG B 1 143 ? 25.887  70.752  120.625 1.00 36.08  ? 140 ARG B N   1 
ATOM 4886  C CA  . ARG B 1 143 ? 26.209  69.326  120.654 1.00 61.71  ? 140 ARG B CA  1 
ATOM 4887  C C   . ARG B 1 143 ? 25.558  68.615  121.833 1.00 58.82  ? 140 ARG B C   1 
ATOM 4888  O O   . ARG B 1 143 ? 24.787  67.678  121.636 1.00 64.17  ? 140 ARG B O   1 
ATOM 4889  C CB  . ARG B 1 143 ? 27.728  69.104  120.673 1.00 46.93  ? 140 ARG B CB  1 
ATOM 4890  C CG  . ARG B 1 143 ? 28.168  67.683  120.355 1.00 49.39  ? 140 ARG B CG  1 
ATOM 4891  C CD  . ARG B 1 143 ? 29.668  67.616  120.458 1.00 57.03  ? 140 ARG B CD  1 
ATOM 4892  N NE  . ARG B 1 143 ? 30.205  66.449  119.793 1.00 79.18  ? 140 ARG B NE  1 
ATOM 4893  C CZ  . ARG B 1 143 ? 30.808  66.406  118.613 1.00 51.46  ? 140 ARG B CZ  1 
ATOM 4894  N NH1 . ARG B 1 143 ? 31.213  65.228  118.187 1.00 53.73  ? 140 ARG B NH1 1 
ATOM 4895  N NH2 . ARG B 1 143 ? 31.003  67.498  117.887 1.00 60.92  ? 140 ARG B NH2 1 
ATOM 4896  N N   . ALA B 1 144 ? 25.862  69.061  123.052 1.00 52.21  ? 141 ALA B N   1 
ATOM 4897  C CA  . ALA B 1 144 ? 25.344  68.370  124.230 1.00 75.29  ? 141 ALA B CA  1 
ATOM 4898  C C   . ALA B 1 144 ? 23.828  68.303  124.181 1.00 55.35  ? 141 ALA B C   1 
ATOM 4899  O O   . ALA B 1 144 ? 23.241  67.243  124.412 1.00 44.29  ? 141 ALA B O   1 
ATOM 4900  C CB  . ALA B 1 144 ? 25.842  69.012  125.542 1.00 48.32  ? 141 ALA B CB  1 
ATOM 4901  N N   . GLU B 1 145 ? 23.196  69.429  123.860 1.00 42.64  ? 142 GLU B N   1 
ATOM 4902  C CA  . GLU B 1 145 ? 21.735  69.465  123.725 1.00 51.47  ? 142 GLU B CA  1 
ATOM 4903  C C   . GLU B 1 145 ? 21.179  68.404  122.758 1.00 56.91  ? 142 GLU B C   1 
ATOM 4904  O O   . GLU B 1 145 ? 20.239  67.693  123.080 1.00 56.66  ? 142 GLU B O   1 
ATOM 4905  C CB  . GLU B 1 145 ? 21.246  70.855  123.291 1.00 49.35  ? 142 GLU B CB  1 
ATOM 4906  C CG  . GLU B 1 145 ? 19.831  70.801  122.711 1.00 66.73  ? 142 GLU B CG  1 
ATOM 4907  C CD  . GLU B 1 145 ? 19.430  72.056  121.961 1.00 74.41  ? 142 GLU B CD  1 
ATOM 4908  O OE1 . GLU B 1 145 ? 20.237  73.007  121.913 1.00 78.62  ? 142 GLU B OE1 1 
ATOM 4909  O OE2 . GLU B 1 145 ? 18.300  72.089  121.429 1.00 46.58  ? 142 GLU B OE2 1 
ATOM 4910  N N   . ILE B 1 146 ? 21.771  68.295  121.574 1.00 47.57  ? 143 ILE B N   1 
ATOM 4911  C CA  . ILE B 1 146 ? 21.300  67.349  120.561 1.00 45.21  ? 143 ILE B CA  1 
ATOM 4912  C C   . ILE B 1 146 ? 21.610  65.888  120.921 1.00 58.41  ? 143 ILE B C   1 
ATOM 4913  O O   . ILE B 1 146 ? 20.817  64.986  120.651 1.00 53.06  ? 143 ILE B O   1 
ATOM 4914  C CB  . ILE B 1 146 ? 21.808  67.752  119.126 1.00 44.25  ? 143 ILE B CB  1 
ATOM 4915  C CG1 . ILE B 1 146 ? 20.685  67.618  118.112 1.00 45.57  ? 143 ILE B CG1 1 
ATOM 4916  C CG2 . ILE B 1 146 ? 23.052  66.970  118.715 1.00 37.70  ? 143 ILE B CG2 1 
ATOM 4917  C CD1 . ILE B 1 146 ? 20.387  66.196  117.788 1.00 57.54  ? 143 ILE B CD1 1 
ATOM 4918  N N   . LEU B 1 147 ? 22.760  65.658  121.546 1.00 52.98  ? 144 LEU B N   1 
ATOM 4919  C CA  . LEU B 1 147 ? 23.070  64.347  122.101 1.00 56.43  ? 144 LEU B CA  1 
ATOM 4920  C C   . LEU B 1 147 ? 22.021  63.973  123.146 1.00 64.01  ? 144 LEU B C   1 
ATOM 4921  O O   . LEU B 1 147 ? 21.431  62.884  123.103 1.00 60.45  ? 144 LEU B O   1 
ATOM 4922  C CB  . LEU B 1 147 ? 24.453  64.364  122.738 1.00 43.49  ? 144 LEU B CB  1 
ATOM 4923  C CG  . LEU B 1 147 ? 25.614  63.755  121.949 1.00 64.02  ? 144 LEU B CG  1 
ATOM 4924  C CD1 . LEU B 1 147 ? 25.382  63.840  120.484 1.00 53.33  ? 144 LEU B CD1 1 
ATOM 4925  C CD2 . LEU B 1 147 ? 26.912  64.453  122.304 1.00 61.43  ? 144 LEU B CD2 1 
ATOM 4926  N N   . ALA B 1 148 ? 21.775  64.898  124.068 1.00 44.29  ? 145 ALA B N   1 
ATOM 4927  C CA  . ALA B 1 148 ? 20.858  64.638  125.185 1.00 64.64  ? 145 ALA B CA  1 
ATOM 4928  C C   . ALA B 1 148 ? 19.442  64.303  124.737 1.00 58.97  ? 145 ALA B C   1 
ATOM 4929  O O   . ALA B 1 148 ? 18.847  63.366  125.270 1.00 50.24  ? 145 ALA B O   1 
ATOM 4930  C CB  . ALA B 1 148 ? 20.857  65.800  126.182 1.00 32.99  ? 145 ALA B CB  1 
ATOM 4931  N N   . LYS B 1 149 ? 18.912  65.057  123.760 1.00 59.33  ? 146 LYS B N   1 
ATOM 4932  C CA  . LYS B 1 149 ? 17.558  64.817  123.226 1.00 50.30  ? 146 LYS B CA  1 
ATOM 4933  C C   . LYS B 1 149 ? 17.435  63.494  122.477 1.00 49.51  ? 146 LYS B C   1 
ATOM 4934  O O   . LYS B 1 149 ? 16.353  62.912  122.402 1.00 61.02  ? 146 LYS B O   1 
ATOM 4935  C CB  . LYS B 1 149 ? 17.085  65.967  122.332 1.00 51.71  ? 146 LYS B CB  1 
ATOM 4936  C CG  . LYS B 1 149 ? 16.775  67.222  123.082 1.00 59.09  ? 146 LYS B CG  1 
ATOM 4937  C CD  . LYS B 1 149 ? 16.539  68.375  122.156 1.00 43.75  ? 146 LYS B CD  1 
ATOM 4938  C CE  . LYS B 1 149 ? 16.120  69.624  122.936 1.00 44.43  ? 146 LYS B CE  1 
ATOM 4939  N NZ  . LYS B 1 149 ? 16.025  70.826  122.059 1.00 39.73  ? 146 LYS B NZ  1 
ATOM 4940  N N   . THR B 1 150 ? 18.550  63.037  121.914 1.00 61.60  ? 147 THR B N   1 
ATOM 4941  C CA  . THR B 1 150 ? 18.585  61.784  121.181 1.00 51.89  ? 147 THR B CA  1 
ATOM 4942  C C   . THR B 1 150 ? 18.627  60.645  122.177 1.00 53.76  ? 147 THR B C   1 
ATOM 4943  O O   . THR B 1 150 ? 17.922  59.653  122.013 1.00 63.80  ? 147 THR B O   1 
ATOM 4944  C CB  . THR B 1 150 ? 19.804  61.720  120.232 1.00 62.83  ? 147 THR B CB  1 
ATOM 4945  O OG1 . THR B 1 150 ? 19.799  62.864  119.383 1.00 60.32  ? 147 THR B OG1 1 
ATOM 4946  C CG2 . THR B 1 150 ? 19.770  60.475  119.365 1.00 42.42  ? 147 THR B CG2 1 
ATOM 4947  N N   . MET B 1 151 ? 19.450  60.794  123.215 1.00 56.36  ? 148 MET B N   1 
ATOM 4948  C CA  . MET B 1 151 ? 19.524  59.795  124.285 1.00 61.45  ? 148 MET B CA  1 
ATOM 4949  C C   . MET B 1 151 ? 18.155  59.619  124.959 1.00 55.75  ? 148 MET B C   1 
ATOM 4950  O O   . MET B 1 151 ? 17.633  58.507  125.065 1.00 60.35  ? 148 MET B O   1 
ATOM 4951  C CB  . MET B 1 151 ? 20.589  60.183  125.316 1.00 52.56  ? 148 MET B CB  1 
ATOM 4952  C CG  . MET B 1 151 ? 21.987  60.317  124.753 1.00 55.42  ? 148 MET B CG  1 
ATOM 4953  S SD  . MET B 1 151 ? 23.209  60.750  125.992 1.00 41.58  ? 148 MET B SD  1 
ATOM 4954  C CE  . MET B 1 151 ? 22.933  59.383  127.125 1.00 46.87  ? 148 MET B CE  1 
ATOM 4955  N N   . VAL B 1 152 ? 17.563  60.732  125.371 1.00 40.06  ? 149 VAL B N   1 
ATOM 4956  C CA  . VAL B 1 152 ? 16.302  60.715  126.101 1.00 61.74  ? 149 VAL B CA  1 
ATOM 4957  C C   . VAL B 1 152 ? 15.085  60.332  125.251 1.00 58.97  ? 149 VAL B C   1 
ATOM 4958  O O   . VAL B 1 152 ? 14.224  59.576  125.704 1.00 61.60  ? 149 VAL B O   1 
ATOM 4959  C CB  . VAL B 1 152 ? 16.040  62.064  126.829 1.00 65.68  ? 149 VAL B CB  1 
ATOM 4960  C CG1 . VAL B 1 152 ? 14.604  62.152  127.261 1.00 63.52  ? 149 VAL B CG1 1 
ATOM 4961  C CG2 . VAL B 1 152 ? 16.932  62.207  128.045 1.00 32.78  ? 149 VAL B CG2 1 
ATOM 4962  N N   . GLY B 1 153 ? 15.008  60.850  124.027 1.00 54.87  ? 150 GLY B N   1 
ATOM 4963  C CA  . GLY B 1 153 ? 13.850  60.616  123.176 1.00 39.02  ? 150 GLY B CA  1 
ATOM 4964  C C   . GLY B 1 153 ? 13.853  59.312  122.388 1.00 37.55  ? 150 GLY B C   1 
ATOM 4965  O O   . GLY B 1 153 ? 12.791  58.746  122.116 1.00 53.02  ? 150 GLY B O   1 
ATOM 4966  N N   . GLN B 1 154 ? 15.041  58.817  122.041 1.00 46.12  ? 151 GLN B N   1 
ATOM 4967  C CA  . GLN B 1 154 ? 15.162  57.597  121.232 1.00 66.24  ? 151 GLN B CA  1 
ATOM 4968  C C   . GLN B 1 154 ? 15.820  56.410  121.953 1.00 62.55  ? 151 GLN B C   1 
ATOM 4969  O O   . GLN B 1 154 ? 15.735  55.260  121.499 1.00 67.89  ? 151 GLN B O   1 
ATOM 4970  C CB  . GLN B 1 154 ? 15.882  57.907  119.919 1.00 50.21  ? 151 GLN B CB  1 
ATOM 4971  C CG  . GLN B 1 154 ? 15.080  58.826  118.976 1.00 51.01  ? 151 GLN B CG  1 
ATOM 4972  C CD  . GLN B 1 154 ? 15.941  59.926  118.357 1.00 57.66  ? 151 GLN B CD  1 
ATOM 4973  O OE1 . GLN B 1 154 ? 15.997  61.053  118.860 1.00 58.59  ? 151 GLN B OE1 1 
ATOM 4974  N NE2 . GLN B 1 154 ? 16.635  59.591  117.281 1.00 36.69  ? 151 GLN B NE2 1 
ATOM 4975  N N   . GLY B 1 155 ? 16.472  56.688  123.076 1.00 51.96  ? 152 GLY B N   1 
ATOM 4976  C CA  . GLY B 1 155 ? 16.978  55.628  123.931 1.00 64.90  ? 152 GLY B CA  1 
ATOM 4977  C C   . GLY B 1 155 ? 18.392  55.216  123.590 1.00 67.61  ? 152 GLY B C   1 
ATOM 4978  O O   . GLY B 1 155 ? 18.824  54.070  123.826 1.00 58.41  ? 152 GLY B O   1 
ATOM 4979  N N   . LYS B 1 156 ? 19.126  56.165  123.027 1.00 61.51  ? 153 LYS B N   1 
ATOM 4980  C CA  . LYS B 1 156 ? 20.481  55.901  122.580 1.00 64.44  ? 153 LYS B CA  1 
ATOM 4981  C C   . LYS B 1 156 ? 21.451  56.101  123.747 1.00 72.03  ? 153 LYS B C   1 
ATOM 4982  O O   . LYS B 1 156 ? 21.216  56.948  124.605 1.00 51.72  ? 153 LYS B O   1 
ATOM 4983  C CB  . LYS B 1 156 ? 20.842  56.809  121.390 1.00 61.76  ? 153 LYS B CB  1 
ATOM 4984  C CG  . LYS B 1 156 ? 20.342  56.307  120.033 1.00 77.98  ? 153 LYS B CG  1 
ATOM 4985  C CD  . LYS B 1 156 ? 20.838  57.170  118.880 1.00 59.03  ? 153 LYS B CD  1 
ATOM 4986  C CE  . LYS B 1 156 ? 20.560  56.521  117.516 1.00 56.91  ? 153 LYS B CE  1 
ATOM 4987  N NZ  . LYS B 1 156 ? 21.835  56.126  116.826 1.00 85.79  ? 153 LYS B NZ  1 
ATOM 4988  N N   . THR B 1 157 ? 22.520  55.306  123.790 1.00 56.65  ? 154 THR B N   1 
ATOM 4989  C CA  . THR B 1 157 ? 23.600  55.544  124.738 1.00 51.96  ? 154 THR B CA  1 
ATOM 4990  C C   . THR B 1 157 ? 24.460  56.703  124.268 1.00 68.25  ? 154 THR B C   1 
ATOM 4991  O O   . THR B 1 157 ? 24.390  57.129  123.117 1.00 62.85  ? 154 THR B O   1 
ATOM 4992  C CB  . THR B 1 157 ? 24.507  54.304  124.949 1.00 62.92  ? 154 THR B CB  1 
ATOM 4993  O OG1 . THR B 1 157 ? 25.151  53.957  123.718 1.00 60.62  ? 154 THR B OG1 1 
ATOM 4994  C CG2 . THR B 1 157 ? 23.697  53.107  125.454 1.00 41.64  ? 154 THR B CG2 1 
ATOM 4995  N N   . VAL B 1 158 ? 25.280  57.207  125.173 1.00 66.78  ? 155 VAL B N   1 
ATOM 4996  C CA  . VAL B 1 158 ? 26.154  58.322  124.863 1.00 62.96  ? 155 VAL B CA  1 
ATOM 4997  C C   . VAL B 1 158 ? 26.837  58.164  123.500 1.00 72.38  ? 155 VAL B C   1 
ATOM 4998  O O   . VAL B 1 158 ? 26.744  59.041  122.654 1.00 58.61  ? 155 VAL B O   1 
ATOM 4999  C CB  . VAL B 1 158 ? 27.230  58.487  125.945 1.00 64.69  ? 155 VAL B CB  1 
ATOM 5000  C CG1 . VAL B 1 158 ? 28.291  59.491  125.504 1.00 52.29  ? 155 VAL B CG1 1 
ATOM 5001  C CG2 . VAL B 1 158 ? 26.595  58.892  127.271 1.00 73.03  ? 155 VAL B CG2 1 
ATOM 5002  N N   . ILE B 1 159 ? 27.521  57.046  123.287 1.00 55.96  ? 156 ILE B N   1 
ATOM 5003  C CA  . ILE B 1 159 ? 28.346  56.899  122.100 1.00 48.77  ? 156 ILE B CA  1 
ATOM 5004  C C   . ILE B 1 159 ? 27.513  56.729  120.830 1.00 65.12  ? 156 ILE B C   1 
ATOM 5005  O O   . ILE B 1 159 ? 27.945  57.139  119.765 1.00 61.19  ? 156 ILE B O   1 
ATOM 5006  C CB  . ILE B 1 159 ? 29.381  55.741  122.236 1.00 54.40  ? 156 ILE B CB  1 
ATOM 5007  C CG1 . ILE B 1 159 ? 30.384  55.782  121.074 1.00 58.43  ? 156 ILE B CG1 1 
ATOM 5008  C CG2 . ILE B 1 159 ? 28.681  54.398  122.305 1.00 46.33  ? 156 ILE B CG2 1 
ATOM 5009  C CD1 . ILE B 1 159 ? 31.104  57.115  120.938 1.00 62.76  ? 156 ILE B CD1 1 
ATOM 5010  N N   . GLN B 1 160 ? 26.333  56.125  120.945 1.00 48.86  ? 157 GLN B N   1 
ATOM 5011  C CA  . GLN B 1 160 ? 25.436  56.000  119.808 1.00 54.65  ? 157 GLN B CA  1 
ATOM 5012  C C   . GLN B 1 160 ? 24.861  57.350  119.406 1.00 67.01  ? 157 GLN B C   1 
ATOM 5013  O O   . GLN B 1 160 ? 24.682  57.626  118.228 1.00 65.85  ? 157 GLN B O   1 
ATOM 5014  C CB  . GLN B 1 160 ? 24.290  55.032  120.088 1.00 46.16  ? 157 GLN B CB  1 
ATOM 5015  C CG  . GLN B 1 160 ? 24.687  53.572  120.052 1.00 54.41  ? 157 GLN B CG  1 
ATOM 5016  C CD  . GLN B 1 160 ? 25.543  53.237  118.857 1.00 69.10  ? 157 GLN B CD  1 
ATOM 5017  O OE1 . GLN B 1 160 ? 25.089  53.297  117.709 1.00 86.78  ? 157 GLN B OE1 1 
ATOM 5018  N NE2 . GLN B 1 160 ? 26.797  52.892  119.114 1.00 61.12  ? 157 GLN B NE2 1 
ATOM 5019  N N   . ALA B 1 161 ? 24.557  58.182  120.390 1.00 53.93  ? 158 ALA B N   1 
ATOM 5020  C CA  . ALA B 1 161 ? 24.047  59.508  120.110 1.00 50.67  ? 158 ALA B CA  1 
ATOM 5021  C C   . ALA B 1 161 ? 25.159  60.348  119.500 1.00 61.60  ? 158 ALA B C   1 
ATOM 5022  O O   . ALA B 1 161 ? 24.931  61.179  118.627 1.00 65.04  ? 158 ALA B O   1 
ATOM 5023  C CB  . ALA B 1 161 ? 23.526  60.167  121.377 1.00 42.37  ? 158 ALA B CB  1 
ATOM 5024  N N   . GLU B 1 162 ? 26.371  60.126  119.973 1.00 47.89  ? 159 GLU B N   1 
ATOM 5025  C CA  . GLU B 1 162 ? 27.513  60.888  119.506 1.00 60.20  ? 159 GLU B CA  1 
ATOM 5026  C C   . GLU B 1 162 ? 27.840  60.629  118.024 1.00 59.29  ? 159 GLU B C   1 
ATOM 5027  O O   . GLU B 1 162 ? 28.071  61.579  117.286 1.00 55.19  ? 159 GLU B O   1 
ATOM 5028  C CB  . GLU B 1 162 ? 28.727  60.624  120.413 1.00 49.06  ? 159 GLU B CB  1 
ATOM 5029  C CG  . GLU B 1 162 ? 30.102  60.972  119.830 1.00 57.31  ? 159 GLU B CG  1 
ATOM 5030  C CD  . GLU B 1 162 ? 30.401  62.484  119.739 1.00 74.20  ? 159 GLU B CD  1 
ATOM 5031  O OE1 . GLU B 1 162 ? 29.509  63.317  119.996 1.00 76.71  ? 159 GLU B OE1 1 
ATOM 5032  O OE2 . GLU B 1 162 ? 31.546  62.842  119.395 1.00 68.71  ? 159 GLU B OE2 1 
ATOM 5033  N N   . ILE B 1 163 ? 27.858  59.361  117.598 1.00 45.80  ? 160 ILE B N   1 
ATOM 5034  C CA  . ILE B 1 163 ? 28.230  59.026  116.223 1.00 64.49  ? 160 ILE B CA  1 
ATOM 5035  C C   . ILE B 1 163 ? 27.094  59.346  115.243 1.00 56.96  ? 160 ILE B C   1 
ATOM 5036  O O   . ILE B 1 163 ? 27.313  59.471  114.043 1.00 67.82  ? 160 ILE B O   1 
ATOM 5037  C CB  . ILE B 1 163 ? 28.636  57.539  116.057 1.00 46.25  ? 160 ILE B CB  1 
ATOM 5038  C CG1 . ILE B 1 163 ? 27.404  56.637  116.182 1.00 53.87  ? 160 ILE B CG1 1 
ATOM 5039  C CG2 . ILE B 1 163 ? 29.735  57.127  117.053 1.00 45.66  ? 160 ILE B CG2 1 
ATOM 5040  C CD1 . ILE B 1 163 ? 27.712  55.174  116.005 1.00 49.85  ? 160 ILE B CD1 1 
ATOM 5041  N N   . ASP B 1 164 ? 25.890  59.489  115.779 1.00 56.99  ? 161 ASP B N   1 
ATOM 5042  C CA  . ASP B 1 164 ? 24.691  59.780  114.997 1.00 56.68  ? 161 ASP B CA  1 
ATOM 5043  C C   . ASP B 1 164 ? 24.318  61.266  115.010 1.00 58.35  ? 161 ASP B C   1 
ATOM 5044  O O   . ASP B 1 164 ? 24.521  61.981  114.029 1.00 67.50  ? 161 ASP B O   1 
ATOM 5045  C CB  . ASP B 1 164 ? 23.520  58.923  115.500 1.00 49.77  ? 161 ASP B CB  1 
ATOM 5046  C CG  . ASP B 1 164 ? 22.159  59.477  115.106 1.00 82.34  ? 161 ASP B CG  1 
ATOM 5047  O OD1 . ASP B 1 164 ? 22.053  60.186  114.080 1.00 51.51  ? 161 ASP B OD1 1 
ATOM 5048  O OD2 . ASP B 1 164 ? 21.178  59.186  115.834 1.00 68.27  ? 161 ASP B OD2 1 
ATOM 5049  N N   . ALA B 1 165 ? 23.777  61.732  116.124 1.00 63.27  ? 162 ALA B N   1 
ATOM 5050  C CA  . ALA B 1 165 ? 23.216  63.077  116.174 1.00 48.63  ? 162 ALA B CA  1 
ATOM 5051  C C   . ALA B 1 165 ? 24.265  64.167  116.058 1.00 58.06  ? 162 ALA B C   1 
ATOM 5052  O O   . ALA B 1 165 ? 23.938  65.304  115.743 1.00 64.77  ? 162 ALA B O   1 
ATOM 5053  C CB  . ALA B 1 165 ? 22.392  63.255  117.435 1.00 54.56  ? 162 ALA B CB  1 
ATOM 5054  N N   . ALA B 1 166 ? 25.525  63.834  116.317 1.00 52.41  ? 163 ALA B N   1 
ATOM 5055  C CA  . ALA B 1 166 ? 26.589  64.811  116.124 1.00 59.51  ? 163 ALA B CA  1 
ATOM 5056  C C   . ALA B 1 166 ? 27.396  64.509  114.869 1.00 68.04  ? 163 ALA B C   1 
ATOM 5057  O O   . ALA B 1 166 ? 27.234  65.176  113.860 1.00 80.57  ? 163 ALA B O   1 
ATOM 5058  C CB  . ALA B 1 166 ? 27.498  64.866  117.333 1.00 52.57  ? 163 ALA B CB  1 
ATOM 5059  N N   . ALA B 1 167 ? 28.249  63.492  114.932 1.00 43.20  ? 164 ALA B N   1 
ATOM 5060  C CA  . ALA B 1 167 ? 29.214  63.212  113.862 1.00 63.07  ? 164 ALA B CA  1 
ATOM 5061  C C   . ALA B 1 167 ? 28.603  63.023  112.478 1.00 59.98  ? 164 ALA B C   1 
ATOM 5062  O O   . ALA B 1 167 ? 29.014  63.682  111.534 1.00 64.78  ? 164 ALA B O   1 
ATOM 5063  C CB  . ALA B 1 167 ? 30.082  62.017  114.211 1.00 51.36  ? 164 ALA B CB  1 
ATOM 5064  N N   . GLU B 1 168 ? 27.626  62.127  112.355 1.00 55.58  ? 165 GLU B N   1 
ATOM 5065  C CA  . GLU B 1 168 ? 27.040  61.826  111.052 1.00 36.87  ? 165 GLU B CA  1 
ATOM 5066  C C   . GLU B 1 168 ? 26.231  62.994  110.483 1.00 53.57  ? 165 GLU B C   1 
ATOM 5067  O O   . GLU B 1 168 ? 26.381  63.345  109.335 1.00 62.00  ? 165 GLU B O   1 
ATOM 5068  C CB  . GLU B 1 168 ? 26.195  60.575  111.121 1.00 44.66  ? 165 GLU B CB  1 
ATOM 5069  C CG  . GLU B 1 168 ? 25.842  60.002  109.763 1.00 61.90  ? 165 GLU B CG  1 
ATOM 5070  C CD  . GLU B 1 168 ? 24.942  58.784  109.859 1.00 91.15  ? 165 GLU B CD  1 
ATOM 5071  O OE1 . GLU B 1 168 ? 24.116  58.745  110.792 1.00 124.59 ? 165 GLU B OE1 1 
ATOM 5072  O OE2 . GLU B 1 168 ? 25.059  57.866  109.014 1.00 79.58  ? 165 GLU B OE2 1 
ATOM 5073  N N   . LEU B 1 169 ? 25.388  63.603  111.300 1.00 47.20  ? 166 LEU B N   1 
ATOM 5074  C CA  . LEU B 1 169 ? 24.619  64.771  110.896 1.00 49.75  ? 166 LEU B CA  1 
ATOM 5075  C C   . LEU B 1 169 ? 25.501  65.971  110.495 1.00 44.09  ? 166 LEU B C   1 
ATOM 5076  O O   . LEU B 1 169 ? 25.259  66.636  109.492 1.00 40.83  ? 166 LEU B O   1 
ATOM 5077  C CB  . LEU B 1 169 ? 23.663  65.163  112.032 1.00 45.28  ? 166 LEU B CB  1 
ATOM 5078  C CG  . LEU B 1 169 ? 22.782  66.365  111.750 1.00 54.73  ? 166 LEU B CG  1 
ATOM 5079  C CD1 . LEU B 1 169 ? 22.026  66.156  110.446 1.00 41.98  ? 166 LEU B CD1 1 
ATOM 5080  C CD2 . LEU B 1 169 ? 21.843  66.609  112.899 1.00 52.92  ? 166 LEU B CD2 1 
ATOM 5081  N N   . ILE B 1 170 ? 26.503  66.267  111.310 1.00 48.72  ? 167 ILE B N   1 
ATOM 5082  C CA  . ILE B 1 170 ? 27.495  67.299  111.010 1.00 43.88  ? 167 ILE B CA  1 
ATOM 5083  C C   . ILE B 1 170 ? 28.230  66.984  109.698 1.00 54.24  ? 167 ILE B C   1 
ATOM 5084  O O   . ILE B 1 170 ? 28.442  67.861  108.877 1.00 55.29  ? 167 ILE B O   1 
ATOM 5085  C CB  . ILE B 1 170 ? 28.509  67.403  112.188 1.00 56.95  ? 167 ILE B CB  1 
ATOM 5086  C CG1 . ILE B 1 170 ? 27.868  68.091  113.382 1.00 49.62  ? 167 ILE B CG1 1 
ATOM 5087  C CG2 . ILE B 1 170 ? 29.799  68.131  111.819 1.00 37.99  ? 167 ILE B CG2 1 
ATOM 5088  C CD1 . ILE B 1 170 ? 28.627  67.842  114.641 1.00 47.85  ? 167 ILE B CD1 1 
ATOM 5089  N N   . ASP B 1 171 ? 28.617  65.725  109.509 1.00 45.19  ? 168 ASP B N   1 
ATOM 5090  C CA  . ASP B 1 171 ? 29.294  65.307  108.289 1.00 40.69  ? 168 ASP B CA  1 
ATOM 5091  C C   . ASP B 1 171 ? 28.400  65.405  107.043 1.00 50.54  ? 168 ASP B C   1 
ATOM 5092  O O   . ASP B 1 171 ? 28.845  65.851  106.009 1.00 41.58  ? 168 ASP B O   1 
ATOM 5093  C CB  . ASP B 1 171 ? 29.896  63.903  108.452 1.00 40.47  ? 168 ASP B CB  1 
ATOM 5094  C CG  . ASP B 1 171 ? 31.136  63.898  109.364 1.00 59.21  ? 168 ASP B CG  1 
ATOM 5095  O OD1 . ASP B 1 171 ? 31.723  64.983  109.603 1.00 54.17  ? 168 ASP B OD1 1 
ATOM 5096  O OD2 . ASP B 1 171 ? 31.520  62.811  109.845 1.00 55.01  ? 168 ASP B OD2 1 
ATOM 5097  N N   . PHE B 1 172 ? 27.144  64.992  107.145 1.00 43.05  ? 169 PHE B N   1 
ATOM 5098  C CA  . PHE B 1 172 ? 26.191  65.147  106.056 1.00 36.20  ? 169 PHE B CA  1 
ATOM 5099  C C   . PHE B 1 172 ? 26.135  66.606  105.625 1.00 46.37  ? 169 PHE B C   1 
ATOM 5100  O O   . PHE B 1 172 ? 26.235  66.904  104.448 1.00 51.86  ? 169 PHE B O   1 
ATOM 5101  C CB  . PHE B 1 172 ? 24.788  64.680  106.471 1.00 33.41  ? 169 PHE B CB  1 
ATOM 5102  C CG  . PHE B 1 172 ? 24.546  63.225  106.273 1.00 54.52  ? 169 PHE B CG  1 
ATOM 5103  C CD1 . PHE B 1 172 ? 24.969  62.598  105.112 1.00 61.98  ? 169 PHE B CD1 1 
ATOM 5104  C CD2 . PHE B 1 172 ? 23.877  62.474  107.241 1.00 55.37  ? 169 PHE B CD2 1 
ATOM 5105  C CE1 . PHE B 1 172 ? 24.745  61.243  104.909 1.00 57.42  ? 169 PHE B CE1 1 
ATOM 5106  C CE2 . PHE B 1 172 ? 23.642  61.108  107.050 1.00 44.26  ? 169 PHE B CE2 1 
ATOM 5107  C CZ  . PHE B 1 172 ? 24.089  60.492  105.876 1.00 58.08  ? 169 PHE B CZ  1 
ATOM 5108  N N   . PHE B 1 173 ? 25.979  67.516  106.577 1.00 42.84  ? 170 PHE B N   1 
ATOM 5109  C CA  . PHE B 1 173 ? 25.905  68.934  106.249 1.00 43.62  ? 170 PHE B CA  1 
ATOM 5110  C C   . PHE B 1 173 ? 27.155  69.455  105.564 1.00 47.65  ? 170 PHE B C   1 
ATOM 5111  O O   . PHE B 1 173 ? 27.070  70.158  104.561 1.00 59.58  ? 170 PHE B O   1 
ATOM 5112  C CB  . PHE B 1 173 ? 25.599  69.783  107.481 1.00 35.27  ? 170 PHE B CB  1 
ATOM 5113  C CG  . PHE B 1 173 ? 24.163  69.703  107.930 1.00 55.88  ? 170 PHE B CG  1 
ATOM 5114  C CD1 . PHE B 1 173 ? 23.235  68.963  107.211 1.00 48.30  ? 170 PHE B CD1 1 
ATOM 5115  C CD2 . PHE B 1 173 ? 23.740  70.378  109.062 1.00 45.46  ? 170 PHE B CD2 1 
ATOM 5116  C CE1 . PHE B 1 173 ? 21.915  68.883  107.616 1.00 55.71  ? 170 PHE B CE1 1 
ATOM 5117  C CE2 . PHE B 1 173 ? 22.425  70.311  109.475 1.00 50.69  ? 170 PHE B CE2 1 
ATOM 5118  C CZ  . PHE B 1 173 ? 21.503  69.565  108.751 1.00 54.77  ? 170 PHE B CZ  1 
ATOM 5119  N N   . ARG B 1 174 ? 28.313  69.108  106.104 1.00 42.82  ? 171 ARG B N   1 
ATOM 5120  C CA  . ARG B 1 174 ? 29.568  69.592  105.546 1.00 53.96  ? 171 ARG B CA  1 
ATOM 5121  C C   . ARG B 1 174 ? 29.937  68.931  104.223 1.00 49.61  ? 171 ARG B C   1 
ATOM 5122  O O   . ARG B 1 174 ? 30.301  69.607  103.285 1.00 51.25  ? 171 ARG B O   1 
ATOM 5123  C CB  . ARG B 1 174 ? 30.704  69.422  106.549 1.00 45.83  ? 171 ARG B CB  1 
ATOM 5124  C CG  . ARG B 1 174 ? 30.576  70.282  107.769 1.00 46.22  ? 171 ARG B CG  1 
ATOM 5125  C CD  . ARG B 1 174 ? 31.930  70.490  108.398 1.00 54.47  ? 171 ARG B CD  1 
ATOM 5126  N NE  . ARG B 1 174 ? 31.842  71.225  109.651 1.00 67.32  ? 171 ARG B NE  1 
ATOM 5127  C CZ  . ARG B 1 174 ? 32.111  70.702  110.842 1.00 60.44  ? 171 ARG B CZ  1 
ATOM 5128  N NH1 . ARG B 1 174 ? 32.486  69.423  110.953 1.00 45.67  ? 171 ARG B NH1 1 
ATOM 5129  N NH2 . ARG B 1 174 ? 32.003  71.465  111.919 1.00 50.45  ? 171 ARG B NH2 1 
ATOM 5130  N N   . PHE B 1 175 ? 29.859  67.609  104.162 1.00 46.99  ? 172 PHE B N   1 
ATOM 5131  C CA  . PHE B 1 175 ? 30.257  66.898  102.967 1.00 46.84  ? 172 PHE B CA  1 
ATOM 5132  C C   . PHE B 1 175 ? 29.315  67.143  101.793 1.00 44.87  ? 172 PHE B C   1 
ATOM 5133  O O   . PHE B 1 175 ? 29.774  67.277  100.668 1.00 43.68  ? 172 PHE B O   1 
ATOM 5134  C CB  . PHE B 1 175 ? 30.423  65.406  103.245 1.00 40.52  ? 172 PHE B CB  1 
ATOM 5135  C CG  . PHE B 1 175 ? 31.751  65.054  103.854 1.00 66.20  ? 172 PHE B CG  1 
ATOM 5136  C CD1 . PHE B 1 175 ? 32.807  64.622  103.065 1.00 53.87  ? 172 PHE B CD1 1 
ATOM 5137  C CD2 . PHE B 1 175 ? 31.947  65.172  105.222 1.00 66.86  ? 172 PHE B CD2 1 
ATOM 5138  C CE1 . PHE B 1 175 ? 34.027  64.303  103.638 1.00 51.90  ? 172 PHE B CE1 1 
ATOM 5139  C CE2 . PHE B 1 175 ? 33.155  64.859  105.795 1.00 48.87  ? 172 PHE B CE2 1 
ATOM 5140  C CZ  . PHE B 1 175 ? 34.194  64.417  105.008 1.00 62.85  ? 172 PHE B CZ  1 
ATOM 5141  N N   . ASN B 1 176 ? 28.011  67.204  102.039 1.00 47.31  ? 173 ASN B N   1 
ATOM 5142  C CA  . ASN B 1 176 ? 27.074  67.504  100.950 1.00 43.36  ? 173 ASN B CA  1 
ATOM 5143  C C   . ASN B 1 176 ? 27.277  68.925  100.450 1.00 52.92  ? 173 ASN B C   1 
ATOM 5144  O O   . ASN B 1 176 ? 27.101  69.194  99.270  1.00 62.14  ? 173 ASN B O   1 
ATOM 5145  C CB  . ASN B 1 176 ? 25.604  67.294  101.356 1.00 29.87  ? 173 ASN B CB  1 
ATOM 5146  C CG  . ASN B 1 176 ? 25.212  65.840  101.378 1.00 32.06  ? 173 ASN B CG  1 
ATOM 5147  O OD1 . ASN B 1 176 ? 24.308  65.455  102.100 1.00 46.05  ? 173 ASN B OD1 1 
ATOM 5148  N ND2 . ASN B 1 176 ? 25.907  65.021  100.598 1.00 46.15  ? 173 ASN B ND2 1 
ATOM 5149  N N   . ALA B 1 177 ? 27.657  69.833  101.342 1.00 40.01  ? 174 ALA B N   1 
ATOM 5150  C CA  . ALA B 1 177 ? 27.944  71.205  100.925 1.00 50.74  ? 174 ALA B CA  1 
ATOM 5151  C C   . ALA B 1 177 ? 29.180  71.260  100.029 1.00 41.84  ? 174 ALA B C   1 
ATOM 5152  O O   . ALA B 1 177 ? 29.195  71.972  99.036  1.00 52.93  ? 174 ALA B O   1 
ATOM 5153  C CB  . ALA B 1 177 ? 28.114  72.119  102.120 1.00 30.03  ? 174 ALA B CB  1 
ATOM 5154  N N   . LYS B 1 178 ? 30.206  70.498  100.384 1.00 35.94  ? 175 LYS B N   1 
ATOM 5155  C CA  . LYS B 1 178 ? 31.414  70.358  99.572  1.00 44.12  ? 175 LYS B CA  1 
ATOM 5156  C C   . LYS B 1 178 ? 31.082  69.780  98.202  1.00 59.18  ? 175 LYS B C   1 
ATOM 5157  O O   . LYS B 1 178 ? 31.541  70.284  97.188  1.00 62.28  ? 175 LYS B O   1 
ATOM 5158  C CB  . LYS B 1 178 ? 32.404  69.430  100.258 1.00 34.24  ? 175 LYS B CB  1 
ATOM 5159  C CG  . LYS B 1 178 ? 33.558  68.972  99.397  1.00 38.78  ? 175 LYS B CG  1 
ATOM 5160  C CD  . LYS B 1 178 ? 34.072  67.612  99.857  1.00 56.84  ? 175 LYS B CD  1 
ATOM 5161  C CE  . LYS B 1 178 ? 35.584  67.561  99.886  1.00 76.28  ? 175 LYS B CE  1 
ATOM 5162  N NZ  . LYS B 1 178 ? 36.153  67.939  98.568  1.00 55.42  ? 175 LYS B NZ  1 
ATOM 5163  N N   . TYR B 1 179 ? 30.289  68.715  98.177  1.00 47.92  ? 176 TYR B N   1 
ATOM 5164  C CA  . TYR B 1 179 ? 29.926  68.067  96.929  1.00 39.83  ? 176 TYR B CA  1 
ATOM 5165  C C   . TYR B 1 179 ? 29.094  68.972  95.996  1.00 42.77  ? 176 TYR B C   1 
ATOM 5166  O O   . TYR B 1 179 ? 29.291  68.956  94.785  1.00 50.20  ? 176 TYR B O   1 
ATOM 5167  C CB  . TYR B 1 179 ? 29.175  66.785  97.209  1.00 32.82  ? 176 TYR B CB  1 
ATOM 5168  C CG  . TYR B 1 179 ? 29.953  65.715  97.963  1.00 42.03  ? 176 TYR B CG  1 
ATOM 5169  C CD1 . TYR B 1 179 ? 31.304  65.518  97.757  1.00 48.88  ? 176 TYR B CD1 1 
ATOM 5170  C CD2 . TYR B 1 179 ? 29.302  64.885  98.867  1.00 33.34  ? 176 TYR B CD2 1 
ATOM 5171  C CE1 . TYR B 1 179 ? 31.990  64.514  98.440  1.00 47.25  ? 176 TYR B CE1 1 
ATOM 5172  C CE2 . TYR B 1 179 ? 29.955  63.895  99.535  1.00 49.35  ? 176 TYR B CE2 1 
ATOM 5173  C CZ  . TYR B 1 179 ? 31.296  63.699  99.335  1.00 67.42  ? 176 TYR B CZ  1 
ATOM 5174  O OH  . TYR B 1 179 ? 31.907  62.680  100.051 1.00 63.18  ? 176 TYR B OH  1 
ATOM 5175  N N   . ALA B 1 180 ? 28.171  69.746  96.563  1.00 33.97  ? 177 ALA B N   1 
ATOM 5176  C CA  . ALA B 1 180 ? 27.307  70.630  95.783  1.00 36.59  ? 177 ALA B CA  1 
ATOM 5177  C C   . ALA B 1 180 ? 28.086  71.795  95.189  1.00 46.28  ? 177 ALA B C   1 
ATOM 5178  O O   . ALA B 1 180 ? 27.826  72.230  94.066  1.00 58.52  ? 177 ALA B O   1 
ATOM 5179  C CB  . ALA B 1 180 ? 26.147  71.148  96.630  1.00 30.68  ? 177 ALA B CB  1 
ATOM 5180  N N   . VAL B 1 181 ? 29.040  72.302  95.957  1.00 49.85  ? 178 VAL B N   1 
ATOM 5181  C CA  . VAL B 1 181 ? 29.883  73.408  95.528  1.00 42.55  ? 178 VAL B CA  1 
ATOM 5182  C C   . VAL B 1 181 ? 30.820  72.990  94.388  1.00 52.75  ? 178 VAL B C   1 
ATOM 5183  O O   . VAL B 1 181 ? 31.050  73.725  93.432  1.00 49.69  ? 178 VAL B O   1 
ATOM 5184  C CB  . VAL B 1 181 ? 30.684  73.951  96.716  1.00 44.13  ? 178 VAL B CB  1 
ATOM 5185  C CG1 . VAL B 1 181 ? 31.894  74.758  96.252  1.00 31.62  ? 178 VAL B CG1 1 
ATOM 5186  C CG2 . VAL B 1 181 ? 29.776  74.783  97.599  1.00 36.60  ? 178 VAL B CG2 1 
ATOM 5187  N N   . GLU B 1 182 ? 31.344  71.788  94.498  1.00 43.56  ? 179 GLU B N   1 
ATOM 5188  C CA  . GLU B 1 182 ? 32.276  71.276  93.526  1.00 50.46  ? 179 GLU B CA  1 
ATOM 5189  C C   . GLU B 1 182 ? 31.567  70.773  92.269  1.00 56.29  ? 179 GLU B C   1 
ATOM 5190  O O   . GLU B 1 182 ? 32.188  70.629  91.217  1.00 61.25  ? 179 GLU B O   1 
ATOM 5191  C CB  . GLU B 1 182 ? 33.133  70.201  94.202  1.00 39.02  ? 179 GLU B CB  1 
ATOM 5192  C CG  . GLU B 1 182 ? 33.810  70.802  95.461  1.00 89.12  ? 179 GLU B CG  1 
ATOM 5193  C CD  . GLU B 1 182 ? 34.957  69.997  96.038  1.00 88.76  ? 179 GLU B CD  1 
ATOM 5194  O OE1 . GLU B 1 182 ? 35.122  68.807  95.684  1.00 89.01  ? 179 GLU B OE1 1 
ATOM 5195  O OE2 . GLU B 1 182 ? 35.696  70.572  96.865  1.00 95.44  ? 179 GLU B OE2 1 
ATOM 5196  N N   . LEU B 1 183 ? 30.262  70.533  92.382  1.00 45.81  ? 180 LEU B N   1 
ATOM 5197  C CA  . LEU B 1 183 ? 29.472  70.060  91.258  1.00 48.54  ? 180 LEU B CA  1 
ATOM 5198  C C   . LEU B 1 183 ? 29.343  71.177  90.245  1.00 60.93  ? 180 LEU B C   1 
ATOM 5199  O O   . LEU B 1 183 ? 29.352  70.934  89.043  1.00 50.26  ? 180 LEU B O   1 
ATOM 5200  C CB  . LEU B 1 183 ? 28.096  69.591  91.710  1.00 35.74  ? 180 LEU B CB  1 
ATOM 5201  C CG  . LEU B 1 183 ? 27.120  69.208  90.602  1.00 51.62  ? 180 LEU B CG  1 
ATOM 5202  C CD1 . LEU B 1 183 ? 27.689  68.009  89.853  1.00 31.20  ? 180 LEU B CD1 1 
ATOM 5203  C CD2 . LEU B 1 183 ? 25.728  68.900  91.155  1.00 35.73  ? 180 LEU B CD2 1 
ATOM 5204  N N   . GLU B 1 184 ? 29.250  72.405  90.744  1.00 50.14  ? 181 GLU B N   1 
ATOM 5205  C CA  . GLU B 1 184 ? 29.185  73.581  89.887  1.00 51.89  ? 181 GLU B CA  1 
ATOM 5206  C C   . GLU B 1 184 ? 30.346  73.658  88.934  1.00 52.76  ? 181 GLU B C   1 
ATOM 5207  O O   . GLU B 1 184 ? 30.228  74.258  87.861  1.00 66.52  ? 181 GLU B O   1 
ATOM 5208  C CB  . GLU B 1 184 ? 29.166  74.851  90.719  1.00 30.73  ? 181 GLU B CB  1 
ATOM 5209  C CG  . GLU B 1 184 ? 27.935  74.978  91.536  1.00 75.75  ? 181 GLU B CG  1 
ATOM 5210  C CD  . GLU B 1 184 ? 26.773  75.400  90.711  1.00 80.19  ? 181 GLU B CD  1 
ATOM 5211  O OE1 . GLU B 1 184 ? 27.005  76.191  89.773  1.00 79.98  ? 181 GLU B OE1 1 
ATOM 5212  O OE2 . GLU B 1 184 ? 25.643  74.947  91.001  1.00 89.22  ? 181 GLU B OE2 1 
ATOM 5213  N N   . GLY B 1 185 ? 31.470  73.064  89.327  1.00 47.99  ? 182 GLY B N   1 
ATOM 5214  C CA  . GLY B 1 185 ? 32.676  73.103  88.512  1.00 42.36  ? 182 GLY B CA  1 
ATOM 5215  C C   . GLY B 1 185 ? 32.645  72.112  87.359  1.00 52.96  ? 182 GLY B C   1 
ATOM 5216  O O   . GLY B 1 185 ? 33.468  72.198  86.456  1.00 73.61  ? 182 GLY B O   1 
ATOM 5217  N N   . GLN B 1 186 ? 31.715  71.157  87.398  1.00 54.93  ? 183 GLN B N   1 
ATOM 5218  C CA  . GLN B 1 186 ? 31.530  70.222  86.285  1.00 57.70  ? 183 GLN B CA  1 
ATOM 5219  C C   . GLN B 1 186 ? 30.739  70.913  85.184  1.00 53.79  ? 183 GLN B C   1 
ATOM 5220  O O   . GLN B 1 186 ? 29.519  71.039  85.247  1.00 40.83  ? 183 GLN B O   1 
ATOM 5221  C CB  . GLN B 1 186 ? 30.840  68.938  86.737  1.00 52.01  ? 183 GLN B CB  1 
ATOM 5222  C CG  . GLN B 1 186 ? 31.512  68.295  87.936  1.00 82.69  ? 183 GLN B CG  1 
ATOM 5223  C CD  . GLN B 1 186 ? 31.213  66.818  88.046  1.00 94.68  ? 183 GLN B CD  1 
ATOM 5224  O OE1 . GLN B 1 186 ? 31.284  66.088  87.058  1.00 97.63  ? 183 GLN B OE1 1 
ATOM 5225  N NE2 . GLN B 1 186 ? 30.881  66.365  89.250  1.00 66.25  ? 183 GLN B NE2 1 
ATOM 5226  N N   . GLN B 1 187 ? 31.461  71.390  84.185  1.00 48.14  ? 184 GLN B N   1 
ATOM 5227  C CA  . GLN B 1 187 ? 30.874  72.208  83.147  1.00 61.82  ? 184 GLN B CA  1 
ATOM 5228  C C   . GLN B 1 187 ? 31.229  71.628  81.795  1.00 67.09  ? 184 GLN B C   1 
ATOM 5229  O O   . GLN B 1 187 ? 32.284  71.006  81.653  1.00 51.92  ? 184 GLN B O   1 
ATOM 5230  C CB  . GLN B 1 187 ? 31.387  73.638  83.272  1.00 37.45  ? 184 GLN B CB  1 
ATOM 5231  C CG  . GLN B 1 187 ? 30.824  74.373  84.479  1.00 27.31  ? 184 GLN B CG  1 
ATOM 5232  C CD  . GLN B 1 187 ? 29.377  74.738  84.297  1.00 51.18  ? 184 GLN B CD  1 
ATOM 5233  O OE1 . GLN B 1 187 ? 28.976  75.227  83.244  1.00 53.93  ? 184 GLN B OE1 1 
ATOM 5234  N NE2 . GLN B 1 187 ? 28.580  74.491  85.308  1.00 30.25  ? 184 GLN B NE2 1 
ATOM 5235  N N   . PRO B 1 188 ? 30.352  71.821  80.796  1.00 43.83  ? 185 PRO B N   1 
ATOM 5236  C CA  . PRO B 1 188 ? 30.648  71.202  79.498  1.00 53.75  ? 185 PRO B CA  1 
ATOM 5237  C C   . PRO B 1 188 ? 31.740  71.932  78.689  1.00 49.48  ? 185 PRO B C   1 
ATOM 5238  O O   . PRO B 1 188 ? 32.221  73.001  79.057  1.00 45.79  ? 185 PRO B O   1 
ATOM 5239  C CB  . PRO B 1 188 ? 29.291  71.211  78.777  1.00 38.63  ? 185 PRO B CB  1 
ATOM 5240  C CG  . PRO B 1 188 ? 28.479  72.307  79.471  1.00 49.23  ? 185 PRO B CG  1 
ATOM 5241  C CD  . PRO B 1 188 ? 29.172  72.703  80.749  1.00 44.00  ? 185 PRO B CD  1 
ATOM 5242  N N   . ILE B 1 189 ? 32.127  71.310  77.584  1.00 64.50  ? 186 ILE B N   1 
ATOM 5243  C CA  . ILE B 1 189 ? 33.114  71.840  76.656  1.00 44.80  ? 186 ILE B CA  1 
ATOM 5244  C C   . ILE B 1 189 ? 32.548  73.038  75.888  1.00 51.97  ? 186 ILE B C   1 
ATOM 5245  O O   . ILE B 1 189 ? 31.402  73.035  75.445  1.00 48.58  ? 186 ILE B O   1 
ATOM 5246  C CB  . ILE B 1 189 ? 33.540  70.724  75.674  1.00 63.38  ? 186 ILE B CB  1 
ATOM 5247  C CG1 . ILE B 1 189 ? 34.382  69.671  76.406  1.00 56.43  ? 186 ILE B CG1 1 
ATOM 5248  C CG2 . ILE B 1 189 ? 34.279  71.287  74.481  1.00 58.06  ? 186 ILE B CG2 1 
ATOM 5249  C CD1 . ILE B 1 189 ? 34.487  68.332  75.667  1.00 64.31  ? 186 ILE B CD1 1 
ATOM 5250  N N   . SER B 1 190 ? 33.343  74.083  75.748  1.00 54.15  ? 187 SER B N   1 
ATOM 5251  C CA  . SER B 1 190 ? 32.931  75.204  74.910  1.00 72.14  ? 187 SER B CA  1 
ATOM 5252  C C   . SER B 1 190 ? 33.718  75.272  73.586  1.00 64.48  ? 187 SER B C   1 
ATOM 5253  O O   . SER B 1 190 ? 34.943  75.174  73.544  1.00 48.05  ? 187 SER B O   1 
ATOM 5254  C CB  . SER B 1 190 ? 33.028  76.525  75.673  1.00 49.37  ? 187 SER B CB  1 
ATOM 5255  O OG  . SER B 1 190 ? 31.883  76.742  76.467  1.00 65.12  ? 187 SER B OG  1 
ATOM 5256  N N   . VAL B 1 191 ? 33.001  75.435  72.493  1.00 66.66  ? 188 VAL B N   1 
ATOM 5257  C CA  . VAL B 1 191 ? 33.670  75.574  71.215  1.00 77.39  ? 188 VAL B CA  1 
ATOM 5258  C C   . VAL B 1 191 ? 33.155  76.796  70.487  1.00 73.37  ? 188 VAL B C   1 
ATOM 5259  O O   . VAL B 1 191 ? 31.960  76.912  70.246  1.00 58.07  ? 188 VAL B O   1 
ATOM 5260  C CB  . VAL B 1 191 ? 33.494  74.320  70.360  1.00 61.83  ? 188 VAL B CB  1 
ATOM 5261  C CG1 . VAL B 1 191 ? 33.687  74.639  68.890  1.00 61.92  ? 188 VAL B CG1 1 
ATOM 5262  C CG2 . VAL B 1 191 ? 34.473  73.262  70.818  1.00 50.18  ? 188 VAL B CG2 1 
ATOM 5263  N N   . PRO B 1 192 ? 34.062  77.723  70.160  1.00 74.59  ? 189 PRO B N   1 
ATOM 5264  C CA  . PRO B 1 192 ? 33.781  78.944  69.397  1.00 68.52  ? 189 PRO B CA  1 
ATOM 5265  C C   . PRO B 1 192 ? 32.961  78.624  68.151  1.00 67.71  ? 189 PRO B C   1 
ATOM 5266  O O   . PRO B 1 192 ? 33.252  77.621  67.485  1.00 60.41  ? 189 PRO B O   1 
ATOM 5267  C CB  . PRO B 1 192 ? 35.172  79.405  68.992  1.00 50.17  ? 189 PRO B CB  1 
ATOM 5268  C CG  . PRO B 1 192 ? 36.044  78.912  70.080  1.00 53.23  ? 189 PRO B CG  1 
ATOM 5269  C CD  . PRO B 1 192 ? 35.491  77.589  70.475  1.00 64.92  ? 189 PRO B CD  1 
ATOM 5270  N N   . PRO B 1 193 ? 31.955  79.459  67.829  1.00 60.43  ? 190 PRO B N   1 
ATOM 5271  C CA  . PRO B 1 193 ? 31.619  80.737  68.466  1.00 74.90  ? 190 PRO B CA  1 
ATOM 5272  C C   . PRO B 1 193 ? 30.567  80.606  69.565  1.00 59.91  ? 190 PRO B C   1 
ATOM 5273  O O   . PRO B 1 193 ? 29.736  81.503  69.694  1.00 49.66  ? 190 PRO B O   1 
ATOM 5274  C CB  . PRO B 1 193 ? 30.991  81.513  67.310  1.00 78.71  ? 190 PRO B CB  1 
ATOM 5275  C CG  . PRO B 1 193 ? 30.206  80.444  66.568  1.00 47.99  ? 190 PRO B CG  1 
ATOM 5276  C CD  . PRO B 1 193 ? 31.020  79.150  66.728  1.00 48.09  ? 190 PRO B CD  1 
ATOM 5277  N N   . SER B 1 194 ? 30.597  79.516  70.325  1.00 58.71  ? 191 SER B N   1 
ATOM 5278  C CA  . SER B 1 194 ? 29.599  79.272  71.362  1.00 59.84  ? 191 SER B CA  1 
ATOM 5279  C C   . SER B 1 194 ? 30.208  78.941  72.718  1.00 49.97  ? 191 SER B C   1 
ATOM 5280  O O   . SER B 1 194 ? 31.265  78.312  72.809  1.00 46.74  ? 191 SER B O   1 
ATOM 5281  C CB  . SER B 1 194 ? 28.652  78.154  70.938  1.00 60.57  ? 191 SER B CB  1 
ATOM 5282  O OG  . SER B 1 194 ? 27.803  78.594  69.896  1.00 59.03  ? 191 SER B OG  1 
ATOM 5283  N N   . THR B 1 195 ? 29.538  79.388  73.772  1.00 35.56  ? 192 THR B N   1 
ATOM 5284  C CA  . THR B 1 195 ? 29.943  79.039  75.126  1.00 58.92  ? 192 THR B CA  1 
ATOM 5285  C C   . THR B 1 195 ? 28.833  78.258  75.800  1.00 52.55  ? 192 THR B C   1 
ATOM 5286  O O   . THR B 1 195 ? 27.665  78.633  75.726  1.00 35.56  ? 192 THR B O   1 
ATOM 5287  C CB  . THR B 1 195 ? 30.304  80.270  75.959  1.00 63.86  ? 192 THR B CB  1 
ATOM 5288  O OG1 . THR B 1 195 ? 29.237  81.217  75.890  1.00 63.08  ? 192 THR B OG1 1 
ATOM 5289  C CG2 . THR B 1 195 ? 31.587  80.908  75.428  1.00 56.12  ? 192 THR B CG2 1 
ATOM 5290  N N   . ASN B 1 196 ? 29.207  77.155  76.434  1.00 40.52  ? 193 ASN B N   1 
ATOM 5291  C CA  . ASN B 1 196 ? 28.244  76.287  77.094  1.00 51.79  ? 193 ASN B CA  1 
ATOM 5292  C C   . ASN B 1 196 ? 28.386  76.275  78.613  1.00 43.87  ? 193 ASN B C   1 
ATOM 5293  O O   . ASN B 1 196 ? 29.471  76.378  79.160  1.00 46.82  ? 193 ASN B O   1 
ATOM 5294  C CB  . ASN B 1 196 ? 28.339  74.865  76.540  1.00 45.40  ? 193 ASN B CB  1 
ATOM 5295  C CG  . ASN B 1 196 ? 28.132  74.816  75.044  1.00 56.92  ? 193 ASN B CG  1 
ATOM 5296  O OD1 . ASN B 1 196 ? 27.039  75.130  74.555  1.00 35.86  ? 193 ASN B OD1 1 
ATOM 5297  N ND2 . ASN B 1 196 ? 29.174  74.411  74.306  1.00 29.07  ? 193 ASN B ND2 1 
ATOM 5298  N N   . SER B 1 197 ? 27.267  76.151  79.296  1.00 47.10  ? 194 SER B N   1 
ATOM 5299  C CA  . SER B 1 197 ? 27.299  76.130  80.737  1.00 49.09  ? 194 SER B CA  1 
ATOM 5300  C C   . SER B 1 197 ? 26.169  75.265  81.237  1.00 46.63  ? 194 SER B C   1 
ATOM 5301  O O   . SER B 1 197 ? 25.131  75.157  80.587  1.00 36.89  ? 194 SER B O   1 
ATOM 5302  C CB  . SER B 1 197 ? 27.201  77.546  81.307  1.00 29.34  ? 194 SER B CB  1 
ATOM 5303  O OG  . SER B 1 197 ? 25.915  78.078  81.095  1.00 55.86  ? 194 SER B OG  1 
ATOM 5304  N N   . THR B 1 198 ? 26.406  74.614  82.370  1.00 39.93  ? 195 THR B N   1 
ATOM 5305  C CA  . THR B 1 198 ? 25.404  73.798  83.027  1.00 37.36  ? 195 THR B CA  1 
ATOM 5306  C C   . THR B 1 198 ? 24.928  74.518  84.290  1.00 38.14  ? 195 THR B C   1 
ATOM 5307  O O   . THR B 1 198 ? 25.719  75.004  85.085  1.00 42.70  ? 195 THR B O   1 
ATOM 5308  C CB  . THR B 1 198 ? 25.956  72.428  83.387  1.00 32.39  ? 195 THR B CB  1 
ATOM 5309  O OG1 . THR B 1 198 ? 26.409  71.773  82.200  1.00 48.40  ? 195 THR B OG1 1 
ATOM 5310  C CG2 . THR B 1 198 ? 24.875  71.581  84.047  1.00 40.48  ? 195 THR B CG2 1 
ATOM 5311  N N   . VAL B 1 199 ? 23.624  74.612  84.442  1.00 29.30  ? 196 VAL B N   1 
ATOM 5312  C CA  . VAL B 1 199 ? 23.010  75.217  85.615  1.00 29.48  ? 196 VAL B CA  1 
ATOM 5313  C C   . VAL B 1 199 ? 22.296  74.131  86.426  1.00 37.32  ? 196 VAL B C   1 
ATOM 5314  O O   . VAL B 1 199 ? 21.362  73.502  85.938  1.00 36.09  ? 196 VAL B O   1 
ATOM 5315  C CB  . VAL B 1 199 ? 21.961  76.221  85.192  1.00 36.69  ? 196 VAL B CB  1 
ATOM 5316  C CG1 . VAL B 1 199 ? 21.267  76.736  86.394  1.00 28.25  ? 196 VAL B CG1 1 
ATOM 5317  C CG2 . VAL B 1 199 ? 22.587  77.346  84.400  1.00 42.91  ? 196 VAL B CG2 1 
ATOM 5318  N N   . TYR B 1 200 ? 22.745  73.884  87.646  1.00 42.71  ? 197 TYR B N   1 
ATOM 5319  C CA  . TYR B 1 200 ? 22.146  72.825  88.457  1.00 34.55  ? 197 TYR B CA  1 
ATOM 5320  C C   . TYR B 1 200 ? 20.861  73.233  89.196  1.00 19.41  ? 197 TYR B C   1 
ATOM 5321  O O   . TYR B 1 200 ? 20.885  73.640  90.351  1.00 56.65  ? 197 TYR B O   1 
ATOM 5322  C CB  . TYR B 1 200 ? 23.191  72.239  89.380  1.00 29.07  ? 197 TYR B CB  1 
ATOM 5323  C CG  . TYR B 1 200 ? 24.295  71.558  88.585  1.00 39.83  ? 197 TYR B CG  1 
ATOM 5324  C CD1 . TYR B 1 200 ? 24.141  70.263  88.101  1.00 29.08  ? 197 TYR B CD1 1 
ATOM 5325  C CD2 . TYR B 1 200 ? 25.467  72.223  88.289  1.00 27.19  ? 197 TYR B CD2 1 
ATOM 5326  C CE1 . TYR B 1 200 ? 25.137  69.650  87.366  1.00 31.88  ? 197 TYR B CE1 1 
ATOM 5327  C CE2 . TYR B 1 200 ? 26.479  71.618  87.550  1.00 35.95  ? 197 TYR B CE2 1 
ATOM 5328  C CZ  . TYR B 1 200 ? 26.309  70.334  87.090  1.00 49.54  ? 197 TYR B CZ  1 
ATOM 5329  O OH  . TYR B 1 200 ? 27.317  69.734  86.352  1.00 41.83  ? 197 TYR B OH  1 
ATOM 5330  N N   . ARG B 1 201 ? 19.732  73.104  88.496  1.00 31.09  ? 198 ARG B N   1 
ATOM 5331  C CA  . ARG B 1 201 ? 18.444  73.538  89.007  1.00 21.04  ? 198 ARG B CA  1 
ATOM 5332  C C   . ARG B 1 201 ? 17.960  72.557  90.059  1.00 34.57  ? 198 ARG B C   1 
ATOM 5333  O O   . ARG B 1 201 ? 18.257  71.369  89.996  1.00 33.35  ? 198 ARG B O   1 
ATOM 5334  C CB  . ARG B 1 201 ? 17.392  73.574  87.899  1.00 27.42  ? 198 ARG B CB  1 
ATOM 5335  C CG  . ARG B 1 201 ? 17.759  74.332  86.640  1.00 38.88  ? 198 ARG B CG  1 
ATOM 5336  C CD  . ARG B 1 201 ? 16.623  74.200  85.630  1.00 24.87  ? 198 ARG B CD  1 
ATOM 5337  N NE  . ARG B 1 201 ? 16.455  72.808  85.215  1.00 41.33  ? 198 ARG B NE  1 
ATOM 5338  C CZ  . ARG B 1 201 ? 15.762  72.395  84.150  1.00 35.30  ? 198 ARG B CZ  1 
ATOM 5339  N NH1 . ARG B 1 201 ? 15.155  73.251  83.332  1.00 26.38  ? 198 ARG B NH1 1 
ATOM 5340  N NH2 . ARG B 1 201 ? 15.680  71.104  83.906  1.00 32.78  ? 198 ARG B NH2 1 
ATOM 5341  N N   . GLY B 1 202 ? 17.192  73.054  91.017  1.00 26.72  ? 199 GLY B N   1 
ATOM 5342  C CA  . GLY B 1 202 ? 16.438  72.165  91.862  1.00 38.16  ? 199 GLY B CA  1 
ATOM 5343  C C   . GLY B 1 202 ? 15.274  71.606  91.071  1.00 37.15  ? 199 GLY B C   1 
ATOM 5344  O O   . GLY B 1 202 ? 14.910  72.153  90.029  1.00 43.64  ? 199 GLY B O   1 
ATOM 5345  N N   . LEU B 1 203 ? 14.687  70.525  91.574  1.00 40.70  ? 200 LEU B N   1 
ATOM 5346  C CA  . LEU B 1 203 ? 13.477  69.970  91.003  1.00 30.83  ? 200 LEU B CA  1 
ATOM 5347  C C   . LEU B 1 203 ? 12.325  70.957  91.083  1.00 33.13  ? 200 LEU B C   1 
ATOM 5348  O O   . LEU B 1 203 ? 12.219  71.748  92.022  1.00 46.33  ? 200 LEU B O   1 
ATOM 5349  C CB  . LEU B 1 203 ? 13.093  68.660  91.689  1.00 35.72  ? 200 LEU B CB  1 
ATOM 5350  C CG  . LEU B 1 203 ? 14.234  67.690  91.950  1.00 34.62  ? 200 LEU B CG  1 
ATOM 5351  C CD1 . LEU B 1 203 ? 13.707  66.396  92.551  1.00 21.63  ? 200 LEU B CD1 1 
ATOM 5352  C CD2 . LEU B 1 203 ? 15.042  67.440  90.673  1.00 28.60  ? 200 LEU B CD2 1 
ATOM 5353  N N   . GLU B 1 204 ? 11.470  70.920  90.073  1.00 56.36  ? 201 GLU B N   1 
ATOM 5354  C CA  . GLU B 1 204 ? 10.368  71.853  90.002  1.00 43.28  ? 201 GLU B CA  1 
ATOM 5355  C C   . GLU B 1 204 ? 9.150   71.236  90.683  1.00 42.56  ? 201 GLU B C   1 
ATOM 5356  O O   . GLU B 1 204 ? 8.547   70.269  90.201  1.00 53.62  ? 201 GLU B O   1 
ATOM 5357  C CB  . GLU B 1 204 ? 10.092  72.254  88.555  1.00 44.57  ? 201 GLU B CB  1 
ATOM 5358  C CG  . GLU B 1 204 ? 9.224   73.483  88.396  1.00 54.79  ? 201 GLU B CG  1 
ATOM 5359  C CD  . GLU B 1 204 ? 8.748   73.699  86.962  1.00 59.97  ? 201 GLU B CD  1 
ATOM 5360  O OE1 . GLU B 1 204 ? 8.945   72.810  86.117  1.00 50.82  ? 201 GLU B OE1 1 
ATOM 5361  O OE2 . GLU B 1 204 ? 8.174   74.764  86.681  1.00 45.85  ? 201 GLU B OE2 1 
ATOM 5362  N N   . GLY B 1 205 ? 8.802   71.825  91.819  1.00 25.10  ? 202 GLY B N   1 
ATOM 5363  C CA  . GLY B 1 205 ? 7.785   71.303  92.717  1.00 40.03  ? 202 GLY B CA  1 
ATOM 5364  C C   . GLY B 1 205 ? 8.283   71.268  94.165  1.00 44.45  ? 202 GLY B C   1 
ATOM 5365  O O   . GLY B 1 205 ? 9.192   72.001  94.539  1.00 46.37  ? 202 GLY B O   1 
ATOM 5366  N N   . PHE B 1 206 ? 7.685   70.412  94.983  1.00 31.60  ? 203 PHE B N   1 
ATOM 5367  C CA  . PHE B 1 206 ? 8.156   70.223  96.349  1.00 45.22  ? 203 PHE B CA  1 
ATOM 5368  C C   . PHE B 1 206 ? 8.573   68.781  96.545  1.00 31.13  ? 203 PHE B C   1 
ATOM 5369  O O   . PHE B 1 206 ? 8.044   67.888  95.899  1.00 41.62  ? 203 PHE B O   1 
ATOM 5370  C CB  . PHE B 1 206 ? 7.077   70.608  97.370  1.00 26.95  ? 203 PHE B CB  1 
ATOM 5371  C CG  . PHE B 1 206 ? 5.989   69.586  97.524  1.00 34.90  ? 203 PHE B CG  1 
ATOM 5372  C CD1 . PHE B 1 206 ? 4.861   69.622  96.710  1.00 36.76  ? 203 PHE B CD1 1 
ATOM 5373  C CD2 . PHE B 1 206 ? 6.084   68.587  98.492  1.00 27.62  ? 203 PHE B CD2 1 
ATOM 5374  C CE1 . PHE B 1 206 ? 3.859   68.672  96.842  1.00 34.54  ? 203 PHE B CE1 1 
ATOM 5375  C CE2 . PHE B 1 206 ? 5.092   67.636  98.625  1.00 22.55  ? 203 PHE B CE2 1 
ATOM 5376  C CZ  . PHE B 1 206 ? 3.975   67.679  97.807  1.00 47.36  ? 203 PHE B CZ  1 
ATOM 5377  N N   . VAL B 1 207 ? 9.531   68.568  97.434  1.00 35.81  ? 204 VAL B N   1 
ATOM 5378  C CA  . VAL B 1 207 ? 9.957   67.234  97.831  1.00 33.17  ? 204 VAL B CA  1 
ATOM 5379  C C   . VAL B 1 207 ? 9.363   66.859  99.194  1.00 38.73  ? 204 VAL B C   1 
ATOM 5380  O O   . VAL B 1 207 ? 9.292   67.689  100.103 1.00 50.02  ? 204 VAL B O   1 
ATOM 5381  C CB  . VAL B 1 207 ? 11.489  67.183  97.917  1.00 34.68  ? 204 VAL B CB  1 
ATOM 5382  C CG1 . VAL B 1 207 ? 11.961  65.850  98.484  1.00 20.39  ? 204 VAL B CG1 1 
ATOM 5383  C CG2 . VAL B 1 207 ? 12.093  67.449  96.543  1.00 33.07  ? 204 VAL B CG2 1 
ATOM 5384  N N   . ALA B 1 208 ? 8.919   65.616  99.328  1.00 37.01  ? 205 ALA B N   1 
ATOM 5385  C CA  . ALA B 1 208 ? 8.419   65.103  100.607 1.00 34.01  ? 205 ALA B CA  1 
ATOM 5386  C C   . ALA B 1 208 ? 9.494   64.250  101.274 1.00 37.39  ? 205 ALA B C   1 
ATOM 5387  O O   . ALA B 1 208 ? 9.950   63.269  100.703 1.00 46.83  ? 205 ALA B O   1 
ATOM 5388  C CB  . ALA B 1 208 ? 7.164   64.290  100.398 1.00 23.67  ? 205 ALA B CB  1 
ATOM 5389  N N   . ALA B 1 209 ? 9.918   64.638  102.472 1.00 40.63  ? 206 ALA B N   1 
ATOM 5390  C CA  . ALA B 1 209 ? 10.956  63.901  103.187 1.00 43.06  ? 206 ALA B CA  1 
ATOM 5391  C C   . ALA B 1 209 ? 10.342  63.166  104.375 1.00 39.78  ? 206 ALA B C   1 
ATOM 5392  O O   . ALA B 1 209 ? 9.737   63.781  105.248 1.00 38.16  ? 206 ALA B O   1 
ATOM 5393  C CB  . ALA B 1 209 ? 12.110  64.834  103.624 1.00 20.68  ? 206 ALA B CB  1 
ATOM 5394  N N   . ILE B 1 210 ? 10.482  61.846  104.382 1.00 36.45  ? 207 ILE B N   1 
ATOM 5395  C CA  . ILE B 1 210 ? 9.858   61.015  105.399 1.00 36.74  ? 207 ILE B CA  1 
ATOM 5396  C C   . ILE B 1 210 ? 10.918  60.243  106.160 1.00 45.96  ? 207 ILE B C   1 
ATOM 5397  O O   . ILE B 1 210 ? 11.475  59.284  105.652 1.00 51.53  ? 207 ILE B O   1 
ATOM 5398  C CB  . ILE B 1 210 ? 8.932   60.025  104.751 1.00 45.99  ? 207 ILE B CB  1 
ATOM 5399  C CG1 . ILE B 1 210 ? 7.829   60.775  104.011 1.00 38.19  ? 207 ILE B CG1 1 
ATOM 5400  C CG2 . ILE B 1 210 ? 8.389   59.053  105.793 1.00 36.43  ? 207 ILE B CG2 1 
ATOM 5401  C CD1 . ILE B 1 210 ? 7.024   59.894  103.070 1.00 47.38  ? 207 ILE B CD1 1 
ATOM 5402  N N   . SER B 1 211 ? 11.202  60.662  107.383 1.00 51.24  ? 208 SER B N   1 
ATOM 5403  C CA  . SER B 1 211 ? 12.295  60.069  108.145 1.00 63.21  ? 208 SER B CA  1 
ATOM 5404  C C   . SER B 1 211 ? 11.832  59.097  109.236 1.00 60.93  ? 208 SER B C   1 
ATOM 5405  O O   . SER B 1 211 ? 10.669  59.156  109.670 1.00 62.96  ? 208 SER B O   1 
ATOM 5406  C CB  . SER B 1 211 ? 13.213  61.165  108.706 1.00 33.38  ? 208 SER B CB  1 
ATOM 5407  O OG  . SER B 1 211 ? 12.499  62.152  109.405 1.00 46.94  ? 208 SER B OG  1 
ATOM 5408  N N   . PRO B 1 212 ? 12.740  58.181  109.652 1.00 72.79  ? 209 PRO B N   1 
ATOM 5409  C CA  . PRO B 1 212 ? 12.514  57.125  110.645 1.00 78.61  ? 209 PRO B CA  1 
ATOM 5410  C C   . PRO B 1 212 ? 13.102  57.487  112.006 1.00 74.61  ? 209 PRO B C   1 
ATOM 5411  O O   . PRO B 1 212 ? 13.837  58.475  112.116 1.00 55.56  ? 209 PRO B O   1 
ATOM 5412  C CB  . PRO B 1 212 ? 13.315  55.963  110.065 1.00 52.91  ? 209 PRO B CB  1 
ATOM 5413  C CG  . PRO B 1 212 ? 14.552  56.643  109.525 1.00 53.97  ? 209 PRO B CG  1 
ATOM 5414  C CD  . PRO B 1 212 ? 14.080  58.039  109.046 1.00 70.73  ? 209 PRO B CD  1 
ATOM 5415  N N   . PHE B 1 213 ? 12.807  56.670  113.017 1.00 70.13  ? 210 PHE B N   1 
ATOM 5416  C CA  . PHE B 1 213 ? 13.222  56.941  114.394 1.00 58.76  ? 210 PHE B CA  1 
ATOM 5417  C C   . PHE B 1 213 ? 14.708  56.695  114.670 1.00 71.78  ? 210 PHE B C   1 
ATOM 5418  O O   . PHE B 1 213 ? 15.300  57.354  115.525 1.00 64.22  ? 210 PHE B O   1 
ATOM 5419  C CB  . PHE B 1 213 ? 12.396  56.098  115.372 1.00 52.38  ? 210 PHE B CB  1 
ATOM 5420  C CG  . PHE B 1 213 ? 12.841  54.662  115.470 1.00 63.49  ? 210 PHE B CG  1 
ATOM 5421  C CD1 . PHE B 1 213 ? 13.863  54.289  116.344 1.00 44.80  ? 210 PHE B CD1 1 
ATOM 5422  C CD2 . PHE B 1 213 ? 12.232  53.677  114.706 1.00 53.13  ? 210 PHE B CD2 1 
ATOM 5423  C CE1 . PHE B 1 213 ? 14.277  52.963  116.424 1.00 66.45  ? 210 PHE B CE1 1 
ATOM 5424  C CE2 . PHE B 1 213 ? 12.644  52.346  114.788 1.00 62.65  ? 210 PHE B CE2 1 
ATOM 5425  C CZ  . PHE B 1 213 ? 13.662  51.992  115.649 1.00 51.27  ? 210 PHE B CZ  1 
ATOM 5426  N N   . ASN B 1 214 ? 15.304  55.739  113.963 1.00 57.87  ? 211 ASN B N   1 
ATOM 5427  C CA  . ASN B 1 214 ? 16.580  55.168  114.412 1.00 76.91  ? 211 ASN B CA  1 
ATOM 5428  C C   . ASN B 1 214 ? 17.805  56.086  114.337 1.00 79.95  ? 211 ASN B C   1 
ATOM 5429  O O   . ASN B 1 214 ? 18.772  55.904  115.079 1.00 76.95  ? 211 ASN B O   1 
ATOM 5430  C CB  . ASN B 1 214 ? 16.861  53.815  113.742 1.00 78.59  ? 211 ASN B CB  1 
ATOM 5431  C CG  . ASN B 1 214 ? 16.810  53.885  112.239 1.00 62.29  ? 211 ASN B CG  1 
ATOM 5432  O OD1 . ASN B 1 214 ? 16.049  54.660  111.667 1.00 91.29  ? 211 ASN B OD1 1 
ATOM 5433  N ND2 . ASN B 1 214 ? 17.614  53.054  111.585 1.00 94.90  ? 211 ASN B ND2 1 
ATOM 5434  N N   . PHE B 1 215 ? 17.771  57.068  113.449 1.00 57.35  ? 212 PHE B N   1 
ATOM 5435  C CA  . PHE B 1 215 ? 18.851  58.047  113.374 1.00 52.55  ? 212 PHE B CA  1 
ATOM 5436  C C   . PHE B 1 215 ? 18.323  59.467  113.271 1.00 63.42  ? 212 PHE B C   1 
ATOM 5437  O O   . PHE B 1 215 ? 17.437  59.781  112.460 1.00 73.68  ? 212 PHE B O   1 
ATOM 5438  C CB  . PHE B 1 215 ? 19.815  57.752  112.216 1.00 52.84  ? 212 PHE B CB  1 
ATOM 5439  C CG  . PHE B 1 215 ? 20.724  56.593  112.469 1.00 52.89  ? 212 PHE B CG  1 
ATOM 5440  C CD1 . PHE B 1 215 ? 20.334  55.300  112.147 1.00 72.72  ? 212 PHE B CD1 1 
ATOM 5441  C CD2 . PHE B 1 215 ? 21.970  56.791  113.046 1.00 85.36  ? 212 PHE B CD2 1 
ATOM 5442  C CE1 . PHE B 1 215 ? 21.173  54.223  112.393 1.00 77.98  ? 212 PHE B CE1 1 
ATOM 5443  C CE2 . PHE B 1 215 ? 22.818  55.721  113.291 1.00 88.28  ? 212 PHE B CE2 1 
ATOM 5444  C CZ  . PHE B 1 215 ? 22.417  54.434  112.963 1.00 89.61  ? 212 PHE B CZ  1 
ATOM 5445  N N   . THR B 1 216 ? 18.870  60.311  114.133 1.00 61.95  ? 213 THR B N   1 
ATOM 5446  C CA  . THR B 1 216 ? 18.569  61.728  114.116 1.00 72.20  ? 213 THR B CA  1 
ATOM 5447  C C   . THR B 1 216 ? 19.185  62.355  112.872 1.00 76.92  ? 213 THR B C   1 
ATOM 5448  O O   . THR B 1 216 ? 18.610  63.276  112.293 1.00 51.02  ? 213 THR B O   1 
ATOM 5449  C CB  . THR B 1 216 ? 19.141  62.426  115.361 1.00 63.19  ? 213 THR B CB  1 
ATOM 5450  O OG1 . THR B 1 216 ? 18.563  61.851  116.531 1.00 56.22  ? 213 THR B OG1 1 
ATOM 5451  C CG2 . THR B 1 216 ? 18.843  63.923  115.333 1.00 58.78  ? 213 THR B CG2 1 
ATOM 5452  N N   . ALA B 1 217 ? 20.357  61.850  112.480 1.00 68.01  ? 214 ALA B N   1 
ATOM 5453  C CA  . ALA B 1 217 ? 21.093  62.353  111.321 1.00 60.93  ? 214 ALA B CA  1 
ATOM 5454  C C   . ALA B 1 217 ? 20.321  62.145  110.037 1.00 61.31  ? 214 ALA B C   1 
ATOM 5455  O O   . ALA B 1 217 ? 20.432  62.946  109.117 1.00 62.90  ? 214 ALA B O   1 
ATOM 5456  C CB  . ALA B 1 217 ? 22.468  61.684  111.210 1.00 44.72  ? 214 ALA B CB  1 
ATOM 5457  N N   . ILE B 1 218 ? 19.555  61.061  109.972 1.00 66.59  ? 215 ILE B N   1 
ATOM 5458  C CA  . ILE B 1 218 ? 18.841  60.706  108.742 1.00 76.90  ? 215 ILE B CA  1 
ATOM 5459  C C   . ILE B 1 218 ? 17.717  61.703  108.409 1.00 78.88  ? 215 ILE B C   1 
ATOM 5460  O O   . ILE B 1 218 ? 17.531  62.078  107.257 1.00 62.31  ? 215 ILE B O   1 
ATOM 5461  C CB  . ILE B 1 218 ? 18.323  59.242  108.770 1.00 81.84  ? 215 ILE B CB  1 
ATOM 5462  C CG1 . ILE B 1 218 ? 19.492  58.264  108.650 1.00 73.43  ? 215 ILE B CG1 1 
ATOM 5463  C CG2 . ILE B 1 218 ? 17.344  58.983  107.640 1.00 59.69  ? 215 ILE B CG2 1 
ATOM 5464  C CD1 . ILE B 1 218 ? 19.068  56.805  108.623 1.00 75.37  ? 215 ILE B CD1 1 
ATOM 5465  N N   . GLY B 1 219 ? 16.977  62.149  109.413 1.00 55.52  ? 216 GLY B N   1 
ATOM 5466  C CA  . GLY B 1 219 ? 16.001  63.184  109.177 1.00 54.42  ? 216 GLY B CA  1 
ATOM 5467  C C   . GLY B 1 219 ? 16.701  64.399  108.606 1.00 65.31  ? 216 GLY B C   1 
ATOM 5468  O O   . GLY B 1 219 ? 16.253  65.010  107.630 1.00 53.85  ? 216 GLY B O   1 
ATOM 5469  N N   . GLY B 1 220 ? 17.827  64.745  109.210 1.00 49.21  ? 217 GLY B N   1 
ATOM 5470  C CA  . GLY B 1 220 ? 18.550  65.933  108.811 1.00 57.22  ? 217 GLY B CA  1 
ATOM 5471  C C   . GLY B 1 220 ? 18.935  65.889  107.355 1.00 50.59  ? 217 GLY B C   1 
ATOM 5472  O O   . GLY B 1 220 ? 18.864  66.882  106.648 1.00 66.46  ? 217 GLY B O   1 
ATOM 5473  N N   . ASN B 1 221 ? 19.358  64.719  106.909 1.00 57.83  ? 218 ASN B N   1 
ATOM 5474  C CA  . ASN B 1 221 ? 19.849  64.567  105.557 1.00 55.90  ? 218 ASN B CA  1 
ATOM 5475  C C   . ASN B 1 221 ? 18.721  64.364  104.532 1.00 50.01  ? 218 ASN B C   1 
ATOM 5476  O O   . ASN B 1 221 ? 18.817  64.815  103.400 1.00 46.35  ? 218 ASN B O   1 
ATOM 5477  C CB  . ASN B 1 221 ? 20.868  63.434  105.515 1.00 36.26  ? 218 ASN B CB  1 
ATOM 5478  C CG  . ASN B 1 221 ? 21.458  63.229  104.140 1.00 53.93  ? 218 ASN B CG  1 
ATOM 5479  O OD1 . ASN B 1 221 ? 21.226  62.203  103.501 1.00 68.58  ? 218 ASN B OD1 1 
ATOM 5480  N ND2 . ASN B 1 221 ? 22.217  64.216  103.669 1.00 53.83  ? 218 ASN B ND2 1 
ATOM 5481  N N   . LEU B 1 222 ? 17.649  63.698  104.943 1.00 49.79  ? 219 LEU B N   1 
ATOM 5482  C CA  . LEU B 1 222 ? 16.521  63.474  104.058 1.00 41.63  ? 219 LEU B CA  1 
ATOM 5483  C C   . LEU B 1 222 ? 15.899  64.781  103.599 1.00 44.88  ? 219 LEU B C   1 
ATOM 5484  O O   . LEU B 1 222 ? 15.476  64.888  102.460 1.00 40.75  ? 219 LEU B O   1 
ATOM 5485  C CB  . LEU B 1 222 ? 15.458  62.604  104.727 1.00 34.32  ? 219 LEU B CB  1 
ATOM 5486  C CG  . LEU B 1 222 ? 15.813  61.133  104.898 1.00 57.21  ? 219 LEU B CG  1 
ATOM 5487  C CD1 . LEU B 1 222 ? 14.620  60.344  105.449 1.00 40.85  ? 219 LEU B CD1 1 
ATOM 5488  C CD2 . LEU B 1 222 ? 16.290  60.576  103.578 1.00 28.74  ? 219 LEU B CD2 1 
ATOM 5489  N N   . ALA B 1 223 ? 15.846  65.756  104.506 1.00 37.63  ? 220 ALA B N   1 
ATOM 5490  C CA  . ALA B 1 223 ? 15.254  67.062  104.255 1.00 42.30  ? 220 ALA B CA  1 
ATOM 5491  C C   . ALA B 1 223 ? 16.332  68.070  103.883 1.00 51.89  ? 220 ALA B C   1 
ATOM 5492  O O   . ALA B 1 223 ? 16.087  68.987  103.100 1.00 36.36  ? 220 ALA B O   1 
ATOM 5493  C CB  . ALA B 1 223 ? 14.445  67.554  105.485 1.00 29.89  ? 220 ALA B CB  1 
ATOM 5494  N N   . GLY B 1 224 ? 17.528  67.875  104.436 1.00 38.66  ? 221 GLY B N   1 
ATOM 5495  C CA  . GLY B 1 224 ? 18.637  68.798  104.250 1.00 37.50  ? 221 GLY B CA  1 
ATOM 5496  C C   . GLY B 1 224 ? 19.319  68.767  102.887 1.00 49.52  ? 221 GLY B C   1 
ATOM 5497  O O   . GLY B 1 224 ? 19.577  69.816  102.297 1.00 51.02  ? 221 GLY B O   1 
ATOM 5498  N N   . ALA B 1 225 ? 19.614  67.571  102.388 1.00 27.56  ? 222 ALA B N   1 
ATOM 5499  C CA  . ALA B 1 225 ? 20.264  67.428  101.086 1.00 41.97  ? 222 ALA B CA  1 
ATOM 5500  C C   . ALA B 1 225 ? 19.408  68.010  99.940  1.00 29.64  ? 222 ALA B C   1 
ATOM 5501  O O   . ALA B 1 225 ? 19.905  68.822  99.151  1.00 35.36  ? 222 ALA B O   1 
ATOM 5502  C CB  . ALA B 1 225 ? 20.684  65.962  100.819 1.00 27.35  ? 222 ALA B CB  1 
ATOM 5503  N N   . PRO B 1 226 ? 18.117  67.639  99.864  1.00 44.13  ? 223 PRO B N   1 
ATOM 5504  C CA  . PRO B 1 226 ? 17.292  68.260  98.812  1.00 34.44  ? 223 PRO B CA  1 
ATOM 5505  C C   . PRO B 1 226 ? 17.184  69.765  98.969  1.00 40.03  ? 223 PRO B C   1 
ATOM 5506  O O   . PRO B 1 226 ? 17.207  70.464  97.961  1.00 44.83  ? 223 PRO B O   1 
ATOM 5507  C CB  . PRO B 1 226 ? 15.933  67.609  99.000  1.00 28.51  ? 223 PRO B CB  1 
ATOM 5508  C CG  . PRO B 1 226 ? 16.242  66.295  99.658  1.00 38.21  ? 223 PRO B CG  1 
ATOM 5509  C CD  . PRO B 1 226 ? 17.392  66.578  100.578 1.00 40.43  ? 223 PRO B CD  1 
ATOM 5510  N N   . ALA B 1 227 ? 17.064  70.260  100.196 1.00 42.59  ? 224 ALA B N   1 
ATOM 5511  C CA  . ALA B 1 227 ? 16.932  71.702  100.414 1.00 36.42  ? 224 ALA B CA  1 
ATOM 5512  C C   . ALA B 1 227 ? 18.185  72.399  99.948  1.00 35.27  ? 224 ALA B C   1 
ATOM 5513  O O   . ALA B 1 227 ? 18.108  73.433  99.315  1.00 42.74  ? 224 ALA B O   1 
ATOM 5514  C CB  . ALA B 1 227 ? 16.667  72.026  101.885 1.00 38.71  ? 224 ALA B CB  1 
ATOM 5515  N N   . LEU B 1 228 ? 19.340  71.838  100.292 1.00 39.74  ? 225 LEU B N   1 
ATOM 5516  C CA  . LEU B 1 228 ? 20.625  72.372  99.850  1.00 38.31  ? 225 LEU B CA  1 
ATOM 5517  C C   . LEU B 1 228 ? 20.691  72.530  98.326  1.00 42.58  ? 225 LEU B C   1 
ATOM 5518  O O   . LEU B 1 228 ? 21.274  73.490  97.834  1.00 37.11  ? 225 LEU B O   1 
ATOM 5519  C CB  . LEU B 1 228 ? 21.778  71.489  100.334 1.00 23.93  ? 225 LEU B CB  1 
ATOM 5520  C CG  . LEU B 1 228 ? 23.132  71.686  99.652  1.00 43.94  ? 225 LEU B CG  1 
ATOM 5521  C CD1 . LEU B 1 228 ? 23.805  72.957  100.162 1.00 41.41  ? 225 LEU B CD1 1 
ATOM 5522  C CD2 . LEU B 1 228 ? 24.009  70.476  99.885  1.00 29.72  ? 225 LEU B CD2 1 
ATOM 5523  N N   . MET B 1 229 ? 20.097  71.586  97.592  1.00 51.59  ? 226 MET B N   1 
ATOM 5524  C CA  . MET B 1 229 ? 20.166  71.582  96.128  1.00 35.91  ? 226 MET B CA  1 
ATOM 5525  C C   . MET B 1 229 ? 19.093  72.465  95.469  1.00 45.68  ? 226 MET B C   1 
ATOM 5526  O O   . MET B 1 229 ? 18.891  72.420  94.261  1.00 46.23  ? 226 MET B O   1 
ATOM 5527  C CB  . MET B 1 229 ? 20.145  70.150  95.578  1.00 35.00  ? 226 MET B CB  1 
ATOM 5528  C CG  . MET B 1 229 ? 21.335  69.280  96.019  1.00 29.59  ? 226 MET B CG  1 
ATOM 5529  S SD  . MET B 1 229 ? 22.957  70.055  95.772  1.00 22.19  ? 226 MET B SD  1 
ATOM 5530  C CE  . MET B 1 229 ? 23.135  69.845  94.006  1.00 36.85  ? 226 MET B CE  1 
ATOM 5531  N N   . GLY B 1 230 ? 18.418  73.281  96.270  1.00 43.83  ? 227 GLY B N   1 
ATOM 5532  C CA  . GLY B 1 230 ? 17.496  74.274  95.743  1.00 21.64  ? 227 GLY B CA  1 
ATOM 5533  C C   . GLY B 1 230 ? 16.029  73.887  95.745  1.00 27.14  ? 227 GLY B C   1 
ATOM 5534  O O   . GLY B 1 230 ? 15.217  74.556  95.114  1.00 30.49  ? 227 GLY B O   1 
ATOM 5535  N N   . ASN B 1 231 ? 15.702  72.802  96.446  1.00 27.99  ? 228 ASN B N   1 
ATOM 5536  C CA  . ASN B 1 231 ? 14.322  72.339  96.612  1.00 37.08  ? 228 ASN B CA  1 
ATOM 5537  C C   . ASN B 1 231 ? 13.637  72.885  97.857  1.00 36.85  ? 228 ASN B C   1 
ATOM 5538  O O   . ASN B 1 231 ? 14.296  73.343  98.761  1.00 35.16  ? 228 ASN B O   1 
ATOM 5539  C CB  . ASN B 1 231 ? 14.286  70.816  96.634  1.00 38.68  ? 228 ASN B CB  1 
ATOM 5540  C CG  . ASN B 1 231 ? 14.805  70.218  95.345  1.00 41.49  ? 228 ASN B CG  1 
ATOM 5541  O OD1 . ASN B 1 231 ? 14.122  70.205  94.324  1.00 41.76  ? 228 ASN B OD1 1 
ATOM 5542  N ND2 . ASN B 1 231 ? 16.024  69.735  95.383  1.00 25.14  ? 228 ASN B ND2 1 
ATOM 5543  N N   . VAL B 1 232 ? 12.309  72.870  97.864  1.00 32.87  ? 229 VAL B N   1 
ATOM 5544  C CA  . VAL B 1 232 ? 11.533  73.155  99.054  1.00 31.40  ? 229 VAL B CA  1 
ATOM 5545  C C   . VAL B 1 232 ? 10.966  71.814  99.536  1.00 39.57  ? 229 VAL B C   1 
ATOM 5546  O O   . VAL B 1 232 ? 10.683  70.936  98.732  1.00 39.15  ? 229 VAL B O   1 
ATOM 5547  C CB  . VAL B 1 232 ? 10.427  74.207  98.792  1.00 32.66  ? 229 VAL B CB  1 
ATOM 5548  C CG1 . VAL B 1 232 ? 11.034  75.487  98.304  1.00 38.00  ? 229 VAL B CG1 1 
ATOM 5549  C CG2 . VAL B 1 232 ? 9.435   73.706  97.788  1.00 31.57  ? 229 VAL B CG2 1 
ATOM 5550  N N   . VAL B 1 233 ? 10.852  71.636  100.844 1.00 48.71  ? 230 VAL B N   1 
ATOM 5551  C CA  . VAL B 1 233 ? 10.600  70.314  101.423 1.00 18.90  ? 230 VAL B CA  1 
ATOM 5552  C C   . VAL B 1 233 ? 9.465   70.326  102.464 1.00 36.00  ? 230 VAL B C   1 
ATOM 5553  O O   . VAL B 1 233 ? 9.381   71.222  103.301 1.00 40.54  ? 230 VAL B O   1 
ATOM 5554  C CB  . VAL B 1 233 ? 11.868  69.791  102.091 1.00 35.96  ? 230 VAL B CB  1 
ATOM 5555  C CG1 . VAL B 1 233 ? 11.608  68.446  102.775 1.00 36.96  ? 230 VAL B CG1 1 
ATOM 5556  C CG2 . VAL B 1 233 ? 13.010  69.691  101.080 1.00 28.31  ? 230 VAL B CG2 1 
ATOM 5557  N N   . LEU B 1 234 ? 8.590   69.331  102.395 1.00 37.71  ? 231 LEU B N   1 
ATOM 5558  C CA  . LEU B 1 234 ? 7.709   69.003  103.510 1.00 38.59  ? 231 LEU B CA  1 
ATOM 5559  C C   . LEU B 1 234 ? 8.315   67.837  104.264 1.00 39.10  ? 231 LEU B C   1 
ATOM 5560  O O   . LEU B 1 234 ? 8.327   66.720  103.772 1.00 54.21  ? 231 LEU B O   1 
ATOM 5561  C CB  . LEU B 1 234 ? 6.307   68.617  103.038 1.00 29.21  ? 231 LEU B CB  1 
ATOM 5562  C CG  . LEU B 1 234 ? 5.273   69.730  103.123 1.00 41.05  ? 231 LEU B CG  1 
ATOM 5563  C CD1 . LEU B 1 234 ? 5.637   70.890  102.191 1.00 40.84  ? 231 LEU B CD1 1 
ATOM 5564  C CD2 . LEU B 1 234 ? 3.923   69.133  102.801 1.00 34.96  ? 231 LEU B CD2 1 
ATOM 5565  N N   . TRP B 1 235 ? 8.817   68.101  105.456 1.00 34.21  ? 232 TRP B N   1 
ATOM 5566  C CA  . TRP B 1 235 ? 9.420   67.071  106.282 1.00 45.10  ? 232 TRP B CA  1 
ATOM 5567  C C   . TRP B 1 235 ? 8.428   66.489  107.314 1.00 53.92  ? 232 TRP B C   1 
ATOM 5568  O O   . TRP B 1 235 ? 7.961   67.212  108.193 1.00 40.01  ? 232 TRP B O   1 
ATOM 5569  C CB  . TRP B 1 235 ? 10.636  67.683  106.979 1.00 32.89  ? 232 TRP B CB  1 
ATOM 5570  C CG  . TRP B 1 235 ? 11.401  66.744  107.811 1.00 46.25  ? 232 TRP B CG  1 
ATOM 5571  C CD1 . TRP B 1 235 ? 11.363  65.391  107.754 1.00 34.39  ? 232 TRP B CD1 1 
ATOM 5572  C CD2 . TRP B 1 235 ? 12.353  67.080  108.830 1.00 38.22  ? 232 TRP B CD2 1 
ATOM 5573  N NE1 . TRP B 1 235 ? 12.228  64.854  108.677 1.00 40.04  ? 232 TRP B NE1 1 
ATOM 5574  C CE2 . TRP B 1 235 ? 12.847  65.872  109.350 1.00 42.94  ? 232 TRP B CE2 1 
ATOM 5575  C CE3 . TRP B 1 235 ? 12.841  68.289  109.347 1.00 42.32  ? 232 TRP B CE3 1 
ATOM 5576  C CZ2 . TRP B 1 235 ? 13.793  65.830  110.373 1.00 52.18  ? 232 TRP B CZ2 1 
ATOM 5577  C CZ3 . TRP B 1 235 ? 13.776  68.247  110.360 1.00 46.40  ? 232 TRP B CZ3 1 
ATOM 5578  C CH2 . TRP B 1 235 ? 14.247  67.025  110.862 1.00 33.38  ? 232 TRP B CH2 1 
ATOM 5579  N N   . LYS B 1 236 ? 8.099   65.199  107.183 1.00 36.40  ? 233 LYS B N   1 
ATOM 5580  C CA  . LYS B 1 236 ? 7.378   64.438  108.222 1.00 45.63  ? 233 LYS B CA  1 
ATOM 5581  C C   . LYS B 1 236 ? 8.343   63.628  109.081 1.00 37.21  ? 233 LYS B C   1 
ATOM 5582  O O   . LYS B 1 236 ? 8.758   62.546  108.680 1.00 58.10  ? 233 LYS B O   1 
ATOM 5583  C CB  . LYS B 1 236 ? 6.353   63.468  107.621 1.00 35.76  ? 233 LYS B CB  1 
ATOM 5584  C CG  . LYS B 1 236 ? 5.607   62.650  108.685 1.00 40.06  ? 233 LYS B CG  1 
ATOM 5585  C CD  . LYS B 1 236 ? 5.082   61.278  108.198 1.00 37.32  ? 233 LYS B CD  1 
ATOM 5586  C CE  . LYS B 1 236 ? 5.520   60.095  109.119 1.00 40.79  ? 233 LYS B CE  1 
ATOM 5587  N NZ  . LYS B 1 236 ? 5.095   60.264  110.541 1.00 66.22  ? 233 LYS B NZ  1 
ATOM 5588  N N   . PRO B 1 237 ? 8.704   64.139  110.270 1.00 36.48  ? 234 PRO B N   1 
ATOM 5589  C CA  . PRO B 1 237 ? 9.655   63.422  111.135 1.00 54.95  ? 234 PRO B CA  1 
ATOM 5590  C C   . PRO B 1 237 ? 9.006   62.267  111.878 1.00 20.42  ? 234 PRO B C   1 
ATOM 5591  O O   . PRO B 1 237 ? 7.784   62.210  111.964 1.00 57.20  ? 234 PRO B O   1 
ATOM 5592  C CB  . PRO B 1 237 ? 10.114  64.486  112.137 1.00 34.87  ? 234 PRO B CB  1 
ATOM 5593  C CG  . PRO B 1 237 ? 9.459   65.770  111.706 1.00 50.21  ? 234 PRO B CG  1 
ATOM 5594  C CD  . PRO B 1 237 ? 8.269   65.398  110.880 1.00 42.73  ? 234 PRO B CD  1 
ATOM 5595  N N   . SER B 1 238 ? 9.823   61.328  112.341 1.00 47.28  ? 235 SER B N   1 
ATOM 5596  C CA  . SER B 1 238 ? 9.309   60.169  113.058 1.00 46.86  ? 235 SER B CA  1 
ATOM 5597  C C   . SER B 1 238 ? 8.776   60.614  114.405 1.00 59.83  ? 235 SER B C   1 
ATOM 5598  O O   . SER B 1 238 ? 9.417   61.389  115.118 1.00 57.12  ? 235 SER B O   1 
ATOM 5599  C CB  . SER B 1 238 ? 10.378  59.100  113.235 1.00 52.19  ? 235 SER B CB  1 
ATOM 5600  O OG  . SER B 1 238 ? 9.804   57.858  113.618 1.00 87.32  ? 235 SER B OG  1 
ATOM 5601  N N   . ASP B 1 239 ? 7.583   60.136  114.730 1.00 43.02  ? 236 ASP B N   1 
ATOM 5602  C CA  . ASP B 1 239 ? 6.932   60.494  115.980 1.00 54.50  ? 236 ASP B CA  1 
ATOM 5603  C C   . ASP B 1 239 ? 7.803   60.155  117.167 1.00 45.83  ? 236 ASP B C   1 
ATOM 5604  O O   . ASP B 1 239 ? 7.810   60.890  118.144 1.00 58.14  ? 236 ASP B O   1 
ATOM 5605  C CB  . ASP B 1 239 ? 5.588   59.795  116.103 1.00 42.99  ? 236 ASP B CB  1 
ATOM 5606  C CG  . ASP B 1 239 ? 4.631   60.185  114.998 1.00 68.25  ? 236 ASP B CG  1 
ATOM 5607  O OD1 . ASP B 1 239 ? 4.957   61.088  114.189 1.00 90.20  ? 236 ASP B OD1 1 
ATOM 5608  O OD2 . ASP B 1 239 ? 3.543   59.580  114.952 1.00 69.00  ? 236 ASP B OD2 1 
ATOM 5609  N N   . THR B 1 240 ? 8.578   59.075  117.053 1.00 56.92  ? 237 THR B N   1 
ATOM 5610  C CA  . THR B 1 240 ? 9.439   58.644  118.149 1.00 47.75  ? 237 THR B CA  1 
ATOM 5611  C C   . THR B 1 240 ? 10.823  59.305  118.163 1.00 61.70  ? 237 THR B C   1 
ATOM 5612  O O   . THR B 1 240 ? 11.672  58.967  118.983 1.00 59.27  ? 237 THR B O   1 
ATOM 5613  C CB  . THR B 1 240 ? 9.552   57.108  118.221 1.00 63.36  ? 237 THR B CB  1 
ATOM 5614  O OG1 . THR B 1 240 ? 10.016  56.602  116.971 1.00 51.34  ? 237 THR B OG1 1 
ATOM 5615  C CG2 . THR B 1 240 ? 8.193   56.488  118.532 1.00 38.68  ? 237 THR B CG2 1 
ATOM 5616  N N   . ALA B 1 241 ? 11.043  60.261  117.269 1.00 53.15  ? 238 ALA B N   1 
ATOM 5617  C CA  . ALA B 1 241 ? 12.277  61.037  117.299 1.00 36.98  ? 238 ALA B CA  1 
ATOM 5618  C C   . ALA B 1 241 ? 12.016  62.544  117.304 1.00 54.96  ? 238 ALA B C   1 
ATOM 5619  O O   . ALA B 1 241 ? 12.917  63.333  117.053 1.00 47.68  ? 238 ALA B O   1 
ATOM 5620  C CB  . ALA B 1 241 ? 13.157  60.663  116.163 1.00 36.92  ? 238 ALA B CB  1 
ATOM 5621  N N   . MET B 1 242 ? 10.792  62.926  117.650 1.00 48.47  ? 239 MET B N   1 
ATOM 5622  C CA  . MET B 1 242 ? 10.320  64.297  117.469 1.00 60.12  ? 239 MET B CA  1 
ATOM 5623  C C   . MET B 1 242 ? 11.186  65.310  118.196 1.00 52.95  ? 239 MET B C   1 
ATOM 5624  O O   . MET B 1 242 ? 11.532  66.348  117.643 1.00 68.19  ? 239 MET B O   1 
ATOM 5625  C CB  . MET B 1 242 ? 8.849   64.421  117.915 1.00 44.78  ? 239 MET B CB  1 
ATOM 5626  C CG  . MET B 1 242 ? 8.139   65.692  117.456 1.00 72.71  ? 239 MET B CG  1 
ATOM 5627  S SD  . MET B 1 242 ? 7.897   65.847  115.652 1.00 39.50  ? 239 MET B SD  1 
ATOM 5628  C CE  . MET B 1 242 ? 7.641   64.170  115.194 1.00 25.16  ? 239 MET B CE  1 
ATOM 5629  N N   . LEU B 1 243 ? 11.534  65.006  119.438 1.00 49.69  ? 240 LEU B N   1 
ATOM 5630  C CA  . LEU B 1 243 ? 12.280  65.933  120.279 1.00 59.15  ? 240 LEU B CA  1 
ATOM 5631  C C   . LEU B 1 243 ? 13.587  66.361  119.614 1.00 52.67  ? 240 LEU B C   1 
ATOM 5632  O O   . LEU B 1 243 ? 13.860  67.557  119.478 1.00 49.22  ? 240 LEU B O   1 
ATOM 5633  C CB  . LEU B 1 243 ? 12.540  65.318  121.668 1.00 52.33  ? 240 LEU B CB  1 
ATOM 5634  C CG  . LEU B 1 243 ? 13.190  66.233  122.698 1.00 54.15  ? 240 LEU B CG  1 
ATOM 5635  C CD1 . LEU B 1 243 ? 12.244  67.351  123.091 1.00 48.48  ? 240 LEU B CD1 1 
ATOM 5636  C CD2 . LEU B 1 243 ? 13.603  65.441  123.917 1.00 57.29  ? 240 LEU B CD2 1 
ATOM 5637  N N   . ALA B 1 244 ? 14.398  65.388  119.208 1.00 49.57  ? 241 ALA B N   1 
ATOM 5638  C CA  . ALA B 1 244 ? 15.667  65.708  118.567 1.00 43.72  ? 241 ALA B CA  1 
ATOM 5639  C C   . ALA B 1 244 ? 15.484  66.232  117.137 1.00 61.13  ? 241 ALA B C   1 
ATOM 5640  O O   . ALA B 1 244 ? 16.244  67.090  116.711 1.00 47.73  ? 241 ALA B O   1 
ATOM 5641  C CB  . ALA B 1 244 ? 16.628  64.535  118.605 1.00 37.16  ? 241 ALA B CB  1 
ATOM 5642  N N   . SER B 1 245 ? 14.480  65.745  116.405 1.00 44.30  ? 242 SER B N   1 
ATOM 5643  C CA  . SER B 1 245 ? 14.244  66.220  115.027 1.00 40.88  ? 242 SER B CA  1 
ATOM 5644  C C   . SER B 1 245 ? 13.926  67.705  114.989 1.00 53.03  ? 242 SER B C   1 
ATOM 5645  O O   . SER B 1 245 ? 14.377  68.418  114.094 1.00 38.24  ? 242 SER B O   1 
ATOM 5646  C CB  . SER B 1 245 ? 13.122  65.449  114.339 1.00 38.73  ? 242 SER B CB  1 
ATOM 5647  O OG  . SER B 1 245 ? 13.421  64.066  114.241 1.00 52.89  ? 242 SER B OG  1 
ATOM 5648  N N   . TYR B 1 246 ? 13.158  68.170  115.970 1.00 41.94  ? 243 TYR B N   1 
ATOM 5649  C CA  . TYR B 1 246 ? 12.747  69.558  116.015 1.00 36.01  ? 243 TYR B CA  1 
ATOM 5650  C C   . TYR B 1 246 ? 13.927  70.411  116.424 1.00 48.50  ? 243 TYR B C   1 
ATOM 5651  O O   . TYR B 1 246 ? 14.026  71.584  116.055 1.00 48.13  ? 243 TYR B O   1 
ATOM 5652  C CB  . TYR B 1 246 ? 11.586  69.735  116.988 1.00 48.19  ? 243 TYR B CB  1 
ATOM 5653  C CG  . TYR B 1 246 ? 11.057  71.147  117.063 1.00 63.88  ? 243 TYR B CG  1 
ATOM 5654  C CD1 . TYR B 1 246 ? 11.127  71.887  118.245 1.00 55.85  ? 243 TYR B CD1 1 
ATOM 5655  C CD2 . TYR B 1 246 ? 10.492  71.747  115.946 1.00 49.85  ? 243 TYR B CD2 1 
ATOM 5656  C CE1 . TYR B 1 246 ? 10.632  73.195  118.302 1.00 51.34  ? 243 TYR B CE1 1 
ATOM 5657  C CE2 . TYR B 1 246 ? 9.992   73.039  115.991 1.00 53.25  ? 243 TYR B CE2 1 
ATOM 5658  C CZ  . TYR B 1 246 ? 10.060  73.755  117.169 1.00 69.55  ? 243 TYR B CZ  1 
ATOM 5659  O OH  . TYR B 1 246 ? 9.561   75.031  117.191 1.00 53.04  ? 243 TYR B OH  1 
ATOM 5660  N N   . ALA B 1 247 ? 14.833  69.807  117.178 1.00 38.12  ? 244 ALA B N   1 
ATOM 5661  C CA  . ALA B 1 247 ? 16.026  70.510  117.632 1.00 51.60  ? 244 ALA B CA  1 
ATOM 5662  C C   . ALA B 1 247 ? 16.937  70.719  116.432 1.00 48.73  ? 244 ALA B C   1 
ATOM 5663  O O   . ALA B 1 247 ? 17.584  71.755  116.293 1.00 52.20  ? 244 ALA B O   1 
ATOM 5664  C CB  . ALA B 1 247 ? 16.730  69.716  118.733 1.00 35.03  ? 244 ALA B CB  1 
ATOM 5665  N N   . VAL B 1 248 ? 16.979  69.723  115.553 1.00 51.98  ? 245 VAL B N   1 
ATOM 5666  C CA  . VAL B 1 248 ? 17.693  69.871  114.291 1.00 43.66  ? 245 VAL B CA  1 
ATOM 5667  C C   . VAL B 1 248 ? 17.019  70.963  113.439 1.00 50.33  ? 245 VAL B C   1 
ATOM 5668  O O   . VAL B 1 248 ? 17.665  71.873  112.945 1.00 37.00  ? 245 VAL B O   1 
ATOM 5669  C CB  . VAL B 1 248 ? 17.776  68.566  113.515 1.00 38.06  ? 245 VAL B CB  1 
ATOM 5670  C CG1 . VAL B 1 248 ? 18.370  68.856  112.138 1.00 36.94  ? 245 VAL B CG1 1 
ATOM 5671  C CG2 . VAL B 1 248 ? 18.632  67.554  114.271 1.00 33.74  ? 245 VAL B CG2 1 
ATOM 5672  N N   . TYR B 1 249 ? 15.704  70.892  113.309 1.00 46.10  ? 246 TYR B N   1 
ATOM 5673  C CA  . TYR B 1 249 ? 14.983  71.905  112.567 1.00 35.49  ? 246 TYR B CA  1 
ATOM 5674  C C   . TYR B 1 249 ? 15.227  73.323  113.070 1.00 47.49  ? 246 TYR B C   1 
ATOM 5675  O O   . TYR B 1 249 ? 15.453  74.228  112.272 1.00 54.40  ? 246 TYR B O   1 
ATOM 5676  C CB  . TYR B 1 249 ? 13.481  71.606  112.545 1.00 37.86  ? 246 TYR B CB  1 
ATOM 5677  C CG  . TYR B 1 249 ? 12.704  72.622  111.756 1.00 52.10  ? 246 TYR B CG  1 
ATOM 5678  C CD1 . TYR B 1 249 ? 12.706  72.586  110.364 1.00 45.62  ? 246 TYR B CD1 1 
ATOM 5679  C CD2 . TYR B 1 249 ? 11.986  73.633  112.388 1.00 37.63  ? 246 TYR B CD2 1 
ATOM 5680  C CE1 . TYR B 1 249 ? 12.013  73.518  109.623 1.00 46.60  ? 246 TYR B CE1 1 
ATOM 5681  C CE2 . TYR B 1 249 ? 11.288  74.576  111.649 1.00 48.48  ? 246 TYR B CE2 1 
ATOM 5682  C CZ  . TYR B 1 249 ? 11.310  74.510  110.260 1.00 50.39  ? 246 TYR B CZ  1 
ATOM 5683  O OH  . TYR B 1 249 ? 10.640  75.427  109.495 1.00 51.63  ? 246 TYR B OH  1 
ATOM 5684  N N   . ARG B 1 250 ? 15.169  73.529  114.380 1.00 42.16  ? 247 ARG B N   1 
ATOM 5685  C CA  . ARG B 1 250 ? 15.348  74.870  114.926 1.00 50.29  ? 247 ARG B CA  1 
ATOM 5686  C C   . ARG B 1 250 ? 16.761  75.388  114.657 1.00 47.13  ? 247 ARG B C   1 
ATOM 5687  O O   . ARG B 1 250 ? 16.960  76.582  114.398 1.00 52.94  ? 247 ARG B O   1 
ATOM 5688  C CB  . ARG B 1 250 ? 15.008  74.911  116.422 1.00 55.33  ? 247 ARG B CB  1 
ATOM 5689  C CG  . ARG B 1 250 ? 13.515  75.060  116.692 1.00 88.16  ? 247 ARG B CG  1 
ATOM 5690  C CD  . ARG B 1 250 ? 13.149  76.473  117.137 1.00 90.00  ? 247 ARG B CD  1 
ATOM 5691  N NE  . ARG B 1 250 ? 13.842  77.497  116.360 1.00 81.87  ? 247 ARG B NE  1 
ATOM 5692  C CZ  . ARG B 1 250 ? 13.326  78.123  115.307 1.00 79.84  ? 247 ARG B CZ  1 
ATOM 5693  N NH1 . ARG B 1 250 ? 12.095  77.841  114.889 1.00 79.80  ? 247 ARG B NH1 1 
ATOM 5694  N NH2 . ARG B 1 250 ? 14.047  79.038  114.667 1.00 47.93  ? 247 ARG B NH2 1 
ATOM 5695  N N   . ILE B 1 251 ? 17.737  74.486  114.702 1.00 41.55  ? 248 ILE B N   1 
ATOM 5696  C CA  . ILE B 1 251 ? 19.123  74.863  114.444 1.00 44.62  ? 248 ILE B CA  1 
ATOM 5697  C C   . ILE B 1 251 ? 19.334  75.342  113.003 1.00 53.16  ? 248 ILE B C   1 
ATOM 5698  O O   . ILE B 1 251 ? 19.988  76.356  112.758 1.00 40.62  ? 248 ILE B O   1 
ATOM 5699  C CB  . ILE B 1 251 ? 20.072  73.709  114.778 1.00 53.89  ? 248 ILE B CB  1 
ATOM 5700  C CG1 . ILE B 1 251 ? 20.250  73.610  116.302 1.00 35.19  ? 248 ILE B CG1 1 
ATOM 5701  C CG2 . ILE B 1 251 ? 21.421  73.891  114.069 1.00 40.10  ? 248 ILE B CG2 1 
ATOM 5702  C CD1 . ILE B 1 251 ? 20.936  72.295  116.758 1.00 42.80  ? 248 ILE B CD1 1 
ATOM 5703  N N   . LEU B 1 252 ? 18.760  74.616  112.053 1.00 41.89  ? 249 LEU B N   1 
ATOM 5704  C CA  . LEU B 1 252 ? 18.791  75.026  110.643 1.00 51.20  ? 249 LEU B CA  1 
ATOM 5705  C C   . LEU B 1 252 ? 18.182  76.390  110.430 1.00 41.48  ? 249 LEU B C   1 
ATOM 5706  O O   . LEU B 1 252 ? 18.737  77.198  109.688 1.00 40.32  ? 249 LEU B O   1 
ATOM 5707  C CB  . LEU B 1 252 ? 18.069  74.014  109.756 1.00 33.79  ? 249 LEU B CB  1 
ATOM 5708  C CG  . LEU B 1 252 ? 18.967  72.841  109.388 1.00 55.44  ? 249 LEU B CG  1 
ATOM 5709  C CD1 . LEU B 1 252 ? 18.163  71.754  108.739 1.00 47.24  ? 249 LEU B CD1 1 
ATOM 5710  C CD2 . LEU B 1 252 ? 20.077  73.330  108.474 1.00 51.73  ? 249 LEU B CD2 1 
ATOM 5711  N N   . ARG B 1 253 ? 17.043  76.648  111.078 1.00 36.59  ? 250 ARG B N   1 
ATOM 5712  C CA  . ARG B 1 253 ? 16.395  77.944  110.951 1.00 31.48  ? 250 ARG B CA  1 
ATOM 5713  C C   . ARG B 1 253 ? 17.254  79.051  111.537 1.00 61.09  ? 250 ARG B C   1 
ATOM 5714  O O   . ARG B 1 253 ? 17.362  80.125  110.953 1.00 66.42  ? 250 ARG B O   1 
ATOM 5715  C CB  . ARG B 1 253 ? 15.006  77.950  111.578 1.00 29.58  ? 250 ARG B CB  1 
ATOM 5716  C CG  . ARG B 1 253 ? 14.036  76.949  111.000 1.00 42.05  ? 250 ARG B CG  1 
ATOM 5717  C CD  . ARG B 1 253 ? 13.919  77.121  109.505 1.00 45.07  ? 250 ARG B CD  1 
ATOM 5718  N NE  . ARG B 1 253 ? 13.687  78.523  109.158 1.00 33.96  ? 250 ARG B NE  1 
ATOM 5719  C CZ  . ARG B 1 253 ? 12.500  79.108  109.205 1.00 38.80  ? 250 ARG B CZ  1 
ATOM 5720  N NH1 . ARG B 1 253 ? 11.435  78.412  109.597 1.00 32.90  ? 250 ARG B NH1 1 
ATOM 5721  N NH2 . ARG B 1 253 ? 12.389  80.385  108.883 1.00 34.80  ? 250 ARG B NH2 1 
ATOM 5722  N N   . GLU B 1 254 ? 17.880  78.788  112.680 1.00 40.33  ? 251 GLU B N   1 
ATOM 5723  C CA  . GLU B 1 254 ? 18.746  79.788  113.294 1.00 47.77  ? 251 GLU B CA  1 
ATOM 5724  C C   . GLU B 1 254 ? 20.018  79.993  112.502 1.00 45.24  ? 251 GLU B C   1 
ATOM 5725  O O   . GLU B 1 254 ? 20.571  81.084  112.499 1.00 50.44  ? 251 GLU B O   1 
ATOM 5726  C CB  . GLU B 1 254 ? 19.102  79.407  114.729 1.00 48.99  ? 251 GLU B CB  1 
ATOM 5727  C CG  . GLU B 1 254 ? 17.927  79.459  115.680 1.00 68.24  ? 251 GLU B CG  1 
ATOM 5728  C CD  . GLU B 1 254 ? 18.287  78.930  117.054 1.00 88.32  ? 251 GLU B CD  1 
ATOM 5729  O OE1 . GLU B 1 254 ? 19.488  78.988  117.410 1.00 78.22  ? 251 GLU B OE1 1 
ATOM 5730  O OE2 . GLU B 1 254 ? 17.380  78.443  117.768 1.00 65.71  ? 251 GLU B OE2 1 
ATOM 5731  N N   . ALA B 1 255 ? 20.499  78.936  111.854 1.00 41.37  ? 252 ALA B N   1 
ATOM 5732  C CA  . ALA B 1 255 ? 21.672  79.043  110.976 1.00 37.76  ? 252 ALA B CA  1 
ATOM 5733  C C   . ALA B 1 255 ? 21.389  79.853  109.717 1.00 46.24  ? 252 ALA B C   1 
ATOM 5734  O O   . ALA B 1 255 ? 22.313  80.169  108.978 1.00 48.33  ? 252 ALA B O   1 
ATOM 5735  C CB  . ALA B 1 255 ? 22.224  77.651  110.607 1.00 40.87  ? 252 ALA B CB  1 
ATOM 5736  N N   . GLY B 1 256 ? 20.118  80.172  109.463 1.00 36.18  ? 253 GLY B N   1 
ATOM 5737  C CA  . GLY B 1 256 ? 19.757  81.040  108.348 1.00 45.40  ? 253 GLY B CA  1 
ATOM 5738  C C   . GLY B 1 256 ? 18.803  80.526  107.270 1.00 46.27  ? 253 GLY B C   1 
ATOM 5739  O O   . GLY B 1 256 ? 18.482  81.257  106.342 1.00 50.32  ? 253 GLY B O   1 
ATOM 5740  N N   . LEU B 1 257 ? 18.357  79.277  107.383 1.00 46.55  ? 254 LEU B N   1 
ATOM 5741  C CA  . LEU B 1 257 ? 17.387  78.723  106.452 1.00 50.72  ? 254 LEU B CA  1 
ATOM 5742  C C   . LEU B 1 257 ? 16.144  79.590  106.408 1.00 43.20  ? 254 LEU B C   1 
ATOM 5743  O O   . LEU B 1 257 ? 15.502  79.808  107.411 1.00 49.60  ? 254 LEU B O   1 
ATOM 5744  C CB  . LEU B 1 257 ? 16.997  77.293  106.837 1.00 48.19  ? 254 LEU B CB  1 
ATOM 5745  C CG  . LEU B 1 257 ? 16.273  76.519  105.726 1.00 57.81  ? 254 LEU B CG  1 
ATOM 5746  C CD1 . LEU B 1 257 ? 17.277  76.133  104.652 1.00 46.01  ? 254 LEU B CD1 1 
ATOM 5747  C CD2 . LEU B 1 257 ? 15.590  75.276  106.248 1.00 43.02  ? 254 LEU B CD2 1 
ATOM 5748  N N   . PRO B 1 258 ? 15.803  80.095  105.231 1.00 46.29  ? 255 PRO B N   1 
ATOM 5749  C CA  . PRO B 1 258 ? 14.598  80.917  105.096 1.00 34.87  ? 255 PRO B CA  1 
ATOM 5750  C C   . PRO B 1 258 ? 13.309  80.127  105.348 1.00 24.56  ? 255 PRO B C   1 
ATOM 5751  O O   . PRO B 1 258 ? 13.288  78.901  105.266 1.00 63.37  ? 255 PRO B O   1 
ATOM 5752  C CB  . PRO B 1 258 ? 14.666  81.390  103.631 1.00 34.59  ? 255 PRO B CB  1 
ATOM 5753  C CG  . PRO B 1 258 ? 16.121  81.308  103.288 1.00 38.22  ? 255 PRO B CG  1 
ATOM 5754  C CD  . PRO B 1 258 ? 16.627  80.101  104.012 1.00 33.64  ? 255 PRO B CD  1 
ATOM 5755  N N   . PRO B 1 259 ? 12.227  80.844  105.662 1.00 36.10  ? 256 PRO B N   1 
ATOM 5756  C CA  . PRO B 1 259 ? 10.895  80.272  105.867 1.00 30.57  ? 256 PRO B CA  1 
ATOM 5757  C C   . PRO B 1 259 ? 10.400  79.573  104.616 1.00 43.27  ? 256 PRO B C   1 
ATOM 5758  O O   . PRO B 1 259 ? 10.751  79.976  103.518 1.00 37.36  ? 256 PRO B O   1 
ATOM 5759  C CB  . PRO B 1 259 ? 10.018  81.500  106.144 1.00 39.67  ? 256 PRO B CB  1 
ATOM 5760  C CG  . PRO B 1 259 ? 10.828  82.690  105.743 1.00 28.71  ? 256 PRO B CG  1 
ATOM 5761  C CD  . PRO B 1 259 ? 12.254  82.298  105.889 1.00 31.22  ? 256 PRO B CD  1 
ATOM 5762  N N   . ASN B 1 260 ? 9.598   78.535  104.787 1.00 55.04  ? 257 ASN B N   1 
ATOM 5763  C CA  . ASN B 1 260 ? 8.997   77.853  103.656 1.00 35.08  ? 257 ASN B CA  1 
ATOM 5764  C C   . ASN B 1 260 ? 9.968   77.077  102.757 1.00 48.74  ? 257 ASN B C   1 
ATOM 5765  O O   . ASN B 1 260 ? 9.571   76.556  101.719 1.00 54.05  ? 257 ASN B O   1 
ATOM 5766  C CB  . ASN B 1 260 ? 8.215   78.855  102.824 1.00 40.68  ? 257 ASN B CB  1 
ATOM 5767  C CG  . ASN B 1 260 ? 7.101   79.502  103.599 1.00 43.43  ? 257 ASN B CG  1 
ATOM 5768  O OD1 . ASN B 1 260 ? 6.226   78.830  104.121 1.00 52.08  ? 257 ASN B OD1 1 
ATOM 5769  N ND2 . ASN B 1 260 ? 7.123   80.816  103.670 1.00 38.81  ? 257 ASN B ND2 1 
ATOM 5770  N N   . ILE B 1 261 ? 11.238  77.023  103.136 1.00 26.96  ? 258 ILE B N   1 
ATOM 5771  C CA  . ILE B 1 261 ? 12.170  76.115  102.482 1.00 29.91  ? 258 ILE B CA  1 
ATOM 5772  C C   . ILE B 1 261 ? 12.043  74.712  103.067 1.00 41.55  ? 258 ILE B C   1 
ATOM 5773  O O   . ILE B 1 261 ? 12.030  73.740  102.330 1.00 38.78  ? 258 ILE B O   1 
ATOM 5774  C CB  . ILE B 1 261 ? 13.623  76.580  102.596 1.00 26.42  ? 258 ILE B CB  1 
ATOM 5775  C CG1 . ILE B 1 261 ? 13.765  78.022  102.081 1.00 45.25  ? 258 ILE B CG1 1 
ATOM 5776  C CG2 . ILE B 1 261 ? 14.551  75.601  101.858 1.00 36.55  ? 258 ILE B CG2 1 
ATOM 5777  C CD1 . ILE B 1 261 ? 13.117  78.283  100.729 1.00 27.63  ? 258 ILE B CD1 1 
ATOM 5778  N N   . ILE B 1 262 ? 11.942  74.608  104.390 1.00 50.47  ? 259 ILE B N   1 
ATOM 5779  C CA  . ILE B 1 262 ? 11.563  73.342  105.003 1.00 35.99  ? 259 ILE B CA  1 
ATOM 5780  C C   . ILE B 1 262 ? 10.376  73.558  105.945 1.00 40.16  ? 259 ILE B C   1 
ATOM 5781  O O   . ILE B 1 262 ? 10.425  74.374  106.859 1.00 55.75  ? 259 ILE B O   1 
ATOM 5782  C CB  . ILE B 1 262 ? 12.741  72.640  105.731 1.00 40.00  ? 259 ILE B CB  1 
ATOM 5783  C CG1 . ILE B 1 262 ? 13.897  72.347  104.768 1.00 44.86  ? 259 ILE B CG1 1 
ATOM 5784  C CG2 . ILE B 1 262 ? 12.293  71.330  106.360 1.00 24.68  ? 259 ILE B CG2 1 
ATOM 5785  C CD1 . ILE B 1 262 ? 15.055  71.555  105.441 1.00 33.25  ? 259 ILE B CD1 1 
ATOM 5786  N N   . GLN B 1 263 ? 9.299   72.828  105.689 1.00 31.37  ? 260 GLN B N   1 
ATOM 5787  C CA  . GLN B 1 263 ? 8.128   72.840  106.538 1.00 23.09  ? 260 GLN B CA  1 
ATOM 5788  C C   . GLN B 1 263 ? 8.228   71.662  107.496 1.00 55.33  ? 260 GLN B C   1 
ATOM 5789  O O   . GLN B 1 263 ? 8.438   70.527  107.076 1.00 48.19  ? 260 GLN B O   1 
ATOM 5790  C CB  . GLN B 1 263 ? 6.830   72.738  105.715 1.00 41.88  ? 260 GLN B CB  1 
ATOM 5791  C CG  . GLN B 1 263 ? 6.706   73.673  104.495 1.00 37.77  ? 260 GLN B CG  1 
ATOM 5792  C CD  . GLN B 1 263 ? 6.714   75.150  104.837 1.00 48.17  ? 260 GLN B CD  1 
ATOM 5793  O OE1 . GLN B 1 263 ? 7.340   75.571  105.808 1.00 43.31  ? 260 GLN B OE1 1 
ATOM 5794  N NE2 . GLN B 1 263 ? 6.012   75.955  104.023 1.00 32.03  ? 260 GLN B NE2 1 
ATOM 5795  N N   . PHE B 1 264 ? 8.092   71.944  108.786 1.00 40.02  ? 261 PHE B N   1 
ATOM 5796  C CA  . PHE B 1 264 ? 8.105   70.914  109.821 1.00 43.53  ? 261 PHE B CA  1 
ATOM 5797  C C   . PHE B 1 264 ? 6.671   70.481  110.071 1.00 48.28  ? 261 PHE B C   1 
ATOM 5798  O O   . PHE B 1 264 ? 5.899   71.202  110.681 1.00 40.88  ? 261 PHE B O   1 
ATOM 5799  C CB  . PHE B 1 264 ? 8.730   71.471  111.095 1.00 44.40  ? 261 PHE B CB  1 
ATOM 5800  C CG  . PHE B 1 264 ? 9.202   70.427  112.075 1.00 48.23  ? 261 PHE B CG  1 
ATOM 5801  C CD1 . PHE B 1 264 ? 10.447  69.835  111.932 1.00 41.01  ? 261 PHE B CD1 1 
ATOM 5802  C CD2 . PHE B 1 264 ? 8.433   70.098  113.188 1.00 43.29  ? 261 PHE B CD2 1 
ATOM 5803  C CE1 . PHE B 1 264 ? 10.898  68.890  112.849 1.00 45.81  ? 261 PHE B CE1 1 
ATOM 5804  C CE2 . PHE B 1 264 ? 8.872   69.159  114.102 1.00 37.98  ? 261 PHE B CE2 1 
ATOM 5805  C CZ  . PHE B 1 264 ? 10.111  68.550  113.931 1.00 46.03  ? 261 PHE B CZ  1 
ATOM 5806  N N   . VAL B 1 265 ? 6.322   69.295  109.592 1.00 26.23  ? 262 VAL B N   1 
ATOM 5807  C CA  . VAL B 1 265 ? 4.944   68.860  109.568 1.00 36.54  ? 262 VAL B CA  1 
ATOM 5808  C C   . VAL B 1 265 ? 4.821   67.401  109.948 1.00 31.55  ? 262 VAL B C   1 
ATOM 5809  O O   . VAL B 1 265 ? 4.591   66.562  109.085 1.00 46.48  ? 262 VAL B O   1 
ATOM 5810  C CB  . VAL B 1 265 ? 4.277   69.095  108.174 1.00 46.20  ? 262 VAL B CB  1 
ATOM 5811  C CG1 . VAL B 1 265 ? 3.956   70.569  107.957 1.00 37.25  ? 262 VAL B CG1 1 
ATOM 5812  C CG2 . VAL B 1 265 ? 5.169   68.608  107.068 1.00 34.84  ? 262 VAL B CG2 1 
ATOM 5813  N N   . PRO B 1 266 ? 4.952   67.092  111.251 1.00 49.88  ? 263 PRO B N   1 
ATOM 5814  C CA  . PRO B 1 266 ? 4.630   65.741  111.720 1.00 51.93  ? 263 PRO B CA  1 
ATOM 5815  C C   . PRO B 1 266 ? 3.204   65.395  111.295 1.00 41.10  ? 263 PRO B C   1 
ATOM 5816  O O   . PRO B 1 266 ? 2.345   66.271  111.223 1.00 38.38  ? 263 PRO B O   1 
ATOM 5817  C CB  . PRO B 1 266 ? 4.687   65.869  113.255 1.00 51.55  ? 263 PRO B CB  1 
ATOM 5818  C CG  . PRO B 1 266 ? 5.449   67.108  113.529 1.00 50.78  ? 263 PRO B CG  1 
ATOM 5819  C CD  . PRO B 1 266 ? 5.221   68.019  112.367 1.00 53.68  ? 263 PRO B CD  1 
ATOM 5820  N N   . ALA B 1 267 ? 2.935   64.133  111.023 1.00 48.28  ? 264 ALA B N   1 
ATOM 5821  C CA  . ALA B 1 267 ? 1.591   63.770  110.608 1.00 29.43  ? 264 ALA B CA  1 
ATOM 5822  C C   . ALA B 1 267 ? 1.404   62.269  110.702 1.00 51.57  ? 264 ALA B C   1 
ATOM 5823  O O   . ALA B 1 267 ? 2.380   61.523  110.865 1.00 50.27  ? 264 ALA B O   1 
ATOM 5824  C CB  . ALA B 1 267 ? 1.324   64.252  109.180 1.00 31.67  ? 264 ALA B CB  1 
ATOM 5825  N N   . ASP B 1 268 ? 0.146   61.836  110.612 1.00 40.72  ? 265 ASP B N   1 
ATOM 5826  C CA  . ASP B 1 268 ? -0.160  60.414  110.474 1.00 54.00  ? 265 ASP B CA  1 
ATOM 5827  C C   . ASP B 1 268 ? 0.480   59.960  109.170 1.00 42.38  ? 265 ASP B C   1 
ATOM 5828  O O   . ASP B 1 268 ? 0.355   60.646  108.155 1.00 58.69  ? 265 ASP B O   1 
ATOM 5829  C CB  . ASP B 1 268 ? -1.684  60.180  110.460 1.00 43.10  ? 265 ASP B CB  1 
ATOM 5830  C CG  . ASP B 1 268 ? -2.053  58.725  110.222 1.00 76.29  ? 265 ASP B CG  1 
ATOM 5831  O OD1 . ASP B 1 268 ? -1.761  57.863  111.092 1.00 68.06  ? 265 ASP B OD1 1 
ATOM 5832  O OD2 . ASP B 1 268 ? -2.647  58.449  109.153 1.00 78.92  ? 265 ASP B OD2 1 
ATOM 5833  N N   . GLY B 1 269 ? 1.174   58.827  109.193 1.00 55.43  ? 266 GLY B N   1 
ATOM 5834  C CA  . GLY B 1 269 ? 1.897   58.339  108.020 1.00 31.63  ? 266 GLY B CA  1 
ATOM 5835  C C   . GLY B 1 269 ? 1.056   58.283  106.744 1.00 70.84  ? 266 GLY B C   1 
ATOM 5836  O O   . GLY B 1 269 ? 1.358   58.976  105.766 1.00 63.43  ? 266 GLY B O   1 
ATOM 5837  N N   . PRO B 1 270 ? -0.002  57.456  106.741 1.00 56.16  ? 267 PRO B N   1 
ATOM 5838  C CA  . PRO B 1 270 ? -0.903  57.301  105.591 1.00 48.46  ? 267 PRO B CA  1 
ATOM 5839  C C   . PRO B 1 270 ? -1.496  58.622  105.098 1.00 57.71  ? 267 PRO B C   1 
ATOM 5840  O O   . PRO B 1 270 ? -1.486  58.858  103.899 1.00 71.90  ? 267 PRO B O   1 
ATOM 5841  C CB  . PRO B 1 270 ? -2.010  56.398  106.137 1.00 64.57  ? 267 PRO B CB  1 
ATOM 5842  C CG  . PRO B 1 270 ? -1.316  55.569  107.200 1.00 48.89  ? 267 PRO B CG  1 
ATOM 5843  C CD  . PRO B 1 270 ? -0.342  56.529  107.839 1.00 50.69  ? 267 PRO B CD  1 
ATOM 5844  N N   . LEU B 1 271 ? -1.997  59.466  105.993 1.00 54.12  ? 268 LEU B N   1 
ATOM 5845  C CA  . LEU B 1 271 ? -2.548  60.756  105.581 1.00 50.87  ? 268 LEU B CA  1 
ATOM 5846  C C   . LEU B 1 271 ? -1.493  61.613  104.858 1.00 36.95  ? 268 LEU B C   1 
ATOM 5847  O O   . LEU B 1 271 ? -1.778  62.218  103.837 1.00 56.11  ? 268 LEU B O   1 
ATOM 5848  C CB  . LEU B 1 271 ? -3.165  61.494  106.780 1.00 40.14  ? 268 LEU B CB  1 
ATOM 5849  C CG  . LEU B 1 271 ? -3.970  62.774  106.523 1.00 47.67  ? 268 LEU B CG  1 
ATOM 5850  C CD1 . LEU B 1 271 ? -3.075  64.009  106.495 1.00 57.64  ? 268 LEU B CD1 1 
ATOM 5851  C CD2 . LEU B 1 271 ? -4.738  62.640  105.225 1.00 53.62  ? 268 LEU B CD2 1 
ATOM 5852  N N   . PHE B 1 272 ? -0.278  61.656  105.389 1.00 42.44  ? 269 PHE B N   1 
ATOM 5853  C CA  . PHE B 1 272 ? 0.803   62.407  104.779 1.00 37.33  ? 269 PHE B CA  1 
ATOM 5854  C C   . PHE B 1 272 ? 1.107   61.817  103.403 1.00 47.45  ? 269 PHE B C   1 
ATOM 5855  O O   . PHE B 1 272 ? 1.170   62.525  102.406 1.00 43.23  ? 269 PHE B O   1 
ATOM 5856  C CB  . PHE B 1 272 ? 2.062   62.370  105.664 1.00 53.72  ? 269 PHE B CB  1 
ATOM 5857  C CG  . PHE B 1 272 ? 3.208   63.182  105.123 1.00 45.39  ? 269 PHE B CG  1 
ATOM 5858  C CD1 . PHE B 1 272 ? 3.272   64.547  105.352 1.00 36.95  ? 269 PHE B CD1 1 
ATOM 5859  C CD2 . PHE B 1 272 ? 4.214   62.580  104.373 1.00 30.30  ? 269 PHE B CD2 1 
ATOM 5860  C CE1 . PHE B 1 272 ? 4.315   65.312  104.835 1.00 49.78  ? 269 PHE B CE1 1 
ATOM 5861  C CE2 . PHE B 1 272 ? 5.264   63.340  103.859 1.00 41.43  ? 269 PHE B CE2 1 
ATOM 5862  C CZ  . PHE B 1 272 ? 5.307   64.711  104.088 1.00 41.69  ? 269 PHE B CZ  1 
ATOM 5863  N N   . GLY B 1 273 ? 1.295   60.510  103.363 1.00 39.92  ? 270 GLY B N   1 
ATOM 5864  C CA  . GLY B 1 273 ? 1.569   59.815  102.126 1.00 22.21  ? 270 GLY B CA  1 
ATOM 5865  C C   . GLY B 1 273 ? 0.467   60.063  101.089 1.00 64.20  ? 270 GLY B C   1 
ATOM 5866  O O   . GLY B 1 273 ? 0.761   60.319  99.917  1.00 36.37  ? 270 GLY B O   1 
ATOM 5867  N N   . ASP B 1 274 ? -0.796  59.995  101.512 1.00 36.54  ? 271 ASP B N   1 
ATOM 5868  C CA  . ASP B 1 274 ? -1.937  60.208  100.610 1.00 42.45  ? 271 ASP B CA  1 
ATOM 5869  C C   . ASP B 1 274 ? -1.962  61.639  100.087 1.00 50.75  ? 271 ASP B C   1 
ATOM 5870  O O   . ASP B 1 274 ? -2.238  61.864  98.926  1.00 42.23  ? 271 ASP B O   1 
ATOM 5871  C CB  . ASP B 1 274 ? -3.280  59.928  101.300 1.00 44.47  ? 271 ASP B CB  1 
ATOM 5872  C CG  . ASP B 1 274 ? -3.473  58.462  101.681 1.00 64.10  ? 271 ASP B CG  1 
ATOM 5873  O OD1 . ASP B 1 274 ? -2.582  57.634  101.395 1.00 79.26  ? 271 ASP B OD1 1 
ATOM 5874  O OD2 . ASP B 1 274 ? -4.539  58.144  102.272 1.00 63.48  ? 271 ASP B OD2 1 
ATOM 5875  N N   . THR B 1 275 ? -1.679  62.610  100.951 1.00 53.50  ? 272 THR B N   1 
ATOM 5876  C CA  . THR B 1 275 ? -1.736  64.014  100.550 1.00 37.82  ? 272 THR B CA  1 
ATOM 5877  C C   . THR B 1 275 ? -0.661  64.404  99.545  1.00 54.56  ? 272 THR B C   1 
ATOM 5878  O O   . THR B 1 275 ? -0.954  65.065  98.554  1.00 48.42  ? 272 THR B O   1 
ATOM 5879  C CB  . THR B 1 275 ? -1.650  64.972  101.751 1.00 33.02  ? 272 THR B CB  1 
ATOM 5880  O OG1 . THR B 1 275 ? -2.660  64.643  102.701 1.00 38.85  ? 272 THR B OG1 1 
ATOM 5881  C CG2 . THR B 1 275 ? -1.850  66.403  101.299 1.00 24.00  ? 272 THR B CG2 1 
ATOM 5882  N N   . VAL B 1 276 ? 0.579   64.005  99.804  1.00 41.64  ? 273 VAL B N   1 
ATOM 5883  C CA  . VAL B 1 276 ? 1.671   64.454  98.971  1.00 37.53  ? 273 VAL B CA  1 
ATOM 5884  C C   . VAL B 1 276 ? 1.686   63.725  97.628  1.00 60.20  ? 273 VAL B C   1 
ATOM 5885  O O   . VAL B 1 276 ? 2.031   64.319  96.616  1.00 51.08  ? 273 VAL B O   1 
ATOM 5886  C CB  . VAL B 1 276 ? 3.044   64.368  99.677  1.00 41.46  ? 273 VAL B CB  1 
ATOM 5887  C CG1 . VAL B 1 276 ? 3.032   65.176  100.947 1.00 33.12  ? 273 VAL B CG1 1 
ATOM 5888  C CG2 . VAL B 1 276 ? 3.430   62.916  99.955  1.00 35.22  ? 273 VAL B CG2 1 
ATOM 5889  N N   . THR B 1 277 ? 1.287   62.457  97.606  1.00 46.98  ? 274 THR B N   1 
ATOM 5890  C CA  . THR B 1 277 ? 1.184   61.739  96.340  1.00 43.24  ? 274 THR B CA  1 
ATOM 5891  C C   . THR B 1 277 ? -0.042  62.155  95.528  1.00 63.50  ? 274 THR B C   1 
ATOM 5892  O O   . THR B 1 277 ? -0.224  61.689  94.416  1.00 43.58  ? 274 THR B O   1 
ATOM 5893  C CB  . THR B 1 277 ? 1.205   60.197  96.488  1.00 54.11  ? 274 THR B CB  1 
ATOM 5894  O OG1 . THR B 1 277 ? 0.078   59.760  97.250  1.00 43.08  ? 274 THR B OG1 1 
ATOM 5895  C CG2 . THR B 1 277 ? 2.485   59.731  97.153  1.00 39.69  ? 274 THR B CG2 1 
ATOM 5896  N N   . SER B 1 278 ? -0.862  63.042  96.087  1.00 48.11  ? 275 SER B N   1 
ATOM 5897  C CA  . SER B 1 278 ? -2.028  63.566  95.403  1.00 48.12  ? 275 SER B CA  1 
ATOM 5898  C C   . SER B 1 278 ? -1.792  64.963  94.857  1.00 53.69  ? 275 SER B C   1 
ATOM 5899  O O   . SER B 1 278 ? -2.592  65.463  94.069  1.00 54.34  ? 275 SER B O   1 
ATOM 5900  C CB  . SER B 1 278 ? -3.250  63.587  96.339  1.00 51.79  ? 275 SER B CB  1 
ATOM 5901  O OG  . SER B 1 278 ? -3.702  62.270  96.559  1.00 58.59  ? 275 SER B OG  1 
ATOM 5902  N N   . SER B 1 279 ? -0.712  65.601  95.288  1.00 33.88  ? 276 SER B N   1 
ATOM 5903  C CA  . SER B 1 279 ? -0.391  66.940  94.818  1.00 30.63  ? 276 SER B CA  1 
ATOM 5904  C C   . SER B 1 279 ? 0.244   66.849  93.450  1.00 42.58  ? 276 SER B C   1 
ATOM 5905  O O   . SER B 1 279 ? 1.172   66.082  93.256  1.00 38.09  ? 276 SER B O   1 
ATOM 5906  C CB  . SER B 1 279 ? 0.572   67.650  95.770  1.00 35.82  ? 276 SER B CB  1 
ATOM 5907  O OG  . SER B 1 279 ? 0.894   68.945  95.292  1.00 59.65  ? 276 SER B OG  1 
ATOM 5908  N N   . GLU B 1 280 ? -0.279  67.627  92.510  1.00 32.27  ? 277 GLU B N   1 
ATOM 5909  C CA  . GLU B 1 280 ? 0.277   67.760  91.165  1.00 48.22  ? 277 GLU B CA  1 
ATOM 5910  C C   . GLU B 1 280 ? 1.703   68.295  91.206  1.00 34.09  ? 277 GLU B C   1 
ATOM 5911  O O   . GLU B 1 280 ? 2.429   68.242  90.203  1.00 46.83  ? 277 GLU B O   1 
ATOM 5912  C CB  . GLU B 1 280 ? -0.599  68.721  90.342  1.00 49.26  ? 277 GLU B CB  1 
ATOM 5913  C CG  . GLU B 1 280 ? -0.844  70.066  91.047  1.00 79.60  ? 277 GLU B CG  1 
ATOM 5914  C CD  . GLU B 1 280 ? -1.857  70.964  90.351  1.00 82.10  ? 277 GLU B CD  1 
ATOM 5915  O OE1 . GLU B 1 280 ? -2.975  71.104  90.883  1.00 77.67  ? 277 GLU B OE1 1 
ATOM 5916  O OE2 . GLU B 1 280 ? -1.532  71.556  89.298  1.00 72.98  ? 277 GLU B OE2 1 
ATOM 5917  N N   . HIS B 1 281 ? 2.099   68.814  92.369  1.00 40.11  ? 278 HIS B N   1 
ATOM 5918  C CA  . HIS B 1 281 ? 3.377   69.526  92.513  1.00 24.57  ? 278 HIS B CA  1 
ATOM 5919  C C   . HIS B 1 281 ? 4.482   68.673  93.106  1.00 41.09  ? 278 HIS B C   1 
ATOM 5920  O O   . HIS B 1 281 ? 5.600   69.137  93.252  1.00 35.08  ? 278 HIS B O   1 
ATOM 5921  C CB  . HIS B 1 281 ? 3.188   70.783  93.359  1.00 33.05  ? 278 HIS B CB  1 
ATOM 5922  C CG  . HIS B 1 281 ? 2.237   71.761  92.758  1.00 60.23  ? 278 HIS B CG  1 
ATOM 5923  N ND1 . HIS B 1 281 ? 2.511   72.437  91.588  1.00 44.93  ? 278 HIS B ND1 1 
ATOM 5924  C CD2 . HIS B 1 281 ? 1.006   72.164  93.152  1.00 45.62  ? 278 HIS B CD2 1 
ATOM 5925  C CE1 . HIS B 1 281 ? 1.491   73.225  91.295  1.00 46.91  ? 278 HIS B CE1 1 
ATOM 5926  N NE2 . HIS B 1 281 ? 0.564   73.075  92.226  1.00 39.65  ? 278 HIS B NE2 1 
ATOM 5927  N N   . LEU B 1 282 ? 4.160   67.442  93.487  1.00 29.53  ? 279 LEU B N   1 
ATOM 5928  C CA  . LEU B 1 282 ? 5.168   66.522  93.982  1.00 45.66  ? 279 LEU B CA  1 
ATOM 5929  C C   . LEU B 1 282 ? 6.229   66.292  92.904  1.00 27.73  ? 279 LEU B C   1 
ATOM 5930  O O   . LEU B 1 282 ? 5.909   65.940  91.771  1.00 55.98  ? 279 LEU B O   1 
ATOM 5931  C CB  . LEU B 1 282 ? 4.514   65.187  94.355  1.00 29.60  ? 279 LEU B CB  1 
ATOM 5932  C CG  . LEU B 1 282 ? 5.466   64.199  95.003  1.00 36.99  ? 279 LEU B CG  1 
ATOM 5933  C CD1 . LEU B 1 282 ? 5.765   64.684  96.395  1.00 36.86  ? 279 LEU B CD1 1 
ATOM 5934  C CD2 . LEU B 1 282 ? 4.861   62.798  95.006  1.00 23.07  ? 279 LEU B CD2 1 
ATOM 5935  N N   . CYS B 1 283 ? 7.486   66.490  93.259  1.00 38.27  ? 280 CYS B N   1 
ATOM 5936  C CA  . CYS B 1 283 ? 8.576   66.233  92.337  1.00 24.18  ? 280 CYS B CA  1 
ATOM 5937  C C   . CYS B 1 283 ? 9.554   65.243  92.937  1.00 42.84  ? 280 CYS B C   1 
ATOM 5938  O O   . CYS B 1 283 ? 10.448  64.750  92.254  1.00 47.11  ? 280 CYS B O   1 
ATOM 5939  C CB  . CYS B 1 283 ? 9.296   67.516  91.913  1.00 30.30  ? 280 CYS B CB  1 
ATOM 5940  S SG  . CYS B 1 283 ? 10.098  68.411  93.265  1.00 48.22  ? 280 CYS B SG  1 
ATOM 5941  N N   . GLY B 1 284 ? 9.376   64.922  94.211  1.00 28.51  ? 281 GLY B N   1 
ATOM 5942  C CA  . GLY B 1 284 ? 10.192  63.866  94.801  1.00 27.82  ? 281 GLY B CA  1 
ATOM 5943  C C   . GLY B 1 284 ? 9.767   63.366  96.162  1.00 27.20  ? 281 GLY B C   1 
ATOM 5944  O O   . GLY B 1 284 ? 9.072   64.056  96.913  1.00 41.24  ? 281 GLY B O   1 
ATOM 5945  N N   . ILE B 1 285 ? 10.138  62.126  96.454  1.00 38.08  ? 282 ILE B N   1 
ATOM 5946  C CA  . ILE B 1 285 ? 9.988   61.564  97.786  1.00 26.08  ? 282 ILE B CA  1 
ATOM 5947  C C   . ILE B 1 285 ? 11.327  60.997  98.264  1.00 40.40  ? 282 ILE B C   1 
ATOM 5948  O O   . ILE B 1 285 ? 11.904  60.133  97.620  1.00 45.53  ? 282 ILE B O   1 
ATOM 5949  C CB  . ILE B 1 285 ? 8.940   60.461  97.858  1.00 48.90  ? 282 ILE B CB  1 
ATOM 5950  C CG1 . ILE B 1 285 ? 7.583   60.989  97.397  1.00 36.12  ? 282 ILE B CG1 1 
ATOM 5951  C CG2 . ILE B 1 285 ? 8.894   59.891  99.281  1.00 31.65  ? 282 ILE B CG2 1 
ATOM 5952  C CD1 . ILE B 1 285 ? 6.510   59.954  97.419  1.00 49.79  ? 282 ILE B CD1 1 
ATOM 5953  N N   . ASN B 1 286 ? 11.817  61.513  99.388  1.00 48.13  ? 283 ASN B N   1 
ATOM 5954  C CA  . ASN B 1 286 ? 13.040  61.040  100.014 1.00 39.31  ? 283 ASN B CA  1 
ATOM 5955  C C   . ASN B 1 286 ? 12.673  60.263  101.277 1.00 46.11  ? 283 ASN B C   1 
ATOM 5956  O O   . ASN B 1 286 ? 12.368  60.847  102.310 1.00 46.19  ? 283 ASN B O   1 
ATOM 5957  C CB  . ASN B 1 286 ? 13.956  62.216  100.356 1.00 23.64  ? 283 ASN B CB  1 
ATOM 5958  C CG  . ASN B 1 286 ? 15.416  61.831  100.352 1.00 40.30  ? 283 ASN B CG  1 
ATOM 5959  O OD1 . ASN B 1 286 ? 15.775  60.715  99.994  1.00 43.21  ? 283 ASN B OD1 1 
ATOM 5960  N ND2 . ASN B 1 286 ? 16.271  62.759  100.749 1.00 35.75  ? 283 ASN B ND2 1 
ATOM 5961  N N   . PHE B 1 287 ? 12.688  58.939  101.163 1.00 29.46  ? 284 PHE B N   1 
ATOM 5962  C CA  . PHE B 1 287 ? 12.141  58.029  102.160 1.00 36.35  ? 284 PHE B CA  1 
ATOM 5963  C C   . PHE B 1 287 ? 13.185  57.144  102.801 1.00 39.84  ? 284 PHE B C   1 
ATOM 5964  O O   . PHE B 1 287 ? 14.072  56.618  102.135 1.00 46.18  ? 284 PHE B O   1 
ATOM 5965  C CB  . PHE B 1 287 ? 11.082  57.132  101.516 1.00 39.31  ? 284 PHE B CB  1 
ATOM 5966  C CG  . PHE B 1 287 ? 10.507  56.090  102.450 1.00 42.48  ? 284 PHE B CG  1 
ATOM 5967  C CD1 . PHE B 1 287 ? 11.041  54.815  102.498 1.00 39.96  ? 284 PHE B CD1 1 
ATOM 5968  C CD2 . PHE B 1 287 ? 9.432   56.384  103.267 1.00 47.83  ? 284 PHE B CD2 1 
ATOM 5969  C CE1 . PHE B 1 287 ? 10.518  53.853  103.344 1.00 46.20  ? 284 PHE B CE1 1 
ATOM 5970  C CE2 . PHE B 1 287 ? 8.902   55.428  104.122 1.00 49.46  ? 284 PHE B CE2 1 
ATOM 5971  C CZ  . PHE B 1 287 ? 9.446   54.159  104.159 1.00 56.22  ? 284 PHE B CZ  1 
ATOM 5972  N N   . THR B 1 288 ? 13.055  56.976  104.111 1.00 56.27  ? 285 THR B N   1 
ATOM 5973  C CA  . THR B 1 288 ? 13.776  55.948  104.862 1.00 49.61  ? 285 THR B CA  1 
ATOM 5974  C C   . THR B 1 288 ? 12.811  55.253  105.812 1.00 49.10  ? 285 THR B C   1 
ATOM 5975  O O   . THR B 1 288 ? 12.018  55.896  106.498 1.00 55.17  ? 285 THR B O   1 
ATOM 5976  C CB  . THR B 1 288 ? 14.986  56.510  105.626 1.00 66.01  ? 285 THR B CB  1 
ATOM 5977  O OG1 . THR B 1 288 ? 15.881  57.144  104.699 1.00 56.81  ? 285 THR B OG1 1 
ATOM 5978  C CG2 . THR B 1 288 ? 15.729  55.381  106.359 1.00 51.66  ? 285 THR B CG2 1 
ATOM 5979  N N   . GLY B 1 289 ? 12.856  53.929  105.821 1.00 57.21  ? 286 GLY B N   1 
ATOM 5980  C CA  . GLY B 1 289 ? 11.922  53.153  106.609 1.00 32.96  ? 286 GLY B CA  1 
ATOM 5981  C C   . GLY B 1 289 ? 11.686  51.784  106.005 1.00 45.18  ? 286 GLY B C   1 
ATOM 5982  O O   . GLY B 1 289 ? 12.598  51.186  105.450 1.00 46.35  ? 286 GLY B O   1 
ATOM 5983  N N   . SER B 1 290 ? 10.455  51.296  106.095 1.00 50.07  ? 287 SER B N   1 
ATOM 5984  C CA  . SER B 1 290 ? 10.153  49.923  105.699 1.00 54.49  ? 287 SER B CA  1 
ATOM 5985  C C   . SER B 1 290 ? 9.870   49.761  104.209 1.00 55.62  ? 287 SER B C   1 
ATOM 5986  O O   . SER B 1 290 ? 9.299   50.651  103.582 1.00 56.32  ? 287 SER B O   1 
ATOM 5987  C CB  . SER B 1 290 ? 8.986   49.376  106.524 1.00 48.47  ? 287 SER B CB  1 
ATOM 5988  O OG  . SER B 1 290 ? 7.779   50.091  106.289 1.00 59.35  ? 287 SER B OG  1 
ATOM 5989  N N   . VAL B 1 291 ? 10.267  48.609  103.666 1.00 65.13  ? 288 VAL B N   1 
ATOM 5990  C CA  . VAL B 1 291 ? 10.008  48.244  102.275 1.00 53.22  ? 288 VAL B CA  1 
ATOM 5991  C C   . VAL B 1 291 ? 8.540   48.407  101.838 1.00 59.02  ? 288 VAL B C   1 
ATOM 5992  O O   . VAL B 1 291 ? 8.264   49.006  100.812 1.00 69.61  ? 288 VAL B O   1 
ATOM 5993  C CB  . VAL B 1 291 ? 10.457  46.794  101.993 1.00 63.27  ? 288 VAL B CB  1 
ATOM 5994  C CG1 . VAL B 1 291 ? 10.593  46.575  100.499 1.00 60.10  ? 288 VAL B CG1 1 
ATOM 5995  C CG2 . VAL B 1 291 ? 11.771  46.513  102.689 1.00 64.24  ? 288 VAL B CG2 1 
ATOM 5996  N N   . PRO B 1 292 ? 7.592   47.874  102.621 1.00 73.49  ? 289 PRO B N   1 
ATOM 5997  C CA  . PRO B 1 292 ? 6.175   47.936  102.223 1.00 59.68  ? 289 PRO B CA  1 
ATOM 5998  C C   . PRO B 1 292 ? 5.596   49.355  102.114 1.00 62.35  ? 289 PRO B C   1 
ATOM 5999  O O   . PRO B 1 292 ? 4.753   49.632  101.241 1.00 39.65  ? 289 PRO B O   1 
ATOM 6000  C CB  . PRO B 1 292 ? 5.461   47.169  103.348 1.00 52.18  ? 289 PRO B CB  1 
ATOM 6001  C CG  . PRO B 1 292 ? 6.544   46.327  103.995 1.00 51.77  ? 289 PRO B CG  1 
ATOM 6002  C CD  . PRO B 1 292 ? 7.794   47.120  103.874 1.00 56.68  ? 289 PRO B CD  1 
ATOM 6003  N N   . THR B 1 293 ? 6.011   50.234  103.018 1.00 39.26  ? 290 THR B N   1 
ATOM 6004  C CA  . THR B 1 293 ? 5.589   51.626  102.964 1.00 45.50  ? 290 THR B CA  1 
ATOM 6005  C C   . THR B 1 293 ? 6.185   52.329  101.745 1.00 45.07  ? 290 THR B C   1 
ATOM 6006  O O   . THR B 1 293 ? 5.495   53.061  101.057 1.00 44.59  ? 290 THR B O   1 
ATOM 6007  C CB  . THR B 1 293 ? 5.990   52.393  104.230 1.00 55.27  ? 290 THR B CB  1 
ATOM 6008  O OG1 . THR B 1 293 ? 5.410   51.759  105.372 1.00 57.04  ? 290 THR B OG1 1 
ATOM 6009  C CG2 . THR B 1 293 ? 5.476   53.822  104.158 1.00 31.07  ? 290 THR B CG2 1 
ATOM 6010  N N   . PHE B 1 294 ? 7.466   52.095  101.476 1.00 34.29  ? 291 PHE B N   1 
ATOM 6011  C CA  . PHE B 1 294 ? 8.103   52.597  100.256 1.00 55.57  ? 291 PHE B CA  1 
ATOM 6012  C C   . PHE B 1 294 ? 7.454   52.111  98.943  1.00 41.85  ? 291 PHE B C   1 
ATOM 6013  O O   . PHE B 1 294 ? 7.209   52.905  98.043  1.00 51.51  ? 291 PHE B O   1 
ATOM 6014  C CB  . PHE B 1 294 ? 9.608   52.285  100.243 1.00 36.61  ? 291 PHE B CB  1 
ATOM 6015  C CG  . PHE B 1 294 ? 10.344  52.934  99.097  1.00 46.34  ? 291 PHE B CG  1 
ATOM 6016  C CD1 . PHE B 1 294 ? 10.343  54.312  98.950  1.00 43.01  ? 291 PHE B CD1 1 
ATOM 6017  C CD2 . PHE B 1 294 ? 11.004  52.172  98.154  1.00 32.69  ? 291 PHE B CD2 1 
ATOM 6018  C CE1 . PHE B 1 294 ? 11.009  54.915  97.888  1.00 45.43  ? 291 PHE B CE1 1 
ATOM 6019  C CE2 . PHE B 1 294 ? 11.664  52.772  97.100  1.00 44.20  ? 291 PHE B CE2 1 
ATOM 6020  C CZ  . PHE B 1 294 ? 11.671  54.144  96.973  1.00 33.73  ? 291 PHE B CZ  1 
ATOM 6021  N N   . LYS B 1 295 ? 7.203   50.812  98.833  1.00 40.81  ? 292 LYS B N   1 
ATOM 6022  C CA  . LYS B 1 295 ? 6.502   50.258  97.683  1.00 36.41  ? 292 LYS B CA  1 
ATOM 6023  C C   . LYS B 1 295 ? 5.118   50.873  97.537  1.00 34.75  ? 292 LYS B C   1 
ATOM 6024  O O   . LYS B 1 295 ? 4.685   51.184  96.431  1.00 47.72  ? 292 LYS B O   1 
ATOM 6025  C CB  . LYS B 1 295 ? 6.361   48.748  97.815  1.00 39.19  ? 292 LYS B CB  1 
ATOM 6026  C CG  . LYS B 1 295 ? 7.636   47.956  97.607  1.00 48.59  ? 292 LYS B CG  1 
ATOM 6027  C CD  . LYS B 1 295 ? 7.432   46.491  98.032  1.00 58.73  ? 292 LYS B CD  1 
ATOM 6028  C CE  . LYS B 1 295 ? 8.440   45.572  97.369  1.00 84.28  ? 292 LYS B CE  1 
ATOM 6029  N NZ  . LYS B 1 295 ? 8.271   44.169  97.846  1.00 96.61  ? 292 LYS B NZ  1 
ATOM 6030  N N   . HIS B 1 296 ? 4.437   51.071  98.661  1.00 37.87  ? 293 HIS B N   1 
ATOM 6031  C CA  . HIS B 1 296 ? 3.105   51.676  98.645  1.00 52.07  ? 293 HIS B CA  1 
ATOM 6032  C C   . HIS B 1 296 ? 3.117   53.100  98.104  1.00 44.72  ? 293 HIS B C   1 
ATOM 6033  O O   . HIS B 1 296 ? 2.256   53.465  97.318  1.00 53.04  ? 293 HIS B O   1 
ATOM 6034  C CB  . HIS B 1 296 ? 2.460   51.640  100.028 1.00 38.81  ? 293 HIS B CB  1 
ATOM 6035  C CG  . HIS B 1 296 ? 1.071   52.190  100.056 1.00 49.75  ? 293 HIS B CG  1 
ATOM 6036  N ND1 . HIS B 1 296 ? 0.726   53.301  100.797 1.00 46.11  ? 293 HIS B ND1 1 
ATOM 6037  C CD2 . HIS B 1 296 ? -0.055  51.794  99.419  1.00 46.88  ? 293 HIS B CD2 1 
ATOM 6038  C CE1 . HIS B 1 296 ? -0.562  53.552  100.636 1.00 46.36  ? 293 HIS B CE1 1 
ATOM 6039  N NE2 . HIS B 1 296 ? -1.057  52.654  99.801  1.00 58.07  ? 293 HIS B NE2 1 
ATOM 6040  N N   . LEU B 1 297 ? 4.094   53.898  98.526  1.00 40.93  ? 294 LEU B N   1 
ATOM 6041  C CA  . LEU B 1 297 ? 4.237   55.271  98.039  1.00 45.43  ? 294 LEU B CA  1 
ATOM 6042  C C   . LEU B 1 297 ? 4.526   55.273  96.540  1.00 44.67  ? 294 LEU B C   1 
ATOM 6043  O O   . LEU B 1 297 ? 3.959   56.053  95.781  1.00 42.74  ? 294 LEU B O   1 
ATOM 6044  C CB  . LEU B 1 297 ? 5.347   55.995  98.807  1.00 27.05  ? 294 LEU B CB  1 
ATOM 6045  C CG  . LEU B 1 297 ? 4.993   56.328  100.262 1.00 47.56  ? 294 LEU B CG  1 
ATOM 6046  C CD1 . LEU B 1 297 ? 6.218   56.714  101.021 1.00 28.67  ? 294 LEU B CD1 1 
ATOM 6047  C CD2 . LEU B 1 297 ? 3.935   57.447  100.345 1.00 28.40  ? 294 LEU B CD2 1 
ATOM 6048  N N   . TRP B 1 298 ? 5.401   54.364  96.126  1.00 39.73  ? 295 TRP B N   1 
ATOM 6049  C CA  . TRP B 1 298 ? 5.759   54.183  94.731  1.00 34.32  ? 295 TRP B CA  1 
ATOM 6050  C C   . TRP B 1 298 ? 4.524   53.852  93.892  1.00 38.52  ? 295 TRP B C   1 
ATOM 6051  O O   . TRP B 1 298 ? 4.353   54.381  92.807  1.00 52.46  ? 295 TRP B O   1 
ATOM 6052  C CB  . TRP B 1 298 ? 6.806   53.061  94.639  1.00 35.08  ? 295 TRP B CB  1 
ATOM 6053  C CG  . TRP B 1 298 ? 7.344   52.765  93.270  1.00 42.07  ? 295 TRP B CG  1 
ATOM 6054  C CD1 . TRP B 1 298 ? 6.627   52.464  92.140  1.00 42.07  ? 295 TRP B CD1 1 
ATOM 6055  C CD2 . TRP B 1 298 ? 8.725   52.689  92.898  1.00 50.44  ? 295 TRP B CD2 1 
ATOM 6056  N NE1 . TRP B 1 298 ? 7.478   52.234  91.086  1.00 52.49  ? 295 TRP B NE1 1 
ATOM 6057  C CE2 . TRP B 1 298 ? 8.771   52.361  91.524  1.00 36.58  ? 295 TRP B CE2 1 
ATOM 6058  C CE3 . TRP B 1 298 ? 9.929   52.877  93.591  1.00 44.16  ? 295 TRP B CE3 1 
ATOM 6059  C CZ2 . TRP B 1 298 ? 9.976   52.219  90.828  1.00 46.63  ? 295 TRP B CZ2 1 
ATOM 6060  C CZ3 . TRP B 1 298 ? 11.127  52.736  92.904  1.00 54.11  ? 295 TRP B CZ3 1 
ATOM 6061  C CH2 . TRP B 1 298 ? 11.144  52.409  91.532  1.00 47.12  ? 295 TRP B CH2 1 
ATOM 6062  N N   . LYS B 1 299 ? 3.659   52.978  94.400  1.00 49.14  ? 296 LYS B N   1 
ATOM 6063  C CA  . LYS B 1 299 ? 2.442   52.618  93.675  1.00 59.26  ? 296 LYS B CA  1 
ATOM 6064  C C   . LYS B 1 299 ? 1.452   53.777  93.601  1.00 49.22  ? 296 LYS B C   1 
ATOM 6065  O O   . LYS B 1 299 ? 0.784   53.952  92.584  1.00 41.45  ? 296 LYS B O   1 
ATOM 6066  C CB  . LYS B 1 299 ? 1.777   51.379  94.275  1.00 38.69  ? 296 LYS B CB  1 
ATOM 6067  C CG  . LYS B 1 299 ? 2.573   50.110  94.053  1.00 35.97  ? 296 LYS B CG  1 
ATOM 6068  C CD  . LYS B 1 299 ? 1.919   48.919  94.740  1.00 33.48  ? 296 LYS B CD  1 
ATOM 6069  C CE  . LYS B 1 299 ? 2.503   47.616  94.246  1.00 52.94  ? 296 LYS B CE  1 
ATOM 6070  N NZ  . LYS B 1 299 ? 2.099   46.472  95.085  1.00 73.40  ? 296 LYS B NZ  1 
ATOM 6071  N N   . GLN B 1 300 ? 1.359   54.563  94.672  1.00 39.45  ? 297 GLN B N   1 
ATOM 6072  C CA  . GLN B 1 300 ? 0.455   55.724  94.700  1.00 43.82  ? 297 GLN B CA  1 
ATOM 6073  C C   . GLN B 1 300 ? 0.893   56.749  93.673  1.00 38.14  ? 297 GLN B C   1 
ATOM 6074  O O   . GLN B 1 300 ? 0.064   57.295  92.953  1.00 52.32  ? 297 GLN B O   1 
ATOM 6075  C CB  . GLN B 1 300 ? 0.392   56.382  96.085  1.00 42.40  ? 297 GLN B CB  1 
ATOM 6076  C CG  . GLN B 1 300 ? -0.403  55.601  97.105  1.00 48.92  ? 297 GLN B CG  1 
ATOM 6077  C CD  . GLN B 1 300 ? -0.524  56.307  98.434  1.00 56.22  ? 297 GLN B CD  1 
ATOM 6078  O OE1 . GLN B 1 300 ? 0.468   56.624  99.080  1.00 53.13  ? 297 GLN B OE1 1 
ATOM 6079  N NE2 . GLN B 1 300 ? -1.751  56.550  98.853  1.00 62.83  ? 297 GLN B NE2 1 
ATOM 6080  N N   . VAL B 1 301 ? 2.202   56.998  93.604  1.00 40.23  ? 298 VAL B N   1 
ATOM 6081  C CA  . VAL B 1 301 ? 2.738   57.954  92.650  1.00 42.03  ? 298 VAL B CA  1 
ATOM 6082  C C   . VAL B 1 301 ? 2.438   57.500  91.221  1.00 46.86  ? 298 VAL B C   1 
ATOM 6083  O O   . VAL B 1 301 ? 2.031   58.303  90.388  1.00 47.24  ? 298 VAL B O   1 
ATOM 6084  C CB  . VAL B 1 301 ? 4.250   58.204  92.850  1.00 29.20  ? 298 VAL B CB  1 
ATOM 6085  C CG1 . VAL B 1 301 ? 4.898   58.764  91.549  1.00 22.98  ? 298 VAL B CG1 1 
ATOM 6086  C CG2 . VAL B 1 301 ? 4.471   59.157  94.001  1.00 35.35  ? 298 VAL B CG2 1 
ATOM 6087  N N   . ALA B 1 302 ? 2.615   56.212  90.947  1.00 34.92  ? 299 ALA B N   1 
ATOM 6088  C CA  . ALA B 1 302 ? 2.320   55.666  89.624  1.00 40.78  ? 299 ALA B CA  1 
ATOM 6089  C C   . ALA B 1 302 ? 0.829   55.767  89.277  1.00 50.95  ? 299 ALA B C   1 
ATOM 6090  O O   . ALA B 1 302 ? 0.474   56.162  88.161  1.00 53.98  ? 299 ALA B O   1 
ATOM 6091  C CB  . ALA B 1 302 ? 2.794   54.256  89.518  1.00 29.57  ? 299 ALA B CB  1 
ATOM 6092  N N   . GLN B 1 303 ? -0.042  55.428  90.228  1.00 40.66  ? 300 GLN B N   1 
ATOM 6093  C CA  . GLN B 1 303 ? -1.494  55.516  90.020  1.00 55.09  ? 300 GLN B CA  1 
ATOM 6094  C C   . GLN B 1 303 ? -1.890  56.942  89.621  1.00 49.13  ? 300 GLN B C   1 
ATOM 6095  O O   . GLN B 1 303 ? -2.851  57.148  88.898  1.00 52.34  ? 300 GLN B O   1 
ATOM 6096  C CB  . GLN B 1 303 ? -2.279  55.036  91.259  1.00 37.35  ? 300 GLN B CB  1 
ATOM 6097  N N   . ASN B 1 304 ? -1.117  57.919  90.071  1.00 42.52  ? 301 ASN B N   1 
ATOM 6098  C CA  . ASN B 1 304 ? -1.416  59.314  89.816  1.00 30.99  ? 301 ASN B CA  1 
ATOM 6099  C C   . ASN B 1 304 ? -0.500  60.000  88.816  1.00 27.99  ? 301 ASN B C   1 
ATOM 6100  O O   . ASN B 1 304 ? -0.500  61.220  88.747  1.00 38.93  ? 301 ASN B O   1 
ATOM 6101  C CB  . ASN B 1 304 ? -1.398  60.105  91.136  1.00 42.24  ? 301 ASN B CB  1 
ATOM 6102  C CG  . ASN B 1 304 ? -2.506  59.680  92.077  1.00 67.03  ? 301 ASN B CG  1 
ATOM 6103  O OD1 . ASN B 1 304 ? -3.590  59.303  91.641  1.00 70.78  ? 301 ASN B OD1 1 
ATOM 6104  N ND2 . ASN B 1 304 ? -2.239  59.729  93.372  1.00 73.86  ? 301 ASN B ND2 1 
ATOM 6105  N N   . LEU B 1 305 ? 0.284   59.234  88.060  1.00 47.48  ? 302 LEU B N   1 
ATOM 6106  C CA  . LEU B 1 305 ? 1.278   59.807  87.143  1.00 46.63  ? 302 LEU B CA  1 
ATOM 6107  C C   . LEU B 1 305 ? 0.754   60.941  86.259  1.00 37.76  ? 302 LEU B C   1 
ATOM 6108  O O   . LEU B 1 305 ? 1.474   61.900  85.990  1.00 55.54  ? 302 LEU B O   1 
ATOM 6109  C CB  . LEU B 1 305 ? 1.898   58.730  86.248  1.00 42.09  ? 302 LEU B CB  1 
ATOM 6110  C CG  . LEU B 1 305 ? 3.365   58.370  86.472  1.00 52.04  ? 302 LEU B CG  1 
ATOM 6111  C CD1 . LEU B 1 305 ? 3.921   57.740  85.226  1.00 44.22  ? 302 LEU B CD1 1 
ATOM 6112  C CD2 . LEU B 1 305 ? 4.172   59.572  86.849  1.00 41.57  ? 302 LEU B CD2 1 
ATOM 6113  N N   . ASP B 1 306 ? -0.490  60.825  85.806  1.00 44.13  ? 303 ASP B N   1 
ATOM 6114  C CA  . ASP B 1 306 ? -1.046  61.761  84.835  1.00 39.14  ? 303 ASP B CA  1 
ATOM 6115  C C   . ASP B 1 306 ? -1.171  63.180  85.363  1.00 49.78  ? 303 ASP B C   1 
ATOM 6116  O O   . ASP B 1 306 ? -1.069  64.142  84.600  1.00 46.42  ? 303 ASP B O   1 
ATOM 6117  C CB  . ASP B 1 306 ? -2.401  61.259  84.317  1.00 50.62  ? 303 ASP B CB  1 
ATOM 6118  C CG  . ASP B 1 306 ? -2.286  59.949  83.546  1.00 82.26  ? 303 ASP B CG  1 
ATOM 6119  O OD1 . ASP B 1 306 ? -1.439  59.869  82.629  1.00 65.23  ? 303 ASP B OD1 1 
ATOM 6120  O OD2 . ASP B 1 306 ? -3.030  58.998  83.868  1.00 79.70  ? 303 ASP B OD2 1 
ATOM 6121  N N   . ARG B 1 307 ? -1.387  63.300  86.670  1.00 39.58  ? 304 ARG B N   1 
ATOM 6122  C CA  . ARG B 1 307 ? -1.580  64.600  87.291  1.00 39.14  ? 304 ARG B CA  1 
ATOM 6123  C C   . ARG B 1 307 ? -0.302  65.393  87.558  1.00 36.84  ? 304 ARG B C   1 
ATOM 6124  O O   . ARG B 1 307 ? -0.362  66.606  87.643  1.00 42.76  ? 304 ARG B O   1 
ATOM 6125  C CB  . ARG B 1 307 ? -2.435  64.498  88.564  1.00 39.87  ? 304 ARG B CB  1 
ATOM 6126  C CG  . ARG B 1 307 ? -1.865  63.574  89.612  1.00 75.07  ? 304 ARG B CG  1 
ATOM 6127  C CD  . ARG B 1 307 ? -2.489  63.707  91.000  1.00 74.32  ? 304 ARG B CD  1 
ATOM 6128  N NE  . ARG B 1 307 ? -3.911  63.681  90.906  1.00 85.07  ? 304 ARG B NE  1 
ATOM 6129  C CZ  . ARG B 1 307 ? -4.833  62.913  91.471  1.00 90.24  ? 304 ARG B CZ  1 
ATOM 6130  N NH1 . ARG B 1 307 ? -4.623  61.923  92.329  1.00 114.90 ? 304 ARG B NH1 1 
ATOM 6131  N NH2 . ARG B 1 307 ? -6.058  63.210  91.111  1.00 126.93 ? 304 ARG B NH2 1 
ATOM 6132  N N   . PHE B 1 308 ? 0.850   64.732  87.676  1.00 31.10  ? 305 PHE B N   1 
ATOM 6133  C CA  . PHE B 1 308 ? 2.077   65.449  88.067  1.00 36.27  ? 305 PHE B CA  1 
ATOM 6134  C C   . PHE B 1 308 ? 2.621   66.275  86.916  1.00 42.84  ? 305 PHE B C   1 
ATOM 6135  O O   . PHE B 1 308 ? 2.564   65.846  85.764  1.00 45.53  ? 305 PHE B O   1 
ATOM 6136  C CB  . PHE B 1 308 ? 3.175   64.487  88.575  1.00 25.80  ? 305 PHE B CB  1 
ATOM 6137  C CG  . PHE B 1 308 ? 2.734   63.602  89.705  1.00 45.05  ? 305 PHE B CG  1 
ATOM 6138  C CD1 . PHE B 1 308 ? 2.369   64.140  90.933  1.00 35.24  ? 305 PHE B CD1 1 
ATOM 6139  C CD2 . PHE B 1 308 ? 2.693   62.229  89.543  1.00 26.69  ? 305 PHE B CD2 1 
ATOM 6140  C CE1 . PHE B 1 308 ? 1.967   63.313  91.966  1.00 36.71  ? 305 PHE B CE1 1 
ATOM 6141  C CE2 . PHE B 1 308 ? 2.272   61.410  90.569  1.00 35.21  ? 305 PHE B CE2 1 
ATOM 6142  C CZ  . PHE B 1 308 ? 1.913   61.957  91.776  1.00 29.81  ? 305 PHE B CZ  1 
ATOM 6143  N N   . HIS B 1 309 ? 3.165   67.446  87.230  1.00 33.89  ? 306 HIS B N   1 
ATOM 6144  C CA  . HIS B 1 309 ? 3.764   68.317  86.220  1.00 23.29  ? 306 HIS B CA  1 
ATOM 6145  C C   . HIS B 1 309 ? 5.104   67.825  85.703  1.00 41.66  ? 306 HIS B C   1 
ATOM 6146  O O   . HIS B 1 309 ? 5.509   68.167  84.585  1.00 46.02  ? 306 HIS B O   1 
ATOM 6147  C CB  . HIS B 1 309 ? 3.870   69.770  86.691  1.00 19.23  ? 306 HIS B CB  1 
ATOM 6148  C CG  . HIS B 1 309 ? 2.544   70.411  86.946  1.00 47.57  ? 306 HIS B CG  1 
ATOM 6149  N ND1 . HIS B 1 309 ? 1.508   70.349  86.043  1.00 52.16  ? 306 HIS B ND1 1 
ATOM 6150  C CD2 . HIS B 1 309 ? 2.077   71.103  88.011  1.00 47.44  ? 306 HIS B CD2 1 
ATOM 6151  C CE1 . HIS B 1 309 ? 0.461   70.986  86.537  1.00 46.03  ? 306 HIS B CE1 1 
ATOM 6152  N NE2 . HIS B 1 309 ? 0.780   71.451  87.729  1.00 50.84  ? 306 HIS B NE2 1 
ATOM 6153  N N   . THR B 1 310 ? 5.786   67.035  86.522  1.00 54.30  ? 307 THR B N   1 
ATOM 6154  C CA  . THR B 1 310 ? 6.932   66.272  86.062  1.00 46.76  ? 307 THR B CA  1 
ATOM 6155  C C   . THR B 1 310 ? 6.943   64.914  86.745  1.00 41.36  ? 307 THR B C   1 
ATOM 6156  O O   . THR B 1 310 ? 6.086   64.637  87.587  1.00 44.12  ? 307 THR B O   1 
ATOM 6157  C CB  . THR B 1 310 ? 8.262   67.016  86.284  1.00 72.16  ? 307 THR B CB  1 
ATOM 6158  O OG1 . THR B 1 310 ? 9.334   66.250  85.703  1.00 58.53  ? 307 THR B OG1 1 
ATOM 6159  C CG2 . THR B 1 310 ? 8.523   67.298  87.799  1.00 22.51  ? 307 THR B CG2 1 
ATOM 6160  N N   . PHE B 1 311 ? 7.896   64.064  86.366  1.00 37.83  ? 308 PHE B N   1 
ATOM 6161  C CA  . PHE B 1 311 ? 8.018   62.722  86.934  1.00 41.71  ? 308 PHE B CA  1 
ATOM 6162  C C   . PHE B 1 311 ? 8.725   62.774  88.276  1.00 47.09  ? 308 PHE B C   1 
ATOM 6163  O O   . PHE B 1 311 ? 9.876   63.226  88.360  1.00 31.45  ? 308 PHE B O   1 
ATOM 6164  C CB  . PHE B 1 311 ? 8.764   61.797  85.982  1.00 44.97  ? 308 PHE B CB  1 
ATOM 6165  C CG  . PHE B 1 311 ? 8.087   61.634  84.664  1.00 57.39  ? 308 PHE B CG  1 
ATOM 6166  C CD1 . PHE B 1 311 ? 8.384   62.474  83.615  1.00 37.75  ? 308 PHE B CD1 1 
ATOM 6167  C CD2 . PHE B 1 311 ? 7.133   60.653  84.479  1.00 40.50  ? 308 PHE B CD2 1 
ATOM 6168  C CE1 . PHE B 1 311 ? 7.750   62.329  82.413  1.00 52.33  ? 308 PHE B CE1 1 
ATOM 6169  C CE2 . PHE B 1 311 ? 6.509   60.505  83.290  1.00 47.32  ? 308 PHE B CE2 1 
ATOM 6170  C CZ  . PHE B 1 311 ? 6.807   61.347  82.250  1.00 58.21  ? 308 PHE B CZ  1 
ATOM 6171  N N   . PRO B 1 312 ? 8.021   62.346  89.338  1.00 36.83  ? 309 PRO B N   1 
ATOM 6172  C CA  . PRO B 1 312 ? 8.565   62.407  90.695  1.00 33.47  ? 309 PRO B CA  1 
ATOM 6173  C C   . PRO B 1 312 ? 9.702   61.412  90.882  1.00 38.08  ? 309 PRO B C   1 
ATOM 6174  O O   . PRO B 1 312 ? 9.609   60.263  90.483  1.00 47.88  ? 309 PRO B O   1 
ATOM 6175  C CB  . PRO B 1 312 ? 7.366   62.052  91.564  1.00 36.93  ? 309 PRO B CB  1 
ATOM 6176  C CG  . PRO B 1 312 ? 6.178   62.403  90.703  1.00 34.09  ? 309 PRO B CG  1 
ATOM 6177  C CD  . PRO B 1 312 ? 6.593   62.005  89.344  1.00 33.40  ? 309 PRO B CD  1 
ATOM 6178  N N   . ARG B 1 313 ? 10.791  61.887  91.469  1.00 29.29  ? 310 ARG B N   1 
ATOM 6179  C CA  . ARG B 1 313 ? 11.896  61.042  91.836  1.00 35.97  ? 310 ARG B CA  1 
ATOM 6180  C C   . ARG B 1 313 ? 11.697  60.444  93.234  1.00 44.05  ? 310 ARG B C   1 
ATOM 6181  O O   . ARG B 1 313 ? 11.545  61.177  94.210  1.00 43.95  ? 310 ARG B O   1 
ATOM 6182  C CB  . ARG B 1 313 ? 13.187  61.845  91.773  1.00 38.79  ? 310 ARG B CB  1 
ATOM 6183  C CG  . ARG B 1 313 ? 13.478  62.358  90.374  1.00 38.30  ? 310 ARG B CG  1 
ATOM 6184  C CD  . ARG B 1 313 ? 14.814  63.059  90.271  1.00 31.78  ? 310 ARG B CD  1 
ATOM 6185  N NE  . ARG B 1 313 ? 15.058  63.595  88.944  1.00 47.71  ? 310 ARG B NE  1 
ATOM 6186  C CZ  . ARG B 1 313 ? 16.181  64.212  88.609  1.00 53.90  ? 310 ARG B CZ  1 
ATOM 6187  N NH1 . ARG B 1 313 ? 17.142  64.341  89.519  1.00 31.73  ? 310 ARG B NH1 1 
ATOM 6188  N NH2 . ARG B 1 313 ? 16.347  64.687  87.384  1.00 46.37  ? 310 ARG B NH2 1 
ATOM 6189  N N   . LEU B 1 314 ? 11.684  59.114  93.306  1.00 28.14  ? 311 LEU B N   1 
ATOM 6190  C CA  . LEU B 1 314 ? 11.567  58.382  94.569  1.00 42.17  ? 311 LEU B CA  1 
ATOM 6191  C C   . LEU B 1 314 ? 12.900  57.782  94.985  1.00 34.12  ? 311 LEU B C   1 
ATOM 6192  O O   . LEU B 1 314 ? 13.469  56.989  94.252  1.00 39.07  ? 311 LEU B O   1 
ATOM 6193  C CB  . LEU B 1 314 ? 10.520  57.265  94.461  1.00 26.27  ? 311 LEU B CB  1 
ATOM 6194  C CG  . LEU B 1 314 ? 9.074   57.692  94.729  1.00 53.68  ? 311 LEU B CG  1 
ATOM 6195  C CD1 . LEU B 1 314 ? 8.606   58.776  93.766  1.00 33.42  ? 311 LEU B CD1 1 
ATOM 6196  C CD2 . LEU B 1 314 ? 8.176   56.503  94.634  1.00 42.37  ? 311 LEU B CD2 1 
ATOM 6197  N N   . ALA B 1 315 ? 13.408  58.185  96.145  1.00 31.52  ? 312 ALA B N   1 
ATOM 6198  C CA  . ALA B 1 315 ? 14.604  57.565  96.733  1.00 36.29  ? 312 ALA B CA  1 
ATOM 6199  C C   . ALA B 1 315 ? 14.199  56.860  98.027  1.00 56.47  ? 312 ALA B C   1 
ATOM 6200  O O   . ALA B 1 315 ? 13.493  57.420  98.851  1.00 35.54  ? 312 ALA B O   1 
ATOM 6201  C CB  . ALA B 1 315 ? 15.728  58.617  96.993  1.00 21.98  ? 312 ALA B CB  1 
ATOM 6202  N N   . GLY B 1 316 ? 14.621  55.615  98.183  1.00 47.75  ? 313 GLY B N   1 
ATOM 6203  C CA  . GLY B 1 316 ? 14.225  54.816  99.325  1.00 35.25  ? 313 GLY B CA  1 
ATOM 6204  C C   . GLY B 1 316 ? 15.379  54.040  99.933  1.00 41.98  ? 313 GLY B C   1 
ATOM 6205  O O   . GLY B 1 316 ? 16.051  53.242  99.262  1.00 61.26  ? 313 GLY B O   1 
ATOM 6206  N N   . GLU B 1 317 ? 15.640  54.302  101.208 1.00 48.99  ? 314 GLU B N   1 
ATOM 6207  C CA  . GLU B 1 317 ? 16.563  53.470  101.968 1.00 55.06  ? 314 GLU B CA  1 
ATOM 6208  C C   . GLU B 1 317 ? 15.691  52.623  102.873 1.00 37.39  ? 314 GLU B C   1 
ATOM 6209  O O   . GLU B 1 317 ? 15.010  53.143  103.757 1.00 52.75  ? 314 GLU B O   1 
ATOM 6210  C CB  . GLU B 1 317 ? 17.569  54.319  102.759 1.00 25.94  ? 314 GLU B CB  1 
ATOM 6211  N N   . CYS B 1 318 ? 15.660  51.320  102.621 1.00 55.81  ? 315 CYS B N   1 
ATOM 6212  C CA  . CYS B 1 318 ? 14.848  50.418  103.434 1.00 47.21  ? 315 CYS B CA  1 
ATOM 6213  C C   . CYS B 1 318 ? 15.722  49.530  104.333 1.00 75.29  ? 315 CYS B C   1 
ATOM 6214  O O   . CYS B 1 318 ? 16.891  49.850  104.568 1.00 57.16  ? 315 CYS B O   1 
ATOM 6215  C CB  . CYS B 1 318 ? 13.903  49.624  102.548 1.00 52.01  ? 315 CYS B CB  1 
ATOM 6216  S SG  . CYS B 1 318 ? 12.941  50.740  101.453 1.00 58.44  ? 315 CYS B SG  1 
ATOM 6217  N N   . GLY B 1 319 ? 15.169  48.443  104.862 1.00 44.35  ? 316 GLY B N   1 
ATOM 6218  C CA  . GLY B 1 319 ? 15.940  47.612  105.772 1.00 55.78  ? 316 GLY B CA  1 
ATOM 6219  C C   . GLY B 1 319 ? 16.944  46.632  105.168 1.00 65.47  ? 316 GLY B C   1 
ATOM 6220  O O   . GLY B 1 319 ? 17.173  46.589  103.962 1.00 54.97  ? 316 GLY B O   1 
ATOM 6221  N N   . GLY B 1 320 ? 17.556  45.839  106.035 1.00 54.49  ? 317 GLY B N   1 
ATOM 6222  C CA  . GLY B 1 320 ? 18.363  44.709  105.618 1.00 54.69  ? 317 GLY B CA  1 
ATOM 6223  C C   . GLY B 1 320 ? 18.187  43.498  106.533 1.00 60.66  ? 317 GLY B C   1 
ATOM 6224  O O   . GLY B 1 320 ? 17.616  43.606  107.623 1.00 62.56  ? 317 GLY B O   1 
ATOM 6225  N N   . LYS B 1 321 ? 18.636  42.337  106.061 1.00 51.03  ? 318 LYS B N   1 
ATOM 6226  C CA  . LYS B 1 321 ? 18.886  41.176  106.907 1.00 49.88  ? 318 LYS B CA  1 
ATOM 6227  C C   . LYS B 1 321 ? 20.379  40.829  106.777 1.00 55.87  ? 318 LYS B C   1 
ATOM 6228  O O   . LYS B 1 321 ? 20.788  39.979  105.972 1.00 60.22  ? 318 LYS B O   1 
ATOM 6229  C CB  . LYS B 1 321 ? 17.994  39.987  106.514 1.00 63.62  ? 318 LYS B CB  1 
ATOM 6230  C CG  . LYS B 1 321 ? 18.011  38.825  107.514 1.00 48.90  ? 318 LYS B CG  1 
ATOM 6231  C CD  . LYS B 1 321 ? 17.296  39.179  108.804 1.00 54.77  ? 318 LYS B CD  1 
ATOM 6232  C CE  . LYS B 1 321 ? 17.417  38.084  109.873 1.00 48.18  ? 318 LYS B CE  1 
ATOM 6233  N NZ  . LYS B 1 321 ? 16.795  38.583  111.139 1.00 58.16  ? 318 LYS B NZ  1 
ATOM 6234  N N   . ASN B 1 322 ? 21.190  41.510  107.571 1.00 42.09  ? 319 ASN B N   1 
ATOM 6235  C CA  . ASN B 1 322 ? 22.623  41.554  107.342 1.00 37.22  ? 319 ASN B CA  1 
ATOM 6236  C C   . ASN B 1 322 ? 23.416  40.447  108.028 1.00 67.99  ? 319 ASN B C   1 
ATOM 6237  O O   . ASN B 1 322 ? 23.034  39.925  109.074 1.00 56.08  ? 319 ASN B O   1 
ATOM 6238  C CB  . ASN B 1 322 ? 23.134  42.928  107.741 1.00 36.05  ? 319 ASN B CB  1 
ATOM 6239  C CG  . ASN B 1 322 ? 22.224  44.017  107.258 1.00 57.78  ? 319 ASN B CG  1 
ATOM 6240  O OD1 . ASN B 1 322 ? 22.072  44.219  106.046 1.00 46.37  ? 319 ASN B OD1 1 
ATOM 6241  N ND2 . ASN B 1 322 ? 21.566  44.700  108.193 1.00 39.00  ? 319 ASN B ND2 1 
ATOM 6242  N N   . PHE B 1 323 ? 24.541  40.104  107.422 1.00 42.83  ? 320 PHE B N   1 
ATOM 6243  C CA  . PHE B 1 323 ? 25.300  38.936  107.826 1.00 55.29  ? 320 PHE B CA  1 
ATOM 6244  C C   . PHE B 1 323 ? 26.724  39.239  108.313 1.00 55.79  ? 320 PHE B C   1 
ATOM 6245  O O   . PHE B 1 323 ? 27.333  40.210  107.887 1.00 60.42  ? 320 PHE B O   1 
ATOM 6246  C CB  . PHE B 1 323 ? 25.355  37.956  106.654 1.00 41.14  ? 320 PHE B CB  1 
ATOM 6247  C CG  . PHE B 1 323 ? 26.092  38.488  105.441 1.00 50.28  ? 320 PHE B CG  1 
ATOM 6248  C CD1 . PHE B 1 323 ? 27.465  38.406  105.352 1.00 50.60  ? 320 PHE B CD1 1 
ATOM 6249  C CD2 . PHE B 1 323 ? 25.407  39.055  104.383 1.00 57.42  ? 320 PHE B CD2 1 
ATOM 6250  C CE1 . PHE B 1 323 ? 28.139  38.888  104.237 1.00 46.16  ? 320 PHE B CE1 1 
ATOM 6251  C CE2 . PHE B 1 323 ? 26.080  39.537  103.276 1.00 44.31  ? 320 PHE B CE2 1 
ATOM 6252  C CZ  . PHE B 1 323 ? 27.446  39.445  103.209 1.00 54.91  ? 320 PHE B CZ  1 
ATOM 6253  N N   . HIS B 1 324 ? 27.217  38.425  109.247 1.00 75.64  ? 321 HIS B N   1 
ATOM 6254  C CA  . HIS B 1 324 ? 28.662  38.249  109.468 1.00 69.26  ? 321 HIS B CA  1 
ATOM 6255  C C   . HIS B 1 324 ? 29.023  36.815  109.104 1.00 53.75  ? 321 HIS B C   1 
ATOM 6256  O O   . HIS B 1 324 ? 28.592  35.868  109.765 1.00 57.90  ? 321 HIS B O   1 
ATOM 6257  C CB  . HIS B 1 324 ? 29.081  38.500  110.918 1.00 48.00  ? 321 HIS B CB  1 
ATOM 6258  C CG  . HIS B 1 324 ? 29.152  39.944  111.293 1.00 56.83  ? 321 HIS B CG  1 
ATOM 6259  N ND1 . HIS B 1 324 ? 29.761  40.378  112.449 1.00 58.91  ? 321 HIS B ND1 1 
ATOM 6260  C CD2 . HIS B 1 324 ? 28.676  41.053  110.684 1.00 58.85  ? 321 HIS B CD2 1 
ATOM 6261  C CE1 . HIS B 1 324 ? 29.675  41.692  112.528 1.00 65.87  ? 321 HIS B CE1 1 
ATOM 6262  N NE2 . HIS B 1 324 ? 29.020  42.127  111.469 1.00 69.75  ? 321 HIS B NE2 1 
ATOM 6263  N N   . PHE B 1 325 ? 29.803  36.657  108.050 1.00 45.07  ? 322 PHE B N   1 
ATOM 6264  C CA  . PHE B 1 325 ? 30.247  35.337  107.625 1.00 60.00  ? 322 PHE B CA  1 
ATOM 6265  C C   . PHE B 1 325 ? 31.664  35.092  108.116 1.00 57.11  ? 322 PHE B C   1 
ATOM 6266  O O   . PHE B 1 325 ? 32.564  35.888  107.835 1.00 52.80  ? 322 PHE B O   1 
ATOM 6267  C CB  . PHE B 1 325 ? 30.202  35.194  106.090 1.00 46.24  ? 322 PHE B CB  1 
ATOM 6268  C CG  . PHE B 1 325 ? 30.723  33.882  105.606 1.00 57.86  ? 322 PHE B CG  1 
ATOM 6269  C CD1 . PHE B 1 325 ? 29.863  32.820  105.393 1.00 59.92  ? 322 PHE B CD1 1 
ATOM 6270  C CD2 . PHE B 1 325 ? 32.087  33.685  105.415 1.00 66.40  ? 322 PHE B CD2 1 
ATOM 6271  C CE1 . PHE B 1 325 ? 30.352  31.578  104.974 1.00 69.40  ? 322 PHE B CE1 1 
ATOM 6272  C CE2 . PHE B 1 325 ? 32.582  32.447  104.985 1.00 66.85  ? 322 PHE B CE2 1 
ATOM 6273  C CZ  . PHE B 1 325 ? 31.709  31.395  104.763 1.00 68.74  ? 322 PHE B CZ  1 
ATOM 6274  N N   . VAL B 1 326 ? 31.863  33.975  108.818 1.00 73.12  ? 323 VAL B N   1 
ATOM 6275  C CA  . VAL B 1 326 ? 33.174  33.617  109.376 1.00 60.07  ? 323 VAL B CA  1 
ATOM 6276  C C   . VAL B 1 326 ? 33.844  32.411  108.691 1.00 67.79  ? 323 VAL B C   1 
ATOM 6277  O O   . VAL B 1 326 ? 33.252  31.342  108.548 1.00 54.24  ? 323 VAL B O   1 
ATOM 6278  C CB  . VAL B 1 326 ? 33.075  33.362  110.884 1.00 53.33  ? 323 VAL B CB  1 
ATOM 6279  C CG1 . VAL B 1 326 ? 34.464  33.215  111.495 1.00 50.24  ? 323 VAL B CG1 1 
ATOM 6280  C CG2 . VAL B 1 326 ? 32.331  34.501  111.548 1.00 59.85  ? 323 VAL B CG2 1 
ATOM 6281  N N   . HIS B 1 327 ? 35.085  32.592  108.261 1.00 67.05  ? 324 HIS B N   1 
ATOM 6282  C CA  . HIS B 1 327 ? 35.865  31.497  107.702 1.00 74.78  ? 324 HIS B CA  1 
ATOM 6283  C C   . HIS B 1 327 ? 36.733  30.918  108.819 1.00 87.43  ? 324 HIS B C   1 
ATOM 6284  O O   . HIS B 1 327 ? 36.975  31.599  109.820 1.00 83.87  ? 324 HIS B O   1 
ATOM 6285  C CB  . HIS B 1 327 ? 36.731  32.019  106.560 1.00 63.84  ? 324 HIS B CB  1 
ATOM 6286  C CG  . HIS B 1 327 ? 37.658  30.996  105.987 1.00 81.34  ? 324 HIS B CG  1 
ATOM 6287  N ND1 . HIS B 1 327 ? 38.993  30.923  106.329 1.00 73.23  ? 324 HIS B ND1 1 
ATOM 6288  C CD2 . HIS B 1 327 ? 37.444  30.008  105.089 1.00 63.10  ? 324 HIS B CD2 1 
ATOM 6289  C CE1 . HIS B 1 327 ? 39.557  29.930  105.667 1.00 71.87  ? 324 HIS B CE1 1 
ATOM 6290  N NE2 . HIS B 1 327 ? 38.640  29.361  104.906 1.00 72.63  ? 324 HIS B NE2 1 
ATOM 6291  N N   . ARG B 1 328 ? 37.202  29.678  108.665 1.00 74.58  ? 325 ARG B N   1 
ATOM 6292  C CA  . ARG B 1 328 ? 37.949  29.017  109.752 1.00 81.87  ? 325 ARG B CA  1 
ATOM 6293  C C   . ARG B 1 328 ? 39.229  29.759  110.178 1.00 78.64  ? 325 ARG B C   1 
ATOM 6294  O O   . ARG B 1 328 ? 39.724  29.580  111.289 1.00 50.47  ? 325 ARG B O   1 
ATOM 6295  C CB  . ARG B 1 328 ? 38.234  27.547  109.424 1.00 70.27  ? 325 ARG B CB  1 
ATOM 6296  C CG  . ARG B 1 328 ? 39.257  27.311  108.342 1.00 75.59  ? 325 ARG B CG  1 
ATOM 6297  C CD  . ARG B 1 328 ? 39.288  25.850  107.939 1.00 59.39  ? 325 ARG B CD  1 
ATOM 6298  N NE  . ARG B 1 328 ? 39.992  25.019  108.904 1.00 102.07 ? 325 ARG B NE  1 
ATOM 6299  C CZ  . ARG B 1 328 ? 39.626  23.781  109.211 1.00 88.88  ? 325 ARG B CZ  1 
ATOM 6300  N NH1 . ARG B 1 328 ? 38.566  23.248  108.630 1.00 89.06  ? 325 ARG B NH1 1 
ATOM 6301  N NH2 . ARG B 1 328 ? 40.315  23.076  110.094 1.00 91.89  ? 325 ARG B NH2 1 
ATOM 6302  N N   . SER B 1 329 ? 39.724  30.625  109.301 1.00 72.75  ? 326 SER B N   1 
ATOM 6303  C CA  . SER B 1 329 ? 40.943  31.393  109.544 1.00 59.50  ? 326 SER B CA  1 
ATOM 6304  C C   . SER B 1 329 ? 40.753  32.692  110.330 1.00 73.57  ? 326 SER B C   1 
ATOM 6305  O O   . SER B 1 329 ? 41.727  33.377  110.638 1.00 69.53  ? 326 SER B O   1 
ATOM 6306  C CB  . SER B 1 329 ? 41.608  31.730  108.213 1.00 63.34  ? 326 SER B CB  1 
ATOM 6307  O OG  . SER B 1 329 ? 40.763  32.554  107.433 1.00 83.02  ? 326 SER B OG  1 
ATOM 6308  N N   . ALA B 1 330 ? 39.508  33.033  110.643 1.00 56.59  ? 327 ALA B N   1 
ATOM 6309  C CA  . ALA B 1 330 ? 39.204  34.306  111.292 1.00 75.88  ? 327 ALA B CA  1 
ATOM 6310  C C   . ALA B 1 330 ? 39.905  34.491  112.639 1.00 81.35  ? 327 ALA B C   1 
ATOM 6311  O O   . ALA B 1 330 ? 40.139  33.520  113.359 1.00 86.29  ? 327 ALA B O   1 
ATOM 6312  C CB  . ALA B 1 330 ? 37.701  34.454  111.464 1.00 65.16  ? 327 ALA B CB  1 
ATOM 6313  N N   . ASP B 1 331 ? 40.241  35.740  112.965 1.00 67.10  ? 328 ASP B N   1 
ATOM 6314  C CA  . ASP B 1 331 ? 40.592  36.125  114.335 1.00 57.31  ? 328 ASP B CA  1 
ATOM 6315  C C   . ASP B 1 331 ? 39.335  36.073  115.210 1.00 88.85  ? 328 ASP B C   1 
ATOM 6316  O O   . ASP B 1 331 ? 38.424  36.900  115.054 1.00 83.77  ? 328 ASP B O   1 
ATOM 6317  C CB  . ASP B 1 331 ? 41.224  37.526  114.369 1.00 72.88  ? 328 ASP B CB  1 
ATOM 6318  C CG  . ASP B 1 331 ? 41.299  38.123  115.786 1.00 97.70  ? 328 ASP B CG  1 
ATOM 6319  O OD1 . ASP B 1 331 ? 40.482  37.775  116.656 1.00 126.74 ? 328 ASP B OD1 1 
ATOM 6320  O OD2 . ASP B 1 331 ? 42.179  38.968  116.033 1.00 97.46  ? 328 ASP B OD2 1 
ATOM 6321  N N   . VAL B 1 332 ? 39.293  35.107  116.130 1.00 62.55  ? 329 VAL B N   1 
ATOM 6322  C CA  . VAL B 1 332 ? 38.097  34.861  116.946 1.00 65.56  ? 329 VAL B CA  1 
ATOM 6323  C C   . VAL B 1 332 ? 37.661  36.046  117.824 1.00 87.84  ? 329 VAL B C   1 
ATOM 6324  O O   . VAL B 1 332 ? 36.462  36.299  117.982 1.00 84.14  ? 329 VAL B O   1 
ATOM 6325  C CB  . VAL B 1 332 ? 38.253  33.591  117.804 1.00 77.27  ? 329 VAL B CB  1 
ATOM 6326  C CG1 . VAL B 1 332 ? 37.148  33.508  118.852 1.00 67.54  ? 329 VAL B CG1 1 
ATOM 6327  C CG2 . VAL B 1 332 ? 38.256  32.358  116.906 1.00 69.54  ? 329 VAL B CG2 1 
ATOM 6328  N N   . GLU B 1 333 ? 38.624  36.773  118.385 1.00 75.34  ? 330 GLU B N   1 
ATOM 6329  C CA  . GLU B 1 333 ? 38.306  37.929  119.218 1.00 65.12  ? 330 GLU B CA  1 
ATOM 6330  C C   . GLU B 1 333 ? 37.630  39.068  118.459 1.00 72.78  ? 330 GLU B C   1 
ATOM 6331  O O   . GLU B 1 333 ? 36.690  39.681  118.969 1.00 79.09  ? 330 GLU B O   1 
ATOM 6332  C CB  . GLU B 1 333 ? 39.557  38.423  119.939 1.00 62.54  ? 330 GLU B CB  1 
ATOM 6333  C CG  . GLU B 1 333 ? 39.995  37.471  121.040 1.00 75.95  ? 330 GLU B CG  1 
ATOM 6334  C CD  . GLU B 1 333 ? 38.878  37.169  122.028 1.00 89.41  ? 330 GLU B CD  1 
ATOM 6335  O OE1 . GLU B 1 333 ? 38.136  38.115  122.389 1.00 84.11  ? 330 GLU B OE1 1 
ATOM 6336  O OE2 . GLU B 1 333 ? 38.738  35.987  122.430 1.00 79.02  ? 330 GLU B OE2 1 
ATOM 6337  N N   . SER B 1 334 ? 38.112  39.344  117.247 1.00 78.77  ? 331 SER B N   1 
ATOM 6338  C CA  . SER B 1 334 ? 37.501  40.348  116.376 1.00 60.16  ? 331 SER B CA  1 
ATOM 6339  C C   . SER B 1 334 ? 36.088  39.920  115.992 1.00 64.84  ? 331 SER B C   1 
ATOM 6340  O O   . SER B 1 334 ? 35.149  40.702  116.101 1.00 69.02  ? 331 SER B O   1 
ATOM 6341  C CB  . SER B 1 334 ? 38.361  40.597  115.139 1.00 67.66  ? 331 SER B CB  1 
ATOM 6342  O OG  . SER B 1 334 ? 39.604  41.198  115.485 1.00 64.06  ? 331 SER B OG  1 
ATOM 6343  N N   . VAL B 1 335 ? 35.927  38.668  115.583 1.00 55.95  ? 332 VAL B N   1 
ATOM 6344  C CA  . VAL B 1 335 ? 34.589  38.137  115.325 1.00 62.11  ? 332 VAL B CA  1 
ATOM 6345  C C   . VAL B 1 335 ? 33.668  38.348  116.517 1.00 63.42  ? 332 VAL B C   1 
ATOM 6346  O O   . VAL B 1 335 ? 32.527  38.786  116.367 1.00 58.31  ? 332 VAL B O   1 
ATOM 6347  C CB  . VAL B 1 335 ? 34.599  36.634  115.024 1.00 60.67  ? 332 VAL B CB  1 
ATOM 6348  C CG1 . VAL B 1 335 ? 33.172  36.104  114.952 1.00 43.40  ? 332 VAL B CG1 1 
ATOM 6349  C CG2 . VAL B 1 335 ? 35.361  36.344  113.750 1.00 56.78  ? 332 VAL B CG2 1 
ATOM 6350  N N   . VAL B 1 336 ? 34.163  38.038  117.707 1.00 58.96  ? 333 VAL B N   1 
ATOM 6351  C CA  . VAL B 1 336 ? 33.326  38.160  118.892 1.00 63.06  ? 333 VAL B CA  1 
ATOM 6352  C C   . VAL B 1 336 ? 32.912  39.602  119.210 1.00 52.71  ? 333 VAL B C   1 
ATOM 6353  O O   . VAL B 1 336 ? 31.728  39.880  119.364 1.00 62.09  ? 333 VAL B O   1 
ATOM 6354  C CB  . VAL B 1 336 ? 33.954  37.466  120.127 1.00 74.72  ? 333 VAL B CB  1 
ATOM 6355  C CG1 . VAL B 1 336 ? 33.223  37.866  121.411 1.00 60.30  ? 333 VAL B CG1 1 
ATOM 6356  C CG2 . VAL B 1 336 ? 33.919  35.958  119.940 1.00 51.87  ? 333 VAL B CG2 1 
ATOM 6357  N N   . SER B 1 337 ? 33.874  40.517  119.298 1.00 51.98  ? 334 SER B N   1 
ATOM 6358  C CA  . SER B 1 337 ? 33.540  41.872  119.703 1.00 74.49  ? 334 SER B CA  1 
ATOM 6359  C C   . SER B 1 337 ? 32.819  42.603  118.566 1.00 80.45  ? 334 SER B C   1 
ATOM 6360  O O   . SER B 1 337 ? 31.896  43.397  118.789 1.00 74.48  ? 334 SER B O   1 
ATOM 6361  C CB  . SER B 1 337 ? 34.786  42.627  120.154 1.00 53.79  ? 334 SER B CB  1 
ATOM 6362  O OG  . SER B 1 337 ? 35.689  42.777  119.092 1.00 84.50  ? 334 SER B OG  1 
ATOM 6363  N N   . GLY B 1 338 ? 33.228  42.307  117.343 1.00 65.50  ? 335 GLY B N   1 
ATOM 6364  C CA  . GLY B 1 338 ? 32.600  42.895  116.185 1.00 62.63  ? 335 GLY B CA  1 
ATOM 6365  C C   . GLY B 1 338 ? 31.145  42.491  116.069 1.00 75.10  ? 335 GLY B C   1 
ATOM 6366  O O   . GLY B 1 338 ? 30.296  43.333  115.757 1.00 49.13  ? 335 GLY B O   1 
ATOM 6367  N N   . THR B 1 339 ? 30.856  41.211  116.311 1.00 56.25  ? 336 THR B N   1 
ATOM 6368  C CA  . THR B 1 339 ? 29.484  40.699  116.196 1.00 52.43  ? 336 THR B CA  1 
ATOM 6369  C C   . THR B 1 339 ? 28.596  41.197  117.321 1.00 64.37  ? 336 THR B C   1 
ATOM 6370  O O   . THR B 1 339 ? 27.409  41.466  117.111 1.00 59.75  ? 336 THR B O   1 
ATOM 6371  C CB  . THR B 1 339 ? 29.443  39.164  116.151 1.00 50.28  ? 336 THR B CB  1 
ATOM 6372  O OG1 . THR B 1 339 ? 30.281  38.700  115.092 1.00 52.61  ? 336 THR B OG1 1 
ATOM 6373  C CG2 . THR B 1 339 ? 28.034  38.658  115.905 1.00 46.16  ? 336 THR B CG2 1 
ATOM 6374  N N   . LEU B 1 340 ? 29.172  41.319  118.516 1.00 54.10  ? 337 LEU B N   1 
ATOM 6375  C CA  . LEU B 1 340 ? 28.402  41.793  119.659 1.00 59.89  ? 337 LEU B CA  1 
ATOM 6376  C C   . LEU B 1 340 ? 27.984  43.222  119.421 1.00 52.51  ? 337 LEU B C   1 
ATOM 6377  O O   . LEU B 1 340 ? 26.820  43.571  119.640 1.00 58.78  ? 337 LEU B O   1 
ATOM 6378  C CB  . LEU B 1 340 ? 29.175  41.655  120.981 1.00 61.69  ? 337 LEU B CB  1 
ATOM 6379  C CG  . LEU B 1 340 ? 29.147  40.238  121.556 1.00 55.89  ? 337 LEU B CG  1 
ATOM 6380  C CD1 . LEU B 1 340 ? 30.357  39.908  122.404 1.00 84.41  ? 337 LEU B CD1 1 
ATOM 6381  C CD2 . LEU B 1 340 ? 27.851  39.901  122.256 1.00 70.53  ? 337 LEU B CD2 1 
ATOM 6382  N N   . ARG B 1 341 ? 28.933  44.042  118.965 1.00 51.98  ? 338 ARG B N   1 
ATOM 6383  C CA  . ARG B 1 341 ? 28.648  45.439  118.659 1.00 66.80  ? 338 ARG B CA  1 
ATOM 6384  C C   . ARG B 1 341 ? 27.586  45.587  117.556 1.00 59.95  ? 338 ARG B C   1 
ATOM 6385  O O   . ARG B 1 341 ? 26.611  46.326  117.700 1.00 57.02  ? 338 ARG B O   1 
ATOM 6386  C CB  . ARG B 1 341 ? 29.931  46.183  118.289 1.00 44.13  ? 338 ARG B CB  1 
ATOM 6387  C CG  . ARG B 1 341 ? 30.665  46.760  119.478 1.00 66.45  ? 338 ARG B CG  1 
ATOM 6388  C CD  . ARG B 1 341 ? 31.849  47.594  119.049 1.00 44.04  ? 338 ARG B CD  1 
ATOM 6389  N NE  . ARG B 1 341 ? 32.486  48.278  120.167 1.00 60.92  ? 338 ARG B NE  1 
ATOM 6390  C CZ  . ARG B 1 341 ? 33.498  49.128  120.041 1.00 74.70  ? 338 ARG B CZ  1 
ATOM 6391  N NH1 . ARG B 1 341 ? 33.980  49.408  118.843 1.00 54.82  ? 338 ARG B NH1 1 
ATOM 6392  N NH2 . ARG B 1 341 ? 34.026  49.697  121.114 1.00 66.68  ? 338 ARG B NH2 1 
ATOM 6393  N N   . SER B 1 342 ? 27.755  44.842  116.477 1.00 55.80  ? 339 SER B N   1 
ATOM 6394  C CA  . SER B 1 342 ? 26.879  44.980  115.331 1.00 59.83  ? 339 SER B CA  1 
ATOM 6395  C C   . SER B 1 342 ? 25.464  44.520  115.656 1.00 53.65  ? 339 SER B C   1 
ATOM 6396  O O   . SER B 1 342 ? 24.493  45.201  115.330 1.00 70.15  ? 339 SER B O   1 
ATOM 6397  C CB  . SER B 1 342 ? 27.447  44.221  114.132 1.00 51.31  ? 339 SER B CB  1 
ATOM 6398  O OG  . SER B 1 342 ? 26.517  44.212  113.064 1.00 65.83  ? 339 SER B OG  1 
ATOM 6399  N N   . ALA B 1 343 ? 25.351  43.377  116.317 1.00 46.16  ? 340 ALA B N   1 
ATOM 6400  C CA  . ALA B 1 343 ? 24.042  42.800  116.641 1.00 65.86  ? 340 ALA B CA  1 
ATOM 6401  C C   . ALA B 1 343 ? 23.249  43.551  117.707 1.00 53.28  ? 340 ALA B C   1 
ATOM 6402  O O   . ALA B 1 343 ? 22.016  43.605  117.652 1.00 58.09  ? 340 ALA B O   1 
ATOM 6403  C CB  . ALA B 1 343 ? 24.188  41.346  117.052 1.00 51.79  ? 340 ALA B CB  1 
ATOM 6404  N N   . PHE B 1 344 ? 23.951  44.158  118.648 1.00 33.78  ? 341 PHE B N   1 
ATOM 6405  C CA  . PHE B 1 344 ? 23.305  44.590  119.883 1.00 51.85  ? 341 PHE B CA  1 
ATOM 6406  C C   . PHE B 1 344 ? 23.435  46.065  120.214 1.00 55.61  ? 341 PHE B C   1 
ATOM 6407  O O   . PHE B 1 344 ? 22.688  46.552  121.047 1.00 45.87  ? 341 PHE B O   1 
ATOM 6408  C CB  . PHE B 1 344 ? 23.790  43.755  121.079 1.00 48.75  ? 341 PHE B CB  1 
ATOM 6409  C CG  . PHE B 1 344 ? 23.497  42.288  120.953 1.00 60.56  ? 341 PHE B CG  1 
ATOM 6410  C CD1 . PHE B 1 344 ? 22.247  41.854  120.551 1.00 63.43  ? 341 PHE B CD1 1 
ATOM 6411  C CD2 . PHE B 1 344 ? 24.470  41.342  121.235 1.00 60.40  ? 341 PHE B CD2 1 
ATOM 6412  C CE1 . PHE B 1 344 ? 21.971  40.506  120.427 1.00 73.25  ? 341 PHE B CE1 1 
ATOM 6413  C CE2 . PHE B 1 344 ? 24.202  39.987  121.108 1.00 53.79  ? 341 PHE B CE2 1 
ATOM 6414  C CZ  . PHE B 1 344 ? 22.954  39.569  120.700 1.00 57.97  ? 341 PHE B CZ  1 
ATOM 6415  N N   . GLU B 1 345 ? 24.364  46.787  119.589 1.00 47.45  ? 342 GLU B N   1 
ATOM 6416  C CA  . GLU B 1 345 ? 24.423  48.225  119.837 1.00 50.37  ? 342 GLU B CA  1 
ATOM 6417  C C   . GLU B 1 345 ? 23.099  48.877  119.456 1.00 57.60  ? 342 GLU B C   1 
ATOM 6418  O O   . GLU B 1 345 ? 22.455  48.473  118.474 1.00 46.46  ? 342 GLU B O   1 
ATOM 6419  C CB  . GLU B 1 345 ? 25.568  48.871  119.084 1.00 52.55  ? 342 GLU B CB  1 
ATOM 6420  C CG  . GLU B 1 345 ? 26.905  48.568  119.684 1.00 70.98  ? 342 GLU B CG  1 
ATOM 6421  C CD  . GLU B 1 345 ? 27.975  49.519  119.211 1.00 85.88  ? 342 GLU B CD  1 
ATOM 6422  O OE1 . GLU B 1 345 ? 28.262  49.519  117.987 1.00 100.71 ? 342 GLU B OE1 1 
ATOM 6423  O OE2 . GLU B 1 345 ? 28.513  50.266  120.066 1.00 81.00  ? 342 GLU B OE2 1 
ATOM 6424  N N   . TYR B 1 346 ? 22.682  49.856  120.257 1.00 54.26  ? 343 TYR B N   1 
ATOM 6425  C CA  . TYR B 1 346 ? 21.362  50.487  120.112 1.00 44.53  ? 343 TYR B CA  1 
ATOM 6426  C C   . TYR B 1 346 ? 20.239  49.474  119.931 1.00 43.20  ? 343 TYR B C   1 
ATOM 6427  O O   . TYR B 1 346 ? 19.266  49.721  119.214 1.00 57.98  ? 343 TYR B O   1 
ATOM 6428  C CB  . TYR B 1 346 ? 21.358  51.494  118.946 1.00 56.17  ? 343 TYR B CB  1 
ATOM 6429  C CG  . TYR B 1 346 ? 20.073  52.278  118.847 1.00 65.26  ? 343 TYR B CG  1 
ATOM 6430  C CD1 . TYR B 1 346 ? 19.433  52.712  120.004 1.00 34.24  ? 343 TYR B CD1 1 
ATOM 6431  C CD2 . TYR B 1 346 ? 19.492  52.586  117.604 1.00 38.82  ? 343 TYR B CD2 1 
ATOM 6432  C CE1 . TYR B 1 346 ? 18.252  53.426  119.949 1.00 55.52  ? 343 TYR B CE1 1 
ATOM 6433  C CE2 . TYR B 1 346 ? 18.303  53.299  117.537 1.00 34.42  ? 343 TYR B CE2 1 
ATOM 6434  C CZ  . TYR B 1 346 ? 17.692  53.719  118.715 1.00 69.94  ? 343 TYR B CZ  1 
ATOM 6435  O OH  . TYR B 1 346 ? 16.521  54.436  118.678 1.00 52.47  ? 343 TYR B OH  1 
ATOM 6436  N N   . GLY B 1 347 ? 20.379  48.323  120.573 1.00 44.97  ? 344 GLY B N   1 
ATOM 6437  C CA  . GLY B 1 347 ? 19.322  47.332  120.564 1.00 51.88  ? 344 GLY B CA  1 
ATOM 6438  C C   . GLY B 1 347 ? 19.107  46.626  119.246 1.00 57.82  ? 344 GLY B C   1 
ATOM 6439  O O   . GLY B 1 347 ? 18.044  46.047  119.050 1.00 59.15  ? 344 GLY B O   1 
ATOM 6440  N N   . GLY B 1 348 ? 20.111  46.661  118.365 1.00 54.17  ? 345 GLY B N   1 
ATOM 6441  C CA  . GLY B 1 348 ? 20.023  46.019  117.073 1.00 49.51  ? 345 GLY B CA  1 
ATOM 6442  C C   . GLY B 1 348 ? 19.028  46.705  116.154 1.00 60.39  ? 345 GLY B C   1 
ATOM 6443  O O   . GLY B 1 348 ? 18.580  46.110  115.178 1.00 55.95  ? 345 GLY B O   1 
ATOM 6444  N N   . GLN B 1 349 ? 18.697  47.955  116.475 1.00 41.35  ? 346 GLN B N   1 
ATOM 6445  C CA  . GLN B 1 349 ? 17.749  48.767  115.704 1.00 62.33  ? 346 GLN B CA  1 
ATOM 6446  C C   . GLN B 1 349 ? 18.428  49.619  114.645 1.00 49.77  ? 346 GLN B C   1 
ATOM 6447  O O   . GLN B 1 349 ? 18.262  50.822  114.603 1.00 57.68  ? 346 GLN B O   1 
ATOM 6448  C CB  . GLN B 1 349 ? 16.968  49.678  116.638 1.00 46.52  ? 346 GLN B CB  1 
ATOM 6449  C CG  . GLN B 1 349 ? 16.346  48.914  117.810 1.00 54.91  ? 346 GLN B CG  1 
ATOM 6450  C CD  . GLN B 1 349 ? 15.356  49.748  118.570 1.00 66.84  ? 346 GLN B CD  1 
ATOM 6451  O OE1 . GLN B 1 349 ? 14.137  49.641  118.359 1.00 63.86  ? 346 GLN B OE1 1 
ATOM 6452  N NE2 . GLN B 1 349 ? 15.868  50.607  119.448 1.00 43.73  ? 346 GLN B NE2 1 
ATOM 6453  N N   . LYS B 1 350 ? 19.212  48.980  113.801 1.00 56.88  ? 347 LYS B N   1 
ATOM 6454  C CA  . LYS B 1 350 ? 19.882  49.668  112.719 1.00 50.12  ? 347 LYS B CA  1 
ATOM 6455  C C   . LYS B 1 350 ? 19.634  48.846  111.469 1.00 70.39  ? 347 LYS B C   1 
ATOM 6456  O O   . LYS B 1 350 ? 19.637  47.608  111.524 1.00 59.01  ? 347 LYS B O   1 
ATOM 6457  C CB  . LYS B 1 350 ? 21.384  49.768  112.982 1.00 45.91  ? 347 LYS B CB  1 
ATOM 6458  C CG  . LYS B 1 350 ? 21.785  50.616  114.172 1.00 53.70  ? 347 LYS B CG  1 
ATOM 6459  C CD  . LYS B 1 350 ? 23.310  50.630  114.296 1.00 52.21  ? 347 LYS B CD  1 
ATOM 6460  C CE  . LYS B 1 350 ? 23.776  51.443  115.495 1.00 47.64  ? 347 LYS B CE  1 
ATOM 6461  N NZ  . LYS B 1 350 ? 25.254  51.412  115.628 1.00 66.37  ? 347 LYS B NZ  1 
ATOM 6462  N N   . CYS B 1 351 ? 19.398  49.544  110.359 1.00 50.49  ? 348 CYS B N   1 
ATOM 6463  C CA  . CYS B 1 351 ? 19.250  48.938  109.044 1.00 56.32  ? 348 CYS B CA  1 
ATOM 6464  C C   . CYS B 1 351 ? 20.477  48.074  108.721 1.00 51.45  ? 348 CYS B C   1 
ATOM 6465  O O   . CYS B 1 351 ? 20.374  47.074  108.004 1.00 52.07  ? 348 CYS B O   1 
ATOM 6466  C CB  . CYS B 1 351 ? 19.050  50.036  107.982 1.00 61.82  ? 348 CYS B CB  1 
ATOM 6467  S SG  . CYS B 1 351 ? 17.751  51.262  108.395 1.00 80.48  ? 348 CYS B SG  1 
ATOM 6468  N N   . SER B 1 352 ? 21.630  48.455  109.277 1.00 40.19  ? 349 SER B N   1 
ATOM 6469  C CA  . SER B 1 352 ? 22.878  47.737  109.064 1.00 40.85  ? 349 SER B CA  1 
ATOM 6470  C C   . SER B 1 352 ? 23.211  46.642  110.079 1.00 55.15  ? 349 SER B C   1 
ATOM 6471  O O   . SER B 1 352 ? 24.205  45.937  109.901 1.00 58.29  ? 349 SER B O   1 
ATOM 6472  C CB  . SER B 1 352 ? 24.036  48.728  109.058 1.00 48.06  ? 349 SER B CB  1 
ATOM 6473  O OG  . SER B 1 352 ? 23.927  49.625  110.145 1.00 47.70  ? 349 SER B OG  1 
ATOM 6474  N N   . ALA B 1 353 ? 22.423  46.495  111.142 1.00 50.15  ? 350 ALA B N   1 
ATOM 6475  C CA  . ALA B 1 353 ? 22.778  45.528  112.204 1.00 42.74  ? 350 ALA B CA  1 
ATOM 6476  C C   . ALA B 1 353 ? 22.887  44.102  111.704 1.00 46.94  ? 350 ALA B C   1 
ATOM 6477  O O   . ALA B 1 353 ? 22.066  43.647  110.903 1.00 53.32  ? 350 ALA B O   1 
ATOM 6478  C CB  . ALA B 1 353 ? 21.813  45.602  113.405 1.00 40.72  ? 350 ALA B CB  1 
ATOM 6479  N N   . CYS B 1 354 ? 23.929  43.413  112.173 1.00 52.72  ? 351 CYS B N   1 
ATOM 6480  C CA  . CYS B 1 354 ? 24.092  41.983  111.946 1.00 59.47  ? 351 CYS B CA  1 
ATOM 6481  C C   . CYS B 1 354 ? 23.044  41.177  112.724 1.00 66.54  ? 351 CYS B C   1 
ATOM 6482  O O   . CYS B 1 354 ? 22.905  41.343  113.931 1.00 64.51  ? 351 CYS B O   1 
ATOM 6483  C CB  . CYS B 1 354 ? 25.488  41.548  112.391 1.00 66.69  ? 351 CYS B CB  1 
ATOM 6484  S SG  . CYS B 1 354 ? 25.690  39.764  112.425 1.00 66.29  ? 351 CYS B SG  1 
ATOM 6485  N N   . SER B 1 355 ? 22.313  40.309  112.030 1.00 54.41  ? 352 SER B N   1 
ATOM 6486  C CA  . SER B 1 355 ? 21.301  39.474  112.668 1.00 61.09  ? 352 SER B CA  1 
ATOM 6487  C C   . SER B 1 355 ? 21.396  38.004  112.216 1.00 61.30  ? 352 SER B C   1 
ATOM 6488  O O   . SER B 1 355 ? 20.672  37.132  112.707 1.00 60.11  ? 352 SER B O   1 
ATOM 6489  C CB  . SER B 1 355 ? 19.895  40.031  112.417 1.00 63.74  ? 352 SER B CB  1 
ATOM 6490  O OG  . SER B 1 355 ? 19.507  39.888  111.060 1.00 52.76  ? 352 SER B OG  1 
ATOM 6491  N N   . ARG B 1 356 ? 22.276  37.743  111.257 1.00 57.37  ? 353 ARG B N   1 
ATOM 6492  C CA  . ARG B 1 356 ? 22.607  36.374  110.880 1.00 54.07  ? 353 ARG B CA  1 
ATOM 6493  C C   . ARG B 1 356 ? 24.105  36.182  110.822 1.00 55.17  ? 353 ARG B C   1 
ATOM 6494  O O   . ARG B 1 356 ? 24.803  36.871  110.089 1.00 63.08  ? 353 ARG B O   1 
ATOM 6495  C CB  . ARG B 1 356 ? 21.932  35.920  109.580 1.00 43.09  ? 353 ARG B CB  1 
ATOM 6496  C CG  . ARG B 1 356 ? 21.825  36.912  108.452 1.00 52.70  ? 353 ARG B CG  1 
ATOM 6497  C CD  . ARG B 1 356 ? 21.812  36.106  107.169 1.00 62.43  ? 353 ARG B CD  1 
ATOM 6498  N NE  . ARG B 1 356 ? 21.208  36.761  106.044 1.00 76.74  ? 353 ARG B NE  1 
ATOM 6499  C CZ  . ARG B 1 356 ? 21.686  37.095  104.844 1.00 49.05  ? 353 ARG B CZ  1 
ATOM 6500  N NH1 . ARG B 1 356 ? 20.824  37.682  104.052 1.00 105.04 ? 353 ARG B NH1 1 
ATOM 6501  N NH2 . ARG B 1 356 ? 22.916  36.901  104.403 1.00 88.59  ? 353 ARG B NH2 1 
ATOM 6502  N N   . LEU B 1 357 ? 24.591  35.255  111.642 1.00 60.56  ? 354 LEU B N   1 
ATOM 6503  C CA  . LEU B 1 357 ? 26.011  34.953  111.755 1.00 63.57  ? 354 LEU B CA  1 
ATOM 6504  C C   . LEU B 1 357 ? 26.280  33.523  111.286 1.00 66.89  ? 354 LEU B C   1 
ATOM 6505  O O   . LEU B 1 357 ? 25.614  32.601  111.718 1.00 65.67  ? 354 LEU B O   1 
ATOM 6506  C CB  . LEU B 1 357 ? 26.459  35.120  113.203 1.00 60.65  ? 354 LEU B CB  1 
ATOM 6507  C CG  . LEU B 1 357 ? 27.843  34.600  113.599 1.00 51.54  ? 354 LEU B CG  1 
ATOM 6508  C CD1 . LEU B 1 357 ? 28.937  35.452  113.004 1.00 59.24  ? 354 LEU B CD1 1 
ATOM 6509  C CD2 . LEU B 1 357 ? 27.962  34.585  115.115 1.00 67.30  ? 354 LEU B CD2 1 
ATOM 6510  N N   . TYR B 1 358 ? 27.246  33.346  110.389 1.00 69.87  ? 355 TYR B N   1 
ATOM 6511  C CA  . TYR B 1 358 ? 27.571  32.023  109.867 1.00 47.87  ? 355 TYR B CA  1 
ATOM 6512  C C   . TYR B 1 358 ? 28.953  31.609  110.380 1.00 71.99  ? 355 TYR B C   1 
ATOM 6513  O O   . TYR B 1 358 ? 29.950  32.285  110.121 1.00 68.48  ? 355 TYR B O   1 
ATOM 6514  C CB  . TYR B 1 358 ? 27.554  32.012  108.331 1.00 46.33  ? 355 TYR B CB  1 
ATOM 6515  C CG  . TYR B 1 358 ? 26.216  32.314  107.680 1.00 64.40  ? 355 TYR B CG  1 
ATOM 6516  C CD1 . TYR B 1 358 ? 25.414  31.291  107.200 1.00 70.39  ? 355 TYR B CD1 1 
ATOM 6517  C CD2 . TYR B 1 358 ? 25.761  33.621  107.528 1.00 46.95  ? 355 TYR B CD2 1 
ATOM 6518  C CE1 . TYR B 1 358 ? 24.189  31.554  106.594 1.00 73.00  ? 355 TYR B CE1 1 
ATOM 6519  C CE2 . TYR B 1 358 ? 24.531  33.890  106.920 1.00 61.44  ? 355 TYR B CE2 1 
ATOM 6520  C CZ  . TYR B 1 358 ? 23.754  32.852  106.454 1.00 64.78  ? 355 TYR B CZ  1 
ATOM 6521  O OH  . TYR B 1 358 ? 22.533  33.084  105.857 1.00 60.00  ? 355 TYR B OH  1 
ATOM 6522  N N   . VAL B 1 359 ? 29.001  30.498  111.109 1.00 69.04  ? 356 VAL B N   1 
ATOM 6523  C CA  . VAL B 1 359 ? 30.220  30.060  111.784 1.00 75.50  ? 356 VAL B CA  1 
ATOM 6524  C C   . VAL B 1 359 ? 30.618  28.646  111.364 1.00 69.32  ? 356 VAL B C   1 
ATOM 6525  O O   . VAL B 1 359 ? 29.759  27.771  111.250 1.00 59.91  ? 356 VAL B O   1 
ATOM 6526  C CB  . VAL B 1 359 ? 30.036  30.073  113.308 1.00 66.86  ? 356 VAL B CB  1 
ATOM 6527  C CG1 . VAL B 1 359 ? 31.363  29.909  113.995 1.00 80.13  ? 356 VAL B CG1 1 
ATOM 6528  C CG2 . VAL B 1 359 ? 29.375  31.360  113.759 1.00 65.20  ? 356 VAL B CG2 1 
ATOM 6529  N N   . PRO B 1 360 ? 31.926  28.418  111.131 1.00 58.33  ? 357 PRO B N   1 
ATOM 6530  C CA  . PRO B 1 360 ? 32.440  27.083  110.778 1.00 65.11  ? 357 PRO B CA  1 
ATOM 6531  C C   . PRO B 1 360 ? 32.379  26.129  111.979 1.00 77.29  ? 357 PRO B C   1 
ATOM 6532  O O   . PRO B 1 360 ? 32.589  26.561  113.112 1.00 67.38  ? 357 PRO B O   1 
ATOM 6533  C CB  . PRO B 1 360 ? 33.910  27.347  110.410 1.00 63.47  ? 357 PRO B CB  1 
ATOM 6534  C CG  . PRO B 1 360 ? 34.107  28.826  110.442 1.00 70.26  ? 357 PRO B CG  1 
ATOM 6535  C CD  . PRO B 1 360 ? 33.012  29.400  111.285 1.00 75.62  ? 357 PRO B CD  1 
ATOM 6536  N N   . HIS B 1 361 ? 32.097  24.854  111.737 1.00 77.39  ? 358 HIS B N   1 
ATOM 6537  C CA  . HIS B 1 361 ? 32.029  23.877  112.820 1.00 82.91  ? 358 HIS B CA  1 
ATOM 6538  C C   . HIS B 1 361 ? 33.303  23.897  113.683 1.00 84.18  ? 358 HIS B C   1 
ATOM 6539  O O   . HIS B 1 361 ? 33.225  23.900  114.908 1.00 64.40  ? 358 HIS B O   1 
ATOM 6540  C CB  . HIS B 1 361 ? 31.777  22.483  112.251 1.00 87.90  ? 358 HIS B CB  1 
ATOM 6541  C CG  . HIS B 1 361 ? 31.714  21.405  113.287 1.00 109.70 ? 358 HIS B CG  1 
ATOM 6542  N ND1 . HIS B 1 361 ? 30.616  21.217  114.097 1.00 114.05 ? 358 HIS B ND1 1 
ATOM 6543  C CD2 . HIS B 1 361 ? 32.610  20.449  113.638 1.00 99.98  ? 358 HIS B CD2 1 
ATOM 6544  C CE1 . HIS B 1 361 ? 30.838  20.193  114.904 1.00 119.65 ? 358 HIS B CE1 1 
ATOM 6545  N NE2 . HIS B 1 361 ? 32.041  19.711  114.647 1.00 100.22 ? 358 HIS B NE2 1 
ATOM 6546  N N   . SER B 1 362 ? 34.468  23.945  113.036 1.00 80.58  ? 359 SER B N   1 
ATOM 6547  C CA  . SER B 1 362 ? 35.753  23.955  113.741 1.00 67.47  ? 359 SER B CA  1 
ATOM 6548  C C   . SER B 1 362 ? 35.903  25.072  114.780 1.00 82.51  ? 359 SER B C   1 
ATOM 6549  O O   . SER B 1 362 ? 36.522  24.879  115.831 1.00 93.97  ? 359 SER B O   1 
ATOM 6550  C CB  . SER B 1 362 ? 36.902  24.013  112.739 1.00 71.39  ? 359 SER B CB  1 
ATOM 6551  O OG  . SER B 1 362 ? 37.013  25.280  112.130 1.00 78.43  ? 359 SER B OG  1 
ATOM 6552  N N   . LEU B 1 363 ? 35.322  26.233  114.491 1.00 95.92  ? 360 LEU B N   1 
ATOM 6553  C CA  . LEU B 1 363 ? 35.453  27.406  115.354 1.00 82.83  ? 360 LEU B CA  1 
ATOM 6554  C C   . LEU B 1 363 ? 34.296  27.579  116.348 1.00 70.75  ? 360 LEU B C   1 
ATOM 6555  O O   . LEU B 1 363 ? 34.395  28.349  117.314 1.00 69.24  ? 360 LEU B O   1 
ATOM 6556  C CB  . LEU B 1 363 ? 35.590  28.672  114.499 1.00 74.22  ? 360 LEU B CB  1 
ATOM 6557  C CG  . LEU B 1 363 ? 36.993  28.951  113.959 1.00 87.89  ? 360 LEU B CG  1 
ATOM 6558  C CD1 . LEU B 1 363 ? 37.012  29.986  112.832 1.00 71.55  ? 360 LEU B CD1 1 
ATOM 6559  C CD2 . LEU B 1 363 ? 37.997  29.283  115.066 1.00 81.29  ? 360 LEU B CD2 1 
ATOM 6560  N N   . TRP B 1 364 ? 33.201  26.865  116.115 1.00 66.30  ? 361 TRP B N   1 
ATOM 6561  C CA  . TRP B 1 364 ? 31.980  27.088  116.891 1.00 59.81  ? 361 TRP B CA  1 
ATOM 6562  C C   . TRP B 1 364 ? 32.165  26.982  118.400 1.00 79.97  ? 361 TRP B C   1 
ATOM 6563  O O   . TRP B 1 364 ? 31.753  27.886  119.118 1.00 82.24  ? 361 TRP B O   1 
ATOM 6564  C CB  . TRP B 1 364 ? 30.832  26.194  116.403 1.00 58.56  ? 361 TRP B CB  1 
ATOM 6565  C CG  . TRP B 1 364 ? 29.511  26.396  117.128 1.00 73.35  ? 361 TRP B CG  1 
ATOM 6566  C CD1 . TRP B 1 364 ? 28.661  25.419  117.577 1.00 71.45  ? 361 TRP B CD1 1 
ATOM 6567  C CD2 . TRP B 1 364 ? 28.901  27.647  117.484 1.00 67.59  ? 361 TRP B CD2 1 
ATOM 6568  N NE1 . TRP B 1 364 ? 27.567  25.986  118.188 1.00 69.31  ? 361 TRP B NE1 1 
ATOM 6569  C CE2 . TRP B 1 364 ? 27.693  27.351  118.149 1.00 71.28  ? 361 TRP B CE2 1 
ATOM 6570  C CE3 . TRP B 1 364 ? 29.260  28.988  117.305 1.00 83.75  ? 361 TRP B CE3 1 
ATOM 6571  C CZ2 . TRP B 1 364 ? 26.843  28.347  118.634 1.00 74.54  ? 361 TRP B CZ2 1 
ATOM 6572  C CZ3 . TRP B 1 364 ? 28.414  29.975  117.793 1.00 75.95  ? 361 TRP B CZ3 1 
ATOM 6573  C CH2 . TRP B 1 364 ? 27.222  29.648  118.447 1.00 68.41  ? 361 TRP B CH2 1 
ATOM 6574  N N   . PRO B 1 365 ? 32.784  25.890  118.886 1.00 89.48  ? 362 PRO B N   1 
ATOM 6575  C CA  . PRO B 1 365 ? 32.896  25.748  120.342 1.00 85.01  ? 362 PRO B CA  1 
ATOM 6576  C C   . PRO B 1 365 ? 33.571  26.964  120.974 1.00 73.33  ? 362 PRO B C   1 
ATOM 6577  O O   . PRO B 1 365 ? 33.068  27.505  121.960 1.00 81.59  ? 362 PRO B O   1 
ATOM 6578  C CB  . PRO B 1 365 ? 33.765  24.497  120.502 1.00 83.54  ? 362 PRO B CB  1 
ATOM 6579  C CG  . PRO B 1 365 ? 33.530  23.710  119.235 1.00 74.36  ? 362 PRO B CG  1 
ATOM 6580  C CD  . PRO B 1 365 ? 33.407  24.758  118.172 1.00 75.55  ? 362 PRO B CD  1 
ATOM 6581  N N   . GLN B 1 366 ? 34.680  27.401  120.388 1.00 65.05  ? 363 GLN B N   1 
ATOM 6582  C CA  . GLN B 1 366 ? 35.414  28.546  120.899 1.00 69.24  ? 363 GLN B CA  1 
ATOM 6583  C C   . GLN B 1 366 ? 34.596  29.819  120.836 1.00 85.42  ? 363 GLN B C   1 
ATOM 6584  O O   . GLN B 1 366 ? 34.551  30.582  121.800 1.00 81.27  ? 363 GLN B O   1 
ATOM 6585  C CB  . GLN B 1 366 ? 36.713  28.723  120.126 1.00 67.85  ? 363 GLN B CB  1 
ATOM 6586  C CG  . GLN B 1 366 ? 37.490  29.957  120.543 1.00 81.79  ? 363 GLN B CG  1 
ATOM 6587  C CD  . GLN B 1 366 ? 38.875  30.000  119.920 1.00 97.17  ? 363 GLN B CD  1 
ATOM 6588  O OE1 . GLN B 1 366 ? 39.294  31.010  119.379 1.00 113.77 ? 363 GLN B OE1 1 
ATOM 6589  N NE2 . GLN B 1 366 ? 39.579  28.898  119.982 1.00 97.31  ? 363 GLN B NE2 1 
ATOM 6590  N N   . ILE B 1 367 ? 33.944  30.038  119.698 1.00 74.55  ? 364 ILE B N   1 
ATOM 6591  C CA  . ILE B 1 367 ? 33.164  31.251  119.496 1.00 76.00  ? 364 ILE B CA  1 
ATOM 6592  C C   . ILE B 1 367 ? 31.899  31.259  120.372 1.00 90.61  ? 364 ILE B C   1 
ATOM 6593  O O   . ILE B 1 367 ? 31.560  32.280  120.977 1.00 72.85  ? 364 ILE B O   1 
ATOM 6594  C CB  . ILE B 1 367 ? 32.834  31.466  117.997 1.00 75.69  ? 364 ILE B CB  1 
ATOM 6595  C CG1 . ILE B 1 367 ? 34.105  31.783  117.220 1.00 72.90  ? 364 ILE B CG1 1 
ATOM 6596  C CG2 . ILE B 1 367 ? 31.850  32.607  117.806 1.00 64.11  ? 364 ILE B CG2 1 
ATOM 6597  C CD1 . ILE B 1 367 ? 33.916  31.819  115.722 1.00 67.39  ? 364 ILE B CD1 1 
ATOM 6598  N N   . LYS B 1 368 ? 31.221  30.116  120.459 1.00 74.40  ? 365 LYS B N   1 
ATOM 6599  C CA  . LYS B 1 368 ? 30.035  29.992  121.300 1.00 70.08  ? 365 LYS B CA  1 
ATOM 6600  C C   . LYS B 1 368 ? 30.341  30.315  122.750 1.00 81.87  ? 365 LYS B C   1 
ATOM 6601  O O   . LYS B 1 368 ? 29.525  30.921  123.447 1.00 81.96  ? 365 LYS B O   1 
ATOM 6602  C CB  . LYS B 1 368 ? 29.456  28.584  121.214 1.00 76.10  ? 365 LYS B CB  1 
ATOM 6603  C CG  . LYS B 1 368 ? 28.284  28.335  122.164 1.00 73.05  ? 365 LYS B CG  1 
ATOM 6604  C CD  . LYS B 1 368 ? 27.770  26.912  122.004 1.00 78.68  ? 365 LYS B CD  1 
ATOM 6605  C CE  . LYS B 1 368 ? 26.497  26.686  122.782 1.00 90.20  ? 365 LYS B CE  1 
ATOM 6606  N NZ  . LYS B 1 368 ? 25.928  25.352  122.455 1.00 87.28  ? 365 LYS B NZ  1 
ATOM 6607  N N   . GLY B 1 369 ? 31.517  29.896  123.202 1.00 77.74  ? 366 GLY B N   1 
ATOM 6608  C CA  . GLY B 1 369 ? 31.917  30.099  124.582 1.00 62.77  ? 366 GLY B CA  1 
ATOM 6609  C C   . GLY B 1 369 ? 32.275  31.533  124.888 1.00 76.34  ? 366 GLY B C   1 
ATOM 6610  O O   . GLY B 1 369 ? 31.845  32.088  125.902 1.00 70.16  ? 366 GLY B O   1 
ATOM 6611  N N   . ARG B 1 370 ? 33.076  32.128  124.012 1.00 61.81  ? 367 ARG B N   1 
ATOM 6612  C CA  . ARG B 1 370 ? 33.462  33.527  124.143 1.00 76.42  ? 367 ARG B CA  1 
ATOM 6613  C C   . ARG B 1 370 ? 32.247  34.449  124.030 1.00 85.46  ? 367 ARG B C   1 
ATOM 6614  O O   . ARG B 1 370 ? 32.155  35.461  124.724 1.00 83.56  ? 367 ARG B O   1 
ATOM 6615  C CB  . ARG B 1 370 ? 34.508  33.871  123.083 1.00 74.76  ? 367 ARG B CB  1 
ATOM 6616  C CG  . ARG B 1 370 ? 35.854  33.111  123.276 1.00 86.37  ? 367 ARG B CG  1 
ATOM 6617  C CD  . ARG B 1 370 ? 36.611  33.697  124.490 1.00 57.99  ? 367 ARG B CD  1 
ATOM 6618  N NE  . ARG B 1 370 ? 36.156  35.040  124.363 1.00 81.23  ? 367 ARG B NE  1 
ATOM 6619  C CZ  . ARG B 1 370 ? 36.046  36.079  125.163 1.00 79.51  ? 367 ARG B CZ  1 
ATOM 6620  N NH1 . ARG B 1 370 ? 35.497  37.109  124.571 1.00 118.38 ? 367 ARG B NH1 1 
ATOM 6621  N NH2 . ARG B 1 370 ? 36.421  36.174  126.424 1.00 100.37 ? 367 ARG B NH2 1 
ATOM 6622  N N   . LEU B 1 371 ? 31.314  34.089  123.157 1.00 71.48  ? 368 LEU B N   1 
ATOM 6623  C CA  . LEU B 1 371 ? 30.104  34.873  122.988 1.00 73.74  ? 368 LEU B CA  1 
ATOM 6624  C C   . LEU B 1 371 ? 29.264  34.843  124.241 1.00 76.71  ? 368 LEU B C   1 
ATOM 6625  O O   . LEU B 1 371 ? 28.833  35.889  124.730 1.00 67.93  ? 368 LEU B O   1 
ATOM 6626  C CB  . LEU B 1 371 ? 29.283  34.362  121.808 1.00 69.96  ? 368 LEU B CB  1 
ATOM 6627  C CG  . LEU B 1 371 ? 29.659  34.912  120.442 1.00 74.06  ? 368 LEU B CG  1 
ATOM 6628  C CD1 . LEU B 1 371 ? 28.710  34.361  119.402 1.00 64.80  ? 368 LEU B CD1 1 
ATOM 6629  C CD2 . LEU B 1 371 ? 29.617  36.437  120.468 1.00 77.58  ? 368 LEU B CD2 1 
ATOM 6630  N N   . LEU B 1 372 ? 29.024  33.634  124.748 1.00 91.87  ? 369 LEU B N   1 
ATOM 6631  C CA  . LEU B 1 372 ? 28.220  33.437  125.957 1.00 76.01  ? 369 LEU B CA  1 
ATOM 6632  C C   . LEU B 1 372 ? 28.846  34.119  127.173 1.00 75.90  ? 369 LEU B C   1 
ATOM 6633  O O   . LEU B 1 372 ? 28.137  34.724  127.985 1.00 60.13  ? 369 LEU B O   1 
ATOM 6634  C CB  . LEU B 1 372 ? 27.975  31.950  126.204 1.00 63.66  ? 369 LEU B CB  1 
ATOM 6635  C CG  . LEU B 1 372 ? 26.673  31.399  125.608 1.00 79.45  ? 369 LEU B CG  1 
ATOM 6636  C CD1 . LEU B 1 372 ? 26.371  32.009  124.253 1.00 68.63  ? 369 LEU B CD1 1 
ATOM 6637  C CD2 . LEU B 1 372 ? 26.720  29.877  125.508 1.00 65.68  ? 369 LEU B CD2 1 
ATOM 6638  N N   . GLU B 1 373 ? 30.172  34.046  127.284 1.00 60.95  ? 370 GLU B N   1 
ATOM 6639  C CA  . GLU B 1 373 ? 30.865  34.716  128.379 1.00 78.10  ? 370 GLU B CA  1 
ATOM 6640  C C   . GLU B 1 373 ? 30.684  36.230  128.294 1.00 76.08  ? 370 GLU B C   1 
ATOM 6641  O O   . GLU B 1 373 ? 30.333  36.880  129.269 1.00 66.66  ? 370 GLU B O   1 
ATOM 6642  C CB  . GLU B 1 373 ? 32.354  34.345  128.418 1.00 67.01  ? 370 GLU B CB  1 
ATOM 6643  N N   . GLU B 1 374 ? 30.901  36.795  127.116 1.00 76.13  ? 371 GLU B N   1 
ATOM 6644  C CA  . GLU B 1 374 ? 30.798  38.243  126.965 1.00 67.55  ? 371 GLU B CA  1 
ATOM 6645  C C   . GLU B 1 374 ? 29.352  38.732  127.044 1.00 67.65  ? 371 GLU B C   1 
ATOM 6646  O O   . GLU B 1 374 ? 29.087  39.798  127.589 1.00 74.85  ? 371 GLU B O   1 
ATOM 6647  C CB  . GLU B 1 374 ? 31.458  38.709  125.671 1.00 60.84  ? 371 GLU B CB  1 
ATOM 6648  C CG  . GLU B 1 374 ? 32.951  38.452  125.606 1.00 62.99  ? 371 GLU B CG  1 
ATOM 6649  C CD  . GLU B 1 374 ? 33.718  39.092  126.742 1.00 88.41  ? 371 GLU B CD  1 
ATOM 6650  O OE1 . GLU B 1 374 ? 33.308  40.175  127.206 1.00 82.83  ? 371 GLU B OE1 1 
ATOM 6651  O OE2 . GLU B 1 374 ? 34.735  38.501  127.174 1.00 89.77  ? 371 GLU B OE2 1 
ATOM 6652  N N   . HIS B 1 375 ? 28.424  37.948  126.503 1.00 58.60  ? 372 HIS B N   1 
ATOM 6653  C CA  . HIS B 1 375 ? 27.000  38.242  126.616 1.00 70.25  ? 372 HIS B CA  1 
ATOM 6654  C C   . HIS B 1 375 ? 26.590  38.491  128.063 1.00 87.23  ? 372 HIS B C   1 
ATOM 6655  O O   . HIS B 1 375 ? 25.795  39.391  128.354 1.00 90.17  ? 372 HIS B O   1 
ATOM 6656  C CB  . HIS B 1 375 ? 26.166  37.092  126.042 1.00 61.65  ? 372 HIS B CB  1 
ATOM 6657  C CG  . HIS B 1 375 ? 24.690  37.261  126.241 1.00 76.89  ? 372 HIS B CG  1 
ATOM 6658  N ND1 . HIS B 1 375 ? 24.072  37.050  127.455 1.00 87.30  ? 372 HIS B ND1 1 
ATOM 6659  C CD2 . HIS B 1 375 ? 23.710  37.626  125.381 1.00 87.80  ? 372 HIS B CD2 1 
ATOM 6660  C CE1 . HIS B 1 375 ? 22.776  37.275  127.336 1.00 74.21  ? 372 HIS B CE1 1 
ATOM 6661  N NE2 . HIS B 1 375 ? 22.530  37.625  126.086 1.00 88.89  ? 372 HIS B NE2 1 
ATOM 6662  N N   . SER B 1 376 ? 27.128  37.681  128.970 1.00 82.50  ? 373 SER B N   1 
ATOM 6663  C CA  . SER B 1 376 ? 26.740  37.771  130.369 1.00 93.22  ? 373 SER B CA  1 
ATOM 6664  C C   . SER B 1 376 ? 27.238  39.066  131.024 1.00 85.57  ? 373 SER B C   1 
ATOM 6665  O O   . SER B 1 376 ? 26.743  39.463  132.081 1.00 77.55  ? 373 SER B O   1 
ATOM 6666  C CB  . SER B 1 376 ? 27.210  36.531  131.141 1.00 87.72  ? 373 SER B CB  1 
ATOM 6667  O OG  . SER B 1 376 ? 28.608  36.543  131.344 1.00 79.79  ? 373 SER B OG  1 
ATOM 6668  N N   . ARG B 1 377 ? 28.204  39.730  130.389 1.00 77.05  ? 374 ARG B N   1 
ATOM 6669  C CA  . ARG B 1 377 ? 28.752  40.985  130.916 1.00 82.48  ? 374 ARG B CA  1 
ATOM 6670  C C   . ARG B 1 377 ? 28.029  42.232  130.364 1.00 91.39  ? 374 ARG B C   1 
ATOM 6671  O O   . ARG B 1 377 ? 28.346  43.358  130.763 1.00 79.55  ? 374 ARG B O   1 
ATOM 6672  C CB  . ARG B 1 377 ? 30.276  41.068  130.688 1.00 61.58  ? 374 ARG B CB  1 
ATOM 6673  N N   . ILE B 1 378 ? 27.049  42.026  129.477 1.00 83.18  ? 375 ILE B N   1 
ATOM 6674  C CA  . ILE B 1 378 ? 26.330  43.127  128.813 1.00 74.94  ? 375 ILE B CA  1 
ATOM 6675  C C   . ILE B 1 378 ? 25.267  43.760  129.705 1.00 88.63  ? 375 ILE B C   1 
ATOM 6676  O O   . ILE B 1 378 ? 24.292  43.098  130.080 1.00 77.29  ? 375 ILE B O   1 
ATOM 6677  C CB  . ILE B 1 378 ? 25.632  42.651  127.507 1.00 82.28  ? 375 ILE B CB  1 
ATOM 6678  C CG1 . ILE B 1 378 ? 26.655  42.375  126.406 1.00 75.06  ? 375 ILE B CG1 1 
ATOM 6679  C CG2 . ILE B 1 378 ? 24.631  43.683  127.006 1.00 60.38  ? 375 ILE B CG2 1 
ATOM 6680  C CD1 . ILE B 1 378 ? 26.055  41.715  125.184 1.00 62.36  ? 375 ILE B CD1 1 
ATOM 6681  N N   . LYS B 1 379 ? 25.443  45.042  130.029 1.00 78.34  ? 376 LYS B N   1 
ATOM 6682  C CA  . LYS B 1 379 ? 24.478  45.755  130.867 1.00 80.07  ? 376 LYS B CA  1 
ATOM 6683  C C   . LYS B 1 379 ? 23.433  46.500  130.036 1.00 85.62  ? 376 LYS B C   1 
ATOM 6684  O O   . LYS B 1 379 ? 23.767  47.361  129.220 1.00 75.01  ? 376 LYS B O   1 
ATOM 6685  C CB  . LYS B 1 379 ? 25.187  46.722  131.822 1.00 70.04  ? 376 LYS B CB  1 
ATOM 6686  N N   . VAL B 1 380 ? 22.169  46.150  130.249 1.00 69.89  ? 377 VAL B N   1 
ATOM 6687  C CA  . VAL B 1 380 ? 21.030  46.838  129.648 1.00 55.95  ? 377 VAL B CA  1 
ATOM 6688  C C   . VAL B 1 380 ? 20.301  47.687  130.693 1.00 72.71  ? 377 VAL B C   1 
ATOM 6689  O O   . VAL B 1 380 ? 19.939  47.194  131.762 1.00 95.12  ? 377 VAL B O   1 
ATOM 6690  C CB  . VAL B 1 380 ? 20.001  45.829  129.079 1.00 56.50  ? 377 VAL B CB  1 
ATOM 6691  C CG1 . VAL B 1 380 ? 18.826  46.569  128.444 1.00 63.89  ? 377 VAL B CG1 1 
ATOM 6692  C CG2 . VAL B 1 380 ? 20.660  44.876  128.096 1.00 68.72  ? 377 VAL B CG2 1 
ATOM 6693  N N   . GLY B 1 381 ? 20.077  48.961  130.390 1.00 69.65  ? 378 GLY B N   1 
ATOM 6694  C CA  . GLY B 1 381 ? 19.382  49.831  131.320 1.00 64.19  ? 378 GLY B CA  1 
ATOM 6695  C C   . GLY B 1 381 ? 19.198  51.279  130.888 1.00 83.26  ? 378 GLY B C   1 
ATOM 6696  O O   . GLY B 1 381 ? 19.160  51.599  129.703 1.00 74.33  ? 378 GLY B O   1 
ATOM 6697  N N   . ASP B 1 382 ? 19.072  52.155  131.878 1.00 75.74  ? 379 ASP B N   1 
ATOM 6698  C CA  . ASP B 1 382 ? 18.862  53.581  131.667 1.00 68.50  ? 379 ASP B CA  1 
ATOM 6699  C C   . ASP B 1 382 ? 20.185  54.248  131.312 1.00 82.73  ? 379 ASP B C   1 
ATOM 6700  O O   . ASP B 1 382 ? 21.103  54.268  132.131 1.00 71.35  ? 379 ASP B O   1 
ATOM 6701  C CB  . ASP B 1 382 ? 18.249  54.200  132.927 1.00 57.15  ? 379 ASP B CB  1 
ATOM 6702  C CG  . ASP B 1 382 ? 17.952  55.673  132.784 1.00 70.94  ? 379 ASP B CG  1 
ATOM 6703  O OD1 . ASP B 1 382 ? 18.795  56.407  132.229 1.00 74.17  ? 379 ASP B OD1 1 
ATOM 6704  O OD2 . ASP B 1 382 ? 16.872  56.097  133.238 1.00 72.34  ? 379 ASP B OD2 1 
ATOM 6705  N N   . PRO B 1 383 ? 20.279  54.793  130.082 1.00 75.89  ? 380 PRO B N   1 
ATOM 6706  C CA  . PRO B 1 383 ? 21.509  55.322  129.472 1.00 55.91  ? 380 PRO B CA  1 
ATOM 6707  C C   . PRO B 1 383 ? 21.892  56.717  129.963 1.00 65.83  ? 380 PRO B C   1 
ATOM 6708  O O   . PRO B 1 383 ? 23.056  57.104  129.857 1.00 64.16  ? 380 PRO B O   1 
ATOM 6709  C CB  . PRO B 1 383 ? 21.151  55.374  127.996 1.00 60.41  ? 380 PRO B CB  1 
ATOM 6710  C CG  . PRO B 1 383 ? 19.699  55.671  127.997 1.00 70.46  ? 380 PRO B CG  1 
ATOM 6711  C CD  . PRO B 1 383 ? 19.124  54.922  129.178 1.00 63.86  ? 380 PRO B CD  1 
ATOM 6712  N N   . ALA B 1 384 ? 20.919  57.458  130.480 1.00 57.12  ? 381 ALA B N   1 
ATOM 6713  C CA  . ALA B 1 384 ? 21.171  58.761  131.072 1.00 59.73  ? 381 ALA B CA  1 
ATOM 6714  C C   . ALA B 1 384 ? 21.645  58.663  132.534 1.00 86.03  ? 381 ALA B C   1 
ATOM 6715  O O   . ALA B 1 384 ? 22.512  59.436  132.958 1.00 89.26  ? 381 ALA B O   1 
ATOM 6716  C CB  . ALA B 1 384 ? 19.925  59.621  130.978 1.00 46.79  ? 381 ALA B CB  1 
ATOM 6717  N N   . GLU B 1 385 ? 21.078  57.721  133.297 1.00 75.99  ? 382 GLU B N   1 
ATOM 6718  C CA  . GLU B 1 385 ? 21.431  57.543  134.716 1.00 89.59  ? 382 GLU B CA  1 
ATOM 6719  C C   . GLU B 1 385 ? 22.710  56.723  134.877 1.00 87.00  ? 382 GLU B C   1 
ATOM 6720  O O   . GLU B 1 385 ? 23.486  56.952  135.805 1.00 83.92  ? 382 GLU B O   1 
ATOM 6721  C CB  . GLU B 1 385 ? 20.279  56.909  135.522 1.00 53.57  ? 382 GLU B CB  1 
ATOM 6722  N N   . ASP B 1 386 ? 22.929  55.788  133.956 1.00 74.63  ? 383 ASP B N   1 
ATOM 6723  C CA  . ASP B 1 386 ? 24.058  54.864  134.034 1.00 67.42  ? 383 ASP B CA  1 
ATOM 6724  C C   . ASP B 1 386 ? 24.842  54.776  132.716 1.00 76.66  ? 383 ASP B C   1 
ATOM 6725  O O   . ASP B 1 386 ? 24.424  54.112  131.767 1.00 67.69  ? 383 ASP B O   1 
ATOM 6726  C CB  . ASP B 1 386 ? 23.565  53.465  134.476 1.00 57.57  ? 383 ASP B CB  1 
ATOM 6727  C CG  . ASP B 1 386 ? 24.708  52.465  134.662 1.00 91.25  ? 383 ASP B CG  1 
ATOM 6728  O OD1 . ASP B 1 386 ? 25.896  52.882  134.686 1.00 79.46  ? 383 ASP B OD1 1 
ATOM 6729  O OD2 . ASP B 1 386 ? 24.409  51.259  134.789 1.00 85.12  ? 383 ASP B OD2 1 
ATOM 6730  N N   . PHE B 1 387 ? 25.993  55.433  132.660 1.00 72.27  ? 384 PHE B N   1 
ATOM 6731  C CA  . PHE B 1 387 ? 26.796  55.423  131.436 1.00 62.80  ? 384 PHE B CA  1 
ATOM 6732  C C   . PHE B 1 387 ? 27.497  54.080  131.168 1.00 70.72  ? 384 PHE B C   1 
ATOM 6733  O O   . PHE B 1 387 ? 28.161  53.905  130.148 1.00 81.89  ? 384 PHE B O   1 
ATOM 6734  C CB  . PHE B 1 387 ? 27.816  56.567  131.438 1.00 59.82  ? 384 PHE B CB  1 
ATOM 6735  C CG  . PHE B 1 387 ? 27.215  57.923  131.170 1.00 64.14  ? 384 PHE B CG  1 
ATOM 6736  C CD1 . PHE B 1 387 ? 25.839  58.082  131.075 1.00 61.08  ? 384 PHE B CD1 1 
ATOM 6737  C CD2 . PHE B 1 387 ? 28.031  59.036  130.989 1.00 64.33  ? 384 PHE B CD2 1 
ATOM 6738  C CE1 . PHE B 1 387 ? 25.278  59.333  130.822 1.00 57.23  ? 384 PHE B CE1 1 
ATOM 6739  C CE2 . PHE B 1 387 ? 27.480  60.289  130.730 1.00 63.26  ? 384 PHE B CE2 1 
ATOM 6740  C CZ  . PHE B 1 387 ? 26.100  60.437  130.655 1.00 48.64  ? 384 PHE B CZ  1 
ATOM 6741  N N   . GLY B 1 388 ? 27.346  53.136  132.088 1.00 74.61  ? 385 GLY B N   1 
ATOM 6742  C CA  . GLY B 1 388 ? 27.899  51.807  131.906 1.00 62.18  ? 385 GLY B CA  1 
ATOM 6743  C C   . GLY B 1 388 ? 26.978  50.955  131.051 1.00 85.30  ? 385 GLY B C   1 
ATOM 6744  O O   . GLY B 1 388 ? 27.307  49.822  130.686 1.00 91.81  ? 385 GLY B O   1 
ATOM 6745  N N   . THR B 1 389 ? 25.811  51.508  130.739 1.00 68.58  ? 386 THR B N   1 
ATOM 6746  C CA  . THR B 1 389 ? 24.860  50.859  129.857 1.00 64.70  ? 386 THR B CA  1 
ATOM 6747  C C   . THR B 1 389 ? 25.460  50.680  128.459 1.00 83.46  ? 386 THR B C   1 
ATOM 6748  O O   . THR B 1 389 ? 25.985  51.634  127.861 1.00 54.43  ? 386 THR B O   1 
ATOM 6749  C CB  . THR B 1 389 ? 23.586  51.698  129.729 1.00 70.64  ? 386 THR B CB  1 
ATOM 6750  O OG1 . THR B 1 389 ? 22.997  51.871  131.020 1.00 71.25  ? 386 THR B OG1 1 
ATOM 6751  C CG2 . THR B 1 389 ? 22.585  51.030  128.791 1.00 52.69  ? 386 THR B CG2 1 
ATOM 6752  N N   . PHE B 1 390 ? 25.389  49.450  127.953 1.00 51.88  ? 387 PHE B N   1 
ATOM 6753  C CA  . PHE B 1 390 ? 25.798  49.161  126.589 1.00 75.41  ? 387 PHE B CA  1 
ATOM 6754  C C   . PHE B 1 390 ? 24.688  49.577  125.598 1.00 89.71  ? 387 PHE B C   1 
ATOM 6755  O O   . PHE B 1 390 ? 24.928  50.391  124.698 1.00 67.44  ? 387 PHE B O   1 
ATOM 6756  C CB  . PHE B 1 390 ? 26.155  47.681  126.441 1.00 53.76  ? 387 PHE B CB  1 
ATOM 6757  C CG  . PHE B 1 390 ? 26.821  47.351  125.131 1.00 76.09  ? 387 PHE B CG  1 
ATOM 6758  C CD1 . PHE B 1 390 ? 27.940  48.058  124.710 1.00 71.03  ? 387 PHE B CD1 1 
ATOM 6759  C CD2 . PHE B 1 390 ? 26.329  46.331  124.325 1.00 55.72  ? 387 PHE B CD2 1 
ATOM 6760  C CE1 . PHE B 1 390 ? 28.559  47.755  123.496 1.00 57.03  ? 387 PHE B CE1 1 
ATOM 6761  C CE2 . PHE B 1 390 ? 26.939  46.010  123.126 1.00 47.06  ? 387 PHE B CE2 1 
ATOM 6762  C CZ  . PHE B 1 390 ? 28.063  46.727  122.706 1.00 54.04  ? 387 PHE B CZ  1 
ATOM 6763  N N   . PHE B 1 391 ? 23.486  49.015  125.768 1.00 55.42  ? 388 PHE B N   1 
ATOM 6764  C CA  . PHE B 1 391 ? 22.292  49.515  125.096 1.00 53.00  ? 388 PHE B CA  1 
ATOM 6765  C C   . PHE B 1 391 ? 21.091  49.514  126.019 1.00 64.32  ? 388 PHE B C   1 
ATOM 6766  O O   . PHE B 1 391 ? 21.137  48.946  127.106 1.00 66.23  ? 388 PHE B O   1 
ATOM 6767  C CB  . PHE B 1 391 ? 21.975  48.737  123.824 1.00 51.75  ? 388 PHE B CB  1 
ATOM 6768  C CG  . PHE B 1 391 ? 21.451  47.334  124.049 1.00 72.23  ? 388 PHE B CG  1 
ATOM 6769  C CD1 . PHE B 1 391 ? 22.319  46.258  124.231 1.00 55.66  ? 388 PHE B CD1 1 
ATOM 6770  C CD2 . PHE B 1 391 ? 20.086  47.084  124.007 1.00 49.80  ? 388 PHE B CD2 1 
ATOM 6771  C CE1 . PHE B 1 391 ? 21.826  44.964  124.398 1.00 56.04  ? 388 PHE B CE1 1 
ATOM 6772  C CE2 . PHE B 1 391 ? 19.594  45.790  124.185 1.00 65.17  ? 388 PHE B CE2 1 
ATOM 6773  C CZ  . PHE B 1 391 ? 20.470  44.733  124.371 1.00 40.98  ? 388 PHE B CZ  1 
ATOM 6774  N N   . SER B 1 392 ? 20.016  50.150  125.561 1.00 43.00  ? 389 SER B N   1 
ATOM 6775  C CA  . SER B 1 392 ? 18.810  50.370  126.356 1.00 41.93  ? 389 SER B CA  1 
ATOM 6776  C C   . SER B 1 392 ? 17.537  49.720  125.775 1.00 49.48  ? 389 SER B C   1 
ATOM 6777  O O   . SER B 1 392 ? 17.596  48.699  125.094 1.00 56.51  ? 389 SER B O   1 
ATOM 6778  C CB  . SER B 1 392 ? 18.602  51.868  126.617 1.00 38.62  ? 389 SER B CB  1 
ATOM 6779  O OG  . SER B 1 392 ? 17.471  52.111  127.447 1.00 61.90  ? 389 SER B OG  1 
ATOM 6780  N N   . ALA B 1 393 ? 16.386  50.286  126.098 1.00 59.70  ? 390 ALA B N   1 
ATOM 6781  C CA  . ALA B 1 393 ? 15.122  49.736  125.638 1.00 69.09  ? 390 ALA B CA  1 
ATOM 6782  C C   . ALA B 1 393 ? 14.973  49.924  124.125 1.00 57.53  ? 390 ALA B C   1 
ATOM 6783  O O   . ALA B 1 393 ? 15.619  50.799  123.544 1.00 66.80  ? 390 ALA B O   1 
ATOM 6784  C CB  . ALA B 1 393 ? 13.973  50.405  126.376 1.00 70.32  ? 390 ALA B CB  1 
ATOM 6785  N N   . VAL B 1 394 ? 14.140  49.092  123.494 1.00 60.39  ? 391 VAL B N   1 
ATOM 6786  C CA  . VAL B 1 394 ? 13.724  49.321  122.113 1.00 55.42  ? 391 VAL B CA  1 
ATOM 6787  C C   . VAL B 1 394 ? 12.732  50.481  122.073 1.00 72.39  ? 391 VAL B C   1 
ATOM 6788  O O   . VAL B 1 394 ? 12.180  50.882  123.110 1.00 54.45  ? 391 VAL B O   1 
ATOM 6789  C CB  . VAL B 1 394 ? 13.135  48.059  121.430 1.00 53.35  ? 391 VAL B CB  1 
ATOM 6790  C CG1 . VAL B 1 394 ? 14.134  46.911  121.488 1.00 48.16  ? 391 VAL B CG1 1 
ATOM 6791  C CG2 . VAL B 1 394 ? 11.836  47.658  122.069 1.00 65.08  ? 391 VAL B CG2 1 
ATOM 6792  N N   . ILE B 1 395 ? 12.509  51.011  120.873 1.00 68.02  ? 392 ILE B N   1 
ATOM 6793  C CA  . ILE B 1 395 ? 11.906  52.329  120.704 1.00 47.57  ? 392 ILE B CA  1 
ATOM 6794  C C   . ILE B 1 395 ? 10.478  52.501  121.222 1.00 54.51  ? 392 ILE B C   1 
ATOM 6795  O O   . ILE B 1 395 ? 10.171  53.512  121.850 1.00 58.02  ? 392 ILE B O   1 
ATOM 6796  C CB  . ILE B 1 395 ? 11.990  52.813  119.230 1.00 65.78  ? 392 ILE B CB  1 
ATOM 6797  C CG1 . ILE B 1 395 ? 11.624  54.294  119.139 1.00 41.83  ? 392 ILE B CG1 1 
ATOM 6798  C CG2 . ILE B 1 395 ? 11.107  51.961  118.306 1.00 37.76  ? 392 ILE B CG2 1 
ATOM 6799  C CD1 . ILE B 1 395 ? 12.683  55.225  119.733 1.00 43.64  ? 392 ILE B CD1 1 
ATOM 6800  N N   . ASP B 1 396 ? 9.606   51.533  120.960 1.00 50.60  ? 393 ASP B N   1 
ATOM 6801  C CA  . ASP B 1 396 ? 8.208   51.688  121.355 1.00 53.29  ? 393 ASP B CA  1 
ATOM 6802  C C   . ASP B 1 396 ? 7.499   50.359  121.550 1.00 72.61  ? 393 ASP B C   1 
ATOM 6803  O O   . ASP B 1 396 ? 8.072   49.296  121.289 1.00 65.03  ? 393 ASP B O   1 
ATOM 6804  C CB  . ASP B 1 396 ? 7.438   52.583  120.355 1.00 64.30  ? 393 ASP B CB  1 
ATOM 6805  C CG  . ASP B 1 396 ? 7.312   51.963  118.940 1.00 79.07  ? 393 ASP B CG  1 
ATOM 6806  O OD1 . ASP B 1 396 ? 7.692   50.785  118.720 1.00 57.68  ? 393 ASP B OD1 1 
ATOM 6807  O OD2 . ASP B 1 396 ? 6.808   52.678  118.041 1.00 75.89  ? 393 ASP B OD2 1 
ATOM 6808  N N   . ALA B 1 397 ? 6.246   50.437  121.992 1.00 60.85  ? 394 ALA B N   1 
ATOM 6809  C CA  . ALA B 1 397 ? 5.469   49.251  122.334 1.00 66.28  ? 394 ALA B CA  1 
ATOM 6810  C C   . ALA B 1 397 ? 5.222   48.315  121.151 1.00 60.39  ? 394 ALA B C   1 
ATOM 6811  O O   . ALA B 1 397 ? 5.316   47.098  121.290 1.00 82.08  ? 394 ALA B O   1 
ATOM 6812  C CB  . ALA B 1 397 ? 4.159   49.658  122.970 1.00 55.43  ? 394 ALA B CB  1 
ATOM 6813  N N   . LYS B 1 398 ? 4.907   48.876  119.992 1.00 63.88  ? 395 LYS B N   1 
ATOM 6814  C CA  . LYS B 1 398 ? 4.649   48.053  118.818 1.00 69.46  ? 395 LYS B CA  1 
ATOM 6815  C C   . LYS B 1 398 ? 5.892   47.245  118.457 1.00 70.57  ? 395 LYS B C   1 
ATOM 6816  O O   . LYS B 1 398 ? 5.793   46.079  118.070 1.00 70.44  ? 395 LYS B O   1 
ATOM 6817  C CB  . LYS B 1 398 ? 4.158   48.904  117.635 1.00 56.36  ? 395 LYS B CB  1 
ATOM 6818  N N   . SER B 1 399 ? 7.060   47.867  118.613 1.00 58.53  ? 396 SER B N   1 
ATOM 6819  C CA  . SER B 1 399 ? 8.346   47.216  118.354 1.00 59.66  ? 396 SER B CA  1 
ATOM 6820  C C   . SER B 1 399 ? 8.625   46.135  119.394 1.00 69.86  ? 396 SER B C   1 
ATOM 6821  O O   . SER B 1 399 ? 9.041   45.024  119.064 1.00 61.69  ? 396 SER B O   1 
ATOM 6822  C CB  . SER B 1 399 ? 9.488   48.256  118.336 1.00 40.53  ? 396 SER B CB  1 
ATOM 6823  O OG  . SER B 1 399 ? 10.756  47.658  118.088 1.00 76.77  ? 396 SER B OG  1 
ATOM 6824  N N   . PHE B 1 400 ? 8.394   46.480  120.654 1.00 63.41  ? 397 PHE B N   1 
ATOM 6825  C CA  . PHE B 1 400 ? 8.537   45.551  121.764 1.00 71.69  ? 397 PHE B CA  1 
ATOM 6826  C C   . PHE B 1 400 ? 7.674   44.298  121.588 1.00 82.33  ? 397 PHE B C   1 
ATOM 6827  O O   . PHE B 1 400 ? 8.140   43.176  121.835 1.00 65.99  ? 397 PHE B O   1 
ATOM 6828  C CB  . PHE B 1 400 ? 8.179   46.251  123.069 1.00 64.98  ? 397 PHE B CB  1 
ATOM 6829  C CG  . PHE B 1 400 ? 8.370   45.398  124.276 1.00 74.40  ? 397 PHE B CG  1 
ATOM 6830  C CD1 . PHE B 1 400 ? 7.332   44.615  124.760 1.00 71.49  ? 397 PHE B CD1 1 
ATOM 6831  C CD2 . PHE B 1 400 ? 9.589   45.374  124.931 1.00 74.98  ? 397 PHE B CD2 1 
ATOM 6832  C CE1 . PHE B 1 400 ? 7.508   43.822  125.889 1.00 74.85  ? 397 PHE B CE1 1 
ATOM 6833  C CE2 . PHE B 1 400 ? 9.771   44.590  126.058 1.00 80.32  ? 397 PHE B CE2 1 
ATOM 6834  C CZ  . PHE B 1 400 ? 8.728   43.811  126.539 1.00 68.57  ? 397 PHE B CZ  1 
ATOM 6835  N N   . ALA B 1 401 ? 6.423   44.486  121.163 1.00 57.54  ? 398 ALA B N   1 
ATOM 6836  C CA  . ALA B 1 401 ? 5.522   43.354  120.928 1.00 69.85  ? 398 ALA B CA  1 
ATOM 6837  C C   . ALA B 1 401 ? 6.023   42.412  119.835 1.00 73.45  ? 398 ALA B C   1 
ATOM 6838  O O   . ALA B 1 401 ? 6.130   41.200  120.043 1.00 73.40  ? 398 ALA B O   1 
ATOM 6839  C CB  . ALA B 1 401 ? 4.120   43.831  120.617 1.00 41.38  ? 398 ALA B CB  1 
ATOM 6840  N N   . ARG B 1 402 ? 6.322   42.980  118.677 1.00 62.75  ? 399 ARG B N   1 
ATOM 6841  C CA  . ARG B 1 402 ? 6.852   42.245  117.529 1.00 68.03  ? 399 ARG B CA  1 
ATOM 6842  C C   . ARG B 1 402 ? 8.064   41.422  117.929 1.00 65.66  ? 399 ARG B C   1 
ATOM 6843  O O   . ARG B 1 402 ? 8.190   40.263  117.545 1.00 65.63  ? 399 ARG B O   1 
ATOM 6844  C CB  . ARG B 1 402 ? 7.263   43.267  116.497 1.00 62.95  ? 399 ARG B CB  1 
ATOM 6845  C CG  . ARG B 1 402 ? 7.381   42.872  115.094 1.00 89.28  ? 399 ARG B CG  1 
ATOM 6846  C CD  . ARG B 1 402 ? 7.323   44.220  114.430 1.00 88.18  ? 399 ARG B CD  1 
ATOM 6847  N NE  . ARG B 1 402 ? 8.607   44.827  114.154 1.00 108.28 ? 399 ARG B NE  1 
ATOM 6848  C CZ  . ARG B 1 402 ? 9.489   45.480  114.908 1.00 117.10 ? 399 ARG B CZ  1 
ATOM 6849  N NH1 . ARG B 1 402 ? 9.384   45.734  116.207 1.00 129.81 ? 399 ARG B NH1 1 
ATOM 6850  N NH2 . ARG B 1 402 ? 10.558  45.875  114.252 1.00 132.04 ? 399 ARG B NH2 1 
ATOM 6851  N N   . ILE B 1 403 ? 8.958   42.020  118.708 1.00 56.39  ? 400 ILE B N   1 
ATOM 6852  C CA  . ILE B 1 403 ? 10.145  41.294  119.162 1.00 72.39  ? 400 ILE B CA  1 
ATOM 6853  C C   . ILE B 1 403 ? 9.804   40.130  120.101 1.00 69.59  ? 400 ILE B C   1 
ATOM 6854  O O   . ILE B 1 403 ? 10.391  39.059  119.974 1.00 68.28  ? 400 ILE B O   1 
ATOM 6855  C CB  . ILE B 1 403 ? 11.207  42.222  119.810 1.00 57.98  ? 400 ILE B CB  1 
ATOM 6856  C CG1 . ILE B 1 403 ? 11.642  43.294  118.813 1.00 45.01  ? 400 ILE B CG1 1 
ATOM 6857  C CG2 . ILE B 1 403 ? 12.396  41.403  120.310 1.00 49.07  ? 400 ILE B CG2 1 
ATOM 6858  C CD1 . ILE B 1 403 ? 12.500  44.443  119.416 1.00 46.83  ? 400 ILE B CD1 1 
ATOM 6859  N N   . LYS B 1 404 ? 8.866   40.333  121.033 1.00 62.53  ? 401 LYS B N   1 
ATOM 6860  C CA  . LYS B 1 404 ? 8.437   39.243  121.917 1.00 72.61  ? 401 LYS B CA  1 
ATOM 6861  C C   . LYS B 1 404 ? 7.847   38.086  121.108 1.00 81.21  ? 401 LYS B C   1 
ATOM 6862  O O   . LYS B 1 404 ? 8.123   36.922  121.401 1.00 71.16  ? 401 LYS B O   1 
ATOM 6863  C CB  . LYS B 1 404 ? 7.449   39.708  122.994 1.00 60.32  ? 401 LYS B CB  1 
ATOM 6864  N N   . LYS B 1 405 ? 7.053   38.400  120.083 1.00 56.60  ? 402 LYS B N   1 
ATOM 6865  C CA  . LYS B 1 405 ? 6.490   37.348  119.244 1.00 64.74  ? 402 LYS B CA  1 
ATOM 6866  C C   . LYS B 1 405 ? 7.601   36.524  118.592 1.00 74.62  ? 402 LYS B C   1 
ATOM 6867  O O   . LYS B 1 405 ? 7.453   35.312  118.417 1.00 79.31  ? 402 LYS B O   1 
ATOM 6868  C CB  . LYS B 1 405 ? 5.491   37.906  118.218 1.00 44.68  ? 402 LYS B CB  1 
ATOM 6869  N N   . TRP B 1 406 ? 8.725   37.175  118.281 1.00 69.28  ? 403 TRP B N   1 
ATOM 6870  C CA  . TRP B 1 406 ? 9.913   36.475  117.763 1.00 60.90  ? 403 TRP B CA  1 
ATOM 6871  C C   . TRP B 1 406 ? 10.600  35.615  118.809 1.00 73.20  ? 403 TRP B C   1 
ATOM 6872  O O   . TRP B 1 406 ? 11.023  34.486  118.525 1.00 56.41  ? 403 TRP B O   1 
ATOM 6873  C CB  . TRP B 1 406 ? 10.940  37.445  117.141 1.00 61.62  ? 403 TRP B CB  1 
ATOM 6874  C CG  . TRP B 1 406 ? 10.619  37.804  115.708 1.00 81.53  ? 403 TRP B CG  1 
ATOM 6875  C CD1 . TRP B 1 406 ? 10.097  38.982  115.260 1.00 67.00  ? 403 TRP B CD1 1 
ATOM 6876  C CD2 . TRP B 1 406 ? 10.766  36.965  114.549 1.00 56.11  ? 403 TRP B CD2 1 
ATOM 6877  N NE1 . TRP B 1 406 ? 9.922   38.933  113.904 1.00 57.76  ? 403 TRP B NE1 1 
ATOM 6878  C CE2 . TRP B 1 406 ? 10.321  37.707  113.440 1.00 68.97  ? 403 TRP B CE2 1 
ATOM 6879  C CE3 . TRP B 1 406 ? 11.224  35.664  114.343 1.00 61.34  ? 403 TRP B CE3 1 
ATOM 6880  C CZ2 . TRP B 1 406 ? 10.320  37.189  112.140 1.00 52.89  ? 403 TRP B CZ2 1 
ATOM 6881  C CZ3 . TRP B 1 406 ? 11.232  35.153  113.047 1.00 54.45  ? 403 TRP B CZ3 1 
ATOM 6882  C CH2 . TRP B 1 406 ? 10.785  35.914  111.968 1.00 66.53  ? 403 TRP B CH2 1 
ATOM 6883  N N   . LEU B 1 407 ? 10.738  36.156  120.012 1.00 69.44  ? 404 LEU B N   1 
ATOM 6884  C CA  . LEU B 1 407 ? 11.289  35.378  121.112 1.00 76.47  ? 404 LEU B CA  1 
ATOM 6885  C C   . LEU B 1 407 ? 10.437  34.118  121.365 1.00 75.87  ? 404 LEU B C   1 
ATOM 6886  O O   . LEU B 1 407 ? 10.976  33.016  121.478 1.00 66.47  ? 404 LEU B O   1 
ATOM 6887  C CB  . LEU B 1 407 ? 11.420  36.239  122.371 1.00 74.38  ? 404 LEU B CB  1 
ATOM 6888  C CG  . LEU B 1 407 ? 12.404  37.407  122.248 1.00 79.11  ? 404 LEU B CG  1 
ATOM 6889  C CD1 . LEU B 1 407 ? 12.400  38.296  123.487 1.00 68.75  ? 404 LEU B CD1 1 
ATOM 6890  C CD2 . LEU B 1 407 ? 13.799  36.888  121.969 1.00 54.34  ? 404 LEU B CD2 1 
ATOM 6891  N N   . GLU B 1 408 ? 9.114   34.273  121.431 1.00 71.14  ? 405 GLU B N   1 
ATOM 6892  C CA  . GLU B 1 408 ? 8.239   33.109  121.579 1.00 81.48  ? 405 GLU B CA  1 
ATOM 6893  C C   . GLU B 1 408 ? 8.430   32.148  120.397 1.00 80.21  ? 405 GLU B C   1 
ATOM 6894  O O   . GLU B 1 408 ? 8.427   30.939  120.585 1.00 79.84  ? 405 GLU B O   1 
ATOM 6895  C CB  . GLU B 1 408 ? 6.761   33.497  121.804 1.00 50.37  ? 405 GLU B CB  1 
ATOM 6896  N N   . HIS B 1 409 ? 8.642   32.683  119.194 1.00 72.65  ? 406 HIS B N   1 
ATOM 6897  C CA  . HIS B 1 409 ? 8.950   31.841  118.023 1.00 69.15  ? 406 HIS B CA  1 
ATOM 6898  C C   . HIS B 1 409 ? 10.274  31.067  118.129 1.00 83.47  ? 406 HIS B C   1 
ATOM 6899  O O   . HIS B 1 409 ? 10.383  29.950  117.633 1.00 72.49  ? 406 HIS B O   1 
ATOM 6900  C CB  . HIS B 1 409 ? 8.947   32.652  116.726 1.00 63.02  ? 406 HIS B CB  1 
ATOM 6901  C CG  . HIS B 1 409 ? 9.430   31.881  115.535 1.00 76.12  ? 406 HIS B CG  1 
ATOM 6902  N ND1 . HIS B 1 409 ? 8.589   31.133  114.740 1.00 71.68  ? 406 HIS B ND1 1 
ATOM 6903  C CD2 . HIS B 1 409 ? 10.671  31.736  115.009 1.00 76.09  ? 406 HIS B CD2 1 
ATOM 6904  C CE1 . HIS B 1 409 ? 9.289   30.564  113.773 1.00 78.60  ? 406 HIS B CE1 1 
ATOM 6905  N NE2 . HIS B 1 409 ? 10.557  30.906  113.919 1.00 62.13  ? 406 HIS B NE2 1 
ATOM 6906  N N   . ALA B 1 410 ? 11.276  31.668  118.761 1.00 61.94  ? 407 ALA B N   1 
ATOM 6907  C CA  . ALA B 1 410 ? 12.554  31.003  118.985 1.00 70.84  ? 407 ALA B CA  1 
ATOM 6908  C C   . ALA B 1 410 ? 12.478  29.806  119.964 1.00 75.49  ? 407 ALA B C   1 
ATOM 6909  O O   . ALA B 1 410 ? 13.253  28.846  119.855 1.00 81.14  ? 407 ALA B O   1 
ATOM 6910  C CB  . ALA B 1 410 ? 13.583  32.013  119.448 1.00 59.25  ? 407 ALA B CB  1 
ATOM 6911  N N   . ARG B 1 411 ? 11.554  29.854  120.919 1.00 68.20  ? 408 ARG B N   1 
ATOM 6912  C CA  . ARG B 1 411 ? 11.337  28.702  121.789 1.00 86.65  ? 408 ARG B CA  1 
ATOM 6913  C C   . ARG B 1 411 ? 10.531  27.632  121.073 1.00 89.58  ? 408 ARG B C   1 
ATOM 6914  O O   . ARG B 1 411 ? 10.910  26.466  121.034 1.00 99.04  ? 408 ARG B O   1 
ATOM 6915  C CB  . ARG B 1 411 ? 10.587  29.122  123.039 1.00 75.07  ? 408 ARG B CB  1 
ATOM 6916  C CG  . ARG B 1 411 ? 11.316  30.114  123.897 1.00 86.50  ? 408 ARG B CG  1 
ATOM 6917  C CD  . ARG B 1 411 ? 10.374  30.626  124.958 1.00 85.77  ? 408 ARG B CD  1 
ATOM 6918  N NE  . ARG B 1 411 ? 10.832  31.901  125.435 1.00 115.60 ? 408 ARG B NE  1 
ATOM 6919  C CZ  . ARG B 1 411 ? 10.345  33.116  125.205 1.00 122.61 ? 408 ARG B CZ  1 
ATOM 6920  N NH1 . ARG B 1 411 ? 9.247   33.365  124.498 1.00 128.60 ? 408 ARG B NH1 1 
ATOM 6921  N NH2 . ARG B 1 411 ? 11.010  34.111  125.756 1.00 108.44 ? 408 ARG B NH2 1 
ATOM 6922  N N   . SER B 1 412 ? 9.412   28.062  120.504 1.00 87.24  ? 409 SER B N   1 
ATOM 6923  C CA  . SER B 1 412 ? 8.473   27.190  119.812 1.00 87.11  ? 409 SER B CA  1 
ATOM 6924  C C   . SER B 1 412 ? 9.116   26.398  118.687 1.00 94.75  ? 409 SER B C   1 
ATOM 6925  O O   . SER B 1 412 ? 8.850   25.215  118.528 1.00 102.10 ? 409 SER B O   1 
ATOM 6926  C CB  . SER B 1 412 ? 7.324   28.017  119.227 1.00 81.94  ? 409 SER B CB  1 
ATOM 6927  O OG  . SER B 1 412 ? 6.903   29.013  120.135 1.00 124.04 ? 409 SER B OG  1 
ATOM 6928  N N   . SER B 1 413 ? 9.942   27.058  117.885 1.00 95.20  ? 410 SER B N   1 
ATOM 6929  C CA  . SER B 1 413 ? 10.517  26.396  116.730 1.00 88.80  ? 410 SER B CA  1 
ATOM 6930  C C   . SER B 1 413 ? 11.484  25.307  117.173 1.00 90.62  ? 410 SER B C   1 
ATOM 6931  O O   . SER B 1 413 ? 12.291  25.506  118.091 1.00 87.67  ? 410 SER B O   1 
ATOM 6932  C CB  . SER B 1 413 ? 11.204  27.390  115.793 1.00 101.77 ? 410 SER B CB  1 
ATOM 6933  O OG  . SER B 1 413 ? 11.499  26.788  114.540 1.00 97.05  ? 410 SER B OG  1 
ATOM 6934  N N   . PRO B 1 414 ? 11.382  24.142  116.521 1.00 93.32  ? 411 PRO B N   1 
ATOM 6935  C CA  . PRO B 1 414 ? 12.228  22.967  116.740 1.00 99.65  ? 411 PRO B CA  1 
ATOM 6936  C C   . PRO B 1 414 ? 13.634  23.199  116.193 1.00 111.23 ? 411 PRO B C   1 
ATOM 6937  O O   . PRO B 1 414 ? 14.615  22.774  116.816 1.00 83.94  ? 411 PRO B O   1 
ATOM 6938  C CB  . PRO B 1 414 ? 11.528  21.872  115.922 1.00 99.16  ? 411 PRO B CB  1 
ATOM 6939  C CG  . PRO B 1 414 ? 10.172  22.438  115.554 1.00 95.84  ? 411 PRO B CG  1 
ATOM 6940  C CD  . PRO B 1 414 ? 10.368  23.901  115.480 1.00 81.91  ? 411 PRO B CD  1 
ATOM 6941  N N   . SER B 1 415 ? 13.721  23.868  115.042 1.00 111.49 ? 412 SER B N   1 
ATOM 6942  C CA  . SER B 1 415 ? 15.000  24.194  114.418 1.00 88.26  ? 412 SER B CA  1 
ATOM 6943  C C   . SER B 1 415 ? 15.782  25.218  115.243 1.00 76.67  ? 412 SER B C   1 
ATOM 6944  O O   . SER B 1 415 ? 16.976  25.420  115.027 1.00 77.68  ? 412 SER B O   1 
ATOM 6945  C CB  . SER B 1 415 ? 14.781  24.732  113.005 1.00 83.77  ? 412 SER B CB  1 
ATOM 6946  O OG  . SER B 1 415 ? 13.958  23.876  112.238 1.00 92.99  ? 412 SER B OG  1 
ATOM 6947  N N   . LEU B 1 416 ? 15.101  25.854  116.191 1.00 57.86  ? 413 LEU B N   1 
ATOM 6948  C CA  . LEU B 1 416 ? 15.678  26.953  116.961 1.00 71.19  ? 413 LEU B CA  1 
ATOM 6949  C C   . LEU B 1 416 ? 15.792  26.680  118.462 1.00 84.20  ? 413 LEU B C   1 
ATOM 6950  O O   . LEU B 1 416 ? 14.872  26.143  119.091 1.00 93.65  ? 413 LEU B O   1 
ATOM 6951  C CB  . LEU B 1 416 ? 14.880  28.249  116.747 1.00 58.76  ? 413 LEU B CB  1 
ATOM 6952  C CG  . LEU B 1 416 ? 14.676  28.780  115.314 1.00 77.93  ? 413 LEU B CG  1 
ATOM 6953  C CD1 . LEU B 1 416 ? 13.888  30.069  115.339 1.00 53.56  ? 413 LEU B CD1 1 
ATOM 6954  C CD2 . LEU B 1 416 ? 15.988  29.001  114.560 1.00 56.56  ? 413 LEU B CD2 1 
ATOM 6955  N N   . THR B 1 417 ? 16.933  27.072  119.020 1.00 65.80  ? 414 THR B N   1 
ATOM 6956  C CA  . THR B 1 417 ? 17.141  27.072  120.457 1.00 82.80  ? 414 THR B CA  1 
ATOM 6957  C C   . THR B 1 417 ? 17.846  28.352  120.897 1.00 76.50  ? 414 THR B C   1 
ATOM 6958  O O   . THR B 1 417 ? 18.859  28.745  120.323 1.00 68.32  ? 414 THR B O   1 
ATOM 6959  C CB  . THR B 1 417 ? 17.967  25.852  120.941 1.00 79.68  ? 414 THR B CB  1 
ATOM 6960  O OG1 . THR B 1 417 ? 19.284  25.917  120.394 1.00 80.81  ? 414 THR B OG1 1 
ATOM 6961  C CG2 . THR B 1 417 ? 17.298  24.533  120.540 1.00 93.23  ? 414 THR B CG2 1 
ATOM 6962  N N   . ILE B 1 418 ? 17.301  28.996  121.923 1.00 73.44  ? 415 ILE B N   1 
ATOM 6963  C CA  . ILE B 1 418 ? 17.910  30.182  122.509 1.00 65.38  ? 415 ILE B CA  1 
ATOM 6964  C C   . ILE B 1 418 ? 19.170  29.807  123.281 1.00 75.42  ? 415 ILE B C   1 
ATOM 6965  O O   . ILE B 1 418 ? 19.115  29.012  124.205 1.00 80.45  ? 415 ILE B O   1 
ATOM 6966  C CB  . ILE B 1 418 ? 16.921  30.884  123.451 1.00 63.55  ? 415 ILE B CB  1 
ATOM 6967  C CG1 . ILE B 1 418 ? 15.633  31.231  122.687 1.00 64.34  ? 415 ILE B CG1 1 
ATOM 6968  C CG2 . ILE B 1 418 ? 17.556  32.113  124.082 1.00 61.49  ? 415 ILE B CG2 1 
ATOM 6969  C CD1 . ILE B 1 418 ? 14.627  32.025  123.490 1.00 62.72  ? 415 ILE B CD1 1 
ATOM 6970  N N   . LEU B 1 419 ? 20.310  30.365  122.896 1.00 81.45  ? 416 LEU B N   1 
ATOM 6971  C CA  . LEU B 1 419 ? 21.553  30.081  123.599 1.00 67.15  ? 416 LEU B CA  1 
ATOM 6972  C C   . LEU B 1 419 ? 21.788  31.083  124.717 1.00 81.70  ? 416 LEU B C   1 
ATOM 6973  O O   . LEU B 1 419 ? 22.530  30.812  125.658 1.00 82.57  ? 416 LEU B O   1 
ATOM 6974  C CB  . LEU B 1 419 ? 22.743  30.097  122.635 1.00 77.84  ? 416 LEU B CB  1 
ATOM 6975  C CG  . LEU B 1 419 ? 22.685  29.123  121.459 1.00 71.68  ? 416 LEU B CG  1 
ATOM 6976  C CD1 . LEU B 1 419 ? 23.937  29.241  120.623 1.00 53.38  ? 416 LEU B CD1 1 
ATOM 6977  C CD2 . LEU B 1 419 ? 22.495  27.693  121.954 1.00 66.09  ? 416 LEU B CD2 1 
ATOM 6978  N N   . ALA B 1 420 ? 21.162  32.249  124.614 1.00 77.26  ? 417 ALA B N   1 
ATOM 6979  C CA  . ALA B 1 420 ? 21.359  33.292  125.617 1.00 68.32  ? 417 ALA B CA  1 
ATOM 6980  C C   . ALA B 1 420 ? 20.269  34.340  125.534 1.00 66.67  ? 417 ALA B C   1 
ATOM 6981  O O   . ALA B 1 420 ? 19.730  34.585  124.462 1.00 83.44  ? 417 ALA B O   1 
ATOM 6982  C CB  . ALA B 1 420 ? 22.744  33.942  125.472 1.00 77.07  ? 417 ALA B CB  1 
ATOM 6983  N N   . GLY B 1 421 ? 19.957  34.948  126.678 1.00 68.43  ? 418 GLY B N   1 
ATOM 6984  C CA  . GLY B 1 421 ? 18.898  35.935  126.792 1.00 70.07  ? 418 GLY B CA  1 
ATOM 6985  C C   . GLY B 1 421 ? 17.535  35.322  126.586 1.00 77.95  ? 418 GLY B C   1 
ATOM 6986  O O   . GLY B 1 421 ? 17.354  34.145  126.867 1.00 73.97  ? 418 GLY B O   1 
ATOM 6987  N N   . GLY B 1 422 ? 16.585  36.107  126.085 1.00 80.42  ? 419 GLY B N   1 
ATOM 6988  C CA  . GLY B 1 422 ? 15.264  35.586  125.798 1.00 56.31  ? 419 GLY B CA  1 
ATOM 6989  C C   . GLY B 1 422 ? 14.203  36.221  126.679 1.00 88.10  ? 419 GLY B C   1 
ATOM 6990  O O   . GLY B 1 422 ? 13.009  36.049  126.445 1.00 66.76  ? 419 GLY B O   1 
ATOM 6991  N N   . LYS B 1 423 ? 14.638  36.951  127.704 1.00 63.40  ? 420 LYS B N   1 
ATOM 6992  C CA  . LYS B 1 423 ? 13.712  37.677  128.565 1.00 90.24  ? 420 LYS B CA  1 
ATOM 6993  C C   . LYS B 1 423 ? 13.453  39.087  128.035 1.00 77.99  ? 420 LYS B C   1 
ATOM 6994  O O   . LYS B 1 423 ? 14.316  39.682  127.400 1.00 95.00  ? 420 LYS B O   1 
ATOM 6995  C CB  . LYS B 1 423 ? 14.247  37.742  130.005 1.00 70.82  ? 420 LYS B CB  1 
ATOM 6996  N N   . CYS B 1 424 ? 12.259  39.608  128.291 1.00 68.85  ? 421 CYS B N   1 
ATOM 6997  C CA  . CYS B 1 424 ? 11.950  41.006  128.019 1.00 78.81  ? 421 CYS B CA  1 
ATOM 6998  C C   . CYS B 1 424 ? 10.980  41.539  129.069 1.00 81.52  ? 421 CYS B C   1 
ATOM 6999  O O   . CYS B 1 424 ? 10.143  40.795  129.567 1.00 79.33  ? 421 CYS B O   1 
ATOM 7000  C CB  . CYS B 1 424 ? 11.392  41.191  126.600 1.00 102.11 ? 421 CYS B CB  1 
ATOM 7001  S SG  . CYS B 1 424 ? 9.798   40.386  126.202 1.00 89.09  ? 421 CYS B SG  1 
ATOM 7002  N N   . ASP B 1 425 ? 11.096  42.824  129.403 1.00 98.66  ? 422 ASP B N   1 
ATOM 7003  C CA  . ASP B 1 425 ? 10.304  43.417  130.488 1.00 91.84  ? 422 ASP B CA  1 
ATOM 7004  C C   . ASP B 1 425 ? 9.855   44.865  130.222 1.00 84.54  ? 422 ASP B C   1 
ATOM 7005  O O   . ASP B 1 425 ? 10.648  45.806  130.296 1.00 82.48  ? 422 ASP B O   1 
ATOM 7006  C CB  . ASP B 1 425 ? 11.082  43.338  131.809 1.00 80.41  ? 422 ASP B CB  1 
ATOM 7007  C CG  . ASP B 1 425 ? 10.314  43.932  132.979 1.00 92.89  ? 422 ASP B CG  1 
ATOM 7008  O OD1 . ASP B 1 425 ? 9.074   44.091  132.873 1.00 75.67  ? 422 ASP B OD1 1 
ATOM 7009  O OD2 . ASP B 1 425 ? 10.953  44.235  134.010 1.00 92.52  ? 422 ASP B OD2 1 
ATOM 7010  N N   . ASP B 1 426 ? 8.569   45.040  129.942 1.00 68.89  ? 423 ASP B N   1 
ATOM 7011  C CA  . ASP B 1 426 ? 8.046   46.348  129.567 1.00 87.54  ? 423 ASP B CA  1 
ATOM 7012  C C   . ASP B 1 426 ? 7.333   47.077  130.708 1.00 84.15  ? 423 ASP B C   1 
ATOM 7013  O O   . ASP B 1 426 ? 6.477   47.919  130.474 1.00 84.12  ? 423 ASP B O   1 
ATOM 7014  C CB  . ASP B 1 426 ? 7.094   46.209  128.380 1.00 88.07  ? 423 ASP B CB  1 
ATOM 7015  C CG  . ASP B 1 426 ? 5.812   45.505  128.750 1.00 73.99  ? 423 ASP B CG  1 
ATOM 7016  O OD1 . ASP B 1 426 ? 5.818   44.765  129.757 1.00 93.26  ? 423 ASP B OD1 1 
ATOM 7017  O OD2 . ASP B 1 426 ? 4.802   45.696  128.041 1.00 71.10  ? 423 ASP B OD2 1 
ATOM 7018  N N   . SER B 1 427 ? 7.691   46.766  131.941 1.00 71.84  ? 424 SER B N   1 
ATOM 7019  C CA  . SER B 1 427 ? 7.043   47.386  133.090 1.00 89.54  ? 424 SER B CA  1 
ATOM 7020  C C   . SER B 1 427 ? 7.474   48.844  133.275 1.00 84.98  ? 424 SER B C   1 
ATOM 7021  O O   . SER B 1 427 ? 6.683   49.675  133.713 1.00 66.18  ? 424 SER B O   1 
ATOM 7022  C CB  . SER B 1 427 ? 7.277   46.564  134.380 1.00 79.64  ? 424 SER B CB  1 
ATOM 7023  O OG  . SER B 1 427 ? 8.652   46.337  134.658 1.00 83.91  ? 424 SER B OG  1 
ATOM 7024  N N   . VAL B 1 428 ? 8.723   49.149  132.935 1.00 77.77  ? 425 VAL B N   1 
ATOM 7025  C CA  . VAL B 1 428 ? 9.267   50.493  133.124 1.00 79.76  ? 425 VAL B CA  1 
ATOM 7026  C C   . VAL B 1 428 ? 9.650   51.121  131.781 1.00 78.30  ? 425 VAL B C   1 
ATOM 7027  O O   . VAL B 1 428 ? 9.278   52.255  131.480 1.00 70.42  ? 425 VAL B O   1 
ATOM 7028  C CB  . VAL B 1 428 ? 10.493  50.468  134.062 1.00 65.42  ? 425 VAL B CB  1 
ATOM 7029  C CG1 . VAL B 1 428 ? 11.123  51.848  134.172 1.00 54.30  ? 425 VAL B CG1 1 
ATOM 7030  C CG2 . VAL B 1 428 ? 10.087  49.966  135.414 1.00 69.74  ? 425 VAL B CG2 1 
ATOM 7031  N N   . GLY B 1 429 ? 10.409  50.369  130.993 1.00 74.10  ? 426 GLY B N   1 
ATOM 7032  C CA  . GLY B 1 429 ? 10.708  50.733  129.626 1.00 74.53  ? 426 GLY B CA  1 
ATOM 7033  C C   . GLY B 1 429 ? 10.500  49.518  128.745 1.00 79.57  ? 426 GLY B C   1 
ATOM 7034  O O   . GLY B 1 429 ? 10.179  48.448  129.244 1.00 80.90  ? 426 GLY B O   1 
ATOM 7035  N N   . TYR B 1 430 ? 10.688  49.673  127.440 1.00 78.26  ? 427 TYR B N   1 
ATOM 7036  C CA  . TYR B 1 430 ? 10.582  48.544  126.526 1.00 63.11  ? 427 TYR B CA  1 
ATOM 7037  C C   . TYR B 1 430 ? 11.878  47.763  126.481 1.00 73.22  ? 427 TYR B C   1 
ATOM 7038  O O   . TYR B 1 430 ? 12.557  47.747  125.456 1.00 65.20  ? 427 TYR B O   1 
ATOM 7039  C CB  . TYR B 1 430 ? 10.198  49.034  125.140 1.00 54.51  ? 427 TYR B CB  1 
ATOM 7040  C CG  . TYR B 1 430 ? 8.995   49.933  125.188 1.00 63.43  ? 427 TYR B CG  1 
ATOM 7041  C CD1 . TYR B 1 430 ? 7.738   49.421  125.483 1.00 68.79  ? 427 TYR B CD1 1 
ATOM 7042  C CD2 . TYR B 1 430 ? 9.116   51.300  124.969 1.00 61.17  ? 427 TYR B CD2 1 
ATOM 7043  C CE1 . TYR B 1 430 ? 6.631   50.237  125.547 1.00 63.19  ? 427 TYR B CE1 1 
ATOM 7044  C CE2 . TYR B 1 430 ? 8.014   52.133  125.031 1.00 56.44  ? 427 TYR B CE2 1 
ATOM 7045  C CZ  . TYR B 1 430 ? 6.775   51.591  125.322 1.00 78.64  ? 427 TYR B CZ  1 
ATOM 7046  O OH  . TYR B 1 430 ? 5.676   52.405  125.382 1.00 81.15  ? 427 TYR B OH  1 
ATOM 7047  N N   . PHE B 1 431 ? 12.213  47.113  127.597 1.00 67.20  ? 428 PHE B N   1 
ATOM 7048  C CA  . PHE B 1 431 ? 13.504  46.437  127.737 1.00 76.01  ? 428 PHE B CA  1 
ATOM 7049  C C   . PHE B 1 431 ? 13.521  45.009  127.218 1.00 52.33  ? 428 PHE B C   1 
ATOM 7050  O O   . PHE B 1 431 ? 12.696  44.191  127.609 1.00 88.20  ? 428 PHE B O   1 
ATOM 7051  C CB  . PHE B 1 431 ? 13.975  46.474  129.188 1.00 53.60  ? 428 PHE B CB  1 
ATOM 7052  C CG  . PHE B 1 431 ? 14.460  47.818  129.620 1.00 68.63  ? 428 PHE B CG  1 
ATOM 7053  C CD1 . PHE B 1 431 ? 15.729  48.257  129.255 1.00 64.07  ? 428 PHE B CD1 1 
ATOM 7054  C CD2 . PHE B 1 431 ? 13.655  48.646  130.374 1.00 60.44  ? 428 PHE B CD2 1 
ATOM 7055  C CE1 . PHE B 1 431 ? 16.189  49.501  129.637 1.00 64.80  ? 428 PHE B CE1 1 
ATOM 7056  C CE2 . PHE B 1 431 ? 14.114  49.894  130.764 1.00 79.16  ? 428 PHE B CE2 1 
ATOM 7057  C CZ  . PHE B 1 431 ? 15.389  50.318  130.390 1.00 60.00  ? 428 PHE B CZ  1 
ATOM 7058  N N   . VAL B 1 432 ? 14.460  44.727  126.317 1.00 80.10  ? 429 VAL B N   1 
ATOM 7059  C CA  . VAL B 1 432 ? 14.659  43.383  125.787 1.00 58.76  ? 429 VAL B CA  1 
ATOM 7060  C C   . VAL B 1 432 ? 16.095  42.987  126.066 1.00 60.53  ? 429 VAL B C   1 
ATOM 7061  O O   . VAL B 1 432 ? 17.003  43.769  125.818 1.00 71.26  ? 429 VAL B O   1 
ATOM 7062  C CB  . VAL B 1 432 ? 14.406  43.322  124.261 1.00 57.58  ? 429 VAL B CB  1 
ATOM 7063  C CG1 . VAL B 1 432 ? 14.578  41.898  123.737 1.00 54.33  ? 429 VAL B CG1 1 
ATOM 7064  C CG2 . VAL B 1 432 ? 13.024  43.840  123.934 1.00 40.75  ? 429 VAL B CG2 1 
ATOM 7065  N N   . GLU B 1 433 ? 16.290  41.783  126.602 1.00 73.71  ? 430 GLU B N   1 
ATOM 7066  C CA  . GLU B 1 433 ? 17.619  41.246  126.820 1.00 78.79  ? 430 GLU B CA  1 
ATOM 7067  C C   . GLU B 1 433 ? 18.227  40.910  125.464 1.00 76.60  ? 430 GLU B C   1 
ATOM 7068  O O   . GLU B 1 433 ? 17.530  40.447  124.557 1.00 74.79  ? 430 GLU B O   1 
ATOM 7069  C CB  . GLU B 1 433 ? 17.559  39.999  127.719 1.00 64.84  ? 430 GLU B CB  1 
ATOM 7070  N N   . PRO B 1 434 ? 19.525  41.168  125.311 1.00 59.03  ? 431 PRO B N   1 
ATOM 7071  C CA  . PRO B 1 434 ? 20.212  40.709  124.102 1.00 72.61  ? 431 PRO B CA  1 
ATOM 7072  C C   . PRO B 1 434 ? 20.004  39.217  123.977 1.00 65.08  ? 431 PRO B C   1 
ATOM 7073  O O   . PRO B 1 434 ? 20.204  38.517  124.948 1.00 58.98  ? 431 PRO B O   1 
ATOM 7074  C CB  . PRO B 1 434 ? 21.686  41.026  124.387 1.00 62.81  ? 431 PRO B CB  1 
ATOM 7075  C CG  . PRO B 1 434 ? 21.775  41.178  125.873 1.00 56.99  ? 431 PRO B CG  1 
ATOM 7076  C CD  . PRO B 1 434 ? 20.445  41.771  126.284 1.00 55.83  ? 431 PRO B CD  1 
ATOM 7077  N N   . CYS B 1 435 ? 19.606  38.739  122.808 1.00 60.40  ? 432 CYS B N   1 
ATOM 7078  C CA  . CYS B 1 435 ? 19.283  37.333  122.644 1.00 54.99  ? 432 CYS B CA  1 
ATOM 7079  C C   . CYS B 1 435 ? 20.106  36.666  121.542 1.00 61.23  ? 432 CYS B C   1 
ATOM 7080  O O   . CYS B 1 435 ? 20.302  37.241  120.473 1.00 83.57  ? 432 CYS B O   1 
ATOM 7081  C CB  . CYS B 1 435 ? 17.792  37.200  122.367 1.00 51.22  ? 432 CYS B CB  1 
ATOM 7082  S SG  . CYS B 1 435 ? 17.222  35.505  122.207 1.00 81.95  ? 432 CYS B SG  1 
ATOM 7083  N N   . ILE B 1 436 ? 20.605  35.461  121.810 1.00 67.74  ? 433 ILE B N   1 
ATOM 7084  C CA  . ILE B 1 436 ? 21.353  34.705  120.807 1.00 64.28  ? 433 ILE B CA  1 
ATOM 7085  C C   . ILE B 1 436 ? 20.664  33.378  120.538 1.00 57.68  ? 433 ILE B C   1 
ATOM 7086  O O   . ILE B 1 436 ? 20.454  32.588  121.445 1.00 77.24  ? 433 ILE B O   1 
ATOM 7087  C CB  . ILE B 1 436 ? 22.822  34.451  121.220 1.00 75.16  ? 433 ILE B CB  1 
ATOM 7088  C CG1 . ILE B 1 436 ? 23.505  35.760  121.623 1.00 73.64  ? 433 ILE B CG1 1 
ATOM 7089  C CG2 . ILE B 1 436 ? 23.597  33.769  120.086 1.00 56.73  ? 433 ILE B CG2 1 
ATOM 7090  C CD1 . ILE B 1 436 ? 24.940  35.586  122.025 1.00 65.25  ? 433 ILE B CD1 1 
ATOM 7091  N N   . VAL B 1 437 ? 20.331  33.142  119.276 1.00 70.92  ? 434 VAL B N   1 
ATOM 7092  C CA  . VAL B 1 437 ? 19.576  31.971  118.881 1.00 60.03  ? 434 VAL B CA  1 
ATOM 7093  C C   . VAL B 1 437 ? 20.393  31.162  117.904 1.00 74.97  ? 434 VAL B C   1 
ATOM 7094  O O   . VAL B 1 437 ? 21.025  31.723  117.014 1.00 93.51  ? 434 VAL B O   1 
ATOM 7095  C CB  . VAL B 1 437 ? 18.267  32.387  118.193 1.00 66.66  ? 434 VAL B CB  1 
ATOM 7096  C CG1 . VAL B 1 437 ? 17.442  31.167  117.824 1.00 66.13  ? 434 VAL B CG1 1 
ATOM 7097  C CG2 . VAL B 1 437 ? 17.474  33.357  119.089 1.00 51.12  ? 434 VAL B CG2 1 
ATOM 7098  N N   . GLU B 1 438 ? 20.398  29.844  118.069 1.00 59.80  ? 435 GLU B N   1 
ATOM 7099  C CA  . GLU B 1 438 ? 21.073  28.989  117.108 1.00 60.35  ? 435 GLU B CA  1 
ATOM 7100  C C   . GLU B 1 438 ? 20.048  28.332  116.208 1.00 66.06  ? 435 GLU B C   1 
ATOM 7101  O O   . GLU B 1 438 ? 19.019  27.864  116.675 1.00 79.62  ? 435 GLU B O   1 
ATOM 7102  C CB  . GLU B 1 438 ? 21.937  27.929  117.792 1.00 64.19  ? 435 GLU B CB  1 
ATOM 7103  C CG  . GLU B 1 438 ? 22.382  26.840  116.822 1.00 71.54  ? 435 GLU B CG  1 
ATOM 7104  C CD  . GLU B 1 438 ? 23.517  25.986  117.353 1.00 93.37  ? 435 GLU B CD  1 
ATOM 7105  O OE1 . GLU B 1 438 ? 23.812  26.060  118.566 1.00 101.72 ? 435 GLU B OE1 1 
ATOM 7106  O OE2 . GLU B 1 438 ? 24.121  25.243  116.545 1.00 73.47  ? 435 GLU B OE2 1 
ATOM 7107  N N   . SER B 1 439 ? 20.327  28.303  114.910 1.00 77.88  ? 436 SER B N   1 
ATOM 7108  C CA  . SER B 1 439 ? 19.410  27.689  113.962 1.00 69.60  ? 436 SER B CA  1 
ATOM 7109  C C   . SER B 1 439 ? 20.062  26.492  113.318 1.00 77.12  ? 436 SER B C   1 
ATOM 7110  O O   . SER B 1 439 ? 21.230  26.543  112.930 1.00 84.64  ? 436 SER B O   1 
ATOM 7111  C CB  . SER B 1 439 ? 18.999  28.685  112.879 1.00 64.78  ? 436 SER B CB  1 
ATOM 7112  O OG  . SER B 1 439 ? 17.917  28.183  112.115 1.00 67.71  ? 436 SER B OG  1 
ATOM 7113  N N   . LYS B 1 440 ? 19.307  25.407  113.215 1.00 80.89  ? 437 LYS B N   1 
ATOM 7114  C CA  . LYS B 1 440 ? 19.797  24.216  112.537 1.00 98.42  ? 437 LYS B CA  1 
ATOM 7115  C C   . LYS B 1 440 ? 19.411  24.310  111.079 1.00 84.46  ? 437 LYS B C   1 
ATOM 7116  O O   . LYS B 1 440 ? 19.924  23.577  110.239 1.00 77.90  ? 437 LYS B O   1 
ATOM 7117  C CB  . LYS B 1 440 ? 19.191  22.960  113.154 1.00 81.42  ? 437 LYS B CB  1 
ATOM 7118  C CG  . LYS B 1 440 ? 19.524  22.782  114.619 1.00 65.22  ? 437 LYS B CG  1 
ATOM 7119  C CD  . LYS B 1 440 ? 21.017  22.749  114.814 1.00 61.01  ? 437 LYS B CD  1 
ATOM 7120  C CE  . LYS B 1 440 ? 21.334  22.519  116.280 1.00 83.57  ? 437 LYS B CE  1 
ATOM 7121  N NZ  . LYS B 1 440 ? 22.790  22.679  116.493 1.00 101.75 ? 437 LYS B NZ  1 
ATOM 7122  N N   . ASP B 1 441 ? 18.497  25.231  110.797 1.00 76.17  ? 438 ASP B N   1 
ATOM 7123  C CA  . ASP B 1 441 ? 17.964  25.425  109.455 1.00 80.52  ? 438 ASP B CA  1 
ATOM 7124  C C   . ASP B 1 441 ? 18.319  26.818  108.953 1.00 81.37  ? 438 ASP B C   1 
ATOM 7125  O O   . ASP B 1 441 ? 17.795  27.815  109.453 1.00 73.97  ? 438 ASP B O   1 
ATOM 7126  C CB  . ASP B 1 441 ? 16.445  25.233  109.463 1.00 67.18  ? 438 ASP B CB  1 
ATOM 7127  C CG  . ASP B 1 441 ? 15.799  25.565  108.126 1.00 89.95  ? 438 ASP B CG  1 
ATOM 7128  O OD1 . ASP B 1 441 ? 16.484  25.504  107.077 1.00 76.92  ? 438 ASP B OD1 1 
ATOM 7129  O OD2 . ASP B 1 441 ? 14.590  25.883  108.133 1.00 86.80  ? 438 ASP B OD2 1 
ATOM 7130  N N   . PRO B 1 442 ? 19.195  26.886  107.944 1.00 62.32  ? 439 PRO B N   1 
ATOM 7131  C CA  . PRO B 1 442 ? 19.725  28.157  107.432 1.00 67.11  ? 439 PRO B CA  1 
ATOM 7132  C C   . PRO B 1 442 ? 18.693  28.972  106.637 1.00 67.66  ? 439 PRO B C   1 
ATOM 7133  O O   . PRO B 1 442 ? 18.972  30.113  106.289 1.00 73.61  ? 439 PRO B O   1 
ATOM 7134  C CB  . PRO B 1 442 ? 20.903  27.713  106.560 1.00 57.99  ? 439 PRO B CB  1 
ATOM 7135  C CG  . PRO B 1 442 ? 20.575  26.322  106.135 1.00 54.88  ? 439 PRO B CG  1 
ATOM 7136  C CD  . PRO B 1 442 ? 19.603  25.734  107.124 1.00 60.28  ? 439 PRO B CD  1 
ATOM 7137  N N   . GLN B 1 443 ? 17.518  28.395  106.389 1.00 76.76  ? 440 GLN B N   1 
ATOM 7138  C CA  . GLN B 1 443 ? 16.428  29.067  105.673 1.00 79.32  ? 440 GLN B CA  1 
ATOM 7139  C C   . GLN B 1 443 ? 15.228  29.332  106.575 1.00 64.33  ? 440 GLN B C   1 
ATOM 7140  O O   . GLN B 1 443 ? 14.124  29.596  106.088 1.00 72.18  ? 440 GLN B O   1 
ATOM 7141  C CB  . GLN B 1 443 ? 15.953  28.216  104.496 1.00 76.19  ? 440 GLN B CB  1 
ATOM 7142  C CG  . GLN B 1 443 ? 17.048  27.728  103.592 1.00 89.62  ? 440 GLN B CG  1 
ATOM 7143  C CD  . GLN B 1 443 ? 17.407  28.747  102.541 1.00 92.52  ? 440 GLN B CD  1 
ATOM 7144  O OE1 . GLN B 1 443 ? 16.850  29.846  102.508 1.00 106.71 ? 440 GLN B OE1 1 
ATOM 7145  N NE2 . GLN B 1 443 ? 18.340  28.388  101.666 1.00 86.57  ? 440 GLN B NE2 1 
ATOM 7146  N N   . GLU B 1 444 ? 15.436  29.231  107.883 1.00 73.53  ? 441 GLU B N   1 
ATOM 7147  C CA  . GLU B 1 444 ? 14.375  29.508  108.851 1.00 76.31  ? 441 GLU B CA  1 
ATOM 7148  C C   . GLU B 1 444 ? 13.976  30.982  108.765 1.00 62.56  ? 441 GLU B C   1 
ATOM 7149  O O   . GLU B 1 444 ? 14.823  31.836  108.529 1.00 81.05  ? 441 GLU B O   1 
ATOM 7150  C CB  . GLU B 1 444 ? 14.844  29.163  110.271 1.00 67.86  ? 441 GLU B CB  1 
ATOM 7151  C CG  . GLU B 1 444 ? 13.885  28.269  111.076 1.00 77.19  ? 441 GLU B CG  1 
ATOM 7152  C CD  . GLU B 1 444 ? 12.836  29.050  111.857 1.00 85.67  ? 441 GLU B CD  1 
ATOM 7153  O OE1 . GLU B 1 444 ? 13.003  30.277  112.013 1.00 87.28  ? 441 GLU B OE1 1 
ATOM 7154  O OE2 . GLU B 1 444 ? 11.839  28.441  112.315 1.00 86.33  ? 441 GLU B OE2 1 
ATOM 7155  N N   . PRO B 1 445 ? 12.678  31.281  108.943 1.00 67.96  ? 442 PRO B N   1 
ATOM 7156  C CA  . PRO B 1 445 ? 12.145  32.649  108.946 1.00 75.50  ? 442 PRO B CA  1 
ATOM 7157  C C   . PRO B 1 445 ? 12.970  33.646  109.759 1.00 75.33  ? 442 PRO B C   1 
ATOM 7158  O O   . PRO B 1 445 ? 13.012  34.829  109.412 1.00 73.65  ? 442 PRO B O   1 
ATOM 7159  C CB  . PRO B 1 445 ? 10.754  32.472  109.572 1.00 50.77  ? 442 PRO B CB  1 
ATOM 7160  C CG  . PRO B 1 445 ? 10.335  31.137  109.088 1.00 65.15  ? 442 PRO B CG  1 
ATOM 7161  C CD  . PRO B 1 445 ? 11.596  30.285  109.006 1.00 66.54  ? 442 PRO B CD  1 
ATOM 7162  N N   . ILE B 1 446 ? 13.617  33.184  110.821 1.00 55.38  ? 443 ILE B N   1 
ATOM 7163  C CA  . ILE B 1 446 ? 14.407  34.081  111.661 1.00 61.99  ? 443 ILE B CA  1 
ATOM 7164  C C   . ILE B 1 446 ? 15.759  34.393  111.033 1.00 59.58  ? 443 ILE B C   1 
ATOM 7165  O O   . ILE B 1 446 ? 16.419  35.348  111.431 1.00 60.66  ? 443 ILE B O   1 
ATOM 7166  C CB  . ILE B 1 446 ? 14.580  33.530  113.105 1.00 62.68  ? 443 ILE B CB  1 
ATOM 7167  C CG1 . ILE B 1 446 ? 14.948  34.648  114.073 1.00 64.36  ? 443 ILE B CG1 1 
ATOM 7168  C CG2 . ILE B 1 446 ? 15.622  32.459  113.157 1.00 37.38  ? 443 ILE B CG2 1 
ATOM 7169  C CD1 . ILE B 1 446 ? 15.055  34.201  115.523 1.00 45.92  ? 443 ILE B CD1 1 
ATOM 7170  N N   . MET B 1 447 ? 16.165  33.577  110.058 1.00 64.68  ? 444 MET B N   1 
ATOM 7171  C CA  . MET B 1 447 ? 17.360  33.838  109.254 1.00 54.34  ? 444 MET B CA  1 
ATOM 7172  C C   . MET B 1 447 ? 17.040  34.766  108.052 1.00 72.20  ? 444 MET B C   1 
ATOM 7173  O O   . MET B 1 447 ? 17.949  35.301  107.410 1.00 59.68  ? 444 MET B O   1 
ATOM 7174  C CB  . MET B 1 447 ? 18.015  32.519  108.774 1.00 55.67  ? 444 MET B CB  1 
ATOM 7175  C CG  . MET B 1 447 ? 18.585  31.610  109.887 1.00 55.88  ? 444 MET B CG  1 
ATOM 7176  S SD  . MET B 1 447 ? 20.140  32.189  110.593 1.00 46.67  ? 444 MET B SD  1 
ATOM 7177  C CE  . MET B 1 447 ? 21.239  31.886  109.225 1.00 42.60  ? 444 MET B CE  1 
ATOM 7178  N N   . LYS B 1 448 ? 15.751  34.968  107.775 1.00 61.65  ? 445 LYS B N   1 
ATOM 7179  C CA  . LYS B 1 448 ? 15.304  35.700  106.586 1.00 66.05  ? 445 LYS B CA  1 
ATOM 7180  C C   . LYS B 1 448 ? 14.557  37.024  106.848 1.00 71.69  ? 445 LYS B C   1 
ATOM 7181  O O   . LYS B 1 448 ? 14.712  37.980  106.096 1.00 65.97  ? 445 LYS B O   1 
ATOM 7182  C CB  . LYS B 1 448 ? 14.437  34.795  105.693 1.00 54.14  ? 445 LYS B CB  1 
ATOM 7183  C CG  . LYS B 1 448 ? 15.111  33.492  105.306 1.00 78.01  ? 445 LYS B CG  1 
ATOM 7184  C CD  . LYS B 1 448 ? 14.635  32.980  103.956 1.00 74.86  ? 445 LYS B CD  1 
ATOM 7185  C CE  . LYS B 1 448 ? 13.235  32.452  103.993 1.00 73.72  ? 445 LYS B CE  1 
ATOM 7186  N NZ  . LYS B 1 448 ? 13.037  31.637  102.769 1.00 84.02  ? 445 LYS B NZ  1 
ATOM 7187  N N   . GLU B 1 449 ? 13.750  37.076  107.903 1.00 68.72  ? 446 GLU B N   1 
ATOM 7188  C CA  . GLU B 1 449 ? 12.910  38.238  108.172 1.00 63.87  ? 446 GLU B CA  1 
ATOM 7189  C C   . GLU B 1 449 ? 13.571  39.237  109.158 1.00 57.86  ? 446 GLU B C   1 
ATOM 7190  O O   . GLU B 1 449 ? 14.182  38.829  110.132 1.00 63.26  ? 446 GLU B O   1 
ATOM 7191  C CB  . GLU B 1 449 ? 11.518  37.771  108.648 1.00 44.18  ? 446 GLU B CB  1 
ATOM 7192  N N   . GLU B 1 450 ? 13.460  40.541  108.887 1.00 60.68  ? 447 GLU B N   1 
ATOM 7193  C CA  . GLU B 1 450 ? 14.096  41.585  109.711 1.00 50.74  ? 447 GLU B CA  1 
ATOM 7194  C C   . GLU B 1 450 ? 13.374  41.849  111.030 1.00 54.77  ? 447 GLU B C   1 
ATOM 7195  O O   . GLU B 1 450 ? 12.200  42.209  111.027 1.00 59.14  ? 447 GLU B O   1 
ATOM 7196  C CB  . GLU B 1 450 ? 14.167  42.897  108.933 1.00 48.08  ? 447 GLU B CB  1 
ATOM 7197  C CG  . GLU B 1 450 ? 14.963  43.998  109.629 1.00 65.48  ? 447 GLU B CG  1 
ATOM 7198  C CD  . GLU B 1 450 ? 14.933  45.329  108.873 1.00 92.99  ? 447 GLU B CD  1 
ATOM 7199  O OE1 . GLU B 1 450 ? 13.873  45.652  108.282 1.00 68.47  ? 447 GLU B OE1 1 
ATOM 7200  O OE2 . GLU B 1 450 ? 15.969  46.050  108.872 1.00 55.99  ? 447 GLU B OE2 1 
ATOM 7201  N N   . ILE B 1 451 ? 14.080  41.708  112.151 1.00 61.56  ? 448 ILE B N   1 
ATOM 7202  C CA  . ILE B 1 451 ? 13.467  41.832  113.476 1.00 41.82  ? 448 ILE B CA  1 
ATOM 7203  C C   . ILE B 1 451 ? 13.519  43.258  114.062 1.00 74.85  ? 448 ILE B C   1 
ATOM 7204  O O   . ILE B 1 451 ? 12.579  43.714  114.752 1.00 42.57  ? 448 ILE B O   1 
ATOM 7205  C CB  . ILE B 1 451 ? 14.098  40.844  114.469 1.00 51.56  ? 448 ILE B CB  1 
ATOM 7206  C CG1 . ILE B 1 451 ? 13.898  39.410  113.986 1.00 52.16  ? 448 ILE B CG1 1 
ATOM 7207  C CG2 . ILE B 1 451 ? 13.481  40.994  115.844 1.00 44.27  ? 448 ILE B CG2 1 
ATOM 7208  C CD1 . ILE B 1 451 ? 14.640  38.411  114.814 1.00 58.94  ? 448 ILE B CD1 1 
ATOM 7209  N N   . PHE B 1 452 ? 14.615  43.957  113.775 1.00 43.70  ? 449 PHE B N   1 
ATOM 7210  C CA  . PHE B 1 452 ? 14.860  45.294  114.315 1.00 69.35  ? 449 PHE B CA  1 
ATOM 7211  C C   . PHE B 1 452 ? 14.832  45.310  115.841 1.00 61.50  ? 449 PHE B C   1 
ATOM 7212  O O   . PHE B 1 452 ? 14.269  46.223  116.464 1.00 66.94  ? 449 PHE B O   1 
ATOM 7213  C CB  . PHE B 1 452 ? 13.903  46.338  113.714 1.00 51.06  ? 449 PHE B CB  1 
ATOM 7214  C CG  . PHE B 1 452 ? 14.612  47.548  113.155 1.00 70.98  ? 449 PHE B CG  1 
ATOM 7215  C CD1 . PHE B 1 452 ? 14.507  48.791  113.780 1.00 65.24  ? 449 PHE B CD1 1 
ATOM 7216  C CD2 . PHE B 1 452 ? 15.404  47.437  112.013 1.00 66.42  ? 449 PHE B CD2 1 
ATOM 7217  C CE1 . PHE B 1 452 ? 15.165  49.908  113.272 1.00 72.62  ? 449 PHE B CE1 1 
ATOM 7218  C CE2 . PHE B 1 452 ? 16.066  48.546  111.493 1.00 53.47  ? 449 PHE B CE2 1 
ATOM 7219  C CZ  . PHE B 1 452 ? 15.947  49.786  112.123 1.00 66.38  ? 449 PHE B CZ  1 
ATOM 7220  N N   . GLY B 1 453 ? 15.457  44.282  116.420 1.00 59.45  ? 450 GLY B N   1 
ATOM 7221  C CA  . GLY B 1 453 ? 15.641  44.165  117.850 1.00 63.63  ? 450 GLY B CA  1 
ATOM 7222  C C   . GLY B 1 453 ? 16.943  43.441  118.093 1.00 65.80  ? 450 GLY B C   1 
ATOM 7223  O O   . GLY B 1 453 ? 17.574  43.014  117.132 1.00 68.67  ? 450 GLY B O   1 
ATOM 7224  N N   . PRO B 1 454 ? 17.343  43.285  119.371 1.00 69.19  ? 451 PRO B N   1 
ATOM 7225  C CA  . PRO B 1 454 ? 18.639  42.684  119.721 1.00 61.69  ? 451 PRO B CA  1 
ATOM 7226  C C   . PRO B 1 454 ? 18.599  41.165  119.655 1.00 68.21  ? 451 PRO B C   1 
ATOM 7227  O O   . PRO B 1 454 ? 18.753  40.510  120.669 1.00 64.21  ? 451 PRO B O   1 
ATOM 7228  C CB  . PRO B 1 454 ? 18.852  43.133  121.168 1.00 45.99  ? 451 PRO B CB  1 
ATOM 7229  C CG  . PRO B 1 454 ? 17.484  43.259  121.712 1.00 62.06  ? 451 PRO B CG  1 
ATOM 7230  C CD  . PRO B 1 454 ? 16.582  43.689  120.568 1.00 51.15  ? 451 PRO B CD  1 
ATOM 7231  N N   . VAL B 1 455 ? 18.397  40.620  118.465 1.00 65.66  ? 452 VAL B N   1 
ATOM 7232  C CA  . VAL B 1 455 ? 18.257  39.182  118.289 1.00 61.49  ? 452 VAL B CA  1 
ATOM 7233  C C   . VAL B 1 455 ? 19.196  38.641  117.211 1.00 50.79  ? 452 VAL B C   1 
ATOM 7234  O O   . VAL B 1 455 ? 18.963  38.833  116.009 1.00 76.82  ? 452 VAL B O   1 
ATOM 7235  C CB  . VAL B 1 455 ? 16.816  38.832  117.908 1.00 68.93  ? 452 VAL B CB  1 
ATOM 7236  C CG1 . VAL B 1 455 ? 16.647  37.326  117.793 1.00 53.67  ? 452 VAL B CG1 1 
ATOM 7237  C CG2 . VAL B 1 455 ? 15.843  39.439  118.920 1.00 52.06  ? 452 VAL B CG2 1 
ATOM 7238  N N   . LEU B 1 456 ? 20.254  37.964  117.651 1.00 54.85  ? 453 LEU B N   1 
ATOM 7239  C CA  . LEU B 1 456 ? 21.253  37.385  116.752 1.00 59.14  ? 453 LEU B CA  1 
ATOM 7240  C C   . LEU B 1 456 ? 21.042  35.890  116.459 1.00 66.81  ? 453 LEU B C   1 
ATOM 7241  O O   . LEU B 1 456 ? 21.091  35.057  117.366 1.00 84.23  ? 453 LEU B O   1 
ATOM 7242  C CB  . LEU B 1 456 ? 22.659  37.593  117.323 1.00 51.29  ? 453 LEU B CB  1 
ATOM 7243  C CG  . LEU B 1 456 ? 23.766  36.914  116.515 1.00 65.61  ? 453 LEU B CG  1 
ATOM 7244  C CD1 . LEU B 1 456 ? 23.949  37.565  115.142 1.00 60.20  ? 453 LEU B CD1 1 
ATOM 7245  C CD2 . LEU B 1 456 ? 25.049  36.964  117.290 1.00 56.33  ? 453 LEU B CD2 1 
ATOM 7246  N N   . SER B 1 457 ? 20.833  35.554  115.191 1.00 47.09  ? 454 SER B N   1 
ATOM 7247  C CA  . SER B 1 457 ? 20.689  34.161  114.773 1.00 59.78  ? 454 SER B CA  1 
ATOM 7248  C C   . SER B 1 457 ? 21.999  33.584  114.257 1.00 59.90  ? 454 SER B C   1 
ATOM 7249  O O   . SER B 1 457 ? 22.667  34.196  113.441 1.00 63.57  ? 454 SER B O   1 
ATOM 7250  C CB  . SER B 1 457 ? 19.630  34.028  113.680 1.00 61.41  ? 454 SER B CB  1 
ATOM 7251  O OG  . SER B 1 457 ? 18.396  34.557  114.104 1.00 68.92  ? 454 SER B OG  1 
ATOM 7252  N N   . VAL B 1 458 ? 22.344  32.387  114.721 1.00 77.46  ? 455 VAL B N   1 
ATOM 7253  C CA  . VAL B 1 458 ? 23.590  31.739  114.331 1.00 62.10  ? 455 VAL B CA  1 
ATOM 7254  C C   . VAL B 1 458 ? 23.348  30.429  113.593 1.00 62.85  ? 455 VAL B C   1 
ATOM 7255  O O   . VAL B 1 458 ? 22.525  29.612  113.996 1.00 71.00  ? 455 VAL B O   1 
ATOM 7256  C CB  . VAL B 1 458 ? 24.422  31.429  115.555 1.00 59.04  ? 455 VAL B CB  1 
ATOM 7257  C CG1 . VAL B 1 458 ? 25.800  30.966  115.142 1.00 49.02  ? 455 VAL B CG1 1 
ATOM 7258  C CG2 . VAL B 1 458 ? 24.473  32.637  116.452 1.00 45.66  ? 455 VAL B CG2 1 
ATOM 7259  N N   . TYR B 1 459 ? 24.075  30.234  112.508 1.00 62.22  ? 456 TYR B N   1 
ATOM 7260  C CA  . TYR B 1 459 ? 24.047  28.974  111.791 1.00 54.57  ? 456 TYR B CA  1 
ATOM 7261  C C   . TYR B 1 459 ? 25.460  28.429  111.702 1.00 71.65  ? 456 TYR B C   1 
ATOM 7262  O O   . TYR B 1 459 ? 26.361  29.101  111.213 1.00 67.15  ? 456 TYR B O   1 
ATOM 7263  C CB  . TYR B 1 459 ? 23.454  29.144  110.392 1.00 41.50  ? 456 TYR B CB  1 
ATOM 7264  C CG  . TYR B 1 459 ? 23.555  27.889  109.546 1.00 67.29  ? 456 TYR B CG  1 
ATOM 7265  C CD1 . TYR B 1 459 ? 22.742  26.790  109.801 1.00 76.38  ? 456 TYR B CD1 1 
ATOM 7266  C CD2 . TYR B 1 459 ? 24.464  27.798  108.498 1.00 57.97  ? 456 TYR B CD2 1 
ATOM 7267  C CE1 . TYR B 1 459 ? 22.827  25.638  109.035 1.00 67.92  ? 456 TYR B CE1 1 
ATOM 7268  C CE2 . TYR B 1 459 ? 24.558  26.651  107.725 1.00 68.13  ? 456 TYR B CE2 1 
ATOM 7269  C CZ  . TYR B 1 459 ? 23.738  25.574  108.002 1.00 83.70  ? 456 TYR B CZ  1 
ATOM 7270  O OH  . TYR B 1 459 ? 23.833  24.433  107.241 1.00 74.77  ? 456 TYR B OH  1 
ATOM 7271  N N   . VAL B 1 460 ? 25.648  27.214  112.199 1.00 76.16  ? 457 VAL B N   1 
ATOM 7272  C CA  . VAL B 1 460 ? 26.947  26.575  112.166 1.00 64.82  ? 457 VAL B CA  1 
ATOM 7273  C C   . VAL B 1 460 ? 27.050  25.692  110.936 1.00 71.11  ? 457 VAL B C   1 
ATOM 7274  O O   . VAL B 1 460 ? 26.200  24.842  110.712 1.00 75.53  ? 457 VAL B O   1 
ATOM 7275  C CB  . VAL B 1 460 ? 27.169  25.762  113.434 1.00 64.51  ? 457 VAL B CB  1 
ATOM 7276  C CG1 . VAL B 1 460 ? 28.557  25.144  113.436 1.00 74.82  ? 457 VAL B CG1 1 
ATOM 7277  C CG2 . VAL B 1 460 ? 26.999  26.662  114.623 1.00 60.46  ? 457 VAL B CG2 1 
ATOM 7278  N N   . TYR B 1 461 ? 28.087  25.910  110.132 1.00 53.41  ? 458 TYR B N   1 
ATOM 7279  C CA  . TYR B 1 461 ? 28.239  25.195  108.870 1.00 67.85  ? 458 TYR B CA  1 
ATOM 7280  C C   . TYR B 1 461 ? 29.489  24.286  108.876 1.00 62.77  ? 458 TYR B C   1 
ATOM 7281  O O   . TYR B 1 461 ? 30.476  24.560  109.552 1.00 66.86  ? 458 TYR B O   1 
ATOM 7282  C CB  . TYR B 1 461 ? 28.235  26.192  107.679 1.00 59.91  ? 458 TYR B CB  1 
ATOM 7283  C CG  . TYR B 1 461 ? 29.507  27.021  107.524 1.00 61.32  ? 458 TYR B CG  1 
ATOM 7284  C CD1 . TYR B 1 461 ? 30.579  26.547  106.768 1.00 61.71  ? 458 TYR B CD1 1 
ATOM 7285  C CD2 . TYR B 1 461 ? 29.642  28.265  108.136 1.00 55.72  ? 458 TYR B CD2 1 
ATOM 7286  C CE1 . TYR B 1 461 ? 31.750  27.283  106.631 1.00 69.29  ? 458 TYR B CE1 1 
ATOM 7287  C CE2 . TYR B 1 461 ? 30.822  29.010  108.002 1.00 64.22  ? 458 TYR B CE2 1 
ATOM 7288  C CZ  . TYR B 1 461 ? 31.873  28.508  107.255 1.00 46.56  ? 458 TYR B CZ  1 
ATOM 7289  O OH  . TYR B 1 461 ? 33.042  29.233  107.110 1.00 65.94  ? 458 TYR B OH  1 
ATOM 7290  N N   . PRO B 1 462 ? 29.441  23.189  108.126 1.00 69.19  ? 459 PRO B N   1 
ATOM 7291  C CA  . PRO B 1 462 ? 30.606  22.307  108.003 1.00 62.93  ? 459 PRO B CA  1 
ATOM 7292  C C   . PRO B 1 462 ? 31.736  22.949  107.191 1.00 88.22  ? 459 PRO B C   1 
ATOM 7293  O O   . PRO B 1 462 ? 31.483  23.422  106.072 1.00 74.45  ? 459 PRO B O   1 
ATOM 7294  C CB  . PRO B 1 462 ? 30.045  21.096  107.245 1.00 79.37  ? 459 PRO B CB  1 
ATOM 7295  C CG  . PRO B 1 462 ? 28.545  21.219  107.343 1.00 78.10  ? 459 PRO B CG  1 
ATOM 7296  C CD  . PRO B 1 462 ? 28.282  22.683  107.379 1.00 78.94  ? 459 PRO B CD  1 
ATOM 7297  N N   . ASP B 1 463 ? 32.951  22.951  107.741 1.00 70.68  ? 460 ASP B N   1 
ATOM 7298  C CA  . ASP B 1 463 ? 34.114  23.550  107.081 1.00 68.31  ? 460 ASP B CA  1 
ATOM 7299  C C   . ASP B 1 463 ? 34.266  23.174  105.606 1.00 75.23  ? 460 ASP B C   1 
ATOM 7300  O O   . ASP B 1 463 ? 34.569  24.023  104.769 1.00 68.34  ? 460 ASP B O   1 
ATOM 7301  C CB  . ASP B 1 463 ? 35.400  23.184  107.820 1.00 70.24  ? 460 ASP B CB  1 
ATOM 7302  C CG  . ASP B 1 463 ? 35.495  23.822  109.189 1.00 101.38 ? 460 ASP B CG  1 
ATOM 7303  O OD1 . ASP B 1 463 ? 34.677  23.461  110.082 1.00 81.78  ? 460 ASP B OD1 1 
ATOM 7304  O OD2 . ASP B 1 463 ? 36.407  24.666  109.367 1.00 93.29  ? 460 ASP B OD2 1 
ATOM 7305  N N   . ASP B 1 464 ? 34.067  21.894  105.302 1.00 88.13  ? 461 ASP B N   1 
ATOM 7306  C CA  . ASP B 1 464 ? 34.215  21.375  103.941 1.00 99.82  ? 461 ASP B CA  1 
ATOM 7307  C C   . ASP B 1 464 ? 33.177  21.954  102.981 1.00 101.62 ? 461 ASP B C   1 
ATOM 7308  O O   . ASP B 1 464 ? 33.334  21.893  101.755 1.00 92.03  ? 461 ASP B O   1 
ATOM 7309  C CB  . ASP B 1 464 ? 34.127  19.844  103.945 1.00 67.58  ? 461 ASP B CB  1 
ATOM 7310  C CG  . ASP B 1 464 ? 33.023  19.318  104.868 1.00 105.83 ? 461 ASP B CG  1 
ATOM 7311  O OD1 . ASP B 1 464 ? 33.254  19.252  106.098 1.00 107.75 ? 461 ASP B OD1 1 
ATOM 7312  O OD2 . ASP B 1 464 ? 31.932  18.958  104.369 1.00 98.71  ? 461 ASP B OD2 1 
ATOM 7313  N N   . LYS B 1 465 ? 32.115  22.514  103.549 1.00 72.74  ? 462 LYS B N   1 
ATOM 7314  C CA  . LYS B 1 465 ? 31.013  23.049  102.765 1.00 84.86  ? 462 LYS B CA  1 
ATOM 7315  C C   . LYS B 1 465 ? 30.961  24.592  102.788 1.00 91.16  ? 462 LYS B C   1 
ATOM 7316  O O   . LYS B 1 465 ? 29.899  25.189  102.628 1.00 72.85  ? 462 LYS B O   1 
ATOM 7317  C CB  . LYS B 1 465 ? 29.679  22.451  103.253 1.00 70.85  ? 462 LYS B CB  1 
ATOM 7318  C CG  . LYS B 1 465 ? 29.281  21.109  102.640 1.00 66.54  ? 462 LYS B CG  1 
ATOM 7319  C CD  . LYS B 1 465 ? 27.887  20.693  103.100 1.00 65.02  ? 462 LYS B CD  1 
ATOM 7320  N N   . TYR B 1 466 ? 32.102  25.246  102.970 1.00 72.46  ? 463 TYR B N   1 
ATOM 7321  C CA  . TYR B 1 466 ? 32.102  26.704  103.060 1.00 77.90  ? 463 TYR B CA  1 
ATOM 7322  C C   . TYR B 1 466 ? 31.804  27.415  101.732 1.00 76.45  ? 463 TYR B C   1 
ATOM 7323  O O   . TYR B 1 466 ? 31.220  28.495  101.725 1.00 68.62  ? 463 TYR B O   1 
ATOM 7324  C CB  . TYR B 1 466 ? 33.407  27.224  103.666 1.00 44.00  ? 463 TYR B CB  1 
ATOM 7325  C CG  . TYR B 1 466 ? 34.422  27.673  102.641 1.00 82.83  ? 463 TYR B CG  1 
ATOM 7326  C CD1 . TYR B 1 466 ? 34.395  28.965  102.121 1.00 67.23  ? 463 TYR B CD1 1 
ATOM 7327  C CD2 . TYR B 1 466 ? 35.418  26.807  102.198 1.00 81.71  ? 463 TYR B CD2 1 
ATOM 7328  C CE1 . TYR B 1 466 ? 35.338  29.381  101.184 1.00 84.01  ? 463 TYR B CE1 1 
ATOM 7329  C CE2 . TYR B 1 466 ? 36.364  27.212  101.269 1.00 78.43  ? 463 TYR B CE2 1 
ATOM 7330  C CZ  . TYR B 1 466 ? 36.321  28.496  100.763 1.00 101.34 ? 463 TYR B CZ  1 
ATOM 7331  O OH  . TYR B 1 466 ? 37.262  28.889  99.832  1.00 88.64  ? 463 TYR B OH  1 
ATOM 7332  N N   . LYS B 1 467 ? 32.205  26.826  100.611 1.00 87.85  ? 464 LYS B N   1 
ATOM 7333  C CA  . LYS B 1 467 ? 31.892  27.431  99.313  1.00 70.78  ? 464 LYS B CA  1 
ATOM 7334  C C   . LYS B 1 467 ? 30.390  27.506  99.064  1.00 70.87  ? 464 LYS B C   1 
ATOM 7335  O O   . LYS B 1 467 ? 29.886  28.525  98.592  1.00 86.90  ? 464 LYS B O   1 
ATOM 7336  C CB  . LYS B 1 467 ? 32.573  26.684  98.168  1.00 56.57  ? 464 LYS B CB  1 
ATOM 7337  C CG  . LYS B 1 467 ? 34.086  26.838  98.147  1.00 87.18  ? 464 LYS B CG  1 
ATOM 7338  C CD  . LYS B 1 467 ? 34.731  25.845  97.190  1.00 71.16  ? 464 LYS B CD  1 
ATOM 7339  C CE  . LYS B 1 467 ? 36.202  26.150  96.991  1.00 82.16  ? 464 LYS B CE  1 
ATOM 7340  N NZ  . LYS B 1 467 ? 36.412  27.460  96.305  1.00 81.41  ? 464 LYS B NZ  1 
ATOM 7341  N N   . GLU B 1 468 ? 29.684  26.423  99.382  1.00 68.82  ? 465 GLU B N   1 
ATOM 7342  C CA  . GLU B 1 468 ? 28.230  26.351  99.224  1.00 75.97  ? 465 GLU B CA  1 
ATOM 7343  C C   . GLU B 1 468 ? 27.510  27.217  100.248 1.00 84.19  ? 465 GLU B C   1 
ATOM 7344  O O   . GLU B 1 468 ? 26.401  27.704  99.988  1.00 65.30  ? 465 GLU B O   1 
ATOM 7345  C CB  . GLU B 1 468 ? 27.731  24.897  99.316  1.00 71.93  ? 465 GLU B CB  1 
ATOM 7346  C CG  . GLU B 1 468 ? 28.660  23.951  100.088 1.00 104.33 ? 465 GLU B CG  1 
ATOM 7347  C CD  . GLU B 1 468 ? 29.754  23.335  99.217  1.00 106.84 ? 465 GLU B CD  1 
ATOM 7348  O OE1 . GLU B 1 468 ? 29.406  22.545  98.317  1.00 110.00 ? 465 GLU B OE1 1 
ATOM 7349  O OE2 . GLU B 1 468 ? 30.956  23.630  99.431  1.00 92.89  ? 465 GLU B OE2 1 
ATOM 7350  N N   . THR B 1 469 ? 28.139  27.406  101.410 1.00 69.37  ? 466 THR B N   1 
ATOM 7351  C CA  . THR B 1 469 ? 27.575  28.266  102.457 1.00 69.70  ? 466 THR B CA  1 
ATOM 7352  C C   . THR B 1 469 ? 27.668  29.753  102.071 1.00 74.50  ? 466 THR B C   1 
ATOM 7353  O O   . THR B 1 469 ? 26.760  30.530  102.369 1.00 51.34  ? 466 THR B O   1 
ATOM 7354  C CB  . THR B 1 469 ? 28.212  27.991  103.842 1.00 66.05  ? 466 THR B CB  1 
ATOM 7355  O OG1 . THR B 1 469 ? 28.012  26.618  104.176 1.00 67.27  ? 466 THR B OG1 1 
ATOM 7356  C CG2 . THR B 1 469 ? 27.559  28.836  104.938 1.00 45.62  ? 466 THR B CG2 1 
ATOM 7357  N N   . LEU B 1 470 ? 28.757  30.137  101.400 1.00 62.75  ? 467 LEU B N   1 
ATOM 7358  C CA  . LEU B 1 470 ? 28.835  31.452  100.751 1.00 66.02  ? 467 LEU B CA  1 
ATOM 7359  C C   . LEU B 1 470 ? 27.608  31.688  99.877  1.00 71.58  ? 467 LEU B C   1 
ATOM 7360  O O   . LEU B 1 470 ? 26.975  32.731  99.966  1.00 69.74  ? 467 LEU B O   1 
ATOM 7361  C CB  . LEU B 1 470 ? 30.099  31.599  99.901  1.00 60.37  ? 467 LEU B CB  1 
ATOM 7362  C CG  . LEU B 1 470 ? 31.383  31.965  100.632 1.00 66.06  ? 467 LEU B CG  1 
ATOM 7363  C CD1 . LEU B 1 470 ? 32.506  32.327  99.686  1.00 73.27  ? 467 LEU B CD1 1 
ATOM 7364  C CD2 . LEU B 1 470 ? 31.153  33.041  101.669 1.00 58.19  ? 467 LEU B CD2 1 
ATOM 7365  N N   . GLN B 1 471 ? 27.274  30.716  99.033  1.00 68.56  ? 468 GLN B N   1 
ATOM 7366  C CA  . GLN B 1 471 ? 26.082  30.810  98.186  1.00 66.23  ? 468 GLN B CA  1 
ATOM 7367  C C   . GLN B 1 471 ? 24.796  30.983  98.982  1.00 65.96  ? 468 GLN B C   1 
ATOM 7368  O O   . GLN B 1 471 ? 23.887  31.677  98.543  1.00 76.65  ? 468 GLN B O   1 
ATOM 7369  C CB  . GLN B 1 471 ? 25.950  29.581  97.289  1.00 57.19  ? 468 GLN B CB  1 
ATOM 7370  C CG  . GLN B 1 471 ? 27.140  29.357  96.359  1.00 79.63  ? 468 GLN B CG  1 
ATOM 7371  C CD  . GLN B 1 471 ? 27.286  30.448  95.322  1.00 97.75  ? 468 GLN B CD  1 
ATOM 7372  O OE1 . GLN B 1 471 ? 26.347  31.204  95.058  1.00 92.21  ? 468 GLN B OE1 1 
ATOM 7373  N NE2 . GLN B 1 471 ? 28.470  30.536  94.723  1.00 83.89  ? 468 GLN B NE2 1 
ATOM 7374  N N   . LEU B 1 472 ? 24.716  30.343  100.145 1.00 67.49  ? 469 LEU B N   1 
ATOM 7375  C CA  . LEU B 1 472 ? 23.537  30.465  101.008 1.00 69.32  ? 469 LEU B CA  1 
ATOM 7376  C C   . LEU B 1 472 ? 23.361  31.880  101.529 1.00 67.73  ? 469 LEU B C   1 
ATOM 7377  O O   . LEU B 1 472 ? 22.246  32.363  101.636 1.00 61.16  ? 469 LEU B O   1 
ATOM 7378  C CB  . LEU B 1 472 ? 23.628  29.527  102.215 1.00 74.12  ? 469 LEU B CB  1 
ATOM 7379  C CG  . LEU B 1 472 ? 23.054  28.131  102.062 1.00 83.37  ? 469 LEU B CG  1 
ATOM 7380  C CD1 . LEU B 1 472 ? 22.684  27.591  103.430 1.00 78.31  ? 469 LEU B CD1 1 
ATOM 7381  C CD2 . LEU B 1 472 ? 21.850  28.175  101.167 1.00 77.73  ? 469 LEU B CD2 1 
ATOM 7382  N N   . VAL B 1 473 ? 24.468  32.519  101.900 1.00 48.55  ? 470 VAL B N   1 
ATOM 7383  C CA  . VAL B 1 473 ? 24.434  33.886  102.371 1.00 52.29  ? 470 VAL B CA  1 
ATOM 7384  C C   . VAL B 1 473 ? 23.788  34.767  101.295 1.00 58.96  ? 470 VAL B C   1 
ATOM 7385  O O   . VAL B 1 473 ? 22.853  35.522  101.560 1.00 65.89  ? 470 VAL B O   1 
ATOM 7386  C CB  . VAL B 1 473 ? 25.847  34.387  102.697 1.00 57.92  ? 470 VAL B CB  1 
ATOM 7387  C CG1 . VAL B 1 473 ? 25.815  35.864  103.054 1.00 64.53  ? 470 VAL B CG1 1 
ATOM 7388  C CG2 . VAL B 1 473 ? 26.452  33.564  103.826 1.00 60.77  ? 470 VAL B CG2 1 
ATOM 7389  N N   . ASP B 1 474 ? 24.283  34.629  100.073 1.00 51.97  ? 471 ASP B N   1 
ATOM 7390  C CA  . ASP B 1 474 ? 23.818  35.412  98.949  1.00 52.00  ? 471 ASP B CA  1 
ATOM 7391  C C   . ASP B 1 474 ? 22.359  35.097  98.627  1.00 59.45  ? 471 ASP B C   1 
ATOM 7392  O O   . ASP B 1 474 ? 21.613  35.975  98.237  1.00 67.32  ? 471 ASP B O   1 
ATOM 7393  C CB  . ASP B 1 474 ? 24.734  35.164  97.739  1.00 50.93  ? 471 ASP B CB  1 
ATOM 7394  C CG  . ASP B 1 474 ? 24.300  35.918  96.497  1.00 55.92  ? 471 ASP B CG  1 
ATOM 7395  O OD1 . ASP B 1 474 ? 24.639  37.115  96.350  1.00 78.33  ? 471 ASP B OD1 1 
ATOM 7396  O OD2 . ASP B 1 474 ? 23.638  35.296  95.651  1.00 58.81  ? 471 ASP B OD2 1 
ATOM 7397  N N   . SER B 1 475 ? 21.939  33.852  98.816  1.00 64.48  ? 472 SER B N   1 
ATOM 7398  C CA  . SER B 1 475 ? 20.659  33.418  98.265  1.00 51.70  ? 472 SER B CA  1 
ATOM 7399  C C   . SER B 1 475 ? 19.511  33.371  99.276  1.00 57.89  ? 472 SER B C   1 
ATOM 7400  O O   . SER B 1 475 ? 18.348  33.219  98.900  1.00 57.11  ? 472 SER B O   1 
ATOM 7401  C CB  . SER B 1 475 ? 20.803  32.065  97.555  1.00 52.26  ? 472 SER B CB  1 
ATOM 7402  O OG  . SER B 1 475 ? 20.802  30.986  98.476  1.00 74.71  ? 472 SER B OG  1 
ATOM 7403  N N   . THR B 1 476 ? 19.824  33.518  100.553 1.00 71.10  ? 473 THR B N   1 
ATOM 7404  C CA  . THR B 1 476 ? 18.828  33.262  101.594 1.00 60.50  ? 473 THR B CA  1 
ATOM 7405  C C   . THR B 1 476 ? 17.779  34.364  101.747 1.00 59.81  ? 473 THR B C   1 
ATOM 7406  O O   . THR B 1 476 ? 16.599  34.072  101.945 1.00 59.43  ? 473 THR B O   1 
ATOM 7407  C CB  . THR B 1 476 ? 19.490  32.939  102.962 1.00 43.54  ? 473 THR B CB  1 
ATOM 7408  O OG1 . THR B 1 476 ? 20.133  31.665  102.888 1.00 79.25  ? 473 THR B OG1 1 
ATOM 7409  C CG2 . THR B 1 476 ? 18.452  32.889  104.085 1.00 59.18  ? 473 THR B CG2 1 
ATOM 7410  N N   . THR B 1 477 ? 18.182  35.628  101.662 1.00 70.95  ? 474 THR B N   1 
ATOM 7411  C CA  . THR B 1 477 ? 17.201  36.692  101.869 1.00 60.39  ? 474 THR B CA  1 
ATOM 7412  C C   . THR B 1 477 ? 16.904  37.545  100.635 1.00 67.32  ? 474 THR B C   1 
ATOM 7413  O O   . THR B 1 477 ? 17.431  37.312  99.546  1.00 67.71  ? 474 THR B O   1 
ATOM 7414  C CB  . THR B 1 477 ? 17.605  37.617  103.015 1.00 69.78  ? 474 THR B CB  1 
ATOM 7415  O OG1 . THR B 1 477 ? 18.617  38.507  102.554 1.00 52.31  ? 474 THR B OG1 1 
ATOM 7416  C CG2 . THR B 1 477 ? 18.129  36.810  104.203 1.00 50.62  ? 474 THR B CG2 1 
ATOM 7417  N N   . SER B 1 478 ? 16.047  38.541  100.844 1.00 69.41  ? 475 SER B N   1 
ATOM 7418  C CA  . SER B 1 478 ? 15.587  39.449  99.799  1.00 60.10  ? 475 SER B CA  1 
ATOM 7419  C C   . SER B 1 478 ? 16.390  40.738  99.772  1.00 56.98  ? 475 SER B C   1 
ATOM 7420  O O   . SER B 1 478 ? 16.275  41.533  98.831  1.00 56.04  ? 475 SER B O   1 
ATOM 7421  C CB  . SER B 1 478 ? 14.107  39.795  100.027 1.00 48.48  ? 475 SER B CB  1 
ATOM 7422  O OG  . SER B 1 478 ? 13.296  38.645  99.921  1.00 73.67  ? 475 SER B OG  1 
ATOM 7423  N N   . TYR B 1 479 ? 17.197  40.918  100.815 1.00 37.70  ? 476 TYR B N   1 
ATOM 7424  C CA  . TYR B 1 479 ? 17.943  42.138  101.083 1.00 42.65  ? 476 TYR B CA  1 
ATOM 7425  C C   . TYR B 1 479 ? 19.368  42.130  100.559 1.00 55.81  ? 476 TYR B C   1 
ATOM 7426  O O   . TYR B 1 479 ? 19.929  41.071  100.252 1.00 48.68  ? 476 TYR B O   1 
ATOM 7427  C CB  . TYR B 1 479 ? 17.954  42.409  102.585 1.00 60.77  ? 476 TYR B CB  1 
ATOM 7428  C CG  . TYR B 1 479 ? 16.562  42.564  103.156 1.00 63.45  ? 476 TYR B CG  1 
ATOM 7429  C CD1 . TYR B 1 479 ? 15.858  43.745  102.990 1.00 48.47  ? 476 TYR B CD1 1 
ATOM 7430  C CD2 . TYR B 1 479 ? 15.945  41.523  103.842 1.00 61.90  ? 476 TYR B CD2 1 
ATOM 7431  C CE1 . TYR B 1 479 ? 14.595  43.891  103.487 1.00 53.47  ? 476 TYR B CE1 1 
ATOM 7432  C CE2 . TYR B 1 479 ? 14.673  41.665  104.346 1.00 48.58  ? 476 TYR B CE2 1 
ATOM 7433  C CZ  . TYR B 1 479 ? 14.002  42.854  104.169 1.00 55.71  ? 476 TYR B CZ  1 
ATOM 7434  O OH  . TYR B 1 479 ? 12.734  43.035  104.676 1.00 50.18  ? 476 TYR B OH  1 
ATOM 7435  N N   . GLY B 1 480 ? 19.944  43.326  100.465 1.00 54.62  ? 477 GLY B N   1 
ATOM 7436  C CA  . GLY B 1 480 ? 21.313  43.491  100.021 1.00 37.78  ? 477 GLY B CA  1 
ATOM 7437  C C   . GLY B 1 480 ? 21.945  44.686  100.683 1.00 59.53  ? 477 GLY B C   1 
ATOM 7438  O O   . GLY B 1 480 ? 22.652  45.438  100.012 1.00 39.14  ? 477 GLY B O   1 
ATOM 7439  N N   . LEU B 1 481 ? 21.711  44.871  101.988 1.00 35.09  ? 478 LEU B N   1 
ATOM 7440  C CA  . LEU B 1 481 ? 22.196  46.086  102.654 1.00 42.34  ? 478 LEU B CA  1 
ATOM 7441  C C   . LEU B 1 481 ? 23.663  46.030  103.107 1.00 43.80  ? 478 LEU B C   1 
ATOM 7442  O O   . LEU B 1 481 ? 24.548  46.532  102.409 1.00 45.97  ? 478 LEU B O   1 
ATOM 7443  C CB  . LEU B 1 481 ? 21.260  46.532  103.774 1.00 41.32  ? 478 LEU B CB  1 
ATOM 7444  C CG  . LEU B 1 481 ? 21.495  47.965  104.261 1.00 54.75  ? 478 LEU B CG  1 
ATOM 7445  C CD1 . LEU B 1 481 ? 21.914  48.864  103.115 1.00 39.81  ? 478 LEU B CD1 1 
ATOM 7446  C CD2 . LEU B 1 481 ? 20.256  48.511  104.929 1.00 53.08  ? 478 LEU B CD2 1 
ATOM 7447  N N   . THR B 1 482 ? 23.933  45.414  104.253 1.00 50.37  ? 479 THR B N   1 
ATOM 7448  C CA  . THR B 1 482 ? 25.317  45.243  104.710 1.00 48.92  ? 479 THR B CA  1 
ATOM 7449  C C   . THR B 1 482 ? 25.689  43.784  104.919 1.00 43.32  ? 479 THR B C   1 
ATOM 7450  O O   . THR B 1 482 ? 24.831  42.902  104.974 1.00 55.98  ? 479 THR B O   1 
ATOM 7451  C CB  . THR B 1 482 ? 25.626  46.029  105.987 1.00 49.65  ? 479 THR B CB  1 
ATOM 7452  O OG1 . THR B 1 482 ? 24.955  45.416  107.090 1.00 53.34  ? 479 THR B OG1 1 
ATOM 7453  C CG2 . THR B 1 482 ? 25.184  47.490  105.835 1.00 45.99  ? 479 THR B CG2 1 
ATOM 7454  N N   . GLY B 1 483 ? 26.989  43.541  104.984 1.00 38.65  ? 480 GLY B N   1 
ATOM 7455  C CA  . GLY B 1 483 ? 27.531  42.203  105.111 1.00 42.16  ? 480 GLY B CA  1 
ATOM 7456  C C   . GLY B 1 483 ? 29.006  42.269  105.500 1.00 56.48  ? 480 GLY B C   1 
ATOM 7457  O O   . GLY B 1 483 ? 29.696  43.222  105.160 1.00 62.15  ? 480 GLY B O   1 
ATOM 7458  N N   . ALA B 1 484 ? 29.495  41.264  106.216 1.00 45.28  ? 481 ALA B N   1 
ATOM 7459  C CA  . ALA B 1 484 ? 30.913  41.199  106.595 1.00 49.35  ? 481 ALA B CA  1 
ATOM 7460  C C   . ALA B 1 484 ? 31.502  39.806  106.453 1.00 50.74  ? 481 ALA B C   1 
ATOM 7461  O O   . ALA B 1 484 ? 30.817  38.794  106.615 1.00 59.86  ? 481 ALA B O   1 
ATOM 7462  C CB  . ALA B 1 484 ? 31.136  41.721  107.999 1.00 48.61  ? 481 ALA B CB  1 
ATOM 7463  N N   . VAL B 1 485 ? 32.783  39.766  106.123 1.00 56.12  ? 482 VAL B N   1 
ATOM 7464  C CA  . VAL B 1 485 ? 33.530  38.514  106.058 1.00 67.20  ? 482 VAL B CA  1 
ATOM 7465  C C   . VAL B 1 485 ? 34.728  38.597  106.994 1.00 57.62  ? 482 VAL B C   1 
ATOM 7466  O O   . VAL B 1 485 ? 35.507  39.552  106.936 1.00 68.36  ? 482 VAL B O   1 
ATOM 7467  C CB  . VAL B 1 485 ? 34.029  38.209  104.633 1.00 50.82  ? 482 VAL B CB  1 
ATOM 7468  C CG1 . VAL B 1 485 ? 35.065  37.122  104.673 1.00 52.82  ? 482 VAL B CG1 1 
ATOM 7469  C CG2 . VAL B 1 485 ? 32.892  37.795  103.761 1.00 68.55  ? 482 VAL B CG2 1 
ATOM 7470  N N   . PHE B 1 486 ? 34.854  37.610  107.872 1.00 62.97  ? 483 PHE B N   1 
ATOM 7471  C CA  . PHE B 1 486 ? 36.021  37.507  108.748 1.00 51.95  ? 483 PHE B CA  1 
ATOM 7472  C C   . PHE B 1 486 ? 36.897  36.336  108.290 1.00 69.26  ? 483 PHE B C   1 
ATOM 7473  O O   . PHE B 1 486 ? 36.483  35.174  108.332 1.00 68.97  ? 483 PHE B O   1 
ATOM 7474  C CB  . PHE B 1 486 ? 35.597  37.343  110.214 1.00 63.61  ? 483 PHE B CB  1 
ATOM 7475  C CG  . PHE B 1 486 ? 34.968  38.576  110.815 1.00 62.79  ? 483 PHE B CG  1 
ATOM 7476  C CD1 . PHE B 1 486 ? 33.607  38.826  110.661 1.00 67.88  ? 483 PHE B CD1 1 
ATOM 7477  C CD2 . PHE B 1 486 ? 35.732  39.481  111.537 1.00 54.72  ? 483 PHE B CD2 1 
ATOM 7478  C CE1 . PHE B 1 486 ? 33.017  39.962  111.215 1.00 50.60  ? 483 PHE B CE1 1 
ATOM 7479  C CE2 . PHE B 1 486 ? 35.146  40.618  112.099 1.00 60.76  ? 483 PHE B CE2 1 
ATOM 7480  C CZ  . PHE B 1 486 ? 33.794  40.852  111.943 1.00 57.56  ? 483 PHE B CZ  1 
ATOM 7481  N N   . SER B 1 487 ? 38.106  36.656  107.845 1.00 51.95  ? 484 SER B N   1 
ATOM 7482  C CA  . SER B 1 487 ? 39.026  35.671  107.294 1.00 64.68  ? 484 SER B CA  1 
ATOM 7483  C C   . SER B 1 487 ? 40.430  36.244  107.275 1.00 67.70  ? 484 SER B C   1 
ATOM 7484  O O   . SER B 1 487 ? 40.637  37.372  106.848 1.00 62.44  ? 484 SER B O   1 
ATOM 7485  C CB  . SER B 1 487 ? 38.617  35.285  105.870 1.00 50.40  ? 484 SER B CB  1 
ATOM 7486  O OG  . SER B 1 487 ? 39.568  34.437  105.260 1.00 61.69  ? 484 SER B OG  1 
ATOM 7487  N N   . GLN B 1 488 ? 41.394  35.468  107.756 1.00 75.44  ? 485 GLN B N   1 
ATOM 7488  C CA  . GLN B 1 488 ? 42.788  35.872  107.689 1.00 69.44  ? 485 GLN B CA  1 
ATOM 7489  C C   . GLN B 1 488 ? 43.380  35.345  106.383 1.00 80.93  ? 485 GLN B C   1 
ATOM 7490  O O   . GLN B 1 488 ? 44.405  35.828  105.904 1.00 68.18  ? 485 GLN B O   1 
ATOM 7491  C CB  . GLN B 1 488 ? 43.565  35.372  108.910 1.00 73.00  ? 485 GLN B CB  1 
ATOM 7492  C CG  . GLN B 1 488 ? 43.110  35.984  110.233 1.00 105.25 ? 485 GLN B CG  1 
ATOM 7493  C CD  . GLN B 1 488 ? 42.940  37.496  110.150 1.00 122.53 ? 485 GLN B CD  1 
ATOM 7494  O OE1 . GLN B 1 488 ? 43.782  38.201  109.584 1.00 97.80  ? 485 GLN B OE1 1 
ATOM 7495  N NE2 . GLN B 1 488 ? 41.841  37.999  110.707 1.00 140.79 ? 485 GLN B NE2 1 
ATOM 7496  N N   . ASP B 1 489 ? 42.712  34.356  105.805 1.00 76.30  ? 486 ASP B N   1 
ATOM 7497  C CA  . ASP B 1 489 ? 43.092  33.811  104.508 1.00 66.37  ? 486 ASP B CA  1 
ATOM 7498  C C   . ASP B 1 489 ? 42.739  34.816  103.408 1.00 88.94  ? 486 ASP B C   1 
ATOM 7499  O O   . ASP B 1 489 ? 41.570  35.033  103.101 1.00 62.27  ? 486 ASP B O   1 
ATOM 7500  C CB  . ASP B 1 489 ? 42.365  32.479  104.278 1.00 71.06  ? 486 ASP B CB  1 
ATOM 7501  C CG  . ASP B 1 489 ? 42.759  31.804  102.973 1.00 100.87 ? 486 ASP B CG  1 
ATOM 7502  O OD1 . ASP B 1 489 ? 42.978  32.508  101.964 1.00 97.64  ? 486 ASP B OD1 1 
ATOM 7503  O OD2 . ASP B 1 489 ? 42.838  30.557  102.959 1.00 102.44 ? 486 ASP B OD2 1 
ATOM 7504  N N   . LYS B 1 490 ? 43.761  35.428  102.820 1.00 92.57  ? 487 LYS B N   1 
ATOM 7505  C CA  . LYS B 1 490 ? 43.563  36.488  101.841 1.00 79.28  ? 487 LYS B CA  1 
ATOM 7506  C C   . LYS B 1 490 ? 42.881  36.011  100.546 1.00 78.51  ? 487 LYS B C   1 
ATOM 7507  O O   . LYS B 1 490 ? 42.143  36.769  99.920  1.00 70.75  ? 487 LYS B O   1 
ATOM 7508  C CB  . LYS B 1 490 ? 44.889  37.215  101.564 1.00 55.00  ? 487 LYS B CB  1 
ATOM 7509  N N   . ASP B 1 491 ? 43.110  34.762  100.153 1.00 73.44  ? 488 ASP B N   1 
ATOM 7510  C CA  . ASP B 1 491 ? 42.484  34.228  98.940  1.00 84.28  ? 488 ASP B CA  1 
ATOM 7511  C C   . ASP B 1 491 ? 40.987  33.947  99.128  1.00 86.05  ? 488 ASP B C   1 
ATOM 7512  O O   . ASP B 1 491 ? 40.193  34.075  98.193  1.00 74.98  ? 488 ASP B O   1 
ATOM 7513  C CB  . ASP B 1 491 ? 43.217  32.973  98.453  1.00 73.40  ? 488 ASP B CB  1 
ATOM 7514  N N   . VAL B 1 492 ? 40.607  33.562  100.341 1.00 83.60  ? 489 VAL B N   1 
ATOM 7515  C CA  . VAL B 1 492 ? 39.201  33.360  100.681 1.00 64.48  ? 489 VAL B CA  1 
ATOM 7516  C C   . VAL B 1 492 ? 38.442  34.682  100.705 1.00 75.55  ? 489 VAL B C   1 
ATOM 7517  O O   . VAL B 1 492 ? 37.282  34.742  100.307 1.00 66.90  ? 489 VAL B O   1 
ATOM 7518  C CB  . VAL B 1 492 ? 39.021  32.635  102.053 1.00 74.82  ? 489 VAL B CB  1 
ATOM 7519  C CG1 . VAL B 1 492 ? 37.637  32.900  102.643 1.00 57.07  ? 489 VAL B CG1 1 
ATOM 7520  C CG2 . VAL B 1 492 ? 39.246  31.149  101.901 1.00 61.69  ? 489 VAL B CG2 1 
ATOM 7521  N N   . VAL B 1 493 ? 39.095  35.738  101.180 1.00 59.00  ? 490 VAL B N   1 
ATOM 7522  C CA  . VAL B 1 493 ? 38.511  37.074  101.127 1.00 69.88  ? 490 VAL B CA  1 
ATOM 7523  C C   . VAL B 1 493 ? 38.199  37.486  99.683  1.00 81.32  ? 490 VAL B C   1 
ATOM 7524  O O   . VAL B 1 493 ? 37.082  37.907  99.388  1.00 66.45  ? 490 VAL B O   1 
ATOM 7525  C CB  . VAL B 1 493 ? 39.428  38.113  101.785 1.00 62.71  ? 490 VAL B CB  1 
ATOM 7526  C CG1 . VAL B 1 493 ? 39.011  39.517  101.397 1.00 49.41  ? 490 VAL B CG1 1 
ATOM 7527  C CG2 . VAL B 1 493 ? 39.405  37.939  103.284 1.00 60.07  ? 490 VAL B CG2 1 
ATOM 7528  N N   . GLN B 1 494 ? 39.177  37.350  98.787  1.00 60.73  ? 491 GLN B N   1 
ATOM 7529  C CA  . GLN B 1 494 ? 38.992  37.711  97.383  1.00 69.75  ? 491 GLN B CA  1 
ATOM 7530  C C   . GLN B 1 494 ? 37.844  36.915  96.752  1.00 68.61  ? 491 GLN B C   1 
ATOM 7531  O O   . GLN B 1 494 ? 37.087  37.436  95.937  1.00 69.00  ? 491 GLN B O   1 
ATOM 7532  C CB  . GLN B 1 494 ? 40.300  37.556  96.577  1.00 38.73  ? 491 GLN B CB  1 
ATOM 7533  N N   . GLU B 1 495 ? 37.712  35.656  97.149  1.00 77.45  ? 492 GLU B N   1 
ATOM 7534  C CA  . GLU B 1 495 ? 36.640  34.788  96.649  1.00 76.48  ? 492 GLU B CA  1 
ATOM 7535  C C   . GLU B 1 495 ? 35.243  35.198  97.133  1.00 66.72  ? 492 GLU B C   1 
ATOM 7536  O O   . GLU B 1 495 ? 34.310  35.282  96.343  1.00 75.53  ? 492 GLU B O   1 
ATOM 7537  C CB  . GLU B 1 495 ? 36.912  33.331  97.048  1.00 69.89  ? 492 GLU B CB  1 
ATOM 7538  C CG  . GLU B 1 495 ? 35.798  32.347  96.694  1.00 81.92  ? 492 GLU B CG  1 
ATOM 7539  C CD  . GLU B 1 495 ? 36.051  30.939  97.237  1.00 100.33 ? 492 GLU B CD  1 
ATOM 7540  O OE1 . GLU B 1 495 ? 36.979  30.757  98.061  1.00 74.21  ? 492 GLU B OE1 1 
ATOM 7541  O OE2 . GLU B 1 495 ? 35.319  30.011  96.832  1.00 92.63  ? 492 GLU B OE2 1 
ATOM 7542  N N   . ALA B 1 496 ? 35.101  35.436  98.432  1.00 64.94  ? 493 ALA B N   1 
ATOM 7543  C CA  . ALA B 1 496 ? 33.818  35.818  99.016  1.00 56.46  ? 493 ALA B CA  1 
ATOM 7544  C C   . ALA B 1 496 ? 33.391  37.185  98.504  1.00 66.36  ? 493 ALA B C   1 
ATOM 7545  O O   . ALA B 1 496 ? 32.206  37.443  98.340  1.00 72.85  ? 493 ALA B O   1 
ATOM 7546  C CB  . ALA B 1 496 ? 33.904  35.824  100.547 1.00 47.50  ? 493 ALA B CB  1 
ATOM 7547  N N   . THR B 1 497 ? 34.369  38.053  98.259  1.00 56.74  ? 494 THR B N   1 
ATOM 7548  C CA  . THR B 1 497 ? 34.120  39.375  97.705  1.00 52.80  ? 494 THR B CA  1 
ATOM 7549  C C   . THR B 1 497 ? 33.405  39.262  96.360  1.00 60.82  ? 494 THR B C   1 
ATOM 7550  O O   . THR B 1 497 ? 32.429  39.963  96.109  1.00 51.72  ? 494 THR B O   1 
ATOM 7551  C CB  . THR B 1 497 ? 35.419  40.164  97.514  1.00 53.85  ? 494 THR B CB  1 
ATOM 7552  O OG1 . THR B 1 497 ? 36.018  40.460  98.789  1.00 52.80  ? 494 THR B OG1 1 
ATOM 7553  C CG2 . THR B 1 497 ? 35.117  41.431  96.818  1.00 27.09  ? 494 THR B CG2 1 
ATOM 7554  N N   . LYS B 1 498 ? 33.888  38.364  95.505  1.00 52.34  ? 495 LYS B N   1 
ATOM 7555  C CA  . LYS B 1 498 ? 33.228  38.062  94.232  1.00 55.08  ? 495 LYS B CA  1 
ATOM 7556  C C   . LYS B 1 498 ? 31.833  37.465  94.452  1.00 63.04  ? 495 LYS B C   1 
ATOM 7557  O O   . LYS B 1 498 ? 30.845  37.964  93.923  1.00 57.66  ? 495 LYS B O   1 
ATOM 7558  C CB  . LYS B 1 498 ? 34.080  37.084  93.404  1.00 57.81  ? 495 LYS B CB  1 
ATOM 7559  C CG  . LYS B 1 498 ? 34.705  37.615  92.129  1.00 59.76  ? 495 LYS B CG  1 
ATOM 7560  C CD  . LYS B 1 498 ? 36.102  36.997  91.911  1.00 74.90  ? 495 LYS B CD  1 
ATOM 7561  C CE  . LYS B 1 498 ? 36.553  37.023  90.452  1.00 70.98  ? 495 LYS B CE  1 
ATOM 7562  N N   . VAL B 1 499 ? 31.751  36.390  95.233  1.00 58.02  ? 496 VAL B N   1 
ATOM 7563  C CA  . VAL B 1 499 ? 30.486  35.676  95.423  1.00 43.75  ? 496 VAL B CA  1 
ATOM 7564  C C   . VAL B 1 499 ? 29.376  36.546  96.000  1.00 62.97  ? 496 VAL B C   1 
ATOM 7565  O O   . VAL B 1 499 ? 28.202  36.419  95.608  1.00 38.99  ? 496 VAL B O   1 
ATOM 7566  C CB  . VAL B 1 499 ? 30.687  34.424  96.309  1.00 57.37  ? 496 VAL B CB  1 
ATOM 7567  C CG1 . VAL B 1 499 ? 29.371  33.834  96.735  1.00 44.29  ? 496 VAL B CG1 1 
ATOM 7568  C CG2 . VAL B 1 499 ? 31.507  33.390  95.557  1.00 55.72  ? 496 VAL B CG2 1 
ATOM 7569  N N   . LEU B 1 500 ? 29.763  37.427  96.923  1.00 51.36  ? 497 LEU B N   1 
ATOM 7570  C CA  . LEU B 1 500 ? 28.829  38.276  97.659  1.00 51.35  ? 497 LEU B CA  1 
ATOM 7571  C C   . LEU B 1 500 ? 28.639  39.680  97.071  1.00 60.92  ? 497 LEU B C   1 
ATOM 7572  O O   . LEU B 1 500 ? 27.988  40.524  97.680  1.00 39.74  ? 497 LEU B O   1 
ATOM 7573  C CB  . LEU B 1 500 ? 29.286  38.393  99.117  1.00 42.41  ? 497 LEU B CB  1 
ATOM 7574  C CG  . LEU B 1 500 ? 29.351  37.041  99.823  1.00 48.30  ? 497 LEU B CG  1 
ATOM 7575  C CD1 . LEU B 1 500 ? 29.904  37.182  101.228 1.00 46.65  ? 497 LEU B CD1 1 
ATOM 7576  C CD2 . LEU B 1 500 ? 27.971  36.395  99.820  1.00 62.93  ? 497 LEU B CD2 1 
ATOM 7577  N N   . ARG B 1 501 ? 29.199  39.920  95.890  1.00 43.41  ? 498 ARG B N   1 
ATOM 7578  C CA  . ARG B 1 501 ? 29.170  41.239  95.252  1.00 50.22  ? 498 ARG B CA  1 
ATOM 7579  C C   . ARG B 1 501 ? 27.836  41.978  95.349  1.00 53.70  ? 498 ARG B C   1 
ATOM 7580  O O   . ARG B 1 501 ? 27.817  43.192  95.527  1.00 46.05  ? 498 ARG B O   1 
ATOM 7581  C CB  . ARG B 1 501 ? 29.553  41.095  93.790  1.00 43.76  ? 498 ARG B CB  1 
ATOM 7582  C CG  . ARG B 1 501 ? 29.667  42.376  93.020  1.00 52.82  ? 498 ARG B CG  1 
ATOM 7583  C CD  . ARG B 1 501 ? 29.911  41.920  91.666  1.00 52.07  ? 498 ARG B CD  1 
ATOM 7584  N NE  . ARG B 1 501 ? 30.532  42.691  90.603  1.00 70.92  ? 498 ARG B NE  1 
ATOM 7585  C CZ  . ARG B 1 501 ? 31.343  43.734  90.523  1.00 52.13  ? 498 ARG B CZ  1 
ATOM 7586  N NH1 . ARG B 1 501 ? 31.737  44.007  89.325  1.00 74.54  ? 498 ARG B NH1 1 
ATOM 7587  N NH2 . ARG B 1 501 ? 31.696  44.553  91.464  1.00 93.11  ? 498 ARG B NH2 1 
ATOM 7588  N N   . ASN B 1 502 ? 26.732  41.245  95.241  1.00 41.49  ? 499 ASN B N   1 
ATOM 7589  C CA  . ASN B 1 502 ? 25.416  41.841  95.289  1.00 48.30  ? 499 ASN B CA  1 
ATOM 7590  C C   . ASN B 1 502 ? 24.629  41.520  96.552  1.00 43.25  ? 499 ASN B C   1 
ATOM 7591  O O   . ASN B 1 502 ? 23.455  41.870  96.652  1.00 45.28  ? 499 ASN B O   1 
ATOM 7592  C CB  . ASN B 1 502 ? 24.591  41.465  94.047  1.00 36.21  ? 499 ASN B CB  1 
ATOM 7593  C CG  . ASN B 1 502 ? 24.891  42.361  92.861  1.00 47.79  ? 499 ASN B CG  1 
ATOM 7594  O OD1 . ASN B 1 502 ? 25.454  41.898  91.884  1.00 51.33  ? 499 ASN B OD1 1 
ATOM 7595  N ND2 . ASN B 1 502 ? 24.522  43.651  92.944  1.00 42.50  ? 499 ASN B ND2 1 
ATOM 7596  N N   . ALA B 1 503 ? 25.266  40.862  97.511  1.00 59.59  ? 500 ALA B N   1 
ATOM 7597  C CA  . ALA B 1 503 ? 24.591  40.542  98.765  1.00 54.64  ? 500 ALA B CA  1 
ATOM 7598  C C   . ALA B 1 503 ? 24.701  41.706  99.765  1.00 51.44  ? 500 ALA B C   1 
ATOM 7599  O O   . ALA B 1 503 ? 23.983  41.764  100.754 1.00 53.82  ? 500 ALA B O   1 
ATOM 7600  C CB  . ALA B 1 503 ? 25.144  39.281  99.343  1.00 54.10  ? 500 ALA B CB  1 
ATOM 7601  N N   . ALA B 1 504 ? 25.588  42.652  99.477  1.00 54.98  ? 501 ALA B N   1 
ATOM 7602  C CA  . ALA B 1 504 ? 25.773  43.783  100.366 1.00 49.00  ? 501 ALA B CA  1 
ATOM 7603  C C   . ALA B 1 504 ? 26.286  45.015  99.623  1.00 55.19  ? 501 ALA B C   1 
ATOM 7604  O O   . ALA B 1 504 ? 27.317  44.960  98.974  1.00 58.51  ? 501 ALA B O   1 
ATOM 7605  C CB  . ALA B 1 504 ? 26.715  43.417  101.460 1.00 37.15  ? 501 ALA B CB  1 
ATOM 7606  N N   . GLY B 1 505 ? 25.555  46.122  99.737  1.00 50.65  ? 502 GLY B N   1 
ATOM 7607  C CA  . GLY B 1 505 ? 25.992  47.410  99.216  1.00 49.56  ? 502 GLY B CA  1 
ATOM 7608  C C   . GLY B 1 505 ? 27.113  48.031  100.038 1.00 47.00  ? 502 GLY B C   1 
ATOM 7609  O O   . GLY B 1 505 ? 27.928  48.794  99.524  1.00 44.77  ? 502 GLY B O   1 
ATOM 7610  N N   . ASN B 1 506 ? 27.128  47.724  101.329 1.00 41.38  ? 503 ASN B N   1 
ATOM 7611  C CA  . ASN B 1 506 ? 28.270  48.006  102.186 1.00 34.45  ? 503 ASN B CA  1 
ATOM 7612  C C   . ASN B 1 506 ? 28.847  46.692  102.688 1.00 49.32  ? 503 ASN B C   1 
ATOM 7613  O O   . ASN B 1 506 ? 28.196  45.925  103.382 1.00 50.12  ? 503 ASN B O   1 
ATOM 7614  C CB  . ASN B 1 506 ? 27.906  48.927  103.340 1.00 48.76  ? 503 ASN B CB  1 
ATOM 7615  C CG  . ASN B 1 506 ? 27.773  50.359  102.901 1.00 51.87  ? 503 ASN B CG  1 
ATOM 7616  O OD1 . ASN B 1 506 ? 26.765  50.745  102.309 1.00 59.19  ? 503 ASN B OD1 1 
ATOM 7617  N ND2 . ASN B 1 506 ? 28.791  51.158  103.173 1.00 53.13  ? 503 ASN B ND2 1 
ATOM 7618  N N   . PHE B 1 507 ? 30.077  46.438  102.289 1.00 48.96  ? 504 PHE B N   1 
ATOM 7619  C CA  . PHE B 1 507 ? 30.697  45.156  102.498 1.00 44.23  ? 504 PHE B CA  1 
ATOM 7620  C C   . PHE B 1 507 ? 31.931  45.394  103.333 1.00 64.77  ? 504 PHE B C   1 
ATOM 7621  O O   . PHE B 1 507 ? 32.718  46.297  103.040 1.00 46.38  ? 504 PHE B O   1 
ATOM 7622  C CB  . PHE B 1 507 ? 31.059  44.524  101.157 1.00 44.16  ? 504 PHE B CB  1 
ATOM 7623  C CG  . PHE B 1 507 ? 31.586  43.120  101.262 1.00 52.37  ? 504 PHE B CG  1 
ATOM 7624  C CD1 . PHE B 1 507 ? 30.789  42.098  101.768 1.00 44.72  ? 504 PHE B CD1 1 
ATOM 7625  C CD2 . PHE B 1 507 ? 32.871  42.817  100.837 1.00 49.85  ? 504 PHE B CD2 1 
ATOM 7626  C CE1 . PHE B 1 507 ? 31.269  40.795  101.860 1.00 45.56  ? 504 PHE B CE1 1 
ATOM 7627  C CE2 . PHE B 1 507 ? 33.365  41.525  100.927 1.00 44.18  ? 504 PHE B CE2 1 
ATOM 7628  C CZ  . PHE B 1 507 ? 32.549  40.503  101.438 1.00 48.35  ? 504 PHE B CZ  1 
ATOM 7629  N N   . TYR B 1 508 ? 32.087  44.597  104.387 1.00 47.14  ? 505 TYR B N   1 
ATOM 7630  C CA  . TYR B 1 508 ? 33.149  44.829  105.349 1.00 48.93  ? 505 TYR B CA  1 
ATOM 7631  C C   . TYR B 1 508 ? 34.062  43.619  105.452 1.00 44.00  ? 505 TYR B C   1 
ATOM 7632  O O   . TYR B 1 508 ? 33.599  42.490  105.534 1.00 58.81  ? 505 TYR B O   1 
ATOM 7633  C CB  . TYR B 1 508 ? 32.557  45.192  106.709 1.00 44.20  ? 505 TYR B CB  1 
ATOM 7634  C CG  . TYR B 1 508 ? 31.748  46.475  106.705 1.00 44.05  ? 505 TYR B CG  1 
ATOM 7635  C CD1 . TYR B 1 508 ? 30.385  46.455  106.431 1.00 37.80  ? 505 TYR B CD1 1 
ATOM 7636  C CD2 . TYR B 1 508 ? 32.336  47.704  106.976 1.00 34.28  ? 505 TYR B CD2 1 
ATOM 7637  C CE1 . TYR B 1 508 ? 29.633  47.626  106.413 1.00 49.60  ? 505 TYR B CE1 1 
ATOM 7638  C CE2 . TYR B 1 508 ? 31.564  48.897  106.974 1.00 29.46  ? 505 TYR B CE2 1 
ATOM 7639  C CZ  . TYR B 1 508 ? 30.223  48.840  106.687 1.00 41.58  ? 505 TYR B CZ  1 
ATOM 7640  O OH  . TYR B 1 508 ? 29.461  49.991  106.677 1.00 58.27  ? 505 TYR B OH  1 
ATOM 7641  N N   . ILE B 1 509 ? 35.365  43.852  105.412 1.00 39.18  ? 506 ILE B N   1 
ATOM 7642  C CA  . ILE B 1 509 ? 36.326  42.749  105.534 1.00 54.68  ? 506 ILE B CA  1 
ATOM 7643  C C   . ILE B 1 509 ? 37.065  42.858  106.866 1.00 64.03  ? 506 ILE B C   1 
ATOM 7644  O O   . ILE B 1 509 ? 37.815  43.816  107.097 1.00 55.30  ? 506 ILE B O   1 
ATOM 7645  C CB  . ILE B 1 509 ? 37.324  42.727  104.366 1.00 59.17  ? 506 ILE B CB  1 
ATOM 7646  C CG1 . ILE B 1 509 ? 36.589  42.489  103.046 1.00 60.77  ? 506 ILE B CG1 1 
ATOM 7647  C CG2 . ILE B 1 509 ? 38.396  41.658  104.585 1.00 43.43  ? 506 ILE B CG2 1 
ATOM 7648  C CD1 . ILE B 1 509 ? 37.443  42.770  101.812 1.00 49.64  ? 506 ILE B CD1 1 
ATOM 7649  N N   . ASN B 1 510 ? 36.827  41.884  107.745 1.00 43.84  ? 507 ASN B N   1 
ATOM 7650  C CA  . ASN B 1 510 ? 37.319  41.934  109.119 1.00 53.02  ? 507 ASN B CA  1 
ATOM 7651  C C   . ASN B 1 510 ? 36.895  43.206  109.854 1.00 56.46  ? 507 ASN B C   1 
ATOM 7652  O O   . ASN B 1 510 ? 37.698  43.860  110.516 1.00 51.73  ? 507 ASN B O   1 
ATOM 7653  C CB  . ASN B 1 510 ? 38.845  41.724  109.176 1.00 44.59  ? 507 ASN B CB  1 
ATOM 7654  C CG  . ASN B 1 510 ? 39.265  40.382  108.582 1.00 65.54  ? 507 ASN B CG  1 
ATOM 7655  O OD1 . ASN B 1 510 ? 38.651  39.352  108.860 1.00 52.85  ? 507 ASN B OD1 1 
ATOM 7656  N ND2 . ASN B 1 510 ? 40.295  40.395  107.738 1.00 50.40  ? 507 ASN B ND2 1 
ATOM 7657  N N   . ASP B 1 511 ? 35.628  43.575  109.707 1.00 67.12  ? 508 ASP B N   1 
ATOM 7658  C CA  . ASP B 1 511 ? 35.046  44.614  110.554 1.00 56.93  ? 508 ASP B CA  1 
ATOM 7659  C C   . ASP B 1 511 ? 33.557  44.389  110.677 1.00 52.85  ? 508 ASP B C   1 
ATOM 7660  O O   . ASP B 1 511 ? 32.977  43.618  109.912 1.00 59.28  ? 508 ASP B O   1 
ATOM 7661  C CB  . ASP B 1 511 ? 35.356  46.026  110.042 1.00 56.06  ? 508 ASP B CB  1 
ATOM 7662  C CG  . ASP B 1 511 ? 35.482  47.044  111.178 1.00 83.84  ? 508 ASP B CG  1 
ATOM 7663  O OD1 . ASP B 1 511 ? 34.767  46.893  112.211 1.00 54.19  ? 508 ASP B OD1 1 
ATOM 7664  O OD2 . ASP B 1 511 ? 36.303  47.988  111.046 1.00 63.61  ? 508 ASP B OD2 1 
ATOM 7665  N N   . LYS B 1 512 ? 32.948  45.040  111.664 1.00 60.15  ? 509 LYS B N   1 
ATOM 7666  C CA  . LYS B 1 512 ? 31.531  44.881  111.913 1.00 61.74  ? 509 LYS B CA  1 
ATOM 7667  C C   . LYS B 1 512 ? 30.739  45.502  110.761 1.00 69.11  ? 509 LYS B C   1 
ATOM 7668  O O   . LYS B 1 512 ? 31.269  46.336  110.025 1.00 69.38  ? 509 LYS B O   1 
ATOM 7669  C CB  . LYS B 1 512 ? 31.154  45.485  113.265 1.00 58.35  ? 509 LYS B CB  1 
ATOM 7670  C CG  . LYS B 1 512 ? 31.474  46.960  113.440 1.00 50.94  ? 509 LYS B CG  1 
ATOM 7671  C CD  . LYS B 1 512 ? 30.965  47.451  114.797 1.00 60.60  ? 509 LYS B CD  1 
ATOM 7672  C CE  . LYS B 1 512 ? 31.316  48.894  115.052 1.00 61.96  ? 509 LYS B CE  1 
ATOM 7673  N NZ  . LYS B 1 512 ? 30.455  49.832  114.248 1.00 69.58  ? 509 LYS B NZ  1 
ATOM 7674  N N   . SER B 1 513 ? 29.484  45.081  110.605 1.00 50.40  ? 510 SER B N   1 
ATOM 7675  C CA  . SER B 1 513 ? 28.658  45.495  109.480 1.00 57.14  ? 510 SER B CA  1 
ATOM 7676  C C   . SER B 1 513 ? 27.896  46.815  109.722 1.00 54.04  ? 510 SER B C   1 
ATOM 7677  O O   . SER B 1 513 ? 27.066  47.215  108.906 1.00 72.11  ? 510 SER B O   1 
ATOM 7678  C CB  . SER B 1 513 ? 27.690  44.369  109.104 1.00 54.61  ? 510 SER B CB  1 
ATOM 7679  O OG  . SER B 1 513 ? 26.729  44.183  110.120 1.00 52.61  ? 510 SER B OG  1 
ATOM 7680  N N   . THR B 1 514 ? 28.192  47.483  110.833 1.00 60.14  ? 511 THR B N   1 
ATOM 7681  C CA  . THR B 1 514 ? 27.609  48.787  111.152 1.00 56.60  ? 511 THR B CA  1 
ATOM 7682  C C   . THR B 1 514 ? 28.647  49.906  111.109 1.00 56.48  ? 511 THR B C   1 
ATOM 7683  O O   . THR B 1 514 ? 29.815  49.660  110.845 1.00 66.36  ? 511 THR B O   1 
ATOM 7684  C CB  . THR B 1 514 ? 26.934  48.798  112.558 1.00 47.22  ? 511 THR B CB  1 
ATOM 7685  O OG1 . THR B 1 514 ? 27.850  48.329  113.553 1.00 71.13  ? 511 THR B OG1 1 
ATOM 7686  C CG2 . THR B 1 514 ? 25.694  47.934  112.565 1.00 42.11  ? 511 THR B CG2 1 
ATOM 7687  N N   . GLY B 1 515 ? 28.212  51.138  111.372 1.00 62.91  ? 512 GLY B N   1 
ATOM 7688  C CA  . GLY B 1 515 ? 29.125  52.262  111.528 1.00 77.44  ? 512 GLY B CA  1 
ATOM 7689  C C   . GLY B 1 515 ? 29.738  52.823  110.256 1.00 83.31  ? 512 GLY B C   1 
ATOM 7690  O O   . GLY B 1 515 ? 30.961  52.992  110.151 1.00 93.23  ? 512 GLY B O   1 
ATOM 7691  N N   . SER B 1 516 ? 28.885  53.110  109.281 1.00 61.67  ? 513 SER B N   1 
ATOM 7692  C CA  . SER B 1 516 ? 29.327  53.771  108.069 1.00 61.71  ? 513 SER B CA  1 
ATOM 7693  C C   . SER B 1 516 ? 29.605  55.236  108.392 1.00 61.20  ? 513 SER B C   1 
ATOM 7694  O O   . SER B 1 516 ? 28.784  55.916  108.992 1.00 69.39  ? 513 SER B O   1 
ATOM 7695  C CB  . SER B 1 516 ? 28.266  53.648  106.962 1.00 53.41  ? 513 SER B CB  1 
ATOM 7696  O OG  . SER B 1 516 ? 27.089  54.385  107.250 1.00 55.58  ? 513 SER B OG  1 
ATOM 7697  N N   . ILE B 1 517 ? 30.771  55.715  107.991 1.00 56.32  ? 514 ILE B N   1 
ATOM 7698  C CA  . ILE B 1 517 ? 31.148  57.091  108.228 1.00 45.15  ? 514 ILE B CA  1 
ATOM 7699  C C   . ILE B 1 517 ? 31.039  57.852  106.918 1.00 64.83  ? 514 ILE B C   1 
ATOM 7700  O O   . ILE B 1 517 ? 31.475  57.364  105.874 1.00 46.35  ? 514 ILE B O   1 
ATOM 7701  C CB  . ILE B 1 517 ? 32.578  57.159  108.768 1.00 49.10  ? 514 ILE B CB  1 
ATOM 7702  C CG1 . ILE B 1 517 ? 32.623  56.509  110.160 1.00 65.88  ? 514 ILE B CG1 1 
ATOM 7703  C CG2 . ILE B 1 517 ? 33.074  58.598  108.802 1.00 46.27  ? 514 ILE B CG2 1 
ATOM 7704  C CD1 . ILE B 1 517 ? 34.030  56.164  110.642 1.00 46.71  ? 514 ILE B CD1 1 
ATOM 7705  N N   . VAL B 1 518 ? 30.445  59.038  106.973 1.00 40.90  ? 515 VAL B N   1 
ATOM 7706  C CA  . VAL B 1 518 ? 30.271  59.872  105.786 1.00 48.01  ? 515 VAL B CA  1 
ATOM 7707  C C   . VAL B 1 518 ? 31.605  60.162  105.109 1.00 71.63  ? 515 VAL B C   1 
ATOM 7708  O O   . VAL B 1 518 ? 32.602  60.464  105.775 1.00 63.54  ? 515 VAL B O   1 
ATOM 7709  C CB  . VAL B 1 518 ? 29.576  61.214  106.110 1.00 48.57  ? 515 VAL B CB  1 
ATOM 7710  C CG1 . VAL B 1 518 ? 29.647  62.156  104.904 1.00 48.23  ? 515 VAL B CG1 1 
ATOM 7711  C CG2 . VAL B 1 518 ? 28.136  60.969  106.553 1.00 43.23  ? 515 VAL B CG2 1 
ATOM 7712  N N   . GLY B 1 519 ? 31.615  60.056  103.782 1.00 65.86  ? 516 GLY B N   1 
ATOM 7713  C CA  . GLY B 1 519 ? 32.809  60.323  102.997 1.00 47.17  ? 516 GLY B CA  1 
ATOM 7714  C C   . GLY B 1 519 ? 33.804  59.173  103.032 1.00 70.58  ? 516 GLY B C   1 
ATOM 7715  O O   . GLY B 1 519 ? 34.804  59.193  102.314 1.00 52.50  ? 516 GLY B O   1 
ATOM 7716  N N   . GLN B 1 520 ? 33.543  58.179  103.881 1.00 43.09  ? 517 GLN B N   1 
ATOM 7717  C CA  . GLN B 1 520 ? 34.390  56.996  103.949 1.00 58.54  ? 517 GLN B CA  1 
ATOM 7718  C C   . GLN B 1 520 ? 33.684  55.698  103.516 1.00 49.60  ? 517 GLN B C   1 
ATOM 7719  O O   . GLN B 1 520 ? 34.208  54.940  102.705 1.00 42.36  ? 517 GLN B O   1 
ATOM 7720  C CB  . GLN B 1 520 ? 34.979  56.853  105.350 1.00 60.93  ? 517 GLN B CB  1 
ATOM 7721  C CG  . GLN B 1 520 ? 36.007  57.908  105.667 1.00 51.16  ? 517 GLN B CG  1 
ATOM 7722  C CD  . GLN B 1 520 ? 36.420  57.905  107.119 1.00 72.21  ? 517 GLN B CD  1 
ATOM 7723  O OE1 . GLN B 1 520 ? 36.544  56.851  107.770 1.00 51.38  ? 517 GLN B OE1 1 
ATOM 7724  N NE2 . GLN B 1 520 ? 36.634  59.095  107.644 1.00 45.19  ? 517 GLN B NE2 1 
ATOM 7725  N N   . GLN B 1 521 ? 32.500  55.451  104.064 1.00 44.31  ? 518 GLN B N   1 
ATOM 7726  C CA  . GLN B 1 521 ? 31.617  54.421  103.532 1.00 61.87  ? 518 GLN B CA  1 
ATOM 7727  C C   . GLN B 1 521 ? 30.249  55.019  103.175 1.00 81.41  ? 518 GLN B C   1 
ATOM 7728  O O   . GLN B 1 521 ? 29.329  55.012  104.006 1.00 47.06  ? 518 GLN B O   1 
ATOM 7729  C CB  . GLN B 1 521 ? 31.434  53.270  104.521 1.00 46.65  ? 518 GLN B CB  1 
ATOM 7730  C CG  . GLN B 1 521 ? 32.717  52.619  104.987 1.00 51.09  ? 518 GLN B CG  1 
ATOM 7731  C CD  . GLN B 1 521 ? 33.401  53.387  106.105 1.00 54.60  ? 518 GLN B CD  1 
ATOM 7732  O OE1 . GLN B 1 521 ? 32.743  54.010  106.944 1.00 56.32  ? 518 GLN B OE1 1 
ATOM 7733  N NE2 . GLN B 1 521 ? 34.729  53.351  106.119 1.00 45.39  ? 518 GLN B NE2 1 
ATOM 7734  N N   . PRO B 1 522 ? 30.120  55.567  101.949 1.00 58.09  ? 519 PRO B N   1 
ATOM 7735  C CA  . PRO B 1 522 ? 28.811  55.993  101.453 1.00 45.40  ? 519 PRO B CA  1 
ATOM 7736  C C   . PRO B 1 522 ? 27.853  54.813  101.608 1.00 59.86  ? 519 PRO B C   1 
ATOM 7737  O O   . PRO B 1 522 ? 28.242  53.686  101.342 1.00 38.60  ? 519 PRO B O   1 
ATOM 7738  C CB  . PRO B 1 522 ? 29.090  56.289  99.981  1.00 49.79  ? 519 PRO B CB  1 
ATOM 7739  C CG  . PRO B 1 522 ? 30.506  56.728  99.964  1.00 44.01  ? 519 PRO B CG  1 
ATOM 7740  C CD  . PRO B 1 522 ? 31.200  55.880  101.001 1.00 48.98  ? 519 PRO B CD  1 
ATOM 7741  N N   . PHE B 1 523 ? 26.625  55.057  102.037 1.00 48.30  ? 520 PHE B N   1 
ATOM 7742  C CA  . PHE B 1 523 ? 25.816  53.972  102.578 1.00 51.67  ? 520 PHE B CA  1 
ATOM 7743  C C   . PHE B 1 523 ? 24.532  53.664  101.801 1.00 40.76  ? 520 PHE B C   1 
ATOM 7744  O O   . PHE B 1 523 ? 23.830  54.563  101.342 1.00 45.96  ? 520 PHE B O   1 
ATOM 7745  C CB  . PHE B 1 523 ? 25.514  54.258  104.056 1.00 44.87  ? 520 PHE B CB  1 
ATOM 7746  C CG  . PHE B 1 523 ? 24.671  53.199  104.724 1.00 66.06  ? 520 PHE B CG  1 
ATOM 7747  C CD1 . PHE B 1 523 ? 23.283  53.340  104.801 1.00 50.80  ? 520 PHE B CD1 1 
ATOM 7748  C CD2 . PHE B 1 523 ? 25.262  52.064  105.280 1.00 45.18  ? 520 PHE B CD2 1 
ATOM 7749  C CE1 . PHE B 1 523 ? 22.497  52.370  105.403 1.00 55.90  ? 520 PHE B CE1 1 
ATOM 7750  C CE2 . PHE B 1 523 ? 24.481  51.080  105.891 1.00 50.06  ? 520 PHE B CE2 1 
ATOM 7751  C CZ  . PHE B 1 523 ? 23.099  51.239  105.956 1.00 70.75  ? 520 PHE B CZ  1 
ATOM 7752  N N   . GLY B 1 524 ? 24.241  52.376  101.664 1.00 53.23  ? 521 GLY B N   1 
ATOM 7753  C CA  . GLY B 1 524 ? 23.038  51.907  100.988 1.00 49.24  ? 521 GLY B CA  1 
ATOM 7754  C C   . GLY B 1 524 ? 23.276  50.634  100.192 1.00 45.76  ? 521 GLY B C   1 
ATOM 7755  O O   . GLY B 1 524 ? 24.406  50.255  99.908  1.00 41.67  ? 521 GLY B O   1 
ATOM 7756  N N   . GLY B 1 525 ? 22.202  49.967  99.814  1.00 39.04  ? 522 GLY B N   1 
ATOM 7757  C CA  . GLY B 1 525 ? 22.329  48.750  99.040  1.00 40.49  ? 522 GLY B CA  1 
ATOM 7758  C C   . GLY B 1 525 ? 21.110  48.493  98.183  1.00 57.11  ? 522 GLY B C   1 
ATOM 7759  O O   . GLY B 1 525 ? 20.074  49.156  98.319  1.00 40.97  ? 522 GLY B O   1 
ATOM 7760  N N   . ALA B 1 526 ? 21.233  47.528  97.287  1.00 47.30  ? 523 ALA B N   1 
ATOM 7761  C CA  . ALA B 1 526 ? 20.156  47.284  96.352  1.00 44.25  ? 523 ALA B CA  1 
ATOM 7762  C C   . ALA B 1 526 ? 19.307  46.093  96.798  1.00 46.54  ? 523 ALA B C   1 
ATOM 7763  O O   . ALA B 1 526 ? 19.025  45.947  97.985  1.00 46.37  ? 523 ALA B O   1 
ATOM 7764  C CB  . ALA B 1 526 ? 20.698  47.120  94.929  1.00 34.06  ? 523 ALA B CB  1 
ATOM 7765  N N   . ARG B 1 527 ? 18.910  45.252  95.851  1.00 52.19  ? 524 ARG B N   1 
ATOM 7766  C CA  . ARG B 1 527 ? 17.858  44.276  96.089  1.00 51.49  ? 524 ARG B CA  1 
ATOM 7767  C C   . ARG B 1 527 ? 16.695  44.946  96.796  1.00 53.78  ? 524 ARG B C   1 
ATOM 7768  O O   . ARG B 1 527 ? 16.338  46.053  96.437  1.00 54.31  ? 524 ARG B O   1 
ATOM 7769  C CB  . ARG B 1 527 ? 18.389  43.074  96.843  1.00 50.65  ? 524 ARG B CB  1 
ATOM 7770  C CG  . ARG B 1 527 ? 19.175  42.167  95.909  1.00 52.49  ? 524 ARG B CG  1 
ATOM 7771  C CD  . ARG B 1 527 ? 19.972  41.173  96.672  1.00 53.71  ? 524 ARG B CD  1 
ATOM 7772  N NE  . ARG B 1 527 ? 20.992  40.512  95.890  1.00 45.30  ? 524 ARG B NE  1 
ATOM 7773  C CZ  . ARG B 1 527 ? 21.451  39.275  96.048  1.00 52.35  ? 524 ARG B CZ  1 
ATOM 7774  N NH1 . ARG B 1 527 ? 20.960  38.449  96.958  1.00 80.75  ? 524 ARG B NH1 1 
ATOM 7775  N NH2 . ARG B 1 527 ? 22.409  38.861  95.246  1.00 41.31  ? 524 ARG B NH2 1 
ATOM 7776  N N   . ALA B 1 528 ? 16.109  44.298  97.790  1.00 41.05  ? 525 ALA B N   1 
ATOM 7777  C CA  . ALA B 1 528 ? 14.942  44.862  98.466  1.00 41.88  ? 525 ALA B CA  1 
ATOM 7778  C C   . ALA B 1 528 ? 15.305  45.982  99.431  1.00 48.20  ? 525 ALA B C   1 
ATOM 7779  O O   . ALA B 1 528 ? 14.423  46.625  99.985  1.00 51.82  ? 525 ALA B O   1 
ATOM 7780  C CB  . ALA B 1 528 ? 14.127  43.756  99.183  1.00 39.15  ? 525 ALA B CB  1 
ATOM 7781  N N   . SER B 1 529 ? 16.599  46.230  99.613  1.00 46.08  ? 526 SER B N   1 
ATOM 7782  C CA  . SER B 1 529 ? 17.035  47.220  100.592 1.00 47.13  ? 526 SER B CA  1 
ATOM 7783  C C   . SER B 1 529 ? 16.907  48.673  100.121 1.00 62.50  ? 526 SER B C   1 
ATOM 7784  O O   . SER B 1 529 ? 17.179  49.598  100.878 1.00 48.63  ? 526 SER B O   1 
ATOM 7785  C CB  . SER B 1 529 ? 18.456  46.939  101.070 1.00 44.31  ? 526 SER B CB  1 
ATOM 7786  O OG  . SER B 1 529 ? 18.548  45.686  101.739 1.00 51.41  ? 526 SER B OG  1 
ATOM 7787  N N   . GLY B 1 530 ? 16.488  48.877  98.878  1.00 47.28  ? 527 GLY B N   1 
ATOM 7788  C CA  . GLY B 1 530 ? 16.236  50.220  98.382  1.00 35.49  ? 527 GLY B CA  1 
ATOM 7789  C C   . GLY B 1 530 ? 16.799  50.593  97.018  1.00 52.43  ? 527 GLY B C   1 
ATOM 7790  O O   . GLY B 1 530 ? 17.198  49.755  96.199  1.00 40.69  ? 527 GLY B O   1 
ATOM 7791  N N   . THR B 1 531 ? 16.833  51.888  96.768  1.00 36.89  ? 528 THR B N   1 
ATOM 7792  C CA  . THR B 1 531 ? 17.236  52.381  95.466  1.00 50.49  ? 528 THR B CA  1 
ATOM 7793  C C   . THR B 1 531 ? 18.740  52.635  95.376  1.00 47.44  ? 528 THR B C   1 
ATOM 7794  O O   . THR B 1 531 ? 19.246  52.963  94.306  1.00 42.76  ? 528 THR B O   1 
ATOM 7795  C CB  . THR B 1 531 ? 16.445  53.663  95.058  1.00 42.35  ? 528 THR B CB  1 
ATOM 7796  O OG1 . THR B 1 531 ? 16.516  54.631  96.107  1.00 35.10  ? 528 THR B OG1 1 
ATOM 7797  C CG2 . THR B 1 531 ? 15.000  53.344  94.795  1.00 40.38  ? 528 THR B CG2 1 
ATOM 7798  N N   . ASN B 1 532 ? 19.435  52.487  96.499  1.00 53.30  ? 529 ASN B N   1 
ATOM 7799  C CA  . ASN B 1 532 ? 20.895  52.615  96.565  1.00 46.92  ? 529 ASN B CA  1 
ATOM 7800  C C   . ASN B 1 532 ? 21.477  53.890  95.942  1.00 46.62  ? 529 ASN B C   1 
ATOM 7801  O O   . ASN B 1 532 ? 22.315  53.842  95.040  1.00 47.62  ? 529 ASN B O   1 
ATOM 7802  C CB  . ASN B 1 532 ? 21.577  51.385  95.974  1.00 34.56  ? 529 ASN B CB  1 
ATOM 7803  C CG  . ASN B 1 532 ? 23.052  51.319  96.318  1.00 54.47  ? 529 ASN B CG  1 
ATOM 7804  O OD1 . ASN B 1 532 ? 23.509  51.929  97.288  1.00 52.48  ? 529 ASN B OD1 1 
ATOM 7805  N ND2 . ASN B 1 532 ? 23.809  50.578  95.516  1.00 53.93  ? 529 ASN B ND2 1 
ATOM 7806  N N   . ASP B 1 533 ? 21.052  55.033  96.459  1.00 42.79  ? 530 ASP B N   1 
ATOM 7807  C CA  . ASP B 1 533 ? 21.559  56.317  95.998  1.00 42.22  ? 530 ASP B CA  1 
ATOM 7808  C C   . ASP B 1 533 ? 22.826  56.772  96.737  1.00 46.17  ? 530 ASP B C   1 
ATOM 7809  O O   . ASP B 1 533 ? 23.409  57.804  96.397  1.00 48.14  ? 530 ASP B O   1 
ATOM 7810  C CB  . ASP B 1 533 ? 20.444  57.387  96.047  1.00 41.64  ? 530 ASP B CB  1 
ATOM 7811  C CG  . ASP B 1 533 ? 19.261  57.035  95.144  1.00 51.91  ? 530 ASP B CG  1 
ATOM 7812  O OD1 . ASP B 1 533 ? 19.471  56.743  93.945  1.00 69.92  ? 530 ASP B OD1 1 
ATOM 7813  O OD2 . ASP B 1 533 ? 18.124  57.012  95.644  1.00 52.34  ? 530 ASP B OD2 1 
ATOM 7814  N N   . LYS B 1 534 ? 23.243  55.998  97.735  1.00 52.37  ? 531 LYS B N   1 
ATOM 7815  C CA  . LYS B 1 534 ? 24.490  56.236  98.464  1.00 44.12  ? 531 LYS B CA  1 
ATOM 7816  C C   . LYS B 1 534 ? 24.626  57.586  99.147  1.00 34.19  ? 531 LYS B C   1 
ATOM 7817  O O   . LYS B 1 534 ? 25.586  58.303  98.887  1.00 33.80  ? 531 LYS B O   1 
ATOM 7818  C CB  . LYS B 1 534 ? 25.709  56.025  97.551  1.00 30.58  ? 531 LYS B CB  1 
ATOM 7819  C CG  . LYS B 1 534 ? 26.001  54.573  97.233  1.00 40.75  ? 531 LYS B CG  1 
ATOM 7820  C CD  . LYS B 1 534 ? 26.043  53.734  98.490  1.00 42.71  ? 531 LYS B CD  1 
ATOM 7821  C CE  . LYS B 1 534 ? 26.873  52.494  98.266  1.00 40.03  ? 531 LYS B CE  1 
ATOM 7822  N NZ  . LYS B 1 534 ? 26.818  51.608  99.431  1.00 40.38  ? 531 LYS B NZ  1 
ATOM 7823  N N   . PRO B 1 535 ? 23.707  57.926  100.061 1.00 42.16  ? 532 PRO B N   1 
ATOM 7824  C CA  . PRO B 1 535 ? 23.963  59.119  100.883 1.00 32.85  ? 532 PRO B CA  1 
ATOM 7825  C C   . PRO B 1 535 ? 25.303  58.991  101.601 1.00 50.65  ? 532 PRO B C   1 
ATOM 7826  O O   . PRO B 1 535 ? 25.681  57.905  102.016 1.00 54.66  ? 532 PRO B O   1 
ATOM 7827  C CB  . PRO B 1 535 ? 22.832  59.096  101.909 1.00 34.00  ? 532 PRO B CB  1 
ATOM 7828  C CG  . PRO B 1 535 ? 22.293  57.696  101.870 1.00 36.85  ? 532 PRO B CG  1 
ATOM 7829  C CD  . PRO B 1 535 ? 22.457  57.263  100.433 1.00 39.78  ? 532 PRO B CD  1 
ATOM 7830  N N   . GLY B 1 536 ? 26.017  60.088  101.755 1.00 41.53  ? 533 GLY B N   1 
ATOM 7831  C CA  . GLY B 1 536 ? 27.344  60.027  102.328 1.00 41.33  ? 533 GLY B CA  1 
ATOM 7832  C C   . GLY B 1 536 ? 28.401  59.977  101.240 1.00 61.73  ? 533 GLY B C   1 
ATOM 7833  O O   . GLY B 1 536 ? 29.585  59.970  101.535 1.00 59.50  ? 533 GLY B O   1 
ATOM 7834  N N   . GLY B 1 537 ? 27.965  59.957  99.981  1.00 54.59  ? 534 GLY B N   1 
ATOM 7835  C CA  . GLY B 1 537 ? 28.864  59.992  98.843  1.00 43.44  ? 534 GLY B CA  1 
ATOM 7836  C C   . GLY B 1 537 ? 28.632  61.214  97.960  1.00 40.85  ? 534 GLY B C   1 
ATOM 7837  O O   . GLY B 1 537 ? 27.678  61.959  98.167  1.00 73.50  ? 534 GLY B O   1 
ATOM 7838  N N   . PRO B 1 538 ? 29.500  61.406  96.954  1.00 60.90  ? 535 PRO B N   1 
ATOM 7839  C CA  . PRO B 1 538 ? 29.478  62.593  96.080  1.00 47.12  ? 535 PRO B CA  1 
ATOM 7840  C C   . PRO B 1 538 ? 28.353  62.607  95.032  1.00 36.58  ? 535 PRO B C   1 
ATOM 7841  O O   . PRO B 1 538 ? 28.056  63.660  94.480  1.00 63.57  ? 535 PRO B O   1 
ATOM 7842  C CB  . PRO B 1 538 ? 30.847  62.561  95.399  1.00 43.72  ? 535 PRO B CB  1 
ATOM 7843  C CG  . PRO B 1 538 ? 31.398  61.143  95.599  1.00 39.97  ? 535 PRO B CG  1 
ATOM 7844  C CD  . PRO B 1 538 ? 30.464  60.380  96.504  1.00 34.52  ? 535 PRO B CD  1 
ATOM 7845  N N   . HIS B 1 539 ? 27.701  61.471  94.821  1.00 41.39  ? 536 HIS B N   1 
ATOM 7846  C CA  . HIS B 1 539 ? 26.695  61.336  93.784  1.00 52.24  ? 536 HIS B CA  1 
ATOM 7847  C C   . HIS B 1 539 ? 25.259  61.446  94.292  1.00 36.13  ? 536 HIS B C   1 
ATOM 7848  O O   . HIS B 1 539 ? 24.328  61.664  93.517  1.00 54.24  ? 536 HIS B O   1 
ATOM 7849  C CB  . HIS B 1 539 ? 26.917  60.010  93.040  1.00 31.88  ? 536 HIS B CB  1 
ATOM 7850  C CG  . HIS B 1 539 ? 28.286  59.890  92.449  1.00 52.45  ? 536 HIS B CG  1 
ATOM 7851  N ND1 . HIS B 1 539 ? 29.083  58.779  92.632  1.00 32.32  ? 536 HIS B ND1 1 
ATOM 7852  C CD2 . HIS B 1 539 ? 29.014  60.758  91.703  1.00 28.09  ? 536 HIS B CD2 1 
ATOM 7853  C CE1 . HIS B 1 539 ? 30.233  58.959  92.008  1.00 49.59  ? 536 HIS B CE1 1 
ATOM 7854  N NE2 . HIS B 1 539 ? 30.222  60.154  91.443  1.00 49.66  ? 536 HIS B NE2 1 
ATOM 7855  N N   . TYR B 1 540 ? 25.078  61.297  95.590  1.00 48.63  ? 537 TYR B N   1 
ATOM 7856  C CA  . TYR B 1 540 ? 23.745  61.340  96.171  1.00 41.62  ? 537 TYR B CA  1 
ATOM 7857  C C   . TYR B 1 540 ? 22.971  62.601  95.781  1.00 43.02  ? 537 TYR B C   1 
ATOM 7858  O O   . TYR B 1 540 ? 21.823  62.529  95.350  1.00 46.83  ? 537 TYR B O   1 
ATOM 7859  C CB  . TYR B 1 540 ? 23.851  61.251  97.689  1.00 24.74  ? 537 TYR B CB  1 
ATOM 7860  C CG  . TYR B 1 540 ? 22.526  61.356  98.432  1.00 36.52  ? 537 TYR B CG  1 
ATOM 7861  C CD1 . TYR B 1 540 ? 21.581  60.340  98.355  1.00 33.03  ? 537 TYR B CD1 1 
ATOM 7862  C CD2 . TYR B 1 540 ? 22.250  62.438  99.258  1.00 33.38  ? 537 TYR B CD2 1 
ATOM 7863  C CE1 . TYR B 1 540 ? 20.398  60.408  99.057  1.00 49.26  ? 537 TYR B CE1 1 
ATOM 7864  C CE2 . TYR B 1 540 ? 21.058  62.505  99.989  1.00 43.15  ? 537 TYR B CE2 1 
ATOM 7865  C CZ  . TYR B 1 540 ? 20.140  61.486  99.878  1.00 52.78  ? 537 TYR B CZ  1 
ATOM 7866  O OH  . TYR B 1 540 ? 18.954  61.533  100.572 1.00 44.31  ? 537 TYR B OH  1 
ATOM 7867  N N   . ILE B 1 541 ? 23.593  63.759  95.956  1.00 38.03  ? 538 ILE B N   1 
ATOM 7868  C CA  . ILE B 1 541 ? 22.940  65.024  95.652  1.00 48.71  ? 538 ILE B CA  1 
ATOM 7869  C C   . ILE B 1 541 ? 22.398  65.119  94.206  1.00 49.36  ? 538 ILE B C   1 
ATOM 7870  O O   . ILE B 1 541 ? 21.457  65.868  93.961  1.00 36.97  ? 538 ILE B O   1 
ATOM 7871  C CB  . ILE B 1 541 ? 23.872  66.223  95.939  1.00 43.62  ? 538 ILE B CB  1 
ATOM 7872  C CG1 . ILE B 1 541 ? 25.205  66.020  95.218  1.00 47.42  ? 538 ILE B CG1 1 
ATOM 7873  C CG2 . ILE B 1 541 ? 24.104  66.383  97.430  1.00 39.24  ? 538 ILE B CG2 1 
ATOM 7874  C CD1 . ILE B 1 541 ? 26.037  67.264  95.036  1.00 45.50  ? 538 ILE B CD1 1 
ATOM 7875  N N   . LEU B 1 542 ? 22.980  64.375  93.260  1.00 33.21  ? 539 LEU B N   1 
ATOM 7876  C CA  . LEU B 1 542 ? 22.497  64.406  91.863  1.00 37.18  ? 539 LEU B CA  1 
ATOM 7877  C C   . LEU B 1 542 ? 21.027  64.018  91.722  1.00 42.45  ? 539 LEU B C   1 
ATOM 7878  O O   . LEU B 1 542 ? 20.350  64.499  90.822  1.00 59.70  ? 539 LEU B O   1 
ATOM 7879  C CB  . LEU B 1 542 ? 23.344  63.526  90.943  1.00 28.24  ? 539 LEU B CB  1 
ATOM 7880  C CG  . LEU B 1 542 ? 24.811  63.926  90.847  1.00 47.63  ? 539 LEU B CG  1 
ATOM 7881  C CD1 . LEU B 1 542 ? 25.564  62.935  90.003  1.00 49.14  ? 539 LEU B CD1 1 
ATOM 7882  C CD2 . LEU B 1 542 ? 24.908  65.299  90.270  1.00 37.10  ? 539 LEU B CD2 1 
ATOM 7883  N N   . ARG B 1 543 ? 20.528  63.144  92.595  1.00 31.07  ? 540 ARG B N   1 
ATOM 7884  C CA  . ARG B 1 543 ? 19.111  62.831  92.549  1.00 25.31  ? 540 ARG B CA  1 
ATOM 7885  C C   . ARG B 1 543 ? 18.228  64.077  92.751  1.00 33.73  ? 540 ARG B C   1 
ATOM 7886  O O   . ARG B 1 543 ? 17.080  64.079  92.341  1.00 39.17  ? 540 ARG B O   1 
ATOM 7887  C CB  . ARG B 1 543 ? 18.757  61.737  93.544  1.00 26.78  ? 540 ARG B CB  1 
ATOM 7888  C CG  . ARG B 1 543 ? 19.486  60.453  93.287  1.00 46.71  ? 540 ARG B CG  1 
ATOM 7889  C CD  . ARG B 1 543 ? 19.178  59.867  91.918  1.00 29.36  ? 540 ARG B CD  1 
ATOM 7890  N NE  . ARG B 1 543 ? 17.778  59.434  91.781  1.00 59.52  ? 540 ARG B NE  1 
ATOM 7891  C CZ  . ARG B 1 543 ? 17.022  59.660  90.712  1.00 54.79  ? 540 ARG B CZ  1 
ATOM 7892  N NH1 . ARG B 1 543 ? 17.508  60.334  89.674  1.00 36.48  ? 540 ARG B NH1 1 
ATOM 7893  N NH2 . ARG B 1 543 ? 15.779  59.218  90.683  1.00 49.41  ? 540 ARG B NH2 1 
ATOM 7894  N N   . TRP B 1 544 ? 18.780  65.138  93.344  1.00 30.58  ? 541 TRP B N   1 
ATOM 7895  C CA  . TRP B 1 544 ? 17.985  66.301  93.763  1.00 42.95  ? 541 TRP B CA  1 
ATOM 7896  C C   . TRP B 1 544 ? 18.197  67.549  92.911  1.00 50.03  ? 541 TRP B C   1 
ATOM 7897  O O   . TRP B 1 544 ? 17.731  68.635  93.248  1.00 42.71  ? 541 TRP B O   1 
ATOM 7898  C CB  . TRP B 1 544 ? 18.189  66.590  95.261  1.00 36.13  ? 541 TRP B CB  1 
ATOM 7899  C CG  . TRP B 1 544 ? 17.960  65.347  96.045  1.00 32.45  ? 541 TRP B CG  1 
ATOM 7900  C CD1 . TRP B 1 544 ? 18.871  64.676  96.808  1.00 49.46  ? 541 TRP B CD1 1 
ATOM 7901  C CD2 . TRP B 1 544 ? 16.743  64.583  96.102  1.00 37.52  ? 541 TRP B CD2 1 
ATOM 7902  N NE1 . TRP B 1 544 ? 18.294  63.556  97.350  1.00 39.21  ? 541 TRP B NE1 1 
ATOM 7903  C CE2 . TRP B 1 544 ? 16.988  63.478  96.928  1.00 34.83  ? 541 TRP B CE2 1 
ATOM 7904  C CE3 . TRP B 1 544 ? 15.463  64.739  95.539  1.00 28.34  ? 541 TRP B CE3 1 
ATOM 7905  C CZ2 . TRP B 1 544 ? 16.010  62.520  97.200  1.00 35.73  ? 541 TRP B CZ2 1 
ATOM 7906  C CZ3 . TRP B 1 544 ? 14.503  63.790  95.806  1.00 33.07  ? 541 TRP B CZ3 1 
ATOM 7907  C CH2 . TRP B 1 544 ? 14.784  62.690  96.631  1.00 35.59  ? 541 TRP B CH2 1 
ATOM 7908  N N   . THR B 1 545 ? 18.899  67.387  91.797  1.00 45.16  ? 542 THR B N   1 
ATOM 7909  C CA  . THR B 1 545 ? 18.995  68.455  90.804  1.00 42.62  ? 542 THR B CA  1 
ATOM 7910  C C   . THR B 1 545 ? 18.511  67.993  89.423  1.00 42.46  ? 542 THR B C   1 
ATOM 7911  O O   . THR B 1 545 ? 18.638  66.820  89.094  1.00 36.56  ? 542 THR B O   1 
ATOM 7912  C CB  . THR B 1 545 ? 20.420  68.980  90.718  1.00 23.58  ? 542 THR B CB  1 
ATOM 7913  O OG1 . THR B 1 545 ? 20.498  69.970  89.702  1.00 40.45  ? 542 THR B OG1 1 
ATOM 7914  C CG2 . THR B 1 545 ? 21.395  67.859  90.393  1.00 19.43  ? 542 THR B CG2 1 
ATOM 7915  N N   . SER B 1 546 ? 17.931  68.916  88.648  1.00 32.64  ? 543 SER B N   1 
ATOM 7916  C CA  . SER B 1 546 ? 17.559  68.668  87.247  1.00 45.12  ? 543 SER B CA  1 
ATOM 7917  C C   . SER B 1 546 ? 18.304  69.668  86.363  1.00 28.55  ? 543 SER B C   1 
ATOM 7918  O O   . SER B 1 546 ? 17.825  70.775  86.148  1.00 44.04  ? 543 SER B O   1 
ATOM 7919  C CB  . SER B 1 546 ? 16.055  68.848  87.043  1.00 29.53  ? 543 SER B CB  1 
ATOM 7920  O OG  . SER B 1 546 ? 15.595  68.203  85.868  1.00 47.99  ? 543 SER B OG  1 
ATOM 7921  N N   . PRO B 1 547 ? 19.483  69.281  85.859  1.00 20.87  ? 544 PRO B N   1 
ATOM 7922  C CA  . PRO B 1 547 ? 20.386  70.224  85.178  1.00 26.39  ? 544 PRO B CA  1 
ATOM 7923  C C   . PRO B 1 547 ? 19.791  70.821  83.912  1.00 46.17  ? 544 PRO B C   1 
ATOM 7924  O O   . PRO B 1 547 ? 19.013  70.189  83.199  1.00 32.13  ? 544 PRO B O   1 
ATOM 7925  C CB  . PRO B 1 547 ? 21.632  69.382  84.858  1.00 31.72  ? 544 PRO B CB  1 
ATOM 7926  C CG  . PRO B 1 547 ? 21.495  68.120  85.722  1.00 29.36  ? 544 PRO B CG  1 
ATOM 7927  C CD  . PRO B 1 547 ? 20.014  67.904  85.866  1.00 28.98  ? 544 PRO B CD  1 
ATOM 7928  N N   . GLN B 1 548 ? 20.129  72.080  83.684  1.00 36.55  ? 545 GLN B N   1 
ATOM 7929  C CA  . GLN B 1 548 ? 19.813  72.777  82.459  1.00 40.35  ? 545 GLN B CA  1 
ATOM 7930  C C   . GLN B 1 548 ? 21.152  73.067  81.779  1.00 43.73  ? 545 GLN B C   1 
ATOM 7931  O O   . GLN B 1 548 ? 22.126  73.407  82.452  1.00 43.77  ? 545 GLN B O   1 
ATOM 7932  C CB  . GLN B 1 548 ? 19.073  74.080  82.785  1.00 39.04  ? 545 GLN B CB  1 
ATOM 7933  C CG  . GLN B 1 548 ? 18.843  74.985  81.606  1.00 33.76  ? 545 GLN B CG  1 
ATOM 7934  C CD  . GLN B 1 548 ? 18.342  76.356  82.004  1.00 34.06  ? 545 GLN B CD  1 
ATOM 7935  O OE1 . GLN B 1 548 ? 18.947  77.026  82.835  1.00 38.83  ? 545 GLN B OE1 1 
ATOM 7936  N NE2 . GLN B 1 548 ? 17.242  76.795  81.396  1.00 27.23  ? 545 GLN B NE2 1 
ATOM 7937  N N   . VAL B 1 549 ? 21.218  72.896  80.463  1.00 47.56  ? 546 VAL B N   1 
ATOM 7938  C CA  . VAL B 1 549 ? 22.392  73.311  79.694  1.00 30.99  ? 546 VAL B CA  1 
ATOM 7939  C C   . VAL B 1 549 ? 22.043  74.551  78.892  1.00 37.79  ? 546 VAL B C   1 
ATOM 7940  O O   . VAL B 1 549 ? 20.981  74.625  78.274  1.00 29.95  ? 546 VAL B O   1 
ATOM 7941  C CB  . VAL B 1 549 ? 22.905  72.201  78.791  1.00 36.67  ? 546 VAL B CB  1 
ATOM 7942  C CG1 . VAL B 1 549 ? 24.110  72.677  78.003  1.00 40.18  ? 546 VAL B CG1 1 
ATOM 7943  C CG2 . VAL B 1 549 ? 23.272  71.009  79.631  1.00 45.52  ? 546 VAL B CG2 1 
ATOM 7944  N N   . ILE B 1 550 ? 22.908  75.549  78.969  1.00 28.99  ? 547 ILE B N   1 
ATOM 7945  C CA  . ILE B 1 550 ? 22.729  76.777  78.222  1.00 44.18  ? 547 ILE B CA  1 
ATOM 7946  C C   . ILE B 1 550 ? 23.867  76.978  77.215  1.00 37.26  ? 547 ILE B C   1 
ATOM 7947  O O   . ILE B 1 550 ? 25.040  77.007  77.584  1.00 45.09  ? 547 ILE B O   1 
ATOM 7948  C CB  . ILE B 1 550 ? 22.667  77.989  79.156  1.00 40.82  ? 547 ILE B CB  1 
ATOM 7949  C CG1 . ILE B 1 550 ? 21.505  77.857  80.130  1.00 44.04  ? 547 ILE B CG1 1 
ATOM 7950  C CG2 . ILE B 1 550 ? 22.520  79.285  78.358  1.00 25.14  ? 547 ILE B CG2 1 
ATOM 7951  C CD1 . ILE B 1 550 ? 21.474  78.956  81.129  1.00 34.27  ? 547 ILE B CD1 1 
ATOM 7952  N N   . LYS B 1 551 ? 23.503  77.113  75.945  1.00 48.21  ? 548 LYS B N   1 
ATOM 7953  C CA  . LYS B 1 551 ? 24.455  77.414  74.881  1.00 47.89  ? 548 LYS B CA  1 
ATOM 7954  C C   . LYS B 1 551 ? 24.207  78.811  74.363  1.00 54.28  ? 548 LYS B C   1 
ATOM 7955  O O   . LYS B 1 551 ? 23.117  79.134  73.867  1.00 31.33  ? 548 LYS B O   1 
ATOM 7956  C CB  . LYS B 1 551 ? 24.327  76.430  73.727  1.00 46.82  ? 548 LYS B CB  1 
ATOM 7957  C CG  . LYS B 1 551 ? 24.989  76.892  72.421  1.00 41.93  ? 548 LYS B CG  1 
ATOM 7958  C CD  . LYS B 1 551 ? 24.733  75.873  71.315  1.00 41.31  ? 548 LYS B CD  1 
ATOM 7959  C CE  . LYS B 1 551 ? 25.490  76.205  70.044  1.00 47.31  ? 548 LYS B CE  1 
ATOM 7960  N NZ  . LYS B 1 551 ? 25.209  75.240  68.952  1.00 31.77  ? 548 LYS B NZ  1 
ATOM 7961  N N   . GLU B 1 552 ? 25.217  79.653  74.497  1.00 35.73  ? 549 GLU B N   1 
ATOM 7962  C CA  . GLU B 1 552 ? 25.140  80.980  73.903  1.00 56.23  ? 549 GLU B CA  1 
ATOM 7963  C C   . GLU B 1 552 ? 26.047  81.096  72.680  1.00 52.70  ? 549 GLU B C   1 
ATOM 7964  O O   . GLU B 1 552 ? 27.230  80.749  72.731  1.00 32.22  ? 549 GLU B O   1 
ATOM 7965  C CB  . GLU B 1 552 ? 25.500  82.048  74.922  1.00 38.37  ? 549 GLU B CB  1 
ATOM 7966  C CG  . GLU B 1 552 ? 25.409  83.442  74.350  1.00 47.68  ? 549 GLU B CG  1 
ATOM 7967  C CD  . GLU B 1 552 ? 25.454  84.503  75.412  1.00 77.94  ? 549 GLU B CD  1 
ATOM 7968  O OE1 . GLU B 1 552 ? 25.631  84.153  76.603  1.00 71.41  ? 549 GLU B OE1 1 
ATOM 7969  O OE2 . GLU B 1 552 ? 25.305  85.687  75.046  1.00 71.42  ? 549 GLU B OE2 1 
ATOM 7970  N N   . THR B 1 553 ? 25.482  81.562  71.572  1.00 39.87  ? 550 THR B N   1 
ATOM 7971  C CA  . THR B 1 553 ? 26.256  81.744  70.345  1.00 51.53  ? 550 THR B CA  1 
ATOM 7972  C C   . THR B 1 553 ? 26.543  83.217  70.103  1.00 38.84  ? 550 THR B C   1 
ATOM 7973  O O   . THR B 1 553 ? 25.632  84.039  70.111  1.00 43.82  ? 550 THR B O   1 
ATOM 7974  C CB  . THR B 1 553 ? 25.525  81.133  69.158  1.00 57.56  ? 550 THR B CB  1 
ATOM 7975  O OG1 . THR B 1 553 ? 25.427  79.726  69.382  1.00 44.79  ? 550 THR B OG1 1 
ATOM 7976  C CG2 . THR B 1 553 ? 26.287  81.385  67.853  1.00 41.30  ? 550 THR B CG2 1 
ATOM 7977  N N   . HIS B 1 554 ? 27.810  83.546  69.878  1.00 54.33  ? 551 HIS B N   1 
ATOM 7978  C CA  . HIS B 1 554 ? 28.244  84.949  69.827  1.00 74.70  ? 551 HIS B CA  1 
ATOM 7979  C C   . HIS B 1 554 ? 28.392  85.566  68.427  1.00 74.09  ? 551 HIS B C   1 
ATOM 7980  O O   . HIS B 1 554 ? 28.560  86.772  68.307  1.00 61.62  ? 551 HIS B O   1 
ATOM 7981  C CB  . HIS B 1 554 ? 29.555  85.123  70.599  1.00 42.71  ? 551 HIS B CB  1 
ATOM 7982  C CG  . HIS B 1 554 ? 29.541  84.494  71.950  1.00 63.10  ? 551 HIS B CG  1 
ATOM 7983  N ND1 . HIS B 1 554 ? 28.810  85.009  72.997  1.00 49.96  ? 551 HIS B ND1 1 
ATOM 7984  C CD2 . HIS B 1 554 ? 30.155  83.384  72.425  1.00 51.39  ? 551 HIS B CD2 1 
ATOM 7985  C CE1 . HIS B 1 554 ? 28.977  84.243  74.063  1.00 41.64  ? 551 HIS B CE1 1 
ATOM 7986  N NE2 . HIS B 1 554 ? 29.786  83.251  73.741  1.00 50.69  ? 551 HIS B NE2 1 
ATOM 7987  N N   . LYS B 1 555 ? 28.358  84.743  67.385  1.00 67.82  ? 552 LYS B N   1 
ATOM 7988  C CA  . LYS B 1 555 ? 28.430  85.235  66.014  1.00 68.86  ? 552 LYS B CA  1 
ATOM 7989  C C   . LYS B 1 555 ? 27.126  84.893  65.282  1.00 78.38  ? 552 LYS B C   1 
ATOM 7990  O O   . LYS B 1 555 ? 26.483  83.902  65.608  1.00 77.00  ? 552 LYS B O   1 
ATOM 7991  C CB  . LYS B 1 555 ? 29.649  84.642  65.292  1.00 37.06  ? 552 LYS B CB  1 
ATOM 7992  N N   . PRO B 1 556 ? 26.721  85.728  64.308  1.00 77.79  ? 553 PRO B N   1 
ATOM 7993  C CA  . PRO B 1 556 ? 25.507  85.529  63.495  1.00 64.41  ? 553 PRO B CA  1 
ATOM 7994  C C   . PRO B 1 556 ? 25.470  84.157  62.829  1.00 60.98  ? 553 PRO B C   1 
ATOM 7995  O O   . PRO B 1 556 ? 26.520  83.617  62.493  1.00 57.40  ? 553 PRO B O   1 
ATOM 7996  C CB  . PRO B 1 556 ? 25.611  86.629  62.432  1.00 57.37  ? 553 PRO B CB  1 
ATOM 7997  C CG  . PRO B 1 556 ? 26.411  87.703  63.097  1.00 76.00  ? 553 PRO B CG  1 
ATOM 7998  C CD  . PRO B 1 556 ? 27.407  86.988  63.973  1.00 76.87  ? 553 PRO B CD  1 
ATOM 7999  N N   . LEU B 1 557 ? 24.275  83.611  62.626  1.00 39.20  ? 554 LEU B N   1 
ATOM 8000  C CA  . LEU B 1 557 ? 24.119  82.206  62.229  1.00 54.71  ? 554 LEU B CA  1 
ATOM 8001  C C   . LEU B 1 557 ? 24.567  81.808  60.816  1.00 75.87  ? 554 LEU B C   1 
ATOM 8002  O O   . LEU B 1 557 ? 25.311  80.842  60.656  1.00 81.77  ? 554 LEU B O   1 
ATOM 8003  C CB  . LEU B 1 557 ? 22.694  81.711  62.505  1.00 54.48  ? 554 LEU B CB  1 
ATOM 8004  C CG  . LEU B 1 557 ? 22.324  81.586  63.991  1.00 53.88  ? 554 LEU B CG  1 
ATOM 8005  C CD1 . LEU B 1 557 ? 20.996  80.907  64.145  1.00 36.88  ? 554 LEU B CD1 1 
ATOM 8006  C CD2 . LEU B 1 557 ? 23.394  80.810  64.761  1.00 23.68  ? 554 LEU B CD2 1 
ATOM 8007  N N   . GLY B 1 558 ? 24.124  82.526  59.794  1.00 64.16  ? 555 GLY B N   1 
ATOM 8008  C CA  . GLY B 1 558 ? 24.481  82.145  58.439  1.00 51.43  ? 555 GLY B CA  1 
ATOM 8009  C C   . GLY B 1 558 ? 23.354  81.479  57.663  1.00 50.77  ? 555 GLY B C   1 
ATOM 8010  O O   . GLY B 1 558 ? 22.246  81.330  58.167  1.00 67.68  ? 555 GLY B O   1 
ATOM 8011  N N   . ASP B 1 559 ? 23.631  81.085  56.425  1.00 66.29  ? 556 ASP B N   1 
ATOM 8012  C CA  . ASP B 1 559 ? 22.595  80.540  55.563  1.00 77.29  ? 556 ASP B CA  1 
ATOM 8013  C C   . ASP B 1 559 ? 22.053  79.256  56.181  1.00 57.95  ? 556 ASP B C   1 
ATOM 8014  O O   . ASP B 1 559 ? 22.751  78.548  56.904  1.00 39.95  ? 556 ASP B O   1 
ATOM 8015  C CB  . ASP B 1 559 ? 23.109  80.314  54.123  1.00 71.99  ? 556 ASP B CB  1 
ATOM 8016  N N   . TRP B 1 560 ? 20.789  78.968  55.915  1.00 55.28  ? 557 TRP B N   1 
ATOM 8017  C CA  . TRP B 1 560 ? 20.185  77.735  56.382  1.00 40.11  ? 557 TRP B CA  1 
ATOM 8018  C C   . TRP B 1 560 ? 20.566  76.553  55.496  1.00 65.22  ? 557 TRP B C   1 
ATOM 8019  O O   . TRP B 1 560 ? 20.418  75.398  55.886  1.00 53.79  ? 557 TRP B O   1 
ATOM 8020  C CB  . TRP B 1 560 ? 18.674  77.879  56.428  1.00 39.66  ? 557 TRP B CB  1 
ATOM 8021  C CG  . TRP B 1 560 ? 18.084  78.392  55.161  1.00 62.79  ? 557 TRP B CG  1 
ATOM 8022  C CD1 . TRP B 1 560 ? 17.785  79.685  54.870  1.00 68.31  ? 557 TRP B CD1 1 
ATOM 8023  C CD2 . TRP B 1 560 ? 17.707  77.624  54.012  1.00 66.23  ? 557 TRP B CD2 1 
ATOM 8024  N NE1 . TRP B 1 560 ? 17.241  79.773  53.619  1.00 62.04  ? 557 TRP B NE1 1 
ATOM 8025  C CE2 . TRP B 1 560 ? 17.191  78.522  53.064  1.00 57.93  ? 557 TRP B CE2 1 
ATOM 8026  C CE3 . TRP B 1 560 ? 17.759  76.261  53.691  1.00 69.10  ? 557 TRP B CE3 1 
ATOM 8027  C CZ2 . TRP B 1 560 ? 16.724  78.104  51.808  1.00 57.91  ? 557 TRP B CZ2 1 
ATOM 8028  C CZ3 . TRP B 1 560 ? 17.301  75.846  52.434  1.00 76.36  ? 557 TRP B CZ3 1 
ATOM 8029  C CH2 . TRP B 1 560 ? 16.791  76.766  51.515  1.00 64.68  ? 557 TRP B CH2 1 
ATOM 8030  N N   . SER B 1 561 ? 21.050  76.846  54.295  1.00 80.61  ? 558 SER B N   1 
ATOM 8031  C CA  . SER B 1 561 ? 21.473  75.808  53.362  1.00 67.84  ? 558 SER B CA  1 
ATOM 8032  C C   . SER B 1 561 ? 22.845  75.298  53.767  1.00 50.17  ? 558 SER B C   1 
ATOM 8033  O O   . SER B 1 561 ? 23.554  75.964  54.520  1.00 46.01  ? 558 SER B O   1 
ATOM 8034  C CB  . SER B 1 561 ? 21.513  76.377  51.944  1.00 53.01  ? 558 SER B CB  1 
ATOM 8035  O OG  . SER B 1 561 ? 22.035  75.441  51.028  1.00 90.12  ? 558 SER B OG  1 
ATOM 8036  N N   . TYR B 1 562 ? 23.227  74.125  53.267  1.00 40.93  ? 559 TYR B N   1 
ATOM 8037  C CA  . TYR B 1 562 ? 24.584  73.611  53.499  1.00 50.87  ? 559 TYR B CA  1 
ATOM 8038  C C   . TYR B 1 562 ? 25.400  73.579  52.212  1.00 61.98  ? 559 TYR B C   1 
ATOM 8039  O O   . TYR B 1 562 ? 24.823  73.503  51.128  1.00 62.09  ? 559 TYR B O   1 
ATOM 8040  C CB  . TYR B 1 562 ? 24.521  72.209  54.103  1.00 53.14  ? 559 TYR B CB  1 
ATOM 8041  C CG  . TYR B 1 562 ? 23.887  72.151  55.472  1.00 48.08  ? 559 TYR B CG  1 
ATOM 8042  C CD1 . TYR B 1 562 ? 24.665  72.060  56.616  1.00 62.86  ? 559 TYR B CD1 1 
ATOM 8043  C CD2 . TYR B 1 562 ? 22.504  72.188  55.623  1.00 54.69  ? 559 TYR B CD2 1 
ATOM 8044  C CE1 . TYR B 1 562 ? 24.080  71.998  57.870  1.00 36.85  ? 559 TYR B CE1 1 
ATOM 8045  C CE2 . TYR B 1 562 ? 21.920  72.137  56.868  1.00 74.18  ? 559 TYR B CE2 1 
ATOM 8046  C CZ  . TYR B 1 562 ? 22.715  72.041  57.982  1.00 53.79  ? 559 TYR B CZ  1 
ATOM 8047  O OH  . TYR B 1 562 ? 22.142  71.989  59.213  1.00 50.27  ? 559 TYR B OH  1 
ATOM 8048  N N   . ALA B 1 563 ? 26.731  73.627  52.320  1.00 62.21  ? 560 ALA B N   1 
ATOM 8049  C CA  . ALA B 1 563 ? 27.584  73.654  51.120  1.00 48.74  ? 560 ALA B CA  1 
ATOM 8050  C C   . ALA B 1 563 ? 27.388  72.443  50.216  1.00 58.07  ? 560 ALA B C   1 
ATOM 8051  O O   . ALA B 1 563 ? 27.244  72.592  49.008  1.00 53.77  ? 560 ALA B O   1 
ATOM 8052  C CB  . ALA B 1 563 ? 29.071  73.824  51.468  1.00 22.97  ? 560 ALA B CB  1 
ATOM 8053  N N   . TYR B 1 564 ? 27.387  71.249  50.796  1.00 61.86  ? 561 TYR B N   1 
ATOM 8054  C CA  . TYR B 1 564 ? 27.192  70.023  50.023  1.00 57.35  ? 561 TYR B CA  1 
ATOM 8055  C C   . TYR B 1 564 ? 25.918  70.077  49.149  1.00 61.38  ? 561 TYR B C   1 
ATOM 8056  O O   . TYR B 1 564 ? 25.792  69.362  48.164  1.00 42.93  ? 561 TYR B O   1 
ATOM 8057  C CB  . TYR B 1 564 ? 27.161  68.807  50.955  1.00 35.56  ? 561 TYR B CB  1 
ATOM 8058  C CG  . TYR B 1 564 ? 25.781  68.469  51.492  1.00 53.70  ? 561 TYR B CG  1 
ATOM 8059  C CD1 . TYR B 1 564 ? 25.254  69.133  52.586  1.00 51.32  ? 561 TYR B CD1 1 
ATOM 8060  C CD2 . TYR B 1 564 ? 25.010  67.480  50.906  1.00 21.89  ? 561 TYR B CD2 1 
ATOM 8061  C CE1 . TYR B 1 564 ? 23.994  68.821  53.070  1.00 59.16  ? 561 TYR B CE1 1 
ATOM 8062  C CE2 . TYR B 1 564 ? 23.766  67.168  51.380  1.00 52.48  ? 561 TYR B CE2 1 
ATOM 8063  C CZ  . TYR B 1 564 ? 23.259  67.835  52.462  1.00 52.07  ? 561 TYR B CZ  1 
ATOM 8064  O OH  . TYR B 1 564 ? 22.011  67.500  52.921  1.00 56.11  ? 561 TYR B OH  1 
ATOM 8065  N N   . MET B 1 565 ? 24.973  70.932  49.521  1.00 65.03  ? 562 MET B N   1 
ATOM 8066  C CA  . MET B 1 565 ? 23.729  71.079  48.776  1.00 66.12  ? 562 MET B CA  1 
ATOM 8067  C C   . MET B 1 565 ? 23.878  71.939  47.511  1.00 65.47  ? 562 MET B C   1 
ATOM 8068  O O   . MET B 1 565 ? 23.025  71.896  46.650  1.00 40.77  ? 562 MET B O   1 
ATOM 8069  C CB  . MET B 1 565 ? 22.619  71.660  49.677  1.00 41.50  ? 562 MET B CB  1 
ATOM 8070  C CG  . MET B 1 565 ? 22.034  70.699  50.720  1.00 41.86  ? 562 MET B CG  1 
ATOM 8071  S SD  . MET B 1 565 ? 21.087  71.498  52.043  1.00 29.25  ? 562 MET B SD  1 
ATOM 8072  C CE  . MET B 1 565 ? 19.857  72.383  51.103  1.00 33.92  ? 562 MET B CE  1 
ATOM 8073  N N   . GLN B 1 566 ? 24.946  72.714  47.374  1.00 61.60  ? 563 GLN B N   1 
ATOM 8074  C CA  . GLN B 1 566 ? 25.067  73.576  46.192  1.00 66.68  ? 563 GLN B CA  1 
ATOM 8075  C C   . GLN B 1 566 ? 25.407  72.755  44.938  1.00 93.04  ? 563 GLN B C   1 
ATOM 8076  O O   . GLN B 1 566 ? 25.787  71.564  45.002  1.00 87.64  ? 563 GLN B O   1 
ATOM 8077  C CB  . GLN B 1 566 ? 26.101  74.699  46.410  1.00 51.81  ? 563 GLN B CB  1 
ATOM 8078  O OXT . GLN B 1 566 ? 25.305  73.265  43.810  1.00 100.24 ? 563 GLN B OXT 1 
ATOM 8079  N N   . ARG C 1 26  ? 45.727  59.681  73.709  1.00 62.26  ? 23  ARG C N   1 
ATOM 8080  C CA  . ARG C 1 26  ? 44.642  58.850  74.199  1.00 96.49  ? 23  ARG C CA  1 
ATOM 8081  C C   . ARG C 1 26  ? 44.676  58.818  75.740  1.00 105.12 ? 23  ARG C C   1 
ATOM 8082  O O   . ARG C 1 26  ? 44.487  59.858  76.374  1.00 74.55  ? 23  ARG C O   1 
ATOM 8083  C CB  . ARG C 1 26  ? 44.727  57.453  73.586  1.00 82.05  ? 23  ARG C CB  1 
ATOM 8084  N N   . TRP C 1 27  ? 44.930  57.651  76.338  1.00 73.57  ? 24  TRP C N   1 
ATOM 8085  C CA  . TRP C 1 27  ? 44.983  57.511  77.808  1.00 77.70  ? 24  TRP C CA  1 
ATOM 8086  C C   . TRP C 1 27  ? 46.091  58.263  78.533  1.00 84.03  ? 24  TRP C C   1 
ATOM 8087  O O   . TRP C 1 27  ? 47.126  58.589  77.957  1.00 113.90 ? 24  TRP C O   1 
ATOM 8088  C CB  . TRP C 1 27  ? 45.141  56.062  78.193  1.00 50.24  ? 24  TRP C CB  1 
ATOM 8089  C CG  . TRP C 1 27  ? 44.092  55.213  77.641  1.00 65.72  ? 24  TRP C CG  1 
ATOM 8090  C CD1 . TRP C 1 27  ? 43.905  54.890  76.330  1.00 78.51  ? 24  TRP C CD1 1 
ATOM 8091  C CD2 . TRP C 1 27  ? 43.065  54.540  78.377  1.00 98.89  ? 24  TRP C CD2 1 
ATOM 8092  N NE1 . TRP C 1 27  ? 42.819  54.054  76.202  1.00 99.94  ? 24  TRP C NE1 1 
ATOM 8093  C CE2 . TRP C 1 27  ? 42.285  53.825  77.444  1.00 108.32 ? 24  TRP C CE2 1 
ATOM 8094  C CE3 . TRP C 1 27  ? 42.728  54.473  79.734  1.00 81.79  ? 24  TRP C CE3 1 
ATOM 8095  C CZ2 . TRP C 1 27  ? 41.188  53.052  77.825  1.00 95.19  ? 24  TRP C CZ2 1 
ATOM 8096  C CZ3 . TRP C 1 27  ? 41.641  53.707  80.108  1.00 89.52  ? 24  TRP C CZ3 1 
ATOM 8097  C CH2 . TRP C 1 27  ? 40.885  53.003  79.158  1.00 97.39  ? 24  TRP C CH2 1 
ATOM 8098  N N   . LYS C 1 28  ? 45.874  58.498  79.821  1.00 62.88  ? 25  LYS C N   1 
ATOM 8099  C CA  . LYS C 1 28  ? 46.864  59.174  80.652  1.00 85.33  ? 25  LYS C CA  1 
ATOM 8100  C C   . LYS C 1 28  ? 46.693  58.770  82.124  1.00 99.21  ? 25  LYS C C   1 
ATOM 8101  O O   . LYS C 1 28  ? 45.699  59.112  82.767  1.00 96.80  ? 25  LYS C O   1 
ATOM 8102  C CB  . LYS C 1 28  ? 46.798  60.689  80.460  1.00 49.72  ? 25  LYS C CB  1 
ATOM 8103  N N   . HIS C 1 29  ? 47.671  58.017  82.627  1.00 69.79  ? 26  HIS C N   1 
ATOM 8104  C CA  . HIS C 1 29  ? 47.673  57.485  83.987  1.00 63.61  ? 26  HIS C CA  1 
ATOM 8105  C C   . HIS C 1 29  ? 48.440  58.394  84.943  1.00 53.19  ? 26  HIS C C   1 
ATOM 8106  O O   . HIS C 1 29  ? 49.451  58.979  84.577  1.00 77.02  ? 26  HIS C O   1 
ATOM 8107  C CB  . HIS C 1 29  ? 48.268  56.077  83.994  1.00 48.53  ? 26  HIS C CB  1 
ATOM 8108  C CG  . HIS C 1 29  ? 47.553  55.126  83.083  1.00 99.83  ? 26  HIS C CG  1 
ATOM 8109  N ND1 . HIS C 1 29  ? 47.013  55.520  81.877  1.00 81.22  ? 26  HIS C ND1 1 
ATOM 8110  C CD2 . HIS C 1 29  ? 47.282  53.803  83.202  1.00 120.52 ? 26  HIS C CD2 1 
ATOM 8111  C CE1 . HIS C 1 29  ? 46.443  54.480  81.291  1.00 114.76 ? 26  HIS C CE1 1 
ATOM 8112  N NE2 . HIS C 1 29  ? 46.593  53.425  82.073  1.00 104.80 ? 26  HIS C NE2 1 
ATOM 8113  N N   . THR C 1 30  ? 47.948  58.530  86.167  1.00 75.32  ? 27  THR C N   1 
ATOM 8114  C CA  . THR C 1 30  ? 48.519  59.492  87.105  1.00 78.33  ? 27  THR C CA  1 
ATOM 8115  C C   . THR C 1 30  ? 48.368  58.969  88.525  1.00 64.36  ? 27  THR C C   1 
ATOM 8116  O O   . THR C 1 30  ? 47.436  58.217  88.804  1.00 86.06  ? 27  THR C O   1 
ATOM 8117  C CB  . THR C 1 30  ? 47.871  60.898  86.943  1.00 70.70  ? 27  THR C CB  1 
ATOM 8118  O OG1 . THR C 1 30  ? 47.677  61.497  88.226  1.00 68.40  ? 27  THR C OG1 1 
ATOM 8119  C CG2 . THR C 1 30  ? 46.527  60.803  86.234  1.00 76.05  ? 27  THR C CG2 1 
ATOM 8120  N N   . SER C 1 31  ? 49.283  59.344  89.417  1.00 75.45  ? 28  SER C N   1 
ATOM 8121  C CA  . SER C 1 31  ? 49.279  58.786  90.775  1.00 67.91  ? 28  SER C CA  1 
ATOM 8122  C C   . SER C 1 31  ? 49.299  59.840  91.874  1.00 69.45  ? 28  SER C C   1 
ATOM 8123  O O   . SER C 1 31  ? 49.689  60.982  91.645  1.00 69.45  ? 28  SER C O   1 
ATOM 8124  C CB  . SER C 1 31  ? 50.445  57.824  90.959  1.00 55.52  ? 28  SER C CB  1 
ATOM 8125  O OG  . SER C 1 31  ? 50.348  56.743  90.053  1.00 58.32  ? 28  SER C OG  1 
ATOM 8126  N N   . SER C 1 32  ? 48.850  59.462  93.067  1.00 53.96  ? 29  SER C N   1 
ATOM 8127  C CA  . SER C 1 32  ? 48.956  60.354  94.224  1.00 84.53  ? 29  SER C CA  1 
ATOM 8128  C C   . SER C 1 32  ? 49.504  59.585  95.424  1.00 49.58  ? 29  SER C C   1 
ATOM 8129  O O   . SER C 1 32  ? 49.591  58.357  95.395  1.00 57.20  ? 29  SER C O   1 
ATOM 8130  C CB  . SER C 1 32  ? 47.622  61.055  94.553  1.00 57.98  ? 29  SER C CB  1 
ATOM 8131  O OG  . SER C 1 32  ? 46.675  60.166  95.132  1.00 83.01  ? 29  SER C OG  1 
ATOM 8132  N N   . LEU C 1 33  ? 49.902  60.308  96.461  1.00 74.20  ? 30  LEU C N   1 
ATOM 8133  C CA  . LEU C 1 33  ? 50.533  59.660  97.601  1.00 86.04  ? 30  LEU C CA  1 
ATOM 8134  C C   . LEU C 1 33  ? 50.107  60.287  98.919  1.00 64.11  ? 30  LEU C C   1 
ATOM 8135  O O   . LEU C 1 33  ? 50.380  61.459  99.163  1.00 101.35 ? 30  LEU C O   1 
ATOM 8136  C CB  . LEU C 1 33  ? 52.048  59.712  97.460  1.00 66.15  ? 30  LEU C CB  1 
ATOM 8137  C CG  . LEU C 1 33  ? 52.757  58.750  98.388  1.00 65.16  ? 30  LEU C CG  1 
ATOM 8138  C CD1 . LEU C 1 33  ? 52.489  57.362  97.883  1.00 97.91  ? 30  LEU C CD1 1 
ATOM 8139  C CD2 . LEU C 1 33  ? 54.234  59.025  98.392  1.00 70.21  ? 30  LEU C CD2 1 
ATOM 8140  N N   . LYS C 1 34  ? 49.414  59.515  99.754  1.00 59.52  ? 31  LYS C N   1 
ATOM 8141  C CA  . LYS C 1 34  ? 48.983  60.010  101.055 1.00 69.50  ? 31  LYS C CA  1 
ATOM 8142  C C   . LYS C 1 34  ? 50.119  59.746  102.021 1.00 73.23  ? 31  LYS C C   1 
ATOM 8143  O O   . LYS C 1 34  ? 50.583  58.610  102.133 1.00 56.61  ? 31  LYS C O   1 
ATOM 8144  C CB  . LYS C 1 34  ? 47.711  59.307  101.533 1.00 62.84  ? 31  LYS C CB  1 
ATOM 8145  N N   . VAL C 1 35  ? 50.594  60.797  102.686 1.00 49.95  ? 32  VAL C N   1 
ATOM 8146  C CA  . VAL C 1 35  ? 51.660  60.649  103.667 1.00 47.11  ? 32  VAL C CA  1 
ATOM 8147  C C   . VAL C 1 35  ? 51.264  61.352  104.947 1.00 71.52  ? 32  VAL C C   1 
ATOM 8148  O O   . VAL C 1 35  ? 50.585  62.379  104.923 1.00 63.79  ? 32  VAL C O   1 
ATOM 8149  C CB  . VAL C 1 35  ? 52.991  61.297  103.201 1.00 63.22  ? 32  VAL C CB  1 
ATOM 8150  C CG1 . VAL C 1 35  ? 53.500  60.667  101.910 1.00 44.43  ? 32  VAL C CG1 1 
ATOM 8151  C CG2 . VAL C 1 35  ? 52.814  62.790  103.037 1.00 111.15 ? 32  VAL C CG2 1 
ATOM 8152  N N   . ALA C 1 36  ? 51.697  60.819  106.078 1.00 58.36  ? 33  ALA C N   1 
ATOM 8153  C CA  . ALA C 1 36  ? 51.556  61.597  107.289 1.00 74.49  ? 33  ALA C CA  1 
ATOM 8154  C C   . ALA C 1 36  ? 52.904  61.862  107.953 1.00 63.64  ? 33  ALA C C   1 
ATOM 8155  O O   . ALA C 1 36  ? 53.913  61.197  107.678 1.00 56.35  ? 33  ALA C O   1 
ATOM 8156  C CB  . ALA C 1 36  ? 50.587  60.939  108.244 1.00 59.24  ? 33  ALA C CB  1 
ATOM 8157  N N   . ASN C 1 37  ? 52.917  62.869  108.808 1.00 40.49  ? 34  ASN C N   1 
ATOM 8158  C CA  . ASN C 1 37  ? 54.059  63.088  109.698 1.00 67.04  ? 34  ASN C CA  1 
ATOM 8159  C C   . ASN C 1 37  ? 54.415  61.882  110.557 1.00 48.79  ? 34  ASN C C   1 
ATOM 8160  O O   . ASN C 1 37  ? 53.519  61.169  111.010 1.00 56.90  ? 34  ASN C O   1 
ATOM 8161  C CB  . ASN C 1 37  ? 53.800  64.308  110.559 1.00 40.59  ? 34  ASN C CB  1 
ATOM 8162  C CG  . ASN C 1 37  ? 53.831  65.573  109.737 1.00 61.50  ? 34  ASN C CG  1 
ATOM 8163  O OD1 . ASN C 1 37  ? 52.800  66.052  109.271 1.00 53.03  ? 34  ASN C OD1 1 
ATOM 8164  N ND2 . ASN C 1 37  ? 55.031  66.087  109.504 1.00 60.55  ? 34  ASN C ND2 1 
ATOM 8165  N N   . GLU C 1 38  ? 55.718  61.632  110.731 1.00 42.21  ? 35  GLU C N   1 
ATOM 8166  C CA  . GLU C 1 38  ? 56.201  60.525  111.551 1.00 60.63  ? 35  GLU C CA  1 
ATOM 8167  C C   . GLU C 1 38  ? 55.886  60.869  113.009 1.00 73.70  ? 35  GLU C C   1 
ATOM 8168  O O   . GLU C 1 38  ? 56.166  61.993  113.446 1.00 62.06  ? 35  GLU C O   1 
ATOM 8169  C CB  . GLU C 1 38  ? 57.711  60.319  111.340 1.00 53.08  ? 35  GLU C CB  1 
ATOM 8170  C CG  . GLU C 1 38  ? 58.380  59.265  112.257 1.00 39.30  ? 35  GLU C CG  1 
ATOM 8171  C CD  . GLU C 1 38  ? 57.883  57.832  111.999 1.00 61.05  ? 35  GLU C CD  1 
ATOM 8172  O OE1 . GLU C 1 38  ? 57.447  57.539  110.871 1.00 65.06  ? 35  GLU C OE1 1 
ATOM 8173  O OE2 . GLU C 1 38  ? 57.921  57.002  112.931 1.00 70.85  ? 35  GLU C OE2 1 
ATOM 8174  N N   . PRO C 1 39  ? 55.258  59.926  113.749 1.00 69.43  ? 36  PRO C N   1 
ATOM 8175  C CA  . PRO C 1 39  ? 54.938  60.164  115.161 1.00 76.62  ? 36  PRO C CA  1 
ATOM 8176  C C   . PRO C 1 39  ? 56.203  60.307  115.979 1.00 59.64  ? 36  PRO C C   1 
ATOM 8177  O O   . PRO C 1 39  ? 57.135  59.515  115.827 1.00 56.14  ? 36  PRO C O   1 
ATOM 8178  C CB  . PRO C 1 39  ? 54.183  58.889  115.585 1.00 53.04  ? 36  PRO C CB  1 
ATOM 8179  C CG  . PRO C 1 39  ? 53.688  58.303  114.322 1.00 63.35  ? 36  PRO C CG  1 
ATOM 8180  C CD  . PRO C 1 39  ? 54.730  58.629  113.288 1.00 56.42  ? 36  PRO C CD  1 
ATOM 8181  N N   . VAL C 1 40  ? 56.224  61.319  116.834 1.00 52.16  ? 37  VAL C N   1 
ATOM 8182  C CA  . VAL C 1 40  ? 57.340  61.549  117.740 1.00 64.92  ? 37  VAL C CA  1 
ATOM 8183  C C   . VAL C 1 40  ? 57.167  60.724  119.023 1.00 65.78  ? 37  VAL C C   1 
ATOM 8184  O O   . VAL C 1 40  ? 56.231  60.949  119.792 1.00 70.77  ? 37  VAL C O   1 
ATOM 8185  C CB  . VAL C 1 40  ? 57.457  63.042  118.063 1.00 60.10  ? 37  VAL C CB  1 
ATOM 8186  C CG1 . VAL C 1 40  ? 58.614  63.294  118.982 1.00 56.66  ? 37  VAL C CG1 1 
ATOM 8187  C CG2 . VAL C 1 40  ? 57.603  63.835  116.764 1.00 55.77  ? 37  VAL C CG2 1 
ATOM 8188  N N   . LEU C 1 41  ? 58.062  59.754  119.225 1.00 70.16  ? 38  LEU C N   1 
ATOM 8189  C CA  . LEU C 1 41  ? 58.022  58.854  120.377 1.00 67.64  ? 38  LEU C CA  1 
ATOM 8190  C C   . LEU C 1 41  ? 58.334  59.586  121.679 1.00 70.34  ? 38  LEU C C   1 
ATOM 8191  O O   . LEU C 1 41  ? 59.042  60.599  121.679 1.00 78.66  ? 38  LEU C O   1 
ATOM 8192  C CB  . LEU C 1 41  ? 59.001  57.700  120.171 1.00 58.31  ? 38  LEU C CB  1 
ATOM 8193  C CG  . LEU C 1 41  ? 58.688  56.904  118.903 1.00 62.35  ? 38  LEU C CG  1 
ATOM 8194  C CD1 . LEU C 1 41  ? 59.650  55.749  118.702 1.00 49.03  ? 38  LEU C CD1 1 
ATOM 8195  C CD2 . LEU C 1 41  ? 57.236  56.415  118.939 1.00 54.17  ? 38  LEU C CD2 1 
ATOM 8196  N N   . ALA C 1 42  ? 57.815  59.065  122.785 1.00 73.20  ? 39  ALA C N   1 
ATOM 8197  C CA  . ALA C 1 42  ? 57.939  59.735  124.086 1.00 72.64  ? 39  ALA C CA  1 
ATOM 8198  C C   . ALA C 1 42  ? 59.164  59.326  124.897 1.00 67.24  ? 39  ALA C C   1 
ATOM 8199  O O   . ALA C 1 42  ? 59.628  60.092  125.741 1.00 70.75  ? 39  ALA C O   1 
ATOM 8200  C CB  . ALA C 1 42  ? 56.673  59.543  124.914 1.00 77.88  ? 39  ALA C CB  1 
ATOM 8201  N N   . PHE C 1 43  ? 59.670  58.119  124.652 1.00 53.47  ? 40  PHE C N   1 
ATOM 8202  C CA  . PHE C 1 43  ? 60.894  57.637  125.297 1.00 64.09  ? 40  PHE C CA  1 
ATOM 8203  C C   . PHE C 1 43  ? 60.827  57.609  126.839 1.00 83.45  ? 40  PHE C C   1 
ATOM 8204  O O   . PHE C 1 43  ? 61.798  57.931  127.530 1.00 63.28  ? 40  PHE C O   1 
ATOM 8205  C CB  . PHE C 1 43  ? 62.100  58.461  124.840 1.00 49.52  ? 40  PHE C CB  1 
ATOM 8206  C CG  . PHE C 1 43  ? 62.526  58.183  123.430 1.00 69.20  ? 40  PHE C CG  1 
ATOM 8207  C CD1 . PHE C 1 43  ? 63.358  57.105  123.146 1.00 68.10  ? 40  PHE C CD1 1 
ATOM 8208  C CD2 . PHE C 1 43  ? 62.103  59.005  122.385 1.00 62.43  ? 40  PHE C CD2 1 
ATOM 8209  C CE1 . PHE C 1 43  ? 63.754  56.846  121.840 1.00 67.73  ? 40  PHE C CE1 1 
ATOM 8210  C CE2 . PHE C 1 43  ? 62.497  58.756  121.081 1.00 64.43  ? 40  PHE C CE2 1 
ATOM 8211  C CZ  . PHE C 1 43  ? 63.326  57.676  120.808 1.00 68.02  ? 40  PHE C CZ  1 
ATOM 8212  N N   . THR C 1 44  ? 59.684  57.213  127.378 1.00 71.25  ? 41  THR C N   1 
ATOM 8213  C CA  . THR C 1 44  ? 59.525  57.147  128.822 1.00 91.81  ? 41  THR C CA  1 
ATOM 8214  C C   . THR C 1 44  ? 60.114  55.853  129.386 1.00 84.05  ? 41  THR C C   1 
ATOM 8215  O O   . THR C 1 44  ? 60.470  54.941  128.629 1.00 62.53  ? 41  THR C O   1 
ATOM 8216  C CB  . THR C 1 44  ? 58.037  57.264  129.224 1.00 90.38  ? 41  THR C CB  1 
ATOM 8217  O OG1 . THR C 1 44  ? 57.295  56.170  128.672 1.00 63.94  ? 41  THR C OG1 1 
ATOM 8218  C CG2 . THR C 1 44  ? 57.440  58.577  128.726 1.00 62.13  ? 41  THR C CG2 1 
ATOM 8219  N N   . GLN C 1 45  ? 60.214  55.780  130.712 1.00 79.40  ? 42  GLN C N   1 
ATOM 8220  C CA  . GLN C 1 45  ? 60.778  54.601  131.379 1.00 95.33  ? 42  GLN C CA  1 
ATOM 8221  C C   . GLN C 1 45  ? 60.069  53.307  130.967 1.00 86.81  ? 42  GLN C C   1 
ATOM 8222  O O   . GLN C 1 45  ? 58.843  53.200  131.053 1.00 69.89  ? 42  GLN C O   1 
ATOM 8223  C CB  . GLN C 1 45  ? 60.735  54.759  132.905 1.00 77.68  ? 42  GLN C CB  1 
ATOM 8224  C CG  . GLN C 1 45  ? 61.875  55.560  133.512 1.00 82.94  ? 42  GLN C CG  1 
ATOM 8225  C CD  . GLN C 1 45  ? 63.195  54.810  133.472 1.00 108.28 ? 42  GLN C CD  1 
ATOM 8226  O OE1 . GLN C 1 45  ? 63.285  53.708  132.910 1.00 85.72  ? 42  GLN C OE1 1 
ATOM 8227  N NE2 . GLN C 1 45  ? 64.230  55.403  134.066 1.00 96.56  ? 42  GLN C NE2 1 
ATOM 8228  N N   . GLY C 1 46  ? 60.845  52.329  130.507 1.00 77.11  ? 43  GLY C N   1 
ATOM 8229  C CA  . GLY C 1 46  ? 60.298  51.031  130.154 1.00 63.89  ? 43  GLY C CA  1 
ATOM 8230  C C   . GLY C 1 46  ? 59.713  50.922  128.763 1.00 90.84  ? 43  GLY C C   1 
ATOM 8231  O O   . GLY C 1 46  ? 59.402  49.811  128.317 1.00 78.91  ? 43  GLY C O   1 
ATOM 8232  N N   . SER C 1 47  ? 59.544  52.057  128.081 1.00 86.11  ? 44  SER C N   1 
ATOM 8233  C CA  . SER C 1 47  ? 59.074  52.023  126.701 1.00 78.11  ? 44  SER C CA  1 
ATOM 8234  C C   . SER C 1 47  ? 60.132  51.308  125.862 1.00 76.33  ? 44  SER C C   1 
ATOM 8235  O O   . SER C 1 47  ? 61.336  51.345  126.192 1.00 69.89  ? 44  SER C O   1 
ATOM 8236  C CB  . SER C 1 47  ? 58.788  53.431  126.158 1.00 70.63  ? 44  SER C CB  1 
ATOM 8237  O OG  . SER C 1 47  ? 59.989  54.130  125.883 1.00 75.40  ? 44  SER C OG  1 
ATOM 8238  N N   . PRO C 1 48  ? 59.678  50.623  124.801 1.00 71.09  ? 45  PRO C N   1 
ATOM 8239  C CA  . PRO C 1 48  ? 60.518  49.859  123.868 1.00 78.51  ? 45  PRO C CA  1 
ATOM 8240  C C   . PRO C 1 48  ? 61.570  50.720  123.169 1.00 83.44  ? 45  PRO C C   1 
ATOM 8241  O O   . PRO C 1 48  ? 62.691  50.246  122.941 1.00 79.54  ? 45  PRO C O   1 
ATOM 8242  C CB  . PRO C 1 48  ? 59.512  49.354  122.828 1.00 70.74  ? 45  PRO C CB  1 
ATOM 8243  C CG  . PRO C 1 48  ? 58.189  49.391  123.515 1.00 76.57  ? 45  PRO C CG  1 
ATOM 8244  C CD  . PRO C 1 48  ? 58.246  50.545  124.460 1.00 63.88  ? 45  PRO C CD  1 
ATOM 8245  N N   . GLU C 1 49  ? 61.200  51.953  122.816 1.00 60.68  ? 46  GLU C N   1 
ATOM 8246  C CA  . GLU C 1 49  ? 62.099  52.849  122.091 1.00 75.03  ? 46  GLU C CA  1 
ATOM 8247  C C   . GLU C 1 49  ? 63.253  53.298  122.987 1.00 74.97  ? 46  GLU C C   1 
ATOM 8248  O O   . GLU C 1 49  ? 64.393  53.407  122.536 1.00 70.84  ? 46  GLU C O   1 
ATOM 8249  C CB  . GLU C 1 49  ? 61.345  54.055  121.496 1.00 56.55  ? 46  GLU C CB  1 
ATOM 8250  C CG  . GLU C 1 49  ? 60.718  55.030  122.510 1.00 63.39  ? 46  GLU C CG  1 
ATOM 8251  C CD  . GLU C 1 49  ? 59.235  54.774  122.796 1.00 79.52  ? 46  GLU C CD  1 
ATOM 8252  O OE1 . GLU C 1 49  ? 58.557  55.690  123.319 1.00 65.50  ? 46  GLU C OE1 1 
ATOM 8253  O OE2 . GLU C 1 49  ? 58.747  53.661  122.514 1.00 74.15  ? 46  GLU C OE2 1 
ATOM 8254  N N   . ARG C 1 50  ? 62.957  53.538  124.260 1.00 61.84  ? 47  ARG C N   1 
ATOM 8255  C CA  . ARG C 1 50  ? 63.989  53.909  125.223 1.00 76.73  ? 47  ARG C CA  1 
ATOM 8256  C C   . ARG C 1 50  ? 64.973  52.761  125.499 1.00 81.44  ? 47  ARG C C   1 
ATOM 8257  O O   . ARG C 1 50  ? 66.174  53.004  125.658 1.00 62.35  ? 47  ARG C O   1 
ATOM 8258  C CB  . ARG C 1 50  ? 63.359  54.413  126.518 1.00 64.02  ? 47  ARG C CB  1 
ATOM 8259  C CG  . ARG C 1 50  ? 64.349  55.034  127.488 1.00 61.63  ? 47  ARG C CG  1 
ATOM 8260  C CD  . ARG C 1 50  ? 63.644  55.325  128.809 1.00 70.42  ? 47  ARG C CD  1 
ATOM 8261  N NE  . ARG C 1 50  ? 64.514  55.918  129.821 1.00 57.53  ? 47  ARG C NE  1 
ATOM 8262  C CZ  . ARG C 1 50  ? 64.345  57.128  130.347 1.00 69.42  ? 47  ARG C CZ  1 
ATOM 8263  N NH1 . ARG C 1 50  ? 63.334  57.888  129.957 1.00 50.86  ? 47  ARG C NH1 1 
ATOM 8264  N NH2 . ARG C 1 50  ? 65.186  57.578  131.270 1.00 63.25  ? 47  ARG C NH2 1 
ATOM 8265  N N   . ASP C 1 51  ? 64.476  51.521  125.548 1.00 58.22  ? 48  ASP C N   1 
ATOM 8266  C CA  . ASP C 1 51  ? 65.367  50.366  125.701 1.00 83.34  ? 48  ASP C CA  1 
ATOM 8267  C C   . ASP C 1 51  ? 66.245  50.183  124.450 1.00 76.71  ? 48  ASP C C   1 
ATOM 8268  O O   . ASP C 1 51  ? 67.471  50.043  124.559 1.00 74.04  ? 48  ASP C O   1 
ATOM 8269  C CB  . ASP C 1 51  ? 64.591  49.086  126.064 1.00 61.28  ? 48  ASP C CB  1 
ATOM 8270  N N   . ALA C 1 52  ? 65.620  50.215  123.270 1.00 73.61  ? 49  ALA C N   1 
ATOM 8271  C CA  . ALA C 1 52  ? 66.345  50.165  121.994 1.00 66.76  ? 49  ALA C CA  1 
ATOM 8272  C C   . ALA C 1 52  ? 67.472  51.208  121.884 1.00 70.93  ? 49  ALA C C   1 
ATOM 8273  O O   . ALA C 1 52  ? 68.573  50.909  121.400 1.00 66.05  ? 49  ALA C O   1 
ATOM 8274  C CB  . ALA C 1 52  ? 65.375  50.325  120.834 1.00 61.02  ? 49  ALA C CB  1 
ATOM 8275  N N   . LEU C 1 53  ? 67.181  52.428  122.328 1.00 61.08  ? 50  LEU C N   1 
ATOM 8276  C CA  . LEU C 1 53  ? 68.106  53.543  122.199 1.00 69.27  ? 50  LEU C CA  1 
ATOM 8277  C C   . LEU C 1 53  ? 69.264  53.402  123.175 1.00 79.11  ? 50  LEU C C   1 
ATOM 8278  O O   . LEU C 1 53  ? 70.399  53.771  122.867 1.00 79.80  ? 50  LEU C O   1 
ATOM 8279  C CB  . LEU C 1 53  ? 67.382  54.879  122.424 1.00 60.64  ? 50  LEU C CB  1 
ATOM 8280  C CG  . LEU C 1 53  ? 68.278  56.113  122.635 1.00 69.79  ? 50  LEU C CG  1 
ATOM 8281  C CD1 . LEU C 1 53  ? 69.205  56.361  121.442 1.00 51.28  ? 50  LEU C CD1 1 
ATOM 8282  C CD2 . LEU C 1 53  ? 67.461  57.370  122.961 1.00 62.56  ? 50  LEU C CD2 1 
ATOM 8283  N N   . GLN C 1 54  ? 68.983  52.873  124.358 1.00 72.14  ? 51  GLN C N   1 
ATOM 8284  C CA  . GLN C 1 54  ? 70.046  52.696  125.343 1.00 81.93  ? 51  GLN C CA  1 
ATOM 8285  C C   . GLN C 1 54  ? 71.008  51.600  124.903 1.00 80.26  ? 51  GLN C C   1 
ATOM 8286  O O   . GLN C 1 54  ? 72.214  51.715  125.129 1.00 67.22  ? 51  GLN C O   1 
ATOM 8287  C CB  . GLN C 1 54  ? 69.496  52.442  126.755 1.00 70.90  ? 51  GLN C CB  1 
ATOM 8288  C CG  . GLN C 1 54  ? 69.876  53.528  127.761 1.00 73.97  ? 51  GLN C CG  1 
ATOM 8289  C CD  . GLN C 1 54  ? 68.762  53.832  128.752 1.00 98.65  ? 51  GLN C CD  1 
ATOM 8290  O OE1 . GLN C 1 54  ? 68.808  54.834  129.466 1.00 89.34  ? 51  GLN C OE1 1 
ATOM 8291  N NE2 . GLN C 1 54  ? 67.755  52.968  128.798 1.00 94.60  ? 51  GLN C NE2 1 
ATOM 8292  N N   . LYS C 1 55  ? 70.484  50.559  124.252 1.00 60.75  ? 52  LYS C N   1 
ATOM 8293  C CA  . LYS C 1 55  ? 71.348  49.519  123.692 1.00 62.86  ? 52  LYS C CA  1 
ATOM 8294  C C   . LYS C 1 55  ? 72.216  50.118  122.587 1.00 73.85  ? 52  LYS C C   1 
ATOM 8295  O O   . LYS C 1 55  ? 73.400  49.813  122.500 1.00 66.33  ? 52  LYS C O   1 
ATOM 8296  C CB  . LYS C 1 55  ? 70.536  48.327  123.170 1.00 48.43  ? 52  LYS C CB  1 
ATOM 8297  N N   . ALA C 1 56  ? 71.623  50.987  121.764 1.00 73.91  ? 53  ALA C N   1 
ATOM 8298  C CA  . ALA C 1 56  ? 72.336  51.624  120.650 1.00 66.76  ? 53  ALA C CA  1 
ATOM 8299  C C   . ALA C 1 56  ? 73.436  52.562  121.134 1.00 67.68  ? 53  ALA C C   1 
ATOM 8300  O O   . ALA C 1 56  ? 74.494  52.670  120.513 1.00 67.51  ? 53  ALA C O   1 
ATOM 8301  C CB  . ALA C 1 56  ? 71.364  52.381  119.750 1.00 61.43  ? 53  ALA C CB  1 
ATOM 8302  N N   . LEU C 1 57  ? 73.173  53.250  122.239 1.00 63.40  ? 54  LEU C N   1 
ATOM 8303  C CA  . LEU C 1 57  ? 74.183  54.111  122.856 1.00 82.29  ? 54  LEU C CA  1 
ATOM 8304  C C   . LEU C 1 57  ? 75.347  53.311  123.441 1.00 87.14  ? 54  LEU C C   1 
ATOM 8305  O O   . LEU C 1 57  ? 76.507  53.687  123.265 1.00 79.93  ? 54  LEU C O   1 
ATOM 8306  C CB  . LEU C 1 57  ? 73.562  54.993  123.941 1.00 63.87  ? 54  LEU C CB  1 
ATOM 8307  C CG  . LEU C 1 57  ? 72.659  56.101  123.409 1.00 71.52  ? 54  LEU C CG  1 
ATOM 8308  C CD1 . LEU C 1 57  ? 71.863  56.730  124.550 1.00 62.10  ? 54  LEU C CD1 1 
ATOM 8309  C CD2 . LEU C 1 57  ? 73.494  57.138  122.658 1.00 59.02  ? 54  LEU C CD2 1 
ATOM 8310  N N   . LYS C 1 58  ? 75.035  52.221  124.142 1.00 64.42  ? 55  LYS C N   1 
ATOM 8311  C CA  . LYS C 1 58  ? 76.067  51.351  124.697 1.00 85.59  ? 55  LYS C CA  1 
ATOM 8312  C C   . LYS C 1 58  ? 76.949  50.760  123.590 1.00 89.71  ? 55  LYS C C   1 
ATOM 8313  O O   . LYS C 1 58  ? 78.170  50.700  123.737 1.00 86.40  ? 55  LYS C O   1 
ATOM 8314  C CB  . LYS C 1 58  ? 75.447  50.236  125.558 1.00 64.40  ? 55  LYS C CB  1 
ATOM 8315  N N   . ASP C 1 59  ? 76.327  50.337  122.488 1.00 78.50  ? 56  ASP C N   1 
ATOM 8316  C CA  . ASP C 1 59  ? 77.051  49.735  121.362 1.00 88.35  ? 56  ASP C CA  1 
ATOM 8317  C C   . ASP C 1 59  ? 78.014  50.740  120.727 1.00 74.76  ? 56  ASP C C   1 
ATOM 8318  O O   . ASP C 1 59  ? 78.759  50.399  119.818 1.00 82.36  ? 56  ASP C O   1 
ATOM 8319  C CB  . ASP C 1 59  ? 76.080  49.156  120.309 1.00 54.74  ? 56  ASP C CB  1 
ATOM 8320  N N   . LEU C 1 60  ? 77.999  51.974  121.228 1.00 68.30  ? 57  LEU C N   1 
ATOM 8321  C CA  . LEU C 1 60  ? 78.824  53.062  120.689 1.00 78.50  ? 57  LEU C CA  1 
ATOM 8322  C C   . LEU C 1 60  ? 79.936  53.541  121.624 1.00 89.83  ? 57  LEU C C   1 
ATOM 8323  O O   . LEU C 1 60  ? 80.937  54.094  121.157 1.00 74.76  ? 57  LEU C O   1 
ATOM 8324  C CB  . LEU C 1 60  ? 77.961  54.285  120.347 1.00 84.18  ? 57  LEU C CB  1 
ATOM 8325  C CG  . LEU C 1 60  ? 77.199  54.391  119.033 1.00 75.97  ? 57  LEU C CG  1 
ATOM 8326  C CD1 . LEU C 1 60  ? 76.499  55.732  118.981 1.00 82.93  ? 57  LEU C CD1 1 
ATOM 8327  C CD2 . LEU C 1 60  ? 78.137  54.223  117.847 1.00 63.63  ? 57  LEU C CD2 1 
ATOM 8328  N N   . LYS C 1 61  ? 79.742  53.382  122.935 1.00 93.10  ? 58  LYS C N   1 
ATOM 8329  C CA  . LYS C 1 61  ? 80.759  53.794  123.907 1.00 96.90  ? 58  LYS C CA  1 
ATOM 8330  C C   . LYS C 1 61  ? 82.097  53.117  123.606 1.00 90.60  ? 58  LYS C C   1 
ATOM 8331  O O   . LYS C 1 61  ? 82.162  51.890  123.451 1.00 78.93  ? 58  LYS C O   1 
ATOM 8332  C CB  . LYS C 1 61  ? 80.309  53.506  125.351 1.00 83.09  ? 58  LYS C CB  1 
ATOM 8333  N N   . GLY C 1 62  ? 83.147  53.928  123.478 1.00 75.86  ? 59  GLY C N   1 
ATOM 8334  C CA  . GLY C 1 62  ? 84.502  53.428  123.278 1.00 97.62  ? 59  GLY C CA  1 
ATOM 8335  C C   . GLY C 1 62  ? 84.860  52.882  121.902 1.00 109.06 ? 59  GLY C C   1 
ATOM 8336  O O   . GLY C 1 62  ? 85.997  52.447  121.672 1.00 104.82 ? 59  GLY C O   1 
ATOM 8337  N N   . ARG C 1 63  ? 83.896  52.887  120.988 1.00 85.88  ? 60  ARG C N   1 
ATOM 8338  C CA  . ARG C 1 63  ? 84.159  52.475  119.613 1.00 89.65  ? 60  ARG C CA  1 
ATOM 8339  C C   . ARG C 1 63  ? 84.314  53.704  118.685 1.00 83.93  ? 60  ARG C C   1 
ATOM 8340  O O   . ARG C 1 63  ? 83.695  54.750  118.909 1.00 80.17  ? 60  ARG C O   1 
ATOM 8341  C CB  . ARG C 1 63  ? 83.073  51.501  119.130 1.00 66.45  ? 60  ARG C CB  1 
ATOM 8342  N N   . MET C 1 64  ? 85.171  53.583  117.674 1.00 79.60  ? 61  MET C N   1 
ATOM 8343  C CA  . MET C 1 64  ? 85.400  54.662  116.710 1.00 77.88  ? 61  MET C CA  1 
ATOM 8344  C C   . MET C 1 64  ? 85.180  54.117  115.300 1.00 82.21  ? 61  MET C C   1 
ATOM 8345  O O   . MET C 1 64  ? 85.910  53.222  114.862 1.00 82.20  ? 61  MET C O   1 
ATOM 8346  C CB  . MET C 1 64  ? 86.831  55.220  116.836 1.00 68.04  ? 61  MET C CB  1 
ATOM 8347  C CG  . MET C 1 64  ? 87.159  56.373  115.878 1.00 73.26  ? 61  MET C CG  1 
ATOM 8348  S SD  . MET C 1 64  ? 88.855  56.996  115.971 1.00 67.26  ? 61  MET C SD  1 
ATOM 8349  C CE  . MET C 1 64  ? 89.710  55.618  115.205 1.00 64.97  ? 61  MET C CE  1 
ATOM 8350  N N   . GLU C 1 65  ? 84.176  54.639  114.595 1.00 82.17  ? 62  GLU C N   1 
ATOM 8351  C CA  . GLU C 1 65  ? 83.879  54.176  113.237 1.00 67.81  ? 62  GLU C CA  1 
ATOM 8352  C C   . GLU C 1 65  ? 84.841  54.784  112.215 1.00 71.16  ? 62  GLU C C   1 
ATOM 8353  O O   . GLU C 1 65  ? 85.111  55.985  112.245 1.00 71.99  ? 62  GLU C O   1 
ATOM 8354  C CB  . GLU C 1 65  ? 82.417  54.464  112.851 1.00 63.11  ? 62  GLU C CB  1 
ATOM 8355  N N   . ALA C 1 66  ? 85.372  53.949  111.322 1.00 73.98  ? 63  ALA C N   1 
ATOM 8356  C CA  . ALA C 1 66  ? 86.209  54.443  110.223 1.00 84.10  ? 63  ALA C CA  1 
ATOM 8357  C C   . ALA C 1 66  ? 85.364  54.671  108.970 1.00 95.03  ? 63  ALA C C   1 
ATOM 8358  O O   . ALA C 1 66  ? 84.771  53.735  108.412 1.00 74.60  ? 63  ALA C O   1 
ATOM 8359  C CB  . ALA C 1 66  ? 87.364  53.495  109.935 1.00 59.22  ? 63  ALA C CB  1 
ATOM 8360  N N   . ILE C 1 67  ? 85.315  55.927  108.536 1.00 76.00  ? 64  ILE C N   1 
ATOM 8361  C CA  . ILE C 1 67  ? 84.408  56.341  107.477 1.00 62.55  ? 64  ILE C CA  1 
ATOM 8362  C C   . ILE C 1 67  ? 85.180  56.820  106.250 1.00 57.77  ? 64  ILE C C   1 
ATOM 8363  O O   . ILE C 1 67  ? 85.868  57.836  106.289 1.00 65.20  ? 64  ILE C O   1 
ATOM 8364  C CB  . ILE C 1 67  ? 83.437  57.445  107.990 1.00 70.16  ? 64  ILE C CB  1 
ATOM 8365  C CG1 . ILE C 1 67  ? 82.591  56.904  109.149 1.00 59.83  ? 64  ILE C CG1 1 
ATOM 8366  C CG2 . ILE C 1 67  ? 82.552  57.953  106.865 1.00 61.08  ? 64  ILE C CG2 1 
ATOM 8367  C CD1 . ILE C 1 67  ? 81.720  57.946  109.876 1.00 58.80  ? 64  ILE C CD1 1 
ATOM 8368  N N   . PRO C 1 68  ? 85.056  56.084  105.145 1.00 70.18  ? 65  PRO C N   1 
ATOM 8369  C CA  . PRO C 1 68  ? 85.772  56.413  103.916 1.00 65.66  ? 65  PRO C CA  1 
ATOM 8370  C C   . PRO C 1 68  ? 84.961  57.399  103.094 1.00 78.57  ? 65  PRO C C   1 
ATOM 8371  O O   . PRO C 1 68  ? 83.788  57.628  103.396 1.00 64.11  ? 65  PRO C O   1 
ATOM 8372  C CB  . PRO C 1 68  ? 85.800  55.070  103.184 1.00 68.54  ? 65  PRO C CB  1 
ATOM 8373  C CG  . PRO C 1 68  ? 84.477  54.449  103.550 1.00 55.86  ? 65  PRO C CG  1 
ATOM 8374  C CD  . PRO C 1 68  ? 84.177  54.913  104.973 1.00 62.17  ? 65  PRO C CD  1 
ATOM 8375  N N   . CYS C 1 69  ? 85.577  57.978  102.072 1.00 70.39  ? 66  CYS C N   1 
ATOM 8376  C CA  . CYS C 1 69  ? 84.804  58.609  101.030 1.00 59.05  ? 66  CYS C CA  1 
ATOM 8377  C C   . CYS C 1 69  ? 84.206  57.480  100.210 1.00 73.64  ? 66  CYS C C   1 
ATOM 8378  O O   . CYS C 1 69  ? 84.821  56.430  100.053 1.00 77.47  ? 66  CYS C O   1 
ATOM 8379  C CB  . CYS C 1 69  ? 85.681  59.506  100.162 1.00 68.20  ? 66  CYS C CB  1 
ATOM 8380  S SG  . CYS C 1 69  ? 86.296  60.906  101.074 1.00 82.12  ? 66  CYS C SG  1 
ATOM 8381  N N   . VAL C 1 70  ? 82.996  57.685  99.712  1.00 64.22  ? 67  VAL C N   1 
ATOM 8382  C CA  . VAL C 1 70  ? 82.370  56.714  98.833  1.00 55.57  ? 67  VAL C CA  1 
ATOM 8383  C C   . VAL C 1 70  ? 82.096  57.347  97.470  1.00 67.53  ? 67  VAL C C   1 
ATOM 8384  O O   . VAL C 1 70  ? 81.321  58.301  97.342  1.00 75.28  ? 67  VAL C O   1 
ATOM 8385  C CB  . VAL C 1 70  ? 81.080  56.162  99.442  1.00 48.41  ? 67  VAL C CB  1 
ATOM 8386  C CG1 . VAL C 1 70  ? 80.463  55.181  98.503  1.00 40.54  ? 67  VAL C CG1 1 
ATOM 8387  C CG2 . VAL C 1 70  ? 81.380  55.505  100.771 1.00 48.86  ? 67  VAL C CG2 1 
ATOM 8388  N N   . VAL C 1 71  ? 82.777  56.836  96.458  1.00 53.63  ? 68  VAL C N   1 
ATOM 8389  C CA  . VAL C 1 71  ? 82.536  57.254  95.091  1.00 59.03  ? 68  VAL C CA  1 
ATOM 8390  C C   . VAL C 1 71  ? 82.042  56.040  94.312  1.00 53.23  ? 68  VAL C C   1 
ATOM 8391  O O   . VAL C 1 71  ? 82.749  55.042  94.199  1.00 82.86  ? 68  VAL C O   1 
ATOM 8392  C CB  . VAL C 1 71  ? 83.816  57.838  94.457  1.00 66.33  ? 68  VAL C CB  1 
ATOM 8393  C CG1 . VAL C 1 71  ? 83.563  58.272  93.006  1.00 53.91  ? 68  VAL C CG1 1 
ATOM 8394  C CG2 . VAL C 1 71  ? 84.320  59.013  95.298  1.00 63.03  ? 68  VAL C CG2 1 
ATOM 8395  N N   . GLY C 1 72  ? 80.828  56.118  93.785  1.00 63.19  ? 69  GLY C N   1 
ATOM 8396  C CA  . GLY C 1 72  ? 80.208  54.963  93.165  1.00 52.34  ? 69  GLY C CA  1 
ATOM 8397  C C   . GLY C 1 72  ? 79.961  53.910  94.227  1.00 57.24  ? 69  GLY C C   1 
ATOM 8398  O O   . GLY C 1 72  ? 79.122  54.084  95.111  1.00 70.34  ? 69  GLY C O   1 
ATOM 8399  N N   . ASP C 1 73  ? 80.701  52.813  94.156  1.00 66.18  ? 70  ASP C N   1 
ATOM 8400  C CA  . ASP C 1 73  ? 80.640  51.792  95.201  1.00 63.79  ? 70  ASP C CA  1 
ATOM 8401  C C   . ASP C 1 73  ? 81.990  51.606  95.877  1.00 60.96  ? 70  ASP C C   1 
ATOM 8402  O O   . ASP C 1 73  ? 82.084  50.885  96.864  1.00 67.97  ? 70  ASP C O   1 
ATOM 8403  C CB  . ASP C 1 73  ? 80.157  50.453  94.640  1.00 57.47  ? 70  ASP C CB  1 
ATOM 8404  C CG  . ASP C 1 73  ? 78.644  50.400  94.464  1.00 87.81  ? 70  ASP C CG  1 
ATOM 8405  O OD1 . ASP C 1 73  ? 77.935  50.997  95.304  1.00 92.96  ? 70  ASP C OD1 1 
ATOM 8406  O OD2 . ASP C 1 73  ? 78.166  49.764  93.491  1.00 75.68  ? 70  ASP C OD2 1 
ATOM 8407  N N   . GLU C 1 74  ? 83.024  52.254  95.332  1.00 55.94  ? 71  GLU C N   1 
ATOM 8408  C CA  . GLU C 1 74  ? 84.386  52.143  95.857  1.00 81.01  ? 71  GLU C CA  1 
ATOM 8409  C C   . GLU C 1 74  ? 84.512  52.988  97.117  1.00 82.65  ? 71  GLU C C   1 
ATOM 8410  O O   . GLU C 1 74  ? 84.187  54.181  97.107  1.00 80.20  ? 71  GLU C O   1 
ATOM 8411  C CB  . GLU C 1 74  ? 85.448  52.565  94.809  1.00 59.57  ? 71  GLU C CB  1 
ATOM 8412  N N   . GLU C 1 75  ? 84.951  52.356  98.204  1.00 71.63  ? 72  GLU C N   1 
ATOM 8413  C CA  . GLU C 1 75  ? 85.355  53.082  99.400  1.00 64.23  ? 72  GLU C CA  1 
ATOM 8414  C C   . GLU C 1 75  ? 86.745  53.641  99.170  1.00 70.89  ? 72  GLU C C   1 
ATOM 8415  O O   . GLU C 1 75  ? 87.665  52.899  98.833  1.00 87.15  ? 72  GLU C O   1 
ATOM 8416  C CB  . GLU C 1 75  ? 85.368  52.171  100.617 1.00 52.87  ? 72  GLU C CB  1 
ATOM 8417  C CG  . GLU C 1 75  ? 84.002  51.701  101.052 1.00 64.19  ? 72  GLU C CG  1 
ATOM 8418  C CD  . GLU C 1 75  ? 84.067  50.742  102.224 1.00 97.26  ? 72  GLU C CD  1 
ATOM 8419  O OE1 . GLU C 1 75  ? 85.153  50.615  102.834 1.00 89.61  ? 72  GLU C OE1 1 
ATOM 8420  O OE2 . GLU C 1 75  ? 83.033  50.108  102.533 1.00 94.72  ? 72  GLU C OE2 1 
ATOM 8421  N N   . VAL C 1 76  ? 86.900  54.948  99.333  1.00 71.91  ? 73  VAL C N   1 
ATOM 8422  C CA  . VAL C 1 76  ? 88.187  55.564  99.066  1.00 64.45  ? 73  VAL C CA  1 
ATOM 8423  C C   . VAL C 1 76  ? 88.758  56.289  100.270 1.00 82.23  ? 73  VAL C C   1 
ATOM 8424  O O   . VAL C 1 76  ? 88.053  57.021  100.962 1.00 82.11  ? 73  VAL C O   1 
ATOM 8425  C CB  . VAL C 1 76  ? 88.110  56.519  97.884  1.00 64.10  ? 73  VAL C CB  1 
ATOM 8426  C CG1 . VAL C 1 76  ? 89.462  57.120  97.622  1.00 60.16  ? 73  VAL C CG1 1 
ATOM 8427  C CG2 . VAL C 1 76  ? 87.630  55.770  96.670  1.00 69.80  ? 73  VAL C CG2 1 
ATOM 8428  N N   . TRP C 1 77  ? 90.049  56.072  100.504 1.00 85.30  ? 74  TRP C N   1 
ATOM 8429  C CA  . TRP C 1 77  ? 90.772  56.743  101.570 1.00 67.74  ? 74  TRP C CA  1 
ATOM 8430  C C   . TRP C 1 77  ? 91.861  57.634  100.996 1.00 79.39  ? 74  TRP C C   1 
ATOM 8431  O O   . TRP C 1 77  ? 92.550  57.248  100.047 1.00 92.43  ? 74  TRP C O   1 
ATOM 8432  C CB  . TRP C 1 77  ? 91.369  55.714  102.532 1.00 56.20  ? 74  TRP C CB  1 
ATOM 8433  C CG  . TRP C 1 77  ? 90.346  55.124  103.455 1.00 67.54  ? 74  TRP C CG  1 
ATOM 8434  C CD1 . TRP C 1 77  ? 89.628  53.966  103.273 1.00 67.03  ? 74  TRP C CD1 1 
ATOM 8435  C CD2 . TRP C 1 77  ? 89.915  55.670  104.709 1.00 64.73  ? 74  TRP C CD2 1 
ATOM 8436  N NE1 . TRP C 1 77  ? 88.780  53.762  104.345 1.00 68.55  ? 74  TRP C NE1 1 
ATOM 8437  C CE2 . TRP C 1 77  ? 88.937  54.796  105.237 1.00 76.74  ? 74  TRP C CE2 1 
ATOM 8438  C CE3 . TRP C 1 77  ? 90.262  56.814  105.438 1.00 70.16  ? 74  TRP C CE3 1 
ATOM 8439  C CZ2 . TRP C 1 77  ? 88.303  55.036  106.464 1.00 60.25  ? 74  TRP C CZ2 1 
ATOM 8440  C CZ3 . TRP C 1 77  ? 89.633  57.050  106.647 1.00 69.21  ? 74  TRP C CZ3 1 
ATOM 8441  C CH2 . TRP C 1 77  ? 88.663  56.165  107.147 1.00 63.92  ? 74  TRP C CH2 1 
ATOM 8442  N N   . THR C 1 78  ? 91.996  58.836  101.556 1.00 78.66  ? 75  THR C N   1 
ATOM 8443  C CA  . THR C 1 78  ? 93.127  59.699  101.230 1.00 71.94  ? 75  THR C CA  1 
ATOM 8444  C C   . THR C 1 78  ? 94.042  59.848  102.444 1.00 67.92  ? 75  THR C C   1 
ATOM 8445  O O   . THR C 1 78  ? 93.706  59.409  103.543 1.00 85.13  ? 75  THR C O   1 
ATOM 8446  C CB  . THR C 1 78  ? 92.684  61.098  100.754 1.00 80.90  ? 75  THR C CB  1 
ATOM 8447  O OG1 . THR C 1 78  ? 92.228  61.866  101.872 1.00 78.45  ? 75  THR C OG1 1 
ATOM 8448  C CG2 . THR C 1 78  ? 91.582  60.993  99.724  1.00 79.27  ? 75  THR C CG2 1 
ATOM 8449  N N   . SER C 1 79  ? 95.201  60.463  102.242 1.00 73.67  ? 76  SER C N   1 
ATOM 8450  C CA  . SER C 1 79  ? 96.161  60.637  103.326 1.00 75.44  ? 76  SER C CA  1 
ATOM 8451  C C   . SER C 1 79  ? 95.710  61.702  104.336 1.00 92.53  ? 76  SER C C   1 
ATOM 8452  O O   . SER C 1 79  ? 96.292  61.828  105.412 1.00 91.78  ? 76  SER C O   1 
ATOM 8453  C CB  . SER C 1 79  ? 97.538  60.994  102.757 1.00 76.58  ? 76  SER C CB  1 
ATOM 8454  O OG  . SER C 1 79  ? 97.481  62.177  101.974 1.00 89.98  ? 76  SER C OG  1 
ATOM 8455  N N   . ASP C 1 80  ? 94.670  62.459  103.988 1.00 94.20  ? 77  ASP C N   1 
ATOM 8456  C CA  . ASP C 1 80  ? 94.214  63.586  104.807 1.00 78.27  ? 77  ASP C CA  1 
ATOM 8457  C C   . ASP C 1 80  ? 93.171  63.130  105.844 1.00 87.52  ? 77  ASP C C   1 
ATOM 8458  O O   . ASP C 1 80  ? 91.994  63.486  105.770 1.00 78.61  ? 77  ASP C O   1 
ATOM 8459  C CB  . ASP C 1 80  ? 93.664  64.702  103.896 1.00 67.42  ? 77  ASP C CB  1 
ATOM 8460  C CG  . ASP C 1 80  ? 93.639  66.069  104.571 1.00 90.45  ? 77  ASP C CG  1 
ATOM 8461  O OD1 . ASP C 1 80  ? 93.831  66.143  105.811 1.00 90.46  ? 77  ASP C OD1 1 
ATOM 8462  O OD2 . ASP C 1 80  ? 93.415  67.072  103.849 1.00 76.84  ? 77  ASP C OD2 1 
ATOM 8463  N N   . VAL C 1 81  ? 93.617  62.338  106.813 1.00 72.17  ? 78  VAL C N   1 
ATOM 8464  C CA  . VAL C 1 81  ? 92.734  61.789  107.834 1.00 74.26  ? 78  VAL C CA  1 
ATOM 8465  C C   . VAL C 1 81  ? 92.244  62.841  108.842 1.00 81.27  ? 78  VAL C C   1 
ATOM 8466  O O   . VAL C 1 81  ? 92.995  63.722  109.265 1.00 75.38  ? 78  VAL C O   1 
ATOM 8467  C CB  . VAL C 1 81  ? 93.425  60.620  108.560 1.00 82.24  ? 78  VAL C CB  1 
ATOM 8468  C CG1 . VAL C 1 81  ? 92.538  60.041  109.659 1.00 74.90  ? 78  VAL C CG1 1 
ATOM 8469  C CG2 . VAL C 1 81  ? 93.795  59.559  107.548 1.00 82.83  ? 78  VAL C CG2 1 
ATOM 8470  N N   . GLN C 1 82  ? 90.973  62.737  109.215 1.00 67.78  ? 79  GLN C N   1 
ATOM 8471  C CA  . GLN C 1 82  ? 90.345  63.671  110.143 1.00 68.66  ? 79  GLN C CA  1 
ATOM 8472  C C   . GLN C 1 82  ? 89.571  62.888  111.203 1.00 70.61  ? 79  GLN C C   1 
ATOM 8473  O O   . GLN C 1 82  ? 89.194  61.737  110.983 1.00 85.74  ? 79  GLN C O   1 
ATOM 8474  C CB  . GLN C 1 82  ? 89.366  64.587  109.397 1.00 64.65  ? 79  GLN C CB  1 
ATOM 8475  C CG  . GLN C 1 82  ? 89.949  65.343  108.227 1.00 72.87  ? 79  GLN C CG  1 
ATOM 8476  C CD  . GLN C 1 82  ? 90.865  66.455  108.677 1.00 82.19  ? 79  GLN C CD  1 
ATOM 8477  O OE1 . GLN C 1 82  ? 90.664  67.050  109.735 1.00 74.56  ? 79  GLN C OE1 1 
ATOM 8478  N NE2 . GLN C 1 82  ? 91.889  66.736  107.879 1.00 89.71  ? 79  GLN C NE2 1 
ATOM 8479  N N   . TYR C 1 83  ? 89.305  63.517  112.341 1.00 75.86  ? 80  TYR C N   1 
ATOM 8480  C CA  . TYR C 1 83  ? 88.526  62.861  113.388 1.00 82.07  ? 80  TYR C CA  1 
ATOM 8481  C C   . TYR C 1 83  ? 87.315  63.682  113.826 1.00 80.24  ? 80  TYR C C   1 
ATOM 8482  O O   . TYR C 1 83  ? 87.328  64.915  113.817 1.00 83.29  ? 80  TYR C O   1 
ATOM 8483  C CB  . TYR C 1 83  ? 89.411  62.531  114.604 1.00 75.21  ? 80  TYR C CB  1 
ATOM 8484  C CG  . TYR C 1 83  ? 90.561  61.603  114.276 1.00 75.02  ? 80  TYR C CG  1 
ATOM 8485  C CD1 . TYR C 1 83  ? 91.785  62.108  113.843 1.00 74.83  ? 80  TYR C CD1 1 
ATOM 8486  C CD2 . TYR C 1 83  ? 90.420  60.225  114.391 1.00 74.86  ? 80  TYR C CD2 1 
ATOM 8487  C CE1 . TYR C 1 83  ? 92.832  61.270  113.529 1.00 86.54  ? 80  TYR C CE1 1 
ATOM 8488  C CE2 . TYR C 1 83  ? 91.465  59.371  114.080 1.00 86.43  ? 80  TYR C CE2 1 
ATOM 8489  C CZ  . TYR C 1 83  ? 92.671  59.901  113.650 1.00 95.39  ? 80  TYR C CZ  1 
ATOM 8490  O OH  . TYR C 1 83  ? 93.719  59.065  113.340 1.00 94.61  ? 80  TYR C OH  1 
ATOM 8491  N N   . GLN C 1 84  ? 86.268  62.977  114.217 1.00 61.49  ? 81  GLN C N   1 
ATOM 8492  C CA  . GLN C 1 84  ? 85.101  63.607  114.802 1.00 79.26  ? 81  GLN C CA  1 
ATOM 8493  C C   . GLN C 1 84  ? 85.048  63.188  116.277 1.00 81.95  ? 81  GLN C C   1 
ATOM 8494  O O   . GLN C 1 84  ? 85.126  62.002  116.609 1.00 69.55  ? 81  GLN C O   1 
ATOM 8495  C CB  . GLN C 1 84  ? 83.824  63.186  114.050 1.00 73.67  ? 81  GLN C CB  1 
ATOM 8496  C CG  . GLN C 1 84  ? 82.564  63.914  114.493 1.00 66.59  ? 81  GLN C CG  1 
ATOM 8497  C CD  . GLN C 1 84  ? 81.300  63.147  114.169 1.00 79.89  ? 81  GLN C CD  1 
ATOM 8498  O OE1 . GLN C 1 84  ? 81.320  62.207  113.365 1.00 65.17  ? 81  GLN C OE1 1 
ATOM 8499  N NE2 . GLN C 1 84  ? 80.190  63.528  114.810 1.00 49.63  ? 81  GLN C NE2 1 
ATOM 8500  N N   . VAL C 1 85  ? 84.943  64.167  117.165 1.00 68.29  ? 82  VAL C N   1 
ATOM 8501  C CA  . VAL C 1 85  ? 84.926  63.884  118.592 1.00 58.41  ? 82  VAL C CA  1 
ATOM 8502  C C   . VAL C 1 85  ? 83.572  64.237  119.217 1.00 77.94  ? 82  VAL C C   1 
ATOM 8503  O O   . VAL C 1 85  ? 82.888  65.155  118.767 1.00 75.59  ? 82  VAL C O   1 
ATOM 8504  C CB  . VAL C 1 85  ? 86.063  64.639  119.345 1.00 83.85  ? 82  VAL C CB  1 
ATOM 8505  C CG1 . VAL C 1 85  ? 87.398  64.461  118.629 1.00 70.18  ? 82  VAL C CG1 1 
ATOM 8506  C CG2 . VAL C 1 85  ? 85.750  66.111  119.476 1.00 67.99  ? 82  VAL C CG2 1 
ATOM 8507  N N   . SER C 1 86  ? 83.187  63.489  120.245 1.00 71.50  ? 83  SER C N   1 
ATOM 8508  C CA  . SER C 1 86  ? 81.952  63.750  120.979 1.00 58.93  ? 83  SER C CA  1 
ATOM 8509  C C   . SER C 1 86  ? 82.035  65.113  121.707 1.00 69.53  ? 83  SER C C   1 
ATOM 8510  O O   . SER C 1 86  ? 82.946  65.344  122.488 1.00 74.58  ? 83  SER C O   1 
ATOM 8511  C CB  . SER C 1 86  ? 81.695  62.597  121.956 1.00 57.78  ? 83  SER C CB  1 
ATOM 8512  O OG  . SER C 1 86  ? 80.481  62.757  122.649 1.00 71.04  ? 83  SER C OG  1 
ATOM 8513  N N   . PRO C 1 87  ? 81.091  66.032  121.427 1.00 85.89  ? 84  PRO C N   1 
ATOM 8514  C CA  . PRO C 1 87  ? 81.149  67.407  121.960 1.00 75.68  ? 84  PRO C CA  1 
ATOM 8515  C C   . PRO C 1 87  ? 81.197  67.528  123.491 1.00 74.37  ? 84  PRO C C   1 
ATOM 8516  O O   . PRO C 1 87  ? 81.838  68.456  124.000 1.00 67.14  ? 84  PRO C O   1 
ATOM 8517  C CB  . PRO C 1 87  ? 79.850  68.039  121.452 1.00 61.34  ? 84  PRO C CB  1 
ATOM 8518  C CG  . PRO C 1 87  ? 79.468  67.218  120.269 1.00 72.28  ? 84  PRO C CG  1 
ATOM 8519  C CD  . PRO C 1 87  ? 79.949  65.835  120.510 1.00 62.47  ? 84  PRO C CD  1 
ATOM 8520  N N   . PHE C 1 88  ? 80.511  66.629  124.198 1.00 70.77  ? 85  PHE C N   1 
ATOM 8521  C CA  . PHE C 1 88  ? 80.460  66.633  125.665 1.00 72.50  ? 85  PHE C CA  1 
ATOM 8522  C C   . PHE C 1 88  ? 81.587  65.821  126.295 1.00 78.13  ? 85  PHE C C   1 
ATOM 8523  O O   . PHE C 1 88  ? 81.684  65.715  127.518 1.00 93.37  ? 85  PHE C O   1 
ATOM 8524  C CB  . PHE C 1 88  ? 79.111  66.109  126.170 1.00 59.20  ? 85  PHE C CB  1 
ATOM 8525  C CG  . PHE C 1 88  ? 78.707  64.797  125.568 1.00 86.16  ? 85  PHE C CG  1 
ATOM 8526  C CD1 . PHE C 1 88  ? 79.112  63.601  126.153 1.00 75.34  ? 85  PHE C CD1 1 
ATOM 8527  C CD2 . PHE C 1 88  ? 77.916  64.754  124.412 1.00 73.16  ? 85  PHE C CD2 1 
ATOM 8528  C CE1 . PHE C 1 88  ? 78.738  62.378  125.604 1.00 58.88  ? 85  PHE C CE1 1 
ATOM 8529  C CE2 . PHE C 1 88  ? 77.534  63.530  123.856 1.00 58.76  ? 85  PHE C CE2 1 
ATOM 8530  C CZ  . PHE C 1 88  ? 77.951  62.343  124.457 1.00 80.46  ? 85  PHE C CZ  1 
ATOM 8531  N N   . ASN C 1 89  ? 82.428  65.240  125.449 1.00 87.16  ? 86  ASN C N   1 
ATOM 8532  C CA  . ASN C 1 89  ? 83.587  64.491  125.906 1.00 85.88  ? 86  ASN C CA  1 
ATOM 8533  C C   . ASN C 1 89  ? 84.609  64.407  124.788 1.00 72.02  ? 86  ASN C C   1 
ATOM 8534  O O   . ASN C 1 89  ? 84.757  63.364  124.161 1.00 67.86  ? 86  ASN C O   1 
ATOM 8535  C CB  . ASN C 1 89  ? 83.171  63.091  126.350 1.00 70.85  ? 86  ASN C CB  1 
ATOM 8536  C CG  . ASN C 1 89  ? 84.341  62.268  126.823 1.00 98.28  ? 86  ASN C CG  1 
ATOM 8537  O OD1 . ASN C 1 89  ? 84.296  61.039  126.790 1.00 97.60  ? 86  ASN C OD1 1 
ATOM 8538  N ND2 . ASN C 1 89  ? 85.408  62.941  127.261 1.00 83.77  ? 86  ASN C ND2 1 
ATOM 8539  N N   . HIS C 1 90  ? 85.304  65.515  124.544 1.00 66.95  ? 87  HIS C N   1 
ATOM 8540  C CA  . HIS C 1 90  ? 86.118  65.664  123.340 1.00 83.69  ? 87  HIS C CA  1 
ATOM 8541  C C   . HIS C 1 90  ? 87.367  64.781  123.312 1.00 86.24  ? 87  HIS C C   1 
ATOM 8542  O O   . HIS C 1 90  ? 88.150  64.819  122.355 1.00 90.14  ? 87  HIS C O   1 
ATOM 8543  C CB  . HIS C 1 90  ? 86.474  67.137  123.116 1.00 93.77  ? 87  HIS C CB  1 
ATOM 8544  C CG  . HIS C 1 90  ? 86.786  67.881  124.377 1.00 103.11 ? 87  HIS C CG  1 
ATOM 8545  N ND1 . HIS C 1 90  ? 87.717  67.435  125.291 1.00 100.92 ? 87  HIS C ND1 1 
ATOM 8546  C CD2 . HIS C 1 90  ? 86.293  69.042  124.873 1.00 82.18  ? 87  HIS C CD2 1 
ATOM 8547  C CE1 . HIS C 1 90  ? 87.784  68.289  126.295 1.00 95.20  ? 87  HIS C CE1 1 
ATOM 8548  N NE2 . HIS C 1 90  ? 86.931  69.272  126.065 1.00 91.62  ? 87  HIS C NE2 1 
ATOM 8549  N N   . GLY C 1 91  ? 87.545  63.988  124.364 1.00 89.58  ? 88  GLY C N   1 
ATOM 8550  C CA  . GLY C 1 91  ? 88.616  63.013  124.413 1.00 78.09  ? 88  GLY C CA  1 
ATOM 8551  C C   . GLY C 1 91  ? 88.256  61.758  123.641 1.00 96.22  ? 88  GLY C C   1 
ATOM 8552  O O   . GLY C 1 91  ? 89.131  61.004  123.225 1.00 105.70 ? 88  GLY C O   1 
ATOM 8553  N N   . HIS C 1 92  ? 86.956  61.534  123.453 1.00 91.29  ? 89  HIS C N   1 
ATOM 8554  C CA  . HIS C 1 92  ? 86.443  60.392  122.682 1.00 74.31  ? 89  HIS C CA  1 
ATOM 8555  C C   . HIS C 1 92  ? 86.341  60.723  121.190 1.00 88.96  ? 89  HIS C C   1 
ATOM 8556  O O   . HIS C 1 92  ? 85.493  61.521  120.783 1.00 90.23  ? 89  HIS C O   1 
ATOM 8557  C CB  . HIS C 1 92  ? 85.052  59.979  123.213 1.00 79.92  ? 89  HIS C CB  1 
ATOM 8558  C CG  . HIS C 1 92  ? 84.470  58.761  122.539 1.00 101.57 ? 89  HIS C CG  1 
ATOM 8559  N ND1 . HIS C 1 92  ? 83.108  58.589  122.379 1.00 84.31  ? 89  HIS C ND1 1 
ATOM 8560  C CD2 . HIS C 1 92  ? 85.058  57.703  121.938 1.00 106.02 ? 89  HIS C CD2 1 
ATOM 8561  C CE1 . HIS C 1 92  ? 82.887  57.446  121.739 1.00 83.91  ? 89  HIS C CE1 1 
ATOM 8562  N NE2 . HIS C 1 92  ? 84.056  56.883  121.483 1.00 109.37 ? 89  HIS C NE2 1 
ATOM 8563  N N   . LYS C 1 93  ? 87.196  60.104  120.378 1.00 97.04  ? 90  LYS C N   1 
ATOM 8564  C CA  . LYS C 1 93  ? 87.079  60.208  118.929 1.00 83.93  ? 90  LYS C CA  1 
ATOM 8565  C C   . LYS C 1 93  ? 86.001  59.217  118.470 1.00 82.33  ? 90  LYS C C   1 
ATOM 8566  O O   . LYS C 1 93  ? 86.207  58.007  118.553 1.00 83.76  ? 90  LYS C O   1 
ATOM 8567  C CB  . LYS C 1 93  ? 88.430  59.913  118.264 1.00 71.92  ? 90  LYS C CB  1 
ATOM 8568  N N   . VAL C 1 94  ? 84.846  59.724  118.024 1.00 76.59  ? 91  VAL C N   1 
ATOM 8569  C CA  . VAL C 1 94  ? 83.732  58.851  117.607 1.00 59.18  ? 91  VAL C CA  1 
ATOM 8570  C C   . VAL C 1 94  ? 83.860  58.361  116.170 1.00 73.68  ? 91  VAL C C   1 
ATOM 8571  O O   . VAL C 1 94  ? 83.278  57.352  115.820 1.00 60.16  ? 91  VAL C O   1 
ATOM 8572  C CB  . VAL C 1 94  ? 82.339  59.508  117.770 1.00 68.93  ? 91  VAL C CB  1 
ATOM 8573  C CG1 . VAL C 1 94  ? 82.155  60.025  119.179 1.00 79.16  ? 91  VAL C CG1 1 
ATOM 8574  C CG2 . VAL C 1 94  ? 82.147  60.629  116.757 1.00 67.02  ? 91  VAL C CG2 1 
ATOM 8575  N N   . ALA C 1 95  ? 84.620  59.072  115.343 1.00 58.85  ? 92  ALA C N   1 
ATOM 8576  C CA  . ALA C 1 95  ? 84.783  58.667  113.960 1.00 72.99  ? 92  ALA C CA  1 
ATOM 8577  C C   . ALA C 1 95  ? 86.112  59.117  113.401 1.00 69.14  ? 92  ALA C C   1 
ATOM 8578  O O   . ALA C 1 95  ? 86.633  60.161  113.785 1.00 79.02  ? 92  ALA C O   1 
ATOM 8579  C CB  . ALA C 1 95  ? 83.639  59.223  113.100 1.00 66.85  ? 92  ALA C CB  1 
ATOM 8580  N N   . LYS C 1 96  ? 86.645  58.314  112.486 1.00 60.60  ? 93  LYS C N   1 
ATOM 8581  C CA  . LYS C 1 96  ? 87.816  58.679  111.699 1.00 77.71  ? 93  LYS C CA  1 
ATOM 8582  C C   . LYS C 1 96  ? 87.426  58.650  110.234 1.00 77.02  ? 93  LYS C C   1 
ATOM 8583  O O   . LYS C 1 96  ? 86.882  57.647  109.744 1.00 67.11  ? 93  LYS C O   1 
ATOM 8584  C CB  . LYS C 1 96  ? 88.974  57.714  111.972 1.00 73.96  ? 93  LYS C CB  1 
ATOM 8585  C CG  . LYS C 1 96  ? 90.059  57.649  110.892 1.00 67.13  ? 93  LYS C CG  1 
ATOM 8586  C CD  . LYS C 1 96  ? 91.262  56.866  111.420 1.00 89.84  ? 93  LYS C CD  1 
ATOM 8587  C CE  . LYS C 1 96  ? 92.051  56.175  110.314 1.00 92.79  ? 93  LYS C CE  1 
ATOM 8588  N NZ  . LYS C 1 96  ? 93.146  55.336  110.894 1.00 95.27  ? 93  LYS C NZ  1 
ATOM 8589  N N   . PHE C 1 97  ? 87.681  59.757  109.547 1.00 60.30  ? 94  PHE C N   1 
ATOM 8590  C CA  . PHE C 1 97  ? 87.329  59.877  108.139 1.00 79.70  ? 94  PHE C CA  1 
ATOM 8591  C C   . PHE C 1 97  ? 88.448  60.599  107.397 1.00 78.62  ? 94  PHE C C   1 
ATOM 8592  O O   . PHE C 1 97  ? 89.550  60.776  107.940 1.00 78.81  ? 94  PHE C O   1 
ATOM 8593  C CB  . PHE C 1 97  ? 85.961  60.573  107.952 1.00 65.11  ? 94  PHE C CB  1 
ATOM 8594  C CG  . PHE C 1 97  ? 85.923  62.018  108.408 1.00 69.45  ? 94  PHE C CG  1 
ATOM 8595  C CD1 . PHE C 1 97  ? 85.996  63.057  107.488 1.00 61.49  ? 94  PHE C CD1 1 
ATOM 8596  C CD2 . PHE C 1 97  ? 85.798  62.332  109.759 1.00 68.74  ? 94  PHE C CD2 1 
ATOM 8597  C CE1 . PHE C 1 97  ? 85.957  64.394  107.917 1.00 80.10  ? 94  PHE C CE1 1 
ATOM 8598  C CE2 . PHE C 1 97  ? 85.762  63.656  110.194 1.00 64.17  ? 94  PHE C CE2 1 
ATOM 8599  C CZ  . PHE C 1 97  ? 85.834  64.690  109.273 1.00 64.50  ? 94  PHE C CZ  1 
ATOM 8600  N N   . CYS C 1 98  ? 88.175  61.011  106.164 1.00 72.06  ? 95  CYS C N   1 
ATOM 8601  C CA  . CYS C 1 98  ? 89.196  61.681  105.380 1.00 72.38  ? 95  CYS C CA  1 
ATOM 8602  C C   . CYS C 1 98  ? 88.614  62.674  104.369 1.00 74.28  ? 95  CYS C C   1 
ATOM 8603  O O   . CYS C 1 98  ? 87.448  62.573  103.973 1.00 83.20  ? 95  CYS C O   1 
ATOM 8604  C CB  . CYS C 1 98  ? 90.064  60.641  104.670 1.00 55.69  ? 95  CYS C CB  1 
ATOM 8605  S SG  . CYS C 1 98  ? 89.162  59.655  103.458 1.00 79.84  ? 95  CYS C SG  1 
ATOM 8606  N N   . TYR C 1 99  ? 89.451  63.627  103.966 1.00 67.89  ? 96  TYR C N   1 
ATOM 8607  C CA  . TYR C 1 99  ? 89.106  64.641  102.980 1.00 68.08  ? 96  TYR C CA  1 
ATOM 8608  C C   . TYR C 1 99  ? 89.416  64.204  101.551 1.00 69.60  ? 96  TYR C C   1 
ATOM 8609  O O   . TYR C 1 99  ? 90.530  63.788  101.246 1.00 74.52  ? 96  TYR C O   1 
ATOM 8610  C CB  . TYR C 1 99  ? 89.898  65.917  103.252 1.00 68.08  ? 96  TYR C CB  1 
ATOM 8611  C CG  . TYR C 1 99  ? 89.377  66.775  104.377 1.00 68.79  ? 96  TYR C CG  1 
ATOM 8612  C CD1 . TYR C 1 99  ? 88.131  66.545  104.946 1.00 68.36  ? 96  TYR C CD1 1 
ATOM 8613  C CD2 . TYR C 1 99  ? 90.126  67.837  104.849 1.00 66.32  ? 96  TYR C CD2 1 
ATOM 8614  C CE1 . TYR C 1 99  ? 87.659  67.344  105.973 1.00 59.50  ? 96  TYR C CE1 1 
ATOM 8615  C CE2 . TYR C 1 99  ? 89.670  68.636  105.868 1.00 63.96  ? 96  TYR C CE2 1 
ATOM 8616  C CZ  . TYR C 1 99  ? 88.438  68.382  106.435 1.00 78.21  ? 96  TYR C CZ  1 
ATOM 8617  O OH  . TYR C 1 99  ? 87.982  69.189  107.458 1.00 68.37  ? 96  TYR C OH  1 
ATOM 8618  N N   . ALA C 1 100 ? 88.438  64.337  100.666 1.00 82.02  ? 97  ALA C N   1 
ATOM 8619  C CA  . ALA C 1 100 ? 88.684  64.178  99.239  1.00 76.74  ? 97  ALA C CA  1 
ATOM 8620  C C   . ALA C 1 100 ? 89.639  65.268  98.757  1.00 73.86  ? 97  ALA C C   1 
ATOM 8621  O O   . ALA C 1 100 ? 89.551  66.424  99.196  1.00 79.44  ? 97  ALA C O   1 
ATOM 8622  C CB  . ALA C 1 100 ? 87.370  64.249  98.476  1.00 70.14  ? 97  ALA C CB  1 
ATOM 8623  N N   . ASP C 1 101 ? 90.558  64.901  97.868  1.00 78.49  ? 98  ASP C N   1 
ATOM 8624  C CA  . ASP C 1 101 ? 91.400  65.889  97.183  1.00 81.66  ? 98  ASP C CA  1 
ATOM 8625  C C   . ASP C 1 101 ? 90.761  66.333  95.857  1.00 85.52  ? 98  ASP C C   1 
ATOM 8626  O O   . ASP C 1 101 ? 89.706  65.805  95.479  1.00 73.62  ? 98  ASP C O   1 
ATOM 8627  C CB  . ASP C 1 101 ? 92.818  65.340  96.956  1.00 81.97  ? 98  ASP C CB  1 
ATOM 8628  C CG  . ASP C 1 101 ? 92.830  63.876  96.523  1.00 97.21  ? 98  ASP C CG  1 
ATOM 8629  O OD1 . ASP C 1 101 ? 91.900  63.425  95.819  1.00 86.44  ? 98  ASP C OD1 1 
ATOM 8630  O OD2 . ASP C 1 101 ? 93.790  63.171  96.890  1.00 101.91 ? 98  ASP C OD2 1 
ATOM 8631  N N   . LYS C 1 102 ? 91.382  67.293  95.162  1.00 62.55  ? 99  LYS C N   1 
ATOM 8632  C CA  . LYS C 1 102 ? 90.852  67.751  93.876  1.00 71.57  ? 99  LYS C CA  1 
ATOM 8633  C C   . LYS C 1 102 ? 90.671  66.560  92.938  1.00 80.80  ? 99  LYS C C   1 
ATOM 8634  O O   . LYS C 1 102 ? 89.663  66.444  92.240  1.00 80.95  ? 99  LYS C O   1 
ATOM 8635  C CB  . LYS C 1 102 ? 91.754  68.806  93.234  1.00 58.89  ? 99  LYS C CB  1 
ATOM 8636  N N   . SER C 1 103 ? 91.646  65.662  92.948  1.00 70.82  ? 100 SER C N   1 
ATOM 8637  C CA  . SER C 1 103 ? 91.616  64.482  92.093  1.00 74.78  ? 100 SER C CA  1 
ATOM 8638  C C   . SER C 1 103 ? 90.382  63.592  92.324  1.00 79.33  ? 100 SER C C   1 
ATOM 8639  O O   . SER C 1 103 ? 89.692  63.206  91.379  1.00 84.46  ? 100 SER C O   1 
ATOM 8640  C CB  . SER C 1 103 ? 92.892  63.665  92.304  1.00 84.55  ? 100 SER C CB  1 
ATOM 8641  O OG  . SER C 1 103 ? 92.713  62.330  91.858  1.00 97.03  ? 100 SER C OG  1 
ATOM 8642  N N   . LEU C 1 104 ? 90.126  63.253  93.583  1.00 82.28  ? 101 LEU C N   1 
ATOM 8643  C CA  . LEU C 1 104 ? 88.990  62.404  93.945  1.00 74.96  ? 101 LEU C CA  1 
ATOM 8644  C C   . LEU C 1 104 ? 87.668  63.096  93.624  1.00 76.10  ? 101 LEU C C   1 
ATOM 8645  O O   . LEU C 1 104 ? 86.753  62.458  93.107  1.00 68.71  ? 101 LEU C O   1 
ATOM 8646  C CB  . LEU C 1 104 ? 89.049  62.024  95.436  1.00 63.10  ? 101 LEU C CB  1 
ATOM 8647  C CG  . LEU C 1 104 ? 87.958  61.128  96.009  1.00 59.60  ? 101 LEU C CG  1 
ATOM 8648  C CD1 . LEU C 1 104 ? 87.797  59.865  95.170  1.00 67.95  ? 101 LEU C CD1 1 
ATOM 8649  C CD2 . LEU C 1 104 ? 88.284  60.765  97.442  1.00 60.48  ? 101 LEU C CD2 1 
ATOM 8650  N N   . LEU C 1 105 ? 87.577  64.397  93.922  1.00 73.33  ? 102 LEU C N   1 
ATOM 8651  C CA  . LEU C 1 105 ? 86.361  65.159  93.658  1.00 64.86  ? 102 LEU C CA  1 
ATOM 8652  C C   . LEU C 1 105 ? 86.015  65.132  92.174  1.00 72.94  ? 102 LEU C C   1 
ATOM 8653  O O   . LEU C 1 105 ? 84.848  64.985  91.800  1.00 79.46  ? 102 LEU C O   1 
ATOM 8654  C CB  . LEU C 1 105 ? 86.489  66.597  94.169  1.00 59.92  ? 102 LEU C CB  1 
ATOM 8655  C CG  . LEU C 1 105 ? 86.506  66.740  95.689  1.00 63.06  ? 102 LEU C CG  1 
ATOM 8656  C CD1 . LEU C 1 105 ? 86.775  68.167  96.095  1.00 62.71  ? 102 LEU C CD1 1 
ATOM 8657  C CD2 . LEU C 1 105 ? 85.191  66.256  96.289  1.00 63.24  ? 102 LEU C CD2 1 
ATOM 8658  N N   . ASN C 1 106 ? 87.023  65.259  91.319  1.00 75.25  ? 103 ASN C N   1 
ATOM 8659  C CA  . ASN C 1 106 ? 86.778  65.210  89.879  1.00 60.15  ? 103 ASN C CA  1 
ATOM 8660  C C   . ASN C 1 106 ? 86.430  63.802  89.377  1.00 68.57  ? 103 ASN C C   1 
ATOM 8661  O O   . ASN C 1 106 ? 85.595  63.649  88.478  1.00 67.25  ? 103 ASN C O   1 
ATOM 8662  C CB  . ASN C 1 106 ? 87.949  65.813  89.107  1.00 67.22  ? 103 ASN C CB  1 
ATOM 8663  C CG  . ASN C 1 106 ? 88.049  67.334  89.279  1.00 85.77  ? 103 ASN C CG  1 
ATOM 8664  O OD1 . ASN C 1 106 ? 89.132  67.875  89.530  1.00 73.58  ? 103 ASN C OD1 1 
ATOM 8665  N ND2 . ASN C 1 106 ? 86.916  68.030  89.140  1.00 58.40  ? 103 ASN C ND2 1 
ATOM 8666  N N   . LYS C 1 107 ? 87.050  62.776  89.960  1.00 58.58  ? 104 LYS C N   1 
ATOM 8667  C CA  . LYS C 1 107 ? 86.661  61.398  89.647  1.00 66.72  ? 104 LYS C CA  1 
ATOM 8668  C C   . LYS C 1 107 ? 85.180  61.226  89.996  1.00 68.52  ? 104 LYS C C   1 
ATOM 8669  O O   . LYS C 1 107 ? 84.423  60.610  89.244  1.00 72.38  ? 104 LYS C O   1 
ATOM 8670  C CB  . LYS C 1 107 ? 87.532  60.370  90.391  1.00 57.31  ? 104 LYS C CB  1 
ATOM 8671  N N   . ALA C 1 108 ? 84.771  61.803  91.129  1.00 76.14  ? 105 ALA C N   1 
ATOM 8672  C CA  . ALA C 1 108 ? 83.386  61.722  91.612  1.00 73.32  ? 105 ALA C CA  1 
ATOM 8673  C C   . ALA C 1 108 ? 82.406  62.421  90.676  1.00 73.09  ? 105 ALA C C   1 
ATOM 8674  O O   . ALA C 1 108 ? 81.312  61.916  90.420  1.00 70.69  ? 105 ALA C O   1 
ATOM 8675  C CB  . ALA C 1 108 ? 83.275  62.297  93.022  1.00 56.52  ? 105 ALA C CB  1 
ATOM 8676  N N   . ILE C 1 109 ? 82.809  63.586  90.178  1.00 71.31  ? 106 ILE C N   1 
ATOM 8677  C CA  . ILE C 1 109 ? 82.025  64.342  89.200  1.00 62.23  ? 106 ILE C CA  1 
ATOM 8678  C C   . ILE C 1 109 ? 81.873  63.573  87.891  1.00 65.69  ? 106 ILE C C   1 
ATOM 8679  O O   . ILE C 1 109 ? 80.759  63.401  87.394  1.00 64.01  ? 106 ILE C O   1 
ATOM 8680  C CB  . ILE C 1 109 ? 82.684  65.715  88.894  1.00 77.42  ? 106 ILE C CB  1 
ATOM 8681  C CG1 . ILE C 1 109 ? 82.656  66.617  90.128  1.00 55.38  ? 106 ILE C CG1 1 
ATOM 8682  C CG2 . ILE C 1 109 ? 82.011  66.396  87.712  1.00 64.53  ? 106 ILE C CG2 1 
ATOM 8683  C CD1 . ILE C 1 109 ? 83.271  67.965  89.882  1.00 63.72  ? 106 ILE C CD1 1 
ATOM 8684  N N   . GLU C 1 110 ? 82.986  63.110  87.329  1.00 67.26  ? 107 GLU C N   1 
ATOM 8685  C CA  . GLU C 1 110 ? 82.929  62.332  86.085  1.00 60.75  ? 107 GLU C CA  1 
ATOM 8686  C C   . GLU C 1 110 ? 82.015  61.118  86.224  1.00 51.18  ? 107 GLU C C   1 
ATOM 8687  O O   . GLU C 1 110 ? 81.224  60.831  85.334  1.00 79.58  ? 107 GLU C O   1 
ATOM 8688  C CB  . GLU C 1 110 ? 84.328  61.907  85.631  1.00 53.04  ? 107 GLU C CB  1 
ATOM 8689  N N   . ALA C 1 111 ? 82.107  60.415  87.351  1.00 61.36  ? 108 ALA C N   1 
ATOM 8690  C CA  . ALA C 1 111 ? 81.315  59.195  87.548  1.00 60.44  ? 108 ALA C CA  1 
ATOM 8691  C C   . ALA C 1 111 ? 79.828  59.480  87.770  1.00 61.94  ? 108 ALA C C   1 
ATOM 8692  O O   . ALA C 1 111 ? 78.972  58.742  87.286  1.00 75.41  ? 108 ALA C O   1 
ATOM 8693  C CB  . ALA C 1 111 ? 81.879  58.367  88.695  1.00 48.37  ? 108 ALA C CB  1 
ATOM 8694  N N   . ALA C 1 112 ? 79.535  60.550  88.506  1.00 59.69  ? 109 ALA C N   1 
ATOM 8695  C CA  . ALA C 1 112 ? 78.163  60.998  88.702  1.00 55.74  ? 109 ALA C CA  1 
ATOM 8696  C C   . ALA C 1 112 ? 77.504  61.331  87.363  1.00 55.92  ? 109 ALA C C   1 
ATOM 8697  O O   . ALA C 1 112 ? 76.378  60.909  87.088  1.00 56.75  ? 109 ALA C O   1 
ATOM 8698  C CB  . ALA C 1 112 ? 78.129  62.205  89.623  1.00 47.08  ? 109 ALA C CB  1 
ATOM 8699  N N   . LEU C 1 113 ? 78.222  62.080  86.535  1.00 50.96  ? 110 LEU C N   1 
ATOM 8700  C CA  . LEU C 1 113 ? 77.726  62.514  85.236  1.00 46.98  ? 110 LEU C CA  1 
ATOM 8701  C C   . LEU C 1 113 ? 77.442  61.361  84.291  1.00 53.45  ? 110 LEU C C   1 
ATOM 8702  O O   . LEU C 1 113 ? 76.521  61.423  83.472  1.00 61.81  ? 110 LEU C O   1 
ATOM 8703  C CB  . LEU C 1 113 ? 78.716  63.476  84.568  1.00 50.28  ? 110 LEU C CB  1 
ATOM 8704  C CG  . LEU C 1 113 ? 78.861  64.848  85.218  1.00 63.00  ? 110 LEU C CG  1 
ATOM 8705  C CD1 . LEU C 1 113 ? 79.883  65.674  84.472  1.00 58.37  ? 110 LEU C CD1 1 
ATOM 8706  C CD2 . LEU C 1 113 ? 77.521  65.565  85.262  1.00 48.55  ? 110 LEU C CD2 1 
ATOM 8707  N N   . ALA C 1 114 ? 78.227  60.302  84.402  1.00 51.34  ? 111 ALA C N   1 
ATOM 8708  C CA  . ALA C 1 114 ? 78.002  59.148  83.543  1.00 56.43  ? 111 ALA C CA  1 
ATOM 8709  C C   . ALA C 1 114 ? 76.808  58.307  84.010  1.00 68.61  ? 111 ALA C C   1 
ATOM 8710  O O   . ALA C 1 114 ? 76.273  57.510  83.239  1.00 70.65  ? 111 ALA C O   1 
ATOM 8711  C CB  . ALA C 1 114 ? 79.252  58.302  83.469  1.00 60.81  ? 111 ALA C CB  1 
ATOM 8712  N N   . ALA C 1 115 ? 76.399  58.478  85.269  1.00 53.85  ? 112 ALA C N   1 
ATOM 8713  C CA  . ALA C 1 115 ? 75.218  57.774  85.792  1.00 60.75  ? 112 ALA C CA  1 
ATOM 8714  C C   . ALA C 1 115 ? 73.905  58.553  85.615  1.00 62.56  ? 112 ALA C C   1 
ATOM 8715  O O   . ALA C 1 115 ? 72.821  58.002  85.788  1.00 66.75  ? 112 ALA C O   1 
ATOM 8716  C CB  . ALA C 1 115 ? 75.419  57.405  87.267  1.00 41.49  ? 112 ALA C CB  1 
ATOM 8717  N N   . ARG C 1 116 ? 74.014  59.831  85.266  1.00 62.03  ? 113 ARG C N   1 
ATOM 8718  C CA  . ARG C 1 116 ? 72.885  60.748  85.366  1.00 51.31  ? 113 ARG C CA  1 
ATOM 8719  C C   . ARG C 1 116 ? 71.733  60.450  84.413  1.00 63.84  ? 113 ARG C C   1 
ATOM 8720  O O   . ARG C 1 116 ? 70.583  60.391  84.854  1.00 68.87  ? 113 ARG C O   1 
ATOM 8721  C CB  . ARG C 1 116 ? 73.347  62.206  85.203  1.00 51.56  ? 113 ARG C CB  1 
ATOM 8722  C CG  . ARG C 1 116 ? 72.290  63.234  85.558  1.00 46.07  ? 113 ARG C CG  1 
ATOM 8723  C CD  . ARG C 1 116 ? 72.687  64.631  85.125  1.00 59.75  ? 113 ARG C CD  1 
ATOM 8724  N NE  . ARG C 1 116 ? 72.839  64.705  83.675  1.00 60.28  ? 113 ARG C NE  1 
ATOM 8725  C CZ  . ARG C 1 116 ? 71.827  64.795  82.816  1.00 65.10  ? 113 ARG C CZ  1 
ATOM 8726  N NH1 . ARG C 1 116 ? 70.572  64.832  83.243  1.00 57.71  ? 113 ARG C NH1 1 
ATOM 8727  N NH2 . ARG C 1 116 ? 72.066  64.851  81.521  1.00 54.42  ? 113 ARG C NH2 1 
ATOM 8728  N N   . LYS C 1 117 ? 72.025  60.276  83.120  1.00 58.10  ? 114 LYS C N   1 
ATOM 8729  C CA  . LYS C 1 117 ? 70.953  60.136  82.127  1.00 54.92  ? 114 LYS C CA  1 
ATOM 8730  C C   . LYS C 1 117 ? 69.994  58.988  82.451  1.00 58.73  ? 114 LYS C C   1 
ATOM 8731  O O   . LYS C 1 117 ? 68.783  59.168  82.352  1.00 61.29  ? 114 LYS C O   1 
ATOM 8732  C CB  . LYS C 1 117 ? 71.488  60.031  80.689  1.00 50.17  ? 114 LYS C CB  1 
ATOM 8733  N N   . GLU C 1 118 ? 70.527  57.826  82.851  1.00 49.68  ? 115 GLU C N   1 
ATOM 8734  C CA  . GLU C 1 118 ? 69.685  56.666  83.177  1.00 54.23  ? 115 GLU C CA  1 
ATOM 8735  C C   . GLU C 1 118 ? 68.870  56.922  84.440  1.00 63.51  ? 115 GLU C C   1 
ATOM 8736  O O   . GLU C 1 118 ? 67.721  56.494  84.552  1.00 62.58  ? 115 GLU C O   1 
ATOM 8737  C CB  . GLU C 1 118 ? 70.516  55.382  83.348  1.00 52.75  ? 115 GLU C CB  1 
ATOM 8738  N N   . TRP C 1 119 ? 69.480  57.621  85.393  1.00 54.19  ? 116 TRP C N   1 
ATOM 8739  C CA  . TRP C 1 119 ? 68.813  57.990  86.631  1.00 47.08  ? 116 TRP C CA  1 
ATOM 8740  C C   . TRP C 1 119 ? 67.722  59.022  86.374  1.00 46.02  ? 116 TRP C C   1 
ATOM 8741  O O   . TRP C 1 119 ? 66.607  58.880  86.863  1.00 52.36  ? 116 TRP C O   1 
ATOM 8742  C CB  . TRP C 1 119 ? 69.828  58.514  87.646  1.00 47.49  ? 116 TRP C CB  1 
ATOM 8743  C CG  . TRP C 1 119 ? 69.243  59.057  88.924  1.00 56.58  ? 116 TRP C CG  1 
ATOM 8744  C CD1 . TRP C 1 119 ? 69.251  60.356  89.327  1.00 46.38  ? 116 TRP C CD1 1 
ATOM 8745  C CD2 . TRP C 1 119 ? 68.579  58.318  89.972  1.00 53.80  ? 116 TRP C CD2 1 
ATOM 8746  N NE1 . TRP C 1 119 ? 68.636  60.481  90.557  1.00 54.20  ? 116 TRP C NE1 1 
ATOM 8747  C CE2 . TRP C 1 119 ? 68.216  59.249  90.976  1.00 46.96  ? 116 TRP C CE2 1 
ATOM 8748  C CE3 . TRP C 1 119 ? 68.257  56.966  90.161  1.00 58.49  ? 116 TRP C CE3 1 
ATOM 8749  C CZ2 . TRP C 1 119 ? 67.550  58.871  92.150  1.00 55.91  ? 116 TRP C CZ2 1 
ATOM 8750  C CZ3 . TRP C 1 119 ? 67.586  56.589  91.337  1.00 43.27  ? 116 TRP C CZ3 1 
ATOM 8751  C CH2 . TRP C 1 119 ? 67.238  57.543  92.308  1.00 51.99  ? 116 TRP C CH2 1 
ATOM 8752  N N   . ASP C 1 120 ? 68.038  60.049  85.593  1.00 37.21  ? 117 ASP C N   1 
ATOM 8753  C CA  . ASP C 1 120 ? 67.030  61.037  85.197  1.00 40.84  ? 117 ASP C CA  1 
ATOM 8754  C C   . ASP C 1 120 ? 65.864  60.386  84.453  1.00 41.87  ? 117 ASP C C   1 
ATOM 8755  O O   . ASP C 1 120 ? 64.711  60.792  84.610  1.00 65.07  ? 117 ASP C O   1 
ATOM 8756  C CB  . ASP C 1 120 ? 67.668  62.171  84.380  1.00 37.46  ? 117 ASP C CB  1 
ATOM 8757  C CG  . ASP C 1 120 ? 66.645  63.182  83.861  1.00 64.24  ? 117 ASP C CG  1 
ATOM 8758  O OD1 . ASP C 1 120 ? 65.627  63.423  84.560  1.00 72.77  ? 117 ASP C OD1 1 
ATOM 8759  O OD2 . ASP C 1 120 ? 66.872  63.731  82.752  1.00 53.31  ? 117 ASP C OD2 1 
ATOM 8760  N N   . LEU C 1 121 ? 66.166  59.360  83.663  1.00 59.08  ? 118 LEU C N   1 
ATOM 8761  C CA  . LEU C 1 121 ? 65.149  58.650  82.871  1.00 63.08  ? 118 LEU C CA  1 
ATOM 8762  C C   . LEU C 1 121 ? 64.305  57.654  83.667  1.00 54.54  ? 118 LEU C C   1 
ATOM 8763  O O   . LEU C 1 121 ? 63.193  57.336  83.267  1.00 58.82  ? 118 LEU C O   1 
ATOM 8764  C CB  . LEU C 1 121 ? 65.790  57.948  81.668  1.00 50.25  ? 118 LEU C CB  1 
ATOM 8765  C CG  . LEU C 1 121 ? 66.037  58.842  80.452  1.00 59.62  ? 118 LEU C CG  1 
ATOM 8766  C CD1 . LEU C 1 121 ? 67.009  58.184  79.520  1.00 44.24  ? 118 LEU C CD1 1 
ATOM 8767  C CD2 . LEU C 1 121 ? 64.747  59.128  79.727  1.00 50.64  ? 118 LEU C CD2 1 
ATOM 8768  N N   . LYS C 1 122 ? 64.832  57.151  84.780  1.00 54.38  ? 119 LYS C N   1 
ATOM 8769  C CA  . LYS C 1 122 ? 64.031  56.304  85.660  1.00 53.09  ? 119 LYS C CA  1 
ATOM 8770  C C   . LYS C 1 122 ? 62.816  57.104  86.153  1.00 53.21  ? 119 LYS C C   1 
ATOM 8771  O O   . LYS C 1 122 ? 62.965  58.226  86.607  1.00 71.44  ? 119 LYS C O   1 
ATOM 8772  C CB  . LYS C 1 122 ? 64.869  55.788  86.825  1.00 34.16  ? 119 LYS C CB  1 
ATOM 8773  N N   . PRO C 1 123 ? 61.607  56.525  86.048  1.00 64.79  ? 120 PRO C N   1 
ATOM 8774  C CA  . PRO C 1 123 ? 60.357  57.209  86.412  1.00 43.04  ? 120 PRO C CA  1 
ATOM 8775  C C   . PRO C 1 123 ? 60.378  57.685  87.854  1.00 58.73  ? 120 PRO C C   1 
ATOM 8776  O O   . PRO C 1 123 ? 61.032  57.052  88.677  1.00 78.40  ? 120 PRO C O   1 
ATOM 8777  C CB  . PRO C 1 123 ? 59.291  56.110  86.254  1.00 48.71  ? 120 PRO C CB  1 
ATOM 8778  C CG  . PRO C 1 123 ? 59.898  55.114  85.357  1.00 51.11  ? 120 PRO C CG  1 
ATOM 8779  C CD  . PRO C 1 123 ? 61.367  55.125  85.660  1.00 50.27  ? 120 PRO C CD  1 
ATOM 8780  N N   . ILE C 1 124 ? 59.656  58.761  88.154  1.00 52.82  ? 121 ILE C N   1 
ATOM 8781  C CA  . ILE C 1 124 ? 59.703  59.379  89.482  1.00 55.26  ? 121 ILE C CA  1 
ATOM 8782  C C   . ILE C 1 124 ? 59.194  58.424  90.563  1.00 49.72  ? 121 ILE C C   1 
ATOM 8783  O O   . ILE C 1 124 ? 59.648  58.471  91.710  1.00 67.96  ? 121 ILE C O   1 
ATOM 8784  C CB  . ILE C 1 124 ? 58.924  60.717  89.527  1.00 41.19  ? 121 ILE C CB  1 
ATOM 8785  C CG1 . ILE C 1 124 ? 59.000  61.363  90.911  1.00 47.70  ? 121 ILE C CG1 1 
ATOM 8786  C CG2 . ILE C 1 124 ? 57.472  60.484  89.166  1.00 53.21  ? 121 ILE C CG2 1 
ATOM 8787  C CD1 . ILE C 1 124 ? 60.380  61.759  91.344  1.00 45.20  ? 121 ILE C CD1 1 
ATOM 8788  N N   . ALA C 1 125 ? 58.283  57.534  90.196  1.00 59.14  ? 122 ALA C N   1 
ATOM 8789  C CA  . ALA C 1 125 ? 57.755  56.582  91.171  1.00 59.66  ? 122 ALA C CA  1 
ATOM 8790  C C   . ALA C 1 125 ? 58.831  55.599  91.641  1.00 51.38  ? 122 ALA C C   1 
ATOM 8791  O O   . ALA C 1 125 ? 58.817  55.167  92.783  1.00 62.85  ? 122 ALA C O   1 
ATOM 8792  C CB  . ALA C 1 125 ? 56.580  55.845  90.600  1.00 50.88  ? 122 ALA C CB  1 
ATOM 8793  N N   . ASP C 1 126 ? 59.760  55.249  90.753  1.00 63.02  ? 123 ASP C N   1 
ATOM 8794  C CA  . ASP C 1 126 ? 60.821  54.308  91.093  1.00 51.19  ? 123 ASP C CA  1 
ATOM 8795  C C   . ASP C 1 126 ? 61.831  54.993  92.008  1.00 66.47  ? 123 ASP C C   1 
ATOM 8796  O O   . ASP C 1 126 ? 62.336  54.387  92.956  1.00 68.12  ? 123 ASP C O   1 
ATOM 8797  C CB  . ASP C 1 126 ? 61.520  53.750  89.834  1.00 61.89  ? 123 ASP C CB  1 
ATOM 8798  C CG  . ASP C 1 126 ? 60.622  52.839  89.001  1.00 78.84  ? 123 ASP C CG  1 
ATOM 8799  O OD1 . ASP C 1 126 ? 59.560  52.416  89.498  1.00 59.54  ? 123 ASP C OD1 1 
ATOM 8800  O OD2 . ASP C 1 126 ? 60.985  52.544  87.844  1.00 78.78  ? 123 ASP C OD2 1 
ATOM 8801  N N   . ARG C 1 127 ? 62.124  56.259  91.716  1.00 54.92  ? 124 ARG C N   1 
ATOM 8802  C CA  . ARG C 1 127 ? 63.026  57.044  92.547  1.00 51.52  ? 124 ARG C CA  1 
ATOM 8803  C C   . ARG C 1 127 ? 62.381  57.328  93.902  1.00 54.58  ? 124 ARG C C   1 
ATOM 8804  O O   . ARG C 1 127 ? 63.002  57.152  94.927  1.00 51.99  ? 124 ARG C O   1 
ATOM 8805  C CB  . ARG C 1 127 ? 63.423  58.347  91.854  1.00 49.73  ? 124 ARG C CB  1 
ATOM 8806  C CG  . ARG C 1 127 ? 64.066  58.156  90.499  1.00 49.20  ? 124 ARG C CG  1 
ATOM 8807  C CD  . ARG C 1 127 ? 64.815  59.396  90.083  1.00 31.86  ? 124 ARG C CD  1 
ATOM 8808  N NE  . ARG C 1 127 ? 63.969  60.566  89.899  1.00 57.82  ? 124 ARG C NE  1 
ATOM 8809  C CZ  . ARG C 1 127 ? 63.656  61.075  88.706  1.00 69.15  ? 124 ARG C CZ  1 
ATOM 8810  N NH1 . ARG C 1 127 ? 64.125  60.511  87.608  1.00 54.72  ? 124 ARG C NH1 1 
ATOM 8811  N NH2 . ARG C 1 127 ? 62.879  62.148  88.601  1.00 65.92  ? 124 ARG C NH2 1 
ATOM 8812  N N   . ALA C 1 128 ? 61.129  57.758  93.904  1.00 43.93  ? 125 ALA C N   1 
ATOM 8813  C CA  . ALA C 1 128 ? 60.419  57.938  95.155  1.00 54.65  ? 125 ALA C CA  1 
ATOM 8814  C C   . ALA C 1 128 ? 60.478  56.700  96.050  1.00 49.34  ? 125 ALA C C   1 
ATOM 8815  O O   . ALA C 1 128 ? 60.626  56.817  97.262  1.00 73.38  ? 125 ALA C O   1 
ATOM 8816  C CB  . ALA C 1 128 ? 58.986  58.316  94.879  1.00 32.01  ? 125 ALA C CB  1 
ATOM 8817  N N   . GLN C 1 129 ? 60.357  55.521  95.449  1.00 48.80  ? 126 GLN C N   1 
ATOM 8818  C CA  . GLN C 1 129 ? 60.285  54.262  96.202  1.00 61.88  ? 126 GLN C CA  1 
ATOM 8819  C C   . GLN C 1 129 ? 61.524  54.039  97.090  1.00 52.42  ? 126 GLN C C   1 
ATOM 8820  O O   . GLN C 1 129 ? 61.424  53.521  98.191  1.00 52.73  ? 126 GLN C O   1 
ATOM 8821  C CB  . GLN C 1 129 ? 60.062  53.078  95.248  1.00 46.34  ? 126 GLN C CB  1 
ATOM 8822  C CG  . GLN C 1 129 ? 59.255  51.950  95.814  1.00 73.10  ? 126 GLN C CG  1 
ATOM 8823  C CD  . GLN C 1 129 ? 58.009  52.452  96.482  1.00 104.27 ? 126 GLN C CD  1 
ATOM 8824  O OE1 . GLN C 1 129 ? 57.254  53.210  95.885  1.00 113.24 ? 126 GLN C OE1 1 
ATOM 8825  N NE2 . GLN C 1 129 ? 57.795  52.061  97.735  1.00 99.27  ? 126 GLN C NE2 1 
ATOM 8826  N N   . ILE C 1 130 ? 62.684  54.448  96.594  1.00 36.96  ? 127 ILE C N   1 
ATOM 8827  C CA  . ILE C 1 130 ? 63.936  54.381  97.329  1.00 38.01  ? 127 ILE C CA  1 
ATOM 8828  C C   . ILE C 1 130 ? 63.888  55.193  98.628  1.00 57.46  ? 127 ILE C C   1 
ATOM 8829  O O   . ILE C 1 130 ? 64.218  54.686  99.699  1.00 57.76  ? 127 ILE C O   1 
ATOM 8830  C CB  . ILE C 1 130 ? 65.095  54.857  96.414  1.00 39.09  ? 127 ILE C CB  1 
ATOM 8831  C CG1 . ILE C 1 130 ? 65.141  53.977  95.158  1.00 41.78  ? 127 ILE C CG1 1 
ATOM 8832  C CG2 . ILE C 1 130 ? 66.442  54.879  97.152  1.00 25.71  ? 127 ILE C CG2 1 
ATOM 8833  C CD1 . ILE C 1 130 ? 66.296  54.275  94.255  1.00 48.93  ? 127 ILE C CD1 1 
ATOM 8834  N N   . PHE C 1 131 ? 63.465  56.448  98.522  1.00 41.88  ? 128 PHE C N   1 
ATOM 8835  C CA  . PHE C 1 131 ? 63.303  57.323  99.684  1.00 57.36  ? 128 PHE C CA  1 
ATOM 8836  C C   . PHE C 1 131 ? 62.165  56.918  100.629 1.00 61.25  ? 128 PHE C C   1 
ATOM 8837  O O   . PHE C 1 131 ? 62.250  57.145  101.825 1.00 68.59  ? 128 PHE C O   1 
ATOM 8838  C CB  . PHE C 1 131 ? 63.170  58.789  99.236  1.00 37.99  ? 128 PHE C CB  1 
ATOM 8839  C CG  . PHE C 1 131 ? 64.367  59.276  98.475  1.00 50.15  ? 128 PHE C CG  1 
ATOM 8840  C CD1 . PHE C 1 131 ? 64.504  59.022  97.113  1.00 43.59  ? 128 PHE C CD1 1 
ATOM 8841  C CD2 . PHE C 1 131 ? 65.394  59.920  99.132  1.00 47.47  ? 128 PHE C CD2 1 
ATOM 8842  C CE1 . PHE C 1 131 ? 65.618  59.438  96.407  1.00 41.68  ? 128 PHE C CE1 1 
ATOM 8843  C CE2 . PHE C 1 131 ? 66.526  60.350  98.430  1.00 39.60  ? 128 PHE C CE2 1 
ATOM 8844  C CZ  . PHE C 1 131 ? 66.636  60.105  97.072  1.00 57.95  ? 128 PHE C CZ  1 
ATOM 8845  N N   . LEU C 1 132 ? 61.105  56.319  100.107 1.00 50.65  ? 129 LEU C N   1 
ATOM 8846  C CA  . LEU C 1 132 ? 60.070  55.787  100.982 1.00 58.33  ? 129 LEU C CA  1 
ATOM 8847  C C   . LEU C 1 132 ? 60.600  54.607  101.819 1.00 56.52  ? 129 LEU C C   1 
ATOM 8848  O O   . LEU C 1 132 ? 60.253  54.468  102.990 1.00 68.56  ? 129 LEU C O   1 
ATOM 8849  C CB  . LEU C 1 132 ? 58.842  55.379  100.168 1.00 43.05  ? 129 LEU C CB  1 
ATOM 8850  C CG  . LEU C 1 132 ? 58.120  56.575  99.558  1.00 59.57  ? 129 LEU C CG  1 
ATOM 8851  C CD1 . LEU C 1 132 ? 56.966  56.128  98.650  1.00 51.50  ? 129 LEU C CD1 1 
ATOM 8852  C CD2 . LEU C 1 132 ? 57.625  57.493  100.672 1.00 42.92  ? 129 LEU C CD2 1 
ATOM 8853  N N   . LYS C 1 133 ? 61.438  53.772  101.208 1.00 47.10  ? 130 LYS C N   1 
ATOM 8854  C CA  . LYS C 1 133 ? 62.002  52.609  101.862 1.00 55.69  ? 130 LYS C CA  1 
ATOM 8855  C C   . LYS C 1 133 ? 63.021  53.079  102.895 1.00 65.26  ? 130 LYS C C   1 
ATOM 8856  O O   . LYS C 1 133 ? 63.066  52.562  104.012 1.00 67.07  ? 130 LYS C O   1 
ATOM 8857  C CB  . LYS C 1 133 ? 62.630  51.660  100.830 1.00 36.50  ? 130 LYS C CB  1 
ATOM 8858  C CG  . LYS C 1 133 ? 63.654  50.709  101.406 1.00 48.03  ? 130 LYS C CG  1 
ATOM 8859  C CD  . LYS C 1 133 ? 63.062  49.342  101.640 1.00 33.80  ? 130 LYS C CD  1 
ATOM 8860  C CE  . LYS C 1 133 ? 64.113  48.362  102.147 1.00 49.21  ? 130 LYS C CE  1 
ATOM 8861  N NZ  . LYS C 1 133 ? 63.967  47.056  101.441 1.00 63.17  ? 130 LYS C NZ  1 
ATOM 8862  N N   . ALA C 1 134 ? 63.823  54.075  102.532 1.00 46.50  ? 131 ALA C N   1 
ATOM 8863  C CA  . ALA C 1 134 ? 64.779  54.642  103.476 1.00 55.02  ? 131 ALA C CA  1 
ATOM 8864  C C   . ALA C 1 134 ? 64.071  55.254  104.677 1.00 63.68  ? 131 ALA C C   1 
ATOM 8865  O O   . ALA C 1 134 ? 64.543  55.131  105.807 1.00 57.96  ? 131 ALA C O   1 
ATOM 8866  C CB  . ALA C 1 134 ? 65.684  55.671  102.805 1.00 44.77  ? 131 ALA C CB  1 
ATOM 8867  N N   . ALA C 1 135 ? 62.940  55.909  104.431 1.00 51.10  ? 132 ALA C N   1 
ATOM 8868  C CA  . ALA C 1 135 ? 62.141  56.482  105.514 1.00 61.64  ? 132 ALA C CA  1 
ATOM 8869  C C   . ALA C 1 135 ? 61.616  55.412  106.463 1.00 55.33  ? 132 ALA C C   1 
ATOM 8870  O O   . ALA C 1 135 ? 61.548  55.622  107.672 1.00 64.24  ? 132 ALA C O   1 
ATOM 8871  C CB  . ALA C 1 135 ? 60.986  57.271  104.958 1.00 48.89  ? 132 ALA C CB  1 
ATOM 8872  N N   . ASP C 1 136 ? 61.226  54.275  105.904 1.00 51.20  ? 133 ASP C N   1 
ATOM 8873  C CA  . ASP C 1 136 ? 60.725  53.168  106.700 1.00 58.49  ? 133 ASP C CA  1 
ATOM 8874  C C   . ASP C 1 136 ? 61.825  52.479  107.505 1.00 57.38  ? 133 ASP C C   1 
ATOM 8875  O O   . ASP C 1 136 ? 61.582  52.038  108.629 1.00 67.00  ? 133 ASP C O   1 
ATOM 8876  C CB  . ASP C 1 136 ? 60.002  52.150  105.820 1.00 42.01  ? 133 ASP C CB  1 
ATOM 8877  C CG  . ASP C 1 136 ? 58.619  52.610  105.405 1.00 74.02  ? 133 ASP C CG  1 
ATOM 8878  O OD1 . ASP C 1 136 ? 58.130  53.646  105.927 1.00 72.34  ? 133 ASP C OD1 1 
ATOM 8879  O OD2 . ASP C 1 136 ? 58.022  51.907  104.557 1.00 54.07  ? 133 ASP C OD2 1 
ATOM 8880  N N   . MET C 1 137 ? 63.023  52.385  106.930 1.00 65.04  ? 134 MET C N   1 
ATOM 8881  C CA  . MET C 1 137 ? 64.200  51.907  107.657 1.00 38.01  ? 134 MET C CA  1 
ATOM 8882  C C   . MET C 1 137 ? 64.509  52.812  108.854 1.00 53.76  ? 134 MET C C   1 
ATOM 8883  O O   . MET C 1 137 ? 64.668  52.339  109.984 1.00 58.47  ? 134 MET C O   1 
ATOM 8884  C CB  . MET C 1 137 ? 65.407  51.778  106.722 1.00 49.87  ? 134 MET C CB  1 
ATOM 8885  C CG  . MET C 1 137 ? 65.281  50.647  105.691 1.00 45.21  ? 134 MET C CG  1 
ATOM 8886  S SD  . MET C 1 137 ? 66.501  50.704  104.389 1.00 39.93  ? 134 MET C SD  1 
ATOM 8887  C CE  . MET C 1 137 ? 67.985  50.321  105.262 1.00 58.07  ? 134 MET C CE  1 
ATOM 8888  N N   . LEU C 1 138 ? 64.559  54.116  108.613 1.00 66.96  ? 135 LEU C N   1 
ATOM 8889  C CA  . LEU C 1 138 ? 64.786  55.091  109.684 1.00 55.78  ? 135 LEU C CA  1 
ATOM 8890  C C   . LEU C 1 138 ? 63.708  55.068  110.745 1.00 59.78  ? 135 LEU C C   1 
ATOM 8891  O O   . LEU C 1 138 ? 63.985  55.262  111.926 1.00 65.65  ? 135 LEU C O   1 
ATOM 8892  C CB  . LEU C 1 138 ? 64.890  56.512  109.128 1.00 53.69  ? 135 LEU C CB  1 
ATOM 8893  C CG  . LEU C 1 138 ? 66.145  56.806  108.317 1.00 52.66  ? 135 LEU C CG  1 
ATOM 8894  C CD1 . LEU C 1 138 ? 65.990  58.092  107.518 1.00 55.92  ? 135 LEU C CD1 1 
ATOM 8895  C CD2 . LEU C 1 138 ? 67.315  56.896  109.269 1.00 57.13  ? 135 LEU C CD2 1 
ATOM 8896  N N   . SER C 1 139 ? 62.473  54.846  110.326 1.00 49.21  ? 136 SER C N   1 
ATOM 8897  C CA  . SER C 1 139 ? 61.340  54.843  111.249 1.00 57.05  ? 136 SER C CA  1 
ATOM 8898  C C   . SER C 1 139 ? 61.370  53.702  112.276 1.00 59.54  ? 136 SER C C   1 
ATOM 8899  O O   . SER C 1 139 ? 61.001  53.894  113.439 1.00 68.68  ? 136 SER C O   1 
ATOM 8900  C CB  . SER C 1 139 ? 60.032  54.780  110.465 1.00 53.94  ? 136 SER C CB  1 
ATOM 8901  O OG  . SER C 1 139 ? 58.936  54.808  111.346 1.00 59.82  ? 136 SER C OG  1 
ATOM 8902  N N   . GLY C 1 140 ? 61.792  52.520  111.838 1.00 51.33  ? 137 GLY C N   1 
ATOM 8903  C CA  . GLY C 1 140 ? 61.770  51.328  112.674 1.00 44.13  ? 137 GLY C CA  1 
ATOM 8904  C C   . GLY C 1 140 ? 63.149  50.895  113.109 1.00 46.78  ? 137 GLY C C   1 
ATOM 8905  O O   . GLY C 1 140 ? 63.702  51.496  114.016 1.00 54.47  ? 137 GLY C O   1 
ATOM 8906  N N   . PRO C 1 141 ? 63.725  49.901  112.404 1.00 55.70  ? 138 PRO C N   1 
ATOM 8907  C CA  . PRO C 1 141 ? 64.990  49.184  112.653 1.00 54.97  ? 138 PRO C CA  1 
ATOM 8908  C C   . PRO C 1 141 ? 66.218  50.075  112.891 1.00 63.83  ? 138 PRO C C   1 
ATOM 8909  O O   . PRO C 1 141 ? 67.059  49.732  113.712 1.00 70.66  ? 138 PRO C O   1 
ATOM 8910  C CB  . PRO C 1 141 ? 65.206  48.392  111.362 1.00 53.35  ? 138 PRO C CB  1 
ATOM 8911  C CG  . PRO C 1 141 ? 63.910  48.372  110.673 1.00 50.48  ? 138 PRO C CG  1 
ATOM 8912  C CD  . PRO C 1 141 ? 63.141  49.553  111.097 1.00 48.58  ? 138 PRO C CD  1 
ATOM 8913  N N   . ARG C 1 142 ? 66.317  51.190  112.178 1.00 58.22  ? 139 ARG C N   1 
ATOM 8914  C CA  . ARG C 1 142 ? 67.510  52.010  112.236 1.00 49.64  ? 139 ARG C CA  1 
ATOM 8915  C C   . ARG C 1 142 ? 67.325  53.238  113.085 1.00 49.97  ? 139 ARG C C   1 
ATOM 8916  O O   . ARG C 1 142 ? 68.263  54.014  113.264 1.00 57.23  ? 139 ARG C O   1 
ATOM 8917  C CB  . ARG C 1 142 ? 67.921  52.422  110.834 1.00 62.31  ? 139 ARG C CB  1 
ATOM 8918  C CG  . ARG C 1 142 ? 68.121  51.238  109.955 1.00 61.72  ? 139 ARG C CG  1 
ATOM 8919  C CD  . ARG C 1 142 ? 69.403  50.594  110.401 1.00 54.97  ? 139 ARG C CD  1 
ATOM 8920  N NE  . ARG C 1 142 ? 69.968  50.025  109.239 1.00 59.18  ? 139 ARG C NE  1 
ATOM 8921  C CZ  . ARG C 1 142 ? 70.983  50.298  108.447 1.00 66.00  ? 139 ARG C CZ  1 
ATOM 8922  N NH1 . ARG C 1 142 ? 72.019  51.101  108.661 1.00 65.95  ? 139 ARG C NH1 1 
ATOM 8923  N NH2 . ARG C 1 142 ? 70.956  49.513  107.413 1.00 79.25  ? 139 ARG C NH2 1 
ATOM 8924  N N   . ARG C 1 143 ? 66.120  53.414  113.615 1.00 40.24  ? 140 ARG C N   1 
ATOM 8925  C CA  . ARG C 1 143 ? 65.836  54.604  114.414 1.00 56.09  ? 140 ARG C CA  1 
ATOM 8926  C C   . ARG C 1 143 ? 66.809  54.768  115.570 1.00 57.06  ? 140 ARG C C   1 
ATOM 8927  O O   . ARG C 1 143 ? 67.499  55.779  115.667 1.00 75.36  ? 140 ARG C O   1 
ATOM 8928  C CB  . ARG C 1 143 ? 64.415  54.568  114.959 1.00 41.50  ? 140 ARG C CB  1 
ATOM 8929  C CG  . ARG C 1 143 ? 63.891  55.917  115.451 1.00 49.21  ? 140 ARG C CG  1 
ATOM 8930  C CD  . ARG C 1 143 ? 62.478  55.700  115.910 1.00 67.42  ? 140 ARG C CD  1 
ATOM 8931  N NE  . ARG C 1 143 ? 61.756  56.931  116.082 1.00 78.84  ? 140 ARG C NE  1 
ATOM 8932  C CZ  . ARG C 1 143 ? 60.823  57.427  115.281 1.00 55.33  ? 140 ARG C CZ  1 
ATOM 8933  N NH1 . ARG C 1 143 ? 60.290  58.584  115.613 1.00 60.50  ? 140 ARG C NH1 1 
ATOM 8934  N NH2 . ARG C 1 143 ? 60.420  56.801  114.186 1.00 74.46  ? 140 ARG C NH2 1 
ATOM 8935  N N   . ALA C 1 144 ? 66.856  53.779  116.453 1.00 53.22  ? 141 ALA C N   1 
ATOM 8936  C CA  . ALA C 1 144 ? 67.719  53.881  117.616 1.00 77.43  ? 141 ALA C CA  1 
ATOM 8937  C C   . ALA C 1 144 ? 69.171  54.154  117.212 1.00 67.11  ? 141 ALA C C   1 
ATOM 8938  O O   . ALA C 1 144 ? 69.834  55.005  117.814 1.00 61.66  ? 141 ALA C O   1 
ATOM 8939  C CB  . ALA C 1 144 ? 67.599  52.644  118.508 1.00 41.90  ? 141 ALA C CB  1 
ATOM 8940  N N   . GLU C 1 145 ? 69.655  53.458  116.185 1.00 51.90  ? 142 GLU C N   1 
ATOM 8941  C CA  . GLU C 1 145 ? 71.015  53.686  115.693 1.00 55.71  ? 142 GLU C CA  1 
ATOM 8942  C C   . GLU C 1 145 ? 71.264  55.132  115.261 1.00 74.76  ? 142 GLU C C   1 
ATOM 8943  O O   . GLU C 1 145 ? 72.252  55.744  115.657 1.00 68.64  ? 142 GLU C O   1 
ATOM 8944  C CB  . GLU C 1 145 ? 71.344  52.768  114.527 1.00 50.11  ? 142 GLU C CB  1 
ATOM 8945  C CG  . GLU C 1 145 ? 72.506  53.290  113.695 1.00 59.83  ? 142 GLU C CG  1 
ATOM 8946  C CD  . GLU C 1 145 ? 72.668  52.566  112.373 1.00 71.47  ? 142 GLU C CD  1 
ATOM 8947  O OE1 . GLU C 1 145 ? 71.896  51.625  112.100 1.00 75.86  ? 142 GLU C OE1 1 
ATOM 8948  O OE2 . GLU C 1 145 ? 73.573  52.944  111.605 1.00 63.82  ? 142 GLU C OE2 1 
ATOM 8949  N N   . ILE C 1 146 ? 70.371  55.676  114.442 1.00 52.52  ? 143 ILE C N   1 
ATOM 8950  C CA  . ILE C 1 146 ? 70.521  57.048  113.962 1.00 49.56  ? 143 ILE C CA  1 
ATOM 8951  C C   . ILE C 1 146 ? 70.335  58.105  115.085 1.00 71.32  ? 143 ILE C C   1 
ATOM 8952  O O   . ILE C 1 146 ? 71.041  59.109  115.122 1.00 49.25  ? 143 ILE C O   1 
ATOM 8953  C CB  . ILE C 1 146 ? 69.599  57.306  112.761 1.00 53.87  ? 143 ILE C CB  1 
ATOM 8954  C CG1 . ILE C 1 146 ? 70.353  58.044  111.664 1.00 52.30  ? 143 ILE C CG1 1 
ATOM 8955  C CG2 . ILE C 1 146 ? 68.329  58.042  113.182 1.00 46.31  ? 143 ILE C CG2 1 
ATOM 8956  C CD1 . ILE C 1 146 ? 70.495  59.472  111.927 1.00 64.27  ? 143 ILE C CD1 1 
ATOM 8957  N N   . LEU C 1 147 ? 69.408  57.867  116.011 1.00 52.30  ? 144 LEU C N   1 
ATOM 8958  C CA  . LEU C 1 147 ? 69.277  58.705  117.198 1.00 53.53  ? 144 LEU C CA  1 
ATOM 8959  C C   . LEU C 1 147 ? 70.569  58.713  118.004 1.00 71.21  ? 144 LEU C C   1 
ATOM 8960  O O   . LEU C 1 147 ? 71.076  59.772  118.385 1.00 67.33  ? 144 LEU C O   1 
ATOM 8961  C CB  . LEU C 1 147 ? 68.145  58.183  118.080 1.00 42.04  ? 144 LEU C CB  1 
ATOM 8962  C CG  . LEU C 1 147 ? 66.817  58.927  118.036 1.00 61.97  ? 144 LEU C CG  1 
ATOM 8963  C CD1 . LEU C 1 147 ? 66.582  59.598  116.687 1.00 58.18  ? 144 LEU C CD1 1 
ATOM 8964  C CD2 . LEU C 1 147 ? 65.712  57.944  118.351 1.00 49.80  ? 144 LEU C CD2 1 
ATOM 8965  N N   . ALA C 1 148 ? 71.095  57.519  118.257 1.00 62.73  ? 145 ALA C N   1 
ATOM 8966  C CA  . ALA C 1 148 ? 72.303  57.361  119.050 1.00 63.56  ? 145 ALA C CA  1 
ATOM 8967  C C   . ALA C 1 148 ? 73.527  58.062  118.441 1.00 62.40  ? 145 ALA C C   1 
ATOM 8968  O O   . ALA C 1 148 ? 74.280  58.712  119.167 1.00 67.53  ? 145 ALA C O   1 
ATOM 8969  C CB  . ALA C 1 148 ? 72.582  55.881  119.306 1.00 58.95  ? 145 ALA C CB  1 
ATOM 8970  N N   . LYS C 1 149 ? 73.718  57.949  117.122 1.00 61.18  ? 146 LYS C N   1 
ATOM 8971  C CA  . LYS C 1 149 ? 74.862  58.582  116.452 1.00 61.52  ? 146 LYS C CA  1 
ATOM 8972  C C   . LYS C 1 149 ? 74.762  60.104  116.425 1.00 62.68  ? 146 LYS C C   1 
ATOM 8973  O O   . LYS C 1 149 ? 75.775  60.813  116.378 1.00 66.99  ? 146 LYS C O   1 
ATOM 8974  C CB  . LYS C 1 149 ? 75.054  58.045  115.036 1.00 60.28  ? 146 LYS C CB  1 
ATOM 8975  C CG  . LYS C 1 149 ? 75.559  56.616  114.994 1.00 60.03  ? 146 LYS C CG  1 
ATOM 8976  C CD  . LYS C 1 149 ? 75.508  56.066  113.582 1.00 67.77  ? 146 LYS C CD  1 
ATOM 8977  C CE  . LYS C 1 149 ? 76.095  54.675  113.535 1.00 53.25  ? 146 LYS C CE  1 
ATOM 8978  N NZ  . LYS C 1 149 ? 76.100  54.168  112.146 1.00 66.17  ? 146 LYS C NZ  1 
ATOM 8979  N N   . THR C 1 150 ? 73.533  60.602  116.461 1.00 65.29  ? 147 THR C N   1 
ATOM 8980  C CA  . THR C 1 150 ? 73.284  62.039  116.488 1.00 56.38  ? 147 THR C CA  1 
ATOM 8981  C C   . THR C 1 150 ? 73.549  62.582  117.899 1.00 71.55  ? 147 THR C C   1 
ATOM 8982  O O   . THR C 1 150 ? 74.188  63.627  118.069 1.00 57.67  ? 147 THR C O   1 
ATOM 8983  C CB  . THR C 1 150 ? 71.841  62.341  116.047 1.00 63.16  ? 147 THR C CB  1 
ATOM 8984  O OG1 . THR C 1 150 ? 71.630  61.800  114.742 1.00 63.92  ? 147 THR C OG1 1 
ATOM 8985  C CG2 . THR C 1 150 ? 71.586  63.816  115.991 1.00 53.69  ? 147 THR C CG2 1 
ATOM 8986  N N   . MET C 1 151 ? 73.063  61.851  118.902 1.00 49.48  ? 148 MET C N   1 
ATOM 8987  C CA  . MET C 1 151 ? 73.334  62.158  120.315 1.00 64.40  ? 148 MET C CA  1 
ATOM 8988  C C   . MET C 1 151 ? 74.836  62.181  120.598 1.00 67.84  ? 148 MET C C   1 
ATOM 8989  O O   . MET C 1 151 ? 75.373  63.149  121.126 1.00 74.10  ? 148 MET C O   1 
ATOM 8990  C CB  . MET C 1 151 ? 72.637  61.141  121.258 1.00 49.82  ? 148 MET C CB  1 
ATOM 8991  C CG  . MET C 1 151 ? 71.115  61.124  121.113 1.00 62.76  ? 148 MET C CG  1 
ATOM 8992  S SD  . MET C 1 151 ? 70.232  60.097  122.303 1.00 41.40  ? 148 MET C SD  1 
ATOM 8993  C CE  . MET C 1 151 ? 70.883  60.781  123.801 1.00 42.96  ? 148 MET C CE  1 
ATOM 8994  N N   . VAL C 1 152 ? 75.518  61.106  120.231 1.00 64.77  ? 149 VAL C N   1 
ATOM 8995  C CA  . VAL C 1 152 ? 76.939  60.980  120.523 1.00 65.60  ? 149 VAL C CA  1 
ATOM 8996  C C   . VAL C 1 152 ? 77.859  61.885  119.691 1.00 58.81  ? 149 VAL C C   1 
ATOM 8997  O O   . VAL C 1 152 ? 78.824  62.434  120.218 1.00 80.19  ? 149 VAL C O   1 
ATOM 8998  C CB  . VAL C 1 152 ? 77.400  59.504  120.416 1.00 84.00  ? 149 VAL C CB  1 
ATOM 8999  C CG1 . VAL C 1 152 ? 78.917  59.419  120.304 1.00 72.08  ? 149 VAL C CG1 1 
ATOM 9000  C CG2 . VAL C 1 152 ? 76.888  58.690  121.618 1.00 51.94  ? 149 VAL C CG2 1 
ATOM 9001  N N   . GLY C 1 153 ? 77.569  62.048  118.407 1.00 63.64  ? 150 GLY C N   1 
ATOM 9002  C CA  . GLY C 1 153 ? 78.452  62.809  117.534 1.00 56.31  ? 150 GLY C CA  1 
ATOM 9003  C C   . GLY C 1 153 ? 78.209  64.304  117.482 1.00 62.26  ? 150 GLY C C   1 
ATOM 9004  O O   . GLY C 1 153 ? 79.124  65.074  117.197 1.00 68.07  ? 150 GLY C O   1 
ATOM 9005  N N   . GLN C 1 154 ? 76.976  64.715  117.758 1.00 59.57  ? 151 GLN C N   1 
ATOM 9006  C CA  . GLN C 1 154 ? 76.610  66.122  117.677 1.00 68.31  ? 151 GLN C CA  1 
ATOM 9007  C C   . GLN C 1 154 ? 76.215  66.733  119.025 1.00 57.82  ? 151 GLN C C   1 
ATOM 9008  O O   . GLN C 1 154 ? 76.151  67.953  119.174 1.00 79.23  ? 151 GLN C O   1 
ATOM 9009  C CB  . GLN C 1 154 ? 75.492  66.305  116.636 1.00 62.79  ? 151 GLN C CB  1 
ATOM 9010  C CG  . GLN C 1 154 ? 75.970  66.096  115.218 1.00 65.65  ? 151 GLN C CG  1 
ATOM 9011  C CD  . GLN C 1 154 ? 74.990  65.322  114.380 1.00 57.87  ? 151 GLN C CD  1 
ATOM 9012  O OE1 . GLN C 1 154 ? 75.081  64.095  114.265 1.00 65.38  ? 151 GLN C OE1 1 
ATOM 9013  N NE2 . GLN C 1 154 ? 74.041  66.036  113.782 1.00 56.20  ? 151 GLN C NE2 1 
ATOM 9014  N N   . GLY C 1 155 ? 75.936  65.883  120.003 1.00 62.27  ? 152 GLY C N   1 
ATOM 9015  C CA  . GLY C 1 155 ? 75.680  66.344  121.358 1.00 65.34  ? 152 GLY C CA  1 
ATOM 9016  C C   . GLY C 1 155 ? 74.228  66.696  121.611 1.00 71.48  ? 152 GLY C C   1 
ATOM 9017  O O   . GLY C 1 155 ? 73.912  67.573  122.419 1.00 68.70  ? 152 GLY C O   1 
ATOM 9018  N N   . LYS C 1 156 ? 73.339  66.012  120.903 1.00 66.22  ? 153 LYS C N   1 
ATOM 9019  C CA  . LYS C 1 156 ? 71.913  66.271  121.016 1.00 69.44  ? 153 LYS C CA  1 
ATOM 9020  C C   . LYS C 1 156 ? 71.323  65.407  122.118 1.00 75.45  ? 153 LYS C C   1 
ATOM 9021  O O   . LYS C 1 156 ? 71.779  64.288  122.333 1.00 66.68  ? 153 LYS C O   1 
ATOM 9022  C CB  . LYS C 1 156 ? 71.204  65.981  119.683 1.00 66.43  ? 153 LYS C CB  1 
ATOM 9023  C CG  . LYS C 1 156 ? 71.258  67.135  118.680 1.00 72.52  ? 153 LYS C CG  1 
ATOM 9024  C CD  . LYS C 1 156 ? 70.440  66.846  117.433 1.00 50.34  ? 153 LYS C CD  1 
ATOM 9025  C CE  . LYS C 1 156 ? 70.315  68.069  116.541 1.00 69.21  ? 153 LYS C CE  1 
ATOM 9026  N NZ  . LYS C 1 156 ? 68.903  68.563  116.470 1.00 83.01  ? 153 LYS C NZ  1 
ATOM 9027  N N   . THR C 1 157 ? 70.321  65.926  122.825 1.00 60.08  ? 154 THR C N   1 
ATOM 9028  C CA  . THR C 1 157 ? 69.598  65.113  123.801 1.00 44.89  ? 154 THR C CA  1 
ATOM 9029  C C   . THR C 1 157 ? 68.621  64.199  123.076 1.00 72.33  ? 154 THR C C   1 
ATOM 9030  O O   . THR C 1 157 ? 68.344  64.372  121.874 1.00 56.49  ? 154 THR C O   1 
ATOM 9031  C CB  . THR C 1 157 ? 68.814  65.967  124.830 1.00 54.81  ? 154 THR C CB  1 
ATOM 9032  O OG1 . THR C 1 157 ? 67.821  66.758  124.166 1.00 67.20  ? 154 THR C OG1 1 
ATOM 9033  C CG2 . THR C 1 157 ? 69.761  66.884  125.576 1.00 47.54  ? 154 THR C CG2 1 
ATOM 9034  N N   . VAL C 1 158 ? 68.097  63.228  123.815 1.00 58.51  ? 155 VAL C N   1 
ATOM 9035  C CA  . VAL C 1 158 ? 67.166  62.266  123.258 1.00 52.17  ? 155 VAL C CA  1 
ATOM 9036  C C   . VAL C 1 158 ? 66.100  62.942  122.370 1.00 72.15  ? 155 VAL C C   1 
ATOM 9037  O O   . VAL C 1 158 ? 65.936  62.584  121.206 1.00 58.78  ? 155 VAL C O   1 
ATOM 9038  C CB  . VAL C 1 158 ? 66.480  61.448  124.373 1.00 54.49  ? 155 VAL C CB  1 
ATOM 9039  C CG1 . VAL C 1 158 ? 65.350  60.615  123.816 1.00 55.26  ? 155 VAL C CG1 1 
ATOM 9040  C CG2 . VAL C 1 158 ? 67.485  60.561  125.073 1.00 69.18  ? 155 VAL C CG2 1 
ATOM 9041  N N   . ILE C 1 159 ? 65.381  63.917  122.918 1.00 42.58  ? 156 ILE C N   1 
ATOM 9042  C CA  . ILE C 1 159 ? 64.253  64.495  122.212 1.00 51.35  ? 156 ILE C CA  1 
ATOM 9043  C C   . ILE C 1 159 ? 64.661  65.355  121.005 1.00 65.91  ? 156 ILE C C   1 
ATOM 9044  O O   . ILE C 1 159 ? 63.928  65.418  120.020 1.00 67.56  ? 156 ILE C O   1 
ATOM 9045  C CB  . ILE C 1 159 ? 63.310  65.285  123.154 1.00 64.38  ? 156 ILE C CB  1 
ATOM 9046  C CG1 . ILE C 1 159 ? 62.019  65.654  122.419 1.00 64.74  ? 156 ILE C CG1 1 
ATOM 9047  C CG2 . ILE C 1 159 ? 63.982  66.542  123.699 1.00 52.44  ? 156 ILE C CG2 1 
ATOM 9048  C CD1 . ILE C 1 159 ? 61.264  64.469  121.884 1.00 63.54  ? 156 ILE C CD1 1 
ATOM 9049  N N   . GLN C 1 160 ? 65.819  66.008  121.082 1.00 54.47  ? 157 GLN C N   1 
ATOM 9050  C CA  . GLN C 1 160 ? 66.351  66.759  119.936 1.00 62.01  ? 157 GLN C CA  1 
ATOM 9051  C C   . GLN C 1 160 ? 66.766  65.829  118.810 1.00 70.30  ? 157 GLN C C   1 
ATOM 9052  O O   . GLN C 1 160 ? 66.578  66.156  117.646 1.00 76.33  ? 157 GLN C O   1 
ATOM 9053  C CB  . GLN C 1 160 ? 67.552  67.647  120.324 1.00 49.50  ? 157 GLN C CB  1 
ATOM 9054  C CG  . GLN C 1 160 ? 67.184  68.883  121.128 1.00 66.39  ? 157 GLN C CG  1 
ATOM 9055  C CD  . GLN C 1 160 ? 66.006  69.629  120.530 1.00 68.21  ? 157 GLN C CD  1 
ATOM 9056  O OE1 . GLN C 1 160 ? 66.099  70.191  119.442 1.00 74.71  ? 157 GLN C OE1 1 
ATOM 9057  N NE2 . GLN C 1 160 ? 64.879  69.615  121.234 1.00 70.69  ? 157 GLN C NE2 1 
ATOM 9058  N N   . ALA C 1 161 ? 67.344  64.680  119.159 1.00 62.29  ? 158 ALA C N   1 
ATOM 9059  C CA  . ALA C 1 161 ? 67.778  63.729  118.152 1.00 58.80  ? 158 ALA C CA  1 
ATOM 9060  C C   . ALA C 1 161 ? 66.549  63.099  117.507 1.00 65.75  ? 158 ALA C C   1 
ATOM 9061  O O   . ALA C 1 161 ? 66.537  62.790  116.316 1.00 74.21  ? 158 ALA C O   1 
ATOM 9062  C CB  . ALA C 1 161 ? 68.686  62.660  118.765 1.00 37.95  ? 158 ALA C CB  1 
ATOM 9063  N N   . GLU C 1 162 ? 65.510  62.926  118.309 1.00 54.76  ? 159 GLU C N   1 
ATOM 9064  C CA  . GLU C 1 162 ? 64.273  62.309  117.860 1.00 55.43  ? 159 GLU C CA  1 
ATOM 9065  C C   . GLU C 1 162 ? 63.510  63.186  116.859 1.00 60.91  ? 159 GLU C C   1 
ATOM 9066  O O   . GLU C 1 162 ? 63.045  62.684  115.839 1.00 74.38  ? 159 GLU C O   1 
ATOM 9067  C CB  . GLU C 1 162 ? 63.401  61.939  119.067 1.00 47.19  ? 159 GLU C CB  1 
ATOM 9068  C CG  . GLU C 1 162 ? 61.917  61.728  118.767 1.00 75.21  ? 159 GLU C CG  1 
ATOM 9069  C CD  . GLU C 1 162 ? 61.595  60.401  118.073 1.00 84.97  ? 159 GLU C CD  1 
ATOM 9070  O OE1 . GLU C 1 162 ? 62.527  59.671  117.670 1.00 69.91  ? 159 GLU C OE1 1 
ATOM 9071  O OE2 . GLU C 1 162 ? 60.392  60.091  117.929 1.00 80.17  ? 159 GLU C OE2 1 
ATOM 9072  N N   . ILE C 1 163 ? 63.388  64.486  117.130 1.00 54.59  ? 160 ILE C N   1 
ATOM 9073  C CA  . ILE C 1 163 ? 62.636  65.366  116.230 1.00 69.16  ? 160 ILE C CA  1 
ATOM 9074  C C   . ILE C 1 163 ? 63.426  65.709  114.972 1.00 66.36  ? 160 ILE C C   1 
ATOM 9075  O O   . ILE C 1 163 ? 62.863  66.134  113.960 1.00 78.97  ? 160 ILE C O   1 
ATOM 9076  C CB  . ILE C 1 163 ? 62.201  66.674  116.913 1.00 56.42  ? 160 ILE C CB  1 
ATOM 9077  C CG1 . ILE C 1 163 ? 63.397  67.598  117.084 1.00 59.42  ? 160 ILE C CG1 1 
ATOM 9078  C CG2 . ILE C 1 163 ? 61.538  66.388  118.259 1.00 61.00  ? 160 ILE C CG2 1 
ATOM 9079  C CD1 . ILE C 1 163 ? 63.048  68.879  117.796 1.00 68.66  ? 160 ILE C CD1 1 
ATOM 9080  N N   . ASP C 1 164 ? 64.732  65.510  115.039 1.00 48.31  ? 161 ASP C N   1 
ATOM 9081  C CA  . ASP C 1 164 ? 65.608  65.786  113.915 1.00 52.75  ? 161 ASP C CA  1 
ATOM 9082  C C   . ASP C 1 164 ? 65.935  64.523  113.095 1.00 58.57  ? 161 ASP C C   1 
ATOM 9083  O O   . ASP C 1 164 ? 65.398  64.312  112.002 1.00 65.17  ? 161 ASP C O   1 
ATOM 9084  C CB  . ASP C 1 164 ? 66.878  66.453  114.441 1.00 61.21  ? 161 ASP C CB  1 
ATOM 9085  C CG  . ASP C 1 164 ? 68.050  66.342  113.484 1.00 87.96  ? 161 ASP C CG  1 
ATOM 9086  O OD1 . ASP C 1 164 ? 67.817  66.275  112.258 1.00 70.09  ? 161 ASP C OD1 1 
ATOM 9087  O OD2 . ASP C 1 164 ? 69.209  66.331  113.962 1.00 75.36  ? 161 ASP C OD2 1 
ATOM 9088  N N   . ALA C 1 165 ? 66.820  63.689  113.627 1.00 73.21  ? 162 ALA C N   1 
ATOM 9089  C CA  . ALA C 1 165 ? 67.366  62.555  112.871 1.00 69.60  ? 162 ALA C CA  1 
ATOM 9090  C C   . ALA C 1 165 ? 66.334  61.488  112.516 1.00 73.89  ? 162 ALA C C   1 
ATOM 9091  O O   . ALA C 1 165 ? 66.551  60.684  111.608 1.00 75.68  ? 162 ALA C O   1 
ATOM 9092  C CB  . ALA C 1 165 ? 68.531  61.923  113.624 1.00 61.61  ? 162 ALA C CB  1 
ATOM 9093  N N   . ALA C 1 166 ? 65.226  61.463  113.244 1.00 55.64  ? 163 ALA C N   1 
ATOM 9094  C CA  . ALA C 1 166 ? 64.140  60.571  112.900 1.00 63.08  ? 163 ALA C CA  1 
ATOM 9095  C C   . ALA C 1 166 ? 63.005  61.339  112.216 1.00 81.66  ? 163 ALA C C   1 
ATOM 9096  O O   . ALA C 1 166 ? 62.872  61.278  110.995 1.00 92.77  ? 163 ALA C O   1 
ATOM 9097  C CB  . ALA C 1 166 ? 63.640  59.846  114.121 1.00 54.92  ? 163 ALA C CB  1 
ATOM 9098  N N   . ALA C 1 167 ? 62.214  62.077  112.997 1.00 55.66  ? 164 ALA C N   1 
ATOM 9099  C CA  . ALA C 1 167 ? 60.967  62.667  112.503 1.00 69.77  ? 164 ALA C CA  1 
ATOM 9100  C C   . ALA C 1 167 ? 61.123  63.580  111.277 1.00 59.58  ? 164 ALA C C   1 
ATOM 9101  O O   . ALA C 1 167 ? 60.430  63.404  110.286 1.00 70.91  ? 164 ALA C O   1 
ATOM 9102  C CB  . ALA C 1 167 ? 60.225  63.381  113.629 1.00 41.49  ? 164 ALA C CB  1 
ATOM 9103  N N   . GLU C 1 168 ? 62.038  64.538  111.339 1.00 53.36  ? 165 GLU C N   1 
ATOM 9104  C CA  . GLU C 1 168 ? 62.203  65.495  110.250 1.00 66.64  ? 165 GLU C CA  1 
ATOM 9105  C C   . GLU C 1 168 ? 62.817  64.876  108.992 1.00 73.52  ? 165 GLU C C   1 
ATOM 9106  O O   . GLU C 1 168 ? 62.345  65.112  107.880 1.00 73.06  ? 165 GLU C O   1 
ATOM 9107  C CB  . GLU C 1 168 ? 63.043  66.675  110.705 1.00 58.93  ? 165 GLU C CB  1 
ATOM 9108  C CG  . GLU C 1 168 ? 62.948  67.859  109.792 1.00 69.46  ? 165 GLU C CG  1 
ATOM 9109  C CD  . GLU C 1 168 ? 63.859  68.993  110.218 1.00 96.32  ? 165 GLU C CD  1 
ATOM 9110  O OE1 . GLU C 1 168 ? 64.936  68.706  110.784 1.00 111.95 ? 165 GLU C OE1 1 
ATOM 9111  O OE2 . GLU C 1 168 ? 63.494  70.171  109.991 1.00 99.05  ? 165 GLU C OE2 1 
ATOM 9112  N N   . LEU C 1 169 ? 63.869  64.088  109.172 1.00 60.15  ? 166 LEU C N   1 
ATOM 9113  C CA  . LEU C 1 169 ? 64.487  63.378  108.062 1.00 51.98  ? 166 LEU C CA  1 
ATOM 9114  C C   . LEU C 1 169 ? 63.510  62.401  107.361 1.00 63.44  ? 166 LEU C C   1 
ATOM 9115  O O   . LEU C 1 169 ? 63.446  62.370  106.134 1.00 56.02  ? 166 LEU C O   1 
ATOM 9116  C CB  . LEU C 1 169 ? 65.726  62.633  108.565 1.00 50.52  ? 166 LEU C CB  1 
ATOM 9117  C CG  . LEU C 1 169 ? 66.446  61.802  107.502 1.00 58.43  ? 166 LEU C CG  1 
ATOM 9118  C CD1 . LEU C 1 169 ? 66.763  62.671  106.302 1.00 66.18  ? 166 LEU C CD1 1 
ATOM 9119  C CD2 . LEU C 1 169 ? 67.703  61.182  108.077 1.00 61.11  ? 166 LEU C CD2 1 
ATOM 9120  N N   . ILE C 1 170 ? 62.771  61.610  108.151 1.00 51.37  ? 167 ILE C N   1 
ATOM 9121  C CA  . ILE C 1 170 ? 61.747  60.692  107.663 1.00 45.18  ? 167 ILE C CA  1 
ATOM 9122  C C   . ILE C 1 170 ? 60.662  61.467  106.911 1.00 61.31  ? 167 ILE C C   1 
ATOM 9123  O O   . ILE C 1 170 ? 60.213  61.062  105.833 1.00 62.86  ? 167 ILE C O   1 
ATOM 9124  C CB  . ILE C 1 170 ? 61.123  59.893  108.839 1.00 50.05  ? 167 ILE C CB  1 
ATOM 9125  C CG1 . ILE C 1 170 ? 62.101  58.831  109.353 1.00 49.93  ? 167 ILE C CG1 1 
ATOM 9126  C CG2 . ILE C 1 170 ? 59.800  59.252  108.440 1.00 53.56  ? 167 ILE C CG2 1 
ATOM 9127  C CD1 . ILE C 1 170 ? 61.814  58.377  110.783 1.00 50.56  ? 167 ILE C CD1 1 
ATOM 9128  N N   . ASP C 1 171 ? 60.268  62.605  107.470 1.00 46.95  ? 168 ASP C N   1 
ATOM 9129  C CA  . ASP C 1 171 ? 59.233  63.432  106.860 1.00 49.30  ? 168 ASP C CA  1 
ATOM 9130  C C   . ASP C 1 171 ? 59.706  64.082  105.558 1.00 69.98  ? 168 ASP C C   1 
ATOM 9131  O O   . ASP C 1 171 ? 58.948  64.180  104.596 1.00 59.27  ? 168 ASP C O   1 
ATOM 9132  C CB  . ASP C 1 171 ? 58.707  64.479  107.847 1.00 43.52  ? 168 ASP C CB  1 
ATOM 9133  C CG  . ASP C 1 171 ? 57.781  63.882  108.905 1.00 57.37  ? 168 ASP C CG  1 
ATOM 9134  O OD1 . ASP C 1 171 ? 57.272  62.756  108.707 1.00 65.73  ? 168 ASP C OD1 1 
ATOM 9135  O OD2 . ASP C 1 171 ? 57.561  64.547  109.939 1.00 63.38  ? 168 ASP C OD2 1 
ATOM 9136  N N   . PHE C 1 172 ? 60.959  64.514  105.518 1.00 51.56  ? 169 PHE C N   1 
ATOM 9137  C CA  . PHE C 1 172 ? 61.518  65.015  104.274 1.00 44.44  ? 169 PHE C CA  1 
ATOM 9138  C C   . PHE C 1 172 ? 61.442  63.971  103.170 1.00 57.18  ? 169 PHE C C   1 
ATOM 9139  O O   . PHE C 1 172 ? 61.000  64.265  102.067 1.00 58.13  ? 169 PHE C O   1 
ATOM 9140  C CB  . PHE C 1 172 ? 62.968  65.433  104.463 1.00 49.66  ? 169 PHE C CB  1 
ATOM 9141  C CG  . PHE C 1 172 ? 63.133  66.849  104.906 1.00 66.16  ? 169 PHE C CG  1 
ATOM 9142  C CD1 . PHE C 1 172 ? 62.410  67.875  104.303 1.00 62.05  ? 169 PHE C CD1 1 
ATOM 9143  C CD2 . PHE C 1 172 ? 64.012  67.162  105.930 1.00 63.44  ? 169 PHE C CD2 1 
ATOM 9144  C CE1 . PHE C 1 172 ? 62.564  69.197  104.711 1.00 65.58  ? 169 PHE C CE1 1 
ATOM 9145  C CE2 . PHE C 1 172 ? 64.172  68.475  106.348 1.00 58.28  ? 169 PHE C CE2 1 
ATOM 9146  C CZ  . PHE C 1 172 ? 63.441  69.501  105.737 1.00 62.34  ? 169 PHE C CZ  1 
ATOM 9147  N N   . PHE C 1 173 ? 61.883  62.753  103.461 1.00 50.11  ? 170 PHE C N   1 
ATOM 9148  C CA  . PHE C 1 173 ? 61.855  61.694  102.463 1.00 46.20  ? 170 PHE C CA  1 
ATOM 9149  C C   . PHE C 1 173 ? 60.435  61.414  101.981 1.00 52.51  ? 170 PHE C C   1 
ATOM 9150  O O   . PHE C 1 173 ? 60.195  61.295  100.783 1.00 62.37  ? 170 PHE C O   1 
ATOM 9151  C CB  . PHE C 1 173 ? 62.500  60.406  103.002 1.00 45.71  ? 170 PHE C CB  1 
ATOM 9152  C CG  . PHE C 1 173 ? 63.990  60.466  103.050 1.00 60.94  ? 170 PHE C CG  1 
ATOM 9153  C CD1 . PHE C 1 173 ? 64.666  61.557  102.504 1.00 51.70  ? 170 PHE C CD1 1 
ATOM 9154  C CD2 . PHE C 1 173 ? 64.723  59.441  103.625 1.00 39.73  ? 170 PHE C CD2 1 
ATOM 9155  C CE1 . PHE C 1 173 ? 66.050  61.625  102.558 1.00 55.08  ? 170 PHE C CE1 1 
ATOM 9156  C CE2 . PHE C 1 173 ? 66.106  59.496  103.675 1.00 48.20  ? 170 PHE C CE2 1 
ATOM 9157  C CZ  . PHE C 1 173 ? 66.776  60.588  103.139 1.00 46.49  ? 170 PHE C CZ  1 
ATOM 9158  N N   . ARG C 1 174 ? 59.503  61.310  102.922 1.00 47.06  ? 171 ARG C N   1 
ATOM 9159  C CA  . ARG C 1 174 ? 58.140  60.945  102.580 1.00 57.62  ? 171 ARG C CA  1 
ATOM 9160  C C   . ARG C 1 174 ? 57.409  62.081  101.865 1.00 60.27  ? 171 ARG C C   1 
ATOM 9161  O O   . ARG C 1 174 ? 56.809  61.884  100.806 1.00 54.60  ? 171 ARG C O   1 
ATOM 9162  C CB  . ARG C 1 174 ? 57.376  60.495  103.826 1.00 45.88  ? 171 ARG C CB  1 
ATOM 9163  C CG  . ARG C 1 174 ? 57.854  59.188  104.394 1.00 48.85  ? 171 ARG C CG  1 
ATOM 9164  C CD  . ARG C 1 174 ? 56.725  58.483  105.132 1.00 60.36  ? 171 ARG C CD  1 
ATOM 9165  N NE  . ARG C 1 174 ? 57.157  57.251  105.779 1.00 66.51  ? 171 ARG C NE  1 
ATOM 9166  C CZ  . ARG C 1 174 ? 57.269  57.111  107.092 1.00 59.84  ? 171 ARG C CZ  1 
ATOM 9167  N NH1 . ARG C 1 174 ? 56.983  58.128  107.886 1.00 63.25  ? 171 ARG C NH1 1 
ATOM 9168  N NH2 . ARG C 1 174 ? 57.660  55.955  107.611 1.00 61.83  ? 171 ARG C NH2 1 
ATOM 9169  N N   . PHE C 1 175 ? 57.465  63.275  102.440 1.00 50.13  ? 172 PHE C N   1 
ATOM 9170  C CA  . PHE C 1 175 ? 56.729  64.394  101.883 1.00 52.10  ? 172 PHE C CA  1 
ATOM 9171  C C   . PHE C 1 175 ? 57.276  64.845  100.536 1.00 50.98  ? 172 PHE C C   1 
ATOM 9172  O O   . PHE C 1 175 ? 56.506  65.165  99.639  1.00 55.61  ? 172 PHE C O   1 
ATOM 9173  C CB  . PHE C 1 175 ? 56.634  65.551  102.870 1.00 40.72  ? 172 PHE C CB  1 
ATOM 9174  C CG  . PHE C 1 175 ? 55.559  65.369  103.913 1.00 54.51  ? 172 PHE C CG  1 
ATOM 9175  C CD1 . PHE C 1 175 ? 54.315  65.964  103.764 1.00 50.48  ? 172 PHE C CD1 1 
ATOM 9176  C CD2 . PHE C 1 175 ? 55.793  64.614  105.050 1.00 56.46  ? 172 PHE C CD2 1 
ATOM 9177  C CE1 . PHE C 1 175 ? 53.321  65.809  104.737 1.00 46.55  ? 172 PHE C CE1 1 
ATOM 9178  C CE2 . PHE C 1 175 ? 54.807  64.458  106.024 1.00 50.95  ? 172 PHE C CE2 1 
ATOM 9179  C CZ  . PHE C 1 175 ? 53.571  65.054  105.864 1.00 57.70  ? 172 PHE C CZ  1 
ATOM 9180  N N   . ASN C 1 176 ? 58.593  64.860  100.380 1.00 49.64  ? 173 ASN C N   1 
ATOM 9181  C CA  . ASN C 1 176 ? 59.173  65.195  99.085  1.00 53.00  ? 173 ASN C CA  1 
ATOM 9182  C C   . ASN C 1 176 ? 58.834  64.168  98.007  1.00 59.63  ? 173 ASN C C   1 
ATOM 9183  O O   . ASN C 1 176 ? 58.675  64.515  96.844  1.00 55.39  ? 173 ASN C O   1 
ATOM 9184  C CB  . ASN C 1 176 ? 60.691  65.377  99.168  1.00 49.33  ? 173 ASN C CB  1 
ATOM 9185  C CG  . ASN C 1 176 ? 61.095  66.726  99.731  1.00 48.52  ? 173 ASN C CG  1 
ATOM 9186  O OD1 . ASN C 1 176 ? 62.177  66.866  100.254 1.00 42.92  ? 173 ASN C OD1 1 
ATOM 9187  N ND2 . ASN C 1 176 ? 60.221  67.715  99.625  1.00 54.76  ? 173 ASN C ND2 1 
ATOM 9188  N N   . ALA C 1 177 ? 58.738  62.904  98.391  1.00 45.03  ? 174 ALA C N   1 
ATOM 9189  C CA  . ALA C 1 177 ? 58.311  61.883  97.452  1.00 49.90  ? 174 ALA C CA  1 
ATOM 9190  C C   . ALA C 1 177 ? 56.839  62.094  97.015  1.00 48.43  ? 174 ALA C C   1 
ATOM 9191  O O   . ALA C 1 177 ? 56.502  61.964  95.845  1.00 53.44  ? 174 ALA C O   1 
ATOM 9192  C CB  . ALA C 1 177 ? 58.515  60.506  98.060  1.00 33.82  ? 174 ALA C CB  1 
ATOM 9193  N N   . LYS C 1 178 ? 55.974  62.433  97.961  1.00 44.79  ? 175 LYS C N   1 
ATOM 9194  C CA  . LYS C 1 178 ? 54.586  62.738  97.665  1.00 52.41  ? 175 LYS C CA  1 
ATOM 9195  C C   . LYS C 1 178 ? 54.478  63.928  96.712  1.00 59.59  ? 175 LYS C C   1 
ATOM 9196  O O   . LYS C 1 178 ? 53.712  63.904  95.759  1.00 66.69  ? 175 LYS C O   1 
ATOM 9197  C CB  . LYS C 1 178 ? 53.841  63.067  98.955  1.00 29.96  ? 175 LYS C CB  1 
ATOM 9198  C CG  . LYS C 1 178 ? 52.513  63.798  98.752  1.00 50.80  ? 175 LYS C CG  1 
ATOM 9199  C CD  . LYS C 1 178 ? 52.145  64.614  99.990  1.00 51.32  ? 175 LYS C CD  1 
ATOM 9200  C CE  . LYS C 1 178 ? 50.687  64.433  100.387 1.00 78.32  ? 175 LYS C CE  1 
ATOM 9201  N NZ  . LYS C 1 178 ? 49.734  64.677  99.253  1.00 61.33  ? 175 LYS C NZ  1 
ATOM 9202  N N   . TYR C 1 179 ? 55.248  64.972  96.985  1.00 44.65  ? 176 TYR C N   1 
ATOM 9203  C CA  . TYR C 1 179 ? 55.219  66.183  96.186  1.00 55.33  ? 176 TYR C CA  1 
ATOM 9204  C C   . TYR C 1 179 ? 55.732  65.963  94.759  1.00 50.24  ? 176 TYR C C   1 
ATOM 9205  O O   . TYR C 1 179 ? 55.205  66.547  93.826  1.00 63.59  ? 176 TYR C O   1 
ATOM 9206  C CB  . TYR C 1 179 ? 56.040  67.280  96.854  1.00 37.85  ? 176 TYR C CB  1 
ATOM 9207  C CG  . TYR C 1 179 ? 55.528  67.771  98.194  1.00 68.83  ? 176 TYR C CG  1 
ATOM 9208  C CD1 . TYR C 1 179 ? 54.164  67.860  98.470  1.00 65.40  ? 176 TYR C CD1 1 
ATOM 9209  C CD2 . TYR C 1 179 ? 56.422  68.170  99.186  1.00 51.63  ? 176 TYR C CD2 1 
ATOM 9210  C CE1 . TYR C 1 179 ? 53.710  68.333  99.707  1.00 52.39  ? 176 TYR C CE1 1 
ATOM 9211  C CE2 . TYR C 1 179 ? 55.979  68.639  100.411 1.00 63.75  ? 176 TYR C CE2 1 
ATOM 9212  C CZ  . TYR C 1 179 ? 54.625  68.719  100.673 1.00 70.48  ? 176 TYR C CZ  1 
ATOM 9213  O OH  . TYR C 1 179 ? 54.211  69.194  101.908 1.00 76.51  ? 176 TYR C OH  1 
ATOM 9214  N N   . ALA C 1 180 ? 56.761  65.137  94.607  1.00 39.67  ? 177 ALA C N   1 
ATOM 9215  C CA  . ALA C 1 180 ? 57.371  64.870  93.308  1.00 53.80  ? 177 ALA C CA  1 
ATOM 9216  C C   . ALA C 1 180 ? 56.464  64.015  92.443  1.00 44.85  ? 177 ALA C C   1 
ATOM 9217  O O   . ALA C 1 180 ? 56.381  64.226  91.239  1.00 57.76  ? 177 ALA C O   1 
ATOM 9218  C CB  . ALA C 1 180 ? 58.739  64.208  93.472  1.00 36.74  ? 177 ALA C CB  1 
ATOM 9219  N N   . VAL C 1 181 ? 55.791  63.056  93.073  1.00 55.55  ? 178 VAL C N   1 
ATOM 9220  C CA  . VAL C 1 181 ? 54.826  62.180  92.407  1.00 47.74  ? 178 VAL C CA  1 
ATOM 9221  C C   . VAL C 1 181 ? 53.579  62.935  91.936  1.00 58.15  ? 178 VAL C C   1 
ATOM 9222  O O   . VAL C 1 181 ? 53.038  62.660  90.865  1.00 57.37  ? 178 VAL C O   1 
ATOM 9223  C CB  . VAL C 1 181 ? 54.402  61.026  93.349  1.00 50.58  ? 178 VAL C CB  1 
ATOM 9224  C CG1 . VAL C 1 181 ? 53.145  60.322  92.840  1.00 41.79  ? 178 VAL C CG1 1 
ATOM 9225  C CG2 . VAL C 1 181 ? 55.547  60.040  93.519  1.00 44.52  ? 178 VAL C CG2 1 
ATOM 9226  N N   . GLU C 1 182 ? 53.130  63.893  92.739  1.00 47.86  ? 179 GLU C N   1 
ATOM 9227  C CA  . GLU C 1 182 ? 51.930  64.665  92.424  1.00 61.59  ? 179 GLU C CA  1 
ATOM 9228  C C   . GLU C 1 182 ? 52.231  65.812  91.452  1.00 65.43  ? 179 GLU C C   1 
ATOM 9229  O O   . GLU C 1 182 ? 51.337  66.341  90.795  1.00 71.38  ? 179 GLU C O   1 
ATOM 9230  C CB  . GLU C 1 182 ? 51.264  65.140  93.726  1.00 49.79  ? 179 GLU C CB  1 
ATOM 9231  C CG  . GLU C 1 182 ? 51.070  63.941  94.686  1.00 96.43  ? 179 GLU C CG  1 
ATOM 9232  C CD  . GLU C 1 182 ? 50.162  64.200  95.872  1.00 91.56  ? 179 GLU C CD  1 
ATOM 9233  O OE1 . GLU C 1 182 ? 49.917  65.375  96.214  1.00 84.86  ? 179 GLU C OE1 1 
ATOM 9234  O OE2 . GLU C 1 182 ? 49.693  63.208  96.470  1.00 90.59  ? 179 GLU C OE2 1 
ATOM 9235  N N   . LEU C 1 183 ? 53.504  66.171  91.348  1.00 64.00  ? 180 LEU C N   1 
ATOM 9236  C CA  . LEU C 1 183 ? 53.942  67.178  90.391  1.00 53.60  ? 180 LEU C CA  1 
ATOM 9237  C C   . LEU C 1 183 ? 53.763  66.680  88.962  1.00 65.48  ? 180 LEU C C   1 
ATOM 9238  O O   . LEU C 1 183 ? 53.427  67.454  88.080  1.00 67.29  ? 180 LEU C O   1 
ATOM 9239  C CB  . LEU C 1 183 ? 55.400  67.543  90.635  1.00 34.07  ? 180 LEU C CB  1 
ATOM 9240  C CG  . LEU C 1 183 ? 55.992  68.521  89.631  1.00 64.94  ? 180 LEU C CG  1 
ATOM 9241  C CD1 . LEU C 1 183 ? 55.197  69.823  89.661  1.00 58.48  ? 180 LEU C CD1 1 
ATOM 9242  C CD2 . LEU C 1 183 ? 57.463  68.770  89.938  1.00 50.22  ? 180 LEU C CD2 1 
ATOM 9243  N N   . GLU C 1 184 ? 53.979  65.383  88.748  1.00 64.89  ? 181 GLU C N   1 
ATOM 9244  C CA  . GLU C 1 184 ? 53.799  64.766  87.437  1.00 63.99  ? 181 GLU C CA  1 
ATOM 9245  C C   . GLU C 1 184 ? 52.396  64.967  86.918  1.00 67.22  ? 181 GLU C C   1 
ATOM 9246  O O   . GLU C 1 184 ? 52.174  64.952  85.703  1.00 86.38  ? 181 GLU C O   1 
ATOM 9247  C CB  . GLU C 1 184 ? 54.058  63.271  87.507  1.00 52.23  ? 181 GLU C CB  1 
ATOM 9248  C CG  . GLU C 1 184 ? 55.477  62.945  87.792  1.00 89.88  ? 181 GLU C CG  1 
ATOM 9249  C CD  . GLU C 1 184 ? 56.320  63.148  86.580  1.00 93.53  ? 181 GLU C CD  1 
ATOM 9250  O OE1 . GLU C 1 184 ? 55.806  62.857  85.478  1.00 88.29  ? 181 GLU C OE1 1 
ATOM 9251  O OE2 . GLU C 1 184 ? 57.476  63.603  86.725  1.00 101.23 ? 181 GLU C OE2 1 
ATOM 9252  N N   . GLY C 1 185 ? 51.447  65.139  87.837  1.00 50.85  ? 182 GLY C N   1 
ATOM 9253  C CA  . GLY C 1 185 ? 50.051  65.316  87.458  1.00 57.99  ? 182 GLY C CA  1 
ATOM 9254  C C   . GLY C 1 185 ? 49.740  66.713  86.949  1.00 64.45  ? 182 GLY C C   1 
ATOM 9255  O O   . GLY C 1 185 ? 48.705  66.933  86.312  1.00 80.59  ? 182 GLY C O   1 
ATOM 9256  N N   . GLN C 1 186 ? 50.634  67.660  87.237  1.00 64.92  ? 183 GLN C N   1 
ATOM 9257  C CA  . GLN C 1 186 ? 50.499  69.013  86.721  1.00 68.99  ? 183 GLN C CA  1 
ATOM 9258  C C   . GLN C 1 186 ? 50.916  69.043  85.254  1.00 75.98  ? 183 GLN C C   1 
ATOM 9259  O O   . GLN C 1 186 ? 52.102  69.107  84.919  1.00 53.76  ? 183 GLN C O   1 
ATOM 9260  C CB  . GLN C 1 186 ? 51.310  69.997  87.553  1.00 64.15  ? 183 GLN C CB  1 
ATOM 9261  C CG  . GLN C 1 186 ? 50.975  69.941  89.029  1.00 79.90  ? 183 GLN C CG  1 
ATOM 9262  C CD  . GLN C 1 186 ? 51.347  71.217  89.763  1.00 91.33  ? 183 GLN C CD  1 
ATOM 9263  N N   . GLN C 1 187 ? 49.915  68.987  84.384  1.00 74.50  ? 184 GLN C N   1 
ATOM 9264  C CA  . GLN C 1 187 ? 50.150  68.836  82.963  1.00 67.84  ? 184 GLN C CA  1 
ATOM 9265  C C   . GLN C 1 187 ? 49.437  69.933  82.192  1.00 74.67  ? 184 GLN C C   1 
ATOM 9266  O O   . GLN C 1 187 ? 48.410  70.436  82.648  1.00 63.95  ? 184 GLN C O   1 
ATOM 9267  C CB  . GLN C 1 187 ? 49.677  67.457  82.534  1.00 43.50  ? 184 GLN C CB  1 
ATOM 9268  C CG  . GLN C 1 187 ? 50.605  66.366  83.037  1.00 45.27  ? 184 GLN C CG  1 
ATOM 9269  C CD  . GLN C 1 187 ? 51.950  66.367  82.329  1.00 65.46  ? 184 GLN C CD  1 
ATOM 9270  O OE1 . GLN C 1 187 ? 52.021  66.497  81.095  1.00 74.81  ? 184 GLN C OE1 1 
ATOM 9271  N NE2 . GLN C 1 187 ? 53.028  66.230  83.104  1.00 53.86  ? 184 GLN C NE2 1 
ATOM 9272  N N   . PRO C 1 188 ? 49.981  70.323  81.026  1.00 53.13  ? 185 PRO C N   1 
ATOM 9273  C CA  . PRO C 1 188 ? 49.312  71.431  80.337  1.00 61.63  ? 185 PRO C CA  1 
ATOM 9274  C C   . PRO C 1 188 ? 48.016  71.003  79.640  1.00 68.78  ? 185 PRO C C   1 
ATOM 9275  O O   . PRO C 1 188 ? 47.644  69.817  79.649  1.00 56.00  ? 185 PRO C O   1 
ATOM 9276  C CB  . PRO C 1 188 ? 50.372  71.934  79.337  1.00 56.14  ? 185 PRO C CB  1 
ATOM 9277  C CG  . PRO C 1 188 ? 51.345  70.772  79.161  1.00 74.71  ? 185 PRO C CG  1 
ATOM 9278  C CD  . PRO C 1 188 ? 51.035  69.707  80.208  1.00 59.08  ? 185 PRO C CD  1 
ATOM 9279  N N   . ILE C 1 189 ? 47.332  71.997  79.080  1.00 77.90  ? 186 ILE C N   1 
ATOM 9280  C CA  . ILE C 1 189 ? 46.100  71.826  78.323  1.00 62.76  ? 186 ILE C CA  1 
ATOM 9281  C C   . ILE C 1 189 ? 46.412  71.232  76.952  1.00 78.92  ? 186 ILE C C   1 
ATOM 9282  O O   . ILE C 1 189 ? 47.397  71.612  76.303  1.00 80.76  ? 186 ILE C O   1 
ATOM 9283  C CB  . ILE C 1 189 ? 45.396  73.198  78.155  1.00 90.67  ? 186 ILE C CB  1 
ATOM 9284  C CG1 . ILE C 1 189 ? 44.814  73.660  79.500  1.00 71.25  ? 186 ILE C CG1 1 
ATOM 9285  C CG2 . ILE C 1 189 ? 44.323  73.154  77.061  1.00 81.71  ? 186 ILE C CG2 1 
ATOM 9286  C CD1 . ILE C 1 189 ? 44.478  75.160  79.553  1.00 82.04  ? 186 ILE C CD1 1 
ATOM 9287  N N   . SER C 1 190 ? 45.588  70.282  76.520  1.00 73.91  ? 187 SER C N   1 
ATOM 9288  C CA  . SER C 1 190 ? 45.735  69.727  75.181  1.00 87.65  ? 187 SER C CA  1 
ATOM 9289  C C   . SER C 1 190 ? 44.590  70.182  74.264  1.00 95.13  ? 187 SER C C   1 
ATOM 9290  O O   . SER C 1 190 ? 43.412  70.141  74.645  1.00 77.48  ? 187 SER C O   1 
ATOM 9291  C CB  . SER C 1 190 ? 45.847  68.200  75.230  1.00 60.28  ? 187 SER C CB  1 
ATOM 9292  O OG  . SER C 1 190 ? 47.178  67.800  75.481  1.00 77.49  ? 187 SER C OG  1 
ATOM 9293  N N   . VAL C 1 191 ? 44.941  70.646  73.067  1.00 88.29  ? 188 VAL C N   1 
ATOM 9294  C CA  . VAL C 1 191 ? 43.928  71.028  72.091  1.00 89.92  ? 188 VAL C CA  1 
ATOM 9295  C C   . VAL C 1 191 ? 44.190  70.365  70.740  1.00 94.34  ? 188 VAL C C   1 
ATOM 9296  O O   . VAL C 1 191 ? 45.254  70.546  70.147  1.00 84.55  ? 188 VAL C O   1 
ATOM 9297  C CB  . VAL C 1 191 ? 43.827  72.559  71.954  1.00 86.99  ? 188 VAL C CB  1 
ATOM 9298  C CG1 . VAL C 1 191 ? 43.239  72.957  70.605  1.00 76.60  ? 188 VAL C CG1 1 
ATOM 9299  C CG2 . VAL C 1 191 ? 43.003  73.140  73.103  1.00 68.95  ? 188 VAL C CG2 1 
ATOM 9300  N N   . PRO C 1 192 ? 43.219  69.570  70.264  1.00 105.02 ? 189 PRO C N   1 
ATOM 9301  C CA  . PRO C 1 192 ? 43.258  68.891  68.963  1.00 84.51  ? 189 PRO C CA  1 
ATOM 9302  C C   . PRO C 1 192 ? 43.661  69.873  67.879  1.00 75.89  ? 189 PRO C C   1 
ATOM 9303  O O   . PRO C 1 192 ? 43.149  70.996  67.882  1.00 67.53  ? 189 PRO C O   1 
ATOM 9304  C CB  . PRO C 1 192 ? 41.803  68.471  68.762  1.00 75.26  ? 189 PRO C CB  1 
ATOM 9305  C CG  . PRO C 1 192 ? 41.297  68.263  70.149  1.00 86.52  ? 189 PRO C CG  1 
ATOM 9306  C CD  . PRO C 1 192 ? 41.952  69.329  70.975  1.00 93.72  ? 189 PRO C CD  1 
ATOM 9307  N N   . PRO C 1 193 ? 44.537  69.457  66.944  1.00 92.41  ? 190 PRO C N   1 
ATOM 9308  C CA  . PRO C 1 193 ? 45.033  68.083  66.767  1.00 87.68  ? 190 PRO C CA  1 
ATOM 9309  C C   . PRO C 1 193 ? 46.349  67.817  67.479  1.00 82.24  ? 190 PRO C C   1 
ATOM 9310  O O   . PRO C 1 193 ? 47.176  67.069  66.942  1.00 81.94  ? 190 PRO C O   1 
ATOM 9311  C CB  . PRO C 1 193 ? 45.292  68.026  65.260  1.00 86.73  ? 190 PRO C CB  1 
ATOM 9312  C CG  . PRO C 1 193 ? 45.835  69.427  64.959  1.00 80.36  ? 190 PRO C CG  1 
ATOM 9313  C CD  . PRO C 1 193 ? 45.090  70.371  65.917  1.00 76.88  ? 190 PRO C CD  1 
ATOM 9314  N N   . SER C 1 194 ? 46.556  68.422  68.646  1.00 85.46  ? 191 SER C N   1 
ATOM 9315  C CA  . SER C 1 194 ? 47.833  68.281  69.353  1.00 74.18  ? 191 SER C CA  1 
ATOM 9316  C C   . SER C 1 194 ? 47.647  67.823  70.791  1.00 73.86  ? 191 SER C C   1 
ATOM 9317  O O   . SER C 1 194 ? 46.639  68.125  71.441  1.00 75.09  ? 191 SER C O   1 
ATOM 9318  C CB  . SER C 1 194 ? 48.655  69.582  69.300  1.00 71.86  ? 191 SER C CB  1 
ATOM 9319  O OG  . SER C 1 194 ? 49.140  69.844  67.985  1.00 69.73  ? 191 SER C OG  1 
ATOM 9320  N N   . THR C 1 195 ? 48.621  67.069  71.281  1.00 66.75  ? 192 THR C N   1 
ATOM 9321  C CA  . THR C 1 195 ? 48.630  66.705  72.685  1.00 80.03  ? 192 THR C CA  1 
ATOM 9322  C C   . THR C 1 195 ? 49.887  67.250  73.353  1.00 74.39  ? 192 THR C C   1 
ATOM 9323  O O   . THR C 1 195 ? 50.984  67.122  72.823  1.00 63.39  ? 192 THR C O   1 
ATOM 9324  C CB  . THR C 1 195 ? 48.517  65.191  72.889  1.00 79.68  ? 192 THR C CB  1 
ATOM 9325  O OG1 . THR C 1 195 ? 49.514  64.523  72.102  1.00 80.03  ? 192 THR C OG1 1 
ATOM 9326  C CG2 . THR C 1 195 ? 47.128  64.717  72.483  1.00 70.04  ? 192 THR C CG2 1 
ATOM 9327  N N   . ASN C 1 196 ? 49.711  67.878  74.511  1.00 65.55  ? 193 ASN C N   1 
ATOM 9328  C CA  . ASN C 1 196 ? 50.835  68.461  75.229  1.00 74.01  ? 193 ASN C CA  1 
ATOM 9329  C C   . ASN C 1 196 ? 51.145  67.752  76.535  1.00 59.37  ? 193 ASN C C   1 
ATOM 9330  O O   . ASN C 1 196 ? 50.250  67.281  77.235  1.00 66.84  ? 193 ASN C O   1 
ATOM 9331  C CB  . ASN C 1 196 ? 50.573  69.938  75.487  1.00 62.28  ? 193 ASN C CB  1 
ATOM 9332  C CG  . ASN C 1 196 ? 50.324  70.707  74.208  1.00 74.15  ? 193 ASN C CG  1 
ATOM 9333  O OD1 . ASN C 1 196 ? 51.202  70.799  73.335  1.00 63.55  ? 193 ASN C OD1 1 
ATOM 9334  N ND2 . ASN C 1 196 ? 49.126  71.272  74.088  1.00 43.07  ? 193 ASN C ND2 1 
ATOM 9335  N N   . SER C 1 197 ? 52.422  67.683  76.864  1.00 55.28  ? 194 SER C N   1 
ATOM 9336  C CA  . SER C 1 197 ? 52.831  67.039  78.095  1.00 62.11  ? 194 SER C CA  1 
ATOM 9337  C C   . SER C 1 197 ? 54.055  67.725  78.669  1.00 53.90  ? 194 SER C C   1 
ATOM 9338  O O   . SER C 1 197 ? 54.870  68.261  77.936  1.00 54.56  ? 194 SER C O   1 
ATOM 9339  C CB  . SER C 1 197 ? 53.116  65.554  77.847  1.00 51.31  ? 194 SER C CB  1 
ATOM 9340  O OG  . SER C 1 197 ? 54.312  65.376  77.115  1.00 65.49  ? 194 SER C OG  1 
ATOM 9341  N N   . THR C 1 198 ? 54.180  67.696  79.990  1.00 47.72  ? 195 THR C N   1 
ATOM 9342  C CA  . THR C 1 198 ? 55.343  68.262  80.660  1.00 44.31  ? 195 THR C CA  1 
ATOM 9343  C C   . THR C 1 198 ? 56.187  67.148  81.257  1.00 56.70  ? 195 THR C C   1 
ATOM 9344  O O   . THR C 1 198 ? 55.678  66.282  81.958  1.00 56.77  ? 195 THR C O   1 
ATOM 9345  C CB  . THR C 1 198 ? 54.941  69.246  81.778  1.00 45.84  ? 195 THR C CB  1 
ATOM 9346  O OG1 . THR C 1 198 ? 54.161  70.310  81.227  1.00 63.64  ? 195 THR C OG1 1 
ATOM 9347  C CG2 . THR C 1 198 ? 56.164  69.844  82.436  1.00 54.16  ? 195 THR C CG2 1 
ATOM 9348  N N   . VAL C 1 199 ? 57.483  67.190  80.975  1.00 56.89  ? 196 VAL C N   1 
ATOM 9349  C CA  . VAL C 1 199 ? 58.431  66.209  81.474  1.00 49.35  ? 196 VAL C CA  1 
ATOM 9350  C C   . VAL C 1 199 ? 59.371  66.872  82.470  1.00 47.72  ? 196 VAL C C   1 
ATOM 9351  O O   . VAL C 1 199 ? 60.110  67.784  82.122  1.00 47.09  ? 196 VAL C O   1 
ATOM 9352  C CB  . VAL C 1 199 ? 59.276  65.640  80.326  1.00 58.18  ? 196 VAL C CB  1 
ATOM 9353  C CG1 . VAL C 1 199 ? 60.261  64.695  80.863  1.00 43.01  ? 196 VAL C CG1 1 
ATOM 9354  C CG2 . VAL C 1 199 ? 58.392  64.943  79.293  1.00 65.49  ? 196 VAL C CG2 1 
ATOM 9355  N N   . TYR C 1 200 ? 59.342  66.420  83.714  1.00 56.40  ? 197 TYR C N   1 
ATOM 9356  C CA  . TYR C 1 200 ? 60.124  67.074  84.758  1.00 51.17  ? 197 TYR C CA  1 
ATOM 9357  C C   . TYR C 1 200 ? 61.558  66.550  84.841  1.00 48.46  ? 197 TYR C C   1 
ATOM 9358  O O   . TYR C 1 200 ? 61.885  65.664  85.644  1.00 64.36  ? 197 TYR C O   1 
ATOM 9359  C CB  . TYR C 1 200 ? 59.386  67.026  86.108  1.00 45.94  ? 197 TYR C CB  1 
ATOM 9360  C CG  . TYR C 1 200 ? 58.089  67.823  86.061  1.00 55.97  ? 197 TYR C CG  1 
ATOM 9361  C CD1 . TYR C 1 200 ? 58.087  69.199  86.262  1.00 45.98  ? 197 TYR C CD1 1 
ATOM 9362  C CD2 . TYR C 1 200 ? 56.875  67.206  85.765  1.00 41.01  ? 197 TYR C CD2 1 
ATOM 9363  C CE1 . TYR C 1 200 ? 56.898  69.942  86.188  1.00 47.68  ? 197 TYR C CE1 1 
ATOM 9364  C CE2 . TYR C 1 200 ? 55.683  67.942  85.698  1.00 47.69  ? 197 TYR C CE2 1 
ATOM 9365  C CZ  . TYR C 1 200 ? 55.703  69.305  85.905  1.00 51.09  ? 197 TYR C CZ  1 
ATOM 9366  O OH  . TYR C 1 200 ? 54.526  70.026  85.840  1.00 55.55  ? 197 TYR C OH  1 
ATOM 9367  N N   . ARG C 1 201 ? 62.414  67.137  84.012  1.00 47.33  ? 198 ARG C N   1 
ATOM 9368  C CA  . ARG C 1 201 ? 63.820  66.748  83.909  1.00 46.91  ? 198 ARG C CA  1 
ATOM 9369  C C   . ARG C 1 201 ? 64.607  67.172  85.121  1.00 52.05  ? 198 ARG C C   1 
ATOM 9370  O O   . ARG C 1 201 ? 64.320  68.189  85.746  1.00 59.08  ? 198 ARG C O   1 
ATOM 9371  C CB  . ARG C 1 201 ? 64.488  67.409  82.687  1.00 47.90  ? 198 ARG C CB  1 
ATOM 9372  C CG  . ARG C 1 201 ? 63.750  67.225  81.353  1.00 53.94  ? 198 ARG C CG  1 
ATOM 9373  C CD  . ARG C 1 201 ? 64.478  67.959  80.254  1.00 43.53  ? 198 ARG C CD  1 
ATOM 9374  N NE  . ARG C 1 201 ? 64.513  69.385  80.543  1.00 65.54  ? 198 ARG C NE  1 
ATOM 9375  C CZ  . ARG C 1 201 ? 64.873  70.329  79.680  1.00 43.09  ? 198 ARG C CZ  1 
ATOM 9376  N NH1 . ARG C 1 201 ? 65.248  70.009  78.451  1.00 60.76  ? 198 ARG C NH1 1 
ATOM 9377  N NH2 . ARG C 1 201 ? 64.867  71.600  80.055  1.00 56.58  ? 198 ARG C NH2 1 
ATOM 9378  N N   . GLY C 1 202 ? 65.632  66.402  85.440  1.00 47.54  ? 199 GLY C N   1 
ATOM 9379  C CA  . GLY C 1 202 ? 66.597  66.853  86.416  1.00 61.31  ? 199 GLY C CA  1 
ATOM 9380  C C   . GLY C 1 202 ? 67.465  67.898  85.745  1.00 67.42  ? 199 GLY C C   1 
ATOM 9381  O O   . GLY C 1 202 ? 67.476  67.992  84.515  1.00 59.55  ? 199 GLY C O   1 
ATOM 9382  N N   . LEU C 1 203 ? 68.183  68.687  86.543  1.00 52.17  ? 200 LEU C N   1 
ATOM 9383  C CA  . LEU C 1 203 ? 69.137  69.633  85.997  1.00 42.94  ? 200 LEU C CA  1 
ATOM 9384  C C   . LEU C 1 203 ? 70.226  68.875  85.271  1.00 52.98  ? 200 LEU C C   1 
ATOM 9385  O O   . LEU C 1 203 ? 70.627  67.779  85.672  1.00 54.65  ? 200 LEU C O   1 
ATOM 9386  C CB  . LEU C 1 203 ? 69.753  70.503  87.096  1.00 39.97  ? 200 LEU C CB  1 
ATOM 9387  C CG  . LEU C 1 203 ? 68.729  71.062  88.073  1.00 50.53  ? 200 LEU C CG  1 
ATOM 9388  C CD1 . LEU C 1 203 ? 69.395  72.051  88.995  1.00 44.57  ? 200 LEU C CD1 1 
ATOM 9389  C CD2 . LEU C 1 203 ? 67.589  71.702  87.305  1.00 38.00  ? 200 LEU C CD2 1 
ATOM 9390  N N   . GLU C 1 204 ? 70.716  69.475  84.196  1.00 73.18  ? 201 GLU C N   1 
ATOM 9391  C CA  . GLU C 1 204 ? 71.778  68.866  83.415  1.00 62.77  ? 201 GLU C CA  1 
ATOM 9392  C C   . GLU C 1 204 ? 73.168  69.247  83.966  1.00 45.81  ? 201 GLU C C   1 
ATOM 9393  O O   . GLU C 1 204 ? 73.610  70.396  83.874  1.00 69.07  ? 201 GLU C O   1 
ATOM 9394  C CB  . GLU C 1 204 ? 71.612  69.239  81.951  1.00 49.94  ? 201 GLU C CB  1 
ATOM 9395  C CG  . GLU C 1 204 ? 72.404  68.378  81.000  1.00 75.65  ? 201 GLU C CG  1 
ATOM 9396  C CD  . GLU C 1 204 ? 72.459  68.949  79.580  1.00 90.14  ? 201 GLU C CD  1 
ATOM 9397  O OE1 . GLU C 1 204 ? 72.045  70.115  79.364  1.00 76.93  ? 201 GLU C OE1 1 
ATOM 9398  O OE2 . GLU C 1 204 ? 72.924  68.220  78.680  1.00 79.18  ? 201 GLU C OE2 1 
ATOM 9399  N N   . GLY C 1 205 ? 73.833  68.264  84.562  1.00 53.22  ? 202 GLY C N   1 
ATOM 9400  C CA  . GLY C 1 205 ? 75.060  68.486  85.309  1.00 39.72  ? 202 GLY C CA  1 
ATOM 9401  C C   . GLY C 1 205 ? 75.029  67.730  86.631  1.00 53.97  ? 202 GLY C C   1 
ATOM 9402  O O   . GLY C 1 205 ? 74.265  66.764  86.792  1.00 60.81  ? 202 GLY C O   1 
ATOM 9403  N N   . PHE C 1 206 ? 75.859  68.166  87.574  1.00 51.43  ? 203 PHE C N   1 
ATOM 9404  C CA  . PHE C 1 206 ? 75.816  67.639  88.939  1.00 65.72  ? 203 PHE C CA  1 
ATOM 9405  C C   . PHE C 1 206 ? 75.499  68.752  89.925  1.00 55.46  ? 203 PHE C C   1 
ATOM 9406  O O   . PHE C 1 206 ? 75.801  69.919  89.684  1.00 66.61  ? 203 PHE C O   1 
ATOM 9407  C CB  . PHE C 1 206 ? 77.146  66.993  89.331  1.00 49.81  ? 203 PHE C CB  1 
ATOM 9408  C CG  . PHE C 1 206 ? 78.226  67.980  89.659  1.00 52.19  ? 203 PHE C CG  1 
ATOM 9409  C CD1 . PHE C 1 206 ? 79.056  68.482  88.660  1.00 56.05  ? 203 PHE C CD1 1 
ATOM 9410  C CD2 . PHE C 1 206 ? 78.408  68.418  90.963  1.00 49.64  ? 203 PHE C CD2 1 
ATOM 9411  C CE1 . PHE C 1 206 ? 80.058  69.397  88.965  1.00 58.08  ? 203 PHE C CE1 1 
ATOM 9412  C CE2 . PHE C 1 206 ? 79.397  69.328  91.278  1.00 48.95  ? 203 PHE C CE2 1 
ATOM 9413  C CZ  . PHE C 1 206 ? 80.229  69.823  90.281  1.00 66.50  ? 203 PHE C CZ  1 
ATOM 9414  N N   . VAL C 1 207 ? 74.894  68.376  91.041  1.00 62.52  ? 204 VAL C N   1 
ATOM 9415  C CA  . VAL C 1 207 ? 74.570  69.316  92.102  1.00 52.99  ? 204 VAL C CA  1 
ATOM 9416  C C   . VAL C 1 207 ? 75.521  69.077  93.265  1.00 43.10  ? 204 VAL C C   1 
ATOM 9417  O O   . VAL C 1 207 ? 75.799  67.928  93.622  1.00 55.13  ? 204 VAL C O   1 
ATOM 9418  C CB  . VAL C 1 207 ? 73.115  69.114  92.596  1.00 47.11  ? 204 VAL C CB  1 
ATOM 9419  C CG1 . VAL C 1 207 ? 72.845  69.963  93.814  1.00 39.44  ? 204 VAL C CG1 1 
ATOM 9420  C CG2 . VAL C 1 207 ? 72.120  69.426  91.482  1.00 43.37  ? 204 VAL C CG2 1 
ATOM 9421  N N   . ALA C 1 208 ? 76.015  70.161  93.854  1.00 55.67  ? 205 ALA C N   1 
ATOM 9422  C CA  . ALA C 1 208 ? 76.858  70.080  95.042  1.00 41.44  ? 205 ALA C CA  1 
ATOM 9423  C C   . ALA C 1 208 ? 76.022  70.387  96.291  1.00 57.12  ? 205 ALA C C   1 
ATOM 9424  O O   . ALA C 1 208 ? 75.408  71.446  96.387  1.00 62.44  ? 205 ALA C O   1 
ATOM 9425  C CB  . ALA C 1 208 ? 78.008  71.034  94.914  1.00 43.22  ? 205 ALA C CB  1 
ATOM 9426  N N   . ALA C 1 209 ? 75.971  69.440  97.221  1.00 48.52  ? 206 ALA C N   1 
ATOM 9427  C CA  . ALA C 1 209 ? 75.215  69.616  98.456  1.00 54.97  ? 206 ALA C CA  1 
ATOM 9428  C C   . ALA C 1 209 ? 76.191  69.807  99.601  1.00 59.62  ? 206 ALA C C   1 
ATOM 9429  O O   . ALA C 1 209 ? 77.050  68.959  99.836  1.00 50.57  ? 206 ALA C O   1 
ATOM 9430  C CB  . ALA C 1 209 ? 74.293  68.413  98.723  1.00 44.44  ? 206 ALA C CB  1 
ATOM 9431  N N   . ILE C 1 210 ? 76.061  70.928  100.301 1.00 52.15  ? 207 ILE C N   1 
ATOM 9432  C CA  . ILE C 1 210 ? 76.958  71.261  101.395 1.00 41.55  ? 207 ILE C CA  1 
ATOM 9433  C C   . ILE C 1 210 ? 76.171  71.452  102.675 1.00 65.79  ? 207 ILE C C   1 
ATOM 9434  O O   . ILE C 1 210 ? 75.487  72.466  102.834 1.00 62.58  ? 207 ILE C O   1 
ATOM 9435  C CB  . ILE C 1 210 ? 77.651  72.560  101.094 1.00 57.72  ? 207 ILE C CB  1 
ATOM 9436  C CG1 . ILE C 1 210 ? 78.480  72.421  99.816  1.00 49.57  ? 207 ILE C CG1 1 
ATOM 9437  C CG2 . ILE C 1 210 ? 78.484  72.983  102.273 1.00 48.01  ? 207 ILE C CG2 1 
ATOM 9438  C CD1 . ILE C 1 210 ? 78.927  73.743  99.237  1.00 56.01  ? 207 ILE C CD1 1 
ATOM 9439  N N   . SER C 1 211 ? 76.261  70.481  103.580 1.00 67.09  ? 208 SER C N   1 
ATOM 9440  C CA  . SER C 1 211 ? 75.430  70.484  104.783 1.00 77.67  ? 208 SER C CA  1 
ATOM 9441  C C   . SER C 1 211 ? 76.200  70.917  106.041 1.00 55.37  ? 208 SER C C   1 
ATOM 9442  O O   . SER C 1 211 ? 77.436  70.871  106.063 1.00 71.31  ? 208 SER C O   1 
ATOM 9443  C CB  . SER C 1 211 ? 74.715  69.132  104.963 1.00 50.39  ? 208 SER C CB  1 
ATOM 9444  O OG  . SER C 1 211 ? 75.632  68.053  104.953 1.00 70.93  ? 208 SER C OG  1 
ATOM 9445  N N   . PRO C 1 212 ? 75.459  71.371  107.076 1.00 78.35  ? 209 PRO C N   1 
ATOM 9446  C CA  . PRO C 1 212 ? 75.981  71.843  108.364 1.00 87.52  ? 209 PRO C CA  1 
ATOM 9447  C C   . PRO C 1 212 ? 75.835  70.803  109.491 1.00 88.00  ? 209 PRO C C   1 
ATOM 9448  O O   . PRO C 1 212 ? 75.191  69.755  109.318 1.00 74.30  ? 209 PRO C O   1 
ATOM 9449  C CB  . PRO C 1 212 ? 75.050  73.002  108.668 1.00 70.98  ? 209 PRO C CB  1 
ATOM 9450  C CG  . PRO C 1 212 ? 73.701  72.448  108.226 1.00 68.84  ? 209 PRO C CG  1 
ATOM 9451  C CD  . PRO C 1 212 ? 73.998  71.581  106.998 1.00 76.66  ? 209 PRO C CD  1 
ATOM 9452  N N   . PHE C 1 213 ? 76.403  71.115  110.653 1.00 74.90  ? 210 PHE C N   1 
ATOM 9453  C CA  . PHE C 1 213 ? 76.421  70.177  111.773 1.00 72.17  ? 210 PHE C CA  1 
ATOM 9454  C C   . PHE C 1 213 ? 75.078  70.054  112.517 1.00 78.15  ? 210 PHE C C   1 
ATOM 9455  O O   . PHE C 1 213 ? 74.735  68.985  113.026 1.00 84.25  ? 210 PHE C O   1 
ATOM 9456  C CB  . PHE C 1 213 ? 77.507  70.579  112.771 1.00 66.53  ? 210 PHE C CB  1 
ATOM 9457  C CG  . PHE C 1 213 ? 77.109  71.720  113.674 1.00 77.89  ? 210 PHE C CG  1 
ATOM 9458  C CD1 . PHE C 1 213 ? 76.389  71.488  114.848 1.00 62.16  ? 210 PHE C CD1 1 
ATOM 9459  C CD2 . PHE C 1 213 ? 77.451  73.024  113.349 1.00 65.61  ? 210 PHE C CD2 1 
ATOM 9460  C CE1 . PHE C 1 213 ? 76.013  72.547  115.675 1.00 86.68  ? 210 PHE C CE1 1 
ATOM 9461  C CE2 . PHE C 1 213 ? 77.089  74.087  114.176 1.00 73.53  ? 210 PHE C CE2 1 
ATOM 9462  C CZ  . PHE C 1 213 ? 76.372  73.854  115.340 1.00 62.89  ? 210 PHE C CZ  1 
ATOM 9463  N N   . ASN C 1 214 ? 74.330  71.149  112.588 1.00 66.09  ? 211 ASN C N   1 
ATOM 9464  C CA  . ASN C 1 214 ? 73.224  71.256  113.538 1.00 85.57  ? 211 ASN C CA  1 
ATOM 9465  C C   . ASN C 1 214 ? 72.033  70.293  113.320 1.00 89.16  ? 211 ASN C C   1 
ATOM 9466  O O   . ASN C 1 214 ? 71.332  69.940  114.277 1.00 73.12  ? 211 ASN C O   1 
ATOM 9467  C CB  . ASN C 1 214 ? 72.756  72.717  113.649 1.00 86.67  ? 211 ASN C CB  1 
ATOM 9468  N N   . PHE C 1 215 ? 71.793  69.877  112.075 1.00 66.62  ? 212 PHE C N   1 
ATOM 9469  C CA  . PHE C 1 215 ? 70.738  68.896  111.821 1.00 67.50  ? 212 PHE C CA  1 
ATOM 9470  C C   . PHE C 1 215 ? 71.204  67.766  110.926 1.00 71.21  ? 212 PHE C C   1 
ATOM 9471  O O   . PHE C 1 215 ? 71.800  67.990  109.869 1.00 84.86  ? 212 PHE C O   1 
ATOM 9472  C CB  . PHE C 1 215 ? 69.465  69.546  111.264 1.00 61.30  ? 212 PHE C CB  1 
ATOM 9473  C CG  . PHE C 1 215 ? 68.671  70.306  112.297 1.00 77.15  ? 212 PHE C CG  1 
ATOM 9474  C CD1 . PHE C 1 215 ? 68.937  71.652  112.548 1.00 76.40  ? 212 PHE C CD1 1 
ATOM 9475  C CD2 . PHE C 1 215 ? 67.663  69.674  113.023 1.00 90.71  ? 212 PHE C CD2 1 
ATOM 9476  C CE1 . PHE C 1 215 ? 68.215  72.354  113.498 1.00 80.93  ? 212 PHE C CE1 1 
ATOM 9477  C CE2 . PHE C 1 215 ? 66.931  70.366  113.979 1.00 87.75  ? 212 PHE C CE2 1 
ATOM 9478  C CZ  . PHE C 1 215 ? 67.207  71.711  114.219 1.00 100.59 ? 212 PHE C CZ  1 
ATOM 9479  N N   . THR C 1 216 ? 70.952  66.546  111.389 1.00 73.79  ? 213 THR C N   1 
ATOM 9480  C CA  . THR C 1 216 ? 71.208  65.348  110.605 1.00 80.24  ? 213 THR C CA  1 
ATOM 9481  C C   . THR C 1 216 ? 70.241  65.291  109.419 1.00 86.14  ? 213 THR C C   1 
ATOM 9482  O O   . THR C 1 216 ? 70.616  64.865  108.325 1.00 66.68  ? 213 THR C O   1 
ATOM 9483  C CB  . THR C 1 216 ? 71.013  64.088  111.454 1.00 66.81  ? 213 THR C CB  1 
ATOM 9484  O OG1 . THR C 1 216 ? 71.884  64.133  112.586 1.00 79.12  ? 213 THR C OG1 1 
ATOM 9485  C CG2 . THR C 1 216 ? 71.296  62.825  110.637 1.00 51.91  ? 213 THR C CG2 1 
ATOM 9486  N N   . ALA C 1 217 ? 69.002  65.726  109.655 1.00 69.36  ? 214 ALA C N   1 
ATOM 9487  C CA  . ALA C 1 217 ? 67.951  65.737  108.642 1.00 64.11  ? 214 ALA C CA  1 
ATOM 9488  C C   . ALA C 1 217 ? 68.313  66.630  107.461 1.00 72.94  ? 214 ALA C C   1 
ATOM 9489  O O   . ALA C 1 217 ? 67.946  66.341  106.321 1.00 74.06  ? 214 ALA C O   1 
ATOM 9490  C CB  . ALA C 1 217 ? 66.599  66.194  109.260 1.00 46.44  ? 214 ALA C CB  1 
ATOM 9491  N N   . ILE C 1 218 ? 69.019  67.723  107.738 1.00 80.62  ? 215 ILE C N   1 
ATOM 9492  C CA  . ILE C 1 218 ? 69.327  68.704  106.703 1.00 78.94  ? 215 ILE C CA  1 
ATOM 9493  C C   . ILE C 1 218 ? 70.302  68.154  105.658 1.00 85.47  ? 215 ILE C C   1 
ATOM 9494  O O   . ILE C 1 218 ? 70.158  68.427  104.469 1.00 77.20  ? 215 ILE C O   1 
ATOM 9495  C CB  . ILE C 1 218 ? 69.841  70.036  107.301 1.00 91.59  ? 215 ILE C CB  1 
ATOM 9496  C CG1 . ILE C 1 218 ? 68.692  70.770  107.996 1.00 78.79  ? 215 ILE C CG1 1 
ATOM 9497  C CG2 . ILE C 1 218 ? 70.461  70.933  106.211 1.00 63.65  ? 215 ILE C CG2 1 
ATOM 9498  C CD1 . ILE C 1 218 ? 69.097  72.107  108.568 1.00 80.77  ? 215 ILE C CD1 1 
ATOM 9499  N N   . GLY C 1 219 ? 71.287  67.375  106.088 1.00 65.41  ? 216 GLY C N   1 
ATOM 9500  C CA  . GLY C 1 219 ? 72.175  66.740  105.130 1.00 70.56  ? 216 GLY C CA  1 
ATOM 9501  C C   . GLY C 1 219 ? 71.355  65.831  104.235 1.00 75.11  ? 216 GLY C C   1 
ATOM 9502  O O   . GLY C 1 219 ? 71.476  65.835  103.012 1.00 65.87  ? 216 GLY C O   1 
ATOM 9503  N N   . GLY C 1 220 ? 70.485  65.055  104.862 1.00 60.97  ? 217 GLY C N   1 
ATOM 9504  C CA  . GLY C 1 220 ? 69.649  64.133  104.130 1.00 67.72  ? 217 GLY C CA  1 
ATOM 9505  C C   . GLY C 1 220 ? 68.856  64.823  103.046 1.00 66.46  ? 217 GLY C C   1 
ATOM 9506  O O   . GLY C 1 220 ? 68.727  64.299  101.941 1.00 84.61  ? 217 GLY C O   1 
ATOM 9507  N N   . ASN C 1 221 ? 68.311  65.995  103.362 1.00 64.95  ? 218 ASN C N   1 
ATOM 9508  C CA  . ASN C 1 221 ? 67.422  66.691  102.432 1.00 62.57  ? 218 ASN C CA  1 
ATOM 9509  C C   . ASN C 1 221 ? 68.185  67.495  101.373 1.00 61.75  ? 218 ASN C C   1 
ATOM 9510  O O   . ASN C 1 221 ? 67.749  67.589  100.227 1.00 61.04  ? 218 ASN C O   1 
ATOM 9511  C CB  . ASN C 1 221 ? 66.426  67.571  103.191 1.00 48.12  ? 218 ASN C CB  1 
ATOM 9512  C CG  . ASN C 1 221 ? 65.465  68.301  102.269 1.00 56.48  ? 218 ASN C CG  1 
ATOM 9513  O OD1 . ASN C 1 221 ? 65.482  69.519  102.186 1.00 59.99  ? 218 ASN C OD1 1 
ATOM 9514  N ND2 . ASN C 1 221 ? 64.630  67.552  101.570 1.00 61.95  ? 218 ASN C ND2 1 
ATOM 9515  N N   . LEU C 1 222 ? 69.337  68.043  101.751 1.00 62.41  ? 219 LEU C N   1 
ATOM 9516  C CA  . LEU C 1 222 ? 70.173  68.801  100.819 1.00 56.09  ? 219 LEU C CA  1 
ATOM 9517  C C   . LEU C 1 222 ? 70.654  67.936  99.657  1.00 67.48  ? 219 LEU C C   1 
ATOM 9518  O O   . LEU C 1 222 ? 70.742  68.407  98.521  1.00 50.84  ? 219 LEU C O   1 
ATOM 9519  C CB  . LEU C 1 222 ? 71.392  69.405  101.537 1.00 52.61  ? 219 LEU C CB  1 
ATOM 9520  C CG  . LEU C 1 222 ? 71.107  70.568  102.492 1.00 68.42  ? 219 LEU C CG  1 
ATOM 9521  C CD1 . LEU C 1 222 ? 72.404  71.210  103.000 1.00 46.30  ? 219 LEU C CD1 1 
ATOM 9522  C CD2 . LEU C 1 222 ? 70.221  71.601  101.827 1.00 45.16  ? 219 LEU C CD2 1 
ATOM 9523  N N   . ALA C 1 223 ? 70.993  66.678  99.953  1.00 57.35  ? 220 ALA C N   1 
ATOM 9524  C CA  . ALA C 1 223 ? 71.443  65.725  98.926  1.00 54.83  ? 220 ALA C CA  1 
ATOM 9525  C C   . ALA C 1 223 ? 70.285  64.897  98.388  1.00 54.81  ? 220 ALA C C   1 
ATOM 9526  O O   . ALA C 1 223 ? 70.264  64.546  97.213  1.00 51.87  ? 220 ALA C O   1 
ATOM 9527  C CB  . ALA C 1 223 ? 72.532  64.815  99.472  1.00 51.43  ? 220 ALA C CB  1 
ATOM 9528  N N   . GLY C 1 224 ? 69.315  64.629  99.263  1.00 51.14  ? 221 GLY C N   1 
ATOM 9529  C CA  . GLY C 1 224 ? 68.167  63.788  98.968  1.00 36.26  ? 221 GLY C CA  1 
ATOM 9530  C C   . GLY C 1 224 ? 67.149  64.366  97.996  1.00 44.50  ? 221 GLY C C   1 
ATOM 9531  O O   . GLY C 1 224 ? 66.764  63.712  97.029  1.00 52.04  ? 221 GLY C O   1 
ATOM 9532  N N   . ALA C 1 225 ? 66.708  65.594  98.251  1.00 42.11  ? 222 ALA C N   1 
ATOM 9533  C CA  . ALA C 1 225 ? 65.710  66.236  97.394  1.00 42.44  ? 222 ALA C CA  1 
ATOM 9534  C C   . ALA C 1 225 ? 66.177  66.361  95.946  1.00 41.81  ? 222 ALA C C   1 
ATOM 9535  O O   . ALA C 1 225 ? 65.460  65.967  95.030  1.00 56.14  ? 222 ALA C O   1 
ATOM 9536  C CB  . ALA C 1 225 ? 65.279  67.604  97.957  1.00 43.58  ? 222 ALA C CB  1 
ATOM 9537  N N   . PRO C 1 226 ? 67.391  66.893  95.726  1.00 54.17  ? 223 PRO C N   1 
ATOM 9538  C CA  . PRO C 1 226 ? 67.875  66.961  94.341  1.00 34.87  ? 223 PRO C CA  1 
ATOM 9539  C C   . PRO C 1 226 ? 68.043  65.590  93.690  1.00 52.35  ? 223 PRO C C   1 
ATOM 9540  O O   . PRO C 1 226 ? 67.712  65.455  92.513  1.00 47.36  ? 223 PRO C O   1 
ATOM 9541  C CB  . PRO C 1 226 ? 69.228  67.660  94.476  1.00 41.06  ? 223 PRO C CB  1 
ATOM 9542  C CG  . PRO C 1 226 ? 69.134  68.422  95.739  1.00 48.68  ? 223 PRO C CG  1 
ATOM 9543  C CD  . PRO C 1 226 ? 68.321  67.547  96.662  1.00 47.23  ? 223 PRO C CD  1 
ATOM 9544  N N   . ALA C 1 227 ? 68.554  64.605  94.428  1.00 47.40  ? 224 ALA C N   1 
ATOM 9545  C CA  . ALA C 1 227 ? 68.668  63.244  93.903  1.00 44.43  ? 224 ALA C CA  1 
ATOM 9546  C C   . ALA C 1 227 ? 67.302  62.691  93.506  1.00 54.80  ? 224 ALA C C   1 
ATOM 9547  O O   . ALA C 1 227 ? 67.159  62.114  92.427  1.00 48.11  ? 224 ALA C O   1 
ATOM 9548  C CB  . ALA C 1 227 ? 69.343  62.308  94.916  1.00 42.93  ? 224 ALA C CB  1 
ATOM 9549  N N   . LEU C 1 228 ? 66.307  62.863  94.381  1.00 47.50  ? 225 LEU C N   1 
ATOM 9550  C CA  . LEU C 1 228 ? 64.940  62.424  94.091  1.00 52.07  ? 225 LEU C CA  1 
ATOM 9551  C C   . LEU C 1 228 ? 64.417  62.984  92.762  1.00 50.05  ? 225 LEU C C   1 
ATOM 9552  O O   . LEU C 1 228 ? 63.714  62.303  92.029  1.00 58.01  ? 225 LEU C O   1 
ATOM 9553  C CB  . LEU C 1 228 ? 63.995  62.808  95.230  1.00 34.33  ? 225 LEU C CB  1 
ATOM 9554  C CG  . LEU C 1 228 ? 62.503  62.728  94.878  1.00 42.40  ? 225 LEU C CG  1 
ATOM 9555  C CD1 . LEU C 1 228 ? 62.043  61.288  94.822  1.00 44.74  ? 225 LEU C CD1 1 
ATOM 9556  C CD2 . LEU C 1 228 ? 61.679  63.496  95.885  1.00 40.38  ? 225 LEU C CD2 1 
ATOM 9557  N N   . MET C 1 229 ? 64.774  64.225  92.457  1.00 50.19  ? 226 MET C N   1 
ATOM 9558  C CA  . MET C 1 229 ? 64.283  64.879  91.252  1.00 46.05  ? 226 MET C CA  1 
ATOM 9559  C C   . MET C 1 229 ? 65.122  64.569  89.999  1.00 70.27  ? 226 MET C C   1 
ATOM 9560  O O   . MET C 1 229 ? 64.935  65.185  88.941  1.00 57.48  ? 226 MET C O   1 
ATOM 9561  C CB  . MET C 1 229 ? 64.129  66.389  91.449  1.00 36.95  ? 226 MET C CB  1 
ATOM 9562  C CG  . MET C 1 229 ? 63.139  66.790  92.551  1.00 41.84  ? 226 MET C CG  1 
ATOM 9563  S SD  . MET C 1 229 ? 61.547  66.026  92.371  1.00 42.71  ? 226 MET C SD  1 
ATOM 9564  C CE  . MET C 1 229 ? 60.873  67.003  91.051  1.00 59.30  ? 226 MET C CE  1 
ATOM 9565  N N   . GLY C 1 230 ? 66.028  63.603  90.104  1.00 60.16  ? 227 GLY C N   1 
ATOM 9566  C CA  . GLY C 1 230 ? 66.705  63.108  88.915  1.00 51.51  ? 227 GLY C CA  1 
ATOM 9567  C C   . GLY C 1 230 ? 68.118  63.612  88.726  1.00 52.32  ? 227 GLY C C   1 
ATOM 9568  O O   . GLY C 1 230 ? 68.710  63.427  87.668  1.00 59.57  ? 227 GLY C O   1 
ATOM 9569  N N   . ASN C 1 231 ? 68.650  64.258  89.754  1.00 56.17  ? 228 ASN C N   1 
ATOM 9570  C CA  . ASN C 1 231 ? 69.997  64.811  89.733  1.00 40.79  ? 228 ASN C CA  1 
ATOM 9571  C C   . ASN C 1 231 ? 71.019  63.868  90.338  1.00 54.86  ? 228 ASN C C   1 
ATOM 9572  O O   . ASN C 1 231 ? 70.665  62.952  91.069  1.00 62.52  ? 228 ASN C O   1 
ATOM 9573  C CB  . ASN C 1 231 ? 70.037  66.129  90.508  1.00 48.76  ? 228 ASN C CB  1 
ATOM 9574  C CG  . ASN C 1 231 ? 69.219  67.216  89.843  1.00 61.07  ? 228 ASN C CG  1 
ATOM 9575  O OD1 . ASN C 1 231 ? 69.630  67.768  88.830  1.00 59.31  ? 228 ASN C OD1 1 
ATOM 9576  N ND2 . ASN C 1 231 ? 68.060  67.533  90.415  1.00 46.49  ? 228 ASN C ND2 1 
ATOM 9577  N N   . VAL C 1 232 ? 72.291  64.096  90.024  1.00 55.19  ? 229 VAL C N   1 
ATOM 9578  C CA  . VAL C 1 232 ? 73.384  63.383  90.668  1.00 50.13  ? 229 VAL C CA  1 
ATOM 9579  C C   . VAL C 1 232 ? 74.084  64.390  91.568  1.00 58.64  ? 229 VAL C C   1 
ATOM 9580  O O   . VAL C 1 232 ? 74.141  65.579  91.242  1.00 55.10  ? 229 VAL C O   1 
ATOM 9581  C CB  . VAL C 1 232 ? 74.361  62.743  89.641  1.00 47.57  ? 229 VAL C CB  1 
ATOM 9582  C CG1 . VAL C 1 232 ? 73.628  61.750  88.765  1.00 51.92  ? 229 VAL C CG1 1 
ATOM 9583  C CG2 . VAL C 1 232 ? 74.997  63.796  88.778  1.00 45.17  ? 229 VAL C CG2 1 
ATOM 9584  N N   . VAL C 1 233 ? 74.596  63.935  92.708  1.00 53.14  ? 230 VAL C N   1 
ATOM 9585  C CA  . VAL C 1 233 ? 74.994  64.866  93.763  1.00 42.76  ? 230 VAL C CA  1 
ATOM 9586  C C   . VAL C 1 233 ? 76.360  64.534  94.337  1.00 45.67  ? 230 VAL C C   1 
ATOM 9587  O O   . VAL C 1 233 ? 76.661  63.372  94.571  1.00 59.35  ? 230 VAL C O   1 
ATOM 9588  C CB  . VAL C 1 233 ? 73.962  64.853  94.919  1.00 55.94  ? 230 VAL C CB  1 
ATOM 9589  C CG1 . VAL C 1 233 ? 74.413  65.737  96.068  1.00 34.47  ? 230 VAL C CG1 1 
ATOM 9590  C CG2 . VAL C 1 233 ? 72.573  65.267  94.425  1.00 37.03  ? 230 VAL C CG2 1 
ATOM 9591  N N   . LEU C 1 234 ? 77.191  65.558  94.535  1.00 51.56  ? 231 LEU C N   1 
ATOM 9592  C CA  . LEU C 1 234 ? 78.372  65.445  95.389  1.00 46.40  ? 231 LEU C CA  1 
ATOM 9593  C C   . LEU C 1 234 ? 78.043  66.033  96.752  1.00 52.82  ? 231 LEU C C   1 
ATOM 9594  O O   . LEU C 1 234 ? 77.863  67.243  96.891  1.00 58.15  ? 231 LEU C O   1 
ATOM 9595  C CB  . LEU C 1 234 ? 79.566  66.193  94.808  1.00 50.18  ? 231 LEU C CB  1 
ATOM 9596  C CG  . LEU C 1 234 ? 80.583  65.355  94.051  1.00 57.78  ? 231 LEU C CG  1 
ATOM 9597  C CD1 . LEU C 1 234 ? 79.956  64.770  92.800  1.00 48.13  ? 231 LEU C CD1 1 
ATOM 9598  C CD2 . LEU C 1 234 ? 81.762  66.227  93.722  1.00 56.71  ? 231 LEU C CD2 1 
ATOM 9599  N N   . TRP C 1 235 ? 77.955  65.174  97.756  1.00 59.75  ? 232 TRP C N   1 
ATOM 9600  C CA  . TRP C 1 235 ? 77.593  65.610  99.098  1.00 55.69  ? 232 TRP C CA  1 
ATOM 9601  C C   . TRP C 1 235 ? 78.824  65.798  99.980  1.00 65.85  ? 232 TRP C C   1 
ATOM 9602  O O   . TRP C 1 235 ? 79.532  64.832  100.261 1.00 57.65  ? 232 TRP C O   1 
ATOM 9603  C CB  . TRP C 1 235 ? 76.671  64.564  99.712  1.00 51.88  ? 232 TRP C CB  1 
ATOM 9604  C CG  . TRP C 1 235 ? 76.168  64.906  101.057 1.00 68.06  ? 232 TRP C CG  1 
ATOM 9605  C CD1 . TRP C 1 235 ? 76.177  66.138  101.654 1.00 45.88  ? 232 TRP C CD1 1 
ATOM 9606  C CD2 . TRP C 1 235 ? 75.568  64.005  101.994 1.00 49.01  ? 232 TRP C CD2 1 
ATOM 9607  N NE1 . TRP C 1 235 ? 75.616  66.056  102.905 1.00 50.94  ? 232 TRP C NE1 1 
ATOM 9608  C CE2 . TRP C 1 235 ? 75.241  64.758  103.144 1.00 54.48  ? 232 TRP C CE2 1 
ATOM 9609  C CE3 . TRP C 1 235 ? 75.269  62.637  101.969 1.00 40.45  ? 232 TRP C CE3 1 
ATOM 9610  C CZ2 . TRP C 1 235 ? 74.637  64.187  104.264 1.00 55.55  ? 232 TRP C CZ2 1 
ATOM 9611  C CZ3 . TRP C 1 235 ? 74.657  62.071  103.075 1.00 49.56  ? 232 TRP C CZ3 1 
ATOM 9612  C CH2 . TRP C 1 235 ? 74.351  62.846  104.210 1.00 55.64  ? 232 TRP C CH2 1 
ATOM 9613  N N   . LYS C 1 236 ? 79.086  67.037  100.400 1.00 49.10  ? 233 LYS C N   1 
ATOM 9614  C CA  . LYS C 1 236 ? 80.084  67.303  101.437 1.00 41.10  ? 233 LYS C CA  1 
ATOM 9615  C C   . LYS C 1 236 ? 79.404  67.463  102.773 1.00 42.00  ? 233 LYS C C   1 
ATOM 9616  O O   . LYS C 1 236 ? 78.836  68.520  103.039 1.00 71.50  ? 233 LYS C O   1 
ATOM 9617  C CB  . LYS C 1 236 ? 80.901  68.575  101.149 1.00 49.01  ? 233 LYS C CB  1 
ATOM 9618  C CG  . LYS C 1 236 ? 81.932  68.899  102.282 1.00 56.06  ? 233 LYS C CG  1 
ATOM 9619  C CD  . LYS C 1 236 ? 82.285  70.394  102.390 1.00 46.43  ? 233 LYS C CD  1 
ATOM 9620  C CE  . LYS C 1 236 ? 82.102  70.908  103.824 1.00 73.35  ? 233 LYS C CE  1 
ATOM 9621  N NZ  . LYS C 1 236 ? 82.943  70.202  104.847 1.00 85.90  ? 233 LYS C NZ  1 
ATOM 9622  N N   . PRO C 1 237 ? 79.489  66.434  103.649 1.00 55.22  ? 234 PRO C N   1 
ATOM 9623  C CA  . PRO C 1 237 ? 78.828  66.539  104.952 1.00 56.36  ? 234 PRO C CA  1 
ATOM 9624  C C   . PRO C 1 237 ? 79.681  67.305  105.968 1.00 54.63  ? 234 PRO C C   1 
ATOM 9625  O O   . PRO C 1 237 ? 80.891  67.459  105.760 1.00 80.10  ? 234 PRO C O   1 
ATOM 9626  C CB  . PRO C 1 237 ? 78.650  65.077  105.379 1.00 56.40  ? 234 PRO C CB  1 
ATOM 9627  C CG  . PRO C 1 237 ? 79.256  64.235  104.277 1.00 53.13  ? 234 PRO C CG  1 
ATOM 9628  C CD  . PRO C 1 237 ? 80.149  65.132  103.496 1.00 48.70  ? 234 PRO C CD  1 
ATOM 9629  N N   . SER C 1 238 ? 79.047  67.789  107.039 1.00 56.54  ? 235 SER C N   1 
ATOM 9630  C CA  . SER C 1 238 ? 79.747  68.533  108.077 1.00 50.26  ? 235 SER C CA  1 
ATOM 9631  C C   . SER C 1 238 ? 80.651  67.591  108.860 1.00 70.47  ? 235 SER C C   1 
ATOM 9632  O O   . SER C 1 238 ? 80.240  66.498  109.269 1.00 55.80  ? 235 SER C O   1 
ATOM 9633  C CB  . SER C 1 238 ? 78.765  69.252  109.017 1.00 60.77  ? 235 SER C CB  1 
ATOM 9634  O OG  . SER C 1 238 ? 79.425  70.173  109.880 1.00 83.52  ? 235 SER C OG  1 
ATOM 9635  N N   . ASP C 1 239 ? 81.889  68.025  109.062 1.00 67.61  ? 236 ASP C N   1 
ATOM 9636  C CA  . ASP C 1 239 ? 82.890  67.220  109.748 1.00 62.29  ? 236 ASP C CA  1 
ATOM 9637  C C   . ASP C 1 239 ? 82.435  66.861  111.147 1.00 64.08  ? 236 ASP C C   1 
ATOM 9638  O O   . ASP C 1 239 ? 82.780  65.804  111.673 1.00 72.99  ? 236 ASP C O   1 
ATOM 9639  C CB  . ASP C 1 239 ? 84.218  67.963  109.811 1.00 49.77  ? 236 ASP C CB  1 
ATOM 9640  C CG  . ASP C 1 239 ? 84.786  68.273  108.435 1.00 81.09  ? 236 ASP C CG  1 
ATOM 9641  O OD1 . ASP C 1 239 ? 84.215  67.828  107.406 1.00 105.48 ? 236 ASP C OD1 1 
ATOM 9642  O OD2 . ASP C 1 239 ? 85.817  68.969  108.393 1.00 71.57  ? 236 ASP C OD2 1 
ATOM 9643  N N   . THR C 1 240 ? 81.638  67.735  111.746 1.00 62.85  ? 237 THR C N   1 
ATOM 9644  C CA  . THR C 1 240 ? 81.134  67.473  113.088 1.00 53.81  ? 237 THR C CA  1 
ATOM 9645  C C   . THR C 1 240 ? 79.812  66.683  113.150 1.00 63.19  ? 237 THR C C   1 
ATOM 9646  O O   . THR C 1 240 ? 79.237  66.489  114.226 1.00 62.43  ? 237 THR C O   1 
ATOM 9647  C CB  . THR C 1 240 ? 81.022  68.777  113.911 1.00 69.61  ? 237 THR C CB  1 
ATOM 9648  O OG1 . THR C 1 240 ? 80.261  69.738  113.173 1.00 64.48  ? 237 THR C OG1 1 
ATOM 9649  C CG2 . THR C 1 240 ? 82.422  69.352  114.219 1.00 49.90  ? 237 THR C CG2 1 
ATOM 9650  N N   . ALA C 1 241 ? 79.339  66.213  112.001 1.00 73.39  ? 238 ALA C N   1 
ATOM 9651  C CA  . ALA C 1 241 ? 78.147  65.368  111.969 1.00 66.57  ? 238 ALA C CA  1 
ATOM 9652  C C   . ALA C 1 241 ? 78.390  64.109  111.147 1.00 67.16  ? 238 ALA C C   1 
ATOM 9653  O O   . ALA C 1 241 ? 77.438  63.428  110.759 1.00 64.01  ? 238 ALA C O   1 
ATOM 9654  C CB  . ALA C 1 241 ? 76.942  66.154  111.422 1.00 43.56  ? 238 ALA C CB  1 
ATOM 9655  N N   . MET C 1 242 ? 79.667  63.801  110.906 1.00 61.18  ? 239 MET C N   1 
ATOM 9656  C CA  . MET C 1 242 ? 80.066  62.725  109.991 1.00 63.39  ? 239 MET C CA  1 
ATOM 9657  C C   . MET C 1 242 ? 79.452  61.374  110.356 1.00 59.53  ? 239 MET C C   1 
ATOM 9658  O O   . MET C 1 242 ? 78.902  60.678  109.493 1.00 68.60  ? 239 MET C O   1 
ATOM 9659  C CB  . MET C 1 242 ? 81.595  62.636  109.907 1.00 67.13  ? 239 MET C CB  1 
ATOM 9660  C CG  . MET C 1 242 ? 82.125  61.785  108.778 1.00 73.70  ? 239 MET C CG  1 
ATOM 9661  S SD  . MET C 1 242 ? 81.727  62.443  107.171 1.00 53.51  ? 239 MET C SD  1 
ATOM 9662  C CE  . MET C 1 242 ? 81.887  64.191  107.493 1.00 43.83  ? 239 MET C CE  1 
ATOM 9663  N N   . LEU C 1 243 ? 79.520  61.010  111.636 1.00 64.67  ? 240 LEU C N   1 
ATOM 9664  C CA  . LEU C 1 243 ? 79.018  59.708  112.082 1.00 67.25  ? 240 LEU C CA  1 
ATOM 9665  C C   . LEU C 1 243 ? 77.567  59.459  111.663 1.00 69.02  ? 240 LEU C C   1 
ATOM 9666  O O   . LEU C 1 243 ? 77.251  58.458  111.023 1.00 68.19  ? 240 LEU C O   1 
ATOM 9667  C CB  . LEU C 1 243 ? 79.156  59.567  113.595 1.00 61.33  ? 240 LEU C CB  1 
ATOM 9668  C CG  . LEU C 1 243 ? 78.850  58.189  114.194 1.00 69.44  ? 240 LEU C CG  1 
ATOM 9669  C CD1 . LEU C 1 243 ? 79.877  57.154  113.751 1.00 45.30  ? 240 LEU C CD1 1 
ATOM 9670  C CD2 . LEU C 1 243 ? 78.812  58.267  115.701 1.00 73.41  ? 240 LEU C CD2 1 
ATOM 9671  N N   . ALA C 1 244 ? 76.687  60.378  112.030 1.00 69.32  ? 241 ALA C N   1 
ATOM 9672  C CA  . ALA C 1 244 ? 75.291  60.247  111.668 1.00 59.25  ? 241 ALA C CA  1 
ATOM 9673  C C   . ALA C 1 244 ? 75.033  60.473  110.171 1.00 63.89  ? 241 ALA C C   1 
ATOM 9674  O O   . ALA C 1 244 ? 74.136  59.858  109.613 1.00 53.25  ? 241 ALA C O   1 
ATOM 9675  C CB  . ALA C 1 244 ? 74.424  61.162  112.535 1.00 41.91  ? 241 ALA C CB  1 
ATOM 9676  N N   . SER C 1 245 ? 75.813  61.335  109.515 1.00 51.22  ? 242 SER C N   1 
ATOM 9677  C CA  . SER C 1 245 ? 75.597  61.603  108.082 1.00 53.42  ? 242 SER C CA  1 
ATOM 9678  C C   . SER C 1 245 ? 75.884  60.362  107.233 1.00 59.49  ? 242 SER C C   1 
ATOM 9679  O O   . SER C 1 245 ? 75.182  60.066  106.269 1.00 60.66  ? 242 SER C O   1 
ATOM 9680  C CB  . SER C 1 245 ? 76.459  62.768  107.586 1.00 52.51  ? 242 SER C CB  1 
ATOM 9681  O OG  . SER C 1 245 ? 76.190  63.964  108.290 1.00 55.65  ? 242 SER C OG  1 
ATOM 9682  N N   . TYR C 1 246 ? 76.929  59.637  107.598 1.00 64.33  ? 243 TYR C N   1 
ATOM 9683  C CA  . TYR C 1 246 ? 77.300  58.426  106.882 1.00 59.93  ? 243 TYR C CA  1 
ATOM 9684  C C   . TYR C 1 246 ? 76.286  57.318  107.134 1.00 58.77  ? 243 TYR C C   1 
ATOM 9685  O O   . TYR C 1 246 ? 76.076  56.441  106.296 1.00 56.19  ? 243 TYR C O   1 
ATOM 9686  C CB  . TYR C 1 246 ? 78.692  57.969  107.317 1.00 59.40  ? 243 TYR C CB  1 
ATOM 9687  C CG  . TYR C 1 246 ? 79.209  56.785  106.546 1.00 73.32  ? 243 TYR C CG  1 
ATOM 9688  C CD1 . TYR C 1 246 ? 79.505  55.593  107.187 1.00 66.77  ? 243 TYR C CD1 1 
ATOM 9689  C CD2 . TYR C 1 246 ? 79.387  56.855  105.170 1.00 75.01  ? 243 TYR C CD2 1 
ATOM 9690  C CE1 . TYR C 1 246 ? 79.976  54.509  106.482 1.00 63.13  ? 243 TYR C CE1 1 
ATOM 9691  C CE2 . TYR C 1 246 ? 79.862  55.772  104.454 1.00 68.44  ? 243 TYR C CE2 1 
ATOM 9692  C CZ  . TYR C 1 246 ? 80.153  54.603  105.120 1.00 72.00  ? 243 TYR C CZ  1 
ATOM 9693  O OH  . TYR C 1 246 ? 80.630  53.517  104.434 1.00 59.35  ? 243 TYR C OH  1 
ATOM 9694  N N   . ALA C 1 247 ? 75.665  57.355  108.305 1.00 47.49  ? 244 ALA C N   1 
ATOM 9695  C CA  . ALA C 1 247 ? 74.625  56.394  108.636 1.00 44.28  ? 244 ALA C CA  1 
ATOM 9696  C C   . ALA C 1 247 ? 73.404  56.642  107.759 1.00 69.99  ? 244 ALA C C   1 
ATOM 9697  O O   . ALA C 1 247 ? 72.723  55.700  107.314 1.00 47.11  ? 244 ALA C O   1 
ATOM 9698  C CB  . ALA C 1 247 ? 74.257  56.518  110.087 1.00 51.12  ? 244 ALA C CB  1 
ATOM 9699  N N   . VAL C 1 248 ? 73.121  57.919  107.516 1.00 47.46  ? 245 VAL C N   1 
ATOM 9700  C CA  . VAL C 1 248 ? 72.058  58.263  106.599 1.00 49.76  ? 245 VAL C CA  1 
ATOM 9701  C C   . VAL C 1 248 ? 72.438  57.799  105.198 1.00 48.50  ? 245 VAL C C   1 
ATOM 9702  O O   . VAL C 1 248 ? 71.636  57.184  104.516 1.00 50.51  ? 245 VAL C O   1 
ATOM 9703  C CB  . VAL C 1 248 ? 71.748  59.760  106.605 1.00 57.27  ? 245 VAL C CB  1 
ATOM 9704  C CG1 . VAL C 1 248 ? 70.782  60.082  105.478 1.00 42.68  ? 245 VAL C CG1 1 
ATOM 9705  C CG2 . VAL C 1 248 ? 71.174  60.165  107.960 1.00 44.45  ? 245 VAL C CG2 1 
ATOM 9706  N N   . TYR C 1 249 ? 73.673  58.063  104.784 1.00 58.83  ? 246 TYR C N   1 
ATOM 9707  C CA  . TYR C 1 249 ? 74.121  57.659  103.449 1.00 47.28  ? 246 TYR C CA  1 
ATOM 9708  C C   . TYR C 1 249 ? 74.039  56.144  103.228 1.00 61.55  ? 246 TYR C C   1 
ATOM 9709  O O   . TYR C 1 249 ? 73.572  55.691  102.191 1.00 54.26  ? 246 TYR C O   1 
ATOM 9710  C CB  . TYR C 1 249 ? 75.542  58.152  103.168 1.00 49.63  ? 246 TYR C CB  1 
ATOM 9711  C CG  . TYR C 1 249 ? 76.037  57.746  101.810 1.00 60.08  ? 246 TYR C CG  1 
ATOM 9712  C CD1 . TYR C 1 249 ? 75.614  58.413  100.683 1.00 44.46  ? 246 TYR C CD1 1 
ATOM 9713  C CD2 . TYR C 1 249 ? 76.907  56.678  101.649 1.00 53.63  ? 246 TYR C CD2 1 
ATOM 9714  C CE1 . TYR C 1 249 ? 76.048  58.045  99.429  1.00 54.16  ? 246 TYR C CE1 1 
ATOM 9715  C CE2 . TYR C 1 249 ? 77.350  56.300  100.389 1.00 52.39  ? 246 TYR C CE2 1 
ATOM 9716  C CZ  . TYR C 1 249 ? 76.912  56.994  99.282  1.00 60.96  ? 246 TYR C CZ  1 
ATOM 9717  O OH  . TYR C 1 249 ? 77.324  56.659  98.007  1.00 67.10  ? 246 TYR C OH  1 
ATOM 9718  N N   . ARG C 1 250 ? 74.497  55.364  104.202 1.00 56.35  ? 247 ARG C N   1 
ATOM 9719  C CA  . ARG C 1 250 ? 74.456  53.913  104.089 1.00 47.54  ? 247 ARG C CA  1 
ATOM 9720  C C   . ARG C 1 250 ? 73.024  53.387  103.983 1.00 48.91  ? 247 ARG C C   1 
ATOM 9721  O O   . ARG C 1 250 ? 72.739  52.470  103.213 1.00 54.99  ? 247 ARG C O   1 
ATOM 9722  C CB  . ARG C 1 250 ? 75.199  53.231  105.245 1.00 48.08  ? 247 ARG C CB  1 
ATOM 9723  C CG  . ARG C 1 250 ? 76.722  53.207  105.114 1.00 65.29  ? 247 ARG C CG  1 
ATOM 9724  C CD  . ARG C 1 250 ? 77.151  52.662  103.750 1.00 95.77  ? 247 ARG C CD  1 
ATOM 9725  N NE  . ARG C 1 250 ? 76.342  51.522  103.326 1.00 104.32 ? 247 ARG C NE  1 
ATOM 9726  C CZ  . ARG C 1 250 ? 76.425  50.955  102.127 1.00 92.88  ? 247 ARG C CZ  1 
ATOM 9727  N NH1 . ARG C 1 250 ? 77.291  51.425  101.236 1.00 79.73  ? 247 ARG C NH1 1 
ATOM 9728  N NH2 . ARG C 1 250 ? 75.644  49.922  101.823 1.00 70.93  ? 247 ARG C NH2 1 
ATOM 9729  N N   . ILE C 1 251 ? 72.116  53.975  104.745 1.00 51.07  ? 248 ILE C N   1 
ATOM 9730  C CA  . ILE C 1 251 ? 70.713  53.569  104.685 1.00 39.38  ? 248 ILE C CA  1 
ATOM 9731  C C   . ILE C 1 251 ? 70.082  53.814  103.291 1.00 64.99  ? 248 ILE C C   1 
ATOM 9732  O O   . ILE C 1 251 ? 69.343  52.969  102.787 1.00 48.04  ? 248 ILE C O   1 
ATOM 9733  C CB  . ILE C 1 251 ? 69.888  54.293  105.762 1.00 51.44  ? 248 ILE C CB  1 
ATOM 9734  C CG1 . ILE C 1 251 ? 70.213  53.742  107.144 1.00 52.31  ? 248 ILE C CG1 1 
ATOM 9735  C CG2 . ILE C 1 251 ? 68.383  54.187  105.476 1.00 39.57  ? 248 ILE C CG2 1 
ATOM 9736  C CD1 . ILE C 1 251 ? 69.683  54.598  108.278 1.00 45.74  ? 248 ILE C CD1 1 
ATOM 9737  N N   . LEU C 1 252 ? 70.372  54.965  102.681 1.00 49.94  ? 249 LEU C N   1 
ATOM 9738  C CA  . LEU C 1 252 ? 69.902  55.276  101.331 1.00 63.15  ? 249 LEU C CA  1 
ATOM 9739  C C   . LEU C 1 252 ? 70.433  54.292  100.307 1.00 56.00  ? 249 LEU C C   1 
ATOM 9740  O O   . LEU C 1 252 ? 69.700  53.858  99.425  1.00 67.10  ? 249 LEU C O   1 
ATOM 9741  C CB  . LEU C 1 252 ? 70.301  56.690  100.926 1.00 44.22  ? 249 LEU C CB  1 
ATOM 9742  C CG  . LEU C 1 252 ? 69.337  57.787  101.358 1.00 59.63  ? 249 LEU C CG  1 
ATOM 9743  C CD1 . LEU C 1 252 ? 69.945  59.150  101.109 1.00 55.00  ? 249 LEU C CD1 1 
ATOM 9744  C CD2 . LEU C 1 252 ? 68.029  57.637  100.621 1.00 46.74  ? 249 LEU C CD2 1 
ATOM 9745  N N   . ARG C 1 253 ? 71.706  53.944  100.424 1.00 45.35  ? 250 ARG C N   1 
ATOM 9746  C CA  . ARG C 1 253 ? 72.298  52.966  99.528  1.00 40.80  ? 250 ARG C CA  1 
ATOM 9747  C C   . ARG C 1 253 ? 71.620  51.614  99.690  1.00 63.58  ? 250 ARG C C   1 
ATOM 9748  O O   . ARG C 1 253 ? 71.322  50.953  98.694  1.00 58.34  ? 250 ARG C O   1 
ATOM 9749  C CB  . ARG C 1 253 ? 73.804  52.846  99.745  1.00 29.07  ? 250 ARG C CB  1 
ATOM 9750  C CG  . ARG C 1 253 ? 74.572  54.118  99.458  1.00 56.66  ? 250 ARG C CG  1 
ATOM 9751  C CD  . ARG C 1 253 ? 74.208  54.670  98.099  1.00 41.22  ? 250 ARG C CD  1 
ATOM 9752  N NE  . ARG C 1 253 ? 74.329  53.651  97.069  1.00 53.27  ? 250 ARG C NE  1 
ATOM 9753  C CZ  . ARG C 1 253 ? 75.475  53.309  96.492  1.00 51.31  ? 250 ARG C CZ  1 
ATOM 9754  N NH1 . ARG C 1 253 ? 76.598  53.915  96.840  1.00 52.02  ? 250 ARG C NH1 1 
ATOM 9755  N NH2 . ARG C 1 253 ? 75.502  52.368  95.565  1.00 54.95  ? 250 ARG C NH2 1 
ATOM 9756  N N   . GLU C 1 254 ? 71.355  51.216  100.935 1.00 41.49  ? 251 GLU C N   1 
ATOM 9757  C CA  . GLU C 1 254 ? 70.700  49.934  101.187 1.00 56.76  ? 251 GLU C CA  1 
ATOM 9758  C C   . GLU C 1 254 ? 69.255  49.957  100.742 1.00 56.54  ? 251 GLU C C   1 
ATOM 9759  O O   . GLU C 1 254 ? 68.708  48.933  100.318 1.00 45.74  ? 251 GLU C O   1 
ATOM 9760  C CB  . GLU C 1 254 ? 70.790  49.522  102.660 1.00 51.04  ? 251 GLU C CB  1 
ATOM 9761  C CG  . GLU C 1 254 ? 72.201  49.220  103.119 1.00 77.01  ? 251 GLU C CG  1 
ATOM 9762  C CD  . GLU C 1 254 ? 72.272  48.968  104.600 1.00 87.02  ? 251 GLU C CD  1 
ATOM 9763  O OE1 . GLU C 1 254 ? 71.225  48.593  105.167 1.00 72.31  ? 251 GLU C OE1 1 
ATOM 9764  O OE2 . GLU C 1 254 ? 73.360  49.160  105.184 1.00 79.46  ? 251 GLU C OE2 1 
ATOM 9765  N N   . ALA C 1 255 ? 68.630  51.125  100.843 1.00 50.93  ? 252 ALA C N   1 
ATOM 9766  C CA  . ALA C 1 255 ? 67.251  51.282  100.388 1.00 45.14  ? 252 ALA C CA  1 
ATOM 9767  C C   . ALA C 1 255 ? 67.134  51.213  98.856  1.00 66.83  ? 252 ALA C C   1 
ATOM 9768  O O   . ALA C 1 255 ? 66.032  51.197  98.301  1.00 51.42  ? 252 ALA C O   1 
ATOM 9769  C CB  . ALA C 1 255 ? 66.648  52.577  100.913 1.00 40.99  ? 252 ALA C CB  1 
ATOM 9770  N N   . GLY C 1 256 ? 68.266  51.189  98.164  1.00 44.81  ? 253 GLY C N   1 
ATOM 9771  C CA  . GLY C 1 256 ? 68.239  50.979  96.727  1.00 47.20  ? 253 GLY C CA  1 
ATOM 9772  C C   . GLY C 1 256 ? 68.881  52.041  95.837  1.00 55.96  ? 253 GLY C C   1 
ATOM 9773  O O   . GLY C 1 256 ? 68.983  51.825  94.647  1.00 55.19  ? 253 GLY C O   1 
ATOM 9774  N N   . LEU C 1 257 ? 69.313  53.165  96.406  1.00 52.19  ? 254 LEU C N   1 
ATOM 9775  C CA  . LEU C 1 257 ? 69.965  54.232  95.647  1.00 53.41  ? 254 LEU C CA  1 
ATOM 9776  C C   . LEU C 1 257 ? 71.156  53.697  94.882  1.00 48.90  ? 254 LEU C C   1 
ATOM 9777  O O   . LEU C 1 257 ? 72.086  53.171  95.480  1.00 56.90  ? 254 LEU C O   1 
ATOM 9778  C CB  . LEU C 1 257 ? 70.449  55.356  96.569  1.00 48.58  ? 254 LEU C CB  1 
ATOM 9779  C CG  . LEU C 1 257 ? 70.842  56.652  95.852  1.00 51.54  ? 254 LEU C CG  1 
ATOM 9780  C CD1 . LEU C 1 257 ? 69.606  57.385  95.379  1.00 38.76  ? 254 LEU C CD1 1 
ATOM 9781  C CD2 . LEU C 1 257 ? 71.666  57.541  96.748  1.00 51.77  ? 254 LEU C CD2 1 
ATOM 9782  N N   . PRO C 1 258 ? 71.132  53.832  93.548  1.00 51.70  ? 255 PRO C N   1 
ATOM 9783  C CA  . PRO C 1 258 ? 72.225  53.338  92.703  1.00 52.79  ? 255 PRO C CA  1 
ATOM 9784  C C   . PRO C 1 258 ? 73.526  54.098  92.950  1.00 56.01  ? 255 PRO C C   1 
ATOM 9785  O O   . PRO C 1 258 ? 73.513  55.223  93.466  1.00 68.71  ? 255 PRO C O   1 
ATOM 9786  C CB  . PRO C 1 258 ? 71.716  53.595  91.275  1.00 40.71  ? 255 PRO C CB  1 
ATOM 9787  C CG  . PRO C 1 258 ? 70.242  53.650  91.412  1.00 44.88  ? 255 PRO C CG  1 
ATOM 9788  C CD  . PRO C 1 258 ? 69.972  54.263  92.754  1.00 53.04  ? 255 PRO C CD  1 
ATOM 9789  N N   . PRO C 1 259 ? 74.651  53.474  92.595  1.00 61.94  ? 256 PRO C N   1 
ATOM 9790  C CA  . PRO C 1 259 ? 75.989  54.070  92.686  1.00 65.46  ? 256 PRO C CA  1 
ATOM 9791  C C   . PRO C 1 259 ? 76.090  55.354  91.886  1.00 52.77  ? 256 PRO C C   1 
ATOM 9792  O O   . PRO C 1 259 ? 75.439  55.475  90.849  1.00 53.82  ? 256 PRO C O   1 
ATOM 9793  C CB  . PRO C 1 259 ? 76.896  53.010  92.041  1.00 53.73  ? 256 PRO C CB  1 
ATOM 9794  C CG  . PRO C 1 259 ? 75.966  52.108  91.265  1.00 47.63  ? 256 PRO C CG  1 
ATOM 9795  C CD  . PRO C 1 259 ? 74.694  52.103  92.066  1.00 55.20  ? 256 PRO C CD  1 
ATOM 9796  N N   . ASN C 1 260 ? 76.890  56.301  92.364  1.00 51.43  ? 257 ASN C N   1 
ATOM 9797  C CA  . ASN C 1 260 ? 77.160  57.497  91.584  1.00 47.34  ? 257 ASN C CA  1 
ATOM 9798  C C   . ASN C 1 260 ? 75.989  58.456  91.488  1.00 57.00  ? 257 ASN C C   1 
ATOM 9799  O O   . ASN C 1 260 ? 76.068  59.452  90.770  1.00 65.32  ? 257 ASN C O   1 
ATOM 9800  C CB  . ASN C 1 260 ? 77.640  57.123  90.175  1.00 47.33  ? 257 ASN C CB  1 
ATOM 9801  C CG  . ASN C 1 260 ? 78.948  56.346  90.197  1.00 71.77  ? 257 ASN C CG  1 
ATOM 9802  O OD1 . ASN C 1 260 ? 79.948  56.787  90.783  1.00 60.91  ? 257 ASN C OD1 1 
ATOM 9803  N ND2 . ASN C 1 260 ? 78.940  55.167  89.578  1.00 54.03  ? 257 ASN C ND2 1 
ATOM 9804  N N   . ILE C 1 261 ? 74.899  58.162  92.191  1.00 51.06  ? 258 ILE C N   1 
ATOM 9805  C CA  . ILE C 1 261 ? 73.801  59.118  92.259  1.00 57.20  ? 258 ILE C CA  1 
ATOM 9806  C C   . ILE C 1 261 ? 74.083  60.104  93.391  1.00 56.84  ? 258 ILE C C   1 
ATOM 9807  O O   . ILE C 1 261 ? 73.890  61.314  93.239  1.00 49.17  ? 258 ILE C O   1 
ATOM 9808  C CB  . ILE C 1 261 ? 72.435  58.450  92.456  1.00 46.77  ? 258 ILE C CB  1 
ATOM 9809  C CG1 . ILE C 1 261 ? 72.191  57.408  91.364  1.00 61.37  ? 258 ILE C CG1 1 
ATOM 9810  C CG2 . ILE C 1 261 ? 71.337  59.502  92.483  1.00 39.45  ? 258 ILE C CG2 1 
ATOM 9811  C CD1 . ILE C 1 261 ? 72.351  57.918  89.946  1.00 37.53  ? 258 ILE C CD1 1 
ATOM 9812  N N   . ILE C 1 262 ? 74.560  59.593  94.517  1.00 51.30  ? 259 ILE C N   1 
ATOM 9813  C CA  . ILE C 1 262 ? 75.107  60.475  95.542  1.00 52.66  ? 259 ILE C CA  1 
ATOM 9814  C C   . ILE C 1 262 ? 76.507  60.025  95.935  1.00 48.47  ? 259 ILE C C   1 
ATOM 9815  O O   . ILE C 1 262 ? 76.712  58.879  96.362  1.00 59.62  ? 259 ILE C O   1 
ATOM 9816  C CB  . ILE C 1 262 ? 74.217  60.558  96.803  1.00 55.85  ? 259 ILE C CB  1 
ATOM 9817  C CG1 . ILE C 1 262 ? 72.824  61.069  96.445  1.00 48.25  ? 259 ILE C CG1 1 
ATOM 9818  C CG2 . ILE C 1 262 ? 74.856  61.467  97.844  1.00 45.07  ? 259 ILE C CG2 1 
ATOM 9819  C CD1 . ILE C 1 262 ? 71.919  61.259  97.641  1.00 49.20  ? 259 ILE C CD1 1 
ATOM 9820  N N   . GLN C 1 263 ? 77.470  60.931  95.766  1.00 47.73  ? 260 GLN C N   1 
ATOM 9821  C CA  . GLN C 1 263 ? 78.856  60.684  96.156  1.00 48.81  ? 260 GLN C CA  1 
ATOM 9822  C C   . GLN C 1 263 ? 79.077  61.241  97.557  1.00 66.18  ? 260 GLN C C   1 
ATOM 9823  O O   . GLN C 1 263 ? 78.739  62.394  97.836  1.00 54.62  ? 260 GLN C O   1 
ATOM 9824  C CB  . GLN C 1 263 ? 79.842  61.329  95.174  1.00 55.79  ? 260 GLN C CB  1 
ATOM 9825  C CG  . GLN C 1 263 ? 79.572  61.083  93.670  1.00 57.91  ? 260 GLN C CG  1 
ATOM 9826  C CD  . GLN C 1 263 ? 79.667  59.616  93.262  1.00 69.00  ? 260 GLN C CD  1 
ATOM 9827  O OE1 . GLN C 1 263 ? 79.363  58.715  94.049  1.00 65.07  ? 260 GLN C OE1 1 
ATOM 9828  N NE2 . GLN C 1 263 ? 80.088  59.373  92.021  1.00 49.61  ? 260 GLN C NE2 1 
ATOM 9829  N N   . PHE C 1 264 ? 79.614  60.406  98.442  1.00 61.80  ? 261 PHE C N   1 
ATOM 9830  C CA  . PHE C 1 264 ? 79.875  60.800  99.818  1.00 52.21  ? 261 PHE C CA  1 
ATOM 9831  C C   . PHE C 1 264 ? 81.319  61.270  99.856  1.00 69.21  ? 261 PHE C C   1 
ATOM 9832  O O   . PHE C 1 264 ? 82.251  60.471  99.852  1.00 63.01  ? 261 PHE C O   1 
ATOM 9833  C CB  . PHE C 1 264 ? 79.652  59.610  100.764 1.00 54.06  ? 261 PHE C CB  1 
ATOM 9834  C CG  . PHE C 1 264 ? 79.494  59.984  102.229 1.00 60.59  ? 261 PHE C CG  1 
ATOM 9835  C CD1 . PHE C 1 264 ? 78.272  60.404  102.721 1.00 48.60  ? 261 PHE C CD1 1 
ATOM 9836  C CD2 . PHE C 1 264 ? 80.559  59.853  103.122 1.00 56.85  ? 261 PHE C CD2 1 
ATOM 9837  C CE1 . PHE C 1 264 ? 78.119  60.730  104.081 1.00 72.22  ? 261 PHE C CE1 1 
ATOM 9838  C CE2 . PHE C 1 264 ? 80.417  60.176  104.474 1.00 49.37  ? 261 PHE C CE2 1 
ATOM 9839  C CZ  . PHE C 1 264 ? 79.193  60.617  104.954 1.00 61.96  ? 261 PHE C CZ  1 
ATOM 9840  N N   . VAL C 1 265 ? 81.501  62.580  99.875  1.00 52.21  ? 262 VAL C N   1 
ATOM 9841  C CA  . VAL C 1 265 ? 82.829  63.155  99.768  1.00 64.91  ? 262 VAL C CA  1 
ATOM 9842  C C   . VAL C 1 265 ? 83.073  64.268  100.782 1.00 50.22  ? 262 VAL C C   1 
ATOM 9843  O O   . VAL C 1 265 ? 83.035  65.448  100.423 1.00 60.27  ? 262 VAL C O   1 
ATOM 9844  C CB  . VAL C 1 265 ? 83.070  63.695  98.334  1.00 58.46  ? 262 VAL C CB  1 
ATOM 9845  C CG1 . VAL C 1 265 ? 83.362  62.555  97.391  1.00 47.64  ? 262 VAL C CG1 1 
ATOM 9846  C CG2 . VAL C 1 265 ? 81.854  64.467  97.850  1.00 43.79  ? 262 VAL C CG2 1 
ATOM 9847  N N   . PRO C 1 266 ? 83.334  63.902  102.048 1.00 62.31  ? 263 PRO C N   1 
ATOM 9848  C CA  . PRO C 1 266 ? 83.781  64.917  103.018 1.00 58.39  ? 263 PRO C CA  1 
ATOM 9849  C C   . PRO C 1 266 ? 85.007  65.626  102.456 1.00 60.51  ? 263 PRO C C   1 
ATOM 9850  O O   . PRO C 1 266 ? 85.781  65.031  101.702 1.00 59.87  ? 263 PRO C O   1 
ATOM 9851  C CB  . PRO C 1 266 ? 84.186  64.094  104.250 1.00 50.59  ? 263 PRO C CB  1 
ATOM 9852  C CG  . PRO C 1 266 ? 83.520  62.755  104.082 1.00 63.38  ? 263 PRO C CG  1 
ATOM 9853  C CD  . PRO C 1 266 ? 83.401  62.534  102.592 1.00 64.10  ? 263 PRO C CD  1 
ATOM 9854  N N   . ALA C 1 267 ? 85.193  66.890  102.800 1.00 69.17  ? 264 ALA C N   1 
ATOM 9855  C CA  . ALA C 1 267 ? 86.335  67.617  102.267 1.00 55.39  ? 264 ALA C CA  1 
ATOM 9856  C C   . ALA C 1 267 ? 86.575  68.922  103.027 1.00 59.62  ? 264 ALA C C   1 
ATOM 9857  O O   . ALA C 1 267 ? 85.729  69.368  103.801 1.00 77.08  ? 264 ALA C O   1 
ATOM 9858  C CB  . ALA C 1 267 ? 86.145  67.871  100.763 1.00 51.88  ? 264 ALA C CB  1 
ATOM 9859  N N   . ASP C 1 268 ? 87.750  69.512  102.838 1.00 69.49  ? 265 ASP C N   1 
ATOM 9860  C CA  . ASP C 1 268 ? 88.000  70.860  103.324 1.00 65.49  ? 265 ASP C CA  1 
ATOM 9861  C C   . ASP C 1 268 ? 87.017  71.782  102.608 1.00 73.34  ? 265 ASP C C   1 
ATOM 9862  O O   . ASP C 1 268 ? 86.828  71.676  101.389 1.00 64.02  ? 265 ASP C O   1 
ATOM 9863  C CB  . ASP C 1 268 ? 89.438  71.277  103.021 1.00 63.71  ? 265 ASP C CB  1 
ATOM 9864  C CG  . ASP C 1 268 ? 89.732  72.721  103.422 1.00 95.69  ? 265 ASP C CG  1 
ATOM 9865  O OD1 . ASP C 1 268 ? 89.752  73.019  104.641 1.00 89.03  ? 265 ASP C OD1 1 
ATOM 9866  O OD2 . ASP C 1 268 ? 89.958  73.550  102.512 1.00 93.66  ? 265 ASP C OD2 1 
ATOM 9867  N N   . GLY C 1 269 ? 86.381  72.674  103.364 1.00 81.96  ? 266 GLY C N   1 
ATOM 9868  C CA  . GLY C 1 269 ? 85.341  73.537  102.818 1.00 53.91  ? 266 GLY C CA  1 
ATOM 9869  C C   . GLY C 1 269 ? 85.766  74.274  101.558 1.00 82.37  ? 266 GLY C C   1 
ATOM 9870  O O   . GLY C 1 269 ? 85.177  74.086  100.493 1.00 76.35  ? 266 GLY C O   1 
ATOM 9871  N N   . PRO C 1 270 ? 86.797  75.126  101.674 1.00 84.51  ? 267 PRO C N   1 
ATOM 9872  C CA  . PRO C 1 270 ? 87.301  75.934  100.554 1.00 66.58  ? 267 PRO C CA  1 
ATOM 9873  C C   . PRO C 1 270 ? 87.685  75.096  99.336  1.00 73.85  ? 267 PRO C C   1 
ATOM 9874  O O   . PRO C 1 270 ? 87.301  75.435  98.219  1.00 82.45  ? 267 PRO C O   1 
ATOM 9875  C CB  . PRO C 1 270 ? 88.532  76.612  101.148 1.00 66.82  ? 267 PRO C CB  1 
ATOM 9876  C CG  . PRO C 1 270 ? 88.202  76.739  102.618 1.00 61.87  ? 267 PRO C CG  1 
ATOM 9877  C CD  . PRO C 1 270 ? 87.468  75.461  102.945 1.00 70.99  ? 267 PRO C CD  1 
ATOM 9878  N N   . LEU C 1 271 ? 88.426  74.014  99.543  1.00 72.76  ? 268 LEU C N   1 
ATOM 9879  C CA  . LEU C 1 271 ? 88.814  73.142  98.432  1.00 73.29  ? 268 LEU C CA  1 
ATOM 9880  C C   . LEU C 1 271 ? 87.597  72.556  97.688  1.00 70.30  ? 268 LEU C C   1 
ATOM 9881  O O   . LEU C 1 271 ? 87.570  72.500  96.457  1.00 61.95  ? 268 LEU C O   1 
ATOM 9882  C CB  . LEU C 1 271 ? 89.748  72.026  98.918  1.00 65.44  ? 268 LEU C CB  1 
ATOM 9883  C CG  . LEU C 1 271 ? 90.403  71.148  97.843  1.00 73.49  ? 268 LEU C CG  1 
ATOM 9884  C CD1 . LEU C 1 271 ? 89.536  69.959  97.476  1.00 71.09  ? 268 LEU C CD1 1 
ATOM 9885  C CD2 . LEU C 1 271 ? 90.752  71.971  96.596  1.00 77.02  ? 268 LEU C CD2 1 
ATOM 9886  N N   . PHE C 1 272 ? 86.590  72.125  98.438  1.00 61.87  ? 269 PHE C N   1 
ATOM 9887  C CA  . PHE C 1 272 ? 85.360  71.612  97.828  1.00 51.81  ? 269 PHE C CA  1 
ATOM 9888  C C   . PHE C 1 272 ? 84.673  72.725  97.038  1.00 67.71  ? 269 PHE C C   1 
ATOM 9889  O O   . PHE C 1 272 ? 84.313  72.556  95.871  1.00 70.82  ? 269 PHE C O   1 
ATOM 9890  C CB  . PHE C 1 272 ? 84.416  71.059  98.906  1.00 55.19  ? 269 PHE C CB  1 
ATOM 9891  C CG  . PHE C 1 272 ? 83.173  70.434  98.362  1.00 53.16  ? 269 PHE C CG  1 
ATOM 9892  C CD1 . PHE C 1 272 ? 83.166  69.105  97.954  1.00 50.13  ? 269 PHE C CD1 1 
ATOM 9893  C CD2 . PHE C 1 272 ? 82.001  71.169  98.262  1.00 54.44  ? 269 PHE C CD2 1 
ATOM 9894  C CE1 . PHE C 1 272 ? 82.019  68.530  97.439  1.00 68.12  ? 269 PHE C CE1 1 
ATOM 9895  C CE2 . PHE C 1 272 ? 80.840  70.592  97.745  1.00 60.39  ? 269 PHE C CE2 1 
ATOM 9896  C CZ  . PHE C 1 272 ? 80.854  69.274  97.335  1.00 58.10  ? 269 PHE C CZ  1 
ATOM 9897  N N   . GLY C 1 273 ? 84.501  73.872  97.683  1.00 69.54  ? 270 GLY C N   1 
ATOM 9898  C CA  . GLY C 1 273 ? 83.879  75.014  97.041  1.00 55.18  ? 270 GLY C CA  1 
ATOM 9899  C C   . GLY C 1 273 ? 84.606  75.402  95.781  1.00 66.80  ? 270 GLY C C   1 
ATOM 9900  O O   . GLY C 1 273 ? 83.981  75.650  94.751  1.00 63.87  ? 270 GLY C O   1 
ATOM 9901  N N   . ASP C 1 274 ? 85.934  75.446  95.862  1.00 65.55  ? 271 ASP C N   1 
ATOM 9902  C CA  . ASP C 1 274 ? 86.761  75.842  94.720  1.00 73.63  ? 271 ASP C CA  1 
ATOM 9903  C C   . ASP C 1 274 ? 86.609  74.858  93.556  1.00 73.90  ? 271 ASP C C   1 
ATOM 9904  O O   . ASP C 1 274 ? 86.515  75.257  92.398  1.00 62.92  ? 271 ASP C O   1 
ATOM 9905  C CB  . ASP C 1 274 ? 88.243  75.950  95.124  1.00 72.61  ? 271 ASP C CB  1 
ATOM 9906  C CG  . ASP C 1 274 ? 88.537  77.150  96.031  1.00 82.74  ? 271 ASP C CG  1 
ATOM 9907  O OD1 . ASP C 1 274 ? 87.601  77.890  96.411  1.00 83.31  ? 271 ASP C OD1 1 
ATOM 9908  O OD2 . ASP C 1 274 ? 89.727  77.341  96.376  1.00 99.68  ? 271 ASP C OD2 1 
ATOM 9909  N N   . THR C 1 275 ? 86.582  73.569  93.871  1.00 66.35  ? 272 THR C N   1 
ATOM 9910  C CA  . THR C 1 275 ? 86.551  72.539  92.833  1.00 52.86  ? 272 THR C CA  1 
ATOM 9911  C C   . THR C 1 275 ? 85.233  72.513  92.084  1.00 76.71  ? 272 THR C C   1 
ATOM 9912  O O   . THR C 1 275 ? 85.221  72.481  90.847  1.00 75.39  ? 272 THR C O   1 
ATOM 9913  C CB  . THR C 1 275 ? 86.811  71.139  93.409  1.00 59.70  ? 272 THR C CB  1 
ATOM 9914  O OG1 . THR C 1 275 ? 88.055  71.132  94.122  1.00 65.71  ? 272 THR C OG1 1 
ATOM 9915  C CG2 . THR C 1 275 ? 86.871  70.115  92.290  1.00 58.25  ? 272 THR C CG2 1 
ATOM 9916  N N   . VAL C 1 276 ? 84.126  72.524  92.826  1.00 69.53  ? 273 VAL C N   1 
ATOM 9917  C CA  . VAL C 1 276 ? 82.814  72.401  92.198  1.00 52.07  ? 273 VAL C CA  1 
ATOM 9918  C C   . VAL C 1 276 ? 82.415  73.666  91.435  1.00 67.23  ? 273 VAL C C   1 
ATOM 9919  O O   . VAL C 1 276 ? 81.795  73.579  90.373  1.00 68.41  ? 273 VAL C O   1 
ATOM 9920  C CB  . VAL C 1 276 ? 81.705  71.949  93.190  1.00 52.79  ? 273 VAL C CB  1 
ATOM 9921  C CG1 . VAL C 1 276 ? 82.082  70.656  93.855  1.00 51.41  ? 273 VAL C CG1 1 
ATOM 9922  C CG2 . VAL C 1 276 ? 81.437  73.020  94.228  1.00 60.11  ? 273 VAL C CG2 1 
ATOM 9923  N N   . THR C 1 277 ? 82.781  74.839  91.953  1.00 65.77  ? 274 THR C N   1 
ATOM 9924  C CA  . THR C 1 277 ? 82.494  76.080  91.223  1.00 61.24  ? 274 THR C CA  1 
ATOM 9925  C C   . THR C 1 277 ? 83.422  76.254  90.017  1.00 69.38  ? 274 THR C C   1 
ATOM 9926  O O   . THR C 1 277 ? 83.276  77.196  89.244  1.00 64.86  ? 274 THR C O   1 
ATOM 9927  C CB  . THR C 1 277 ? 82.510  77.353  92.121  1.00 69.74  ? 274 THR C CB  1 
ATOM 9928  O OG1 . THR C 1 277 ? 83.806  77.543  92.721  1.00 62.70  ? 274 THR C OG1 1 
ATOM 9929  C CG2 . THR C 1 277 ? 81.445  77.248  93.198  1.00 62.32  ? 274 THR C CG2 1 
ATOM 9930  N N   . SER C 1 278 ? 84.362  75.327  89.854  1.00 69.02  ? 275 SER C N   1 
ATOM 9931  C CA  . SER C 1 278 ? 85.287  75.343  88.725  1.00 78.98  ? 275 SER C CA  1 
ATOM 9932  C C   . SER C 1 278 ? 84.876  74.347  87.645  1.00 82.44  ? 275 SER C C   1 
ATOM 9933  O O   . SER C 1 278 ? 85.353  74.420  86.518  1.00 81.07  ? 275 SER C O   1 
ATOM 9934  C CB  . SER C 1 278 ? 86.721  75.054  89.183  1.00 62.27  ? 275 SER C CB  1 
ATOM 9935  O OG  . SER C 1 278 ? 87.234  76.152  89.905  1.00 78.36  ? 275 SER C OG  1 
ATOM 9936  N N   . SER C 1 279 ? 83.998  73.411  87.992  1.00 74.12  ? 276 SER C N   1 
ATOM 9937  C CA  . SER C 1 279 ? 83.511  72.453  87.009  1.00 67.12  ? 276 SER C CA  1 
ATOM 9938  C C   . SER C 1 279 ? 82.490  73.090  86.055  1.00 74.95  ? 276 SER C C   1 
ATOM 9939  O O   . SER C 1 279 ? 81.551  73.765  86.481  1.00 74.54  ? 276 SER C O   1 
ATOM 9940  C CB  . SER C 1 279 ? 82.921  71.219  87.693  1.00 60.85  ? 276 SER C CB  1 
ATOM 9941  O OG  . SER C 1 279 ? 82.431  70.291  86.731  1.00 67.73  ? 276 SER C OG  1 
ATOM 9942  N N   . GLU C 1 280 ? 82.693  72.875  84.759  1.00 60.94  ? 277 GLU C N   1 
ATOM 9943  C CA  . GLU C 1 280 ? 81.771  73.350  83.728  1.00 73.46  ? 277 GLU C CA  1 
ATOM 9944  C C   . GLU C 1 280 ? 80.423  72.654  83.866  1.00 57.50  ? 277 GLU C C   1 
ATOM 9945  O O   . GLU C 1 280 ? 79.437  73.039  83.221  1.00 67.77  ? 277 GLU C O   1 
ATOM 9946  C CB  . GLU C 1 280 ? 82.351  73.027  82.345  1.00 66.58  ? 277 GLU C CB  1 
ATOM 9947  C CG  . GLU C 1 280 ? 82.801  71.568  82.249  1.00 94.75  ? 277 GLU C CG  1 
ATOM 9948  C CD  . GLU C 1 280 ? 83.553  71.233  80.976  1.00 102.44 ? 277 GLU C CD  1 
ATOM 9949  O OE1 . GLU C 1 280 ? 84.786  71.030  81.049  1.00 89.84  ? 277 GLU C OE1 1 
ATOM 9950  O OE2 . GLU C 1 280 ? 82.906  71.142  79.910  1.00 100.76 ? 277 GLU C OE2 1 
ATOM 9951  N N   . HIS C 1 281 ? 80.393  71.617  84.699  1.00 61.35  ? 278 HIS C N   1 
ATOM 9952  C CA  . HIS C 1 281 ? 79.223  70.746  84.798  1.00 60.34  ? 278 HIS C CA  1 
ATOM 9953  C C   . HIS C 1 281 ? 78.340  71.062  85.988  1.00 67.18  ? 278 HIS C C   1 
ATOM 9954  O O   . HIS C 1 281 ? 77.279  70.463  86.144  1.00 64.88  ? 278 HIS C O   1 
ATOM 9955  C CB  . HIS C 1 281 ? 79.655  69.283  84.859  1.00 67.94  ? 278 HIS C CB  1 
ATOM 9956  C CG  . HIS C 1 281 ? 80.372  68.816  83.631  1.00 83.10  ? 278 HIS C CG  1 
ATOM 9957  N ND1 . HIS C 1 281 ? 79.758  68.728  82.398  1.00 71.51  ? 278 HIS C ND1 1 
ATOM 9958  C CD2 . HIS C 1 281 ? 81.650  68.407  83.447  1.00 72.90  ? 278 HIS C CD2 1 
ATOM 9959  C CE1 . HIS C 1 281 ? 80.629  68.289  81.507  1.00 62.14  ? 278 HIS C CE1 1 
ATOM 9960  N NE2 . HIS C 1 281 ? 81.783  68.084  82.117  1.00 68.67  ? 278 HIS C NE2 1 
ATOM 9961  N N   . LEU C 1 282 ? 78.786  71.984  86.832  1.00 57.93  ? 279 LEU C N   1 
ATOM 9962  C CA  . LEU C 1 282 ? 77.974  72.428  87.947  1.00 57.67  ? 279 LEU C CA  1 
ATOM 9963  C C   . LEU C 1 282 ? 76.640  72.970  87.429  1.00 49.29  ? 279 LEU C C   1 
ATOM 9964  O O   . LEU C 1 282 ? 76.615  73.858  86.574  1.00 62.79  ? 279 LEU C O   1 
ATOM 9965  C CB  . LEU C 1 282 ? 78.705  73.511  88.734  1.00 50.62  ? 279 LEU C CB  1 
ATOM 9966  C CG  . LEU C 1 282 ? 77.981  73.934  90.007  1.00 56.92  ? 279 LEU C CG  1 
ATOM 9967  C CD1 . LEU C 1 282 ? 78.103  72.818  91.040  1.00 61.35  ? 279 LEU C CD1 1 
ATOM 9968  C CD2 . LEU C 1 282 ? 78.558  75.256  90.520  1.00 46.06  ? 279 LEU C CD2 1 
ATOM 9969  N N   . CYS C 1 283 ? 75.537  72.429  87.940  1.00 60.89  ? 280 CYS C N   1 
ATOM 9970  C CA  . CYS C 1 283 ? 74.212  72.949  87.613  1.00 56.20  ? 280 CYS C CA  1 
ATOM 9971  C C   . CYS C 1 283 ? 73.463  73.399  88.858  1.00 55.28  ? 280 CYS C C   1 
ATOM 9972  O O   . CYS C 1 283 ? 72.374  73.967  88.751  1.00 72.18  ? 280 CYS C O   1 
ATOM 9973  C CB  . CYS C 1 283 ? 73.382  71.937  86.821  1.00 49.73  ? 280 CYS C CB  1 
ATOM 9974  S SG  . CYS C 1 283 ? 73.121  70.407  87.714  1.00 74.15  ? 280 CYS C SG  1 
ATOM 9975  N N   . GLY C 1 284 ? 74.050  73.184  90.034  1.00 53.87  ? 281 GLY C N   1 
ATOM 9976  C CA  . GLY C 1 284 ? 73.448  73.707  91.248  1.00 42.63  ? 281 GLY C CA  1 
ATOM 9977  C C   . GLY C 1 284 ? 74.274  73.556  92.497  1.00 49.94  ? 281 GLY C C   1 
ATOM 9978  O O   . GLY C 1 284 ? 75.144  72.691  92.571  1.00 65.54  ? 281 GLY C O   1 
ATOM 9979  N N   . ILE C 1 285 ? 74.003  74.424  93.470  1.00 54.59  ? 282 ILE C N   1 
ATOM 9980  C CA  . ILE C 1 285 ? 74.544  74.288  94.818  1.00 52.63  ? 282 ILE C CA  1 
ATOM 9981  C C   . ILE C 1 285 ? 73.423  74.374  95.850  1.00 59.23  ? 282 ILE C C   1 
ATOM 9982  O O   . ILE C 1 285 ? 72.684  75.358  95.897  1.00 61.05  ? 282 ILE C O   1 
ATOM 9983  C CB  . ILE C 1 285 ? 75.551  75.374  95.135  1.00 56.48  ? 282 ILE C CB  1 
ATOM 9984  C CG1 . ILE C 1 285 ? 76.702  75.313  94.149  1.00 53.64  ? 282 ILE C CG1 1 
ATOM 9985  C CG2 . ILE C 1 285 ? 76.057  75.222  96.563  1.00 51.87  ? 282 ILE C CG2 1 
ATOM 9986  C CD1 . ILE C 1 285 ? 77.752  76.350  94.440  1.00 57.47  ? 282 ILE C CD1 1 
ATOM 9987  N N   . ASN C 1 286 ? 73.300  73.330  96.663  1.00 54.95  ? 283 ASN C N   1 
ATOM 9988  C CA  . ASN C 1 286 ? 72.316  73.282  97.734  1.00 55.40  ? 283 ASN C CA  1 
ATOM 9989  C C   . ASN C 1 286 ? 73.054  73.452  99.050  1.00 53.66  ? 283 ASN C C   1 
ATOM 9990  O O   . ASN C 1 286 ? 73.669  72.515  99.539  1.00 45.85  ? 283 ASN C O   1 
ATOM 9991  C CB  . ASN C 1 286 ? 71.552  71.957  97.714  1.00 35.27  ? 283 ASN C CB  1 
ATOM 9992  C CG  . ASN C 1 286 ? 70.150  72.091  98.264  1.00 65.98  ? 283 ASN C CG  1 
ATOM 9993  O OD1 . ASN C 1 286 ? 69.715  73.192  98.632  1.00 52.92  ? 283 ASN C OD1 1 
ATOM 9994  N ND2 . ASN C 1 286 ? 69.419  70.969  98.302  1.00 47.99  ? 283 ASN C ND2 1 
ATOM 9995  N N   . PHE C 1 287 ? 72.981  74.660  99.604  1.00 56.37  ? 284 PHE C N   1 
ATOM 9996  C CA  . PHE C 1 287 ? 73.793  75.073  100.746 1.00 45.55  ? 284 PHE C CA  1 
ATOM 9997  C C   . PHE C 1 287 ? 72.973  75.431  101.979 1.00 55.82  ? 284 PHE C C   1 
ATOM 9998  O O   . PHE C 1 287 ? 71.945  76.114  101.901 1.00 57.41  ? 284 PHE C O   1 
ATOM 9999  C CB  . PHE C 1 287 ? 74.644  76.282  100.346 1.00 51.56  ? 284 PHE C CB  1 
ATOM 10000 C CG  . PHE C 1 287 ? 75.458  76.856  101.465 1.00 58.29  ? 284 PHE C CG  1 
ATOM 10001 C CD1 . PHE C 1 287 ? 74.960  77.876  102.255 1.00 59.80  ? 284 PHE C CD1 1 
ATOM 10002 C CD2 . PHE C 1 287 ? 76.736  76.379  101.726 1.00 68.81  ? 284 PHE C CD2 1 
ATOM 10003 C CE1 . PHE C 1 287 ? 75.719  78.399  103.292 1.00 71.77  ? 284 PHE C CE1 1 
ATOM 10004 C CE2 . PHE C 1 287 ? 77.493  76.903  102.759 1.00 55.93  ? 284 PHE C CE2 1 
ATOM 10005 C CZ  . PHE C 1 287 ? 76.984  77.908  103.541 1.00 67.30  ? 284 PHE C CZ  1 
ATOM 10006 N N   . THR C 1 288 ? 73.457  74.958  103.118 1.00 49.72  ? 285 THR C N   1 
ATOM 10007 C CA  . THR C 1 288 ? 73.006  75.409  104.426 1.00 63.35  ? 285 THR C CA  1 
ATOM 10008 C C   . THR C 1 288 ? 74.232  75.706  105.292 1.00 53.51  ? 285 THR C C   1 
ATOM 10009 O O   . THR C 1 288 ? 75.171  74.909  105.361 1.00 63.47  ? 285 THR C O   1 
ATOM 10010 C CB  . THR C 1 288 ? 72.073  74.382  105.123 1.00 77.07  ? 285 THR C CB  1 
ATOM 10011 O OG1 . THR C 1 288 ? 70.928  74.124  104.290 1.00 61.68  ? 285 THR C OG1 1 
ATOM 10012 C CG2 . THR C 1 288 ? 71.605  74.919  106.470 1.00 53.51  ? 285 THR C CG2 1 
ATOM 10013 N N   . GLY C 1 289 ? 74.222  76.866  105.936 1.00 67.24  ? 286 GLY C N   1 
ATOM 10014 C CA  . GLY C 1 289 ? 75.340  77.300  106.762 1.00 56.54  ? 286 GLY C CA  1 
ATOM 10015 C C   . GLY C 1 289 ? 75.381  78.814  106.883 1.00 62.48  ? 286 GLY C C   1 
ATOM 10016 O O   . GLY C 1 289 ? 74.349  79.464  106.997 1.00 67.45  ? 286 GLY C O   1 
ATOM 10017 N N   . SER C 1 290 ? 76.579  79.380  106.833 1.00 58.96  ? 287 SER C N   1 
ATOM 10018 C CA  . SER C 1 290 ? 76.757  80.796  107.127 1.00 66.67  ? 287 SER C CA  1 
ATOM 10019 C C   . SER C 1 290 ? 76.610  81.685  105.895 1.00 68.85  ? 287 SER C C   1 
ATOM 10020 O O   . SER C 1 290 ? 76.965  81.292  104.786 1.00 77.72  ? 287 SER C O   1 
ATOM 10021 C CB  . SER C 1 290 ? 78.123  81.033  107.769 1.00 74.92  ? 287 SER C CB  1 
ATOM 10022 O OG  . SER C 1 290 ? 79.167  80.710  106.860 1.00 78.19  ? 287 SER C OG  1 
ATOM 10023 N N   . VAL C 1 291 ? 76.091  82.889  106.111 1.00 68.28  ? 288 VAL C N   1 
ATOM 10024 C CA  . VAL C 1 291 ? 75.896  83.862  105.045 1.00 54.79  ? 288 VAL C CA  1 
ATOM 10025 C C   . VAL C 1 291 ? 77.154  84.130  104.210 1.00 57.64  ? 288 VAL C C   1 
ATOM 10026 O O   . VAL C 1 291 ? 77.101  84.121  102.987 1.00 76.56  ? 288 VAL C O   1 
ATOM 10027 C CB  . VAL C 1 291 ? 75.366  85.196  105.606 1.00 64.33  ? 288 VAL C CB  1 
ATOM 10028 C CG1 . VAL C 1 291 ? 74.785  86.040  104.482 1.00 74.91  ? 288 VAL C CG1 1 
ATOM 10029 C CG2 . VAL C 1 291 ? 74.313  84.941  106.676 1.00 81.20  ? 288 VAL C CG2 1 
ATOM 10030 N N   . PRO C 1 292 ? 78.295  84.379  104.866 1.00 73.81  ? 289 PRO C N   1 
ATOM 10031 C CA  . PRO C 1 292 ? 79.530  84.714  104.139 1.00 77.65  ? 289 PRO C CA  1 
ATOM 10032 C C   . PRO C 1 292 ? 80.033  83.600  103.210 1.00 69.69  ? 289 PRO C C   1 
ATOM 10033 O O   . PRO C 1 292 ? 80.512  83.876  102.107 1.00 64.06  ? 289 PRO C O   1 
ATOM 10034 C CB  . PRO C 1 292 ? 80.545  84.962  105.267 1.00 65.05  ? 289 PRO C CB  1 
ATOM 10035 C CG  . PRO C 1 292 ? 79.715  85.284  106.462 1.00 62.54  ? 289 PRO C CG  1 
ATOM 10036 C CD  . PRO C 1 292 ? 78.478  84.456  106.323 1.00 73.89  ? 289 PRO C CD  1 
ATOM 10037 N N   . THR C 1 293 ? 79.946  82.358  103.664 1.00 54.80  ? 290 THR C N   1 
ATOM 10038 C CA  . THR C 1 293 ? 80.310  81.229  102.825 1.00 58.09  ? 290 THR C CA  1 
ATOM 10039 C C   . THR C 1 293 ? 79.384  81.096  101.619 1.00 67.91  ? 290 THR C C   1 
ATOM 10040 O O   . THR C 1 293 ? 79.840  80.813  100.511 1.00 69.90  ? 290 THR C O   1 
ATOM 10041 C CB  . THR C 1 293 ? 80.276  79.942  103.607 1.00 56.86  ? 290 THR C CB  1 
ATOM 10042 O OG1 . THR C 1 293 ? 81.154  80.062  104.732 1.00 65.53  ? 290 THR C OG1 1 
ATOM 10043 C CG2 . THR C 1 293 ? 80.726  78.784  102.718 1.00 47.05  ? 290 THR C CG2 1 
ATOM 10044 N N   . PHE C 1 294 ? 78.087  81.297  101.829 1.00 56.57  ? 291 PHE C N   1 
ATOM 10045 C CA  . PHE C 1 294 ? 77.124  81.264  100.725 1.00 57.99  ? 291 PHE C CA  1 
ATOM 10046 C C   . PHE C 1 294 ? 77.369  82.391  99.713  1.00 62.26  ? 291 PHE C C   1 
ATOM 10047 O O   . PHE C 1 294 ? 77.360  82.160  98.505  1.00 70.49  ? 291 PHE C O   1 
ATOM 10048 C CB  . PHE C 1 294 ? 75.682  81.325  101.241 1.00 53.17  ? 291 PHE C CB  1 
ATOM 10049 C CG  . PHE C 1 294 ? 74.651  81.196  100.159 1.00 54.53  ? 291 PHE C CG  1 
ATOM 10050 C CD1 . PHE C 1 294 ? 74.583  80.048  99.386  1.00 51.85  ? 291 PHE C CD1 1 
ATOM 10051 C CD2 . PHE C 1 294 ? 73.746  82.221  99.912  1.00 60.06  ? 291 PHE C CD2 1 
ATOM 10052 C CE1 . PHE C 1 294 ? 73.632  79.919  98.378  1.00 62.87  ? 291 PHE C CE1 1 
ATOM 10053 C CE2 . PHE C 1 294 ? 72.788  82.102  98.908  1.00 56.99  ? 291 PHE C CE2 1 
ATOM 10054 C CZ  . PHE C 1 294 ? 72.736  80.949  98.141  1.00 68.06  ? 291 PHE C CZ  1 
ATOM 10055 N N   . LYS C 1 295 ? 77.586  83.609  100.202 1.00 54.19  ? 292 LYS C N   1 
ATOM 10056 C CA  . LYS C 1 295 ? 77.897  84.740  99.321  1.00 59.52  ? 292 LYS C CA  1 
ATOM 10057 C C   . LYS C 1 295 ? 79.180  84.473  98.534  1.00 59.80  ? 292 LYS C C   1 
ATOM 10058 O O   . LYS C 1 295 ? 79.294  84.787  97.351  1.00 66.20  ? 292 LYS C O   1 
ATOM 10059 C CB  . LYS C 1 295 ? 78.064  86.043  100.120 1.00 51.71  ? 292 LYS C CB  1 
ATOM 10060 C CG  . LYS C 1 295 ? 76.775  86.684  100.602 1.00 64.48  ? 292 LYS C CG  1 
ATOM 10061 C CD  . LYS C 1 295 ? 77.090  87.781  101.613 1.00 76.60  ? 292 LYS C CD  1 
ATOM 10062 C CE  . LYS C 1 295 ? 75.918  88.738  101.808 1.00 91.79  ? 292 LYS C CE  1 
ATOM 10063 N NZ  . LYS C 1 295 ? 76.209  89.759  102.858 1.00 95.86  ? 292 LYS C NZ  1 
ATOM 10064 N N   . HIS C 1 296 ? 80.163  83.904  99.209  1.00 68.14  ? 293 HIS C N   1 
ATOM 10065 C CA  . HIS C 1 296 ? 81.402  83.550  98.541  1.00 65.84  ? 293 HIS C CA  1 
ATOM 10066 C C   . HIS C 1 296 ? 81.212  82.559  97.375  1.00 70.21  ? 293 HIS C C   1 
ATOM 10067 O O   . HIS C 1 296 ? 81.801  82.744  96.311  1.00 57.24  ? 293 HIS C O   1 
ATOM 10068 C CB  . HIS C 1 296 ? 82.410  82.991  99.541  1.00 56.65  ? 293 HIS C CB  1 
ATOM 10069 C CG  . HIS C 1 296 ? 83.738  82.691  98.925  1.00 71.92  ? 293 HIS C CG  1 
ATOM 10070 N ND1 . HIS C 1 296 ? 84.296  81.433  98.930  1.00 62.95  ? 293 HIS C ND1 1 
ATOM 10071 C CD2 . HIS C 1 296 ? 84.608  83.486  98.257  1.00 69.25  ? 293 HIS C CD2 1 
ATOM 10072 C CE1 . HIS C 1 296 ? 85.458  81.465  98.301  1.00 66.30  ? 293 HIS C CE1 1 
ATOM 10073 N NE2 . HIS C 1 296 ? 85.669  82.699  97.884  1.00 78.52  ? 293 HIS C NE2 1 
ATOM 10074 N N   . LEU C 1 297 ? 80.412  81.509  97.589  1.00 62.51  ? 294 LEU C N   1 
ATOM 10075 C CA  . LEU C 1 297 ? 80.147  80.504  96.562  1.00 59.55  ? 294 LEU C CA  1 
ATOM 10076 C C   . LEU C 1 297 ? 79.403  81.139  95.395  1.00 70.38  ? 294 LEU C C   1 
ATOM 10077 O O   . LEU C 1 297 ? 79.674  80.835  94.223  1.00 63.19  ? 294 LEU C O   1 
ATOM 10078 C CB  . LEU C 1 297 ? 79.323  79.325  97.133  1.00 43.87  ? 294 LEU C CB  1 
ATOM 10079 C CG  . LEU C 1 297 ? 80.063  78.425  98.107  1.00 56.52  ? 294 LEU C CG  1 
ATOM 10080 C CD1 . LEU C 1 297 ? 79.093  77.594  98.893  1.00 50.79  ? 294 LEU C CD1 1 
ATOM 10081 C CD2 . LEU C 1 297 ? 81.027  77.543  97.332  1.00 43.00  ? 294 LEU C CD2 1 
ATOM 10082 N N   . TRP C 1 298 ? 78.462  82.018  95.737  1.00 65.77  ? 295 TRP C N   1 
ATOM 10083 C CA  . TRP C 1 298 ? 77.680  82.766  94.758  1.00 66.78  ? 295 TRP C CA  1 
ATOM 10084 C C   . TRP C 1 298 ? 78.589  83.615  93.873  1.00 64.33  ? 295 TRP C C   1 
ATOM 10085 O O   . TRP C 1 298 ? 78.399  83.674  92.655  1.00 55.61  ? 295 TRP C O   1 
ATOM 10086 C CB  . TRP C 1 298 ? 76.668  83.645  95.491  1.00 52.14  ? 295 TRP C CB  1 
ATOM 10087 C CG  . TRP C 1 298 ? 75.749  84.461  94.629  1.00 67.22  ? 295 TRP C CG  1 
ATOM 10088 C CD1 . TRP C 1 298 ? 76.098  85.359  93.638  1.00 65.84  ? 295 TRP C CD1 1 
ATOM 10089 C CD2 . TRP C 1 298 ? 74.325  84.505  94.724  1.00 68.33  ? 295 TRP C CD2 1 
ATOM 10090 N NE1 . TRP C 1 298 ? 74.971  85.933  93.104  1.00 57.85  ? 295 TRP C NE1 1 
ATOM 10091 C CE2 . TRP C 1 298 ? 73.868  85.429  93.752  1.00 65.71  ? 295 TRP C CE2 1 
ATOM 10092 C CE3 . TRP C 1 298 ? 73.386  83.842  95.528  1.00 62.06  ? 295 TRP C CE3 1 
ATOM 10093 C CZ2 . TRP C 1 298 ? 72.511  85.706  93.566  1.00 46.26  ? 295 TRP C CZ2 1 
ATOM 10094 C CZ3 . TRP C 1 298 ? 72.038  84.113  95.335  1.00 70.61  ? 295 TRP C CZ3 1 
ATOM 10095 C CH2 . TRP C 1 298 ? 71.615  85.033  94.359  1.00 55.38  ? 295 TRP C CH2 1 
ATOM 10096 N N   . LYS C 1 299 ? 79.576  84.265  94.493  1.00 62.10  ? 296 LYS C N   1 
ATOM 10097 C CA  . LYS C 1 299 ? 80.534  85.087  93.754  1.00 71.98  ? 296 LYS C CA  1 
ATOM 10098 C C   . LYS C 1 299 ? 81.462  84.238  92.872  1.00 73.61  ? 296 LYS C C   1 
ATOM 10099 O O   . LYS C 1 299 ? 81.780  84.613  91.746  1.00 57.29  ? 296 LYS C O   1 
ATOM 10100 C CB  . LYS C 1 299 ? 81.348  85.973  94.699  1.00 51.22  ? 296 LYS C CB  1 
ATOM 10101 C CG  . LYS C 1 299 ? 80.550  87.121  95.297  1.00 62.14  ? 296 LYS C CG  1 
ATOM 10102 C CD  . LYS C 1 299 ? 81.381  87.940  96.282  1.00 64.88  ? 296 LYS C CD  1 
ATOM 10103 C CE  . LYS C 1 299 ? 80.671  89.223  96.672  1.00 72.93  ? 296 LYS C CE  1 
ATOM 10104 N NZ  . LYS C 1 299 ? 81.316  89.891  97.833  1.00 83.06  ? 296 LYS C NZ  1 
ATOM 10105 N N   . GLN C 1 300 ? 81.896  83.093  93.384  1.00 62.41  ? 297 GLN C N   1 
ATOM 10106 C CA  . GLN C 1 300 ? 82.725  82.184  92.600  1.00 61.37  ? 297 GLN C CA  1 
ATOM 10107 C C   . GLN C 1 300 ? 82.006  81.694  91.352  1.00 70.86  ? 297 GLN C C   1 
ATOM 10108 O O   . GLN C 1 300 ? 82.590  81.658  90.267  1.00 71.30  ? 297 GLN C O   1 
ATOM 10109 C CB  . GLN C 1 300 ? 83.170  80.986  93.439  1.00 57.40  ? 297 GLN C CB  1 
ATOM 10110 C CG  . GLN C 1 300 ? 84.287  81.303  94.393  1.00 56.64  ? 297 GLN C CG  1 
ATOM 10111 C CD  . GLN C 1 300 ? 84.775  80.083  95.166  1.00 81.93  ? 297 GLN C CD  1 
ATOM 10112 O OE1 . GLN C 1 300 ? 83.995  79.378  95.806  1.00 78.19  ? 297 GLN C OE1 1 
ATOM 10113 N NE2 . GLN C 1 300 ? 86.074  79.836  95.110  1.00 80.84  ? 297 GLN C NE2 1 
ATOM 10114 N N   . VAL C 1 301 ? 80.742  81.304  91.511  1.00 74.17  ? 298 VAL C N   1 
ATOM 10115 C CA  . VAL C 1 301 ? 79.944  80.859  90.371  1.00 58.36  ? 298 VAL C CA  1 
ATOM 10116 C C   . VAL C 1 301 ? 79.803  81.976  89.323  1.00 67.87  ? 298 VAL C C   1 
ATOM 10117 O O   . VAL C 1 301 ? 79.942  81.732  88.118  1.00 72.64  ? 298 VAL C O   1 
ATOM 10118 C CB  . VAL C 1 301 ? 78.557  80.325  90.807  1.00 52.75  ? 298 VAL C CB  1 
ATOM 10119 C CG1 . VAL C 1 301 ? 77.557  80.357  89.637  1.00 47.58  ? 298 VAL C CG1 1 
ATOM 10120 C CG2 . VAL C 1 301 ? 78.694  78.925  91.368  1.00 51.68  ? 298 VAL C CG2 1 
ATOM 10121 N N   . ALA C 1 302 ? 79.546  83.200  89.778  1.00 53.61  ? 299 ALA C N   1 
ATOM 10122 C CA  . ALA C 1 302 ? 79.427  84.334  88.858  1.00 61.30  ? 299 ALA C CA  1 
ATOM 10123 C C   . ALA C 1 302 ? 80.737  84.579  88.118  1.00 66.82  ? 299 ALA C C   1 
ATOM 10124 O O   . ALA C 1 302 ? 80.739  84.737  86.904  1.00 68.61  ? 299 ALA C O   1 
ATOM 10125 C CB  . ALA C 1 302 ? 79.005  85.587  89.599  1.00 47.98  ? 299 ALA C CB  1 
ATOM 10126 N N   . GLN C 1 303 ? 81.851  84.600  88.853  1.00 69.63  ? 300 GLN C N   1 
ATOM 10127 C CA  . GLN C 1 303 ? 83.174  84.808  88.248  1.00 84.96  ? 300 GLN C CA  1 
ATOM 10128 C C   . GLN C 1 303 ? 83.419  83.812  87.111  1.00 73.73  ? 300 GLN C C   1 
ATOM 10129 O O   . GLN C 1 303 ? 84.131  84.108  86.154  1.00 70.83  ? 300 GLN C O   1 
ATOM 10130 C CB  . GLN C 1 303 ? 84.310  84.729  89.294  1.00 59.93  ? 300 GLN C CB  1 
ATOM 10131 N N   . ASN C 1 304 ? 82.807  82.638  87.209  1.00 69.93  ? 301 ASN C N   1 
ATOM 10132 C CA  . ASN C 1 304 ? 83.040  81.581  86.227  1.00 62.43  ? 301 ASN C CA  1 
ATOM 10133 C C   . ASN C 1 304 ? 81.864  81.342  85.275  1.00 60.24  ? 301 ASN C C   1 
ATOM 10134 O O   . ASN C 1 304 ? 81.874  80.375  84.521  1.00 55.36  ? 301 ASN C O   1 
ATOM 10135 C CB  . ASN C 1 304 ? 83.425  80.270  86.932  1.00 63.12  ? 301 ASN C CB  1 
ATOM 10136 C CG  . ASN C 1 304 ? 84.747  80.376  87.661  1.00 80.14  ? 301 ASN C CG  1 
ATOM 10137 O OD1 . ASN C 1 304 ? 85.655  81.071  87.212  1.00 93.29  ? 301 ASN C OD1 1 
ATOM 10138 N ND2 . ASN C 1 304 ? 84.859  79.704  88.798  1.00 91.12  ? 301 ASN C ND2 1 
ATOM 10139 N N   . LEU C 1 305 ? 80.862  82.219  85.307  1.00 67.06  ? 302 LEU C N   1 
ATOM 10140 C CA  . LEU C 1 305 ? 79.639  82.032  84.505  1.00 69.74  ? 302 LEU C CA  1 
ATOM 10141 C C   . LEU C 1 305 ? 79.870  81.541  83.077  1.00 62.43  ? 302 LEU C C   1 
ATOM 10142 O O   . LEU C 1 305 ? 79.086  80.747  82.555  1.00 70.58  ? 302 LEU C O   1 
ATOM 10143 C CB  . LEU C 1 305 ? 78.794  83.311  84.444  1.00 59.70  ? 302 LEU C CB  1 
ATOM 10144 C CG  . LEU C 1 305 ? 77.460  83.299  85.192  1.00 72.72  ? 302 LEU C CG  1 
ATOM 10145 C CD1 . LEU C 1 305 ? 76.554  84.326  84.574  1.00 59.64  ? 302 LEU C CD1 1 
ATOM 10146 C CD2 . LEU C 1 305 ? 76.801  81.929  85.160  1.00 54.53  ? 302 LEU C CD2 1 
ATOM 10147 N N   . ASP C 1 306 ? 80.939  82.015  82.444  1.00 73.85  ? 303 ASP C N   1 
ATOM 10148 C CA  . ASP C 1 306 ? 81.177  81.728  81.027  1.00 57.64  ? 303 ASP C CA  1 
ATOM 10149 C C   . ASP C 1 306 ? 81.462  80.257  80.731  1.00 70.34  ? 303 ASP C C   1 
ATOM 10150 O O   . ASP C 1 306 ? 81.152  79.751  79.639  1.00 73.05  ? 303 ASP C O   1 
ATOM 10151 C CB  . ASP C 1 306 ? 82.316  82.597  80.499  1.00 74.93  ? 303 ASP C CB  1 
ATOM 10152 C CG  . ASP C 1 306 ? 81.970  84.064  80.513  1.00 98.86  ? 303 ASP C CG  1 
ATOM 10153 O OD1 . ASP C 1 306 ? 80.890  84.411  79.983  1.00 81.85  ? 303 ASP C OD1 1 
ATOM 10154 O OD2 . ASP C 1 306 ? 82.765  84.855  81.071  1.00 99.01  ? 303 ASP C OD2 1 
ATOM 10155 N N   . ARG C 1 307 ? 82.040  79.566  81.705  1.00 59.43  ? 304 ARG C N   1 
ATOM 10156 C CA  . ARG C 1 307 ? 82.384  78.162  81.509  1.00 68.53  ? 304 ARG C CA  1 
ATOM 10157 C C   . ARG C 1 307 ? 81.255  77.133  81.724  1.00 74.94  ? 304 ARG C C   1 
ATOM 10158 O O   . ARG C 1 307 ? 81.330  76.024  81.187  1.00 69.02  ? 304 ARG C O   1 
ATOM 10159 C CB  . ARG C 1 307 ? 83.621  77.790  82.321  1.00 69.51  ? 304 ARG C CB  1 
ATOM 10160 C CG  . ARG C 1 307 ? 83.514  77.956  83.802  1.00 92.34  ? 304 ARG C CG  1 
ATOM 10161 C CD  . ARG C 1 307 ? 84.629  77.108  84.308  1.00 84.20  ? 304 ARG C CD  1 
ATOM 10162 N NE  . ARG C 1 307 ? 85.476  77.792  85.223  1.00 95.00  ? 304 ARG C NE  1 
ATOM 10163 C CZ  . ARG C 1 307 ? 86.730  78.199  85.120  1.00 100.59 ? 304 ARG C CZ  1 
ATOM 10164 N NH1 . ARG C 1 307 ? 87.194  78.770  86.206  1.00 124.54 ? 304 ARG C NH1 1 
ATOM 10165 N NH2 . ARG C 1 307 ? 87.506  78.077  84.052  1.00 124.15 ? 304 ARG C NH2 1 
ATOM 10166 N N   . PHE C 1 308 ? 80.219  77.481  82.488  1.00 73.05  ? 305 PHE C N   1 
ATOM 10167 C CA  . PHE C 1 308 ? 79.159  76.507  82.777  1.00 64.04  ? 305 PHE C CA  1 
ATOM 10168 C C   . PHE C 1 308 ? 78.305  76.262  81.538  1.00 61.07  ? 305 PHE C C   1 
ATOM 10169 O O   . PHE C 1 308 ? 78.061  77.176  80.750  1.00 69.55  ? 305 PHE C O   1 
ATOM 10170 C CB  . PHE C 1 308 ? 78.278  76.955  83.952  1.00 56.17  ? 305 PHE C CB  1 
ATOM 10171 C CG  . PHE C 1 308 ? 79.045  77.287  85.191  1.00 52.08  ? 305 PHE C CG  1 
ATOM 10172 C CD1 . PHE C 1 308 ? 79.752  76.304  85.868  1.00 52.62  ? 305 PHE C CD1 1 
ATOM 10173 C CD2 . PHE C 1 308 ? 79.051  78.575  85.690  1.00 47.55  ? 305 PHE C CD2 1 
ATOM 10174 C CE1 . PHE C 1 308 ? 80.460  76.607  87.031  1.00 54.68  ? 305 PHE C CE1 1 
ATOM 10175 C CE2 . PHE C 1 308 ? 79.768  78.895  86.851  1.00 51.66  ? 305 PHE C CE2 1 
ATOM 10176 C CZ  . PHE C 1 308 ? 80.470  77.905  87.518  1.00 53.03  ? 305 PHE C CZ  1 
ATOM 10177 N N   . HIS C 1 309 ? 77.863  75.020  81.370  1.00 63.18  ? 306 HIS C N   1 
ATOM 10178 C CA  . HIS C 1 309 ? 76.996  74.663  80.248  1.00 61.27  ? 306 HIS C CA  1 
ATOM 10179 C C   . HIS C 1 309 ? 75.558  75.157  80.423  1.00 71.28  ? 306 HIS C C   1 
ATOM 10180 O O   . HIS C 1 309 ? 74.819  75.307  79.451  1.00 75.00  ? 306 HIS C O   1 
ATOM 10181 C CB  . HIS C 1 309 ? 77.022  73.152  79.997  1.00 50.64  ? 306 HIS C CB  1 
ATOM 10182 C CG  . HIS C 1 309 ? 78.350  72.648  79.525  1.00 73.56  ? 306 HIS C CG  1 
ATOM 10183 N ND1 . HIS C 1 309 ? 79.052  73.243  78.496  1.00 85.34  ? 306 HIS C ND1 1 
ATOM 10184 C CD2 . HIS C 1 309 ? 79.110  71.610  79.945  1.00 78.53  ? 306 HIS C CD2 1 
ATOM 10185 C CE1 . HIS C 1 309 ? 80.187  72.595  78.306  1.00 72.27  ? 306 HIS C CE1 1 
ATOM 10186 N NE2 . HIS C 1 309 ? 80.246  71.597  79.170  1.00 83.15  ? 306 HIS C NE2 1 
ATOM 10187 N N   . THR C 1 310 ? 75.166  75.393  81.667  1.00 76.97  ? 307 THR C N   1 
ATOM 10188 C CA  . THR C 1 310 ? 73.925  76.094  81.942  1.00 74.74  ? 307 THR C CA  1 
ATOM 10189 C C   . THR C 1 310 ? 74.122  76.953  83.183  1.00 61.86  ? 307 THR C C   1 
ATOM 10190 O O   . THR C 1 310 ? 75.199  76.952  83.783  1.00 67.85  ? 307 THR C O   1 
ATOM 10191 C CB  . THR C 1 310 ? 72.723  75.134  82.095  1.00 78.94  ? 307 THR C CB  1 
ATOM 10192 O OG1 . THR C 1 310 ? 71.505  75.896  82.233  1.00 62.04  ? 307 THR C OG1 1 
ATOM 10193 C CG2 . THR C 1 310 ? 72.937  74.186  83.284  1.00 55.36  ? 307 THR C CG2 1 
ATOM 10194 N N   . PHE C 1 311 ? 73.090  77.709  83.540  1.00 66.31  ? 308 PHE C N   1 
ATOM 10195 C CA  . PHE C 1 311 ? 73.145  78.598  84.695  1.00 62.90  ? 308 PHE C CA  1 
ATOM 10196 C C   . PHE C 1 311 ? 72.881  77.821  85.968  1.00 63.13  ? 308 PHE C C   1 
ATOM 10197 O O   . PHE C 1 311 ? 71.815  77.232  86.142  1.00 68.15  ? 308 PHE C O   1 
ATOM 10198 C CB  . PHE C 1 311 ? 72.136  79.726  84.534  1.00 61.98  ? 308 PHE C CB  1 
ATOM 10199 C CG  . PHE C 1 311 ? 72.398  80.581  83.330  1.00 76.79  ? 308 PHE C CG  1 
ATOM 10200 C CD1 . PHE C 1 311 ? 71.784  80.303  82.122  1.00 59.53  ? 308 PHE C CD1 1 
ATOM 10201 C CD2 . PHE C 1 311 ? 73.289  81.641  83.396  1.00 68.00  ? 308 PHE C CD2 1 
ATOM 10202 C CE1 . PHE C 1 311 ? 72.041  81.080  81.007  1.00 70.43  ? 308 PHE C CE1 1 
ATOM 10203 C CE2 . PHE C 1 311 ? 73.544  82.421  82.288  1.00 72.65  ? 308 PHE C CE2 1 
ATOM 10204 C CZ  . PHE C 1 311 ? 72.919  82.141  81.091  1.00 65.71  ? 308 PHE C CZ  1 
ATOM 10205 N N   . PRO C 1 312 ? 73.877  77.786  86.851  1.00 59.58  ? 309 PRO C N   1 
ATOM 10206 C CA  . PRO C 1 312 ? 73.752  77.024  88.095  1.00 53.52  ? 309 PRO C CA  1 
ATOM 10207 C C   . PRO C 1 312 ? 72.730  77.653  89.044  1.00 57.64  ? 309 PRO C C   1 
ATOM 10208 O O   . PRO C 1 312 ? 72.685  78.873  89.231  1.00 69.40  ? 309 PRO C O   1 
ATOM 10209 C CB  . PRO C 1 312 ? 75.169  77.089  88.684  1.00 54.53  ? 309 PRO C CB  1 
ATOM 10210 C CG  . PRO C 1 312 ? 76.056  77.391  87.491  1.00 51.09  ? 309 PRO C CG  1 
ATOM 10211 C CD  . PRO C 1 312 ? 75.240  78.301  86.639  1.00 49.94  ? 309 PRO C CD  1 
ATOM 10212 N N   . ARG C 1 313 ? 71.901  76.801  89.630  1.00 55.65  ? 310 ARG C N   1 
ATOM 10213 C CA  . ARG C 1 313 ? 70.936  77.231  90.626  1.00 48.94  ? 310 ARG C CA  1 
ATOM 10214 C C   . ARG C 1 313 ? 71.567  77.150  92.019  1.00 49.54  ? 310 ARG C C   1 
ATOM 10215 O O   . ARG C 1 313 ? 72.020  76.085  92.431  1.00 54.77  ? 310 ARG C O   1 
ATOM 10216 C CB  . ARG C 1 313 ? 69.678  76.370  90.518  1.00 45.39  ? 310 ARG C CB  1 
ATOM 10217 C CG  . ARG C 1 313 ? 68.974  76.547  89.170  1.00 44.86  ? 310 ARG C CG  1 
ATOM 10218 C CD  . ARG C 1 313 ? 67.698  75.755  89.075  1.00 50.31  ? 310 ARG C CD  1 
ATOM 10219 N NE  . ARG C 1 313 ? 67.062  75.873  87.762  1.00 46.94  ? 310 ARG C NE  1 
ATOM 10220 C CZ  . ARG C 1 313 ? 65.875  75.347  87.475  1.00 67.03  ? 310 ARG C CZ  1 
ATOM 10221 N NH1 . ARG C 1 313 ? 65.203  74.672  88.411  1.00 56.42  ? 310 ARG C NH1 1 
ATOM 10222 N NH2 . ARG C 1 313 ? 65.356  75.494  86.263  1.00 53.72  ? 310 ARG C NH2 1 
ATOM 10223 N N   . LEU C 1 314 ? 71.628  78.289  92.713  1.00 42.31  ? 311 LEU C N   1 
ATOM 10224 C CA  . LEU C 1 314 ? 72.090  78.333  94.092  1.00 40.86  ? 311 LEU C CA  1 
ATOM 10225 C C   . LEU C 1 314 ? 70.930  78.476  95.072  1.00 60.59  ? 311 LEU C C   1 
ATOM 10226 O O   . LEU C 1 314 ? 70.157  79.430  94.987  1.00 72.74  ? 311 LEU C O   1 
ATOM 10227 C CB  . LEU C 1 314 ? 73.054  79.487  94.285  1.00 47.18  ? 311 LEU C CB  1 
ATOM 10228 C CG  . LEU C 1 314 ? 74.502  79.205  93.896  1.00 66.05  ? 311 LEU C CG  1 
ATOM 10229 C CD1 . LEU C 1 314 ? 74.591  78.796  92.450  1.00 63.23  ? 311 LEU C CD1 1 
ATOM 10230 C CD2 . LEU C 1 314 ? 75.352  80.428  94.142  1.00 68.20  ? 311 LEU C CD2 1 
ATOM 10231 N N   . ALA C 1 315 ? 70.796  77.515  95.982  1.00 50.15  ? 312 ALA C N   1 
ATOM 10232 C CA  . ALA C 1 315 ? 69.845  77.615  97.085  1.00 52.78  ? 312 ALA C CA  1 
ATOM 10233 C C   . ALA C 1 315 ? 70.619  77.706  98.395  1.00 58.42  ? 312 ALA C C   1 
ATOM 10234 O O   . ALA C 1 315 ? 71.554  76.937  98.615  1.00 50.52  ? 312 ALA C O   1 
ATOM 10235 C CB  . ALA C 1 315 ? 68.898  76.423  97.084  1.00 40.13  ? 312 ALA C CB  1 
ATOM 10236 N N   . GLY C 1 316 ? 70.253  78.667  99.242  1.00 59.39  ? 313 GLY C N   1 
ATOM 10237 C CA  . GLY C 1 316 ? 70.949  78.885  100.499 1.00 41.09  ? 313 GLY C CA  1 
ATOM 10238 C C   . GLY C 1 316 ? 70.025  79.107  101.680 1.00 47.43  ? 313 GLY C C   1 
ATOM 10239 O O   . GLY C 1 316 ? 69.170  79.993  101.672 1.00 69.42  ? 313 GLY C O   1 
ATOM 10240 N N   . GLU C 1 317 ? 70.160  78.258  102.685 1.00 55.54  ? 314 GLU C N   1 
ATOM 10241 C CA  . GLU C 1 317 ? 69.531  78.523  103.960 1.00 62.37  ? 314 GLU C CA  1 
ATOM 10242 C C   . GLU C 1 317 ? 70.648  78.977  104.883 1.00 64.45  ? 314 GLU C C   1 
ATOM 10243 O O   . GLU C 1 317 ? 71.577  78.228  105.163 1.00 62.49  ? 314 GLU C O   1 
ATOM 10244 C CB  . GLU C 1 317 ? 68.847  77.281  104.503 1.00 40.99  ? 314 GLU C CB  1 
ATOM 10245 N N   . CYS C 1 318 ? 70.591  80.230  105.311 1.00 70.95  ? 315 CYS C N   1 
ATOM 10246 C CA  . CYS C 1 318 ? 71.602  80.755  106.220 1.00 68.62  ? 315 CYS C CA  1 
ATOM 10247 C C   . CYS C 1 318 ? 71.031  80.989  107.634 1.00 86.02  ? 315 CYS C C   1 
ATOM 10248 O O   . CYS C 1 318 ? 69.989  80.425  107.989 1.00 76.69  ? 315 CYS C O   1 
ATOM 10249 C CB  . CYS C 1 318 ? 72.244  82.008  105.623 1.00 66.64  ? 315 CYS C CB  1 
ATOM 10250 S SG  . CYS C 1 318 ? 72.903  81.729  103.947 1.00 66.32  ? 315 CYS C SG  1 
ATOM 10251 N N   . GLY C 1 319 ? 71.712  81.799  108.441 1.00 62.55  ? 316 GLY C N   1 
ATOM 10252 C CA  . GLY C 1 319 ? 71.303  81.991  109.822 1.00 69.28  ? 316 GLY C CA  1 
ATOM 10253 C C   . GLY C 1 319 ? 70.179  82.988  110.070 1.00 80.10  ? 316 GLY C C   1 
ATOM 10254 O O   . GLY C 1 319 ? 69.597  83.540  109.137 1.00 84.72  ? 316 GLY C O   1 
ATOM 10255 N N   . GLY C 1 320 ? 69.866  83.201  111.346 1.00 65.22  ? 317 GLY C N   1 
ATOM 10256 C CA  . GLY C 1 320 ? 68.907  84.211  111.758 1.00 60.32  ? 317 GLY C CA  1 
ATOM 10257 C C   . GLY C 1 320 ? 69.327  84.870  113.065 1.00 64.66  ? 317 GLY C C   1 
ATOM 10258 O O   . GLY C 1 320 ? 70.171  84.356  113.789 1.00 63.51  ? 317 GLY C O   1 
ATOM 10259 N N   . LYS C 1 321 ? 68.771  86.045  113.337 1.00 75.62  ? 318 LYS C N   1 
ATOM 10260 C CA  . LYS C 1 321 ? 68.812  86.621  114.674 1.00 59.57  ? 318 LYS C CA  1 
ATOM 10261 C C   . LYS C 1 321 ? 67.364  86.760  115.125 1.00 72.24  ? 318 LYS C C   1 
ATOM 10262 O O   . LYS C 1 321 ? 66.742  87.830  114.995 1.00 66.10  ? 318 LYS C O   1 
ATOM 10263 C CB  . LYS C 1 321 ? 69.516  87.977  114.695 1.00 74.39  ? 318 LYS C CB  1 
ATOM 10264 C CG  . LYS C 1 321 ? 69.781  88.514  116.125 1.00 67.61  ? 318 LYS C CG  1 
ATOM 10265 C CD  . LYS C 1 321 ? 70.878  87.708  116.834 1.00 62.71  ? 318 LYS C CD  1 
ATOM 10266 C CE  . LYS C 1 321 ? 71.098  88.163  118.293 1.00 66.03  ? 318 LYS C CE  1 
ATOM 10267 N NZ  . LYS C 1 321 ? 72.069  87.259  118.998 1.00 70.20  ? 318 LYS C NZ  1 
ATOM 10268 N N   . ASN C 1 322 ? 66.830  85.662  115.649 1.00 65.20  ? 319 ASN C N   1 
ATOM 10269 C CA  . ASN C 1 322 ? 65.394  85.538  115.833 1.00 57.26  ? 319 ASN C CA  1 
ATOM 10270 C C   . ASN C 1 322 ? 64.841  86.078  117.146 1.00 76.20  ? 319 ASN C C   1 
ATOM 10271 O O   . ASN C 1 322 ? 65.536  86.121  118.161 1.00 68.56  ? 319 ASN C O   1 
ATOM 10272 C CB  . ASN C 1 322 ? 64.999  84.093  115.619 1.00 56.96  ? 319 ASN C CB  1 
ATOM 10273 C CG  . ASN C 1 322 ? 65.723  83.489  114.446 1.00 68.34  ? 319 ASN C CG  1 
ATOM 10274 O OD1 . ASN C 1 322 ? 65.451  83.826  113.295 1.00 68.80  ? 319 ASN C OD1 1 
ATOM 10275 N ND2 . ASN C 1 322 ? 66.682  82.620  114.728 1.00 56.95  ? 319 ASN C ND2 1 
ATOM 10276 N N   . PHE C 1 323 ? 63.577  86.490  117.103 1.00 60.24  ? 320 PHE C N   1 
ATOM 10277 C CA  . PHE C 1 323 ? 62.976  87.226  118.201 1.00 65.55  ? 320 PHE C CA  1 
ATOM 10278 C C   . PHE C 1 323 ? 61.773  86.520  118.817 1.00 75.18  ? 320 PHE C C   1 
ATOM 10279 O O   . PHE C 1 323 ? 61.068  85.788  118.120 1.00 63.55  ? 320 PHE C O   1 
ATOM 10280 C CB  . PHE C 1 323 ? 62.566  88.624  117.721 1.00 55.78  ? 320 PHE C CB  1 
ATOM 10281 C CG  . PHE C 1 323 ? 61.504  88.622  116.645 1.00 57.47  ? 320 PHE C CG  1 
ATOM 10282 C CD1 . PHE C 1 323 ? 60.163  88.582  116.980 1.00 55.56  ? 320 PHE C CD1 1 
ATOM 10283 C CD2 . PHE C 1 323 ? 61.848  88.675  115.302 1.00 69.46  ? 320 PHE C CD2 1 
ATOM 10284 C CE1 . PHE C 1 323 ? 59.183  88.588  115.994 1.00 70.06  ? 320 PHE C CE1 1 
ATOM 10285 C CE2 . PHE C 1 323 ? 60.873  88.688  114.314 1.00 58.53  ? 320 PHE C CE2 1 
ATOM 10286 C CZ  . PHE C 1 323 ? 59.540  88.645  114.658 1.00 56.34  ? 320 PHE C CZ  1 
ATOM 10287 N N   . HIS C 1 324 ? 61.582  86.720  120.128 1.00 74.84  ? 321 HIS C N   1 
ATOM 10288 C CA  . HIS C 1 324 ? 60.268  86.589  120.769 1.00 52.15  ? 321 HIS C CA  1 
ATOM 10289 C C   . HIS C 1 324 ? 59.829  87.979  121.241 1.00 65.34  ? 321 HIS C C   1 
ATOM 10290 O O   . HIS C 1 324 ? 60.455  88.566  122.129 1.00 76.52  ? 321 HIS C O   1 
ATOM 10291 C CB  . HIS C 1 324 ? 60.289  85.639  121.977 1.00 67.50  ? 321 HIS C CB  1 
ATOM 10292 C CG  . HIS C 1 324 ? 60.317  84.182  121.623 1.00 72.00  ? 321 HIS C CG  1 
ATOM 10293 N ND1 . HIS C 1 324 ? 60.042  83.188  122.542 1.00 72.12  ? 321 HIS C ND1 1 
ATOM 10294 C CD2 . HIS C 1 324 ? 60.604  83.547  120.462 1.00 74.76  ? 321 HIS C CD2 1 
ATOM 10295 C CE1 . HIS C 1 324 ? 60.151  82.005  121.959 1.00 67.88  ? 321 HIS C CE1 1 
ATOM 10296 N NE2 . HIS C 1 324 ? 60.488  82.196  120.696 1.00 82.90  ? 321 HIS C NE2 1 
ATOM 10297 N N   . PHE C 1 325 ? 58.760  88.508  120.646 1.00 55.70  ? 322 PHE C N   1 
ATOM 10298 C CA  . PHE C 1 325 ? 58.198  89.781  121.072 1.00 60.88  ? 322 PHE C CA  1 
ATOM 10299 C C   . PHE C 1 325 ? 56.993  89.548  121.990 1.00 76.50  ? 322 PHE C C   1 
ATOM 10300 O O   . PHE C 1 325 ? 56.077  88.792  121.642 1.00 64.52  ? 322 PHE C O   1 
ATOM 10301 C CB  . PHE C 1 325 ? 57.783  90.622  119.862 1.00 70.17  ? 322 PHE C CB  1 
ATOM 10302 C CG  . PHE C 1 325 ? 57.144  91.931  120.236 1.00 80.98  ? 322 PHE C CG  1 
ATOM 10303 C CD1 . PHE C 1 325 ? 57.910  93.087  120.339 1.00 85.09  ? 322 PHE C CD1 1 
ATOM 10304 C CD2 . PHE C 1 325 ? 55.786  92.000  120.514 1.00 74.97  ? 322 PHE C CD2 1 
ATOM 10305 C CE1 . PHE C 1 325 ? 57.334  94.293  120.701 1.00 78.80  ? 322 PHE C CE1 1 
ATOM 10306 C CE2 . PHE C 1 325 ? 55.198  93.199  120.882 1.00 72.68  ? 322 PHE C CE2 1 
ATOM 10307 C CZ  . PHE C 1 325 ? 55.976  94.352  120.974 1.00 92.63  ? 322 PHE C CZ  1 
ATOM 10308 N N   . VAL C 1 326 ? 56.997  90.196  123.156 1.00 66.64  ? 323 VAL C N   1 
ATOM 10309 C CA  . VAL C 1 326 ? 55.921  90.029  124.135 1.00 64.62  ? 323 VAL C CA  1 
ATOM 10310 C C   . VAL C 1 326 ? 55.093  91.307  124.371 1.00 81.19  ? 323 VAL C C   1 
ATOM 10311 O O   . VAL C 1 326 ? 55.626  92.390  124.667 1.00 71.65  ? 323 VAL C O   1 
ATOM 10312 C CB  . VAL C 1 326 ? 56.472  89.549  125.491 1.00 68.81  ? 323 VAL C CB  1 
ATOM 10313 C CG1 . VAL C 1 326 ? 55.324  89.254  126.448 1.00 59.17  ? 323 VAL C CG1 1 
ATOM 10314 C CG2 . VAL C 1 326 ? 57.382  88.321  125.304 1.00 55.74  ? 323 VAL C CG2 1 
ATOM 10315 N N   . HIS C 1 327 ? 53.780  91.170  124.241 1.00 78.33  ? 324 HIS C N   1 
ATOM 10316 C CA  . HIS C 1 327 ? 52.867  92.268  124.530 1.00 91.77  ? 324 HIS C CA  1 
ATOM 10317 C C   . HIS C 1 327 ? 52.382  92.139  125.970 1.00 95.38  ? 324 HIS C C   1 
ATOM 10318 O O   . HIS C 1 327 ? 52.437  91.047  126.540 1.00 84.26  ? 324 HIS C O   1 
ATOM 10319 C CB  . HIS C 1 327 ? 51.690  92.228  123.562 1.00 72.39  ? 324 HIS C CB  1 
ATOM 10320 C CG  . HIS C 1 327 ? 50.654  93.269  123.831 1.00 88.23  ? 324 HIS C CG  1 
ATOM 10321 N ND1 . HIS C 1 327 ? 49.468  92.988  124.476 1.00 93.88  ? 324 HIS C ND1 1 
ATOM 10322 C CD2 . HIS C 1 327 ? 50.621  94.592  123.538 1.00 83.85  ? 324 HIS C CD2 1 
ATOM 10323 C CE1 . HIS C 1 327 ? 48.750  94.093  124.569 1.00 91.72  ? 324 HIS C CE1 1 
ATOM 10324 N NE2 . HIS C 1 327 ? 49.427  95.081  124.008 1.00 97.14  ? 324 HIS C NE2 1 
ATOM 10325 N N   . ARG C 1 328 ? 51.911  93.241  126.559 1.00 86.70  ? 325 ARG C N   1 
ATOM 10326 C CA  . ARG C 1 328 ? 51.497  93.230  127.972 1.00 86.90  ? 325 ARG C CA  1 
ATOM 10327 C C   . ARG C 1 328 ? 50.407  92.189  128.280 1.00 89.11  ? 325 ARG C C   1 
ATOM 10328 O O   . ARG C 1 328 ? 50.240  91.774  129.429 1.00 83.20  ? 325 ARG C O   1 
ATOM 10329 C CB  . ARG C 1 328 ? 51.065  94.630  128.449 1.00 78.24  ? 325 ARG C CB  1 
ATOM 10330 N N   . SER C 1 329 ? 49.687  91.751  127.249 1.00 87.29  ? 326 SER C N   1 
ATOM 10331 C CA  . SER C 1 329 ? 48.583  90.803  127.417 1.00 70.42  ? 326 SER C CA  1 
ATOM 10332 C C   . SER C 1 329 ? 49.001  89.326  127.421 1.00 90.42  ? 326 SER C C   1 
ATOM 10333 O O   . SER C 1 329 ? 48.163  88.435  127.630 1.00 72.46  ? 326 SER C O   1 
ATOM 10334 C CB  . SER C 1 329 ? 47.549  91.015  126.313 1.00 66.54  ? 326 SER C CB  1 
ATOM 10335 O OG  . SER C 1 329 ? 48.110  90.759  125.042 1.00 94.60  ? 326 SER C OG  1 
ATOM 10336 N N   . ALA C 1 330 ? 50.285  89.063  127.187 1.00 78.56  ? 327 ALA C N   1 
ATOM 10337 C CA  . ALA C 1 330 ? 50.759  87.689  127.014 1.00 80.01  ? 327 ALA C CA  1 
ATOM 10338 C C   . ALA C 1 330 ? 50.502  86.792  128.226 1.00 84.10  ? 327 ALA C C   1 
ATOM 10339 O O   . ALA C 1 330 ? 50.468  87.260  129.365 1.00 85.29  ? 327 ALA C O   1 
ATOM 10340 C CB  . ALA C 1 330 ? 52.238  87.688  126.666 1.00 76.45  ? 327 ALA C CB  1 
ATOM 10341 N N   . ASP C 1 331 ? 50.310  85.499  127.968 1.00 81.36  ? 328 ASP C N   1 
ATOM 10342 C CA  . ASP C 1 331 ? 50.345  84.479  129.021 1.00 73.05  ? 328 ASP C CA  1 
ATOM 10343 C C   . ASP C 1 331 ? 51.805  84.288  129.449 1.00 92.33  ? 328 ASP C C   1 
ATOM 10344 O O   . ASP C 1 331 ? 52.619  83.767  128.689 1.00 83.30  ? 328 ASP C O   1 
ATOM 10345 C CB  . ASP C 1 331 ? 49.738  83.150  128.524 1.00 70.05  ? 328 ASP C CB  1 
ATOM 10346 C CG  . ASP C 1 331 ? 50.075  81.950  129.430 1.00 99.53  ? 328 ASP C CG  1 
ATOM 10347 O OD1 . ASP C 1 331 ? 51.122  81.964  130.110 1.00 129.65 ? 328 ASP C OD1 1 
ATOM 10348 O OD2 . ASP C 1 331 ? 49.295  80.971  129.449 1.00 82.32  ? 328 ASP C OD2 1 
ATOM 10349 N N   . VAL C 1 332 ? 52.122  84.708  130.670 1.00 79.45  ? 329 VAL C N   1 
ATOM 10350 C CA  . VAL C 1 332 ? 53.498  84.719  131.160 1.00 75.63  ? 329 VAL C CA  1 
ATOM 10351 C C   . VAL C 1 332 ? 54.158  83.344  131.195 1.00 81.75  ? 329 VAL C C   1 
ATOM 10352 O O   . VAL C 1 332 ? 55.351  83.219  130.921 1.00 77.71  ? 329 VAL C O   1 
ATOM 10353 C CB  . VAL C 1 332 ? 53.592  85.401  132.549 1.00 75.24  ? 329 VAL C CB  1 
ATOM 10354 C CG1 . VAL C 1 332 ? 54.958  85.145  133.198 1.00 72.02  ? 329 VAL C CG1 1 
ATOM 10355 C CG2 . VAL C 1 332 ? 53.308  86.912  132.417 1.00 64.02  ? 329 VAL C CG2 1 
ATOM 10356 N N   . GLU C 1 333 ? 53.387  82.315  131.528 1.00 77.84  ? 330 GLU C N   1 
ATOM 10357 C CA  . GLU C 1 333 ? 53.939  80.963  131.603 1.00 75.82  ? 330 GLU C CA  1 
ATOM 10358 C C   . GLU C 1 333 ? 54.349  80.412  130.243 1.00 72.16  ? 330 GLU C C   1 
ATOM 10359 O O   . GLU C 1 333 ? 55.395  79.772  130.121 1.00 84.30  ? 330 GLU C O   1 
ATOM 10360 C CB  . GLU C 1 333 ? 52.986  80.004  132.325 1.00 56.45  ? 330 GLU C CB  1 
ATOM 10361 C CG  . GLU C 1 333 ? 52.912  80.257  133.832 1.00 65.39  ? 330 GLU C CG  1 
ATOM 10362 C CD  . GLU C 1 333 ? 54.283  80.232  134.524 1.00 88.31  ? 330 GLU C CD  1 
ATOM 10363 O OE1 . GLU C 1 333 ? 55.116  79.355  134.190 1.00 80.11  ? 330 GLU C OE1 1 
ATOM 10364 O OE2 . GLU C 1 333 ? 54.525  81.088  135.410 1.00 63.09  ? 330 GLU C OE2 1 
ATOM 10365 N N   . SER C 1 334 ? 53.531  80.668  129.226 1.00 76.43  ? 331 SER C N   1 
ATOM 10366 C CA  . SER C 1 334 ? 53.861  80.279  127.847 1.00 63.68  ? 331 SER C CA  1 
ATOM 10367 C C   . SER C 1 334 ? 55.099  81.017  127.364 1.00 70.35  ? 331 SER C C   1 
ATOM 10368 O O   . SER C 1 334 ? 55.976  80.418  126.740 1.00 65.73  ? 331 SER C O   1 
ATOM 10369 C CB  . SER C 1 334 ? 52.687  80.549  126.897 1.00 60.06  ? 331 SER C CB  1 
ATOM 10370 O OG  . SER C 1 334 ? 51.607  79.667  127.145 1.00 68.14  ? 331 SER C OG  1 
ATOM 10371 N N   . VAL C 1 335 ? 55.166  82.316  127.655 1.00 64.93  ? 332 VAL C N   1 
ATOM 10372 C CA  . VAL C 1 335 ? 56.340  83.111  127.306 1.00 75.25  ? 332 VAL C CA  1 
ATOM 10373 C C   . VAL C 1 335 ? 57.575  82.476  127.928 1.00 64.62  ? 332 VAL C C   1 
ATOM 10374 O O   . VAL C 1 335 ? 58.594  82.297  127.273 1.00 64.49  ? 332 VAL C O   1 
ATOM 10375 C CB  . VAL C 1 335 ? 56.241  84.578  127.803 1.00 58.45  ? 332 VAL C CB  1 
ATOM 10376 C CG1 . VAL C 1 335 ? 57.574  85.289  127.589 1.00 59.95  ? 332 VAL C CG1 1 
ATOM 10377 C CG2 . VAL C 1 335 ? 55.108  85.325  127.104 1.00 66.17  ? 332 VAL C CG2 1 
ATOM 10378 N N   . VAL C 1 336 ? 57.471  82.125  129.202 1.00 74.37  ? 333 VAL C N   1 
ATOM 10379 C CA  . VAL C 1 336 ? 58.622  81.611  129.930 1.00 65.71  ? 333 VAL C CA  1 
ATOM 10380 C C   . VAL C 1 336 ? 59.110  80.273  129.382 1.00 62.96  ? 333 VAL C C   1 
ATOM 10381 O O   . VAL C 1 336 ? 60.282  80.139  129.025 1.00 61.11  ? 333 VAL C O   1 
ATOM 10382 C CB  . VAL C 1 336 ? 58.358  81.533  131.450 1.00 72.55  ? 333 VAL C CB  1 
ATOM 10383 C CG1 . VAL C 1 336 ? 59.429  80.683  132.134 1.00 56.76  ? 333 VAL C CG1 1 
ATOM 10384 C CG2 . VAL C 1 336 ? 58.302  82.944  132.042 1.00 56.01  ? 333 VAL C CG2 1 
ATOM 10385 N N   . SER C 1 337 ? 58.223  79.286  129.295 1.00 56.11  ? 334 SER C N   1 
ATOM 10386 C CA  . SER C 1 337 ? 58.654  77.962  128.853 1.00 73.13  ? 334 SER C CA  1 
ATOM 10387 C C   . SER C 1 337 ? 58.985  77.951  127.363 1.00 73.25  ? 334 SER C C   1 
ATOM 10388 O O   . SER C 1 337 ? 59.904  77.262  126.928 1.00 69.21  ? 334 SER C O   1 
ATOM 10389 C CB  . SER C 1 337 ? 57.607  76.898  129.180 1.00 50.14  ? 334 SER C CB  1 
ATOM 10390 O OG  . SER C 1 337 ? 56.443  77.082  128.390 1.00 82.88  ? 334 SER C OG  1 
ATOM 10391 N N   . GLY C 1 338 ? 58.228  78.718  126.585 1.00 57.01  ? 335 GLY C N   1 
ATOM 10392 C CA  . GLY C 1 338 ? 58.492  78.853  125.167 1.00 52.26  ? 335 GLY C CA  1 
ATOM 10393 C C   . GLY C 1 338 ? 59.849  79.475  124.871 1.00 73.94  ? 335 GLY C C   1 
ATOM 10394 O O   . GLY C 1 338 ? 60.560  79.028  123.968 1.00 58.69  ? 335 GLY C O   1 
ATOM 10395 N N   . THR C 1 339 ? 60.215  80.503  125.638 1.00 51.95  ? 336 THR C N   1 
ATOM 10396 C CA  . THR C 1 339 ? 61.477  81.209  125.420 1.00 63.15  ? 336 THR C CA  1 
ATOM 10397 C C   . THR C 1 339 ? 62.677  80.393  125.872 1.00 68.40  ? 336 THR C C   1 
ATOM 10398 O O   . THR C 1 339 ? 63.733  80.442  125.236 1.00 66.87  ? 336 THR C O   1 
ATOM 10399 C CB  . THR C 1 339 ? 61.509  82.597  126.122 1.00 60.50  ? 336 THR C CB  1 
ATOM 10400 O OG1 . THR C 1 339 ? 60.395  83.383  125.687 1.00 68.93  ? 336 THR C OG1 1 
ATOM 10401 C CG2 . THR C 1 339 ? 62.798  83.342  125.785 1.00 55.26  ? 336 THR C CG2 1 
ATOM 10402 N N   . LEU C 1 340 ? 62.514  79.661  126.974 1.00 57.50  ? 337 LEU C N   1 
ATOM 10403 C CA  . LEU C 1 340 ? 63.583  78.824  127.495 1.00 53.61  ? 337 LEU C CA  1 
ATOM 10404 C C   . LEU C 1 340 ? 63.885  77.736  126.479 1.00 54.44  ? 337 LEU C C   1 
ATOM 10405 O O   . LEU C 1 340 ? 65.045  77.499  126.146 1.00 62.51  ? 337 LEU C O   1 
ATOM 10406 C CB  . LEU C 1 340 ? 63.210  78.228  128.862 1.00 57.82  ? 337 LEU C CB  1 
ATOM 10407 C CG  . LEU C 1 340 ? 63.400  79.192  130.043 1.00 73.88  ? 337 LEU C CG  1 
ATOM 10408 C CD1 . LEU C 1 340 ? 62.487  78.907  131.237 1.00 78.19  ? 337 LEU C CD1 1 
ATOM 10409 C CD2 . LEU C 1 340 ? 64.863  79.354  130.471 1.00 67.66  ? 337 LEU C CD2 1 
ATOM 10410 N N   . ARG C 1 341 ? 62.838  77.079  125.985 1.00 62.67  ? 338 ARG C N   1 
ATOM 10411 C CA  . ARG C 1 341 ? 63.012  76.029  124.985 1.00 72.28  ? 338 ARG C CA  1 
ATOM 10412 C C   . ARG C 1 341 ? 63.682  76.558  123.727 1.00 62.82  ? 338 ARG C C   1 
ATOM 10413 O O   . ARG C 1 341 ? 64.680  75.994  123.287 1.00 53.54  ? 338 ARG C O   1 
ATOM 10414 C CB  . ARG C 1 341 ? 61.685  75.360  124.634 1.00 55.47  ? 338 ARG C CB  1 
ATOM 10415 C CG  . ARG C 1 341 ? 61.282  74.251  125.584 1.00 62.84  ? 338 ARG C CG  1 
ATOM 10416 C CD  . ARG C 1 341 ? 60.034  73.533  125.092 1.00 57.51  ? 338 ARG C CD  1 
ATOM 10417 N NE  . ARG C 1 341 ? 59.716  72.354  125.896 1.00 66.97  ? 338 ARG C NE  1 
ATOM 10418 C CZ  . ARG C 1 341 ? 58.722  71.512  125.625 1.00 79.71  ? 338 ARG C CZ  1 
ATOM 10419 N NH1 . ARG C 1 341 ? 57.941  71.719  124.563 1.00 59.96  ? 338 ARG C NH1 1 
ATOM 10420 N NH2 . ARG C 1 341 ? 58.503  70.464  126.416 1.00 58.33  ? 338 ARG C NH2 1 
ATOM 10421 N N   . SER C 1 342 ? 63.150  77.647  123.172 1.00 57.87  ? 339 SER C N   1 
ATOM 10422 C CA  . SER C 1 342 ? 63.684  78.212  121.931 1.00 65.27  ? 339 SER C CA  1 
ATOM 10423 C C   . SER C 1 342 ? 65.146  78.666  122.065 1.00 69.93  ? 339 SER C C   1 
ATOM 10424 O O   . SER C 1 342 ? 65.978  78.360  121.209 1.00 69.57  ? 339 SER C O   1 
ATOM 10425 C CB  . SER C 1 342 ? 62.800  79.363  121.443 1.00 68.86  ? 339 SER C CB  1 
ATOM 10426 O OG  . SER C 1 342 ? 63.330  79.960  120.280 1.00 78.12  ? 339 SER C OG  1 
ATOM 10427 N N   . ALA C 1 343 ? 65.454  79.372  123.151 1.00 56.74  ? 340 ALA C N   1 
ATOM 10428 C CA  . ALA C 1 343 ? 66.774  79.949  123.342 1.00 57.25  ? 340 ALA C CA  1 
ATOM 10429 C C   . ALA C 1 343 ? 67.846  78.905  123.651 1.00 63.23  ? 340 ALA C C   1 
ATOM 10430 O O   . ALA C 1 343 ? 69.005  79.045  123.228 1.00 56.97  ? 340 ALA C O   1 
ATOM 10431 C CB  . ALA C 1 343 ? 66.728  80.993  124.439 1.00 50.12  ? 340 ALA C CB  1 
ATOM 10432 N N   . PHE C 1 344 ? 67.454  77.860  124.381 1.00 58.88  ? 341 PHE C N   1 
ATOM 10433 C CA  . PHE C 1 344 ? 68.430  76.973  125.024 1.00 64.51  ? 341 PHE C CA  1 
ATOM 10434 C C   . PHE C 1 344 ? 68.438  75.512  124.590 1.00 66.43  ? 341 PHE C C   1 
ATOM 10435 O O   . PHE C 1 344 ? 69.426  74.817  124.834 1.00 64.50  ? 341 PHE C O   1 
ATOM 10436 C CB  . PHE C 1 344 ? 68.349  77.061  126.564 1.00 62.72  ? 341 PHE C CB  1 
ATOM 10437 C CG  . PHE C 1 344 ? 68.632  78.437  127.109 1.00 63.12  ? 341 PHE C CG  1 
ATOM 10438 C CD1 . PHE C 1 344 ? 69.700  79.185  126.636 1.00 75.57  ? 341 PHE C CD1 1 
ATOM 10439 C CD2 . PHE C 1 344 ? 67.805  78.995  128.067 1.00 64.19  ? 341 PHE C CD2 1 
ATOM 10440 C CE1 . PHE C 1 344 ? 69.950  80.462  127.123 1.00 80.71  ? 341 PHE C CE1 1 
ATOM 10441 C CE2 . PHE C 1 344 ? 68.046  80.275  128.552 1.00 68.03  ? 341 PHE C CE2 1 
ATOM 10442 C CZ  . PHE C 1 344 ? 69.122  81.010  128.079 1.00 53.36  ? 341 PHE C CZ  1 
ATOM 10443 N N   . GLU C 1 345 ? 67.365  75.031  123.963 1.00 63.33  ? 342 GLU C N   1 
ATOM 10444 C CA  . GLU C 1 345 ? 67.369  73.645  123.489 1.00 63.41  ? 342 GLU C CA  1 
ATOM 10445 C C   . GLU C 1 345 ? 68.496  73.450  122.495 1.00 53.44  ? 342 GLU C C   1 
ATOM 10446 O O   . GLU C 1 345 ? 68.785  74.341  121.697 1.00 55.95  ? 342 GLU C O   1 
ATOM 10447 C CB  . GLU C 1 345 ? 66.041  73.255  122.860 1.00 48.17  ? 342 GLU C CB  1 
ATOM 10448 C CG  . GLU C 1 345 ? 64.951  73.102  123.869 1.00 53.90  ? 342 GLU C CG  1 
ATOM 10449 C CD  . GLU C 1 345 ? 63.800  72.340  123.305 1.00 74.89  ? 342 GLU C CD  1 
ATOM 10450 O OE1 . GLU C 1 345 ? 63.149  72.852  122.364 1.00 96.51  ? 342 GLU C OE1 1 
ATOM 10451 O OE2 . GLU C 1 345 ? 63.573  71.213  123.792 1.00 89.57  ? 342 GLU C OE2 1 
ATOM 10452 N N   . TYR C 1 346 ? 69.135  72.289  122.566 1.00 51.86  ? 343 TYR C N   1 
ATOM 10453 C CA  . TYR C 1 346 ? 70.349  72.018  121.791 1.00 57.95  ? 343 TYR C CA  1 
ATOM 10454 C C   . TYR C 1 346 ? 71.387  73.148  121.877 1.00 58.12  ? 343 TYR C C   1 
ATOM 10455 O O   . TYR C 1 346 ? 72.144  73.401  120.937 1.00 70.35  ? 343 TYR C O   1 
ATOM 10456 C CB  . TYR C 1 346 ? 70.012  71.677  120.339 1.00 51.54  ? 343 TYR C CB  1 
ATOM 10457 C CG  . TYR C 1 346 ? 71.206  71.197  119.552 1.00 68.87  ? 343 TYR C CG  1 
ATOM 10458 C CD1 . TYR C 1 346 ? 72.120  70.332  120.125 1.00 41.96  ? 343 TYR C CD1 1 
ATOM 10459 C CD2 . TYR C 1 346 ? 71.422  71.609  118.234 1.00 59.22  ? 343 TYR C CD2 1 
ATOM 10460 C CE1 . TYR C 1 346 ? 73.225  69.875  119.415 1.00 76.73  ? 343 TYR C CE1 1 
ATOM 10461 C CE2 . TYR C 1 346 ? 72.528  71.172  117.521 1.00 58.33  ? 343 TYR C CE2 1 
ATOM 10462 C CZ  . TYR C 1 346 ? 73.430  70.296  118.116 1.00 78.24  ? 343 TYR C CZ  1 
ATOM 10463 O OH  . TYR C 1 346 ? 74.545  69.830  117.432 1.00 54.29  ? 343 TYR C OH  1 
ATOM 10464 N N   . GLY C 1 347 ? 71.422  73.820  123.020 1.00 66.20  ? 344 GLY C N   1 
ATOM 10465 C CA  . GLY C 1 347 ? 72.395  74.871  123.254 1.00 59.44  ? 344 GLY C CA  1 
ATOM 10466 C C   . GLY C 1 347 ? 72.250  76.097  122.376 1.00 74.08  ? 344 GLY C C   1 
ATOM 10467 O O   . GLY C 1 347 ? 73.225  76.817  122.132 1.00 74.86  ? 344 GLY C O   1 
ATOM 10468 N N   . GLY C 1 348 ? 71.032  76.355  121.914 1.00 56.94  ? 345 GLY C N   1 
ATOM 10469 C CA  . GLY C 1 348 ? 70.783  77.530  121.100 1.00 62.75  ? 345 GLY C CA  1 
ATOM 10470 C C   . GLY C 1 348 ? 71.426  77.487  119.711 1.00 70.70  ? 345 GLY C C   1 
ATOM 10471 O O   . GLY C 1 348 ? 71.554  78.520  119.054 1.00 69.01  ? 345 GLY C O   1 
ATOM 10472 N N   . GLN C 1 349 ? 71.817  76.289  119.278 1.00 60.56  ? 346 GLN C N   1 
ATOM 10473 C CA  . GLN C 1 349 ? 72.501  76.058  118.006 1.00 66.40  ? 346 GLN C CA  1 
ATOM 10474 C C   . GLN C 1 349 ? 71.518  75.695  116.881 1.00 64.47  ? 346 GLN C C   1 
ATOM 10475 O O   . GLN C 1 349 ? 71.659  74.679  116.202 1.00 60.27  ? 346 GLN C O   1 
ATOM 10476 C CB  . GLN C 1 349 ? 73.537  74.941  118.154 1.00 53.31  ? 346 GLN C CB  1 
ATOM 10477 C CG  . GLN C 1 349 ? 74.474  75.118  119.330 1.00 73.00  ? 346 GLN C CG  1 
ATOM 10478 C CD  . GLN C 1 349 ? 75.638  74.162  119.283 1.00 71.02  ? 346 GLN C CD  1 
ATOM 10479 O OE1 . GLN C 1 349 ? 76.753  74.532  118.880 1.00 70.26  ? 346 GLN C OE1 1 
ATOM 10480 N NE2 . GLN C 1 349 ? 75.389  72.918  119.683 1.00 52.70  ? 346 GLN C NE2 1 
ATOM 10481 N N   . LYS C 1 350 ? 70.514  76.533  116.701 1.00 65.18  ? 347 LYS C N   1 
ATOM 10482 C CA  . LYS C 1 350 ? 69.560  76.341  115.637 1.00 61.62  ? 347 LYS C CA  1 
ATOM 10483 C C   . LYS C 1 350 ? 69.422  77.660  114.931 1.00 75.21  ? 347 LYS C C   1 
ATOM 10484 O O   . LYS C 1 350 ? 69.436  78.713  115.580 1.00 65.48  ? 347 LYS C O   1 
ATOM 10485 C CB  . LYS C 1 350 ? 68.202  75.915  116.187 1.00 45.96  ? 347 LYS C CB  1 
ATOM 10486 C CG  . LYS C 1 350 ? 68.172  74.555  116.869 1.00 48.17  ? 347 LYS C CG  1 
ATOM 10487 C CD  . LYS C 1 350 ? 66.756  74.259  117.347 1.00 54.76  ? 347 LYS C CD  1 
ATOM 10488 C CE  . LYS C 1 350 ? 66.684  72.964  118.126 1.00 60.21  ? 347 LYS C CE  1 
ATOM 10489 N NZ  . LYS C 1 350 ? 65.313  72.736  118.656 1.00 65.50  ? 347 LYS C NZ  1 
ATOM 10490 N N   . CYS C 1 351 ? 69.301  77.592  113.605 1.00 69.09  ? 348 CYS C N   1 
ATOM 10491 C CA  . CYS C 1 351 ? 69.089  78.770  112.776 1.00 63.54  ? 348 CYS C CA  1 
ATOM 10492 C C   . CYS C 1 351 ? 67.827  79.512  113.237 1.00 59.22  ? 348 CYS C C   1 
ATOM 10493 O O   . CYS C 1 351 ? 67.708  80.725  113.052 1.00 69.42  ? 348 CYS C O   1 
ATOM 10494 C CB  . CYS C 1 351 ? 68.968  78.341  111.311 1.00 79.93  ? 348 CYS C CB  1 
ATOM 10495 S SG  . CYS C 1 351 ? 70.297  77.215  110.779 1.00 105.79 ? 348 CYS C SG  1 
ATOM 10496 N N   . SER C 1 352 ? 66.910  78.771  113.865 1.00 62.07  ? 349 SER C N   1 
ATOM 10497 C CA  . SER C 1 352 ? 65.642  79.303  114.353 1.00 53.32  ? 349 SER C CA  1 
ATOM 10498 C C   . SER C 1 352 ? 65.600  79.723  115.825 1.00 65.89  ? 349 SER C C   1 
ATOM 10499 O O   . SER C 1 352 ? 64.616  80.331  116.260 1.00 70.46  ? 349 SER C O   1 
ATOM 10500 C CB  . SER C 1 352 ? 64.550  78.271  114.131 1.00 63.70  ? 349 SER C CB  1 
ATOM 10501 O OG  . SER C 1 352 ? 64.972  77.028  114.654 1.00 65.56  ? 349 SER C OG  1 
ATOM 10502 N N   . ALA C 1 353 ? 66.643  79.412  116.593 1.00 59.59  ? 350 ALA C N   1 
ATOM 10503 C CA  . ALA C 1 353 ? 66.659  79.753  118.022 1.00 60.13  ? 350 ALA C CA  1 
ATOM 10504 C C   . ALA C 1 353 ? 66.411  81.232  118.304 1.00 61.04  ? 350 ALA C C   1 
ATOM 10505 O O   . ALA C 1 353 ? 66.929  82.116  117.613 1.00 72.23  ? 350 ALA C O   1 
ATOM 10506 C CB  . ALA C 1 353 ? 67.959  79.302  118.692 1.00 48.01  ? 350 ALA C CB  1 
ATOM 10507 N N   . CYS C 1 354 ? 65.606  81.478  119.334 1.00 64.09  ? 351 CYS C N   1 
ATOM 10508 C CA  . CYS C 1 354 ? 65.374  82.812  119.868 1.00 66.84  ? 351 CYS C CA  1 
ATOM 10509 C C   . CYS C 1 354 ? 66.606  83.306  120.624 1.00 65.17  ? 351 CYS C C   1 
ATOM 10510 O O   . CYS C 1 354 ? 67.110  82.614  121.502 1.00 75.78  ? 351 CYS C O   1 
ATOM 10511 C CB  . CYS C 1 354 ? 64.186  82.771  120.825 1.00 59.25  ? 351 CYS C CB  1 
ATOM 10512 S SG  . CYS C 1 354 ? 63.994  84.266  121.774 1.00 77.37  ? 351 CYS C SG  1 
ATOM 10513 N N   . SER C 1 355 ? 67.090  84.497  120.283 1.00 51.53  ? 352 SER C N   1 
ATOM 10514 C CA  . SER C 1 355 ? 68.265  85.062  120.945 1.00 65.97  ? 352 SER C CA  1 
ATOM 10515 C C   . SER C 1 355 ? 68.049  86.529  121.315 1.00 72.56  ? 352 SER C C   1 
ATOM 10516 O O   . SER C 1 355 ? 68.906  87.147  121.951 1.00 77.20  ? 352 SER C O   1 
ATOM 10517 C CB  . SER C 1 355 ? 69.539  84.885  120.100 1.00 67.16  ? 352 SER C CB  1 
ATOM 10518 O OG  . SER C 1 355 ? 69.478  85.627  118.894 1.00 79.42  ? 352 SER C OG  1 
ATOM 10519 N N   . ARG C 1 356 ? 66.911  87.076  120.899 1.00 56.95  ? 353 ARG C N   1 
ATOM 10520 C CA  . ARG C 1 356 ? 66.508  88.410  121.307 1.00 66.12  ? 353 ARG C CA  1 
ATOM 10521 C C   . ARG C 1 356 ? 65.040  88.411  121.734 1.00 79.07  ? 353 ARG C C   1 
ATOM 10522 O O   . ARG C 1 356 ? 64.149  88.038  120.964 1.00 75.52  ? 353 ARG C O   1 
ATOM 10523 C CB  . ARG C 1 356 ? 66.839  89.480  120.238 1.00 48.32  ? 353 ARG C CB  1 
ATOM 10524 C CG  . ARG C 1 356 ? 66.486  89.179  118.811 1.00 60.22  ? 353 ARG C CG  1 
ATOM 10525 C CD  . ARG C 1 356 ? 66.096  90.487  118.142 1.00 64.02  ? 353 ARG C CD  1 
ATOM 10526 N NE  . ARG C 1 356 ? 66.347  90.523  116.728 1.00 88.77  ? 353 ARG C NE  1 
ATOM 10527 C CZ  . ARG C 1 356 ? 65.536  90.711  115.690 1.00 76.79  ? 353 ARG C CZ  1 
ATOM 10528 N NH1 . ARG C 1 356 ? 66.135  90.699  114.523 1.00 112.81 ? 353 ARG C NH1 1 
ATOM 10529 N NH2 . ARG C 1 356 ? 64.224  90.912  115.744 1.00 94.88  ? 353 ARG C NH2 1 
ATOM 10530 N N   . LEU C 1 357 ? 64.817  88.798  122.988 1.00 67.11  ? 354 LEU C N   1 
ATOM 10531 C CA  . LEU C 1 357 ? 63.485  88.808  123.590 1.00 66.89  ? 354 LEU C CA  1 
ATOM 10532 C C   . LEU C 1 357 ? 63.095  90.237  123.955 1.00 78.58  ? 354 LEU C C   1 
ATOM 10533 O O   . LEU C 1 357 ? 63.856  90.939  124.620 1.00 84.65  ? 354 LEU C O   1 
ATOM 10534 C CB  . LEU C 1 357 ? 63.474  87.926  124.849 1.00 69.45  ? 354 LEU C CB  1 
ATOM 10535 C CG  . LEU C 1 357 ? 62.288  87.980  125.819 1.00 59.60  ? 354 LEU C CG  1 
ATOM 10536 C CD1 . LEU C 1 357 ? 61.019  87.362  125.204 1.00 65.55  ? 354 LEU C CD1 1 
ATOM 10537 C CD2 . LEU C 1 357 ? 62.654  87.260  127.105 1.00 74.15  ? 354 LEU C CD2 1 
ATOM 10538 N N   . TYR C 1 358 ? 61.913  90.669  123.521 1.00 70.55  ? 355 TYR C N   1 
ATOM 10539 C CA  . TYR C 1 358 ? 61.415  92.010  123.849 1.00 70.69  ? 355 TYR C CA  1 
ATOM 10540 C C   . TYR C 1 358 ? 60.246  91.938  124.857 1.00 80.26  ? 355 TYR C C   1 
ATOM 10541 O O   . TYR C 1 358 ? 59.222  91.308  124.592 1.00 76.20  ? 355 TYR C O   1 
ATOM 10542 C CB  . TYR C 1 358 ? 60.985  92.745  122.575 1.00 62.29  ? 355 TYR C CB  1 
ATOM 10543 C CG  . TYR C 1 358 ? 62.088  92.962  121.556 1.00 75.84  ? 355 TYR C CG  1 
ATOM 10544 C CD1 . TYR C 1 358 ? 62.741  94.182  121.464 1.00 70.75  ? 355 TYR C CD1 1 
ATOM 10545 C CD2 . TYR C 1 358 ? 62.464  91.950  120.671 1.00 76.12  ? 355 TYR C CD2 1 
ATOM 10546 C CE1 . TYR C 1 358 ? 63.740  94.393  120.521 1.00 84.59  ? 355 TYR C CE1 1 
ATOM 10547 C CE2 . TYR C 1 358 ? 63.465  92.155  119.720 1.00 77.47  ? 355 TYR C CE2 1 
ATOM 10548 C CZ  . TYR C 1 358 ? 64.095  93.377  119.652 1.00 77.95  ? 355 TYR C CZ  1 
ATOM 10549 O OH  . TYR C 1 358 ? 65.086  93.585  118.724 1.00 76.07  ? 355 TYR C OH  1 
ATOM 10550 N N   . VAL C 1 359 ? 60.414  92.579  126.012 1.00 81.41  ? 356 VAL C N   1 
ATOM 10551 C CA  . VAL C 1 359 ? 59.469  92.455  127.128 1.00 82.34  ? 356 VAL C CA  1 
ATOM 10552 C C   . VAL C 1 359 ? 58.962  93.828  127.580 1.00 92.35  ? 356 VAL C C   1 
ATOM 10553 O O   . VAL C 1 359 ? 59.742  94.788  127.683 1.00 73.38  ? 356 VAL C O   1 
ATOM 10554 C CB  . VAL C 1 359 ? 60.118  91.765  128.372 1.00 81.82  ? 356 VAL C CB  1 
ATOM 10555 C CG1 . VAL C 1 359 ? 59.064  91.402  129.390 1.00 86.44  ? 356 VAL C CG1 1 
ATOM 10556 C CG2 . VAL C 1 359 ? 60.895  90.522  127.984 1.00 83.14  ? 356 VAL C CG2 1 
ATOM 10557 N N   . PRO C 1 360 ? 57.651  93.927  127.865 1.00 82.09  ? 357 PRO C N   1 
ATOM 10558 C CA  . PRO C 1 360 ? 57.065  95.180  128.352 1.00 82.90  ? 357 PRO C CA  1 
ATOM 10559 C C   . PRO C 1 360 ? 57.488  95.452  129.803 1.00 89.45  ? 357 PRO C C   1 
ATOM 10560 O O   . PRO C 1 360 ? 57.633  94.514  130.598 1.00 67.28  ? 357 PRO C O   1 
ATOM 10561 C CB  . PRO C 1 360 ? 55.550  94.919  128.283 1.00 78.63  ? 357 PRO C CB  1 
ATOM 10562 C CG  . PRO C 1 360 ? 55.377  93.595  127.601 1.00 82.74  ? 357 PRO C CG  1 
ATOM 10563 C CD  . PRO C 1 360 ? 56.653  92.848  127.798 1.00 84.93  ? 357 PRO C CD  1 
ATOM 10564 N N   . HIS C 1 361 ? 57.691  96.723  130.137 1.00 86.69  ? 358 HIS C N   1 
ATOM 10565 C CA  . HIS C 1 361 ? 58.088  97.105  131.484 1.00 83.12  ? 358 HIS C CA  1 
ATOM 10566 C C   . HIS C 1 361 ? 57.134  96.510  132.532 1.00 87.48  ? 358 HIS C C   1 
ATOM 10567 O O   . HIS C 1 361 ? 57.568  95.953  133.547 1.00 73.77  ? 358 HIS C O   1 
ATOM 10568 C CB  . HIS C 1 361 ? 58.153  98.630  131.594 1.00 91.56  ? 358 HIS C CB  1 
ATOM 10569 C CG  . HIS C 1 361 ? 58.538  99.118  132.952 1.00 110.80 ? 358 HIS C CG  1 
ATOM 10570 N ND1 . HIS C 1 361 ? 59.831  99.058  133.425 1.00 122.86 ? 358 HIS C ND1 1 
ATOM 10571 C CD2 . HIS C 1 361 ? 57.797  99.669  133.943 1.00 101.94 ? 358 HIS C CD2 1 
ATOM 10572 C CE1 . HIS C 1 361 ? 59.871  99.555  134.650 1.00 127.47 ? 358 HIS C CE1 1 
ATOM 10573 N NE2 . HIS C 1 361 ? 58.651  99.933  134.988 1.00 111.38 ? 358 HIS C NE2 1 
ATOM 10574 N N   . SER C 1 362 ? 55.832  96.599  132.268 1.00 97.38  ? 359 SER C N   1 
ATOM 10575 C CA  . SER C 1 362 ? 54.812  96.101  133.201 1.00 89.05  ? 359 SER C CA  1 
ATOM 10576 C C   . SER C 1 362 ? 54.981  94.622  133.572 1.00 87.07  ? 359 SER C C   1 
ATOM 10577 O O   . SER C 1 362 ? 54.713  94.224  134.710 1.00 80.48  ? 359 SER C O   1 
ATOM 10578 C CB  . SER C 1 362 ? 53.397  96.356  132.648 1.00 88.76  ? 359 SER C CB  1 
ATOM 10579 O OG  . SER C 1 362 ? 53.101  95.528  131.537 1.00 93.13  ? 359 SER C OG  1 
ATOM 10580 N N   . LEU C 1 363 ? 55.422  93.817  132.606 1.00 94.57  ? 360 LEU C N   1 
ATOM 10581 C CA  . LEU C 1 363 ? 55.552  92.376  132.799 1.00 79.09  ? 360 LEU C CA  1 
ATOM 10582 C C   . LEU C 1 363 ? 56.950  91.934  133.233 1.00 85.37  ? 360 LEU C C   1 
ATOM 10583 O O   . LEU C 1 363 ? 57.129  90.796  133.672 1.00 93.73  ? 360 LEU C O   1 
ATOM 10584 C CB  . LEU C 1 363 ? 55.171  91.632  131.517 1.00 90.88  ? 360 LEU C CB  1 
ATOM 10585 C CG  . LEU C 1 363 ? 53.674  91.445  131.259 1.00 95.04  ? 360 LEU C CG  1 
ATOM 10586 C CD1 . LEU C 1 363 ? 53.351  91.025  129.810 1.00 85.67  ? 360 LEU C CD1 1 
ATOM 10587 C CD2 . LEU C 1 363 ? 53.035  90.526  132.288 1.00 86.27  ? 360 LEU C CD2 1 
ATOM 10588 N N   . TRP C 1 364 ? 57.937  92.819  133.107 1.00 81.74  ? 361 TRP C N   1 
ATOM 10589 C CA  . TRP C 1 364 ? 59.332  92.428  133.296 1.00 74.99  ? 361 TRP C CA  1 
ATOM 10590 C C   . TRP C 1 364 ? 59.612  91.792  134.656 1.00 89.89  ? 361 TRP C C   1 
ATOM 10591 O O   . TRP C 1 364 ? 60.246  90.733  134.719 1.00 84.08  ? 361 TRP C O   1 
ATOM 10592 C CB  . TRP C 1 364 ? 60.287  93.599  133.025 1.00 72.67  ? 361 TRP C CB  1 
ATOM 10593 C CG  . TRP C 1 364 ? 61.756  93.258  133.192 1.00 77.10  ? 361 TRP C CG  1 
ATOM 10594 C CD1 . TRP C 1 364 ? 62.700  94.008  133.836 1.00 78.51  ? 361 TRP C CD1 1 
ATOM 10595 C CD2 . TRP C 1 364 ? 62.434  92.081  132.720 1.00 72.11  ? 361 TRP C CD2 1 
ATOM 10596 N NE1 . TRP C 1 364 ? 63.921  93.377  133.791 1.00 88.56  ? 361 TRP C NE1 1 
ATOM 10597 C CE2 . TRP C 1 364 ? 63.786  92.193  133.112 1.00 88.71  ? 361 TRP C CE2 1 
ATOM 10598 C CE3 . TRP C 1 364 ? 62.032  90.948  132.001 1.00 84.31  ? 361 TRP C CE3 1 
ATOM 10599 C CZ2 . TRP C 1 364 ? 64.740  91.215  132.806 1.00 85.05  ? 361 TRP C CZ2 1 
ATOM 10600 C CZ3 . TRP C 1 364 ? 62.978  89.975  131.701 1.00 75.93  ? 361 TRP C CZ3 1 
ATOM 10601 C CH2 . TRP C 1 364 ? 64.316  90.117  132.103 1.00 82.06  ? 361 TRP C CH2 1 
ATOM 10602 N N   . PRO C 1 365 ? 59.140  92.421  135.746 1.00 90.38  ? 362 PRO C N   1 
ATOM 10603 C CA  . PRO C 1 365 ? 59.479  91.855  137.061 1.00 92.81  ? 362 PRO C CA  1 
ATOM 10604 C C   . PRO C 1 365 ? 59.022  90.403  137.167 1.00 81.63  ? 362 PRO C C   1 
ATOM 10605 O O   . PRO C 1 365 ? 59.785  89.539  137.615 1.00 83.24  ? 362 PRO C O   1 
ATOM 10606 C CB  . PRO C 1 365 ? 58.709  92.750  138.043 1.00 74.95  ? 362 PRO C CB  1 
ATOM 10607 C CG  . PRO C 1 365 ? 58.564  94.067  137.308 1.00 77.74  ? 362 PRO C CG  1 
ATOM 10608 C CD  . PRO C 1 365 ? 58.348  93.660  135.858 1.00 80.60  ? 362 PRO C CD  1 
ATOM 10609 N N   . GLN C 1 366 ? 57.796  90.138  136.726 1.00 57.86  ? 363 GLN C N   1 
ATOM 10610 C CA  . GLN C 1 366 ? 57.235  88.794  136.804 1.00 73.44  ? 363 GLN C CA  1 
ATOM 10611 C C   . GLN C 1 366 ? 58.006  87.818  135.928 1.00 94.74  ? 363 GLN C C   1 
ATOM 10612 O O   . GLN C 1 366 ? 58.341  86.714  136.361 1.00 90.71  ? 363 GLN C O   1 
ATOM 10613 C CB  . GLN C 1 366 ? 55.762  88.803  136.386 1.00 76.70  ? 363 GLN C CB  1 
ATOM 10614 C CG  . GLN C 1 366 ? 55.119  87.431  136.344 1.00 73.70  ? 363 GLN C CG  1 
ATOM 10615 N N   . ILE C 1 367 ? 58.284  88.233  134.694 1.00 83.92  ? 364 ILE C N   1 
ATOM 10616 C CA  . ILE C 1 367 ? 58.977  87.385  133.727 1.00 73.37  ? 364 ILE C CA  1 
ATOM 10617 C C   . ILE C 1 367 ? 60.448  87.173  134.108 1.00 89.27  ? 364 ILE C C   1 
ATOM 10618 O O   . ILE C 1 367 ? 60.964  86.063  133.986 1.00 72.68  ? 364 ILE C O   1 
ATOM 10619 C CB  . ILE C 1 367 ? 58.844  87.954  132.286 1.00 84.75  ? 364 ILE C CB  1 
ATOM 10620 C CG1 . ILE C 1 367 ? 57.392  87.870  131.824 1.00 77.98  ? 364 ILE C CG1 1 
ATOM 10621 C CG2 . ILE C 1 367 ? 59.715  87.191  131.301 1.00 69.64  ? 364 ILE C CG2 1 
ATOM 10622 C CD1 . ILE C 1 367 ? 57.129  88.546  130.510 1.00 75.45  ? 364 ILE C CD1 1 
ATOM 10623 N N   . LYS C 1 368 ? 61.111  88.227  134.588 1.00 79.11  ? 365 LYS C N   1 
ATOM 10624 C CA  . LYS C 1 368 ? 62.498  88.121  135.041 1.00 76.59  ? 365 LYS C CA  1 
ATOM 10625 C C   . LYS C 1 368 ? 62.626  87.093  136.171 1.00 91.43  ? 365 LYS C C   1 
ATOM 10626 O O   . LYS C 1 368 ? 63.596  86.312  136.231 1.00 76.16  ? 365 LYS C O   1 
ATOM 10627 C CB  . LYS C 1 368 ? 63.020  89.482  135.500 1.00 74.50  ? 365 LYS C CB  1 
ATOM 10628 C CG  . LYS C 1 368 ? 64.400  89.436  136.128 1.00 72.62  ? 365 LYS C CG  1 
ATOM 10629 C CD  . LYS C 1 368 ? 64.841  90.815  136.557 1.00 73.37  ? 365 LYS C CD  1 
ATOM 10630 C CE  . LYS C 1 368 ? 66.305  90.822  136.975 1.00 94.29  ? 365 LYS C CE  1 
ATOM 10631 N NZ  . LYS C 1 368 ? 66.794  92.212  137.195 1.00 85.27  ? 365 LYS C NZ  1 
ATOM 10632 N N   . GLY C 1 369 ? 61.629  87.094  137.057 1.00 79.79  ? 366 GLY C N   1 
ATOM 10633 C CA  . GLY C 1 369 ? 61.627  86.237  138.231 1.00 73.90  ? 366 GLY C CA  1 
ATOM 10634 C C   . GLY C 1 369 ? 61.385  84.780  137.903 1.00 86.75  ? 366 GLY C C   1 
ATOM 10635 O O   . GLY C 1 369 ? 62.076  83.883  138.406 1.00 84.46  ? 366 GLY C O   1 
ATOM 10636 N N   . ARG C 1 370 ? 60.393  84.549  137.051 1.00 75.21  ? 367 ARG C N   1 
ATOM 10637 C CA  . ARG C 1 370 ? 60.064  83.206  136.594 1.00 68.53  ? 367 ARG C CA  1 
ATOM 10638 C C   . ARG C 1 370 ? 61.199  82.629  135.754 1.00 78.64  ? 367 ARG C C   1 
ATOM 10639 O O   . ARG C 1 370 ? 61.516  81.445  135.867 1.00 66.52  ? 367 ARG C O   1 
ATOM 10640 C CB  . ARG C 1 370 ? 58.755  83.236  135.798 1.00 64.90  ? 367 ARG C CB  1 
ATOM 10641 C CG  . ARG C 1 370 ? 57.527  83.635  136.648 1.00 70.75  ? 367 ARG C CG  1 
ATOM 10642 C CD  . ARG C 1 370 ? 57.160  82.470  137.562 1.00 49.75  ? 367 ARG C CD  1 
ATOM 10643 N NE  . ARG C 1 370 ? 57.559  81.416  136.701 1.00 76.05  ? 367 ARG C NE  1 
ATOM 10644 C CZ  . ARG C 1 370 ? 57.883  80.147  136.854 1.00 70.20  ? 367 ARG C CZ  1 
ATOM 10645 N NH1 . ARG C 1 370 ? 58.231  79.588  135.723 1.00 109.87 ? 367 ARG C NH1 1 
ATOM 10646 N NH2 . ARG C 1 370 ? 57.875  79.430  137.965 1.00 87.09  ? 367 ARG C NH2 1 
ATOM 10647 N N   . LEU C 1 371 ? 61.811  83.474  134.921 1.00 74.28  ? 368 LEU C N   1 
ATOM 10648 C CA  . LEU C 1 371 ? 62.934  83.050  134.087 1.00 75.82  ? 368 LEU C CA  1 
ATOM 10649 C C   . LEU C 1 371 ? 64.110  82.638  134.945 1.00 66.38  ? 368 LEU C C   1 
ATOM 10650 O O   . LEU C 1 371 ? 64.657  81.561  134.765 1.00 58.53  ? 368 LEU C O   1 
ATOM 10651 C CB  . LEU C 1 371 ? 63.376  84.156  133.122 1.00 75.88  ? 368 LEU C CB  1 
ATOM 10652 C CG  . LEU C 1 371 ? 62.578  84.268  131.834 1.00 71.48  ? 368 LEU C CG  1 
ATOM 10653 C CD1 . LEU C 1 371 ? 63.151  85.370  130.994 1.00 62.89  ? 368 LEU C CD1 1 
ATOM 10654 C CD2 . LEU C 1 371 ? 62.592  82.939  131.097 1.00 71.69  ? 368 LEU C CD2 1 
ATOM 10655 N N   . LEU C 1 372 ? 64.501  83.511  135.869 1.00 64.87  ? 369 LEU C N   1 
ATOM 10656 C CA  . LEU C 1 372 ? 65.614  83.220  136.769 1.00 80.37  ? 369 LEU C CA  1 
ATOM 10657 C C   . LEU C 1 372 ? 65.366  81.966  137.621 1.00 80.14  ? 369 LEU C C   1 
ATOM 10658 O O   . LEU C 1 372 ? 66.274  81.152  137.828 1.00 69.10  ? 369 LEU C O   1 
ATOM 10659 C CB  . LEU C 1 372 ? 65.929  84.434  137.649 1.00 63.44  ? 369 LEU C CB  1 
ATOM 10660 C CG  . LEU C 1 372 ? 67.006  85.353  137.062 1.00 71.97  ? 369 LEU C CG  1 
ATOM 10661 C CD1 . LEU C 1 372 ? 66.846  85.491  135.571 1.00 59.84  ? 369 LEU C CD1 1 
ATOM 10662 C CD2 . LEU C 1 372 ? 66.983  86.709  137.736 1.00 68.99  ? 369 LEU C CD2 1 
ATOM 10663 N N   . GLU C 1 373 ? 64.134  81.800  138.095 1.00 68.50  ? 370 GLU C N   1 
ATOM 10664 C CA  . GLU C 1 373 ? 63.793  80.612  138.875 1.00 84.56  ? 370 GLU C CA  1 
ATOM 10665 C C   . GLU C 1 373 ? 63.892  79.327  138.054 1.00 78.47  ? 370 GLU C C   1 
ATOM 10666 O O   . GLU C 1 373 ? 64.415  78.326  138.538 1.00 58.41  ? 370 GLU C O   1 
ATOM 10667 C CB  . GLU C 1 373 ? 62.394  80.717  139.502 1.00 69.97  ? 370 GLU C CB  1 
ATOM 10668 C CG  . GLU C 1 373 ? 62.063  79.559  140.469 1.00 62.49  ? 370 GLU C CG  1 
ATOM 10669 C CD  . GLU C 1 373 ? 60.550  79.318  140.642 1.00 83.82  ? 370 GLU C CD  1 
ATOM 10670 O OE1 . GLU C 1 373 ? 59.735  80.188  140.254 1.00 67.90  ? 370 GLU C OE1 1 
ATOM 10671 O OE2 . GLU C 1 373 ? 60.173  78.244  141.159 1.00 81.17  ? 370 GLU C OE2 1 
ATOM 10672 N N   . GLU C 1 374 ? 63.375  79.348  136.827 1.00 61.53  ? 371 GLU C N   1 
ATOM 10673 C CA  . GLU C 1 374 ? 63.439  78.167  135.973 1.00 62.94  ? 371 GLU C CA  1 
ATOM 10674 C C   . GLU C 1 374 ? 64.862  77.893  135.468 1.00 62.59  ? 371 GLU C C   1 
ATOM 10675 O O   . GLU C 1 374 ? 65.288  76.744  135.388 1.00 63.79  ? 371 GLU C O   1 
ATOM 10676 C CB  . GLU C 1 374 ? 62.446  78.284  134.816 1.00 55.57  ? 371 GLU C CB  1 
ATOM 10677 C CG  . GLU C 1 374 ? 60.998  78.293  135.254 1.00 64.49  ? 371 GLU C CG  1 
ATOM 10678 C CD  . GLU C 1 374 ? 60.625  77.086  136.119 1.00 88.66  ? 371 GLU C CD  1 
ATOM 10679 O OE1 . GLU C 1 374 ? 61.177  75.977  135.904 1.00 72.03  ? 371 GLU C OE1 1 
ATOM 10680 O OE2 . GLU C 1 374 ? 59.772  77.255  137.021 1.00 77.43  ? 371 GLU C OE2 1 
ATOM 10681 N N   . HIS C 1 375 ? 65.589  78.955  135.140 1.00 70.00  ? 372 HIS C N   1 
ATOM 10682 C CA  . HIS C 1 375 ? 66.962  78.843  134.660 1.00 77.02  ? 372 HIS C CA  1 
ATOM 10683 C C   . HIS C 1 375 ? 67.784  78.007  135.628 1.00 77.13  ? 372 HIS C C   1 
ATOM 10684 O O   . HIS C 1 375 ? 68.610  77.194  135.211 1.00 66.56  ? 372 HIS C O   1 
ATOM 10685 C CB  . HIS C 1 375 ? 67.588  80.243  134.510 1.00 70.80  ? 372 HIS C CB  1 
ATOM 10686 C CG  . HIS C 1 375 ? 69.052  80.222  134.204 1.00 81.75  ? 372 HIS C CG  1 
ATOM 10687 N ND1 . HIS C 1 375 ? 70.008  79.976  135.167 1.00 80.19  ? 372 HIS C ND1 1 
ATOM 10688 C CD2 . HIS C 1 375 ? 69.724  80.415  133.044 1.00 78.18  ? 372 HIS C CD2 1 
ATOM 10689 C CE1 . HIS C 1 375 ? 71.205  80.014  134.613 1.00 81.80  ? 372 HIS C CE1 1 
ATOM 10690 N NE2 . HIS C 1 375 ? 71.061  80.286  133.327 1.00 86.99  ? 372 HIS C NE2 1 
ATOM 10691 N N   . SER C 1 376 ? 67.554  78.217  136.924 1.00 64.49  ? 373 SER C N   1 
ATOM 10692 C CA  . SER C 1 376 ? 68.342  77.553  137.965 1.00 89.69  ? 373 SER C CA  1 
ATOM 10693 C C   . SER C 1 376 ? 68.049  76.054  138.045 1.00 75.91  ? 373 SER C C   1 
ATOM 10694 O O   . SER C 1 376 ? 68.820  75.305  138.638 1.00 63.22  ? 373 SER C O   1 
ATOM 10695 C CB  . SER C 1 376 ? 68.174  78.230  139.347 1.00 88.02  ? 373 SER C CB  1 
ATOM 10696 O OG  . SER C 1 376 ? 66.925  77.953  139.955 1.00 81.00  ? 373 SER C OG  1 
ATOM 10697 N N   . ARG C 1 377 ? 66.937  75.632  137.446 1.00 67.06  ? 374 ARG C N   1 
ATOM 10698 C CA  . ARG C 1 377 ? 66.559  74.220  137.401 1.00 72.19  ? 374 ARG C CA  1 
ATOM 10699 C C   . ARG C 1 377 ? 67.094  73.512  136.148 1.00 74.94  ? 374 ARG C C   1 
ATOM 10700 O O   . ARG C 1 377 ? 66.888  72.308  136.001 1.00 66.51  ? 374 ARG C O   1 
ATOM 10701 C CB  . ARG C 1 377 ? 65.016  74.036  137.479 1.00 64.34  ? 374 ARG C CB  1 
ATOM 10702 C CG  . ARG C 1 377 ? 64.320  74.374  138.826 1.00 80.63  ? 374 ARG C CG  1 
ATOM 10703 C CD  . ARG C 1 377 ? 62.801  74.072  138.800 1.00 51.82  ? 374 ARG C CD  1 
ATOM 10704 N N   . ILE C 1 378 ? 67.764  74.248  135.252 1.00 84.71  ? 375 ILE C N   1 
ATOM 10705 C CA  . ILE C 1 378 ? 68.250  73.696  133.970 1.00 77.29  ? 375 ILE C CA  1 
ATOM 10706 C C   . ILE C 1 378 ? 69.533  72.874  134.134 1.00 87.58  ? 375 ILE C C   1 
ATOM 10707 O O   . ILE C 1 378 ? 70.574  73.412  134.506 1.00 77.64  ? 375 ILE C O   1 
ATOM 10708 C CB  . ILE C 1 378 ? 68.521  74.809  132.926 1.00 67.19  ? 375 ILE C CB  1 
ATOM 10709 C CG1 . ILE C 1 378 ? 67.214  75.436  132.448 1.00 60.09  ? 375 ILE C CG1 1 
ATOM 10710 C CG2 . ILE C 1 378 ? 69.308  74.255  131.727 1.00 59.64  ? 375 ILE C CG2 1 
ATOM 10711 C CD1 . ILE C 1 378 ? 67.421  76.643  131.564 1.00 64.58  ? 375 ILE C CD1 1 
ATOM 10712 N N   . LYS C 1 379 ? 69.469  71.577  133.849 1.00 68.24  ? 376 LYS C N   1 
ATOM 10713 C CA  . LYS C 1 379 ? 70.656  70.741  133.962 1.00 71.19  ? 376 LYS C CA  1 
ATOM 10714 C C   . LYS C 1 379 ? 71.379  70.624  132.613 1.00 87.12  ? 376 LYS C C   1 
ATOM 10715 O O   . LYS C 1 379 ? 70.787  70.223  131.600 1.00 65.95  ? 376 LYS C O   1 
ATOM 10716 C CB  . LYS C 1 379 ? 70.315  69.359  134.547 1.00 65.22  ? 376 LYS C CB  1 
ATOM 10717 N N   . VAL C 1 380 ? 72.656  71.009  132.619 1.00 69.73  ? 377 VAL C N   1 
ATOM 10718 C CA  . VAL C 1 380 ? 73.559  70.826  131.480 1.00 66.11  ? 377 VAL C CA  1 
ATOM 10719 C C   . VAL C 1 380 ? 74.554  69.685  131.731 1.00 70.27  ? 377 VAL C C   1 
ATOM 10720 O O   . VAL C 1 380 ? 75.227  69.660  132.757 1.00 95.85  ? 377 VAL C O   1 
ATOM 10721 C CB  . VAL C 1 380 ? 74.347  72.114  131.198 1.00 48.51  ? 377 VAL C CB  1 
ATOM 10722 C CG1 . VAL C 1 380 ? 75.228  71.948  129.954 1.00 69.38  ? 377 VAL C CG1 1 
ATOM 10723 C CG2 . VAL C 1 380 ? 73.385  73.272  130.996 1.00 79.77  ? 377 VAL C CG2 1 
ATOM 10724 N N   . GLY C 1 381 ? 74.649  68.737  130.806 1.00 69.40  ? 378 GLY C N   1 
ATOM 10725 C CA  . GLY C 1 381 ? 75.581  67.633  130.983 1.00 67.12  ? 378 GLY C CA  1 
ATOM 10726 C C   . GLY C 1 381 ? 75.618  66.604  129.864 1.00 80.59  ? 378 GLY C C   1 
ATOM 10727 O O   . GLY C 1 381 ? 75.262  66.884  128.714 1.00 71.69  ? 378 GLY C O   1 
ATOM 10728 N N   . ASP C 1 382 ? 76.066  65.407  130.222 1.00 65.82  ? 379 ASP C N   1 
ATOM 10729 C CA  . ASP C 1 382 ? 76.182  64.278  129.307 1.00 67.30  ? 379 ASP C CA  1 
ATOM 10730 C C   . ASP C 1 382 ? 74.795  63.688  129.034 1.00 87.85  ? 379 ASP C C   1 
ATOM 10731 O O   . ASP C 1 382 ? 74.147  63.175  129.956 1.00 65.43  ? 379 ASP C O   1 
ATOM 10732 C CB  . ASP C 1 382 ? 77.119  63.216  129.908 1.00 79.02  ? 379 ASP C CB  1 
ATOM 10733 C CG  . ASP C 1 382 ? 77.389  62.040  128.962 1.00 88.39  ? 379 ASP C CG  1 
ATOM 10734 O OD1 . ASP C 1 382 ? 76.436  61.514  128.351 1.00 76.65  ? 379 ASP C OD1 1 
ATOM 10735 O OD2 . ASP C 1 382 ? 78.566  61.631  128.841 1.00 85.35  ? 379 ASP C OD2 1 
ATOM 10736 N N   . PRO C 1 383 ? 74.346  63.752  127.761 1.00 63.56  ? 380 PRO C N   1 
ATOM 10737 C CA  . PRO C 1 383 ? 72.988  63.405  127.326 1.00 58.11  ? 380 PRO C CA  1 
ATOM 10738 C C   . PRO C 1 383 ? 72.773  61.903  127.156 1.00 68.47  ? 380 PRO C C   1 
ATOM 10739 O O   . PRO C 1 383 ? 71.627  61.451  127.161 1.00 65.25  ? 380 PRO C O   1 
ATOM 10740 C CB  . PRO C 1 383 ? 72.876  64.100  125.963 1.00 71.35  ? 380 PRO C CB  1 
ATOM 10741 C CG  . PRO C 1 383 ? 74.275  64.056  125.423 1.00 81.79  ? 380 PRO C CG  1 
ATOM 10742 C CD  . PRO C 1 383 ? 75.191  64.186  126.631 1.00 65.91  ? 380 PRO C CD  1 
ATOM 10743 N N   . ALA C 1 384 ? 73.857  61.153  126.982 1.00 68.85  ? 381 ALA C N   1 
ATOM 10744 C CA  . ALA C 1 384 ? 73.785  59.695  126.902 1.00 73.26  ? 381 ALA C CA  1 
ATOM 10745 C C   . ALA C 1 384 ? 73.761  59.026  128.290 1.00 84.90  ? 381 ALA C C   1 
ATOM 10746 O O   . ALA C 1 384 ? 73.045  58.032  128.485 1.00 80.70  ? 381 ALA C O   1 
ATOM 10747 C CB  . ALA C 1 384 ? 74.937  59.159  126.057 1.00 57.97  ? 381 ALA C CB  1 
ATOM 10748 N N   . GLU C 1 385 ? 74.531  59.580  129.238 1.00 64.45  ? 382 GLU C N   1 
ATOM 10749 C CA  . GLU C 1 385 ? 74.627  59.032  130.599 1.00 88.15  ? 382 GLU C CA  1 
ATOM 10750 C C   . GLU C 1 385 ? 73.455  59.501  131.460 1.00 88.46  ? 382 GLU C C   1 
ATOM 10751 O O   . GLU C 1 385 ? 72.975  58.770  132.324 1.00 92.08  ? 382 GLU C O   1 
ATOM 10752 C CB  . GLU C 1 385 ? 75.966  59.397  131.278 1.00 59.04  ? 382 GLU C CB  1 
ATOM 10753 N N   . ASP C 1 386 ? 72.990  60.719  131.206 1.00 78.65  ? 383 ASP C N   1 
ATOM 10754 C CA  . ASP C 1 386 ? 71.930  61.334  132.010 1.00 73.68  ? 383 ASP C CA  1 
ATOM 10755 C C   . ASP C 1 386 ? 70.803  61.915  131.143 1.00 76.48  ? 383 ASP C C   1 
ATOM 10756 O O   . ASP C 1 386 ? 70.960  62.981  130.523 1.00 57.05  ? 383 ASP C O   1 
ATOM 10757 C CB  . ASP C 1 386 ? 72.528  62.422  132.921 1.00 67.53  ? 383 ASP C CB  1 
ATOM 10758 C CG  . ASP C 1 386 ? 71.496  63.063  133.860 1.00 85.26  ? 383 ASP C CG  1 
ATOM 10759 O OD1 . ASP C 1 386 ? 70.387  62.508  134.041 1.00 81.20  ? 383 ASP C OD1 1 
ATOM 10760 O OD2 . ASP C 1 386 ? 71.815  64.128  134.430 1.00 71.37  ? 383 ASP C OD2 1 
ATOM 10761 N N   . PHE C 1 387 ? 69.669  61.215  131.105 1.00 67.48  ? 384 PHE C N   1 
ATOM 10762 C CA  . PHE C 1 387 ? 68.528  61.650  130.293 1.00 64.57  ? 384 PHE C CA  1 
ATOM 10763 C C   . PHE C 1 387 ? 67.770  62.834  130.902 1.00 72.23  ? 384 PHE C C   1 
ATOM 10764 O O   . PHE C 1 387 ? 66.819  63.352  130.302 1.00 69.90  ? 384 PHE C O   1 
ATOM 10765 C CB  . PHE C 1 387 ? 67.564  60.491  130.002 1.00 65.28  ? 384 PHE C CB  1 
ATOM 10766 C CG  . PHE C 1 387 ? 68.054  59.536  128.944 1.00 57.65  ? 384 PHE C CG  1 
ATOM 10767 C CD1 . PHE C 1 387 ? 69.345  59.631  128.437 1.00 65.16  ? 384 PHE C CD1 1 
ATOM 10768 C CD2 . PHE C 1 387 ? 67.215  58.549  128.445 1.00 71.34  ? 384 PHE C CD2 1 
ATOM 10769 C CE1 . PHE C 1 387 ? 69.799  58.750  127.452 1.00 63.58  ? 384 PHE C CE1 1 
ATOM 10770 C CE2 . PHE C 1 387 ? 67.661  57.657  127.457 1.00 63.77  ? 384 PHE C CE2 1 
ATOM 10771 C CZ  . PHE C 1 387 ? 68.955  57.756  126.969 1.00 53.17  ? 384 PHE C CZ  1 
ATOM 10772 N N   . GLY C 1 388 ? 68.197  63.255  132.089 1.00 71.82  ? 385 GLY C N   1 
ATOM 10773 C CA  . GLY C 1 388 ? 67.639  64.430  132.735 1.00 61.08  ? 385 GLY C CA  1 
ATOM 10774 C C   . GLY C 1 388 ? 68.266  65.695  132.190 1.00 70.25  ? 385 GLY C C   1 
ATOM 10775 O O   . GLY C 1 388 ? 67.853  66.802  132.523 1.00 87.88  ? 385 GLY C O   1 
ATOM 10776 N N   . THR C 1 389 ? 69.278  65.522  131.348 1.00 64.93  ? 386 THR C N   1 
ATOM 10777 C CA  . THR C 1 389 ? 69.921  66.640  130.663 1.00 72.48  ? 386 THR C CA  1 
ATOM 10778 C C   . THR C 1 389 ? 68.943  67.369  129.730 1.00 75.46  ? 386 THR C C   1 
ATOM 10779 O O   . THR C 1 389 ? 68.240  66.747  128.920 1.00 58.92  ? 386 THR C O   1 
ATOM 10780 C CB  . THR C 1 389 ? 71.123  66.159  129.831 1.00 76.27  ? 386 THR C CB  1 
ATOM 10781 O OG1 . THR C 1 389 ? 72.077  65.528  130.689 1.00 69.39  ? 386 THR C OG1 1 
ATOM 10782 C CG2 . THR C 1 389 ? 71.787  67.333  129.114 1.00 60.01  ? 386 THR C CG2 1 
ATOM 10783 N N   . PHE C 1 390 ? 68.898  68.688  129.855 1.00 56.06  ? 387 PHE C N   1 
ATOM 10784 C CA  . PHE C 1 390 ? 68.054  69.511  129.007 1.00 70.06  ? 387 PHE C CA  1 
ATOM 10785 C C   . PHE C 1 390 ? 68.800  69.793  127.696 1.00 87.71  ? 387 PHE C C   1 
ATOM 10786 O O   . PHE C 1 390 ? 68.284  69.519  126.604 1.00 72.37  ? 387 PHE C O   1 
ATOM 10787 C CB  . PHE C 1 390 ? 67.654  70.811  129.727 1.00 65.43  ? 387 PHE C CB  1 
ATOM 10788 C CG  . PHE C 1 390 ? 66.635  71.630  128.976 1.00 73.82  ? 387 PHE C CG  1 
ATOM 10789 C CD1 . PHE C 1 390 ? 65.432  71.062  128.576 1.00 77.58  ? 387 PHE C CD1 1 
ATOM 10790 C CD2 . PHE C 1 390 ? 66.878  72.952  128.666 1.00 48.17  ? 387 PHE C CD2 1 
ATOM 10791 C CE1 . PHE C 1 390 ? 64.491  71.801  127.880 1.00 57.74  ? 387 PHE C CE1 1 
ATOM 10792 C CE2 . PHE C 1 390 ? 65.941  73.707  127.984 1.00 56.55  ? 387 PHE C CE2 1 
ATOM 10793 C CZ  . PHE C 1 390 ? 64.745  73.130  127.590 1.00 62.73  ? 387 PHE C CZ  1 
ATOM 10794 N N   . PHE C 1 391 ? 70.012  70.336  127.816 1.00 67.76  ? 388 PHE C N   1 
ATOM 10795 C CA  . PHE C 1 391 ? 70.946  70.423  126.694 1.00 67.96  ? 388 PHE C CA  1 
ATOM 10796 C C   . PHE C 1 391 ? 72.386  70.158  127.152 1.00 66.50  ? 388 PHE C C   1 
ATOM 10797 O O   . PHE C 1 391 ? 72.656  70.100  128.350 1.00 78.94  ? 388 PHE C O   1 
ATOM 10798 C CB  . PHE C 1 391 ? 70.822  71.759  125.939 1.00 51.42  ? 388 PHE C CB  1 
ATOM 10799 C CG  . PHE C 1 391 ? 71.433  72.940  126.652 1.00 67.53  ? 388 PHE C CG  1 
ATOM 10800 C CD1 . PHE C 1 391 ? 70.679  73.688  127.551 1.00 75.67  ? 388 PHE C CD1 1 
ATOM 10801 C CD2 . PHE C 1 391 ? 72.739  73.334  126.394 1.00 51.17  ? 388 PHE C CD2 1 
ATOM 10802 C CE1 . PHE C 1 391 ? 71.217  74.796  128.202 1.00 68.72  ? 388 PHE C CE1 1 
ATOM 10803 C CE2 . PHE C 1 391 ? 73.294  74.443  127.053 1.00 71.71  ? 388 PHE C CE2 1 
ATOM 10804 C CZ  . PHE C 1 391 ? 72.528  75.173  127.955 1.00 61.32  ? 388 PHE C CZ  1 
ATOM 10805 N N   . SER C 1 392 ? 73.289  69.997  126.184 1.00 66.72  ? 389 SER C N   1 
ATOM 10806 C CA  . SER C 1 392 ? 74.667  69.574  126.420 1.00 53.06  ? 389 SER C CA  1 
ATOM 10807 C C   . SER C 1 392 ? 75.685  70.584  125.879 1.00 60.86  ? 389 SER C C   1 
ATOM 10808 O O   . SER C 1 392 ? 75.381  71.764  125.738 1.00 68.72  ? 389 SER C O   1 
ATOM 10809 C CB  . SER C 1 392 ? 74.917  68.190  125.809 1.00 61.29  ? 389 SER C CB  1 
ATOM 10810 O OG  . SER C 1 392 ? 76.230  67.728  126.088 1.00 76.47  ? 389 SER C OG  1 
ATOM 10811 N N   . ALA C 1 393 ? 76.898  70.115  125.602 1.00 69.71  ? 390 ALA C N   1 
ATOM 10812 C CA  . ALA C 1 393 ? 77.975  70.981  125.135 1.00 63.27  ? 390 ALA C CA  1 
ATOM 10813 C C   . ALA C 1 393 ? 77.660  71.548  123.754 1.00 68.34  ? 390 ALA C C   1 
ATOM 10814 O O   . ALA C 1 393 ? 76.844  70.981  123.016 1.00 72.64  ? 390 ALA C O   1 
ATOM 10815 C CB  . ALA C 1 393 ? 79.281  70.208  125.098 1.00 70.07  ? 390 ALA C CB  1 
ATOM 10816 N N   . VAL C 1 394 ? 78.282  72.678  123.419 1.00 61.40  ? 391 VAL C N   1 
ATOM 10817 C CA  . VAL C 1 394 ? 78.252  73.176  122.045 1.00 65.75  ? 391 VAL C CA  1 
ATOM 10818 C C   . VAL C 1 394 ? 79.187  72.313  121.186 1.00 77.28  ? 391 VAL C C   1 
ATOM 10819 O O   . VAL C 1 394 ? 80.011  71.551  121.710 1.00 65.77  ? 391 VAL C O   1 
ATOM 10820 C CB  . VAL C 1 394 ? 78.609  74.687  121.921 1.00 71.15  ? 391 VAL C CB  1 
ATOM 10821 C CG1 . VAL C 1 394 ? 77.689  75.539  122.802 1.00 66.53  ? 391 VAL C CG1 1 
ATOM 10822 C CG2 . VAL C 1 394 ? 80.056  74.931  122.266 1.00 76.54  ? 391 VAL C CG2 1 
ATOM 10823 N N   . ILE C 1 395 ? 79.038  72.435  119.870 1.00 83.38  ? 392 ILE C N   1 
ATOM 10824 C CA  . ILE C 1 395 ? 79.553  71.446  118.922 1.00 64.66  ? 392 ILE C CA  1 
ATOM 10825 C C   . ILE C 1 395 ? 81.088  71.266  118.901 1.00 67.88  ? 392 ILE C C   1 
ATOM 10826 O O   . ILE C 1 395 ? 81.587  70.141  118.883 1.00 75.32  ? 392 ILE C O   1 
ATOM 10827 C CB  . ILE C 1 395 ? 78.997  71.702  117.483 1.00 65.29  ? 392 ILE C CB  1 
ATOM 10828 C CG1 . ILE C 1 395 ? 79.316  70.522  116.558 1.00 64.62  ? 392 ILE C CG1 1 
ATOM 10829 C CG2 . ILE C 1 395 ? 79.519  73.017  116.905 1.00 62.78  ? 392 ILE C CG2 1 
ATOM 10830 C CD1 . ILE C 1 395 ? 78.510  69.263  116.866 1.00 61.59  ? 392 ILE C CD1 1 
ATOM 10831 N N   . ASP C 1 396 ? 81.834  72.363  118.900 1.00 59.11  ? 393 ASP C N   1 
ATOM 10832 C CA  . ASP C 1 396 ? 83.288  72.271  118.778 1.00 73.06  ? 393 ASP C CA  1 
ATOM 10833 C C   . ASP C 1 396 ? 84.039  73.439  119.427 1.00 89.29  ? 393 ASP C C   1 
ATOM 10834 O O   . ASP C 1 396 ? 83.438  74.390  119.929 1.00 78.31  ? 393 ASP C O   1 
ATOM 10835 C CB  . ASP C 1 396 ? 83.726  72.075  117.312 1.00 64.79  ? 393 ASP C CB  1 
ATOM 10836 C CG  . ASP C 1 396 ? 83.423  73.279  116.420 1.00 85.06  ? 393 ASP C CG  1 
ATOM 10837 O OD1 . ASP C 1 396 ? 82.981  74.335  116.917 1.00 84.06  ? 393 ASP C OD1 1 
ATOM 10838 O OD2 . ASP C 1 396 ? 83.635  73.165  115.191 1.00 94.57  ? 393 ASP C OD2 1 
ATOM 10839 N N   . ALA C 1 397 ? 85.361  73.353  119.412 1.00 87.23  ? 394 ALA C N   1 
ATOM 10840 C CA  . ALA C 1 397 ? 86.191  74.327  120.097 1.00 74.98  ? 394 ALA C CA  1 
ATOM 10841 C C   . ALA C 1 397 ? 86.052  75.723  119.493 1.00 77.99  ? 394 ALA C C   1 
ATOM 10842 O O   . ALA C 1 397 ? 85.983  76.718  120.226 1.00 87.10  ? 394 ALA C O   1 
ATOM 10843 C CB  . ALA C 1 397 ? 87.638  73.874  120.073 1.00 71.87  ? 394 ALA C CB  1 
ATOM 10844 N N   . LYS C 1 398 ? 86.023  75.805  118.164 1.00 82.43  ? 395 LYS C N   1 
ATOM 10845 C CA  . LYS C 1 398 ? 85.916  77.110  117.505 1.00 87.74  ? 395 LYS C CA  1 
ATOM 10846 C C   . LYS C 1 398 ? 84.617  77.822  117.915 1.00 85.42  ? 395 LYS C C   1 
ATOM 10847 O O   . LYS C 1 398 ? 84.596  79.042  118.140 1.00 73.51  ? 395 LYS C O   1 
ATOM 10848 C CB  . LYS C 1 398 ? 86.027  76.982  115.978 1.00 60.86  ? 395 LYS C CB  1 
ATOM 10849 N N   . SER C 1 399 ? 83.542  77.043  118.023 1.00 71.30  ? 396 SER C N   1 
ATOM 10850 C CA  . SER C 1 399 ? 82.244  77.536  118.500 1.00 80.23  ? 396 SER C CA  1 
ATOM 10851 C C   . SER C 1 399 ? 82.298  77.940  119.984 1.00 88.14  ? 396 SER C C   1 
ATOM 10852 O O   . SER C 1 399 ? 81.824  79.009  120.372 1.00 69.54  ? 396 SER C O   1 
ATOM 10853 C CB  . SER C 1 399 ? 81.151  76.481  118.270 1.00 67.36  ? 396 SER C CB  1 
ATOM 10854 O OG  . SER C 1 399 ? 79.887  76.909  118.760 1.00 90.96  ? 396 SER C OG  1 
ATOM 10855 N N   . PHE C 1 400 ? 82.883  77.073  120.803 1.00 78.43  ? 397 PHE C N   1 
ATOM 10856 C CA  . PHE C 1 400 ? 83.108  77.364  122.215 1.00 84.32  ? 397 PHE C CA  1 
ATOM 10857 C C   . PHE C 1 400 ? 83.871  78.681  122.424 1.00 90.09  ? 397 PHE C C   1 
ATOM 10858 O O   . PHE C 1 400 ? 83.491  79.496  123.265 1.00 84.87  ? 397 PHE C O   1 
ATOM 10859 C CB  . PHE C 1 400 ? 83.860  76.204  122.875 1.00 76.73  ? 397 PHE C CB  1 
ATOM 10860 C CG  . PHE C 1 400 ? 84.034  76.361  124.359 1.00 90.89  ? 397 PHE C CG  1 
ATOM 10861 C CD1 . PHE C 1 400 ? 85.158  76.987  124.876 1.00 87.92  ? 397 PHE C CD1 1 
ATOM 10862 C CD2 . PHE C 1 400 ? 83.075  75.880  125.238 1.00 90.17  ? 397 PHE C CD2 1 
ATOM 10863 C CE1 . PHE C 1 400 ? 85.326  77.136  126.251 1.00 88.00  ? 397 PHE C CE1 1 
ATOM 10864 C CE2 . PHE C 1 400 ? 83.235  76.027  126.609 1.00 95.85  ? 397 PHE C CE2 1 
ATOM 10865 C CZ  . PHE C 1 400 ? 84.365  76.658  127.118 1.00 86.70  ? 397 PHE C CZ  1 
ATOM 10866 N N   . ALA C 1 401 ? 84.940  78.884  121.656 1.00 85.06  ? 398 ALA C N   1 
ATOM 10867 C CA  . ALA C 1 401 ? 85.749  80.098  121.767 1.00 89.48  ? 398 ALA C CA  1 
ATOM 10868 C C   . ALA C 1 401 ? 84.936  81.348  121.421 1.00 94.32  ? 398 ALA C C   1 
ATOM 10869 O O   . ALA C 1 401 ? 84.891  82.316  122.197 1.00 86.18  ? 398 ALA C O   1 
ATOM 10870 C CB  . ALA C 1 401 ? 86.995  80.001  120.876 1.00 63.42  ? 398 ALA C CB  1 
ATOM 10871 N N   . ARG C 1 402 ? 84.300  81.318  120.249 1.00 69.34  ? 399 ARG C N   1 
ATOM 10872 C CA  . ARG C 1 402 ? 83.447  82.420  119.807 1.00 85.27  ? 399 ARG C CA  1 
ATOM 10873 C C   . ARG C 1 402 ? 82.428  82.803  120.894 1.00 85.66  ? 399 ARG C C   1 
ATOM 10874 O O   . ARG C 1 402 ? 82.215  83.985  121.174 1.00 78.15  ? 399 ARG C O   1 
ATOM 10875 C CB  . ARG C 1 402 ? 82.741  82.073  118.481 1.00 64.57  ? 399 ARG C CB  1 
ATOM 10876 N N   . ILE C 1 403 ? 81.814  81.800  121.518 1.00 72.11  ? 400 ILE C N   1 
ATOM 10877 C CA  . ILE C 1 403 ? 80.821  82.059  122.559 1.00 77.64  ? 400 ILE C CA  1 
ATOM 10878 C C   . ILE C 1 403 ? 81.423  82.704  123.823 1.00 90.17  ? 400 ILE C C   1 
ATOM 10879 O O   . ILE C 1 403 ? 80.818  83.611  124.403 1.00 80.92  ? 400 ILE C O   1 
ATOM 10880 C CB  . ILE C 1 403 ? 79.984  80.799  122.920 1.00 73.59  ? 400 ILE C CB  1 
ATOM 10881 C CG1 . ILE C 1 403 ? 79.232  80.274  121.688 1.00 75.79  ? 400 ILE C CG1 1 
ATOM 10882 C CG2 . ILE C 1 403 ? 78.960  81.134  124.005 1.00 61.75  ? 400 ILE C CG2 1 
ATOM 10883 C CD1 . ILE C 1 403 ? 78.581  78.882  121.887 1.00 62.36  ? 400 ILE C CD1 1 
ATOM 10884 N N   . LYS C 1 404 ? 82.608  82.251  124.240 1.00 78.60  ? 401 LYS C N   1 
ATOM 10885 C CA  . LYS C 1 404 ? 83.273  82.845  125.401 1.00 85.40  ? 401 LYS C CA  1 
ATOM 10886 C C   . LYS C 1 404 ? 83.578  84.324  125.145 1.00 87.31  ? 401 LYS C C   1 
ATOM 10887 O O   . LYS C 1 404 ? 83.359  85.160  126.020 1.00 73.16  ? 401 LYS C O   1 
ATOM 10888 C CB  . LYS C 1 404 ? 84.547  82.074  125.789 1.00 77.08  ? 401 LYS C CB  1 
ATOM 10889 N N   . LYS C 1 405 ? 84.064  84.650  123.944 1.00 82.78  ? 402 LYS C N   1 
ATOM 10890 C CA  . LYS C 1 405 ? 84.354  86.046  123.614 1.00 85.36  ? 402 LYS C CA  1 
ATOM 10891 C C   . LYS C 1 405 ? 83.083  86.888  123.744 1.00 90.48  ? 402 LYS C C   1 
ATOM 10892 O O   . LYS C 1 405 ? 83.152  88.047  124.142 1.00 100.10 ? 402 LYS C O   1 
ATOM 10893 C CB  . LYS C 1 405 ? 85.006  86.212  122.228 1.00 66.47  ? 402 LYS C CB  1 
ATOM 10894 N N   . TRP C 1 406 ? 81.923  86.296  123.441 1.00 89.16  ? 403 TRP C N   1 
ATOM 10895 C CA  . TRP C 1 406 ? 80.629  86.972  123.657 1.00 78.64  ? 403 TRP C CA  1 
ATOM 10896 C C   . TRP C 1 406 ? 80.284  87.123  125.139 1.00 91.84  ? 403 TRP C C   1 
ATOM 10897 O O   . TRP C 1 406 ? 79.813  88.177  125.577 1.00 81.62  ? 403 TRP C O   1 
ATOM 10898 C CB  . TRP C 1 406 ? 79.478  86.265  122.936 1.00 60.89  ? 403 TRP C CB  1 
ATOM 10899 C CG  . TRP C 1 406 ? 79.345  86.668  121.478 1.00 92.95  ? 403 TRP C CG  1 
ATOM 10900 C CD1 . TRP C 1 406 ? 79.691  85.915  120.379 1.00 86.79  ? 403 TRP C CD1 1 
ATOM 10901 C CD2 . TRP C 1 406 ? 78.850  87.919  120.963 1.00 71.04  ? 403 TRP C CD2 1 
ATOM 10902 N NE1 . TRP C 1 406 ? 79.434  86.618  119.220 1.00 74.75  ? 403 TRP C NE1 1 
ATOM 10903 C CE2 . TRP C 1 406 ? 78.924  87.849  119.549 1.00 84.77  ? 403 TRP C CE2 1 
ATOM 10904 C CE3 . TRP C 1 406 ? 78.338  89.077  121.553 1.00 58.74  ? 403 TRP C CE3 1 
ATOM 10905 C CZ2 . TRP C 1 406 ? 78.515  88.902  118.726 1.00 70.21  ? 403 TRP C CZ2 1 
ATOM 10906 C CZ3 . TRP C 1 406 ? 77.934  90.122  120.732 1.00 64.92  ? 403 TRP C CZ3 1 
ATOM 10907 C CH2 . TRP C 1 406 ? 78.025  90.026  119.336 1.00 77.24  ? 403 TRP C CH2 1 
ATOM 10908 N N   . LEU C 1 407 ? 80.507  86.067  125.911 1.00 77.83  ? 404 LEU C N   1 
ATOM 10909 C CA  . LEU C 1 407 ? 80.325  86.157  127.344 1.00 80.49  ? 404 LEU C CA  1 
ATOM 10910 C C   . LEU C 1 407 ? 81.212  87.261  127.931 1.00 87.91  ? 404 LEU C C   1 
ATOM 10911 O O   . LEU C 1 407 ? 80.737  88.082  128.715 1.00 89.30  ? 404 LEU C O   1 
ATOM 10912 C CB  . LEU C 1 407 ? 80.598  84.806  128.003 1.00 85.22  ? 404 LEU C CB  1 
ATOM 10913 C CG  . LEU C 1 407 ? 79.629  83.696  127.590 1.00 90.47  ? 404 LEU C CG  1 
ATOM 10914 C CD1 . LEU C 1 407 ? 79.995  82.359  128.254 1.00 85.76  ? 404 LEU C CD1 1 
ATOM 10915 C CD2 . LEU C 1 407 ? 78.193  84.091  127.913 1.00 68.07  ? 404 LEU C CD2 1 
ATOM 10916 N N   . GLU C 1 408 ? 82.490  87.291  127.551 1.00 77.81  ? 405 GLU C N   1 
ATOM 10917 C CA  . GLU C 1 408 ? 83.374  88.362  128.005 1.00 91.90  ? 405 GLU C CA  1 
ATOM 10918 C C   . GLU C 1 408 ? 82.813  89.719  127.578 1.00 91.69  ? 405 GLU C C   1 
ATOM 10919 O O   . GLU C 1 408 ? 82.886  90.688  128.339 1.00 88.17  ? 405 GLU C O   1 
ATOM 10920 C CB  . GLU C 1 408 ? 84.814  88.165  127.504 1.00 80.33  ? 405 GLU C CB  1 
ATOM 10921 N N   . HIS C 1 409 ? 82.228  89.781  126.378 1.00 75.25  ? 406 HIS C N   1 
ATOM 10922 C CA  . HIS C 1 409 ? 81.626  91.027  125.878 1.00 85.36  ? 406 HIS C CA  1 
ATOM 10923 C C   . HIS C 1 409 ? 80.406  91.475  126.700 1.00 97.14  ? 406 HIS C C   1 
ATOM 10924 O O   . HIS C 1 409 ? 80.159  92.672  126.883 1.00 84.49  ? 406 HIS C O   1 
ATOM 10925 C CB  . HIS C 1 409 ? 81.232  90.903  124.398 1.00 82.87  ? 406 HIS C CB  1 
ATOM 10926 C CG  . HIS C 1 409 ? 80.425  92.062  123.890 1.00 93.09  ? 406 HIS C CG  1 
ATOM 10927 N ND1 . HIS C 1 409 ? 80.999  93.205  123.369 1.00 91.40  ? 406 HIS C ND1 1 
ATOM 10928 C CD2 . HIS C 1 409 ? 79.085  92.261  123.838 1.00 92.78  ? 406 HIS C CD2 1 
ATOM 10929 C CE1 . HIS C 1 409 ? 80.048  94.054  123.016 1.00 88.37  ? 406 HIS C CE1 1 
ATOM 10930 N NE2 . HIS C 1 409 ? 78.877  93.506  123.289 1.00 84.87  ? 406 HIS C NE2 1 
ATOM 10931 N N   . ALA C 1 410 ? 79.636  90.507  127.180 1.00 75.14  ? 407 ALA C N   1 
ATOM 10932 C CA  . ALA C 1 410 ? 78.476  90.803  128.012 1.00 86.22  ? 407 ALA C CA  1 
ATOM 10933 C C   . ALA C 1 410 ? 78.835  91.419  129.385 1.00 85.83  ? 407 ALA C C   1 
ATOM 10934 O O   . ALA C 1 410 ? 78.064  92.214  129.923 1.00 84.57  ? 407 ALA C O   1 
ATOM 10935 C CB  . ALA C 1 410 ? 77.600  89.547  128.168 1.00 63.65  ? 407 ALA C CB  1 
ATOM 10936 N N   . ARG C 1 411 ? 79.991  91.052  129.946 1.00 84.61  ? 408 ARG C N   1 
ATOM 10937 C CA  . ARG C 1 411 ? 80.478  91.675  131.182 1.00 101.38 ? 408 ARG C CA  1 
ATOM 10938 C C   . ARG C 1 411 ? 81.039  93.060  130.877 1.00 104.29 ? 408 ARG C C   1 
ATOM 10939 O O   . ARG C 1 411 ? 80.642  94.041  131.493 1.00 98.09  ? 408 ARG C O   1 
ATOM 10940 C CB  . ARG C 1 411 ? 81.558  90.815  131.849 1.00 90.56  ? 408 ARG C CB  1 
ATOM 10941 C CG  . ARG C 1 411 ? 81.081  89.437  132.283 1.00 94.58  ? 408 ARG C CG  1 
ATOM 10942 C CD  . ARG C 1 411 ? 82.234  88.576  132.769 1.00 86.56  ? 408 ARG C CD  1 
ATOM 10943 N N   . SER C 1 412 ? 81.943  93.116  129.897 1.00 115.08 ? 409 SER C N   1 
ATOM 10944 C CA  . SER C 1 412 ? 82.646  94.335  129.503 1.00 101.55 ? 409 SER C CA  1 
ATOM 10945 C C   . SER C 1 412 ? 81.700  95.456  129.120 1.00 107.00 ? 409 SER C C   1 
ATOM 10946 O O   . SER C 1 412 ? 81.900  96.607  129.515 1.00 113.33 ? 409 SER C O   1 
ATOM 10947 C CB  . SER C 1 412 ? 83.568  94.051  128.312 1.00 102.26 ? 409 SER C CB  1 
ATOM 10948 O OG  . SER C 1 412 ? 84.243  92.819  128.479 1.00 135.99 ? 409 SER C OG  1 
ATOM 10949 N N   . SER C 1 413 ? 80.681  95.127  128.332 1.00 104.53 ? 410 SER C N   1 
ATOM 10950 C CA  . SER C 1 413 ? 79.769  96.158  127.852 1.00 97.80  ? 410 SER C CA  1 
ATOM 10951 C C   . SER C 1 413 ? 78.984  96.779  129.003 1.00 107.42 ? 410 SER C C   1 
ATOM 10952 O O   . SER C 1 413 ? 78.484  96.066  129.884 1.00 111.38 ? 410 SER C O   1 
ATOM 10953 C CB  . SER C 1 413 ? 78.827  95.632  126.770 1.00 102.27 ? 410 SER C CB  1 
ATOM 10954 O OG  . SER C 1 413 ? 78.162  96.714  126.132 1.00 95.21  ? 410 SER C OG  1 
ATOM 10955 N N   . PRO C 1 414 ? 78.903  98.123  129.006 1.00 116.47 ? 411 PRO C N   1 
ATOM 10956 C CA  . PRO C 1 414 ? 78.166  98.919  129.995 1.00 108.71 ? 411 PRO C CA  1 
ATOM 10957 C C   . PRO C 1 414 ? 76.652  98.785  129.781 1.00 117.74 ? 411 PRO C C   1 
ATOM 10958 O O   . PRO C 1 414 ? 75.896  98.740  130.754 1.00 91.20  ? 411 PRO C O   1 
ATOM 10959 C CB  . PRO C 1 414 ? 78.615  100.358 129.697 1.00 101.73 ? 411 PRO C CB  1 
ATOM 10960 C CG  . PRO C 1 414 ? 79.782  100.236 128.731 1.00 106.26 ? 411 PRO C CG  1 
ATOM 10961 C CD  . PRO C 1 414 ? 79.559  98.972  127.994 1.00 93.00  ? 411 PRO C CD  1 
ATOM 10962 N N   . SER C 1 415 ? 76.228  98.717  128.517 1.00 122.27 ? 412 SER C N   1 
ATOM 10963 C CA  . SER C 1 415 ? 74.818  98.531  128.162 1.00 106.17 ? 412 SER C CA  1 
ATOM 10964 C C   . SER C 1 415 ? 74.326  97.135  128.550 1.00 103.34 ? 412 SER C C   1 
ATOM 10965 O O   . SER C 1 415 ? 73.116  96.884  128.589 1.00 98.42  ? 412 SER C O   1 
ATOM 10966 C CB  . SER C 1 415 ? 74.596  98.748  126.653 1.00 94.52  ? 412 SER C CB  1 
ATOM 10967 O OG  . SER C 1 415 ? 75.120  99.991  126.216 1.00 101.53 ? 412 SER C OG  1 
ATOM 10968 N N   . LEU C 1 416 ? 75.267  96.231  128.834 1.00 86.11  ? 413 LEU C N   1 
ATOM 10969 C CA  . LEU C 1 416 ? 74.937  94.833  129.117 1.00 80.02  ? 413 LEU C CA  1 
ATOM 10970 C C   . LEU C 1 416 ? 75.275  94.372  130.546 1.00 99.38  ? 413 LEU C C   1 
ATOM 10971 O O   . LEU C 1 416 ? 76.346  94.685  131.098 1.00 102.76 ? 413 LEU C O   1 
ATOM 10972 C CB  . LEU C 1 416 ? 75.606  93.893  128.103 1.00 65.51  ? 413 LEU C CB  1 
ATOM 10973 C CG  . LEU C 1 416 ? 75.389  94.142  126.601 1.00 90.06  ? 413 LEU C CG  1 
ATOM 10974 C CD1 . LEU C 1 416 ? 76.125  93.104  125.749 1.00 61.90  ? 413 LEU C CD1 1 
ATOM 10975 C CD2 . LEU C 1 416 ? 73.909  94.169  126.236 1.00 75.89  ? 413 LEU C CD2 1 
ATOM 10976 N N   . THR C 1 417 ? 74.340  93.619  131.127 1.00 82.44  ? 414 THR C N   1 
ATOM 10977 C CA  . THR C 1 417 ? 74.561  92.904  132.380 1.00 93.01  ? 414 THR C CA  1 
ATOM 10978 C C   . THR C 1 417 ? 74.004  91.471  132.298 1.00 95.61  ? 414 THR C C   1 
ATOM 10979 O O   . THR C 1 417 ? 72.867  91.242  131.856 1.00 81.43  ? 414 THR C O   1 
ATOM 10980 C CB  . THR C 1 417 ? 73.946  93.629  133.605 1.00 94.30  ? 414 THR C CB  1 
ATOM 10981 O OG1 . THR C 1 417 ? 72.517  93.625  133.504 1.00 92.19  ? 414 THR C OG1 1 
ATOM 10982 C CG2 . THR C 1 417 ? 74.476  95.080  133.729 1.00 95.61  ? 414 THR C CG2 1 
ATOM 10983 N N   . ILE C 1 418 ? 74.828  90.514  132.719 1.00 90.95  ? 415 ILE C N   1 
ATOM 10984 C CA  . ILE C 1 418 ? 74.438  89.119  132.770 1.00 76.10  ? 415 ILE C CA  1 
ATOM 10985 C C   . ILE C 1 418 ? 73.480  88.905  133.937 1.00 79.89  ? 415 ILE C C   1 
ATOM 10986 O O   . ILE C 1 418 ? 73.837  89.160  135.079 1.00 87.82  ? 415 ILE C O   1 
ATOM 10987 C CB  . ILE C 1 418 ? 75.671  88.213  132.952 1.00 76.43  ? 415 ILE C CB  1 
ATOM 10988 C CG1 . ILE C 1 418 ? 76.693  88.459  131.830 1.00 76.25  ? 415 ILE C CG1 1 
ATOM 10989 C CG2 . ILE C 1 418 ? 75.249  86.760  133.026 1.00 60.90  ? 415 ILE C CG2 1 
ATOM 10990 C CD1 . ILE C 1 418 ? 77.882  87.506  131.848 1.00 70.18  ? 415 ILE C CD1 1 
ATOM 10991 N N   . LEU C 1 419 ? 72.261  88.457  133.647 1.00 89.90  ? 416 LEU C N   1 
ATOM 10992 C CA  . LEU C 1 419 ? 71.270  88.177  134.690 1.00 77.84  ? 416 LEU C CA  1 
ATOM 10993 C C   . LEU C 1 419 ? 71.357  86.742  135.206 1.00 83.11  ? 416 LEU C C   1 
ATOM 10994 O O   . LEU C 1 419 ? 70.900  86.445  136.305 1.00 76.75  ? 416 LEU C O   1 
ATOM 10995 C CB  . LEU C 1 419 ? 69.850  88.440  134.179 1.00 75.02  ? 416 LEU C CB  1 
ATOM 10996 C CG  . LEU C 1 419 ? 69.557  89.846  133.665 1.00 78.18  ? 416 LEU C CG  1 
ATOM 10997 C CD1 . LEU C 1 419 ? 68.103  89.948  133.229 1.00 64.86  ? 416 LEU C CD1 1 
ATOM 10998 C CD2 . LEU C 1 419 ? 69.887  90.900  134.729 1.00 70.69  ? 416 LEU C CD2 1 
ATOM 10999 N N   . ALA C 1 420 ? 71.927  85.855  134.398 1.00 88.40  ? 417 ALA C N   1 
ATOM 11000 C CA  . ALA C 1 420 ? 72.037  84.447  134.764 1.00 77.91  ? 417 ALA C CA  1 
ATOM 11001 C C   . ALA C 1 420 ? 73.033  83.712  133.868 1.00 82.03  ? 417 ALA C C   1 
ATOM 11002 O O   . ALA C 1 420 ? 73.181  84.040  132.685 1.00 74.40  ? 417 ALA C O   1 
ATOM 11003 C CB  . ALA C 1 420 ? 70.679  83.776  134.708 1.00 67.69  ? 417 ALA C CB  1 
ATOM 11004 N N   . GLY C 1 421 ? 73.702  82.716  134.444 1.00 73.68  ? 418 GLY C N   1 
ATOM 11005 C CA  . GLY C 1 421 ? 74.726  81.966  133.743 1.00 77.95  ? 418 GLY C CA  1 
ATOM 11006 C C   . GLY C 1 421 ? 75.960  82.810  133.517 1.00 80.48  ? 418 GLY C C   1 
ATOM 11007 O O   . GLY C 1 421 ? 76.212  83.759  134.258 1.00 79.33  ? 418 GLY C O   1 
ATOM 11008 N N   . GLY C 1 422 ? 76.728  82.473  132.488 1.00 86.97  ? 419 GLY C N   1 
ATOM 11009 C CA  . GLY C 1 422 ? 77.917  83.237  132.160 1.00 73.52  ? 419 GLY C CA  1 
ATOM 11010 C C   . GLY C 1 422 ? 79.194  82.432  132.327 1.00 100.55 ? 419 GLY C C   1 
ATOM 11011 O O   . GLY C 1 422 ? 80.276  82.876  131.920 1.00 87.65  ? 419 GLY C O   1 
ATOM 11012 N N   . LYS C 1 423 ? 79.073  81.251  132.933 1.00 81.16  ? 420 LYS C N   1 
ATOM 11013 C CA  . LYS C 1 423 ? 80.222  80.360  133.079 1.00 105.57 ? 420 LYS C CA  1 
ATOM 11014 C C   . LYS C 1 423 ? 80.297  79.420  131.882 1.00 90.92  ? 420 LYS C C   1 
ATOM 11015 O O   . LYS C 1 423 ? 79.273  79.103  131.290 1.00 81.55  ? 420 LYS C O   1 
ATOM 11016 C CB  . LYS C 1 423 ? 80.149  79.556  134.392 1.00 62.23  ? 420 LYS C CB  1 
ATOM 11017 N N   . CYS C 1 424 ? 81.515  79.006  131.530 1.00 86.29  ? 421 CYS C N   1 
ATOM 11018 C CA  . CYS C 1 424 ? 81.738  77.950  130.547 1.00 93.45  ? 421 CYS C CA  1 
ATOM 11019 C C   . CYS C 1 424 ? 82.974  77.133  130.909 1.00 78.65  ? 421 CYS C C   1 
ATOM 11020 O O   . CYS C 1 424 ? 83.935  77.668  131.456 1.00 81.49  ? 421 CYS C O   1 
ATOM 11021 C CB  . CYS C 1 424 ? 81.864  78.533  129.134 1.00 119.76 ? 421 CYS C CB  1 
ATOM 11022 S SG  . CYS C 1 424 ? 83.259  79.668  128.868 1.00 91.60  ? 421 CYS C SG  1 
ATOM 11023 N N   . ASP C 1 425 ? 82.953  75.843  130.597 1.00 85.04  ? 422 ASP C N   1 
ATOM 11024 C CA  . ASP C 1 425 ? 84.037  74.947  130.999 1.00 96.00  ? 422 ASP C CA  1 
ATOM 11025 C C   . ASP C 1 425 ? 84.360  73.885  129.939 1.00 98.37  ? 422 ASP C C   1 
ATOM 11026 O O   . ASP C 1 425 ? 83.603  72.933  129.749 1.00 94.70  ? 422 ASP C O   1 
ATOM 11027 C CB  . ASP C 1 425 ? 83.688  74.279  132.339 1.00 90.03  ? 422 ASP C CB  1 
ATOM 11028 C CG  . ASP C 1 425 ? 84.772  73.339  132.836 1.00 104.09 ? 422 ASP C CG  1 
ATOM 11029 O OD1 . ASP C 1 425 ? 85.924  73.446  132.352 1.00 99.91  ? 422 ASP C OD1 1 
ATOM 11030 O OD2 . ASP C 1 425 ? 84.467  72.505  133.724 1.00 98.08  ? 422 ASP C OD2 1 
ATOM 11031 N N   . ASP C 1 426 ? 85.501  74.040  129.273 1.00 84.81  ? 423 ASP C N   1 
ATOM 11032 C CA  . ASP C 1 426 ? 85.891  73.124  128.202 1.00 100.93 ? 423 ASP C CA  1 
ATOM 11033 C C   . ASP C 1 426 ? 86.890  72.051  128.627 1.00 89.47  ? 423 ASP C C   1 
ATOM 11034 O O   . ASP C 1 426 ? 87.646  71.547  127.804 1.00 92.06  ? 423 ASP C O   1 
ATOM 11035 C CB  . ASP C 1 426 ? 86.464  73.913  127.019 1.00 108.43 ? 423 ASP C CB  1 
ATOM 11036 C CG  . ASP C 1 426 ? 87.818  74.525  127.325 1.00 93.42  ? 423 ASP C CG  1 
ATOM 11037 O OD1 . ASP C 1 426 ? 88.141  74.692  128.522 1.00 100.29 ? 423 ASP C OD1 1 
ATOM 11038 O OD2 . ASP C 1 426 ? 88.551  74.838  126.360 1.00 95.87  ? 423 ASP C OD2 1 
ATOM 11039 N N   . SER C 1 427 ? 86.899  71.697  129.904 1.00 82.32  ? 424 SER C N   1 
ATOM 11040 C CA  . SER C 1 427 ? 87.880  70.729  130.388 1.00 103.09 ? 424 SER C CA  1 
ATOM 11041 C C   . SER C 1 427 ? 87.544  69.306  129.940 1.00 96.73  ? 424 SER C C   1 
ATOM 11042 O O   . SER C 1 427 ? 88.440  68.503  129.672 1.00 93.91  ? 424 SER C O   1 
ATOM 11043 C CB  . SER C 1 427 ? 88.064  70.819  131.916 1.00 89.65  ? 424 SER C CB  1 
ATOM 11044 O OG  . SER C 1 427 ? 86.840  70.666  132.617 1.00 102.89 ? 424 SER C OG  1 
ATOM 11045 N N   . VAL C 1 428 ? 86.251  69.010  129.848 1.00 89.55  ? 425 VAL C N   1 
ATOM 11046 C CA  . VAL C 1 428 ? 85.788  67.677  129.476 1.00 90.17  ? 425 VAL C CA  1 
ATOM 11047 C C   . VAL C 1 428 ? 85.021  67.702  128.153 1.00 96.63  ? 425 VAL C C   1 
ATOM 11048 O O   . VAL C 1 428 ? 85.296  66.917  127.239 1.00 89.49  ? 425 VAL C O   1 
ATOM 11049 C CB  . VAL C 1 428 ? 84.897  67.086  130.575 1.00 69.75  ? 425 VAL C CB  1 
ATOM 11050 C CG1 . VAL C 1 428 ? 84.318  65.742  130.140 1.00 62.65  ? 425 VAL C CG1 1 
ATOM 11051 C CG2 . VAL C 1 428 ? 85.688  66.938  131.850 1.00 78.30  ? 425 VAL C CG2 1 
ATOM 11052 N N   . GLY C 1 429 ? 84.048  68.605  128.076 1.00 89.95  ? 426 GLY C N   1 
ATOM 11053 C CA  . GLY C 1 429 ? 83.322  68.874  126.852 1.00 71.37  ? 426 GLY C CA  1 
ATOM 11054 C C   . GLY C 1 429 ? 83.259  70.378  126.656 1.00 92.31  ? 426 GLY C C   1 
ATOM 11055 O O   . GLY C 1 429 ? 83.724  71.140  127.502 1.00 84.27  ? 426 GLY C O   1 
ATOM 11056 N N   . TYR C 1 430 ? 82.689  70.818  125.542 1.00 85.38  ? 427 TYR C N   1 
ATOM 11057 C CA  . TYR C 1 430 ? 82.566  72.245  125.300 1.00 81.50  ? 427 TYR C CA  1 
ATOM 11058 C C   . TYR C 1 430 ? 81.310  72.779  125.980 1.00 86.57  ? 427 TYR C C   1 
ATOM 11059 O O   . TYR C 1 430 ? 80.353  73.192  125.324 1.00 88.93  ? 427 TYR C O   1 
ATOM 11060 C CB  . TYR C 1 430 ? 82.552  72.525  123.801 1.00 78.49  ? 427 TYR C CB  1 
ATOM 11061 C CG  . TYR C 1 430 ? 83.709  71.883  123.087 1.00 82.31  ? 427 TYR C CG  1 
ATOM 11062 C CD1 . TYR C 1 430 ? 84.995  72.371  123.246 1.00 74.80  ? 427 TYR C CD1 1 
ATOM 11063 C CD2 . TYR C 1 430 ? 83.520  70.783  122.268 1.00 73.70  ? 427 TYR C CD2 1 
ATOM 11064 C CE1 . TYR C 1 430 ? 86.054  71.791  122.601 1.00 67.00  ? 427 TYR C CE1 1 
ATOM 11065 C CE2 . TYR C 1 430 ? 84.579  70.195  121.616 1.00 66.55  ? 427 TYR C CE2 1 
ATOM 11066 C CZ  . TYR C 1 430 ? 85.846  70.701  121.791 1.00 79.58  ? 427 TYR C CZ  1 
ATOM 11067 O OH  . TYR C 1 430 ? 86.912  70.121  121.145 1.00 86.99  ? 427 TYR C OH  1 
ATOM 11068 N N   . PHE C 1 431 ? 81.323  72.768  127.306 1.00 80.42  ? 428 PHE C N   1 
ATOM 11069 C CA  . PHE C 1 431 ? 80.139  73.111  128.089 1.00 82.54  ? 428 PHE C CA  1 
ATOM 11070 C C   . PHE C 1 431 ? 79.976  74.605  128.361 1.00 68.17  ? 428 PHE C C   1 
ATOM 11071 O O   . PHE C 1 431 ? 80.875  75.252  128.891 1.00 95.60  ? 428 PHE C O   1 
ATOM 11072 C CB  . PHE C 1 431 ? 80.134  72.328  129.405 1.00 56.45  ? 428 PHE C CB  1 
ATOM 11073 C CG  . PHE C 1 431 ? 79.782  70.881  129.239 1.00 76.54  ? 428 PHE C CG  1 
ATOM 11074 C CD1 . PHE C 1 431 ? 78.457  70.491  129.039 1.00 69.71  ? 428 PHE C CD1 1 
ATOM 11075 C CD2 . PHE C 1 431 ? 80.769  69.910  129.269 1.00 78.30  ? 428 PHE C CD2 1 
ATOM 11076 C CE1 . PHE C 1 431 ? 78.125  69.158  128.892 1.00 71.30  ? 428 PHE C CE1 1 
ATOM 11077 C CE2 . PHE C 1 431 ? 80.440  68.569  129.111 1.00 84.51  ? 428 PHE C CE2 1 
ATOM 11078 C CZ  . PHE C 1 431 ? 79.117  68.193  128.929 1.00 69.94  ? 428 PHE C CZ  1 
ATOM 11079 N N   . VAL C 1 432 ? 78.819  75.141  127.985 1.00 79.38  ? 429 VAL C N   1 
ATOM 11080 C CA  . VAL C 1 432 ? 78.477  76.536  128.253 1.00 70.84  ? 429 VAL C CA  1 
ATOM 11081 C C   . VAL C 1 432 ? 77.176  76.566  129.053 1.00 72.99  ? 429 VAL C C   1 
ATOM 11082 O O   . VAL C 1 432 ? 76.196  75.906  128.695 1.00 70.82  ? 429 VAL C O   1 
ATOM 11083 C CB  . VAL C 1 432 ? 78.286  77.339  126.935 1.00 77.47  ? 429 VAL C CB  1 
ATOM 11084 C CG1 . VAL C 1 432 ? 77.976  78.816  127.217 1.00 62.93  ? 429 VAL C CG1 1 
ATOM 11085 C CG2 . VAL C 1 432 ? 79.508  77.202  126.047 1.00 55.62  ? 429 VAL C CG2 1 
ATOM 11086 N N   . GLU C 1 433 ? 77.169  77.316  130.146 1.00 76.45  ? 430 GLU C N   1 
ATOM 11087 C CA  . GLU C 1 433 ? 75.951  77.469  130.923 1.00 80.31  ? 430 GLU C CA  1 
ATOM 11088 C C   . GLU C 1 433 ? 74.973  78.311  130.104 1.00 84.81  ? 430 GLU C C   1 
ATOM 11089 O O   . GLU C 1 433 ? 75.382  79.218  129.371 1.00 78.24  ? 430 GLU C O   1 
ATOM 11090 C CB  . GLU C 1 433 ? 76.236  78.109  132.294 1.00 64.19  ? 430 GLU C CB  1 
ATOM 11091 N N   . PRO C 1 434 ? 73.675  77.994  130.204 1.00 70.91  ? 431 PRO C N   1 
ATOM 11092 C CA  . PRO C 1 434 ? 72.660  78.863  129.604 1.00 67.11  ? 431 PRO C CA  1 
ATOM 11093 C C   . PRO C 1 434 ? 72.796  80.259  130.203 1.00 73.30  ? 431 PRO C C   1 
ATOM 11094 O O   . PRO C 1 434 ? 72.905  80.415  131.429 1.00 64.21  ? 431 PRO C O   1 
ATOM 11095 C CB  . PRO C 1 434 ? 71.342  78.212  130.036 1.00 66.83  ? 431 PRO C CB  1 
ATOM 11096 C CG  . PRO C 1 434 ? 71.693  77.377  131.248 1.00 64.57  ? 431 PRO C CG  1 
ATOM 11097 C CD  . PRO C 1 434 ? 73.087  76.898  130.997 1.00 59.80  ? 431 PRO C CD  1 
ATOM 11098 N N   . CYS C 1 435 ? 72.813  81.266  129.345 1.00 65.52  ? 432 CYS C N   1 
ATOM 11099 C CA  . CYS C 1 435 ? 73.102  82.617  129.787 1.00 72.45  ? 432 CYS C CA  1 
ATOM 11100 C C   . CYS C 1 435 ? 71.994  83.591  129.383 1.00 75.17  ? 432 CYS C C   1 
ATOM 11101 O O   . CYS C 1 435 ? 71.513  83.572  128.247 1.00 87.68  ? 432 CYS C O   1 
ATOM 11102 C CB  . CYS C 1 435 ? 74.461  83.082  129.241 1.00 60.80  ? 432 CYS C CB  1 
ATOM 11103 S SG  . CYS C 1 435 ? 74.902  84.734  129.812 1.00 81.95  ? 432 CYS C SG  1 
ATOM 11104 N N   . ILE C 1 436 ? 71.590  84.433  130.326 1.00 78.68  ? 433 ILE C N   1 
ATOM 11105 C CA  . ILE C 1 436 ? 70.599  85.467  130.056 1.00 64.19  ? 433 ILE C CA  1 
ATOM 11106 C C   . ILE C 1 436 ? 71.178  86.857  130.296 1.00 58.72  ? 433 ILE C C   1 
ATOM 11107 O O   . ILE C 1 436 ? 71.613  87.182  131.397 1.00 74.73  ? 433 ILE C O   1 
ATOM 11108 C CB  . ILE C 1 436 ? 69.339  85.291  130.920 1.00 77.58  ? 433 ILE C CB  1 
ATOM 11109 C CG1 . ILE C 1 436 ? 68.805  83.864  130.795 1.00 82.45  ? 433 ILE C CG1 1 
ATOM 11110 C CG2 . ILE C 1 436 ? 68.264  86.286  130.499 1.00 67.12  ? 433 ILE C CG2 1 
ATOM 11111 C CD1 . ILE C 1 436 ? 67.567  83.613  131.632 1.00 79.39  ? 433 ILE C CD1 1 
ATOM 11112 N N   . VAL C 1 437 ? 71.163  87.669  129.251 1.00 69.19  ? 434 VAL C N   1 
ATOM 11113 C CA  . VAL C 1 437 ? 71.759  88.989  129.287 1.00 83.03  ? 434 VAL C CA  1 
ATOM 11114 C C   . VAL C 1 437 ? 70.677  90.042  129.088 1.00 87.11  ? 434 VAL C C   1 
ATOM 11115 O O   . VAL C 1 437 ? 69.822  89.907  128.207 1.00 84.68  ? 434 VAL C O   1 
ATOM 11116 C CB  . VAL C 1 437 ? 72.812  89.135  128.163 1.00 76.81  ? 434 VAL C CB  1 
ATOM 11117 C CG1 . VAL C 1 437 ? 73.498  90.496  128.245 1.00 86.31  ? 434 VAL C CG1 1 
ATOM 11118 C CG2 . VAL C 1 437 ? 73.831  87.996  128.238 1.00 64.77  ? 434 VAL C CG2 1 
ATOM 11119 N N   . GLU C 1 438 ? 70.705  91.088  129.907 1.00 76.66  ? 435 GLU C N   1 
ATOM 11120 C CA  . GLU C 1 438 ? 69.802  92.206  129.699 1.00 75.03  ? 435 GLU C CA  1 
ATOM 11121 C C   . GLU C 1 438 ? 70.526  93.349  129.002 1.00 78.28  ? 435 GLU C C   1 
ATOM 11122 O O   . GLU C 1 438 ? 71.657  93.671  129.361 1.00 90.13  ? 435 GLU C O   1 
ATOM 11123 C CB  . GLU C 1 438 ? 69.186  92.687  131.017 1.00 77.82  ? 435 GLU C CB  1 
ATOM 11124 C CG  . GLU C 1 438 ? 68.476  94.025  130.851 1.00 87.66  ? 435 GLU C CG  1 
ATOM 11125 C CD  . GLU C 1 438 ? 67.536  94.366  131.995 1.00 105.36 ? 435 GLU C CD  1 
ATOM 11126 O OE1 . GLU C 1 438 ? 67.615  93.712  133.062 1.00 96.70  ? 435 GLU C OE1 1 
ATOM 11127 O OE2 . GLU C 1 438 ? 66.715  95.301  131.814 1.00 86.94  ? 435 GLU C OE2 1 
ATOM 11128 N N   . SER C 1 439 ? 69.879  93.944  127.997 1.00 83.63  ? 436 SER C N   1 
ATOM 11129 C CA  . SER C 1 439 ? 70.457  95.068  127.257 1.00 79.00  ? 436 SER C CA  1 
ATOM 11130 C C   . SER C 1 439 ? 69.625  96.314  127.465 1.00 80.88  ? 436 SER C C   1 
ATOM 11131 O O   . SER C 1 439 ? 68.393  96.272  127.404 1.00 87.23  ? 436 SER C O   1 
ATOM 11132 C CB  . SER C 1 439 ? 70.562  94.764  125.758 1.00 79.52  ? 436 SER C CB  1 
ATOM 11133 O OG  . SER C 1 439 ? 71.336  95.763  125.106 1.00 83.61  ? 436 SER C OG  1 
ATOM 11134 N N   . LYS C 1 440 ? 70.309  97.420  127.731 1.00 99.38  ? 437 LYS C N   1 
ATOM 11135 C CA  . LYS C 1 440 ? 69.657  98.712  127.861 1.00 101.11 ? 437 LYS C CA  1 
ATOM 11136 C C   . LYS C 1 440 ? 69.601  99.349  126.478 1.00 97.43  ? 437 LYS C C   1 
ATOM 11137 O O   . LYS C 1 440 ? 68.853  100.295 126.247 1.00 97.22  ? 437 LYS C O   1 
ATOM 11138 C CB  . LYS C 1 440 ? 70.416  99.606  128.846 1.00 81.03  ? 437 LYS C CB  1 
ATOM 11139 N N   . ASP C 1 441 ? 70.392  98.802  125.558 1.00 86.88  ? 438 ASP C N   1 
ATOM 11140 C CA  . ASP C 1 441 ? 70.495  99.331  124.205 1.00 84.26  ? 438 ASP C CA  1 
ATOM 11141 C C   . ASP C 1 441 ? 69.979  98.291  123.225 1.00 89.59  ? 438 ASP C C   1 
ATOM 11142 O O   . ASP C 1 441 ? 70.589  97.235  123.055 1.00 94.08  ? 438 ASP C O   1 
ATOM 11143 C CB  . ASP C 1 441 ? 71.959  99.697  123.894 1.00 83.60  ? 438 ASP C CB  1 
ATOM 11144 C CG  . ASP C 1 441 ? 72.174  100.159 122.446 1.00 95.49  ? 438 ASP C CG  1 
ATOM 11145 O OD1 . ASP C 1 441 ? 71.210  100.603 121.771 1.00 69.16  ? 438 ASP C OD1 1 
ATOM 11146 O OD2 . ASP C 1 441 ? 73.336  100.087 121.989 1.00 90.97  ? 438 ASP C OD2 1 
ATOM 11147 N N   . PRO C 1 442 ? 68.853  98.590  122.569 1.00 75.93  ? 439 PRO C N   1 
ATOM 11148 C CA  . PRO C 1 442 ? 68.197  97.641  121.658 1.00 74.08  ? 439 PRO C CA  1 
ATOM 11149 C C   . PRO C 1 442 ? 68.947  97.446  120.315 1.00 85.25  ? 439 PRO C C   1 
ATOM 11150 O O   . PRO C 1 442 ? 68.564  96.586  119.502 1.00 88.09  ? 439 PRO C O   1 
ATOM 11151 C CB  . PRO C 1 442 ? 66.802  98.254  121.461 1.00 63.42  ? 439 PRO C CB  1 
ATOM 11152 C CG  . PRO C 1 442 ? 66.986  99.735  121.727 1.00 66.38  ? 439 PRO C CG  1 
ATOM 11153 C CD  . PRO C 1 442 ? 68.217  99.921  122.573 1.00 71.62  ? 439 PRO C CD  1 
ATOM 11154 N N   . GLN C 1 443 ? 70.011  98.222  120.105 1.00 71.27  ? 440 GLN C N   1 
ATOM 11155 C CA  . GLN C 1 443 ? 70.818  98.137  118.889 1.00 81.44  ? 440 GLN C CA  1 
ATOM 11156 C C   . GLN C 1 443 ? 72.233  97.654  119.193 1.00 85.22  ? 440 GLN C C   1 
ATOM 11157 O O   . GLN C 1 443 ? 73.129  97.799  118.353 1.00 87.32  ? 440 GLN C O   1 
ATOM 11158 C CB  . GLN C 1 443 ? 70.922  99.509  118.216 1.00 80.90  ? 440 GLN C CB  1 
ATOM 11159 C CG  . GLN C 1 443 ? 69.605  100.201 117.968 1.00 86.75  ? 440 GLN C CG  1 
ATOM 11160 C CD  . GLN C 1 443 ? 68.950  99.750  116.685 1.00 100.36 ? 440 GLN C CD  1 
ATOM 11161 O OE1 . GLN C 1 443 ? 69.477  98.891  115.972 1.00 117.67 ? 440 GLN C OE1 1 
ATOM 11162 N NE2 . GLN C 1 443 ? 67.795  100.333 116.375 1.00 87.98  ? 440 GLN C NE2 1 
ATOM 11163 N N   . GLU C 1 444 ? 72.437  97.116  120.398 1.00 73.63  ? 441 GLU C N   1 
ATOM 11164 C CA  . GLU C 1 444 ? 73.735  96.570  120.798 1.00 75.89  ? 441 GLU C CA  1 
ATOM 11165 C C   . GLU C 1 444 ? 74.084  95.362  119.915 1.00 81.12  ? 441 GLU C C   1 
ATOM 11166 O O   . GLU C 1 444 ? 73.193  94.588  119.560 1.00 90.22  ? 441 GLU C O   1 
ATOM 11167 C CB  . GLU C 1 444 ? 73.697  96.159  122.278 1.00 64.02  ? 441 GLU C CB  1 
ATOM 11168 C CG  . GLU C 1 444 ? 74.851  96.678  123.133 1.00 75.94  ? 441 GLU C CG  1 
ATOM 11169 C CD  . GLU C 1 444 ? 76.079  95.778  123.093 1.00 88.53  ? 441 GLU C CD  1 
ATOM 11170 O OE1 . GLU C 1 444 ? 75.979  94.635  122.599 1.00 95.11  ? 441 GLU C OE1 1 
ATOM 11171 O OE2 . GLU C 1 444 ? 77.152  96.214  123.556 1.00 93.89  ? 441 GLU C OE2 1 
ATOM 11172 N N   . PRO C 1 445 ? 75.377  95.201  119.552 1.00 89.16  ? 442 PRO C N   1 
ATOM 11173 C CA  . PRO C 1 445 ? 75.870  94.077  118.731 1.00 72.35  ? 442 PRO C CA  1 
ATOM 11174 C C   . PRO C 1 445 ? 75.341  92.698  119.146 1.00 81.31  ? 442 PRO C C   1 
ATOM 11175 O O   . PRO C 1 445 ? 75.224  91.809  118.298 1.00 74.87  ? 442 PRO C O   1 
ATOM 11176 C CB  . PRO C 1 445 ? 77.382  94.134  118.937 1.00 64.92  ? 442 PRO C CB  1 
ATOM 11177 C CG  . PRO C 1 445 ? 77.651  95.606  119.132 1.00 79.76  ? 442 PRO C CG  1 
ATOM 11178 C CD  . PRO C 1 445 ? 76.447  96.174  119.851 1.00 72.66  ? 442 PRO C CD  1 
ATOM 11179 N N   . ILE C 1 446 ? 75.036  92.518  120.428 1.00 78.81  ? 443 ILE C N   1 
ATOM 11180 C CA  . ILE C 1 446 ? 74.542  91.231  120.906 1.00 70.96  ? 443 ILE C CA  1 
ATOM 11181 C C   . ILE C 1 446 ? 73.051  91.083  120.612 1.00 66.24  ? 443 ILE C C   1 
ATOM 11182 O O   . ILE C 1 446 ? 72.505  89.982  120.685 1.00 69.10  ? 443 ILE C O   1 
ATOM 11183 C CB  . ILE C 1 446 ? 74.808  91.042  122.414 1.00 75.21  ? 443 ILE C CB  1 
ATOM 11184 C CG1 . ILE C 1 446 ? 74.704  89.568  122.799 1.00 72.98  ? 443 ILE C CG1 1 
ATOM 11185 C CG2 . ILE C 1 446 ? 73.833  91.860  123.242 1.00 57.22  ? 443 ILE C CG2 1 
ATOM 11186 C CD1 . ILE C 1 446 ? 75.076  89.292  124.254 1.00 56.49  ? 443 ILE C CD1 1 
ATOM 11187 N N   . MET C 1 447 ? 72.398  92.195  120.279 1.00 65.41  ? 444 MET C N   1 
ATOM 11188 C CA  . MET C 1 447 ? 71.013  92.165  119.811 1.00 69.25  ? 444 MET C CA  1 
ATOM 11189 C C   . MET C 1 447 ? 70.945  91.955  118.286 1.00 80.09  ? 444 MET C C   1 
ATOM 11190 O O   . MET C 1 447 ? 69.875  91.655  117.742 1.00 72.91  ? 444 MET C O   1 
ATOM 11191 C CB  . MET C 1 447 ? 70.263  93.448  120.216 1.00 62.40  ? 444 MET C CB  1 
ATOM 11192 C CG  . MET C 1 447 ? 70.042  93.631  121.719 1.00 61.88  ? 444 MET C CG  1 
ATOM 11193 S SD  . MET C 1 447 ? 68.757  92.577  122.427 1.00 78.25  ? 444 MET C SD  1 
ATOM 11194 C CE  . MET C 1 447 ? 67.286  93.296  121.722 1.00 58.31  ? 444 MET C CE  1 
ATOM 11195 N N   . LYS C 1 448 ? 72.094  92.087  117.614 1.00 83.80  ? 445 LYS C N   1 
ATOM 11196 C CA  . LYS C 1 448 ? 72.163  92.073  116.142 1.00 76.57  ? 445 LYS C CA  1 
ATOM 11197 C C   . LYS C 1 448 ? 72.949  90.898  115.510 1.00 81.54  ? 445 LYS C C   1 
ATOM 11198 O O   . LYS C 1 448 ? 72.573  90.402  114.450 1.00 72.22  ? 445 LYS C O   1 
ATOM 11199 C CB  . LYS C 1 448 ? 72.717  93.410  115.618 1.00 60.23  ? 445 LYS C CB  1 
ATOM 11200 C CG  . LYS C 1 448 ? 71.936  94.639  116.061 1.00 73.86  ? 445 LYS C CG  1 
ATOM 11201 C CD  . LYS C 1 448 ? 72.092  95.791  115.075 1.00 67.02  ? 445 LYS C CD  1 
ATOM 11202 N N   . GLU C 1 449 ? 74.031  90.467  116.155 1.00 82.43  ? 446 GLU C N   1 
ATOM 11203 C CA  . GLU C 1 449 ? 74.910  89.448  115.593 1.00 69.22  ? 446 GLU C CA  1 
ATOM 11204 C C   . GLU C 1 449 ? 74.573  88.024  116.110 1.00 72.33  ? 446 GLU C C   1 
ATOM 11205 O O   . GLU C 1 449 ? 74.305  87.822  117.301 1.00 65.09  ? 446 GLU C O   1 
ATOM 11206 C CB  . GLU C 1 449 ? 76.380  89.835  115.850 1.00 58.67  ? 446 GLU C CB  1 
ATOM 11207 N N   . GLU C 1 450 ? 74.576  87.040  115.209 1.00 70.70  ? 447 GLU C N   1 
ATOM 11208 C CA  . GLU C 1 450 ? 74.218  85.653  115.562 1.00 69.37  ? 447 GLU C CA  1 
ATOM 11209 C C   . GLU C 1 450 ? 75.312  84.909  116.346 1.00 81.55  ? 447 GLU C C   1 
ATOM 11210 O O   . GLU C 1 450 ? 76.443  84.768  115.869 1.00 75.93  ? 447 GLU C O   1 
ATOM 11211 C CB  . GLU C 1 450 ? 73.867  84.854  114.304 1.00 57.83  ? 447 GLU C CB  1 
ATOM 11212 C CG  . GLU C 1 450 ? 73.317  83.444  114.563 1.00 62.48  ? 447 GLU C CG  1 
ATOM 11213 C CD  . GLU C 1 450 ? 73.154  82.627  113.261 1.00 100.69 ? 447 GLU C CD  1 
ATOM 11214 O OE1 . GLU C 1 450 ? 73.993  82.776  112.339 1.00 88.23  ? 447 GLU C OE1 1 
ATOM 11215 O OE2 . GLU C 1 450 ? 72.188  81.834  113.157 1.00 79.28  ? 447 GLU C OE2 1 
ATOM 11216 N N   . ILE C 1 451 ? 74.962  84.412  117.530 1.00 68.97  ? 448 ILE C N   1 
ATOM 11217 C CA  . ILE C 1 451 ? 75.937  83.770  118.404 1.00 58.88  ? 448 ILE C CA  1 
ATOM 11218 C C   . ILE C 1 451 ? 76.036  82.241  118.208 1.00 80.46  ? 448 ILE C C   1 
ATOM 11219 O O   . ILE C 1 451 ? 77.112  81.646  118.350 1.00 67.55  ? 448 ILE C O   1 
ATOM 11220 C CB  . ILE C 1 451 ? 75.625  84.091  119.881 1.00 62.33  ? 448 ILE C CB  1 
ATOM 11221 C CG1 . ILE C 1 451 ? 75.612  85.604  120.101 1.00 66.15  ? 448 ILE C CG1 1 
ATOM 11222 C CG2 . ILE C 1 451 ? 76.644  83.433  120.825 1.00 65.30  ? 448 ILE C CG2 1 
ATOM 11223 C CD1 . ILE C 1 451 ? 75.246  85.999  121.526 1.00 71.01  ? 448 ILE C CD1 1 
ATOM 11224 N N   . PHE C 1 452 ? 74.913  81.614  117.873 1.00 57.12  ? 449 PHE C N   1 
ATOM 11225 C CA  . PHE C 1 452 ? 74.855  80.157  117.777 1.00 75.29  ? 449 PHE C CA  1 
ATOM 11226 C C   . PHE C 1 452 ? 75.361  79.457  119.057 1.00 75.05  ? 449 PHE C C   1 
ATOM 11227 O O   . PHE C 1 452 ? 76.104  78.458  119.011 1.00 78.95  ? 449 PHE C O   1 
ATOM 11228 C CB  . PHE C 1 452 ? 75.578  79.657  116.519 1.00 56.74  ? 449 PHE C CB  1 
ATOM 11229 C CG  . PHE C 1 452 ? 74.729  78.762  115.660 1.00 68.67  ? 449 PHE C CG  1 
ATOM 11230 C CD1 . PHE C 1 452 ? 75.014  77.407  115.546 1.00 69.30  ? 449 PHE C CD1 1 
ATOM 11231 C CD2 . PHE C 1 452 ? 73.625  79.271  114.986 1.00 76.39  ? 449 PHE C CD2 1 
ATOM 11232 C CE1 . PHE C 1 452 ? 74.228  76.578  114.762 1.00 72.90  ? 449 PHE C CE1 1 
ATOM 11233 C CE2 . PHE C 1 452 ? 72.820  78.448  114.198 1.00 63.90  ? 449 PHE C CE2 1 
ATOM 11234 C CZ  . PHE C 1 452 ? 73.125  77.096  114.089 1.00 77.77  ? 449 PHE C CZ  1 
ATOM 11235 N N   . GLY C 1 453 ? 74.938  80.003  120.193 1.00 60.98  ? 450 GLY C N   1 
ATOM 11236 C CA  . GLY C 1 453 ? 75.182  79.418  121.498 1.00 73.21  ? 450 GLY C CA  1 
ATOM 11237 C C   . GLY C 1 453 ? 73.992  79.714  122.392 1.00 75.85  ? 450 GLY C C   1 
ATOM 11238 O O   . GLY C 1 453 ? 73.051  80.392  121.965 1.00 72.28  ? 450 GLY C O   1 
ATOM 11239 N N   . PRO C 1 454 ? 74.022  79.214  123.637 1.00 73.82  ? 451 PRO C N   1 
ATOM 11240 C CA  . PRO C 1 454 ? 72.883  79.372  124.550 1.00 73.64  ? 451 PRO C CA  1 
ATOM 11241 C C   . PRO C 1 454 ? 72.887  80.740  125.241 1.00 82.27  ? 451 PRO C C   1 
ATOM 11242 O O   . PRO C 1 454 ? 73.051  80.820  126.462 1.00 62.14  ? 451 PRO C O   1 
ATOM 11243 C CB  . PRO