data_3VA2
# 
_entry.id   3VA2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VA2         
RCSB  RCSB069784   
WWPDB D_1000069784 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3VA2 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kusano, S.'         1 
'Kukimoto-Niino, M.' 2 
'Shirouzu, M.'       3 
'Yokoyama, S.'       4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of interleukin-5 dimer recognition by its alpha receptor' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            21 
_citation.page_first                850 
_citation.page_last                 864 
_citation.year                      2012 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22528658 
_citation.pdbx_database_id_DOI      10.1002/pro.2072 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kusano, S.'         1  
primary 'Kukimoto-Niino, M.' 2  
primary 'Hino, N.'           3  
primary 'Ohsawa, N.'         4  
primary 'Ikutani, M.'        5  
primary 'Takaki, S.'         6  
primary 'Sakamoto, K.'       7  
primary 'Hara-Yokoyama, M.'  8  
primary 'Shirouzu, M.'       9  
primary 'Takatsu, K.'        10 
primary 'Yokoyama, S.'       11 
# 
_cell.entry_id           3VA2 
_cell.length_a           58.633 
_cell.length_b           88.680 
_cell.length_c           126.674 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3VA2 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Interleukin-5                          13374.286 2  ? ? 'UNP residues 23-134'             ? 
2 polymer man 'Interleukin-5 receptor subunit alpha' 36393.727 1  ? ? 'ectodomain, UNP residues 21-335' ? 
3 water   nat water                                  18.015    32 ? ? ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'IL-5, B-cell differentiation factor I, Eosinophil differentiation factor, T-cell replacing factor, TRF' 
2 'IL-5 receptor subunit alpha, IL-5R subunit alpha, IL-5R-alpha, IL-5RA, CDw125'                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSSGSSGEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIK
KYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
;
;GSSGSSGEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIK
KYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
;
A,B ? 
2 'polypeptide(L)' no no 
;GSSGSSGDLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKG
FSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYY
RYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTR
LSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGN
DE
;
;GSSGSSGDLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKG
FSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYY
RYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTR
LSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGN
DE
;
C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLU n 
1 9   ILE n 
1 10  PRO n 
1 11  THR n 
1 12  SER n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  LYS n 
1 17  GLU n 
1 18  THR n 
1 19  LEU n 
1 20  ALA n 
1 21  LEU n 
1 22  LEU n 
1 23  SER n 
1 24  THR n 
1 25  HIS n 
1 26  ARG n 
1 27  THR n 
1 28  LEU n 
1 29  LEU n 
1 30  ILE n 
1 31  ALA n 
1 32  ASN n 
1 33  GLU n 
1 34  THR n 
1 35  LEU n 
1 36  ARG n 
1 37  ILE n 
1 38  PRO n 
1 39  VAL n 
1 40  PRO n 
1 41  VAL n 
1 42  HIS n 
1 43  LYS n 
1 44  ASN n 
1 45  HIS n 
1 46  GLN n 
1 47  LEU n 
1 48  CYS n 
1 49  THR n 
1 50  GLU n 
1 51  GLU n 
1 52  ILE n 
1 53  PHE n 
1 54  GLN n 
1 55  GLY n 
1 56  ILE n 
1 57  GLY n 
1 58  THR n 
1 59  LEU n 
1 60  GLU n 
1 61  SER n 
1 62  GLN n 
1 63  THR n 
1 64  VAL n 
1 65  GLN n 
1 66  GLY n 
1 67  GLY n 
1 68  THR n 
1 69  VAL n 
1 70  GLU n 
1 71  ARG n 
1 72  LEU n 
1 73  PHE n 
1 74  LYS n 
1 75  ASN n 
1 76  LEU n 
1 77  SER n 
1 78  LEU n 
1 79  ILE n 
1 80  LYS n 
1 81  LYS n 
1 82  TYR n 
1 83  ILE n 
1 84  ASP n 
1 85  GLY n 
1 86  GLN n 
1 87  LYS n 
1 88  LYS n 
1 89  LYS n 
1 90  CYS n 
1 91  GLY n 
1 92  GLU n 
1 93  GLU n 
1 94  ARG n 
1 95  ARG n 
1 96  ARG n 
1 97  VAL n 
1 98  ASN n 
1 99  GLN n 
1 100 PHE n 
1 101 LEU n 
1 102 ASP n 
1 103 TYR n 
1 104 LEU n 
1 105 GLN n 
1 106 GLU n 
1 107 PHE n 
1 108 LEU n 
1 109 GLY n 
1 110 VAL n 
1 111 MET n 
1 112 ASN n 
1 113 THR n 
1 114 GLU n 
1 115 TRP n 
1 116 ILE n 
1 117 ILE n 
1 118 GLU n 
1 119 SER n 
2 1   GLY n 
2 2   SER n 
2 3   SER n 
2 4   GLY n 
2 5   SER n 
2 6   SER n 
2 7   GLY n 
2 8   ASP n 
2 9   LEU n 
2 10  LEU n 
2 11  PRO n 
2 12  ASP n 
2 13  GLU n 
2 14  LYS n 
2 15  ILE n 
2 16  SER n 
2 17  LEU n 
2 18  LEU n 
2 19  PRO n 
2 20  PRO n 
2 21  VAL n 
2 22  ASN n 
2 23  PHE n 
2 24  THR n 
2 25  ILE n 
2 26  LYS n 
2 27  VAL n 
2 28  THR n 
2 29  GLY n 
2 30  LEU n 
2 31  ALA n 
2 32  GLN n 
2 33  VAL n 
2 34  LEU n 
2 35  LEU n 
2 36  GLN n 
2 37  TRP n 
2 38  LYS n 
2 39  PRO n 
2 40  ASN n 
2 41  PRO n 
2 42  ASP n 
2 43  GLN n 
2 44  GLU n 
2 45  GLN n 
2 46  ARG n 
2 47  ASN n 
2 48  VAL n 
2 49  ASN n 
2 50  LEU n 
2 51  GLU n 
2 52  TYR n 
2 53  GLN n 
2 54  VAL n 
2 55  LYS n 
2 56  ILE n 
2 57  ASN n 
2 58  ALA n 
2 59  PRO n 
2 60  LYS n 
2 61  GLU n 
2 62  ASP n 
2 63  ASP n 
2 64  TYR n 
2 65  GLU n 
2 66  THR n 
2 67  ARG n 
2 68  ILE n 
2 69  THR n 
2 70  GLU n 
2 71  SER n 
2 72  LYS n 
2 73  CYS n 
2 74  VAL n 
2 75  THR n 
2 76  ILE n 
2 77  LEU n 
2 78  HIS n 
2 79  LYS n 
2 80  GLY n 
2 81  PHE n 
2 82  SER n 
2 83  ALA n 
2 84  SER n 
2 85  VAL n 
2 86  ARG n 
2 87  THR n 
2 88  ILE n 
2 89  LEU n 
2 90  GLN n 
2 91  ASN n 
2 92  ASP n 
2 93  HIS n 
2 94  SER n 
2 95  LEU n 
2 96  LEU n 
2 97  ALA n 
2 98  SER n 
2 99  SER n 
2 100 TRP n 
2 101 ALA n 
2 102 SER n 
2 103 ALA n 
2 104 GLU n 
2 105 LEU n 
2 106 HIS n 
2 107 ALA n 
2 108 PRO n 
2 109 PRO n 
2 110 GLY n 
2 111 SER n 
2 112 PRO n 
2 113 GLY n 
2 114 THR n 
2 115 SER n 
2 116 ILE n 
2 117 VAL n 
2 118 ASN n 
2 119 LEU n 
2 120 THR n 
2 121 CYS n 
2 122 THR n 
2 123 THR n 
2 124 ASN n 
2 125 THR n 
2 126 THR n 
2 127 GLU n 
2 128 ASP n 
2 129 ASN n 
2 130 TYR n 
2 131 SER n 
2 132 ARG n 
2 133 LEU n 
2 134 ARG n 
2 135 SER n 
2 136 TYR n 
2 137 GLN n 
2 138 VAL n 
2 139 SER n 
2 140 LEU n 
2 141 HIS n 
2 142 CYS n 
2 143 THR n 
2 144 TRP n 
2 145 LEU n 
2 146 VAL n 
2 147 GLY n 
2 148 THR n 
2 149 ASP n 
2 150 ALA n 
2 151 PRO n 
2 152 GLU n 
2 153 ASP n 
2 154 THR n 
2 155 GLN n 
2 156 TYR n 
2 157 PHE n 
2 158 LEU n 
2 159 TYR n 
2 160 TYR n 
2 161 ARG n 
2 162 TYR n 
2 163 GLY n 
2 164 SER n 
2 165 TRP n 
2 166 THR n 
2 167 GLU n 
2 168 GLU n 
2 169 CYS n 
2 170 GLN n 
2 171 GLU n 
2 172 TYR n 
2 173 SER n 
2 174 LYS n 
2 175 ASP n 
2 176 THR n 
2 177 LEU n 
2 178 GLY n 
2 179 ARG n 
2 180 ASN n 
2 181 ILE n 
2 182 ALA n 
2 183 CYS n 
2 184 TRP n 
2 185 PHE n 
2 186 PRO n 
2 187 ARG n 
2 188 THR n 
2 189 PHE n 
2 190 ILE n 
2 191 LEU n 
2 192 SER n 
2 193 LYS n 
2 194 GLY n 
2 195 ARG n 
2 196 ASP n 
2 197 TRP n 
2 198 LEU n 
2 199 ALA n 
2 200 VAL n 
2 201 LEU n 
2 202 VAL n 
2 203 ASN n 
2 204 GLY n 
2 205 SER n 
2 206 SER n 
2 207 LYS n 
2 208 HIS n 
2 209 SER n 
2 210 ALA n 
2 211 ILE n 
2 212 ARG n 
2 213 PRO n 
2 214 PHE n 
2 215 ASP n 
2 216 GLN n 
2 217 LEU n 
2 218 PHE n 
2 219 ALA n 
2 220 LEU n 
2 221 HIS n 
2 222 ALA n 
2 223 ILE n 
2 224 ASP n 
2 225 GLN n 
2 226 ILE n 
2 227 ASN n 
2 228 PRO n 
2 229 PRO n 
2 230 LEU n 
2 231 ASN n 
2 232 VAL n 
2 233 THR n 
2 234 ALA n 
2 235 GLU n 
2 236 ILE n 
2 237 GLU n 
2 238 GLY n 
2 239 THR n 
2 240 ARG n 
2 241 LEU n 
2 242 SER n 
2 243 ILE n 
2 244 GLN n 
2 245 TRP n 
2 246 GLU n 
2 247 LYS n 
2 248 PRO n 
2 249 VAL n 
2 250 SER n 
2 251 ALA n 
2 252 PHE n 
2 253 PRO n 
2 254 ILE n 
2 255 HIS n 
2 256 CYS n 
2 257 PHE n 
2 258 ASP n 
2 259 TYR n 
2 260 GLU n 
2 261 VAL n 
2 262 LYS n 
2 263 ILE n 
2 264 HIS n 
2 265 ASN n 
2 266 THR n 
2 267 ARG n 
2 268 ASN n 
2 269 GLY n 
2 270 TYR n 
2 271 LEU n 
2 272 GLN n 
2 273 ILE n 
2 274 GLU n 
2 275 LYS n 
2 276 LEU n 
2 277 MET n 
2 278 THR n 
2 279 ASN n 
2 280 ALA n 
2 281 PHE n 
2 282 ILE n 
2 283 SER n 
2 284 ILE n 
2 285 ILE n 
2 286 ASP n 
2 287 ASP n 
2 288 LEU n 
2 289 SER n 
2 290 LYS n 
2 291 TYR n 
2 292 ASP n 
2 293 VAL n 
2 294 GLN n 
2 295 VAL n 
2 296 ARG n 
2 297 ALA n 
2 298 ALA n 
2 299 VAL n 
2 300 SER n 
2 301 SER n 
2 302 MET n 
2 303 CYS n 
2 304 ARG n 
2 305 GLU n 
2 306 ALA n 
2 307 GLY n 
2 308 LEU n 
2 309 TRP n 
2 310 SER n 
2 311 GLU n 
2 312 TRP n 
2 313 SER n 
2 314 GLN n 
2 315 PRO n 
2 316 ILE n 
2 317 TYR n 
2 318 VAL n 
2 319 GLY n 
2 320 ASN n 
2 321 ASP n 
2 322 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? IL5           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'CELL-FREE SYNTHESIS' ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'IL5RA, IL5R' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'CELL-FREE SYNTHESIS' ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IL5_HUMAN   P05113 1 
;EIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQK
KKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
;
23 ? 
2 UNP IL5RA_HUMAN Q01344 2 
;DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT
ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK
PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE
;
21 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VA2 A 8 ? 119 ? P05113 23 ? 134 ? 23 134 
2 1 3VA2 B 8 ? 119 ? P05113 23 ? 134 ? 23 134 
3 2 3VA2 C 8 ? 322 ? Q01344 21 ? 335 ? 21 335 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VA2 GLY A 1 ? UNP P05113 ? ? 'EXPRESSION TAG' 16 1  
1 3VA2 SER A 2 ? UNP P05113 ? ? 'EXPRESSION TAG' 17 2  
1 3VA2 SER A 3 ? UNP P05113 ? ? 'EXPRESSION TAG' 18 3  
1 3VA2 GLY A 4 ? UNP P05113 ? ? 'EXPRESSION TAG' 19 4  
1 3VA2 SER A 5 ? UNP P05113 ? ? 'EXPRESSION TAG' 20 5  
1 3VA2 SER A 6 ? UNP P05113 ? ? 'EXPRESSION TAG' 21 6  
1 3VA2 GLY A 7 ? UNP P05113 ? ? 'EXPRESSION TAG' 22 7  
2 3VA2 GLY B 1 ? UNP P05113 ? ? 'EXPRESSION TAG' 16 8  
2 3VA2 SER B 2 ? UNP P05113 ? ? 'EXPRESSION TAG' 17 9  
2 3VA2 SER B 3 ? UNP P05113 ? ? 'EXPRESSION TAG' 18 10 
2 3VA2 GLY B 4 ? UNP P05113 ? ? 'EXPRESSION TAG' 19 11 
2 3VA2 SER B 5 ? UNP P05113 ? ? 'EXPRESSION TAG' 20 12 
2 3VA2 SER B 6 ? UNP P05113 ? ? 'EXPRESSION TAG' 21 13 
2 3VA2 GLY B 7 ? UNP P05113 ? ? 'EXPRESSION TAG' 22 14 
3 3VA2 GLY C 1 ? UNP Q01344 ? ? 'EXPRESSION TAG' 14 15 
3 3VA2 SER C 2 ? UNP Q01344 ? ? 'EXPRESSION TAG' 15 16 
3 3VA2 SER C 3 ? UNP Q01344 ? ? 'EXPRESSION TAG' 16 17 
3 3VA2 GLY C 4 ? UNP Q01344 ? ? 'EXPRESSION TAG' 17 18 
3 3VA2 SER C 5 ? UNP Q01344 ? ? 'EXPRESSION TAG' 18 19 
3 3VA2 SER C 6 ? UNP Q01344 ? ? 'EXPRESSION TAG' 19 20 
3 3VA2 GLY C 7 ? UNP Q01344 ? ? 'EXPRESSION TAG' 20 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3VA2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
'0.1M Na HEPES, 22% (v/v) PEG 4000, 2% i-Propanol, 6% (w/v) 1,6-Hexanediol , pH 7.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-11-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3VA2 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.703 
_reflns.number_obs                   18667 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.070 
_reflns.pdbx_netI_over_sigmaI        22.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.80 2.9  100  0.349  0.064 7.2  6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1  1 
2.90 3.02 100  0.552  0.065 7.5  6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2  1 
3.02 3.15 99.9 0.806  0.066 7.8  6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3  1 
3.15 3.32 100  1.354  0.069 8.8  6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4  1 
3.32 3.53 99.9 2.321  0.073 12.0 6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5  1 
3.53 3.80 100  3.300  0.076 13.8 6.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6  1 
3.80 4.18 100  5.369  0.082 19.7 6.7 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7  1 
4.18 4.79 99.9 9.095  0.096 31.5 6.6 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8  1 
4.79 6.03 100  8.409  0.088 39.2 6.5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9  1 
6.03 50   94.9 14.303 0.218 59.1 5.8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 
# 
_refine.entry_id                                 3VA2 
_refine.ls_number_reflns_obs                     18615 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.027 
_refine.ls_d_res_high                            2.703 
_refine.ls_percent_reflns_obs                    99.44 
_refine.ls_R_factor_obs                          0.2253 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2227 
_refine.ls_R_factor_R_free                       0.2755 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.0937 
_refine.aniso_B[2][2]                            -17.8849 
_refine.aniso_B[3][3]                            -10.0862 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.343 
_refine.solvent_model_param_bsol                 77.279 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.73 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.34 
_refine.pdbx_overall_phase_error                 27.68 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4203 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               4235 
_refine_hist.d_res_high                       2.703 
_refine_hist.d_res_low                        43.027 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 4298 'X-RAY DIFFRACTION' ? 
f_angle_d          0.730  ? ? 5829 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.659 ? ? 1589 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.050  ? ? 666  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.002  ? ? 741  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' 7 2.7032 2.8457  2474 0.3176 100.00 0.3943 . . 134 . . 
'X-RAY DIFFRACTION' 7 2.8457 3.0240  2497 0.2842 100.00 0.3078 . . 146 . . 
'X-RAY DIFFRACTION' 7 3.0240 3.2574  2522 0.2559 100.00 0.3300 . . 128 . . 
'X-RAY DIFFRACTION' 7 3.2574 3.5851  2493 0.2438 100.00 0.3239 . . 137 . . 
'X-RAY DIFFRACTION' 7 3.5851 4.1035  2535 0.2165 100.00 0.2674 . . 132 . . 
'X-RAY DIFFRACTION' 7 4.1035 5.1686  2551 0.1765 100.00 0.2636 . . 139 . . 
'X-RAY DIFFRACTION' 7 5.1686 43.0322 2601 0.2219 97.00  0.2289 . . 126 . . 
# 
_struct.entry_id                  3VA2 
_struct.title                     'Crystal structure of human Interleukin-5 in complex with its alpha receptor' 
_struct.pdbx_descriptor           'Interleukin-5, Interleukin-5 receptor subunit alpha' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VA2 
_struct_keywords.pdbx_keywords   'CYTOKINE/CYTOKINE RECEPTOR' 
_struct_keywords.text            
;cytokine, eosinophilic, asthma, JAK/STAT, fibronectin III-like (Fn III) domain, canonical cytokine receptor homology module (CRM), B cell growth, Ig secretion, eosinophils proliferation, cell surface, CYTOKINE-CYTOKINE RECEPTOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? HIS A 25  ? PRO A 25  HIS A 40  1 ? 16 
HELX_P HELX_P2  2  HIS A 25  ? ALA A 31  ? HIS A 40  ALA A 46  1 ? 7  
HELX_P HELX_P3  3  ASN A 44  ? LEU A 47  ? ASN A 59  LEU A 62  5 ? 4  
HELX_P HELX_P4  4  CYS A 48  ? SER A 61  ? CYS A 63  SER A 76  1 ? 14 
HELX_P HELX_P5  5  THR A 68  ? LYS A 89  ? THR A 83  LYS A 104 1 ? 22 
HELX_P HELX_P6  6  ARG A 96  ? GLU A 114 ? ARG A 111 GLU A 129 1 ? 19 
HELX_P HELX_P7  7  ALA B 13  ? SER B 23  ? ALA B 28  SER B 38  1 ? 11 
HELX_P HELX_P8  8  HIS B 25  ? ILE B 30  ? HIS B 40  ILE B 45  1 ? 6  
HELX_P HELX_P9  9  ASN B 44  ? LEU B 47  ? ASN B 59  LEU B 62  5 ? 4  
HELX_P HELX_P10 10 CYS B 48  ? SER B 61  ? CYS B 63  SER B 76  1 ? 14 
HELX_P HELX_P11 11 GLY B 67  ? LYS B 89  ? GLY B 82  LYS B 104 1 ? 23 
HELX_P HELX_P12 12 GLN B 99  ? GLU B 114 ? GLN B 114 GLU B 129 1 ? 16 
HELX_P HELX_P13 13 SER C 111 ? SER C 115 ? SER C 124 SER C 128 5 ? 5  
HELX_P HELX_P14 14 LEU C 220 ? ILE C 223 ? LEU C 233 ILE C 236 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 48  SG ? ? ? 1_555 B CYS 90  SG ? ? A CYS 63  B CYS 105 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? A CYS 90  SG ? ? ? 1_555 B CYS 48  SG ? ? A CYS 105 B CYS 63  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3 disulf ? ? C CYS 121 SG ? ? ? 1_555 C CYS 142 SG ? ? C CYS 134 C CYS 155 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4 disulf ? ? C CYS 169 SG ? ? ? 1_555 C CYS 183 SG ? ? C CYS 182 C CYS 196 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5 disulf ? ? C CYS 256 SG ? ? ? 1_555 C CYS 303 SG ? ? C CYS 269 C CYS 316 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 97 B . ? VAL 112 B ASN 98 B ? ASN 113 B 1 4.21  
2 ALA 58 C . ? ALA 71  C PRO 59 C ? PRO 72  C 1 -0.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 6 ? 
C ? 6 ? 
D ? 3 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 36  ? PRO A 38  ? ARG A 51  PRO A 53  
A 2 ARG B 94  ? ARG B 96  ? ARG B 109 ARG B 111 
B 1 ILE B 37  ? PRO B 38  ? ILE B 52  PRO B 53  
B 2 GLU A 93  ? ARG A 95  ? GLU A 108 ARG A 110 
B 3 ASP C 62  ? THR C 66  ? ASP C 75  THR C 79  
B 4 GLU C 51  ? ALA C 58  ? GLU C 64  ALA C 71  
B 5 PHE C 81  ? GLN C 90  ? PHE C 94  GLN C 103 
B 6 LEU C 95  ? ALA C 97  ? LEU C 108 ALA C 110 
C 1 ILE B 37  ? PRO B 38  ? ILE B 52  PRO B 53  
C 2 GLU A 93  ? ARG A 95  ? GLU A 108 ARG A 110 
C 3 ASP C 62  ? THR C 66  ? ASP C 75  THR C 79  
C 4 GLU C 51  ? ALA C 58  ? GLU C 64  ALA C 71  
C 5 PHE C 81  ? GLN C 90  ? PHE C 94  GLN C 103 
C 6 ALA C 101 ? LEU C 105 ? ALA C 114 LEU C 118 
D 1 VAL C 21  ? GLY C 29  ? VAL C 34  GLY C 42  
D 2 GLN C 32  ? LYS C 38  ? GLN C 45  LYS C 51  
D 3 GLU C 70  ? VAL C 74  ? GLU C 83  VAL C 87  
E 1 TYR C 172 ? LYS C 174 ? TYR C 185 LYS C 187 
E 2 ASN C 180 ? PHE C 185 ? ASN C 193 PHE C 198 
E 3 GLN C 137 ? LEU C 145 ? GLN C 150 LEU C 158 
E 4 VAL C 117 ? THR C 126 ? VAL C 130 THR C 139 
E 5 ASP C 224 ? GLN C 225 ? ASP C 237 GLN C 238 
F 1 TRP C 165 ? GLU C 168 ? TRP C 178 GLU C 181 
F 2 GLN C 155 ? TYR C 162 ? GLN C 168 TYR C 175 
F 3 TRP C 197 ? SER C 205 ? TRP C 210 SER C 218 
F 4 PHE C 214 ? ALA C 219 ? PHE C 227 ALA C 232 
G 1 LEU C 230 ? GLU C 237 ? LEU C 243 GLU C 250 
G 2 ARG C 240 ? GLU C 246 ? ARG C 253 GLU C 259 
G 3 ALA C 280 ? ILE C 284 ? ALA C 293 ILE C 297 
H 1 LEU C 271 ? LEU C 276 ? LEU C 284 LEU C 289 
H 2 PHE C 257 ? ASN C 265 ? PHE C 270 ASN C 278 
H 3 LYS C 290 ? VAL C 299 ? LYS C 303 VAL C 312 
H 4 ILE C 316 ? GLY C 319 ? ILE C 329 GLY C 332 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 37  ? N ILE A 52  O ARG B 95  ? O ARG B 110 
B 1 2 O ILE B 37  ? O ILE B 52  N ARG A 95  ? N ARG A 110 
B 2 3 N ARG A 94  ? N ARG A 109 O GLU C 65  ? O GLU C 78  
B 3 4 O ASP C 62  ? O ASP C 75  N ILE C 56  ? N ILE C 69  
B 4 5 N LYS C 55  ? N LYS C 68  O SER C 84  ? O SER C 97  
B 5 6 N LEU C 89  ? N LEU C 102 O LEU C 96  ? O LEU C 109 
C 1 2 O ILE B 37  ? O ILE B 52  N ARG A 95  ? N ARG A 110 
C 2 3 N ARG A 94  ? N ARG A 109 O GLU C 65  ? O GLU C 78  
C 3 4 O ASP C 62  ? O ASP C 75  N ILE C 56  ? N ILE C 69  
C 4 5 N LYS C 55  ? N LYS C 68  O SER C 84  ? O SER C 97  
C 5 6 N PHE C 81  ? N PHE C 94  O LEU C 105 ? O LEU C 118 
D 1 2 N THR C 24  ? N THR C 37  O GLN C 36  ? O GLN C 49  
D 2 3 N LEU C 35  ? N LEU C 48  O SER C 71  ? O SER C 84  
E 1 2 N SER C 173 ? N SER C 186 O ILE C 181 ? O ILE C 194 
E 2 3 O CYS C 183 ? O CYS C 196 N CYS C 142 ? N CYS C 155 
E 3 4 O LEU C 145 ? O LEU C 158 N VAL C 117 ? N VAL C 130 
E 4 5 N THR C 123 ? N THR C 136 O GLN C 225 ? O GLN C 238 
F 1 2 O GLU C 167 ? O GLU C 180 N TYR C 160 ? N TYR C 173 
F 2 3 N TYR C 159 ? N TYR C 172 O LEU C 201 ? O LEU C 214 
F 3 4 N VAL C 202 ? N VAL C 215 O PHE C 214 ? O PHE C 227 
G 1 2 N GLU C 235 ? N GLU C 248 O SER C 242 ? O SER C 255 
G 2 3 N ILE C 243 ? N ILE C 256 O PHE C 281 ? O PHE C 294 
H 1 2 O LEU C 276 ? O LEU C 289 N TYR C 259 ? N TYR C 272 
H 2 3 N ASP C 258 ? N ASP C 271 O ALA C 298 ? O ALA C 311 
H 3 4 N TYR C 291 ? N TYR C 304 O VAL C 318 ? O VAL C 331 
# 
_database_PDB_matrix.entry_id          3VA2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3VA2 
_atom_sites.fract_transf_matrix[1][1]   0.017055 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011276 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007894 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 9   ? 22.487  19.767  8.454   1.00 138.18 ? 24  ILE A N   1 
ATOM   2    C CA  . ILE A 1 9   ? 22.963  18.776  9.419   1.00 138.12 ? 24  ILE A CA  1 
ATOM   3    C C   . ILE A 1 9   ? 22.492  17.341  9.122   1.00 136.44 ? 24  ILE A C   1 
ATOM   4    O O   . ILE A 1 9   ? 23.304  16.414  9.157   1.00 131.48 ? 24  ILE A O   1 
ATOM   5    C CB  . ILE A 1 9   ? 22.671  19.201  10.884  1.00 141.38 ? 24  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 9   ? 23.779  20.129  11.388  1.00 141.43 ? 24  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 9   ? 22.562  17.990  11.794  1.00 139.20 ? 24  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 9   ? 25.161  19.504  11.347  1.00 134.31 ? 24  ILE A CD1 1 
ATOM   9    N N   . PRO A 1 10  ? 21.190  17.144  8.829   1.00 135.84 ? 25  PRO A N   1 
ATOM   10   C CA  . PRO A 1 10  ? 20.839  15.804  8.341   1.00 125.27 ? 25  PRO A CA  1 
ATOM   11   C C   . PRO A 1 10  ? 21.477  15.546  6.979   1.00 115.77 ? 25  PRO A C   1 
ATOM   12   O O   . PRO A 1 10  ? 21.507  16.450  6.144   1.00 115.47 ? 25  PRO A O   1 
ATOM   13   C CB  . PRO A 1 10  ? 19.311  15.853  8.226   1.00 132.65 ? 25  PRO A CB  1 
ATOM   14   C CG  . PRO A 1 10  ? 18.967  17.300  8.183   1.00 142.02 ? 25  PRO A CG  1 
ATOM   15   C CD  . PRO A 1 10  ? 19.997  17.988  9.018   1.00 139.23 ? 25  PRO A CD  1 
ATOM   16   N N   . THR A 1 11  ? 21.974  14.329  6.771   1.00 105.76 ? 26  THR A N   1 
ATOM   17   C CA  . THR A 1 11  ? 22.809  14.003  5.615   1.00 99.21  ? 26  THR A CA  1 
ATOM   18   C C   . THR A 1 11  ? 22.164  14.322  4.264   1.00 98.48  ? 26  THR A C   1 
ATOM   19   O O   . THR A 1 11  ? 22.843  14.769  3.339   1.00 95.26  ? 26  THR A O   1 
ATOM   20   C CB  . THR A 1 11  ? 23.232  12.517  5.634   1.00 99.39  ? 26  THR A CB  1 
ATOM   21   O OG1 . THR A 1 11  ? 23.511  12.115  6.981   1.00 98.23  ? 26  THR A OG1 1 
ATOM   22   C CG2 . THR A 1 11  ? 24.468  12.297  4.773   1.00 89.15  ? 26  THR A CG2 1 
ATOM   23   N N   . SER A 1 12  ? 20.860  14.090  4.155   1.00 105.80 ? 27  SER A N   1 
ATOM   24   C CA  . SER A 1 12  ? 20.130  14.378  2.924   1.00 109.29 ? 27  SER A CA  1 
ATOM   25   C C   . SER A 1 12  ? 20.159  15.871  2.607   1.00 109.25 ? 27  SER A C   1 
ATOM   26   O O   . SER A 1 12  ? 20.371  16.270  1.461   1.00 108.29 ? 27  SER A O   1 
ATOM   27   C CB  . SER A 1 12  ? 18.686  13.896  3.040   1.00 109.48 ? 27  SER A CB  1 
ATOM   28   O OG  . SER A 1 12  ? 18.035  14.513  4.136   1.00 112.50 ? 27  SER A OG  1 
ATOM   29   N N   . ALA A 1 13  ? 19.950  16.690  3.631   1.00 108.14 ? 28  ALA A N   1 
ATOM   30   C CA  . ALA A 1 13  ? 20.016  18.137  3.475   1.00 111.15 ? 28  ALA A CA  1 
ATOM   31   C C   . ALA A 1 13  ? 21.449  18.589  3.210   1.00 109.90 ? 28  ALA A C   1 
ATOM   32   O O   . ALA A 1 13  ? 21.675  19.600  2.546   1.00 115.26 ? 28  ALA A O   1 
ATOM   33   C CB  . ALA A 1 13  ? 19.461  18.829  4.709   1.00 115.20 ? 28  ALA A CB  1 
ATOM   34   N N   . LEU A 1 14  ? 22.412  17.835  3.730   1.00 101.30 ? 29  LEU A N   1 
ATOM   35   C CA  . LEU A 1 14  ? 23.822  18.169  3.558   1.00 95.22  ? 29  LEU A CA  1 
ATOM   36   C C   . LEU A 1 14  ? 24.252  18.044  2.097   1.00 95.26  ? 29  LEU A C   1 
ATOM   37   O O   . LEU A 1 14  ? 24.964  18.902  1.575   1.00 102.69 ? 29  LEU A O   1 
ATOM   38   C CB  . LEU A 1 14  ? 24.695  17.280  4.449   1.00 97.69  ? 29  LEU A CB  1 
ATOM   39   C CG  . LEU A 1 14  ? 26.208  17.512  4.405   1.00 100.09 ? 29  LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 14  ? 26.554  18.866  5.001   1.00 100.65 ? 29  LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 14  ? 26.954  16.394  5.123   1.00 93.76  ? 29  LEU A CD2 1 
ATOM   42   N N   . VAL A 1 15  ? 23.808  16.974  1.444   1.00 91.80  ? 30  VAL A N   1 
ATOM   43   C CA  . VAL A 1 15  ? 24.134  16.731  0.042   1.00 96.59  ? 30  VAL A CA  1 
ATOM   44   C C   . VAL A 1 15  ? 23.474  17.760  -0.872  1.00 102.07 ? 30  VAL A C   1 
ATOM   45   O O   . VAL A 1 15  ? 24.122  18.316  -1.761  1.00 107.90 ? 30  VAL A O   1 
ATOM   46   C CB  . VAL A 1 15  ? 23.719  15.308  -0.391  1.00 97.21  ? 30  VAL A CB  1 
ATOM   47   C CG1 . VAL A 1 15  ? 23.849  15.142  -1.896  1.00 92.30  ? 30  VAL A CG1 1 
ATOM   48   C CG2 . VAL A 1 15  ? 24.556  14.267  0.339   1.00 93.06  ? 30  VAL A CG2 1 
ATOM   49   N N   . LYS A 1 16  ? 22.185  18.011  -0.645  1.00 98.03  ? 31  LYS A N   1 
ATOM   50   C CA  . LYS A 1 16  ? 21.444  19.010  -1.411  1.00 100.76 ? 31  LYS A CA  1 
ATOM   51   C C   . LYS A 1 16  ? 22.125  20.372  -1.342  1.00 103.38 ? 31  LYS A C   1 
ATOM   52   O O   . LYS A 1 16  ? 22.171  21.103  -2.330  1.00 105.55 ? 31  LYS A O   1 
ATOM   53   C CB  . LYS A 1 16  ? 20.005  19.129  -0.903  1.00 102.52 ? 31  LYS A CB  1 
ATOM   54   C CG  . LYS A 1 16  ? 19.115  17.943  -1.235  1.00 104.43 ? 31  LYS A CG  1 
ATOM   55   C CD  . LYS A 1 16  ? 17.682  18.192  -0.787  1.00 122.53 ? 31  LYS A CD  1 
ATOM   56   C CE  . LYS A 1 16  ? 17.049  19.354  -1.542  1.00 136.09 ? 31  LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 16  ? 16.912  19.078  -3.001  1.00 142.74 ? 31  LYS A NZ  1 
ATOM   58   N N   . GLU A 1 17  ? 22.652  20.703  -0.167  1.00 106.33 ? 32  GLU A N   1 
ATOM   59   C CA  . GLU A 1 17  ? 23.376  21.954  0.029   1.00 114.82 ? 32  GLU A CA  1 
ATOM   60   C C   . GLU A 1 17  ? 24.738  21.920  -0.656  1.00 119.90 ? 32  GLU A C   1 
ATOM   61   O O   . GLU A 1 17  ? 25.099  22.846  -1.384  1.00 122.23 ? 32  GLU A O   1 
ATOM   62   C CB  . GLU A 1 17  ? 23.554  22.241  1.523   1.00 113.68 ? 32  GLU A CB  1 
ATOM   63   C CG  . GLU A 1 17  ? 24.492  23.403  1.826   1.00 122.08 ? 32  GLU A CG  1 
ATOM   64   C CD  . GLU A 1 17  ? 24.642  23.667  3.315   1.00 130.57 ? 32  GLU A CD  1 
ATOM   65   O OE1 . GLU A 1 17  ? 24.014  22.944  4.118   1.00 131.42 ? 32  GLU A OE1 1 
ATOM   66   O OE2 . GLU A 1 17  ? 25.388  24.601  3.683   1.00 134.46 ? 32  GLU A OE2 1 
ATOM   67   N N   . THR A 1 18  ? 25.485  20.845  -0.419  1.00 114.94 ? 33  THR A N   1 
ATOM   68   C CA  . THR A 1 18  ? 26.838  20.704  -0.950  1.00 109.78 ? 33  THR A CA  1 
ATOM   69   C C   . THR A 1 18  ? 26.863  20.780  -2.476  1.00 112.20 ? 33  THR A C   1 
ATOM   70   O O   . THR A 1 18  ? 27.784  21.351  -3.059  1.00 110.92 ? 33  THR A O   1 
ATOM   71   C CB  . THR A 1 18  ? 27.486  19.379  -0.496  1.00 109.47 ? 33  THR A CB  1 
ATOM   72   O OG1 . THR A 1 18  ? 27.237  19.174  0.901   1.00 115.64 ? 33  THR A OG1 1 
ATOM   73   C CG2 . THR A 1 18  ? 28.987  19.408  -0.742  1.00 106.97 ? 33  THR A CG2 1 
ATOM   74   N N   . LEU A 1 19  ? 25.845  20.208  -3.114  1.00 114.28 ? 34  LEU A N   1 
ATOM   75   C CA  . LEU A 1 19  ? 25.716  20.255  -4.570  1.00 113.48 ? 34  LEU A CA  1 
ATOM   76   C C   . LEU A 1 19  ? 25.614  21.686  -5.095  1.00 113.09 ? 34  LEU A C   1 
ATOM   77   O O   . LEU A 1 19  ? 26.284  22.048  -6.063  1.00 118.08 ? 34  LEU A O   1 
ATOM   78   C CB  . LEU A 1 19  ? 24.500  19.446  -5.028  1.00 114.60 ? 34  LEU A CB  1 
ATOM   79   C CG  . LEU A 1 19  ? 24.729  17.965  -5.338  1.00 114.27 ? 34  LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 19  ? 23.406  17.242  -5.541  1.00 116.69 ? 34  LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 19  ? 25.611  17.817  -6.567  1.00 117.21 ? 34  LEU A CD2 1 
ATOM   82   N N   . ALA A 1 20  ? 24.772  22.489  -4.452  1.00 124.97 ? 35  ALA A N   1 
ATOM   83   C CA  . ALA A 1 20  ? 24.585  23.883  -4.836  1.00 124.12 ? 35  ALA A CA  1 
ATOM   84   C C   . ALA A 1 20  ? 25.886  24.670  -4.731  1.00 142.25 ? 35  ALA A C   1 
ATOM   85   O O   . ALA A 1 20  ? 26.281  25.365  -5.669  1.00 146.54 ? 35  ALA A O   1 
ATOM   86   C CB  . ALA A 1 20  ? 23.510  24.525  -3.975  1.00 124.61 ? 35  ALA A CB  1 
ATOM   87   N N   . LEU A 1 21  ? 26.546  24.554  -3.582  1.00 117.97 ? 36  LEU A N   1 
ATOM   88   C CA  . LEU A 1 21  ? 27.820  25.226  -3.346  1.00 136.77 ? 36  LEU A CA  1 
ATOM   89   C C   . LEU A 1 21  ? 28.880  24.798  -4.358  1.00 143.00 ? 36  LEU A C   1 
ATOM   90   O O   . LEU A 1 21  ? 29.712  25.603  -4.776  1.00 148.80 ? 36  LEU A O   1 
ATOM   91   C CB  . LEU A 1 21  ? 28.321  24.935  -1.928  1.00 126.08 ? 36  LEU A CB  1 
ATOM   92   C CG  . LEU A 1 21  ? 27.857  25.805  -0.755  1.00 125.01 ? 36  LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 21  ? 26.352  25.732  -0.541  1.00 127.28 ? 36  LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 21  ? 28.595  25.377  0.497   1.00 121.58 ? 36  LEU A CD2 1 
ATOM   95   N N   . LEU A 1 22  ? 28.842  23.526  -4.745  1.00 140.50 ? 37  LEU A N   1 
ATOM   96   C CA  . LEU A 1 22  ? 29.813  22.969  -5.681  1.00 135.82 ? 37  LEU A CA  1 
ATOM   97   C C   . LEU A 1 22  ? 29.718  23.626  -7.055  1.00 137.29 ? 37  LEU A C   1 
ATOM   98   O O   . LEU A 1 22  ? 30.728  23.830  -7.728  1.00 135.47 ? 37  LEU A O   1 
ATOM   99   C CB  . LEU A 1 22  ? 29.607  21.461  -5.816  1.00 131.88 ? 37  LEU A CB  1 
ATOM   100  C CG  . LEU A 1 22  ? 30.820  20.562  -5.576  1.00 125.69 ? 37  LEU A CG  1 
ATOM   101  C CD1 . LEU A 1 22  ? 30.429  19.112  -5.790  1.00 127.68 ? 37  LEU A CD1 1 
ATOM   102  C CD2 . LEU A 1 22  ? 31.979  20.951  -6.480  1.00 123.32 ? 37  LEU A CD2 1 
ATOM   103  N N   . SER A 1 23  ? 28.498  23.957  -7.463  1.00 139.59 ? 38  SER A N   1 
ATOM   104  C CA  . SER A 1 23  ? 28.266  24.577  -8.763  1.00 145.76 ? 38  SER A CA  1 
ATOM   105  C C   . SER A 1 23  ? 28.635  26.059  -8.767  1.00 143.52 ? 38  SER A C   1 
ATOM   106  O O   . SER A 1 23  ? 28.993  26.614  -9.807  1.00 143.18 ? 38  SER A O   1 
ATOM   107  C CB  . SER A 1 23  ? 26.807  24.398  -9.183  1.00 150.18 ? 38  SER A CB  1 
ATOM   108  O OG  . SER A 1 23  ? 25.930  24.961  -8.224  1.00 150.34 ? 38  SER A OG  1 
ATOM   109  N N   . THR A 1 24  ? 28.544  26.696  -7.605  1.00 143.77 ? 39  THR A N   1 
ATOM   110  C CA  . THR A 1 24  ? 28.868  28.112  -7.484  1.00 149.45 ? 39  THR A CA  1 
ATOM   111  C C   . THR A 1 24  ? 30.369  28.350  -7.617  1.00 150.92 ? 39  THR A C   1 
ATOM   112  O O   . THR A 1 24  ? 30.805  29.258  -8.326  1.00 151.07 ? 39  THR A O   1 
ATOM   113  C CB  . THR A 1 24  ? 28.386  28.685  -6.133  1.00 141.71 ? 39  THR A CB  1 
ATOM   114  O OG1 . THR A 1 24  ? 26.961  28.567  -6.042  1.00 141.38 ? 39  THR A OG1 1 
ATOM   115  C CG2 . THR A 1 24  ? 28.778  30.149  -5.999  1.00 139.16 ? 39  THR A CG2 1 
ATOM   116  N N   . HIS A 1 25  ? 31.155  27.520  -6.939  1.00 144.56 ? 40  HIS A N   1 
ATOM   117  C CA  . HIS A 1 25  ? 32.604  27.694  -6.900  1.00 145.68 ? 40  HIS A CA  1 
ATOM   118  C C   . HIS A 1 25  ? 33.334  26.853  -7.948  1.00 148.06 ? 40  HIS A C   1 
ATOM   119  O O   . HIS A 1 25  ? 34.460  26.409  -7.719  1.00 143.10 ? 40  HIS A O   1 
ATOM   120  C CB  . HIS A 1 25  ? 33.140  27.375  -5.502  1.00 145.46 ? 40  HIS A CB  1 
ATOM   121  C CG  . HIS A 1 25  ? 32.571  28.245  -4.423  1.00 155.19 ? 40  HIS A CG  1 
ATOM   122  N ND1 . HIS A 1 25  ? 33.143  29.447  -4.057  1.00 159.65 ? 40  HIS A ND1 1 
ATOM   123  C CD2 . HIS A 1 25  ? 31.488  28.088  -3.629  1.00 155.05 ? 40  HIS A CD2 1 
ATOM   124  C CE1 . HIS A 1 25  ? 32.434  29.990  -3.086  1.00 156.16 ? 40  HIS A CE1 1 
ATOM   125  N NE2 . HIS A 1 25  ? 31.423  29.188  -2.805  1.00 154.07 ? 40  HIS A NE2 1 
ATOM   126  N N   . ARG A 1 26  ? 32.693  26.645  -9.095  1.00 154.95 ? 41  ARG A N   1 
ATOM   127  C CA  . ARG A 1 26  ? 33.288  25.887  -10.194 1.00 156.19 ? 41  ARG A CA  1 
ATOM   128  C C   . ARG A 1 26  ? 34.585  26.515  -10.688 1.00 152.13 ? 41  ARG A C   1 
ATOM   129  O O   . ARG A 1 26  ? 35.666  25.945  -10.530 1.00 145.08 ? 41  ARG A O   1 
ATOM   130  C CB  . ARG A 1 26  ? 32.320  25.804  -11.372 1.00 165.77 ? 41  ARG A CB  1 
ATOM   131  C CG  . ARG A 1 26  ? 31.210  24.784  -11.239 1.00 169.49 ? 41  ARG A CG  1 
ATOM   132  C CD  . ARG A 1 26  ? 30.493  24.655  -12.573 1.00 179.25 ? 41  ARG A CD  1 
ATOM   133  N NE  . ARG A 1 26  ? 29.305  23.812  -12.507 1.00 180.71 ? 41  ARG A NE  1 
ATOM   134  C CZ  . ARG A 1 26  ? 28.586  23.461  -13.568 1.00 184.62 ? 41  ARG A CZ  1 
ATOM   135  N NH1 . ARG A 1 26  ? 28.939  23.877  -14.777 1.00 190.28 ? 41  ARG A NH1 1 
ATOM   136  N NH2 . ARG A 1 26  ? 27.516  22.692  -13.422 1.00 181.95 ? 41  ARG A NH2 1 
ATOM   137  N N   . THR A 1 27  ? 34.454  27.690  -11.296 1.00 158.09 ? 42  THR A N   1 
ATOM   138  C CA  . THR A 1 27  ? 35.570  28.403  -11.907 1.00 161.03 ? 42  THR A CA  1 
ATOM   139  C C   . THR A 1 27  ? 36.740  28.594  -10.944 1.00 156.15 ? 42  THR A C   1 
ATOM   140  O O   . THR A 1 27  ? 37.902  28.558  -11.350 1.00 152.55 ? 42  THR A O   1 
ATOM   141  C CB  . THR A 1 27  ? 35.119  29.789  -12.412 1.00 168.20 ? 42  THR A CB  1 
ATOM   142  O OG1 . THR A 1 27  ? 33.826  29.681  -13.020 1.00 174.75 ? 42  THR A OG1 1 
ATOM   143  C CG2 . THR A 1 27  ? 36.112  30.344  -13.421 1.00 173.02 ? 42  THR A CG2 1 
ATOM   144  N N   . LEU A 1 28  ? 36.420  28.789  -9.669  1.00 155.40 ? 43  LEU A N   1 
ATOM   145  C CA  . LEU A 1 28  ? 37.422  29.023  -8.635  1.00 152.22 ? 43  LEU A CA  1 
ATOM   146  C C   . LEU A 1 28  ? 38.376  27.836  -8.494  1.00 149.74 ? 43  LEU A C   1 
ATOM   147  O O   . LEU A 1 28  ? 39.594  28.010  -8.419  1.00 153.22 ? 43  LEU A O   1 
ATOM   148  C CB  . LEU A 1 28  ? 36.727  29.319  -7.301  1.00 149.77 ? 43  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 28  ? 37.513  30.009  -6.183  1.00 149.10 ? 43  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 28  ? 36.606  30.974  -5.425  1.00 151.69 ? 43  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 28  ? 38.124  28.988  -5.232  1.00 135.11 ? 43  LEU A CD2 1 
ATOM   152  N N   . LEU A 1 29  ? 37.815  26.631  -8.471  1.00 144.56 ? 44  LEU A N   1 
ATOM   153  C CA  . LEU A 1 29  ? 38.601  25.410  -8.320  1.00 145.25 ? 44  LEU A CA  1 
ATOM   154  C C   . LEU A 1 29  ? 39.319  25.023  -9.615  1.00 151.01 ? 44  LEU A C   1 
ATOM   155  O O   . LEU A 1 29  ? 40.330  24.318  -9.587  1.00 145.52 ? 44  LEU A O   1 
ATOM   156  C CB  . LEU A 1 29  ? 37.696  24.261  -7.863  1.00 140.16 ? 44  LEU A CB  1 
ATOM   157  C CG  . LEU A 1 29  ? 36.929  24.474  -6.553  1.00 139.06 ? 44  LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 29  ? 35.671  23.623  -6.506  1.00 131.15 ? 44  LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 29  ? 37.819  24.154  -5.370  1.00 142.88 ? 44  LEU A CD2 1 
ATOM   160  N N   . ILE A 1 30  ? 38.792  25.496  -10.742 1.00 151.91 ? 45  ILE A N   1 
ATOM   161  C CA  . ILE A 1 30  ? 39.299  25.152  -12.074 1.00 158.85 ? 45  ILE A CA  1 
ATOM   162  C C   . ILE A 1 30  ? 40.789  25.462  -12.273 1.00 167.71 ? 45  ILE A C   1 
ATOM   163  O O   . ILE A 1 30  ? 41.482  24.757  -13.011 1.00 171.05 ? 45  ILE A O   1 
ATOM   164  C CB  . ILE A 1 30  ? 38.438  25.833  -13.183 1.00 153.67 ? 45  ILE A CB  1 
ATOM   165  C CG1 . ILE A 1 30  ? 37.424  24.841  -13.757 1.00 152.75 ? 45  ILE A CG1 1 
ATOM   166  C CG2 . ILE A 1 30  ? 39.298  26.415  -14.299 1.00 154.58 ? 45  ILE A CG2 1 
ATOM   167  C CD1 . ILE A 1 30  ? 36.567  25.416  -14.863 1.00 154.16 ? 45  ILE A CD1 1 
ATOM   168  N N   . ALA A 1 31  ? 41.262  26.494  -11.576 1.00 171.92 ? 46  ALA A N   1 
ATOM   169  C CA  . ALA A 1 31  ? 42.617  27.050  -11.705 1.00 178.50 ? 46  ALA A CA  1 
ATOM   170  C C   . ALA A 1 31  ? 43.744  26.118  -12.177 1.00 187.74 ? 46  ALA A C   1 
ATOM   171  O O   . ALA A 1 31  ? 43.977  25.980  -13.379 1.00 193.72 ? 46  ALA A O   1 
ATOM   172  C CB  . ALA A 1 31  ? 43.020  27.739  -10.404 1.00 171.64 ? 46  ALA A CB  1 
ATOM   173  N N   . ASN A 1 32  ? 44.438  25.497  -11.224 1.00 186.51 ? 47  ASN A N   1 
ATOM   174  C CA  . ASN A 1 32  ? 45.657  24.732  -11.503 1.00 184.70 ? 47  ASN A CA  1 
ATOM   175  C C   . ASN A 1 32  ? 45.510  23.658  -12.583 1.00 190.66 ? 47  ASN A C   1 
ATOM   176  O O   . ASN A 1 32  ? 44.843  22.644  -12.379 1.00 190.63 ? 47  ASN A O   1 
ATOM   177  C CB  . ASN A 1 32  ? 46.206  24.109  -10.214 1.00 167.96 ? 47  ASN A CB  1 
ATOM   178  C CG  . ASN A 1 32  ? 47.608  23.550  -10.384 1.00 160.37 ? 47  ASN A CG  1 
ATOM   179  O OD1 . ASN A 1 32  ? 48.312  23.885  -11.337 1.00 165.11 ? 47  ASN A OD1 1 
ATOM   180  N ND2 . ASN A 1 32  ? 48.023  22.700  -9.452  1.00 149.67 ? 47  ASN A ND2 1 
ATOM   181  N N   . GLU A 1 33  ? 46.148  23.892  -13.727 1.00 196.72 ? 48  GLU A N   1 
ATOM   182  C CA  . GLU A 1 33  ? 46.086  22.967  -14.856 1.00 197.46 ? 48  GLU A CA  1 
ATOM   183  C C   . GLU A 1 33  ? 47.215  21.939  -14.820 1.00 195.83 ? 48  GLU A C   1 
ATOM   184  O O   . GLU A 1 33  ? 47.170  20.932  -15.527 1.00 197.40 ? 48  GLU A O   1 
ATOM   185  C CB  . GLU A 1 33  ? 46.110  23.734  -16.181 1.00 205.89 ? 48  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 33  ? 44.860  24.561  -16.442 1.00 204.55 ? 48  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 33  ? 43.626  23.704  -16.654 1.00 197.93 ? 48  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 33  ? 43.773  22.536  -17.075 1.00 194.24 ? 48  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 33  ? 42.507  24.196  -16.399 1.00 195.47 ? 48  GLU A OE2 1 
ATOM   190  N N   . THR A 1 34  ? 48.228  22.202  -14.000 1.00 190.76 ? 49  THR A N   1 
ATOM   191  C CA  . THR A 1 34  ? 49.304  21.244  -13.781 1.00 179.98 ? 49  THR A CA  1 
ATOM   192  C C   . THR A 1 34  ? 48.752  20.077  -12.974 1.00 164.20 ? 49  THR A C   1 
ATOM   193  O O   . THR A 1 34  ? 49.189  18.935  -13.121 1.00 163.23 ? 49  THR A O   1 
ATOM   194  C CB  . THR A 1 34  ? 50.474  21.881  -13.006 1.00 179.71 ? 49  THR A CB  1 
ATOM   195  O OG1 . THR A 1 34  ? 50.842  23.123  -13.619 1.00 186.28 ? 49  THR A OG1 1 
ATOM   196  C CG2 . THR A 1 34  ? 51.680  20.949  -12.987 1.00 177.32 ? 49  THR A CG2 1 
ATOM   197  N N   . LEU A 1 35  ? 47.774  20.384  -12.127 1.00 154.04 ? 50  LEU A N   1 
ATOM   198  C CA  . LEU A 1 35  ? 47.154  19.399  -11.251 1.00 143.86 ? 50  LEU A CA  1 
ATOM   199  C C   . LEU A 1 35  ? 46.457  18.288  -12.034 1.00 139.51 ? 50  LEU A C   1 
ATOM   200  O O   . LEU A 1 35  ? 45.581  18.547  -12.861 1.00 134.54 ? 50  LEU A O   1 
ATOM   201  C CB  . LEU A 1 35  ? 46.163  20.089  -10.309 1.00 133.65 ? 50  LEU A CB  1 
ATOM   202  C CG  . LEU A 1 35  ? 45.581  19.264  -9.161  1.00 130.90 ? 50  LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 35  ? 46.695  18.706  -8.296  1.00 126.42 ? 50  LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 35  ? 44.633  20.113  -8.329  1.00 127.75 ? 50  LEU A CD2 1 
ATOM   205  N N   . ARG A 1 36  ? 46.860  17.050  -11.764 1.00 136.08 ? 51  ARG A N   1 
ATOM   206  C CA  . ARG A 1 36  ? 46.256  15.881  -12.393 1.00 137.63 ? 51  ARG A CA  1 
ATOM   207  C C   . ARG A 1 36  ? 45.703  14.937  -11.333 1.00 132.62 ? 51  ARG A C   1 
ATOM   208  O O   . ARG A 1 36  ? 46.450  14.397  -10.516 1.00 128.05 ? 51  ARG A O   1 
ATOM   209  C CB  . ARG A 1 36  ? 47.284  15.144  -13.252 1.00 143.04 ? 51  ARG A CB  1 
ATOM   210  C CG  . ARG A 1 36  ? 47.829  15.951  -14.418 1.00 150.91 ? 51  ARG A CG  1 
ATOM   211  C CD  . ARG A 1 36  ? 46.742  16.268  -15.433 1.00 152.49 ? 51  ARG A CD  1 
ATOM   212  N NE  . ARG A 1 36  ? 47.294  16.503  -16.764 1.00 160.42 ? 51  ARG A NE  1 
ATOM   213  C CZ  . ARG A 1 36  ? 47.625  17.699  -17.241 1.00 163.41 ? 51  ARG A CZ  1 
ATOM   214  N NH1 . ARG A 1 36  ? 47.457  18.784  -16.497 1.00 162.78 ? 51  ARG A NH1 1 
ATOM   215  N NH2 . ARG A 1 36  ? 48.122  17.811  -18.466 1.00 167.67 ? 51  ARG A NH2 1 
ATOM   216  N N   . ILE A 1 37  ? 44.389  14.740  -11.348 1.00 131.83 ? 52  ILE A N   1 
ATOM   217  C CA  . ILE A 1 37  ? 43.746  13.866  -10.377 1.00 129.90 ? 52  ILE A CA  1 
ATOM   218  C C   . ILE A 1 37  ? 42.961  12.755  -11.065 1.00 123.58 ? 52  ILE A C   1 
ATOM   219  O O   . ILE A 1 37  ? 42.193  13.018  -11.991 1.00 116.80 ? 52  ILE A O   1 
ATOM   220  C CB  . ILE A 1 37  ? 42.792  14.649  -9.464  1.00 128.86 ? 52  ILE A CB  1 
ATOM   221  C CG1 . ILE A 1 37  ? 43.109  16.143  -9.519  1.00 128.64 ? 52  ILE A CG1 1 
ATOM   222  C CG2 . ILE A 1 37  ? 42.881  14.129  -8.042  1.00 107.25 ? 52  ILE A CG2 1 
ATOM   223  C CD1 . ILE A 1 37  ? 42.119  16.987  -8.775  1.00 110.60 ? 52  ILE A CD1 1 
ATOM   224  N N   . PRO A 1 38  ? 43.161  11.506  -10.613 1.00 128.21 ? 53  PRO A N   1 
ATOM   225  C CA  . PRO A 1 38  ? 42.474  10.314  -11.125 1.00 125.76 ? 53  PRO A CA  1 
ATOM   226  C C   . PRO A 1 38  ? 40.956  10.477  -11.246 1.00 120.95 ? 53  PRO A C   1 
ATOM   227  O O   . PRO A 1 38  ? 40.295  10.915  -10.303 1.00 110.60 ? 53  PRO A O   1 
ATOM   228  C CB  . PRO A 1 38  ? 42.827  9.230   -10.090 1.00 125.16 ? 53  PRO A CB  1 
ATOM   229  C CG  . PRO A 1 38  ? 43.567  9.944   -8.971  1.00 128.61 ? 53  PRO A CG  1 
ATOM   230  C CD  . PRO A 1 38  ? 44.165  11.151  -9.599  1.00 129.40 ? 53  PRO A CD  1 
ATOM   231  N N   . VAL A 1 39  ? 40.421  10.136  -12.417 1.00 105.97 ? 54  VAL A N   1 
ATOM   232  C CA  . VAL A 1 39  ? 38.982  10.179  -12.663 1.00 105.79 ? 54  VAL A CA  1 
ATOM   233  C C   . VAL A 1 39  ? 38.512  8.877   -13.306 1.00 113.35 ? 54  VAL A C   1 
ATOM   234  O O   . VAL A 1 39  ? 38.956  8.526   -14.400 1.00 120.87 ? 54  VAL A O   1 
ATOM   235  C CB  . VAL A 1 39  ? 38.594  11.356  -13.580 1.00 105.46 ? 54  VAL A CB  1 
ATOM   236  C CG1 . VAL A 1 39  ? 37.099  11.336  -13.862 1.00 95.46  ? 54  VAL A CG1 1 
ATOM   237  C CG2 . VAL A 1 39  ? 39.005  12.677  -12.951 1.00 104.97 ? 54  VAL A CG2 1 
ATOM   238  N N   . PRO A 1 40  ? 37.611  8.153   -12.621 1.00 108.95 ? 55  PRO A N   1 
ATOM   239  C CA  . PRO A 1 40  ? 37.111  6.843   -13.058 1.00 101.33 ? 55  PRO A CA  1 
ATOM   240  C C   . PRO A 1 40  ? 36.454  6.879   -14.436 1.00 98.99  ? 55  PRO A C   1 
ATOM   241  O O   . PRO A 1 40  ? 35.851  7.887   -14.800 1.00 94.01  ? 55  PRO A O   1 
ATOM   242  C CB  . PRO A 1 40  ? 36.065  6.500   -11.993 1.00 102.02 ? 55  PRO A CB  1 
ATOM   243  C CG  . PRO A 1 40  ? 36.499  7.251   -10.790 1.00 104.42 ? 55  PRO A CG  1 
ATOM   244  C CD  . PRO A 1 40  ? 37.062  8.538   -11.309 1.00 108.99 ? 55  PRO A CD  1 
ATOM   245  N N   . VAL A 1 41  ? 36.571  5.784   -15.183 1.00 100.02 ? 56  VAL A N   1 
ATOM   246  C CA  . VAL A 1 41  ? 35.999  5.691   -16.524 1.00 99.01  ? 56  VAL A CA  1 
ATOM   247  C C   . VAL A 1 41  ? 34.601  5.075   -16.514 1.00 98.44  ? 56  VAL A C   1 
ATOM   248  O O   . VAL A 1 41  ? 33.933  5.008   -17.547 1.00 97.29  ? 56  VAL A O   1 
ATOM   249  C CB  . VAL A 1 41  ? 36.907  4.880   -17.475 1.00 104.98 ? 56  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 41  ? 37.952  5.783   -18.110 1.00 102.82 ? 56  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 41  ? 37.561  3.722   -16.732 1.00 102.86 ? 56  VAL A CG2 1 
ATOM   252  N N   . HIS A 1 42  ? 34.167  4.622   -15.343 1.00 101.33 ? 57  HIS A N   1 
ATOM   253  C CA  . HIS A 1 42  ? 32.820  4.086   -15.189 1.00 103.49 ? 57  HIS A CA  1 
ATOM   254  C C   . HIS A 1 42  ? 32.038  4.865   -14.135 1.00 97.12  ? 57  HIS A C   1 
ATOM   255  O O   . HIS A 1 42  ? 32.577  5.763   -13.489 1.00 95.00  ? 57  HIS A O   1 
ATOM   256  C CB  . HIS A 1 42  ? 32.860  2.594   -14.846 1.00 109.88 ? 57  HIS A CB  1 
ATOM   257  C CG  . HIS A 1 42  ? 33.619  2.276   -13.596 1.00 111.60 ? 57  HIS A CG  1 
ATOM   258  N ND1 . HIS A 1 42  ? 33.093  2.470   -12.335 1.00 107.55 ? 57  HIS A ND1 1 
ATOM   259  C CD2 . HIS A 1 42  ? 34.860  1.770   -13.411 1.00 111.39 ? 57  HIS A CD2 1 
ATOM   260  C CE1 . HIS A 1 42  ? 33.981  2.101   -11.430 1.00 108.17 ? 57  HIS A CE1 1 
ATOM   261  N NE2 . HIS A 1 42  ? 35.062  1.671   -12.055 1.00 108.98 ? 57  HIS A NE2 1 
ATOM   262  N N   . LYS A 1 43  ? 30.766  4.521   -13.963 1.00 92.48  ? 58  LYS A N   1 
ATOM   263  C CA  . LYS A 1 43  ? 29.914  5.257   -13.037 1.00 95.78  ? 58  LYS A CA  1 
ATOM   264  C C   . LYS A 1 43  ? 29.450  4.415   -11.851 1.00 93.48  ? 58  LYS A C   1 
ATOM   265  O O   . LYS A 1 43  ? 28.423  4.704   -11.235 1.00 91.38  ? 58  LYS A O   1 
ATOM   266  C CB  . LYS A 1 43  ? 28.729  5.878   -13.780 1.00 110.49 ? 58  LYS A CB  1 
ATOM   267  C CG  . LYS A 1 43  ? 29.163  6.812   -14.898 1.00 120.21 ? 58  LYS A CG  1 
ATOM   268  C CD  . LYS A 1 43  ? 27.983  7.417   -15.635 1.00 126.94 ? 58  LYS A CD  1 
ATOM   269  C CE  . LYS A 1 43  ? 28.456  8.316   -16.767 1.00 133.55 ? 58  LYS A CE  1 
ATOM   270  N NZ  . LYS A 1 43  ? 27.327  8.945   -17.505 1.00 139.10 ? 58  LYS A NZ  1 
ATOM   271  N N   . ASN A 1 44  ? 30.218  3.373   -11.541 1.00 97.87  ? 59  ASN A N   1 
ATOM   272  C CA  . ASN A 1 44  ? 30.041  2.636   -10.299 1.00 98.48  ? 59  ASN A CA  1 
ATOM   273  C C   . ASN A 1 44  ? 30.740  3.410   -9.189  1.00 92.90  ? 59  ASN A C   1 
ATOM   274  O O   . ASN A 1 44  ? 31.818  3.026   -8.733  1.00 90.24  ? 59  ASN A O   1 
ATOM   275  C CB  . ASN A 1 44  ? 30.625  1.226   -10.411 1.00 107.51 ? 59  ASN A CB  1 
ATOM   276  C CG  . ASN A 1 44  ? 30.055  0.444   -11.586 1.00 112.70 ? 59  ASN A CG  1 
ATOM   277  O OD1 . ASN A 1 44  ? 30.785  -0.248  -12.299 1.00 103.13 ? 59  ASN A OD1 1 
ATOM   278  N ND2 . ASN A 1 44  ? 28.746  0.554   -11.795 1.00 114.23 ? 59  ASN A ND2 1 
ATOM   279  N N   . HIS A 1 45  ? 30.119  4.512   -8.775  1.00 88.97  ? 60  HIS A N   1 
ATOM   280  C CA  . HIS A 1 45  ? 30.725  5.465   -7.849  1.00 84.71  ? 60  HIS A CA  1 
ATOM   281  C C   . HIS A 1 45  ? 31.129  4.842   -6.513  1.00 83.49  ? 60  HIS A C   1 
ATOM   282  O O   . HIS A 1 45  ? 32.167  5.187   -5.945  1.00 90.46  ? 60  HIS A O   1 
ATOM   283  C CB  . HIS A 1 45  ? 29.763  6.631   -7.592  1.00 88.66  ? 60  HIS A CB  1 
ATOM   284  C CG  . HIS A 1 45  ? 29.235  7.273   -8.839  1.00 98.97  ? 60  HIS A CG  1 
ATOM   285  N ND1 . HIS A 1 45  ? 29.959  8.195   -9.568  1.00 101.90 ? 60  HIS A ND1 1 
ATOM   286  C CD2 . HIS A 1 45  ? 28.048  7.143   -9.475  1.00 102.39 ? 60  HIS A CD2 1 
ATOM   287  C CE1 . HIS A 1 45  ? 29.244  8.593   -10.603 1.00 101.41 ? 60  HIS A CE1 1 
ATOM   288  N NE2 . HIS A 1 45  ? 28.080  7.971   -10.573 1.00 107.86 ? 60  HIS A NE2 1 
ATOM   289  N N   . GLN A 1 46  ? 30.303  3.926   -6.017  1.00 75.67  ? 61  GLN A N   1 
ATOM   290  C CA  . GLN A 1 46  ? 30.481  3.369   -4.678  1.00 82.74  ? 61  GLN A CA  1 
ATOM   291  C C   . GLN A 1 46  ? 31.760  2.543   -4.531  1.00 86.00  ? 61  GLN A C   1 
ATOM   292  O O   . GLN A 1 46  ? 32.159  2.201   -3.419  1.00 84.80  ? 61  GLN A O   1 
ATOM   293  C CB  . GLN A 1 46  ? 29.253  2.548   -4.274  1.00 91.45  ? 61  GLN A CB  1 
ATOM   294  C CG  . GLN A 1 46  ? 27.941  3.295   -4.459  1.00 92.34  ? 61  GLN A CG  1 
ATOM   295  C CD  . GLN A 1 46  ? 26.749  2.548   -3.887  1.00 104.70 ? 61  GLN A CD  1 
ATOM   296  O OE1 . GLN A 1 46  ? 26.901  1.648   -3.059  1.00 110.41 ? 61  GLN A OE1 1 
ATOM   297  N NE2 . GLN A 1 46  ? 25.552  2.920   -4.330  1.00 108.86 ? 61  GLN A NE2 1 
ATOM   298  N N   . LEU A 1 47  ? 32.399  2.229   -5.652  1.00 88.37  ? 62  LEU A N   1 
ATOM   299  C CA  . LEU A 1 47  ? 33.697  1.568   -5.630  1.00 86.82  ? 62  LEU A CA  1 
ATOM   300  C C   . LEU A 1 47  ? 34.814  2.584   -5.420  1.00 85.03  ? 62  LEU A C   1 
ATOM   301  O O   . LEU A 1 47  ? 35.883  2.247   -4.910  1.00 83.10  ? 62  LEU A O   1 
ATOM   302  C CB  . LEU A 1 47  ? 33.941  0.819   -6.942  1.00 85.59  ? 62  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 47  ? 33.223  -0.509  -7.187  1.00 93.31  ? 62  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 47  ? 33.544  -1.031  -8.578  1.00 84.23  ? 62  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 47  ? 33.633  -1.520  -6.138  1.00 94.54  ? 62  LEU A CD2 1 
ATOM   306  N N   . CYS A 1 48  ? 34.555  3.832   -5.800  1.00 81.64  ? 63  CYS A N   1 
ATOM   307  C CA  . CYS A 1 48  ? 35.613  4.832   -5.916  1.00 82.98  ? 63  CYS A CA  1 
ATOM   308  C C   . CYS A 1 48  ? 35.576  5.928   -4.853  1.00 85.35  ? 63  CYS A C   1 
ATOM   309  O O   . CYS A 1 48  ? 36.107  7.016   -5.069  1.00 91.82  ? 63  CYS A O   1 
ATOM   310  C CB  . CYS A 1 48  ? 35.569  5.469   -7.309  1.00 85.11  ? 63  CYS A CB  1 
ATOM   311  S SG  . CYS A 1 48  ? 35.342  4.286   -8.658  1.00 100.74 ? 63  CYS A SG  1 
ATOM   312  N N   . THR A 1 49  ? 34.966  5.648   -3.706  1.00 81.53  ? 64  THR A N   1 
ATOM   313  C CA  . THR A 1 49  ? 34.876  6.647   -2.644  1.00 79.02  ? 64  THR A CA  1 
ATOM   314  C C   . THR A 1 49  ? 36.248  6.997   -2.074  1.00 83.81  ? 64  THR A C   1 
ATOM   315  O O   . THR A 1 49  ? 36.472  8.120   -1.626  1.00 91.89  ? 64  THR A O   1 
ATOM   316  C CB  . THR A 1 49  ? 33.950  6.195   -1.503  1.00 69.39  ? 64  THR A CB  1 
ATOM   317  O OG1 . THR A 1 49  ? 34.544  5.092   -0.813  1.00 76.33  ? 64  THR A OG1 1 
ATOM   318  C CG2 . THR A 1 49  ? 32.601  5.774   -2.057  1.00 74.54  ? 64  THR A CG2 1 
ATOM   319  N N   . GLU A 1 50  ? 37.166  6.035   -2.098  1.00 88.45  ? 65  GLU A N   1 
ATOM   320  C CA  . GLU A 1 50  ? 38.526  6.282   -1.637  1.00 96.51  ? 65  GLU A CA  1 
ATOM   321  C C   . GLU A 1 50  ? 39.256  7.178   -2.633  1.00 94.52  ? 65  GLU A C   1 
ATOM   322  O O   . GLU A 1 50  ? 39.980  8.090   -2.240  1.00 87.95  ? 65  GLU A O   1 
ATOM   323  C CB  . GLU A 1 50  ? 39.288  4.968   -1.441  1.00 106.66 ? 65  GLU A CB  1 
ATOM   324  C CG  . GLU A 1 50  ? 40.605  5.116   -0.684  1.00 120.50 ? 65  GLU A CG  1 
ATOM   325  C CD  . GLU A 1 50  ? 41.411  3.828   -0.645  1.00 128.46 ? 65  GLU A CD  1 
ATOM   326  O OE1 . GLU A 1 50  ? 41.313  3.032   -1.604  1.00 131.59 ? 65  GLU A OE1 1 
ATOM   327  O OE2 . GLU A 1 50  ? 42.139  3.610   0.347   1.00 126.94 ? 65  GLU A OE2 1 
ATOM   328  N N   . GLU A 1 51  ? 39.051  6.921   -3.922  1.00 94.19  ? 66  GLU A N   1 
ATOM   329  C CA  . GLU A 1 51  ? 39.667  7.723   -4.976  1.00 89.00  ? 66  GLU A CA  1 
ATOM   330  C C   . GLU A 1 51  ? 39.116  9.147   -5.007  1.00 87.59  ? 66  GLU A C   1 
ATOM   331  O O   . GLU A 1 51  ? 39.869  10.110  -5.161  1.00 87.66  ? 66  GLU A O   1 
ATOM   332  C CB  . GLU A 1 51  ? 39.477  7.063   -6.346  1.00 89.45  ? 66  GLU A CB  1 
ATOM   333  C CG  . GLU A 1 51  ? 40.446  5.927   -6.646  1.00 100.15 ? 66  GLU A CG  1 
ATOM   334  C CD  . GLU A 1 51  ? 40.243  4.723   -5.747  1.00 109.52 ? 66  GLU A CD  1 
ATOM   335  O OE1 . GLU A 1 51  ? 39.165  4.095   -5.821  1.00 110.83 ? 66  GLU A OE1 1 
ATOM   336  O OE2 . GLU A 1 51  ? 41.163  4.409   -4.963  1.00 112.67 ? 66  GLU A OE2 1 
ATOM   337  N N   . ILE A 1 52  ? 37.801  9.272   -4.862  1.00 88.88  ? 67  ILE A N   1 
ATOM   338  C CA  . ILE A 1 52  ? 37.136  10.570  -4.913  1.00 88.35  ? 67  ILE A CA  1 
ATOM   339  C C   . ILE A 1 52  ? 37.602  11.515  -3.803  1.00 85.38  ? 67  ILE A C   1 
ATOM   340  O O   . ILE A 1 52  ? 37.944  12.669  -4.062  1.00 83.57  ? 67  ILE A O   1 
ATOM   341  C CB  . ILE A 1 52  ? 35.601  10.408  -4.853  1.00 84.81  ? 67  ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 52  ? 35.077  9.791   -6.153  1.00 88.52  ? 67  ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 52  ? 34.934  11.744  -4.624  1.00 82.30  ? 67  ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 52  ? 33.619  9.388   -6.090  1.00 94.90  ? 67  ILE A CD1 1 
ATOM   345  N N   . PHE A 1 53  ? 37.629  11.019  -2.571  1.00 81.61  ? 68  PHE A N   1 
ATOM   346  C CA  . PHE A 1 53  ? 38.019  11.848  -1.436  1.00 86.83  ? 68  PHE A CA  1 
ATOM   347  C C   . PHE A 1 53  ? 39.530  12.063  -1.348  1.00 92.94  ? 68  PHE A C   1 
ATOM   348  O O   . PHE A 1 53  ? 39.997  12.902  -0.578  1.00 92.92  ? 68  PHE A O   1 
ATOM   349  C CB  . PHE A 1 53  ? 37.462  11.278  -0.132  1.00 86.15  ? 68  PHE A CB  1 
ATOM   350  C CG  . PHE A 1 53  ? 35.976  11.458  0.016   1.00 88.58  ? 68  PHE A CG  1 
ATOM   351  C CD1 . PHE A 1 53  ? 35.434  12.722  0.197   1.00 78.48  ? 68  PHE A CD1 1 
ATOM   352  C CD2 . PHE A 1 53  ? 35.121  10.368  -0.020  1.00 88.95  ? 68  PHE A CD2 1 
ATOM   353  C CE1 . PHE A 1 53  ? 34.069  12.894  0.334   1.00 83.25  ? 68  PHE A CE1 1 
ATOM   354  C CE2 . PHE A 1 53  ? 33.759  10.535  0.118   1.00 90.34  ? 68  PHE A CE2 1 
ATOM   355  C CZ  . PHE A 1 53  ? 33.230  11.799  0.295   1.00 90.35  ? 68  PHE A CZ  1 
ATOM   356  N N   . GLN A 1 54  ? 40.289  11.299  -2.130  1.00 98.34  ? 69  GLN A N   1 
ATOM   357  C CA  . GLN A 1 54  ? 41.711  11.575  -2.305  1.00 94.59  ? 69  GLN A CA  1 
ATOM   358  C C   . GLN A 1 54  ? 41.854  12.758  -3.250  1.00 94.98  ? 69  GLN A C   1 
ATOM   359  O O   . GLN A 1 54  ? 42.754  13.585  -3.100  1.00 100.62 ? 69  GLN A O   1 
ATOM   360  C CB  . GLN A 1 54  ? 42.446  10.357  -2.868  1.00 92.47  ? 69  GLN A CB  1 
ATOM   361  C CG  . GLN A 1 54  ? 42.839  9.323   -1.825  1.00 101.83 ? 69  GLN A CG  1 
ATOM   362  C CD  . GLN A 1 54  ? 43.334  8.025   -2.440  1.00 111.80 ? 69  GLN A CD  1 
ATOM   363  O OE1 . GLN A 1 54  ? 43.279  7.836   -3.656  1.00 113.38 ? 69  GLN A OE1 1 
ATOM   364  N NE2 . GLN A 1 54  ? 43.820  7.120   -1.596  1.00 112.37 ? 69  GLN A NE2 1 
ATOM   365  N N   . GLY A 1 55  ? 40.953  12.831  -4.225  1.00 89.26  ? 70  GLY A N   1 
ATOM   366  C CA  . GLY A 1 55  ? 40.923  13.942  -5.156  1.00 83.76  ? 70  GLY A CA  1 
ATOM   367  C C   . GLY A 1 55  ? 40.389  15.203  -4.509  1.00 96.76  ? 70  GLY A C   1 
ATOM   368  O O   . GLY A 1 55  ? 40.801  16.311  -4.850  1.00 102.07 ? 70  GLY A O   1 
ATOM   369  N N   . ILE A 1 56  ? 39.459  15.026  -3.576  1.00 101.15 ? 71  ILE A N   1 
ATOM   370  C CA  . ILE A 1 56  ? 38.931  16.132  -2.789  1.00 96.71  ? 71  ILE A CA  1 
ATOM   371  C C   . ILE A 1 56  ? 40.046  16.747  -1.950  1.00 97.57  ? 71  ILE A C   1 
ATOM   372  O O   . ILE A 1 56  ? 40.218  17.968  -1.921  1.00 102.54 ? 71  ILE A O   1 
ATOM   373  C CB  . ILE A 1 56  ? 37.799  15.657  -1.856  1.00 100.78 ? 71  ILE A CB  1 
ATOM   374  C CG1 . ILE A 1 56  ? 36.573  15.243  -2.674  1.00 101.03 ? 71  ILE A CG1 1 
ATOM   375  C CG2 . ILE A 1 56  ? 37.426  16.744  -0.864  1.00 103.14 ? 71  ILE A CG2 1 
ATOM   376  C CD1 . ILE A 1 56  ? 36.008  16.363  -3.511  1.00 102.73 ? 71  ILE A CD1 1 
ATOM   377  N N   . GLY A 1 57  ? 40.815  15.887  -1.287  1.00 96.28  ? 72  GLY A N   1 
ATOM   378  C CA  . GLY A 1 57  ? 41.875  16.327  -0.399  1.00 86.44  ? 72  GLY A CA  1 
ATOM   379  C C   . GLY A 1 57  ? 43.083  16.930  -1.091  1.00 88.53  ? 72  GLY A C   1 
ATOM   380  O O   . GLY A 1 57  ? 43.940  17.521  -0.435  1.00 95.34  ? 72  GLY A O   1 
ATOM   381  N N   . THR A 1 58  ? 43.165  16.777  -2.410  1.00 130.37 ? 73  THR A N   1 
ATOM   382  C CA  . THR A 1 58  ? 44.244  17.396  -3.172  1.00 127.06 ? 73  THR A CA  1 
ATOM   383  C C   . THR A 1 58  ? 43.790  18.729  -3.758  1.00 123.77 ? 73  THR A C   1 
ATOM   384  O O   . THR A 1 58  ? 44.441  19.288  -4.643  1.00 132.14 ? 73  THR A O   1 
ATOM   385  C CB  . THR A 1 58  ? 44.778  16.471  -4.284  1.00 124.54 ? 73  THR A CB  1 
ATOM   386  O OG1 . THR A 1 58  ? 43.691  16.013  -5.097  1.00 127.68 ? 73  THR A OG1 1 
ATOM   387  C CG2 . THR A 1 58  ? 45.491  15.273  -3.678  1.00 124.79 ? 73  THR A CG2 1 
ATOM   388  N N   . LEU A 1 59  ? 42.662  19.224  -3.255  1.00 117.63 ? 74  LEU A N   1 
ATOM   389  C CA  . LEU A 1 59  ? 42.165  20.550  -3.607  1.00 121.94 ? 74  LEU A CA  1 
ATOM   390  C C   . LEU A 1 59  ? 42.197  21.446  -2.379  1.00 121.48 ? 74  LEU A C   1 
ATOM   391  O O   . LEU A 1 59  ? 42.614  22.602  -2.451  1.00 112.93 ? 74  LEU A O   1 
ATOM   392  C CB  . LEU A 1 59  ? 40.735  20.472  -4.146  1.00 118.82 ? 74  LEU A CB  1 
ATOM   393  C CG  . LEU A 1 59  ? 40.549  20.460  -5.665  1.00 116.05 ? 74  LEU A CG  1 
ATOM   394  C CD1 . LEU A 1 59  ? 41.233  19.255  -6.258  1.00 118.21 ? 74  LEU A CD1 1 
ATOM   395  C CD2 . LEU A 1 59  ? 39.072  20.467  -6.021  1.00 110.83 ? 74  LEU A CD2 1 
ATOM   396  N N   . GLU A 1 60  ? 41.756  20.893  -1.252  1.00 120.20 ? 75  GLU A N   1 
ATOM   397  C CA  . GLU A 1 60  ? 41.757  21.601  0.024   1.00 125.77 ? 75  GLU A CA  1 
ATOM   398  C C   . GLU A 1 60  ? 43.170  22.036  0.405   1.00 132.32 ? 75  GLU A C   1 
ATOM   399  O O   . GLU A 1 60  ? 43.360  23.044  1.086   1.00 138.35 ? 75  GLU A O   1 
ATOM   400  C CB  . GLU A 1 60  ? 41.159  20.711  1.118   1.00 123.72 ? 75  GLU A CB  1 
ATOM   401  C CG  . GLU A 1 60  ? 40.954  21.401  2.457   1.00 128.55 ? 75  GLU A CG  1 
ATOM   402  C CD  . GLU A 1 60  ? 40.292  20.499  3.483   1.00 133.09 ? 75  GLU A CD  1 
ATOM   403  O OE1 . GLU A 1 60  ? 39.910  19.366  3.122   1.00 134.22 ? 75  GLU A OE1 1 
ATOM   404  O OE2 . GLU A 1 60  ? 40.155  20.922  4.651   1.00 136.07 ? 75  GLU A OE2 1 
ATOM   405  N N   . SER A 1 61  ? 44.160  21.271  -0.045  1.00 129.93 ? 76  SER A N   1 
ATOM   406  C CA  . SER A 1 61  ? 45.558  21.594  0.213   1.00 132.08 ? 76  SER A CA  1 
ATOM   407  C C   . SER A 1 61  ? 46.152  22.464  -0.893  1.00 129.78 ? 76  SER A C   1 
ATOM   408  O O   . SER A 1 61  ? 47.356  22.727  -0.903  1.00 134.57 ? 76  SER A O   1 
ATOM   409  C CB  . SER A 1 61  ? 46.383  20.315  0.378   1.00 132.17 ? 76  SER A CB  1 
ATOM   410  O OG  . SER A 1 61  ? 46.341  19.521  -0.795  1.00 129.01 ? 76  SER A OG  1 
ATOM   411  N N   . GLN A 1 62  ? 45.309  22.910  -1.821  1.00 126.85 ? 77  GLN A N   1 
ATOM   412  C CA  . GLN A 1 62  ? 45.768  23.759  -2.921  1.00 132.99 ? 77  GLN A CA  1 
ATOM   413  C C   . GLN A 1 62  ? 44.897  24.997  -3.139  1.00 130.99 ? 77  GLN A C   1 
ATOM   414  O O   . GLN A 1 62  ? 45.380  26.021  -3.621  1.00 137.95 ? 77  GLN A O   1 
ATOM   415  C CB  . GLN A 1 62  ? 45.881  22.961  -4.226  1.00 135.58 ? 77  GLN A CB  1 
ATOM   416  C CG  . GLN A 1 62  ? 47.085  22.034  -4.294  1.00 142.91 ? 77  GLN A CG  1 
ATOM   417  C CD  . GLN A 1 62  ? 47.420  21.619  -5.714  1.00 144.17 ? 77  GLN A CD  1 
ATOM   418  O OE1 . GLN A 1 62  ? 46.753  22.025  -6.666  1.00 140.57 ? 77  GLN A OE1 1 
ATOM   419  N NE2 . GLN A 1 62  ? 48.462  20.811  -5.864  1.00 151.14 ? 77  GLN A NE2 1 
ATOM   420  N N   . THR A 1 63  ? 43.617  24.902  -2.792  1.00 125.69 ? 78  THR A N   1 
ATOM   421  C CA  . THR A 1 63  ? 42.711  26.040  -2.931  1.00 125.11 ? 78  THR A CA  1 
ATOM   422  C C   . THR A 1 63  ? 42.676  26.875  -1.654  1.00 130.98 ? 78  THR A C   1 
ATOM   423  O O   . THR A 1 63  ? 43.130  26.432  -0.600  1.00 133.87 ? 78  THR A O   1 
ATOM   424  C CB  . THR A 1 63  ? 41.280  25.596  -3.284  1.00 117.65 ? 78  THR A CB  1 
ATOM   425  O OG1 . THR A 1 63  ? 40.707  24.891  -2.177  1.00 126.43 ? 78  THR A OG1 1 
ATOM   426  C CG2 . THR A 1 63  ? 41.291  24.699  -4.510  1.00 112.27 ? 78  THR A CG2 1 
ATOM   427  N N   . VAL A 1 64  ? 42.138  28.086  -1.757  1.00 128.83 ? 79  VAL A N   1 
ATOM   428  C CA  . VAL A 1 64  ? 42.066  28.989  -0.614  1.00 126.83 ? 79  VAL A CA  1 
ATOM   429  C C   . VAL A 1 64  ? 40.710  28.893  0.075   1.00 126.78 ? 79  VAL A C   1 
ATOM   430  O O   . VAL A 1 64  ? 39.683  29.236  -0.509  1.00 110.43 ? 79  VAL A O   1 
ATOM   431  C CB  . VAL A 1 64  ? 42.318  30.453  -1.034  1.00 126.66 ? 79  VAL A CB  1 
ATOM   432  C CG1 . VAL A 1 64  ? 42.188  31.382  0.163   1.00 123.90 ? 79  VAL A CG1 1 
ATOM   433  C CG2 . VAL A 1 64  ? 43.691  30.591  -1.672  1.00 127.67 ? 79  VAL A CG2 1 
ATOM   434  N N   . GLN A 1 65  ? 40.714  28.423  1.319   1.00 134.94 ? 80  GLN A N   1 
ATOM   435  C CA  . GLN A 1 65  ? 39.486  28.304  2.099   1.00 138.86 ? 80  GLN A CA  1 
ATOM   436  C C   . GLN A 1 65  ? 39.051  29.671  2.629   1.00 135.61 ? 80  GLN A C   1 
ATOM   437  O O   . GLN A 1 65  ? 39.090  29.917  3.834   1.00 140.62 ? 80  GLN A O   1 
ATOM   438  C CB  . GLN A 1 65  ? 39.687  27.331  3.266   1.00 149.29 ? 80  GLN A CB  1 
ATOM   439  C CG  . GLN A 1 65  ? 40.322  26.000  2.881   1.00 153.06 ? 80  GLN A CG  1 
ATOM   440  C CD  . GLN A 1 65  ? 40.641  25.136  4.089   1.00 164.86 ? 80  GLN A CD  1 
ATOM   441  O OE1 . GLN A 1 65  ? 40.020  25.270  5.145   1.00 171.58 ? 80  GLN A OE1 1 
ATOM   442  N NE2 . GLN A 1 65  ? 41.618  24.249  3.941   1.00 167.25 ? 80  GLN A NE2 1 
ATOM   443  N N   . GLY A 1 66  ? 38.629  30.552  1.725   1.00 132.19 ? 81  GLY A N   1 
ATOM   444  C CA  . GLY A 1 66  ? 38.300  31.920  2.086   1.00 139.42 ? 81  GLY A CA  1 
ATOM   445  C C   . GLY A 1 66  ? 36.823  32.181  2.312   1.00 144.55 ? 81  GLY A C   1 
ATOM   446  O O   . GLY A 1 66  ? 36.364  32.232  3.452   1.00 154.93 ? 81  GLY A O   1 
ATOM   447  N N   . GLY A 1 67  ? 36.079  32.355  1.224   1.00 137.24 ? 82  GLY A N   1 
ATOM   448  C CA  . GLY A 1 67  ? 34.655  32.631  1.311   1.00 132.30 ? 82  GLY A CA  1 
ATOM   449  C C   . GLY A 1 67  ? 33.842  31.411  1.702   1.00 126.89 ? 82  GLY A C   1 
ATOM   450  O O   . GLY A 1 67  ? 34.118  30.768  2.715   1.00 128.40 ? 82  GLY A O   1 
ATOM   451  N N   . THR A 1 68  ? 32.827  31.092  0.904   1.00 120.36 ? 83  THR A N   1 
ATOM   452  C CA  . THR A 1 68  ? 32.036  29.888  1.141   1.00 121.93 ? 83  THR A CA  1 
ATOM   453  C C   . THR A 1 68  ? 32.714  28.668  0.526   1.00 120.47 ? 83  THR A C   1 
ATOM   454  O O   . THR A 1 68  ? 32.150  27.573  0.509   1.00 114.22 ? 83  THR A O   1 
ATOM   455  C CB  . THR A 1 68  ? 30.591  30.013  0.614   1.00 117.40 ? 83  THR A CB  1 
ATOM   456  O OG1 . THR A 1 68  ? 30.604  30.485  -0.739  1.00 119.56 ? 83  THR A OG1 1 
ATOM   457  C CG2 . THR A 1 68  ? 29.789  30.977  1.474   1.00 113.17 ? 83  THR A CG2 1 
ATOM   458  N N   . VAL A 1 69  ? 33.927  28.872  0.018   1.00 120.32 ? 84  VAL A N   1 
ATOM   459  C CA  . VAL A 1 69  ? 34.773  27.783  -0.450  1.00 115.32 ? 84  VAL A CA  1 
ATOM   460  C C   . VAL A 1 69  ? 35.078  26.867  0.726   1.00 121.15 ? 84  VAL A C   1 
ATOM   461  O O   . VAL A 1 69  ? 35.200  25.651  0.572   1.00 124.73 ? 84  VAL A O   1 
ATOM   462  C CB  . VAL A 1 69  ? 36.097  28.319  -1.028  1.00 111.85 ? 84  VAL A CB  1 
ATOM   463  C CG1 . VAL A 1 69  ? 36.980  27.180  -1.512  1.00 103.58 ? 84  VAL A CG1 1 
ATOM   464  C CG2 . VAL A 1 69  ? 35.820  29.282  -2.158  1.00 117.18 ? 84  VAL A CG2 1 
ATOM   465  N N   . GLU A 1 70  ? 35.184  27.465  1.907   1.00 102.32 ? 85  GLU A N   1 
ATOM   466  C CA  . GLU A 1 70  ? 35.474  26.718  3.122   1.00 104.41 ? 85  GLU A CA  1 
ATOM   467  C C   . GLU A 1 70  ? 34.290  25.849  3.537   1.00 102.30 ? 85  GLU A C   1 
ATOM   468  O O   . GLU A 1 70  ? 34.474  24.770  4.102   1.00 93.50  ? 85  GLU A O   1 
ATOM   469  C CB  . GLU A 1 70  ? 35.867  27.664  4.261   1.00 101.27 ? 85  GLU A CB  1 
ATOM   470  C CG  . GLU A 1 70  ? 36.449  26.955  5.476   1.00 108.38 ? 85  GLU A CG  1 
ATOM   471  C CD  . GLU A 1 70  ? 36.843  27.913  6.582   1.00 133.43 ? 85  GLU A CD  1 
ATOM   472  O OE1 . GLU A 1 70  ? 37.700  27.541  7.412   1.00 138.69 ? 85  GLU A OE1 1 
ATOM   473  O OE2 . GLU A 1 70  ? 36.294  29.035  6.628   1.00 151.53 ? 85  GLU A OE2 1 
ATOM   474  N N   . ARG A 1 71  ? 33.076  26.317  3.254   1.00 106.55 ? 86  ARG A N   1 
ATOM   475  C CA  . ARG A 1 71  ? 31.876  25.563  3.605   1.00 109.62 ? 86  ARG A CA  1 
ATOM   476  C C   . ARG A 1 71  ? 31.748  24.308  2.744   1.00 99.83  ? 86  ARG A C   1 
ATOM   477  O O   . ARG A 1 71  ? 31.277  23.270  3.211   1.00 92.96  ? 86  ARG A O   1 
ATOM   478  C CB  . ARG A 1 71  ? 30.615  26.427  3.479   1.00 115.56 ? 86  ARG A CB  1 
ATOM   479  C CG  . ARG A 1 71  ? 29.429  25.889  4.275   1.00 120.91 ? 86  ARG A CG  1 
ATOM   480  C CD  . ARG A 1 71  ? 28.100  26.470  3.812   1.00 132.67 ? 86  ARG A CD  1 
ATOM   481  N NE  . ARG A 1 71  ? 28.021  27.919  3.971   1.00 145.63 ? 86  ARG A NE  1 
ATOM   482  C CZ  . ARG A 1 71  ? 26.976  28.651  3.596   1.00 155.20 ? 86  ARG A CZ  1 
ATOM   483  N NH1 . ARG A 1 71  ? 25.923  28.069  3.038   1.00 158.91 ? 86  ARG A NH1 1 
ATOM   484  N NH2 . ARG A 1 71  ? 26.984  29.965  3.777   1.00 157.89 ? 86  ARG A NH2 1 
ATOM   485  N N   . LEU A 1 72  ? 32.177  24.410  1.489   1.00 93.67  ? 87  LEU A N   1 
ATOM   486  C CA  . LEU A 1 72  ? 32.141  23.281  0.567   1.00 98.23  ? 87  LEU A CA  1 
ATOM   487  C C   . LEU A 1 72  ? 33.008  22.125  1.058   1.00 95.77  ? 87  LEU A C   1 
ATOM   488  O O   . LEU A 1 72  ? 32.524  21.008  1.236   1.00 92.91  ? 87  LEU A O   1 
ATOM   489  C CB  . LEU A 1 72  ? 32.586  23.718  -0.832  1.00 102.31 ? 87  LEU A CB  1 
ATOM   490  C CG  . LEU A 1 72  ? 32.782  22.614  -1.877  1.00 103.81 ? 87  LEU A CG  1 
ATOM   491  C CD1 . LEU A 1 72  ? 31.502  21.818  -2.078  1.00 103.18 ? 87  LEU A CD1 1 
ATOM   492  C CD2 . LEU A 1 72  ? 33.263  23.202  -3.195  1.00 105.20 ? 87  LEU A CD2 1 
ATOM   493  N N   . PHE A 1 73  ? 34.289  22.402  1.280   1.00 94.29  ? 88  PHE A N   1 
ATOM   494  C CA  . PHE A 1 73  ? 35.230  21.380  1.727   1.00 83.80  ? 88  PHE A CA  1 
ATOM   495  C C   . PHE A 1 73  ? 34.878  20.827  3.109   1.00 80.56  ? 88  PHE A C   1 
ATOM   496  O O   . PHE A 1 73  ? 35.263  19.710  3.455   1.00 84.44  ? 88  PHE A O   1 
ATOM   497  C CB  . PHE A 1 73  ? 36.659  21.928  1.720   1.00 90.08  ? 88  PHE A CB  1 
ATOM   498  C CG  . PHE A 1 73  ? 37.241  22.098  0.341   1.00 100.93 ? 88  PHE A CG  1 
ATOM   499  C CD1 . PHE A 1 73  ? 37.900  21.047  -0.278  1.00 108.91 ? 88  PHE A CD1 1 
ATOM   500  C CD2 . PHE A 1 73  ? 37.138  23.307  -0.332  1.00 107.12 ? 88  PHE A CD2 1 
ATOM   501  C CE1 . PHE A 1 73  ? 38.441  21.196  -1.540  1.00 113.42 ? 88  PHE A CE1 1 
ATOM   502  C CE2 . PHE A 1 73  ? 37.678  23.460  -1.598  1.00 110.22 ? 88  PHE A CE2 1 
ATOM   503  C CZ  . PHE A 1 73  ? 38.330  22.403  -2.202  1.00 114.13 ? 88  PHE A CZ  1 
ATOM   504  N N   . LYS A 1 74  ? 34.147  21.610  3.898   1.00 84.53  ? 89  LYS A N   1 
ATOM   505  C CA  . LYS A 1 74  ? 33.709  21.159  5.214   1.00 88.08  ? 89  LYS A CA  1 
ATOM   506  C C   . LYS A 1 74  ? 32.514  20.221  5.078   1.00 83.83  ? 89  LYS A C   1 
ATOM   507  O O   . LYS A 1 74  ? 32.396  19.238  5.811   1.00 78.26  ? 89  LYS A O   1 
ATOM   508  C CB  . LYS A 1 74  ? 33.349  22.347  6.106   1.00 98.70  ? 89  LYS A CB  1 
ATOM   509  C CG  . LYS A 1 74  ? 33.442  22.047  7.595   1.00 116.77 ? 89  LYS A CG  1 
ATOM   510  C CD  . LYS A 1 74  ? 32.368  22.777  8.389   1.00 136.39 ? 89  LYS A CD  1 
ATOM   511  C CE  . LYS A 1 74  ? 30.993  22.169  8.146   1.00 139.78 ? 89  LYS A CE  1 
ATOM   512  N NZ  . LYS A 1 74  ? 29.948  22.759  9.028   1.00 145.43 ? 89  LYS A NZ  1 
ATOM   513  N N   . ASN A 1 75  ? 31.627  20.534  4.138   1.00 83.61  ? 90  ASN A N   1 
ATOM   514  C CA  . ASN A 1 75  ? 30.494  19.668  3.837   1.00 78.80  ? 90  ASN A CA  1 
ATOM   515  C C   . ASN A 1 75  ? 30.966  18.340  3.259   1.00 76.65  ? 90  ASN A C   1 
ATOM   516  O O   . ASN A 1 75  ? 30.485  17.278  3.648   1.00 80.67  ? 90  ASN A O   1 
ATOM   517  C CB  . ASN A 1 75  ? 29.534  20.354  2.861   1.00 84.54  ? 90  ASN A CB  1 
ATOM   518  C CG  . ASN A 1 75  ? 28.734  21.467  3.509   1.00 93.00  ? 90  ASN A CG  1 
ATOM   519  O OD1 . ASN A 1 75  ? 28.949  21.810  4.671   1.00 87.78  ? 90  ASN A OD1 1 
ATOM   520  N ND2 . ASN A 1 75  ? 27.805  22.042  2.751   1.00 97.96  ? 90  ASN A ND2 1 
ATOM   521  N N   . LEU A 1 76  ? 31.915  18.414  2.330   1.00 73.51  ? 91  LEU A N   1 
ATOM   522  C CA  . LEU A 1 76  ? 32.508  17.224  1.736   1.00 71.25  ? 91  LEU A CA  1 
ATOM   523  C C   . LEU A 1 76  ? 33.200  16.384  2.805   1.00 65.75  ? 91  LEU A C   1 
ATOM   524  O O   . LEU A 1 76  ? 33.208  15.153  2.734   1.00 63.51  ? 91  LEU A O   1 
ATOM   525  C CB  . LEU A 1 76  ? 33.495  17.611  0.632   1.00 68.98  ? 91  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 76  ? 32.887  18.281  -0.605  1.00 71.79  ? 91  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 76  ? 33.971  18.744  -1.566  1.00 76.14  ? 91  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 76  ? 31.929  17.332  -1.304  1.00 69.82  ? 91  LEU A CD2 1 
ATOM   529  N N   . SER A 1 77  ? 33.768  17.062  3.798   1.00 64.47  ? 92  SER A N   1 
ATOM   530  C CA  . SER A 1 77  ? 34.365  16.400  4.952   1.00 67.26  ? 92  SER A CA  1 
ATOM   531  C C   . SER A 1 77  ? 33.309  15.630  5.736   1.00 69.57  ? 92  SER A C   1 
ATOM   532  O O   . SER A 1 77  ? 33.531  14.492  6.149   1.00 75.46  ? 92  SER A O   1 
ATOM   533  C CB  . SER A 1 77  ? 35.039  17.430  5.862   1.00 73.66  ? 92  SER A CB  1 
ATOM   534  O OG  . SER A 1 77  ? 35.254  16.901  7.159   1.00 84.52  ? 92  SER A OG  1 
ATOM   535  N N   . LEU A 1 78  ? 32.158  16.263  5.933   1.00 68.60  ? 93  LEU A N   1 
ATOM   536  C CA  . LEU A 1 78  ? 31.052  15.644  6.653   1.00 72.29  ? 93  LEU A CA  1 
ATOM   537  C C   . LEU A 1 78  ? 30.417  14.511  5.847   1.00 68.84  ? 93  LEU A C   1 
ATOM   538  O O   . LEU A 1 78  ? 29.960  13.519  6.413   1.00 67.79  ? 93  LEU A O   1 
ATOM   539  C CB  . LEU A 1 78  ? 29.999  16.693  7.023   1.00 70.70  ? 93  LEU A CB  1 
ATOM   540  C CG  . LEU A 1 78  ? 30.388  17.703  8.109   1.00 78.87  ? 93  LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 78  ? 29.357  18.823  8.219   1.00 85.48  ? 93  LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 78  ? 30.549  16.990  9.436   1.00 68.18  ? 93  LEU A CD2 1 
ATOM   543  N N   . ILE A 1 79  ? 30.387  14.665  4.526   1.00 57.95  ? 94  ILE A N   1 
ATOM   544  C CA  . ILE A 1 79  ? 29.893  13.610  3.643   1.00 69.14  ? 94  ILE A CA  1 
ATOM   545  C C   . ILE A 1 79  ? 30.838  12.411  3.690   1.00 70.40  ? 94  ILE A C   1 
ATOM   546  O O   . ILE A 1 79  ? 30.396  11.262  3.699   1.00 71.09  ? 94  ILE A O   1 
ATOM   547  C CB  . ILE A 1 79  ? 29.728  14.114  2.185   1.00 67.81  ? 94  ILE A CB  1 
ATOM   548  C CG1 . ILE A 1 79  ? 28.576  15.117  2.097   1.00 63.36  ? 94  ILE A CG1 1 
ATOM   549  C CG2 . ILE A 1 79  ? 29.461  12.962  1.230   1.00 53.60  ? 94  ILE A CG2 1 
ATOM   550  C CD1 . ILE A 1 79  ? 28.295  15.597  0.692   1.00 61.77  ? 94  ILE A CD1 1 
ATOM   551  N N   . LYS A 1 80  ? 32.138  12.689  3.734   1.00 66.94  ? 95  LYS A N   1 
ATOM   552  C CA  . LYS A 1 80  ? 33.139  11.637  3.865   1.00 63.21  ? 95  LYS A CA  1 
ATOM   553  C C   . LYS A 1 80  ? 32.939  10.861  5.161   1.00 70.53  ? 95  LYS A C   1 
ATOM   554  O O   . LYS A 1 80  ? 33.047  9.633   5.184   1.00 75.36  ? 95  LYS A O   1 
ATOM   555  C CB  . LYS A 1 80  ? 34.554  12.220  3.813   1.00 60.44  ? 95  LYS A CB  1 
ATOM   556  C CG  . LYS A 1 80  ? 35.640  11.235  4.222   1.00 62.41  ? 95  LYS A CG  1 
ATOM   557  C CD  . LYS A 1 80  ? 37.029  11.761  3.903   1.00 72.79  ? 95  LYS A CD  1 
ATOM   558  C CE  . LYS A 1 80  ? 38.104  10.811  4.414   1.00 75.39  ? 95  LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 80  ? 37.875  9.402   3.978   1.00 74.22  ? 95  LYS A NZ  1 
ATOM   560  N N   . LYS A 1 81  ? 32.637  11.584  6.235   1.00 70.68  ? 96  LYS A N   1 
ATOM   561  C CA  . LYS A 1 81  ? 32.394  10.960  7.529   1.00 70.53  ? 96  LYS A CA  1 
ATOM   562  C C   . LYS A 1 81  ? 31.145  10.084  7.501   1.00 67.51  ? 96  LYS A C   1 
ATOM   563  O O   . LYS A 1 81  ? 31.101  9.040   8.149   1.00 70.00  ? 96  LYS A O   1 
ATOM   564  C CB  . LYS A 1 81  ? 32.285  12.018  8.628   1.00 68.62  ? 96  LYS A CB  1 
ATOM   565  C CG  . LYS A 1 81  ? 33.619  12.632  9.027   1.00 86.31  ? 96  LYS A CG  1 
ATOM   566  C CD  . LYS A 1 81  ? 33.433  13.745  10.048  1.00 102.43 ? 96  LYS A CD  1 
ATOM   567  C CE  . LYS A 1 81  ? 34.757  14.423  10.377  1.00 114.09 ? 96  LYS A CE  1 
ATOM   568  N NZ  . LYS A 1 81  ? 34.562  15.639  11.218  1.00 122.27 ? 96  LYS A NZ  1 
ATOM   569  N N   . TYR A 1 82  ? 30.134  10.506  6.747   1.00 59.08  ? 97  TYR A N   1 
ATOM   570  C CA  . TYR A 1 82  ? 28.932  9.696   6.580   1.00 60.02  ? 97  TYR A CA  1 
ATOM   571  C C   . TYR A 1 82  ? 29.269  8.390   5.872   1.00 71.65  ? 97  TYR A C   1 
ATOM   572  O O   . TYR A 1 82  ? 28.899  7.307   6.330   1.00 68.21  ? 97  TYR A O   1 
ATOM   573  C CB  . TYR A 1 82  ? 27.858  10.450  5.792   1.00 54.49  ? 97  TYR A CB  1 
ATOM   574  C CG  . TYR A 1 82  ? 26.696  9.571   5.383   1.00 60.33  ? 97  TYR A CG  1 
ATOM   575  C CD1 . TYR A 1 82  ? 25.746  9.168   6.313   1.00 60.94  ? 97  TYR A CD1 1 
ATOM   576  C CD2 . TYR A 1 82  ? 26.555  9.135   4.070   1.00 59.00  ? 97  TYR A CD2 1 
ATOM   577  C CE1 . TYR A 1 82  ? 24.684  8.356   5.945   1.00 58.72  ? 97  TYR A CE1 1 
ATOM   578  C CE2 . TYR A 1 82  ? 25.498  8.324   3.695   1.00 59.81  ? 97  TYR A CE2 1 
ATOM   579  C CZ  . TYR A 1 82  ? 24.567  7.938   4.635   1.00 66.68  ? 97  TYR A CZ  1 
ATOM   580  O OH  . TYR A 1 82  ? 23.515  7.133   4.261   1.00 76.49  ? 97  TYR A OH  1 
ATOM   581  N N   . ILE A 1 83  ? 29.980  8.504   4.754   1.00 74.28  ? 98  ILE A N   1 
ATOM   582  C CA  . ILE A 1 83  ? 30.369  7.347   3.956   1.00 63.02  ? 98  ILE A CA  1 
ATOM   583  C C   . ILE A 1 83  ? 31.272  6.399   4.739   1.00 67.08  ? 98  ILE A C   1 
ATOM   584  O O   . ILE A 1 83  ? 31.105  5.180   4.677   1.00 75.29  ? 98  ILE A O   1 
ATOM   585  C CB  . ILE A 1 83  ? 31.052  7.782   2.638   1.00 63.70  ? 98  ILE A CB  1 
ATOM   586  C CG1 . ILE A 1 83  ? 30.043  8.521   1.753   1.00 66.33  ? 98  ILE A CG1 1 
ATOM   587  C CG2 . ILE A 1 83  ? 31.617  6.585   1.898   1.00 69.82  ? 98  ILE A CG2 1 
ATOM   588  C CD1 . ILE A 1 83  ? 30.611  8.990   0.439   1.00 70.97  ? 98  ILE A CD1 1 
ATOM   589  N N   . ASP A 1 84  ? 32.213  6.964   5.491   1.00 60.30  ? 99  ASP A N   1 
ATOM   590  C CA  . ASP A 1 84  ? 33.090  6.169   6.348   1.00 63.06  ? 99  ASP A CA  1 
ATOM   591  C C   . ASP A 1 84  ? 32.278  5.364   7.355   1.00 71.24  ? 99  ASP A C   1 
ATOM   592  O O   . ASP A 1 84  ? 32.618  4.224   7.672   1.00 68.46  ? 99  ASP A O   1 
ATOM   593  C CB  . ASP A 1 84  ? 34.093  7.060   7.087   1.00 55.75  ? 99  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 84  ? 35.187  7.590   6.177   1.00 74.04  ? 99  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 84  ? 35.358  7.045   5.066   1.00 75.40  ? 99  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 84  ? 35.884  8.544   6.581   1.00 71.76  ? 99  ASP A OD2 1 
ATOM   597  N N   . GLY A 1 85  ? 31.205  5.969   7.855   1.00 66.21  ? 100 GLY A N   1 
ATOM   598  C CA  . GLY A 1 85  ? 30.311  5.296   8.777   1.00 62.89  ? 100 GLY A CA  1 
ATOM   599  C C   . GLY A 1 85  ? 29.585  4.139   8.117   1.00 65.07  ? 100 GLY A C   1 
ATOM   600  O O   . GLY A 1 85  ? 29.338  3.112   8.746   1.00 71.07  ? 100 GLY A O   1 
ATOM   601  N N   . GLN A 1 86  ? 29.245  4.304   6.842   1.00 58.66  ? 101 GLN A N   1 
ATOM   602  C CA  . GLN A 1 86  ? 28.560  3.258   6.089   1.00 58.32  ? 101 GLN A CA  1 
ATOM   603  C C   . GLN A 1 86  ? 29.472  2.053   5.875   1.00 61.88  ? 101 GLN A C   1 
ATOM   604  O O   . GLN A 1 86  ? 29.026  0.910   5.941   1.00 60.43  ? 101 GLN A O   1 
ATOM   605  C CB  . GLN A 1 86  ? 28.072  3.791   4.739   1.00 61.82  ? 101 GLN A CB  1 
ATOM   606  C CG  . GLN A 1 86  ? 26.986  4.843   4.839   1.00 63.05  ? 101 GLN A CG  1 
ATOM   607  C CD  . GLN A 1 86  ? 25.694  4.289   5.403   1.00 70.99  ? 101 GLN A CD  1 
ATOM   608  O OE1 . GLN A 1 86  ? 24.928  3.631   4.698   1.00 71.90  ? 101 GLN A OE1 1 
ATOM   609  N NE2 . GLN A 1 86  ? 25.445  4.551   6.683   1.00 67.76  ? 101 GLN A NE2 1 
ATOM   610  N N   . LYS A 1 87  ? 30.750  2.317   5.616   1.00 61.84  ? 102 LYS A N   1 
ATOM   611  C CA  . LYS A 1 87  ? 31.740  1.257   5.445   1.00 69.15  ? 102 LYS A CA  1 
ATOM   612  C C   . LYS A 1 87  ? 32.001  0.529   6.753   1.00 64.70  ? 102 LYS A C   1 
ATOM   613  O O   . LYS A 1 87  ? 32.199  -0.682  6.770   1.00 76.35  ? 102 LYS A O   1 
ATOM   614  C CB  . LYS A 1 87  ? 33.053  1.830   4.919   1.00 77.62  ? 102 LYS A CB  1 
ATOM   615  C CG  . LYS A 1 87  ? 32.992  2.316   3.487   1.00 90.82  ? 102 LYS A CG  1 
ATOM   616  C CD  . LYS A 1 87  ? 34.256  3.069   3.121   1.00 105.26 ? 102 LYS A CD  1 
ATOM   617  C CE  . LYS A 1 87  ? 34.374  3.244   1.621   1.00 111.02 ? 102 LYS A CE  1 
ATOM   618  N NZ  . LYS A 1 87  ? 35.550  4.083   1.244   1.00 114.40 ? 102 LYS A NZ  1 
ATOM   619  N N   . LYS A 1 88  ? 32.018  1.280   7.847   1.00 72.21  ? 103 LYS A N   1 
ATOM   620  C CA  . LYS A 1 88  ? 32.173  0.693   9.167   1.00 71.70  ? 103 LYS A CA  1 
ATOM   621  C C   . LYS A 1 88  ? 31.007  -0.255  9.424   1.00 66.75  ? 103 LYS A C   1 
ATOM   622  O O   . LYS A 1 88  ? 31.165  -1.304  10.043  1.00 73.40  ? 103 LYS A O   1 
ATOM   623  C CB  . LYS A 1 88  ? 32.215  1.797   10.221  1.00 76.51  ? 103 LYS A CB  1 
ATOM   624  C CG  . LYS A 1 88  ? 32.757  1.365   11.569  1.00 96.51  ? 103 LYS A CG  1 
ATOM   625  C CD  . LYS A 1 88  ? 33.054  2.576   12.443  1.00 108.03 ? 103 LYS A CD  1 
ATOM   626  C CE  . LYS A 1 88  ? 33.989  3.557   11.737  1.00 114.13 ? 103 LYS A CE  1 
ATOM   627  N NZ  . LYS A 1 88  ? 34.234  4.797   12.536  1.00 115.52 ? 103 LYS A NZ  1 
ATOM   628  N N   . LYS A 1 89  ? 29.840  0.120   8.910   1.00 67.71  ? 104 LYS A N   1 
ATOM   629  C CA  . LYS A 1 89  ? 28.625  -0.672  9.051   1.00 64.94  ? 104 LYS A CA  1 
ATOM   630  C C   . LYS A 1 89  ? 28.635  -1.946  8.201   1.00 76.40  ? 104 LYS A C   1 
ATOM   631  O O   . LYS A 1 89  ? 27.764  -2.800  8.356   1.00 74.81  ? 104 LYS A O   1 
ATOM   632  C CB  . LYS A 1 89  ? 27.406  0.177   8.683   1.00 76.01  ? 104 LYS A CB  1 
ATOM   633  C CG  . LYS A 1 89  ? 26.593  0.677   9.866   1.00 88.56  ? 104 LYS A CG  1 
ATOM   634  C CD  . LYS A 1 89  ? 27.316  1.723   10.691  1.00 102.77 ? 104 LYS A CD  1 
ATOM   635  C CE  . LYS A 1 89  ? 26.344  2.403   11.642  1.00 106.93 ? 104 LYS A CE  1 
ATOM   636  N NZ  . LYS A 1 89  ? 25.163  2.936   10.904  1.00 101.08 ? 104 LYS A NZ  1 
ATOM   637  N N   . CYS A 1 90  ? 29.612  -2.073  7.308   1.00 56.11  ? 105 CYS A N   1 
ATOM   638  C CA  . CYS A 1 90  ? 29.674  -3.224  6.409   1.00 53.70  ? 105 CYS A CA  1 
ATOM   639  C C   . CYS A 1 90  ? 29.945  -4.541  7.131   1.00 59.39  ? 105 CYS A C   1 
ATOM   640  O O   . CYS A 1 90  ? 29.509  -5.599  6.684   1.00 60.97  ? 105 CYS A O   1 
ATOM   641  C CB  . CYS A 1 90  ? 30.727  -3.013  5.318   1.00 55.90  ? 105 CYS A CB  1 
ATOM   642  S SG  . CYS A 1 90  ? 30.293  -1.803  4.050   1.00 73.80  ? 105 CYS A SG  1 
ATOM   643  N N   . GLY A 1 91  ? 30.666  -4.476  8.245   1.00 56.82  ? 106 GLY A N   1 
ATOM   644  C CA  . GLY A 1 91  ? 31.049  -5.679  8.961   1.00 51.80  ? 106 GLY A CA  1 
ATOM   645  C C   . GLY A 1 91  ? 30.921  -5.599  10.469  1.00 58.66  ? 106 GLY A C   1 
ATOM   646  O O   . GLY A 1 91  ? 31.576  -6.351  11.192  1.00 64.70  ? 106 GLY A O   1 
ATOM   647  N N   . GLU A 1 92  ? 30.080  -4.689  10.947  1.00 65.96  ? 107 GLU A N   1 
ATOM   648  C CA  . GLU A 1 92  ? 29.834  -4.564  12.377  1.00 67.00  ? 107 GLU A CA  1 
ATOM   649  C C   . GLU A 1 92  ? 29.134  -5.799  12.928  1.00 70.80  ? 107 GLU A C   1 
ATOM   650  O O   . GLU A 1 92  ? 29.442  -6.260  14.027  1.00 66.51  ? 107 GLU A O   1 
ATOM   651  C CB  . GLU A 1 92  ? 28.997  -3.320  12.676  1.00 73.94  ? 107 GLU A CB  1 
ATOM   652  C CG  . GLU A 1 92  ? 29.800  -2.035  12.785  1.00 89.65  ? 107 GLU A CG  1 
ATOM   653  C CD  . GLU A 1 92  ? 28.927  -0.835  13.092  1.00 102.27 ? 107 GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 92  ? 27.686  -0.974  13.035  1.00 107.42 ? 107 GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 92  ? 29.478  0.245   13.395  1.00 100.05 ? 107 GLU A OE2 1 
ATOM   656  N N   . GLU A 1 93  ? 28.192  -6.333  12.157  1.00 69.20  ? 108 GLU A N   1 
ATOM   657  C CA  . GLU A 1 93  ? 27.413  -7.486  12.592  1.00 66.40  ? 108 GLU A CA  1 
ATOM   658  C C   . GLU A 1 93  ? 27.745  -8.739  11.795  1.00 65.85  ? 108 GLU A C   1 
ATOM   659  O O   . GLU A 1 93  ? 27.873  -8.692  10.573  1.00 65.32  ? 108 GLU A O   1 
ATOM   660  C CB  . GLU A 1 93  ? 25.915  -7.192  12.484  1.00 64.82  ? 108 GLU A CB  1 
ATOM   661  C CG  . GLU A 1 93  ? 25.412  -6.128  13.440  1.00 71.17  ? 108 GLU A CG  1 
ATOM   662  C CD  . GLU A 1 93  ? 23.907  -5.942  13.363  1.00 70.89  ? 108 GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 93  ? 23.289  -6.454  12.404  1.00 62.18  ? 108 GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 93  ? 23.341  -5.285  14.263  1.00 77.72  ? 108 GLU A OE2 1 
ATOM   665  N N   . ARG A 1 94  ? 27.880  -9.858  12.499  1.00 65.07  ? 109 ARG A N   1 
ATOM   666  C CA  . ARG A 1 94  ? 28.109  -11.149 11.860  1.00 62.56  ? 109 ARG A CA  1 
ATOM   667  C C   . ARG A 1 94  ? 26.889  -12.038 12.069  1.00 61.20  ? 109 ARG A C   1 
ATOM   668  O O   . ARG A 1 94  ? 26.512  -12.328 13.204  1.00 58.26  ? 109 ARG A O   1 
ATOM   669  C CB  . ARG A 1 94  ? 29.357  -11.821 12.435  1.00 63.36  ? 109 ARG A CB  1 
ATOM   670  C CG  . ARG A 1 94  ? 30.638  -11.023 12.253  1.00 64.08  ? 109 ARG A CG  1 
ATOM   671  C CD  . ARG A 1 94  ? 31.825  -11.736 12.882  1.00 71.26  ? 109 ARG A CD  1 
ATOM   672  N NE  . ARG A 1 94  ? 31.622  -11.951 14.312  1.00 92.22  ? 109 ARG A NE  1 
ATOM   673  C CZ  . ARG A 1 94  ? 32.222  -11.256 15.272  1.00 101.27 ? 109 ARG A CZ  1 
ATOM   674  N NH1 . ARG A 1 94  ? 33.087  -10.296 14.967  1.00 107.14 ? 109 ARG A NH1 1 
ATOM   675  N NH2 . ARG A 1 94  ? 31.963  -11.528 16.543  1.00 101.55 ? 109 ARG A NH2 1 
ATOM   676  N N   . ARG A 1 95  ? 26.277  -12.472 10.972  1.00 59.93  ? 110 ARG A N   1 
ATOM   677  C CA  . ARG A 1 95  ? 24.998  -13.169 11.046  1.00 60.57  ? 110 ARG A CA  1 
ATOM   678  C C   . ARG A 1 95  ? 25.031  -14.576 10.451  1.00 65.73  ? 110 ARG A C   1 
ATOM   679  O O   . ARG A 1 95  ? 26.052  -15.012 9.915   1.00 62.02  ? 110 ARG A O   1 
ATOM   680  C CB  . ARG A 1 95  ? 23.903  -12.332 10.379  1.00 62.31  ? 110 ARG A CB  1 
ATOM   681  C CG  . ARG A 1 95  ? 23.598  -11.038 11.113  1.00 65.83  ? 110 ARG A CG  1 
ATOM   682  C CD  . ARG A 1 95  ? 22.487  -10.263 10.435  1.00 62.75  ? 110 ARG A CD  1 
ATOM   683  N NE  . ARG A 1 95  ? 22.006  -9.173  11.278  1.00 63.08  ? 110 ARG A NE  1 
ATOM   684  C CZ  . ARG A 1 95  ? 21.007  -9.292  12.145  1.00 64.61  ? 110 ARG A CZ  1 
ATOM   685  N NH1 . ARG A 1 95  ? 20.382  -10.455 12.278  1.00 63.76  ? 110 ARG A NH1 1 
ATOM   686  N NH2 . ARG A 1 95  ? 20.632  -8.251  12.877  1.00 70.96  ? 110 ARG A NH2 1 
ATOM   687  N N   . ARG A 1 96  ? 23.904  -15.277 10.561  1.00 63.63  ? 111 ARG A N   1 
ATOM   688  C CA  . ARG A 1 96  ? 23.763  -16.630 10.032  1.00 55.11  ? 111 ARG A CA  1 
ATOM   689  C C   . ARG A 1 96  ? 24.022  -16.660 8.532   1.00 63.13  ? 111 ARG A C   1 
ATOM   690  O O   . ARG A 1 96  ? 23.861  -15.648 7.847   1.00 76.34  ? 111 ARG A O   1 
ATOM   691  C CB  . ARG A 1 96  ? 22.363  -17.172 10.331  1.00 64.99  ? 111 ARG A CB  1 
ATOM   692  C CG  . ARG A 1 96  ? 22.016  -17.199 11.815  1.00 76.02  ? 111 ARG A CG  1 
ATOM   693  C CD  . ARG A 1 96  ? 20.538  -17.479 12.049  1.00 76.97  ? 111 ARG A CD  1 
ATOM   694  N NE  . ARG A 1 96  ? 20.245  -17.756 13.455  1.00 77.78  ? 111 ARG A NE  1 
ATOM   695  C CZ  . ARG A 1 96  ? 19.022  -17.957 13.936  1.00 95.98  ? 111 ARG A CZ  1 
ATOM   696  N NH1 . ARG A 1 96  ? 17.975  -17.907 13.124  1.00 106.61 ? 111 ARG A NH1 1 
ATOM   697  N NH2 . ARG A 1 96  ? 18.841  -18.205 15.227  1.00 96.81  ? 111 ARG A NH2 1 
ATOM   698  N N   . VAL A 1 97  ? 24.423  -17.824 8.031   1.00 67.73  ? 112 VAL A N   1 
ATOM   699  C CA  . VAL A 1 97  ? 24.768  -17.985 6.624   1.00 69.48  ? 112 VAL A CA  1 
ATOM   700  C C   . VAL A 1 97  ? 23.597  -17.651 5.701   1.00 62.61  ? 112 VAL A C   1 
ATOM   701  O O   . VAL A 1 97  ? 23.781  -17.006 4.667   1.00 61.15  ? 112 VAL A O   1 
ATOM   702  C CB  . VAL A 1 97  ? 25.295  -19.413 6.350   1.00 75.69  ? 112 VAL A CB  1 
ATOM   703  C CG1 . VAL A 1 97  ? 25.438  -19.668 4.857   1.00 76.52  ? 112 VAL A CG1 1 
ATOM   704  C CG2 . VAL A 1 97  ? 26.626  -19.612 7.056   1.00 79.23  ? 112 VAL A CG2 1 
ATOM   705  N N   . ASN A 1 98  ? 22.396  -18.065 6.093   1.00 54.51  ? 113 ASN A N   1 
ATOM   706  C CA  . ASN A 1 98  ? 21.204  -17.802 5.295   1.00 72.00  ? 113 ASN A CA  1 
ATOM   707  C C   . ASN A 1 98  ? 20.934  -16.315 5.089   1.00 71.52  ? 113 ASN A C   1 
ATOM   708  O O   . ASN A 1 98  ? 20.441  -15.907 4.038   1.00 74.36  ? 113 ASN A O   1 
ATOM   709  C CB  . ASN A 1 98  ? 19.982  -18.498 5.897   1.00 75.98  ? 113 ASN A CB  1 
ATOM   710  C CG  . ASN A 1 98  ? 19.733  -18.098 7.335   1.00 87.84  ? 113 ASN A CG  1 
ATOM   711  O OD1 . ASN A 1 98  ? 20.337  -18.648 8.256   1.00 94.05  ? 113 ASN A OD1 1 
ATOM   712  N ND2 . ASN A 1 98  ? 18.837  -17.138 7.538   1.00 84.62  ? 113 ASN A ND2 1 
ATOM   713  N N   . GLN A 1 99  ? 21.266  -15.508 6.092   1.00 70.23  ? 114 GLN A N   1 
ATOM   714  C CA  . GLN A 1 99  ? 21.094  -14.065 5.991   1.00 71.16  ? 114 GLN A CA  1 
ATOM   715  C C   . GLN A 1 99  ? 22.209  -13.428 5.160   1.00 70.02  ? 114 GLN A C   1 
ATOM   716  O O   . GLN A 1 99  ? 21.989  -12.418 4.491   1.00 66.32  ? 114 GLN A O   1 
ATOM   717  C CB  . GLN A 1 99  ? 21.013  -13.425 7.381   1.00 69.22  ? 114 GLN A CB  1 
ATOM   718  C CG  . GLN A 1 99  ? 19.783  -13.832 8.183   1.00 72.83  ? 114 GLN A CG  1 
ATOM   719  C CD  . GLN A 1 99  ? 19.682  -13.105 9.515   1.00 76.47  ? 114 GLN A CD  1 
ATOM   720  O OE1 . GLN A 1 99  ? 20.601  -13.151 10.334  1.00 89.36  ? 114 GLN A OE1 1 
ATOM   721  N NE2 . GLN A 1 99  ? 18.562  -12.424 9.734   1.00 78.72  ? 114 GLN A NE2 1 
ATOM   722  N N   . PHE A 1 100 ? 23.401  -14.017 5.202   1.00 68.65  ? 115 PHE A N   1 
ATOM   723  C CA  . PHE A 1 100 ? 24.515  -13.533 4.388   1.00 63.13  ? 115 PHE A CA  1 
ATOM   724  C C   . PHE A 1 100 ? 24.231  -13.755 2.910   1.00 66.48  ? 115 PHE A C   1 
ATOM   725  O O   . PHE A 1 100 ? 24.425  -12.858 2.087   1.00 72.22  ? 115 PHE A O   1 
ATOM   726  C CB  . PHE A 1 100 ? 25.826  -14.222 4.782   1.00 57.30  ? 115 PHE A CB  1 
ATOM   727  C CG  . PHE A 1 100 ? 26.968  -13.951 3.836   1.00 66.29  ? 115 PHE A CG  1 
ATOM   728  C CD1 . PHE A 1 100 ? 27.707  -12.782 3.932   1.00 77.65  ? 115 PHE A CD1 1 
ATOM   729  C CD2 . PHE A 1 100 ? 27.312  -14.873 2.859   1.00 66.83  ? 115 PHE A CD2 1 
ATOM   730  C CE1 . PHE A 1 100 ? 28.760  -12.537 3.069   1.00 76.43  ? 115 PHE A CE1 1 
ATOM   731  C CE2 . PHE A 1 100 ? 28.363  -14.631 1.990   1.00 74.41  ? 115 PHE A CE2 1 
ATOM   732  C CZ  . PHE A 1 100 ? 29.087  -13.462 2.095   1.00 70.45  ? 115 PHE A CZ  1 
ATOM   733  N N   . LEU A 1 101 ? 23.766  -14.957 2.586   1.00 61.68  ? 116 LEU A N   1 
ATOM   734  C CA  . LEU A 1 101 ? 23.459  -15.323 1.210   1.00 65.24  ? 116 LEU A CA  1 
ATOM   735  C C   . LEU A 1 101 ? 22.338  -14.459 0.642   1.00 65.15  ? 116 LEU A C   1 
ATOM   736  O O   . LEU A 1 101 ? 22.345  -14.122 -0.541  1.00 67.77  ? 116 LEU A O   1 
ATOM   737  C CB  . LEU A 1 101 ? 23.090  -16.807 1.119   1.00 71.91  ? 116 LEU A CB  1 
ATOM   738  C CG  . LEU A 1 101 ? 24.177  -17.788 1.569   1.00 69.35  ? 116 LEU A CG  1 
ATOM   739  C CD1 . LEU A 1 101 ? 23.709  -19.228 1.428   1.00 71.88  ? 116 LEU A CD1 1 
ATOM   740  C CD2 . LEU A 1 101 ? 25.450  -17.553 0.777   1.00 65.93  ? 116 LEU A CD2 1 
ATOM   741  N N   . ASP A 1 102 ? 21.376  -14.101 1.488   1.00 65.42  ? 117 ASP A N   1 
ATOM   742  C CA  . ASP A 1 102 ? 20.309  -13.187 1.089   1.00 71.34  ? 117 ASP A CA  1 
ATOM   743  C C   . ASP A 1 102 ? 20.885  -11.859 0.611   1.00 77.32  ? 117 ASP A C   1 
ATOM   744  O O   . ASP A 1 102 ? 20.423  -11.288 -0.376  1.00 79.30  ? 117 ASP A O   1 
ATOM   745  C CB  . ASP A 1 102 ? 19.357  -12.937 2.258   1.00 77.85  ? 117 ASP A CB  1 
ATOM   746  C CG  . ASP A 1 102 ? 18.379  -14.073 2.468   1.00 91.28  ? 117 ASP A CG  1 
ATOM   747  O OD1 . ASP A 1 102 ? 17.497  -13.935 3.340   1.00 91.07  ? 117 ASP A OD1 1 
ATOM   748  O OD2 . ASP A 1 102 ? 18.482  -15.096 1.758   1.00 101.35 ? 117 ASP A OD2 1 
ATOM   749  N N   . TYR A 1 103 ? 21.897  -11.376 1.327   1.00 72.54  ? 118 TYR A N   1 
ATOM   750  C CA  . TYR A 1 103 ? 22.556  -10.122 0.992   1.00 72.75  ? 118 TYR A CA  1 
ATOM   751  C C   . TYR A 1 103 ? 23.413  -10.274 -0.262  1.00 75.90  ? 118 TYR A C   1 
ATOM   752  O O   . TYR A 1 103 ? 23.423  -9.394  -1.123  1.00 83.37  ? 118 TYR A O   1 
ATOM   753  C CB  . TYR A 1 103 ? 23.416  -9.639  2.163   1.00 76.49  ? 118 TYR A CB  1 
ATOM   754  C CG  . TYR A 1 103 ? 23.784  -8.176  2.080   1.00 77.62  ? 118 TYR A CG  1 
ATOM   755  C CD1 . TYR A 1 103 ? 23.016  -7.211  2.717   1.00 77.03  ? 118 TYR A CD1 1 
ATOM   756  C CD2 . TYR A 1 103 ? 24.893  -7.759  1.357   1.00 78.66  ? 118 TYR A CD2 1 
ATOM   757  C CE1 . TYR A 1 103 ? 23.344  -5.871  2.641   1.00 77.70  ? 118 TYR A CE1 1 
ATOM   758  C CE2 . TYR A 1 103 ? 25.230  -6.421  1.274   1.00 82.25  ? 118 TYR A CE2 1 
ATOM   759  C CZ  . TYR A 1 103 ? 24.452  -5.482  1.918   1.00 79.92  ? 118 TYR A CZ  1 
ATOM   760  O OH  . TYR A 1 103 ? 24.778  -4.149  1.842   1.00 81.07  ? 118 TYR A OH  1 
ATOM   761  N N   . LEU A 1 104 ? 24.128  -11.390 -0.360  1.00 73.70  ? 119 LEU A N   1 
ATOM   762  C CA  . LEU A 1 104 ? 24.971  -11.663 -1.520  1.00 74.32  ? 119 LEU A CA  1 
ATOM   763  C C   . LEU A 1 104 ? 24.139  -11.758 -2.796  1.00 75.56  ? 119 LEU A C   1 
ATOM   764  O O   . LEU A 1 104 ? 24.516  -11.223 -3.837  1.00 80.74  ? 119 LEU A O   1 
ATOM   765  C CB  . LEU A 1 104 ? 25.764  -12.956 -1.309  1.00 70.58  ? 119 LEU A CB  1 
ATOM   766  C CG  . LEU A 1 104 ? 26.558  -13.477 -2.511  1.00 70.42  ? 119 LEU A CG  1 
ATOM   767  C CD1 . LEU A 1 104 ? 27.607  -12.464 -2.934  1.00 71.27  ? 119 LEU A CD1 1 
ATOM   768  C CD2 . LEU A 1 104 ? 27.199  -14.819 -2.188  1.00 73.07  ? 119 LEU A CD2 1 
ATOM   769  N N   . GLN A 1 105 ? 23.006  -12.443 -2.702  1.00 74.69  ? 120 GLN A N   1 
ATOM   770  C CA  . GLN A 1 105 ? 22.071  -12.556 -3.814  1.00 86.05  ? 120 GLN A CA  1 
ATOM   771  C C   . GLN A 1 105 ? 21.514  -11.182 -4.185  1.00 85.88  ? 120 GLN A C   1 
ATOM   772  O O   . GLN A 1 105 ? 21.372  -10.846 -5.363  1.00 77.48  ? 120 GLN A O   1 
ATOM   773  C CB  . GLN A 1 105 ? 20.933  -13.506 -3.432  1.00 90.58  ? 120 GLN A CB  1 
ATOM   774  C CG  . GLN A 1 105 ? 19.766  -13.521 -4.396  1.00 100.98 ? 120 GLN A CG  1 
ATOM   775  C CD  . GLN A 1 105 ? 18.584  -14.310 -3.865  1.00 110.33 ? 120 GLN A CD  1 
ATOM   776  O OE1 . GLN A 1 105 ? 18.599  -14.792 -2.731  1.00 112.56 ? 120 GLN A OE1 1 
ATOM   777  N NE2 . GLN A 1 105 ? 17.554  -14.453 -4.690  1.00 115.42 ? 120 GLN A NE2 1 
ATOM   778  N N   . GLU A 1 106 ? 21.205  -10.392 -3.163  1.00 81.62  ? 121 GLU A N   1 
ATOM   779  C CA  . GLU A 1 106 ? 20.683  -9.047  -3.350  1.00 73.71  ? 121 GLU A CA  1 
ATOM   780  C C   . GLU A 1 106 ? 21.776  -8.162  -3.941  1.00 78.45  ? 121 GLU A C   1 
ATOM   781  O O   . GLU A 1 106 ? 21.504  -7.265  -4.737  1.00 82.75  ? 121 GLU A O   1 
ATOM   782  C CB  . GLU A 1 106 ? 20.194  -8.494  -2.011  1.00 81.12  ? 121 GLU A CB  1 
ATOM   783  C CG  . GLU A 1 106 ? 19.200  -7.352  -2.109  1.00 98.91  ? 121 GLU A CG  1 
ATOM   784  C CD  . GLU A 1 106 ? 18.499  -7.080  -0.787  1.00 116.17 ? 121 GLU A CD  1 
ATOM   785  O OE1 . GLU A 1 106 ? 18.415  -5.898  -0.389  1.00 124.27 ? 121 GLU A OE1 1 
ATOM   786  O OE2 . GLU A 1 106 ? 18.030  -8.047  -0.148  1.00 118.64 ? 121 GLU A OE2 1 
ATOM   787  N N   . PHE A 1 107 ? 23.018  -8.442  -3.559  1.00 63.29  ? 122 PHE A N   1 
ATOM   788  C CA  . PHE A 1 107 ? 24.181  -7.729  -4.081  1.00 71.31  ? 122 PHE A CA  1 
ATOM   789  C C   . PHE A 1 107 ? 24.357  -7.962  -5.576  1.00 77.79  ? 122 PHE A C   1 
ATOM   790  O O   . PHE A 1 107 ? 24.493  -7.015  -6.353  1.00 82.77  ? 122 PHE A O   1 
ATOM   791  C CB  . PHE A 1 107 ? 25.441  -8.176  -3.335  1.00 75.78  ? 122 PHE A CB  1 
ATOM   792  C CG  . PHE A 1 107 ? 26.730  -7.798  -4.017  1.00 82.47  ? 122 PHE A CG  1 
ATOM   793  C CD1 . PHE A 1 107 ? 27.251  -6.518  -3.894  1.00 81.89  ? 122 PHE A CD1 1 
ATOM   794  C CD2 . PHE A 1 107 ? 27.437  -8.734  -4.758  1.00 84.59  ? 122 PHE A CD2 1 
ATOM   795  C CE1 . PHE A 1 107 ? 28.443  -6.175  -4.511  1.00 88.94  ? 122 PHE A CE1 1 
ATOM   796  C CE2 . PHE A 1 107 ? 28.629  -8.396  -5.375  1.00 86.12  ? 122 PHE A CE2 1 
ATOM   797  C CZ  . PHE A 1 107 ? 29.133  -7.116  -5.251  1.00 90.97  ? 122 PHE A CZ  1 
ATOM   798  N N   . LEU A 1 108 ? 24.367  -9.230  -5.968  1.00 72.62  ? 123 LEU A N   1 
ATOM   799  C CA  . LEU A 1 108 ? 24.553  -9.599  -7.366  1.00 74.43  ? 123 LEU A CA  1 
ATOM   800  C C   . LEU A 1 108 ? 23.394  -9.117  -8.243  1.00 66.60  ? 123 LEU A C   1 
ATOM   801  O O   . LEU A 1 108 ? 23.573  -8.863  -9.436  1.00 62.29  ? 123 LEU A O   1 
ATOM   802  C CB  . LEU A 1 108 ? 24.746  -11.114 -7.493  1.00 69.53  ? 123 LEU A CB  1 
ATOM   803  C CG  . LEU A 1 108 ? 26.074  -11.651 -6.949  1.00 77.28  ? 123 LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 108 ? 26.083  -13.172 -6.920  1.00 75.00  ? 123 LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 108 ? 27.223  -11.133 -7.792  1.00 75.18  ? 123 LEU A CD2 1 
ATOM   806  N N   . GLY A 1 109 ? 22.213  -8.976  -7.646  1.00 72.62  ? 124 GLY A N   1 
ATOM   807  C CA  . GLY A 1 109 ? 21.060  -8.452  -8.357  1.00 78.16  ? 124 GLY A CA  1 
ATOM   808  C C   . GLY A 1 109 ? 21.203  -6.976  -8.692  1.00 78.55  ? 124 GLY A C   1 
ATOM   809  O O   . GLY A 1 109 ? 20.725  -6.515  -9.732  1.00 69.50  ? 124 GLY A O   1 
ATOM   810  N N   . VAL A 1 110 ? 21.865  -6.234  -7.807  1.00 76.66  ? 125 VAL A N   1 
ATOM   811  C CA  . VAL A 1 110 ? 22.101  -4.808  -8.015  1.00 72.62  ? 125 VAL A CA  1 
ATOM   812  C C   . VAL A 1 110 ? 23.106  -4.565  -9.136  1.00 75.85  ? 125 VAL A C   1 
ATOM   813  O O   . VAL A 1 110 ? 22.889  -3.709  -9.994  1.00 86.52  ? 125 VAL A O   1 
ATOM   814  C CB  . VAL A 1 110 ? 22.598  -4.123  -6.725  1.00 71.30  ? 125 VAL A CB  1 
ATOM   815  C CG1 . VAL A 1 110 ? 22.972  -2.676  -6.998  1.00 67.82  ? 125 VAL A CG1 1 
ATOM   816  C CG2 . VAL A 1 110 ? 21.533  -4.202  -5.647  1.00 68.12  ? 125 VAL A CG2 1 
ATOM   817  N N   . MET A 1 111 ? 24.199  -5.325  -9.121  1.00 77.21  ? 126 MET A N   1 
ATOM   818  C CA  . MET A 1 111 ? 25.201  -5.268  -10.183 1.00 76.86  ? 126 MET A CA  1 
ATOM   819  C C   . MET A 1 111 ? 24.556  -5.440  -11.553 1.00 83.94  ? 126 MET A C   1 
ATOM   820  O O   . MET A 1 111 ? 24.814  -4.668  -12.478 1.00 85.67  ? 126 MET A O   1 
ATOM   821  C CB  . MET A 1 111 ? 26.249  -6.365  -9.989  1.00 68.67  ? 126 MET A CB  1 
ATOM   822  C CG  . MET A 1 111 ? 27.284  -6.087  -8.916  1.00 67.08  ? 126 MET A CG  1 
ATOM   823  S SD  . MET A 1 111 ? 28.443  -7.460  -8.741  1.00 128.55 ? 126 MET A SD  1 
ATOM   824  C CE  . MET A 1 111 ? 28.945  -7.709  -10.445 1.00 61.63  ? 126 MET A CE  1 
ATOM   825  N N   . ASN A 1 112 ? 23.718  -6.464  -11.670 1.00 78.11  ? 127 ASN A N   1 
ATOM   826  C CA  . ASN A 1 112 ? 22.995  -6.737  -12.903 1.00 82.88  ? 127 ASN A CA  1 
ATOM   827  C C   . ASN A 1 112 ? 22.040  -5.608  -13.278 1.00 82.53  ? 127 ASN A C   1 
ATOM   828  O O   . ASN A 1 112 ? 21.994  -5.188  -14.434 1.00 85.18  ? 127 ASN A O   1 
ATOM   829  C CB  . ASN A 1 112 ? 22.238  -8.062  -12.789 1.00 95.60  ? 127 ASN A CB  1 
ATOM   830  C CG  . ASN A 1 112 ? 22.808  -9.136  -13.690 1.00 104.10 ? 127 ASN A CG  1 
ATOM   831  O OD1 . ASN A 1 112 ? 23.775  -9.809  -13.338 1.00 108.98 ? 127 ASN A OD1 1 
ATOM   832  N ND2 . ASN A 1 112 ? 22.210  -9.299  -14.864 1.00 106.14 ? 127 ASN A ND2 1 
ATOM   833  N N   . THR A 1 113 ? 21.285  -5.117  -12.299 1.00 75.73  ? 128 THR A N   1 
ATOM   834  C CA  . THR A 1 113 ? 20.344  -4.027  -12.533 1.00 72.00  ? 128 THR A CA  1 
ATOM   835  C C   . THR A 1 113 ? 21.076  -2.761  -12.955 1.00 83.50  ? 128 THR A C   1 
ATOM   836  O O   . THR A 1 113 ? 20.628  -2.037  -13.846 1.00 93.86  ? 128 THR A O   1 
ATOM   837  C CB  . THR A 1 113 ? 19.523  -3.701  -11.270 1.00 83.60  ? 128 THR A CB  1 
ATOM   838  O OG1 . THR A 1 113 ? 19.019  -4.912  -10.694 1.00 85.69  ? 128 THR A OG1 1 
ATOM   839  C CG2 . THR A 1 113 ? 18.363  -2.765  -11.607 1.00 67.38  ? 128 THR A CG2 1 
ATOM   840  N N   . GLU A 1 114 ? 22.211  -2.507  -12.311 1.00 85.91  ? 129 GLU A N   1 
ATOM   841  C CA  . GLU A 1 114 ? 22.976  -1.291  -12.553 1.00 91.22  ? 129 GLU A CA  1 
ATOM   842  C C   . GLU A 1 114 ? 24.224  -1.555  -13.393 1.00 103.28 ? 129 GLU A C   1 
ATOM   843  O O   . GLU A 1 114 ? 25.349  -1.393  -12.918 1.00 98.51  ? 129 GLU A O   1 
ATOM   844  C CB  . GLU A 1 114 ? 23.366  -0.632  -11.225 1.00 85.29  ? 129 GLU A CB  1 
ATOM   845  C CG  . GLU A 1 114 ? 22.213  -0.455  -10.240 1.00 90.95  ? 129 GLU A CG  1 
ATOM   846  C CD  . GLU A 1 114 ? 21.169  0.547   -10.708 1.00 113.44 ? 129 GLU A CD  1 
ATOM   847  O OE1 . GLU A 1 114 ? 21.441  1.306   -11.663 1.00 131.68 ? 129 GLU A OE1 1 
ATOM   848  O OE2 . GLU A 1 114 ? 20.071  0.577   -10.112 1.00 108.38 ? 129 GLU A OE2 1 
ATOM   849  N N   . TRP A 1 115 ? 24.009  -1.959  -14.643 1.00 117.78 ? 130 TRP A N   1 
ATOM   850  C CA  . TRP A 1 115 ? 25.090  -2.178  -15.601 1.00 133.02 ? 130 TRP A CA  1 
ATOM   851  C C   . TRP A 1 115 ? 24.544  -2.359  -17.013 1.00 144.38 ? 130 TRP A C   1 
ATOM   852  O O   . TRP A 1 115 ? 24.226  -1.386  -17.695 1.00 151.18 ? 130 TRP A O   1 
ATOM   853  C CB  . TRP A 1 115 ? 25.937  -3.392  -15.212 1.00 136.86 ? 130 TRP A CB  1 
ATOM   854  C CG  . TRP A 1 115 ? 26.561  -4.089  -16.386 1.00 149.53 ? 130 TRP A CG  1 
ATOM   855  C CD1 . TRP A 1 115 ? 26.211  -5.306  -16.892 1.00 152.57 ? 130 TRP A CD1 1 
ATOM   856  C CD2 . TRP A 1 115 ? 27.638  -3.607  -17.205 1.00 156.80 ? 130 TRP A CD2 1 
ATOM   857  N NE1 . TRP A 1 115 ? 27.005  -5.616  -17.971 1.00 157.42 ? 130 TRP A NE1 1 
ATOM   858  C CE2 . TRP A 1 115 ? 27.885  -4.593  -18.183 1.00 159.29 ? 130 TRP A CE2 1 
ATOM   859  C CE3 . TRP A 1 115 ? 28.413  -2.445  -17.202 1.00 154.80 ? 130 TRP A CE3 1 
ATOM   860  C CZ2 . TRP A 1 115 ? 28.880  -4.446  -19.151 1.00 157.56 ? 130 TRP A CZ2 1 
ATOM   861  C CZ3 . TRP A 1 115 ? 29.399  -2.304  -18.164 1.00 156.61 ? 130 TRP A CZ3 1 
ATOM   862  C CH2 . TRP A 1 115 ? 29.623  -3.300  -19.125 1.00 157.69 ? 130 TRP A CH2 1 
ATOM   863  N N   . ILE B 1 9   ? 35.079  -17.132 -22.060 1.00 190.42 ? 24  ILE B N   1 
ATOM   864  C CA  . ILE B 1 9   ? 34.945  -16.876 -20.630 1.00 185.75 ? 24  ILE B CA  1 
ATOM   865  C C   . ILE B 1 9   ? 34.585  -15.412 -20.371 1.00 182.23 ? 24  ILE B C   1 
ATOM   866  O O   . ILE B 1 9   ? 35.462  -14.584 -20.116 1.00 179.53 ? 24  ILE B O   1 
ATOM   867  C CB  . ILE B 1 9   ? 36.236  -17.241 -19.871 1.00 180.71 ? 24  ILE B CB  1 
ATOM   868  C CG1 . ILE B 1 9   ? 36.738  -18.620 -20.308 1.00 183.38 ? 24  ILE B CG1 1 
ATOM   869  C CG2 . ILE B 1 9   ? 36.005  -17.195 -18.365 1.00 168.06 ? 24  ILE B CG2 1 
ATOM   870  C CD1 . ILE B 1 9   ? 38.055  -19.019 -19.680 1.00 178.80 ? 24  ILE B CD1 1 
ATOM   871  N N   . PRO B 1 10  ? 33.283  -15.092 -20.445 1.00 177.26 ? 25  PRO B N   1 
ATOM   872  C CA  . PRO B 1 10  ? 32.759  -13.729 -20.316 1.00 169.32 ? 25  PRO B CA  1 
ATOM   873  C C   . PRO B 1 10  ? 32.513  -13.331 -18.865 1.00 161.14 ? 25  PRO B C   1 
ATOM   874  O O   . PRO B 1 10  ? 33.099  -13.922 -17.959 1.00 155.40 ? 25  PRO B O   1 
ATOM   875  C CB  . PRO B 1 10  ? 31.430  -13.812 -21.062 1.00 173.09 ? 25  PRO B CB  1 
ATOM   876  C CG  . PRO B 1 10  ? 30.971  -15.205 -20.808 1.00 174.87 ? 25  PRO B CG  1 
ATOM   877  C CD  . PRO B 1 10  ? 32.215  -16.060 -20.755 1.00 178.03 ? 25  PRO B CD  1 
ATOM   878  N N   . THR B 1 11  ? 31.655  -12.334 -18.656 1.00 163.46 ? 26  THR B N   1 
ATOM   879  C CA  . THR B 1 11  ? 31.353  -11.834 -17.317 1.00 158.97 ? 26  THR B CA  1 
ATOM   880  C C   . THR B 1 11  ? 29.865  -11.547 -17.125 1.00 160.46 ? 26  THR B C   1 
ATOM   881  O O   . THR B 1 11  ? 29.264  -11.977 -16.143 1.00 155.63 ? 26  THR B O   1 
ATOM   882  C CB  . THR B 1 11  ? 32.126  -10.533 -17.006 1.00 154.20 ? 26  THR B CB  1 
ATOM   883  O OG1 . THR B 1 11  ? 31.801  -9.536  -17.982 1.00 161.00 ? 26  THR B OG1 1 
ATOM   884  C CG2 . THR B 1 11  ? 33.631  -10.772 -17.011 1.00 148.69 ? 26  THR B CG2 1 
ATOM   885  N N   . SER B 1 12  ? 29.274  -10.823 -18.071 1.00 164.52 ? 27  SER B N   1 
ATOM   886  C CA  . SER B 1 12  ? 27.903  -10.327 -17.930 1.00 162.12 ? 27  SER B CA  1 
ATOM   887  C C   . SER B 1 12  ? 26.844  -11.423 -17.797 1.00 157.90 ? 27  SER B C   1 
ATOM   888  O O   . SER B 1 12  ? 25.695  -11.143 -17.452 1.00 159.80 ? 27  SER B O   1 
ATOM   889  C CB  . SER B 1 12  ? 27.552  -9.398  -19.095 1.00 168.40 ? 27  SER B CB  1 
ATOM   890  O OG  . SER B 1 12  ? 28.453  -8.307  -19.159 1.00 167.09 ? 27  SER B OG  1 
ATOM   891  N N   . ALA B 1 13  ? 27.233  -12.663 -18.073 1.00 148.01 ? 28  ALA B N   1 
ATOM   892  C CA  . ALA B 1 13  ? 26.324  -13.796 -17.943 1.00 141.19 ? 28  ALA B CA  1 
ATOM   893  C C   . ALA B 1 13  ? 26.794  -14.762 -16.858 1.00 135.74 ? 28  ALA B C   1 
ATOM   894  O O   . ALA B 1 13  ? 26.162  -15.791 -16.617 1.00 135.97 ? 28  ALA B O   1 
ATOM   895  C CB  . ALA B 1 13  ? 26.178  -14.516 -19.271 1.00 140.52 ? 28  ALA B CB  1 
ATOM   896  N N   . LEU B 1 14  ? 27.912  -14.427 -16.219 1.00 133.18 ? 29  LEU B N   1 
ATOM   897  C CA  . LEU B 1 14  ? 28.410  -15.186 -15.077 1.00 131.76 ? 29  LEU B CA  1 
ATOM   898  C C   . LEU B 1 14  ? 27.375  -15.136 -13.965 1.00 127.66 ? 29  LEU B C   1 
ATOM   899  O O   . LEU B 1 14  ? 26.937  -16.169 -13.458 1.00 133.17 ? 29  LEU B O   1 
ATOM   900  C CB  . LEU B 1 14  ? 29.715  -14.575 -14.559 1.00 125.55 ? 29  LEU B CB  1 
ATOM   901  C CG  . LEU B 1 14  ? 31.027  -15.364 -14.587 1.00 125.66 ? 29  LEU B CG  1 
ATOM   902  C CD1 . LEU B 1 14  ? 32.145  -14.532 -13.975 1.00 117.66 ? 29  LEU B CD1 1 
ATOM   903  C CD2 . LEU B 1 14  ? 30.883  -16.678 -13.851 1.00 128.25 ? 29  LEU B CD2 1 
ATOM   904  N N   . VAL B 1 15  ? 26.990  -13.914 -13.608 1.00 114.68 ? 30  VAL B N   1 
ATOM   905  C CA  . VAL B 1 15  ? 26.063  -13.652 -12.515 1.00 120.67 ? 30  VAL B CA  1 
ATOM   906  C C   . VAL B 1 15  ? 24.744  -14.405 -12.671 1.00 131.72 ? 30  VAL B C   1 
ATOM   907  O O   . VAL B 1 15  ? 24.209  -14.937 -11.698 1.00 140.76 ? 30  VAL B O   1 
ATOM   908  C CB  . VAL B 1 15  ? 25.764  -12.144 -12.408 1.00 122.28 ? 30  VAL B CB  1 
ATOM   909  C CG1 . VAL B 1 15  ? 25.384  -11.780 -10.987 1.00 116.72 ? 30  VAL B CG1 1 
ATOM   910  C CG2 . VAL B 1 15  ? 26.972  -11.335 -12.849 1.00 122.23 ? 30  VAL B CG2 1 
ATOM   911  N N   . LYS B 1 16  ? 24.229  -14.445 -13.898 1.00 131.00 ? 31  LYS B N   1 
ATOM   912  C CA  . LYS B 1 16  ? 22.967  -15.120 -14.191 1.00 133.85 ? 31  LYS B CA  1 
ATOM   913  C C   . LYS B 1 16  ? 23.034  -16.594 -13.823 1.00 136.49 ? 31  LYS B C   1 
ATOM   914  O O   . LYS B 1 16  ? 22.117  -17.140 -13.208 1.00 136.15 ? 31  LYS B O   1 
ATOM   915  C CB  . LYS B 1 16  ? 22.592  -14.948 -15.666 1.00 142.63 ? 31  LYS B CB  1 
ATOM   916  C CG  . LYS B 1 16  ? 21.219  -15.492 -16.040 1.00 143.80 ? 31  LYS B CG  1 
ATOM   917  C CD  . LYS B 1 16  ? 21.323  -16.746 -16.894 1.00 143.91 ? 31  LYS B CD  1 
ATOM   918  C CE  . LYS B 1 16  ? 19.970  -17.124 -17.476 1.00 148.13 ? 31  LYS B CE  1 
ATOM   919  N NZ  . LYS B 1 16  ? 19.398  -16.022 -18.299 1.00 147.38 ? 31  LYS B NZ  1 
ATOM   920  N N   . GLU B 1 17  ? 24.138  -17.226 -14.199 1.00 140.99 ? 32  GLU B N   1 
ATOM   921  C CA  . GLU B 1 17  ? 24.360  -18.631 -13.904 1.00 143.83 ? 32  GLU B CA  1 
ATOM   922  C C   . GLU B 1 17  ? 24.823  -18.800 -12.461 1.00 129.52 ? 32  GLU B C   1 
ATOM   923  O O   . GLU B 1 17  ? 24.531  -19.811 -11.822 1.00 123.34 ? 32  GLU B O   1 
ATOM   924  C CB  . GLU B 1 17  ? 25.391  -19.210 -14.873 1.00 153.91 ? 32  GLU B CB  1 
ATOM   925  C CG  . GLU B 1 17  ? 25.020  -19.024 -16.338 1.00 166.33 ? 32  GLU B CG  1 
ATOM   926  C CD  . GLU B 1 17  ? 26.138  -19.413 -17.284 1.00 172.12 ? 32  GLU B CD  1 
ATOM   927  O OE1 . GLU B 1 17  ? 25.861  -19.590 -18.489 1.00 179.28 ? 32  GLU B OE1 1 
ATOM   928  O OE2 . GLU B 1 17  ? 27.294  -19.538 -16.826 1.00 168.16 ? 32  GLU B OE2 1 
ATOM   929  N N   . THR B 1 18  ? 25.535  -17.801 -11.948 1.00 123.87 ? 33  THR B N   1 
ATOM   930  C CA  . THR B 1 18  ? 26.008  -17.827 -10.567 1.00 114.67 ? 33  THR B CA  1 
ATOM   931  C C   . THR B 1 18  ? 24.860  -17.710 -9.565  1.00 111.36 ? 33  THR B C   1 
ATOM   932  O O   . THR B 1 18  ? 24.786  -18.484 -8.611  1.00 102.78 ? 33  THR B O   1 
ATOM   933  C CB  . THR B 1 18  ? 27.040  -16.714 -10.295 1.00 105.40 ? 33  THR B CB  1 
ATOM   934  O OG1 . THR B 1 18  ? 28.215  -16.949 -11.081 1.00 108.42 ? 33  THR B OG1 1 
ATOM   935  C CG2 . THR B 1 18  ? 27.423  -16.691 -8.825  1.00 94.50  ? 33  THR B CG2 1 
ATOM   936  N N   . LEU B 1 19  ? 23.970  -16.742 -9.782  1.00 102.31 ? 34  LEU B N   1 
ATOM   937  C CA  . LEU B 1 19  ? 22.798  -16.577 -8.924  1.00 107.60 ? 34  LEU B CA  1 
ATOM   938  C C   . LEU B 1 19  ? 21.929  -17.831 -8.926  1.00 111.92 ? 34  LEU B C   1 
ATOM   939  O O   . LEU B 1 19  ? 21.427  -18.253 -7.882  1.00 116.04 ? 34  LEU B O   1 
ATOM   940  C CB  . LEU B 1 19  ? 21.963  -15.366 -9.354  1.00 110.48 ? 34  LEU B CB  1 
ATOM   941  C CG  . LEU B 1 19  ? 22.275  -14.022 -8.692  1.00 117.93 ? 34  LEU B CG  1 
ATOM   942  C CD1 . LEU B 1 19  ? 21.094  -13.074 -8.825  1.00 124.04 ? 34  LEU B CD1 1 
ATOM   943  C CD2 . LEU B 1 19  ? 22.634  -14.214 -7.231  1.00 119.27 ? 34  LEU B CD2 1 
ATOM   944  N N   . ALA B 1 20  ? 21.759  -18.420 -10.104 1.00 112.76 ? 35  ALA B N   1 
ATOM   945  C CA  . ALA B 1 20  ? 20.986  -19.646 -10.249 1.00 117.47 ? 35  ALA B CA  1 
ATOM   946  C C   . ALA B 1 20  ? 21.604  -20.787 -9.445  1.00 116.06 ? 35  ALA B C   1 
ATOM   947  O O   . ALA B 1 20  ? 20.893  -21.646 -8.922  1.00 118.68 ? 35  ALA B O   1 
ATOM   948  C CB  . ALA B 1 20  ? 20.871  -20.027 -11.717 1.00 117.69 ? 35  ALA B CB  1 
ATOM   949  N N   . LEU B 1 21  ? 22.931  -20.790 -9.351  1.00 111.96 ? 36  LEU B N   1 
ATOM   950  C CA  . LEU B 1 21  ? 23.641  -21.780 -8.547  1.00 110.50 ? 36  LEU B CA  1 
ATOM   951  C C   . LEU B 1 21  ? 23.344  -21.586 -7.063  1.00 113.07 ? 36  LEU B C   1 
ATOM   952  O O   . LEU B 1 21  ? 23.082  -22.548 -6.342  1.00 105.68 ? 36  LEU B O   1 
ATOM   953  C CB  . LEU B 1 21  ? 25.150  -21.697 -8.791  1.00 107.94 ? 36  LEU B CB  1 
ATOM   954  C CG  . LEU B 1 21  ? 25.705  -22.343 -10.063 1.00 111.61 ? 36  LEU B CG  1 
ATOM   955  C CD1 . LEU B 1 21  ? 27.213  -22.139 -10.148 1.00 111.99 ? 36  LEU B CD1 1 
ATOM   956  C CD2 . LEU B 1 21  ? 25.356  -23.821 -10.106 1.00 107.62 ? 36  LEU B CD2 1 
ATOM   957  N N   . LEU B 1 22  ? 23.383  -20.333 -6.617  1.00 114.93 ? 37  LEU B N   1 
ATOM   958  C CA  . LEU B 1 22  ? 23.104  -19.996 -5.225  1.00 112.12 ? 37  LEU B CA  1 
ATOM   959  C C   . LEU B 1 22  ? 21.677  -20.360 -4.819  1.00 122.13 ? 37  LEU B C   1 
ATOM   960  O O   . LEU B 1 22  ? 21.401  -20.612 -3.645  1.00 126.34 ? 37  LEU B O   1 
ATOM   961  C CB  . LEU B 1 22  ? 23.361  -18.509 -4.972  1.00 107.21 ? 37  LEU B CB  1 
ATOM   962  C CG  . LEU B 1 22  ? 24.782  -18.115 -4.560  1.00 104.53 ? 37  LEU B CG  1 
ATOM   963  C CD1 . LEU B 1 22  ? 24.983  -16.619 -4.700  1.00 102.85 ? 37  LEU B CD1 1 
ATOM   964  C CD2 . LEU B 1 22  ? 25.052  -18.549 -3.132  1.00 101.05 ? 37  LEU B CD2 1 
ATOM   965  N N   . SER B 1 23  ? 20.777  -20.391 -5.796  1.00 125.89 ? 38  SER B N   1 
ATOM   966  C CA  . SER B 1 23  ? 19.377  -20.708 -5.545  1.00 123.14 ? 38  SER B CA  1 
ATOM   967  C C   . SER B 1 23  ? 19.185  -22.181 -5.192  1.00 126.76 ? 38  SER B C   1 
ATOM   968  O O   . SER B 1 23  ? 18.192  -22.555 -4.566  1.00 128.90 ? 38  SER B O   1 
ATOM   969  C CB  . SER B 1 23  ? 18.530  -20.346 -6.767  1.00 121.74 ? 38  SER B CB  1 
ATOM   970  O OG  . SER B 1 23  ? 17.160  -20.628 -6.546  1.00 122.12 ? 38  SER B OG  1 
ATOM   971  N N   . THR B 1 24  ? 20.143  -23.012 -5.590  1.00 127.96 ? 39  THR B N   1 
ATOM   972  C CA  . THR B 1 24  ? 20.041  -24.452 -5.381  1.00 136.68 ? 39  THR B CA  1 
ATOM   973  C C   . THR B 1 24  ? 20.821  -24.919 -4.155  1.00 134.80 ? 39  THR B C   1 
ATOM   974  O O   . THR B 1 24  ? 20.277  -25.599 -3.285  1.00 139.89 ? 39  THR B O   1 
ATOM   975  C CB  . THR B 1 24  ? 20.538  -25.240 -6.611  1.00 142.38 ? 39  THR B CB  1 
ATOM   976  O OG1 . THR B 1 24  ? 21.954  -25.070 -6.751  1.00 148.99 ? 39  THR B OG1 1 
ATOM   977  C CG2 . THR B 1 24  ? 19.843  -24.759 -7.877  1.00 135.28 ? 39  THR B CG2 1 
ATOM   978  N N   . HIS B 1 25  ? 22.096  -24.545 -4.088  1.00 126.57 ? 40  HIS B N   1 
ATOM   979  C CA  . HIS B 1 25  ? 22.981  -25.011 -3.022  1.00 120.88 ? 40  HIS B CA  1 
ATOM   980  C C   . HIS B 1 25  ? 22.778  -24.260 -1.709  1.00 104.66 ? 40  HIS B C   1 
ATOM   981  O O   . HIS B 1 25  ? 23.557  -24.420 -0.769  1.00 100.41 ? 40  HIS B O   1 
ATOM   982  C CB  . HIS B 1 25  ? 24.442  -24.918 -3.466  1.00 124.33 ? 40  HIS B CB  1 
ATOM   983  C CG  . HIS B 1 25  ? 24.751  -25.724 -4.689  1.00 131.80 ? 40  HIS B CG  1 
ATOM   984  N ND1 . HIS B 1 25  ? 24.518  -25.261 -5.966  1.00 136.58 ? 40  HIS B ND1 1 
ATOM   985  C CD2 . HIS B 1 25  ? 25.264  -26.969 -4.828  1.00 133.63 ? 40  HIS B CD2 1 
ATOM   986  C CE1 . HIS B 1 25  ? 24.881  -26.183 -6.839  1.00 138.11 ? 40  HIS B CE1 1 
ATOM   987  N NE2 . HIS B 1 25  ? 25.336  -27.230 -6.175  1.00 140.15 ? 40  HIS B NE2 1 
ATOM   988  N N   . ARG B 1 26  ? 21.729  -23.445 -1.655  1.00 98.89  ? 41  ARG B N   1 
ATOM   989  C CA  . ARG B 1 26  ? 21.387  -22.682 -0.458  1.00 103.90 ? 41  ARG B CA  1 
ATOM   990  C C   . ARG B 1 26  ? 21.210  -23.600 0.751   1.00 106.30 ? 41  ARG B C   1 
ATOM   991  O O   . ARG B 1 26  ? 21.845  -23.402 1.785   1.00 108.34 ? 41  ARG B O   1 
ATOM   992  C CB  . ARG B 1 26  ? 20.117  -21.865 -0.708  1.00 109.20 ? 41  ARG B CB  1 
ATOM   993  C CG  . ARG B 1 26  ? 19.655  -21.021 0.467   1.00 113.69 ? 41  ARG B CG  1 
ATOM   994  C CD  . ARG B 1 26  ? 18.443  -20.184 0.088   1.00 123.95 ? 41  ARG B CD  1 
ATOM   995  N NE  . ARG B 1 26  ? 17.904  -19.450 1.230   1.00 127.61 ? 41  ARG B NE  1 
ATOM   996  C CZ  . ARG B 1 26  ? 18.296  -18.232 1.593   1.00 123.33 ? 41  ARG B CZ  1 
ATOM   997  N NH1 . ARG B 1 26  ? 19.238  -17.601 0.904   1.00 112.03 ? 41  ARG B NH1 1 
ATOM   998  N NH2 . ARG B 1 26  ? 17.746  -17.645 2.647   1.00 125.90 ? 41  ARG B NH2 1 
ATOM   999  N N   . THR B 1 27  ? 20.359  -24.612 0.605   1.00 106.04 ? 42  THR B N   1 
ATOM   1000 C CA  . THR B 1 27  ? 20.120  -25.586 1.667   1.00 108.97 ? 42  THR B CA  1 
ATOM   1001 C C   . THR B 1 27  ? 21.397  -26.297 2.121   1.00 109.09 ? 42  THR B C   1 
ATOM   1002 O O   . THR B 1 27  ? 21.531  -26.656 3.292   1.00 110.15 ? 42  THR B O   1 
ATOM   1003 C CB  . THR B 1 27  ? 19.083  -26.644 1.240   1.00 122.33 ? 42  THR B CB  1 
ATOM   1004 O OG1 . THR B 1 27  ? 19.245  -26.936 -0.153  1.00 127.54 ? 42  THR B OG1 1 
ATOM   1005 C CG2 . THR B 1 27  ? 17.671  -26.135 1.482   1.00 123.23 ? 42  THR B CG2 1 
ATOM   1006 N N   . LEU B 1 28  ? 22.327  -26.501 1.194   1.00 106.70 ? 43  LEU B N   1 
ATOM   1007 C CA  . LEU B 1 28  ? 23.607  -27.124 1.519   1.00 107.18 ? 43  LEU B CA  1 
ATOM   1008 C C   . LEU B 1 28  ? 24.500  -26.140 2.267   1.00 107.23 ? 43  LEU B C   1 
ATOM   1009 O O   . LEU B 1 28  ? 25.136  -26.493 3.261   1.00 109.78 ? 43  LEU B O   1 
ATOM   1010 C CB  . LEU B 1 28  ? 24.297  -27.629 0.243   1.00 108.08 ? 43  LEU B CB  1 
ATOM   1011 C CG  . LEU B 1 28  ? 25.631  -28.390 0.311   1.00 106.87 ? 43  LEU B CG  1 
ATOM   1012 C CD1 . LEU B 1 28  ? 26.830  -27.450 0.252   1.00 105.46 ? 43  LEU B CD1 1 
ATOM   1013 C CD2 . LEU B 1 28  ? 25.703  -29.267 1.549   1.00 106.62 ? 43  LEU B CD2 1 
ATOM   1014 N N   . LEU B 1 29  ? 24.535  -24.902 1.787   1.00 102.62 ? 44  LEU B N   1 
ATOM   1015 C CA  . LEU B 1 29  ? 25.399  -23.877 2.363   1.00 99.81  ? 44  LEU B CA  1 
ATOM   1016 C C   . LEU B 1 29  ? 24.954  -23.448 3.761   1.00 98.50  ? 44  LEU B C   1 
ATOM   1017 O O   . LEU B 1 29  ? 25.787  -23.194 4.631   1.00 88.24  ? 44  LEU B O   1 
ATOM   1018 C CB  . LEU B 1 29  ? 25.472  -22.661 1.433   1.00 89.80  ? 44  LEU B CB  1 
ATOM   1019 C CG  . LEU B 1 29  ? 26.188  -22.876 0.095   1.00 91.50  ? 44  LEU B CG  1 
ATOM   1020 C CD1 . LEU B 1 29  ? 25.993  -21.681 -0.826  1.00 91.88  ? 44  LEU B CD1 1 
ATOM   1021 C CD2 . LEU B 1 29  ? 27.664  -23.139 0.327   1.00 92.88  ? 44  LEU B CD2 1 
ATOM   1022 N N   . ILE B 1 30  ? 23.643  -23.378 3.976   1.00 101.71 ? 45  ILE B N   1 
ATOM   1023 C CA  . ILE B 1 30  ? 23.108  -22.915 5.254   1.00 98.38  ? 45  ILE B CA  1 
ATOM   1024 C C   . ILE B 1 30  ? 22.977  -24.042 6.279   1.00 94.46  ? 45  ILE B C   1 
ATOM   1025 O O   . ILE B 1 30  ? 22.304  -23.890 7.300   1.00 93.88  ? 45  ILE B O   1 
ATOM   1026 C CB  . ILE B 1 30  ? 21.748  -22.204 5.083   1.00 96.55  ? 45  ILE B CB  1 
ATOM   1027 C CG1 . ILE B 1 30  ? 20.656  -23.203 4.694   1.00 93.51  ? 45  ILE B CG1 1 
ATOM   1028 C CG2 . ILE B 1 30  ? 21.860  -21.090 4.055   1.00 91.19  ? 45  ILE B CG2 1 
ATOM   1029 C CD1 . ILE B 1 30  ? 19.295  -22.566 4.490   1.00 88.89  ? 45  ILE B CD1 1 
ATOM   1030 N N   . ALA B 1 31  ? 23.628  -25.167 6.000   1.00 98.71  ? 46  ALA B N   1 
ATOM   1031 C CA  . ALA B 1 31  ? 23.638  -26.297 6.922   1.00 102.60 ? 46  ALA B CA  1 
ATOM   1032 C C   . ALA B 1 31  ? 24.489  -25.981 8.148   1.00 99.34  ? 46  ALA B C   1 
ATOM   1033 O O   . ALA B 1 31  ? 24.201  -26.447 9.252   1.00 93.15  ? 46  ALA B O   1 
ATOM   1034 C CB  . ALA B 1 31  ? 24.149  -27.546 6.225   1.00 100.61 ? 46  ALA B CB  1 
ATOM   1035 N N   . ASN B 1 32  ? 25.542  -25.194 7.945   1.00 107.10 ? 47  ASN B N   1 
ATOM   1036 C CA  . ASN B 1 32  ? 26.368  -24.719 9.048   1.00 108.29 ? 47  ASN B CA  1 
ATOM   1037 C C   . ASN B 1 32  ? 25.630  -23.615 9.793   1.00 98.75  ? 47  ASN B C   1 
ATOM   1038 O O   . ASN B 1 32  ? 25.433  -22.521 9.263   1.00 89.31  ? 47  ASN B O   1 
ATOM   1039 C CB  . ASN B 1 32  ? 27.711  -24.201 8.529   1.00 107.08 ? 47  ASN B CB  1 
ATOM   1040 C CG  . ASN B 1 32  ? 28.747  -24.050 9.631   1.00 106.64 ? 47  ASN B CG  1 
ATOM   1041 O OD1 . ASN B 1 32  ? 28.417  -24.044 10.816  1.00 105.42 ? 47  ASN B OD1 1 
ATOM   1042 N ND2 . ASN B 1 32  ? 30.011  -23.924 9.240   1.00 108.21 ? 47  ASN B ND2 1 
ATOM   1043 N N   . GLU B 1 33  ? 25.221  -23.908 11.023  1.00 96.94  ? 48  GLU B N   1 
ATOM   1044 C CA  . GLU B 1 33  ? 24.376  -22.991 11.782  1.00 99.80  ? 48  GLU B CA  1 
ATOM   1045 C C   . GLU B 1 33  ? 25.133  -22.270 12.897  1.00 98.15  ? 48  GLU B C   1 
ATOM   1046 O O   . GLU B 1 33  ? 24.589  -21.380 13.550  1.00 102.93 ? 48  GLU B O   1 
ATOM   1047 C CB  . GLU B 1 33  ? 23.159  -23.734 12.343  1.00 104.04 ? 48  GLU B CB  1 
ATOM   1048 C CG  . GLU B 1 33  ? 22.272  -24.352 11.267  1.00 114.01 ? 48  GLU B CG  1 
ATOM   1049 C CD  . GLU B 1 33  ? 21.071  -25.086 11.838  1.00 130.07 ? 48  GLU B CD  1 
ATOM   1050 O OE1 . GLU B 1 33  ? 20.871  -25.043 13.071  1.00 131.38 ? 48  GLU B OE1 1 
ATOM   1051 O OE2 . GLU B 1 33  ? 20.326  -25.708 11.050  1.00 138.90 ? 48  GLU B OE2 1 
ATOM   1052 N N   . THR B 1 34  ? 26.389  -22.652 13.106  1.00 94.27  ? 49  THR B N   1 
ATOM   1053 C CA  . THR B 1 34  ? 27.232  -21.982 14.090  1.00 91.25  ? 49  THR B CA  1 
ATOM   1054 C C   . THR B 1 34  ? 27.993  -20.828 13.444  1.00 89.23  ? 49  THR B C   1 
ATOM   1055 O O   . THR B 1 34  ? 28.375  -19.869 14.116  1.00 84.85  ? 49  THR B O   1 
ATOM   1056 C CB  . THR B 1 34  ? 28.254  -22.945 14.717  1.00 92.32  ? 49  THR B CB  1 
ATOM   1057 O OG1 . THR B 1 34  ? 29.300  -23.214 13.775  1.00 97.05  ? 49  THR B OG1 1 
ATOM   1058 C CG2 . THR B 1 34  ? 27.583  -24.248 15.122  1.00 96.12  ? 49  THR B CG2 1 
ATOM   1059 N N   . LEU B 1 35  ? 28.206  -20.925 12.134  1.00 82.79  ? 50  LEU B N   1 
ATOM   1060 C CA  . LEU B 1 35  ? 29.008  -19.946 11.409  1.00 78.83  ? 50  LEU B CA  1 
ATOM   1061 C C   . LEU B 1 35  ? 28.340  -18.579 11.349  1.00 76.05  ? 50  LEU B C   1 
ATOM   1062 O O   . LEU B 1 35  ? 27.196  -18.455 10.915  1.00 72.82  ? 50  LEU B O   1 
ATOM   1063 C CB  . LEU B 1 35  ? 29.306  -20.435 9.989   1.00 77.19  ? 50  LEU B CB  1 
ATOM   1064 C CG  . LEU B 1 35  ? 30.278  -19.563 9.189   1.00 76.52  ? 50  LEU B CG  1 
ATOM   1065 C CD1 . LEU B 1 35  ? 31.574  -19.406 9.958   1.00 69.26  ? 50  LEU B CD1 1 
ATOM   1066 C CD2 . LEU B 1 35  ? 30.541  -20.163 7.817   1.00 80.44  ? 50  LEU B CD2 1 
ATOM   1067 N N   . ARG B 1 36  ? 29.071  -17.559 11.786  1.00 73.26  ? 51  ARG B N   1 
ATOM   1068 C CA  . ARG B 1 36  ? 28.605  -16.180 11.711  1.00 70.44  ? 51  ARG B CA  1 
ATOM   1069 C C   . ARG B 1 36  ? 29.453  -15.380 10.722  1.00 75.48  ? 51  ARG B C   1 
ATOM   1070 O O   . ARG B 1 36  ? 30.676  -15.301 10.850  1.00 80.08  ? 51  ARG B O   1 
ATOM   1071 C CB  . ARG B 1 36  ? 28.622  -15.524 13.095  1.00 60.21  ? 51  ARG B CB  1 
ATOM   1072 C CG  . ARG B 1 36  ? 27.688  -16.179 14.115  1.00 61.11  ? 51  ARG B CG  1 
ATOM   1073 C CD  . ARG B 1 36  ? 26.223  -15.847 13.849  1.00 58.58  ? 51  ARG B CD  1 
ATOM   1074 N NE  . ARG B 1 36  ? 25.446  -17.019 13.450  1.00 76.87  ? 51  ARG B NE  1 
ATOM   1075 C CZ  . ARG B 1 36  ? 24.793  -17.811 14.296  1.00 81.29  ? 51  ARG B CZ  1 
ATOM   1076 N NH1 . ARG B 1 36  ? 24.817  -17.561 15.597  1.00 82.94  ? 51  ARG B NH1 1 
ATOM   1077 N NH2 . ARG B 1 36  ? 24.112  -18.853 13.840  1.00 85.48  ? 51  ARG B NH2 1 
ATOM   1078 N N   . ILE B 1 37  ? 28.789  -14.791 9.733   1.00 69.11  ? 52  ILE B N   1 
ATOM   1079 C CA  . ILE B 1 37  ? 29.468  -14.087 8.653   1.00 70.36  ? 52  ILE B CA  1 
ATOM   1080 C C   . ILE B 1 37  ? 29.009  -12.634 8.601   1.00 63.51  ? 52  ILE B C   1 
ATOM   1081 O O   . ILE B 1 37  ? 27.815  -12.356 8.721   1.00 56.40  ? 52  ILE B O   1 
ATOM   1082 C CB  . ILE B 1 37  ? 29.192  -14.780 7.301   1.00 76.62  ? 52  ILE B CB  1 
ATOM   1083 C CG1 . ILE B 1 37  ? 29.587  -16.258 7.371   1.00 73.48  ? 52  ILE B CG1 1 
ATOM   1084 C CG2 . ILE B 1 37  ? 29.948  -14.108 6.183   1.00 89.68  ? 52  ILE B CG2 1 
ATOM   1085 C CD1 . ILE B 1 37  ? 29.441  -16.990 6.052   1.00 76.35  ? 52  ILE B CD1 1 
ATOM   1086 N N   . PRO B 1 38  ? 29.960  -11.697 8.446   1.00 64.10  ? 53  PRO B N   1 
ATOM   1087 C CA  . PRO B 1 38  ? 29.624  -10.270 8.402   1.00 56.40  ? 53  PRO B CA  1 
ATOM   1088 C C   . PRO B 1 38  ? 28.574  -9.921  7.350   1.00 62.58  ? 53  PRO B C   1 
ATOM   1089 O O   . PRO B 1 38  ? 28.765  -10.203 6.167   1.00 62.94  ? 53  PRO B O   1 
ATOM   1090 C CB  . PRO B 1 38  ? 30.965  -9.601  8.052   1.00 58.46  ? 53  PRO B CB  1 
ATOM   1091 C CG  . PRO B 1 38  ? 31.877  -10.723 7.617   1.00 69.55  ? 53  PRO B CG  1 
ATOM   1092 C CD  . PRO B 1 38  ? 31.416  -11.907 8.393   1.00 68.88  ? 53  PRO B CD  1 
ATOM   1093 N N   . VAL B 1 39  ? 27.472  -9.325  7.795   1.00 65.88  ? 54  VAL B N   1 
ATOM   1094 C CA  . VAL B 1 39  ? 26.428  -8.841  6.902   1.00 61.79  ? 54  VAL B CA  1 
ATOM   1095 C C   . VAL B 1 39  ? 26.193  -7.366  7.179   1.00 63.41  ? 54  VAL B C   1 
ATOM   1096 O O   . VAL B 1 39  ? 25.909  -6.988  8.315   1.00 59.59  ? 54  VAL B O   1 
ATOM   1097 C CB  . VAL B 1 39  ? 25.101  -9.586  7.123   1.00 62.12  ? 54  VAL B CB  1 
ATOM   1098 C CG1 . VAL B 1 39  ? 24.023  -9.032  6.201   1.00 62.75  ? 54  VAL B CG1 1 
ATOM   1099 C CG2 . VAL B 1 39  ? 25.282  -11.072 6.897   1.00 47.59  ? 54  VAL B CG2 1 
ATOM   1100 N N   . PRO B 1 40  ? 26.325  -6.522  6.143   1.00 64.58  ? 55  PRO B N   1 
ATOM   1101 C CA  . PRO B 1 40  ? 26.138  -5.077  6.309   1.00 57.02  ? 55  PRO B CA  1 
ATOM   1102 C C   . PRO B 1 40  ? 24.732  -4.777  6.811   1.00 58.33  ? 55  PRO B C   1 
ATOM   1103 O O   . PRO B 1 40  ? 23.791  -5.472  6.431   1.00 63.64  ? 55  PRO B O   1 
ATOM   1104 C CB  . PRO B 1 40  ? 26.309  -4.534  4.884   1.00 53.92  ? 55  PRO B CB  1 
ATOM   1105 C CG  . PRO B 1 40  ? 27.129  -5.564  4.180   1.00 64.89  ? 55  PRO B CG  1 
ATOM   1106 C CD  . PRO B 1 40  ? 26.698  -6.877  4.763   1.00 65.56  ? 55  PRO B CD  1 
ATOM   1107 N N   . VAL B 1 41  ? 24.590  -3.766  7.659   1.00 59.12  ? 56  VAL B N   1 
ATOM   1108 C CA  . VAL B 1 41  ? 23.282  -3.421  8.198   1.00 64.16  ? 56  VAL B CA  1 
ATOM   1109 C C   . VAL B 1 41  ? 22.590  -2.373  7.328   1.00 66.62  ? 56  VAL B C   1 
ATOM   1110 O O   . VAL B 1 41  ? 21.558  -1.820  7.709   1.00 78.05  ? 56  VAL B O   1 
ATOM   1111 C CB  . VAL B 1 41  ? 23.376  -2.931  9.657   1.00 56.42  ? 56  VAL B CB  1 
ATOM   1112 C CG1 . VAL B 1 41  ? 24.228  -3.883  10.489  1.00 54.46  ? 56  VAL B CG1 1 
ATOM   1113 C CG2 . VAL B 1 41  ? 23.954  -1.543  9.710   1.00 52.47  ? 56  VAL B CG2 1 
ATOM   1114 N N   . HIS B 1 42  ? 23.166  -2.108  6.158   1.00 57.89  ? 57  HIS B N   1 
ATOM   1115 C CA  . HIS B 1 42  ? 22.585  -1.161  5.210   1.00 59.82  ? 57  HIS B CA  1 
ATOM   1116 C C   . HIS B 1 42  ? 22.484  -1.772  3.816   1.00 60.76  ? 57  HIS B C   1 
ATOM   1117 O O   . HIS B 1 42  ? 23.065  -2.824  3.549   1.00 66.33  ? 57  HIS B O   1 
ATOM   1118 C CB  . HIS B 1 42  ? 23.386  0.147   5.177   1.00 62.96  ? 57  HIS B CB  1 
ATOM   1119 C CG  . HIS B 1 42  ? 24.801  -0.014  4.708   1.00 64.95  ? 57  HIS B CG  1 
ATOM   1120 N ND1 . HIS B 1 42  ? 25.133  -0.138  3.377   1.00 67.35  ? 57  HIS B ND1 1 
ATOM   1121 C CD2 . HIS B 1 42  ? 25.964  -0.062  5.397   1.00 62.10  ? 57  HIS B CD2 1 
ATOM   1122 C CE1 . HIS B 1 42  ? 26.446  -0.261  3.266   1.00 63.43  ? 57  HIS B CE1 1 
ATOM   1123 N NE2 . HIS B 1 42  ? 26.973  -0.216  4.471   1.00 61.63  ? 57  HIS B NE2 1 
ATOM   1124 N N   . LYS B 1 43  ? 21.750  -1.106  2.929   1.00 63.30  ? 58  LYS B N   1 
ATOM   1125 C CA  . LYS B 1 43  ? 21.472  -1.655  1.604   1.00 71.91  ? 58  LYS B CA  1 
ATOM   1126 C C   . LYS B 1 43  ? 22.256  -0.968  0.485   1.00 78.79  ? 58  LYS B C   1 
ATOM   1127 O O   . LYS B 1 43  ? 21.836  -0.974  -0.672  1.00 87.38  ? 58  LYS B O   1 
ATOM   1128 C CB  . LYS B 1 43  ? 19.967  -1.622  1.308   1.00 74.89  ? 58  LYS B CB  1 
ATOM   1129 C CG  . LYS B 1 43  ? 19.152  -2.585  2.158   1.00 88.31  ? 58  LYS B CG  1 
ATOM   1130 C CD  . LYS B 1 43  ? 19.653  -4.012  1.981   1.00 107.75 ? 58  LYS B CD  1 
ATOM   1131 C CE  . LYS B 1 43  ? 18.963  -4.980  2.930   1.00 112.06 ? 58  LYS B CE  1 
ATOM   1132 N NZ  . LYS B 1 43  ? 17.497  -5.049  2.681   1.00 117.36 ? 58  LYS B NZ  1 
ATOM   1133 N N   . ASN B 1 44  ? 23.392  -0.375  0.838   1.00 75.91  ? 59  ASN B N   1 
ATOM   1134 C CA  . ASN B 1 44  ? 24.312  0.171   -0.154  1.00 77.97  ? 59  ASN B CA  1 
ATOM   1135 C C   . ASN B 1 44  ? 25.394  -0.861  -0.463  1.00 79.76  ? 59  ASN B C   1 
ATOM   1136 O O   . ASN B 1 44  ? 26.542  -0.730  -0.035  1.00 79.23  ? 59  ASN B O   1 
ATOM   1137 C CB  . ASN B 1 44  ? 24.922  1.486   0.334   1.00 75.99  ? 59  ASN B CB  1 
ATOM   1138 C CG  . ASN B 1 44  ? 23.904  2.614   0.397   1.00 81.50  ? 59  ASN B CG  1 
ATOM   1139 O OD1 . ASN B 1 44  ? 23.189  2.874   -0.572  1.00 84.19  ? 59  ASN B OD1 1 
ATOM   1140 N ND2 . ASN B 1 44  ? 23.829  3.283   1.542   1.00 81.94  ? 59  ASN B ND2 1 
ATOM   1141 N N   . HIS B 1 45  ? 25.000  -1.885  -1.214  1.00 77.95  ? 60  HIS B N   1 
ATOM   1142 C CA  . HIS B 1 45  ? 25.800  -3.094  -1.424  1.00 76.56  ? 60  HIS B CA  1 
ATOM   1143 C C   . HIS B 1 45  ? 27.236  -2.878  -1.905  1.00 79.79  ? 60  HIS B C   1 
ATOM   1144 O O   . HIS B 1 45  ? 28.161  -3.520  -1.408  1.00 88.52  ? 60  HIS B O   1 
ATOM   1145 C CB  . HIS B 1 45  ? 25.079  -4.037  -2.393  1.00 78.30  ? 60  HIS B CB  1 
ATOM   1146 C CG  . HIS B 1 45  ? 23.675  -4.364  -1.989  1.00 83.36  ? 60  HIS B CG  1 
ATOM   1147 N ND1 . HIS B 1 45  ? 22.592  -3.604  -2.377  1.00 86.43  ? 60  HIS B ND1 1 
ATOM   1148 C CD2 . HIS B 1 45  ? 23.175  -5.371  -1.234  1.00 81.73  ? 60  HIS B CD2 1 
ATOM   1149 C CE1 . HIS B 1 45  ? 21.488  -4.127  -1.877  1.00 83.20  ? 60  HIS B CE1 1 
ATOM   1150 N NE2 . HIS B 1 45  ? 21.813  -5.200  -1.179  1.00 76.76  ? 60  HIS B NE2 1 
ATOM   1151 N N   . GLN B 1 46  ? 27.418  -1.984  -2.872  1.00 73.81  ? 61  GLN B N   1 
ATOM   1152 C CA  . GLN B 1 46  ? 28.714  -1.809  -3.530  1.00 78.47  ? 61  GLN B CA  1 
ATOM   1153 C C   . GLN B 1 46  ? 29.797  -1.216  -2.621  1.00 76.26  ? 61  GLN B C   1 
ATOM   1154 O O   . GLN B 1 46  ? 30.984  -1.254  -2.950  1.00 82.33  ? 61  GLN B O   1 
ATOM   1155 C CB  . GLN B 1 46  ? 28.553  -0.968  -4.800  1.00 89.37  ? 61  GLN B CB  1 
ATOM   1156 C CG  . GLN B 1 46  ? 27.421  -1.438  -5.704  1.00 102.72 ? 61  GLN B CG  1 
ATOM   1157 C CD  . GLN B 1 46  ? 27.255  -0.573  -6.940  1.00 124.36 ? 61  GLN B CD  1 
ATOM   1158 O OE1 . GLN B 1 46  ? 28.211  0.039   -7.417  1.00 139.97 ? 61  GLN B OE1 1 
ATOM   1159 N NE2 . GLN B 1 46  ? 26.033  -0.513  -7.460  1.00 123.83 ? 61  GLN B NE2 1 
ATOM   1160 N N   . LEU B 1 47  ? 29.386  -0.673  -1.479  1.00 75.01  ? 62  LEU B N   1 
ATOM   1161 C CA  . LEU B 1 47  ? 30.332  -0.143  -0.503  1.00 76.83  ? 62  LEU B CA  1 
ATOM   1162 C C   . LEU B 1 47  ? 30.988  -1.264  0.304   1.00 77.25  ? 62  LEU B C   1 
ATOM   1163 O O   . LEU B 1 47  ? 31.947  -1.029  1.038   1.00 75.43  ? 62  LEU B O   1 
ATOM   1164 C CB  . LEU B 1 47  ? 29.636  0.833   0.452   1.00 75.42  ? 62  LEU B CB  1 
ATOM   1165 C CG  . LEU B 1 47  ? 29.284  2.239   -0.041  1.00 82.45  ? 62  LEU B CG  1 
ATOM   1166 C CD1 . LEU B 1 47  ? 28.616  3.034   1.071   1.00 75.23  ? 62  LEU B CD1 1 
ATOM   1167 C CD2 . LEU B 1 47  ? 30.521  2.962   -0.542  1.00 78.33  ? 62  LEU B CD2 1 
ATOM   1168 N N   . CYS B 1 48  ? 30.477  -2.483  0.160   1.00 73.97  ? 63  CYS B N   1 
ATOM   1169 C CA  . CYS B 1 48  ? 30.880  -3.573  1.041   1.00 72.37  ? 63  CYS B CA  1 
ATOM   1170 C C   . CYS B 1 48  ? 31.436  -4.794  0.322   1.00 66.72  ? 63  CYS B C   1 
ATOM   1171 O O   . CYS B 1 48  ? 31.234  -5.919  0.776   1.00 73.21  ? 63  CYS B O   1 
ATOM   1172 C CB  . CYS B 1 48  ? 29.699  -4.002  1.913   1.00 74.27  ? 63  CYS B CB  1 
ATOM   1173 S SG  . CYS B 1 48  ? 28.917  -2.656  2.818   1.00 79.08  ? 63  CYS B SG  1 
ATOM   1174 N N   . THR B 1 49  ? 32.139  -4.578  -0.785  1.00 75.27  ? 64  THR B N   1 
ATOM   1175 C CA  . THR B 1 49  ? 32.724  -5.683  -1.543  1.00 80.99  ? 64  THR B CA  1 
ATOM   1176 C C   . THR B 1 49  ? 33.779  -6.448  -0.742  1.00 76.47  ? 64  THR B C   1 
ATOM   1177 O O   . THR B 1 49  ? 33.832  -7.679  -0.789  1.00 77.72  ? 64  THR B O   1 
ATOM   1178 C CB  . THR B 1 49  ? 33.339  -5.202  -2.877  1.00 90.16  ? 64  THR B CB  1 
ATOM   1179 O OG1 . THR B 1 49  ? 34.271  -4.143  -2.626  1.00 96.76  ? 64  THR B OG1 1 
ATOM   1180 C CG2 . THR B 1 49  ? 32.254  -4.701  -3.816  1.00 86.74  ? 64  THR B CG2 1 
ATOM   1181 N N   . GLU B 1 50  ? 34.609  -5.711  -0.007  1.00 92.42  ? 65  GLU B N   1 
ATOM   1182 C CA  . GLU B 1 50  ? 35.662  -6.311  0.808   1.00 77.59  ? 65  GLU B CA  1 
ATOM   1183 C C   . GLU B 1 50  ? 35.108  -7.280  1.846   1.00 90.80  ? 65  GLU B C   1 
ATOM   1184 O O   . GLU B 1 50  ? 35.692  -8.333  2.092   1.00 94.28  ? 65  GLU B O   1 
ATOM   1185 C CB  . GLU B 1 50  ? 36.493  -5.234  1.510   1.00 89.39  ? 65  GLU B CB  1 
ATOM   1186 C CG  . GLU B 1 50  ? 37.600  -4.633  0.662   1.00 103.90 ? 65  GLU B CG  1 
ATOM   1187 C CD  . GLU B 1 50  ? 38.474  -3.670  1.446   1.00 124.95 ? 65  GLU B CD  1 
ATOM   1188 O OE1 . GLU B 1 50  ? 38.156  -3.395  2.625   1.00 132.37 ? 65  GLU B OE1 1 
ATOM   1189 O OE2 . GLU B 1 50  ? 39.480  -3.189  0.883   1.00 129.07 ? 65  GLU B OE2 1 
ATOM   1190 N N   . GLU B 1 51  ? 33.979  -6.921  2.448   1.00 72.70  ? 66  GLU B N   1 
ATOM   1191 C CA  . GLU B 1 51  ? 33.368  -7.747  3.484   1.00 90.02  ? 66  GLU B CA  1 
ATOM   1192 C C   . GLU B 1 51  ? 32.547  -8.893  2.896   1.00 80.17  ? 66  GLU B C   1 
ATOM   1193 O O   . GLU B 1 51  ? 32.483  -9.979  3.473   1.00 85.63  ? 66  GLU B O   1 
ATOM   1194 C CB  . GLU B 1 51  ? 32.492  -6.898  4.410   1.00 69.07  ? 66  GLU B CB  1 
ATOM   1195 C CG  . GLU B 1 51  ? 33.255  -5.896  5.269   1.00 82.23  ? 66  GLU B CG  1 
ATOM   1196 C CD  . GLU B 1 51  ? 33.646  -4.637  4.510   1.00 103.09 ? 66  GLU B CD  1 
ATOM   1197 O OE1 . GLU B 1 51  ? 33.214  -4.479  3.347   1.00 102.57 ? 66  GLU B OE1 1 
ATOM   1198 O OE2 . GLU B 1 51  ? 34.384  -3.803  5.079   1.00 117.14 ? 66  GLU B OE2 1 
ATOM   1199 N N   . ILE B 1 52  ? 31.912  -8.644  1.755   1.00 70.17  ? 67  ILE B N   1 
ATOM   1200 C CA  . ILE B 1 52  ? 31.105  -9.666  1.094   1.00 73.99  ? 67  ILE B CA  1 
ATOM   1201 C C   . ILE B 1 52  ? 31.971  -10.827 0.613   1.00 76.37  ? 67  ILE B C   1 
ATOM   1202 O O   . ILE B 1 52  ? 31.663  -11.991 0.867   1.00 78.49  ? 67  ILE B O   1 
ATOM   1203 C CB  . ILE B 1 52  ? 30.313  -9.081  -0.098  1.00 78.76  ? 67  ILE B CB  1 
ATOM   1204 C CG1 . ILE B 1 52  ? 29.163  -8.205  0.406   1.00 85.10  ? 67  ILE B CG1 1 
ATOM   1205 C CG2 . ILE B 1 52  ? 29.763  -10.198 -0.971  1.00 76.10  ? 67  ILE B CG2 1 
ATOM   1206 C CD1 . ILE B 1 52  ? 28.536  -7.335  -0.669  1.00 87.24  ? 67  ILE B CD1 1 
ATOM   1207 N N   . PHE B 1 53  ? 33.066  -10.502 -0.067  1.00 74.89  ? 68  PHE B N   1 
ATOM   1208 C CA  . PHE B 1 53  ? 33.951  -11.524 -0.616  1.00 86.84  ? 68  PHE B CA  1 
ATOM   1209 C C   . PHE B 1 53  ? 34.896  -12.125 0.427   1.00 91.92  ? 68  PHE B C   1 
ATOM   1210 O O   . PHE B 1 53  ? 35.494  -13.176 0.197   1.00 101.19 ? 68  PHE B O   1 
ATOM   1211 C CB  . PHE B 1 53  ? 34.726  -10.980 -1.819  1.00 87.52  ? 68  PHE B CB  1 
ATOM   1212 C CG  . PHE B 1 53  ? 33.893  -10.854 -3.066  1.00 90.59  ? 68  PHE B CG  1 
ATOM   1213 C CD1 . PHE B 1 53  ? 33.748  -11.931 -3.928  1.00 91.53  ? 68  PHE B CD1 1 
ATOM   1214 C CD2 . PHE B 1 53  ? 33.251  -9.665  -3.374  1.00 88.99  ? 68  PHE B CD2 1 
ATOM   1215 C CE1 . PHE B 1 53  ? 32.981  -11.822 -5.074  1.00 99.43  ? 68  PHE B CE1 1 
ATOM   1216 C CE2 . PHE B 1 53  ? 32.484  -9.553  -4.519  1.00 91.15  ? 68  PHE B CE2 1 
ATOM   1217 C CZ  . PHE B 1 53  ? 32.350  -10.632 -5.370  1.00 101.01 ? 68  PHE B CZ  1 
ATOM   1218 N N   . GLN B 1 54  ? 35.031  -11.458 1.571   1.00 85.23  ? 69  GLN B N   1 
ATOM   1219 C CA  . GLN B 1 54  ? 35.751  -12.041 2.696   1.00 88.84  ? 69  GLN B CA  1 
ATOM   1220 C C   . GLN B 1 54  ? 34.831  -13.063 3.348   1.00 89.26  ? 69  GLN B C   1 
ATOM   1221 O O   . GLN B 1 54  ? 35.278  -14.104 3.832   1.00 94.24  ? 69  GLN B O   1 
ATOM   1222 C CB  . GLN B 1 54  ? 36.168  -10.966 3.702   1.00 92.62  ? 69  GLN B CB  1 
ATOM   1223 C CG  . GLN B 1 54  ? 37.104  -11.458 4.798   1.00 111.65 ? 69  GLN B CG  1 
ATOM   1224 C CD  . GLN B 1 54  ? 38.022  -10.363 5.316   1.00 132.06 ? 69  GLN B CD  1 
ATOM   1225 O OE1 . GLN B 1 54  ? 37.843  -9.185  5.001   1.00 135.46 ? 69  GLN B OE1 1 
ATOM   1226 N NE2 . GLN B 1 54  ? 39.019  -10.749 6.108   1.00 140.38 ? 69  GLN B NE2 1 
ATOM   1227 N N   . GLY B 1 55  ? 33.536  -12.761 3.339   1.00 82.54  ? 70  GLY B N   1 
ATOM   1228 C CA  . GLY B 1 55  ? 32.537  -13.679 3.850   1.00 86.19  ? 70  GLY B CA  1 
ATOM   1229 C C   . GLY B 1 55  ? 32.411  -14.902 2.965   1.00 86.48  ? 70  GLY B C   1 
ATOM   1230 O O   . GLY B 1 55  ? 32.224  -16.018 3.453   1.00 86.44  ? 70  GLY B O   1 
ATOM   1231 N N   . ILE B 1 56  ? 32.514  -14.686 1.657   1.00 87.12  ? 71  ILE B N   1 
ATOM   1232 C CA  . ILE B 1 56  ? 32.486  -15.775 0.688   1.00 93.80  ? 71  ILE B CA  1 
ATOM   1233 C C   . ILE B 1 56  ? 33.688  -16.695 0.895   1.00 95.11  ? 71  ILE B C   1 
ATOM   1234 O O   . ILE B 1 56  ? 33.577  -17.916 0.766   1.00 96.72  ? 71  ILE B O   1 
ATOM   1235 C CB  . ILE B 1 56  ? 32.464  -15.232 -0.761  1.00 98.66  ? 71  ILE B CB  1 
ATOM   1236 C CG1 . ILE B 1 56  ? 31.141  -14.510 -1.032  1.00 93.19  ? 71  ILE B CG1 1 
ATOM   1237 C CG2 . ILE B 1 56  ? 32.676  -16.353 -1.770  1.00 91.82  ? 71  ILE B CG2 1 
ATOM   1238 C CD1 . ILE B 1 56  ? 31.077  -13.835 -2.381  1.00 91.50  ? 71  ILE B CD1 1 
ATOM   1239 N N   . GLY B 1 57  ? 34.827  -16.104 1.245   1.00 85.88  ? 72  GLY B N   1 
ATOM   1240 C CA  . GLY B 1 57  ? 36.029  -16.870 1.524   1.00 90.74  ? 72  GLY B CA  1 
ATOM   1241 C C   . GLY B 1 57  ? 35.913  -17.736 2.766   1.00 117.74 ? 72  GLY B C   1 
ATOM   1242 O O   . GLY B 1 57  ? 36.303  -18.905 2.756   1.00 120.47 ? 72  GLY B O   1 
ATOM   1243 N N   . THR B 1 58  ? 35.381  -17.158 3.839   1.00 111.37 ? 73  THR B N   1 
ATOM   1244 C CA  . THR B 1 58  ? 35.154  -17.892 5.077   1.00 103.93 ? 73  THR B CA  1 
ATOM   1245 C C   . THR B 1 58  ? 34.131  -19.000 4.850   1.00 104.77 ? 73  THR B C   1 
ATOM   1246 O O   . THR B 1 58  ? 34.276  -20.110 5.366   1.00 114.13 ? 73  THR B O   1 
ATOM   1247 C CB  . THR B 1 58  ? 34.662  -16.956 6.199   1.00 103.96 ? 73  THR B CB  1 
ATOM   1248 O OG1 . THR B 1 58  ? 35.680  -15.993 6.500   1.00 109.62 ? 73  THR B OG1 1 
ATOM   1249 C CG2 . THR B 1 58  ? 34.335  -17.746 7.457   1.00 102.84 ? 73  THR B CG2 1 
ATOM   1250 N N   . LEU B 1 59  ? 33.105  -18.698 4.061   1.00 96.11  ? 74  LEU B N   1 
ATOM   1251 C CA  . LEU B 1 59  ? 32.085  -19.685 3.730   1.00 89.23  ? 74  LEU B CA  1 
ATOM   1252 C C   . LEU B 1 59  ? 32.662  -20.783 2.841   1.00 100.10 ? 74  LEU B C   1 
ATOM   1253 O O   . LEU B 1 59  ? 32.173  -21.911 2.841   1.00 116.04 ? 74  LEU B O   1 
ATOM   1254 C CB  . LEU B 1 59  ? 30.887  -19.014 3.051   1.00 87.29  ? 74  LEU B CB  1 
ATOM   1255 C CG  . LEU B 1 59  ? 29.680  -19.900 2.724   1.00 92.73  ? 74  LEU B CG  1 
ATOM   1256 C CD1 . LEU B 1 59  ? 29.182  -20.601 3.975   1.00 80.89  ? 74  LEU B CD1 1 
ATOM   1257 C CD2 . LEU B 1 59  ? 28.569  -19.078 2.087   1.00 86.90  ? 74  LEU B CD2 1 
ATOM   1258 N N   . GLU B 1 60  ? 33.708  -20.447 2.089   1.00 98.71  ? 75  GLU B N   1 
ATOM   1259 C CA  . GLU B 1 60  ? 34.402  -21.430 1.263   1.00 104.81 ? 75  GLU B CA  1 
ATOM   1260 C C   . GLU B 1 60  ? 35.329  -22.282 2.117   1.00 109.34 ? 75  GLU B C   1 
ATOM   1261 O O   . GLU B 1 60  ? 35.443  -23.490 1.914   1.00 121.62 ? 75  GLU B O   1 
ATOM   1262 C CB  . GLU B 1 60  ? 35.211  -20.748 0.158   1.00 115.64 ? 75  GLU B CB  1 
ATOM   1263 C CG  . GLU B 1 60  ? 35.801  -21.717 -0.863  1.00 132.56 ? 75  GLU B CG  1 
ATOM   1264 C CD  . GLU B 1 60  ? 36.737  -21.038 -1.848  1.00 144.13 ? 75  GLU B CD  1 
ATOM   1265 O OE1 . GLU B 1 60  ? 37.689  -20.369 -1.395  1.00 147.54 ? 75  GLU B OE1 1 
ATOM   1266 O OE2 . GLU B 1 60  ? 36.519  -21.170 -3.072  1.00 148.70 ? 75  GLU B OE2 1 
ATOM   1267 N N   . SER B 1 61  ? 35.983  -21.645 3.083   1.00 133.70 ? 76  SER B N   1 
ATOM   1268 C CA  . SER B 1 61  ? 36.921  -22.332 3.965   1.00 139.39 ? 76  SER B CA  1 
ATOM   1269 C C   . SER B 1 61  ? 36.204  -23.091 5.080   1.00 142.66 ? 76  SER B C   1 
ATOM   1270 O O   . SER B 1 61  ? 36.767  -23.315 6.152   1.00 149.77 ? 76  SER B O   1 
ATOM   1271 C CB  . SER B 1 61  ? 37.911  -21.333 4.565   1.00 139.83 ? 76  SER B CB  1 
ATOM   1272 O OG  . SER B 1 61  ? 38.540  -20.568 3.552   1.00 131.53 ? 76  SER B OG  1 
ATOM   1273 N N   . GLN B 1 62  ? 34.960  -23.482 4.819   1.00 139.75 ? 77  GLN B N   1 
ATOM   1274 C CA  . GLN B 1 62  ? 34.155  -24.231 5.776   1.00 142.72 ? 77  GLN B CA  1 
ATOM   1275 C C   . GLN B 1 62  ? 33.044  -24.989 5.063   1.00 137.28 ? 77  GLN B C   1 
ATOM   1276 O O   . GLN B 1 62  ? 31.999  -25.270 5.649   1.00 126.90 ? 77  GLN B O   1 
ATOM   1277 C CB  . GLN B 1 62  ? 33.537  -23.294 6.813   1.00 145.50 ? 77  GLN B CB  1 
ATOM   1278 C CG  . GLN B 1 62  ? 34.209  -23.335 8.170   1.00 153.20 ? 77  GLN B CG  1 
ATOM   1279 C CD  . GLN B 1 62  ? 33.340  -22.746 9.263   1.00 156.90 ? 77  GLN B CD  1 
ATOM   1280 O OE1 . GLN B 1 62  ? 32.112  -22.759 9.172   1.00 157.29 ? 77  GLN B OE1 1 
ATOM   1281 N NE2 . GLN B 1 62  ? 33.976  -22.225 10.305  1.00 159.50 ? 77  GLN B NE2 1 
ATOM   1282 N N   . THR B 1 63  ? 33.274  -25.314 3.796   1.00 136.82 ? 78  THR B N   1 
ATOM   1283 C CA  . THR B 1 63  ? 32.272  -26.000 2.992   1.00 139.62 ? 78  THR B CA  1 
ATOM   1284 C C   . THR B 1 63  ? 32.864  -27.220 2.294   1.00 149.87 ? 78  THR B C   1 
ATOM   1285 O O   . THR B 1 63  ? 33.968  -27.159 1.750   1.00 156.94 ? 78  THR B O   1 
ATOM   1286 C CB  . THR B 1 63  ? 31.669  -25.054 1.935   1.00 130.49 ? 78  THR B CB  1 
ATOM   1287 O OG1 . THR B 1 63  ? 31.109  -23.907 2.586   1.00 128.22 ? 78  THR B OG1 1 
ATOM   1288 C CG2 . THR B 1 63  ? 30.583  -25.758 1.134   1.00 126.52 ? 78  THR B CG2 1 
ATOM   1289 N N   . VAL B 1 64  ? 32.131  -28.330 2.325   1.00 151.29 ? 79  VAL B N   1 
ATOM   1290 C CA  . VAL B 1 64  ? 32.537  -29.535 1.612   1.00 151.53 ? 79  VAL B CA  1 
ATOM   1291 C C   . VAL B 1 64  ? 32.651  -29.260 0.113   1.00 149.83 ? 79  VAL B C   1 
ATOM   1292 O O   . VAL B 1 64  ? 31.645  -29.121 -0.585  1.00 148.17 ? 79  VAL B O   1 
ATOM   1293 C CB  . VAL B 1 64  ? 31.570  -30.713 1.874   1.00 149.56 ? 79  VAL B CB  1 
ATOM   1294 C CG1 . VAL B 1 64  ? 31.928  -31.410 3.173   1.00 148.35 ? 79  VAL B CG1 1 
ATOM   1295 C CG2 . VAL B 1 64  ? 30.126  -30.234 1.911   1.00 151.18 ? 79  VAL B CG2 1 
ATOM   1296 N N   . GLN B 1 65  ? 33.887  -29.164 -0.369  1.00 154.22 ? 80  GLN B N   1 
ATOM   1297 C CA  . GLN B 1 65  ? 34.152  -28.886 -1.777  1.00 159.65 ? 80  GLN B CA  1 
ATOM   1298 C C   . GLN B 1 65  ? 33.541  -29.971 -2.662  1.00 162.26 ? 80  GLN B C   1 
ATOM   1299 O O   . GLN B 1 65  ? 34.242  -30.859 -3.147  1.00 163.33 ? 80  GLN B O   1 
ATOM   1300 C CB  . GLN B 1 65  ? 35.660  -28.795 -2.030  1.00 164.97 ? 80  GLN B CB  1 
ATOM   1301 C CG  . GLN B 1 65  ? 36.450  -28.043 -0.959  1.00 165.34 ? 80  GLN B CG  1 
ATOM   1302 C CD  . GLN B 1 65  ? 36.372  -26.533 -1.105  1.00 164.29 ? 80  GLN B CD  1 
ATOM   1303 O OE1 . GLN B 1 65  ? 35.360  -25.988 -1.547  1.00 160.88 ? 80  GLN B OE1 1 
ATOM   1304 N NE2 . GLN B 1 65  ? 37.449  -25.849 -0.734  1.00 165.82 ? 80  GLN B NE2 1 
ATOM   1305 N N   . GLY B 1 66  ? 32.229  -29.892 -2.866  1.00 156.21 ? 81  GLY B N   1 
ATOM   1306 C CA  . GLY B 1 66  ? 31.505  -30.913 -3.600  1.00 155.22 ? 81  GLY B CA  1 
ATOM   1307 C C   . GLY B 1 66  ? 31.615  -30.793 -5.107  1.00 156.89 ? 81  GLY B C   1 
ATOM   1308 O O   . GLY B 1 66  ? 32.654  -30.396 -5.637  1.00 157.13 ? 81  GLY B O   1 
ATOM   1309 N N   . GLY B 1 67  ? 30.536  -31.145 -5.799  1.00 155.97 ? 82  GLY B N   1 
ATOM   1310 C CA  . GLY B 1 67  ? 30.514  -31.123 -7.249  1.00 151.64 ? 82  GLY B CA  1 
ATOM   1311 C C   . GLY B 1 67  ? 30.102  -29.779 -7.812  1.00 149.19 ? 82  GLY B C   1 
ATOM   1312 O O   . GLY B 1 67  ? 30.948  -28.971 -8.193  1.00 143.43 ? 82  GLY B O   1 
ATOM   1313 N N   . THR B 1 68  ? 28.796  -29.535 -7.860  1.00 156.42 ? 83  THR B N   1 
ATOM   1314 C CA  . THR B 1 68  ? 28.267  -28.290 -8.407  1.00 157.84 ? 83  THR B CA  1 
ATOM   1315 C C   . THR B 1 68  ? 28.398  -27.133 -7.415  1.00 155.46 ? 83  THR B C   1 
ATOM   1316 O O   . THR B 1 68  ? 27.974  -26.013 -7.699  1.00 153.45 ? 83  THR B O   1 
ATOM   1317 C CB  . THR B 1 68  ? 26.791  -28.439 -8.834  1.00 160.05 ? 83  THR B CB  1 
ATOM   1318 O OG1 . THR B 1 68  ? 26.314  -29.741 -8.469  1.00 167.13 ? 83  THR B OG1 1 
ATOM   1319 C CG2 . THR B 1 68  ? 26.641  -28.251 -10.339 1.00 158.24 ? 83  THR B CG2 1 
ATOM   1320 N N   . VAL B 1 69  ? 28.983  -27.412 -6.252  1.00 157.20 ? 84  VAL B N   1 
ATOM   1321 C CA  . VAL B 1 69  ? 29.225  -26.387 -5.243  1.00 146.81 ? 84  VAL B CA  1 
ATOM   1322 C C   . VAL B 1 69  ? 30.554  -25.694 -5.506  1.00 150.75 ? 84  VAL B C   1 
ATOM   1323 O O   . VAL B 1 69  ? 30.667  -24.473 -5.400  1.00 150.13 ? 84  VAL B O   1 
ATOM   1324 C CB  . VAL B 1 69  ? 29.284  -26.987 -3.826  1.00 141.49 ? 84  VAL B CB  1 
ATOM   1325 C CG1 . VAL B 1 69  ? 29.089  -25.899 -2.781  1.00 137.75 ? 84  VAL B CG1 1 
ATOM   1326 C CG2 . VAL B 1 69  ? 28.239  -28.072 -3.662  1.00 145.16 ? 84  VAL B CG2 1 
ATOM   1327 N N   . GLU B 1 70  ? 31.557  -26.494 -5.854  1.00 140.02 ? 85  GLU B N   1 
ATOM   1328 C CA  . GLU B 1 70  ? 32.920  -26.014 -6.043  1.00 146.69 ? 85  GLU B CA  1 
ATOM   1329 C C   . GLU B 1 70  ? 33.019  -25.016 -7.194  1.00 144.15 ? 85  GLU B C   1 
ATOM   1330 O O   . GLU B 1 70  ? 33.920  -24.177 -7.222  1.00 142.59 ? 85  GLU B O   1 
ATOM   1331 C CB  . GLU B 1 70  ? 33.856  -27.201 -6.281  1.00 156.40 ? 85  GLU B CB  1 
ATOM   1332 C CG  . GLU B 1 70  ? 35.277  -26.999 -5.787  1.00 162.74 ? 85  GLU B CG  1 
ATOM   1333 C CD  . GLU B 1 70  ? 35.988  -28.314 -5.522  1.00 171.56 ? 85  GLU B CD  1 
ATOM   1334 O OE1 . GLU B 1 70  ? 35.394  -29.379 -5.797  1.00 169.56 ? 85  GLU B OE1 1 
ATOM   1335 O OE2 . GLU B 1 70  ? 37.136  -28.284 -5.032  1.00 179.05 ? 85  GLU B OE2 1 
ATOM   1336 N N   . ARG B 1 71  ? 32.086  -25.108 -8.137  1.00 139.82 ? 86  ARG B N   1 
ATOM   1337 C CA  . ARG B 1 71  ? 32.040  -24.180 -9.262  1.00 135.06 ? 86  ARG B CA  1 
ATOM   1338 C C   . ARG B 1 71  ? 31.544  -22.801 -8.833  1.00 120.26 ? 86  ARG B C   1 
ATOM   1339 O O   . ARG B 1 71  ? 32.062  -21.780 -9.290  1.00 110.02 ? 86  ARG B O   1 
ATOM   1340 C CB  . ARG B 1 71  ? 31.158  -24.732 -10.386 1.00 139.16 ? 86  ARG B CB  1 
ATOM   1341 C CG  . ARG B 1 71  ? 30.767  -23.697 -11.432 1.00 138.98 ? 86  ARG B CG  1 
ATOM   1342 C CD  . ARG B 1 71  ? 30.058  -24.331 -12.616 1.00 139.19 ? 86  ARG B CD  1 
ATOM   1343 N NE  . ARG B 1 71  ? 29.340  -23.339 -13.410 1.00 137.78 ? 86  ARG B NE  1 
ATOM   1344 C CZ  . ARG B 1 71  ? 29.897  -22.588 -14.355 1.00 135.88 ? 86  ARG B CZ  1 
ATOM   1345 N NH1 . ARG B 1 71  ? 31.188  -22.713 -14.628 1.00 137.92 ? 86  ARG B NH1 1 
ATOM   1346 N NH2 . ARG B 1 71  ? 29.163  -21.710 -15.025 1.00 129.07 ? 86  ARG B NH2 1 
ATOM   1347 N N   . LEU B 1 72  ? 30.541  -22.783 -7.958  1.00 119.33 ? 87  LEU B N   1 
ATOM   1348 C CA  . LEU B 1 72  ? 29.963  -21.540 -7.454  1.00 116.99 ? 87  LEU B CA  1 
ATOM   1349 C C   . LEU B 1 72  ? 31.025  -20.624 -6.858  1.00 117.85 ? 87  LEU B C   1 
ATOM   1350 O O   . LEU B 1 72  ? 31.013  -19.413 -7.076  1.00 113.06 ? 87  LEU B O   1 
ATOM   1351 C CB  . LEU B 1 72  ? 28.895  -21.840 -6.398  1.00 109.66 ? 87  LEU B CB  1 
ATOM   1352 C CG  . LEU B 1 72  ? 28.297  -20.644 -5.646  1.00 100.92 ? 87  LEU B CG  1 
ATOM   1353 C CD1 . LEU B 1 72  ? 27.426  -19.809 -6.566  1.00 105.51 ? 87  LEU B CD1 1 
ATOM   1354 C CD2 . LEU B 1 72  ? 27.506  -21.103 -4.434  1.00 100.75 ? 87  LEU B CD2 1 
ATOM   1355 N N   . PHE B 1 73  ? 31.954  -21.221 -6.121  1.00 122.70 ? 88  PHE B N   1 
ATOM   1356 C CA  . PHE B 1 73  ? 32.955  -20.462 -5.383  1.00 127.05 ? 88  PHE B CA  1 
ATOM   1357 C C   . PHE B 1 73  ? 34.129  -19.997 -6.246  1.00 132.83 ? 88  PHE B C   1 
ATOM   1358 O O   . PHE B 1 73  ? 34.935  -19.175 -5.811  1.00 139.26 ? 88  PHE B O   1 
ATOM   1359 C CB  . PHE B 1 73  ? 33.437  -21.269 -4.177  1.00 129.17 ? 88  PHE B CB  1 
ATOM   1360 C CG  . PHE B 1 73  ? 32.405  -21.403 -3.090  1.00 133.29 ? 88  PHE B CG  1 
ATOM   1361 C CD1 . PHE B 1 73  ? 32.460  -20.595 -1.967  1.00 136.57 ? 88  PHE B CD1 1 
ATOM   1362 C CD2 . PHE B 1 73  ? 31.374  -22.325 -3.195  1.00 135.45 ? 88  PHE B CD2 1 
ATOM   1363 C CE1 . PHE B 1 73  ? 31.518  -20.708 -0.966  1.00 139.04 ? 88  PHE B CE1 1 
ATOM   1364 C CE2 . PHE B 1 73  ? 30.426  -22.441 -2.195  1.00 138.58 ? 88  PHE B CE2 1 
ATOM   1365 C CZ  . PHE B 1 73  ? 30.500  -21.632 -1.080  1.00 140.67 ? 88  PHE B CZ  1 
ATOM   1366 N N   . LYS B 1 74  ? 34.226  -20.523 -7.464  1.00 130.95 ? 89  LYS B N   1 
ATOM   1367 C CA  . LYS B 1 74  ? 35.168  -19.988 -8.442  1.00 130.73 ? 89  LYS B CA  1 
ATOM   1368 C C   . LYS B 1 74  ? 34.491  -18.872 -9.224  1.00 123.46 ? 89  LYS B C   1 
ATOM   1369 O O   . LYS B 1 74  ? 35.101  -17.842 -9.507  1.00 127.07 ? 89  LYS B O   1 
ATOM   1370 C CB  . LYS B 1 74  ? 35.678  -21.072 -9.396  1.00 140.88 ? 89  LYS B CB  1 
ATOM   1371 C CG  . LYS B 1 74  ? 36.470  -20.517 -10.580 1.00 146.92 ? 89  LYS B CG  1 
ATOM   1372 C CD  . LYS B 1 74  ? 37.147  -21.612 -11.389 1.00 152.35 ? 89  LYS B CD  1 
ATOM   1373 C CE  . LYS B 1 74  ? 38.332  -22.198 -10.639 1.00 159.22 ? 89  LYS B CE  1 
ATOM   1374 N NZ  . LYS B 1 74  ? 39.043  -23.238 -11.439 1.00 163.01 ? 89  LYS B NZ  1 
ATOM   1375 N N   . ASN B 1 75  ? 33.224  -19.085 -9.569  1.00 120.84 ? 90  ASN B N   1 
ATOM   1376 C CA  . ASN B 1 75  ? 32.428  -18.052 -10.223 1.00 122.39 ? 90  ASN B CA  1 
ATOM   1377 C C   . ASN B 1 75  ? 32.339  -16.801 -9.357  1.00 118.91 ? 90  ASN B C   1 
ATOM   1378 O O   . ASN B 1 75  ? 32.362  -15.681 -9.866  1.00 117.62 ? 90  ASN B O   1 
ATOM   1379 C CB  . ASN B 1 75  ? 31.028  -18.569 -10.560 1.00 121.84 ? 90  ASN B CB  1 
ATOM   1380 C CG  . ASN B 1 75  ? 31.022  -19.493 -11.762 1.00 131.77 ? 90  ASN B CG  1 
ATOM   1381 O OD1 . ASN B 1 75  ? 32.041  -20.095 -12.101 1.00 139.86 ? 90  ASN B OD1 1 
ATOM   1382 N ND2 . ASN B 1 75  ? 29.872  -19.607 -12.416 1.00 134.97 ? 90  ASN B ND2 1 
ATOM   1383 N N   . LEU B 1 76  ? 32.242  -17.001 -8.046  1.00 116.24 ? 91  LEU B N   1 
ATOM   1384 C CA  . LEU B 1 76  ? 32.297  -15.894 -7.099  1.00 112.87 ? 91  LEU B CA  1 
ATOM   1385 C C   . LEU B 1 76  ? 33.708  -15.310 -7.052  1.00 116.29 ? 91  LEU B C   1 
ATOM   1386 O O   . LEU B 1 76  ? 33.887  -14.100 -6.922  1.00 117.36 ? 91  LEU B O   1 
ATOM   1387 C CB  . LEU B 1 76  ? 31.860  -16.353 -5.705  1.00 107.76 ? 91  LEU B CB  1 
ATOM   1388 C CG  . LEU B 1 76  ? 30.368  -16.657 -5.540  1.00 98.46  ? 91  LEU B CG  1 
ATOM   1389 C CD1 . LEU B 1 76  ? 30.082  -17.291 -4.186  1.00 97.01  ? 91  LEU B CD1 1 
ATOM   1390 C CD2 . LEU B 1 76  ? 29.551  -15.391 -5.724  1.00 91.23  ? 91  LEU B CD2 1 
ATOM   1391 N N   . SER B 1 77  ? 34.707  -16.180 -7.171  1.00 114.92 ? 92  SER B N   1 
ATOM   1392 C CA  . SER B 1 77  ? 36.103  -15.757 -7.189  1.00 119.76 ? 92  SER B CA  1 
ATOM   1393 C C   . SER B 1 77  ? 36.430  -15.007 -8.481  1.00 117.32 ? 92  SER B C   1 
ATOM   1394 O O   . SER B 1 77  ? 37.226  -14.065 -8.479  1.00 101.63 ? 92  SER B O   1 
ATOM   1395 C CB  . SER B 1 77  ? 37.023  -16.969 -7.026  1.00 128.38 ? 92  SER B CB  1 
ATOM   1396 O OG  . SER B 1 77  ? 38.387  -16.585 -7.009  1.00 135.98 ? 92  SER B OG  1 
ATOM   1397 N N   . LEU B 1 78  ? 35.811  -15.432 -9.579  1.00 108.71 ? 93  LEU B N   1 
ATOM   1398 C CA  . LEU B 1 78  ? 35.976  -14.762 -10.865 1.00 111.35 ? 93  LEU B CA  1 
ATOM   1399 C C   . LEU B 1 78  ? 35.317  -13.385 -10.857 1.00 111.25 ? 93  LEU B C   1 
ATOM   1400 O O   . LEU B 1 78  ? 35.873  -12.416 -11.376 1.00 111.00 ? 93  LEU B O   1 
ATOM   1401 C CB  . LEU B 1 78  ? 35.398  -15.614 -11.999 1.00 114.15 ? 93  LEU B CB  1 
ATOM   1402 C CG  . LEU B 1 78  ? 36.184  -16.873 -12.385 1.00 126.72 ? 93  LEU B CG  1 
ATOM   1403 C CD1 . LEU B 1 78  ? 35.449  -17.663 -13.458 1.00 124.76 ? 93  LEU B CD1 1 
ATOM   1404 C CD2 . LEU B 1 78  ? 37.588  -16.512 -12.847 1.00 111.03 ? 93  LEU B CD2 1 
ATOM   1405 N N   . ILE B 1 79  ? 34.127  -13.307 -10.268 1.00 108.02 ? 94  ILE B N   1 
ATOM   1406 C CA  . ILE B 1 79  ? 33.410  -12.042 -10.142 1.00 110.52 ? 94  ILE B CA  1 
ATOM   1407 C C   . ILE B 1 79  ? 34.218  -11.040 -9.314  1.00 107.13 ? 94  ILE B C   1 
ATOM   1408 O O   . ILE B 1 79  ? 34.227  -9.842  -9.608  1.00 102.91 ? 94  ILE B O   1 
ATOM   1409 C CB  . ILE B 1 79  ? 32.003  -12.252 -9.526  1.00 108.45 ? 94  ILE B CB  1 
ATOM   1410 C CG1 . ILE B 1 79  ? 31.062  -12.889 -10.554 1.00 103.06 ? 94  ILE B CG1 1 
ATOM   1411 C CG2 . ILE B 1 79  ? 31.416  -10.938 -9.042  1.00 106.22 ? 94  ILE B CG2 1 
ATOM   1412 C CD1 . ILE B 1 79  ? 29.681  -13.213 -10.010 1.00 102.13 ? 94  ILE B CD1 1 
ATOM   1413 N N   . LYS B 1 80  ? 34.911  -11.543 -8.294  1.00 104.34 ? 95  LYS B N   1 
ATOM   1414 C CA  . LYS B 1 80  ? 35.765  -10.709 -7.451  1.00 100.78 ? 95  LYS B CA  1 
ATOM   1415 C C   . LYS B 1 80  ? 36.830  -9.971  -8.260  1.00 98.06  ? 95  LYS B C   1 
ATOM   1416 O O   . LYS B 1 80  ? 37.025  -8.768  -8.088  1.00 103.46 ? 95  LYS B O   1 
ATOM   1417 C CB  . LYS B 1 80  ? 36.437  -11.548 -6.361  1.00 103.38 ? 95  LYS B CB  1 
ATOM   1418 C CG  . LYS B 1 80  ? 37.573  -10.818 -5.656  1.00 115.53 ? 95  LYS B CG  1 
ATOM   1419 C CD  . LYS B 1 80  ? 38.304  -11.707 -4.666  1.00 124.07 ? 95  LYS B CD  1 
ATOM   1420 C CE  . LYS B 1 80  ? 39.623  -11.075 -4.241  1.00 128.21 ? 95  LYS B CE  1 
ATOM   1421 N NZ  . LYS B 1 80  ? 39.463  -9.654  -3.820  1.00 126.78 ? 95  LYS B NZ  1 
ATOM   1422 N N   . LYS B 1 81  ? 37.512  -10.693 -9.144  1.00 97.93  ? 96  LYS B N   1 
ATOM   1423 C CA  . LYS B 1 81  ? 38.583  -10.098 -9.935  1.00 124.09 ? 96  LYS B CA  1 
ATOM   1424 C C   . LYS B 1 81  ? 38.067  -9.221  -11.072 1.00 120.99 ? 96  LYS B C   1 
ATOM   1425 O O   . LYS B 1 81  ? 38.835  -8.483  -11.688 1.00 123.96 ? 96  LYS B O   1 
ATOM   1426 C CB  . LYS B 1 81  ? 39.554  -11.162 -10.452 1.00 130.39 ? 96  LYS B CB  1 
ATOM   1427 C CG  . LYS B 1 81  ? 40.463  -11.721 -9.367  1.00 135.38 ? 96  LYS B CG  1 
ATOM   1428 C CD  . LYS B 1 81  ? 41.722  -12.343 -9.947  1.00 138.43 ? 96  LYS B CD  1 
ATOM   1429 C CE  . LYS B 1 81  ? 42.709  -12.695 -8.843  1.00 140.47 ? 96  LYS B CE  1 
ATOM   1430 N NZ  . LYS B 1 81  ? 43.991  -13.242 -9.371  1.00 145.88 ? 96  LYS B NZ  1 
ATOM   1431 N N   . TYR B 1 82  ? 36.769  -9.299  -11.350 1.00 111.24 ? 97  TYR B N   1 
ATOM   1432 C CA  . TYR B 1 82  ? 36.137  -8.317  -12.221 1.00 103.09 ? 97  TYR B CA  1 
ATOM   1433 C C   . TYR B 1 82  ? 35.897  -7.055  -11.404 1.00 101.21 ? 97  TYR B C   1 
ATOM   1434 O O   . TYR B 1 82  ? 36.091  -5.941  -11.888 1.00 101.33 ? 97  TYR B O   1 
ATOM   1435 C CB  . TYR B 1 82  ? 34.821  -8.841  -12.806 1.00 103.50 ? 97  TYR B CB  1 
ATOM   1436 C CG  . TYR B 1 82  ? 33.925  -7.746  -13.350 1.00 114.44 ? 97  TYR B CG  1 
ATOM   1437 C CD1 . TYR B 1 82  ? 34.359  -6.905  -14.369 1.00 125.14 ? 97  TYR B CD1 1 
ATOM   1438 C CD2 . TYR B 1 82  ? 32.645  -7.553  -12.844 1.00 114.88 ? 97  TYR B CD2 1 
ATOM   1439 C CE1 . TYR B 1 82  ? 33.545  -5.899  -14.865 1.00 129.59 ? 97  TYR B CE1 1 
ATOM   1440 C CE2 . TYR B 1 82  ? 31.823  -6.552  -13.335 1.00 118.58 ? 97  TYR B CE2 1 
ATOM   1441 C CZ  . TYR B 1 82  ? 32.277  -5.729  -14.344 1.00 128.34 ? 97  TYR B CZ  1 
ATOM   1442 O OH  . TYR B 1 82  ? 31.463  -4.732  -14.835 1.00 128.26 ? 97  TYR B OH  1 
ATOM   1443 N N   . ILE B 1 83  ? 35.482  -7.244  -10.156 1.00 93.89  ? 98  ILE B N   1 
ATOM   1444 C CA  . ILE B 1 83  ? 35.298  -6.135  -9.230  1.00 97.89  ? 98  ILE B CA  1 
ATOM   1445 C C   . ILE B 1 83  ? 36.650  -5.545  -8.830  1.00 104.90 ? 98  ILE B C   1 
ATOM   1446 O O   . ILE B 1 83  ? 36.810  -4.323  -8.760  1.00 107.83 ? 98  ILE B O   1 
ATOM   1447 C CB  . ILE B 1 83  ? 34.509  -6.578  -7.982  1.00 90.82  ? 98  ILE B CB  1 
ATOM   1448 C CG1 . ILE B 1 83  ? 33.083  -6.969  -8.377  1.00 89.58  ? 98  ILE B CG1 1 
ATOM   1449 C CG2 . ILE B 1 83  ? 34.478  -5.473  -6.940  1.00 88.12  ? 98  ILE B CG2 1 
ATOM   1450 C CD1 . ILE B 1 83  ? 32.205  -7.363  -7.211  1.00 95.78  ? 98  ILE B CD1 1 
ATOM   1451 N N   . ASP B 1 84  ? 37.623  -6.418  -8.582  1.00 107.29 ? 99  ASP B N   1 
ATOM   1452 C CA  . ASP B 1 84  ? 38.991  -5.987  -8.322  1.00 109.70 ? 99  ASP B CA  1 
ATOM   1453 C C   . ASP B 1 84  ? 39.533  -5.224  -9.523  1.00 110.60 ? 99  ASP B C   1 
ATOM   1454 O O   . ASP B 1 84  ? 40.344  -4.310  -9.377  1.00 105.76 ? 99  ASP B O   1 
ATOM   1455 C CB  . ASP B 1 84  ? 39.889  -7.186  -8.013  1.00 117.48 ? 99  ASP B CB  1 
ATOM   1456 C CG  . ASP B 1 84  ? 39.807  -7.621  -6.562  1.00 125.13 ? 99  ASP B CG  1 
ATOM   1457 O OD1 . ASP B 1 84  ? 38.730  -7.470  -5.950  1.00 128.50 ? 99  ASP B OD1 1 
ATOM   1458 O OD2 . ASP B 1 84  ? 40.826  -8.113  -6.036  1.00 127.87 ? 99  ASP B OD2 1 
ATOM   1459 N N   . GLY B 1 85  ? 39.072  -5.600  -10.711 1.00 110.35 ? 100 GLY B N   1 
ATOM   1460 C CA  . GLY B 1 85  ? 39.450  -4.907  -11.927 1.00 108.05 ? 100 GLY B CA  1 
ATOM   1461 C C   . GLY B 1 85  ? 38.877  -3.504  -11.975 1.00 105.74 ? 100 GLY B C   1 
ATOM   1462 O O   . GLY B 1 85  ? 39.593  -2.540  -12.251 1.00 115.41 ? 100 GLY B O   1 
ATOM   1463 N N   . GLN B 1 86  ? 37.581  -3.390  -11.699 1.00 98.88  ? 101 GLN B N   1 
ATOM   1464 C CA  . GLN B 1 86  ? 36.905  -2.099  -11.702 1.00 101.26 ? 101 GLN B CA  1 
ATOM   1465 C C   . GLN B 1 86  ? 37.459  -1.181  -10.615 1.00 98.87  ? 101 GLN B C   1 
ATOM   1466 O O   . GLN B 1 86  ? 37.477  0.040   -10.774 1.00 91.34  ? 101 GLN B O   1 
ATOM   1467 C CB  . GLN B 1 86  ? 35.395  -2.281  -11.513 1.00 101.55 ? 101 GLN B CB  1 
ATOM   1468 C CG  . GLN B 1 86  ? 34.707  -3.088  -12.607 1.00 104.74 ? 101 GLN B CG  1 
ATOM   1469 C CD  . GLN B 1 86  ? 34.657  -2.360  -13.937 1.00 112.00 ? 101 GLN B CD  1 
ATOM   1470 O OE1 . GLN B 1 86  ? 35.658  -2.270  -14.649 1.00 114.41 ? 101 GLN B OE1 1 
ATOM   1471 N NE2 . GLN B 1 86  ? 33.485  -1.836  -14.279 1.00 111.81 ? 101 GLN B NE2 1 
ATOM   1472 N N   . LYS B 1 87  ? 37.914  -1.775  -9.515  1.00 102.03 ? 102 LYS B N   1 
ATOM   1473 C CA  . LYS B 1 87  ? 38.445  -1.009  -8.391  1.00 105.74 ? 102 LYS B CA  1 
ATOM   1474 C C   . LYS B 1 87  ? 39.672  -0.185  -8.774  1.00 114.32 ? 102 LYS B C   1 
ATOM   1475 O O   . LYS B 1 87  ? 39.738  1.011   -8.493  1.00 120.02 ? 102 LYS B O   1 
ATOM   1476 C CB  . LYS B 1 87  ? 38.789  -1.938  -7.227  1.00 116.36 ? 102 LYS B CB  1 
ATOM   1477 C CG  . LYS B 1 87  ? 39.279  -1.215  -5.987  1.00 125.33 ? 102 LYS B CG  1 
ATOM   1478 C CD  . LYS B 1 87  ? 39.653  -2.199  -4.886  1.00 131.76 ? 102 LYS B CD  1 
ATOM   1479 C CE  . LYS B 1 87  ? 40.772  -3.141  -5.324  1.00 132.85 ? 102 LYS B CE  1 
ATOM   1480 N NZ  . LYS B 1 87  ? 41.171  -4.075  -4.232  1.00 126.48 ? 102 LYS B NZ  1 
ATOM   1481 N N   . LYS B 1 88  ? 40.642  -0.829  -9.416  1.00 119.33 ? 103 LYS B N   1 
ATOM   1482 C CA  . LYS B 1 88  ? 41.852  -0.137  -9.843  1.00 122.47 ? 103 LYS B CA  1 
ATOM   1483 C C   . LYS B 1 88  ? 41.586  0.803   -11.013 1.00 122.41 ? 103 LYS B C   1 
ATOM   1484 O O   . LYS B 1 88  ? 42.398  1.678   -11.310 1.00 122.15 ? 103 LYS B O   1 
ATOM   1485 C CB  . LYS B 1 88  ? 42.962  -1.129  -10.198 1.00 127.51 ? 103 LYS B CB  1 
ATOM   1486 C CG  . LYS B 1 88  ? 43.758  -1.617  -9.000  1.00 132.52 ? 103 LYS B CG  1 
ATOM   1487 C CD  . LYS B 1 88  ? 45.150  -2.072  -9.409  1.00 136.37 ? 103 LYS B CD  1 
ATOM   1488 C CE  . LYS B 1 88  ? 46.036  -2.288  -8.192  1.00 138.37 ? 103 LYS B CE  1 
ATOM   1489 N NZ  . LYS B 1 88  ? 47.443  -2.603  -8.569  1.00 142.14 ? 103 LYS B NZ  1 
ATOM   1490 N N   . LYS B 1 89  ? 40.447  0.622   -11.674 1.00 154.24 ? 104 LYS B N   1 
ATOM   1491 C CA  . LYS B 1 89  ? 40.062  1.499   -12.776 1.00 144.57 ? 104 LYS B CA  1 
ATOM   1492 C C   . LYS B 1 89  ? 39.458  2.805   -12.264 1.00 141.92 ? 104 LYS B C   1 
ATOM   1493 O O   . LYS B 1 89  ? 39.140  3.700   -13.047 1.00 128.01 ? 104 LYS B O   1 
ATOM   1494 C CB  . LYS B 1 89  ? 39.087  0.794   -13.725 1.00 142.00 ? 104 LYS B CB  1 
ATOM   1495 C CG  . LYS B 1 89  ? 39.740  -0.239  -14.635 1.00 148.85 ? 104 LYS B CG  1 
ATOM   1496 C CD  . LYS B 1 89  ? 38.785  -0.693  -15.729 1.00 150.44 ? 104 LYS B CD  1 
ATOM   1497 C CE  . LYS B 1 89  ? 39.481  -1.585  -16.742 1.00 153.82 ? 104 LYS B CE  1 
ATOM   1498 N NZ  . LYS B 1 89  ? 38.561  -1.970  -17.847 1.00 160.78 ? 104 LYS B NZ  1 
ATOM   1499 N N   . CYS B 1 90  ? 39.306  2.909   -10.947 1.00 141.11 ? 105 CYS B N   1 
ATOM   1500 C CA  . CYS B 1 90  ? 38.778  4.122   -10.333 1.00 138.69 ? 105 CYS B CA  1 
ATOM   1501 C C   . CYS B 1 90  ? 39.850  5.201   -10.219 1.00 143.91 ? 105 CYS B C   1 
ATOM   1502 O O   . CYS B 1 90  ? 39.554  6.393   -10.305 1.00 137.44 ? 105 CYS B O   1 
ATOM   1503 C CB  . CYS B 1 90  ? 38.194  3.823   -8.951  1.00 134.80 ? 105 CYS B CB  1 
ATOM   1504 S SG  . CYS B 1 90  ? 36.703  2.805   -8.966  1.00 135.98 ? 105 CYS B SG  1 
ATOM   1505 N N   . GLY B 1 91  ? 41.096  4.780   -10.028 1.00 152.38 ? 106 GLY B N   1 
ATOM   1506 C CA  . GLY B 1 91  ? 42.183  5.721   -9.835  1.00 157.34 ? 106 GLY B CA  1 
ATOM   1507 C C   . GLY B 1 91  ? 43.521  5.315   -10.423 1.00 159.99 ? 106 GLY B C   1 
ATOM   1508 O O   . GLY B 1 91  ? 44.466  5.022   -9.690  1.00 165.41 ? 106 GLY B O   1 
ATOM   1509 N N   . GLU B 1 92  ? 43.603  5.305   -11.749 1.00 156.22 ? 107 GLU B N   1 
ATOM   1510 C CA  . GLU B 1 92  ? 44.868  5.080   -12.441 1.00 159.99 ? 107 GLU B CA  1 
ATOM   1511 C C   . GLU B 1 92  ? 44.912  5.914   -13.718 1.00 164.46 ? 107 GLU B C   1 
ATOM   1512 O O   . GLU B 1 92  ? 45.936  5.983   -14.398 1.00 161.93 ? 107 GLU B O   1 
ATOM   1513 C CB  . GLU B 1 92  ? 45.079  3.594   -12.743 1.00 157.34 ? 107 GLU B CB  1 
ATOM   1514 C CG  . GLU B 1 92  ? 44.081  3.001   -13.718 1.00 152.62 ? 107 GLU B CG  1 
ATOM   1515 C CD  . GLU B 1 92  ? 44.308  1.520   -13.951 1.00 157.56 ? 107 GLU B CD  1 
ATOM   1516 O OE1 . GLU B 1 92  ? 45.248  0.958   -13.349 1.00 159.42 ? 107 GLU B OE1 1 
ATOM   1517 O OE2 . GLU B 1 92  ? 43.546  0.917   -14.734 1.00 161.11 ? 107 GLU B OE2 1 
ATOM   1518 N N   . GLU B 1 93  ? 43.786  6.545   -14.035 1.00 165.79 ? 108 GLU B N   1 
ATOM   1519 C CA  . GLU B 1 93  ? 43.719  7.491   -15.140 1.00 159.77 ? 108 GLU B CA  1 
ATOM   1520 C C   . GLU B 1 93  ? 43.527  8.901   -14.601 1.00 155.34 ? 108 GLU B C   1 
ATOM   1521 O O   . GLU B 1 93  ? 42.432  9.266   -14.177 1.00 153.30 ? 108 GLU B O   1 
ATOM   1522 C CB  . GLU B 1 93  ? 42.573  7.142   -16.095 1.00 161.26 ? 108 GLU B CB  1 
ATOM   1523 C CG  . GLU B 1 93  ? 42.292  8.220   -17.138 1.00 163.10 ? 108 GLU B CG  1 
ATOM   1524 C CD  . GLU B 1 93  ? 41.166  7.848   -18.084 1.00 165.63 ? 108 GLU B CD  1 
ATOM   1525 O OE1 . GLU B 1 93  ? 40.366  8.739   -18.441 1.00 163.73 ? 108 GLU B OE1 1 
ATOM   1526 O OE2 . GLU B 1 93  ? 41.087  6.666   -18.479 1.00 168.90 ? 108 GLU B OE2 1 
ATOM   1527 N N   . ARG B 1 94  ? 44.597  9.687   -14.607 1.00 156.07 ? 109 ARG B N   1 
ATOM   1528 C CA  . ARG B 1 94  ? 44.509  11.081  -14.198 1.00 150.58 ? 109 ARG B CA  1 
ATOM   1529 C C   . ARG B 1 94  ? 44.004  11.930  -15.355 1.00 145.53 ? 109 ARG B C   1 
ATOM   1530 O O   . ARG B 1 94  ? 44.584  11.922  -16.440 1.00 147.36 ? 109 ARG B O   1 
ATOM   1531 C CB  . ARG B 1 94  ? 45.867  11.591  -13.716 1.00 148.69 ? 109 ARG B CB  1 
ATOM   1532 C CG  . ARG B 1 94  ? 46.348  10.914  -12.447 1.00 156.98 ? 109 ARG B CG  1 
ATOM   1533 C CD  . ARG B 1 94  ? 47.651  11.509  -11.948 1.00 162.45 ? 109 ARG B CD  1 
ATOM   1534 N NE  . ARG B 1 94  ? 48.084  10.879  -10.704 1.00 174.37 ? 109 ARG B NE  1 
ATOM   1535 C CZ  . ARG B 1 94  ? 48.747  9.729   -10.641 1.00 180.10 ? 109 ARG B CZ  1 
ATOM   1536 N NH1 . ARG B 1 94  ? 49.056  9.078   -11.754 1.00 180.55 ? 109 ARG B NH1 1 
ATOM   1537 N NH2 . ARG B 1 94  ? 49.100  9.229   -9.465  1.00 182.70 ? 109 ARG B NH2 1 
ATOM   1538 N N   . ARG B 1 95  ? 42.913  12.651  -15.125 1.00 142.97 ? 110 ARG B N   1 
ATOM   1539 C CA  . ARG B 1 95  ? 42.354  13.518  -16.152 1.00 144.75 ? 110 ARG B CA  1 
ATOM   1540 C C   . ARG B 1 95  ? 42.321  14.971  -15.698 1.00 143.19 ? 110 ARG B C   1 
ATOM   1541 O O   . ARG B 1 95  ? 42.750  15.294  -14.590 1.00 138.52 ? 110 ARG B O   1 
ATOM   1542 C CB  . ARG B 1 95  ? 40.968  13.035  -16.586 1.00 154.23 ? 110 ARG B CB  1 
ATOM   1543 C CG  . ARG B 1 95  ? 41.016  11.833  -17.517 1.00 160.38 ? 110 ARG B CG  1 
ATOM   1544 C CD  . ARG B 1 95  ? 41.914  12.120  -18.714 1.00 166.94 ? 110 ARG B CD  1 
ATOM   1545 N NE  . ARG B 1 95  ? 42.126  10.943  -19.552 1.00 171.72 ? 110 ARG B NE  1 
ATOM   1546 C CZ  . ARG B 1 95  ? 41.407  10.654  -20.632 1.00 172.15 ? 110 ARG B CZ  1 
ATOM   1547 N NH1 . ARG B 1 95  ? 40.422  11.457  -21.009 1.00 173.85 ? 110 ARG B NH1 1 
ATOM   1548 N NH2 . ARG B 1 95  ? 41.673  9.562   -21.335 1.00 169.53 ? 110 ARG B NH2 1 
ATOM   1549 N N   . ARG B 1 96  ? 41.807  15.842  -16.559 1.00 150.24 ? 111 ARG B N   1 
ATOM   1550 C CA  . ARG B 1 96  ? 41.966  17.276  -16.364 1.00 154.13 ? 111 ARG B CA  1 
ATOM   1551 C C   . ARG B 1 96  ? 40.894  17.919  -15.493 1.00 158.61 ? 111 ARG B C   1 
ATOM   1552 O O   . ARG B 1 96  ? 39.696  17.753  -15.725 1.00 156.28 ? 111 ARG B O   1 
ATOM   1553 C CB  . ARG B 1 96  ? 42.038  17.994  -17.712 1.00 149.53 ? 111 ARG B CB  1 
ATOM   1554 C CG  . ARG B 1 96  ? 42.620  19.397  -17.633 1.00 144.45 ? 111 ARG B CG  1 
ATOM   1555 C CD  . ARG B 1 96  ? 42.640  20.061  -18.999 1.00 146.30 ? 111 ARG B CD  1 
ATOM   1556 N NE  . ARG B 1 96  ? 43.209  19.185  -20.019 1.00 149.56 ? 111 ARG B NE  1 
ATOM   1557 C CZ  . ARG B 1 96  ? 44.492  19.167  -20.362 1.00 152.35 ? 111 ARG B CZ  1 
ATOM   1558 N NH1 . ARG B 1 96  ? 45.353  19.982  -19.767 1.00 150.89 ? 111 ARG B NH1 1 
ATOM   1559 N NH2 . ARG B 1 96  ? 44.916  18.333  -21.303 1.00 152.85 ? 111 ARG B NH2 1 
ATOM   1560 N N   . VAL B 1 97  ? 41.354  18.649  -14.484 1.00 162.56 ? 112 VAL B N   1 
ATOM   1561 C CA  . VAL B 1 97  ? 40.510  19.555  -13.726 1.00 165.85 ? 112 VAL B CA  1 
ATOM   1562 C C   . VAL B 1 97  ? 39.871  20.533  -14.715 1.00 169.18 ? 112 VAL B C   1 
ATOM   1563 O O   . VAL B 1 97  ? 40.576  21.254  -15.424 1.00 169.82 ? 112 VAL B O   1 
ATOM   1564 C CB  . VAL B 1 97  ? 41.358  20.306  -12.669 1.00 168.81 ? 112 VAL B CB  1 
ATOM   1565 C CG1 . VAL B 1 97  ? 40.786  21.681  -12.353 1.00 178.33 ? 112 VAL B CG1 1 
ATOM   1566 C CG2 . VAL B 1 97  ? 41.506  19.465  -11.410 1.00 162.86 ? 112 VAL B CG2 1 
ATOM   1567 N N   . ASN B 1 98  ? 38.542  20.541  -14.789 1.00 149.27 ? 113 ASN B N   1 
ATOM   1568 C CA  . ASN B 1 98  ? 37.698  19.734  -13.915 1.00 141.27 ? 113 ASN B CA  1 
ATOM   1569 C C   . ASN B 1 98  ? 36.782  18.735  -14.619 1.00 130.14 ? 113 ASN B C   1 
ATOM   1570 O O   . ASN B 1 98  ? 35.605  19.017  -14.839 1.00 122.22 ? 113 ASN B O   1 
ATOM   1571 C CB  . ASN B 1 98  ? 36.851  20.644  -13.023 1.00 155.95 ? 113 ASN B CB  1 
ATOM   1572 C CG  . ASN B 1 98  ? 37.593  21.096  -11.789 1.00 165.21 ? 113 ASN B CG  1 
ATOM   1573 O OD1 . ASN B 1 98  ? 38.211  20.288  -11.095 1.00 164.21 ? 113 ASN B OD1 1 
ATOM   1574 N ND2 . ASN B 1 98  ? 37.545  22.393  -11.509 1.00 173.14 ? 113 ASN B ND2 1 
ATOM   1575 N N   . GLN B 1 99  ? 37.324  17.572  -14.969 1.00 131.88 ? 114 GLN B N   1 
ATOM   1576 C CA  . GLN B 1 99  ? 36.496  16.425  -15.322 1.00 134.23 ? 114 GLN B CA  1 
ATOM   1577 C C   . GLN B 1 99  ? 36.179  15.728  -14.009 1.00 121.27 ? 114 GLN B C   1 
ATOM   1578 O O   . GLN B 1 99  ? 35.181  15.015  -13.882 1.00 117.46 ? 114 GLN B O   1 
ATOM   1579 C CB  . GLN B 1 99  ? 37.246  15.466  -16.246 1.00 138.25 ? 114 GLN B CB  1 
ATOM   1580 C CG  . GLN B 1 99  ? 37.701  16.075  -17.560 1.00 145.35 ? 114 GLN B CG  1 
ATOM   1581 C CD  . GLN B 1 99  ? 38.678  15.184  -18.306 1.00 150.77 ? 114 GLN B CD  1 
ATOM   1582 O OE1 . GLN B 1 99  ? 39.761  15.622  -18.695 1.00 157.14 ? 114 GLN B OE1 1 
ATOM   1583 N NE2 . GLN B 1 99  ? 38.299  13.927  -18.510 1.00 146.41 ? 114 GLN B NE2 1 
ATOM   1584 N N   . PHE B 1 100 ? 37.056  15.951  -13.035 1.00 112.49 ? 115 PHE B N   1 
ATOM   1585 C CA  . PHE B 1 100 ? 36.910  15.409  -11.693 1.00 109.78 ? 115 PHE B CA  1 
ATOM   1586 C C   . PHE B 1 100 ? 35.664  15.962  -11.017 1.00 107.64 ? 115 PHE B C   1 
ATOM   1587 O O   . PHE B 1 100 ? 34.897  15.217  -10.408 1.00 103.68 ? 115 PHE B O   1 
ATOM   1588 C CB  . PHE B 1 100 ? 38.150  15.737  -10.857 1.00 112.10 ? 115 PHE B CB  1 
ATOM   1589 C CG  . PHE B 1 100 ? 38.042  15.317  -9.419  1.00 113.41 ? 115 PHE B CG  1 
ATOM   1590 C CD1 . PHE B 1 100 ? 38.249  13.998  -9.052  1.00 111.12 ? 115 PHE B CD1 1 
ATOM   1591 C CD2 . PHE B 1 100 ? 37.742  16.244  -8.432  1.00 113.75 ? 115 PHE B CD2 1 
ATOM   1592 C CE1 . PHE B 1 100 ? 38.151  13.608  -7.732  1.00 105.51 ? 115 PHE B CE1 1 
ATOM   1593 C CE2 . PHE B 1 100 ? 37.643  15.859  -7.110  1.00 105.68 ? 115 PHE B CE2 1 
ATOM   1594 C CZ  . PHE B 1 100 ? 37.847  14.540  -6.759  1.00 103.33 ? 115 PHE B CZ  1 
ATOM   1595 N N   . LEU B 1 101 ? 35.467  17.273  -11.122 1.00 113.75 ? 116 LEU B N   1 
ATOM   1596 C CA  . LEU B 1 101 ? 34.295  17.902  -10.529 1.00 114.44 ? 116 LEU B CA  1 
ATOM   1597 C C   . LEU B 1 101 ? 33.015  17.473  -11.235 1.00 112.73 ? 116 LEU B C   1 
ATOM   1598 O O   . LEU B 1 101 ? 31.967  17.366  -10.604 1.00 113.36 ? 116 LEU B O   1 
ATOM   1599 C CB  . LEU B 1 101 ? 34.422  19.427  -10.520 1.00 117.23 ? 116 LEU B CB  1 
ATOM   1600 C CG  . LEU B 1 101 ? 35.392  20.019  -9.494  1.00 117.17 ? 116 LEU B CG  1 
ATOM   1601 C CD1 . LEU B 1 101 ? 35.160  21.512  -9.350  1.00 122.70 ? 116 LEU B CD1 1 
ATOM   1602 C CD2 . LEU B 1 101 ? 35.272  19.322  -8.149  1.00 115.16 ? 116 LEU B CD2 1 
ATOM   1603 N N   . ASP B 1 102 ? 33.105  17.223  -12.539 1.00 111.43 ? 117 ASP B N   1 
ATOM   1604 C CA  . ASP B 1 102 ? 31.967  16.717  -13.300 1.00 116.09 ? 117 ASP B CA  1 
ATOM   1605 C C   . ASP B 1 102 ? 31.523  15.377  -12.730 1.00 113.31 ? 117 ASP B C   1 
ATOM   1606 O O   . ASP B 1 102 ? 30.332  15.124  -12.547 1.00 116.17 ? 117 ASP B O   1 
ATOM   1607 C CB  . ASP B 1 102 ? 32.337  16.542  -14.773 1.00 122.91 ? 117 ASP B CB  1 
ATOM   1608 C CG  . ASP B 1 102 ? 32.848  17.820  -15.404 1.00 127.74 ? 117 ASP B CG  1 
ATOM   1609 O OD1 . ASP B 1 102 ? 32.567  18.911  -14.866 1.00 131.71 ? 117 ASP B OD1 1 
ATOM   1610 O OD2 . ASP B 1 102 ? 33.529  17.729  -16.447 1.00 125.14 ? 117 ASP B OD2 1 
ATOM   1611 N N   . TYR B 1 103 ? 32.503  14.524  -12.454 1.00 111.16 ? 118 TYR B N   1 
ATOM   1612 C CA  . TYR B 1 103 ? 32.262  13.212  -11.872 1.00 111.81 ? 118 TYR B CA  1 
ATOM   1613 C C   . TYR B 1 103 ? 31.672  13.354  -10.474 1.00 104.35 ? 118 TYR B C   1 
ATOM   1614 O O   . TYR B 1 103 ? 30.817  12.567  -10.067 1.00 102.53 ? 118 TYR B O   1 
ATOM   1615 C CB  . TYR B 1 103 ? 33.575  12.427  -11.815 1.00 119.57 ? 118 TYR B CB  1 
ATOM   1616 C CG  . TYR B 1 103 ? 33.440  11.003  -11.331 1.00 125.52 ? 118 TYR B CG  1 
ATOM   1617 C CD1 . TYR B 1 103 ? 32.831  10.037  -12.122 1.00 131.45 ? 118 TYR B CD1 1 
ATOM   1618 C CD2 . TYR B 1 103 ? 33.938  10.618  -10.092 1.00 123.41 ? 118 TYR B CD2 1 
ATOM   1619 C CE1 . TYR B 1 103 ? 32.709  8.730   -11.689 1.00 132.33 ? 118 TYR B CE1 1 
ATOM   1620 C CE2 . TYR B 1 103 ? 33.821  9.312   -9.649  1.00 125.86 ? 118 TYR B CE2 1 
ATOM   1621 C CZ  . TYR B 1 103 ? 33.205  8.372   -10.452 1.00 130.54 ? 118 TYR B CZ  1 
ATOM   1622 O OH  . TYR B 1 103 ? 33.083  7.070   -10.023 1.00 127.42 ? 118 TYR B OH  1 
ATOM   1623 N N   . LEU B 1 104 ? 32.125  14.372  -9.750  1.00 105.37 ? 119 LEU B N   1 
ATOM   1624 C CA  . LEU B 1 104 ? 31.697  14.592  -8.374  1.00 100.24 ? 119 LEU B CA  1 
ATOM   1625 C C   . LEU B 1 104 ? 30.222  14.983  -8.277  1.00 106.62 ? 119 LEU B C   1 
ATOM   1626 O O   . LEU B 1 104 ? 29.534  14.589  -7.336  1.00 100.66 ? 119 LEU B O   1 
ATOM   1627 C CB  . LEU B 1 104 ? 32.579  15.652  -7.710  1.00 96.60  ? 119 LEU B CB  1 
ATOM   1628 C CG  . LEU B 1 104 ? 32.340  15.943  -6.227  1.00 91.47  ? 119 LEU B CG  1 
ATOM   1629 C CD1 . LEU B 1 104 ? 32.492  14.680  -5.399  1.00 81.22  ? 119 LEU B CD1 1 
ATOM   1630 C CD2 . LEU B 1 104 ? 33.302  17.013  -5.750  1.00 94.12  ? 119 LEU B CD2 1 
ATOM   1631 N N   . GLN B 1 105 ? 29.742  15.750  -9.252  1.00 116.97 ? 120 GLN B N   1 
ATOM   1632 C CA  . GLN B 1 105 ? 28.338  16.151  -9.287  1.00 128.19 ? 120 GLN B CA  1 
ATOM   1633 C C   . GLN B 1 105 ? 27.438  14.928  -9.427  1.00 125.78 ? 120 GLN B C   1 
ATOM   1634 O O   . GLN B 1 105 ? 26.430  14.802  -8.729  1.00 124.95 ? 120 GLN B O   1 
ATOM   1635 C CB  . GLN B 1 105 ? 28.070  17.119  -10.445 1.00 149.79 ? 120 GLN B CB  1 
ATOM   1636 C CG  . GLN B 1 105 ? 29.042  18.287  -10.557 1.00 166.13 ? 120 GLN B CG  1 
ATOM   1637 C CD  . GLN B 1 105 ? 28.901  19.312  -9.445  1.00 177.15 ? 120 GLN B CD  1 
ATOM   1638 O OE1 . GLN B 1 105 ? 27.996  19.236  -8.614  1.00 183.04 ? 120 GLN B OE1 1 
ATOM   1639 N NE2 . GLN B 1 105 ? 29.805  20.286  -9.429  1.00 178.17 ? 120 GLN B NE2 1 
ATOM   1640 N N   . GLU B 1 106 ? 27.812  14.034  -10.339 1.00 126.74 ? 121 GLU B N   1 
ATOM   1641 C CA  . GLU B 1 106 ? 27.089  12.785  -10.548 1.00 129.54 ? 121 GLU B CA  1 
ATOM   1642 C C   . GLU B 1 106 ? 27.076  11.956  -9.269  1.00 126.69 ? 121 GLU B C   1 
ATOM   1643 O O   . GLU B 1 106 ? 26.040  11.424  -8.872  1.00 131.95 ? 121 GLU B O   1 
ATOM   1644 C CB  . GLU B 1 106 ? 27.732  11.972  -11.674 1.00 134.28 ? 121 GLU B CB  1 
ATOM   1645 C CG  . GLU B 1 106 ? 27.561  12.550  -13.070 1.00 146.29 ? 121 GLU B CG  1 
ATOM   1646 C CD  . GLU B 1 106 ? 28.256  11.708  -14.125 1.00 149.89 ? 121 GLU B CD  1 
ATOM   1647 O OE1 . GLU B 1 106 ? 29.199  10.969  -13.769 1.00 145.26 ? 121 GLU B OE1 1 
ATOM   1648 O OE2 . GLU B 1 106 ? 27.856  11.778  -15.307 1.00 154.20 ? 121 GLU B OE2 1 
ATOM   1649 N N   . PHE B 1 107 ? 28.240  11.860  -8.633  1.00 116.50 ? 122 PHE B N   1 
ATOM   1650 C CA  . PHE B 1 107 ? 28.404  11.096  -7.401  1.00 102.47 ? 122 PHE B CA  1 
ATOM   1651 C C   . PHE B 1 107 ? 27.469  11.579  -6.299  1.00 102.46 ? 122 PHE B C   1 
ATOM   1652 O O   . PHE B 1 107 ? 26.732  10.788  -5.709  1.00 98.86  ? 122 PHE B O   1 
ATOM   1653 C CB  . PHE B 1 107 ? 29.859  11.170  -6.934  1.00 100.95 ? 122 PHE B CB  1 
ATOM   1654 C CG  . PHE B 1 107 ? 30.091  10.610  -5.560  1.00 100.93 ? 122 PHE B CG  1 
ATOM   1655 C CD1 . PHE B 1 107 ? 29.869  9.268   -5.293  1.00 102.76 ? 122 PHE B CD1 1 
ATOM   1656 C CD2 . PHE B 1 107 ? 30.552  11.424  -4.538  1.00 100.91 ? 122 PHE B CD2 1 
ATOM   1657 C CE1 . PHE B 1 107 ? 30.089  8.751   -4.028  1.00 100.17 ? 122 PHE B CE1 1 
ATOM   1658 C CE2 . PHE B 1 107 ? 30.776  10.913  -3.273  1.00 97.57  ? 122 PHE B CE2 1 
ATOM   1659 C CZ  . PHE B 1 107 ? 30.546  9.576   -3.019  1.00 94.32  ? 122 PHE B CZ  1 
ATOM   1660 N N   . LEU B 1 108 ? 27.498  12.879  -6.028  1.00 103.55 ? 123 LEU B N   1 
ATOM   1661 C CA  . LEU B 1 108 ? 26.636  13.463  -5.007  1.00 109.50 ? 123 LEU B CA  1 
ATOM   1662 C C   . LEU B 1 108 ? 25.168  13.425  -5.430  1.00 118.32 ? 123 LEU B C   1 
ATOM   1663 O O   . LEU B 1 108 ? 24.272  13.348  -4.589  1.00 125.36 ? 123 LEU B O   1 
ATOM   1664 C CB  . LEU B 1 108 ? 27.061  14.901  -4.698  1.00 105.20 ? 123 LEU B CB  1 
ATOM   1665 C CG  . LEU B 1 108 ? 28.439  15.096  -4.062  1.00 94.36  ? 123 LEU B CG  1 
ATOM   1666 C CD1 . LEU B 1 108 ? 28.699  16.567  -3.801  1.00 79.85  ? 123 LEU B CD1 1 
ATOM   1667 C CD2 . LEU B 1 108 ? 28.529  14.304  -2.776  1.00 97.44  ? 123 LEU B CD2 1 
ATOM   1668 N N   . GLY B 1 109 ? 24.927  13.479  -6.737  1.00 112.04 ? 124 GLY B N   1 
ATOM   1669 C CA  . GLY B 1 109 ? 23.578  13.391  -7.266  1.00 107.83 ? 124 GLY B CA  1 
ATOM   1670 C C   . GLY B 1 109 ? 22.974  12.015  -7.056  1.00 109.75 ? 124 GLY B C   1 
ATOM   1671 O O   . GLY B 1 109 ? 21.797  11.889  -6.717  1.00 107.74 ? 124 GLY B O   1 
ATOM   1672 N N   . VAL B 1 110 ? 23.786  10.982  -7.262  1.00 107.76 ? 125 VAL B N   1 
ATOM   1673 C CA  . VAL B 1 110 ? 23.353  9.603   -7.060  1.00 112.88 ? 125 VAL B CA  1 
ATOM   1674 C C   . VAL B 1 110 ? 23.010  9.349   -5.595  1.00 106.93 ? 125 VAL B C   1 
ATOM   1675 O O   . VAL B 1 110 ? 21.955  8.794   -5.278  1.00 104.96 ? 125 VAL B O   1 
ATOM   1676 C CB  . VAL B 1 110 ? 24.441  8.603   -7.514  1.00 120.00 ? 125 VAL B CB  1 
ATOM   1677 C CG1 . VAL B 1 110 ? 24.151  7.211   -6.977  1.00 125.30 ? 125 VAL B CG1 1 
ATOM   1678 C CG2 . VAL B 1 110 ? 24.534  8.581   -9.027  1.00 129.49 ? 125 VAL B CG2 1 
ATOM   1679 N N   . MET B 1 111 ? 23.910  9.774   -4.712  1.00 104.29 ? 126 MET B N   1 
ATOM   1680 C CA  . MET B 1 111 ? 23.736  9.643   -3.269  1.00 105.13 ? 126 MET B CA  1 
ATOM   1681 C C   . MET B 1 111 ? 22.440  10.306  -2.821  1.00 106.83 ? 126 MET B C   1 
ATOM   1682 O O   . MET B 1 111 ? 21.774  9.839   -1.896  1.00 105.84 ? 126 MET B O   1 
ATOM   1683 C CB  . MET B 1 111 ? 24.923  10.291  -2.556  1.00 105.50 ? 126 MET B CB  1 
ATOM   1684 C CG  . MET B 1 111 ? 25.068  9.930   -1.091  1.00 108.50 ? 126 MET B CG  1 
ATOM   1685 S SD  . MET B 1 111 ? 26.460  10.785  -0.331  1.00 96.86  ? 126 MET B SD  1 
ATOM   1686 C CE  . MET B 1 111 ? 27.584  10.875  -1.724  1.00 85.75  ? 126 MET B CE  1 
ATOM   1687 N N   . ASN B 1 112 ? 22.090  11.395  -3.498  1.00 117.30 ? 127 ASN B N   1 
ATOM   1688 C CA  . ASN B 1 112 ? 20.874  12.140  -3.209  1.00 128.76 ? 127 ASN B CA  1 
ATOM   1689 C C   . ASN B 1 112 ? 19.628  11.411  -3.707  1.00 133.64 ? 127 ASN B C   1 
ATOM   1690 O O   . ASN B 1 112 ? 18.661  11.239  -2.965  1.00 139.03 ? 127 ASN B O   1 
ATOM   1691 C CB  . ASN B 1 112 ? 20.956  13.538  -3.830  1.00 131.85 ? 127 ASN B CB  1 
ATOM   1692 C CG  . ASN B 1 112 ? 19.833  14.451  -3.372  1.00 139.83 ? 127 ASN B CG  1 
ATOM   1693 O OD1 . ASN B 1 112 ? 19.203  14.212  -2.342  1.00 144.81 ? 127 ASN B OD1 1 
ATOM   1694 N ND2 . ASN B 1 112 ? 19.579  15.507  -4.138  1.00 140.88 ? 127 ASN B ND2 1 
ATOM   1695 N N   . THR B 1 113 ? 19.662  10.974  -4.963  1.00 134.63 ? 128 THR B N   1 
ATOM   1696 C CA  . THR B 1 113 ? 18.518  10.300  -5.572  1.00 140.67 ? 128 THR B CA  1 
ATOM   1697 C C   . THR B 1 113 ? 18.396  8.833   -5.162  1.00 145.16 ? 128 THR B C   1 
ATOM   1698 O O   . THR B 1 113 ? 17.378  8.418   -4.609  1.00 148.33 ? 128 THR B O   1 
ATOM   1699 C CB  . THR B 1 113 ? 18.569  10.369  -7.115  1.00 135.40 ? 128 THR B CB  1 
ATOM   1700 O OG1 . THR B 1 113 ? 19.699  9.630   -7.596  1.00 133.26 ? 128 THR B OG1 1 
ATOM   1701 C CG2 . THR B 1 113 ? 18.667  11.810  -7.586  1.00 131.73 ? 128 THR B CG2 1 
ATOM   1702 N N   . GLU B 1 114 ? 19.441  8.058   -5.436  1.00 141.62 ? 129 GLU B N   1 
ATOM   1703 C CA  . GLU B 1 114 ? 19.381  6.604   -5.304  1.00 146.00 ? 129 GLU B CA  1 
ATOM   1704 C C   . GLU B 1 114 ? 19.498  6.084   -3.870  1.00 151.25 ? 129 GLU B C   1 
ATOM   1705 O O   . GLU B 1 114 ? 18.584  5.423   -3.374  1.00 162.02 ? 129 GLU B O   1 
ATOM   1706 C CB  . GLU B 1 114 ? 20.440  5.942   -6.194  1.00 145.68 ? 129 GLU B CB  1 
ATOM   1707 C CG  . GLU B 1 114 ? 20.285  6.249   -7.677  1.00 148.34 ? 129 GLU B CG  1 
ATOM   1708 C CD  . GLU B 1 114 ? 21.220  5.431   -8.549  1.00 155.98 ? 129 GLU B CD  1 
ATOM   1709 O OE1 . GLU B 1 114 ? 21.716  4.384   -8.078  1.00 158.22 ? 129 GLU B OE1 1 
ATOM   1710 O OE2 . GLU B 1 114 ? 21.460  5.837   -9.706  1.00 158.85 ? 129 GLU B OE2 1 
ATOM   1711 N N   . TRP B 1 115 ? 20.620  6.383   -3.218  1.00 147.09 ? 130 TRP B N   1 
ATOM   1712 C CA  . TRP B 1 115 ? 20.937  5.846   -1.891  1.00 149.09 ? 130 TRP B CA  1 
ATOM   1713 C C   . TRP B 1 115 ? 19.823  6.025   -0.861  1.00 157.60 ? 130 TRP B C   1 
ATOM   1714 O O   . TRP B 1 115 ? 19.063  6.992   -0.911  1.00 159.89 ? 130 TRP B O   1 
ATOM   1715 C CB  . TRP B 1 115 ? 22.204  6.500   -1.326  1.00 145.91 ? 130 TRP B CB  1 
ATOM   1716 C CG  . TRP B 1 115 ? 23.480  6.238   -2.076  1.00 141.53 ? 130 TRP B CG  1 
ATOM   1717 C CD1 . TRP B 1 115 ? 23.614  5.901   -3.391  1.00 144.27 ? 130 TRP B CD1 1 
ATOM   1718 C CD2 . TRP B 1 115 ? 24.810  6.302   -1.541  1.00 133.59 ? 130 TRP B CD2 1 
ATOM   1719 N NE1 . TRP B 1 115 ? 24.944  5.755   -3.708  1.00 143.06 ? 130 TRP B NE1 1 
ATOM   1720 C CE2 . TRP B 1 115 ? 25.696  5.994   -2.591  1.00 136.51 ? 130 TRP B CE2 1 
ATOM   1721 C CE3 . TRP B 1 115 ? 25.332  6.589   -0.277  1.00 129.63 ? 130 TRP B CE3 1 
ATOM   1722 C CZ2 . TRP B 1 115 ? 27.081  5.967   -2.413  1.00 132.94 ? 130 TRP B CZ2 1 
ATOM   1723 C CZ3 . TRP B 1 115 ? 26.705  6.562   -0.104  1.00 128.46 ? 130 TRP B CZ3 1 
ATOM   1724 C CH2 . TRP B 1 115 ? 27.563  6.252   -1.165  1.00 128.97 ? 130 TRP B CH2 1 
ATOM   1725 N N   . ILE B 1 116 ? 19.736  5.082   0.072   1.00 166.08 ? 131 ILE B N   1 
ATOM   1726 C CA  . ILE B 1 116 ? 18.887  5.241   1.246   1.00 175.29 ? 131 ILE B CA  1 
ATOM   1727 C C   . ILE B 1 116 ? 19.711  5.912   2.340   1.00 189.77 ? 131 ILE B C   1 
ATOM   1728 O O   . ILE B 1 116 ? 20.819  5.471   2.648   1.00 187.13 ? 131 ILE B O   1 
ATOM   1729 C CB  . ILE B 1 116 ? 18.347  3.884   1.754   1.00 169.35 ? 131 ILE B CB  1 
ATOM   1730 C CG1 . ILE B 1 116 ? 17.292  3.330   0.792   1.00 174.01 ? 131 ILE B CG1 1 
ATOM   1731 C CG2 . ILE B 1 116 ? 17.750  4.028   3.146   1.00 166.40 ? 131 ILE B CG2 1 
ATOM   1732 C CD1 . ILE B 1 116 ? 16.063  4.207   0.656   1.00 175.24 ? 131 ILE B CD1 1 
ATOM   1733 N N   . ILE B 1 117 ? 19.182  6.990   2.911   1.00 88.27  ? 132 ILE B N   1 
ATOM   1734 C CA  . ILE B 1 117 ? 19.897  7.737   3.941   1.00 93.90  ? 132 ILE B CA  1 
ATOM   1735 C C   . ILE B 1 117 ? 19.043  7.935   5.189   1.00 96.54  ? 132 ILE B C   1 
ATOM   1736 O O   . ILE B 1 117 ? 19.436  7.543   6.288   1.00 102.66 ? 132 ILE B O   1 
ATOM   1737 C CB  . ILE B 1 117 ? 20.350  9.115   3.422   1.00 96.32  ? 132 ILE B CB  1 
ATOM   1738 C CG1 . ILE B 1 117 ? 21.365  8.950   2.289   1.00 90.58  ? 132 ILE B CG1 1 
ATOM   1739 C CG2 . ILE B 1 117 ? 20.945  9.940   4.548   1.00 102.75 ? 132 ILE B CG2 1 
ATOM   1740 C CD1 . ILE B 1 117 ? 21.818  10.259  1.687   1.00 89.10  ? 132 ILE B CD1 1 
ATOM   1741 N N   . LYS C 2 14  ? 43.096  -15.077 33.114  1.00 177.35 ? 27  LYS C N   1 
ATOM   1742 C CA  . LYS C 2 14  ? 42.174  -14.987 34.240  1.00 173.85 ? 27  LYS C CA  1 
ATOM   1743 C C   . LYS C 2 14  ? 41.025  -14.035 33.935  1.00 171.54 ? 27  LYS C C   1 
ATOM   1744 O O   . LYS C 2 14  ? 41.140  -12.826 34.140  1.00 174.13 ? 27  LYS C O   1 
ATOM   1745 C CB  . LYS C 2 14  ? 42.907  -14.528 35.502  1.00 172.63 ? 27  LYS C CB  1 
ATOM   1746 C CG  . LYS C 2 14  ? 43.895  -15.542 36.050  1.00 173.64 ? 27  LYS C CG  1 
ATOM   1747 C CD  . LYS C 2 14  ? 43.196  -16.830 36.448  1.00 168.10 ? 27  LYS C CD  1 
ATOM   1748 C CE  . LYS C 2 14  ? 44.172  -17.813 37.072  1.00 170.95 ? 27  LYS C CE  1 
ATOM   1749 N NZ  . LYS C 2 14  ? 43.503  -19.085 37.458  1.00 166.93 ? 27  LYS C NZ  1 
ATOM   1750 N N   . ILE C 2 15  ? 39.918  -14.587 33.447  1.00 164.83 ? 28  ILE C N   1 
ATOM   1751 C CA  . ILE C 2 15  ? 38.747  -13.784 33.107  1.00 156.53 ? 28  ILE C CA  1 
ATOM   1752 C C   . ILE C 2 15  ? 37.418  -14.471 33.430  1.00 143.36 ? 28  ILE C C   1 
ATOM   1753 O O   . ILE C 2 15  ? 37.166  -15.603 33.013  1.00 136.97 ? 28  ILE C O   1 
ATOM   1754 C CB  . ILE C 2 15  ? 38.756  -13.360 31.616  1.00 137.13 ? 28  ILE C CB  1 
ATOM   1755 C CG1 . ILE C 2 15  ? 39.656  -12.139 31.413  1.00 140.67 ? 28  ILE C CG1 1 
ATOM   1756 C CG2 . ILE C 2 15  ? 37.349  -13.040 31.134  1.00 128.28 ? 28  ILE C CG2 1 
ATOM   1757 C CD1 . ILE C 2 15  ? 39.548  -11.514 30.038  1.00 136.43 ? 28  ILE C CD1 1 
ATOM   1758 N N   . SER C 2 16  ? 36.580  -13.772 34.190  1.00 134.51 ? 29  SER C N   1 
ATOM   1759 C CA  . SER C 2 16  ? 35.189  -14.160 34.376  1.00 121.24 ? 29  SER C CA  1 
ATOM   1760 C C   . SER C 2 16  ? 34.315  -13.129 33.670  1.00 111.18 ? 29  SER C C   1 
ATOM   1761 O O   . SER C 2 16  ? 34.376  -11.941 33.986  1.00 110.31 ? 29  SER C O   1 
ATOM   1762 C CB  . SER C 2 16  ? 34.840  -14.217 35.862  1.00 122.41 ? 29  SER C CB  1 
ATOM   1763 O OG  . SER C 2 16  ? 33.465  -14.502 36.049  1.00 121.62 ? 29  SER C OG  1 
ATOM   1764 N N   . LEU C 2 17  ? 33.510  -13.577 32.710  1.00 103.37 ? 30  LEU C N   1 
ATOM   1765 C CA  . LEU C 2 17  ? 32.746  -12.651 31.877  1.00 91.09  ? 30  LEU C CA  1 
ATOM   1766 C C   . LEU C 2 17  ? 31.541  -12.035 32.569  1.00 91.42  ? 30  LEU C C   1 
ATOM   1767 O O   . LEU C 2 17  ? 30.648  -12.739 33.040  1.00 100.03 ? 30  LEU C O   1 
ATOM   1768 C CB  . LEU C 2 17  ? 32.306  -13.310 30.568  1.00 91.44  ? 30  LEU C CB  1 
ATOM   1769 C CG  . LEU C 2 17  ? 33.266  -13.127 29.390  1.00 91.65  ? 30  LEU C CG  1 
ATOM   1770 C CD1 . LEU C 2 17  ? 32.584  -13.467 28.080  1.00 85.92  ? 30  LEU C CD1 1 
ATOM   1771 C CD2 . LEU C 2 17  ? 33.805  -11.709 29.360  1.00 89.21  ? 30  LEU C CD2 1 
ATOM   1772 N N   . LEU C 2 18  ? 31.523  -10.707 32.612  1.00 92.89  ? 31  LEU C N   1 
ATOM   1773 C CA  . LEU C 2 18  ? 30.395  -9.969  33.158  1.00 95.65  ? 31  LEU C CA  1 
ATOM   1774 C C   . LEU C 2 18  ? 29.441  -9.576  32.034  1.00 96.69  ? 31  LEU C C   1 
ATOM   1775 O O   . LEU C 2 18  ? 29.878  -9.170  30.957  1.00 91.85  ? 31  LEU C O   1 
ATOM   1776 C CB  . LEU C 2 18  ? 30.888  -8.722  33.896  1.00 96.45  ? 31  LEU C CB  1 
ATOM   1777 C CG  . LEU C 2 18  ? 31.882  -8.975  35.032  1.00 96.09  ? 31  LEU C CG  1 
ATOM   1778 C CD1 . LEU C 2 18  ? 32.231  -7.685  35.760  1.00 92.93  ? 31  LEU C CD1 1 
ATOM   1779 C CD2 . LEU C 2 18  ? 31.323  -10.005 35.999  1.00 92.01  ? 31  LEU C CD2 1 
ATOM   1780 N N   . PRO C 2 19  ? 28.128  -9.703  32.280  1.00 102.18 ? 32  PRO C N   1 
ATOM   1781 C CA  . PRO C 2 19  ? 27.120  -9.331  31.282  1.00 99.55  ? 32  PRO C CA  1 
ATOM   1782 C C   . PRO C 2 19  ? 27.078  -7.821  31.078  1.00 94.70  ? 32  PRO C C   1 
ATOM   1783 O O   . PRO C 2 19  ? 27.457  -7.080  31.986  1.00 95.65  ? 32  PRO C O   1 
ATOM   1784 C CB  . PRO C 2 19  ? 25.811  -9.810  31.918  1.00 94.29  ? 32  PRO C CB  1 
ATOM   1785 C CG  . PRO C 2 19  ? 26.074  -9.768  33.382  1.00 84.86  ? 32  PRO C CG  1 
ATOM   1786 C CD  . PRO C 2 19  ? 27.516  -10.166 33.537  1.00 95.75  ? 32  PRO C CD  1 
ATOM   1787 N N   . PRO C 2 20  ? 26.624  -7.365  29.899  1.00 89.72  ? 33  PRO C N   1 
ATOM   1788 C CA  . PRO C 2 20  ? 26.521  -5.921  29.667  1.00 81.59  ? 33  PRO C CA  1 
ATOM   1789 C C   . PRO C 2 20  ? 25.434  -5.310  30.539  1.00 84.81  ? 33  PRO C C   1 
ATOM   1790 O O   . PRO C 2 20  ? 24.596  -6.038  31.070  1.00 83.70  ? 33  PRO C O   1 
ATOM   1791 C CB  . PRO C 2 20  ? 26.129  -5.830  28.189  1.00 82.94  ? 33  PRO C CB  1 
ATOM   1792 C CG  . PRO C 2 20  ? 25.469  -7.127  27.890  1.00 82.41  ? 33  PRO C CG  1 
ATOM   1793 C CD  . PRO C 2 20  ? 26.178  -8.147  28.733  1.00 85.29  ? 33  PRO C CD  1 
ATOM   1794 N N   . VAL C 2 21  ? 25.453  -3.991  30.688  1.00 86.16  ? 34  VAL C N   1 
ATOM   1795 C CA  . VAL C 2 21  ? 24.464  -3.302  31.507  1.00 88.52  ? 34  VAL C CA  1 
ATOM   1796 C C   . VAL C 2 21  ? 23.731  -2.244  30.692  1.00 89.43  ? 34  VAL C C   1 
ATOM   1797 O O   . VAL C 2 21  ? 24.075  -2.000  29.535  1.00 76.36  ? 34  VAL C O   1 
ATOM   1798 C CB  . VAL C 2 21  ? 25.115  -2.638  32.732  1.00 94.98  ? 34  VAL C CB  1 
ATOM   1799 C CG1 . VAL C 2 21  ? 25.626  -3.696  33.699  1.00 96.93  ? 34  VAL C CG1 1 
ATOM   1800 C CG2 . VAL C 2 21  ? 26.242  -1.710  32.295  1.00 92.36  ? 34  VAL C CG2 1 
ATOM   1801 N N   . ASN C 2 22  ? 22.725  -1.625  31.308  1.00 89.82  ? 35  ASN C N   1 
ATOM   1802 C CA  . ASN C 2 22  ? 21.936  -0.575  30.668  1.00 85.50  ? 35  ASN C CA  1 
ATOM   1803 C C   . ASN C 2 22  ? 21.374  -1.008  29.317  1.00 85.03  ? 35  ASN C C   1 
ATOM   1804 O O   . ASN C 2 22  ? 21.416  -0.253  28.346  1.00 83.36  ? 35  ASN C O   1 
ATOM   1805 C CB  . ASN C 2 22  ? 22.763  0.707   30.516  1.00 89.34  ? 35  ASN C CB  1 
ATOM   1806 C CG  . ASN C 2 22  ? 23.164  1.310   31.855  1.00 112.64 ? 35  ASN C CG  1 
ATOM   1807 O OD1 . ASN C 2 22  ? 22.379  1.328   32.803  1.00 122.71 ? 35  ASN C OD1 1 
ATOM   1808 N ND2 . ASN C 2 22  ? 24.394  1.809   31.935  1.00 117.23 ? 35  ASN C ND2 1 
ATOM   1809 N N   . PHE C 2 23  ? 20.859  -2.232  29.258  1.00 82.44  ? 36  PHE C N   1 
ATOM   1810 C CA  . PHE C 2 23  ? 20.317  -2.771  28.016  1.00 79.51  ? 36  PHE C CA  1 
ATOM   1811 C C   . PHE C 2 23  ? 18.917  -2.233  27.746  1.00 86.56  ? 36  PHE C C   1 
ATOM   1812 O O   . PHE C 2 23  ? 17.975  -2.540  28.474  1.00 87.14  ? 36  PHE C O   1 
ATOM   1813 C CB  . PHE C 2 23  ? 20.306  -4.300  28.044  1.00 72.60  ? 36  PHE C CB  1 
ATOM   1814 C CG  . PHE C 2 23  ? 19.732  -4.924  26.802  1.00 75.62  ? 36  PHE C CG  1 
ATOM   1815 C CD1 . PHE C 2 23  ? 20.073  -4.445  25.546  1.00 78.62  ? 36  PHE C CD1 1 
ATOM   1816 C CD2 . PHE C 2 23  ? 18.862  -5.998  26.890  1.00 74.33  ? 36  PHE C CD2 1 
ATOM   1817 C CE1 . PHE C 2 23  ? 19.548  -5.019  24.402  1.00 76.73  ? 36  PHE C CE1 1 
ATOM   1818 C CE2 . PHE C 2 23  ? 18.334  -6.576  25.749  1.00 70.02  ? 36  PHE C CE2 1 
ATOM   1819 C CZ  . PHE C 2 23  ? 18.678  -6.088  24.503  1.00 70.54  ? 36  PHE C CZ  1 
ATOM   1820 N N   . THR C 2 24  ? 18.789  -1.432  26.692  1.00 91.62  ? 37  THR C N   1 
ATOM   1821 C CA  . THR C 2 24  ? 17.512  -0.814  26.358  1.00 88.42  ? 37  THR C CA  1 
ATOM   1822 C C   . THR C 2 24  ? 16.966  -1.299  25.020  1.00 83.08  ? 37  THR C C   1 
ATOM   1823 O O   . THR C 2 24  ? 17.708  -1.799  24.173  1.00 87.11  ? 37  THR C O   1 
ATOM   1824 C CB  . THR C 2 24  ? 17.623  0.728   26.301  1.00 93.14  ? 37  THR C CB  1 
ATOM   1825 O OG1 . THR C 2 24  ? 17.982  1.137   24.975  1.00 102.22 ? 37  THR C OG1 1 
ATOM   1826 C CG2 . THR C 2 24  ? 18.661  1.237   27.291  1.00 78.09  ? 37  THR C CG2 1 
ATOM   1827 N N   . ILE C 2 25  ? 15.655  -1.159  24.848  1.00 84.56  ? 38  ILE C N   1 
ATOM   1828 C CA  . ILE C 2 25  ? 15.006  -1.356  23.558  1.00 81.55  ? 38  ILE C CA  1 
ATOM   1829 C C   . ILE C 2 25  ? 14.013  -0.226  23.343  1.00 89.98  ? 38  ILE C C   1 
ATOM   1830 O O   . ILE C 2 25  ? 13.045  -0.096  24.094  1.00 101.09 ? 38  ILE C O   1 
ATOM   1831 C CB  . ILE C 2 25  ? 14.218  -2.678  23.497  1.00 76.05  ? 38  ILE C CB  1 
ATOM   1832 C CG1 . ILE C 2 25  ? 15.110  -3.867  23.853  1.00 73.90  ? 38  ILE C CG1 1 
ATOM   1833 C CG2 . ILE C 2 25  ? 13.611  -2.874  22.116  1.00 69.09  ? 38  ILE C CG2 1 
ATOM   1834 C CD1 . ILE C 2 25  ? 14.375  -5.185  23.846  1.00 73.55  ? 38  ILE C CD1 1 
ATOM   1835 N N   . LYS C 2 26  ? 14.246  0.599   22.330  1.00 82.43  ? 39  LYS C N   1 
ATOM   1836 C CA  . LYS C 2 26  ? 13.292  1.656   22.007  1.00 80.34  ? 39  LYS C CA  1 
ATOM   1837 C C   . LYS C 2 26  ? 12.799  1.556   20.569  1.00 81.39  ? 39  LYS C C   1 
ATOM   1838 O O   . LYS C 2 26  ? 13.558  1.213   19.661  1.00 74.54  ? 39  LYS C O   1 
ATOM   1839 C CB  . LYS C 2 26  ? 13.879  3.045   22.284  1.00 76.73  ? 39  LYS C CB  1 
ATOM   1840 C CG  . LYS C 2 26  ? 15.162  3.363   21.535  1.00 91.60  ? 39  LYS C CG  1 
ATOM   1841 C CD  . LYS C 2 26  ? 15.491  4.847   21.650  1.00 98.34  ? 39  LYS C CD  1 
ATOM   1842 C CE  . LYS C 2 26  ? 16.820  5.188   20.989  1.00 101.75 ? 39  LYS C CE  1 
ATOM   1843 N NZ  . LYS C 2 26  ? 17.008  6.662   20.880  1.00 101.42 ? 39  LYS C NZ  1 
ATOM   1844 N N   . VAL C 2 27  ? 11.516  1.844   20.377  1.00 83.57  ? 40  VAL C N   1 
ATOM   1845 C CA  . VAL C 2 27  ? 10.922  1.887   19.050  1.00 81.83  ? 40  VAL C CA  1 
ATOM   1846 C C   . VAL C 2 27  ? 11.396  3.146   18.336  1.00 83.13  ? 40  VAL C C   1 
ATOM   1847 O O   . VAL C 2 27  ? 11.223  4.255   18.842  1.00 79.83  ? 40  VAL C O   1 
ATOM   1848 C CB  . VAL C 2 27  ? 9.384   1.901   19.137  1.00 81.73  ? 40  VAL C CB  1 
ATOM   1849 C CG1 . VAL C 2 27  ? 8.766   1.774   17.752  1.00 77.67  ? 40  VAL C CG1 1 
ATOM   1850 C CG2 . VAL C 2 27  ? 8.905   0.779   20.039  1.00 83.54  ? 40  VAL C CG2 1 
ATOM   1851 N N   . THR C 2 28  ? 12.005  2.973   17.167  1.00 79.38  ? 41  THR C N   1 
ATOM   1852 C CA  . THR C 2 28  ? 12.546  4.101   16.413  1.00 80.62  ? 41  THR C CA  1 
ATOM   1853 C C   . THR C 2 28  ? 11.707  4.417   15.177  1.00 79.09  ? 41  THR C C   1 
ATOM   1854 O O   . THR C 2 28  ? 11.927  5.425   14.505  1.00 78.61  ? 41  THR C O   1 
ATOM   1855 C CB  . THR C 2 28  ? 14.007  3.853   15.992  1.00 74.52  ? 41  THR C CB  1 
ATOM   1856 O OG1 . THR C 2 28  ? 14.075  2.712   15.128  1.00 71.52  ? 41  THR C OG1 1 
ATOM   1857 C CG2 . THR C 2 28  ? 14.874  3.609   17.216  1.00 67.72  ? 41  THR C CG2 1 
ATOM   1858 N N   . GLY C 2 29  ? 10.745  3.547   14.887  1.00 80.42  ? 42  GLY C N   1 
ATOM   1859 C CA  . GLY C 2 29  ? 9.848   3.740   13.762  1.00 80.91  ? 42  GLY C CA  1 
ATOM   1860 C C   . GLY C 2 29  ? 8.907   2.563   13.598  1.00 80.50  ? 42  GLY C C   1 
ATOM   1861 O O   . GLY C 2 29  ? 8.898   1.651   14.427  1.00 75.96  ? 42  GLY C O   1 
ATOM   1862 N N   . LEU C 2 30  ? 8.110   2.584   12.533  1.00 76.45  ? 43  LEU C N   1 
ATOM   1863 C CA  . LEU C 2 30  ? 7.187   1.489   12.252  1.00 76.58  ? 43  LEU C CA  1 
ATOM   1864 C C   . LEU C 2 30  ? 7.960   0.195   12.059  1.00 80.05  ? 43  LEU C C   1 
ATOM   1865 O O   . LEU C 2 30  ? 8.817   0.105   11.180  1.00 89.50  ? 43  LEU C O   1 
ATOM   1866 C CB  . LEU C 2 30  ? 6.350   1.773   11.001  1.00 79.19  ? 43  LEU C CB  1 
ATOM   1867 C CG  . LEU C 2 30  ? 5.321   2.903   11.049  1.00 89.84  ? 43  LEU C CG  1 
ATOM   1868 C CD1 . LEU C 2 30  ? 4.342   2.769   9.893   1.00 84.28  ? 43  LEU C CD1 1 
ATOM   1869 C CD2 . LEU C 2 30  ? 4.590   2.899   12.378  1.00 101.16 ? 43  LEU C CD2 1 
ATOM   1870 N N   . ALA C 2 31  ? 7.655   -0.796  12.892  1.00 77.06  ? 44  ALA C N   1 
ATOM   1871 C CA  . ALA C 2 31  ? 8.309   -2.101  12.846  1.00 79.65  ? 44  ALA C CA  1 
ATOM   1872 C C   . ALA C 2 31  ? 9.833   -2.009  12.915  1.00 80.19  ? 44  ALA C C   1 
ATOM   1873 O O   . ALA C 2 31  ? 10.543  -2.719  12.202  1.00 82.51  ? 44  ALA C O   1 
ATOM   1874 C CB  . ALA C 2 31  ? 7.869   -2.884  11.609  1.00 71.87  ? 44  ALA C CB  1 
ATOM   1875 N N   . GLN C 2 32  ? 10.329  -1.138  13.787  1.00 74.38  ? 45  GLN C N   1 
ATOM   1876 C CA  . GLN C 2 32  ? 11.759  -0.874  13.867  1.00 70.51  ? 45  GLN C CA  1 
ATOM   1877 C C   . GLN C 2 32  ? 12.181  -0.483  15.283  1.00 72.42  ? 45  GLN C C   1 
ATOM   1878 O O   . GLN C 2 32  ? 11.725  0.527   15.821  1.00 82.83  ? 45  GLN C O   1 
ATOM   1879 C CB  . GLN C 2 32  ? 12.135  0.228   12.872  1.00 67.34  ? 45  GLN C CB  1 
ATOM   1880 C CG  . GLN C 2 32  ? 13.625  0.399   12.648  1.00 64.13  ? 45  GLN C CG  1 
ATOM   1881 C CD  . GLN C 2 32  ? 13.935  1.422   11.570  1.00 82.25  ? 45  GLN C CD  1 
ATOM   1882 O OE1 . GLN C 2 32  ? 14.542  1.099   10.547  1.00 89.47  ? 45  GLN C OE1 1 
ATOM   1883 N NE2 . GLN C 2 32  ? 13.519  2.665   11.795  1.00 80.63  ? 45  GLN C NE2 1 
ATOM   1884 N N   . VAL C 2 33  ? 13.053  -1.292  15.880  1.00 62.82  ? 46  VAL C N   1 
ATOM   1885 C CA  . VAL C 2 33  ? 13.583  -1.007  17.212  1.00 72.13  ? 46  VAL C CA  1 
ATOM   1886 C C   . VAL C 2 33  ? 15.101  -0.867  17.208  1.00 69.15  ? 46  VAL C C   1 
ATOM   1887 O O   . VAL C 2 33  ? 15.788  -1.396  16.332  1.00 63.90  ? 46  VAL C O   1 
ATOM   1888 C CB  . VAL C 2 33  ? 13.205  -2.106  18.225  1.00 63.16  ? 46  VAL C CB  1 
ATOM   1889 C CG1 . VAL C 2 33  ? 11.704  -2.286  18.265  1.00 60.70  ? 46  VAL C CG1 1 
ATOM   1890 C CG2 . VAL C 2 33  ? 13.901  -3.420  17.882  1.00 57.92  ? 46  VAL C CG2 1 
ATOM   1891 N N   . LEU C 2 34  ? 15.620  -0.145  18.195  1.00 62.90  ? 47  LEU C N   1 
ATOM   1892 C CA  . LEU C 2 34  ? 17.059  -0.055  18.393  1.00 67.58  ? 47  LEU C CA  1 
ATOM   1893 C C   . LEU C 2 34  ? 17.440  -0.689  19.720  1.00 68.15  ? 47  LEU C C   1 
ATOM   1894 O O   . LEU C 2 34  ? 17.001  -0.245  20.780  1.00 70.13  ? 47  LEU C O   1 
ATOM   1895 C CB  . LEU C 2 34  ? 17.530  1.403   18.364  1.00 70.69  ? 47  LEU C CB  1 
ATOM   1896 C CG  . LEU C 2 34  ? 19.034  1.595   18.606  1.00 71.85  ? 47  LEU C CG  1 
ATOM   1897 C CD1 . LEU C 2 34  ? 19.847  0.951   17.489  1.00 57.16  ? 47  LEU C CD1 1 
ATOM   1898 C CD2 . LEU C 2 34  ? 19.392  3.067   18.759  1.00 68.65  ? 47  LEU C CD2 1 
ATOM   1899 N N   . LEU C 2 35  ? 18.247  -1.740  19.658  1.00 69.55  ? 48  LEU C N   1 
ATOM   1900 C CA  . LEU C 2 35  ? 18.776  -2.337  20.870  1.00 63.94  ? 48  LEU C CA  1 
ATOM   1901 C C   . LEU C 2 35  ? 20.005  -1.547  21.301  1.00 66.20  ? 48  LEU C C   1 
ATOM   1902 O O   . LEU C 2 35  ? 20.870  -1.237  20.483  1.00 64.12  ? 48  LEU C O   1 
ATOM   1903 C CB  . LEU C 2 35  ? 19.143  -3.807  20.646  1.00 64.13  ? 48  LEU C CB  1 
ATOM   1904 C CG  . LEU C 2 35  ? 18.086  -4.727  20.026  1.00 71.10  ? 48  LEU C CG  1 
ATOM   1905 C CD1 . LEU C 2 35  ? 18.520  -6.172  20.150  1.00 64.96  ? 48  LEU C CD1 1 
ATOM   1906 C CD2 . LEU C 2 35  ? 16.743  -4.528  20.686  1.00 86.15  ? 48  LEU C CD2 1 
ATOM   1907 N N   . GLN C 2 36  ? 20.070  -1.205  22.582  1.00 58.88  ? 49  GLN C N   1 
ATOM   1908 C CA  . GLN C 2 36  ? 21.202  -0.458  23.113  1.00 71.42  ? 49  GLN C CA  1 
ATOM   1909 C C   . GLN C 2 36  ? 21.673  -1.031  24.443  1.00 70.46  ? 49  GLN C C   1 
ATOM   1910 O O   . GLN C 2 36  ? 20.866  -1.353  25.310  1.00 70.69  ? 49  GLN C O   1 
ATOM   1911 C CB  . GLN C 2 36  ? 20.840  1.018   23.283  1.00 82.85  ? 49  GLN C CB  1 
ATOM   1912 C CG  . GLN C 2 36  ? 20.934  1.837   22.011  1.00 85.57  ? 49  GLN C CG  1 
ATOM   1913 C CD  . GLN C 2 36  ? 20.440  3.251   22.210  1.00 87.57  ? 49  GLN C CD  1 
ATOM   1914 O OE1 . GLN C 2 36  ? 19.371  3.468   22.780  1.00 88.59  ? 49  GLN C OE1 1 
ATOM   1915 N NE2 . GLN C 2 36  ? 21.218  4.223   21.749  1.00 98.26  ? 49  GLN C NE2 1 
ATOM   1916 N N   . TRP C 2 37  ? 22.986  -1.160  24.592  1.00 65.29  ? 50  TRP C N   1 
ATOM   1917 C CA  . TRP C 2 37  ? 23.580  -1.609  25.847  1.00 71.17  ? 50  TRP C CA  1 
ATOM   1918 C C   . TRP C 2 37  ? 24.929  -0.933  26.023  1.00 73.25  ? 50  TRP C C   1 
ATOM   1919 O O   . TRP C 2 37  ? 25.417  -0.270  25.110  1.00 68.70  ? 50  TRP C O   1 
ATOM   1920 C CB  . TRP C 2 37  ? 23.738  -3.135  25.872  1.00 77.21  ? 50  TRP C CB  1 
ATOM   1921 C CG  . TRP C 2 37  ? 24.583  -3.674  24.758  1.00 72.15  ? 50  TRP C CG  1 
ATOM   1922 C CD1 . TRP C 2 37  ? 25.925  -3.917  24.789  1.00 71.96  ? 50  TRP C CD1 1 
ATOM   1923 C CD2 . TRP C 2 37  ? 24.142  -4.032  23.444  1.00 73.44  ? 50  TRP C CD2 1 
ATOM   1924 N NE1 . TRP C 2 37  ? 26.346  -4.405  23.577  1.00 69.30  ? 50  TRP C NE1 1 
ATOM   1925 C CE2 . TRP C 2 37  ? 25.269  -4.487  22.732  1.00 72.46  ? 50  TRP C CE2 1 
ATOM   1926 C CE3 . TRP C 2 37  ? 22.901  -4.012  22.799  1.00 70.08  ? 50  TRP C CE3 1 
ATOM   1927 C CZ2 . TRP C 2 37  ? 25.194  -4.918  21.407  1.00 66.25  ? 50  TRP C CZ2 1 
ATOM   1928 C CZ3 . TRP C 2 37  ? 22.827  -4.439  21.488  1.00 65.50  ? 50  TRP C CZ3 1 
ATOM   1929 C CH2 . TRP C 2 37  ? 23.966  -4.887  20.804  1.00 65.34  ? 50  TRP C CH2 1 
ATOM   1930 N N   . LYS C 2 38  ? 25.519  -1.084  27.202  1.00 73.98  ? 51  LYS C N   1 
ATOM   1931 C CA  . LYS C 2 38  ? 26.844  -0.538  27.462  1.00 89.01  ? 51  LYS C CA  1 
ATOM   1932 C C   . LYS C 2 38  ? 27.720  -1.600  28.112  1.00 92.21  ? 51  LYS C C   1 
ATOM   1933 O O   . LYS C 2 38  ? 27.227  -2.420  28.888  1.00 96.75  ? 51  LYS C O   1 
ATOM   1934 C CB  . LYS C 2 38  ? 26.762  0.705   28.356  1.00 91.53  ? 51  LYS C CB  1 
ATOM   1935 C CG  . LYS C 2 38  ? 26.639  2.025   27.600  1.00 95.65  ? 51  LYS C CG  1 
ATOM   1936 C CD  . LYS C 2 38  ? 25.227  2.267   27.084  1.00 106.82 ? 51  LYS C CD  1 
ATOM   1937 C CE  . LYS C 2 38  ? 25.158  3.535   26.240  1.00 116.31 ? 51  LYS C CE  1 
ATOM   1938 N NZ  . LYS C 2 38  ? 23.790  3.792   25.707  1.00 118.11 ? 51  LYS C NZ  1 
ATOM   1939 N N   . PRO C 2 39  ? 29.024  -1.594  27.792  1.00 85.74  ? 52  PRO C N   1 
ATOM   1940 C CA  . PRO C 2 39  ? 29.951  -2.556  28.395  1.00 88.48  ? 52  PRO C CA  1 
ATOM   1941 C C   . PRO C 2 39  ? 29.990  -2.405  29.908  1.00 88.06  ? 52  PRO C C   1 
ATOM   1942 O O   . PRO C 2 39  ? 30.002  -1.280  30.408  1.00 94.19  ? 52  PRO C O   1 
ATOM   1943 C CB  . PRO C 2 39  ? 31.304  -2.159  27.800  1.00 91.43  ? 52  PRO C CB  1 
ATOM   1944 C CG  . PRO C 2 39  ? 31.135  -0.742  27.358  1.00 88.38  ? 52  PRO C CG  1 
ATOM   1945 C CD  . PRO C 2 39  ? 29.715  -0.643  26.904  1.00 81.35  ? 52  PRO C CD  1 
ATOM   1946 N N   . ASN C 2 40  ? 29.995  -3.525  30.621  1.00 86.00  ? 53  ASN C N   1 
ATOM   1947 C CA  . ASN C 2 40  ? 30.072  -3.505  32.073  1.00 102.13 ? 53  ASN C CA  1 
ATOM   1948 C C   . ASN C 2 40  ? 31.359  -2.819  32.527  1.00 111.11 ? 53  ASN C C   1 
ATOM   1949 O O   . ASN C 2 40  ? 32.455  -3.306  32.255  1.00 114.15 ? 53  ASN C O   1 
ATOM   1950 C CB  . ASN C 2 40  ? 29.995  -4.932  32.620  1.00 101.11 ? 53  ASN C CB  1 
ATOM   1951 C CG  . ASN C 2 40  ? 29.632  -4.981  34.092  1.00 104.25 ? 53  ASN C CG  1 
ATOM   1952 O OD1 . ASN C 2 40  ? 30.004  -4.102  34.869  1.00 108.79 ? 53  ASN C OD1 1 
ATOM   1953 N ND2 . ASN C 2 40  ? 28.900  -6.018  34.483  1.00 103.13 ? 53  ASN C ND2 1 
ATOM   1954 N N   . PRO C 2 41  ? 31.228  -1.672  33.210  1.00 109.50 ? 54  PRO C N   1 
ATOM   1955 C CA  . PRO C 2 41  ? 32.401  -0.923  33.672  1.00 117.57 ? 54  PRO C CA  1 
ATOM   1956 C C   . PRO C 2 41  ? 33.170  -1.703  34.732  1.00 126.92 ? 54  PRO C C   1 
ATOM   1957 O O   . PRO C 2 41  ? 34.342  -1.421  34.979  1.00 125.09 ? 54  PRO C O   1 
ATOM   1958 C CB  . PRO C 2 41  ? 31.788  0.343   34.280  1.00 111.64 ? 54  PRO C CB  1 
ATOM   1959 C CG  . PRO C 2 41  ? 30.413  -0.067  34.686  1.00 105.74 ? 54  PRO C CG  1 
ATOM   1960 C CD  . PRO C 2 41  ? 29.967  -1.043  33.638  1.00 106.77 ? 54  PRO C CD  1 
ATOM   1961 N N   . ASP C 2 42  ? 32.511  -2.684  35.340  1.00 135.76 ? 55  ASP C N   1 
ATOM   1962 C CA  . ASP C 2 42  ? 33.139  -3.517  36.357  1.00 144.56 ? 55  ASP C CA  1 
ATOM   1963 C C   . ASP C 2 42  ? 33.946  -4.644  35.713  1.00 141.19 ? 55  ASP C C   1 
ATOM   1964 O O   . ASP C 2 42  ? 34.650  -5.384  36.401  1.00 139.06 ? 55  ASP C O   1 
ATOM   1965 C CB  . ASP C 2 42  ? 32.079  -4.089  37.303  1.00 148.54 ? 55  ASP C CB  1 
ATOM   1966 C CG  . ASP C 2 42  ? 32.668  -4.593  38.606  1.00 157.62 ? 55  ASP C CG  1 
ATOM   1967 O OD1 . ASP C 2 42  ? 33.616  -3.961  39.116  1.00 161.25 ? 55  ASP C OD1 1 
ATOM   1968 O OD2 . ASP C 2 42  ? 32.180  -5.622  39.119  1.00 160.46 ? 55  ASP C OD2 1 
ATOM   1969 N N   . GLN C 2 43  ? 33.839  -4.773  34.392  1.00 142.40 ? 56  GLN C N   1 
ATOM   1970 C CA  . GLN C 2 43  ? 34.627  -5.758  33.659  1.00 141.98 ? 56  GLN C CA  1 
ATOM   1971 C C   . GLN C 2 43  ? 36.092  -5.337  33.671  1.00 150.79 ? 56  GLN C C   1 
ATOM   1972 O O   . GLN C 2 43  ? 36.413  -4.185  33.375  1.00 141.53 ? 56  GLN C O   1 
ATOM   1973 C CB  . GLN C 2 43  ? 34.128  -5.902  32.218  1.00 133.58 ? 56  GLN C CB  1 
ATOM   1974 C CG  . GLN C 2 43  ? 34.707  -7.090  31.458  1.00 131.48 ? 56  GLN C CG  1 
ATOM   1975 C CD  . GLN C 2 43  ? 34.059  -8.409  31.843  1.00 128.49 ? 56  GLN C CD  1 
ATOM   1976 O OE1 . GLN C 2 43  ? 32.956  -8.726  31.396  1.00 118.32 ? 56  GLN C OE1 1 
ATOM   1977 N NE2 . GLN C 2 43  ? 34.746  -9.186  32.673  1.00 133.96 ? 56  GLN C NE2 1 
ATOM   1978 N N   . GLU C 2 44  ? 36.962  -6.281  34.024  1.00 169.01 ? 57  GLU C N   1 
ATOM   1979 C CA  . GLU C 2 44  ? 38.405  -6.057  34.146  1.00 184.93 ? 57  GLU C CA  1 
ATOM   1980 C C   . GLU C 2 44  ? 38.979  -5.219  33.006  1.00 191.69 ? 57  GLU C C   1 
ATOM   1981 O O   . GLU C 2 44  ? 38.626  -5.427  31.845  1.00 187.42 ? 57  GLU C O   1 
ATOM   1982 C CB  . GLU C 2 44  ? 39.144  -7.398  34.249  1.00 184.19 ? 57  GLU C CB  1 
ATOM   1983 C CG  . GLU C 2 44  ? 38.337  -8.616  33.792  1.00 178.52 ? 57  GLU C CG  1 
ATOM   1984 C CD  . GLU C 2 44  ? 37.343  -9.100  34.839  1.00 178.27 ? 57  GLU C CD  1 
ATOM   1985 O OE1 . GLU C 2 44  ? 37.488  -10.244 35.318  1.00 180.13 ? 57  GLU C OE1 1 
ATOM   1986 O OE2 . GLU C 2 44  ? 36.412  -8.337  35.177  1.00 174.88 ? 57  GLU C OE2 1 
ATOM   1987 N N   . GLN C 2 45  ? 39.857  -4.276  33.358  1.00 199.48 ? 58  GLN C N   1 
ATOM   1988 C CA  . GLN C 2 45  ? 40.374  -3.266  32.426  1.00 198.01 ? 58  GLN C CA  1 
ATOM   1989 C C   . GLN C 2 45  ? 40.688  -3.795  31.030  1.00 192.27 ? 58  GLN C C   1 
ATOM   1990 O O   . GLN C 2 45  ? 41.526  -4.679  30.855  1.00 191.44 ? 58  GLN C O   1 
ATOM   1991 C CB  . GLN C 2 45  ? 41.593  -2.543  33.008  1.00 203.35 ? 58  GLN C CB  1 
ATOM   1992 C CG  . GLN C 2 45  ? 41.243  -1.406  33.953  1.00 205.43 ? 58  GLN C CG  1 
ATOM   1993 C CD  . GLN C 2 45  ? 42.415  -0.473  34.196  1.00 215.33 ? 58  GLN C CD  1 
ATOM   1994 O OE1 . GLN C 2 45  ? 43.049  0.004   33.255  1.00 218.71 ? 58  GLN C OE1 1 
ATOM   1995 N NE2 . GLN C 2 45  ? 42.711  -0.213  35.465  1.00 219.29 ? 58  GLN C NE2 1 
ATOM   1996 N N   . ARG C 2 46  ? 39.994  -3.227  30.049  1.00 187.54 ? 59  ARG C N   1 
ATOM   1997 C CA  . ARG C 2 46  ? 39.968  -3.738  28.683  1.00 182.41 ? 59  ARG C CA  1 
ATOM   1998 C C   . ARG C 2 46  ? 41.354  -3.881  28.060  1.00 188.03 ? 59  ARG C C   1 
ATOM   1999 O O   . ARG C 2 46  ? 41.923  -2.914  27.555  1.00 194.24 ? 59  ARG C O   1 
ATOM   2000 C CB  . ARG C 2 46  ? 39.094  -2.836  27.808  1.00 173.71 ? 59  ARG C CB  1 
ATOM   2001 C CG  . ARG C 2 46  ? 37.978  -2.134  28.569  1.00 168.37 ? 59  ARG C CG  1 
ATOM   2002 C CD  . ARG C 2 46  ? 36.912  -3.110  29.040  1.00 165.09 ? 59  ARG C CD  1 
ATOM   2003 N NE  . ARG C 2 46  ? 36.013  -3.495  27.958  1.00 163.52 ? 59  ARG C NE  1 
ATOM   2004 C CZ  . ARG C 2 46  ? 34.910  -2.828  27.637  1.00 159.42 ? 59  ARG C CZ  1 
ATOM   2005 N NH1 . ARG C 2 46  ? 34.572  -1.741  28.318  1.00 162.05 ? 59  ARG C NH1 1 
ATOM   2006 N NH2 . ARG C 2 46  ? 34.147  -3.246  26.637  1.00 153.96 ? 59  ARG C NH2 1 
ATOM   2007 N N   . ASN C 2 47  ? 41.889  -5.096  28.110  1.00 184.65 ? 60  ASN C N   1 
ATOM   2008 C CA  . ASN C 2 47  ? 43.149  -5.415  27.451  1.00 182.58 ? 60  ASN C CA  1 
ATOM   2009 C C   . ASN C 2 47  ? 42.904  -6.405  26.321  1.00 171.92 ? 60  ASN C C   1 
ATOM   2010 O O   . ASN C 2 47  ? 43.790  -6.679  25.511  1.00 169.78 ? 60  ASN C O   1 
ATOM   2011 C CB  . ASN C 2 47  ? 44.153  -5.985  28.452  1.00 187.47 ? 60  ASN C CB  1 
ATOM   2012 C CG  . ASN C 2 47  ? 44.420  -5.042  29.608  1.00 191.98 ? 60  ASN C CG  1 
ATOM   2013 O OD1 . ASN C 2 47  ? 44.183  -3.838  29.508  1.00 191.72 ? 60  ASN C OD1 1 
ATOM   2014 N ND2 . ASN C 2 47  ? 44.919  -5.584  30.713  1.00 196.16 ? 60  ASN C ND2 1 
ATOM   2015 N N   . VAL C 2 48  ? 41.687  -6.935  26.277  1.00 163.64 ? 61  VAL C N   1 
ATOM   2016 C CA  . VAL C 2 48  ? 41.279  -7.848  25.218  1.00 153.01 ? 61  VAL C CA  1 
ATOM   2017 C C   . VAL C 2 48  ? 39.946  -7.394  24.618  1.00 133.74 ? 61  VAL C C   1 
ATOM   2018 O O   . VAL C 2 48  ? 39.059  -6.929  25.333  1.00 128.79 ? 61  VAL C O   1 
ATOM   2019 C CB  . VAL C 2 48  ? 41.197  -9.308  25.730  1.00 149.91 ? 61  VAL C CB  1 
ATOM   2020 C CG1 . VAL C 2 48  ? 40.167  -9.439  26.847  1.00 142.00 ? 61  VAL C CG1 1 
ATOM   2021 C CG2 . VAL C 2 48  ? 40.896  -10.264 24.587  1.00 144.79 ? 61  VAL C CG2 1 
ATOM   2022 N N   . ASN C 2 49  ? 39.821  -7.511  23.300  1.00 121.83 ? 62  ASN C N   1 
ATOM   2023 C CA  . ASN C 2 49  ? 38.643  -7.017  22.595  1.00 124.03 ? 62  ASN C CA  1 
ATOM   2024 C C   . ASN C 2 49  ? 37.394  -7.864  22.825  1.00 121.39 ? 62  ASN C C   1 
ATOM   2025 O O   . ASN C 2 49  ? 37.323  -9.012  22.389  1.00 120.90 ? 62  ASN C O   1 
ATOM   2026 C CB  . ASN C 2 49  ? 38.935  -6.902  21.099  1.00 123.07 ? 62  ASN C CB  1 
ATOM   2027 C CG  . ASN C 2 49  ? 40.109  -5.990  20.807  1.00 128.27 ? 62  ASN C CG  1 
ATOM   2028 O OD1 . ASN C 2 49  ? 40.911  -5.691  21.693  1.00 133.08 ? 62  ASN C OD1 1 
ATOM   2029 N ND2 . ASN C 2 49  ? 40.215  -5.541  19.563  1.00 124.28 ? 62  ASN C ND2 1 
ATOM   2030 N N   . LEU C 2 50  ? 36.412  -7.289  23.512  1.00 110.59 ? 63  LEU C N   1 
ATOM   2031 C CA  . LEU C 2 50  ? 35.155  -7.980  23.766  1.00 99.78  ? 63  LEU C CA  1 
ATOM   2032 C C   . LEU C 2 50  ? 34.160  -7.742  22.637  1.00 97.77  ? 63  LEU C C   1 
ATOM   2033 O O   . LEU C 2 50  ? 34.183  -6.700  21.982  1.00 100.78 ? 63  LEU C O   1 
ATOM   2034 C CB  . LEU C 2 50  ? 34.545  -7.528  25.097  1.00 94.10  ? 63  LEU C CB  1 
ATOM   2035 C CG  . LEU C 2 50  ? 35.309  -7.888  26.375  1.00 98.17  ? 63  LEU C CG  1 
ATOM   2036 C CD1 . LEU C 2 50  ? 34.506  -7.508  27.609  1.00 95.49  ? 63  LEU C CD1 1 
ATOM   2037 C CD2 . LEU C 2 50  ? 35.649  -9.367  26.392  1.00 97.55  ? 63  LEU C CD2 1 
ATOM   2038 N N   . GLU C 2 51  ? 33.293  -8.721  22.406  1.00 77.32  ? 64  GLU C N   1 
ATOM   2039 C CA  . GLU C 2 51  ? 32.199  -8.569  21.457  1.00 65.81  ? 64  GLU C CA  1 
ATOM   2040 C C   . GLU C 2 51  ? 30.901  -8.957  22.148  1.00 62.89  ? 64  GLU C C   1 
ATOM   2041 O O   . GLU C 2 51  ? 30.899  -9.252  23.344  1.00 68.55  ? 64  GLU C O   1 
ATOM   2042 C CB  . GLU C 2 51  ? 32.436  -9.430  20.218  1.00 69.41  ? 64  GLU C CB  1 
ATOM   2043 C CG  . GLU C 2 51  ? 33.663  -9.019  19.419  1.00 88.68  ? 64  GLU C CG  1 
ATOM   2044 C CD  . GLU C 2 51  ? 33.972  -9.972  18.282  1.00 103.72 ? 64  GLU C CD  1 
ATOM   2045 O OE1 . GLU C 2 51  ? 34.169  -11.178 18.548  1.00 108.28 ? 64  GLU C OE1 1 
ATOM   2046 O OE2 . GLU C 2 51  ? 34.009  -9.516  17.119  1.00 111.58 ? 64  GLU C OE2 1 
ATOM   2047 N N   . TYR C 2 52  ? 29.800  -8.955  21.403  1.00 65.83  ? 65  TYR C N   1 
ATOM   2048 C CA  . TYR C 2 52  ? 28.493  -9.222  21.994  1.00 66.17  ? 65  TYR C CA  1 
ATOM   2049 C C   . TYR C 2 52  ? 27.652  -10.152 21.132  1.00 61.38  ? 65  TYR C C   1 
ATOM   2050 O O   . TYR C 2 52  ? 27.823  -10.214 19.915  1.00 67.24  ? 65  TYR C O   1 
ATOM   2051 C CB  . TYR C 2 52  ? 27.743  -7.911  22.248  1.00 56.71  ? 65  TYR C CB  1 
ATOM   2052 C CG  . TYR C 2 52  ? 28.543  -6.930  23.074  1.00 65.59  ? 65  TYR C CG  1 
ATOM   2053 C CD1 . TYR C 2 52  ? 28.571  -7.021  24.460  1.00 61.18  ? 65  TYR C CD1 1 
ATOM   2054 C CD2 . TYR C 2 52  ? 29.287  -5.925  22.467  1.00 70.06  ? 65  TYR C CD2 1 
ATOM   2055 C CE1 . TYR C 2 52  ? 29.310  -6.131  25.222  1.00 64.66  ? 65  TYR C CE1 1 
ATOM   2056 C CE2 . TYR C 2 52  ? 30.027  -5.030  23.218  1.00 74.48  ? 65  TYR C CE2 1 
ATOM   2057 C CZ  . TYR C 2 52  ? 30.036  -5.137  24.594  1.00 77.85  ? 65  TYR C CZ  1 
ATOM   2058 O OH  . TYR C 2 52  ? 30.774  -4.245  25.339  1.00 82.22  ? 65  TYR C OH  1 
ATOM   2059 N N   . GLN C 2 53  ? 26.746  -10.884 21.771  1.00 63.27  ? 66  GLN C N   1 
ATOM   2060 C CA  . GLN C 2 53  ? 25.847  -11.768 21.046  1.00 64.97  ? 66  GLN C CA  1 
ATOM   2061 C C   . GLN C 2 53  ? 24.412  -11.372 21.318  1.00 61.46  ? 66  GLN C C   1 
ATOM   2062 O O   . GLN C 2 53  ? 23.954  -11.425 22.458  1.00 67.52  ? 66  GLN C O   1 
ATOM   2063 C CB  . GLN C 2 53  ? 26.064  -13.225 21.453  1.00 70.22  ? 66  GLN C CB  1 
ATOM   2064 C CG  . GLN C 2 53  ? 25.101  -14.197 20.776  1.00 62.97  ? 66  GLN C CG  1 
ATOM   2065 C CD  . GLN C 2 53  ? 25.279  -15.630 21.248  1.00 68.79  ? 66  GLN C CD  1 
ATOM   2066 O OE1 . GLN C 2 53  ? 26.112  -15.914 22.110  1.00 76.31  ? 66  GLN C OE1 1 
ATOM   2067 N NE2 . GLN C 2 53  ? 24.493  -16.540 20.684  1.00 70.74  ? 66  GLN C NE2 1 
ATOM   2068 N N   . VAL C 2 54  ? 23.706  -10.974 20.267  1.00 55.25  ? 67  VAL C N   1 
ATOM   2069 C CA  . VAL C 2 54  ? 22.300  -10.622 20.388  1.00 57.18  ? 67  VAL C CA  1 
ATOM   2070 C C   . VAL C 2 54  ? 21.409  -11.833 20.110  1.00 63.57  ? 67  VAL C C   1 
ATOM   2071 O O   . VAL C 2 54  ? 21.607  -12.546 19.128  1.00 60.51  ? 67  VAL C O   1 
ATOM   2072 C CB  . VAL C 2 54  ? 21.925  -9.490  19.410  1.00 60.45  ? 67  VAL C CB  1 
ATOM   2073 C CG1 . VAL C 2 54  ? 20.453  -9.144  19.541  1.00 57.57  ? 67  VAL C CG1 1 
ATOM   2074 C CG2 . VAL C 2 54  ? 22.796  -8.266  19.662  1.00 57.91  ? 67  VAL C CG2 1 
ATOM   2075 N N   . LYS C 2 55  ? 20.440  -12.071 20.986  1.00 66.83  ? 68  LYS C N   1 
ATOM   2076 C CA  . LYS C 2 55  ? 19.465  -13.130 20.767  1.00 69.00  ? 68  LYS C CA  1 
ATOM   2077 C C   . LYS C 2 55  ? 18.067  -12.539 20.817  1.00 67.71  ? 68  LYS C C   1 
ATOM   2078 O O   . LYS C 2 55  ? 17.704  -11.875 21.787  1.00 77.73  ? 68  LYS C O   1 
ATOM   2079 C CB  . LYS C 2 55  ? 19.608  -14.227 21.825  1.00 80.78  ? 68  LYS C CB  1 
ATOM   2080 C CG  . LYS C 2 55  ? 18.672  -15.416 21.632  1.00 97.02  ? 68  LYS C CG  1 
ATOM   2081 C CD  . LYS C 2 55  ? 18.831  -16.424 22.763  1.00 113.15 ? 68  LYS C CD  1 
ATOM   2082 C CE  . LYS C 2 55  ? 17.953  -17.651 22.557  1.00 124.91 ? 68  LYS C CE  1 
ATOM   2083 N NZ  . LYS C 2 55  ? 18.092  -18.632 23.673  1.00 129.63 ? 68  LYS C NZ  1 
ATOM   2084 N N   . ILE C 2 56  ? 17.290  -12.767 19.764  1.00 62.24  ? 69  ILE C N   1 
ATOM   2085 C CA  . ILE C 2 56  ? 15.909  -12.302 19.727  1.00 65.81  ? 69  ILE C CA  1 
ATOM   2086 C C   . ILE C 2 56  ? 14.956  -13.462 19.999  1.00 68.58  ? 69  ILE C C   1 
ATOM   2087 O O   . ILE C 2 56  ? 14.885  -14.421 19.228  1.00 70.13  ? 69  ILE C O   1 
ATOM   2088 C CB  . ILE C 2 56  ? 15.583  -11.632 18.381  1.00 63.98  ? 69  ILE C CB  1 
ATOM   2089 C CG1 . ILE C 2 56  ? 16.390  -10.338 18.249  1.00 65.58  ? 69  ILE C CG1 1 
ATOM   2090 C CG2 . ILE C 2 56  ? 14.096  -11.330 18.276  1.00 53.37  ? 69  ILE C CG2 1 
ATOM   2091 C CD1 . ILE C 2 56  ? 16.652  -9.920  16.830  1.00 70.15  ? 69  ILE C CD1 1 
ATOM   2092 N N   . ASN C 2 57  ? 14.229  -13.368 21.108  1.00 66.84  ? 70  ASN C N   1 
ATOM   2093 C CA  . ASN C 2 57  ? 13.375  -14.461 21.565  1.00 73.91  ? 70  ASN C CA  1 
ATOM   2094 C C   . ASN C 2 57  ? 11.971  -14.456 20.964  1.00 76.32  ? 70  ASN C C   1 
ATOM   2095 O O   . ASN C 2 57  ? 11.367  -15.513 20.780  1.00 72.01  ? 70  ASN C O   1 
ATOM   2096 C CB  . ASN C 2 57  ? 13.285  -14.455 23.094  1.00 76.94  ? 70  ASN C CB  1 
ATOM   2097 C CG  . ASN C 2 57  ? 14.649  -14.421 23.755  1.00 75.23  ? 70  ASN C CG  1 
ATOM   2098 O OD1 . ASN C 2 57  ? 15.392  -15.405 23.725  1.00 69.23  ? 70  ASN C OD1 1 
ATOM   2099 N ND2 . ASN C 2 57  ? 14.987  -13.285 24.358  1.00 64.38  ? 70  ASN C ND2 1 
ATOM   2100 N N   . ALA C 2 58  ? 11.458  -13.268 20.659  1.00 77.04  ? 71  ALA C N   1 
ATOM   2101 C CA  . ALA C 2 58  ? 10.098  -13.124 20.148  1.00 70.33  ? 71  ALA C CA  1 
ATOM   2102 C C   . ALA C 2 58  ? 9.938   -11.803 19.401  1.00 72.73  ? 71  ALA C C   1 
ATOM   2103 O O   . ALA C 2 58  ? 10.615  -10.829 19.721  1.00 77.43  ? 71  ALA C O   1 
ATOM   2104 C CB  . ALA C 2 58  ? 9.099   -13.206 21.293  1.00 67.27  ? 71  ALA C CB  1 
ATOM   2105 N N   . PRO C 2 59  ? 9.030   -11.755 18.409  1.00 74.24  ? 72  PRO C N   1 
ATOM   2106 C CA  . PRO C 2 59  ? 8.156   -12.842 17.948  1.00 74.29  ? 72  PRO C CA  1 
ATOM   2107 C C   . PRO C 2 59  ? 8.850   -13.804 16.984  1.00 79.03  ? 72  PRO C C   1 
ATOM   2108 O O   . PRO C 2 59  ? 8.393   -14.936 16.827  1.00 78.39  ? 72  PRO C O   1 
ATOM   2109 C CB  . PRO C 2 59  ? 7.026   -12.094 17.236  1.00 63.10  ? 72  PRO C CB  1 
ATOM   2110 C CG  . PRO C 2 59  ? 7.686   -10.870 16.707  1.00 62.38  ? 72  PRO C CG  1 
ATOM   2111 C CD  . PRO C 2 59  ? 8.726   -10.484 17.726  1.00 65.13  ? 72  PRO C CD  1 
ATOM   2112 N N   . LYS C 2 60  ? 9.933   -13.365 16.352  1.00 83.55  ? 73  LYS C N   1 
ATOM   2113 C CA  . LYS C 2 60  ? 10.687  -14.238 15.454  1.00 90.87  ? 73  LYS C CA  1 
ATOM   2114 C C   . LYS C 2 60  ? 12.109  -14.446 15.953  1.00 87.60  ? 73  LYS C C   1 
ATOM   2115 O O   . LYS C 2 60  ? 12.841  -13.485 16.177  1.00 94.43  ? 73  LYS C O   1 
ATOM   2116 C CB  . LYS C 2 60  ? 10.707  -13.680 14.028  1.00 101.60 ? 73  LYS C CB  1 
ATOM   2117 C CG  . LYS C 2 60  ? 9.794   -14.422 13.062  1.00 109.92 ? 73  LYS C CG  1 
ATOM   2118 C CD  . LYS C 2 60  ? 9.883   -13.858 11.650  1.00 108.33 ? 73  LYS C CD  1 
ATOM   2119 C CE  . LYS C 2 60  ? 9.093   -14.711 10.666  1.00 115.58 ? 73  LYS C CE  1 
ATOM   2120 N NZ  . LYS C 2 60  ? 9.620   -16.104 10.591  1.00 115.43 ? 73  LYS C NZ  1 
ATOM   2121 N N   . GLU C 2 61  ? 12.495  -15.707 16.114  1.00 86.57  ? 74  GLU C N   1 
ATOM   2122 C CA  . GLU C 2 61  ? 13.795  -16.045 16.679  1.00 87.77  ? 74  GLU C CA  1 
ATOM   2123 C C   . GLU C 2 61  ? 14.970  -15.750 15.751  1.00 81.55  ? 74  GLU C C   1 
ATOM   2124 O O   . GLU C 2 61  ? 14.925  -16.033 14.552  1.00 75.88  ? 74  GLU C O   1 
ATOM   2125 C CB  . GLU C 2 61  ? 13.827  -17.511 17.111  1.00 91.89  ? 74  GLU C CB  1 
ATOM   2126 C CG  . GLU C 2 61  ? 12.917  -17.827 18.287  1.00 107.30 ? 74  GLU C CG  1 
ATOM   2127 C CD  . GLU C 2 61  ? 13.103  -19.242 18.797  1.00 122.71 ? 74  GLU C CD  1 
ATOM   2128 O OE1 . GLU C 2 61  ? 13.454  -20.123 17.984  1.00 125.00 ? 74  GLU C OE1 1 
ATOM   2129 O OE2 . GLU C 2 61  ? 12.903  -19.473 20.009  1.00 129.56 ? 74  GLU C OE2 1 
ATOM   2130 N N   . ASP C 2 62  ? 16.024  -15.183 16.327  1.00 72.04  ? 75  ASP C N   1 
ATOM   2131 C CA  . ASP C 2 62  ? 17.248  -14.896 15.595  1.00 63.02  ? 75  ASP C CA  1 
ATOM   2132 C C   . ASP C 2 62  ? 18.392  -14.738 16.590  1.00 60.44  ? 75  ASP C C   1 
ATOM   2133 O O   . ASP C 2 62  ? 18.162  -14.527 17.783  1.00 62.30  ? 75  ASP C O   1 
ATOM   2134 C CB  . ASP C 2 62  ? 17.080  -13.618 14.770  1.00 64.90  ? 75  ASP C CB  1 
ATOM   2135 C CG  . ASP C 2 62  ? 18.185  -13.427 13.749  1.00 74.43  ? 75  ASP C CG  1 
ATOM   2136 O OD1 . ASP C 2 62  ? 19.051  -14.320 13.622  1.00 74.79  ? 75  ASP C OD1 1 
ATOM   2137 O OD2 . ASP C 2 62  ? 18.174  -12.387 13.056  1.00 71.85  ? 75  ASP C OD2 1 
ATOM   2138 N N   . ASP C 2 63  ? 19.621  -14.866 16.103  1.00 56.21  ? 76  ASP C N   1 
ATOM   2139 C CA  . ASP C 2 63  ? 20.792  -14.562 16.915  1.00 58.87  ? 76  ASP C CA  1 
ATOM   2140 C C   . ASP C 2 63  ? 22.002  -14.241 16.042  1.00 56.85  ? 76  ASP C C   1 
ATOM   2141 O O   . ASP C 2 63  ? 22.184  -14.822 14.972  1.00 52.78  ? 76  ASP C O   1 
ATOM   2142 C CB  . ASP C 2 63  ? 21.101  -15.678 17.924  1.00 60.48  ? 76  ASP C CB  1 
ATOM   2143 C CG  . ASP C 2 63  ? 21.957  -16.780 17.340  1.00 75.29  ? 76  ASP C CG  1 
ATOM   2144 O OD1 . ASP C 2 63  ? 21.642  -17.262 16.234  1.00 93.33  ? 76  ASP C OD1 1 
ATOM   2145 O OD2 . ASP C 2 63  ? 22.951  -17.166 17.990  1.00 71.88  ? 76  ASP C OD2 1 
ATOM   2146 N N   . TYR C 2 64  ? 22.818  -13.301 16.507  1.00 55.94  ? 77  TYR C N   1 
ATOM   2147 C CA  . TYR C 2 64  ? 23.968  -12.827 15.750  1.00 56.53  ? 77  TYR C CA  1 
ATOM   2148 C C   . TYR C 2 64  ? 24.952  -12.130 16.678  1.00 62.00  ? 77  TYR C C   1 
ATOM   2149 O O   . TYR C 2 64  ? 24.669  -11.934 17.859  1.00 59.97  ? 77  TYR C O   1 
ATOM   2150 C CB  . TYR C 2 64  ? 23.515  -11.867 14.650  1.00 59.24  ? 77  TYR C CB  1 
ATOM   2151 C CG  . TYR C 2 64  ? 22.698  -10.700 15.163  1.00 56.23  ? 77  TYR C CG  1 
ATOM   2152 C CD1 . TYR C 2 64  ? 23.297  -9.482  15.464  1.00 56.88  ? 77  TYR C CD1 1 
ATOM   2153 C CD2 . TYR C 2 64  ? 21.327  -10.820 15.355  1.00 53.08  ? 77  TYR C CD2 1 
ATOM   2154 C CE1 . TYR C 2 64  ? 22.552  -8.419  15.935  1.00 58.24  ? 77  TYR C CE1 1 
ATOM   2155 C CE2 . TYR C 2 64  ? 20.576  -9.765  15.828  1.00 49.18  ? 77  TYR C CE2 1 
ATOM   2156 C CZ  . TYR C 2 64  ? 21.191  -8.567  16.114  1.00 57.26  ? 77  TYR C CZ  1 
ATOM   2157 O OH  . TYR C 2 64  ? 20.434  -7.519  16.580  1.00 53.24  ? 77  TYR C OH  1 
ATOM   2158 N N   . GLU C 2 65  ? 26.108  -11.757 16.140  1.00 64.32  ? 78  GLU C N   1 
ATOM   2159 C CA  . GLU C 2 65  ? 27.142  -11.096 16.928  1.00 64.66  ? 78  GLU C CA  1 
ATOM   2160 C C   . GLU C 2 65  ? 27.391  -9.680  16.417  1.00 70.71  ? 78  GLU C C   1 
ATOM   2161 O O   . GLU C 2 65  ? 27.102  -9.374  15.262  1.00 65.76  ? 78  GLU C O   1 
ATOM   2162 C CB  . GLU C 2 65  ? 28.441  -11.901 16.873  1.00 72.14  ? 78  GLU C CB  1 
ATOM   2163 C CG  . GLU C 2 65  ? 28.266  -13.386 17.148  1.00 82.52  ? 78  GLU C CG  1 
ATOM   2164 C CD  . GLU C 2 65  ? 29.527  -14.176 16.861  1.00 96.62  ? 78  GLU C CD  1 
ATOM   2165 O OE1 . GLU C 2 65  ? 30.588  -13.547 16.661  1.00 102.62 ? 78  GLU C OE1 1 
ATOM   2166 O OE2 . GLU C 2 65  ? 29.458  -15.424 16.830  1.00 101.84 ? 78  GLU C OE2 1 
ATOM   2167 N N   . THR C 2 66  ? 27.924  -8.819  17.280  1.00 70.75  ? 79  THR C N   1 
ATOM   2168 C CA  . THR C 2 66  ? 28.271  -7.454  16.890  1.00 62.43  ? 79  THR C CA  1 
ATOM   2169 C C   . THR C 2 66  ? 29.509  -6.976  17.637  1.00 62.78  ? 79  THR C C   1 
ATOM   2170 O O   . THR C 2 66  ? 29.777  -7.426  18.749  1.00 63.32  ? 79  THR C O   1 
ATOM   2171 C CB  . THR C 2 66  ? 27.103  -6.475  17.134  1.00 61.21  ? 79  THR C CB  1 
ATOM   2172 O OG1 . THR C 2 66  ? 27.478  -5.152  16.724  1.00 76.41  ? 79  THR C OG1 1 
ATOM   2173 C CG2 . THR C 2 66  ? 26.718  -6.459  18.599  1.00 58.80  ? 79  THR C CG2 1 
ATOM   2174 N N   . ARG C 2 67  ? 30.269  -6.077  17.017  1.00 63.78  ? 80  ARG C N   1 
ATOM   2175 C CA  . ARG C 2 67  ? 31.473  -5.539  17.643  1.00 63.60  ? 80  ARG C CA  1 
ATOM   2176 C C   . ARG C 2 67  ? 31.151  -4.320  18.499  1.00 73.62  ? 80  ARG C C   1 
ATOM   2177 O O   . ARG C 2 67  ? 31.937  -3.935  19.365  1.00 75.03  ? 80  ARG C O   1 
ATOM   2178 C CB  . ARG C 2 67  ? 32.509  -5.149  16.589  1.00 71.99  ? 80  ARG C CB  1 
ATOM   2179 C CG  . ARG C 2 67  ? 32.933  -6.265  15.654  1.00 94.07  ? 80  ARG C CG  1 
ATOM   2180 C CD  . ARG C 2 67  ? 33.867  -5.716  14.586  1.00 105.82 ? 80  ARG C CD  1 
ATOM   2181 N NE  . ARG C 2 67  ? 33.518  -4.337  14.249  1.00 113.32 ? 80  ARG C NE  1 
ATOM   2182 C CZ  . ARG C 2 67  ? 33.786  -3.753  13.086  1.00 114.98 ? 80  ARG C CZ  1 
ATOM   2183 N NH1 . ARG C 2 67  ? 34.407  -4.428  12.127  1.00 115.88 ? 80  ARG C NH1 1 
ATOM   2184 N NH2 . ARG C 2 67  ? 33.425  -2.493  12.881  1.00 107.95 ? 80  ARG C NH2 1 
ATOM   2185 N N   . ILE C 2 68  ? 29.996  -3.713  18.246  1.00 74.96  ? 81  ILE C N   1 
ATOM   2186 C CA  . ILE C 2 68  ? 29.601  -2.497  18.949  1.00 74.23  ? 81  ILE C CA  1 
ATOM   2187 C C   . ILE C 2 68  ? 28.519  -2.737  20.003  1.00 64.64  ? 81  ILE C C   1 
ATOM   2188 O O   . ILE C 2 68  ? 28.144  -3.878  20.273  1.00 65.01  ? 81  ILE C O   1 
ATOM   2189 C CB  . ILE C 2 68  ? 29.141  -1.405  17.968  1.00 75.02  ? 81  ILE C CB  1 
ATOM   2190 C CG1 . ILE C 2 68  ? 27.846  -1.818  17.265  1.00 62.74  ? 81  ILE C CG1 1 
ATOM   2191 C CG2 . ILE C 2 68  ? 30.237  -1.114  16.953  1.00 62.76  ? 81  ILE C CG2 1 
ATOM   2192 C CD1 . ILE C 2 68  ? 27.317  -0.763  16.319  1.00 58.30  ? 81  ILE C CD1 1 
ATOM   2193 N N   . THR C 2 69  ? 28.018  -1.653  20.589  1.00 70.68  ? 82  THR C N   1 
ATOM   2194 C CA  . THR C 2 69  ? 27.123  -1.752  21.736  1.00 71.57  ? 82  THR C CA  1 
ATOM   2195 C C   . THR C 2 69  ? 25.684  -1.339  21.431  1.00 71.40  ? 82  THR C C   1 
ATOM   2196 O O   . THR C 2 69  ? 24.907  -1.049  22.343  1.00 74.56  ? 82  THR C O   1 
ATOM   2197 C CB  . THR C 2 69  ? 27.646  -0.929  22.929  1.00 74.10  ? 82  THR C CB  1 
ATOM   2198 O OG1 . THR C 2 69  ? 27.935  0.407   22.501  1.00 74.99  ? 82  THR C OG1 1 
ATOM   2199 C CG2 . THR C 2 69  ? 28.909  -1.557  23.501  1.00 68.70  ? 82  THR C CG2 1 
ATOM   2200 N N   . GLU C 2 70  ? 25.334  -1.308  20.149  1.00 70.87  ? 83  GLU C N   1 
ATOM   2201 C CA  . GLU C 2 70  ? 23.951  -1.077  19.745  1.00 71.23  ? 83  GLU C CA  1 
ATOM   2202 C C   . GLU C 2 70  ? 23.641  -1.798  18.436  1.00 71.86  ? 83  GLU C C   1 
ATOM   2203 O O   . GLU C 2 70  ? 24.546  -2.116  17.663  1.00 77.37  ? 83  GLU C O   1 
ATOM   2204 C CB  . GLU C 2 70  ? 23.645  0.421   19.630  1.00 74.01  ? 83  GLU C CB  1 
ATOM   2205 C CG  . GLU C 2 70  ? 24.211  1.095   18.393  1.00 80.48  ? 83  GLU C CG  1 
ATOM   2206 C CD  . GLU C 2 70  ? 23.843  2.566   18.316  1.00 90.87  ? 83  GLU C CD  1 
ATOM   2207 O OE1 . GLU C 2 70  ? 23.874  3.130   17.200  1.00 91.67  ? 83  GLU C OE1 1 
ATOM   2208 O OE2 . GLU C 2 70  ? 23.526  3.159   19.370  1.00 96.99  ? 83  GLU C OE2 1 
ATOM   2209 N N   . SER C 2 71  ? 22.362  -2.061  18.193  1.00 66.70  ? 84  SER C N   1 
ATOM   2210 C CA  . SER C 2 71  ? 21.957  -2.794  17.000  1.00 62.09  ? 84  SER C CA  1 
ATOM   2211 C C   . SER C 2 71  ? 20.507  -2.515  16.632  1.00 69.57  ? 84  SER C C   1 
ATOM   2212 O O   . SER C 2 71  ? 19.618  -2.599  17.480  1.00 66.58  ? 84  SER C O   1 
ATOM   2213 C CB  . SER C 2 71  ? 22.148  -4.297  17.211  1.00 62.15  ? 84  SER C CB  1 
ATOM   2214 O OG  . SER C 2 71  ? 21.603  -5.035  16.132  1.00 61.11  ? 84  SER C OG  1 
ATOM   2215 N N   . LYS C 2 72  ? 20.271  -2.188  15.365  1.00 72.30  ? 85  LYS C N   1 
ATOM   2216 C CA  . LYS C 2 72  ? 18.911  -1.996  14.874  1.00 72.73  ? 85  LYS C CA  1 
ATOM   2217 C C   . LYS C 2 72  ? 18.280  -3.328  14.489  1.00 69.09  ? 85  LYS C C   1 
ATOM   2218 O O   . LYS C 2 72  ? 18.891  -4.136  13.790  1.00 69.52  ? 85  LYS C O   1 
ATOM   2219 C CB  . LYS C 2 72  ? 18.884  -1.042  13.675  1.00 74.11  ? 85  LYS C CB  1 
ATOM   2220 C CG  . LYS C 2 72  ? 17.672  -1.230  12.763  1.00 83.79  ? 85  LYS C CG  1 
ATOM   2221 C CD  . LYS C 2 72  ? 17.195  0.085   12.170  1.00 94.62  ? 85  LYS C CD  1 
ATOM   2222 C CE  . LYS C 2 72  ? 18.277  0.763   11.348  1.00 110.46 ? 85  LYS C CE  1 
ATOM   2223 N NZ  . LYS C 2 72  ? 17.836  2.106   10.872  1.00 118.70 ? 85  LYS C NZ  1 
ATOM   2224 N N   . CYS C 2 73  ? 17.056  -3.552  14.954  1.00 66.77  ? 86  CYS C N   1 
ATOM   2225 C CA  . CYS C 2 73  ? 16.297  -4.729  14.558  1.00 60.76  ? 86  CYS C CA  1 
ATOM   2226 C C   . CYS C 2 73  ? 14.984  -4.322  13.897  1.00 68.04  ? 86  CYS C C   1 
ATOM   2227 O O   . CYS C 2 73  ? 14.176  -3.604  14.488  1.00 66.61  ? 86  CYS C O   1 
ATOM   2228 C CB  . CYS C 2 73  ? 16.023  -5.625  15.768  1.00 48.74  ? 86  CYS C CB  1 
ATOM   2229 S SG  . CYS C 2 73  ? 14.997  -7.073  15.406  1.00 90.15  ? 86  CYS C SG  1 
ATOM   2230 N N   . VAL C 2 74  ? 14.783  -4.776  12.665  1.00 57.76  ? 87  VAL C N   1 
ATOM   2231 C CA  . VAL C 2 74  ? 13.515  -4.572  11.979  1.00 55.49  ? 87  VAL C CA  1 
ATOM   2232 C C   . VAL C 2 74  ? 12.593  -5.761  12.238  1.00 58.61  ? 87  VAL C C   1 
ATOM   2233 O O   . VAL C 2 74  ? 12.902  -6.895  11.868  1.00 52.82  ? 87  VAL C O   1 
ATOM   2234 C CB  . VAL C 2 74  ? 13.721  -4.360  10.467  1.00 55.90  ? 87  VAL C CB  1 
ATOM   2235 C CG1 . VAL C 2 74  ? 12.409  -4.521  9.717   1.00 59.39  ? 87  VAL C CG1 1 
ATOM   2236 C CG2 . VAL C 2 74  ? 14.322  -2.988  10.218  1.00 53.21  ? 87  VAL C CG2 1 
ATOM   2237 N N   . THR C 2 75  ? 11.467  -5.494  12.892  1.00 57.17  ? 88  THR C N   1 
ATOM   2238 C CA  . THR C 2 75  ? 10.571  -6.551  13.357  1.00 61.57  ? 88  THR C CA  1 
ATOM   2239 C C   . THR C 2 75  ? 9.170   -6.018  13.618  1.00 67.46  ? 88  THR C C   1 
ATOM   2240 O O   . THR C 2 75  ? 9.005   -4.858  13.982  1.00 70.56  ? 88  THR C O   1 
ATOM   2241 C CB  . THR C 2 75  ? 11.089  -7.182  14.667  1.00 59.09  ? 88  THR C CB  1 
ATOM   2242 O OG1 . THR C 2 75  ? 10.134  -8.133  15.154  1.00 66.89  ? 88  THR C OG1 1 
ATOM   2243 C CG2 . THR C 2 75  ? 11.313  -6.109  15.731  1.00 46.80  ? 88  THR C CG2 1 
ATOM   2244 N N   . ILE C 2 76  ? 8.160   -6.865  13.442  1.00 64.92  ? 89  ILE C N   1 
ATOM   2245 C CA  . ILE C 2 76  ? 6.800   -6.482  13.804  1.00 64.70  ? 89  ILE C CA  1 
ATOM   2246 C C   . ILE C 2 76  ? 6.712   -6.301  15.317  1.00 71.01  ? 89  ILE C C   1 
ATOM   2247 O O   . ILE C 2 76  ? 7.458   -6.932  16.067  1.00 69.35  ? 89  ILE C O   1 
ATOM   2248 C CB  . ILE C 2 76  ? 5.752   -7.510  13.314  1.00 61.82  ? 89  ILE C CB  1 
ATOM   2249 C CG1 . ILE C 2 76  ? 5.966   -8.869  13.985  1.00 53.82  ? 89  ILE C CG1 1 
ATOM   2250 C CG2 . ILE C 2 76  ? 5.808   -7.644  11.800  1.00 67.59  ? 89  ILE C CG2 1 
ATOM   2251 C CD1 . ILE C 2 76  ? 4.969   -9.926  13.552  1.00 56.24  ? 89  ILE C CD1 1 
ATOM   2252 N N   . LEU C 2 77  ? 5.815   -5.429  15.764  1.00 71.02  ? 90  LEU C N   1 
ATOM   2253 C CA  . LEU C 2 77  ? 5.751   -5.082  17.180  1.00 70.08  ? 90  LEU C CA  1 
ATOM   2254 C C   . LEU C 2 77  ? 4.411   -5.421  17.827  1.00 75.53  ? 90  LEU C C   1 
ATOM   2255 O O   . LEU C 2 77  ? 4.290   -5.416  19.053  1.00 84.61  ? 90  LEU C O   1 
ATOM   2256 C CB  . LEU C 2 77  ? 6.068   -3.595  17.375  1.00 73.00  ? 90  LEU C CB  1 
ATOM   2257 C CG  . LEU C 2 77  ? 7.457   -3.132  16.926  1.00 72.67  ? 90  LEU C CG  1 
ATOM   2258 C CD1 . LEU C 2 77  ? 7.596   -1.620  17.046  1.00 78.21  ? 90  LEU C CD1 1 
ATOM   2259 C CD2 . LEU C 2 77  ? 8.508   -3.826  17.756  1.00 72.85  ? 90  LEU C CD2 1 
ATOM   2260 N N   . HIS C 2 78  ? 3.414   -5.737  17.005  1.00 77.13  ? 91  HIS C N   1 
ATOM   2261 C CA  . HIS C 2 78  ? 2.051   -5.946  17.494  1.00 88.17  ? 91  HIS C CA  1 
ATOM   2262 C C   . HIS C 2 78  ? 1.884   -7.204  18.351  1.00 91.97  ? 91  HIS C C   1 
ATOM   2263 O O   . HIS C 2 78  ? 0.834   -7.413  18.959  1.00 103.02 ? 91  HIS C O   1 
ATOM   2264 C CB  . HIS C 2 78  ? 1.052   -5.951  16.330  1.00 91.20  ? 91  HIS C CB  1 
ATOM   2265 C CG  . HIS C 2 78  ? 1.049   -7.217  15.533  1.00 88.92  ? 91  HIS C CG  1 
ATOM   2266 N ND1 . HIS C 2 78  ? 1.870   -7.419  14.444  1.00 85.81  ? 91  HIS C ND1 1 
ATOM   2267 C CD2 . HIS C 2 78  ? 0.311   -8.349  15.658  1.00 87.91  ? 91  HIS C CD2 1 
ATOM   2268 C CE1 . HIS C 2 78  ? 1.645   -8.618  13.938  1.00 85.12  ? 91  HIS C CE1 1 
ATOM   2269 N NE2 . HIS C 2 78  ? 0.702   -9.201  14.658  1.00 83.80  ? 91  HIS C NE2 1 
ATOM   2270 N N   . LYS C 2 79  ? 2.918   -8.037  18.396  1.00 85.54  ? 92  LYS C N   1 
ATOM   2271 C CA  . LYS C 2 79  ? 2.910   -9.219  19.249  1.00 84.33  ? 92  LYS C CA  1 
ATOM   2272 C C   . LYS C 2 79  ? 3.814   -9.019  20.460  1.00 88.55  ? 92  LYS C C   1 
ATOM   2273 O O   . LYS C 2 79  ? 3.990   -9.930  21.269  1.00 87.15  ? 92  LYS C O   1 
ATOM   2274 C CB  . LYS C 2 79  ? 3.372   -10.452 18.468  1.00 78.30  ? 92  LYS C CB  1 
ATOM   2275 C CG  . LYS C 2 79  ? 2.450   -10.865 17.332  1.00 79.68  ? 92  LYS C CG  1 
ATOM   2276 C CD  . LYS C 2 79  ? 2.976   -12.099 16.608  1.00 82.00  ? 92  LYS C CD  1 
ATOM   2277 C CE  . LYS C 2 79  ? 1.983   -12.582 15.560  1.00 90.21  ? 92  LYS C CE  1 
ATOM   2278 N NZ  . LYS C 2 79  ? 2.481   -13.773 14.821  1.00 97.92  ? 92  LYS C NZ  1 
ATOM   2279 N N   . GLY C 2 80  ? 4.381   -7.824  20.583  1.00 88.98  ? 93  GLY C N   1 
ATOM   2280 C CA  . GLY C 2 80  ? 5.396   -7.568  21.587  1.00 82.65  ? 93  GLY C CA  1 
ATOM   2281 C C   . GLY C 2 80  ? 6.760   -7.948  21.039  1.00 83.48  ? 93  GLY C C   1 
ATOM   2282 O O   . GLY C 2 80  ? 6.862   -8.444  19.917  1.00 89.03  ? 93  GLY C O   1 
ATOM   2283 N N   . PHE C 2 81  ? 7.809   -7.722  21.822  1.00 81.48  ? 94  PHE C N   1 
ATOM   2284 C CA  . PHE C 2 81  ? 9.164   -8.043  21.386  1.00 74.77  ? 94  PHE C CA  1 
ATOM   2285 C C   . PHE C 2 81  ? 10.065  -8.368  22.574  1.00 79.38  ? 94  PHE C C   1 
ATOM   2286 O O   . PHE C 2 81  ? 9.977   -7.729  23.620  1.00 79.24  ? 94  PHE C O   1 
ATOM   2287 C CB  . PHE C 2 81  ? 9.737   -6.875  20.587  1.00 72.00  ? 94  PHE C CB  1 
ATOM   2288 C CG  . PHE C 2 81  ? 11.137  -7.094  20.095  1.00 69.12  ? 94  PHE C CG  1 
ATOM   2289 C CD1 . PHE C 2 81  ? 11.375  -7.806  18.932  1.00 66.42  ? 94  PHE C CD1 1 
ATOM   2290 C CD2 . PHE C 2 81  ? 12.215  -6.557  20.780  1.00 66.45  ? 94  PHE C CD2 1 
ATOM   2291 C CE1 . PHE C 2 81  ? 12.665  -7.993  18.470  1.00 72.85  ? 94  PHE C CE1 1 
ATOM   2292 C CE2 . PHE C 2 81  ? 13.504  -6.742  20.325  1.00 69.21  ? 94  PHE C CE2 1 
ATOM   2293 C CZ  . PHE C 2 81  ? 13.731  -7.459  19.168  1.00 73.98  ? 94  PHE C CZ  1 
ATOM   2294 N N   . SER C 2 82  ? 10.933  -9.361  22.401  1.00 79.65  ? 95  SER C N   1 
ATOM   2295 C CA  . SER C 2 82  ? 11.839  -9.787  23.462  1.00 77.08  ? 95  SER C CA  1 
ATOM   2296 C C   . SER C 2 82  ? 13.227  -10.093 22.911  1.00 70.37  ? 95  SER C C   1 
ATOM   2297 O O   . SER C 2 82  ? 13.366  -10.813 21.922  1.00 71.61  ? 95  SER C O   1 
ATOM   2298 C CB  . SER C 2 82  ? 11.280  -11.022 24.171  1.00 75.79  ? 95  SER C CB  1 
ATOM   2299 O OG  . SER C 2 82  ? 12.188  -11.512 25.143  1.00 75.13  ? 95  SER C OG  1 
ATOM   2300 N N   . ALA C 2 83  ? 14.254  -9.544  23.554  1.00 62.01  ? 96  ALA C N   1 
ATOM   2301 C CA  . ALA C 2 83  ? 15.632  -9.768  23.129  1.00 54.57  ? 96  ALA C CA  1 
ATOM   2302 C C   . ALA C 2 83  ? 16.575  -9.922  24.315  1.00 58.38  ? 96  ALA C C   1 
ATOM   2303 O O   . ALA C 2 83  ? 16.275  -9.477  25.423  1.00 69.99  ? 96  ALA C O   1 
ATOM   2304 C CB  . ALA C 2 83  ? 16.100  -8.640  22.229  1.00 55.15  ? 96  ALA C CB  1 
ATOM   2305 N N   . SER C 2 84  ? 17.722  -10.545 24.071  1.00 66.99  ? 97  SER C N   1 
ATOM   2306 C CA  . SER C 2 84  ? 18.723  -10.744 25.108  1.00 71.56  ? 97  SER C CA  1 
ATOM   2307 C C   . SER C 2 84  ? 20.112  -10.507 24.526  1.00 71.06  ? 97  SER C C   1 
ATOM   2308 O O   . SER C 2 84  ? 20.330  -10.720 23.334  1.00 63.70  ? 97  SER C O   1 
ATOM   2309 C CB  . SER C 2 84  ? 18.618  -12.159 25.680  1.00 71.22  ? 97  SER C CB  1 
ATOM   2310 O OG  . SER C 2 84  ? 17.327  -12.408 26.211  1.00 73.13  ? 97  SER C OG  1 
ATOM   2311 N N   . VAL C 2 85  ? 21.051  -10.068 25.358  1.00 77.10  ? 98  VAL C N   1 
ATOM   2312 C CA  . VAL C 2 85  ? 22.398  -9.778  24.866  1.00 72.20  ? 98  VAL C CA  1 
ATOM   2313 C C   . VAL C 2 85  ? 23.513  -10.296 25.782  1.00 68.66  ? 98  VAL C C   1 
ATOM   2314 O O   . VAL C 2 85  ? 23.488  -10.086 26.996  1.00 71.05  ? 98  VAL C O   1 
ATOM   2315 C CB  . VAL C 2 85  ? 22.581  -8.269  24.565  1.00 65.18  ? 98  VAL C CB  1 
ATOM   2316 C CG1 . VAL C 2 85  ? 22.278  -7.433  25.794  1.00 75.00  ? 98  VAL C CG1 1 
ATOM   2317 C CG2 . VAL C 2 85  ? 23.979  -7.988  24.039  1.00 57.69  ? 98  VAL C CG2 1 
ATOM   2318 N N   . ARG C 2 86  ? 24.477  -10.993 25.186  1.00 72.40  ? 99  ARG C N   1 
ATOM   2319 C CA  . ARG C 2 86  ? 25.604  -11.562 25.916  1.00 69.44  ? 99  ARG C CA  1 
ATOM   2320 C C   . ARG C 2 86  ? 26.866  -10.736 25.718  1.00 75.05  ? 99  ARG C C   1 
ATOM   2321 O O   . ARG C 2 86  ? 26.940  -9.894  24.822  1.00 79.25  ? 99  ARG C O   1 
ATOM   2322 C CB  . ARG C 2 86  ? 25.899  -12.971 25.401  1.00 69.67  ? 99  ARG C CB  1 
ATOM   2323 C CG  . ARG C 2 86  ? 25.247  -14.119 26.148  1.00 64.42  ? 99  ARG C CG  1 
ATOM   2324 C CD  . ARG C 2 86  ? 25.594  -15.427 25.442  1.00 64.48  ? 99  ARG C CD  1 
ATOM   2325 N NE  . ARG C 2 86  ? 25.139  -16.624 26.144  1.00 79.17  ? 99  ARG C NE  1 
ATOM   2326 C CZ  . ARG C 2 86  ? 25.121  -17.834 25.594  1.00 80.60  ? 99  ARG C CZ  1 
ATOM   2327 N NH1 . ARG C 2 86  ? 25.524  -17.992 24.340  1.00 67.31  ? 99  ARG C NH1 1 
ATOM   2328 N NH2 . ARG C 2 86  ? 24.698  -18.883 26.290  1.00 95.35  ? 99  ARG C NH2 1 
ATOM   2329 N N   . THR C 2 87  ? 27.861  -10.990 26.561  1.00 67.97  ? 100 THR C N   1 
ATOM   2330 C CA  . THR C 2 87  ? 29.224  -10.574 26.274  1.00 72.64  ? 100 THR C CA  1 
ATOM   2331 C C   . THR C 2 87  ? 29.954  -11.826 25.819  1.00 71.91  ? 100 THR C C   1 
ATOM   2332 O O   . THR C 2 87  ? 29.864  -12.867 26.470  1.00 65.12  ? 100 THR C O   1 
ATOM   2333 C CB  . THR C 2 87  ? 29.939  -10.026 27.520  1.00 82.47  ? 100 THR C CB  1 
ATOM   2334 O OG1 . THR C 2 87  ? 29.161  -8.972  28.099  1.00 88.82  ? 100 THR C OG1 1 
ATOM   2335 C CG2 . THR C 2 87  ? 31.320  -9.495  27.152  1.00 73.53  ? 100 THR C CG2 1 
ATOM   2336 N N   . ILE C 2 88  ? 30.656  -11.746 24.694  1.00 75.03  ? 101 ILE C N   1 
ATOM   2337 C CA  . ILE C 2 88  ? 31.413  -12.900 24.222  1.00 77.23  ? 101 ILE C CA  1 
ATOM   2338 C C   . ILE C 2 88  ? 32.906  -12.603 24.143  1.00 73.01  ? 101 ILE C C   1 
ATOM   2339 O O   . ILE C 2 88  ? 33.314  -11.513 23.742  1.00 62.08  ? 101 ILE C O   1 
ATOM   2340 C CB  . ILE C 2 88  ? 30.900  -13.444 22.860  1.00 74.82  ? 101 ILE C CB  1 
ATOM   2341 C CG1 . ILE C 2 88  ? 30.952  -12.364 21.779  1.00 82.82  ? 101 ILE C CG1 1 
ATOM   2342 C CG2 . ILE C 2 88  ? 29.485  -13.994 22.993  1.00 54.94  ? 101 ILE C CG2 1 
ATOM   2343 C CD1 . ILE C 2 88  ? 30.576  -12.866 20.394  1.00 84.61  ? 101 ILE C CD1 1 
ATOM   2344 N N   . LEU C 2 89  ? 33.709  -13.575 24.562  1.00 76.99  ? 102 LEU C N   1 
ATOM   2345 C CA  . LEU C 2 89  ? 35.158  -13.490 24.463  1.00 84.61  ? 102 LEU C CA  1 
ATOM   2346 C C   . LEU C 2 89  ? 35.671  -14.777 23.839  1.00 83.82  ? 102 LEU C C   1 
ATOM   2347 O O   . LEU C 2 89  ? 35.536  -15.855 24.423  1.00 83.14  ? 102 LEU C O   1 
ATOM   2348 C CB  . LEU C 2 89  ? 35.781  -13.302 25.846  1.00 93.23  ? 102 LEU C CB  1 
ATOM   2349 C CG  . LEU C 2 89  ? 37.310  -13.285 25.895  1.00 96.06  ? 102 LEU C CG  1 
ATOM   2350 C CD1 . LEU C 2 89  ? 37.837  -12.122 25.080  1.00 94.67  ? 102 LEU C CD1 1 
ATOM   2351 C CD2 . LEU C 2 89  ? 37.807  -13.207 27.330  1.00 100.14 ? 102 LEU C CD2 1 
ATOM   2352 N N   . GLN C 2 90  ? 36.254  -14.669 22.650  1.00 87.81  ? 103 GLN C N   1 
ATOM   2353 C CA  . GLN C 2 90  ? 36.705  -15.852 21.928  1.00 97.69  ? 103 GLN C CA  1 
ATOM   2354 C C   . GLN C 2 90  ? 38.074  -15.682 21.281  1.00 99.84  ? 103 GLN C C   1 
ATOM   2355 O O   . GLN C 2 90  ? 38.401  -14.624 20.740  1.00 93.04  ? 103 GLN C O   1 
ATOM   2356 C CB  . GLN C 2 90  ? 35.673  -16.262 20.870  1.00 106.26 ? 103 GLN C CB  1 
ATOM   2357 C CG  . GLN C 2 90  ? 35.185  -15.115 19.994  1.00 109.21 ? 103 GLN C CG  1 
ATOM   2358 C CD  . GLN C 2 90  ? 34.143  -15.554 18.979  1.00 105.90 ? 103 GLN C CD  1 
ATOM   2359 O OE1 . GLN C 2 90  ? 33.935  -16.748 18.761  1.00 109.51 ? 103 GLN C OE1 1 
ATOM   2360 N NE2 . GLN C 2 90  ? 33.484  -14.586 18.353  1.00 97.69  ? 103 GLN C NE2 1 
ATOM   2361 N N   . ASN C 2 91  ? 38.869  -16.743 21.354  1.00 108.75 ? 104 ASN C N   1 
ATOM   2362 C CA  . ASN C 2 91  ? 40.136  -16.815 20.645  1.00 118.46 ? 104 ASN C CA  1 
ATOM   2363 C C   . ASN C 2 91  ? 40.135  -18.018 19.703  1.00 133.94 ? 104 ASN C C   1 
ATOM   2364 O O   . ASN C 2 91  ? 39.485  -17.996 18.657  1.00 134.59 ? 104 ASN C O   1 
ATOM   2365 C CB  . ASN C 2 91  ? 41.304  -16.880 21.635  1.00 112.77 ? 104 ASN C CB  1 
ATOM   2366 C CG  . ASN C 2 91  ? 41.025  -17.798 22.816  1.00 109.50 ? 104 ASN C CG  1 
ATOM   2367 O OD1 . ASN C 2 91  ? 40.418  -18.858 22.665  1.00 113.77 ? 104 ASN C OD1 1 
ATOM   2368 N ND2 . ASN C 2 91  ? 41.473  -17.392 23.999  1.00 99.07  ? 104 ASN C ND2 1 
ATOM   2369 N N   . ASP C 2 92  ? 40.865  -19.062 20.077  1.00 146.39 ? 105 ASP C N   1 
ATOM   2370 C CA  . ASP C 2 92  ? 40.800  -20.337 19.376  1.00 151.65 ? 105 ASP C CA  1 
ATOM   2371 C C   . ASP C 2 92  ? 40.758  -21.434 20.425  1.00 150.62 ? 105 ASP C C   1 
ATOM   2372 O O   . ASP C 2 92  ? 40.018  -22.408 20.295  1.00 150.80 ? 105 ASP C O   1 
ATOM   2373 C CB  . ASP C 2 92  ? 42.017  -20.534 18.473  1.00 159.24 ? 105 ASP C CB  1 
ATOM   2374 C CG  . ASP C 2 92  ? 42.555  -19.229 17.928  1.00 161.67 ? 105 ASP C CG  1 
ATOM   2375 O OD1 . ASP C 2 92  ? 41.891  -18.627 17.056  1.00 158.63 ? 105 ASP C OD1 1 
ATOM   2376 O OD2 . ASP C 2 92  ? 43.644  -18.808 18.371  1.00 163.51 ? 105 ASP C OD2 1 
ATOM   2377 N N   . HIS C 2 93  ? 41.566  -21.257 21.467  1.00 147.06 ? 106 HIS C N   1 
ATOM   2378 C CA  . HIS C 2 93  ? 41.609  -22.185 22.589  1.00 143.97 ? 106 HIS C CA  1 
ATOM   2379 C C   . HIS C 2 93  ? 40.251  -22.293 23.270  1.00 138.75 ? 106 HIS C C   1 
ATOM   2380 O O   . HIS C 2 93  ? 39.839  -23.378 23.679  1.00 140.05 ? 106 HIS C O   1 
ATOM   2381 C CB  . HIS C 2 93  ? 42.659  -21.743 23.613  1.00 149.78 ? 106 HIS C CB  1 
ATOM   2382 C CG  . HIS C 2 93  ? 44.066  -21.808 23.107  1.00 169.50 ? 106 HIS C CG  1 
ATOM   2383 N ND1 . HIS C 2 93  ? 44.852  -22.941 23.233  1.00 180.42 ? 106 HIS C ND1 1 
ATOM   2384 C CD2 . HIS C 2 93  ? 44.834  -20.892 22.481  1.00 176.76 ? 106 HIS C CD2 1 
ATOM   2385 C CE1 . HIS C 2 93  ? 46.034  -22.712 22.704  1.00 183.37 ? 106 HIS C CE1 1 
ATOM   2386 N NE2 . HIS C 2 93  ? 46.057  -21.475 22.237  1.00 183.95 ? 106 HIS C NE2 1 
ATOM   2387 N N   . SER C 2 94  ? 39.555  -21.166 23.387  1.00 127.83 ? 107 SER C N   1 
ATOM   2388 C CA  . SER C 2 94  ? 38.296  -21.143 24.122  1.00 109.29 ? 107 SER C CA  1 
ATOM   2389 C C   . SER C 2 94  ? 37.313  -20.064 23.673  1.00 97.22  ? 107 SER C C   1 
ATOM   2390 O O   . SER C 2 94  ? 37.687  -19.091 23.017  1.00 87.48  ? 107 SER C O   1 
ATOM   2391 C CB  . SER C 2 94  ? 38.564  -20.995 25.622  1.00 103.26 ? 107 SER C CB  1 
ATOM   2392 O OG  . SER C 2 94  ? 39.253  -19.789 25.902  1.00 103.34 ? 107 SER C OG  1 
ATOM   2393 N N   . LEU C 2 95  ? 36.048  -20.261 24.032  1.00 94.17  ? 108 LEU C N   1 
ATOM   2394 C CA  . LEU C 2 95  ? 35.025  -19.239 23.864  1.00 87.30  ? 108 LEU C CA  1 
ATOM   2395 C C   . LEU C 2 95  ? 34.338  -19.000 25.200  1.00 90.46  ? 108 LEU C C   1 
ATOM   2396 O O   . LEU C 2 95  ? 33.879  -19.940 25.850  1.00 87.94  ? 108 LEU C O   1 
ATOM   2397 C CB  . LEU C 2 95  ? 33.997  -19.651 22.804  1.00 83.04  ? 108 LEU C CB  1 
ATOM   2398 C CG  . LEU C 2 95  ? 32.830  -18.682 22.569  1.00 80.61  ? 108 LEU C CG  1 
ATOM   2399 C CD1 . LEU C 2 95  ? 32.532  -18.547 21.086  1.00 81.97  ? 108 LEU C CD1 1 
ATOM   2400 C CD2 . LEU C 2 95  ? 31.584  -19.141 23.311  1.00 75.89  ? 108 LEU C CD2 1 
ATOM   2401 N N   . LEU C 2 96  ? 34.278  -17.739 25.612  1.00 93.44  ? 109 LEU C N   1 
ATOM   2402 C CA  . LEU C 2 96  ? 33.591  -17.381 26.844  1.00 88.00  ? 109 LEU C CA  1 
ATOM   2403 C C   . LEU C 2 96  ? 32.336  -16.567 26.550  1.00 80.88  ? 109 LEU C C   1 
ATOM   2404 O O   . LEU C 2 96  ? 32.359  -15.638 25.741  1.00 82.79  ? 109 LEU C O   1 
ATOM   2405 C CB  . LEU C 2 96  ? 34.521  -16.603 27.782  1.00 89.71  ? 109 LEU C CB  1 
ATOM   2406 C CG  . LEU C 2 96  ? 35.620  -17.391 28.500  1.00 95.72  ? 109 LEU C CG  1 
ATOM   2407 C CD1 . LEU C 2 96  ? 36.499  -16.467 29.331  1.00 100.53 ? 109 LEU C CD1 1 
ATOM   2408 C CD2 . LEU C 2 96  ? 35.004  -18.468 29.373  1.00 98.01  ? 109 LEU C CD2 1 
ATOM   2409 N N   . ALA C 2 97  ? 31.240  -16.930 27.208  1.00 70.20  ? 110 ALA C N   1 
ATOM   2410 C CA  . ALA C 2 97  ? 29.986  -16.200 27.080  1.00 72.60  ? 110 ALA C CA  1 
ATOM   2411 C C   . ALA C 2 97  ? 29.414  -15.900 28.460  1.00 78.72  ? 110 ALA C C   1 
ATOM   2412 O O   . ALA C 2 97  ? 29.277  -16.797 29.291  1.00 74.79  ? 110 ALA C O   1 
ATOM   2413 C CB  . ALA C 2 97  ? 28.991  -16.996 26.256  1.00 72.49  ? 110 ALA C CB  1 
ATOM   2414 N N   . SER C 2 98  ? 29.079  -14.636 28.695  1.00 77.25  ? 111 SER C N   1 
ATOM   2415 C CA  . SER C 2 98  ? 28.517  -14.218 29.973  1.00 76.22  ? 111 SER C CA  1 
ATOM   2416 C C   . SER C 2 98  ? 27.043  -14.580 30.048  1.00 77.42  ? 111 SER C C   1 
ATOM   2417 O O   . SER C 2 98  ? 26.480  -15.122 29.097  1.00 77.12  ? 111 SER C O   1 
ATOM   2418 C CB  . SER C 2 98  ? 28.685  -12.711 30.164  1.00 75.65  ? 111 SER C CB  1 
ATOM   2419 O OG  . SER C 2 98  ? 27.851  -11.987 29.274  1.00 74.07  ? 111 SER C OG  1 
ATOM   2420 N N   . SER C 2 99  ? 26.423  -14.282 31.186  1.00 80.41  ? 112 SER C N   1 
ATOM   2421 C CA  . SER C 2 99  ? 24.991  -14.492 31.354  1.00 84.17  ? 112 SER C CA  1 
ATOM   2422 C C   . SER C 2 99  ? 24.217  -13.494 30.502  1.00 79.26  ? 112 SER C C   1 
ATOM   2423 O O   . SER C 2 99  ? 24.788  -12.535 29.985  1.00 65.87  ? 112 SER C O   1 
ATOM   2424 C CB  . SER C 2 99  ? 24.593  -14.352 32.824  1.00 82.67  ? 112 SER C CB  1 
ATOM   2425 O OG  . SER C 2 99  ? 24.885  -13.053 33.309  1.00 90.02  ? 112 SER C OG  1 
ATOM   2426 N N   . TRP C 2 100 ? 22.916  -13.721 30.363  1.00 81.78  ? 113 TRP C N   1 
ATOM   2427 C CA  . TRP C 2 100 ? 22.086  -12.885 29.503  1.00 81.48  ? 113 TRP C CA  1 
ATOM   2428 C C   . TRP C 2 100 ? 21.562  -11.630 30.195  1.00 89.60  ? 113 TRP C C   1 
ATOM   2429 O O   . TRP C 2 100 ? 21.096  -11.675 31.334  1.00 91.78  ? 113 TRP C O   1 
ATOM   2430 C CB  . TRP C 2 100 ? 20.901  -13.683 28.950  1.00 68.91  ? 113 TRP C CB  1 
ATOM   2431 C CG  . TRP C 2 100 ? 21.276  -14.783 27.998  1.00 69.06  ? 113 TRP C CG  1 
ATOM   2432 C CD1 . TRP C 2 100 ? 21.351  -16.118 28.276  1.00 71.59  ? 113 TRP C CD1 1 
ATOM   2433 C CD2 . TRP C 2 100 ? 21.620  -14.644 26.613  1.00 72.73  ? 113 TRP C CD2 1 
ATOM   2434 N NE1 . TRP C 2 100 ? 21.723  -16.817 27.153  1.00 75.21  ? 113 TRP C NE1 1 
ATOM   2435 C CE2 . TRP C 2 100 ? 21.893  -15.936 26.118  1.00 67.89  ? 113 TRP C CE2 1 
ATOM   2436 C CE3 . TRP C 2 100 ? 21.726  -13.553 25.745  1.00 73.92  ? 113 TRP C CE3 1 
ATOM   2437 C CZ2 . TRP C 2 100 ? 22.260  -16.165 24.792  1.00 65.53  ? 113 TRP C CZ2 1 
ATOM   2438 C CZ3 . TRP C 2 100 ? 22.093  -13.782 24.431  1.00 69.56  ? 113 TRP C CZ3 1 
ATOM   2439 C CH2 . TRP C 2 100 ? 22.355  -15.077 23.967  1.00 69.48  ? 113 TRP C CH2 1 
ATOM   2440 N N   . ALA C 2 101 ? 21.646  -10.508 29.491  1.00 86.69  ? 114 ALA C N   1 
ATOM   2441 C CA  . ALA C 2 101 ? 20.936  -9.304  29.885  1.00 82.10  ? 114 ALA C CA  1 
ATOM   2442 C C   . ALA C 2 101 ? 19.738  -9.189  28.957  1.00 85.26  ? 114 ALA C C   1 
ATOM   2443 O O   . ALA C 2 101 ? 19.898  -9.093  27.740  1.00 91.07  ? 114 ALA C O   1 
ATOM   2444 C CB  . ALA C 2 101 ? 21.833  -8.087  29.758  1.00 72.26  ? 114 ALA C CB  1 
ATOM   2445 N N   . SER C 2 102 ? 18.540  -9.212  29.529  1.00 77.81  ? 115 SER C N   1 
ATOM   2446 C CA  . SER C 2 102 ? 17.323  -9.264  28.726  1.00 78.44  ? 115 SER C CA  1 
ATOM   2447 C C   . SER C 2 102 ? 16.444  -8.024  28.856  1.00 75.97  ? 115 SER C C   1 
ATOM   2448 O O   . SER C 2 102 ? 16.533  -7.278  29.832  1.00 75.55  ? 115 SER C O   1 
ATOM   2449 C CB  . SER C 2 102 ? 16.516  -10.517 29.070  1.00 82.44  ? 115 SER C CB  1 
ATOM   2450 O OG  . SER C 2 102 ? 17.263  -11.687 28.784  1.00 84.03  ? 115 SER C OG  1 
ATOM   2451 N N   . ALA C 2 103 ? 15.598  -7.814  27.854  1.00 77.87  ? 116 ALA C N   1 
ATOM   2452 C CA  . ALA C 2 103 ? 14.649  -6.709  27.854  1.00 75.34  ? 116 ALA C CA  1 
ATOM   2453 C C   . ALA C 2 103 ? 13.501  -7.048  26.917  1.00 82.54  ? 116 ALA C C   1 
ATOM   2454 O O   . ALA C 2 103 ? 13.708  -7.687  25.886  1.00 82.14  ? 116 ALA C O   1 
ATOM   2455 C CB  . ALA C 2 103 ? 15.329  -5.426  27.417  1.00 74.42  ? 116 ALA C CB  1 
ATOM   2456 N N   . GLU C 2 104 ? 12.293  -6.626  27.272  1.00 91.26  ? 117 GLU C N   1 
ATOM   2457 C CA  . GLU C 2 104 ? 11.125  -6.945  26.459  1.00 91.78  ? 117 GLU C CA  1 
ATOM   2458 C C   . GLU C 2 104 ? 10.142  -5.789  26.329  1.00 89.92  ? 117 GLU C C   1 
ATOM   2459 O O   . GLU C 2 104 ? 9.976   -4.990  27.251  1.00 96.74  ? 117 GLU C O   1 
ATOM   2460 C CB  . GLU C 2 104 ? 10.404  -8.180  27.008  1.00 100.05 ? 117 GLU C CB  1 
ATOM   2461 C CG  . GLU C 2 104 ? 9.923   -8.041  28.447  1.00 119.80 ? 117 GLU C CG  1 
ATOM   2462 C CD  . GLU C 2 104 ? 9.158   -9.265  28.928  1.00 132.14 ? 117 GLU C CD  1 
ATOM   2463 O OE1 . GLU C 2 104 ? 8.982   -9.414  30.158  1.00 133.25 ? 117 GLU C OE1 1 
ATOM   2464 O OE2 . GLU C 2 104 ? 8.729   -10.076 28.077  1.00 132.52 ? 117 GLU C OE2 1 
ATOM   2465 N N   . LEU C 2 105 ? 9.496   -5.706  25.171  1.00 87.14  ? 118 LEU C N   1 
ATOM   2466 C CA  . LEU C 2 105 ? 8.400   -4.769  24.974  1.00 92.75  ? 118 LEU C CA  1 
ATOM   2467 C C   . LEU C 2 105 ? 7.091   -5.542  25.053  1.00 95.79  ? 118 LEU C C   1 
ATOM   2468 O O   . LEU C 2 105 ? 6.822   -6.406  24.218  1.00 99.94  ? 118 LEU C O   1 
ATOM   2469 C CB  . LEU C 2 105 ? 8.521   -4.068  23.619  1.00 87.57  ? 118 LEU C CB  1 
ATOM   2470 C CG  . LEU C 2 105 ? 9.714   -3.127  23.427  1.00 86.03  ? 118 LEU C CG  1 
ATOM   2471 C CD1 . LEU C 2 105 ? 9.749   -2.577  22.007  1.00 79.45  ? 118 LEU C CD1 1 
ATOM   2472 C CD2 . LEU C 2 105 ? 9.657   -1.998  24.439  1.00 87.00  ? 118 LEU C CD2 1 
ATOM   2473 N N   . HIS C 2 106 ? 6.288   -5.241  26.067  1.00 88.33  ? 119 HIS C N   1 
ATOM   2474 C CA  . HIS C 2 106 ? 5.035   -5.956  26.289  1.00 94.22  ? 119 HIS C CA  1 
ATOM   2475 C C   . HIS C 2 106 ? 4.063   -5.777  25.127  1.00 90.42  ? 119 HIS C C   1 
ATOM   2476 O O   . HIS C 2 106 ? 4.012   -4.714  24.507  1.00 96.86  ? 119 HIS C O   1 
ATOM   2477 C CB  . HIS C 2 106 ? 4.384   -5.517  27.604  1.00 109.69 ? 119 HIS C CB  1 
ATOM   2478 C CG  . HIS C 2 106 ? 5.121   -5.975  28.823  1.00 125.76 ? 119 HIS C CG  1 
ATOM   2479 N ND1 . HIS C 2 106 ? 6.375   -5.507  29.157  1.00 130.69 ? 119 HIS C ND1 1 
ATOM   2480 C CD2 . HIS C 2 106 ? 4.784   -6.863  29.789  1.00 134.88 ? 119 HIS C CD2 1 
ATOM   2481 C CE1 . HIS C 2 106 ? 6.776   -6.084  30.274  1.00 134.17 ? 119 HIS C CE1 1 
ATOM   2482 N NE2 . HIS C 2 106 ? 5.829   -6.912  30.679  1.00 137.93 ? 119 HIS C NE2 1 
ATOM   2483 N N   . ALA C 2 107 ? 3.305   -6.830  24.836  1.00 82.48  ? 120 ALA C N   1 
ATOM   2484 C CA  . ALA C 2 107 ? 2.324   -6.807  23.758  1.00 89.48  ? 120 ALA C CA  1 
ATOM   2485 C C   . ALA C 2 107 ? 1.299   -5.700  23.982  1.00 99.61  ? 120 ALA C C   1 
ATOM   2486 O O   . ALA C 2 107 ? 0.935   -5.411  25.122  1.00 96.26  ? 120 ALA C O   1 
ATOM   2487 C CB  . ALA C 2 107 ? 1.632   -8.158  23.652  1.00 84.56  ? 120 ALA C CB  1 
ATOM   2488 N N   . PRO C 2 108 ? 0.837   -5.072  22.889  1.00 98.24  ? 121 PRO C N   1 
ATOM   2489 C CA  . PRO C 2 108 ? -0.149  -3.989  22.969  1.00 100.69 ? 121 PRO C CA  1 
ATOM   2490 C C   . PRO C 2 108 ? -1.433  -4.421  23.672  1.00 108.76 ? 121 PRO C C   1 
ATOM   2491 O O   . PRO C 2 108 ? -1.910  -5.534  23.444  1.00 101.42 ? 121 PRO C O   1 
ATOM   2492 C CB  . PRO C 2 108 ? -0.441  -3.676  21.499  1.00 93.65  ? 121 PRO C CB  1 
ATOM   2493 C CG  . PRO C 2 108 ? 0.779   -4.108  20.770  1.00 92.38  ? 121 PRO C CG  1 
ATOM   2494 C CD  . PRO C 2 108 ? 1.270   -5.321  21.503  1.00 92.94  ? 121 PRO C CD  1 
ATOM   2495 N N   . PRO C 2 109 ? -1.983  -3.546  24.528  1.00 115.37 ? 122 PRO C N   1 
ATOM   2496 C CA  . PRO C 2 109 ? -3.230  -3.838  25.240  1.00 115.91 ? 122 PRO C CA  1 
ATOM   2497 C C   . PRO C 2 109 ? -4.401  -3.949  24.275  1.00 121.38 ? 122 PRO C C   1 
ATOM   2498 O O   . PRO C 2 109 ? -4.452  -3.218  23.285  1.00 114.36 ? 122 PRO C O   1 
ATOM   2499 C CB  . PRO C 2 109 ? -3.409  -2.618  26.148  1.00 117.45 ? 122 PRO C CB  1 
ATOM   2500 C CG  . PRO C 2 109 ? -2.626  -1.534  25.493  1.00 115.74 ? 122 PRO C CG  1 
ATOM   2501 C CD  . PRO C 2 109 ? -1.449  -2.217  24.871  1.00 115.02 ? 122 PRO C CD  1 
ATOM   2502 N N   . GLY C 2 110 ? -5.325  -4.859  24.565  1.00 130.36 ? 123 GLY C N   1 
ATOM   2503 C CA  . GLY C 2 110 ? -6.481  -5.074  23.716  1.00 131.89 ? 123 GLY C CA  1 
ATOM   2504 C C   . GLY C 2 110 ? -6.819  -6.543  23.545  1.00 135.32 ? 123 GLY C C   1 
ATOM   2505 O O   . GLY C 2 110 ? -5.993  -7.418  23.812  1.00 133.76 ? 123 GLY C O   1 
ATOM   2506 N N   . SER C 2 111 ? -8.043  -6.810  23.100  1.00 142.89 ? 124 SER C N   1 
ATOM   2507 C CA  . SER C 2 111 ? -8.510  -8.172  22.858  1.00 143.58 ? 124 SER C CA  1 
ATOM   2508 C C   . SER C 2 111 ? -8.053  -8.667  21.487  1.00 142.92 ? 124 SER C C   1 
ATOM   2509 O O   . SER C 2 111 ? -7.900  -7.871  20.559  1.00 146.03 ? 124 SER C O   1 
ATOM   2510 C CB  . SER C 2 111 ? -10.038 -8.231  22.971  1.00 141.40 ? 124 SER C CB  1 
ATOM   2511 O OG  . SER C 2 111 ? -10.560 -9.435  22.434  1.00 137.19 ? 124 SER C OG  1 
ATOM   2512 N N   . PRO C 2 112 ? -7.820  -9.985  21.359  1.00 137.95 ? 125 PRO C N   1 
ATOM   2513 C CA  . PRO C 2 112 ? -7.391  -10.580 20.089  1.00 128.22 ? 125 PRO C CA  1 
ATOM   2514 C C   . PRO C 2 112 ? -8.332  -10.290 18.921  1.00 122.60 ? 125 PRO C C   1 
ATOM   2515 O O   . PRO C 2 112 ? -7.861  -9.997  17.823  1.00 119.73 ? 125 PRO C O   1 
ATOM   2516 C CB  . PRO C 2 112 ? -7.364  -12.087 20.393  1.00 128.41 ? 125 PRO C CB  1 
ATOM   2517 C CG  . PRO C 2 112 ? -8.104  -12.253 21.690  1.00 136.75 ? 125 PRO C CG  1 
ATOM   2518 C CD  . PRO C 2 112 ? -7.856  -10.985 22.438  1.00 140.07 ? 125 PRO C CD  1 
ATOM   2519 N N   . GLY C 2 113 ? -9.638  -10.361 19.156  1.00 121.81 ? 126 GLY C N   1 
ATOM   2520 C CA  . GLY C 2 113 ? -10.607 -10.160 18.094  1.00 121.09 ? 126 GLY C CA  1 
ATOM   2521 C C   . GLY C 2 113 ? -10.875 -8.707  17.748  1.00 114.96 ? 126 GLY C C   1 
ATOM   2522 O O   . GLY C 2 113 ? -11.781 -8.409  16.969  1.00 106.53 ? 126 GLY C O   1 
ATOM   2523 N N   . THR C 2 114 ? -10.091 -7.801  18.323  1.00 117.03 ? 127 THR C N   1 
ATOM   2524 C CA  . THR C 2 114 ? -10.236 -6.375  18.045  1.00 123.92 ? 127 THR C CA  1 
ATOM   2525 C C   . THR C 2 114 ? -9.378  -5.944  16.856  1.00 121.52 ? 127 THR C C   1 
ATOM   2526 O O   . THR C 2 114 ? -9.601  -4.885  16.268  1.00 114.14 ? 127 THR C O   1 
ATOM   2527 C CB  . THR C 2 114 ? -9.864  -5.518  19.269  1.00 127.52 ? 127 THR C CB  1 
ATOM   2528 O OG1 . THR C 2 114 ? -8.534  -5.837  19.695  1.00 124.97 ? 127 THR C OG1 1 
ATOM   2529 C CG2 . THR C 2 114 ? -10.832 -5.774  20.412  1.00 130.28 ? 127 THR C CG2 1 
ATOM   2530 N N   . SER C 2 115 ? -8.399  -6.773  16.509  1.00 120.35 ? 128 SER C N   1 
ATOM   2531 C CA  . SER C 2 115 ? -7.472  -6.472  15.422  1.00 111.83 ? 128 SER C CA  1 
ATOM   2532 C C   . SER C 2 115 ? -8.108  -6.642  14.046  1.00 106.72 ? 128 SER C C   1 
ATOM   2533 O O   . SER C 2 115 ? -9.136  -7.306  13.905  1.00 105.79 ? 128 SER C O   1 
ATOM   2534 C CB  . SER C 2 115 ? -6.234  -7.365  15.530  1.00 110.59 ? 128 SER C CB  1 
ATOM   2535 O OG  . SER C 2 115 ? -5.520  -7.393  14.305  1.00 108.08 ? 128 SER C OG  1 
ATOM   2536 N N   . ILE C 2 116 ? -7.492  -6.039  13.032  1.00 102.46 ? 129 ILE C N   1 
ATOM   2537 C CA  . ILE C 2 116 ? -7.938  -6.221  11.656  1.00 100.31 ? 129 ILE C CA  1 
ATOM   2538 C C   . ILE C 2 116 ? -7.596  -7.624  11.181  1.00 101.31 ? 129 ILE C C   1 
ATOM   2539 O O   . ILE C 2 116 ? -6.835  -8.340  11.833  1.00 101.31 ? 129 ILE C O   1 
ATOM   2540 C CB  . ILE C 2 116 ? -7.278  -5.215  10.695  1.00 95.37  ? 129 ILE C CB  1 
ATOM   2541 C CG1 . ILE C 2 116 ? -5.766  -5.441  10.636  1.00 85.28  ? 129 ILE C CG1 1 
ATOM   2542 C CG2 . ILE C 2 116 ? -7.594  -3.794  11.112  1.00 101.99 ? 129 ILE C CG2 1 
ATOM   2543 C CD1 . ILE C 2 116 ? -5.100  -4.771  9.454   1.00 72.34  ? 129 ILE C CD1 1 
ATOM   2544 N N   . VAL C 2 117 ? -8.158  -8.013  10.040  1.00 103.72 ? 130 VAL C N   1 
ATOM   2545 C CA  . VAL C 2 117 ? -7.950  -9.351  9.499   1.00 107.47 ? 130 VAL C CA  1 
ATOM   2546 C C   . VAL C 2 117 ? -7.557  -9.292  8.025   1.00 106.18 ? 130 VAL C C   1 
ATOM   2547 O O   . VAL C 2 117 ? -8.114  -8.503  7.260   1.00 110.70 ? 130 VAL C O   1 
ATOM   2548 C CB  . VAL C 2 117 ? -9.223  -10.219 9.644   1.00 116.70 ? 130 VAL C CB  1 
ATOM   2549 C CG1 . VAL C 2 117 ? -8.980  -11.628 9.123   1.00 114.46 ? 130 VAL C CG1 1 
ATOM   2550 C CG2 . VAL C 2 117 ? -9.682  -10.262 11.094  1.00 117.43 ? 130 VAL C CG2 1 
ATOM   2551 N N   . ASN C 2 118 ? -6.588  -10.122 7.643   1.00 101.08 ? 131 ASN C N   1 
ATOM   2552 C CA  . ASN C 2 118 ? -6.179  -10.269 6.248   1.00 99.17  ? 131 ASN C CA  1 
ATOM   2553 C C   . ASN C 2 118 ? -5.676  -8.980  5.595   1.00 94.73  ? 131 ASN C C   1 
ATOM   2554 O O   . ASN C 2 118 ? -6.240  -8.519  4.603   1.00 89.50  ? 131 ASN C O   1 
ATOM   2555 C CB  . ASN C 2 118 ? -7.311  -10.887 5.418   1.00 105.43 ? 131 ASN C CB  1 
ATOM   2556 C CG  . ASN C 2 118 ? -7.676  -12.285 5.881   1.00 125.49 ? 131 ASN C CG  1 
ATOM   2557 O OD1 . ASN C 2 118 ? -7.072  -12.818 6.811   1.00 133.16 ? 131 ASN C OD1 1 
ATOM   2558 N ND2 . ASN C 2 118 ? -8.675  -12.883 5.239   1.00 137.22 ? 131 ASN C ND2 1 
ATOM   2559 N N   . LEU C 2 119 ? -4.614  -8.404  6.152   1.00 91.03  ? 132 LEU C N   1 
ATOM   2560 C CA  . LEU C 2 119 ? -4.004  -7.214  5.565   1.00 88.06  ? 132 LEU C CA  1 
ATOM   2561 C C   . LEU C 2 119 ? -3.300  -7.566  4.259   1.00 93.12  ? 132 LEU C C   1 
ATOM   2562 O O   . LEU C 2 119 ? -2.323  -8.315  4.250   1.00 102.84 ? 132 LEU C O   1 
ATOM   2563 C CB  . LEU C 2 119 ? -3.014  -6.568  6.540   1.00 82.44  ? 132 LEU C CB  1 
ATOM   2564 C CG  . LEU C 2 119 ? -2.215  -5.373  6.007   1.00 83.92  ? 132 LEU C CG  1 
ATOM   2565 C CD1 . LEU C 2 119 ? -3.157  -4.269  5.561   1.00 88.93  ? 132 LEU C CD1 1 
ATOM   2566 C CD2 . LEU C 2 119 ? -1.227  -4.850  7.045   1.00 83.91  ? 132 LEU C CD2 1 
ATOM   2567 N N   . THR C 2 120 ? -3.806  -7.027  3.156   1.00 89.65  ? 133 THR C N   1 
ATOM   2568 C CA  . THR C 2 120 ? -3.205  -7.259  1.852   1.00 88.89  ? 133 THR C CA  1 
ATOM   2569 C C   . THR C 2 120 ? -2.852  -5.927  1.205   1.00 84.24  ? 133 THR C C   1 
ATOM   2570 O O   . THR C 2 120 ? -3.715  -5.064  1.044   1.00 92.32  ? 133 THR C O   1 
ATOM   2571 C CB  . THR C 2 120 ? -4.159  -8.036  0.929   1.00 93.94  ? 133 THR C CB  1 
ATOM   2572 O OG1 . THR C 2 120 ? -4.649  -9.194  1.615   1.00 98.13  ? 133 THR C OG1 1 
ATOM   2573 C CG2 . THR C 2 120 ? -3.443  -8.463  -0.341  1.00 89.51  ? 133 THR C CG2 1 
ATOM   2574 N N   . CYS C 2 121 ? -1.583  -5.762  0.844   1.00 82.98  ? 134 CYS C N   1 
ATOM   2575 C CA  . CYS C 2 121 ? -1.112  -4.520  0.233   1.00 80.68  ? 134 CYS C CA  1 
ATOM   2576 C C   . CYS C 2 121 ? -0.537  -4.751  -1.160  1.00 75.39  ? 134 CYS C C   1 
ATOM   2577 O O   . CYS C 2 121 ? 0.022   -5.810  -1.443  1.00 76.65  ? 134 CYS C O   1 
ATOM   2578 C CB  . CYS C 2 121 ? -0.069  -3.847  1.126   1.00 75.71  ? 134 CYS C CB  1 
ATOM   2579 S SG  . CYS C 2 121 ? -0.712  -3.288  2.719   1.00 96.56  ? 134 CYS C SG  1 
ATOM   2580 N N   . THR C 2 122 ? -0.674  -3.748  -2.022  1.00 83.64  ? 135 THR C N   1 
ATOM   2581 C CA  . THR C 2 122 ? -0.218  -3.852  -3.401  1.00 84.57  ? 135 THR C CA  1 
ATOM   2582 C C   . THR C 2 122 ? 0.446   -2.559  -3.860  1.00 78.24  ? 135 THR C C   1 
ATOM   2583 O O   . THR C 2 122 ? -0.128  -1.477  -3.729  1.00 85.83  ? 135 THR C O   1 
ATOM   2584 C CB  . THR C 2 122 ? -1.389  -4.159  -4.356  1.00 82.14  ? 135 THR C CB  1 
ATOM   2585 O OG1 . THR C 2 122 ? -2.036  -5.373  -3.956  1.00 80.95  ? 135 THR C OG1 1 
ATOM   2586 C CG2 . THR C 2 122 ? -0.889  -4.303  -5.783  1.00 82.12  ? 135 THR C CG2 1 
ATOM   2587 N N   . THR C 2 123 ? 1.658   -2.674  -4.394  1.00 73.45  ? 136 THR C N   1 
ATOM   2588 C CA  . THR C 2 123 ? 2.357   -1.522  -4.951  1.00 79.84  ? 136 THR C CA  1 
ATOM   2589 C C   . THR C 2 123 ? 2.358   -1.595  -6.473  1.00 87.67  ? 136 THR C C   1 
ATOM   2590 O O   . THR C 2 123 ? 2.419   -2.681  -7.048  1.00 91.10  ? 136 THR C O   1 
ATOM   2591 C CB  . THR C 2 123 ? 3.810   -1.405  -4.427  1.00 82.68  ? 136 THR C CB  1 
ATOM   2592 O OG1 . THR C 2 123 ? 4.505   -2.640  -4.635  1.00 79.34  ? 136 THR C OG1 1 
ATOM   2593 C CG2 . THR C 2 123 ? 3.821   -1.070  -2.943  1.00 88.55  ? 136 THR C CG2 1 
ATOM   2594 N N   . ASN C 2 124 ? 2.271   -0.435  -7.117  1.00 90.37  ? 137 ASN C N   1 
ATOM   2595 C CA  . ASN C 2 124 ? 2.327   -0.350  -8.573  1.00 92.09  ? 137 ASN C CA  1 
ATOM   2596 C C   . ASN C 2 124 ? 3.147   0.855   -9.028  1.00 93.25  ? 137 ASN C C   1 
ATOM   2597 O O   . ASN C 2 124 ? 3.126   1.906   -8.390  1.00 82.41  ? 137 ASN C O   1 
ATOM   2598 C CB  . ASN C 2 124 ? 0.919   -0.281  -9.170  1.00 97.43  ? 137 ASN C CB  1 
ATOM   2599 C CG  . ASN C 2 124 ? 0.921   -0.403  -10.684 1.00 107.30 ? 137 ASN C CG  1 
ATOM   2600 O OD1 . ASN C 2 124 ? 1.622   -1.242  -11.249 1.00 107.42 ? 137 ASN C OD1 1 
ATOM   2601 N ND2 . ASN C 2 124 ? 0.141   0.444   -11.348 1.00 113.38 ? 137 ASN C ND2 1 
ATOM   2602 N N   . THR C 2 125 ? 3.870   0.699   -10.131 1.00 94.79  ? 138 THR C N   1 
ATOM   2603 C CA  . THR C 2 125 ? 4.711   1.773   -10.645 1.00 90.21  ? 138 THR C CA  1 
ATOM   2604 C C   . THR C 2 125 ? 4.068   2.426   -11.865 1.00 98.29  ? 138 THR C C   1 
ATOM   2605 O O   . THR C 2 125 ? 3.659   1.739   -12.800 1.00 108.74 ? 138 THR C O   1 
ATOM   2606 C CB  . THR C 2 125 ? 6.116   1.252   -11.019 1.00 88.73  ? 138 THR C CB  1 
ATOM   2607 O OG1 . THR C 2 125 ? 6.748   0.698   -9.858  1.00 93.13  ? 138 THR C OG1 1 
ATOM   2608 C CG2 . THR C 2 125 ? 6.979   2.375   -11.570 1.00 99.96  ? 138 THR C CG2 1 
ATOM   2609 N N   . THR C 2 126 ? 3.966   3.753   -11.841 1.00 98.70  ? 139 THR C N   1 
ATOM   2610 C CA  . THR C 2 126 ? 3.449   4.511   -12.977 1.00 111.10 ? 139 THR C CA  1 
ATOM   2611 C C   . THR C 2 126 ? 4.434   5.609   -13.370 1.00 115.40 ? 139 THR C C   1 
ATOM   2612 O O   . THR C 2 126 ? 5.439   5.820   -12.692 1.00 109.51 ? 139 THR C O   1 
ATOM   2613 C CB  . THR C 2 126 ? 2.076   5.147   -12.672 1.00 111.97 ? 139 THR C CB  1 
ATOM   2614 O OG1 . THR C 2 126 ? 2.218   6.139   -11.648 1.00 117.55 ? 139 THR C OG1 1 
ATOM   2615 C CG2 . THR C 2 126 ? 1.079   4.089   -12.219 1.00 110.83 ? 139 THR C CG2 1 
ATOM   2616 N N   . GLU C 2 127 ? 4.146   6.304   -14.465 1.00 126.24 ? 140 GLU C N   1 
ATOM   2617 C CA  . GLU C 2 127 ? 5.025   7.367   -14.938 1.00 128.62 ? 140 GLU C CA  1 
ATOM   2618 C C   . GLU C 2 127 ? 4.685   8.706   -14.299 1.00 126.98 ? 140 GLU C C   1 
ATOM   2619 O O   . GLU C 2 127 ? 3.519   9.099   -14.235 1.00 121.13 ? 140 GLU C O   1 
ATOM   2620 C CB  . GLU C 2 127 ? 4.985   7.471   -16.463 1.00 132.83 ? 140 GLU C CB  1 
ATOM   2621 C CG  . GLU C 2 127 ? 5.915   6.496   -17.163 1.00 139.15 ? 140 GLU C CG  1 
ATOM   2622 C CD  . GLU C 2 127 ? 5.562   6.291   -18.622 1.00 148.13 ? 140 GLU C CD  1 
ATOM   2623 O OE1 . GLU C 2 127 ? 4.381   6.477   -18.983 1.00 155.53 ? 140 GLU C OE1 1 
ATOM   2624 O OE2 . GLU C 2 127 ? 6.469   5.942   -19.407 1.00 146.35 ? 140 GLU C OE2 1 
ATOM   2625 N N   . ASP C 2 128 ? 5.718   9.398   -13.829 1.00 127.44 ? 141 ASP C N   1 
ATOM   2626 C CA  . ASP C 2 128 ? 5.551   10.670  -13.140 1.00 128.45 ? 141 ASP C CA  1 
ATOM   2627 C C   . ASP C 2 128 ? 5.843   11.854  -14.065 1.00 128.42 ? 141 ASP C C   1 
ATOM   2628 O O   . ASP C 2 128 ? 6.999   12.142  -14.382 1.00 123.69 ? 141 ASP C O   1 
ATOM   2629 C CB  . ASP C 2 128 ? 6.446   10.717  -11.899 1.00 127.06 ? 141 ASP C CB  1 
ATOM   2630 C CG  . ASP C 2 128 ? 5.903   11.637  -10.823 1.00 135.58 ? 141 ASP C CG  1 
ATOM   2631 O OD1 . ASP C 2 128 ? 6.576   11.809  -9.783  1.00 131.72 ? 141 ASP C OD1 1 
ATOM   2632 O OD2 . ASP C 2 128 ? 4.798   12.186  -11.018 1.00 145.78 ? 141 ASP C OD2 1 
ATOM   2633 N N   . ASN C 2 129 ? 4.786   12.528  -14.505 1.00 133.46 ? 142 ASN C N   1 
ATOM   2634 C CA  . ASN C 2 129 ? 4.925   13.707  -15.350 1.00 149.19 ? 142 ASN C CA  1 
ATOM   2635 C C   . ASN C 2 129 ? 4.694   14.962  -14.525 1.00 157.85 ? 142 ASN C C   1 
ATOM   2636 O O   . ASN C 2 129 ? 5.145   16.050  -14.881 1.00 164.12 ? 142 ASN C O   1 
ATOM   2637 C CB  . ASN C 2 129 ? 3.938   13.655  -16.516 1.00 155.38 ? 142 ASN C CB  1 
ATOM   2638 C CG  . ASN C 2 129 ? 4.002   12.344  -17.273 1.00 153.38 ? 142 ASN C CG  1 
ATOM   2639 O OD1 . ASN C 2 129 ? 4.785   12.193  -18.212 1.00 158.61 ? 142 ASN C OD1 1 
ATOM   2640 N ND2 . ASN C 2 129 ? 3.175   11.386  -16.869 1.00 141.71 ? 142 ASN C ND2 1 
ATOM   2641 N N   . TYR C 2 130 ? 3.987   14.790  -13.414 1.00 164.51 ? 143 TYR C N   1 
ATOM   2642 C CA  . TYR C 2 130 ? 3.724   15.867  -12.469 1.00 176.59 ? 143 TYR C CA  1 
ATOM   2643 C C   . TYR C 2 130 ? 5.021   16.373  -11.849 1.00 178.00 ? 143 TYR C C   1 
ATOM   2644 O O   . TYR C 2 130 ? 5.107   17.522  -11.413 1.00 185.49 ? 143 TYR C O   1 
ATOM   2645 C CB  . TYR C 2 130 ? 2.771   15.365  -11.378 1.00 180.15 ? 143 TYR C CB  1 
ATOM   2646 C CG  . TYR C 2 130 ? 2.656   16.249  -10.152 1.00 187.01 ? 143 TYR C CG  1 
ATOM   2647 C CD1 . TYR C 2 130 ? 1.716   17.269  -10.094 1.00 194.64 ? 143 TYR C CD1 1 
ATOM   2648 C CD2 . TYR C 2 130 ? 3.471   16.046  -9.043  1.00 183.86 ? 143 TYR C CD2 1 
ATOM   2649 C CE1 . TYR C 2 130 ? 1.601   18.071  -8.974  1.00 197.12 ? 143 TYR C CE1 1 
ATOM   2650 C CE2 . TYR C 2 130 ? 3.364   16.841  -7.921  1.00 187.13 ? 143 TYR C CE2 1 
ATOM   2651 C CZ  . TYR C 2 130 ? 2.427   17.852  -7.892  1.00 195.01 ? 143 TYR C CZ  1 
ATOM   2652 O OH  . TYR C 2 130 ? 2.316   18.647  -6.776  1.00 199.01 ? 143 TYR C OH  1 
ATOM   2653 N N   . SER C 2 131 ? 6.029   15.509  -11.817 1.00 169.52 ? 144 SER C N   1 
ATOM   2654 C CA  . SER C 2 131 ? 7.286   15.821  -11.151 1.00 162.22 ? 144 SER C CA  1 
ATOM   2655 C C   . SER C 2 131 ? 8.500   15.511  -12.021 1.00 166.95 ? 144 SER C C   1 
ATOM   2656 O O   . SER C 2 131 ? 8.760   14.353  -12.345 1.00 169.23 ? 144 SER C O   1 
ATOM   2657 C CB  . SER C 2 131 ? 7.386   15.038  -9.842  1.00 148.62 ? 144 SER C CB  1 
ATOM   2658 O OG  . SER C 2 131 ? 8.640   15.249  -9.216  1.00 145.02 ? 144 SER C OG  1 
ATOM   2659 N N   . ARG C 2 132 ? 9.246   16.550  -12.387 1.00 166.66 ? 145 ARG C N   1 
ATOM   2660 C CA  . ARG C 2 132 ? 10.510  16.376  -13.096 1.00 165.62 ? 145 ARG C CA  1 
ATOM   2661 C C   . ARG C 2 132 ? 11.613  16.008  -12.113 1.00 170.47 ? 145 ARG C C   1 
ATOM   2662 O O   . ARG C 2 132 ? 12.738  15.700  -12.509 1.00 176.31 ? 145 ARG C O   1 
ATOM   2663 C CB  . ARG C 2 132 ? 10.898  17.658  -13.834 1.00 166.11 ? 145 ARG C CB  1 
ATOM   2664 C CG  . ARG C 2 132 ? 9.944   18.068  -14.940 1.00 169.26 ? 145 ARG C CG  1 
ATOM   2665 C CD  . ARG C 2 132 ? 10.385  19.379  -15.574 1.00 178.20 ? 145 ARG C CD  1 
ATOM   2666 N NE  . ARG C 2 132 ? 9.463   19.835  -16.610 1.00 182.70 ? 145 ARG C NE  1 
ATOM   2667 C CZ  . ARG C 2 132 ? 9.562   21.006  -17.231 1.00 185.28 ? 145 ARG C CZ  1 
ATOM   2668 N NH1 . ARG C 2 132 ? 8.680   21.344  -18.163 1.00 188.82 ? 145 ARG C NH1 1 
ATOM   2669 N NH2 . ARG C 2 132 ? 10.543  21.842  -16.916 1.00 185.39 ? 145 ARG C NH2 1 
ATOM   2670 N N   . LEU C 2 133 ? 11.282  16.049  -10.826 1.00 167.18 ? 146 LEU C N   1 
ATOM   2671 C CA  . LEU C 2 133 ? 12.251  15.783  -9.772  1.00 159.95 ? 146 LEU C CA  1 
ATOM   2672 C C   . LEU C 2 133 ? 12.628  14.305  -9.711  1.00 156.66 ? 146 LEU C C   1 
ATOM   2673 O O   . LEU C 2 133 ? 13.781  13.964  -9.449  1.00 157.50 ? 146 LEU C O   1 
ATOM   2674 C CB  . LEU C 2 133 ? 11.700  16.241  -8.418  1.00 155.71 ? 146 LEU C CB  1 
ATOM   2675 C CG  . LEU C 2 133 ? 12.650  16.969  -7.460  1.00 153.73 ? 146 LEU C CG  1 
ATOM   2676 C CD1 . LEU C 2 133 ? 12.777  16.216  -6.141  1.00 146.89 ? 146 LEU C CD1 1 
ATOM   2677 C CD2 . LEU C 2 133 ? 14.019  17.196  -8.088  1.00 154.64 ? 146 LEU C CD2 1 
ATOM   2678 N N   . ARG C 2 134 ? 11.655  13.434  -9.962  1.00 155.37 ? 147 ARG C N   1 
ATOM   2679 C CA  . ARG C 2 134 ? 11.876  11.997  -9.858  1.00 149.43 ? 147 ARG C CA  1 
ATOM   2680 C C   . ARG C 2 134 ? 11.342  11.219  -11.051 1.00 146.15 ? 147 ARG C C   1 
ATOM   2681 O O   . ARG C 2 134 ? 10.463  11.692  -11.776 1.00 138.26 ? 147 ARG C O   1 
ATOM   2682 C CB  . ARG C 2 134 ? 11.253  11.455  -8.574  1.00 143.12 ? 147 ARG C CB  1 
ATOM   2683 C CG  . ARG C 2 134 ? 9.787   11.821  -8.388  1.00 145.19 ? 147 ARG C CG  1 
ATOM   2684 C CD  . ARG C 2 134 ? 9.402   11.821  -6.913  1.00 145.95 ? 147 ARG C CD  1 
ATOM   2685 N NE  . ARG C 2 134 ? 10.239  12.730  -6.131  1.00 153.80 ? 147 ARG C NE  1 
ATOM   2686 C CZ  . ARG C 2 134 ? 11.272  12.346  -5.385  1.00 158.00 ? 147 ARG C CZ  1 
ATOM   2687 N NH1 . ARG C 2 134 ? 11.979  13.244  -4.713  1.00 158.91 ? 147 ARG C NH1 1 
ATOM   2688 N NH2 . ARG C 2 134 ? 11.598  11.063  -5.311  1.00 157.35 ? 147 ARG C NH2 1 
ATOM   2689 N N   . SER C 2 135 ? 11.885  10.020  -11.242 1.00 151.61 ? 148 SER C N   1 
ATOM   2690 C CA  . SER C 2 135 ? 11.394  9.102   -12.262 1.00 153.52 ? 148 SER C CA  1 
ATOM   2691 C C   . SER C 2 135 ? 10.463  8.083   -11.624 1.00 146.31 ? 148 SER C C   1 
ATOM   2692 O O   . SER C 2 135 ? 10.834  7.396   -10.671 1.00 142.42 ? 148 SER C O   1 
ATOM   2693 C CB  . SER C 2 135 ? 12.551  8.390   -12.972 1.00 150.00 ? 148 SER C CB  1 
ATOM   2694 O OG  . SER C 2 135 ? 13.300  9.298   -13.760 1.00 145.30 ? 148 SER C OG  1 
ATOM   2695 N N   . TYR C 2 136 ? 9.246   8.017   -12.153 1.00 135.96 ? 149 TYR C N   1 
ATOM   2696 C CA  . TYR C 2 136 ? 8.235   7.039   -11.745 1.00 115.89 ? 149 TYR C CA  1 
ATOM   2697 C C   . TYR C 2 136 ? 7.614   7.265   -10.361 1.00 105.76 ? 149 TYR C C   1 
ATOM   2698 O O   . TYR C 2 136 ? 8.305   7.596   -9.396  1.00 108.66 ? 149 TYR C O   1 
ATOM   2699 C CB  . TYR C 2 136 ? 8.765   5.599   -11.838 1.00 101.00 ? 149 TYR C CB  1 
ATOM   2700 C CG  . TYR C 2 136 ? 9.427   5.274   -13.157 1.00 104.14 ? 149 TYR C CG  1 
ATOM   2701 C CD1 . TYR C 2 136 ? 8.669   5.074   -14.301 1.00 109.54 ? 149 TYR C CD1 1 
ATOM   2702 C CD2 . TYR C 2 136 ? 10.810  5.176   -13.259 1.00 100.35 ? 149 TYR C CD2 1 
ATOM   2703 C CE1 . TYR C 2 136 ? 9.267   4.788   -15.509 1.00 109.92 ? 149 TYR C CE1 1 
ATOM   2704 C CE2 . TYR C 2 136 ? 11.418  4.891   -14.462 1.00 99.52  ? 149 TYR C CE2 1 
ATOM   2705 C CZ  . TYR C 2 136 ? 10.644  4.696   -15.583 1.00 111.57 ? 149 TYR C CZ  1 
ATOM   2706 O OH  . TYR C 2 136 ? 11.256  4.410   -16.781 1.00 106.59 ? 149 TYR C OH  1 
ATOM   2707 N N   . GLN C 2 137 ? 6.299   7.072   -10.283 1.00 104.19 ? 150 GLN C N   1 
ATOM   2708 C CA  . GLN C 2 137 ? 5.573   7.093   -9.017  1.00 108.61 ? 150 GLN C CA  1 
ATOM   2709 C C   . GLN C 2 137 ? 5.478   5.672   -8.497  1.00 107.88 ? 150 GLN C C   1 
ATOM   2710 O O   . GLN C 2 137 ? 5.682   4.719   -9.246  1.00 116.30 ? 150 GLN C O   1 
ATOM   2711 C CB  . GLN C 2 137 ? 4.152   7.630   -9.216  1.00 121.64 ? 150 GLN C CB  1 
ATOM   2712 C CG  . GLN C 2 137 ? 4.063   9.044   -9.740  1.00 139.14 ? 150 GLN C CG  1 
ATOM   2713 C CD  . GLN C 2 137 ? 2.761   9.304   -10.474 1.00 149.22 ? 150 GLN C CD  1 
ATOM   2714 O OE1 . GLN C 2 137 ? 2.145   8.383   -11.009 1.00 145.86 ? 150 GLN C OE1 1 
ATOM   2715 N NE2 . GLN C 2 137 ? 2.336   10.560  -10.501 1.00 158.83 ? 150 GLN C NE2 1 
ATOM   2716 N N   . VAL C 2 138 ? 5.173   5.533   -7.211  1.00 96.29  ? 151 VAL C N   1 
ATOM   2717 C CA  . VAL C 2 138 ? 4.833   4.237   -6.640  1.00 94.74  ? 151 VAL C CA  1 
ATOM   2718 C C   . VAL C 2 138 ? 3.582   4.386   -5.784  1.00 89.66  ? 151 VAL C C   1 
ATOM   2719 O O   . VAL C 2 138 ? 3.551   5.175   -4.840  1.00 84.59  ? 151 VAL C O   1 
ATOM   2720 C CB  . VAL C 2 138 ? 5.976   3.644   -5.793  1.00 97.26  ? 151 VAL C CB  1 
ATOM   2721 C CG1 . VAL C 2 138 ? 5.502   2.396   -5.067  1.00 71.32  ? 151 VAL C CG1 1 
ATOM   2722 C CG2 . VAL C 2 138 ? 7.173   3.319   -6.670  1.00 75.14  ? 151 VAL C CG2 1 
ATOM   2723 N N   . SER C 2 139 ? 2.544   3.635   -6.132  1.00 83.04  ? 152 SER C N   1 
ATOM   2724 C CA  . SER C 2 139 ? 1.274   3.714   -5.422  1.00 84.36  ? 152 SER C CA  1 
ATOM   2725 C C   . SER C 2 139 ? 1.102   2.586   -4.409  1.00 86.64  ? 152 SER C C   1 
ATOM   2726 O O   . SER C 2 139 ? 1.699   1.520   -4.544  1.00 82.23  ? 152 SER C O   1 
ATOM   2727 C CB  . SER C 2 139 ? 0.107   3.725   -6.410  1.00 87.92  ? 152 SER C CB  1 
ATOM   2728 O OG  . SER C 2 139 ? 0.196   2.638   -7.313  1.00 99.71  ? 152 SER C OG  1 
ATOM   2729 N N   . LEU C 2 140 ? 0.283   2.828   -3.391  1.00 89.96  ? 153 LEU C N   1 
ATOM   2730 C CA  . LEU C 2 140 ? 0.054   1.833   -2.349  1.00 91.79  ? 153 LEU C CA  1 
ATOM   2731 C C   . LEU C 2 140 ? -1.432  1.625   -2.069  1.00 90.75  ? 153 LEU C C   1 
ATOM   2732 O O   . LEU C 2 140 ? -2.129  2.540   -1.629  1.00 90.04  ? 153 LEU C O   1 
ATOM   2733 C CB  . LEU C 2 140 ? 0.789   2.223   -1.064  1.00 89.21  ? 153 LEU C CB  1 
ATOM   2734 C CG  . LEU C 2 140 ? 0.663   1.271   0.127   1.00 83.12  ? 153 LEU C CG  1 
ATOM   2735 C CD1 . LEU C 2 140 ? 1.121   -0.122  -0.264  1.00 83.72  ? 153 LEU C CD1 1 
ATOM   2736 C CD2 . LEU C 2 140 ? 1.462   1.784   1.320   1.00 68.88  ? 153 LEU C CD2 1 
ATOM   2737 N N   . HIS C 2 141 ? -1.908  0.411   -2.325  1.00 82.59  ? 154 HIS C N   1 
ATOM   2738 C CA  . HIS C 2 141 ? -3.298  0.060   -2.064  1.00 84.59  ? 154 HIS C CA  1 
ATOM   2739 C C   . HIS C 2 141 ? -3.380  -1.080  -1.054  1.00 87.54  ? 154 HIS C C   1 
ATOM   2740 O O   . HIS C 2 141 ? -2.901  -2.184  -1.313  1.00 81.83  ? 154 HIS C O   1 
ATOM   2741 C CB  . HIS C 2 141 ? -4.002  -0.330  -3.365  1.00 88.33  ? 154 HIS C CB  1 
ATOM   2742 C CG  . HIS C 2 141 ? -5.446  -0.679  -3.192  1.00 99.14  ? 154 HIS C CG  1 
ATOM   2743 N ND1 . HIS C 2 141 ? -6.317  0.098   -2.457  1.00 105.78 ? 154 HIS C ND1 1 
ATOM   2744 C CD2 . HIS C 2 141 ? -6.175  -1.718  -3.663  1.00 100.36 ? 154 HIS C CD2 1 
ATOM   2745 C CE1 . HIS C 2 141 ? -7.518  -0.450  -2.481  1.00 109.02 ? 154 HIS C CE1 1 
ATOM   2746 N NE2 . HIS C 2 141 ? -7.461  -1.551  -3.207  1.00 106.60 ? 154 HIS C NE2 1 
ATOM   2747 N N   . CYS C 2 142 ? -3.985  -0.812  0.098   1.00 92.83  ? 155 CYS C N   1 
ATOM   2748 C CA  . CYS C 2 142 ? -4.076  -1.818  1.152   1.00 90.68  ? 155 CYS C CA  1 
ATOM   2749 C C   . CYS C 2 142 ? -5.512  -2.101  1.572   1.00 89.71  ? 155 CYS C C   1 
ATOM   2750 O O   . CYS C 2 142 ? -6.312  -1.183  1.744   1.00 91.00  ? 155 CYS C O   1 
ATOM   2751 C CB  . CYS C 2 142 ? -3.245  -1.401  2.369   1.00 89.52  ? 155 CYS C CB  1 
ATOM   2752 S SG  . CYS C 2 142 ? -1.464  -1.492  2.111   1.00 115.59 ? 155 CYS C SG  1 
ATOM   2753 N N   . THR C 2 143 ? -5.821  -3.383  1.740   1.00 87.33  ? 156 THR C N   1 
ATOM   2754 C CA  . THR C 2 143 ? -7.144  -3.820  2.169   1.00 90.65  ? 156 THR C CA  1 
ATOM   2755 C C   . THR C 2 143 ? -7.068  -4.701  3.413   1.00 90.84  ? 156 THR C C   1 
ATOM   2756 O O   . THR C 2 143 ? -6.041  -5.326  3.682   1.00 92.04  ? 156 THR C O   1 
ATOM   2757 C CB  . THR C 2 143 ? -7.871  -4.600  1.055   1.00 95.49  ? 156 THR C CB  1 
ATOM   2758 O OG1 . THR C 2 143 ? -6.915  -5.348  0.293   1.00 96.37  ? 156 THR C OG1 1 
ATOM   2759 C CG2 . THR C 2 143 ? -8.606  -3.648  0.129   1.00 92.64  ? 156 THR C CG2 1 
ATOM   2760 N N   . TRP C 2 144 ? -8.163  -4.749  4.168   1.00 89.72  ? 157 TRP C N   1 
ATOM   2761 C CA  . TRP C 2 144 ? -8.242  -5.599  5.353   1.00 92.29  ? 157 TRP C CA  1 
ATOM   2762 C C   . TRP C 2 144 ? -9.686  -5.813  5.783   1.00 97.59  ? 157 TRP C C   1 
ATOM   2763 O O   . TRP C 2 144 ? -10.595 -5.172  5.261   1.00 100.36 ? 157 TRP C O   1 
ATOM   2764 C CB  . TRP C 2 144 ? -7.443  -4.994  6.510   1.00 92.02  ? 157 TRP C CB  1 
ATOM   2765 C CG  . TRP C 2 144 ? -7.930  -3.645  6.948   1.00 100.16 ? 157 TRP C CG  1 
ATOM   2766 C CD1 . TRP C 2 144 ? -8.898  -3.380  7.874   1.00 100.75 ? 157 TRP C CD1 1 
ATOM   2767 C CD2 . TRP C 2 144 ? -7.459  -2.374  6.485   1.00 99.69  ? 157 TRP C CD2 1 
ATOM   2768 N NE1 . TRP C 2 144 ? -9.061  -2.024  8.013   1.00 101.37 ? 157 TRP C NE1 1 
ATOM   2769 C CE2 . TRP C 2 144 ? -8.189  -1.384  7.171   1.00 101.56 ? 157 TRP C CE2 1 
ATOM   2770 C CE3 . TRP C 2 144 ? -6.492  -1.978  5.556   1.00 92.35  ? 157 TRP C CE3 1 
ATOM   2771 C CZ2 . TRP C 2 144 ? -7.983  -0.022  6.956   1.00 101.26 ? 157 TRP C CZ2 1 
ATOM   2772 C CZ3 . TRP C 2 144 ? -6.289  -0.627  5.344   1.00 84.83  ? 157 TRP C CZ3 1 
ATOM   2773 C CH2 . TRP C 2 144 ? -7.032  0.335   6.040   1.00 92.59  ? 157 TRP C CH2 1 
ATOM   2774 N N   . LEU C 2 145 ? -9.891  -6.716  6.736   1.00 101.57 ? 158 LEU C N   1 
ATOM   2775 C CA  . LEU C 2 145 ? -11.219 -6.951  7.292   1.00 99.59  ? 158 LEU C CA  1 
ATOM   2776 C C   . LEU C 2 145 ? -11.289 -6.368  8.704   1.00 94.35  ? 158 LEU C C   1 
ATOM   2777 O O   . LEU C 2 145 ? -10.255 -6.090  9.313   1.00 93.61  ? 158 LEU C O   1 
ATOM   2778 C CB  . LEU C 2 145 ? -11.560 -8.446  7.289   1.00 105.78 ? 158 LEU C CB  1 
ATOM   2779 C CG  . LEU C 2 145 ? -12.123 -9.039  5.988   1.00 108.78 ? 158 LEU C CG  1 
ATOM   2780 C CD1 . LEU C 2 145 ? -11.111 -8.982  4.850   1.00 112.19 ? 158 LEU C CD1 1 
ATOM   2781 C CD2 . LEU C 2 145 ? -12.597 -10.469 6.205   1.00 106.03 ? 158 LEU C CD2 1 
ATOM   2782 N N   . VAL C 2 146 ? -12.501 -6.177  9.220   1.00 103.45 ? 159 VAL C N   1 
ATOM   2783 C CA  . VAL C 2 146 ? -12.689 -5.485  10.495  1.00 110.50 ? 159 VAL C CA  1 
ATOM   2784 C C   . VAL C 2 146 ? -12.366 -6.355  11.713  1.00 111.98 ? 159 VAL C C   1 
ATOM   2785 O O   . VAL C 2 146 ? -11.598 -5.953  12.589  1.00 105.13 ? 159 VAL C O   1 
ATOM   2786 C CB  . VAL C 2 146 ? -14.127 -4.945  10.627  1.00 115.30 ? 159 VAL C CB  1 
ATOM   2787 C CG1 . VAL C 2 146 ? -14.217 -3.940  11.765  1.00 117.87 ? 159 VAL C CG1 1 
ATOM   2788 C CG2 . VAL C 2 146 ? -14.567 -4.305  9.321   1.00 104.38 ? 159 VAL C CG2 1 
ATOM   2789 N N   . GLY C 2 147 ? -12.958 -7.545  11.764  1.00 118.43 ? 160 GLY C N   1 
ATOM   2790 C CA  . GLY C 2 147 ? -12.758 -8.450  12.883  1.00 121.99 ? 160 GLY C CA  1 
ATOM   2791 C C   . GLY C 2 147 ? -14.065 -8.863  13.532  1.00 137.69 ? 160 GLY C C   1 
ATOM   2792 O O   . GLY C 2 147 ? -15.021 -8.087  13.567  1.00 141.52 ? 160 GLY C O   1 
ATOM   2793 N N   . THR C 2 148 ? -14.107 -10.086 14.052  1.00 143.02 ? 161 THR C N   1 
ATOM   2794 C CA  . THR C 2 148 ? -15.322 -10.622 14.660  1.00 156.27 ? 161 THR C CA  1 
ATOM   2795 C C   . THR C 2 148 ? -15.690 -9.891  15.950  1.00 159.96 ? 161 THR C C   1 
ATOM   2796 O O   . THR C 2 148 ? -16.841 -9.491  16.140  1.00 163.45 ? 161 THR C O   1 
ATOM   2797 C CB  . THR C 2 148 ? -15.201 -12.137 14.947  1.00 161.50 ? 161 THR C CB  1 
ATOM   2798 O OG1 . THR C 2 148 ? -14.908 -12.836 13.731  1.00 161.84 ? 161 THR C OG1 1 
ATOM   2799 C CG2 . THR C 2 148 ? -16.498 -12.677 15.537  1.00 165.16 ? 161 THR C CG2 1 
ATOM   2800 N N   . ASP C 2 149 ? -14.708 -9.717  16.832  1.00 156.51 ? 162 ASP C N   1 
ATOM   2801 C CA  . ASP C 2 149 ? -14.930 -9.040  18.109  1.00 156.88 ? 162 ASP C CA  1 
ATOM   2802 C C   . ASP C 2 149 ? -14.726 -7.535  17.986  1.00 142.07 ? 162 ASP C C   1 
ATOM   2803 O O   . ASP C 2 149 ? -14.711 -6.819  18.987  1.00 138.30 ? 162 ASP C O   1 
ATOM   2804 C CB  . ASP C 2 149 ? -14.009 -9.605  19.197  1.00 165.71 ? 162 ASP C CB  1 
ATOM   2805 C CG  . ASP C 2 149 ? -14.341 -11.043 19.555  1.00 177.06 ? 162 ASP C CG  1 
ATOM   2806 O OD1 . ASP C 2 149 ? -15.045 -11.706 18.765  1.00 184.00 ? 162 ASP C OD1 1 
ATOM   2807 O OD2 . ASP C 2 149 ? -13.898 -11.509 20.627  1.00 179.57 ? 162 ASP C OD2 1 
ATOM   2808 N N   . ALA C 2 150 ? -14.564 -7.060  16.757  1.00 135.28 ? 163 ALA C N   1 
ATOM   2809 C CA  . ALA C 2 150 ? -14.411 -5.633  16.519  1.00 132.88 ? 163 ALA C CA  1 
ATOM   2810 C C   . ALA C 2 150 ? -15.697 -4.895  16.875  1.00 145.43 ? 163 ALA C C   1 
ATOM   2811 O O   . ALA C 2 150 ? -16.769 -5.229  16.368  1.00 148.88 ? 163 ALA C O   1 
ATOM   2812 C CB  . ALA C 2 150 ? -14.031 -5.373  15.074  1.00 121.57 ? 163 ALA C CB  1 
ATOM   2813 N N   . PRO C 2 151 ? -15.591 -3.894  17.764  1.00 147.67 ? 164 PRO C N   1 
ATOM   2814 C CA  . PRO C 2 151 ? -16.722 -3.065  18.196  1.00 153.61 ? 164 PRO C CA  1 
ATOM   2815 C C   . PRO C 2 151 ? -17.444 -2.393  17.029  1.00 159.84 ? 164 PRO C C   1 
ATOM   2816 O O   . PRO C 2 151 ? -16.945 -2.395  15.906  1.00 157.70 ? 164 PRO C O   1 
ATOM   2817 C CB  . PRO C 2 151 ? -16.055 -2.011  19.083  1.00 151.27 ? 164 PRO C CB  1 
ATOM   2818 C CG  . PRO C 2 151 ? -14.853 -2.699  19.624  1.00 145.27 ? 164 PRO C CG  1 
ATOM   2819 C CD  . PRO C 2 151 ? -14.358 -3.565  18.501  1.00 142.86 ? 164 PRO C CD  1 
ATOM   2820 N N   . GLU C 2 152 ? -18.612 -1.825  17.300  1.00 166.70 ? 165 GLU C N   1 
ATOM   2821 C CA  . GLU C 2 152 ? -19.413 -1.198  16.257  1.00 167.82 ? 165 GLU C CA  1 
ATOM   2822 C C   . GLU C 2 152 ? -19.039 0.271   16.109  1.00 166.10 ? 165 GLU C C   1 
ATOM   2823 O O   . GLU C 2 152 ? -19.412 0.924   15.134  1.00 172.30 ? 165 GLU C O   1 
ATOM   2824 C CB  . GLU C 2 152 ? -20.899 -1.334  16.589  1.00 173.43 ? 165 GLU C CB  1 
ATOM   2825 C CG  . GLU C 2 152 ? -21.320 -2.758  16.911  1.00 175.62 ? 165 GLU C CG  1 
ATOM   2826 C CD  . GLU C 2 152 ? -22.570 -2.824  17.766  1.00 186.98 ? 165 GLU C CD  1 
ATOM   2827 O OE1 . GLU C 2 152 ? -22.637 -3.705  18.650  1.00 188.20 ? 165 GLU C OE1 1 
ATOM   2828 O OE2 . GLU C 2 152 ? -23.486 -2.001  17.556  1.00 193.06 ? 165 GLU C OE2 1 
ATOM   2829 N N   . ASP C 2 153 ? -18.288 0.778   17.081  1.00 153.69 ? 166 ASP C N   1 
ATOM   2830 C CA  . ASP C 2 153 ? -17.942 2.192   17.138  1.00 148.55 ? 166 ASP C CA  1 
ATOM   2831 C C   . ASP C 2 153 ? -16.467 2.440   16.827  1.00 138.58 ? 166 ASP C C   1 
ATOM   2832 O O   . ASP C 2 153 ? -16.037 3.588   16.720  1.00 136.81 ? 166 ASP C O   1 
ATOM   2833 C CB  . ASP C 2 153 ? -18.257 2.746   18.528  1.00 153.88 ? 166 ASP C CB  1 
ATOM   2834 C CG  . ASP C 2 153 ? -17.212 2.356   19.558  1.00 149.80 ? 166 ASP C CG  1 
ATOM   2835 O OD1 . ASP C 2 153 ? -17.188 1.176   19.969  1.00 151.50 ? 166 ASP C OD1 1 
ATOM   2836 O OD2 . ASP C 2 153 ? -16.412 3.229   19.957  1.00 139.19 ? 166 ASP C OD2 1 
ATOM   2837 N N   . THR C 2 154 ? -15.695 1.367   16.684  1.00 131.83 ? 167 THR C N   1 
ATOM   2838 C CA  . THR C 2 154 ? -14.247 1.487   16.516  1.00 126.66 ? 167 THR C CA  1 
ATOM   2839 C C   . THR C 2 154 ? -13.816 2.024   15.148  1.00 123.92 ? 167 THR C C   1 
ATOM   2840 O O   . THR C 2 154 ? -14.545 1.909   14.164  1.00 123.75 ? 167 THR C O   1 
ATOM   2841 C CB  . THR C 2 154 ? -13.535 0.144   16.777  1.00 125.49 ? 167 THR C CB  1 
ATOM   2842 O OG1 . THR C 2 154 ? -12.141 0.273   16.470  1.00 122.94 ? 167 THR C OG1 1 
ATOM   2843 C CG2 . THR C 2 154 ? -14.133 -0.951  15.917  1.00 128.92 ? 167 THR C CG2 1 
ATOM   2844 N N   . GLN C 2 155 ? -12.620 2.607   15.103  1.00 120.51 ? 168 GLN C N   1 
ATOM   2845 C CA  . GLN C 2 155 ? -12.070 3.165   13.869  1.00 119.16 ? 168 GLN C CA  1 
ATOM   2846 C C   . GLN C 2 155 ? -10.622 2.713   13.674  1.00 118.01 ? 168 GLN C C   1 
ATOM   2847 O O   . GLN C 2 155 ? -9.909  2.461   14.646  1.00 116.27 ? 168 GLN C O   1 
ATOM   2848 C CB  . GLN C 2 155 ? -12.158 4.696   13.893  1.00 113.40 ? 168 GLN C CB  1 
ATOM   2849 C CG  . GLN C 2 155 ? -11.741 5.391   12.600  1.00 113.46 ? 168 GLN C CG  1 
ATOM   2850 C CD  . GLN C 2 155 ? -12.548 4.934   11.398  1.00 124.43 ? 168 GLN C CD  1 
ATOM   2851 O OE1 . GLN C 2 155 ? -12.251 3.903   10.795  1.00 122.52 ? 168 GLN C OE1 1 
ATOM   2852 N NE2 . GLN C 2 155 ? -13.575 5.702   11.043  1.00 130.40 ? 168 GLN C NE2 1 
ATOM   2853 N N   . TYR C 2 156 ? -10.192 2.602   12.420  1.00 119.57 ? 169 TYR C N   1 
ATOM   2854 C CA  . TYR C 2 156 ? -8.827  2.183   12.115  1.00 111.77 ? 169 TYR C CA  1 
ATOM   2855 C C   . TYR C 2 156 ? -8.007  3.300   11.465  1.00 114.46 ? 169 TYR C C   1 
ATOM   2856 O O   . TYR C 2 156 ? -8.559  4.201   10.833  1.00 109.18 ? 169 TYR C O   1 
ATOM   2857 C CB  . TYR C 2 156 ? -8.835  0.946   11.213  1.00 106.84 ? 169 TYR C CB  1 
ATOM   2858 C CG  . TYR C 2 156 ? -9.381  -0.301  11.874  1.00 106.30 ? 169 TYR C CG  1 
ATOM   2859 C CD1 . TYR C 2 156 ? -8.738  -0.868  12.968  1.00 101.81 ? 169 TYR C CD1 1 
ATOM   2860 C CD2 . TYR C 2 156 ? -10.532 -0.917  11.398  1.00 98.27  ? 169 TYR C CD2 1 
ATOM   2861 C CE1 . TYR C 2 156 ? -9.232  -2.008  13.574  1.00 91.40  ? 169 TYR C CE1 1 
ATOM   2862 C CE2 . TYR C 2 156 ? -11.032 -2.058  11.996  1.00 104.63 ? 169 TYR C CE2 1 
ATOM   2863 C CZ  . TYR C 2 156 ? -10.376 -2.600  13.083  1.00 108.33 ? 169 TYR C CZ  1 
ATOM   2864 O OH  . TYR C 2 156 ? -10.868 -3.737  13.681  1.00 117.32 ? 169 TYR C OH  1 
ATOM   2865 N N   . PHE C 2 157 ? -6.687  3.232   11.627  1.00 115.04 ? 170 PHE C N   1 
ATOM   2866 C CA  . PHE C 2 157 ? -5.778  4.203   11.022  1.00 116.62 ? 170 PHE C CA  1 
ATOM   2867 C C   . PHE C 2 157 ? -4.602  3.491   10.359  1.00 105.78 ? 170 PHE C C   1 
ATOM   2868 O O   . PHE C 2 157 ? -3.963  2.635   10.969  1.00 95.02  ? 170 PHE C O   1 
ATOM   2869 C CB  . PHE C 2 157 ? -5.258  5.191   12.071  1.00 124.47 ? 170 PHE C CB  1 
ATOM   2870 C CG  . PHE C 2 157 ? -6.334  5.792   12.930  1.00 129.90 ? 170 PHE C CG  1 
ATOM   2871 C CD1 . PHE C 2 157 ? -6.564  5.311   14.208  1.00 129.96 ? 170 PHE C CD1 1 
ATOM   2872 C CD2 . PHE C 2 157 ? -7.116  6.836   12.462  1.00 136.67 ? 170 PHE C CD2 1 
ATOM   2873 C CE1 . PHE C 2 157 ? -7.552  5.858   15.003  1.00 132.56 ? 170 PHE C CE1 1 
ATOM   2874 C CE2 . PHE C 2 157 ? -8.108  7.388   13.254  1.00 138.50 ? 170 PHE C CE2 1 
ATOM   2875 C CZ  . PHE C 2 157 ? -8.326  6.898   14.527  1.00 137.90 ? 170 PHE C CZ  1 
ATOM   2876 N N   . LEU C 2 158 ? -4.315  3.852   9.112   1.00 109.54 ? 171 LEU C N   1 
ATOM   2877 C CA  . LEU C 2 158 ? -3.219  3.236   8.371   1.00 103.42 ? 171 LEU C CA  1 
ATOM   2878 C C   . LEU C 2 158 ? -1.966  4.106   8.403   1.00 98.06  ? 171 LEU C C   1 
ATOM   2879 O O   . LEU C 2 158 ? -2.040  5.329   8.292   1.00 98.57  ? 171 LEU C O   1 
ATOM   2880 C CB  . LEU C 2 158 ? -3.649  2.971   6.923   1.00 105.87 ? 171 LEU C CB  1 
ATOM   2881 C CG  . LEU C 2 158 ? -2.798  2.093   5.996   1.00 93.25  ? 171 LEU C CG  1 
ATOM   2882 C CD1 . LEU C 2 158 ? -1.617  2.840   5.390   1.00 73.97  ? 171 LEU C CD1 1 
ATOM   2883 C CD2 . LEU C 2 158 ? -2.322  0.866   6.729   1.00 87.03  ? 171 LEU C CD2 1 
ATOM   2884 N N   . TYR C 2 159 ? -0.817  3.458   8.562   1.00 92.08  ? 172 TYR C N   1 
ATOM   2885 C CA  . TYR C 2 159 ? 0.475   4.118   8.442   1.00 91.86  ? 172 TYR C CA  1 
ATOM   2886 C C   . TYR C 2 159 ? 1.430   3.165   7.736   1.00 88.80  ? 172 TYR C C   1 
ATOM   2887 O O   . TYR C 2 159 ? 1.349   1.950   7.924   1.00 96.25  ? 172 TYR C O   1 
ATOM   2888 C CB  . TYR C 2 159 ? 1.048   4.474   9.818   1.00 86.15  ? 172 TYR C CB  1 
ATOM   2889 C CG  . TYR C 2 159 ? 0.077   5.141   10.768  1.00 85.27  ? 172 TYR C CG  1 
ATOM   2890 C CD1 . TYR C 2 159 ? -0.800  4.387   11.535  1.00 92.97  ? 172 TYR C CD1 1 
ATOM   2891 C CD2 . TYR C 2 159 ? 0.051   6.522   10.913  1.00 89.08  ? 172 TYR C CD2 1 
ATOM   2892 C CE1 . TYR C 2 159 ? -1.687  4.987   12.410  1.00 97.31  ? 172 TYR C CE1 1 
ATOM   2893 C CE2 . TYR C 2 159 ? -0.833  7.133   11.788  1.00 95.21  ? 172 TYR C CE2 1 
ATOM   2894 C CZ  . TYR C 2 159 ? -1.701  6.360   12.534  1.00 98.43  ? 172 TYR C CZ  1 
ATOM   2895 O OH  . TYR C 2 159 ? -2.584  6.955   13.408  1.00 89.36  ? 172 TYR C OH  1 
ATOM   2896 N N   . TYR C 2 160 ? 2.331   3.705   6.922   1.00 83.50  ? 173 TYR C N   1 
ATOM   2897 C CA  . TYR C 2 160 ? 3.378   2.886   6.321   1.00 81.05  ? 173 TYR C CA  1 
ATOM   2898 C C   . TYR C 2 160 ? 4.746   3.527   6.525   1.00 84.56  ? 173 TYR C C   1 
ATOM   2899 O O   . TYR C 2 160 ? 4.841   4.712   6.842   1.00 88.55  ? 173 TYR C O   1 
ATOM   2900 C CB  . TYR C 2 160 ? 3.114   2.657   4.829   1.00 75.68  ? 173 TYR C CB  1 
ATOM   2901 C CG  . TYR C 2 160 ? 3.642   3.745   3.916   1.00 77.35  ? 173 TYR C CG  1 
ATOM   2902 C CD1 . TYR C 2 160 ? 4.921   3.665   3.370   1.00 70.92  ? 173 TYR C CD1 1 
ATOM   2903 C CD2 . TYR C 2 160 ? 2.857   4.839   3.581   1.00 79.49  ? 173 TYR C CD2 1 
ATOM   2904 C CE1 . TYR C 2 160 ? 5.403   4.652   2.532   1.00 78.87  ? 173 TYR C CE1 1 
ATOM   2905 C CE2 . TYR C 2 160 ? 3.330   5.826   2.741   1.00 88.25  ? 173 TYR C CE2 1 
ATOM   2906 C CZ  . TYR C 2 160 ? 4.602   5.730   2.221   1.00 84.89  ? 173 TYR C CZ  1 
ATOM   2907 O OH  . TYR C 2 160 ? 5.070   6.717   1.385   1.00 88.01  ? 173 TYR C OH  1 
ATOM   2908 N N   . ARG C 2 161 ? 5.800   2.740   6.340   1.00 78.85  ? 174 ARG C N   1 
ATOM   2909 C CA  . ARG C 2 161 ? 7.160   3.259   6.422   1.00 80.09  ? 174 ARG C CA  1 
ATOM   2910 C C   . ARG C 2 161 ? 8.072   2.589   5.404   1.00 80.19  ? 174 ARG C C   1 
ATOM   2911 O O   . ARG C 2 161 ? 8.164   1.362   5.360   1.00 75.69  ? 174 ARG C O   1 
ATOM   2912 C CB  . ARG C 2 161 ? 7.741   3.052   7.822   1.00 78.85  ? 174 ARG C CB  1 
ATOM   2913 C CG  . ARG C 2 161 ? 9.003   3.866   8.085   1.00 79.27  ? 174 ARG C CG  1 
ATOM   2914 C CD  . ARG C 2 161 ? 9.939   3.188   9.066   1.00 71.45  ? 174 ARG C CD  1 
ATOM   2915 N NE  . ARG C 2 161 ? 10.934  2.376   8.375   1.00 82.66  ? 174 ARG C NE  1 
ATOM   2916 C CZ  . ARG C 2 161 ? 11.191  1.105   8.662   1.00 79.27  ? 174 ARG C CZ  1 
ATOM   2917 N NH1 . ARG C 2 161 ? 10.531  0.498   9.639   1.00 70.39  ? 174 ARG C NH1 1 
ATOM   2918 N NH2 . ARG C 2 161 ? 12.111  0.441   7.976   1.00 86.38  ? 174 ARG C NH2 1 
ATOM   2919 N N   . TYR C 2 162 ? 8.740   3.392   4.583   1.00 79.38  ? 175 TYR C N   1 
ATOM   2920 C CA  . TYR C 2 162 ? 9.811   2.873   3.744   1.00 81.33  ? 175 TYR C CA  1 
ATOM   2921 C C   . TYR C 2 162 ? 11.091  3.664   3.978   1.00 85.49  ? 175 TYR C C   1 
ATOM   2922 O O   . TYR C 2 162 ? 11.148  4.867   3.713   1.00 82.54  ? 175 TYR C O   1 
ATOM   2923 C CB  . TYR C 2 162 ? 9.441   2.879   2.261   1.00 85.36  ? 175 TYR C CB  1 
ATOM   2924 C CG  . TYR C 2 162 ? 10.460  2.136   1.431   1.00 83.53  ? 175 TYR C CG  1 
ATOM   2925 C CD1 . TYR C 2 162 ? 11.506  2.807   0.813   1.00 85.19  ? 175 TYR C CD1 1 
ATOM   2926 C CD2 . TYR C 2 162 ? 10.398  0.757   1.298   1.00 79.75  ? 175 TYR C CD2 1 
ATOM   2927 C CE1 . TYR C 2 162 ? 12.449  2.128   0.071   1.00 84.08  ? 175 TYR C CE1 1 
ATOM   2928 C CE2 . TYR C 2 162 ? 11.335  0.070   0.558   1.00 80.89  ? 175 TYR C CE2 1 
ATOM   2929 C CZ  . TYR C 2 162 ? 12.358  0.759   -0.052  1.00 77.49  ? 175 TYR C CZ  1 
ATOM   2930 O OH  . TYR C 2 162 ? 13.293  0.075   -0.788  1.00 76.99  ? 175 TYR C OH  1 
ATOM   2931 N N   . GLY C 2 163 ? 12.115  2.979   4.474   1.00 85.58  ? 176 GLY C N   1 
ATOM   2932 C CA  . GLY C 2 163 ? 13.359  3.629   4.832   1.00 84.99  ? 176 GLY C CA  1 
ATOM   2933 C C   . GLY C 2 163 ? 13.186  4.477   6.075   1.00 78.74  ? 176 GLY C C   1 
ATOM   2934 O O   . GLY C 2 163 ? 12.888  3.962   7.154   1.00 83.78  ? 176 GLY C O   1 
ATOM   2935 N N   . SER C 2 164 ? 13.358  5.784   5.924   1.00 72.46  ? 177 SER C N   1 
ATOM   2936 C CA  . SER C 2 164 ? 13.243  6.693   7.054   1.00 83.30  ? 177 SER C CA  1 
ATOM   2937 C C   . SER C 2 164 ? 11.987  7.558   6.985   1.00 84.26  ? 177 SER C C   1 
ATOM   2938 O O   . SER C 2 164 ? 11.793  8.441   7.820   1.00 79.31  ? 177 SER C O   1 
ATOM   2939 C CB  . SER C 2 164 ? 14.494  7.569   7.159   1.00 86.19  ? 177 SER C CB  1 
ATOM   2940 O OG  . SER C 2 164 ? 14.954  7.956   5.875   1.00 87.99  ? 177 SER C OG  1 
ATOM   2941 N N   . TRP C 2 165 ? 11.129  7.295   6.003   1.00 89.82  ? 178 TRP C N   1 
ATOM   2942 C CA  . TRP C 2 165 ? 9.922   8.100   5.820   1.00 98.07  ? 178 TRP C CA  1 
ATOM   2943 C C   . TRP C 2 165 ? 8.648   7.363   6.232   1.00 90.45  ? 178 TRP C C   1 
ATOM   2944 O O   . TRP C 2 165 ? 8.455   6.197   5.886   1.00 83.37  ? 178 TRP C O   1 
ATOM   2945 C CB  . TRP C 2 165 ? 9.811   8.581   4.372   1.00 103.27 ? 178 TRP C CB  1 
ATOM   2946 C CG  . TRP C 2 165 ? 11.026  9.315   3.897   1.00 112.73 ? 178 TRP C CG  1 
ATOM   2947 C CD1 . TRP C 2 165 ? 11.413  10.576  4.250   1.00 119.38 ? 178 TRP C CD1 1 
ATOM   2948 C CD2 . TRP C 2 165 ? 12.014  8.835   2.978   1.00 120.93 ? 178 TRP C CD2 1 
ATOM   2949 N NE1 . TRP C 2 165 ? 12.583  10.909  3.610   1.00 123.21 ? 178 TRP C NE1 1 
ATOM   2950 C CE2 . TRP C 2 165 ? 12.972  9.857   2.822   1.00 126.85 ? 178 TRP C CE2 1 
ATOM   2951 C CE3 . TRP C 2 165 ? 12.183  7.640   2.272   1.00 124.82 ? 178 TRP C CE3 1 
ATOM   2952 C CZ2 . TRP C 2 165 ? 14.081  9.720   1.990   1.00 133.52 ? 178 TRP C CZ2 1 
ATOM   2953 C CZ3 . TRP C 2 165 ? 13.285  7.506   1.447   1.00 128.78 ? 178 TRP C CZ3 1 
ATOM   2954 C CH2 . TRP C 2 165 ? 14.219  8.539   1.313   1.00 133.72 ? 178 TRP C CH2 1 
ATOM   2955 N N   . THR C 2 166 ? 7.784   8.054   6.972   1.00 90.59  ? 179 THR C N   1 
ATOM   2956 C CA  . THR C 2 166 ? 6.521   7.484   7.433   1.00 87.35  ? 179 THR C CA  1 
ATOM   2957 C C   . THR C 2 166 ? 5.354   8.387   7.034   1.00 92.64  ? 179 THR C C   1 
ATOM   2958 O O   . THR C 2 166 ? 5.443   9.610   7.145   1.00 87.34  ? 179 THR C O   1 
ATOM   2959 C CB  . THR C 2 166 ? 6.513   7.292   8.971   1.00 83.94  ? 179 THR C CB  1 
ATOM   2960 O OG1 . THR C 2 166 ? 7.590   6.428   9.357   1.00 85.01  ? 179 THR C OG1 1 
ATOM   2961 C CG2 . THR C 2 166 ? 5.198   6.681   9.434   1.00 84.46  ? 179 THR C CG2 1 
ATOM   2962 N N   . GLU C 2 167 ? 4.265   7.787   6.561   1.00 94.82  ? 180 GLU C N   1 
ATOM   2963 C CA  . GLU C 2 167 ? 3.074   8.546   6.187   1.00 90.47  ? 180 GLU C CA  1 
ATOM   2964 C C   . GLU C 2 167 ? 1.798   7.885   6.700   1.00 96.74  ? 180 GLU C C   1 
ATOM   2965 O O   . GLU C 2 167 ? 1.714   6.661   6.785   1.00 100.77 ? 180 GLU C O   1 
ATOM   2966 C CB  . GLU C 2 167 ? 2.992   8.704   4.667   1.00 92.08  ? 180 GLU C CB  1 
ATOM   2967 C CG  . GLU C 2 167 ? 3.993   9.678   4.077   1.00 106.01 ? 180 GLU C CG  1 
ATOM   2968 C CD  . GLU C 2 167 ? 3.844   9.822   2.575   1.00 120.61 ? 180 GLU C CD  1 
ATOM   2969 O OE1 . GLU C 2 167 ? 3.669   10.966  2.102   1.00 121.51 ? 180 GLU C OE1 1 
ATOM   2970 O OE2 . GLU C 2 167 ? 3.907   8.794   1.866   1.00 126.43 ? 180 GLU C OE2 1 
ATOM   2971 N N   . GLU C 2 168 ? 0.811   8.706   7.046   1.00 102.84 ? 181 GLU C N   1 
ATOM   2972 C CA  . GLU C 2 168 ? -0.504  8.211   7.439   1.00 96.94  ? 181 GLU C CA  1 
ATOM   2973 C C   . GLU C 2 168 ? -1.447  8.294   6.246   1.00 101.16 ? 181 GLU C C   1 
ATOM   2974 O O   . GLU C 2 168 ? -1.365  9.234   5.453   1.00 108.44 ? 181 GLU C O   1 
ATOM   2975 C CB  . GLU C 2 168 ? -1.066  9.030   8.603   1.00 93.77  ? 181 GLU C CB  1 
ATOM   2976 C CG  . GLU C 2 168 ? -2.455  8.594   9.057   1.00 100.15 ? 181 GLU C CG  1 
ATOM   2977 C CD  . GLU C 2 168 ? -2.985  9.429   10.206  1.00 112.29 ? 181 GLU C CD  1 
ATOM   2978 O OE1 . GLU C 2 168 ? -2.226  10.272  10.729  1.00 119.58 ? 181 GLU C OE1 1 
ATOM   2979 O OE2 . GLU C 2 168 ? -4.162  9.245   10.585  1.00 113.63 ? 181 GLU C OE2 1 
ATOM   2980 N N   . CYS C 2 169 ? -2.335  7.312   6.116   1.00 100.25 ? 182 CYS C N   1 
ATOM   2981 C CA  . CYS C 2 169 ? -3.297  7.290   5.018   1.00 103.30 ? 182 CYS C CA  1 
ATOM   2982 C C   . CYS C 2 169 ? -4.280  8.445   5.127   1.00 102.21 ? 182 CYS C C   1 
ATOM   2983 O O   . CYS C 2 169 ? -4.561  8.931   6.221   1.00 102.71 ? 182 CYS C O   1 
ATOM   2984 C CB  . CYS C 2 169 ? -4.057  5.963   4.993   1.00 108.23 ? 182 CYS C CB  1 
ATOM   2985 S SG  . CYS C 2 169 ? -5.259  5.806   3.647   1.00 108.60 ? 182 CYS C SG  1 
ATOM   2986 N N   . GLN C 2 170 ? -4.795  8.879   3.981   1.00 106.93 ? 183 GLN C N   1 
ATOM   2987 C CA  . GLN C 2 170 ? -5.777  9.955   3.927   1.00 110.45 ? 183 GLN C CA  1 
ATOM   2988 C C   . GLN C 2 170 ? -6.910  9.595   2.971   1.00 112.90 ? 183 GLN C C   1 
ATOM   2989 O O   . GLN C 2 170 ? -7.906  10.314  2.872   1.00 121.93 ? 183 GLN C O   1 
ATOM   2990 C CB  . GLN C 2 170 ? -5.116  11.260  3.482   1.00 103.37 ? 183 GLN C CB  1 
ATOM   2991 C CG  . GLN C 2 170 ? -5.310  12.415  4.449   1.00 112.90 ? 183 GLN C CG  1 
ATOM   2992 C CD  . GLN C 2 170 ? -4.526  12.237  5.735   1.00 112.36 ? 183 GLN C CD  1 
ATOM   2993 O OE1 . GLN C 2 170 ? -3.446  11.646  5.742   1.00 100.48 ? 183 GLN C OE1 1 
ATOM   2994 N NE2 . GLN C 2 170 ? -5.067  12.754  6.833   1.00 115.41 ? 183 GLN C NE2 1 
ATOM   2995 N N   . GLU C 2 171 ? -6.746  8.482   2.262   1.00 113.75 ? 184 GLU C N   1 
ATOM   2996 C CA  . GLU C 2 171 ? -7.769  7.996   1.342   1.00 119.87 ? 184 GLU C CA  1 
ATOM   2997 C C   . GLU C 2 171 ? -8.332  6.656   1.809   1.00 116.82 ? 184 GLU C C   1 
ATOM   2998 O O   . GLU C 2 171 ? -7.896  5.596   1.357   1.00 109.23 ? 184 GLU C O   1 
ATOM   2999 C CB  . GLU C 2 171 ? -7.207  7.867   -0.076  1.00 124.48 ? 184 GLU C CB  1 
ATOM   3000 C CG  . GLU C 2 171 ? -6.870  9.192   -0.746  1.00 130.79 ? 184 GLU C CG  1 
ATOM   3001 C CD  . GLU C 2 171 ? -7.590  9.372   -2.069  1.00 141.16 ? 184 GLU C CD  1 
ATOM   3002 O OE1 . GLU C 2 171 ? -8.784  9.013   -2.148  1.00 144.60 ? 184 GLU C OE1 1 
ATOM   3003 O OE2 . GLU C 2 171 ? -6.963  9.865   -3.032  1.00 144.51 ? 184 GLU C OE2 1 
ATOM   3004 N N   . TYR C 2 172 ? -9.305  6.711   2.713   1.00 121.14 ? 185 TYR C N   1 
ATOM   3005 C CA  . TYR C 2 172 ? -9.903  5.501   3.264   1.00 112.18 ? 185 TYR C CA  1 
ATOM   3006 C C   . TYR C 2 172 ? -11.180 5.093   2.537   1.00 118.29 ? 185 TYR C C   1 
ATOM   3007 O O   . TYR C 2 172 ? -12.048 5.927   2.273   1.00 124.43 ? 185 TYR C O   1 
ATOM   3008 C CB  . TYR C 2 172 ? -10.230 5.686   4.748   1.00 107.93 ? 185 TYR C CB  1 
ATOM   3009 C CG  . TYR C 2 172 ? -9.032  5.839   5.660   1.00 108.24 ? 185 TYR C CG  1 
ATOM   3010 C CD1 . TYR C 2 172 ? -8.618  7.093   6.090   1.00 101.58 ? 185 TYR C CD1 1 
ATOM   3011 C CD2 . TYR C 2 172 ? -8.328  4.728   6.107   1.00 94.82  ? 185 TYR C CD2 1 
ATOM   3012 C CE1 . TYR C 2 172 ? -7.529  7.238   6.931   1.00 110.53 ? 185 TYR C CE1 1 
ATOM   3013 C CE2 . TYR C 2 172 ? -7.239  4.863   6.950   1.00 98.27  ? 185 TYR C CE2 1 
ATOM   3014 C CZ  . TYR C 2 172 ? -6.844  6.119   7.358   1.00 108.35 ? 185 TYR C CZ  1 
ATOM   3015 O OH  . TYR C 2 172 ? -5.761  6.254   8.195   1.00 115.07 ? 185 TYR C OH  1 
ATOM   3016 N N   . SER C 2 173 ? -11.285 3.808   2.217   1.00 124.93 ? 186 SER C N   1 
ATOM   3017 C CA  . SER C 2 173 ? -12.560 3.220   1.835   1.00 127.65 ? 186 SER C CA  1 
ATOM   3018 C C   . SER C 2 173 ? -13.203 2.698   3.113   1.00 132.28 ? 186 SER C C   1 
ATOM   3019 O O   . SER C 2 173 ? -12.504 2.253   4.023   1.00 129.51 ? 186 SER C O   1 
ATOM   3020 C CB  . SER C 2 173 ? -12.362 2.083   0.831   1.00 122.32 ? 186 SER C CB  1 
ATOM   3021 O OG  . SER C 2 173 ? -11.900 2.572   -0.417  1.00 120.95 ? 186 SER C OG  1 
ATOM   3022 N N   . LYS C 2 174 ? -14.527 2.761   3.194   1.00 137.60 ? 187 LYS C N   1 
ATOM   3023 C CA  . LYS C 2 174 ? -15.218 2.371   4.418   1.00 131.27 ? 187 LYS C CA  1 
ATOM   3024 C C   . LYS C 2 174 ? -16.299 1.322   4.186   1.00 127.33 ? 187 LYS C C   1 
ATOM   3025 O O   . LYS C 2 174 ? -16.689 1.050   3.050   1.00 120.47 ? 187 LYS C O   1 
ATOM   3026 C CB  . LYS C 2 174 ? -15.827 3.597   5.105   1.00 125.73 ? 187 LYS C CB  1 
ATOM   3027 C CG  . LYS C 2 174 ? -14.803 4.590   5.626   1.00 122.64 ? 187 LYS C CG  1 
ATOM   3028 C CD  . LYS C 2 174 ? -15.477 5.746   6.346   1.00 128.00 ? 187 LYS C CD  1 
ATOM   3029 C CE  . LYS C 2 174 ? -14.468 6.811   6.744   1.00 129.19 ? 187 LYS C CE  1 
ATOM   3030 N NZ  . LYS C 2 174 ? -13.706 7.313   5.568   1.00 118.05 ? 187 LYS C NZ  1 
ATOM   3031 N N   . ASP C 2 175 ? -16.778 0.737   5.278   1.00 127.06 ? 188 ASP C N   1 
ATOM   3032 C CA  . ASP C 2 175 ? -17.866 -0.228  5.220   1.00 130.19 ? 188 ASP C CA  1 
ATOM   3033 C C   . ASP C 2 175 ? -19.174 0.416   5.671   1.00 139.26 ? 188 ASP C C   1 
ATOM   3034 O O   . ASP C 2 175 ? -19.275 1.641   5.763   1.00 124.32 ? 188 ASP C O   1 
ATOM   3035 C CB  . ASP C 2 175 ? -17.546 -1.455  6.080   1.00 130.24 ? 188 ASP C CB  1 
ATOM   3036 C CG  . ASP C 2 175 ? -17.300 -1.101  7.535   1.00 129.20 ? 188 ASP C CG  1 
ATOM   3037 O OD1 . ASP C 2 175 ? -17.216 0.104   7.848   1.00 123.46 ? 188 ASP C OD1 1 
ATOM   3038 O OD2 . ASP C 2 175 ? -17.178 -2.028  8.364   1.00 110.68 ? 188 ASP C OD2 1 
ATOM   3039 N N   . THR C 2 176 ? -20.165 -0.422  5.957   1.00 145.85 ? 189 THR C N   1 
ATOM   3040 C CA  . THR C 2 176 ? -21.480 0.030   6.401   1.00 149.60 ? 189 THR C CA  1 
ATOM   3041 C C   . THR C 2 176 ? -21.427 0.951   7.624   1.00 156.68 ? 189 THR C C   1 
ATOM   3042 O O   . THR C 2 176 ? -22.131 1.964   7.678   1.00 167.26 ? 189 THR C O   1 
ATOM   3043 C CB  . THR C 2 176 ? -22.404 -1.183  6.680   1.00 147.39 ? 189 THR C CB  1 
ATOM   3044 O OG1 . THR C 2 176 ? -23.093 -1.546  5.476   1.00 149.33 ? 189 THR C OG1 1 
ATOM   3045 C CG2 . THR C 2 176 ? -23.424 -0.869  7.764   1.00 152.66 ? 189 THR C CG2 1 
ATOM   3046 N N   . LEU C 2 177 ? -20.577 0.614   8.589   1.00 155.55 ? 190 LEU C N   1 
ATOM   3047 C CA  . LEU C 2 177 ? -20.528 1.347   9.853   1.00 153.14 ? 190 LEU C CA  1 
ATOM   3048 C C   . LEU C 2 177 ? -19.556 2.524   9.853   1.00 144.42 ? 190 LEU C C   1 
ATOM   3049 O O   . LEU C 2 177 ? -19.304 3.123   10.898  1.00 144.88 ? 190 LEU C O   1 
ATOM   3050 C CB  . LEU C 2 177 ? -20.197 0.399   11.008  1.00 150.37 ? 190 LEU C CB  1 
ATOM   3051 C CG  . LEU C 2 177 ? -21.358 0.082   11.954  1.00 153.10 ? 190 LEU C CG  1 
ATOM   3052 C CD1 . LEU C 2 177 ? -20.989 -1.042  12.909  1.00 143.62 ? 190 LEU C CD1 1 
ATOM   3053 C CD2 . LEU C 2 177 ? -21.777 1.329   12.723  1.00 159.15 ? 190 LEU C CD2 1 
ATOM   3054 N N   . GLY C 2 178 ? -19.012 2.853   8.687   1.00 135.05 ? 191 GLY C N   1 
ATOM   3055 C CA  . GLY C 2 178 ? -18.123 3.993   8.568   1.00 134.12 ? 191 GLY C CA  1 
ATOM   3056 C C   . GLY C 2 178 ? -16.761 3.776   9.198   1.00 139.49 ? 191 GLY C C   1 
ATOM   3057 O O   . GLY C 2 178 ? -16.038 4.733   9.480   1.00 144.86 ? 191 GLY C O   1 
ATOM   3058 N N   . ARG C 2 179 ? -16.407 2.516   9.427   1.00 135.77 ? 192 ARG C N   1 
ATOM   3059 C CA  . ARG C 2 179 ? -15.081 2.182   9.930   1.00 136.39 ? 192 ARG C CA  1 
ATOM   3060 C C   . ARG C 2 179 ? -14.169 1.763   8.777   1.00 127.20 ? 192 ARG C C   1 
ATOM   3061 O O   . ARG C 2 179 ? -14.570 0.991   7.906   1.00 107.00 ? 192 ARG C O   1 
ATOM   3062 C CB  . ARG C 2 179 ? -15.163 1.098   11.011  1.00 141.27 ? 192 ARG C CB  1 
ATOM   3063 C CG  . ARG C 2 179 ? -16.287 0.096   10.807  1.00 143.93 ? 192 ARG C CG  1 
ATOM   3064 C CD  . ARG C 2 179 ? -16.414 -0.866  11.979  1.00 140.27 ? 192 ARG C CD  1 
ATOM   3065 N NE  . ARG C 2 179 ? -17.322 -1.967  11.667  1.00 134.60 ? 192 ARG C NE  1 
ATOM   3066 C CZ  . ARG C 2 179 ? -17.592 -2.976  12.490  1.00 133.23 ? 192 ARG C CZ  1 
ATOM   3067 N NH1 . ARG C 2 179 ? -17.026 -3.033  13.688  1.00 134.68 ? 192 ARG C NH1 1 
ATOM   3068 N NH2 . ARG C 2 179 ? -18.430 -3.932  12.113  1.00 132.32 ? 192 ARG C NH2 1 
ATOM   3069 N N   . ASN C 2 180 ? -12.948 2.289   8.777   1.00 118.07 ? 193 ASN C N   1 
ATOM   3070 C CA  . ASN C 2 180 ? -12.019 2.121   7.660   1.00 113.54 ? 193 ASN C CA  1 
ATOM   3071 C C   . ASN C 2 180 ? -11.682 0.665   7.333   1.00 110.70 ? 193 ASN C C   1 
ATOM   3072 O O   . ASN C 2 180 ? -11.423 -0.144  8.227   1.00 104.75 ? 193 ASN C O   1 
ATOM   3073 C CB  . ASN C 2 180 ? -10.742 2.924   7.912   1.00 111.43 ? 193 ASN C CB  1 
ATOM   3074 C CG  . ASN C 2 180 ? -11.017 4.403   8.094   1.00 111.53 ? 193 ASN C CG  1 
ATOM   3075 O OD1 . ASN C 2 180 ? -11.881 4.971   7.427   1.00 114.71 ? 193 ASN C OD1 1 
ATOM   3076 N ND2 . ASN C 2 180 ? -10.287 5.034   9.007   1.00 102.89 ? 193 ASN C ND2 1 
ATOM   3077 N N   . ILE C 2 181 ? -11.682 0.342   6.042   1.00 111.77 ? 194 ILE C N   1 
ATOM   3078 C CA  . ILE C 2 181 ? -11.514 -1.039  5.604   1.00 105.58 ? 194 ILE C CA  1 
ATOM   3079 C C   . ILE C 2 181 ? -10.497 -1.174  4.464   1.00 96.67  ? 194 ILE C C   1 
ATOM   3080 O O   . ILE C 2 181 ? -10.063 -2.280  4.141   1.00 90.23  ? 194 ILE C O   1 
ATOM   3081 C CB  . ILE C 2 181 ? -12.876 -1.664  5.199   1.00 135.36 ? 194 ILE C CB  1 
ATOM   3082 C CG1 . ILE C 2 181 ? -12.954 -3.127  5.642   1.00 146.00 ? 194 ILE C CG1 1 
ATOM   3083 C CG2 . ILE C 2 181 ? -13.129 -1.506  3.701   1.00 129.69 ? 194 ILE C CG2 1 
ATOM   3084 C CD1 . ILE C 2 181 ? -14.334 -3.751  5.495   1.00 159.04 ? 194 ILE C CD1 1 
ATOM   3085 N N   . ALA C 2 182 ? -10.113 -0.047  3.870   1.00 100.89 ? 195 ALA C N   1 
ATOM   3086 C CA  . ALA C 2 182 ? -9.137  -0.043  2.781   1.00 99.15  ? 195 ALA C CA  1 
ATOM   3087 C C   . ALA C 2 182 ? -8.434  1.310   2.667   1.00 110.85 ? 195 ALA C C   1 
ATOM   3088 O O   . ALA C 2 182 ? -8.977  2.334   3.085   1.00 109.51 ? 195 ALA C O   1 
ATOM   3089 C CB  . ALA C 2 182 ? -9.805  -0.412  1.466   1.00 96.57  ? 195 ALA C CB  1 
ATOM   3090 N N   . CYS C 2 183 ? -7.229  1.312   2.098   1.00 117.36 ? 196 CYS C N   1 
ATOM   3091 C CA  . CYS C 2 183 ? -6.434  2.536   1.984   1.00 115.71 ? 196 CYS C CA  1 
ATOM   3092 C C   . CYS C 2 183 ? -5.890  2.741   0.570   1.00 108.13 ? 196 CYS C C   1 
ATOM   3093 O O   . CYS C 2 183 ? -5.801  1.794   -0.211  1.00 104.20 ? 196 CYS C O   1 
ATOM   3094 C CB  . CYS C 2 183 ? -5.279  2.514   2.989   1.00 114.18 ? 196 CYS C CB  1 
ATOM   3095 S SG  . CYS C 2 183 ? -4.358  4.065   3.110   1.00 162.70 ? 196 CYS C SG  1 
ATOM   3096 N N   . TRP C 2 184 ? -5.529  3.981   0.247   1.00 112.88 ? 197 TRP C N   1 
ATOM   3097 C CA  . TRP C 2 184 ? -4.994  4.303   -1.074  1.00 110.22 ? 197 TRP C CA  1 
ATOM   3098 C C   . TRP C 2 184 ? -3.963  5.430   -1.049  1.00 109.67 ? 197 TRP C C   1 
ATOM   3099 O O   . TRP C 2 184 ? -4.242  6.539   -0.590  1.00 110.83 ? 197 TRP C O   1 
ATOM   3100 C CB  . TRP C 2 184 ? -6.123  4.652   -2.049  1.00 107.00 ? 197 TRP C CB  1 
ATOM   3101 C CG  . TRP C 2 184 ? -5.639  5.231   -3.350  1.00 110.84 ? 197 TRP C CG  1 
ATOM   3102 C CD1 . TRP C 2 184 ? -5.818  6.508   -3.798  1.00 116.42 ? 197 TRP C CD1 1 
ATOM   3103 C CD2 . TRP C 2 184 ? -4.885  4.555   -4.363  1.00 107.07 ? 197 TRP C CD2 1 
ATOM   3104 N NE1 . TRP C 2 184 ? -5.229  6.667   -5.030  1.00 110.79 ? 197 TRP C NE1 1 
ATOM   3105 C CE2 . TRP C 2 184 ? -4.647  5.479   -5.400  1.00 103.36 ? 197 TRP C CE2 1 
ATOM   3106 C CE3 . TRP C 2 184 ? -4.387  3.253   -4.498  1.00 104.98 ? 197 TRP C CE3 1 
ATOM   3107 C CZ2 . TRP C 2 184 ? -3.939  5.149   -6.553  1.00 99.23  ? 197 TRP C CZ2 1 
ATOM   3108 C CZ3 . TRP C 2 184 ? -3.683  2.925   -5.643  1.00 102.65 ? 197 TRP C CZ3 1 
ATOM   3109 C CH2 . TRP C 2 184 ? -3.466  3.869   -6.655  1.00 104.07 ? 197 TRP C CH2 1 
ATOM   3110 N N   . PHE C 2 185 ? -2.770  5.129   -1.550  1.00 102.81 ? 198 PHE C N   1 
ATOM   3111 C CA  . PHE C 2 185 ? -1.714  6.118   -1.710  1.00 89.51  ? 198 PHE C CA  1 
ATOM   3112 C C   . PHE C 2 185 ? -1.393  6.260   -3.192  1.00 88.63  ? 198 PHE C C   1 
ATOM   3113 O O   . PHE C 2 185 ? -0.775  5.372   -3.772  1.00 91.21  ? 198 PHE C O   1 
ATOM   3114 C CB  . PHE C 2 185 ? -0.444  5.664   -0.987  1.00 85.67  ? 198 PHE C CB  1 
ATOM   3115 C CG  . PHE C 2 185 ? -0.452  5.906   0.497   1.00 92.91  ? 198 PHE C CG  1 
ATOM   3116 C CD1 . PHE C 2 185 ? -0.051  7.128   1.014   1.00 93.46  ? 198 PHE C CD1 1 
ATOM   3117 C CD2 . PHE C 2 185 ? -0.823  4.902   1.377   1.00 97.30  ? 198 PHE C CD2 1 
ATOM   3118 C CE1 . PHE C 2 185 ? -0.043  7.351   2.378   1.00 95.49  ? 198 PHE C CE1 1 
ATOM   3119 C CE2 . PHE C 2 185 ? -0.816  5.120   2.742   1.00 97.45  ? 198 PHE C CE2 1 
ATOM   3120 C CZ  . PHE C 2 185 ? -0.424  6.346   3.243   1.00 99.72  ? 198 PHE C CZ  1 
ATOM   3121 N N   . PRO C 2 186 ? -1.818  7.367   -3.818  1.00 97.61  ? 199 PRO C N   1 
ATOM   3122 C CA  . PRO C 2 186 ? -1.397  7.583   -5.207  1.00 99.65  ? 199 PRO C CA  1 
ATOM   3123 C C   . PRO C 2 186 ? 0.107   7.838   -5.293  1.00 102.34 ? 199 PRO C C   1 
ATOM   3124 O O   . PRO C 2 186 ? 0.742   7.443   -6.272  1.00 98.51  ? 199 PRO C O   1 
ATOM   3125 C CB  . PRO C 2 186 ? -2.180  8.833   -5.626  1.00 100.71 ? 199 PRO C CB  1 
ATOM   3126 C CG  . PRO C 2 186 ? -2.540  9.514   -4.349  1.00 105.44 ? 199 PRO C CG  1 
ATOM   3127 C CD  . PRO C 2 186 ? -2.732  8.418   -3.341  1.00 103.91 ? 199 PRO C CD  1 
ATOM   3128 N N   . ARG C 2 187 ? 0.660   8.484   -4.269  1.00 105.07 ? 200 ARG C N   1 
ATOM   3129 C CA  . ARG C 2 187 ? 2.090   8.775   -4.207  1.00 106.34 ? 200 ARG C CA  1 
ATOM   3130 C C   . ARG C 2 187 ? 2.715   8.278   -2.904  1.00 99.87  ? 200 ARG C C   1 
ATOM   3131 O O   . ARG C 2 187 ? 2.136   8.435   -1.829  1.00 99.51  ? 200 ARG C O   1 
ATOM   3132 C CB  . ARG C 2 187 ? 2.340   10.277  -4.360  1.00 116.22 ? 200 ARG C CB  1 
ATOM   3133 C CG  . ARG C 2 187 ? 1.956   10.837  -5.714  1.00 123.06 ? 200 ARG C CG  1 
ATOM   3134 C CD  . ARG C 2 187 ? 2.365   12.291  -5.835  1.00 135.42 ? 200 ARG C CD  1 
ATOM   3135 N NE  . ARG C 2 187 ? 3.175   12.518  -7.026  1.00 141.76 ? 200 ARG C NE  1 
ATOM   3136 C CZ  . ARG C 2 187 ? 2.673   12.757  -8.232  1.00 150.87 ? 200 ARG C CZ  1 
ATOM   3137 N NH1 . ARG C 2 187 ? 1.359   12.802  -8.408  1.00 149.69 ? 200 ARG C NH1 1 
ATOM   3138 N NH2 . ARG C 2 187 ? 3.484   12.948  -9.261  1.00 161.23 ? 200 ARG C NH2 1 
ATOM   3139 N N   . THR C 2 188 ? 3.897   7.675   -3.001  1.00 97.74  ? 201 THR C N   1 
ATOM   3140 C CA  . THR C 2 188 ? 4.606   7.199   -1.815  1.00 94.74  ? 201 THR C CA  1 
ATOM   3141 C C   . THR C 2 188 ? 6.086   7.567   -1.840  1.00 97.51  ? 201 THR C C   1 
ATOM   3142 O O   . THR C 2 188 ? 6.587   8.105   -2.827  1.00 98.04  ? 201 THR C O   1 
ATOM   3143 C CB  . THR C 2 188 ? 4.487   5.668   -1.640  1.00 87.77  ? 201 THR C CB  1 
ATOM   3144 O OG1 . THR C 2 188 ? 4.985   5.005   -2.809  1.00 85.34  ? 201 THR C OG1 1 
ATOM   3145 C CG2 . THR C 2 188 ? 3.046   5.264   -1.409  1.00 90.42  ? 201 THR C CG2 1 
ATOM   3146 N N   . PHE C 2 189 ? 6.777   7.274   -0.741  1.00 98.90  ? 202 PHE C N   1 
ATOM   3147 C CA  . PHE C 2 189 ? 8.225   7.445   -0.664  1.00 105.18 ? 202 PHE C CA  1 
ATOM   3148 C C   . PHE C 2 189 ? 8.928   6.162   -1.097  1.00 104.68 ? 202 PHE C C   1 
ATOM   3149 O O   . PHE C 2 189 ? 10.158  6.092   -1.126  1.00 111.18 ? 202 PHE C O   1 
ATOM   3150 C CB  . PHE C 2 189 ? 8.655   7.812   0.760   1.00 102.07 ? 202 PHE C CB  1 
ATOM   3151 C CG  . PHE C 2 189 ? 8.408   9.251   1.125   1.00 105.28 ? 202 PHE C CG  1 
ATOM   3152 C CD1 . PHE C 2 189 ? 7.191   9.649   1.654   1.00 109.57 ? 202 PHE C CD1 1 
ATOM   3153 C CD2 . PHE C 2 189 ? 9.400   10.204  0.954   1.00 104.81 ? 202 PHE C CD2 1 
ATOM   3154 C CE1 . PHE C 2 189 ? 6.966   10.970  1.998   1.00 114.75 ? 202 PHE C CE1 1 
ATOM   3155 C CE2 . PHE C 2 189 ? 9.180   11.528  1.297   1.00 111.16 ? 202 PHE C CE2 1 
ATOM   3156 C CZ  . PHE C 2 189 ? 7.961   11.910  1.819   1.00 114.37 ? 202 PHE C CZ  1 
ATOM   3157 N N   . ILE C 2 190 ? 8.134   5.149   -1.429  1.00 96.58  ? 203 ILE C N   1 
ATOM   3158 C CA  . ILE C 2 190 ? 8.653   3.840   -1.816  1.00 88.25  ? 203 ILE C CA  1 
ATOM   3159 C C   . ILE C 2 190 ? 9.441   3.918   -3.116  1.00 93.96  ? 203 ILE C C   1 
ATOM   3160 O O   . ILE C 2 190 ? 8.912   4.333   -4.146  1.00 100.18 ? 203 ILE C O   1 
ATOM   3161 C CB  . ILE C 2 190 ? 7.507   2.824   -1.983  1.00 84.79  ? 203 ILE C CB  1 
ATOM   3162 C CG1 . ILE C 2 190 ? 6.704   2.722   -0.682  1.00 90.91  ? 203 ILE C CG1 1 
ATOM   3163 C CG2 . ILE C 2 190 ? 8.054   1.466   -2.380  1.00 75.99  ? 203 ILE C CG2 1 
ATOM   3164 C CD1 . ILE C 2 190 ? 5.374   2.011   -0.830  1.00 91.10  ? 203 ILE C CD1 1 
ATOM   3165 N N   . LEU C 2 191 ? 10.710  3.525   -3.062  1.00 97.95  ? 204 LEU C N   1 
ATOM   3166 C CA  . LEU C 2 191 ? 11.559  3.527   -4.247  1.00 102.16 ? 204 LEU C CA  1 
ATOM   3167 C C   . LEU C 2 191 ? 11.180  2.376   -5.171  1.00 108.08 ? 204 LEU C C   1 
ATOM   3168 O O   . LEU C 2 191 ? 11.041  1.235   -4.731  1.00 107.69 ? 204 LEU C O   1 
ATOM   3169 C CB  . LEU C 2 191 ? 13.043  3.454   -3.866  1.00 105.37 ? 204 LEU C CB  1 
ATOM   3170 C CG  . LEU C 2 191 ? 13.745  4.787   -3.568  1.00 114.15 ? 204 LEU C CG  1 
ATOM   3171 C CD1 . LEU C 2 191 ? 13.257  5.402   -2.262  1.00 118.90 ? 204 LEU C CD1 1 
ATOM   3172 C CD2 . LEU C 2 191 ? 15.261  4.625   -3.557  1.00 110.61 ? 204 LEU C CD2 1 
ATOM   3173 N N   . SER C 2 192 ? 11.008  2.691   -6.451  1.00 118.45 ? 205 SER C N   1 
ATOM   3174 C CA  . SER C 2 192 ? 10.528  1.728   -7.439  1.00 121.37 ? 205 SER C CA  1 
ATOM   3175 C C   . SER C 2 192 ? 11.507  0.584   -7.697  1.00 119.22 ? 205 SER C C   1 
ATOM   3176 O O   . SER C 2 192 ? 11.098  -0.530  -8.024  1.00 124.70 ? 205 SER C O   1 
ATOM   3177 C CB  . SER C 2 192 ? 10.176  2.446   -8.743  1.00 131.51 ? 205 SER C CB  1 
ATOM   3178 O OG  . SER C 2 192 ? 11.080  3.510   -8.995  1.00 134.22 ? 205 SER C OG  1 
ATOM   3179 N N   . LYS C 2 193 ? 12.798  0.865   -7.555  1.00 115.14 ? 206 LYS C N   1 
ATOM   3180 C CA  . LYS C 2 193 ? 13.810  -0.184  -7.586  1.00 106.35 ? 206 LYS C CA  1 
ATOM   3181 C C   . LYS C 2 193 ? 14.316  -0.447  -6.174  1.00 93.90  ? 206 LYS C C   1 
ATOM   3182 O O   . LYS C 2 193 ? 15.445  -0.897  -5.976  1.00 91.28  ? 206 LYS C O   1 
ATOM   3183 C CB  . LYS C 2 193 ? 14.971  0.187   -8.511  1.00 109.67 ? 206 LYS C CB  1 
ATOM   3184 C CG  . LYS C 2 193 ? 14.586  0.242   -9.980  1.00 115.28 ? 206 LYS C CG  1 
ATOM   3185 C CD  . LYS C 2 193 ? 15.806  0.235   -10.887 1.00 114.73 ? 206 LYS C CD  1 
ATOM   3186 C CE  . LYS C 2 193 ? 16.762  1.368   -10.555 1.00 107.99 ? 206 LYS C CE  1 
ATOM   3187 N NZ  . LYS C 2 193 ? 17.961  1.353   -11.440 1.00 106.25 ? 206 LYS C NZ  1 
ATOM   3188 N N   . GLY C 2 194 ? 13.464  -0.160  -5.196  1.00 86.29  ? 207 GLY C N   1 
ATOM   3189 C CA  . GLY C 2 194 ? 13.820  -0.327  -3.803  1.00 77.82  ? 207 GLY C CA  1 
ATOM   3190 C C   . GLY C 2 194 ? 14.024  -1.778  -3.429  1.00 82.63  ? 207 GLY C C   1 
ATOM   3191 O O   . GLY C 2 194 ? 13.427  -2.675  -4.027  1.00 88.20  ? 207 GLY C O   1 
ATOM   3192 N N   . ARG C 2 195 ? 14.871  -2.004  -2.430  1.00 83.33  ? 208 ARG C N   1 
ATOM   3193 C CA  . ARG C 2 195 ? 15.213  -3.351  -1.993  1.00 84.37  ? 208 ARG C CA  1 
ATOM   3194 C C   . ARG C 2 195 ? 15.145  -3.470  -0.473  1.00 84.25  ? 208 ARG C C   1 
ATOM   3195 O O   . ARG C 2 195 ? 15.813  -4.312  0.127   1.00 87.47  ? 208 ARG C O   1 
ATOM   3196 C CB  . ARG C 2 195 ? 16.606  -3.726  -2.503  1.00 79.19  ? 208 ARG C CB  1 
ATOM   3197 C CG  . ARG C 2 195 ? 16.684  -3.859  -4.018  1.00 80.85  ? 208 ARG C CG  1 
ATOM   3198 C CD  . ARG C 2 195 ? 18.117  -3.989  -4.497  1.00 80.53  ? 208 ARG C CD  1 
ATOM   3199 N NE  . ARG C 2 195 ? 18.230  -4.870  -5.657  1.00 87.09  ? 208 ARG C NE  1 
ATOM   3200 C CZ  . ARG C 2 195 ? 18.049  -4.481  -6.915  1.00 97.54  ? 208 ARG C CZ  1 
ATOM   3201 N NH1 . ARG C 2 195 ? 17.740  -3.221  -7.183  1.00 104.88 ? 208 ARG C NH1 1 
ATOM   3202 N NH2 . ARG C 2 195 ? 18.175  -5.353  -7.905  1.00 102.36 ? 208 ARG C NH2 1 
ATOM   3203 N N   . ASP C 2 196 ? 14.329  -2.620  0.143   1.00 79.01  ? 209 ASP C N   1 
ATOM   3204 C CA  . ASP C 2 196 ? 14.129  -2.656  1.586   1.00 73.90  ? 209 ASP C CA  1 
ATOM   3205 C C   . ASP C 2 196 ? 12.681  -3.004  1.914   1.00 69.10  ? 209 ASP C C   1 
ATOM   3206 O O   . ASP C 2 196 ? 11.818  -3.004  1.035   1.00 70.25  ? 209 ASP C O   1 
ATOM   3207 C CB  . ASP C 2 196 ? 14.496  -1.308  2.206   1.00 79.31  ? 209 ASP C CB  1 
ATOM   3208 C CG  . ASP C 2 196 ? 15.055  -1.442  3.608   1.00 89.72  ? 209 ASP C CG  1 
ATOM   3209 O OD1 . ASP C 2 196 ? 14.777  -2.464  4.273   1.00 83.14  ? 209 ASP C OD1 1 
ATOM   3210 O OD2 . ASP C 2 196 ? 15.777  -0.521  4.046   1.00 99.21  ? 209 ASP C OD2 1 
ATOM   3211 N N   . TRP C 2 197 ? 12.419  -3.295  3.184   1.00 65.19  ? 210 TRP C N   1 
ATOM   3212 C CA  . TRP C 2 197 ? 11.085  -3.698  3.618   1.00 67.00  ? 210 TRP C CA  1 
ATOM   3213 C C   . TRP C 2 197 ? 10.085  -2.551  3.558   1.00 72.31  ? 210 TRP C C   1 
ATOM   3214 O O   . TRP C 2 197 ? 10.458  -1.383  3.668   1.00 73.77  ? 210 TRP C O   1 
ATOM   3215 C CB  . TRP C 2 197 ? 11.126  -4.241  5.046   1.00 65.23  ? 210 TRP C CB  1 
ATOM   3216 C CG  . TRP C 2 197 ? 11.869  -5.524  5.192   1.00 73.98  ? 210 TRP C CG  1 
ATOM   3217 C CD1 . TRP C 2 197 ? 13.107  -5.698  5.742   1.00 69.45  ? 210 TRP C CD1 1 
ATOM   3218 C CD2 . TRP C 2 197 ? 11.425  -6.823  4.786   1.00 73.52  ? 210 TRP C CD2 1 
ATOM   3219 N NE1 . TRP C 2 197 ? 13.460  -7.024  5.704   1.00 73.25  ? 210 TRP C NE1 1 
ATOM   3220 C CE2 . TRP C 2 197 ? 12.444  -7.737  5.121   1.00 75.07  ? 210 TRP C CE2 1 
ATOM   3221 C CE3 . TRP C 2 197 ? 10.264  -7.303  4.172   1.00 70.09  ? 210 TRP C CE3 1 
ATOM   3222 C CZ2 . TRP C 2 197 ? 12.340  -9.102  4.863   1.00 64.61  ? 210 TRP C CZ2 1 
ATOM   3223 C CZ3 . TRP C 2 197 ? 10.161  -8.657  3.916   1.00 72.74  ? 210 TRP C CZ3 1 
ATOM   3224 C CH2 . TRP C 2 197 ? 11.194  -9.542  4.261   1.00 67.87  ? 210 TRP C CH2 1 
ATOM   3225 N N   . LEU C 2 198 ? 8.814   -2.897  3.380   1.00 73.60  ? 211 LEU C N   1 
ATOM   3226 C CA  . LEU C 2 198 ? 7.727   -1.943  3.547   1.00 74.08  ? 211 LEU C CA  1 
ATOM   3227 C C   . LEU C 2 198 ? 6.973   -2.256  4.835   1.00 71.35  ? 211 LEU C C   1 
ATOM   3228 O O   . LEU C 2 198 ? 6.199   -3.209  4.899   1.00 69.74  ? 211 LEU C O   1 
ATOM   3229 C CB  . LEU C 2 198 ? 6.765   -1.981  2.357   1.00 63.50  ? 211 LEU C CB  1 
ATOM   3230 C CG  . LEU C 2 198 ? 5.529   -1.085  2.495   1.00 68.88  ? 211 LEU C CG  1 
ATOM   3231 C CD1 . LEU C 2 198 ? 5.940   0.373   2.455   1.00 77.50  ? 211 LEU C CD1 1 
ATOM   3232 C CD2 . LEU C 2 198 ? 4.492   -1.380  1.421   1.00 77.84  ? 211 LEU C CD2 1 
ATOM   3233 N N   . ALA C 2 199 ? 7.213   -1.459  5.867   1.00 65.89  ? 212 ALA C N   1 
ATOM   3234 C CA  . ALA C 2 199 ? 6.506   -1.634  7.125   1.00 68.24  ? 212 ALA C CA  1 
ATOM   3235 C C   . ALA C 2 199 ? 5.158   -0.933  7.049   1.00 75.49  ? 212 ALA C C   1 
ATOM   3236 O O   . ALA C 2 199 ? 5.093   0.262   6.766   1.00 78.84  ? 212 ALA C O   1 
ATOM   3237 C CB  . ALA C 2 199 ? 7.322   -1.086  8.273   1.00 61.04  ? 212 ALA C CB  1 
ATOM   3238 N N   . VAL C 2 200 ? 4.088   -1.681  7.301   1.00 73.88  ? 213 VAL C N   1 
ATOM   3239 C CA  . VAL C 2 200 ? 2.733   -1.135  7.282   1.00 80.73  ? 213 VAL C CA  1 
ATOM   3240 C C   . VAL C 2 200 ? 2.068   -1.294  8.652   1.00 78.08  ? 213 VAL C C   1 
ATOM   3241 O O   . VAL C 2 200 ? 2.143   -2.359  9.257   1.00 68.78  ? 213 VAL C O   1 
ATOM   3242 C CB  . VAL C 2 200 ? 1.881   -1.833  6.201   1.00 80.72  ? 213 VAL C CB  1 
ATOM   3243 C CG1 . VAL C 2 200 ? 0.420   -1.429  6.316   1.00 76.93  ? 213 VAL C CG1 1 
ATOM   3244 C CG2 . VAL C 2 200 ? 2.424   -1.517  4.816   1.00 81.99  ? 213 VAL C CG2 1 
ATOM   3245 N N   . LEU C 2 201 ? 1.426   -0.237  9.142   1.00 82.73  ? 214 LEU C N   1 
ATOM   3246 C CA  . LEU C 2 201 ? 0.797   -0.278  10.461  1.00 87.10  ? 214 LEU C CA  1 
ATOM   3247 C C   . LEU C 2 201 ? -0.668  0.148   10.405  1.00 95.05  ? 214 LEU C C   1 
ATOM   3248 O O   . LEU C 2 201 ? -0.992  1.231   9.917   1.00 103.45 ? 214 LEU C O   1 
ATOM   3249 C CB  . LEU C 2 201 ? 1.576   0.606   11.446  1.00 86.92  ? 214 LEU C CB  1 
ATOM   3250 C CG  . LEU C 2 201 ? 1.277   0.568   12.951  1.00 89.35  ? 214 LEU C CG  1 
ATOM   3251 C CD1 . LEU C 2 201 ? 0.219   1.581   13.336  1.00 94.79  ? 214 LEU C CD1 1 
ATOM   3252 C CD2 . LEU C 2 201 ? 0.859   -0.824  13.383  1.00 90.99  ? 214 LEU C CD2 1 
ATOM   3253 N N   . VAL C 2 202 ? -1.546  -0.715  10.908  1.00 93.38  ? 215 VAL C N   1 
ATOM   3254 C CA  . VAL C 2 202 ? -2.962  -0.392  11.034  1.00 101.23 ? 215 VAL C CA  1 
ATOM   3255 C C   . VAL C 2 202 ? -3.345  -0.298  12.510  1.00 102.43 ? 215 VAL C C   1 
ATOM   3256 O O   . VAL C 2 202 ? -3.526  -1.316  13.179  1.00 98.36  ? 215 VAL C O   1 
ATOM   3257 C CB  . VAL C 2 202 ? -3.841  -1.453  10.354  1.00 98.19  ? 215 VAL C CB  1 
ATOM   3258 C CG1 . VAL C 2 202 ? -5.301  -1.018  10.355  1.00 95.05  ? 215 VAL C CG1 1 
ATOM   3259 C CG2 . VAL C 2 202 ? -3.357  -1.695  8.943   1.00 93.86  ? 215 VAL C CG2 1 
ATOM   3260 N N   . ASN C 2 203 ? -3.457  0.927   13.015  1.00 108.52 ? 216 ASN C N   1 
ATOM   3261 C CA  . ASN C 2 203 ? -3.765  1.147   14.424  1.00 118.53 ? 216 ASN C CA  1 
ATOM   3262 C C   . ASN C 2 203 ? -5.264  1.316   14.662  1.00 125.77 ? 216 ASN C C   1 
ATOM   3263 O O   . ASN C 2 203 ? -6.036  1.447   13.713  1.00 123.04 ? 216 ASN C O   1 
ATOM   3264 C CB  . ASN C 2 203 ? -3.001  2.364   14.945  1.00 125.51 ? 216 ASN C CB  1 
ATOM   3265 C CG  . ASN C 2 203 ? -2.570  2.206   16.387  1.00 132.12 ? 216 ASN C CG  1 
ATOM   3266 O OD1 . ASN C 2 203 ? -3.365  1.832   17.249  1.00 141.35 ? 216 ASN C OD1 1 
ATOM   3267 N ND2 . ASN C 2 203 ? -1.298  2.481   16.656  1.00 127.20 ? 216 ASN C ND2 1 
ATOM   3268 N N   . GLY C 2 204 ? -5.673  1.313   15.928  1.00 127.26 ? 217 GLY C N   1 
ATOM   3269 C CA  . GLY C 2 204 ? -7.082  1.405   16.270  1.00 122.71 ? 217 GLY C CA  1 
ATOM   3270 C C   . GLY C 2 204 ? -7.375  2.304   17.457  1.00 118.48 ? 217 GLY C C   1 
ATOM   3271 O O   . GLY C 2 204 ? -6.462  2.741   18.161  1.00 110.09 ? 217 GLY C O   1 
ATOM   3272 N N   . SER C 2 205 ? -8.659  2.577   17.674  1.00 127.31 ? 218 SER C N   1 
ATOM   3273 C CA  . SER C 2 205 ? -9.101  3.431   18.771  1.00 134.61 ? 218 SER C CA  1 
ATOM   3274 C C   . SER C 2 205 ? -10.605 3.315   18.985  1.00 141.88 ? 218 SER C C   1 
ATOM   3275 O O   . SER C 2 205 ? -11.378 3.278   18.026  1.00 144.37 ? 218 SER C O   1 
ATOM   3276 C CB  . SER C 2 205 ? -8.743  4.894   18.497  1.00 133.69 ? 218 SER C CB  1 
ATOM   3277 O OG  . SER C 2 205 ? -9.483  5.400   17.400  1.00 134.99 ? 218 SER C OG  1 
ATOM   3278 N N   . SER C 2 206 ? -11.011 3.254   20.249  1.00 146.69 ? 219 SER C N   1 
ATOM   3279 C CA  . SER C 2 206 ? -12.423 3.295   20.616  1.00 148.02 ? 219 SER C CA  1 
ATOM   3280 C C   . SER C 2 206 ? -12.582 3.782   22.050  1.00 151.79 ? 219 SER C C   1 
ATOM   3281 O O   . SER C 2 206 ? -11.795 3.429   22.929  1.00 152.63 ? 219 SER C O   1 
ATOM   3282 C CB  . SER C 2 206 ? -13.078 1.922   20.454  1.00 145.86 ? 219 SER C CB  1 
ATOM   3283 O OG  . SER C 2 206 ? -14.399 1.925   20.965  1.00 154.57 ? 219 SER C OG  1 
ATOM   3284 N N   . LYS C 2 207 ? -13.606 4.597   22.278  1.00 161.13 ? 220 LYS C N   1 
ATOM   3285 C CA  . LYS C 2 207 ? -13.882 5.128   23.605  1.00 169.95 ? 220 LYS C CA  1 
ATOM   3286 C C   . LYS C 2 207 ? -14.450 4.059   24.536  1.00 168.04 ? 220 LYS C C   1 
ATOM   3287 O O   . LYS C 2 207 ? -14.516 4.256   25.749  1.00 173.31 ? 220 LYS C O   1 
ATOM   3288 C CB  . LYS C 2 207 ? -14.857 6.306   23.513  1.00 180.44 ? 220 LYS C CB  1 
ATOM   3289 C CG  . LYS C 2 207 ? -14.215 7.673   23.702  1.00 185.10 ? 220 LYS C CG  1 
ATOM   3290 C CD  . LYS C 2 207 ? -14.476 8.590   22.515  1.00 187.54 ? 220 LYS C CD  1 
ATOM   3291 C CE  . LYS C 2 207 ? -13.658 8.174   21.302  1.00 183.05 ? 220 LYS C CE  1 
ATOM   3292 N NZ  . LYS C 2 207 ? -13.803 9.142   20.178  1.00 182.83 ? 220 LYS C NZ  1 
ATOM   3293 N N   . HIS C 2 208 ? -14.851 2.926   23.968  1.00 157.87 ? 221 HIS C N   1 
ATOM   3294 C CA  . HIS C 2 208 ? -15.557 1.908   24.738  1.00 155.74 ? 221 HIS C CA  1 
ATOM   3295 C C   . HIS C 2 208 ? -14.849 0.553   24.766  1.00 149.16 ? 221 HIS C C   1 
ATOM   3296 O O   . HIS C 2 208 ? -15.441 -0.446  25.180  1.00 152.09 ? 221 HIS C O   1 
ATOM   3297 C CB  . HIS C 2 208 ? -16.982 1.741   24.205  1.00 166.19 ? 221 HIS C CB  1 
ATOM   3298 C CG  . HIS C 2 208 ? -17.632 3.029   23.813  1.00 176.96 ? 221 HIS C CG  1 
ATOM   3299 N ND1 . HIS C 2 208 ? -17.523 3.563   22.546  1.00 178.42 ? 221 HIS C ND1 1 
ATOM   3300 C CD2 . HIS C 2 208 ? -18.396 3.897   24.520  1.00 181.16 ? 221 HIS C CD2 1 
ATOM   3301 C CE1 . HIS C 2 208 ? -18.194 4.698   22.489  1.00 179.00 ? 221 HIS C CE1 1 
ATOM   3302 N NE2 . HIS C 2 208 ? -18.733 4.924   23.674  1.00 182.61 ? 221 HIS C NE2 1 
ATOM   3303 N N   . SER C 2 209 ? -13.591 0.523   24.330  1.00 143.98 ? 222 SER C N   1 
ATOM   3304 C CA  . SER C 2 209 ? -12.792 -0.704  24.345  1.00 140.59 ? 222 SER C CA  1 
ATOM   3305 C C   . SER C 2 209 ? -11.323 -0.448  24.013  1.00 129.92 ? 222 SER C C   1 
ATOM   3306 O O   . SER C 2 209 ? -10.926 0.675   23.701  1.00 126.54 ? 222 SER C O   1 
ATOM   3307 C CB  . SER C 2 209 ? -13.357 -1.738  23.364  1.00 139.19 ? 222 SER C CB  1 
ATOM   3308 O OG  . SER C 2 209 ? -13.264 -1.275  22.028  1.00 137.86 ? 222 SER C OG  1 
ATOM   3309 N N   . ALA C 2 210 ? -10.524 -1.509  24.076  1.00 121.33 ? 223 ALA C N   1 
ATOM   3310 C CA  . ALA C 2 210 ? -9.124  -1.446  23.677  1.00 124.00 ? 223 ALA C CA  1 
ATOM   3311 C C   . ALA C 2 210 ? -8.934  -2.240  22.392  1.00 118.60 ? 223 ALA C C   1 
ATOM   3312 O O   . ALA C 2 210 ? -9.495  -3.325  22.242  1.00 117.07 ? 223 ALA C O   1 
ATOM   3313 C CB  . ALA C 2 210 ? -8.236  -1.994  24.776  1.00 126.84 ? 223 ALA C CB  1 
ATOM   3314 N N   . ILE C 2 211 ? -8.145  -1.701  21.467  1.00 115.41 ? 224 ILE C N   1 
ATOM   3315 C CA  . ILE C 2 211 ? -7.954  -2.340  20.166  1.00 110.43 ? 224 ILE C CA  1 
ATOM   3316 C C   . ILE C 2 211 ? -6.513  -2.777  19.936  1.00 113.74 ? 224 ILE C C   1 
ATOM   3317 O O   . ILE C 2 211 ? -5.588  -1.969  20.019  1.00 116.14 ? 224 ILE C O   1 
ATOM   3318 C CB  . ILE C 2 211 ? -8.376  -1.415  19.001  1.00 103.73 ? 224 ILE C CB  1 
ATOM   3319 C CG1 . ILE C 2 211 ? -9.888  -1.213  18.998  1.00 102.27 ? 224 ILE C CG1 1 
ATOM   3320 C CG2 . ILE C 2 211 ? -7.944  -1.994  17.665  1.00 98.82  ? 224 ILE C CG2 1 
ATOM   3321 C CD1 . ILE C 2 211 ? -10.341 -0.108  19.897  1.00 114.67 ? 224 ILE C CD1 1 
ATOM   3322 N N   . ARG C 2 212 ? -6.328  -4.059  19.644  1.00 116.20 ? 225 ARG C N   1 
ATOM   3323 C CA  . ARG C 2 212 ? -5.014  -4.562  19.274  1.00 108.49 ? 225 ARG C CA  1 
ATOM   3324 C C   . ARG C 2 212 ? -4.667  -4.136  17.852  1.00 98.52  ? 225 ARG C C   1 
ATOM   3325 O O   . ARG C 2 212 ? -5.399  -4.444  16.911  1.00 92.27  ? 225 ARG C O   1 
ATOM   3326 C CB  . ARG C 2 212 ? -4.956  -6.084  19.410  1.00 114.93 ? 225 ARG C CB  1 
ATOM   3327 C CG  . ARG C 2 212 ? -4.509  -6.550  20.785  1.00 126.86 ? 225 ARG C CG  1 
ATOM   3328 C CD  . ARG C 2 212 ? -4.652  -8.054  20.956  1.00 135.50 ? 225 ARG C CD  1 
ATOM   3329 N NE  . ARG C 2 212 ? -4.220  -8.790  19.772  1.00 138.33 ? 225 ARG C NE  1 
ATOM   3330 C CZ  . ARG C 2 212 ? -4.005  -10.101 19.745  1.00 134.66 ? 225 ARG C CZ  1 
ATOM   3331 N NH1 . ARG C 2 212 ? -4.171  -10.828 20.842  1.00 131.91 ? 225 ARG C NH1 1 
ATOM   3332 N NH2 . ARG C 2 212 ? -3.618  -10.686 18.620  1.00 131.44 ? 225 ARG C NH2 1 
ATOM   3333 N N   . PRO C 2 213 ? -3.549  -3.411  17.695  1.00 97.31  ? 226 PRO C N   1 
ATOM   3334 C CA  . PRO C 2 213 ? -3.070  -2.962  16.383  1.00 96.73  ? 226 PRO C CA  1 
ATOM   3335 C C   . PRO C 2 213 ? -2.486  -4.119  15.578  1.00 83.79  ? 226 PRO C C   1 
ATOM   3336 O O   . PRO C 2 213 ? -2.272  -5.199  16.130  1.00 76.64  ? 226 PRO C O   1 
ATOM   3337 C CB  . PRO C 2 213 ? -1.957  -1.975  16.744  1.00 92.36  ? 226 PRO C CB  1 
ATOM   3338 C CG  . PRO C 2 213 ? -1.448  -2.461  18.057  1.00 82.21  ? 226 PRO C CG  1 
ATOM   3339 C CD  . PRO C 2 213 ? -2.657  -2.979  18.785  1.00 89.15  ? 226 PRO C CD  1 
ATOM   3340 N N   . PHE C 2 214 ? -2.241  -3.894  14.290  1.00 80.69  ? 227 PHE C N   1 
ATOM   3341 C CA  . PHE C 2 214 ? -1.581  -4.892  13.453  1.00 80.18  ? 227 PHE C CA  1 
ATOM   3342 C C   . PHE C 2 214 ? -0.552  -4.253  12.523  1.00 85.12  ? 227 PHE C C   1 
ATOM   3343 O O   . PHE C 2 214 ? -0.839  -3.261  11.851  1.00 90.39  ? 227 PHE C O   1 
ATOM   3344 C CB  . PHE C 2 214 ? -2.601  -5.690  12.633  1.00 70.30  ? 227 PHE C CB  1 
ATOM   3345 C CG  . PHE C 2 214 ? -1.977  -6.743  11.755  1.00 78.35  ? 227 PHE C CG  1 
ATOM   3346 C CD1 . PHE C 2 214 ? -1.740  -6.498  10.410  1.00 73.30  ? 227 PHE C CD1 1 
ATOM   3347 C CD2 . PHE C 2 214 ? -1.618  -7.974  12.278  1.00 81.73  ? 227 PHE C CD2 1 
ATOM   3348 C CE1 . PHE C 2 214 ? -1.159  -7.464  9.606   1.00 72.52  ? 227 PHE C CE1 1 
ATOM   3349 C CE2 . PHE C 2 214 ? -1.039  -8.941  11.479  1.00 77.13  ? 227 PHE C CE2 1 
ATOM   3350 C CZ  . PHE C 2 214 ? -0.810  -8.687  10.142  1.00 75.46  ? 227 PHE C CZ  1 
ATOM   3351 N N   . ASP C 2 215 ? 0.647   -4.827  12.489  1.00 82.93  ? 228 ASP C N   1 
ATOM   3352 C CA  . ASP C 2 215 ? 1.674   -4.389  11.552  1.00 84.65  ? 228 ASP C CA  1 
ATOM   3353 C C   . ASP C 2 215 ? 2.218   -5.569  10.756  1.00 76.40  ? 228 ASP C C   1 
ATOM   3354 O O   . ASP C 2 215 ? 2.096   -6.718  11.181  1.00 71.79  ? 228 ASP C O   1 
ATOM   3355 C CB  . ASP C 2 215 ? 2.808   -3.646  12.268  1.00 87.23  ? 228 ASP C CB  1 
ATOM   3356 C CG  . ASP C 2 215 ? 3.297   -4.367  13.512  1.00 89.35  ? 228 ASP C CG  1 
ATOM   3357 O OD1 . ASP C 2 215 ? 2.997   -5.568  13.677  1.00 97.77  ? 228 ASP C OD1 1 
ATOM   3358 O OD2 . ASP C 2 215 ? 3.995   -3.727  14.326  1.00 87.90  ? 228 ASP C OD2 1 
ATOM   3359 N N   . GLN C 2 216 ? 2.813   -5.284  9.601   1.00 77.33  ? 229 GLN C N   1 
ATOM   3360 C CA  . GLN C 2 216 ? 3.336   -6.335  8.734   1.00 73.24  ? 229 GLN C CA  1 
ATOM   3361 C C   . GLN C 2 216 ? 4.496   -5.835  7.875   1.00 69.84  ? 229 GLN C C   1 
ATOM   3362 O O   . GLN C 2 216 ? 4.496   -4.690  7.422   1.00 74.53  ? 229 GLN C O   1 
ATOM   3363 C CB  . GLN C 2 216 ? 2.218   -6.891  7.845   1.00 71.47  ? 229 GLN C CB  1 
ATOM   3364 C CG  . GLN C 2 216 ? 2.624   -8.086  6.993   1.00 73.89  ? 229 GLN C CG  1 
ATOM   3365 C CD  . GLN C 2 216 ? 1.446   -8.726  6.282   1.00 82.92  ? 229 GLN C CD  1 
ATOM   3366 O OE1 . GLN C 2 216 ? 0.288   -8.512  6.650   1.00 95.54  ? 229 GLN C OE1 1 
ATOM   3367 N NE2 . GLN C 2 216 ? 1.736   -9.516  5.254   1.00 76.65  ? 229 GLN C NE2 1 
ATOM   3368 N N   . LEU C 2 217 ? 5.484   -6.699  7.658   1.00 67.66  ? 230 LEU C N   1 
ATOM   3369 C CA  . LEU C 2 217 ? 6.607   -6.379  6.781   1.00 65.81  ? 230 LEU C CA  1 
ATOM   3370 C C   . LEU C 2 217 ? 6.423   -6.994  5.396   1.00 69.97  ? 230 LEU C C   1 
ATOM   3371 O O   . LEU C 2 217 ? 6.289   -8.210  5.257   1.00 78.47  ? 230 LEU C O   1 
ATOM   3372 C CB  . LEU C 2 217 ? 7.924   -6.863  7.396   1.00 62.85  ? 230 LEU C CB  1 
ATOM   3373 C CG  . LEU C 2 217 ? 8.475   -6.060  8.577   1.00 71.48  ? 230 LEU C CG  1 
ATOM   3374 C CD1 . LEU C 2 217 ? 9.640   -6.795  9.219   1.00 63.55  ? 230 LEU C CD1 1 
ATOM   3375 C CD2 . LEU C 2 217 ? 8.902   -4.677  8.112   1.00 74.09  ? 230 LEU C CD2 1 
ATOM   3376 N N   . PHE C 2 218 ? 6.411   -6.147  4.373   1.00 68.88  ? 231 PHE C N   1 
ATOM   3377 C CA  . PHE C 2 218 ? 6.262   -6.615  3.003   1.00 65.85  ? 231 PHE C CA  1 
ATOM   3378 C C   . PHE C 2 218 ? 7.570   -6.428  2.246   1.00 74.65  ? 231 PHE C C   1 
ATOM   3379 O O   . PHE C 2 218 ? 8.260   -5.425  2.423   1.00 84.09  ? 231 PHE C O   1 
ATOM   3380 C CB  . PHE C 2 218 ? 5.146   -5.851  2.284   1.00 66.94  ? 231 PHE C CB  1 
ATOM   3381 C CG  . PHE C 2 218 ? 3.781   -6.036  2.890   1.00 63.33  ? 231 PHE C CG  1 
ATOM   3382 C CD1 . PHE C 2 218 ? 3.368   -5.251  3.955   1.00 62.28  ? 231 PHE C CD1 1 
ATOM   3383 C CD2 . PHE C 2 218 ? 2.902   -6.979  2.380   1.00 60.49  ? 231 PHE C CD2 1 
ATOM   3384 C CE1 . PHE C 2 218 ? 2.110   -5.414  4.508   1.00 68.83  ? 231 PHE C CE1 1 
ATOM   3385 C CE2 . PHE C 2 218 ? 1.644   -7.143  2.929   1.00 68.21  ? 231 PHE C CE2 1 
ATOM   3386 C CZ  . PHE C 2 218 ? 1.247   -6.359  3.993   1.00 71.50  ? 231 PHE C CZ  1 
ATOM   3387 N N   . ALA C 2 219 ? 7.910   -7.403  1.409   1.00 64.30  ? 232 ALA C N   1 
ATOM   3388 C CA  . ALA C 2 219 ? 9.013   -7.256  0.467   1.00 56.78  ? 232 ALA C CA  1 
ATOM   3389 C C   . ALA C 2 219 ? 8.441   -6.748  -0.847  1.00 68.84  ? 232 ALA C C   1 
ATOM   3390 O O   . ALA C 2 219 ? 7.413   -7.245  -1.312  1.00 75.37  ? 232 ALA C O   1 
ATOM   3391 C CB  . ALA C 2 219 ? 9.720   -8.579  0.261   1.00 54.73  ? 232 ALA C CB  1 
ATOM   3392 N N   . LEU C 2 220 ? 9.101   -5.758  -1.439  1.00 71.75  ? 233 LEU C N   1 
ATOM   3393 C CA  . LEU C 2 220 ? 8.584   -5.101  -2.636  1.00 71.86  ? 233 LEU C CA  1 
ATOM   3394 C C   . LEU C 2 220 ? 8.385   -6.068  -3.800  1.00 77.53  ? 233 LEU C C   1 
ATOM   3395 O O   . LEU C 2 220 ? 7.403   -5.969  -4.534  1.00 84.60  ? 233 LEU C O   1 
ATOM   3396 C CB  . LEU C 2 220 ? 9.496   -3.943  -3.053  1.00 75.65  ? 233 LEU C CB  1 
ATOM   3397 C CG  . LEU C 2 220 ? 9.653   -2.819  -2.024  1.00 78.87  ? 233 LEU C CG  1 
ATOM   3398 C CD1 . LEU C 2 220 ? 10.625  -1.764  -2.519  1.00 85.50  ? 233 LEU C CD1 1 
ATOM   3399 C CD2 . LEU C 2 220 ? 8.302   -2.201  -1.726  1.00 79.07  ? 233 LEU C CD2 1 
ATOM   3400 N N   . HIS C 2 221 ? 9.304   -7.017  -3.950  1.00 67.70  ? 234 HIS C N   1 
ATOM   3401 C CA  . HIS C 2 221 ? 9.235   -7.983  -5.043  1.00 70.79  ? 234 HIS C CA  1 
ATOM   3402 C C   . HIS C 2 221 ? 8.016   -8.899  -4.935  1.00 79.26  ? 234 HIS C C   1 
ATOM   3403 O O   . HIS C 2 221 ? 7.624   -9.543  -5.907  1.00 79.07  ? 234 HIS C O   1 
ATOM   3404 C CB  . HIS C 2 221 ? 10.520  -8.813  -5.106  1.00 67.11  ? 234 HIS C CB  1 
ATOM   3405 C CG  . HIS C 2 221 ? 10.726  -9.703  -3.922  1.00 76.60  ? 234 HIS C CG  1 
ATOM   3406 N ND1 . HIS C 2 221 ? 10.152  -10.952 -3.818  1.00 78.39  ? 234 HIS C ND1 1 
ATOM   3407 C CD2 . HIS C 2 221 ? 11.448  -9.526  -2.788  1.00 73.17  ? 234 HIS C CD2 1 
ATOM   3408 C CE1 . HIS C 2 221 ? 10.512  -11.506 -2.673  1.00 76.22  ? 234 HIS C CE1 1 
ATOM   3409 N NE2 . HIS C 2 221 ? 11.297  -10.662 -2.031  1.00 70.40  ? 234 HIS C NE2 1 
ATOM   3410 N N   . ALA C 2 222 ? 7.414   -8.943  -3.752  1.00 80.03  ? 235 ALA C N   1 
ATOM   3411 C CA  . ALA C 2 222 ? 6.279   -9.822  -3.507  1.00 75.50  ? 235 ALA C CA  1 
ATOM   3412 C C   . ALA C 2 222 ? 4.937   -9.121  -3.701  1.00 78.25  ? 235 ALA C C   1 
ATOM   3413 O O   . ALA C 2 222 ? 3.926   -9.770  -3.966  1.00 78.68  ? 235 ALA C O   1 
ATOM   3414 C CB  . ALA C 2 222 ? 6.366   -10.413 -2.111  1.00 69.84  ? 235 ALA C CB  1 
ATOM   3415 N N   . ILE C 2 223 ? 4.929   -7.799  -3.569  1.00 73.51  ? 236 ILE C N   1 
ATOM   3416 C CA  . ILE C 2 223 ? 3.681   -7.042  -3.622  1.00 67.01  ? 236 ILE C CA  1 
ATOM   3417 C C   . ILE C 2 223 ? 3.584   -6.126  -4.840  1.00 77.44  ? 236 ILE C C   1 
ATOM   3418 O O   . ILE C 2 223 ? 2.519   -5.580  -5.131  1.00 77.56  ? 236 ILE C O   1 
ATOM   3419 C CB  . ILE C 2 223 ? 3.480   -6.195  -2.347  1.00 64.72  ? 236 ILE C CB  1 
ATOM   3420 C CG1 . ILE C 2 223 ? 4.523   -5.076  -2.275  1.00 70.70  ? 236 ILE C CG1 1 
ATOM   3421 C CG2 . ILE C 2 223 ? 3.547   -7.072  -1.106  1.00 63.12  ? 236 ILE C CG2 1 
ATOM   3422 C CD1 . ILE C 2 223 ? 4.382   -4.178  -1.058  1.00 69.86  ? 236 ILE C CD1 1 
ATOM   3423 N N   . ASP C 2 224 ? 4.695   -5.952  -5.549  1.00 79.83  ? 237 ASP C N   1 
ATOM   3424 C CA  . ASP C 2 224 ? 4.716   -5.065  -6.707  1.00 86.09  ? 237 ASP C CA  1 
ATOM   3425 C C   . ASP C 2 224 ? 4.016   -5.707  -7.890  1.00 95.64  ? 237 ASP C C   1 
ATOM   3426 O O   . ASP C 2 224 ? 4.545   -6.638  -8.497  1.00 100.04 ? 237 ASP C O   1 
ATOM   3427 C CB  . ASP C 2 224 ? 6.151   -4.699  -7.095  1.00 92.41  ? 237 ASP C CB  1 
ATOM   3428 C CG  . ASP C 2 224 ? 6.216   -3.605  -8.154  1.00 110.80 ? 237 ASP C CG  1 
ATOM   3429 O OD1 . ASP C 2 224 ? 5.260   -2.805  -8.259  1.00 112.43 ? 237 ASP C OD1 1 
ATOM   3430 O OD2 . ASP C 2 224 ? 7.230   -3.542  -8.880  1.00 118.28 ? 237 ASP C OD2 1 
ATOM   3431 N N   . GLN C 2 225 ? 2.825   -5.210  -8.209  1.00 95.03  ? 238 GLN C N   1 
ATOM   3432 C CA  . GLN C 2 225 ? 2.109   -5.663  -9.393  1.00 93.38  ? 238 GLN C CA  1 
ATOM   3433 C C   . GLN C 2 225 ? 2.771   -5.106  -10.645 1.00 85.71  ? 238 GLN C C   1 
ATOM   3434 O O   . GLN C 2 225 ? 2.783   -3.895  -10.865 1.00 89.46  ? 238 GLN C O   1 
ATOM   3435 C CB  . GLN C 2 225 ? 0.641   -5.235  -9.349  1.00 102.67 ? 238 GLN C CB  1 
ATOM   3436 C CG  . GLN C 2 225 ? -0.160  -5.631  -10.589 1.00 116.98 ? 238 GLN C CG  1 
ATOM   3437 C CD  . GLN C 2 225 ? -0.230  -7.139  -10.806 1.00 127.50 ? 238 GLN C CD  1 
ATOM   3438 O OE1 . GLN C 2 225 ? 0.724   -7.758  -11.283 1.00 123.78 ? 238 GLN C OE1 1 
ATOM   3439 N NE2 . GLN C 2 225 ? -1.368  -7.734  -10.462 1.00 133.83 ? 238 GLN C NE2 1 
ATOM   3440 N N   . ILE C 2 226 ? 3.323   -5.997  -11.461 1.00 85.40  ? 239 ILE C N   1 
ATOM   3441 C CA  . ILE C 2 226 ? 4.027   -5.591  -12.670 1.00 86.36  ? 239 ILE C CA  1 
ATOM   3442 C C   . ILE C 2 226 ? 3.036   -5.223  -13.770 1.00 94.78  ? 239 ILE C C   1 
ATOM   3443 O O   . ILE C 2 226 ? 2.072   -5.947  -14.018 1.00 98.44  ? 239 ILE C O   1 
ATOM   3444 C CB  . ILE C 2 226 ? 4.967   -6.709  -13.176 1.00 88.36  ? 239 ILE C CB  1 
ATOM   3445 C CG1 . ILE C 2 226 ? 5.838   -7.240  -12.031 1.00 88.85  ? 239 ILE C CG1 1 
ATOM   3446 C CG2 . ILE C 2 226 ? 5.839   -6.206  -14.314 1.00 78.30  ? 239 ILE C CG2 1 
ATOM   3447 C CD1 . ILE C 2 226 ? 6.730   -6.189  -11.403 1.00 87.85  ? 239 ILE C CD1 1 
ATOM   3448 N N   . ASN C 2 227 ? 3.269   -4.087  -14.419 1.00 94.14  ? 240 ASN C N   1 
ATOM   3449 C CA  . ASN C 2 227 ? 2.430   -3.656  -15.533 1.00 89.70  ? 240 ASN C CA  1 
ATOM   3450 C C   . ASN C 2 227 ? 2.689   -4.515  -16.772 1.00 96.65  ? 240 ASN C C   1 
ATOM   3451 O O   . ASN C 2 227 ? 3.767   -5.093  -16.910 1.00 95.98  ? 240 ASN C O   1 
ATOM   3452 C CB  . ASN C 2 227 ? 2.662   -2.171  -15.826 1.00 91.21  ? 240 ASN C CB  1 
ATOM   3453 C CG  . ASN C 2 227 ? 2.129   -1.270  -14.724 1.00 94.60  ? 240 ASN C CG  1 
ATOM   3454 O OD1 . ASN C 2 227 ? 0.973   -1.388  -14.314 1.00 92.48  ? 240 ASN C OD1 1 
ATOM   3455 N ND2 . ASN C 2 227 ? 2.974   -0.372  -14.232 1.00 89.95  ? 240 ASN C ND2 1 
ATOM   3456 N N   . PRO C 2 228 ? 1.693   -4.623  -17.668 1.00 98.07  ? 241 PRO C N   1 
ATOM   3457 C CA  . PRO C 2 228 ? 1.839   -5.466  -18.861 1.00 91.77  ? 241 PRO C CA  1 
ATOM   3458 C C   . PRO C 2 228 ? 2.853   -4.898  -19.845 1.00 101.99 ? 241 PRO C C   1 
ATOM   3459 O O   . PRO C 2 228 ? 3.157   -3.708  -19.775 1.00 109.73 ? 241 PRO C O   1 
ATOM   3460 C CB  . PRO C 2 228 ? 0.441   -5.428  -19.489 1.00 96.07  ? 241 PRO C CB  1 
ATOM   3461 C CG  . PRO C 2 228 ? -0.472  -5.006  -18.388 1.00 105.72 ? 241 PRO C CG  1 
ATOM   3462 C CD  . PRO C 2 228 ? 0.332   -4.075  -17.546 1.00 104.46 ? 241 PRO C CD  1 
ATOM   3463 N N   . PRO C 2 229 ? 3.378   -5.742  -20.749 1.00 107.55 ? 242 PRO C N   1 
ATOM   3464 C CA  . PRO C 2 229 ? 4.209   -5.231  -21.844 1.00 109.17 ? 242 PRO C CA  1 
ATOM   3465 C C   . PRO C 2 229 ? 3.394   -4.268  -22.698 1.00 111.50 ? 242 PRO C C   1 
ATOM   3466 O O   . PRO C 2 229 ? 2.199   -4.489  -22.892 1.00 110.83 ? 242 PRO C O   1 
ATOM   3467 C CB  . PRO C 2 229 ? 4.541   -6.490  -22.650 1.00 108.93 ? 242 PRO C CB  1 
ATOM   3468 C CG  . PRO C 2 229 ? 4.407   -7.613  -21.679 1.00 111.06 ? 242 PRO C CG  1 
ATOM   3469 C CD  . PRO C 2 229 ? 3.294   -7.213  -20.755 1.00 107.52 ? 242 PRO C CD  1 
ATOM   3470 N N   . LEU C 2 230 ? 4.027   -3.217  -23.204 1.00 110.99 ? 243 LEU C N   1 
ATOM   3471 C CA  . LEU C 2 230 ? 3.291   -2.171  -23.903 1.00 117.40 ? 243 LEU C CA  1 
ATOM   3472 C C   . LEU C 2 230 ? 3.502   -2.230  -25.413 1.00 118.43 ? 243 LEU C C   1 
ATOM   3473 O O   . LEU C 2 230 ? 4.481   -2.805  -25.887 1.00 119.30 ? 243 LEU C O   1 
ATOM   3474 C CB  . LEU C 2 230 ? 3.685   -0.797  -23.353 1.00 126.32 ? 243 LEU C CB  1 
ATOM   3475 C CG  . LEU C 2 230 ? 2.630   0.311   -23.398 1.00 141.06 ? 243 LEU C CG  1 
ATOM   3476 C CD1 . LEU C 2 230 ? 1.236   -0.270  -23.229 1.00 142.94 ? 243 LEU C CD1 1 
ATOM   3477 C CD2 . LEU C 2 230 ? 2.916   1.331   -22.309 1.00 136.71 ? 243 LEU C CD2 1 
ATOM   3478 N N   . ASN C 2 231 ? 2.570   -1.637  -26.157 1.00 117.22 ? 244 ASN C N   1 
ATOM   3479 C CA  . ASN C 2 231 ? 2.640   -1.581  -27.617 1.00 121.07 ? 244 ASN C CA  1 
ATOM   3480 C C   . ASN C 2 231 ? 2.809   -2.951  -28.268 1.00 117.14 ? 244 ASN C C   1 
ATOM   3481 O O   . ASN C 2 231 ? 3.585   -3.111  -29.213 1.00 119.11 ? 244 ASN C O   1 
ATOM   3482 C CB  . ASN C 2 231 ? 3.747   -0.626  -28.072 1.00 115.56 ? 244 ASN C CB  1 
ATOM   3483 C CG  . ASN C 2 231 ? 3.499   0.801   -27.630 1.00 130.79 ? 244 ASN C CG  1 
ATOM   3484 O OD1 . ASN C 2 231 ? 2.365   1.280   -27.651 1.00 118.56 ? 244 ASN C OD1 1 
ATOM   3485 N ND2 . ASN C 2 231 ? 4.558   1.488   -27.220 1.00 131.75 ? 244 ASN C ND2 1 
ATOM   3486 N N   . VAL C 2 232 ? 2.080   -3.935  -27.750 1.00 112.62 ? 245 VAL C N   1 
ATOM   3487 C CA  . VAL C 2 232 ? 2.113   -5.289  -28.289 1.00 113.91 ? 245 VAL C CA  1 
ATOM   3488 C C   . VAL C 2 232 ? 1.483   -5.333  -29.675 1.00 124.93 ? 245 VAL C C   1 
ATOM   3489 O O   . VAL C 2 232 ? 0.269   -5.188  -29.820 1.00 128.10 ? 245 VAL C O   1 
ATOM   3490 C CB  . VAL C 2 232 ? 1.370   -6.281  -27.374 1.00 111.20 ? 245 VAL C CB  1 
ATOM   3491 C CG1 . VAL C 2 232 ? 1.366   -7.667  -27.988 1.00 101.99 ? 245 VAL C CG1 1 
ATOM   3492 C CG2 . VAL C 2 232 ? 2.008   -6.311  -25.998 1.00 108.92 ? 245 VAL C CG2 1 
ATOM   3493 N N   . THR C 2 233 ? 2.315   -5.525  -30.692 1.00 131.12 ? 246 THR C N   1 
ATOM   3494 C CA  . THR C 2 233 ? 1.830   -5.610  -32.063 1.00 142.06 ? 246 THR C CA  1 
ATOM   3495 C C   . THR C 2 233 ? 2.269   -6.915  -32.718 1.00 145.70 ? 246 THR C C   1 
ATOM   3496 O O   . THR C 2 233 ? 3.370   -7.407  -32.468 1.00 140.26 ? 246 THR C O   1 
ATOM   3497 C CB  . THR C 2 233 ? 2.328   -4.428  -32.918 1.00 150.55 ? 246 THR C CB  1 
ATOM   3498 O OG1 . THR C 2 233 ? 3.752   -4.497  -33.053 1.00 155.54 ? 246 THR C OG1 1 
ATOM   3499 C CG2 . THR C 2 233 ? 1.942   -3.100  -32.278 1.00 148.43 ? 246 THR C CG2 1 
ATOM   3500 N N   . ALA C 2 234 ? 1.398   -7.472  -33.553 1.00 152.00 ? 247 ALA C N   1 
ATOM   3501 C CA  . ALA C 2 234 ? 1.714   -8.683  -34.301 1.00 142.99 ? 247 ALA C CA  1 
ATOM   3502 C C   . ALA C 2 234 ? 1.419   -8.482  -35.783 1.00 141.14 ? 247 ALA C C   1 
ATOM   3503 O O   . ALA C 2 234 ? 0.304   -8.122  -36.159 1.00 133.32 ? 247 ALA C O   1 
ATOM   3504 C CB  . ALA C 2 234 ? 0.932   -9.869  -33.755 1.00 128.56 ? 247 ALA C CB  1 
ATOM   3505 N N   . GLU C 2 235 ? 2.423   -8.712  -36.622 1.00 147.71 ? 248 GLU C N   1 
ATOM   3506 C CA  . GLU C 2 235 ? 2.258   -8.548  -38.061 1.00 153.08 ? 248 GLU C CA  1 
ATOM   3507 C C   . GLU C 2 235 ? 2.424   -9.878  -38.782 1.00 154.14 ? 248 GLU C C   1 
ATOM   3508 O O   . GLU C 2 235 ? 3.278   -10.688 -38.424 1.00 148.89 ? 248 GLU C O   1 
ATOM   3509 C CB  . GLU C 2 235 ? 3.266   -7.537  -38.609 1.00 155.68 ? 248 GLU C CB  1 
ATOM   3510 C CG  . GLU C 2 235 ? 3.064   -7.192  -40.079 1.00 165.29 ? 248 GLU C CG  1 
ATOM   3511 C CD  . GLU C 2 235 ? 4.301   -6.587  -40.711 1.00 171.94 ? 248 GLU C CD  1 
ATOM   3512 O OE1 . GLU C 2 235 ? 4.165   -5.602  -41.468 1.00 173.64 ? 248 GLU C OE1 1 
ATOM   3513 O OE2 . GLU C 2 235 ? 5.410   -7.102  -40.457 1.00 174.66 ? 248 GLU C OE2 1 
ATOM   3514 N N   . ILE C 2 236 ? 1.597   -10.098 -39.798 1.00 158.69 ? 249 ILE C N   1 
ATOM   3515 C CA  . ILE C 2 236 ? 1.725   -11.275 -40.645 1.00 159.30 ? 249 ILE C CA  1 
ATOM   3516 C C   . ILE C 2 236 ? 2.383   -10.904 -41.967 1.00 170.05 ? 249 ILE C C   1 
ATOM   3517 O O   . ILE C 2 236 ? 1.793   -10.198 -42.787 1.00 175.55 ? 249 ILE C O   1 
ATOM   3518 C CB  . ILE C 2 236 ? 0.356   -11.916 -40.945 1.00 153.53 ? 249 ILE C CB  1 
ATOM   3519 C CG1 . ILE C 2 236 ? -0.322  -12.373 -39.647 1.00 148.90 ? 249 ILE C CG1 1 
ATOM   3520 C CG2 . ILE C 2 236 ? 0.516   -13.062 -41.942 1.00 152.06 ? 249 ILE C CG2 1 
ATOM   3521 C CD1 . ILE C 2 236 ? -0.570  -13.867 -39.555 1.00 139.08 ? 249 ILE C CD1 1 
ATOM   3522 N N   . GLU C 2 237 ? 3.611   -11.369 -42.170 1.00 176.31 ? 250 GLU C N   1 
ATOM   3523 C CA  . GLU C 2 237 ? 4.278   -11.183 -43.450 1.00 189.44 ? 250 GLU C CA  1 
ATOM   3524 C C   . GLU C 2 237 ? 4.280   -12.502 -44.210 1.00 198.80 ? 250 GLU C C   1 
ATOM   3525 O O   . GLU C 2 237 ? 5.299   -13.187 -44.295 1.00 201.21 ? 250 GLU C O   1 
ATOM   3526 C CB  . GLU C 2 237 ? 5.704   -10.656 -43.266 1.00 188.81 ? 250 GLU C CB  1 
ATOM   3527 C CG  . GLU C 2 237 ? 6.375   -10.240 -44.570 1.00 195.45 ? 250 GLU C CG  1 
ATOM   3528 C CD  . GLU C 2 237 ? 7.644   -9.440  -44.352 1.00 195.57 ? 250 GLU C CD  1 
ATOM   3529 O OE1 . GLU C 2 237 ? 8.682   -9.793  -44.951 1.00 196.82 ? 250 GLU C OE1 1 
ATOM   3530 O OE2 . GLU C 2 237 ? 7.601   -8.452  -43.590 1.00 193.52 ? 250 GLU C OE2 1 
ATOM   3531 N N   . GLY C 2 238 ? 3.117   -12.857 -44.746 1.00 201.87 ? 251 GLY C N   1 
ATOM   3532 C CA  . GLY C 2 238 ? 2.961   -14.088 -45.495 1.00 200.97 ? 251 GLY C CA  1 
ATOM   3533 C C   . GLY C 2 238 ? 3.032   -15.329 -44.628 1.00 194.64 ? 251 GLY C C   1 
ATOM   3534 O O   . GLY C 2 238 ? 2.046   -15.723 -44.006 1.00 189.71 ? 251 GLY C O   1 
ATOM   3535 N N   . THR C 2 239 ? 4.213   -15.937 -44.579 1.00 192.14 ? 252 THR C N   1 
ATOM   3536 C CA  . THR C 2 239 ? 4.391   -17.231 -43.930 1.00 181.52 ? 252 THR C CA  1 
ATOM   3537 C C   . THR C 2 239 ? 4.898   -17.155 -42.490 1.00 179.34 ? 252 THR C C   1 
ATOM   3538 O O   . THR C 2 239 ? 5.066   -18.184 -41.836 1.00 177.74 ? 252 THR C O   1 
ATOM   3539 C CB  . THR C 2 239 ? 5.352   -18.122 -44.740 1.00 174.79 ? 252 THR C CB  1 
ATOM   3540 O OG1 . THR C 2 239 ? 5.651   -19.309 -43.995 1.00 162.43 ? 252 THR C OG1 1 
ATOM   3541 C CG2 . THR C 2 239 ? 6.645   -17.376 -45.036 1.00 176.97 ? 252 THR C CG2 1 
ATOM   3542 N N   . ARG C 2 240 ? 5.141   -15.947 -41.992 1.00 177.05 ? 253 ARG C N   1 
ATOM   3543 C CA  . ARG C 2 240 ? 5.673   -15.799 -40.639 1.00 164.89 ? 253 ARG C CA  1 
ATOM   3544 C C   . ARG C 2 240 ? 4.952   -14.759 -39.791 1.00 159.39 ? 253 ARG C C   1 
ATOM   3545 O O   . ARG C 2 240 ? 4.300   -13.852 -40.310 1.00 156.19 ? 253 ARG C O   1 
ATOM   3546 C CB  . ARG C 2 240 ? 7.168   -15.475 -40.674 1.00 163.12 ? 253 ARG C CB  1 
ATOM   3547 C CG  . ARG C 2 240 ? 8.064   -16.668 -40.947 1.00 164.88 ? 253 ARG C CG  1 
ATOM   3548 C CD  . ARG C 2 240 ? 9.519   -16.271 -40.798 1.00 170.09 ? 253 ARG C CD  1 
ATOM   3549 N NE  . ARG C 2 240 ? 9.738   -14.910 -41.278 1.00 179.04 ? 253 ARG C NE  1 
ATOM   3550 C CZ  . ARG C 2 240 ? 10.930  -14.331 -41.380 1.00 182.30 ? 253 ARG C CZ  1 
ATOM   3551 N NH1 . ARG C 2 240 ? 12.026  -14.996 -41.042 1.00 181.48 ? 253 ARG C NH1 1 
ATOM   3552 N NH2 . ARG C 2 240 ? 11.024  -13.087 -41.827 1.00 184.43 ? 253 ARG C NH2 1 
ATOM   3553 N N   . LEU C 2 241 ? 5.093   -14.905 -38.477 1.00 159.89 ? 254 LEU C N   1 
ATOM   3554 C CA  . LEU C 2 241 ? 4.541   -13.958 -37.518 1.00 154.98 ? 254 LEU C CA  1 
ATOM   3555 C C   . LEU C 2 241 ? 5.642   -13.070 -36.948 1.00 151.60 ? 254 LEU C C   1 
ATOM   3556 O O   . LEU C 2 241 ? 6.737   -13.543 -36.646 1.00 150.15 ? 254 LEU C O   1 
ATOM   3557 C CB  . LEU C 2 241 ? 3.834   -14.702 -36.383 1.00 143.23 ? 254 LEU C CB  1 
ATOM   3558 C CG  . LEU C 2 241 ? 2.311   -14.564 -36.334 1.00 140.32 ? 254 LEU C CG  1 
ATOM   3559 C CD1 . LEU C 2 241 ? 1.731   -15.345 -35.165 1.00 132.89 ? 254 LEU C CD1 1 
ATOM   3560 C CD2 . LEU C 2 241 ? 1.923   -13.100 -36.248 1.00 140.22 ? 254 LEU C CD2 1 
ATOM   3561 N N   . SER C 2 242 ? 5.351   -11.781 -36.810 1.00 147.30 ? 255 SER C N   1 
ATOM   3562 C CA  . SER C 2 242 ? 6.297   -10.843 -36.220 1.00 144.11 ? 255 SER C CA  1 
ATOM   3563 C C   . SER C 2 242 ? 5.670   -10.152 -35.017 1.00 129.89 ? 255 SER C C   1 
ATOM   3564 O O   . SER C 2 242 ? 4.691   -9.421  -35.155 1.00 128.30 ? 255 SER C O   1 
ATOM   3565 C CB  . SER C 2 242 ? 6.741   -9.801  -37.248 1.00 159.56 ? 255 SER C CB  1 
ATOM   3566 O OG  . SER C 2 242 ? 7.589   -8.833  -36.652 1.00 166.81 ? 255 SER C OG  1 
ATOM   3567 N N   . ILE C 2 243 ? 6.238   -10.387 -33.838 1.00 124.84 ? 256 ILE C N   1 
ATOM   3568 C CA  . ILE C 2 243 ? 5.695   -9.833  -32.603 1.00 123.12 ? 256 ILE C CA  1 
ATOM   3569 C C   . ILE C 2 243 ? 6.703   -8.936  -31.888 1.00 121.36 ? 256 ILE C C   1 
ATOM   3570 O O   . ILE C 2 243 ? 7.879   -9.282  -31.765 1.00 115.21 ? 256 ILE C O   1 
ATOM   3571 C CB  . ILE C 2 243 ? 5.254   -10.956 -31.638 1.00 120.89 ? 256 ILE C CB  1 
ATOM   3572 C CG1 . ILE C 2 243 ? 4.392   -11.987 -32.375 1.00 120.11 ? 256 ILE C CG1 1 
ATOM   3573 C CG2 . ILE C 2 243 ? 4.510   -10.378 -30.438 1.00 115.72 ? 256 ILE C CG2 1 
ATOM   3574 C CD1 . ILE C 2 243 ? 4.119   -13.242 -31.574 1.00 112.13 ? 256 ILE C CD1 1 
ATOM   3575 N N   . GLN C 2 244 ? 6.236   -7.780  -31.427 1.00 125.20 ? 257 GLN C N   1 
ATOM   3576 C CA  . GLN C 2 244 ? 7.053   -6.880  -30.616 1.00 126.84 ? 257 GLN C CA  1 
ATOM   3577 C C   . GLN C 2 244 ? 6.205   -6.175  -29.561 1.00 116.66 ? 257 GLN C C   1 
ATOM   3578 O O   . GLN C 2 244 ? 5.006   -5.965  -29.750 1.00 115.31 ? 257 GLN C O   1 
ATOM   3579 C CB  . GLN C 2 244 ? 7.774   -5.848  -31.492 1.00 142.26 ? 257 GLN C CB  1 
ATOM   3580 C CG  . GLN C 2 244 ? 6.868   -5.090  -32.449 1.00 150.91 ? 257 GLN C CG  1 
ATOM   3581 C CD  . GLN C 2 244 ? 6.703   -5.798  -33.781 1.00 153.84 ? 257 GLN C CD  1 
ATOM   3582 O OE1 . GLN C 2 244 ? 7.640   -6.416  -34.287 1.00 153.51 ? 257 GLN C OE1 1 
ATOM   3583 N NE2 . GLN C 2 244 ? 5.509   -5.712  -34.355 1.00 153.68 ? 257 GLN C NE2 1 
ATOM   3584 N N   . TRP C 2 245 ? 6.840   -5.820  -28.450 1.00 110.02 ? 258 TRP C N   1 
ATOM   3585 C CA  . TRP C 2 245 ? 6.172   -5.113  -27.369 1.00 110.34 ? 258 TRP C CA  1 
ATOM   3586 C C   . TRP C 2 245 ? 7.141   -4.105  -26.771 1.00 114.68 ? 258 TRP C C   1 
ATOM   3587 O O   . TRP C 2 245 ? 8.133   -3.743  -27.408 1.00 126.40 ? 258 TRP C O   1 
ATOM   3588 C CB  . TRP C 2 245 ? 5.686   -6.091  -26.300 1.00 116.30 ? 258 TRP C CB  1 
ATOM   3589 C CG  . TRP C 2 245 ? 6.749   -7.024  -25.808 1.00 117.05 ? 258 TRP C CG  1 
ATOM   3590 C CD1 . TRP C 2 245 ? 7.519   -6.870  -24.693 1.00 117.31 ? 258 TRP C CD1 1 
ATOM   3591 C CD2 . TRP C 2 245 ? 7.166   -8.254  -26.416 1.00 113.97 ? 258 TRP C CD2 1 
ATOM   3592 N NE1 . TRP C 2 245 ? 8.389   -7.926  -24.568 1.00 118.36 ? 258 TRP C NE1 1 
ATOM   3593 C CE2 . TRP C 2 245 ? 8.192   -8.792  -25.614 1.00 116.73 ? 258 TRP C CE2 1 
ATOM   3594 C CE3 . TRP C 2 245 ? 6.772   -8.955  -27.562 1.00 110.61 ? 258 TRP C CE3 1 
ATOM   3595 C CZ2 . TRP C 2 245 ? 8.830   -9.995  -25.919 1.00 112.56 ? 258 TRP C CZ2 1 
ATOM   3596 C CZ3 . TRP C 2 245 ? 7.406   -10.150 -27.863 1.00 109.45 ? 258 TRP C CZ3 1 
ATOM   3597 C CH2 . TRP C 2 245 ? 8.423   -10.657 -27.046 1.00 109.08 ? 258 TRP C CH2 1 
ATOM   3598 N N   . GLU C 2 246 ? 6.866   -3.642  -25.557 1.00 119.35 ? 259 GLU C N   1 
ATOM   3599 C CA  . GLU C 2 246 ? 7.795   -2.733  -24.890 1.00 124.37 ? 259 GLU C CA  1 
ATOM   3600 C C   . GLU C 2 246 ? 7.902   -2.996  -23.397 1.00 122.29 ? 259 GLU C C   1 
ATOM   3601 O O   . GLU C 2 246 ? 6.902   -3.286  -22.730 1.00 118.08 ? 259 GLU C O   1 
ATOM   3602 C CB  . GLU C 2 246 ? 7.438   -1.268  -25.170 1.00 131.02 ? 259 GLU C CB  1 
ATOM   3603 C CG  . GLU C 2 246 ? 8.342   -0.632  -26.224 1.00 138.40 ? 259 GLU C CG  1 
ATOM   3604 C CD  . GLU C 2 246 ? 7.604   0.312   -27.157 1.00 144.45 ? 259 GLU C CD  1 
ATOM   3605 O OE1 . GLU C 2 246 ? 6.747   1.085   -26.679 1.00 147.18 ? 259 GLU C OE1 1 
ATOM   3606 O OE2 . GLU C 2 246 ? 7.886   0.284   -28.374 1.00 150.01 ? 259 GLU C OE2 1 
ATOM   3607 N N   . LYS C 2 247 ? 9.129   -2.898  -22.890 1.00 127.09 ? 260 LYS C N   1 
ATOM   3608 C CA  . LYS C 2 247 ? 9.404   -3.141  -21.481 1.00 128.92 ? 260 LYS C CA  1 
ATOM   3609 C C   . LYS C 2 247 ? 8.555   -2.231  -20.597 1.00 127.39 ? 260 LYS C C   1 
ATOM   3610 O O   . LYS C 2 247 ? 8.733   -1.013  -20.598 1.00 140.31 ? 260 LYS C O   1 
ATOM   3611 C CB  . LYS C 2 247 ? 10.902  -2.992  -21.186 1.00 141.69 ? 260 LYS C CB  1 
ATOM   3612 C CG  . LYS C 2 247 ? 11.787  -3.615  -22.283 1.00 155.63 ? 260 LYS C CG  1 
ATOM   3613 C CD  . LYS C 2 247 ? 12.565  -4.830  -21.793 1.00 156.74 ? 260 LYS C CD  1 
ATOM   3614 C CE  . LYS C 2 247 ? 13.152  -5.623  -22.943 1.00 160.23 ? 260 LYS C CE  1 
ATOM   3615 N NZ  . LYS C 2 247 ? 13.916  -6.819  -22.498 1.00 159.83 ? 260 LYS C NZ  1 
ATOM   3616 N N   . PRO C 2 248 ? 7.624   -2.838  -19.840 1.00 120.90 ? 261 PRO C N   1 
ATOM   3617 C CA  . PRO C 2 248 ? 6.537   -2.167  -19.114 1.00 120.60 ? 261 PRO C CA  1 
ATOM   3618 C C   . PRO C 2 248 ? 6.954   -0.978  -18.249 1.00 117.37 ? 261 PRO C C   1 
ATOM   3619 O O   . PRO C 2 248 ? 8.132   -0.811  -17.920 1.00 102.79 ? 261 PRO C O   1 
ATOM   3620 C CB  . PRO C 2 248 ? 5.952   -3.287  -18.237 1.00 113.41 ? 261 PRO C CB  1 
ATOM   3621 C CG  . PRO C 2 248 ? 6.989   -4.368  -18.218 1.00 109.54 ? 261 PRO C CG  1 
ATOM   3622 C CD  . PRO C 2 248 ? 7.648   -4.283  -19.556 1.00 115.41 ? 261 PRO C CD  1 
ATOM   3623 N N   . VAL C 2 249 ? 5.966   -0.157  -17.899 1.00 118.63 ? 262 VAL C N   1 
ATOM   3624 C CA  . VAL C 2 249 ? 6.178   1.007   -17.049 1.00 114.59 ? 262 VAL C CA  1 
ATOM   3625 C C   . VAL C 2 249 ? 6.713   0.581   -15.689 1.00 108.35 ? 262 VAL C C   1 
ATOM   3626 O O   . VAL C 2 249 ? 5.950   0.298   -14.763 1.00 104.94 ? 262 VAL C O   1 
ATOM   3627 C CB  . VAL C 2 249 ? 4.878   1.818   -16.854 1.00 116.97 ? 262 VAL C CB  1 
ATOM   3628 C CG1 . VAL C 2 249 ? 5.169   3.103   -16.101 1.00 100.18 ? 262 VAL C CG1 1 
ATOM   3629 C CG2 . VAL C 2 249 ? 4.238   2.129   -18.201 1.00 100.93 ? 262 VAL C CG2 1 
ATOM   3630 N N   . SER C 2 250 ? 8.036   0.522   -15.591 1.00 112.00 ? 263 SER C N   1 
ATOM   3631 C CA  . SER C 2 250 ? 8.716   0.218   -14.342 1.00 110.67 ? 263 SER C CA  1 
ATOM   3632 C C   . SER C 2 250 ? 10.057  0.933   -14.333 1.00 112.02 ? 263 SER C C   1 
ATOM   3633 O O   . SER C 2 250 ? 10.549  1.356   -15.380 1.00 112.96 ? 263 SER C O   1 
ATOM   3634 C CB  . SER C 2 250 ? 8.931   -1.289  -14.194 1.00 112.25 ? 263 SER C CB  1 
ATOM   3635 O OG  . SER C 2 250 ? 9.996   -1.731  -15.017 1.00 115.70 ? 263 SER C OG  1 
ATOM   3636 N N   . ALA C 2 251 ? 10.653  1.067   -13.155 1.00 110.32 ? 264 ALA C N   1 
ATOM   3637 C CA  . ALA C 2 251 ? 11.949  1.721   -13.055 1.00 107.68 ? 264 ALA C CA  1 
ATOM   3638 C C   . ALA C 2 251 ? 13.074  0.787   -13.481 1.00 101.19 ? 264 ALA C C   1 
ATOM   3639 O O   . ALA C 2 251 ? 14.172  1.237   -13.806 1.00 108.07 ? 264 ALA C O   1 
ATOM   3640 C CB  . ALA C 2 251 ? 12.181  2.229   -11.653 1.00 110.68 ? 264 ALA C CB  1 
ATOM   3641 N N   . PHE C 2 252 ? 12.795  -0.512  -13.472 1.00 98.75  ? 265 PHE C N   1 
ATOM   3642 C CA  . PHE C 2 252 ? 13.758  -1.504  -13.932 1.00 95.20  ? 265 PHE C CA  1 
ATOM   3643 C C   . PHE C 2 252 ? 14.052  -1.306  -15.416 1.00 106.30 ? 265 PHE C C   1 
ATOM   3644 O O   . PHE C 2 252 ? 13.144  -1.005  -16.192 1.00 94.10  ? 265 PHE C O   1 
ATOM   3645 C CB  . PHE C 2 252 ? 13.253  -2.919  -13.647 1.00 90.47  ? 265 PHE C CB  1 
ATOM   3646 C CG  . PHE C 2 252 ? 13.527  -3.380  -12.245 1.00 93.83  ? 265 PHE C CG  1 
ATOM   3647 C CD1 . PHE C 2 252 ? 14.726  -4.001  -11.931 1.00 90.01  ? 265 PHE C CD1 1 
ATOM   3648 C CD2 . PHE C 2 252 ? 12.597  -3.178  -11.237 1.00 88.61  ? 265 PHE C CD2 1 
ATOM   3649 C CE1 . PHE C 2 252 ? 14.989  -4.420  -10.641 1.00 82.19  ? 265 PHE C CE1 1 
ATOM   3650 C CE2 . PHE C 2 252 ? 12.855  -3.594  -9.945  1.00 83.91  ? 265 PHE C CE2 1 
ATOM   3651 C CZ  . PHE C 2 252 ? 14.052  -4.215  -9.647  1.00 86.48  ? 265 PHE C CZ  1 
ATOM   3652 N N   . PRO C 2 253 ? 15.331  -1.465  -15.805 1.00 111.07 ? 266 PRO C N   1 
ATOM   3653 C CA  . PRO C 2 253 ? 15.865  -1.175  -17.144 1.00 117.76 ? 266 PRO C CA  1 
ATOM   3654 C C   . PRO C 2 253 ? 15.252  -2.004  -18.272 1.00 127.23 ? 266 PRO C C   1 
ATOM   3655 O O   . PRO C 2 253 ? 14.054  -1.908  -18.531 1.00 133.08 ? 266 PRO C O   1 
ATOM   3656 C CB  . PRO C 2 253 ? 17.358  -1.502  -17.006 1.00 109.94 ? 266 PRO C CB  1 
ATOM   3657 C CG  . PRO C 2 253 ? 17.454  -2.394  -15.819 1.00 103.28 ? 266 PRO C CG  1 
ATOM   3658 C CD  . PRO C 2 253 ? 16.389  -1.923  -14.889 1.00 103.31 ? 266 PRO C CD  1 
ATOM   3659 N N   . ILE C 2 254 ? 16.078  -2.795  -18.949 1.00 129.58 ? 267 ILE C N   1 
ATOM   3660 C CA  . ILE C 2 254 ? 15.625  -3.566  -20.102 1.00 126.94 ? 267 ILE C CA  1 
ATOM   3661 C C   . ILE C 2 254 ? 16.193  -4.981  -20.067 1.00 128.53 ? 267 ILE C C   1 
ATOM   3662 O O   . ILE C 2 254 ? 15.509  -5.950  -20.401 1.00 129.96 ? 267 ILE C O   1 
ATOM   3663 C CB  . ILE C 2 254 ? 15.978  -2.852  -21.434 1.00 122.66 ? 267 ILE C CB  1 
ATOM   3664 C CG1 . ILE C 2 254 ? 14.835  -1.920  -21.847 1.00 124.77 ? 267 ILE C CG1 1 
ATOM   3665 C CG2 . ILE C 2 254 ? 16.282  -3.854  -22.539 1.00 126.88 ? 267 ILE C CG2 1 
ATOM   3666 C CD1 . ILE C 2 254 ? 14.889  -1.461  -23.291 1.00 121.37 ? 267 ILE C CD1 1 
ATOM   3667 N N   . HIS C 2 255 ? 17.441  -5.094  -19.625 1.00 96.57  ? 268 HIS C N   1 
ATOM   3668 C CA  . HIS C 2 255 ? 18.109  -6.385  -19.512 1.00 99.66  ? 268 HIS C CA  1 
ATOM   3669 C C   . HIS C 2 255 ? 17.680  -7.146  -18.256 1.00 101.89 ? 268 HIS C C   1 
ATOM   3670 O O   . HIS C 2 255 ? 18.362  -8.079  -17.832 1.00 102.28 ? 268 HIS C O   1 
ATOM   3671 C CB  . HIS C 2 255 ? 19.621  -6.181  -19.477 1.00 97.26  ? 268 HIS C CB  1 
ATOM   3672 C CG  . HIS C 2 255 ? 20.087  -5.379  -18.297 1.00 107.70 ? 268 HIS C CG  1 
ATOM   3673 N ND1 . HIS C 2 255 ? 19.975  -4.014  -18.238 1.00 106.60 ? 268 HIS C ND1 1 
ATOM   3674 C CD2 . HIS C 2 255 ? 20.659  -5.771  -17.132 1.00 105.39 ? 268 HIS C CD2 1 
ATOM   3675 C CE1 . HIS C 2 255 ? 20.463  -3.584  -17.081 1.00 105.90 ? 268 HIS C CE1 1 
ATOM   3676 N NE2 . HIS C 2 255 ? 20.880  -4.628  -16.397 1.00 111.10 ? 268 HIS C NE2 1 
ATOM   3677 N N   . CYS C 2 256 ? 16.552  -6.755  -17.670 1.00 88.74  ? 269 CYS C N   1 
ATOM   3678 C CA  . CYS C 2 256 ? 16.117  -7.329  -16.402 1.00 91.64  ? 269 CYS C CA  1 
ATOM   3679 C C   . CYS C 2 256 ? 14.672  -7.825  -16.420 1.00 94.16  ? 269 CYS C C   1 
ATOM   3680 O O   . CYS C 2 256 ? 14.042  -7.948  -15.369 1.00 88.49  ? 269 CYS C O   1 
ATOM   3681 C CB  . CYS C 2 256 ? 16.295  -6.310  -15.273 1.00 89.25  ? 269 CYS C CB  1 
ATOM   3682 S SG  . CYS C 2 256 ? 18.008  -5.833  -14.947 1.00 104.28 ? 269 CYS C SG  1 
ATOM   3683 N N   . PHE C 2 257 ? 14.146  -8.120  -17.605 1.00 100.03 ? 270 PHE C N   1 
ATOM   3684 C CA  . PHE C 2 257 ? 12.755  -8.556  -17.713 1.00 100.03 ? 270 PHE C CA  1 
ATOM   3685 C C   . PHE C 2 257 ? 12.571  -9.954  -18.295 1.00 104.61 ? 270 PHE C C   1 
ATOM   3686 O O   . PHE C 2 257 ? 13.176  -10.300 -19.308 1.00 113.91 ? 270 PHE C O   1 
ATOM   3687 C CB  . PHE C 2 257 ? 11.934  -7.548  -18.519 1.00 101.38 ? 270 PHE C CB  1 
ATOM   3688 C CG  . PHE C 2 257 ? 11.280  -6.494  -17.679 1.00 106.67 ? 270 PHE C CG  1 
ATOM   3689 C CD1 . PHE C 2 257 ? 11.805  -5.214  -17.612 1.00 106.32 ? 270 PHE C CD1 1 
ATOM   3690 C CD2 . PHE C 2 257 ? 10.141  -6.787  -16.948 1.00 113.71 ? 270 PHE C CD2 1 
ATOM   3691 C CE1 . PHE C 2 257 ? 11.201  -4.246  -16.836 1.00 112.92 ? 270 PHE C CE1 1 
ATOM   3692 C CE2 . PHE C 2 257 ? 9.535   -5.824  -16.171 1.00 115.66 ? 270 PHE C CE2 1 
ATOM   3693 C CZ  . PHE C 2 257 ? 10.064  -4.553  -16.115 1.00 117.74 ? 270 PHE C CZ  1 
ATOM   3694 N N   . ASP C 2 258 ? 11.725  -10.748 -17.644 1.00 102.38 ? 271 ASP C N   1 
ATOM   3695 C CA  . ASP C 2 258 ? 11.313  -12.042 -18.177 1.00 97.90  ? 271 ASP C CA  1 
ATOM   3696 C C   . ASP C 2 258 ? 9.975   -11.907 -18.890 1.00 92.59  ? 271 ASP C C   1 
ATOM   3697 O O   . ASP C 2 258 ? 9.037   -11.319 -18.353 1.00 94.10  ? 271 ASP C O   1 
ATOM   3698 C CB  . ASP C 2 258 ? 11.196  -13.077 -17.057 1.00 98.31  ? 271 ASP C CB  1 
ATOM   3699 C CG  . ASP C 2 258 ? 12.527  -13.701 -16.701 1.00 103.33 ? 271 ASP C CG  1 
ATOM   3700 O OD1 . ASP C 2 258 ? 13.421  -13.716 -17.570 1.00 105.87 ? 271 ASP C OD1 1 
ATOM   3701 O OD2 . ASP C 2 258 ? 12.676  -14.186 -15.559 1.00 105.75 ? 271 ASP C OD2 1 
ATOM   3702 N N   . TYR C 2 259 ? 9.888   -12.450 -20.100 1.00 90.41  ? 272 TYR C N   1 
ATOM   3703 C CA  . TYR C 2 259 ? 8.650   -12.386 -20.868 1.00 84.12  ? 272 TYR C CA  1 
ATOM   3704 C C   . TYR C 2 259 ? 8.152   -13.761 -21.262 1.00 84.69  ? 272 TYR C C   1 
ATOM   3705 O O   . TYR C 2 259 ? 8.939   -14.655 -21.564 1.00 91.39  ? 272 TYR C O   1 
ATOM   3706 C CB  . TYR C 2 259 ? 8.830   -11.547 -22.134 1.00 92.20  ? 272 TYR C CB  1 
ATOM   3707 C CG  . TYR C 2 259 ? 9.123   -10.101 -21.859 1.00 85.61  ? 272 TYR C CG  1 
ATOM   3708 C CD1 . TYR C 2 259 ? 8.132   -9.257  -21.381 1.00 100.52 ? 272 TYR C CD1 1 
ATOM   3709 C CD2 . TYR C 2 259 ? 10.389  -9.579  -22.072 1.00 87.57  ? 272 TYR C CD2 1 
ATOM   3710 C CE1 . TYR C 2 259 ? 8.393   -7.935  -21.120 1.00 105.56 ? 272 TYR C CE1 1 
ATOM   3711 C CE2 . TYR C 2 259 ? 10.661  -8.257  -21.815 1.00 108.72 ? 272 TYR C CE2 1 
ATOM   3712 C CZ  . TYR C 2 259 ? 9.658   -7.440  -21.339 1.00 108.42 ? 272 TYR C CZ  1 
ATOM   3713 O OH  . TYR C 2 259 ? 9.914   -6.122  -21.076 1.00 100.05 ? 272 TYR C OH  1 
ATOM   3714 N N   . GLU C 2 260 ? 6.835   -13.917 -21.255 1.00 87.60  ? 273 GLU C N   1 
ATOM   3715 C CA  . GLU C 2 260 ? 6.195   -15.063 -21.875 1.00 89.28  ? 273 GLU C CA  1 
ATOM   3716 C C   . GLU C 2 260 ? 5.305   -14.556 -22.999 1.00 94.01  ? 273 GLU C C   1 
ATOM   3717 O O   . GLU C 2 260 ? 4.475   -13.668 -22.796 1.00 100.33 ? 273 GLU C O   1 
ATOM   3718 C CB  . GLU C 2 260 ? 5.375   -15.861 -20.860 1.00 81.85  ? 273 GLU C CB  1 
ATOM   3719 C CG  . GLU C 2 260 ? 6.207   -16.727 -19.926 1.00 93.21  ? 273 GLU C CG  1 
ATOM   3720 C CD  . GLU C 2 260 ? 5.354   -17.599 -19.023 1.00 102.24 ? 273 GLU C CD  1 
ATOM   3721 O OE1 . GLU C 2 260 ? 4.147   -17.310 -18.880 1.00 103.55 ? 273 GLU C OE1 1 
ATOM   3722 O OE2 . GLU C 2 260 ? 5.889   -18.577 -18.458 1.00 101.66 ? 273 GLU C OE2 1 
ATOM   3723 N N   . VAL C 2 261 ? 5.499   -15.110 -24.190 1.00 90.61  ? 274 VAL C N   1 
ATOM   3724 C CA  . VAL C 2 261 ? 4.679   -14.757 -25.340 1.00 96.62  ? 274 VAL C CA  1 
ATOM   3725 C C   . VAL C 2 261 ? 3.869   -15.969 -25.805 1.00 97.83  ? 274 VAL C C   1 
ATOM   3726 O O   . VAL C 2 261 ? 4.427   -17.022 -26.118 1.00 93.71  ? 274 VAL C O   1 
ATOM   3727 C CB  . VAL C 2 261 ? 5.527   -14.167 -26.490 1.00 95.93  ? 274 VAL C CB  1 
ATOM   3728 C CG1 . VAL C 2 261 ? 6.725   -15.057 -26.800 1.00 95.16  ? 274 VAL C CG1 1 
ATOM   3729 C CG2 . VAL C 2 261 ? 4.671   -13.943 -27.723 1.00 99.77  ? 274 VAL C CG2 1 
ATOM   3730 N N   . LYS C 2 262 ? 2.549   -15.814 -25.828 1.00 100.95 ? 275 LYS C N   1 
ATOM   3731 C CA  . LYS C 2 262 ? 1.645   -16.925 -26.106 1.00 98.66  ? 275 LYS C CA  1 
ATOM   3732 C C   . LYS C 2 262 ? 0.993   -16.806 -27.478 1.00 100.08 ? 275 LYS C C   1 
ATOM   3733 O O   . LYS C 2 262 ? 0.195   -15.899 -27.723 1.00 90.86  ? 275 LYS C O   1 
ATOM   3734 C CB  . LYS C 2 262 ? 0.565   -17.003 -25.025 1.00 94.00  ? 275 LYS C CB  1 
ATOM   3735 C CG  . LYS C 2 262 ? -0.408  -18.160 -25.181 1.00 97.54  ? 275 LYS C CG  1 
ATOM   3736 C CD  . LYS C 2 262 ? -1.813  -17.743 -24.773 1.00 105.23 ? 275 LYS C CD  1 
ATOM   3737 C CE  . LYS C 2 262 ? -1.838  -17.131 -23.381 1.00 104.10 ? 275 LYS C CE  1 
ATOM   3738 N NZ  . LYS C 2 262 ? -3.206  -16.666 -23.009 1.00 108.62 ? 275 LYS C NZ  1 
ATOM   3739 N N   . ILE C 2 263 ? 1.328   -17.734 -28.367 1.00 101.24 ? 276 ILE C N   1 
ATOM   3740 C CA  . ILE C 2 263 ? 0.738   -17.760 -29.696 1.00 107.02 ? 276 ILE C CA  1 
ATOM   3741 C C   . ILE C 2 263 ? -0.323  -18.852 -29.768 1.00 103.56 ? 276 ILE C C   1 
ATOM   3742 O O   . ILE C 2 263 ? -0.006  -20.039 -29.700 1.00 101.28 ? 276 ILE C O   1 
ATOM   3743 C CB  . ILE C 2 263 ? 1.803   -18.019 -30.770 1.00 112.66 ? 276 ILE C CB  1 
ATOM   3744 C CG1 . ILE C 2 263 ? 3.164   -17.489 -30.307 1.00 115.17 ? 276 ILE C CG1 1 
ATOM   3745 C CG2 . ILE C 2 263 ? 1.387   -17.384 -32.084 1.00 108.53 ? 276 ILE C CG2 1 
ATOM   3746 C CD1 . ILE C 2 263 ? 4.294   -17.767 -31.276 1.00 119.34 ? 276 ILE C CD1 1 
ATOM   3747 N N   . HIS C 2 264 ? -1.583  -18.449 -29.904 1.00 106.58 ? 277 HIS C N   1 
ATOM   3748 C CA  . HIS C 2 264 ? -2.687  -19.404 -29.907 1.00 111.55 ? 277 HIS C CA  1 
ATOM   3749 C C   . HIS C 2 264 ? -3.338  -19.537 -31.278 1.00 120.41 ? 277 HIS C C   1 
ATOM   3750 O O   . HIS C 2 264 ? -3.826  -18.558 -31.844 1.00 121.13 ? 277 HIS C O   1 
ATOM   3751 C CB  . HIS C 2 264 ? -3.740  -19.013 -28.865 1.00 110.41 ? 277 HIS C CB  1 
ATOM   3752 C CG  . HIS C 2 264 ? -4.941  -19.905 -28.853 1.00 115.77 ? 277 HIS C CG  1 
ATOM   3753 N ND1 . HIS C 2 264 ? -6.226  -19.430 -29.023 1.00 123.04 ? 277 HIS C ND1 1 
ATOM   3754 C CD2 . HIS C 2 264 ? -5.057  -21.245 -28.693 1.00 118.88 ? 277 HIS C CD2 1 
ATOM   3755 C CE1 . HIS C 2 264 ? -7.077  -20.437 -28.967 1.00 124.98 ? 277 HIS C CE1 1 
ATOM   3756 N NE2 . HIS C 2 264 ? -6.393  -21.551 -28.767 1.00 124.43 ? 277 HIS C NE2 1 
ATOM   3757 N N   . ASN C 2 265 ? -3.342  -20.755 -31.806 1.00 121.90 ? 278 ASN C N   1 
ATOM   3758 C CA  . ASN C 2 265 ? -4.027  -21.045 -33.055 1.00 124.71 ? 278 ASN C CA  1 
ATOM   3759 C C   . ASN C 2 265 ? -5.531  -21.103 -32.808 1.00 123.95 ? 278 ASN C C   1 
ATOM   3760 O O   . ASN C 2 265 ? -6.024  -22.042 -32.187 1.00 122.39 ? 278 ASN C O   1 
ATOM   3761 C CB  . ASN C 2 265 ? -3.530  -22.371 -33.632 1.00 104.13 ? 278 ASN C CB  1 
ATOM   3762 C CG  . ASN C 2 265 ? -3.816  -22.510 -35.115 1.00 117.46 ? 278 ASN C CG  1 
ATOM   3763 O OD1 . ASN C 2 265 ? -4.875  -22.112 -35.597 1.00 117.60 ? 278 ASN C OD1 1 
ATOM   3764 N ND2 . ASN C 2 265 ? -2.864  -23.077 -35.847 1.00 110.76 ? 278 ASN C ND2 1 
ATOM   3765 N N   . THR C 2 266 ? -6.256  -20.096 -33.287 1.00 126.95 ? 279 THR C N   1 
ATOM   3766 C CA  . THR C 2 266 ? -7.694  -20.009 -33.039 1.00 127.64 ? 279 THR C CA  1 
ATOM   3767 C C   . THR C 2 266 ? -8.479  -21.087 -33.784 1.00 130.93 ? 279 THR C C   1 
ATOM   3768 O O   . THR C 2 266 ? -9.661  -21.298 -33.512 1.00 130.16 ? 279 THR C O   1 
ATOM   3769 C CB  . THR C 2 266 ? -8.263  -18.622 -33.421 1.00 129.70 ? 279 THR C CB  1 
ATOM   3770 O OG1 . THR C 2 266 ? -8.109  -18.408 -34.829 1.00 133.10 ? 279 THR C OG1 1 
ATOM   3771 C CG2 . THR C 2 266 ? -7.551  -17.509 -32.659 1.00 125.10 ? 279 THR C CG2 1 
ATOM   3772 N N   . ARG C 2 267 ? -7.818  -21.764 -34.719 1.00 135.23 ? 280 ARG C N   1 
ATOM   3773 C CA  . ARG C 2 267 ? -8.464  -22.797 -35.524 1.00 138.45 ? 280 ARG C CA  1 
ATOM   3774 C C   . ARG C 2 267 ? -8.545  -24.126 -34.778 1.00 134.25 ? 280 ARG C C   1 
ATOM   3775 O O   . ARG C 2 267 ? -9.622  -24.543 -34.349 1.00 136.95 ? 280 ARG C O   1 
ATOM   3776 C CB  . ARG C 2 267 ? -7.719  -22.988 -36.848 1.00 143.84 ? 280 ARG C CB  1 
ATOM   3777 C CG  . ARG C 2 267 ? -8.421  -23.906 -37.840 1.00 149.33 ? 280 ARG C CG  1 
ATOM   3778 C CD  . ARG C 2 267 ? -7.528  -24.207 -39.035 1.00 151.45 ? 280 ARG C CD  1 
ATOM   3779 N NE  . ARG C 2 267 ? -6.755  -25.433 -38.852 1.00 151.05 ? 280 ARG C NE  1 
ATOM   3780 C CZ  . ARG C 2 267 ? -5.568  -25.658 -39.407 1.00 151.10 ? 280 ARG C CZ  1 
ATOM   3781 N NH1 . ARG C 2 267 ? -5.006  -24.732 -40.173 1.00 159.19 ? 280 ARG C NH1 1 
ATOM   3782 N NH2 . ARG C 2 267 ? -4.939  -26.805 -39.189 1.00 144.60 ? 280 ARG C NH2 1 
ATOM   3783 N N   . ASN C 2 268 ? -7.402  -24.787 -34.625 1.00 126.94 ? 281 ASN C N   1 
ATOM   3784 C CA  . ASN C 2 268 ? -7.362  -26.101 -33.989 1.00 120.93 ? 281 ASN C CA  1 
ATOM   3785 C C   . ASN C 2 268 ? -6.975  -26.067 -32.510 1.00 113.94 ? 281 ASN C C   1 
ATOM   3786 O O   . ASN C 2 268 ? -7.177  -27.045 -31.789 1.00 109.61 ? 281 ASN C O   1 
ATOM   3787 C CB  . ASN C 2 268 ? -6.433  -27.047 -34.758 1.00 120.22 ? 281 ASN C CB  1 
ATOM   3788 C CG  . ASN C 2 268 ? -5.030  -26.489 -34.921 1.00 115.97 ? 281 ASN C CG  1 
ATOM   3789 O OD1 . ASN C 2 268 ? -4.704  -25.426 -34.393 1.00 111.08 ? 281 ASN C OD1 1 
ATOM   3790 N ND2 . ASN C 2 268 ? -4.192  -27.208 -35.659 1.00 116.57 ? 281 ASN C ND2 1 
ATOM   3791 N N   . GLY C 2 269 ? -6.414  -24.948 -32.065 1.00 115.22 ? 282 GLY C N   1 
ATOM   3792 C CA  . GLY C 2 269 ? -6.049  -24.792 -30.668 1.00 109.51 ? 282 GLY C CA  1 
ATOM   3793 C C   . GLY C 2 269 ? -4.597  -25.106 -30.363 1.00 109.51 ? 282 GLY C C   1 
ATOM   3794 O O   . GLY C 2 269 ? -4.230  -25.277 -29.200 1.00 111.31 ? 282 GLY C O   1 
ATOM   3795 N N   . TYR C 2 270 ? -3.773  -25.186 -31.404 1.00 112.98 ? 283 TYR C N   1 
ATOM   3796 C CA  . TYR C 2 270 ? -2.345  -25.440 -31.232 1.00 104.97 ? 283 TYR C CA  1 
ATOM   3797 C C   . TYR C 2 270 ? -1.717  -24.305 -30.426 1.00 100.05 ? 283 TYR C C   1 
ATOM   3798 O O   . TYR C 2 270 ? -1.981  -23.132 -30.690 1.00 94.47  ? 283 TYR C O   1 
ATOM   3799 C CB  . TYR C 2 270 ? -1.653  -25.586 -32.591 1.00 99.20  ? 283 TYR C CB  1 
ATOM   3800 C CG  . TYR C 2 270 ? -0.272  -26.200 -32.511 1.00 104.15 ? 283 TYR C CG  1 
ATOM   3801 C CD1 . TYR C 2 270 ? 0.863   -25.404 -32.434 1.00 103.41 ? 283 TYR C CD1 1 
ATOM   3802 C CD2 . TYR C 2 270 ? -0.105  -27.578 -32.506 1.00 98.36  ? 283 TYR C CD2 1 
ATOM   3803 C CE1 . TYR C 2 270 ? 2.126   -25.964 -32.358 1.00 99.51  ? 283 TYR C CE1 1 
ATOM   3804 C CE2 . TYR C 2 270 ? 1.150   -28.146 -32.430 1.00 98.01  ? 283 TYR C CE2 1 
ATOM   3805 C CZ  . TYR C 2 270 ? 2.262   -27.337 -32.357 1.00 100.79 ? 283 TYR C CZ  1 
ATOM   3806 O OH  . TYR C 2 270 ? 3.512   -27.907 -32.282 1.00 99.59  ? 283 TYR C OH  1 
ATOM   3807 N N   . LEU C 2 271 ? -0.897  -24.654 -29.439 1.00 90.13  ? 284 LEU C N   1 
ATOM   3808 C CA  . LEU C 2 271 ? -0.383  -23.659 -28.502 1.00 92.80  ? 284 LEU C CA  1 
ATOM   3809 C C   . LEU C 2 271 ? 1.141   -23.644 -28.397 1.00 92.46  ? 284 LEU C C   1 
ATOM   3810 O O   . LEU C 2 271 ? 1.783   -24.693 -28.321 1.00 86.68  ? 284 LEU C O   1 
ATOM   3811 C CB  . LEU C 2 271 ? -0.999  -23.873 -27.115 1.00 90.87  ? 284 LEU C CB  1 
ATOM   3812 C CG  . LEU C 2 271 ? -0.800  -22.746 -26.095 1.00 94.93  ? 284 LEU C CG  1 
ATOM   3813 C CD1 . LEU C 2 271 ? -1.464  -21.477 -26.594 1.00 103.24 ? 284 LEU C CD1 1 
ATOM   3814 C CD2 . LEU C 2 271 ? -1.351  -23.137 -24.734 1.00 85.39  ? 284 LEU C CD2 1 
ATOM   3815 N N   . GLN C 2 272 ? 1.708   -22.441 -28.389 1.00 94.92  ? 285 GLN C N   1 
ATOM   3816 C CA  . GLN C 2 272 ? 3.146   -22.257 -28.230 1.00 101.04 ? 285 GLN C CA  1 
ATOM   3817 C C   . GLN C 2 272 ? 3.447   -21.063 -27.328 1.00 98.17  ? 285 GLN C C   1 
ATOM   3818 O O   . GLN C 2 272 ? 3.060   -19.932 -27.628 1.00 101.69 ? 285 GLN C O   1 
ATOM   3819 C CB  . GLN C 2 272 ? 3.822   -22.068 -29.591 1.00 112.88 ? 285 GLN C CB  1 
ATOM   3820 C CG  . GLN C 2 272 ? 5.303   -21.726 -29.509 1.00 122.25 ? 285 GLN C CG  1 
ATOM   3821 C CD  . GLN C 2 272 ? 5.915   -21.435 -30.869 1.00 139.29 ? 285 GLN C CD  1 
ATOM   3822 O OE1 . GLN C 2 272 ? 5.208   -21.340 -31.874 1.00 143.15 ? 285 GLN C OE1 1 
ATOM   3823 N NE2 . GLN C 2 272 ? 7.236   -21.293 -30.906 1.00 144.44 ? 285 GLN C NE2 1 
ATOM   3824 N N   . ILE C 2 273 ? 4.130   -21.321 -26.218 1.00 82.80  ? 286 ILE C N   1 
ATOM   3825 C CA  . ILE C 2 273 ? 4.528   -20.260 -25.302 1.00 89.34  ? 286 ILE C CA  1 
ATOM   3826 C C   . ILE C 2 273 ? 6.041   -20.252 -25.138 1.00 92.39  ? 286 ILE C C   1 
ATOM   3827 O O   . ILE C 2 273 ? 6.647   -21.290 -24.886 1.00 91.34  ? 286 ILE C O   1 
ATOM   3828 C CB  . ILE C 2 273 ? 3.882   -20.437 -23.916 1.00 80.24  ? 286 ILE C CB  1 
ATOM   3829 C CG1 . ILE C 2 273 ? 2.361   -20.504 -24.043 1.00 84.63  ? 286 ILE C CG1 1 
ATOM   3830 C CG2 . ILE C 2 273 ? 4.285   -19.301 -22.990 1.00 76.64  ? 286 ILE C CG2 1 
ATOM   3831 C CD1 . ILE C 2 273 ? 1.656   -20.706 -22.723 1.00 75.29  ? 286 ILE C CD1 1 
ATOM   3832 N N   . GLU C 2 274 ? 6.646   -19.080 -25.292 1.00 96.81  ? 287 GLU C N   1 
ATOM   3833 C CA  . GLU C 2 274 ? 8.085   -18.934 -25.118 1.00 111.02 ? 287 GLU C CA  1 
ATOM   3834 C C   . GLU C 2 274 ? 8.410   -18.005 -23.960 1.00 98.77  ? 287 GLU C C   1 
ATOM   3835 O O   . GLU C 2 274 ? 8.005   -16.842 -23.955 1.00 87.39  ? 287 GLU C O   1 
ATOM   3836 C CB  . GLU C 2 274 ? 8.728   -18.398 -26.400 1.00 130.55 ? 287 GLU C CB  1 
ATOM   3837 C CG  . GLU C 2 274 ? 9.228   -19.473 -27.350 1.00 145.56 ? 287 GLU C CG  1 
ATOM   3838 C CD  . GLU C 2 274 ? 10.550  -20.073 -26.909 1.00 151.50 ? 287 GLU C CD  1 
ATOM   3839 O OE1 . GLU C 2 274 ? 11.183  -19.511 -25.989 1.00 148.92 ? 287 GLU C OE1 1 
ATOM   3840 O OE2 . GLU C 2 274 ? 10.958  -21.104 -27.484 1.00 156.94 ? 287 GLU C OE2 1 
ATOM   3841 N N   . LYS C 2 275 ? 9.138   -18.517 -22.974 1.00 101.25 ? 288 LYS C N   1 
ATOM   3842 C CA  . LYS C 2 275 ? 9.650   -17.658 -21.919 1.00 103.41 ? 288 LYS C CA  1 
ATOM   3843 C C   . LYS C 2 275 ? 10.989  -17.077 -22.366 1.00 100.17 ? 288 LYS C C   1 
ATOM   3844 O O   . LYS C 2 275 ? 11.955  -17.810 -22.575 1.00 104.00 ? 288 LYS C O   1 
ATOM   3845 C CB  . LYS C 2 275 ? 9.798   -18.412 -20.597 1.00 107.44 ? 288 LYS C CB  1 
ATOM   3846 C CG  . LYS C 2 275 ? 9.990   -17.484 -19.406 1.00 116.20 ? 288 LYS C CG  1 
ATOM   3847 C CD  . LYS C 2 275 ? 10.312  -18.238 -18.128 1.00 114.93 ? 288 LYS C CD  1 
ATOM   3848 C CE  . LYS C 2 275 ? 10.432  -17.279 -16.953 1.00 113.36 ? 288 LYS C CE  1 
ATOM   3849 N NZ  . LYS C 2 275 ? 10.943  -17.948 -15.727 1.00 110.16 ? 288 LYS C NZ  1 
ATOM   3850 N N   . LEU C 2 276 ? 11.037  -15.758 -22.523 1.00 96.32  ? 289 LEU C N   1 
ATOM   3851 C CA  . LEU C 2 276 ? 12.221  -15.100 -23.062 1.00 105.42 ? 289 LEU C CA  1 
ATOM   3852 C C   . LEU C 2 276 ? 12.493  -13.763 -22.375 1.00 103.93 ? 289 LEU C C   1 
ATOM   3853 O O   . LEU C 2 276 ? 11.702  -13.312 -21.547 1.00 100.10 ? 289 LEU C O   1 
ATOM   3854 C CB  . LEU C 2 276 ? 12.093  -14.912 -24.582 1.00 110.61 ? 289 LEU C CB  1 
ATOM   3855 C CG  . LEU C 2 276 ? 11.173  -13.823 -25.151 1.00 118.63 ? 289 LEU C CG  1 
ATOM   3856 C CD1 . LEU C 2 276 ? 11.334  -13.740 -26.660 1.00 124.97 ? 289 LEU C CD1 1 
ATOM   3857 C CD2 . LEU C 2 276 ? 9.711   -14.053 -24.797 1.00 118.32 ? 289 LEU C CD2 1 
ATOM   3858 N N   . MET C 2 277 ? 13.620  -13.142 -22.717 1.00 108.23 ? 290 MET C N   1 
ATOM   3859 C CA  . MET C 2 277 ? 13.988  -11.842 -22.158 1.00 107.30 ? 290 MET C CA  1 
ATOM   3860 C C   . MET C 2 277 ? 14.072  -10.761 -23.232 1.00 113.44 ? 290 MET C C   1 
ATOM   3861 O O   . MET C 2 277 ? 13.969  -9.572  -22.932 1.00 120.89 ? 290 MET C O   1 
ATOM   3862 C CB  . MET C 2 277 ? 15.315  -11.929 -21.398 1.00 103.94 ? 290 MET C CB  1 
ATOM   3863 C CG  . MET C 2 277 ? 15.229  -12.699 -20.086 1.00 104.67 ? 290 MET C CG  1 
ATOM   3864 S SD  . MET C 2 277 ? 16.698  -12.527 -19.053 1.00 107.69 ? 290 MET C SD  1 
ATOM   3865 C CE  . MET C 2 277 ? 17.898  -13.429 -20.026 1.00 156.31 ? 290 MET C CE  1 
ATOM   3866 N N   . THR C 2 278 ? 14.263  -11.177 -24.481 1.00 116.48 ? 291 THR C N   1 
ATOM   3867 C CA  . THR C 2 278 ? 14.321  -10.235 -25.595 1.00 119.26 ? 291 THR C CA  1 
ATOM   3868 C C   . THR C 2 278 ? 12.948  -9.609  -25.832 1.00 119.52 ? 291 THR C C   1 
ATOM   3869 O O   . THR C 2 278 ? 11.930  -10.144 -25.393 1.00 113.98 ? 291 THR C O   1 
ATOM   3870 C CB  . THR C 2 278 ? 14.816  -10.906 -26.889 1.00 118.02 ? 291 THR C CB  1 
ATOM   3871 O OG1 . THR C 2 278 ? 13.702  -11.184 -27.746 1.00 130.07 ? 291 THR C OG1 1 
ATOM   3872 C CG2 . THR C 2 278 ? 15.557  -12.199 -26.574 1.00 104.13 ? 291 THR C CG2 1 
ATOM   3873 N N   . ASN C 2 279 ? 12.921  -8.480  -26.534 1.00 125.08 ? 292 ASN C N   1 
ATOM   3874 C CA  . ASN C 2 279 ? 11.697  -7.691  -26.655 1.00 127.69 ? 292 ASN C CA  1 
ATOM   3875 C C   . ASN C 2 279 ? 10.908  -7.929  -27.947 1.00 133.68 ? 292 ASN C C   1 
ATOM   3876 O O   . ASN C 2 279 ? 9.944   -7.217  -28.234 1.00 106.33 ? 292 ASN C O   1 
ATOM   3877 C CB  . ASN C 2 279 ? 12.017  -6.203  -26.489 1.00 127.26 ? 292 ASN C CB  1 
ATOM   3878 C CG  . ASN C 2 279 ? 10.802  -5.386  -26.098 1.00 120.48 ? 292 ASN C CG  1 
ATOM   3879 O OD1 . ASN C 2 279 ? 10.587  -5.094  -24.922 1.00 112.74 ? 292 ASN C OD1 1 
ATOM   3880 N ND2 . ASN C 2 279 ? 9.997   -5.018  -27.085 1.00 118.15 ? 292 ASN C ND2 1 
ATOM   3881 N N   . ALA C 2 280 ? 11.313  -8.931  -28.719 1.00 130.90 ? 293 ALA C N   1 
ATOM   3882 C CA  . ALA C 2 280 ? 10.603  -9.282  -29.946 1.00 129.13 ? 293 ALA C CA  1 
ATOM   3883 C C   . ALA C 2 280 ? 10.631  -10.790 -30.181 1.00 124.38 ? 293 ALA C C   1 
ATOM   3884 O O   . ALA C 2 280 ? 11.436  -11.503 -29.581 1.00 116.51 ? 293 ALA C O   1 
ATOM   3885 C CB  . ALA C 2 280 ? 11.196  -8.543  -31.136 1.00 113.94 ? 293 ALA C CB  1 
ATOM   3886 N N   . PHE C 2 281 ? 9.752   -11.274 -31.054 1.00 126.92 ? 294 PHE C N   1 
ATOM   3887 C CA  . PHE C 2 281 ? 9.681   -12.705 -31.333 1.00 123.83 ? 294 PHE C CA  1 
ATOM   3888 C C   . PHE C 2 281 ? 9.069   -13.003 -32.700 1.00 120.69 ? 294 PHE C C   1 
ATOM   3889 O O   . PHE C 2 281 ? 8.145   -12.319 -33.141 1.00 122.84 ? 294 PHE C O   1 
ATOM   3890 C CB  . PHE C 2 281 ? 8.903   -13.428 -30.230 1.00 126.75 ? 294 PHE C CB  1 
ATOM   3891 C CG  . PHE C 2 281 ? 8.967   -14.926 -30.326 1.00 124.17 ? 294 PHE C CG  1 
ATOM   3892 C CD1 . PHE C 2 281 ? 10.110  -15.609 -29.940 1.00 117.99 ? 294 PHE C CD1 1 
ATOM   3893 C CD2 . PHE C 2 281 ? 7.884   -15.651 -30.794 1.00 122.84 ? 294 PHE C CD2 1 
ATOM   3894 C CE1 . PHE C 2 281 ? 10.173  -16.988 -30.025 1.00 115.29 ? 294 PHE C CE1 1 
ATOM   3895 C CE2 . PHE C 2 281 ? 7.942   -17.031 -30.881 1.00 116.99 ? 294 PHE C CE2 1 
ATOM   3896 C CZ  . PHE C 2 281 ? 9.088   -17.699 -30.496 1.00 114.82 ? 294 PHE C CZ  1 
ATOM   3897 N N   . ILE C 2 282 ? 9.597   -14.030 -33.362 1.00 127.17 ? 295 ILE C N   1 
ATOM   3898 C CA  . ILE C 2 282 ? 9.137   -14.431 -34.688 1.00 137.11 ? 295 ILE C CA  1 
ATOM   3899 C C   . ILE C 2 282 ? 9.087   -15.956 -34.798 1.00 144.42 ? 295 ILE C C   1 
ATOM   3900 O O   . ILE C 2 282 ? 10.018  -16.644 -34.378 1.00 142.84 ? 295 ILE C O   1 
ATOM   3901 C CB  . ILE C 2 282 ? 10.052  -13.852 -35.796 1.00 132.75 ? 295 ILE C CB  1 
ATOM   3902 C CG1 . ILE C 2 282 ? 9.778   -12.358 -35.993 1.00 128.50 ? 295 ILE C CG1 1 
ATOM   3903 C CG2 . ILE C 2 282 ? 9.858   -14.591 -37.110 1.00 138.27 ? 295 ILE C CG2 1 
ATOM   3904 C CD1 . ILE C 2 282 ? 10.578  -11.728 -37.114 1.00 129.62 ? 295 ILE C CD1 1 
ATOM   3905 N N   . SER C 2 283 ? 7.996   -16.484 -35.347 1.00 150.91 ? 296 SER C N   1 
ATOM   3906 C CA  . SER C 2 283 ? 7.865   -17.928 -35.531 1.00 151.57 ? 296 SER C CA  1 
ATOM   3907 C C   . SER C 2 283 ? 7.012   -18.277 -36.747 1.00 153.06 ? 296 SER C C   1 
ATOM   3908 O O   . SER C 2 283 ? 6.393   -17.404 -37.356 1.00 151.22 ? 296 SER C O   1 
ATOM   3909 C CB  . SER C 2 283 ? 7.278   -18.583 -34.279 1.00 148.42 ? 296 SER C CB  1 
ATOM   3910 O OG  . SER C 2 283 ? 5.901   -18.277 -34.136 1.00 148.27 ? 296 SER C OG  1 
ATOM   3911 N N   . ILE C 2 284 ? 6.988   -19.560 -37.096 1.00 158.34 ? 297 ILE C N   1 
ATOM   3912 C CA  . ILE C 2 284 ? 6.191   -20.023 -38.224 1.00 160.33 ? 297 ILE C CA  1 
ATOM   3913 C C   . ILE C 2 284 ? 4.741   -20.244 -37.806 1.00 154.49 ? 297 ILE C C   1 
ATOM   3914 O O   . ILE C 2 284 ? 4.438   -20.395 -36.621 1.00 144.05 ? 297 ILE C O   1 
ATOM   3915 C CB  . ILE C 2 284 ? 6.759   -21.321 -38.845 1.00 159.40 ? 297 ILE C CB  1 
ATOM   3916 C CG1 . ILE C 2 284 ? 6.159   -22.559 -38.171 1.00 156.96 ? 297 ILE C CG1 1 
ATOM   3917 C CG2 . ILE C 2 284 ? 8.279   -21.330 -38.768 1.00 156.36 ? 297 ILE C CG2 1 
ATOM   3918 C CD1 . ILE C 2 284 ? 6.474   -23.858 -38.887 1.00 157.02 ? 297 ILE C CD1 1 
ATOM   3919 N N   . ILE C 2 285 ? 3.853   -20.253 -38.793 1.00 157.92 ? 298 ILE C N   1 
ATOM   3920 C CA  . ILE C 2 285 ? 2.428   -20.440 -38.572 1.00 157.22 ? 298 ILE C CA  1 
ATOM   3921 C C   . ILE C 2 285 ? 1.845   -21.093 -39.816 1.00 163.11 ? 298 ILE C C   1 
ATOM   3922 O O   . ILE C 2 285 ? 2.397   -22.061 -40.338 1.00 165.18 ? 298 ILE C O   1 
ATOM   3923 C CB  . ILE C 2 285 ? 1.716   -19.091 -38.343 1.00 156.34 ? 298 ILE C CB  1 
ATOM   3924 C CG1 . ILE C 2 285 ? 2.304   -18.021 -39.268 1.00 160.57 ? 298 ILE C CG1 1 
ATOM   3925 C CG2 . ILE C 2 285 ? 1.835   -18.650 -36.891 1.00 149.89 ? 298 ILE C CG2 1 
ATOM   3926 C CD1 . ILE C 2 285 ? 1.547   -16.721 -39.255 1.00 160.30 ? 298 ILE C CD1 1 
ATOM   3927 N N   . ASP C 2 286 ? 0.724   -20.556 -40.282 1.00 163.99 ? 299 ASP C N   1 
ATOM   3928 C CA  . ASP C 2 286 ? 0.197   -20.884 -41.597 1.00 170.68 ? 299 ASP C CA  1 
ATOM   3929 C C   . ASP C 2 286 ? -0.410  -19.627 -42.209 1.00 179.55 ? 299 ASP C C   1 
ATOM   3930 O O   . ASP C 2 286 ? -0.688  -18.659 -41.501 1.00 176.25 ? 299 ASP C O   1 
ATOM   3931 C CB  . ASP C 2 286 ? -0.841  -22.010 -41.515 1.00 165.40 ? 299 ASP C CB  1 
ATOM   3932 C CG  . ASP C 2 286 ? -1.903  -21.763 -40.454 1.00 158.19 ? 299 ASP C CG  1 
ATOM   3933 O OD1 . ASP C 2 286 ? -2.110  -20.597 -40.061 1.00 159.03 ? 299 ASP C OD1 1 
ATOM   3934 O OD2 . ASP C 2 286 ? -2.538  -22.745 -40.014 1.00 147.63 ? 299 ASP C OD2 1 
ATOM   3935 N N   . ASP C 2 287 ? -0.608  -19.635 -43.522 1.00 185.10 ? 300 ASP C N   1 
ATOM   3936 C CA  . ASP C 2 287 ? -1.330  -18.551 -44.170 1.00 190.03 ? 300 ASP C CA  1 
ATOM   3937 C C   . ASP C 2 287 ? -2.817  -18.785 -43.947 1.00 187.49 ? 300 ASP C C   1 
ATOM   3938 O O   . ASP C 2 287 ? -3.648  -17.927 -44.241 1.00 192.39 ? 300 ASP C O   1 
ATOM   3939 C CB  . ASP C 2 287 ? -1.035  -18.521 -45.672 1.00 202.31 ? 300 ASP C CB  1 
ATOM   3940 C CG  . ASP C 2 287 ? 0.451   -18.565 -45.982 1.00 205.10 ? 300 ASP C CG  1 
ATOM   3941 O OD1 . ASP C 2 287 ? 1.255   -18.140 -45.126 1.00 202.96 ? 300 ASP C OD1 1 
ATOM   3942 O OD2 . ASP C 2 287 ? 0.812   -19.023 -47.087 1.00 206.13 ? 300 ASP C OD2 1 
ATOM   3943 N N   . LEU C 2 288 ? -3.135  -19.955 -43.401 1.00 178.87 ? 301 LEU C N   1 
ATOM   3944 C CA  . LEU C 2 288 ? -4.504  -20.455 -43.348 1.00 174.24 ? 301 LEU C CA  1 
ATOM   3945 C C   . LEU C 2 288 ? -5.299  -20.028 -42.115 1.00 166.19 ? 301 LEU C C   1 
ATOM   3946 O O   . LEU C 2 288 ? -6.481  -19.702 -42.222 1.00 163.44 ? 301 LEU C O   1 
ATOM   3947 C CB  . LEU C 2 288 ? -4.510  -21.985 -43.450 1.00 173.88 ? 301 LEU C CB  1 
ATOM   3948 C CG  . LEU C 2 288 ? -3.961  -22.643 -44.723 1.00 179.81 ? 301 LEU C CG  1 
ATOM   3949 C CD1 . LEU C 2 288 ? -4.416  -21.890 -45.969 1.00 182.82 ? 301 LEU C CD1 1 
ATOM   3950 C CD2 . LEU C 2 288 ? -2.439  -22.794 -44.689 1.00 179.62 ? 301 LEU C CD2 1 
ATOM   3951 N N   . SER C 2 289 ? -4.659  -20.036 -40.950 1.00 164.14 ? 302 SER C N   1 
ATOM   3952 C CA  . SER C 2 289 ? -5.384  -19.852 -39.693 1.00 156.98 ? 302 SER C CA  1 
ATOM   3953 C C   . SER C 2 289 ? -5.271  -18.456 -39.087 1.00 156.24 ? 302 SER C C   1 
ATOM   3954 O O   . SER C 2 289 ? -4.353  -17.695 -39.396 1.00 157.53 ? 302 SER C O   1 
ATOM   3955 C CB  . SER C 2 289 ? -4.937  -20.892 -38.664 1.00 145.49 ? 302 SER C CB  1 
ATOM   3956 O OG  . SER C 2 289 ? -4.990  -22.199 -39.205 1.00 144.74 ? 302 SER C OG  1 
ATOM   3957 N N   . LYS C 2 290 ? -6.222  -18.136 -38.216 1.00 153.46 ? 303 LYS C N   1 
ATOM   3958 C CA  . LYS C 2 290 ? -6.200  -16.894 -37.459 1.00 151.98 ? 303 LYS C CA  1 
ATOM   3959 C C   . LYS C 2 290 ? -5.550  -17.149 -36.103 1.00 150.93 ? 303 LYS C C   1 
ATOM   3960 O O   . LYS C 2 290 ? -5.802  -18.175 -35.472 1.00 146.38 ? 303 LYS C O   1 
ATOM   3961 C CB  . LYS C 2 290 ? -7.623  -16.367 -37.265 1.00 152.07 ? 303 LYS C CB  1 
ATOM   3962 C CG  . LYS C 2 290 ? -7.706  -15.018 -36.574 1.00 153.31 ? 303 LYS C CG  1 
ATOM   3963 C CD  . LYS C 2 290 ? -9.137  -14.704 -36.163 1.00 156.57 ? 303 LYS C CD  1 
ATOM   3964 C CE  . LYS C 2 290 ? -9.268  -13.277 -35.664 1.00 155.36 ? 303 LYS C CE  1 
ATOM   3965 N NZ  . LYS C 2 290 ? -10.588 -13.020 -35.026 1.00 153.97 ? 303 LYS C NZ  1 
ATOM   3966 N N   . TYR C 2 291 ? -4.712  -16.219 -35.660 1.00 151.10 ? 304 TYR C N   1 
ATOM   3967 C CA  . TYR C 2 291 ? -4.020  -16.362 -34.384 1.00 139.63 ? 304 TYR C CA  1 
ATOM   3968 C C   . TYR C 2 291 ? -4.282  -15.170 -33.474 1.00 141.49 ? 304 TYR C C   1 
ATOM   3969 O O   . TYR C 2 291 ? -4.467  -14.049 -33.945 1.00 148.28 ? 304 TYR C O   1 
ATOM   3970 C CB  . TYR C 2 291 ? -2.511  -16.499 -34.605 1.00 126.89 ? 304 TYR C CB  1 
ATOM   3971 C CG  . TYR C 2 291 ? -2.087  -17.760 -35.323 1.00 122.59 ? 304 TYR C CG  1 
ATOM   3972 C CD1 . TYR C 2 291 ? -1.571  -18.841 -34.620 1.00 116.59 ? 304 TYR C CD1 1 
ATOM   3973 C CD2 . TYR C 2 291 ? -2.192  -17.866 -36.704 1.00 116.64 ? 304 TYR C CD2 1 
ATOM   3974 C CE1 . TYR C 2 291 ? -1.177  -19.993 -35.271 1.00 110.04 ? 304 TYR C CE1 1 
ATOM   3975 C CE2 . TYR C 2 291 ? -1.802  -19.013 -37.362 1.00 121.60 ? 304 TYR C CE2 1 
ATOM   3976 C CZ  . TYR C 2 291 ? -1.296  -20.074 -36.642 1.00 126.56 ? 304 TYR C CZ  1 
ATOM   3977 O OH  . TYR C 2 291 ? -0.905  -21.218 -37.298 1.00 116.28 ? 304 TYR C OH  1 
ATOM   3978 N N   . ASP C 2 292 ? -4.303  -15.417 -32.168 1.00 135.19 ? 305 ASP C N   1 
ATOM   3979 C CA  . ASP C 2 292 ? -4.324  -14.336 -31.190 1.00 131.03 ? 305 ASP C CA  1 
ATOM   3980 C C   . ASP C 2 292 ? -3.068  -14.426 -30.336 1.00 114.51 ? 305 ASP C C   1 
ATOM   3981 O O   . ASP C 2 292 ? -2.657  -15.515 -29.938 1.00 106.80 ? 305 ASP C O   1 
ATOM   3982 C CB  . ASP C 2 292 ? -5.586  -14.376 -30.320 1.00 135.24 ? 305 ASP C CB  1 
ATOM   3983 C CG  . ASP C 2 292 ? -5.707  -15.657 -29.519 1.00 130.63 ? 305 ASP C CG  1 
ATOM   3984 O OD1 . ASP C 2 292 ? -5.888  -15.578 -28.284 1.00 123.82 ? 305 ASP C OD1 1 
ATOM   3985 O OD2 . ASP C 2 292 ? -5.634  -16.745 -30.125 1.00 138.89 ? 305 ASP C OD2 1 
ATOM   3986 N N   . VAL C 2 293 ? -2.454  -13.277 -30.073 1.00 109.75 ? 306 VAL C N   1 
ATOM   3987 C CA  . VAL C 2 293 ? -1.176  -13.228 -29.369 1.00 110.85 ? 306 VAL C CA  1 
ATOM   3988 C C   . VAL C 2 293 ? -1.244  -12.381 -28.098 1.00 108.92 ? 306 VAL C C   1 
ATOM   3989 O O   . VAL C 2 293 ? -1.766  -11.266 -28.106 1.00 112.80 ? 306 VAL C O   1 
ATOM   3990 C CB  . VAL C 2 293 ? -0.054  -12.686 -30.288 1.00 115.92 ? 306 VAL C CB  1 
ATOM   3991 C CG1 . VAL C 2 293 ? 1.242   -12.517 -29.514 1.00 104.80 ? 306 VAL C CG1 1 
ATOM   3992 C CG2 . VAL C 2 293 ? 0.153   -13.611 -31.482 1.00 103.63 ? 306 VAL C CG2 1 
ATOM   3993 N N   . GLN C 2 294 ? -0.717  -12.922 -27.005 1.00 99.40  ? 307 GLN C N   1 
ATOM   3994 C CA  . GLN C 2 294 ? -0.626  -12.181 -25.753 1.00 90.42  ? 307 GLN C CA  1 
ATOM   3995 C C   . GLN C 2 294 ? 0.801   -12.210 -25.214 1.00 93.66  ? 307 GLN C C   1 
ATOM   3996 O O   . GLN C 2 294 ? 1.549   -13.149 -25.475 1.00 92.52  ? 307 GLN C O   1 
ATOM   3997 C CB  . GLN C 2 294 ? -1.600  -12.751 -24.721 1.00 100.33 ? 307 GLN C CB  1 
ATOM   3998 C CG  . GLN C 2 294 ? -3.049  -12.365 -24.959 1.00 101.25 ? 307 GLN C CG  1 
ATOM   3999 C CD  . GLN C 2 294 ? -3.997  -13.092 -24.032 1.00 101.24 ? 307 GLN C CD  1 
ATOM   4000 O OE1 . GLN C 2 294 ? -4.053  -14.322 -24.026 1.00 106.19 ? 307 GLN C OE1 1 
ATOM   4001 N NE2 . GLN C 2 294 ? -4.745  -12.338 -23.235 1.00 103.99 ? 307 GLN C NE2 1 
ATOM   4002 N N   . VAL C 2 295 ? 1.185   -11.170 -24.480 1.00 96.31  ? 308 VAL C N   1 
ATOM   4003 C CA  . VAL C 2 295 ? 2.505   -11.130 -23.860 1.00 97.77  ? 308 VAL C CA  1 
ATOM   4004 C C   . VAL C 2 295 ? 2.358   -10.903 -22.357 1.00 94.36  ? 308 VAL C C   1 
ATOM   4005 O O   . VAL C 2 295 ? 1.374   -10.318 -21.905 1.00 98.54  ? 308 VAL C O   1 
ATOM   4006 C CB  . VAL C 2 295 ? 3.407   -10.041 -24.487 1.00 106.10 ? 308 VAL C CB  1 
ATOM   4007 C CG1 . VAL C 2 295 ? 4.873   -10.325 -24.194 1.00 103.00 ? 308 VAL C CG1 1 
ATOM   4008 C CG2 . VAL C 2 295 ? 3.193   -9.978  -25.987 1.00 101.33 ? 308 VAL C CG2 1 
ATOM   4009 N N   . ARG C 2 296 ? 3.341   -11.370 -21.594 1.00 92.46  ? 309 ARG C N   1 
ATOM   4010 C CA  . ARG C 2 296 ? 3.269   -11.392 -20.140 1.00 79.15  ? 309 ARG C CA  1 
ATOM   4011 C C   . ARG C 2 296 ? 4.641   -11.030 -19.589 1.00 87.35  ? 309 ARG C C   1 
ATOM   4012 O O   . ARG C 2 296 ? 5.652   -11.551 -20.055 1.00 85.89  ? 309 ARG C O   1 
ATOM   4013 C CB  . ARG C 2 296 ? 2.880   -12.799 -19.696 1.00 76.60  ? 309 ARG C CB  1 
ATOM   4014 C CG  . ARG C 2 296 ? 2.567   -12.985 -18.224 1.00 73.98  ? 309 ARG C CG  1 
ATOM   4015 C CD  . ARG C 2 296 ? 2.406   -14.473 -17.954 1.00 71.88  ? 309 ARG C CD  1 
ATOM   4016 N NE  . ARG C 2 296 ? 1.949   -14.787 -16.605 1.00 83.21  ? 309 ARG C NE  1 
ATOM   4017 C CZ  . ARG C 2 296 ? 1.947   -16.015 -16.099 1.00 81.73  ? 309 ARG C CZ  1 
ATOM   4018 N NH1 . ARG C 2 296 ? 2.383   -17.030 -16.832 1.00 75.35  ? 309 ARG C NH1 1 
ATOM   4019 N NH2 . ARG C 2 296 ? 1.518   -16.230 -14.863 1.00 100.96 ? 309 ARG C NH2 1 
ATOM   4020 N N   . ALA C 2 297 ? 4.682   -10.139 -18.603 1.00 81.62  ? 310 ALA C N   1 
ATOM   4021 C CA  . ALA C 2 297 ? 5.959   -9.639  -18.098 1.00 79.07  ? 310 ALA C CA  1 
ATOM   4022 C C   . ALA C 2 297 ? 6.185   -9.898  -16.614 1.00 81.40  ? 310 ALA C C   1 
ATOM   4023 O O   . ALA C 2 297 ? 5.252   -9.867  -15.811 1.00 83.59  ? 310 ALA C O   1 
ATOM   4024 C CB  . ALA C 2 297 ? 6.101   -8.153  -18.392 1.00 80.98  ? 310 ALA C CB  1 
ATOM   4025 N N   . ALA C 2 298 ? 7.443   -10.148 -16.268 1.00 74.87  ? 311 ALA C N   1 
ATOM   4026 C CA  . ALA C 2 298 ? 7.874   -10.259 -14.881 1.00 73.25  ? 311 ALA C CA  1 
ATOM   4027 C C   . ALA C 2 298 ? 9.340   -9.861  -14.795 1.00 87.24  ? 311 ALA C C   1 
ATOM   4028 O O   . ALA C 2 298 ? 10.119  -10.159 -15.700 1.00 82.24  ? 311 ALA C O   1 
ATOM   4029 C CB  . ALA C 2 298 ? 7.681   -11.670 -14.374 1.00 70.21  ? 311 ALA C CB  1 
ATOM   4030 N N   . VAL C 2 299 ? 9.713   -9.182  -13.713 1.00 90.68  ? 312 VAL C N   1 
ATOM   4031 C CA  . VAL C 2 299 ? 11.106  -8.814  -13.494 1.00 88.63  ? 312 VAL C CA  1 
ATOM   4032 C C   . VAL C 2 299 ? 11.947  -10.080 -13.383 1.00 85.86  ? 312 VAL C C   1 
ATOM   4033 O O   . VAL C 2 299 ? 11.613  -10.988 -12.621 1.00 89.20  ? 312 VAL C O   1 
ATOM   4034 C CB  . VAL C 2 299 ? 11.284  -7.972  -12.216 1.00 74.35  ? 312 VAL C CB  1 
ATOM   4035 C CG1 . VAL C 2 299 ? 12.739  -7.572  -12.041 1.00 75.64  ? 312 VAL C CG1 1 
ATOM   4036 C CG2 . VAL C 2 299 ? 10.394  -6.740  -12.261 1.00 76.05  ? 312 VAL C CG2 1 
ATOM   4037 N N   . SER C 2 300 ? 13.026  -10.140 -14.159 1.00 88.91  ? 313 SER C N   1 
ATOM   4038 C CA  . SER C 2 300 ? 13.891  -11.317 -14.194 1.00 83.67  ? 313 SER C CA  1 
ATOM   4039 C C   . SER C 2 300 ? 14.435  -11.640 -12.813 1.00 82.88  ? 313 SER C C   1 
ATOM   4040 O O   . SER C 2 300 ? 14.535  -10.759 -11.961 1.00 95.37  ? 313 SER C O   1 
ATOM   4041 C CB  . SER C 2 300 ? 15.053  -11.099 -15.162 1.00 91.40  ? 313 SER C CB  1 
ATOM   4042 O OG  . SER C 2 300 ? 16.025  -12.119 -15.025 1.00 93.41  ? 313 SER C OG  1 
ATOM   4043 N N   . SER C 2 301 ? 14.789  -12.903 -12.596 1.00 93.24  ? 314 SER C N   1 
ATOM   4044 C CA  . SER C 2 301 ? 15.349  -13.333 -11.318 1.00 94.44  ? 314 SER C CA  1 
ATOM   4045 C C   . SER C 2 301 ? 16.770  -12.804 -11.159 1.00 94.89  ? 314 SER C C   1 
ATOM   4046 O O   . SER C 2 301 ? 17.417  -13.030 -10.135 1.00 106.58 ? 314 SER C O   1 
ATOM   4047 C CB  . SER C 2 301 ? 15.366  -14.861 -11.227 1.00 90.73  ? 314 SER C CB  1 
ATOM   4048 O OG  . SER C 2 301 ? 14.407  -15.439 -12.101 1.00 96.77  ? 314 SER C OG  1 
ATOM   4049 N N   . MET C 2 302 ? 17.245  -12.098 -12.178 1.00 96.43  ? 315 MET C N   1 
ATOM   4050 C CA  . MET C 2 302 ? 18.614  -11.609 -12.203 1.00 103.53 ? 315 MET C CA  1 
ATOM   4051 C C   . MET C 2 302 ? 18.817  -10.232 -11.594 1.00 91.07  ? 315 MET C C   1 
ATOM   4052 O O   . MET C 2 302 ? 19.937  -9.865  -11.240 1.00 84.61  ? 315 MET C O   1 
ATOM   4053 C CB  . MET C 2 302 ? 19.167  -11.635 -13.626 1.00 113.77 ? 315 MET C CB  1 
ATOM   4054 C CG  . MET C 2 302 ? 19.925  -12.903 -13.909 1.00 117.13 ? 315 MET C CG  1 
ATOM   4055 S SD  . MET C 2 302 ? 20.702  -13.454 -12.377 1.00 334.93 ? 315 MET C SD  1 
ATOM   4056 C CE  . MET C 2 302 ? 22.041  -12.271 -12.221 1.00 183.63 ? 315 MET C CE  1 
ATOM   4057 N N   . CYS C 2 303 ? 17.738  -9.469  -11.479 1.00 92.38  ? 316 CYS C N   1 
ATOM   4058 C CA  . CYS C 2 303 ? 17.814  -8.139  -10.897 1.00 92.95  ? 316 CYS C CA  1 
ATOM   4059 C C   . CYS C 2 303 ? 17.252  -8.159  -9.482  1.00 85.96  ? 316 CYS C C   1 
ATOM   4060 O O   . CYS C 2 303 ? 17.794  -7.531  -8.574  1.00 81.99  ? 316 CYS C O   1 
ATOM   4061 C CB  . CYS C 2 303 ? 17.047  -7.143  -11.766 1.00 93.55  ? 316 CYS C CB  1 
ATOM   4062 S SG  . CYS C 2 303 ? 17.532  -7.183  -13.506 1.00 106.72 ? 316 CYS C SG  1 
ATOM   4063 N N   . ARG C 2 304 ? 16.167  -8.903  -9.305  1.00 73.29  ? 317 ARG C N   1 
ATOM   4064 C CA  . ARG C 2 304 ? 15.498  -8.999  -8.016  1.00 72.51  ? 317 ARG C CA  1 
ATOM   4065 C C   . ARG C 2 304 ? 15.131  -10.455 -7.748  1.00 87.42  ? 317 ARG C C   1 
ATOM   4066 O O   . ARG C 2 304 ? 15.378  -11.324 -8.585  1.00 95.77  ? 317 ARG C O   1 
ATOM   4067 C CB  . ARG C 2 304 ? 14.247  -8.116  -8.013  1.00 74.77  ? 317 ARG C CB  1 
ATOM   4068 C CG  . ARG C 2 304 ? 13.883  -7.544  -6.653  1.00 88.58  ? 317 ARG C CG  1 
ATOM   4069 C CD  . ARG C 2 304 ? 13.024  -6.290  -6.783  1.00 91.57  ? 317 ARG C CD  1 
ATOM   4070 N NE  . ARG C 2 304 ? 11.761  -6.540  -7.474  1.00 86.91  ? 317 ARG C NE  1 
ATOM   4071 C CZ  . ARG C 2 304 ? 10.751  -5.676  -7.515  1.00 91.83  ? 317 ARG C CZ  1 
ATOM   4072 N NH1 . ARG C 2 304 ? 10.853  -4.505  -6.898  1.00 93.65  ? 317 ARG C NH1 1 
ATOM   4073 N NH2 . ARG C 2 304 ? 9.637   -5.983  -8.166  1.00 93.26  ? 317 ARG C NH2 1 
ATOM   4074 N N   . GLU C 2 305 ? 14.557  -10.727 -6.581  1.00 90.67  ? 318 GLU C N   1 
ATOM   4075 C CA  . GLU C 2 305 ? 14.051  -12.062 -6.293  1.00 87.83  ? 318 GLU C CA  1 
ATOM   4076 C C   . GLU C 2 305 ? 12.723  -12.239 -7.018  1.00 90.40  ? 318 GLU C C   1 
ATOM   4077 O O   . GLU C 2 305 ? 12.039  -11.257 -7.304  1.00 103.65 ? 318 GLU C O   1 
ATOM   4078 C CB  . GLU C 2 305 ? 13.884  -12.270 -4.787  1.00 98.70  ? 318 GLU C CB  1 
ATOM   4079 C CG  . GLU C 2 305 ? 13.657  -13.721 -4.386  1.00 115.18 ? 318 GLU C CG  1 
ATOM   4080 C CD  . GLU C 2 305 ? 14.333  -14.080 -3.078  1.00 127.35 ? 318 GLU C CD  1 
ATOM   4081 O OE1 . GLU C 2 305 ? 13.855  -13.632 -2.014  1.00 130.00 ? 318 GLU C OE1 1 
ATOM   4082 O OE2 . GLU C 2 305 ? 15.345  -14.811 -3.116  1.00 134.16 ? 318 GLU C OE2 1 
ATOM   4083 N N   . ALA C 2 306 ? 12.375  -13.487 -7.325  1.00 80.71  ? 319 ALA C N   1 
ATOM   4084 C CA  . ALA C 2 306 ? 11.164  -13.811 -8.076  1.00 71.86  ? 319 ALA C CA  1 
ATOM   4085 C C   . ALA C 2 306 ? 9.917   -13.114 -7.540  1.00 70.77  ? 319 ALA C C   1 
ATOM   4086 O O   . ALA C 2 306 ? 9.670   -13.095 -6.333  1.00 75.07  ? 319 ALA C O   1 
ATOM   4087 C CB  . ALA C 2 306 ? 10.950  -15.318 -8.102  1.00 69.02  ? 319 ALA C CB  1 
ATOM   4088 N N   . GLY C 2 307 ? 9.133   -12.544 -8.447  1.00 77.67  ? 320 GLY C N   1 
ATOM   4089 C CA  . GLY C 2 307 ? 7.936   -11.824 -8.065  1.00 64.10  ? 320 GLY C CA  1 
ATOM   4090 C C   . GLY C 2 307 ? 6.714   -12.240 -8.858  1.00 73.11  ? 320 GLY C C   1 
ATOM   4091 O O   . GLY C 2 307 ? 6.633   -13.366 -9.356  1.00 69.98  ? 320 GLY C O   1 
ATOM   4092 N N   . LEU C 2 308 ? 5.760   -11.324 -8.977  1.00 68.19  ? 321 LEU C N   1 
ATOM   4093 C CA  . LEU C 2 308 ? 4.517   -11.605 -9.680  1.00 70.43  ? 321 LEU C CA  1 
ATOM   4094 C C   . LEU C 2 308 ? 4.674   -11.390 -11.182 1.00 67.08  ? 321 LEU C C   1 
ATOM   4095 O O   . LEU C 2 308 ? 5.520   -10.611 -11.623 1.00 78.03  ? 321 LEU C O   1 
ATOM   4096 C CB  . LEU C 2 308 ? 3.400   -10.704 -9.148  1.00 70.83  ? 321 LEU C CB  1 
ATOM   4097 C CG  . LEU C 2 308 ? 3.250   -10.637 -7.624  1.00 72.69  ? 321 LEU C CG  1 
ATOM   4098 C CD1 . LEU C 2 308 ? 2.316   -9.507  -7.226  1.00 77.28  ? 321 LEU C CD1 1 
ATOM   4099 C CD2 . LEU C 2 308 ? 2.745   -11.958 -7.081  1.00 66.66  ? 321 LEU C CD2 1 
ATOM   4100 N N   . TRP C 2 309 ? 3.863   -12.095 -11.964 1.00 73.23  ? 322 TRP C N   1 
ATOM   4101 C CA  . TRP C 2 309 ? 3.777   -11.840 -13.396 1.00 79.13  ? 322 TRP C CA  1 
ATOM   4102 C C   . TRP C 2 309 ? 2.796   -10.704 -13.634 1.00 85.72  ? 322 TRP C C   1 
ATOM   4103 O O   . TRP C 2 309 ? 1.944   -10.422 -12.792 1.00 93.02  ? 322 TRP C O   1 
ATOM   4104 C CB  . TRP C 2 309 ? 3.293   -13.085 -14.146 1.00 79.26  ? 322 TRP C CB  1 
ATOM   4105 C CG  . TRP C 2 309 ? 4.314   -14.171 -14.264 1.00 87.23  ? 322 TRP C CG  1 
ATOM   4106 C CD1 . TRP C 2 309 ? 4.478   -15.234 -13.427 1.00 88.87  ? 322 TRP C CD1 1 
ATOM   4107 C CD2 . TRP C 2 309 ? 5.312   -14.305 -15.283 1.00 87.95  ? 322 TRP C CD2 1 
ATOM   4108 N NE1 . TRP C 2 309 ? 5.517   -16.022 -13.859 1.00 92.38  ? 322 TRP C NE1 1 
ATOM   4109 C CE2 . TRP C 2 309 ? 6.048   -15.472 -14.999 1.00 90.10  ? 322 TRP C CE2 1 
ATOM   4110 C CE3 . TRP C 2 309 ? 5.653   -13.553 -16.413 1.00 85.45  ? 322 TRP C CE3 1 
ATOM   4111 C CZ2 . TRP C 2 309 ? 7.104   -15.905 -15.795 1.00 83.73  ? 322 TRP C CZ2 1 
ATOM   4112 C CZ3 . TRP C 2 309 ? 6.705   -13.983 -17.204 1.00 83.23  ? 322 TRP C CZ3 1 
ATOM   4113 C CH2 . TRP C 2 309 ? 7.417   -15.148 -16.890 1.00 84.03  ? 322 TRP C CH2 1 
ATOM   4114 N N   . SER C 2 310 ? 2.914   -10.050 -14.782 1.00 86.33  ? 323 SER C N   1 
ATOM   4115 C CA  . SER C 2 310 ? 1.923   -9.063  -15.176 1.00 87.69  ? 323 SER C CA  1 
ATOM   4116 C C   . SER C 2 310 ? 0.697   -9.796  -15.700 1.00 84.97  ? 323 SER C C   1 
ATOM   4117 O O   . SER C 2 310 ? 0.727   -11.014 -15.886 1.00 88.79  ? 323 SER C O   1 
ATOM   4118 C CB  . SER C 2 310 ? 2.474   -8.149  -16.268 1.00 86.01  ? 323 SER C CB  1 
ATOM   4119 O OG  . SER C 2 310 ? 2.520   -8.820  -17.513 1.00 82.73  ? 323 SER C OG  1 
ATOM   4120 N N   . GLU C 2 311 ? -0.385  -9.058  -15.925 1.00 82.06  ? 324 GLU C N   1 
ATOM   4121 C CA  . GLU C 2 311 ? -1.537  -9.609  -16.618 1.00 77.82  ? 324 GLU C CA  1 
ATOM   4122 C C   . GLU C 2 311 ? -1.100  -9.815  -18.057 1.00 79.27  ? 324 GLU C C   1 
ATOM   4123 O O   . GLU C 2 311 ? -0.182  -9.142  -18.524 1.00 80.52  ? 324 GLU C O   1 
ATOM   4124 C CB  . GLU C 2 311 ? -2.704  -8.623  -16.582 1.00 128.65 ? 324 GLU C CB  1 
ATOM   4125 C CG  . GLU C 2 311 ? -2.997  -8.036  -15.211 1.00 131.89 ? 324 GLU C CG  1 
ATOM   4126 C CD  . GLU C 2 311 ? -4.055  -8.811  -14.450 1.00 133.85 ? 324 GLU C CD  1 
ATOM   4127 O OE1 . GLU C 2 311 ? -5.049  -9.240  -15.076 1.00 134.98 ? 324 GLU C OE1 1 
ATOM   4128 O OE2 . GLU C 2 311 ? -3.893  -8.991  -13.223 1.00 130.85 ? 324 GLU C OE2 1 
ATOM   4129 N N   . TRP C 2 312 ? -1.731  -10.746 -18.762 1.00 87.87  ? 325 TRP C N   1 
ATOM   4130 C CA  . TRP C 2 312 ? -1.471  -10.882 -20.189 1.00 89.12  ? 325 TRP C CA  1 
ATOM   4131 C C   . TRP C 2 312 ? -1.945  -9.621  -20.903 1.00 94.82  ? 325 TRP C C   1 
ATOM   4132 O O   . TRP C 2 312 ? -2.918  -8.990  -20.485 1.00 92.89  ? 325 TRP C O   1 
ATOM   4133 C CB  . TRP C 2 312 ? -2.177  -12.111 -20.764 1.00 88.67  ? 325 TRP C CB  1 
ATOM   4134 C CG  . TRP C 2 312 ? -1.615  -13.417 -20.277 1.00 97.90  ? 325 TRP C CG  1 
ATOM   4135 C CD1 . TRP C 2 312 ? -2.035  -14.138 -19.198 1.00 95.19  ? 325 TRP C CD1 1 
ATOM   4136 C CD2 . TRP C 2 312 ? -0.532  -14.158 -20.856 1.00 100.70 ? 325 TRP C CD2 1 
ATOM   4137 N NE1 . TRP C 2 312 ? -1.282  -15.279 -19.067 1.00 92.30  ? 325 TRP C NE1 1 
ATOM   4138 C CE2 . TRP C 2 312 ? -0.351  -15.316 -20.074 1.00 92.03  ? 325 TRP C CE2 1 
ATOM   4139 C CE3 . TRP C 2 312 ? 0.304   -13.955 -21.959 1.00 100.21 ? 325 TRP C CE3 1 
ATOM   4140 C CZ2 . TRP C 2 312 ? 0.628   -16.267 -20.359 1.00 77.49  ? 325 TRP C CZ2 1 
ATOM   4141 C CZ3 . TRP C 2 312 ? 1.277   -14.899 -22.240 1.00 79.22  ? 325 TRP C CZ3 1 
ATOM   4142 C CH2 . TRP C 2 312 ? 1.430   -16.040 -21.444 1.00 76.49  ? 325 TRP C CH2 1 
ATOM   4143 N N   . SER C 2 313 ? -1.248  -9.248  -21.972 1.00 99.62  ? 326 SER C N   1 
ATOM   4144 C CA  . SER C 2 313 ? -1.623  -8.073  -22.745 1.00 98.89  ? 326 SER C CA  1 
ATOM   4145 C C   . SER C 2 313 ? -2.983  -8.301  -23.388 1.00 103.13 ? 326 SER C C   1 
ATOM   4146 O O   . SER C 2 313 ? -3.458  -9.437  -23.461 1.00 93.92  ? 326 SER C O   1 
ATOM   4147 C CB  . SER C 2 313 ? -0.580  -7.780  -23.825 1.00 100.09 ? 326 SER C CB  1 
ATOM   4148 O OG  . SER C 2 313 ? -0.589  -8.782  -24.827 1.00 104.01 ? 326 SER C OG  1 
ATOM   4149 N N   . GLN C 2 314 ? -3.615  -7.223  -23.840 1.00 114.17 ? 327 GLN C N   1 
ATOM   4150 C CA  . GLN C 2 314 ? -4.889  -7.341  -24.537 1.00 117.69 ? 327 GLN C CA  1 
ATOM   4151 C C   . GLN C 2 314 ? -4.702  -8.193  -25.786 1.00 114.58 ? 327 GLN C C   1 
ATOM   4152 O O   . GLN C 2 314 ? -3.806  -7.929  -26.593 1.00 109.99 ? 327 GLN C O   1 
ATOM   4153 C CB  . GLN C 2 314 ? -5.451  -5.963  -24.893 1.00 125.84 ? 327 GLN C CB  1 
ATOM   4154 C CG  . GLN C 2 314 ? -6.015  -5.195  -23.704 1.00 125.47 ? 327 GLN C CG  1 
ATOM   4155 C CD  . GLN C 2 314 ? -7.211  -5.885  -23.074 1.00 125.94 ? 327 GLN C CD  1 
ATOM   4156 O OE1 . GLN C 2 314 ? -7.110  -6.463  -21.991 1.00 121.99 ? 327 GLN C OE1 1 
ATOM   4157 N NE2 . GLN C 2 314 ? -8.354  -5.824  -23.749 1.00 129.00 ? 327 GLN C NE2 1 
ATOM   4158 N N   . PRO C 2 315 ? -5.540  -9.233  -25.933 1.00 108.18 ? 328 PRO C N   1 
ATOM   4159 C CA  . PRO C 2 315 ? -5.425  -10.225 -27.008 1.00 102.77 ? 328 PRO C CA  1 
ATOM   4160 C C   . PRO C 2 315 ? -5.475  -9.591  -28.391 1.00 118.76 ? 328 PRO C C   1 
ATOM   4161 O O   . PRO C 2 315 ? -6.513  -9.056  -28.782 1.00 121.06 ? 328 PRO C O   1 
ATOM   4162 C CB  . PRO C 2 315 ? -6.659  -11.109 -26.802 1.00 99.36  ? 328 PRO C CB  1 
ATOM   4163 C CG  . PRO C 2 315 ? -7.019  -10.935 -25.366 1.00 104.40 ? 328 PRO C CG  1 
ATOM   4164 C CD  . PRO C 2 315 ? -6.685  -9.513  -25.047 1.00 107.03 ? 328 PRO C CD  1 
ATOM   4165 N N   . ILE C 2 316 ? -4.366  -9.646  -29.120 1.00 124.49 ? 329 ILE C N   1 
ATOM   4166 C CA  . ILE C 2 316 ? -4.345  -9.126  -30.482 1.00 130.56 ? 329 ILE C CA  1 
ATOM   4167 C C   . ILE C 2 316 ? -4.513  -10.238 -31.522 1.00 140.09 ? 329 ILE C C   1 
ATOM   4168 O O   . ILE C 2 316 ? -3.563  -10.936 -31.883 1.00 146.26 ? 329 ILE C O   1 
ATOM   4169 C CB  . ILE C 2 316 ? -3.103  -8.243  -30.772 1.00 125.80 ? 329 ILE C CB  1 
ATOM   4170 C CG1 . ILE C 2 316 ? -1.799  -8.972  -30.451 1.00 125.65 ? 329 ILE C CG1 1 
ATOM   4171 C CG2 . ILE C 2 316 ? -3.172  -6.951  -29.973 1.00 124.26 ? 329 ILE C CG2 1 
ATOM   4172 C CD1 . ILE C 2 316 ? -0.574  -8.215  -30.901 1.00 128.48 ? 329 ILE C CD1 1 
ATOM   4173 N N   . TYR C 2 317 ? -5.746  -10.399 -31.986 1.00 139.92 ? 330 TYR C N   1 
ATOM   4174 C CA  . TYR C 2 317 ? -6.072  -11.413 -32.977 1.00 139.75 ? 330 TYR C CA  1 
ATOM   4175 C C   . TYR C 2 317 ? -5.476  -11.019 -34.323 1.00 139.98 ? 330 TYR C C   1 
ATOM   4176 O O   . TYR C 2 317 ? -5.719  -9.915  -34.810 1.00 147.42 ? 330 TYR C O   1 
ATOM   4177 C CB  . TYR C 2 317 ? -7.590  -11.559 -33.095 1.00 144.19 ? 330 TYR C CB  1 
ATOM   4178 C CG  . TYR C 2 317 ? -8.288  -11.884 -31.791 1.00 144.38 ? 330 TYR C CG  1 
ATOM   4179 C CD1 . TYR C 2 317 ? -8.618  -10.881 -30.888 1.00 141.82 ? 330 TYR C CD1 1 
ATOM   4180 C CD2 . TYR C 2 317 ? -8.628  -13.191 -31.471 1.00 142.55 ? 330 TYR C CD2 1 
ATOM   4181 C CE1 . TYR C 2 317 ? -9.256  -11.172 -29.699 1.00 139.02 ? 330 TYR C CE1 1 
ATOM   4182 C CE2 . TYR C 2 317 ? -9.267  -13.492 -30.282 1.00 142.03 ? 330 TYR C CE2 1 
ATOM   4183 C CZ  . TYR C 2 317 ? -9.579  -12.478 -29.401 1.00 143.62 ? 330 TYR C CZ  1 
ATOM   4184 O OH  . TYR C 2 317 ? -10.216 -12.768 -28.216 1.00 149.12 ? 330 TYR C OH  1 
ATOM   4185 N N   . VAL C 2 318 ? -4.692  -11.911 -34.920 1.00 139.35 ? 331 VAL C N   1 
ATOM   4186 C CA  . VAL C 2 318 ? -4.027  -11.592 -36.181 1.00 144.75 ? 331 VAL C CA  1 
ATOM   4187 C C   . VAL C 2 318 ? -4.121  -12.735 -37.191 1.00 145.66 ? 331 VAL C C   1 
ATOM   4188 O O   . VAL C 2 318 ? -4.281  -13.898 -36.817 1.00 140.74 ? 331 VAL C O   1 
ATOM   4189 C CB  . VAL C 2 318 ? -2.548  -11.182 -35.964 1.00 131.79 ? 331 VAL C CB  1 
ATOM   4190 C CG1 . VAL C 2 318 ? -1.617  -12.363 -36.176 1.00 120.28 ? 331 VAL C CG1 1 
ATOM   4191 C CG2 . VAL C 2 318 ? -2.172  -10.047 -36.899 1.00 125.91 ? 331 VAL C CG2 1 
ATOM   4192 N N   . GLY C 2 319 ? -4.035  -12.387 -38.472 1.00 151.49 ? 332 GLY C N   1 
ATOM   4193 C CA  . GLY C 2 319 ? -4.097  -13.366 -39.542 1.00 153.66 ? 332 GLY C CA  1 
ATOM   4194 C C   . GLY C 2 319 ? -5.504  -13.808 -39.897 1.00 157.57 ? 332 GLY C C   1 
ATOM   4195 O O   . GLY C 2 319 ? -6.486  -13.271 -39.384 1.00 155.94 ? 332 GLY C O   1 
ATOM   4196 N N   . ASN C 2 320 ? -5.595  -14.795 -40.783 1.00 166.18 ? 333 ASN C N   1 
ATOM   4197 C CA  . ASN C 2 320 ? -6.877  -15.340 -41.212 1.00 171.57 ? 333 ASN C CA  1 
ATOM   4198 C C   . ASN C 2 320 ? -6.716  -16.699 -41.879 1.00 175.28 ? 333 ASN C C   1 
ATOM   4199 O O   . ASN C 2 320 ? -6.036  -16.822 -42.899 1.00 180.29 ? 333 ASN C O   1 
ATOM   4200 C CB  . ASN C 2 320 ? -7.585  -14.374 -42.164 1.00 172.97 ? 333 ASN C CB  1 
ATOM   4201 C CG  . ASN C 2 320 ? -8.750  -13.660 -41.509 1.00 167.98 ? 333 ASN C CG  1 
ATOM   4202 O OD1 . ASN C 2 320 ? -9.894  -14.105 -41.599 1.00 169.68 ? 333 ASN C OD1 1 
ATOM   4203 N ND2 . ASN C 2 320 ? -8.465  -12.546 -40.845 1.00 161.88 ? 333 ASN C ND2 1 
HETATM 4204 O O   . HOH D 3 .   ? 21.687  -13.952 12.401  1.00 59.16  ? 201 HOH A O   1 
HETATM 4205 O O   . HOH D 3 .   ? 27.433  -5.504  10.173  1.00 56.22  ? 202 HOH A O   1 
HETATM 4206 O O   . HOH D 3 .   ? 21.515  -20.347 8.677   1.00 67.77  ? 203 HOH A O   1 
HETATM 4207 O O   . HOH D 3 .   ? 17.469  -12.220 -1.789  1.00 73.74  ? 204 HOH A O   1 
HETATM 4208 O O   . HOH D 3 .   ? 26.440  6.260   8.419   1.00 72.05  ? 205 HOH A O   1 
HETATM 4209 O O   . HOH E 3 .   ? 23.374  -7.275  9.616   1.00 60.95  ? 201 HOH B O   1 
HETATM 4210 O O   . HOH E 3 .   ? 25.584  -15.755 17.117  1.00 57.19  ? 202 HOH B O   1 
HETATM 4211 O O   . HOH E 3 .   ? 34.459  -13.770 7.611   1.00 62.40  ? 203 HOH B O   1 
HETATM 4212 O O   . HOH E 3 .   ? 21.052  -6.763  8.424   1.00 72.04  ? 204 HOH B O   1 
HETATM 4213 O O   . HOH E 3 .   ? 19.643  -9.125  7.870   1.00 72.87  ? 205 HOH B O   1 
HETATM 4214 O O   . HOH E 3 .   ? 31.400  -18.420 13.633  1.00 78.55  ? 206 HOH B O   1 
HETATM 4215 O O   . HOH F 3 .   ? 4.298   -1.733  -10.829 1.00 77.96  ? 401 HOH C O   1 
HETATM 4216 O O   . HOH F 3 .   ? 5.273   -1.025  14.477  1.00 70.03  ? 402 HOH C O   1 
HETATM 4217 O O   . HOH F 3 .   ? -0.859  -13.456 -15.331 1.00 69.70  ? 403 HOH C O   1 
HETATM 4218 O O   . HOH F 3 .   ? 28.201  -16.454 18.701  1.00 64.41  ? 404 HOH C O   1 
HETATM 4219 O O   . HOH F 3 .   ? 9.650   -1.859  -6.776  1.00 73.63  ? 405 HOH C O   1 
HETATM 4220 O O   . HOH F 3 .   ? 7.143   -10.946 6.425   1.00 71.93  ? 406 HOH C O   1 
HETATM 4221 O O   . HOH F 3 .   ? 9.081   0.037   -10.781 1.00 67.12  ? 407 HOH C O   1 
HETATM 4222 O O   . HOH F 3 .   ? 22.639  -1.915  13.219  1.00 55.71  ? 408 HOH C O   1 
HETATM 4223 O O   . HOH F 3 .   ? 4.409   0.616   17.146  1.00 75.55  ? 409 HOH C O   1 
HETATM 4224 O O   . HOH F 3 .   ? 5.195   3.208   16.743  1.00 71.84  ? 410 HOH C O   1 
HETATM 4225 O O   . HOH F 3 .   ? 21.045  -4.299  12.390  1.00 69.83  ? 411 HOH C O   1 
HETATM 4226 O O   . HOH F 3 .   ? 16.747  2.162   14.832  1.00 70.48  ? 412 HOH C O   1 
HETATM 4227 O O   . HOH F 3 .   ? -1.356  -9.684  7.164   1.00 75.98  ? 413 HOH C O   1 
HETATM 4228 O O   . HOH F 3 .   ? 4.102   -9.895  4.590   1.00 70.83  ? 414 HOH C O   1 
HETATM 4229 O O   . HOH F 3 .   ? 7.841   -9.769  -11.415 1.00 72.98  ? 415 HOH C O   1 
HETATM 4230 O O   . HOH F 3 .   ? 6.515   -8.006  -8.577  1.00 76.10  ? 416 HOH C O   1 
HETATM 4231 O O   . HOH F 3 .   ? -0.823  -10.720 3.243   1.00 74.34  ? 417 HOH C O   1 
HETATM 4232 O O   . HOH F 3 .   ? 15.979  0.578   -1.100  1.00 76.19  ? 418 HOH C O   1 
HETATM 4233 O O   . HOH F 3 .   ? 15.252  3.672   8.984   1.00 77.47  ? 419 HOH C O   1 
HETATM 4234 O O   . HOH F 3 .   ? 19.686  -4.637  10.311  1.00 75.03  ? 420 HOH C O   1 
HETATM 4235 O O   . HOH F 3 .   ? 12.352  0.256   4.888   1.00 74.90  ? 421 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 9   ? 1.6458 1.5634 2.0410 0.4194  -0.0550 -0.2921 24  ILE A N   
2    C CA  . ILE A 9   ? 1.6116 1.5801 2.0562 0.3728  -0.0019 -0.2687 24  ILE A CA  
3    C C   . ILE A 9   ? 1.4843 1.6037 2.0959 0.3416  0.0379  -0.2690 24  ILE A C   
4    O O   . ILE A 9   ? 1.4028 1.5383 2.0545 0.2803  0.0582  -0.2429 24  ILE A O   
5    C CB  . ILE A 9   ? 1.6828 1.6254 2.0638 0.4128  0.0272  -0.2737 24  ILE A CB  
6    C CG1 . ILE A 9   ? 1.7956 1.5689 2.0092 0.3961  -0.0092 -0.2546 24  ILE A CG1 
7    C CG2 . ILE A 9   ? 1.5836 1.6395 2.0657 0.3820  0.0921  -0.2566 24  ILE A CG2 
8    C CD1 . ILE A 9   ? 1.7131 1.4619 1.9282 0.3090  -0.0098 -0.2086 24  ILE A CD1 
9    N N   . PRO A 10  ? 1.4075 1.6355 2.1185 0.3827  0.0453  -0.2960 25  PRO A N   
10   C CA  . PRO A 10  ? 1.1836 1.5319 2.0441 0.3410  0.0654  -0.2944 25  PRO A CA  
11   C C   . PRO A 10  ? 1.0792 1.3873 1.9320 0.3033  0.0266  -0.2959 25  PRO A C   
12   O O   . PRO A 10  ? 1.1226 1.3646 1.9000 0.3297  -0.0203 -0.3083 25  PRO A O   
13   C CB  . PRO A 10  ? 1.2046 1.6716 2.1640 0.3938  0.0682  -0.3188 25  PRO A CB  
14   C CG  . PRO A 10  ? 1.3838 1.7763 2.2362 0.4677  0.0361  -0.3387 25  PRO A CG  
15   C CD  . PRO A 10  ? 1.4432 1.6994 2.1476 0.4647  0.0391  -0.3241 25  PRO A CD  
16   N N   . THR A 11  ? 0.9168 1.2610 1.8406 0.2462  0.0465  -0.2826 26  THR A N   
17   C CA  . THR A 11  ? 0.8581 1.1554 1.7559 0.2118  0.0208  -0.2802 26  THR A CA  
18   C C   . THR A 11  ? 0.8450 1.1513 1.7454 0.2367  -0.0275 -0.3109 26  THR A C   
19   O O   . THR A 11  ? 0.8556 1.0910 1.6731 0.2326  -0.0596 -0.3078 26  THR A O   
20   C CB  . THR A 11  ? 0.8159 1.1581 1.8022 0.1582  0.0523  -0.2684 26  THR A CB  
21   O OG1 . THR A 11  ? 0.7875 1.1474 1.7975 0.1386  0.0979  -0.2404 26  THR A OG1 
22   C CG2 . THR A 11  ? 0.7285 1.0037 1.6552 0.1293  0.0403  -0.2551 26  THR A CG2 
23   N N   . SER A 12  ? 0.8742 1.2743 1.8715 0.2608  -0.0333 -0.3356 27  SER A N   
24   C CA  . SER A 12  ? 0.9089 1.3270 1.9165 0.2851  -0.0841 -0.3637 27  SER A CA  
25   C C   . SER A 12  ? 0.9747 1.3113 1.8652 0.3349  -0.1230 -0.3668 27  SER A C   
26   O O   . SER A 12  ? 0.9992 1.2865 1.8288 0.3386  -0.1675 -0.3742 27  SER A O   
27   C CB  . SER A 12  ? 0.8216 1.3699 1.9683 0.3003  -0.0837 -0.3807 27  SER A CB  
28   O OG  . SER A 12  ? 0.8392 1.4322 2.0028 0.3459  -0.0564 -0.3739 27  SER A OG  
29   N N   . ALA A 13  ? 0.9806 1.2963 1.8320 0.3745  -0.1076 -0.3605 28  ALA A N   
30   C CA  . ALA A 13  ? 1.0927 1.3085 1.8219 0.4231  -0.1469 -0.3626 28  ALA A CA  
31   C C   . ALA A 13  ? 1.1624 1.2495 1.7639 0.3867  -0.1642 -0.3349 28  ALA A C   
32   O O   . ALA A 13  ? 1.2927 1.2914 1.7954 0.4059  -0.2123 -0.3312 28  ALA A O   
33   C CB  . ALA A 13  ? 1.1514 1.3655 1.8600 0.4784  -0.1238 -0.3666 28  ALA A CB  
34   N N   . LEU A 14  ? 1.0525 1.1347 1.6617 0.3329  -0.1264 -0.3100 29  LEU A N   
35   C CA  . LEU A 14  ? 1.0427 1.0254 1.5498 0.2932  -0.1378 -0.2741 29  LEU A CA  
36   C C   . LEU A 14  ? 1.0539 1.0261 1.5396 0.2738  -0.1684 -0.2704 29  LEU A C   
37   O O   . LEU A 14  ? 1.2111 1.0973 1.5933 0.2680  -0.2035 -0.2457 29  LEU A O   
38   C CB  . LEU A 14  ? 1.0579 1.0573 1.5966 0.2434  -0.0885 -0.2459 29  LEU A CB  
39   C CG  . LEU A 14  ? 1.1432 1.0625 1.5974 0.1977  -0.0951 -0.1991 29  LEU A CG  
40   C CD1 . LEU A 14  ? 1.2301 1.0343 1.5599 0.2110  -0.1288 -0.1806 29  LEU A CD1 
41   C CD2 . LEU A 14  ? 1.0289 0.9903 1.5432 0.1514  -0.0454 -0.1733 29  LEU A CD2 
42   N N   . VAL A 15  ? 0.9508 1.0078 1.5295 0.2630  -0.1571 -0.2934 30  VAL A N   
43   C CA  . VAL A 15  ? 1.0219 1.0731 1.5752 0.2502  -0.1826 -0.2970 30  VAL A CA  
44   C C   . VAL A 15  ? 1.1208 1.1408 1.6166 0.2910  -0.2408 -0.3123 30  VAL A C   
45   O O   . VAL A 15  ? 1.2451 1.2054 1.6491 0.2848  -0.2708 -0.2924 30  VAL A O   
46   C CB  . VAL A 15  ? 0.9670 1.1013 1.6253 0.2313  -0.1637 -0.3252 30  VAL A CB  
47   C CG1 . VAL A 15  ? 0.9228 1.0451 1.5391 0.2307  -0.1970 -0.3396 30  VAL A CG1 
48   C CG2 . VAL A 15  ? 0.8947 1.0441 1.5970 0.1896  -0.1106 -0.3045 30  VAL A CG2 
49   N N   . LYS A 16  ? 1.0348 1.1021 1.5879 0.3337  -0.2557 -0.3426 31  LYS A N   
50   C CA  . LYS A 16  ? 1.0925 1.1349 1.6010 0.3804  -0.3127 -0.3566 31  LYS A CA  
51   C C   . LYS A 16  ? 1.2125 1.1306 1.5848 0.3934  -0.3432 -0.3264 31  LYS A C   
52   O O   . LYS A 16  ? 1.2829 1.1481 1.5794 0.4062  -0.3930 -0.3190 31  LYS A O   
53   C CB  . LYS A 16  ? 1.0580 1.1794 1.6579 0.4309  -0.3153 -0.3857 31  LYS A CB  
54   C CG  . LYS A 16  ? 0.9942 1.2411 1.7323 0.4176  -0.3077 -0.4123 31  LYS A CG  
55   C CD  . LYS A 16  ? 1.1603 1.5009 1.9944 0.4702  -0.3133 -0.4304 31  LYS A CD  
56   C CE  . LYS A 16  ? 1.3608 1.6692 2.1410 0.5283  -0.3743 -0.4392 31  LYS A CE  
57   N NZ  . LYS A 16  ? 1.4446 1.7604 2.2184 0.5103  -0.4265 -0.4511 31  LYS A NZ  
58   N N   . GLU A 17  ? 1.2788 1.1453 1.6160 0.3870  -0.3176 -0.3067 32  GLU A N   
59   C CA  . GLU A 17  ? 1.4748 1.2086 1.6793 0.3892  -0.3513 -0.2749 32  GLU A CA  
60   C C   . GLU A 17  ? 1.5776 1.2639 1.7141 0.3313  -0.3588 -0.2290 32  GLU A C   
61   O O   . GLU A 17  ? 1.6658 1.2718 1.7065 0.3312  -0.4075 -0.2036 32  GLU A O   
62   C CB  . GLU A 17  ? 1.4833 1.1721 1.6640 0.3956  -0.3248 -0.2692 32  GLU A CB  
63   C CG  . GLU A 17  ? 1.6873 1.2250 1.7261 0.3811  -0.3628 -0.2317 32  GLU A CG  
64   C CD  . GLU A 17  ? 1.8257 1.3086 1.8268 0.3886  -0.3418 -0.2313 32  GLU A CD  
65   O OE1 . GLU A 17  ? 1.7780 1.3500 1.8652 0.4077  -0.2914 -0.2576 32  GLU A OE1 
66   O OE2 . GLU A 17  ? 1.9598 1.3082 1.8408 0.3732  -0.3786 -0.2024 32  GLU A OE2 
67   N N   . THR A 18  ? 1.4790 1.2200 1.6683 0.2841  -0.3095 -0.2145 33  THR A N   
68   C CA  . THR A 18  ? 1.4380 1.1557 1.5776 0.2329  -0.3045 -0.1657 33  THR A CA  
69   C C   . THR A 18  ? 1.4772 1.2046 1.5812 0.2363  -0.3343 -0.1636 33  THR A C   
70   O O   . THR A 18  ? 1.5054 1.1829 1.5260 0.2110  -0.3553 -0.1155 33  THR A O   
71   C CB  . THR A 18  ? 1.3834 1.1733 1.6026 0.1940  -0.2428 -0.1575 33  THR A CB  
72   O OG1 . THR A 18  ? 1.4443 1.2416 1.7078 0.1956  -0.2133 -0.1662 33  THR A OG1 
73   C CG2 . THR A 18  ? 1.3777 1.1426 1.5442 0.1461  -0.2342 -0.0959 33  THR A CG2 
74   N N   . LEU A 19  ? 1.4607 1.2550 1.6265 0.2651  -0.3384 -0.2121 34  LEU A N   
75   C CA  . LEU A 19  ? 1.4613 1.2638 1.5866 0.2738  -0.3714 -0.2179 34  LEU A CA  
76   C C   . LEU A 19  ? 1.5199 1.2361 1.5408 0.2949  -0.4340 -0.1945 34  LEU A C   
77   O O   . LEU A 19  ? 1.6199 1.3067 1.5601 0.2782  -0.4553 -0.1589 34  LEU A O   
78   C CB  . LEU A 19  ? 1.4195 1.3022 1.6325 0.2998  -0.3761 -0.2765 34  LEU A CB  
79   C CG  . LEU A 19  ? 1.3708 1.3218 1.6490 0.2742  -0.3355 -0.2978 34  LEU A CG  
80   C CD1 . LEU A 19  ? 1.3451 1.3677 1.7209 0.2930  -0.3495 -0.3530 34  LEU A CD1 
81   C CD2 . LEU A 19  ? 1.4422 1.3755 1.6356 0.2598  -0.3394 -0.2779 34  LEU A CD2 
82   N N   . ALA A 20  ? 1.9599 1.1271 1.6612 0.1458  -0.5918 -0.2962 35  ALA A N   
83   C CA  . ALA A 20  ? 2.0162 1.0830 1.6168 0.1955  -0.6038 -0.2700 35  ALA A CA  
84   C C   . ALA A 20  ? 2.2978 1.2452 1.8620 0.1760  -0.5374 -0.2482 35  ALA A C   
85   O O   . ALA A 20  ? 2.4385 1.2563 1.8730 0.1901  -0.5213 -0.2242 35  ALA A O   
86   C CB  . ALA A 20  ? 1.9719 1.1180 1.6448 0.2432  -0.6506 -0.2743 35  ALA A CB  
87   N N   . LEU A 21  ? 1.9357 0.9328 1.6136 0.1386  -0.5012 -0.2536 36  LEU A N   
88   C CA  . LEU A 21  ? 2.2115 1.1147 1.8704 0.1088  -0.4386 -0.2311 36  LEU A CA  
89   C C   . LEU A 21  ? 2.3470 1.1556 1.9308 0.0769  -0.3884 -0.2158 36  LEU A C   
90   O O   . LEU A 21  ? 2.4905 1.1756 1.9878 0.0736  -0.3483 -0.1915 36  LEU A O   
91   C CB  . LEU A 21  ? 1.9944 0.9965 1.7996 0.0588  -0.4144 -0.2358 36  LEU A CB  
92   C CG  . LEU A 21  ? 1.9492 0.9932 1.8074 0.0688  -0.4280 -0.2455 36  LEU A CG  
93   C CD1 . LEU A 21  ? 1.9368 1.0703 1.8292 0.1189  -0.4915 -0.2721 36  LEU A CD1 
94   C CD2 . LEU A 21  ? 1.8317 0.9697 1.8181 -0.0020 -0.3982 -0.2428 36  LEU A CD2 
95   N N   . LEU A 22  ? 2.2857 1.1492 1.9035 0.0519  -0.3863 -0.2321 37  LEU A N   
96   C CA  . LEU A 22  ? 2.2733 1.0532 1.8339 0.0175  -0.3290 -0.2248 37  LEU A CA  
97   C C   . LEU A 22  ? 2.4000 1.0430 1.7736 0.0445  -0.3335 -0.2152 37  LEU A C   
98   O O   . LEU A 22  ? 2.4399 0.9707 1.7366 0.0226  -0.2770 -0.1985 37  LEU A O   
99   C CB  . LEU A 22  ? 2.1702 1.0352 1.8054 -0.0122 -0.3255 -0.2511 37  LEU A CB  
100  C CG  . LEU A 22  ? 2.0531 0.9288 1.7938 -0.0674 -0.2505 -0.2410 37  LEU A CG  
101  C CD1 . LEU A 22  ? 2.0321 0.9813 1.8377 -0.0896 -0.2492 -0.2710 37  LEU A CD1 
102  C CD2 . LEU A 22  ? 2.1059 0.8345 1.7451 -0.0837 -0.1814 -0.2194 37  LEU A CD2 
103  N N   . SER A 23  ? 2.4466 1.1054 1.7518 0.0897  -0.4020 -0.2212 38  SER A N   
104  C CA  . SER A 23  ? 2.6206 1.1671 1.7506 0.1134  -0.4191 -0.2042 38  SER A CA  
105  C C   . SER A 23  ? 2.6521 1.0893 1.7119 0.1450  -0.4090 -0.1688 38  SER A C   
106  O O   . SER A 23  ? 2.7356 1.0511 1.6534 0.1481  -0.3949 -0.1461 38  SER A O   
107  C CB  . SER A 23  ? 2.6653 1.2819 1.7589 0.1478  -0.5010 -0.2122 38  SER A CB  
108  O OG  . SER A 23  ? 2.6092 1.3095 1.7935 0.1944  -0.5506 -0.2088 38  SER A OG  
109  N N   . THR A 24  ? 2.6096 1.0875 1.7654 0.1638  -0.4136 -0.1656 39  THR A N   
110  C CA  . THR A 24  ? 2.7352 1.1083 1.8351 0.1909  -0.3984 -0.1369 39  THR A CA  
111  C C   . THR A 24  ? 2.8004 1.0705 1.8634 0.1460  -0.3225 -0.1204 39  THR A C   
112  O O   . THR A 24  ? 2.8863 1.0251 1.8286 0.1581  -0.3038 -0.0928 39  THR A O   
113  C CB  . THR A 24  ? 2.5760 1.0190 1.7894 0.2124  -0.4135 -0.1464 39  THR A CB  
114  O OG1 . THR A 24  ? 2.5293 1.0639 1.7786 0.2604  -0.4822 -0.1576 39  THR A OG1 
115  C CG2 . THR A 24  ? 2.6046 0.9254 1.7576 0.2342  -0.3867 -0.1212 39  THR A CG2 
116  N N   . HIS A 25  ? 2.6616 0.9964 1.8348 0.0933  -0.2798 -0.1323 40  HIS A N   
117  C CA  . HIS A 25  ? 2.7020 0.9625 1.8708 0.0470  -0.2071 -0.1110 40  HIS A CA  
118  C C   . HIS A 25  ? 2.7668 0.9763 1.8826 0.0140  -0.1616 -0.1101 40  HIS A C   
119  O O   . HIS A 25  ? 2.6825 0.8913 1.8632 -0.0333 -0.0996 -0.0988 40  HIS A O   
120  C CB  . HIS A 25  ? 2.6115 0.9743 1.9412 0.0033  -0.1828 -0.1117 40  HIS A CB  
121  C CG  . HIS A 25  ? 2.7074 1.1081 2.0812 0.0219  -0.2120 -0.1174 40  HIS A CG  
122  N ND1 . HIS A 25  ? 2.8076 1.1207 2.1375 0.0147  -0.1830 -0.0986 40  HIS A ND1 
123  C CD2 . HIS A 25  ? 2.6410 1.1533 2.0970 0.0439  -0.2617 -0.1429 40  HIS A CD2 
124  C CE1 . HIS A 25  ? 2.7293 1.0934 2.1107 0.0301  -0.2093 -0.1154 40  HIS A CE1 
125  N NE2 . HIS A 25  ? 2.6356 1.1225 2.0959 0.0493  -0.2572 -0.1419 40  HIS A NE2 
126  N N   . ARG A 26  ? 2.9064 1.0748 1.9060 0.0354  -0.1901 -0.1202 41  ARG A N   
127  C CA  . ARG A 26  ? 2.9675 1.0739 1.8932 0.0006  -0.1433 -0.1272 41  ARG A CA  
128  C C   . ARG A 26  ? 2.9864 0.9601 1.8338 -0.0232 -0.0740 -0.0984 41  ARG A C   
129  O O   . ARG A 26  ? 2.8737 0.8458 1.7928 -0.0669 -0.0045 -0.0938 41  ARG A O   
130  C CB  . ARG A 26  ? 3.1469 1.2215 1.9300 0.0221  -0.1928 -0.1384 41  ARG A CB  
131  C CG  . ARG A 26  ? 3.1326 1.3314 1.9757 0.0259  -0.2450 -0.1722 41  ARG A CG  
132  C CD  . ARG A 26  ? 3.3253 1.4793 2.0061 0.0275  -0.2819 -0.1779 41  ARG A CD  
133  N NE  . ARG A 26  ? 3.2913 1.5633 2.0117 0.0321  -0.3426 -0.2062 41  ARG A NE  
134  C CZ  . ARG A 26  ? 3.3851 1.6488 1.9809 0.0202  -0.3799 -0.2155 41  ARG A CZ  
135  N NH1 . ARG A 26  ? 3.5551 1.6979 1.9767 0.0015  -0.3620 -0.1990 41  ARG A NH1 
136  N NH2 . ARG A 26  ? 3.2976 1.6771 1.9387 0.0210  -0.4357 -0.2401 41  ARG A NH2 
137  N N   . THR A 27  ? 3.1451 1.0106 1.8512 0.0067  -0.0935 -0.0747 42  THR A N   
138  C CA  . THR A 27  ? 3.2619 0.9898 1.8668 -0.0125 -0.0354 -0.0460 42  THR A CA  
139  C C   . THR A 27  ? 3.1280 0.9284 1.8766 -0.0439 0.0224  -0.0264 42  THR A C   
140  O O   . THR A 27  ? 3.0809 0.8774 1.8379 -0.0771 0.0875  -0.0099 42  THR A O   
141  C CB  . THR A 27  ? 3.4331 1.0598 1.8978 0.0320  -0.0762 -0.0170 42  THR A CB  
142  O OG1 . THR A 27  ? 3.5287 1.1855 1.9254 0.0676  -0.1490 -0.0246 42  THR A OG1 
143  C CG2 . THR A 27  ? 3.5905 1.0698 1.9138 0.0093  -0.0228 0.0089  42  THR A CG2 
144  N N   . LEU A 28  ? 3.0450 0.9414 1.9181 -0.0354 -0.0047 -0.0279 43  LEU A N   
145  C CA  . LEU A 28  ? 2.9237 0.9198 1.9400 -0.0704 0.0368  -0.0070 43  LEU A CA  
146  C C   . LEU A 28  ? 2.8184 0.9046 1.9665 -0.1179 0.0910  -0.0025 43  LEU A C   
147  O O   . LEU A 28  ? 2.8320 0.9530 2.0366 -0.1481 0.1406  0.0257  43  LEU A O   
148  C CB  . LEU A 28  ? 2.8377 0.9077 1.9452 -0.0596 -0.0059 -0.0168 43  LEU A CB  
149  C CG  . LEU A 28  ? 2.7747 0.9123 1.9782 -0.0928 0.0207  0.0045  43  LEU A CG  
150  C CD1 . LEU A 28  ? 2.8196 0.9405 2.0032 -0.0628 -0.0210 -0.0087 43  LEU A CD1 
151  C CD2 . LEU A 28  ? 2.4946 0.7664 1.8726 -0.1446 0.0425  0.0117  43  LEU A CD2 
152  N N   . LEU A 29  ? 2.7219 0.8480 1.9228 -0.1220 0.0789  -0.0292 44  LEU A N   
153  C CA  . LEU A 29  ? 2.6529 0.8692 1.9966 -0.1615 0.1298  -0.0242 44  LEU A CA  
154  C C   . LEU A 29  ? 2.7747 0.9201 2.0428 -0.1742 0.1892  -0.0247 44  LEU A C   
155  O O   . LEU A 29  ? 2.6448 0.8575 2.0268 -0.2032 0.2443  -0.0077 44  LEU A O   
156  C CB  . LEU A 29  ? 2.5403 0.8199 1.9654 -0.1627 0.0988  -0.0563 44  LEU A CB  
157  C CG  . LEU A 29  ? 2.4744 0.8299 1.9792 -0.1558 0.0399  -0.0621 44  LEU A CG  
158  C CD1 . LEU A 29  ? 2.3385 0.7725 1.8722 -0.1340 -0.0158 -0.1030 44  LEU A CD1 
159  C CD2 . LEU A 29  ? 2.4133 0.9043 2.1112 -0.2003 0.0681  -0.0271 44  LEU A CD2 
160  N N   . ILE A 30  ? 2.7839 1.3600 1.6280 -0.2293 0.5846  0.0460  45  ILE A N   
161  C CA  . ILE A 30  ? 2.8360 1.4909 1.7087 -0.2232 0.6487  0.0453  45  ILE A CA  
162  C C   . ILE A 30  ? 2.9096 1.5850 1.8778 -0.2993 0.6885  0.0716  45  ILE A C   
163  O O   . ILE A 30  ? 2.8813 1.6699 1.9480 -0.3065 0.7263  0.0603  45  ILE A O   
164  C CB  . ILE A 30  ? 2.8530 1.4419 1.5437 -0.1647 0.6886  0.0608  45  ILE A CB  
165  C CG1 . ILE A 30  ? 2.8159 1.4933 1.4947 -0.0842 0.6819  0.0144  45  ILE A CG1 
166  C CG2 . ILE A 30  ? 2.8712 1.4612 1.5410 -0.1891 0.7625  0.0977  45  ILE A CG2 
167  C CD1 . ILE A 30  ? 2.9070 1.5394 1.4111 -0.0189 0.7191  0.0235  45  ILE A CD1 
168  N N   . ALA A 31  ? 3.0052 1.5751 1.9519 -0.3547 0.6766  0.1023  46  ALA A N   
169  C CA  . ALA A 31  ? 3.0657 1.6267 2.0896 -0.4307 0.7138  0.1324  46  ALA A CA  
170  C C   . ALA A 31  ? 3.0801 1.7855 2.2676 -0.4627 0.7467  0.1205  46  ALA A C   
171  O O   . ALA A 31  ? 3.1424 1.9009 2.3173 -0.4452 0.8061  0.1313  46  ALA A O   
172  C CB  . ALA A 31  ? 2.9946 1.4749 2.0522 -0.4875 0.6656  0.1376  46  ALA A CB  
173  N N   . ASN A 32  ? 2.9919 1.7647 2.3299 -0.5058 0.7079  0.0989  47  ASN A N   
174  C CA  . ASN A 32  ? 2.8714 1.7707 2.3757 -0.5483 0.7350  0.0903  47  ASN A CA  
175  C C   . ASN A 32  ? 2.8919 1.9181 2.4343 -0.4997 0.7699  0.0654  47  ASN A C   
176  O O   . ASN A 32  ? 2.8541 1.9523 2.4367 -0.4526 0.7370  0.0266  47  ASN A O   
177  C CB  . ASN A 32  ? 2.5899 1.5494 2.2423 -0.5867 0.6788  0.0666  47  ASN A CB  
178  C CG  . ASN A 32  ? 2.4000 1.4708 2.2224 -0.6432 0.7058  0.0634  47  ASN A CG  
179  O OD1 . ASN A 32  ? 2.4551 1.5360 2.2824 -0.6686 0.7660  0.0859  47  ASN A OD1 
180  N ND2 . ASN A 32  ? 2.1883 1.3467 2.1517 -0.6609 0.6628  0.0388  47  ASN A ND2 
181  N N   . GLU A 33  ? 2.9600 2.0173 2.4971 -0.5100 0.8369  0.0875  48  GLU A N   
182  C CA  . GLU A 33  ? 2.9165 2.1010 2.4852 -0.4615 0.8741  0.0609  48  GLU A CA  
183  C C   . GLU A 33  ? 2.7833 2.1102 2.5473 -0.5000 0.8801  0.0365  48  GLU A C   
184  O O   . GLU A 33  ? 2.7406 2.1914 2.5682 -0.4602 0.8955  -0.0006 48  GLU A O   
185  C CB  . GLU A 33  ? 3.0718 2.2298 2.5214 -0.4391 0.9461  0.0992  48  GLU A CB  
186  C CG  . GLU A 33  ? 3.1594 2.2002 2.4122 -0.3822 0.9456  0.1175  48  GLU A CG  
187  C CD  . GLU A 33  ? 3.0720 2.1670 2.2815 -0.2983 0.9155  0.0646  48  GLU A CD  
188  O OE1 . GLU A 33  ? 2.9425 2.1788 2.2591 -0.2728 0.9179  0.0179  48  GLU A OE1 
189  O OE2 . GLU A 33  ? 3.1182 2.1154 2.1933 -0.2576 0.8889  0.0673  48  GLU A OE2 
190  N N   . THR A 34  ? 2.6913 2.0030 2.5535 -0.5759 0.8668  0.0538  49  THR A N   
191  C CA  . THR A 34  ? 2.4484 1.8895 2.5004 -0.6159 0.8648  0.0313  49  THR A CA  
192  C C   . THR A 34  ? 2.1952 1.7060 2.3378 -0.5843 0.8049  -0.0143 49  THR A C   
193  O O   . THR A 34  ? 2.0911 1.7334 2.3777 -0.5801 0.8058  -0.0467 49  THR A O   
194  C CB  . THR A 34  ? 2.4314 1.8342 2.5626 -0.7035 0.8597  0.0590  49  THR A CB  
195  O OG1 . THR A 34  ? 2.5750 1.8860 2.6170 -0.7331 0.9113  0.1083  49  THR A OG1 
196  C CG2 . THR A 34  ? 2.2912 1.8341 2.6120 -0.7442 0.8695  0.0402  49  THR A CG2 
197  N N   . LEU A 35  ? 2.1236 1.5456 2.1836 -0.5599 0.7546  -0.0143 50  LEU A N   
198  C CA  . LEU A 35  ? 1.9514 1.4258 2.0886 -0.5275 0.6974  -0.0462 50  LEU A CA  
199  C C   . LEU A 35  ? 1.8522 1.4243 2.0241 -0.4590 0.7063  -0.0881 50  LEU A C   
200  O O   . LEU A 35  ? 1.8432 1.3801 1.8886 -0.4050 0.7260  -0.0950 50  LEU A O   
201  C CB  . LEU A 35  ? 1.9024 1.2561 1.9195 -0.5082 0.6478  -0.0331 50  LEU A CB  
202  C CG  . LEU A 35  ? 1.8286 1.2234 1.9216 -0.4811 0.5855  -0.0517 50  LEU A CG  
203  C CD1 . LEU A 35  ? 1.6845 1.1658 1.9532 -0.5335 0.5651  -0.0522 50  LEU A CD1 
204  C CD2 . LEU A 35  ? 1.8766 1.1471 1.8301 -0.4613 0.5420  -0.0355 50  LEU A CD2 
205  N N   . ARG A 36  ? 1.7071 1.4053 2.0581 -0.4601 0.6912  -0.1181 51  ARG A N   
206  C CA  . ARG A 36  ? 1.6687 1.4699 2.0907 -0.3981 0.6934  -0.1661 51  ARG A CA  
207  C C   . ARG A 36  ? 1.5537 1.3964 2.0888 -0.3747 0.6380  -0.1827 51  ARG A C   
208  O O   . ARG A 36  ? 1.4266 1.3298 2.1088 -0.4123 0.6177  -0.1764 51  ARG A O   
209  C CB  . ARG A 36  ? 1.6487 1.5811 2.2049 -0.4146 0.7351  -0.1906 51  ARG A CB  
210  C CG  . ARG A 36  ? 1.7871 1.7022 2.2445 -0.4285 0.7968  -0.1719 51  ARG A CG  
211  C CD  . ARG A 36  ? 1.8701 1.7526 2.1711 -0.3569 0.8183  -0.1864 51  ARG A CD  
212  N NE  . ARG A 36  ? 1.9654 1.9016 2.2283 -0.3494 0.8821  -0.1843 51  ARG A NE  
213  C CZ  . ARG A 36  ? 2.0736 1.9289 2.2064 -0.3725 0.9256  -0.1325 51  ARG A CZ  
214  N NH1 . ARG A 36  ? 2.1475 1.8585 2.1790 -0.4070 0.9094  -0.0846 51  ARG A NH1 
215  N NH2 . ARG A 36  ? 2.1128 2.0354 2.2223 -0.3585 0.9860  -0.1279 51  ARG A NH2 
216  N N   . ILE A 37  ? 1.5753 1.3892 2.0445 -0.3103 0.6152  -0.2011 52  ILE A N   
217  C CA  . ILE A 37  ? 1.5036 1.3545 2.0777 -0.2811 0.5664  -0.2104 52  ILE A CA  
218  C C   . ILE A 37  ? 1.3665 1.3054 2.0234 -0.2152 0.5686  -0.2639 52  ILE A C   
219  O O   . ILE A 37  ? 1.3281 1.2401 1.8698 -0.1682 0.5865  -0.2889 52  ILE A O   
220  C CB  . ILE A 37  ? 1.5771 1.3075 2.0116 -0.2642 0.5259  -0.1797 52  ILE A CB  
221  C CG1 . ILE A 37  ? 1.6745 1.2790 1.9343 -0.3040 0.5408  -0.1436 52  ILE A CG1 
222  C CG2 . ILE A 37  ? 1.2527 1.0162 1.8061 -0.2755 0.4784  -0.1590 52  ILE A CG2 
223  C CD1 . ILE A 37  ? 1.5378 1.0195 1.6449 -0.2820 0.5036  -0.1201 52  ILE A CD1 
224  N N   . PRO A 38  ? 1.3194 1.3677 2.1841 -0.2099 0.5505  -0.2828 53  PRO A N   
225  C CA  . PRO A 38  ? 1.2155 1.3576 2.2053 -0.1507 0.5474  -0.3378 53  PRO A CA  
226  C C   . PRO A 38  ? 1.2126 1.2928 2.0900 -0.0842 0.5277  -0.3542 53  PRO A C   
227  O O   . PRO A 38  ? 1.1339 1.1324 1.9358 -0.0772 0.4941  -0.3170 53  PRO A O   
228  C CB  . PRO A 38  ? 1.1059 1.3329 2.3168 -0.1635 0.5190  -0.3270 53  PRO A CB  
229  C CG  . PRO A 38  ? 1.1808 1.3523 2.3536 -0.2225 0.5023  -0.2655 53  PRO A CG  
230  C CD  . PRO A 38  ? 1.2709 1.3671 2.2785 -0.2628 0.5340  -0.2530 53  PRO A CD  
231  N N   . VAL A 39  ? 1.1620 1.4827 1.3815 -0.2342 0.2629  0.0630  54  VAL A N   
232  C CA  . VAL A 39  ? 1.1983 1.4332 1.3879 -0.2413 0.2219  0.0772  54  VAL A CA  
233  C C   . VAL A 39  ? 1.3066 1.5076 1.4927 -0.2251 0.2394  0.0480  54  VAL A C   
234  O O   . VAL A 39  ? 1.4171 1.6235 1.5520 -0.2517 0.2646  0.0218  54  VAL A O   
235  C CB  . VAL A 39  ? 1.2415 1.4269 1.3387 -0.3019 0.1843  0.0935  54  VAL A CB  
236  C CG1 . VAL A 39  ? 1.1494 1.2471 1.2304 -0.3036 0.1341  0.0992  54  VAL A CG1 
237  C CG2 . VAL A 39  ? 1.2240 1.4378 1.3266 -0.3196 0.1653  0.1225  54  VAL A CG2 
238  N N   . PRO A 40  ? 1.2455 1.4098 1.4845 -0.1849 0.2300  0.0493  55  PRO A N   
239  C CA  . PRO A 40  ? 1.1566 1.2874 1.4060 -0.1636 0.2482  0.0211  55  PRO A CA  
240  C C   . PRO A 40  ? 1.1694 1.2472 1.3446 -0.2036 0.2298  0.0056  55  PRO A C   
241  O O   . PRO A 40  ? 1.1364 1.1726 1.2629 -0.2385 0.1845  0.0230  55  PRO A O   
242  C CB  . PRO A 40  ? 1.1607 1.2477 1.4680 -0.1294 0.2326  0.0322  55  PRO A CB  
243  C CG  . PRO A 40  ? 1.1683 1.2901 1.5090 -0.1174 0.2255  0.0607  55  PRO A CG  
244  C CD  . PRO A 40  ? 1.2312 1.3849 1.5249 -0.1602 0.2075  0.0749  55  PRO A CD  
245  N N   . VAL A 41  ? 1.1865 1.2614 1.3526 -0.1974 0.2606  -0.0280 56  VAL A N   
246  C CA  . VAL A 41  ? 1.2171 1.2395 1.3055 -0.2347 0.2451  -0.0468 56  VAL A CA  
247  C C   . VAL A 41  ? 1.2222 1.1780 1.3401 -0.2145 0.2183  -0.0574 56  VAL A C   
248  O O   . VAL A 41  ? 1.2445 1.1472 1.3049 -0.2403 0.1933  -0.0735 56  VAL A O   
249  C CB  . VAL A 41  ? 1.2910 1.3493 1.3487 -0.2476 0.2965  -0.0853 56  VAL A CB  
250  C CG1 . VAL A 41  ? 1.2772 1.3706 1.2589 -0.3006 0.3117  -0.0841 56  VAL A CG1 
251  C CG2 . VAL A 41  ? 1.2136 1.3266 1.3679 -0.1929 0.3429  -0.1058 56  VAL A CG2 
252  N N   . HIS A 42  ? 1.2302 1.1854 1.4344 -0.1708 0.2241  -0.0512 57  HIS A N   
253  C CA  . HIS A 42  ? 1.2639 1.1592 1.5092 -0.1546 0.2051  -0.0660 57  HIS A CA  
254  C C   . HIS A 42  ? 1.1734 1.0487 1.4681 -0.1490 0.1719  -0.0444 57  HIS A C   
255  O O   . HIS A 42  ? 1.1350 1.0436 1.4308 -0.1541 0.1643  -0.0152 57  HIS A O   
256  C CB  . HIS A 42  ? 1.3262 1.2226 1.6259 -0.1135 0.2524  -0.0900 57  HIS A CB  
257  C CG  . HIS A 42  ? 1.3193 1.2518 1.6694 -0.0764 0.2840  -0.0725 57  HIS A CG  
258  N ND1 . HIS A 42  ? 1.2602 1.1707 1.6555 -0.0584 0.2768  -0.0525 57  HIS A ND1 
259  C CD2 . HIS A 42  ? 1.2955 1.2801 1.6568 -0.0543 0.3195  -0.0754 57  HIS A CD2 
260  C CE1 . HIS A 42  ? 1.2507 1.1901 1.6690 -0.0270 0.3031  -0.0386 57  HIS A CE1 
261  N NE2 . HIS A 42  ? 1.2498 1.2360 1.6551 -0.0208 0.3259  -0.0531 57  HIS A NE2 
262  N N   . LYS A 43  ? 1.1160 0.9401 1.4578 -0.1406 0.1546  -0.0644 58  LYS A N   
263  C CA  . LYS A 43  ? 1.1454 0.9503 1.5434 -0.1411 0.1252  -0.0560 58  LYS A CA  
264  C C   . LYS A 43  ? 1.0966 0.8874 1.5678 -0.1110 0.1646  -0.0663 58  LYS A C   
265  O O   . LYS A 43  ? 1.0605 0.8223 1.5893 -0.1149 0.1491  -0.0791 58  LYS A O   
266  C CB  . LYS A 43  ? 1.3487 1.1023 1.7472 -0.1658 0.0614  -0.0762 58  LYS A CB  
267  C CG  . LYS A 43  ? 1.5058 1.2522 1.8096 -0.2014 0.0157  -0.0597 58  LYS A CG  
268  C CD  . LYS A 43  ? 1.6144 1.2958 1.9128 -0.2220 -0.0608 -0.0790 58  LYS A CD  
269  C CE  . LYS A 43  ? 1.7474 1.4017 1.9254 -0.2620 -0.1078 -0.0578 58  LYS A CE  
270  N NZ  . LYS A 43  ? 1.8486 1.4254 2.0112 -0.2799 -0.1966 -0.0744 58  LYS A NZ  
271  N N   . ASN A 44  ? 1.1482 0.9548 1.6154 -0.0834 0.2153  -0.0638 59  ASN A N   
272  C CA  . ASN A 44  ? 1.1492 0.9333 1.6593 -0.0570 0.2534  -0.0622 59  ASN A CA  
273  C C   . ASN A 44  ? 1.0680 0.8853 1.5765 -0.0525 0.2533  -0.0251 59  ASN A C   
274  O O   . ASN A 44  ? 1.0308 0.8752 1.5228 -0.0284 0.2775  -0.0063 59  ASN A O   
275  C CB  . ASN A 44  ? 1.2686 1.0458 1.7706 -0.0266 0.2978  -0.0727 59  ASN A CB  
276  C CG  . ASN A 44  ? 1.3432 1.0950 1.8440 -0.0315 0.3002  -0.1112 59  ASN A CG  
277  O OD1 . ASN A 44  ? 1.2228 0.9956 1.7000 -0.0206 0.3196  -0.1216 59  ASN A OD1 
278  N ND2 . ASN A 44  ? 1.3659 1.0752 1.8990 -0.0482 0.2798  -0.1379 59  ASN A ND2 
279  N N   . HIS A 45  ? 1.0110 0.8268 1.5428 -0.0747 0.2218  -0.0187 60  HIS A N   
280  C CA  . HIS A 45  ? 0.9453 0.7977 1.4754 -0.0770 0.2140  0.0146  60  HIS A CA  
281  C C   . HIS A 45  ? 0.9328 0.7726 1.4666 -0.0508 0.2525  0.0303  60  HIS A C   
282  O O   . HIS A 45  ? 1.0143 0.8939 1.5287 -0.0383 0.2544  0.0590  60  HIS A O   
283  C CB  . HIS A 45  ? 0.9853 0.8284 1.5552 -0.1051 0.1749  0.0089  60  HIS A CB  
284  C CG  . HIS A 45  ? 1.1212 0.9562 1.6830 -0.1300 0.1239  -0.0063 60  HIS A CG  
285  N ND1 . HIS A 45  ? 1.1655 1.0319 1.6744 -0.1481 0.0906  0.0168  60  HIS A ND1 
286  C CD2 . HIS A 45  ? 1.1681 0.9593 1.7628 -0.1412 0.0967  -0.0433 60  HIS A CD2 
287  C CE1 . HIS A 45  ? 1.1748 1.0072 1.6711 -0.1698 0.0422  -0.0007 60  HIS A CE1 
288  N NE2 . HIS A 45  ? 1.2519 1.0416 1.8048 -0.1634 0.0414  -0.0385 60  HIS A NE2 
289  N N   . GLN A 46  ? 0.8477 0.6257 1.4017 -0.0444 0.2816  0.0099  61  GLN A N   
290  C CA  . GLN A 46  ? 0.9543 0.6939 1.4953 -0.0277 0.3150  0.0251  61  GLN A CA  
291  C C   . GLN A 46  ? 1.0063 0.7547 1.5066 0.0105  0.3309  0.0464  61  GLN A C   
292  O O   . GLN A 46  ? 1.0104 0.7270 1.4846 0.0282  0.3457  0.0670  61  GLN A O   
293  C CB  . GLN A 46  ? 1.0834 0.7440 1.6472 -0.0378 0.3473  -0.0063 61  GLN A CB  
294  C CG  . GLN A 46  ? 1.0756 0.7315 1.7016 -0.0732 0.3297  -0.0409 61  GLN A CG  
295  C CD  . GLN A 46  ? 1.2457 0.8284 1.9042 -0.0888 0.3703  -0.0791 61  GLN A CD  
296  O OE1 . GLN A 46  ? 1.3501 0.8782 1.9669 -0.0790 0.4127  -0.0696 61  GLN A OE1 
297  N NE2 . GLN A 46  ? 1.2726 0.8814 1.9822 -0.1068 0.3449  -0.1210 61  GLN A NE2 
298  N N   . LEU A 47  ? 1.0249 0.8131 1.5197 0.0221  0.3254  0.0378  62  LEU A N   
299  C CA  . LEU A 47  ? 1.0028 0.8164 1.4794 0.0583  0.3351  0.0484  62  LEU A CA  
300  C C   . LEU A 47  ? 0.9563 0.8464 1.4279 0.0598  0.3135  0.0723  62  LEU A C   
301  O O   . LEU A 47  ? 0.9270 0.8365 1.3939 0.0919  0.3155  0.0840  62  LEU A O   
302  C CB  . LEU A 47  ? 0.9798 0.8116 1.4606 0.0652  0.3445  0.0200  62  LEU A CB  
303  C CG  . LEU A 47  ? 1.0980 0.8611 1.5862 0.0771  0.3710  -0.0064 62  LEU A CG  
304  C CD1 . LEU A 47  ? 0.9705 0.7670 1.4628 0.0782  0.3769  -0.0363 62  LEU A CD1 
305  C CD2 . LEU A 47  ? 1.1366 0.8434 1.6121 0.1143  0.3904  0.0066  62  LEU A CD2 
306  N N   . CYS A 48  ? 0.8987 0.8285 1.3747 0.0255  0.2895  0.0772  63  CYS A N   
307  C CA  . CYS A 48  ? 0.8915 0.8990 1.3625 0.0189  0.2719  0.0935  63  CYS A CA  
308  C C   . CYS A 48  ? 0.9151 0.9358 1.3919 0.0080  0.2537  0.1200  63  CYS A C   
309  O O   . CYS A 48  ? 0.9779 1.0567 1.4540 -0.0106 0.2344  0.1312  63  CYS A O   
310  C CB  . CYS A 48  ? 0.9120 0.9537 1.3680 -0.0157 0.2569  0.0806  63  CYS A CB  
311  S SG  . CYS A 48  ? 1.1219 1.1405 1.5652 -0.0137 0.2766  0.0442  63  CYS A SG  
312  N N   . THR A 49  ? 0.8851 0.8493 1.3635 0.0157  0.2626  0.1281  64  THR A N   
313  C CA  . THR A 49  ? 0.8484 0.8222 1.3317 0.0025  0.2492  0.1488  64  THR A CA  
314  C C   . THR A 49  ? 0.8932 0.9237 1.3674 0.0253  0.2399  0.1711  64  THR A C   
315  O O   . THR A 49  ? 0.9788 1.0506 1.4621 0.0096  0.2219  0.1863  64  THR A O   
316  C CB  . THR A 49  ? 0.7555 0.6493 1.2316 -0.0004 0.2691  0.1479  64  THR A CB  
317  O OG1 . THR A 49  ? 0.8712 0.7198 1.3091 0.0356  0.2871  0.1590  64  THR A OG1 
318  C CG2 . THR A 49  ? 0.8302 0.6722 1.3298 -0.0218 0.2816  0.1164  64  THR A CG2 
319  N N   . GLU A 50  ? 0.9542 0.9877 1.4187 0.0634  0.2496  0.1686  65  GLU A N   
320  C CA  . GLU A 50  ? 1.0348 1.1271 1.5051 0.0899  0.2367  0.1800  65  GLU A CA  
321  C C   . GLU A 50  ? 0.9705 1.1566 1.4641 0.0694  0.2288  0.1707  65  GLU A C   
322  O O   . GLU A 50  ? 0.8634 1.1085 1.3697 0.0657  0.2143  0.1819  65  GLU A O   
323  C CB  . GLU A 50  ? 1.1733 1.2401 1.6394 0.1391  0.2427  0.1721  65  GLU A CB  
324  C CG  . GLU A 50  ? 1.3297 1.4408 1.8078 0.1744  0.2209  0.1806  65  GLU A CG  
325  C CD  . GLU A 50  ? 1.4344 1.5241 1.9225 0.2265  0.2174  0.1653  65  GLU A CD  
326  O OE1 . GLU A 50  ? 1.4697 1.5558 1.9743 0.2310  0.2363  0.1397  65  GLU A OE1 
327  O OE2 . GLU A 50  ? 1.4233 1.4964 1.9035 0.2639  0.1917  0.1769  65  GLU A OE2 
328  N N   . GLU A 51  ? 0.9638 1.1582 1.4566 0.0524  0.2400  0.1490  66  GLU A N   
329  C CA  . GLU A 51  ? 0.8739 1.1397 1.3680 0.0226  0.2381  0.1386  66  GLU A CA  
330  C C   . GLU A 51  ? 0.8569 1.1312 1.3400 -0.0209 0.2149  0.1571  66  GLU A C   
331  O O   . GLU A 51  ? 0.8369 1.1722 1.3216 -0.0399 0.2074  0.1625  66  GLU A O   
332  C CB  . GLU A 51  ? 0.8878 1.1442 1.3666 0.0096  0.2555  0.1107  66  GLU A CB  
333  C CG  . GLU A 51  ? 1.0065 1.2903 1.5086 0.0446  0.2795  0.0823  66  GLU A CG  
334  C CD  . GLU A 51  ? 1.1404 1.3644 1.6562 0.0932  0.2827  0.0851  66  GLU A CD  
335  O OE1 . GLU A 51  ? 1.1872 1.3379 1.6860 0.0915  0.2891  0.0847  66  GLU A OE1 
336  O OE2 . GLU A 51  ? 1.1650 1.4096 1.7063 0.1322  0.2766  0.0864  66  GLU A OE2 
337  N N   . ILE A 52  ? 0.8955 1.1077 1.3737 -0.0370 0.2033  0.1624  67  ILE A N   
338  C CA  . ILE A 52  ? 0.8891 1.1000 1.3680 -0.0756 0.1742  0.1744  67  ILE A CA  
339  C C   . ILE A 52  ? 0.8320 1.0817 1.3302 -0.0748 0.1625  0.1961  67  ILE A C   
340  O O   . ILE A 52  ? 0.7960 1.0868 1.2924 -0.1021 0.1438  0.2058  67  ILE A O   
341  C CB  . ILE A 52  ? 0.8638 1.0029 1.3558 -0.0876 0.1641  0.1645  67  ILE A CB  
342  C CG1 . ILE A 52  ? 0.9288 1.0343 1.4004 -0.0978 0.1642  0.1417  67  ILE A CG1 
343  C CG2 . ILE A 52  ? 0.8253 0.9640 1.3377 -0.1198 0.1293  0.1729  67  ILE A CG2 
344  C CD1 . ILE A 52  ? 1.0235 1.0611 1.5212 -0.1027 0.1588  0.1220  67  ILE A CD1 
345  N N   . PHE A 53  ? 0.7870 1.0175 1.2963 -0.0455 0.1730  0.2039  68  PHE A N   
346  C CA  . PHE A 53  ? 0.8383 1.0995 1.3612 -0.0441 0.1616  0.2228  68  PHE A CA  
347  C C   . PHE A 53  ? 0.8883 1.2256 1.4173 -0.0252 0.1614  0.2270  68  PHE A C   
348  O O   . PHE A 53  ? 0.8702 1.2470 1.4133 -0.0272 0.1486  0.2404  68  PHE A O   
349  C CB  . PHE A 53  ? 0.8522 1.0529 1.3682 -0.0266 0.1722  0.2289  68  PHE A CB  
350  C CG  . PHE A 53  ? 0.8976 1.0404 1.4274 -0.0555 0.1734  0.2181  68  PHE A CG  
351  C CD1 . PHE A 53  ? 0.7524 0.9152 1.3143 -0.0888 0.1521  0.2187  68  PHE A CD1 
352  C CD2 . PHE A 53  ? 0.9300 0.9999 1.4499 -0.0499 0.1958  0.2019  68  PHE A CD2 
353  C CE1 . PHE A 53  ? 0.8180 0.9339 1.4113 -0.1144 0.1513  0.1985  68  PHE A CE1 
354  C CE2 . PHE A 53  ? 0.9540 0.9774 1.5012 -0.0782 0.1995  0.1820  68  PHE A CE2 
355  C CZ  . PHE A 53  ? 0.9319 0.9805 1.5206 -0.1097 0.1764  0.1779  68  PHE A CZ  
356  N N   . GLN A 54  ? 0.9497 1.3106 1.4760 -0.0077 0.1767  0.2099  69  GLN A N   
357  C CA  . GLN A 54  ? 0.8674 1.3116 1.4149 0.0021  0.1797  0.2004  69  GLN A CA  
358  C C   . GLN A 54  ? 0.8602 1.3489 1.3995 -0.0474 0.1760  0.1992  69  GLN A C   
359  O O   . GLN A 54  ? 0.9032 1.4588 1.4612 -0.0570 0.1731  0.1995  69  GLN A O   
360  C CB  . GLN A 54  ? 0.8328 1.2895 1.3911 0.0338  0.2001  0.1727  69  GLN A CB  
361  C CG  . GLN A 54  ? 0.9567 1.3850 1.5274 0.0898  0.1948  0.1735  69  GLN A CG  
362  C CD  . GLN A 54  ? 1.0785 1.5038 1.6656 0.1218  0.2113  0.1433  69  GLN A CD  
363  O OE1 . GLN A 54  ? 1.0932 1.5355 1.6793 0.0993  0.2325  0.1205  69  GLN A OE1 
364  N NE2 . GLN A 54  ? 1.0913 1.4887 1.6898 0.1738  0.1989  0.1421  69  GLN A NE2 
365  N N   . GLY A 55  ? 0.8135 1.2577 1.3204 -0.0800 0.1736  0.1971  70  GLY A N   
366  C CA  . GLY A 55  ? 0.7491 1.2070 1.2266 -0.1312 0.1620  0.2007  70  GLY A CA  
367  C C   . GLY A 55  ? 0.9122 1.3639 1.4004 -0.1532 0.1306  0.2247  70  GLY A C   
368  O O   . GLY A 55  ? 0.9733 1.4560 1.4488 -0.1878 0.1197  0.2324  70  GLY A O   
369  N N   . ILE A 56  ? 0.9743 1.3829 1.4860 -0.1363 0.1189  0.2333  71  ILE A N   
370  C CA  . ILE A 56  ? 0.9103 1.3172 1.4470 -0.1533 0.0927  0.2491  71  ILE A CA  
371  C C   . ILE A 56  ? 0.8901 1.3678 1.4494 -0.1434 0.0957  0.2590  71  ILE A C   
372  O O   . ILE A 56  ? 0.9400 1.4479 1.5082 -0.1717 0.0774  0.2691  71  ILE A O   
373  C CB  . ILE A 56  ? 0.9729 1.3230 1.5331 -0.1384 0.0922  0.2467  71  ILE A CB  
374  C CG1 . ILE A 56  ? 1.0003 1.2841 1.5542 -0.1528 0.0835  0.2309  71  ILE A CG1 
375  C CG2 . ILE A 56  ? 0.9875 1.3484 1.5829 -0.1536 0.0729  0.2565  71  ILE A CG2 
376  C CD1 . ILE A 56  ? 1.0268 1.2976 1.5788 -0.1930 0.0435  0.2317  71  ILE A CD1 
377  N N   . GLY A 57  ? 0.8628 1.3634 1.4321 -0.1019 0.1150  0.2542  72  GLY A N   
378  C CA  . GLY A 57  ? 0.7079 1.2727 1.3037 -0.0844 0.1130  0.2588  72  GLY A CA  
379  C C   . GLY A 57  ? 0.7047 1.3481 1.3110 -0.1008 0.1207  0.2476  72  GLY A C   
380  O O   . GLY A 57  ? 0.7602 1.4647 1.3975 -0.0935 0.1161  0.2478  72  GLY A O   
381  N N   . THR A 58  ? 1.0786 1.5853 2.2896 -0.1933 0.4850  0.2948  73  THR A N   
382  C CA  . THR A 58  ? 1.0475 1.5767 2.2037 -0.2794 0.4791  0.2572  73  THR A CA  
383  C C   . THR A 58  ? 1.1038 1.4874 2.1114 -0.3494 0.4548  0.2149  73  THR A C   
384  O O   . THR A 58  ? 1.2443 1.5952 2.1815 -0.4221 0.4522  0.1764  73  THR A O   
385  C CB  . THR A 58  ? 1.0004 1.5404 2.1911 -0.2725 0.4875  0.2283  73  THR A CB  
386  O OG1 . THR A 58  ? 1.0747 1.4940 2.2827 -0.2364 0.4918  0.2084  73  THR A OG1 
387  C CG2 . THR A 58  ? 0.9347 1.5974 2.2095 -0.2143 0.4918  0.2559  73  THR A CG2 
388  N N   . LEU A 59  ? 1.0861 1.3688 2.0146 -0.3177 0.4277  0.2173  74  LEU A N   
389  C CA  . LEU A 59  ? 1.2552 1.3833 1.9947 -0.3673 0.3832  0.1727  74  LEU A CA  
390  C C   . LEU A 59  ? 1.2803 1.4212 1.9142 -0.3657 0.3401  0.1884  74  LEU A C   
391  O O   . LEU A 59  ? 1.2382 1.3242 1.7285 -0.4320 0.3008  0.1575  74  LEU A O   
392  C CB  . LEU A 59  ? 1.2699 1.2529 1.9917 -0.3289 0.3791  0.1506  74  LEU A CB  
393  C CG  . LEU A 59  ? 1.2826 1.1526 1.9741 -0.3605 0.3854  0.0978  74  LEU A CG  
394  C CD1 . LEU A 59  ? 1.2221 1.1944 2.0750 -0.3489 0.4329  0.1084  74  LEU A CD1 
395  C CD2 . LEU A 59  ? 1.2696 0.9991 1.9423 -0.3146 0.3683  0.0713  74  LEU A CD2 
396  N N   . GLU A 60  ? 1.2174 1.4272 1.9226 -0.2864 0.3487  0.2376  75  GLU A N   
397  C CA  . GLU A 60  ? 1.3120 1.5438 1.9230 -0.2639 0.3094  0.2575  75  GLU A CA  
398  C C   . GLU A 60  ? 1.3677 1.7059 1.9541 -0.3152 0.2846  0.2521  75  GLU A C   
399  O O   . GLU A 60  ? 1.4927 1.8105 1.9535 -0.3334 0.2323  0.2399  75  GLU A O   
400  C CB  . GLU A 60  ? 1.2283 1.5322 1.9404 -0.1602 0.3390  0.3205  75  GLU A CB  
401  C CG  . GLU A 60  ? 1.3242 1.6344 1.9258 -0.1164 0.3010  0.3432  75  GLU A CG  
402  C CD  . GLU A 60  ? 1.3309 1.7000 2.0257 -0.0083 0.3419  0.4113  75  GLU A CD  
403  O OE1 . GLU A 60  ? 1.2847 1.6791 2.1362 0.0269  0.3987  0.4392  75  GLU A OE1 
404  O OE2 . GLU A 60  ? 1.3914 1.7774 2.0012 0.0439  0.3184  0.4377  75  GLU A OE2 
405  N N   . SER A 61  ? 1.2572 1.7097 1.9697 -0.3370 0.3197  0.2576  76  SER A N   
406  C CA  . SER A 61  ? 1.2435 1.8117 1.9631 -0.3887 0.3003  0.2481  76  SER A CA  
407  C C   . SER A 61  ? 1.2631 1.7639 1.9042 -0.4981 0.2893  0.1951  76  SER A C   
408  O O   . SER A 61  ? 1.2838 1.8788 1.9506 -0.5555 0.2813  0.1817  76  SER A O   
409  C CB  . SER A 61  ? 1.1270 1.8670 2.0277 -0.3506 0.3441  0.2827  76  SER A CB  
410  O OG  . SER A 61  ? 1.0591 1.7873 2.0553 -0.3631 0.3947  0.2747  76  SER A OG  
411  N N   . GLN A 62  ? 1.3118 1.6486 1.8592 -0.5245 0.2904  0.1650  77  GLN A N   
412  C CA  . GLN A 62  ? 1.4511 1.6987 1.9033 -0.6221 0.2863  0.1189  77  GLN A CA  
413  C C   . GLN A 62  ? 1.5558 1.6091 1.8121 -0.6515 0.2412  0.0845  77  GLN A C   
414  O O   . GLN A 62  ? 1.7060 1.6859 1.8496 -0.7354 0.2208  0.0514  77  GLN A O   
415  C CB  . GLN A 62  ? 1.4592 1.6992 1.9931 -0.6325 0.3432  0.1089  77  GLN A CB  
416  C CG  . GLN A 62  ? 1.4359 1.8589 2.1351 -0.6366 0.3854  0.1283  77  GLN A CG  
417  C CD  . GLN A 62  ? 1.4488 1.8469 2.1823 -0.6699 0.4345  0.1065  77  GLN A CD  
418  O OE1 . GLN A 62  ? 1.4920 1.7302 2.1188 -0.6867 0.4348  0.0763  77  GLN A OE1 
419  N NE2 . GLN A 62  ? 1.4473 1.9933 2.3022 -0.6542 0.4564  0.1248  77  GLN A NE2 
420  N N   . THR A 63  ? 1.5291 1.4981 1.7485 -0.5822 0.2279  0.0927  78  THR A N   
421  C CA  . THR A 63  ? 1.6443 1.4309 1.6782 -0.5979 0.1814  0.0591  78  THR A CA  
422  C C   . THR A 63  ? 1.7477 1.5416 1.6872 -0.5848 0.1233  0.0665  78  THR A C   
423  O O   . THR A 63  ? 1.7091 1.6445 1.7328 -0.5427 0.1215  0.1019  78  THR A O   
424  C CB  . THR A 63  ? 1.5829 1.2654 1.6220 -0.5304 0.1923  0.0554  78  THR A CB  
425  O OG1 . THR A 63  ? 1.6335 1.4009 1.7693 -0.4406 0.2003  0.1008  78  THR A OG1 
426  C CG2 . THR A 63  ? 1.4835 1.1599 1.6224 -0.5316 0.2425  0.0441  78  THR A CG2 
427  N N   . VAL A 64  ? 1.8345 1.4698 1.5907 -0.6154 0.0731  0.0311  79  VAL A N   
428  C CA  . VAL A 64  ? 1.8511 1.4721 1.4958 -0.6028 0.0098  0.0301  79  VAL A CA  
429  C C   . VAL A 64  ? 1.8819 1.4474 1.4877 -0.5075 -0.0040 0.0461  79  VAL A C   
430  O O   . VAL A 64  ? 1.7529 1.1714 1.2714 -0.4987 -0.0119 0.0202  79  VAL A O   
431  C CB  . VAL A 64  ? 1.9586 1.4357 1.4183 -0.6925 -0.0427 -0.0182 79  VAL A CB  
432  C CG1 . VAL A 64  ? 1.9706 1.4251 1.3118 -0.6720 -0.1158 -0.0239 79  VAL A CG1 
433  C CG2 . VAL A 64  ? 1.9350 1.4729 1.4431 -0.7908 -0.0226 -0.0303 79  VAL A CG2 
434  N N   . GLN A 65  ? 1.9243 1.6083 1.5947 -0.4323 -0.0053 0.0888  80  GLN A N   
435  C CA  . GLN A 65  ? 1.9950 1.6436 1.6375 -0.3361 -0.0098 0.1127  80  GLN A CA  
436  C C   . GLN A 65  ? 2.0629 1.5903 1.4995 -0.3393 -0.0844 0.0812  80  GLN A C   
437  O O   . GLN A 65  ? 2.1245 1.7023 1.5159 -0.2851 -0.1170 0.1016  80  GLN A O   
438  C CB  . GLN A 65  ? 2.0301 1.8423 1.8000 -0.2490 0.0205  0.1747  80  GLN A CB  
439  C CG  . GLN A 65  ? 1.9659 1.9122 1.9373 -0.2460 0.0871  0.2070  80  GLN A CG  
440  C CD  . GLN A 65  ? 2.0294 2.1301 2.1046 -0.1608 0.1113  0.2681  80  GLN A CD  
441  O OE1 . GLN A 65  ? 2.1343 2.2313 2.1538 -0.0817 0.0986  0.2972  80  GLN A OE1 
442  N NE2 . GLN A 65  ? 1.9671 2.2015 2.1860 -0.1718 0.1472  0.2881  80  GLN A NE2 
443  N N   . GLY A 66  ? 2.1189 1.4805 1.4232 -0.3966 -0.1130 0.0306  81  GLY A N   
444  C CA  . GLY A 66  ? 2.3226 1.5534 1.4213 -0.4111 -0.1881 -0.0060 81  GLY A CA  
445  C C   . GLY A 66  ? 2.4533 1.5733 1.4657 -0.3368 -0.2030 -0.0121 81  GLY A C   
446  O O   . GLY A 66  ? 2.5817 1.7384 1.5665 -0.2569 -0.2205 0.0135  81  GLY A O   
447  N N   . GLY A 67  ? 2.4213 1.4052 1.3880 -0.3583 -0.1967 -0.0477 82  GLY A N   
448  C CA  . GLY A 67  ? 2.4203 1.2944 1.3121 -0.2921 -0.2134 -0.0626 82  GLY A CA  
449  C C   . GLY A 67  ? 2.2604 1.2323 1.3284 -0.1984 -0.1525 -0.0160 82  GLY A C   
450  O O   . GLY A 67  ? 2.1991 1.3129 1.3664 -0.1443 -0.1248 0.0383  82  GLY A O   
451  N N   . THR A 68  ? 2.1908 1.0829 1.2996 -0.1767 -0.1323 -0.0379 83  THR A N   
452  C CA  . THR A 68  ? 2.1175 1.0961 1.4190 -0.0967 -0.0705 0.0032  83  THR A CA  
453  C C   . THR A 68  ? 1.9982 1.0834 1.4958 -0.1207 -0.0086 0.0272  83  THR A C   
454  O O   . THR A 68  ? 1.8374 0.9873 1.5150 -0.0670 0.0454  0.0571  83  THR A O   
455  C CB  . THR A 68  ? 2.1053 0.9632 1.3922 -0.0551 -0.0791 -0.0342 83  THR A CB  
456  O OG1 . THR A 68  ? 2.2082 0.9271 1.4073 -0.1199 -0.1079 -0.0993 83  THR A OG1 
457  C CG2 . THR A 68  ? 2.1268 0.9147 1.2586 -0.0040 -0.1270 -0.0432 83  THR A CG2 
458  N N   . VAL A 69  ? 2.0016 1.1035 1.4666 -0.2019 -0.0166 0.0132  84  VAL A N   
459  C CA  . VAL A 69  ? 1.8418 1.0606 1.4792 -0.2256 0.0386  0.0379  84  VAL A CA  
460  C C   . VAL A 69  ? 1.8095 1.2016 1.5920 -0.1626 0.0797  0.1084  84  VAL A C   
461  O O   . VAL A 69  ? 1.7598 1.2505 1.7288 -0.1367 0.1375  0.1423  84  VAL A O   
462  C CB  . VAL A 69  ? 1.8234 1.0396 1.3867 -0.3238 0.0213  0.0134  84  VAL A CB  
463  C CG1 . VAL A 69  ? 1.6166 0.9603 1.3588 -0.3431 0.0795  0.0377  84  VAL A CG1 
464  C CG2 . VAL A 69  ? 2.0074 1.0389 1.4061 -0.3833 -0.0156 -0.0508 84  VAL A CG2 
465  N N   . GLU A 70  ? 1.4954 0.8281 1.5641 -0.1687 0.0483  0.0098  85  GLU A N   
466  C CA  . GLU A 70  ? 1.5232 0.8786 1.5652 -0.1850 0.0464  -0.0241 85  GLU A CA  
467  C C   . GLU A 70  ? 1.4630 0.8621 1.5619 -0.1205 0.0661  -0.0251 85  GLU A C   
468  O O   . GLU A 70  ? 1.3167 0.7971 1.4389 -0.1249 0.0510  -0.0380 85  GLU A O   
469  C CB  . GLU A 70  ? 1.5726 0.7830 1.4921 -0.2313 0.0685  -0.0564 85  GLU A CB  
470  C CG  . GLU A 70  ? 1.6617 0.9130 1.5431 -0.2723 0.0553  -0.0843 85  GLU A CG  
471  C CD  . GLU A 70  ? 2.0716 1.1815 1.8167 -0.3335 0.0776  -0.1183 85  GLU A CD  
472  O OE1 . GLU A 70  ? 2.1387 1.2928 1.8381 -0.3964 0.0539  -0.1318 85  GLU A OE1 
473  O OE2 . GLU A 70  ? 2.3737 1.3275 2.0562 -0.3209 0.1206  -0.1296 85  GLU A OE2 
474  N N   . ARG A 71  ? 1.5246 0.8745 1.6495 -0.0611 0.0993  -0.0059 86  ARG A N   
475  C CA  . ARG A 71  ? 1.5287 0.9278 1.7084 -0.0018 0.1192  -0.0015 86  ARG A CA  
476  C C   . ARG A 71  ? 1.3210 0.8778 1.5942 0.0092  0.0868  0.0197  86  ARG A C   
477  O O   . ARG A 71  ? 1.2011 0.8240 1.5070 0.0282  0.0862  0.0121  86  ARG A O   
478  C CB  . ARG A 71  ? 1.6254 0.9459 1.8196 0.0617  0.1649  0.0224  86  ARG A CB  
479  C CG  . ARG A 71  ? 1.6772 1.0184 1.8986 0.1153  0.1973  0.0169  86  ARG A CG  
480  C CD  . ARG A 71  ? 1.8116 1.1380 2.0914 0.1890  0.2348  0.0601  86  ARG A CD  
481  N NE  . ARG A 71  ? 2.0478 1.2114 2.2743 0.2060  0.2786  0.0606  86  ARG A NE  
482  C CZ  . ARG A 71  ? 2.1645 1.2913 2.4409 0.2744  0.3177  0.1040  86  ARG A CZ  
483  N NH1 . ARG A 71  ? 2.1332 1.3914 2.5132 0.3260  0.3134  0.1532  86  ARG A NH1 
484  N NH2 . ARG A 71  ? 2.2657 1.2504 2.4830 0.2826  0.3522  0.0991  86  ARG A NH2 
485  N N   . LEU A 72  ? 1.2133 0.8241 1.5216 -0.0084 0.0620  0.0444  87  LEU A N   
486  C CA  . LEU A 72  ? 1.2001 0.9489 1.5834 -0.0087 0.0366  0.0583  87  LEU A CA  
487  C C   . LEU A 72  ? 1.1454 0.9592 1.5341 -0.0371 0.0155  0.0287  87  LEU A C   
488  O O   . LEU A 72  ? 1.0734 0.9532 1.5037 -0.0173 0.0150  0.0248  87  LEU A O   
489  C CB  . LEU A 72  ? 1.2318 1.0195 1.6360 -0.0347 0.0165  0.0854  87  LEU A CB  
490  C CG  . LEU A 72  ? 1.1858 1.1082 1.6503 -0.0517 -0.0061 0.0904  87  LEU A CG  
491  C CD1 . LEU A 72  ? 1.1380 1.1267 1.6557 -0.0141 0.0036  0.1074  87  LEU A CD1 
492  C CD2 . LEU A 72  ? 1.1905 1.1449 1.6617 -0.0860 -0.0233 0.1155  87  LEU A CD2 
493  N N   . PHE A 73  ? 1.1458 0.9425 1.4942 -0.0844 -0.0016 0.0130  88  PHE A N   
494  C CA  . PHE A 73  ? 0.9844 0.8511 1.3484 -0.1092 -0.0222 -0.0042 88  PHE A CA  
495  C C   . PHE A 73  ? 0.9568 0.8027 1.3015 -0.0956 -0.0134 -0.0201 88  PHE A C   
496  O O   . PHE A 73  ? 0.9710 0.8864 1.3511 -0.0980 -0.0273 -0.0242 88  PHE A O   
497  C CB  . PHE A 73  ? 1.0780 0.9412 1.4035 -0.1658 -0.0429 -0.0086 88  PHE A CB  
498  C CG  . PHE A 73  ? 1.1850 1.1074 1.5427 -0.1868 -0.0572 0.0056  88  PHE A CG  
499  C CD1 . PHE A 73  ? 1.2266 1.2630 1.6485 -0.1930 -0.0701 0.0039  88  PHE A CD1 
500  C CD2 . PHE A 73  ? 1.2956 1.1564 1.6182 -0.2013 -0.0543 0.0211  88  PHE A CD2 
501  C CE1 . PHE A 73  ? 1.2560 1.3511 1.7023 -0.2168 -0.0786 0.0127  88  PHE A CE1 
502  C CE2 . PHE A 73  ? 1.3056 1.2284 1.6538 -0.2277 -0.0692 0.0361  88  PHE A CE2 
503  C CZ  . PHE A 73  ? 1.2948 1.3388 1.7028 -0.2375 -0.0807 0.0295  88  PHE A CZ  
504  N N   . LYS A 74  ? 1.0584 0.8063 1.3471 -0.0812 0.0127  -0.0278 89  LYS A N   
505  C CA  . LYS A 74  ? 1.1187 0.8467 1.3811 -0.0722 0.0250  -0.0440 89  LYS A CA  
506  C C   . LYS A 74  ? 1.0249 0.8100 1.3503 -0.0221 0.0356  -0.0336 89  LYS A C   
507  O O   . LYS A 74  ? 0.9360 0.7626 1.2748 -0.0197 0.0296  -0.0392 89  LYS A O   
508  C CB  . LYS A 74  ? 1.3268 0.9241 1.4994 -0.0776 0.0581  -0.0625 89  LYS A CB  
509  C CG  . LYS A 74  ? 1.5825 1.1571 1.6971 -0.1021 0.0637  -0.0860 89  LYS A CG  
510  C CD  . LYS A 74  ? 1.8857 1.3535 1.9429 -0.0751 0.1139  -0.1057 89  LYS A CD  
511  C CE  . LYS A 74  ? 1.8872 1.4056 2.0181 -0.0066 0.1335  -0.0894 89  LYS A CE  
512  N NZ  . LYS A 74  ? 2.0029 1.4353 2.0873 0.0241  0.1868  -0.1078 89  LYS A NZ  
513  N N   . ASN A 75  ? 1.0074 0.7992 1.3701 0.0131  0.0494  -0.0133 90  ASN A N   
514  C CA  . ASN A 75  ? 0.9033 0.7648 1.3259 0.0508  0.0560  0.0026  90  ASN A CA  
515  C C   . ASN A 75  ? 0.8261 0.7850 1.3012 0.0346  0.0294  0.0027  90  ASN A C   
516  O O   . ASN A 75  ? 0.8546 0.8566 1.3541 0.0455  0.0287  0.0008  90  ASN A O   
517  C CB  . ASN A 75  ? 0.9644 0.8288 1.4190 0.0836  0.0717  0.0348  90  ASN A CB  
518  C CG  . ASN A 75  ? 1.1143 0.8843 1.5351 0.1196  0.1107  0.0390  90  ASN A CG  
519  O OD1 . ASN A 75  ? 1.0955 0.7856 1.4541 0.1121  0.1286  0.0097  90  ASN A OD1 
520  N ND2 . ASN A 75  ? 1.1601 0.9403 1.6218 0.1576  0.1269  0.0778  90  ASN A ND2 
521  N N   . LEU A 76  ? 0.7721 0.7596 1.2615 0.0076  0.0111  0.0039  91  LEU A N   
522  C CA  . LEU A 76  ? 0.7010 0.7685 1.2377 -0.0073 -0.0052 -0.0015 91  LEU A CA  
523  C C   . LEU A 76  ? 0.6292 0.7044 1.1648 -0.0160 -0.0153 -0.0152 91  LEU A C   
524  O O   . LEU A 76  ? 0.5705 0.6948 1.1477 -0.0103 -0.0184 -0.0176 91  LEU A O   
525  C CB  . LEU A 76  ? 0.6600 0.7546 1.2062 -0.0368 -0.0176 0.0000  91  LEU A CB  
526  C CG  . LEU A 76  ? 0.6880 0.7959 1.2439 -0.0361 -0.0134 0.0215  91  LEU A CG  
527  C CD1 . LEU A 76  ? 0.7354 0.8674 1.2902 -0.0732 -0.0269 0.0220  91  LEU A CD1 
528  C CD2 . LEU A 76  ? 0.6264 0.8022 1.2244 -0.0253 -0.0076 0.0299  91  LEU A CD2 
529  N N   . SER A 77  ? 0.6470 0.6709 1.1316 -0.0335 -0.0196 -0.0214 92  SER A N   
530  C CA  . SER A 77  ? 0.6805 0.7169 1.1580 -0.0475 -0.0324 -0.0246 92  SER A CA  
531  C C   . SER A 77  ? 0.7083 0.7444 1.1906 -0.0224 -0.0222 -0.0241 92  SER A C   
532  O O   . SER A 77  ? 0.7577 0.8362 1.2734 -0.0213 -0.0334 -0.0182 92  SER A O   
533  C CB  . SER A 77  ? 0.8055 0.7842 1.2091 -0.0839 -0.0375 -0.0311 92  SER A CB  
534  O OG  . SER A 77  ? 0.9471 0.9340 1.3303 -0.0995 -0.0472 -0.0299 92  SER A OG  
535  N N   . LEU A 78  ? 0.7216 0.7111 1.1737 -0.0009 0.0010  -0.0268 93  LEU A N   
536  C CA  . LEU A 78  ? 0.7655 0.7615 1.2195 0.0216  0.0139  -0.0250 93  LEU A CA  
537  C C   . LEU A 78  ? 0.6794 0.7407 1.1955 0.0396  0.0116  -0.0137 93  LEU A C   
538  O O   . LEU A 78  ? 0.6536 0.7396 1.1825 0.0440  0.0096  -0.0101 93  LEU A O   
539  C CB  . LEU A 78  ? 0.7795 0.7147 1.1921 0.0447  0.0462  -0.0287 93  LEU A CB  
540  C CG  . LEU A 78  ? 0.9388 0.7885 1.2695 0.0226  0.0598  -0.0490 93  LEU A CG  
541  C CD1 . LEU A 78  ? 1.0575 0.8337 1.3566 0.0556  0.1029  -0.0537 93  LEU A CD1 
542  C CD2 . LEU A 78  ? 0.8088 0.6717 1.1101 -0.0009 0.0511  -0.0567 93  LEU A CD2 
543  N N   . ILE A 79  ? 0.5224 0.6098 1.0697 0.0424  0.0120  -0.0077 94  ILE A N   
544  C CA  . ILE A 79  ? 0.6292 0.7755 1.2224 0.0449  0.0111  -0.0017 94  ILE A CA  
545  C C   . ILE A 79  ? 0.6282 0.7971 1.2497 0.0304  -0.0018 -0.0112 94  ILE A C   
546  O O   . ILE A 79  ? 0.6226 0.8131 1.2655 0.0320  0.0004  -0.0106 94  ILE A O   
547  C CB  . ILE A 79  ? 0.5969 0.7712 1.2084 0.0400  0.0138  0.0077  94  ILE A CB  
548  C CG1 . ILE A 79  ? 0.5472 0.7110 1.1491 0.0638  0.0290  0.0304  94  ILE A CG1 
549  C CG2 . ILE A 79  ? 0.3865 0.6187 1.0314 0.0254  0.0136  0.0061  94  ILE A CG2 
550  C CD1 . ILE A 79  ? 0.5063 0.7105 1.1304 0.0566  0.0276  0.0523  94  ILE A CD1 
551  N N   . LYS A 80  ? 0.5856 0.7491 1.2087 0.0163  -0.0136 -0.0167 95  LYS A N   
552  C CA  . LYS A 80  ? 0.5166 0.7062 1.1787 0.0110  -0.0228 -0.0178 95  LYS A CA  
553  C C   . LYS A 80  ? 0.6129 0.7944 1.2726 0.0168  -0.0301 -0.0074 95  LYS A C   
554  O O   . LYS A 80  ? 0.6562 0.8528 1.3544 0.0235  -0.0295 -0.0029 95  LYS A O   
555  C CB  . LYS A 80  ? 0.4765 0.6775 1.1423 -0.0063 -0.0358 -0.0166 95  LYS A CB  
556  C CG  . LYS A 80  ? 0.4731 0.7104 1.1878 -0.0053 -0.0458 -0.0058 95  LYS A CG  
557  C CD  . LYS A 80  ? 0.5872 0.8606 1.3181 -0.0236 -0.0565 -0.0006 95  LYS A CD  
558  C CE  . LYS A 80  ? 0.5830 0.9064 1.3751 -0.0163 -0.0661 0.0220  95  LYS A CE  
559  N NZ  . LYS A 80  ? 0.5465 0.8751 1.3985 0.0142  -0.0454 0.0180  95  LYS A NZ  
560  N N   . LYS A 81  ? 0.6412 0.7931 1.2513 0.0117  -0.0341 -0.0039 96  LYS A N   
561  C CA  . LYS A 81  ? 0.6444 0.7936 1.2417 0.0091  -0.0422 0.0075  96  LYS A CA  
562  C C   . LYS A 81  ? 0.6005 0.7559 1.2088 0.0243  -0.0307 0.0098  96  LYS A C   
563  O O   . LYS A 81  ? 0.6236 0.7886 1.2475 0.0227  -0.0393 0.0231  96  LYS A O   
564  C CB  . LYS A 81  ? 0.6558 0.7678 1.1836 -0.0075 -0.0417 0.0032  96  LYS A CB  
565  C CG  . LYS A 81  ? 0.8872 0.9990 1.3931 -0.0395 -0.0602 0.0070  96  LYS A CG  
566  C CD  . LYS A 81  ? 1.1388 1.1962 1.5570 -0.0656 -0.0523 -0.0060 96  LYS A CD  
567  C CE  . LYS A 81  ? 1.2976 1.3557 1.6816 -0.1109 -0.0721 -0.0022 96  LYS A CE  
568  N NZ  . LYS A 81  ? 1.4604 1.4433 1.7420 -0.1440 -0.0563 -0.0244 96  LYS A NZ  
569  N N   . TYR A 82  ? 0.4961 0.6513 1.0974 0.0359  -0.0132 0.0026  97  TYR A N   
570  C CA  . TYR A 82  ? 0.4979 0.6736 1.1091 0.0422  -0.0038 0.0083  97  TYR A CA  
571  C C   . TYR A 82  ? 0.6269 0.8165 1.2789 0.0346  -0.0062 0.0066  97  TYR A C   
572  O O   . TYR A 82  ? 0.5816 0.7702 1.2399 0.0303  -0.0083 0.0144  97  TYR A O   
573  C CB  . TYR A 82  ? 0.4244 0.6164 1.0297 0.0534  0.0130  0.0109  97  TYR A CB  
574  C CG  . TYR A 82  ? 0.4802 0.7129 1.0992 0.0491  0.0194  0.0213  97  TYR A CG  
575  C CD1 . TYR A 82  ? 0.4887 0.7340 1.0926 0.0520  0.0233  0.0322  97  TYR A CD1 
576  C CD2 . TYR A 82  ? 0.4462 0.7091 1.0863 0.0337  0.0218  0.0199  97  TYR A CD2 
577  C CE1 . TYR A 82  ? 0.4433 0.7326 1.0553 0.0397  0.0269  0.0447  97  TYR A CE1 
578  C CE2 . TYR A 82  ? 0.4429 0.7451 1.0846 0.0170  0.0263  0.0299  97  TYR A CE2 
579  C CZ  . TYR A 82  ? 0.5295 0.8457 1.1583 0.0201  0.0276  0.0438  97  TYR A CZ  
580  O OH  . TYR A 82  ? 0.6395 1.0012 1.2658 -0.0043 0.0301  0.0567  97  TYR A OH  
581  N N   . ILE A 83  ? 0.6500 0.8465 1.3256 0.0309  -0.0025 -0.0050 98  ILE A N   
582  C CA  . ILE A 83  ? 0.4955 0.6941 1.2051 0.0236  0.0061  -0.0152 98  ILE A CA  
583  C C   . ILE A 83  ? 0.5421 0.7236 1.2832 0.0319  -0.0015 -0.0056 98  ILE A C   
584  O O   . ILE A 83  ? 0.6464 0.8092 1.4050 0.0308  0.0077  -0.0058 98  ILE A O   
585  C CB  . ILE A 83  ? 0.4936 0.7082 1.2187 0.0156  0.0151  -0.0320 98  ILE A CB  
586  C CG1 . ILE A 83  ? 0.5265 0.7666 1.2274 0.0036  0.0210  -0.0313 98  ILE A CG1 
587  C CG2 . ILE A 83  ? 0.5627 0.7698 1.3205 0.0095  0.0330  -0.0494 98  ILE A CG2 
588  C CD1 . ILE A 83  ? 0.5749 0.8377 1.2840 -0.0125 0.0274  -0.0437 98  ILE A CD1 
589  N N   . ASP A 84  ? 0.4522 0.6400 1.1988 0.0371  -0.0183 0.0070  99  ASP A N   
590  C CA  . ASP A 84  ? 0.4743 0.6641 1.2576 0.0445  -0.0312 0.0305  99  ASP A CA  
591  C C   . ASP A 84  ? 0.5882 0.7615 1.3568 0.0422  -0.0385 0.0487  99  ASP A C   
592  O O   . ASP A 84  ? 0.5439 0.7061 1.3510 0.0503  -0.0400 0.0677  99  ASP A O   
593  C CB  . ASP A 84  ? 0.3757 0.5897 1.1531 0.0367  -0.0533 0.0468  99  ASP A CB  
594  C CG  . ASP A 84  ? 0.5891 0.8289 1.3953 0.0367  -0.0495 0.0377  99  ASP A CG  
595  O OD1 . ASP A 84  ? 0.5933 0.8349 1.4367 0.0477  -0.0282 0.0210  99  ASP A OD1 
596  O OD2 . ASP A 84  ? 0.5609 0.8192 1.3467 0.0201  -0.0664 0.0459  99  ASP A OD2 
597  N N   . GLY A 85  ? 0.5428 0.7147 1.2581 0.0324  -0.0405 0.0454  100 GLY A N   
598  C CA  . GLY A 85  ? 0.5098 0.6756 1.2042 0.0251  -0.0458 0.0611  100 GLY A CA  
599  C C   . GLY A 85  ? 0.5389 0.6875 1.2462 0.0223  -0.0311 0.0560  100 GLY A C   
600  O O   . GLY A 85  ? 0.6184 0.7514 1.3304 0.0162  -0.0372 0.0750  100 GLY A O   
601  N N   . GLN A 86  ? 0.4570 0.6075 1.1642 0.0199  -0.0123 0.0319  101 GLN A N   
602  C CA  . GLN A 86  ? 0.4594 0.5920 1.1647 0.0039  0.0043  0.0218  101 GLN A CA  
603  C C   . GLN A 86  ? 0.5063 0.5922 1.2528 0.0106  0.0145  0.0206  101 GLN A C   
604  O O   . GLN A 86  ? 0.5027 0.5497 1.2437 -0.0024 0.0230  0.0239  101 GLN A O   
605  C CB  . GLN A 86  ? 0.5003 0.6567 1.1918 -0.0094 0.0203  -0.0005 101 GLN A CB  
606  C CG  . GLN A 86  ? 0.5103 0.7133 1.1720 -0.0106 0.0161  0.0089  101 GLN A CG  
607  C CD  . GLN A 86  ? 0.6131 0.8345 1.2495 -0.0262 0.0147  0.0253  101 GLN A CD  
608  O OE1 . GLN A 86  ? 0.6244 0.8597 1.2476 -0.0552 0.0232  0.0231  101 GLN A OE1 
609  N NE2 . GLN A 86  ? 0.5749 0.8009 1.1987 -0.0141 0.0044  0.0415  101 GLN A NE2 
610  N N   . LYS A 87  ? 0.4907 0.5793 1.2796 0.0313  0.0166  0.0177  102 LYS A N   
611  C CA  . LYS A 87  ? 0.5776 0.6283 1.4214 0.0498  0.0321  0.0216  102 LYS A CA  
612  C C   . LYS A 87  ? 0.5173 0.5540 1.3870 0.0624  0.0122  0.0647  102 LYS A C   
613  O O   . LYS A 87  ? 0.6719 0.6563 1.5726 0.0724  0.0273  0.0748  102 LYS A O   
614  C CB  . LYS A 87  ? 0.6598 0.7398 1.5495 0.0701  0.0376  0.0152  102 LYS A CB  
615  C CG  . LYS A 87  ? 0.8294 0.9188 1.7025 0.0557  0.0616  -0.0257 102 LYS A CG  
616  C CD  . LYS A 87  ? 0.9852 1.1171 1.8972 0.0706  0.0606  -0.0269 102 LYS A CD  
617  C CE  . LYS A 87  ? 1.0586 1.1962 1.9634 0.0551  0.0905  -0.0669 102 LYS A CE  
618  N NZ  . LYS A 87  ? 1.0738 1.2622 2.0106 0.0633  0.0873  -0.0669 102 LYS A NZ  
619  N N   . LYS A 88  ? 0.6034 0.6832 1.4572 0.0591  -0.0199 0.0910  103 LYS A N   
620  C CA  . LYS A 88  ? 0.5916 0.6732 1.4594 0.0598  -0.0447 0.1371  103 LYS A CA  
621  C C   . LYS A 88  ? 0.5540 0.5935 1.3886 0.0411  -0.0402 0.1405  103 LYS A C   
622  O O   . LYS A 88  ? 0.6396 0.6485 1.5007 0.0450  -0.0469 0.1748  103 LYS A O   
623  C CB  . LYS A 88  ? 0.6470 0.7813 1.4788 0.0444  -0.0750 0.1535  103 LYS A CB  
624  C CG  . LYS A 88  ? 0.8854 1.0440 1.7375 0.0386  -0.1058 0.2073  103 LYS A CG  
625  C CD  . LYS A 88  ? 1.0288 1.2381 1.8379 0.0146  -0.1302 0.2148  103 LYS A CD  
626  C CE  . LYS A 88  ? 1.0932 1.3261 1.9171 0.0221  -0.1257 0.1957  103 LYS A CE  
627  N NZ  . LYS A 88  ? 1.1197 1.3844 1.8851 -0.0102 -0.1448 0.1959  103 LYS A NZ  
628  N N   . LYS A 89  ? 0.5836 0.6261 1.3629 0.0194  -0.0293 0.1095  104 LYS A N   
629  C CA  . LYS A 89  ? 0.5701 0.5876 1.3099 -0.0075 -0.0253 0.1113  104 LYS A CA  
630  C C   . LYS A 89  ? 0.7358 0.6788 1.4884 -0.0136 0.0025  0.0970  104 LYS A C   
631  O O   . LYS A 89  ? 0.7381 0.6469 1.4574 -0.0418 0.0055  0.1025  104 LYS A O   
632  C CB  . LYS A 89  ? 0.7132 0.7750 1.3997 -0.0277 -0.0209 0.0893  104 LYS A CB  
633  C CG  . LYS A 89  ? 0.8697 0.9766 1.5187 -0.0386 -0.0394 0.1094  104 LYS A CG  
634  C CD  . LYS A 89  ? 1.0394 1.1750 1.6905 -0.0228 -0.0552 0.1179  104 LYS A CD  
635  C CE  . LYS A 89  ? 1.0952 1.2713 1.6965 -0.0354 -0.0595 0.1230  104 LYS A CE  
636  N NZ  . LYS A 89  ? 1.0186 1.2241 1.5980 -0.0359 -0.0389 0.1038  104 LYS A NZ  
637  N N   . CYS A 90  ? 0.8973 0.6319 0.6027 0.0947  0.0397  -0.1434 105 CYS A N   
638  C CA  . CYS A 90  ? 0.8686 0.6027 0.5692 0.0837  0.0235  -0.1203 105 CYS A CA  
639  C C   . CYS A 90  ? 0.9295 0.6962 0.6310 0.0664  0.0085  -0.1136 105 CYS A C   
640  O O   . CYS A 90  ? 0.9444 0.7249 0.6473 0.0575  0.0021  -0.0952 105 CYS A O   
641  C CB  . CYS A 90  ? 0.9146 0.5936 0.6156 0.0776  0.0303  -0.1238 105 CYS A CB  
642  S SG  . CYS A 90  ? 1.1570 0.7961 0.8510 0.0975  0.0468  -0.1123 105 CYS A SG  
643  N N   . GLY A 91  ? 0.8916 0.6732 0.5941 0.0599  0.0041  -0.1273 106 GLY A N   
644  C CA  . GLY A 91  ? 0.8149 0.6295 0.5237 0.0467  -0.0106 -0.1111 106 GLY A CA  
645  C C   . GLY A 91  ? 0.8930 0.7537 0.5820 0.0433  -0.0180 -0.1165 106 GLY A C   
646  O O   . GLY A 91  ? 0.9581 0.8481 0.6521 0.0326  -0.0336 -0.1012 106 GLY A O   
647  N N   . GLU A 92  ? 0.9901 0.8581 0.6580 0.0515  -0.0043 -0.1357 107 GLU A N   
648  C CA  . GLU A 92  ? 1.0003 0.9085 0.6368 0.0430  -0.0041 -0.1466 107 GLU A CA  
649  C C   . GLU A 92  ? 1.0383 0.9858 0.6658 0.0412  -0.0109 -0.1148 107 GLU A C   
650  O O   . GLU A 92  ? 0.9798 0.9647 0.5824 0.0289  -0.0223 -0.1058 107 GLU A O   
651  C CB  . GLU A 92  ? 1.0954 0.9930 0.7208 0.0513  0.0248  -0.1770 107 GLU A CB  
652  C CG  . GLU A 92  ? 1.3038 1.1732 0.9291 0.0446  0.0390  -0.2177 107 GLU A CG  
653  C CD  . GLU A 92  ? 1.4687 1.3217 1.0955 0.0529  0.0792  -0.2469 107 GLU A CD  
654  O OE1 . GLU A 92  ? 1.5274 1.3898 1.1644 0.0686  0.0931  -0.2302 107 GLU A OE1 
655  O OE2 . GLU A 92  ? 1.4480 1.2791 1.0744 0.0428  0.1009  -0.2876 107 GLU A OE2 
656  N N   . GLU A 93  ? 1.0132 0.9551 0.6611 0.0515  -0.0036 -0.0966 108 GLU A N   
657  C CA  . GLU A 93  ? 0.9667 0.9410 0.6153 0.0495  -0.0022 -0.0699 108 GLU A CA  
658  C C   . GLU A 93  ? 0.9513 0.9178 0.6328 0.0437  -0.0088 -0.0426 108 GLU A C   
659  O O   . GLU A 93  ? 0.9480 0.8841 0.6496 0.0436  -0.0081 -0.0465 108 GLU A O   
660  C CB  . GLU A 93  ? 0.9412 0.9252 0.5965 0.0609  0.0166  -0.0742 108 GLU A CB  
661  C CG  . GLU A 93  ? 1.0274 1.0185 0.6584 0.0647  0.0364  -0.1000 108 GLU A CG  
662  C CD  . GLU A 93  ? 1.0111 1.0153 0.6670 0.0779  0.0585  -0.0983 108 GLU A CD  
663  O OE1 . GLU A 93  ? 0.8865 0.8972 0.5787 0.0843  0.0517  -0.0794 108 GLU A OE1 
664  O OE2 . GLU A 93  ? 1.1002 1.1107 0.7423 0.0789  0.0843  -0.1174 108 GLU A OE2 
665  N N   . ARG A 94  ? 0.9312 0.9236 0.6177 0.0371  -0.0104 -0.0144 109 ARG A N   
666  C CA  . ARG A 94  ? 0.8887 0.8714 0.6168 0.0300  -0.0045 0.0114  109 ARG A CA  
667  C C   . ARG A 94  ? 0.8609 0.8658 0.5988 0.0287  0.0134  0.0262  109 ARG A C   
668  O O   . ARG A 94  ? 0.8196 0.8551 0.5390 0.0313  0.0180  0.0422  109 ARG A O   
669  C CB  . ARG A 94  ? 0.8889 0.8813 0.6373 0.0255  -0.0148 0.0404  109 ARG A CB  
670  C CG  . ARG A 94  ? 0.9023 0.8784 0.6539 0.0239  -0.0326 0.0254  109 ARG A CG  
671  C CD  . ARG A 94  ? 0.9740 0.9741 0.7595 0.0205  -0.0469 0.0618  109 ARG A CD  
672  N NE  . ARG A 94  ? 1.2326 1.2882 0.9830 0.0208  -0.0603 0.0866  109 ARG A NE  
673  C CZ  . ARG A 94  ? 1.3471 1.4405 1.0603 0.0143  -0.0866 0.0803  109 ARG A CZ  
674  N NH1 . ARG A 94  ? 1.4244 1.5049 1.1415 0.0085  -0.1006 0.0484  109 ARG A NH1 
675  N NH2 . ARG A 94  ? 1.3480 1.4930 1.0176 0.0102  -0.0970 0.1046  109 ARG A NH2 
676  N N   . ARG A 95  ? 0.8404 0.8315 0.6050 0.0215  0.0248  0.0197  110 ARG A N   
677  C CA  . ARG A 95  ? 0.8351 0.8507 0.6156 0.0174  0.0422  0.0250  110 ARG A CA  
678  C C   . ARG A 95  ? 0.8889 0.8939 0.7145 -0.0011 0.0635  0.0378  110 ARG A C   
679  O O   . ARG A 95  ? 0.8450 0.8194 0.6922 -0.0104 0.0675  0.0430  110 ARG A O   
680  C CB  . ARG A 95  ? 0.8551 0.8811 0.6313 0.0219  0.0376  0.0019  110 ARG A CB  
681  C CG  . ARG A 95  ? 0.9061 0.9421 0.6528 0.0405  0.0323  -0.0104 110 ARG A CG  
682  C CD  . ARG A 95  ? 0.8572 0.9070 0.6198 0.0493  0.0311  -0.0226 110 ARG A CD  
683  N NE  . ARG A 95  ? 0.8626 0.9210 0.6130 0.0665  0.0406  -0.0334 110 ARG A NE  
684  C CZ  . ARG A 95  ? 0.8702 0.9560 0.6289 0.0706  0.0603  -0.0320 110 ARG A CZ  
685  N NH1 . ARG A 95  ? 0.8443 0.9535 0.6247 0.0604  0.0698  -0.0181 110 ARG A NH1 
686  N NH2 . ARG A 95  ? 0.9539 1.0395 0.7027 0.0828  0.0771  -0.0470 110 ARG A NH2 
687  N N   . ARG A 96  ? 0.8475 0.8760 0.6942 -0.0082 0.0828  0.0401  111 ARG A N   
688  C CA  . ARG A 96  ? 0.7266 0.7457 0.6216 -0.0305 0.1124  0.0453  111 ARG A CA  
689  C C   . ARG A 96  ? 0.8345 0.8267 0.7375 -0.0539 0.1117  0.0185  111 ARG A C   
690  O O   . ARG A 96  ? 1.0119 1.0054 0.8835 -0.0515 0.0866  -0.0018 111 ARG A O   
691  C CB  . ARG A 96  ? 0.8332 0.8863 0.7497 -0.0365 0.1325  0.0431  111 ARG A CB  
692  C CG  . ARG A 96  ? 0.9705 1.0461 0.8720 -0.0170 0.1409  0.0688  111 ARG A CG  
693  C CD  . ARG A 96  ? 0.9642 1.0724 0.8879 -0.0212 0.1609  0.0604  111 ARG A CD  
694  N NE  . ARG A 96  ? 0.9749 1.0961 0.8844 -0.0076 0.1808  0.0874  111 ARG A NE  
695  C CZ  . ARG A 96  ? 1.1914 1.3375 1.1178 -0.0077 0.2043  0.0841  111 ARG A CZ  
696  N NH1 . ARG A 96  ? 1.3051 1.4738 1.2719 -0.0200 0.2059  0.0560  111 ARG A NH1 
697  N NH2 . ARG A 96  ? 1.2078 1.3598 1.1106 0.0028  0.2257  0.1102  111 ARG A NH2 
698  N N   . VAL A 97  ? 0.8875 0.8534 0.8327 -0.0778 0.1439  0.0197  112 VAL A N   
699  C CA  . VAL A 97  ? 0.9198 0.8534 0.8666 -0.1080 0.1524  -0.0091 112 VAL A CA  
700  C C   . VAL A 97  ? 0.8301 0.7953 0.7537 -0.1286 0.1376  -0.0404 112 VAL A C   
701  O O   . VAL A 97  ? 0.8273 0.7809 0.7153 -0.1400 0.1189  -0.0601 112 VAL A O   
702  C CB  . VAL A 97  ? 0.9904 0.8880 0.9975 -0.1342 0.2035  -0.0055 112 VAL A CB  
703  C CG1 . VAL A 97  ? 1.0137 0.8790 1.0149 -0.1764 0.2213  -0.0456 112 VAL A CG1 
704  C CG2 . VAL A 97  ? 1.0342 0.9038 1.0726 -0.1123 0.2113  0.0319  112 VAL A CG2 
705  N N   . ASN A 98  ? 0.7054 0.7147 0.6510 -0.1326 0.1448  -0.0413 113 ASN A N   
706  C CA  . ASN A 98  ? 0.9142 0.9697 0.8518 -0.1524 0.1267  -0.0657 113 ASN A CA  
707  C C   . ASN A 98  ? 0.9142 0.9931 0.8102 -0.1266 0.0807  -0.0624 113 ASN A C   
708  O O   . ASN A 98  ? 0.9478 1.0520 0.8255 -0.1438 0.0578  -0.0770 113 ASN A O   
709  C CB  . ASN A 98  ? 0.9344 1.0355 0.9169 -0.1582 0.1454  -0.0651 113 ASN A CB  
710  C CG  . ASN A 98  ? 1.0794 1.1942 1.0641 -0.1172 0.1435  -0.0359 113 ASN A CG  
711  O OD1 . ASN A 98  ? 1.1631 1.2519 1.1587 -0.1045 0.1678  -0.0118 113 ASN A OD1 
712  N ND2 . ASN A 98  ? 1.0273 1.1848 1.0030 -0.0978 0.1167  -0.0359 113 ASN A ND2 
713  N N   . GLN A 99  ? 0.9050 0.9766 0.7870 -0.0874 0.0696  -0.0421 114 GLN A N   
714  C CA  . GLN A 99  ? 0.9224 1.0060 0.7753 -0.0608 0.0375  -0.0390 114 GLN A CA  
715  C C   . GLN A 99  ? 0.9358 0.9735 0.7511 -0.0618 0.0247  -0.0446 114 GLN A C   
716  O O   . GLN A 99  ? 0.8935 0.9394 0.6872 -0.0527 0.0013  -0.0450 114 GLN A O   
717  C CB  . GLN A 99  ? 0.8968 0.9866 0.7468 -0.0258 0.0388  -0.0243 114 GLN A CB  
718  C CG  . GLN A 99  ? 0.9166 1.0506 0.8000 -0.0221 0.0537  -0.0191 114 GLN A CG  
719  C CD  . GLN A 99  ? 0.9669 1.1033 0.8354 0.0072  0.0596  -0.0099 114 GLN A CD  
720  O OE1 . GLN A 99  ? 1.1485 1.2581 0.9888 0.0144  0.0655  -0.0013 114 GLN A OE1 
721  N NE2 . GLN A 99  ? 0.9766 1.1481 0.8663 0.0215  0.0593  -0.0120 114 GLN A NE2 
722  N N   . PHE A 100 ? 0.9347 0.9241 0.7497 -0.0714 0.0431  -0.0452 115 PHE A N   
723  C CA  . PHE A 100 ? 0.8904 0.8307 0.6776 -0.0761 0.0387  -0.0531 115 PHE A CA  
724  C C   . PHE A 100 ? 0.9406 0.8785 0.7067 -0.1114 0.0377  -0.0722 115 PHE A C   
725  O O   . PHE A 100 ? 1.0303 0.9553 0.7584 -0.1090 0.0197  -0.0751 115 PHE A O   
726  C CB  . PHE A 100 ? 0.8244 0.7189 0.6338 -0.0795 0.0623  -0.0465 115 PHE A CB  
727  C CG  . PHE A 100 ? 0.9619 0.8013 0.7557 -0.0915 0.0680  -0.0585 115 PHE A CG  
728  C CD1 . PHE A 100 ? 1.1206 0.9380 0.8919 -0.0682 0.0504  -0.0570 115 PHE A CD1 
729  C CD2 . PHE A 100 ? 0.9766 0.7821 0.7807 -0.1291 0.0978  -0.0751 115 PHE A CD2 
730  C CE1 . PHE A 100 ? 1.1266 0.8900 0.8876 -0.0793 0.0605  -0.0684 115 PHE A CE1 
731  C CE2 . PHE A 100 ? 1.0962 0.8454 0.8855 -0.1420 0.1099  -0.0879 115 PHE A CE2 
732  C CZ  . PHE A 100 ? 1.0599 0.7883 0.8284 -0.1156 0.0903  -0.0828 115 PHE A CZ  
733  N N   . LEU A 101 ? 0.8679 0.8189 0.6567 -0.1469 0.0597  -0.0857 116 LEU A N   
734  C CA  . LEU A 101 ? 0.9203 0.8755 0.6831 -0.1922 0.0619  -0.1109 116 LEU A CA  
735  C C   . LEU A 101 ? 0.9075 0.9250 0.6428 -0.1885 0.0197  -0.1059 116 LEU A C   
736  O O   . LEU A 101 ? 0.9561 0.9745 0.6444 -0.2121 0.0045  -0.1147 116 LEU A O   
737  C CB  . LEU A 101 ? 0.9896 0.9510 0.7915 -0.2341 0.1001  -0.1317 116 LEU A CB  
738  C CG  . LEU A 101 ? 0.9631 0.8634 0.8085 -0.2394 0.1493  -0.1301 116 LEU A CG  
739  C CD1 . LEU A 101 ? 0.9781 0.8821 0.8708 -0.2819 0.1956  -0.1516 116 LEU A CD1 
740  C CD2 . LEU A 101 ? 0.9511 0.7844 0.7696 -0.2510 0.1626  -0.1406 116 LEU A CD2 
741  N N   . ASP A 102 ? 0.8826 0.9533 0.6498 -0.1590 0.0027  -0.0882 117 ASP A N   
742  C CA  . ASP A 102 ? 0.9378 1.0721 0.7007 -0.1459 -0.0362 -0.0735 117 ASP A CA  
743  C C   . ASP A 102 ? 1.0366 1.1431 0.7581 -0.1193 -0.0576 -0.0566 117 ASP A C   
744  O O   . ASP A 102 ? 1.0591 1.1988 0.7550 -0.1264 -0.0861 -0.0458 117 ASP A O   
745  C CB  . ASP A 102 ? 0.9877 1.1680 0.8023 -0.1122 -0.0393 -0.0568 117 ASP A CB  
746  C CG  . ASP A 102 ? 1.1261 1.3553 0.9867 -0.1401 -0.0254 -0.0700 117 ASP A CG  
747  O OD1 . ASP A 102 ? 1.0953 1.3643 1.0008 -0.1172 -0.0242 -0.0583 117 ASP A OD1 
748  O OD2 . ASP A 102 ? 1.2572 1.4822 1.1116 -0.1872 -0.0104 -0.0952 117 ASP A OD2 
749  N N   . TYR A 103 ? 0.9966 1.0455 0.7140 -0.0898 -0.0432 -0.0523 118 TYR A N   
750  C CA  . TYR A 103 ? 1.0216 1.0341 0.7083 -0.0641 -0.0537 -0.0404 118 TYR A CA  
751  C C   . TYR A 103 ? 1.0943 1.0599 0.7295 -0.0954 -0.0484 -0.0529 118 TYR A C   
752  O O   . TYR A 103 ? 1.2021 1.1641 0.8015 -0.0897 -0.0653 -0.0394 118 TYR A O   
753  C CB  . TYR A 103 ? 1.0790 1.0486 0.7787 -0.0315 -0.0382 -0.0398 118 TYR A CB  
754  C CG  . TYR A 103 ? 1.1062 1.0505 0.7924 0.0009  -0.0452 -0.0289 118 TYR A CG  
755  C CD1 . TYR A 103 ? 1.0794 1.0542 0.7931 0.0352  -0.0506 -0.0142 118 TYR A CD1 
756  C CD2 . TYR A 103 ? 1.1502 1.0356 0.8030 -0.0039 -0.0387 -0.0346 118 TYR A CD2 
757  C CE1 . TYR A 103 ? 1.0982 1.0446 0.8092 0.0639  -0.0476 -0.0058 118 TYR A CE1 
758  C CE2 . TYR A 103 ? 1.2069 1.0649 0.8534 0.0252  -0.0384 -0.0254 118 TYR A CE2 
759  C CZ  . TYR A 103 ? 1.1570 1.0454 0.8341 0.0590  -0.0420 -0.0111 118 TYR A CZ  
760  O OH  . TYR A 103 ? 1.1812 1.0376 0.8614 0.0871  -0.0327 -0.0034 118 TYR A OH  
761  N N   . LEU A 104 ? 1.0795 1.0065 0.7141 -0.1283 -0.0198 -0.0765 119 LEU A N   
762  C CA  . LEU A 104 ? 1.1201 0.9945 0.7093 -0.1644 -0.0031 -0.0949 119 LEU A CA  
763  C C   . LEU A 104 ? 1.1375 1.0550 0.6786 -0.2025 -0.0231 -0.0998 119 LEU A C   
764  O O   . LEU A 104 ? 1.2310 1.1233 0.7134 -0.2154 -0.0287 -0.0982 119 LEU A O   
765  C CB  . LEU A 104 ? 1.0783 0.9074 0.6961 -0.1933 0.0398  -0.1183 119 LEU A CB  
766  C CG  . LEU A 104 ? 1.1081 0.8792 0.6884 -0.2404 0.0711  -0.1456 119 LEU A CG  
767  C CD1 . LEU A 104 ? 1.1499 0.8616 0.6963 -0.2223 0.0719  -0.1393 119 LEU A CD1 
768  C CD2 . LEU A 104 ? 1.1372 0.8684 0.7705 -0.2655 0.1211  -0.1643 119 LEU A CD2 
769  N N   . GLN A 105 ? 1.0954 1.0818 0.6608 -0.2227 -0.0341 -0.1052 120 GLN A N   
770  C CA  . GLN A 105 ? 1.2309 1.2810 0.7574 -0.2622 -0.0617 -0.1090 120 GLN A CA  
771  C C   . GLN A 105 ? 1.2207 1.3153 0.7271 -0.2270 -0.1079 -0.0667 120 GLN A C   
772  O O   . GLN A 105 ? 1.1283 1.2426 0.5728 -0.2516 -0.1305 -0.0582 120 GLN A O   
773  C CB  . GLN A 105 ? 1.2478 1.3693 0.8245 -0.2852 -0.0638 -0.1226 120 GLN A CB  
774  C CG  . GLN A 105 ? 1.3568 1.5705 0.9096 -0.3217 -0.1038 -0.1217 120 GLN A CG  
775  C CD  . GLN A 105 ? 1.4274 1.7172 1.0475 -0.3364 -0.1068 -0.1327 120 GLN A CD  
776  O OE1 . GLN A 105 ? 1.4420 1.7119 1.1231 -0.3146 -0.0774 -0.1368 120 GLN A OE1 
777  N NE2 . GLN A 105 ? 1.4653 1.8462 1.0741 -0.3756 -0.1426 -0.1365 120 GLN A NE2 
778  N N   . GLU A 106 ? 1.1439 1.2533 0.7038 -0.1701 -0.1178 -0.0384 121 GLU A N   
779  C CA  . GLU A 106 ? 1.0304 1.1754 0.5948 -0.1287 -0.1506 0.0057  121 GLU A CA  
780  C C   . GLU A 106 ? 1.1329 1.2043 0.6435 -0.1150 -0.1415 0.0159  121 GLU A C   
781  O O   . GLU A 106 ? 1.1894 1.2824 0.6722 -0.1029 -0.1662 0.0509  121 GLU A O   
782  C CB  . GLU A 106 ? 1.0934 1.2564 0.7326 -0.0764 -0.1473 0.0229  121 GLU A CB  
783  C CG  . GLU A 106 ? 1.2852 1.5103 0.9626 -0.0377 -0.1770 0.0690  121 GLU A CG  
784  C CD  . GLU A 106 ? 1.4685 1.7196 1.2259 0.0008  -0.1657 0.0760  121 GLU A CD  
785  O OE1 . GLU A 106 ? 1.5635 1.8041 1.3539 0.0467  -0.1599 0.1019  121 GLU A OE1 
786  O OE2 . GLU A 106 ? 1.4806 1.7586 1.2685 -0.0166 -0.1566 0.0542  121 GLU A OE2 
787  N N   . PHE A 107 ? 0.9248 0.6543 0.8257 0.0242  0.0566  -0.1706 122 PHE A N   
788  C CA  . PHE A 107 ? 1.0379 0.7827 0.8888 -0.0177 0.0389  -0.1771 122 PHE A CA  
789  C C   . PHE A 107 ? 1.1135 0.8916 0.9505 -0.0607 0.0189  -0.1670 122 PHE A C   
790  O O   . PHE A 107 ? 1.1874 0.9526 1.0050 -0.0957 -0.0053 -0.1487 122 PHE A O   
791  C CB  . PHE A 107 ? 1.0938 0.8732 0.9121 -0.0066 0.0603  -0.2091 122 PHE A CB  
792  C CG  . PHE A 107 ? 1.1805 0.9952 0.9579 -0.0523 0.0473  -0.2173 122 PHE A CG  
793  C CD1 . PHE A 107 ? 1.1862 0.9755 0.9497 -0.0749 0.0295  -0.2137 122 PHE A CD1 
794  C CD2 . PHE A 107 ? 1.1943 1.0685 0.9511 -0.0709 0.0537  -0.2283 122 PHE A CD2 
795  C CE1 . PHE A 107 ? 1.2725 1.0974 1.0094 -0.1179 0.0210  -0.2175 122 PHE A CE1 
796  C CE2 . PHE A 107 ? 1.2126 1.1244 0.9350 -0.1104 0.0457  -0.2326 122 PHE A CE2 
797  C CZ  . PHE A 107 ? 1.2840 1.1724 0.9999 -0.1350 0.0309  -0.2256 122 PHE A CZ  
798  N N   . LEU A 108 ? 1.0312 0.8513 0.8765 -0.0546 0.0292  -0.1786 123 LEU A N   
799  C CA  . LEU A 108 ? 1.0485 0.9045 0.8751 -0.0860 0.0098  -0.1740 123 LEU A CA  
800  C C   . LEU A 108 ? 0.9514 0.7766 0.8026 -0.0955 -0.0194 -0.1474 123 LEU A C   
801  O O   . LEU A 108 ? 0.9014 0.7419 0.7233 -0.1240 -0.0422 -0.1358 123 LEU A O   
802  C CB  . LEU A 108 ? 0.9685 0.8709 0.8027 -0.0706 0.0247  -0.1967 123 LEU A CB  
803  C CG  . LEU A 108 ? 1.0652 1.0099 0.8612 -0.0670 0.0490  -0.2242 123 LEU A CG  
804  C CD1 . LEU A 108 ? 1.0198 0.9994 0.8305 -0.0443 0.0652  -0.2455 123 LEU A CD1 
805  C CD2 . LEU A 108 ? 1.0450 1.0252 0.7862 -0.1075 0.0364  -0.2232 123 LEU A CD2 
806  N N   . GLY A 109 ? 1.0243 0.8073 0.9277 -0.0683 -0.0178 -0.1368 124 GLY A N   
807  C CA  . GLY A 109 ? 1.0957 0.8468 1.0270 -0.0732 -0.0461 -0.1130 124 GLY A CA  
808  C C   . GLY A 109 ? 1.1243 0.8397 1.0204 -0.0990 -0.0669 -0.0905 124 GLY A C   
809  O O   . GLY A 109 ? 1.0158 0.7203 0.9044 -0.1163 -0.0951 -0.0713 124 GLY A O   
810  N N   . VAL A 110 ? 1.1140 0.8096 0.9893 -0.0994 -0.0544 -0.0936 125 VAL A N   
811  C CA  . VAL A 110 ? 1.0845 0.7424 0.9323 -0.1249 -0.0732 -0.0736 125 VAL A CA  
812  C C   . VAL A 110 ? 1.1307 0.8216 0.9297 -0.1679 -0.0840 -0.0655 125 VAL A C   
813  O O   . VAL A 110 ? 1.2790 0.9473 1.0611 -0.1911 -0.1063 -0.0384 125 VAL A O   
814  C CB  . VAL A 110 ? 1.0791 0.7075 0.9227 -0.1112 -0.0605 -0.0851 125 VAL A CB  
815  C CG1 . VAL A 110 ? 1.0555 0.6459 0.8755 -0.1425 -0.0822 -0.0665 125 VAL A CG1 
816  C CG2 . VAL A 110 ? 1.0370 0.6284 0.9228 -0.0635 -0.0494 -0.0865 125 VAL A CG2 
817  N N   . MET A 111 ? 1.1376 0.8828 0.9132 -0.1757 -0.0661 -0.0871 126 MET A N   
818  C CA  . MET A 111 ? 1.1339 0.9220 0.8646 -0.2120 -0.0707 -0.0793 126 MET A CA  
819  C C   . MET A 111 ? 1.2251 1.0211 0.9431 -0.2193 -0.0930 -0.0591 126 MET A C   
820  O O   . MET A 111 ? 1.2590 1.0514 0.9446 -0.2462 -0.1068 -0.0320 126 MET A O   
821  C CB  . MET A 111 ? 1.0147 0.8664 0.7279 -0.2091 -0.0480 -0.1093 126 MET A CB  
822  C CG  . MET A 111 ? 0.9939 0.8517 0.7030 -0.2103 -0.0295 -0.1295 126 MET A CG  
823  S SD  . MET A 111 ? 1.7544 1.6891 1.4409 -0.2025 -0.0039 -0.1657 126 MET A SD  
824  C CE  . MET A 111 ? 0.9031 0.8912 0.5474 -0.2356 -0.0148 -0.1473 126 MET A CE  
825  N N   . ASN A 112 ? 1.1383 0.9450 0.8844 -0.1929 -0.0969 -0.0727 127 ASN A N   
826  C CA  . ASN A 112 ? 1.1982 1.0119 0.9391 -0.1917 -0.1234 -0.0614 127 ASN A CA  
827  C C   . ASN A 112 ? 1.2097 0.9675 0.9585 -0.1952 -0.1485 -0.0306 127 ASN A C   
828  O O   . ASN A 112 ? 1.2549 1.0145 0.9672 -0.2089 -0.1695 -0.0093 127 ASN A O   
829  C CB  . ASN A 112 ? 1.3379 1.1694 1.1249 -0.1614 -0.1244 -0.0862 127 ASN A CB  
830  C CG  . ASN A 112 ? 1.4363 1.3268 1.1924 -0.1627 -0.1292 -0.1046 127 ASN A CG  
831  O OD1 . ASN A 112 ? 1.4909 1.4216 1.2284 -0.1637 -0.1066 -0.1254 127 ASN A OD1 
832  N ND2 . ASN A 112 ? 1.4631 1.3591 1.2105 -0.1591 -0.1609 -0.0989 127 ASN A ND2 
833  N N   . THR A 113 ? 1.1255 0.8340 0.9181 -0.1791 -0.1455 -0.0275 128 THR A N   
834  C CA  . THR A 113 ? 1.0939 0.7459 0.8961 -0.1790 -0.1688 0.0002  128 THR A CA  
835  C C   . THR A 113 ? 1.2629 0.8935 1.0162 -0.2118 -0.1745 0.0275  128 THR A C   
836  O O   . THR A 113 ? 1.4094 1.0146 1.1421 -0.2209 -0.1977 0.0551  128 THR A O   
837  C CB  . THR A 113 ? 1.2390 0.8439 1.0936 -0.1524 -0.1603 -0.0022 128 THR A CB  
838  O OG1 . THR A 113 ? 1.2406 0.8686 1.1465 -0.1222 -0.1449 -0.0252 128 THR A OG1 
839  C CG2 . THR A 113 ? 1.0462 0.5974 0.9165 -0.1463 -0.1875 0.0237  128 THR A CG2 
840  N N   . GLU A 114 ? 1.2950 0.9361 1.0331 -0.2286 -0.1535 0.0198  129 GLU A N   
841  C CA  . GLU A 114 ? 1.3798 0.9990 1.0871 -0.2621 -0.1564 0.0448  129 GLU A CA  
842  C C   . GLU A 114 ? 1.5279 1.2053 1.1912 -0.2911 -0.1454 0.0501  129 GLU A C   
843  O O   . GLU A 114 ? 1.4623 1.1598 1.1208 -0.3102 -0.1278 0.0415  129 GLU A O   
844  C CB  . GLU A 114 ? 1.3088 0.8935 1.0382 -0.2608 -0.1457 0.0329  129 GLU A CB  
845  C CG  . GLU A 114 ? 1.3841 0.9173 1.1544 -0.2245 -0.1509 0.0252  129 GLU A CG  
846  C CD  . GLU A 114 ? 1.6874 1.1612 1.4616 -0.2237 -0.1774 0.0564  129 GLU A CD  
847  O OE1 . GLU A 114 ? 1.9326 1.3948 1.6757 -0.2534 -0.1912 0.0856  129 GLU A OE1 
848  O OE2 . GLU A 114 ? 1.6234 1.0625 1.4321 -0.1913 -0.1829 0.0535  129 GLU A OE2 
849  N N   . TRP A 115 ? 1.7126 1.4180 1.3444 -0.2912 -0.1572 0.0635  130 TRP A N   
850  C CA  . TRP A 115 ? 1.9031 1.6647 1.4861 -0.3132 -0.1474 0.0746  130 TRP A CA  
851  C C   . TRP A 115 ? 2.0561 1.8296 1.6001 -0.3036 -0.1685 0.0947  130 TRP A C   
852  O O   . TRP A 115 ? 2.1614 1.8991 1.6835 -0.3128 -0.1824 0.1318  130 TRP A O   
853  C CB  . TRP A 115 ? 1.9305 1.7570 1.5123 -0.3074 -0.1254 0.0379  130 TRP A CB  
854  C CG  . TRP A 115 ? 2.0863 1.9773 1.6180 -0.3107 -0.1230 0.0412  130 TRP A CG  
855  C CD1 . TRP A 115 ? 2.1157 2.0443 1.6368 -0.2849 -0.1320 0.0178  130 TRP A CD1 
856  C CD2 . TRP A 115 ? 2.1819 2.1072 1.6685 -0.3387 -0.1112 0.0702  130 TRP A CD2 
857  N NE1 . TRP A 115 ? 2.1775 2.1616 1.6423 -0.2916 -0.1283 0.0279  130 TRP A NE1 
858  C CE2 . TRP A 115 ? 2.2082 2.1934 1.6507 -0.3239 -0.1130 0.0622  130 TRP A CE2 
859  C CE3 . TRP A 115 ? 2.1621 2.0734 1.6460 -0.3737 -0.0991 0.1028  130 TRP A CE3 
860  C CZ2 . TRP A 115 ? 2.1874 2.2216 1.5775 -0.3400 -0.0998 0.0882  130 TRP A CZ2 
861  C CZ3 . TRP A 115 ? 2.1831 2.1433 1.6241 -0.3937 -0.0844 0.1308  130 TRP A CZ3 
862  C CH2 . TRP A 115 ? 2.1924 2.2149 1.5841 -0.3753 -0.0832 0.1245  130 TRP A CH2 
863  N N   . ILE B 9   ? 3.2524 2.1489 1.8339 -0.1004 0.4058  -0.3941 24  ILE B N   
864  C CA  . ILE B 9   ? 3.1694 2.0337 1.8546 -0.1118 0.3896  -0.3539 24  ILE B CA  
865  C C   . ILE B 9   ? 3.1298 2.0104 1.7839 -0.0871 0.3485  -0.2835 24  ILE B C   
866  O O   . ILE B 9   ? 3.1066 1.9492 1.7657 -0.0728 0.3653  -0.2135 24  ILE B O   
867  C CB  . ILE B 9   ? 3.1004 1.8967 1.8692 -0.1195 0.4421  -0.3218 24  ILE B CB  
868  C CG1 . ILE B 9   ? 3.1365 1.9100 1.9210 -0.1350 0.4885  -0.3876 24  ILE B CG1 
869  C CG2 . ILE B 9   ? 2.9114 1.6843 1.7899 -0.1314 0.4244  -0.2944 24  ILE B CG2 
870  C CD1 . ILE B 9   ? 3.0732 1.7870 1.9333 -0.1370 0.5436  -0.3566 24  ILE B CD1 
871  N N   . PRO B 10  ? 3.0575 1.9950 1.6825 -0.0817 0.2933  -0.3031 25  PRO B N   
872  C CA  . PRO B 10  ? 2.9637 1.9213 1.5485 -0.0523 0.2485  -0.2455 25  PRO B CA  
873  C C   . PRO B 10  ? 2.8372 1.7710 1.5144 -0.0529 0.2243  -0.2111 25  PRO B C   
874  O O   . PRO B 10  ? 2.7483 1.6393 1.5170 -0.0723 0.2522  -0.2105 25  PRO B O   
875  C CB  . PRO B 10  ? 3.0057 2.0468 1.5240 -0.0464 0.2026  -0.2961 25  PRO B CB  
876  C CG  . PRO B 10  ? 3.0009 2.0578 1.5854 -0.0843 0.2074  -0.3757 25  PRO B CG  
877  C CD  . PRO B 10  ? 3.0492 2.0393 1.6758 -0.1032 0.2699  -0.3868 25  PRO B CD  
878  N N   . THR B 11  ? 2.8653 1.8300 1.5155 -0.0272 0.1728  -0.1829 26  THR B N   
879  C CA  . THR B 11  ? 2.7883 1.7383 1.5135 -0.0185 0.1449  -0.1515 26  THR B CA  
880  C C   . THR B 11  ? 2.7863 1.8104 1.5001 -0.0030 0.0865  -0.1711 26  THR B C   
881  O O   . THR B 11  ? 2.6905 1.7401 1.4825 -0.0134 0.0708  -0.1895 26  THR B O   
882  C CB  . THR B 11  ? 2.7517 1.6410 1.4662 0.0083  0.1425  -0.0744 26  THR B CB  
883  O OG1 . THR B 11  ? 2.8662 1.7729 1.4783 0.0386  0.1176  -0.0452 26  THR B OG1 
884  C CG2 . THR B 11  ? 2.6939 1.5173 1.4384 -0.0083 0.1992  -0.0485 26  THR B CG2 
885  N N   . SER B 12  ? 2.8563 1.9218 1.4731 0.0242  0.0556  -0.1637 27  SER B N   
886  C CA  . SER B 12  ? 2.8078 1.9468 1.4054 0.0489  -0.0028 -0.1713 27  SER B CA  
887  C C   . SER B 12  ? 2.7119 1.9324 1.3550 0.0201  -0.0192 -0.2411 27  SER B C   
888  O O   . SER B 12  ? 2.7095 2.0001 1.3619 0.0361  -0.0652 -0.2484 27  SER B O   
889  C CB  . SER B 12  ? 2.9166 2.0863 1.3956 0.0856  -0.0285 -0.1482 27  SER B CB  
890  O OG  . SER B 12  ? 2.9365 2.0295 1.3826 0.1110  -0.0169 -0.0760 27  SER B OG  
891  N N   . ALA B 13  ? 2.5791 1.7904 1.2541 -0.0221 0.0184  -0.2917 28  ALA B N   
892  C CA  . ALA B 13  ? 2.4523 1.7284 1.1838 -0.0581 0.0067  -0.3589 28  ALA B CA  
893  C C   . ALA B 13  ? 2.3588 1.5890 1.2095 -0.0938 0.0419  -0.3675 28  ALA B C   
894  O O   . ALA B 13  ? 2.3266 1.5961 1.2437 -0.1297 0.0393  -0.4168 28  ALA B O   
895  C CB  . ALA B 13  ? 2.4536 1.7653 1.1201 -0.0774 0.0130  -0.4230 28  ALA B CB  
896  N N   . LEU B 14  ? 2.3437 1.4926 1.2239 -0.0842 0.0745  -0.3174 29  LEU B N   
897  C CA  . LEU B 14  ? 2.3024 1.4101 1.2939 -0.1083 0.1063  -0.3126 29  LEU B CA  
898  C C   . LEU B 14  ? 2.2064 1.3742 1.2698 -0.1044 0.0711  -0.3057 29  LEU B C   
899  O O   . LEU B 14  ? 2.2396 1.4345 1.3859 -0.1376 0.0792  -0.3365 29  LEU B O   
900  C CB  . LEU B 14  ? 2.2475 1.2724 1.2505 -0.0901 0.1365  -0.2535 29  LEU B CB  
901  C CG  . LEU B 14  ? 2.2609 1.2139 1.2999 -0.1127 0.1971  -0.2562 29  LEU B CG  
902  C CD1 . LEU B 14  ? 2.1752 1.0659 1.2294 -0.0912 0.2136  -0.1916 29  LEU B CD1 
903  C CD2 . LEU B 14  ? 2.2592 1.2128 1.4009 -0.1471 0.2194  -0.2899 29  LEU B CD2 
904  N N   . VAL B 15  ? 2.0459 1.2346 1.0770 -0.0618 0.0325  -0.2633 30  VAL B N   
905  C CA  . VAL B 15  ? 2.0821 1.3320 1.1707 -0.0448 -0.0024 -0.2490 30  VAL B CA  
906  C C   . VAL B 15  ? 2.1784 1.5291 1.2973 -0.0699 -0.0272 -0.2974 30  VAL B C   
907  O O   . VAL B 15  ? 2.2478 1.6434 1.4571 -0.0831 -0.0295 -0.2985 30  VAL B O   
908  C CB  . VAL B 15  ? 2.1211 1.3784 1.1468 0.0113  -0.0457 -0.2056 30  VAL B CB  
909  C CG1 . VAL B 15  ? 2.0191 1.3025 1.1131 0.0375  -0.0661 -0.1778 30  VAL B CG1 
910  C CG2 . VAL B 15  ? 2.1718 1.3343 1.1380 0.0291  -0.0266 -0.1662 30  VAL B CG2 
911  N N   . LYS B 16  ? 2.1803 1.5720 1.2253 -0.0763 -0.0459 -0.3356 31  LYS B N   
912  C CA  . LYS B 16  ? 2.1740 1.6680 1.2435 -0.1030 -0.0746 -0.3868 31  LYS B CA  
913  C C   . LYS B 16  ? 2.1762 1.6613 1.3486 -0.1615 -0.0413 -0.4258 31  LYS B C   
914  O O   . LYS B 16  ? 2.1201 1.6784 1.3746 -0.1837 -0.0568 -0.4390 31  LYS B O   
915  C CB  . LYS B 16  ? 2.3073 1.8400 1.2721 -0.0996 -0.0971 -0.4251 31  LYS B CB  
916  C CG  . LYS B 16  ? 2.2763 1.9281 1.2594 -0.1235 -0.1364 -0.4796 31  LYS B CG  
917  C CD  . LYS B 16  ? 2.2769 1.9227 1.2684 -0.1780 -0.1165 -0.5531 31  LYS B CD  
918  C CE  . LYS B 16  ? 2.2889 2.0583 1.2812 -0.1991 -0.1636 -0.6108 31  LYS B CE  
919  N NZ  . LYS B 16  ? 2.2941 2.1336 1.1721 -0.1491 -0.2087 -0.5997 31  LYS B NZ  
920  N N   . GLU B 17  ? 2.2641 1.6588 1.4341 -0.1849 0.0059  -0.4408 32  GLU B N   
921  C CA  . GLU B 17  ? 2.2789 1.6433 1.5429 -0.2371 0.0424  -0.4761 32  GLU B CA  
922  C C   . GLU B 17  ? 2.0764 1.4053 1.4396 -0.2347 0.0694  -0.4261 32  GLU B C   
923  O O   . GLU B 17  ? 1.9601 1.3011 1.4253 -0.2713 0.0849  -0.4384 32  GLU B O   
924  C CB  . GLU B 17  ? 2.4492 1.7316 1.6671 -0.2545 0.0830  -0.5119 32  GLU B CB  
925  C CG  . GLU B 17  ? 2.6297 1.9510 1.7388 -0.2507 0.0584  -0.5610 32  GLU B CG  
926  C CD  . GLU B 17  ? 2.7486 1.9934 1.7977 -0.2547 0.1007  -0.5878 32  GLU B CD  
927  O OE1 . GLU B 17  ? 2.8543 2.1316 1.8258 -0.2589 0.0870  -0.6423 32  GLU B OE1 
928  O OE2 . GLU B 17  ? 2.7170 1.8767 1.7955 -0.2508 0.1471  -0.5548 32  GLU B OE2 
929  N N   . THR B 18  ? 2.0282 1.3156 1.3628 -0.1912 0.0736  -0.3687 33  THR B N   
930  C CA  . THR B 18  ? 1.8925 1.1540 1.3103 -0.1806 0.0945  -0.3205 33  THR B CA  
931  C C   . THR B 18  ? 1.7975 1.1548 1.2789 -0.1708 0.0616  -0.3029 33  THR B C   
932  O O   . THR B 18  ? 1.6511 1.0213 1.2328 -0.1903 0.0826  -0.2911 33  THR B O   
933  C CB  . THR B 18  ? 1.8124 1.0093 1.1828 -0.1367 0.1007  -0.2685 33  THR B CB  
934  O OG1 . THR B 18  ? 1.8920 1.0048 1.2225 -0.1485 0.1405  -0.2773 33  THR B OG1 
935  C CG2 . THR B 18  ? 1.6501 0.8366 1.1040 -0.1213 0.1142  -0.2234 33  THR B CG2 
936  N N   . LEU B 19  ? 1.9319 1.0540 0.9014 -0.2932 0.0628  -0.2170 34  LEU B N   
937  C CA  . LEU B 19  ? 1.9636 1.1368 0.9880 -0.3122 0.0256  -0.2091 34  LEU B CA  
938  C C   . LEU B 19  ? 2.0353 1.1753 1.0420 -0.3434 0.0102  -0.2359 34  LEU B C   
939  O O   . LEU B 19  ? 2.0627 1.2202 1.1261 -0.3548 0.0017  -0.2314 34  LEU B O   
940  C CB  . LEU B 19  ? 1.9851 1.2113 1.0013 -0.3161 -0.0090 -0.1962 34  LEU B CB  
941  C CG  . LEU B 19  ? 2.0399 1.3239 1.1170 -0.2945 -0.0080 -0.1638 34  LEU B CG  
942  C CD1 . LEU B 19  ? 2.0983 1.4365 1.1780 -0.3031 -0.0504 -0.1527 34  LEU B CD1 
943  C CD2 . LEU B 19  ? 2.0187 1.3297 1.1834 -0.2856 0.0027  -0.1519 34  LEU B CD2 
944  N N   . ALA B 20  ? 2.0882 1.1799 1.0160 -0.3572 0.0082  -0.2647 35  ALA B N   
945  C CA  . ALA B 20  ? 2.1677 1.2211 1.0746 -0.3900 -0.0034 -0.2969 35  ALA B CA  
946  C C   . ALA B 20  ? 2.1587 1.1587 1.0922 -0.3869 0.0305  -0.3004 35  ALA B C   
947  O O   . ALA B 20  ? 2.1828 1.1771 1.1493 -0.4090 0.0236  -0.3087 35  ALA B O   
948  C CB  . ALA B 20  ? 2.2024 1.2311 1.0383 -0.3926 -0.0075 -0.3220 35  ALA B CB  
949  N N   . LEU B 21  ? 2.1172 1.0897 1.0472 -0.3537 0.0691  -0.2894 36  LEU B N   
950  C CA  . LEU B 21  ? 2.1063 1.0322 1.0601 -0.3405 0.1033  -0.2888 36  LEU B CA  
951  C C   . LEU B 21  ? 2.0938 1.0684 1.1340 -0.3357 0.0971  -0.2622 36  LEU B C   
952  O O   . LEU B 21  ? 2.0040 0.9465 1.0648 -0.3448 0.1063  -0.2654 36  LEU B O   
953  C CB  . LEU B 21  ? 2.0887 0.9891 1.0234 -0.3019 0.1438  -0.2834 36  LEU B CB  
954  C CG  . LEU B 21  ? 2.1847 1.0191 1.0369 -0.2990 0.1641  -0.3101 36  LEU B CG  
955  C CD1 . LEU B 21  ? 2.1974 1.0169 1.0409 -0.2599 0.2055  -0.3029 36  LEU B CD1 
956  C CD2 . LEU B 21  ? 2.1510 0.9389 0.9991 -0.3129 0.1689  -0.3274 36  LEU B CD2 
957  N N   . LEU B 22  ? 2.0761 1.1259 1.1647 -0.3204 0.0832  -0.2358 37  LEU B N   
958  C CA  . LEU B 22  ? 1.9945 1.1004 1.1651 -0.3123 0.0745  -0.2105 37  LEU B CA  
959  C C   . LEU B 22  ? 2.1086 1.2308 1.3011 -0.3485 0.0437  -0.2148 37  LEU B C   
960  O O   . LEU B 22  ? 2.1365 1.2787 1.3853 -0.3460 0.0448  -0.1995 37  LEU B O   
961  C CB  . LEU B 22  ? 1.8926 1.0748 1.1062 -0.2918 0.0632  -0.1863 37  LEU B CB  
962  C CG  . LEU B 22  ? 1.8452 1.0386 1.0879 -0.2513 0.0966  -0.1738 37  LEU B CG  
963  C CD1 . LEU B 22  ? 1.7945 1.0495 1.0637 -0.2397 0.0867  -0.1573 37  LEU B CD1 
964  C CD2 . LEU B 22  ? 1.7737 0.9852 1.0803 -0.2306 0.1084  -0.1608 37  LEU B CD2 
965  N N   . SER B 23  ? 2.1729 1.2896 1.3209 -0.3810 0.0170  -0.2366 38  SER B N   
966  C CA  . SER B 23  ? 2.1234 1.2625 1.2927 -0.4193 -0.0138 -0.2464 38  SER B CA  
967  C C   . SER B 23  ? 2.1932 1.2638 1.3593 -0.4403 0.0071  -0.2637 38  SER B C   
968  O O   . SER B 23  ? 2.2004 1.2902 1.4071 -0.4668 -0.0066 -0.2639 38  SER B O   
969  C CB  . SER B 23  ? 2.1169 1.2727 1.2359 -0.4448 -0.0485 -0.2699 38  SER B CB  
970  O OG  . SER B 23  ? 2.0941 1.2940 1.2517 -0.4751 -0.0780 -0.2776 38  SER B OG  
971  N N   . THR B 24  ? 2.2500 1.2416 1.3701 -0.4267 0.0427  -0.2771 39  THR B N   
972  C CA  . THR B 24  ? 2.3792 1.3126 1.5014 -0.4362 0.0668  -0.2881 39  THR B CA  
973  C C   . THR B 24  ? 2.3595 1.2538 1.5084 -0.4093 0.1030  -0.2671 39  THR B C   
974  O O   . THR B 24  ? 2.4148 1.2992 1.6012 -0.4206 0.1103  -0.2586 39  THR B O   
975  C CB  . THR B 24  ? 2.4910 1.3674 1.5513 -0.4330 0.0834  -0.3144 39  THR B CB  
976  O OG1 . THR B 24  ? 2.5976 1.4383 1.6251 -0.3947 0.1144  -0.3074 39  THR B OG1 
977  C CG2 . THR B 24  ? 2.3995 1.3134 1.4271 -0.4525 0.0489  -0.3355 39  THR B CG2 
978  N N   . HIS B 25  ? 2.2603 1.1491 1.3996 -0.3666 0.1262  -0.2544 40  HIS B N   
979  C CA  . HIS B 25  ? 2.1860 1.0536 1.3533 -0.3272 0.1612  -0.2333 40  HIS B CA  
980  C C   . HIS B 25  ? 1.9273 0.8766 1.1727 -0.3083 0.1492  -0.1993 40  HIS B C   
981  O O   . HIS B 25  ? 1.8631 0.8151 1.1369 -0.2681 0.1735  -0.1798 40  HIS B O   
982  C CB  . HIS B 25  ? 2.2478 1.0928 1.3832 -0.2856 0.1901  -0.2355 40  HIS B CB  
983  C CG  . HIS B 25  ? 2.3954 1.1590 1.4533 -0.2971 0.2061  -0.2676 40  HIS B CG  
984  N ND1 . HIS B 25  ? 2.4645 1.2431 1.4819 -0.3157 0.1857  -0.2854 40  HIS B ND1 
985  C CD2 . HIS B 25  ? 2.4477 1.1486 1.4810 -0.2832 0.2365  -0.2751 40  HIS B CD2 
986  C CE1 . HIS B 25  ? 2.5159 1.2437 1.4879 -0.3137 0.2028  -0.3040 40  HIS B CE1 
987  N NE2 . HIS B 25  ? 2.5544 1.2345 1.5361 -0.2953 0.2332  -0.2986 40  HIS B NE2 
988  N N   . ARG B 26  ? 1.8204 0.8386 1.0985 -0.3348 0.1108  -0.1939 41  ARG B N   
989  C CA  . ARG B 26  ? 1.8323 0.9319 1.1836 -0.3205 0.0950  -0.1642 41  ARG B CA  
990  C C   . ARG B 26  ? 1.8612 0.9346 1.2429 -0.3126 0.1165  -0.1486 41  ARG B C   
991  O O   . ARG B 26  ? 1.8641 0.9675 1.2849 -0.2709 0.1307  -0.1249 41  ARG B O   
992  C CB  . ARG B 26  ? 1.8704 1.0360 1.2427 -0.3560 0.0503  -0.1657 41  ARG B CB  
993  C CG  . ARG B 26  ? 1.8734 1.1265 1.3200 -0.3434 0.0305  -0.1370 41  ARG B CG  
994  C CD  . ARG B 26  ? 1.9772 1.2945 1.4378 -0.3754 -0.0140 -0.1407 41  ARG B CD  
995  N NE  . ARG B 26  ? 1.9729 1.3717 1.5039 -0.3652 -0.0332 -0.1150 41  ARG B NE  
996  C CZ  . ARG B 26  ? 1.8845 1.3503 1.4513 -0.3355 -0.0454 -0.0967 41  ARG B CZ  
997  N NH1 . ARG B 26  ? 1.7518 1.2121 1.2929 -0.3149 -0.0380 -0.1001 41  ARG B NH1 
998  N NH2 . ARG B 26  ? 1.8723 1.4097 1.5016 -0.3271 -0.0631 -0.0760 41  ARG B NH2 
999  N N   . THR B 27  ? 1.8832 0.8998 1.2459 -0.3517 0.1205  -0.1633 42  THR B N   
1000 C CA  . THR B 27  ? 1.9266 0.9035 1.3103 -0.3483 0.1465  -0.1482 42  THR B CA  
1001 C C   . THR B 27  ? 1.9552 0.8718 1.3178 -0.2985 0.1906  -0.1379 42  THR B C   
1002 O O   . THR B 27  ? 1.9593 0.8748 1.3509 -0.2700 0.2107  -0.1123 42  THR B O   
1003 C CB  . THR B 27  ? 2.1254 1.0364 1.4861 -0.4036 0.1496  -0.1724 42  THR B CB  
1004 O OG1 . THR B 27  ? 2.2271 1.0911 1.5278 -0.4247 0.1464  -0.2081 42  THR B OG1 
1005 C CG2 . THR B 27  ? 2.0971 1.0799 1.5054 -0.4448 0.1129  -0.1709 42  THR B CG2 
1006 N N   . LEU B 28  ? 1.9586 0.8272 1.2684 -0.2852 0.2058  -0.1576 43  LEU B N   
1007 C CA  . LEU B 28  ? 1.9893 0.8064 1.2766 -0.2345 0.2462  -0.1511 43  LEU B CA  
1008 C C   . LEU B 28  ? 1.9463 0.8481 1.2798 -0.1814 0.2435  -0.1283 43  LEU B C   
1009 O O   . LEU B 28  ? 1.9738 0.8729 1.3246 -0.1355 0.2678  -0.1091 43  LEU B O   
1010 C CB  . LEU B 28  ? 2.0487 0.7924 1.2656 -0.2380 0.2627  -0.1819 43  LEU B CB  
1011 C CG  . LEU B 28  ? 2.0669 0.7461 1.2477 -0.1887 0.3056  -0.1828 43  LEU B CG  
1012 C CD1 . LEU B 28  ? 2.0221 0.7663 1.2186 -0.1432 0.3064  -0.1773 43  LEU B CD1 
1013 C CD2 . LEU B 28  ? 2.0718 0.7116 1.2677 -0.1596 0.3353  -0.1592 43  LEU B CD2 
1014 N N   . LEU B 29  ? 1.8565 0.8333 1.2095 -0.1871 0.2144  -0.1316 44  LEU B N   
1015 C CA  . LEU B 29  ? 1.7780 0.8366 1.1778 -0.1425 0.2113  -0.1164 44  LEU B CA  
1016 C C   . LEU B 29  ? 1.7148 0.8450 1.1825 -0.1249 0.1983  -0.0888 44  LEU B C   
1017 O O   . LEU B 29  ? 1.5592 0.7317 1.0618 -0.0754 0.2100  -0.0755 44  LEU B O   
1018 C CB  . LEU B 29  ? 1.6336 0.7444 1.0342 -0.1575 0.1864  -0.1268 44  LEU B CB  
1019 C CG  . LEU B 29  ? 1.6950 0.7502 1.0313 -0.1618 0.2024  -0.1513 44  LEU B CG  
1020 C CD1 . LEU B 29  ? 1.6855 0.7878 1.0176 -0.1819 0.1765  -0.1574 44  LEU B CD1 
1021 C CD2 . LEU B 29  ? 1.7175 0.7602 1.0514 -0.1107 0.2381  -0.1521 44  LEU B CD2 
1022 N N   . ILE B 30  ? 1.7433 0.8909 1.2301 -0.1640 0.1740  -0.0823 45  ILE B N   
1023 C CA  . ILE B 30  ? 1.6561 0.8758 1.2063 -0.1502 0.1594  -0.0564 45  ILE B CA  
1024 C C   . ILE B 30  ? 1.6222 0.7945 1.1723 -0.1324 0.1881  -0.0387 45  ILE B C   
1025 O O   . ILE B 30  ? 1.5853 0.8025 1.1790 -0.1289 0.1791  -0.0169 45  ILE B O   
1026 C CB  . ILE B 30  ? 1.6061 0.8792 1.1831 -0.1968 0.1190  -0.0557 45  ILE B CB  
1027 C CG1 . ILE B 30  ? 1.5993 0.8073 1.1464 -0.2478 0.1207  -0.0669 45  ILE B CG1 
1028 C CG2 . ILE B 30  ? 1.5272 0.8405 1.0969 -0.2104 0.0929  -0.0701 45  ILE B CG2 
1029 C CD1 . ILE B 30  ? 1.5128 0.7780 1.0865 -0.2932 0.0804  -0.0700 45  ILE B CD1 
1030 N N   . ALA B 31  ? 1.7242 0.8036 1.2228 -0.1190 0.2246  -0.0470 46  ALA B N   
1031 C CA  . ALA B 31  ? 1.7965 0.8166 1.2852 -0.0957 0.2588  -0.0286 46  ALA B CA  
1032 C C   . ALA B 31  ? 1.7235 0.8021 1.2487 -0.0266 0.2690  -0.0048 46  ALA B C   
1033 O O   . ALA B 31  ? 1.6412 0.7165 1.1817 -0.0041 0.2837  0.0204  46  ALA B O   
1034 C CB  . ALA B 31  ? 1.8338 0.7350 1.2538 -0.0973 0.2953  -0.0456 46  ALA B CB  
1035 N N   . ASN B 32  ? 1.7990 0.9324 1.3379 0.0073  0.2625  -0.0144 47  ASN B N   
1036 C CA  . ASN B 32  ? 1.7748 0.9829 1.3570 0.0714  0.2656  0.0008  47  ASN B CA  
1037 C C   . ASN B 32  ? 1.5969 0.9091 1.2459 0.0650  0.2301  0.0152  47  ASN B C   
1038 O O   . ASN B 32  ? 1.4485 0.8203 1.1246 0.0397  0.1995  0.0039  47  ASN B O   
1039 C CB  . ASN B 32  ? 1.7496 0.9870 1.3319 0.1036  0.2706  -0.0193 47  ASN B CB  
1040 C CG  . ASN B 32  ? 1.7124 1.0102 1.3291 0.1764  0.2826  -0.0103 47  ASN B CG  
1041 O OD1 . ASN B 32  ? 1.6728 1.0112 1.3214 0.2039  0.2791  0.0120  47  ASN B OD1 
1042 N ND2 . ASN B 32  ? 1.7306 1.0392 1.3417 0.2095  0.2969  -0.0291 47  ASN B ND2 
1043 N N   . GLU B 33  ? 1.5599 0.8911 1.2322 0.0901  0.2357  0.0413  48  GLU B N   
1044 C CA  . GLU B 33  ? 1.5458 0.9687 1.2776 0.0823  0.2036  0.0563  48  GLU B CA  
1045 C C   . GLU B 33  ? 1.4758 0.9948 1.2587 0.1464  0.1971  0.0652  48  GLU B C   
1046 O O   . GLU B 33  ? 1.4900 1.0948 1.3260 0.1471  0.1691  0.0745  48  GLU B O   
1047 C CB  . GLU B 33  ? 1.6138 0.9986 1.3404 0.0561  0.2111  0.0785  48  GLU B CB  
1048 C CG  . GLU B 33  ? 1.7801 1.0840 1.4676 -0.0135 0.2123  0.0643  48  GLU B CG  
1049 C CD  . GLU B 33  ? 1.9941 1.2635 1.6844 -0.0431 0.2228  0.0836  48  GLU B CD  
1050 O OE1 . GLU B 33  ? 1.9862 1.2977 1.7080 -0.0095 0.2279  0.1114  48  GLU B OE1 
1051 O OE2 . GLU B 33  ? 2.1378 1.3398 1.7998 -0.1000 0.2269  0.0695  48  GLU B OE2 
1052 N N   . THR B 34  ? 1.4354 0.9433 1.2031 0.2012  0.2221  0.0596  49  THR B N   
1053 C CA  . THR B 34  ? 1.3485 0.9529 1.1656 0.2645  0.2155  0.0603  49  THR B CA  
1054 C C   . THR B 34  ? 1.2893 0.9593 1.1418 0.2611  0.1963  0.0321  49  THR B C   
1055 O O   . THR B 34  ? 1.1807 0.9505 1.0926 0.2920  0.1778  0.0270  49  THR B O   
1056 C CB  . THR B 34  ? 1.3832 0.9544 1.1700 0.3327  0.2516  0.0666  49  THR B CB  
1057 O OG1 . THR B 34  ? 1.4681 0.9968 1.2226 0.3385  0.2696  0.0419  49  THR B OG1 
1058 C CG2 . THR B 34  ? 1.4797 0.9561 1.2164 0.3316  0.2807  0.0943  49  THR B CG2 
1059 N N   . LEU B 35  ? 1.2393 0.8515 1.0549 0.2230  0.2024  0.0131  50  LEU B N   
1060 C CA  . LEU B 35  ? 1.1655 0.8241 1.0057 0.2192  0.1929  -0.0124 50  LEU B CA  
1061 C C   . LEU B 35  ? 1.0871 0.8224 0.9799 0.1870  0.1555  -0.0139 50  LEU B C   
1062 O O   . LEU B 35  ? 1.0578 0.7711 0.9380 0.1370  0.1368  -0.0059 50  LEU B O   
1063 C CB  . LEU B 35  ? 1.1938 0.7656 0.9734 0.1858  0.2103  -0.0297 50  LEU B CB  
1064 C CG  . LEU B 35  ? 1.1674 0.7757 0.9644 0.1860  0.2103  -0.0547 50  LEU B CG  
1065 C CD1 . LEU B 35  ? 1.0405 0.7128 0.8781 0.2500  0.2247  -0.0651 50  LEU B CD1 
1066 C CD2 . LEU B 35  ? 1.2699 0.7874 0.9989 0.1570  0.2301  -0.0698 50  LEU B CD2 
1067 N N   . ARG B 36  ? 1.0013 0.8278 0.9544 0.2172  0.1450  -0.0262 51  ARG B N   
1068 C CA  . ARG B 36  ? 0.9244 0.8225 0.9294 0.1918  0.1127  -0.0302 51  ARG B CA  
1069 C C   . ARG B 36  ? 0.9814 0.8905 0.9959 0.1792  0.1174  -0.0547 51  ARG B C   
1070 O O   . ARG B 36  ? 1.0228 0.9610 1.0591 0.2157  0.1357  -0.0729 51  ARG B O   
1071 C CB  . ARG B 36  ? 0.7380 0.7369 0.8126 0.2330  0.0950  -0.0252 51  ARG B CB  
1072 C CG  . ARG B 36  ? 0.7527 0.7481 0.8209 0.2449  0.0900  0.0024  51  ARG B CG  
1073 C CD  . ARG B 36  ? 0.7245 0.7113 0.7899 0.1910  0.0638  0.0178  51  ARG B CD  
1074 N NE  . ARG B 36  ? 1.0075 0.9012 1.0121 0.1593  0.0779  0.0327  51  ARG B NE  
1075 C CZ  . ARG B 36  ? 1.0726 0.9486 1.0675 0.1701  0.0858  0.0560  51  ARG B CZ  
1076 N NH1 . ARG B 36  ? 1.0557 1.0027 1.0930 0.2155  0.0797  0.0690  51  ARG B NH1 
1077 N NH2 . ARG B 36  ? 1.1727 0.9595 1.1156 0.1352  0.1012  0.0654  51  ARG B NH2 
1078 N N   . ILE B 37  ? 0.9137 0.8007 0.9113 0.1284  0.1021  -0.0550 52  ILE B N   
1079 C CA  . ILE B 37  ? 0.9326 0.8143 0.9265 0.1111  0.1104  -0.0736 52  ILE B CA  
1080 C C   . ILE B 37  ? 0.8093 0.7524 0.8514 0.0905  0.0830  -0.0733 52  ILE B C   
1081 O O   . ILE B 37  ? 0.7170 0.6669 0.7588 0.0651  0.0556  -0.0576 52  ILE B O   
1082 C CB  . ILE B 37  ? 1.0716 0.8554 0.9842 0.0721  0.1225  -0.0752 52  ILE B CB  
1083 C CG1 . ILE B 37  ? 1.0715 0.7862 0.9341 0.0920  0.1505  -0.0755 52  ILE B CG1 
1084 C CG2 . ILE B 37  ? 1.2433 1.0183 1.1458 0.0588  0.1357  -0.0921 52  ILE B CG2 
1085 C CD1 . ILE B 37  ? 1.1664 0.7848 0.9497 0.0575  0.1646  -0.0825 52  ILE B CD1 
1086 N N   . PRO B 38  ? 0.7868 0.7757 0.8729 0.1020  0.0918  -0.0914 53  PRO B N   
1087 C CA  . PRO B 38  ? 0.6557 0.6977 0.7894 0.0848  0.0704  -0.0921 53  PRO B CA  
1088 C C   . PRO B 38  ? 0.7664 0.7602 0.8510 0.0368  0.0538  -0.0788 53  PRO B C   
1089 O O   . PRO B 38  ? 0.8122 0.7411 0.8383 0.0147  0.0702  -0.0825 53  PRO B O   
1090 C CB  . PRO B 38  ? 0.6607 0.7297 0.8309 0.0975  0.0954  -0.1165 53  PRO B CB  
1091 C CG  . PRO B 38  ? 0.8330 0.8508 0.9587 0.1133  0.1287  -0.1270 53  PRO B CG  
1092 C CD  . PRO B 38  ? 0.8393 0.8381 0.9398 0.1339  0.1234  -0.1135 53  PRO B CD  
1093 N N   . VAL B 39  ? 0.7891 0.8180 0.8961 0.0242  0.0210  -0.0644 54  VAL B N   
1094 C CA  . VAL B 39  ? 0.7599 0.7594 0.8284 -0.0157 0.0004  -0.0528 54  VAL B CA  
1095 C C   . VAL B 39  ? 0.7411 0.8023 0.8657 -0.0159 -0.0195 -0.0510 54  VAL B C   
1096 O O   . VAL B 39  ? 0.6515 0.7784 0.8344 0.0034  -0.0381 -0.0479 54  VAL B O   
1097 C CB  . VAL B 39  ? 0.7808 0.7613 0.8181 -0.0343 -0.0230 -0.0363 54  VAL B CB  
1098 C CG1 . VAL B 39  ? 0.8073 0.7690 0.8079 -0.0722 -0.0474 -0.0279 54  VAL B CG1 
1099 C CG2 . VAL B 39  ? 0.6373 0.5504 0.6205 -0.0355 -0.0015 -0.0385 54  VAL B CG2 
1100 N N   . PRO B 40  ? 0.7704 0.8081 0.8753 -0.0359 -0.0139 -0.0527 55  PRO B N   
1101 C CA  . PRO B 40  ? 0.6428 0.7274 0.7963 -0.0367 -0.0284 -0.0506 55  PRO B CA  
1102 C C   . PRO B 40  ? 0.6463 0.7624 0.8076 -0.0452 -0.0687 -0.0333 55  PRO B C   
1103 O O   . PRO B 40  ? 0.7424 0.8247 0.8507 -0.0652 -0.0839 -0.0219 55  PRO B O   
1104 C CB  . PRO B 40  ? 0.6396 0.6680 0.7412 -0.0604 -0.0128 -0.0487 55  PRO B CB  
1105 C CG  . PRO B 40  ? 0.8142 0.7854 0.8657 -0.0615 0.0193  -0.0588 55  PRO B CG  
1106 C CD  . PRO B 40  ? 0.8314 0.7945 0.8650 -0.0558 0.0094  -0.0564 55  PRO B CD  
1107 N N   . VAL B 41  ? 0.6117 0.7941 0.8406 -0.0304 -0.0856 -0.0338 56  VAL B N   
1108 C CA  . VAL B 41  ? 0.6589 0.8785 0.9003 -0.0350 -0.1236 -0.0182 56  VAL B CA  
1109 C C   . VAL B 41  ? 0.7044 0.9070 0.9198 -0.0559 -0.1389 -0.0074 56  VAL B C   
1110 O O   . VAL B 41  ? 0.8319 1.0708 1.0629 -0.0575 -0.1705 0.0041  56  VAL B O   
1111 C CB  . VAL B 41  ? 0.5051 0.8085 0.8301 -0.0042 -0.1371 -0.0240 56  VAL B CB  
1112 C CG1 . VAL B 41  ? 0.4663 0.7881 0.8149 0.0243  -0.1185 -0.0358 56  VAL B CG1 
1113 C CG2 . VAL B 41  ? 0.4264 0.7620 0.8054 0.0038  -0.1325 -0.0363 56  VAL B CG2 
1114 N N   . HIS B 42  ? 0.6263 0.7737 0.7995 -0.0691 -0.1151 -0.0102 57  HIS B N   
1115 C CA  . HIS B 42  ? 0.6721 0.7930 0.8078 -0.0850 -0.1246 0.0023  57  HIS B CA  
1116 C C   . HIS B 42  ? 0.7396 0.7856 0.7833 -0.1068 -0.1131 0.0067  57  HIS B C   
1117 O O   . HIS B 42  ? 0.8312 0.8424 0.8464 -0.1099 -0.0921 -0.0027 57  HIS B O   
1118 C CB  . HIS B 42  ? 0.6931 0.8245 0.8744 -0.0756 -0.1048 -0.0039 57  HIS B CB  
1119 C CG  . HIS B 42  ? 0.7284 0.8279 0.9115 -0.0740 -0.0603 -0.0198 57  HIS B CG  
1120 N ND1 . HIS B 42  ? 0.8057 0.8351 0.9183 -0.0897 -0.0353 -0.0153 57  HIS B ND1 
1121 C CD2 . HIS B 42  ? 0.6593 0.7928 0.9073 -0.0570 -0.0366 -0.0415 57  HIS B CD2 
1122 C CE1 . HIS B 42  ? 0.7515 0.7716 0.8868 -0.0840 0.0037  -0.0327 57  HIS B CE1 
1123 N NE2 . HIS B 42  ? 0.6796 0.7638 0.8981 -0.0644 0.0031  -0.0498 57  HIS B NE2 
1124 N N   . LYS B 43  ? 0.7960 0.8179 0.7912 -0.1187 -0.1272 0.0204  58  LYS B N   
1125 C CA  . LYS B 43  ? 0.9572 0.9153 0.8599 -0.1372 -0.1233 0.0239  58  LYS B CA  
1126 C C   . LYS B 43  ? 1.0752 0.9807 0.9378 -0.1375 -0.0903 0.0267  58  LYS B C   
1127 O O   . LYS B 43  ? 1.2257 1.0854 1.0091 -0.1476 -0.0928 0.0347  58  LYS B O   
1128 C CB  . LYS B 43  ? 1.0045 0.9737 0.8672 -0.1491 -0.1654 0.0356  58  LYS B CB  
1129 C CG  . LYS B 43  ? 1.1546 1.1611 1.0397 -0.1564 -0.1921 0.0319  58  LYS B CG  
1130 C CD  . LYS B 43  ? 1.4243 1.3894 1.2803 -0.1668 -0.1712 0.0184  58  LYS B CD  
1131 C CE  . LYS B 43  ? 1.4593 1.4555 1.3432 -0.1726 -0.1896 0.0164  58  LYS B CE  
1132 N NZ  . LYS B 43  ? 1.5286 1.5434 1.3869 -0.1923 -0.2277 0.0215  58  LYS B NZ  
1133 N N   . ASN B 44  ? 1.0171 0.9318 0.9352 -0.1257 -0.0587 0.0192  59  ASN B N   
1134 C CA  . ASN B 44  ? 1.0702 0.9340 0.9584 -0.1272 -0.0182 0.0202  59  ASN B CA  
1135 C C   . ASN B 44  ? 1.1086 0.9413 0.9804 -0.1290 0.0164  0.0033  59  ASN B C   
1136 O O   . ASN B 44  ? 1.0774 0.9266 1.0064 -0.1197 0.0473  -0.0115 59  ASN B O   
1137 C CB  . ASN B 44  ? 1.0118 0.9022 0.9732 -0.1169 -0.0004 0.0192  59  ASN B CB  
1138 C CG  . ASN B 44  ? 1.0764 0.9812 1.0391 -0.1136 -0.0288 0.0382  59  ASN B CG  
1139 O OD1 . ASN B 44  ? 1.1492 1.0139 1.0360 -0.1183 -0.0387 0.0567  59  ASN B OD1 
1140 N ND2 . ASN B 44  ? 1.0339 0.9981 1.0812 -0.1024 -0.0430 0.0327  59  ASN B ND2 
1141 N N   . HIS B 45  ? 1.1259 0.9159 0.9198 -0.1403 0.0102  0.0034  60  HIS B N   
1142 C CA  . HIS B 45  ? 1.1259 0.8857 0.8974 -0.1411 0.0353  -0.0131 60  HIS B CA  
1143 C C   . HIS B 45  ? 1.1731 0.9071 0.9514 -0.1348 0.0858  -0.0229 60  HIS B C   
1144 O O   . HIS B 45  ? 1.2671 1.0140 1.0823 -0.1247 0.1072  -0.0404 60  HIS B O   
1145 C CB  . HIS B 45  ? 1.1965 0.9051 0.8732 -0.1569 0.0217  -0.0120 60  HIS B CB  
1146 C CG  . HIS B 45  ? 1.2539 0.9889 0.9245 -0.1670 -0.0254 -0.0064 60  HIS B CG  
1147 N ND1 . HIS B 45  ? 1.2986 1.0434 0.9419 -0.1726 -0.0561 0.0085  60  HIS B ND1 
1148 C CD2 . HIS B 45  ? 1.2208 0.9749 0.9096 -0.1719 -0.0449 -0.0136 60  HIS B CD2 
1149 C CE1 . HIS B 45  ? 1.2457 1.0205 0.8951 -0.1822 -0.0937 0.0079  60  HIS B CE1 
1150 N NE2 . HIS B 45  ? 1.1536 0.9322 0.8308 -0.1834 -0.0862 -0.0047 60  HIS B NE2 
1151 N N   . GLN B 46  ? 1.1214 0.8198 0.8631 -0.1391 0.1060  -0.0114 61  GLN B N   
1152 C CA  . GLN B 46  ? 1.1930 0.8591 0.9292 -0.1369 0.1577  -0.0190 61  GLN B CA  
1153 C C   . GLN B 46  ? 1.1135 0.8298 0.9543 -0.1265 0.1836  -0.0343 61  GLN B C   
1154 O O   . GLN B 46  ? 1.1901 0.8939 1.0440 -0.1240 0.2272  -0.0473 61  GLN B O   
1155 C CB  . GLN B 46  ? 1.3727 0.9847 1.0383 -0.1429 0.1745  0.0010  61  GLN B CB  
1156 C CG  . GLN B 46  ? 1.5891 1.1613 1.1524 -0.1501 0.1444  0.0135  61  GLN B CG  
1157 C CD  . GLN B 46  ? 1.9052 1.4264 1.3935 -0.1492 0.1605  0.0351  61  GLN B CD  
1158 O OE1 . GLN B 46  ? 2.1110 1.6050 1.6022 -0.1464 0.2069  0.0392  61  GLN B OE1 
1159 N NE2 . GLN B 46  ? 1.9250 1.4346 1.3455 -0.1504 0.1233  0.0490  61  GLN B NE2 
1160 N N   . LEU B 47  ? 1.0521 0.8292 0.9688 -0.1199 0.1566  -0.0352 62  LEU B N   
1161 C CA  . LEU B 47  ? 1.0207 0.8562 1.0424 -0.1085 0.1747  -0.0551 62  LEU B CA  
1162 C C   . LEU B 47  ? 1.0010 0.8733 1.0607 -0.0931 0.1771  -0.0784 62  LEU B C   
1163 O O   . LEU B 47  ? 0.9337 0.8571 1.0753 -0.0800 0.1955  -0.1006 62  LEU B O   
1164 C CB  . LEU B 47  ? 0.9632 0.8524 1.0502 -0.1040 0.1431  -0.0498 62  LEU B CB  
1165 C CG  . LEU B 47  ? 1.0612 0.9280 1.1437 -0.1123 0.1485  -0.0318 62  LEU B CG  
1166 C CD1 . LEU B 47  ? 0.9263 0.8530 1.0791 -0.1041 0.1143  -0.0312 62  LEU B CD1 
1167 C CD2 . LEU B 47  ? 1.0062 0.8524 1.1177 -0.1177 0.2030  -0.0417 62  LEU B CD2 
1168 N N   . CYS B 48  ? 0.9883 0.8343 0.9879 -0.0934 0.1595  -0.0745 63  CYS B N   
1169 C CA  . CYS B 48  ? 0.9476 0.8249 0.9773 -0.0751 0.1565  -0.0912 63  CYS B CA  
1170 C C   . CYS B 48  ? 0.9155 0.7389 0.8807 -0.0743 0.1808  -0.0991 63  CYS B C   
1171 O O   . CYS B 48  ? 1.0037 0.8241 0.9537 -0.0650 0.1687  -0.1027 63  CYS B O   
1172 C CB  . CYS B 48  ? 0.9607 0.8657 0.9954 -0.0720 0.1110  -0.0807 63  CYS B CB  
1173 S SG  . CYS B 48  ? 0.9761 0.9465 1.0822 -0.0699 0.0777  -0.0715 63  CYS B SG  
1174 N N   . THR B 49  ? 1.0517 0.8302 0.9782 -0.0829 0.2171  -0.1013 64  THR B N   
1175 C CA  . THR B 49  ? 1.1629 0.8886 1.0257 -0.0810 0.2428  -0.1103 64  THR B CA  
1176 C C   . THR B 49  ? 1.0763 0.8385 0.9906 -0.0547 0.2612  -0.1339 64  THR B C   
1177 O O   . THR B 49  ? 1.1170 0.8481 0.9879 -0.0462 0.2625  -0.1392 64  THR B O   
1178 C CB  . THR B 49  ? 1.3120 0.9875 1.1263 -0.0927 0.2818  -0.1077 64  THR B CB  
1179 O OG1 . THR B 49  ? 1.3558 1.0725 1.2479 -0.0888 0.3115  -0.1171 64  THR B OG1 
1180 C CG2 . THR B 49  ? 1.3095 0.9376 1.0485 -0.1128 0.2631  -0.0834 64  THR B CG2 
1181 N N   . GLU B 50  ? 1.0401 0.9738 1.4977 -0.1046 0.2400  -0.0327 65  GLU B N   
1182 C CA  . GLU B 50  ? 0.8106 0.8114 1.3261 -0.0763 0.2395  -0.0144 65  GLU B CA  
1183 C C   . GLU B 50  ? 0.9958 0.9686 1.4858 -0.0428 0.2331  -0.0223 65  GLU B C   
1184 O O   . GLU B 50  ? 1.0239 1.0217 1.5365 -0.0062 0.2555  -0.0101 65  GLU B O   
1185 C CB  . GLU B 50  ? 0.9201 0.9853 1.4909 -0.1045 0.1956  0.0013  65  GLU B CB  
1186 C CG  . GLU B 50  ? 1.0610 1.1973 1.6895 -0.1296 0.2049  0.0280  65  GLU B CG  
1187 C CD  . GLU B 50  ? 1.2894 1.4891 1.9691 -0.1646 0.1538  0.0506  65  GLU B CD  
1188 O OE1 . GLU B 50  ? 1.3994 1.5724 2.0574 -0.1691 0.1109  0.0392  65  GLU B OE1 
1189 O OE2 . GLU B 50  ? 1.2971 1.5730 2.0341 -0.1897 0.1549  0.0827  65  GLU B OE2 
1190 N N   . GLU B 51  ? 0.7990 0.7224 1.2410 -0.0524 0.2040  -0.0393 66  GLU B N   
1191 C CA  . GLU B 51  ? 1.0329 0.9369 1.4505 -0.0246 0.1936  -0.0430 66  GLU B CA  
1192 C C   . GLU B 51  ? 0.9472 0.7896 1.3092 -0.0100 0.2246  -0.0471 66  GLU B C   
1193 O O   . GLU B 51  ? 1.0222 0.8556 1.3758 0.0184  0.2300  -0.0420 66  GLU B O   
1194 C CB  . GLU B 51  ? 0.7853 0.6688 1.1704 -0.0351 0.1518  -0.0541 66  GLU B CB  
1195 C CG  . GLU B 51  ? 0.9280 0.8503 1.3461 -0.0486 0.1119  -0.0515 66  GLU B CG  
1196 C CD  . GLU B 51  ? 1.1899 1.1107 1.6162 -0.0877 0.1013  -0.0523 66  GLU B CD  
1197 O OE1 . GLU B 51  ? 1.1998 1.0913 1.6061 -0.1016 0.1258  -0.0568 66  GLU B OE1 
1198 O OE2 . GLU B 51  ? 1.3521 1.2981 1.8007 -0.1084 0.0654  -0.0463 66  GLU B OE2 
1199 N N   . ILE B 52  ? 0.8506 0.6459 1.1696 -0.0334 0.2412  -0.0543 67  ILE B N   
1200 C CA  . ILE B 52  ? 0.9442 0.6700 1.1972 -0.0312 0.2648  -0.0559 67  ILE B CA  
1201 C C   . ILE B 52  ? 0.9798 0.6902 1.2315 -0.0014 0.3035  -0.0513 67  ILE B C   
1202 O O   . ILE B 52  ? 1.0363 0.6991 1.2469 0.0191  0.3110  -0.0489 67  ILE B O   
1203 C CB  . ILE B 52  ? 1.0342 0.7169 1.2414 -0.0679 0.2728  -0.0613 67  ILE B CB  
1204 C CG1 . ILE B 52  ? 1.1207 0.8032 1.3093 -0.0864 0.2393  -0.0610 67  ILE B CG1 
1205 C CG2 . ILE B 52  ? 1.0507 0.6562 1.1848 -0.0718 0.2990  -0.0606 67  ILE B CG2 
1206 C CD1 . ILE B 52  ? 1.1646 0.8241 1.3259 -0.1217 0.2428  -0.0621 67  ILE B CD1 
1207 N N   . PHE B 53  ? 0.9338 0.6842 1.2273 0.0034  0.3279  -0.0469 68  PHE B N   
1208 C CA  . PHE B 53  ? 1.0905 0.8298 1.3792 0.0417  0.3721  -0.0394 68  PHE B CA  
1209 C C   . PHE B 53  ? 1.1151 0.9147 1.4628 0.0851  0.3717  -0.0229 68  PHE B C   
1210 O O   . PHE B 53  ? 1.2439 1.0234 1.5777 0.1288  0.4078  -0.0147 68  PHE B O   
1211 C CB  . PHE B 53  ? 1.0824 0.8514 1.3916 0.0346  0.4038  -0.0344 68  PHE B CB  
1212 C CG  . PHE B 53  ? 1.1737 0.8630 1.4053 0.0034  0.4189  -0.0489 68  PHE B CG  
1213 C CD1 . PHE B 53  ? 1.2442 0.8423 1.3910 0.0224  0.4571  -0.0556 68  PHE B CD1 
1214 C CD2 . PHE B 53  ? 1.1494 0.8472 1.3846 -0.0450 0.3936  -0.0548 68  PHE B CD2 
1215 C CE1 . PHE B 53  ? 1.3954 0.9180 1.4646 -0.0119 0.4673  -0.0670 68  PHE B CE1 
1216 C CE2 . PHE B 53  ? 1.2214 0.8533 1.3888 -0.0756 0.4062  -0.0637 68  PHE B CE2 
1217 C CZ  . PHE B 53  ? 1.4019 0.9489 1.4872 -0.0620 0.4418  -0.0694 68  PHE B CZ  
1218 N N   . GLN B 54  ? 0.9879 0.8557 1.3946 0.0749  0.3310  -0.0170 69  GLN B N   
1219 C CA  . GLN B 54  ? 0.9982 0.9213 1.4559 0.1101  0.3227  0.0000  69  GLN B CA  
1220 C C   . GLN B 54  ? 1.0461 0.8995 1.4458 0.1261  0.3138  -0.0079 69  GLN B C   
1221 O O   . GLN B 54  ? 1.1069 0.9604 1.5133 0.1664  0.3267  0.0042  69  GLN B O   
1222 C CB  . GLN B 54  ? 0.9951 1.0032 1.5209 0.0874  0.2772  0.0088  69  GLN B CB  
1223 C CG  . GLN B 54  ? 1.1896 1.2732 1.7795 0.1180  0.2673  0.0330  69  GLN B CG  
1224 C CD  . GLN B 54  ? 1.3906 1.5716 2.0557 0.0905  0.2331  0.0526  69  GLN B CD  
1225 O OE1 . GLN B 54  ? 1.4361 1.6145 2.0963 0.0471  0.2103  0.0436  69  GLN B OE1 
1226 N NE2 . GLN B 54  ? 1.4462 1.7104 2.1773 0.1129  0.2269  0.0827  69  GLN B NE2 
1227 N N   . GLY B 55  ? 0.9984 0.7963 1.3416 0.0942  0.2915  -0.0235 70  GLY B N   
1228 C CA  . GLY B 55  ? 1.0846 0.8209 1.3692 0.0999  0.2800  -0.0245 70  GLY B CA  
1229 C C   . GLY B 55  ? 1.1441 0.7859 1.3557 0.1150  0.3152  -0.0256 70  GLY B C   
1230 O O   . GLY B 55  ? 1.1697 0.7671 1.3474 0.1371  0.3146  -0.0185 70  GLY B O   
1231 N N   . ILE B 56  ? 1.1761 0.7792 1.3550 0.1021  0.3443  -0.0341 71  ILE B N   
1232 C CA  . ILE B 56  ? 1.3247 0.8222 1.4171 0.1170  0.3802  -0.0382 71  ILE B CA  
1233 C C   . ILE B 56  ? 1.3317 0.8368 1.4451 0.1787  0.4131  -0.0275 71  ILE B C   
1234 O O   . ILE B 56  ? 1.4100 0.8179 1.4471 0.2048  0.4298  -0.0274 71  ILE B O   
1235 C CB  . ILE B 56  ? 1.4091 0.8740 1.4656 0.0924  0.4063  -0.0492 71  ILE B CB  
1236 C CG1 . ILE B 56  ? 1.3589 0.8016 1.3802 0.0339  0.3757  -0.0552 71  ILE B CG1 
1237 C CG2 . ILE B 56  ? 1.3927 0.7436 1.3524 0.1174  0.4489  -0.0549 71  ILE B CG2 
1238 C CD1 . ILE B 56  ? 1.3528 0.7757 1.3481 0.0042  0.3957  -0.0637 71  ILE B CD1 
1239 N N   . GLY B 57  ? 1.1429 0.7630 1.3572 0.2010  0.4200  -0.0144 72  GLY B N   
1240 C CA  . GLY B 57  ? 1.1797 0.8357 1.4323 0.2629  0.4510  0.0053  72  GLY B CA  
1241 C C   . GLY B 57  ? 1.5218 1.1719 1.7798 0.2882  0.4297  0.0154  72  GLY B C   
1242 O O   . GLY B 57  ? 1.5883 1.1814 1.8074 0.3383  0.4578  0.0236  72  GLY B O   
1243 N N   . THR B 58  ? 1.4088 1.1136 1.7093 0.2566  0.3808  0.0154  73  THR B N   
1244 C CA  . THR B 58  ? 1.3122 1.0182 1.6184 0.2739  0.3553  0.0257  73  THR B CA  
1245 C C   . THR B 58  ? 1.4046 0.9761 1.6001 0.2702  0.3553  0.0177  73  THR B C   
1246 O O   . THR B 58  ? 1.5447 1.0750 1.7166 0.3047  0.3591  0.0293  73  THR B O   
1247 C CB  . THR B 58  ? 1.2701 1.0525 1.6272 0.2390  0.3034  0.0250  73  THR B CB  
1248 O OG1 . THR B 58  ? 1.2730 1.1689 1.7233 0.2378  0.2962  0.0356  73  THR B OG1 
1249 C CG2 . THR B 58  ? 1.2562 1.0389 1.6122 0.2554  0.2775  0.0367  73  THR B CG2 
1250 N N   . LEU B 59  ? 1.3414 0.8433 1.4669 0.2250  0.3487  0.0018  74  LEU B N   
1251 C CA  . LEU B 59  ? 1.3355 0.7070 1.3479 0.2077  0.3428  -0.0007 74  LEU B CA  
1252 C C   . LEU B 59  ? 1.5382 0.7957 1.4696 0.2473  0.3874  -0.0043 74  LEU B C   
1253 O O   . LEU B 59  ? 1.8105 0.9506 1.6478 0.2500  0.3827  -0.0012 74  LEU B O   
1254 C CB  . LEU B 59  ? 1.3382 0.6770 1.3012 0.1464  0.3241  -0.0101 74  LEU B CB  
1255 C CG  . LEU B 59  ? 1.4861 0.7033 1.3338 0.1110  0.3066  -0.0043 74  LEU B CG  
1256 C CD1 . LEU B 59  ? 1.3322 0.5585 1.1829 0.1140  0.2718  0.0160  74  LEU B CD1 
1257 C CD2 . LEU B 59  ? 1.4221 0.6384 1.2415 0.0508  0.2880  -0.0056 74  LEU B CD2 
1258 N N   . GLU B 60  ? 1.4998 0.7889 1.4617 0.2793  0.4301  -0.0084 75  GLU B N   
1259 C CA  . GLU B 60  ? 1.6358 0.8250 1.5216 0.3324  0.4809  -0.0103 75  GLU B CA  
1260 C C   . GLU B 60  ? 1.6709 0.8873 1.5963 0.4008  0.4960  0.0103  75  GLU B C   
1261 O O   . GLU B 60  ? 1.8989 0.9914 1.7307 0.4420  0.5187  0.0112  75  GLU B O   
1262 C CB  . GLU B 60  ? 1.7513 0.9815 1.6608 0.3476  0.5250  -0.0154 75  GLU B CB  
1263 C CG  . GLU B 60  ? 2.0395 1.1506 1.8465 0.4047  0.5828  -0.0198 75  GLU B CG  
1264 C CD  . GLU B 60  ? 2.1496 1.3298 1.9968 0.4290  0.6301  -0.0169 75  GLU B CD  
1265 O OE1 . GLU B 60  ? 2.0952 1.4360 2.0748 0.4502  0.6363  0.0061  75  GLU B OE1 
1266 O OE2 . GLU B 60  ? 2.2764 1.3528 2.0206 0.4233  0.6587  -0.0343 75  GLU B OE2 
1267 N N   . SER B 61  ? 2.1500 1.2261 1.7039 0.3376  -0.1808 0.2341  76  SER B N   
1268 C CA  . SER B 61  ? 2.1776 1.2928 1.8256 0.3831  -0.1480 0.3109  76  SER B CA  
1269 C C   . SER B 61  ? 2.2299 1.3502 1.8405 0.4071  -0.1347 0.3040  76  SER B C   
1270 O O   . SER B 61  ? 2.2858 1.4543 1.9504 0.4495  -0.1549 0.3610  76  SER B O   
1271 C CB  . SER B 61  ? 2.1254 1.3286 1.8589 0.4027  -0.2423 0.3595  76  SER B CB  
1272 O OG  . SER B 61  ? 2.0171 1.2081 1.7724 0.3705  -0.2537 0.3615  76  SER B OG  
1273 N N   . GLN B 62  ? 2.2415 1.3133 1.7550 0.3771  -0.1001 0.2315  77  GLN B N   
1274 C CA  . GLN B 62  ? 2.2992 1.3640 1.7594 0.3845  -0.0741 0.2118  77  GLN B CA  
1275 C C   . GLN B 62  ? 2.2840 1.2773 1.6549 0.3420  0.0127  0.1354  77  GLN B C   
1276 O O   . GLN B 62  ? 2.1737 1.1719 1.4762 0.3256  0.0156  0.0799  77  GLN B O   
1277 C CB  . GLN B 62  ? 2.3161 1.4621 1.7501 0.3875  -0.1922 0.1776  77  GLN B CB  
1278 C CG  . GLN B 62  ? 2.3781 1.5805 1.8623 0.4317  -0.2340 0.2478  77  GLN B CG  
1279 C CD  . GLN B 62  ? 2.4200 1.6871 1.8543 0.4261  -0.3206 0.1997  77  GLN B CD  
1280 O OE1 . GLN B 62  ? 2.4543 1.7119 1.8101 0.3925  -0.3160 0.1138  77  GLN B OE1 
1281 N NE2 . GLN B 62  ? 2.4117 1.7535 1.8950 0.4578  -0.3995 0.2496  77  GLN B NE2 
1282 N N   . THR B 63  ? 2.2979 1.2309 1.6698 0.3195  0.0856  0.1277  78  THR B N   
1283 C CA  . THR B 63  ? 2.3812 1.2522 1.6714 0.2742  0.1690  0.0504  78  THR B CA  
1284 C C   . THR B 63  ? 2.5344 1.3146 1.8455 0.2720  0.3082  0.0865  78  THR B C   
1285 O O   . THR B 63  ? 2.6037 1.3725 1.9869 0.2889  0.3282  0.1447  78  THR B O   
1286 C CB  . THR B 63  ? 2.2771 1.1622 1.5186 0.2380  0.1110  -0.0226 78  THR B CB  
1287 O OG1 . THR B 63  ? 2.2286 1.1913 1.4518 0.2462  -0.0196 -0.0593 78  THR B OG1 
1288 C CG2 . THR B 63  ? 2.2700 1.1090 1.4280 0.1909  0.1913  -0.1107 78  THR B CG2 
1289 N N   . VAL B 64  ? 2.5946 1.3103 1.8434 0.2485  0.4076  0.0476  79  VAL B N   
1290 C CA  . VAL B 64  ? 2.6288 1.2448 1.8840 0.2408  0.5478  0.0676  79  VAL B CA  
1291 C C   . VAL B 64  ? 2.6144 1.2117 1.8666 0.2040  0.5745  0.0325  79  VAL B C   
1292 O O   . VAL B 64  ? 2.6195 1.2156 1.7945 0.1540  0.5778  -0.0561 79  VAL B O   
1293 C CB  . VAL B 64  ? 2.6570 1.1989 1.8269 0.2087  0.6506  0.0167  79  VAL B CB  
1294 C CG1 . VAL B 64  ? 2.6510 1.1570 1.8286 0.2535  0.6738  0.0871  79  VAL B CG1 
1295 C CG2 . VAL B 64  ? 2.6868 1.2845 1.7726 0.1584  0.6002  -0.0932 79  VAL B CG2 
1296 N N   . GLN B 65  ? 2.6450 1.2342 1.9805 0.2283  0.5912  0.0998  80  GLN B N   
1297 C CA  . GLN B 65  ? 2.7225 1.2892 2.0543 0.1917  0.6198  0.0764  80  GLN B CA  
1298 C C   . GLN B 65  ? 2.8063 1.2863 2.0728 0.1455  0.7500  0.0171  80  GLN B C   
1299 O O   . GLN B 65  ? 2.8283 1.2417 2.1359 0.1506  0.8610  0.0492  80  GLN B O   
1300 C CB  . GLN B 65  ? 2.7503 1.3241 2.1937 0.2245  0.6369  0.1592  80  GLN B CB  
1301 C CG  . GLN B 65  ? 2.6981 1.3571 2.2268 0.2775  0.5333  0.2291  80  GLN B CG  
1302 C CD  . GLN B 65  ? 2.6675 1.3936 2.1813 0.2587  0.4037  0.2113  80  GLN B CD  
1303 O OE1 . GLN B 65  ? 2.6579 1.3776 2.0771 0.2195  0.3592  0.1406  80  GLN B OE1 
1304 N NE2 . GLN B 65  ? 2.6345 1.4244 2.2413 0.2878  0.3423  0.2732  80  GLN B NE2 
1305 N N   . GLY B 66  ? 2.7598 1.2470 1.9285 0.1008  0.7359  -0.0750 81  GLY B N   
1306 C CA  . GLY B 66  ? 2.7934 1.2107 1.8935 0.0501  0.8551  -0.1443 81  GLY B CA  
1307 C C   . GLY B 66  ? 2.8334 1.2222 1.9055 0.0062  0.8954  -0.1800 81  GLY B C   
1308 O O   . GLY B 66  ? 2.8190 1.2037 1.9474 0.0194  0.8884  -0.1251 81  GLY B O   
1309 N N   . GLY B 67  ? 2.8569 1.2303 1.8389 -0.0502 0.9395  -0.2763 82  GLY B N   
1310 C CA  . GLY B 67  ? 2.8276 1.1703 1.7637 -0.0979 0.9836  -0.3194 82  GLY B CA  
1311 C C   . GLY B 67  ? 2.7949 1.1986 1.6750 -0.1097 0.8539  -0.3565 82  GLY B C   
1312 O O   . GLY B 67  ? 2.7122 1.1174 1.6201 -0.0955 0.7999  -0.3024 82  GLY B O   
1313 N N   . THR B 68  ? 2.8732 1.3655 1.7046 -0.1360 0.7846  -0.4324 83  THR B N   
1314 C CA  . THR B 68  ? 2.8938 1.4397 1.6637 -0.1387 0.6580  -0.4750 83  THR B CA  
1315 C C   . THR B 68  ? 2.8582 1.4227 1.6259 -0.0874 0.5321  -0.4546 83  THR B C   
1316 O O   . THR B 68  ? 2.8388 1.4383 1.5532 -0.0802 0.4133  -0.4849 83  THR B O   
1317 C CB  . THR B 68  ? 2.8666 1.5634 1.6512 -0.1683 0.6028  -0.5435 83  THR B CB  
1318 O OG1 . THR B 68  ? 2.9252 1.6572 1.7680 -0.1942 0.6866  -0.5490 83  THR B OG1 
1319 C CG2 . THR B 68  ? 2.8539 1.5591 1.5996 -0.2018 0.5978  -0.5640 83  THR B CG2 
1320 N N   . VAL B 69  ? 2.8490 1.4221 1.7016 -0.0496 0.5420  -0.3867 84  VAL B N   
1321 C CA  . VAL B 69  ? 2.6835 1.3159 1.5787 -0.0019 0.4148  -0.3429 84  VAL B CA  
1322 C C   . VAL B 69  ? 2.7224 1.3319 1.6735 0.0187  0.3808  -0.2518 84  VAL B C   
1323 O O   . VAL B 69  ? 2.7075 1.3473 1.6496 0.0361  0.2609  -0.2387 84  VAL B O   
1324 C CB  . VAL B 69  ? 2.5885 1.2442 1.5434 0.0287  0.4371  -0.3090 84  VAL B CB  
1325 C CG1 . VAL B 69  ? 2.5085 1.2441 1.4813 0.0665  0.2965  -0.3011 84  VAL B CG1 
1326 C CG2 . VAL B 69  ? 2.6542 1.3005 1.5605 -0.0056 0.5267  -0.3858 84  VAL B CG2 
1327 N N   . GLU B 70  ? 2.9224 1.0635 1.3341 0.1451  0.4103  -0.0739 85  GLU B N   
1328 C CA  . GLU B 70  ? 2.9558 1.1423 1.4756 0.1895  0.4235  -0.0899 85  GLU B CA  
1329 C C   . GLU B 70  ? 2.8817 1.1450 1.4503 0.1909  0.4750  -0.0961 85  GLU B C   
1330 O O   . GLU B 70  ? 2.8130 1.1322 1.4728 0.2178  0.4899  -0.1021 85  GLU B O   
1331 C CB  . GLU B 70  ? 3.0826 1.2289 1.6310 0.2251  0.4092  -0.1083 85  GLU B CB  
1332 C CG  . GLU B 70  ? 3.1197 1.2883 1.7754 0.2696  0.3951  -0.1179 85  GLU B CG  
1333 C CD  . GLU B 70  ? 3.2453 1.3556 1.9174 0.2959  0.3604  -0.1295 85  GLU B CD  
1334 O OE1 . GLU B 70  ? 3.2628 1.3161 1.8637 0.2813  0.3500  -0.1321 85  GLU B OE1 
1335 O OE2 . GLU B 70  ? 3.3065 1.4287 2.0680 0.3306  0.3413  -0.1353 85  GLU B OE2 
1336 N N   . ARG B 71  ? 2.8442 1.1122 1.3560 0.1601  0.4989  -0.0915 86  ARG B N   
1337 C CA  . ARG B 71  ? 2.7453 1.0882 1.2983 0.1529  0.5427  -0.0914 86  ARG B CA  
1338 C C   . ARG B 71  ? 2.5291 0.9305 1.1099 0.1300  0.5480  -0.0743 86  ARG B C   
1339 O O   . ARG B 71  ? 2.3501 0.8232 1.0071 0.1416  0.5756  -0.0759 86  ARG B O   
1340 C CB  . ARG B 71  ? 2.8209 1.1521 1.3145 0.1233  0.5568  -0.0877 86  ARG B CB  
1341 C CG  . ARG B 71  ? 2.7786 1.1900 1.3120 0.1006  0.5878  -0.0779 86  ARG B CG  
1342 C CD  . ARG B 71  ? 2.7990 1.1987 1.2911 0.0766  0.5947  -0.0781 86  ARG B CD  
1343 N NE  . ARG B 71  ? 2.7428 1.2163 1.2760 0.0438  0.6039  -0.0641 86  ARG B NE  
1344 C CZ  . ARG B 71  ? 2.6735 1.2209 1.2684 0.0522  0.6335  -0.0686 86  ARG B CZ  
1345 N NH1 . ARG B 71  ? 2.6851 1.2440 1.3113 0.0930  0.6612  -0.0875 86  ARG B NH1 
1346 N NH2 . ARG B 71  ? 2.5515 1.1666 1.1860 0.0206  0.6315  -0.0559 86  ARG B NH2 
1347 N N   . LEU B 72  ? 2.5456 0.9195 1.0688 0.0970  0.5212  -0.0582 87  LEU B N   
1348 C CA  . LEU B 72  ? 2.4874 0.9182 1.0396 0.0724  0.5204  -0.0443 87  LEU B CA  
1349 C C   . LEU B 72  ? 2.4587 0.9272 1.0919 0.1070  0.5247  -0.0552 87  LEU B C   
1350 O O   . LEU B 72  ? 2.3527 0.8952 1.0479 0.1015  0.5443  -0.0507 87  LEU B O   
1351 C CB  . LEU B 72  ? 2.4305 0.8205 0.9155 0.0379  0.4849  -0.0298 87  LEU B CB  
1352 C CG  . LEU B 72  ? 2.2845 0.7378 0.8120 0.0137  0.4741  -0.0204 87  LEU B CG  
1353 C CD1 . LEU B 72  ? 2.2893 0.8293 0.8902 -0.0163 0.4815  -0.0152 87  LEU B CD1 
1354 C CD2 . LEU B 72  ? 2.3146 0.7270 0.7862 -0.0113 0.4353  -0.0134 87  LEU B CD2 
1355 N N   . PHE B 73  ? 2.5305 0.9522 1.1793 0.1420  0.4999  -0.0658 88  PHE B N   
1356 C CA  . PHE B 73  ? 2.5369 1.0042 1.2864 0.1712  0.4846  -0.0665 88  PHE B CA  
1357 C C   . PHE B 73  ? 2.5564 1.0808 1.4097 0.2088  0.5160  -0.0765 88  PHE B C   
1358 O O   . PHE B 73  ? 2.5854 1.1670 1.5387 0.2301  0.5075  -0.0738 88  PHE B O   
1359 C CB  . PHE B 73  ? 2.5911 0.9931 1.3238 0.1885  0.4368  -0.0672 88  PHE B CB  
1360 C CG  . PHE B 73  ? 2.6804 1.0510 1.3331 0.1509  0.4031  -0.0531 88  PHE B CG  
1361 C CD1 . PHE B 73  ? 2.6951 1.1071 1.3869 0.1454  0.3760  -0.0456 88  PHE B CD1 
1362 C CD2 . PHE B 73  ? 2.7683 1.0706 1.3074 0.1202  0.3991  -0.0481 88  PHE B CD2 
1363 C CE1 . PHE B 73  ? 2.7591 1.1481 1.3758 0.1101  0.3483  -0.0345 88  PHE B CE1 
1364 C CE2 . PHE B 73  ? 2.8396 1.1186 1.3072 0.0841  0.3704  -0.0337 88  PHE B CE2 
1365 C CZ  . PHE B 73  ? 2.8385 1.1627 1.3437 0.0790  0.3465  -0.0275 88  PHE B CZ  
1366 N N   . LYS B 74  ? 2.5428 1.0576 1.3750 0.2151  0.5506  -0.0871 89  LYS B N   
1367 C CA  . LYS B 74  ? 2.4878 1.0690 1.4104 0.2424  0.5890  -0.0946 89  LYS B CA  
1368 C C   . LYS B 74  ? 2.3672 1.0218 1.3017 0.2115  0.6227  -0.0813 89  LYS B C   
1369 O O   . LYS B 74  ? 2.3518 1.0895 1.3868 0.2229  0.6392  -0.0742 89  LYS B O   
1370 C CB  . LYS B 74  ? 2.6279 1.1872 1.5377 0.2608  0.6049  -0.1107 89  LYS B CB  
1371 C CG  . LYS B 74  ? 2.6530 1.2881 1.6412 0.2799  0.6512  -0.1172 89  LYS B CG  
1372 C CD  . LYS B 74  ? 2.7290 1.3437 1.7160 0.3042  0.6641  -0.1394 89  LYS B CD  
1373 C CE  . LYS B 74  ? 2.8024 1.3916 1.8556 0.3486  0.6361  -0.1534 89  LYS B CE  
1374 N NZ  . LYS B 74  ? 2.8514 1.4266 1.9157 0.3745  0.6498  -0.1794 89  LYS B NZ  
1375 N N   . ASN B 75  ? 2.3688 1.0063 1.2163 0.1677  0.6233  -0.0713 90  ASN B N   
1376 C CA  . ASN B 75  ? 2.3581 1.0680 1.2240 0.1303  0.6408  -0.0522 90  ASN B CA  
1377 C C   . ASN B 75  ? 2.2771 1.0377 1.2031 0.1249  0.6310  -0.0424 90  ASN B C   
1378 O O   . ASN B 75  ? 2.2096 1.0516 1.2079 0.1155  0.6496  -0.0298 90  ASN B O   
1379 C CB  . ASN B 75  ? 2.3839 1.0695 1.1759 0.0825  0.6207  -0.0391 90  ASN B CB  
1380 C CG  . ASN B 75  ? 2.5280 1.1924 1.2862 0.0814  0.6334  -0.0463 90  ASN B CG  
1381 O OD1 . ASN B 75  ? 2.6352 1.2798 1.3991 0.1175  0.6521  -0.0643 90  ASN B OD1 
1382 N ND2 . ASN B 75  ? 2.5733 1.2464 1.3084 0.0418  0.6193  -0.0368 90  ASN B ND2 
1383 N N   . LEU B 76  ? 2.2595 0.9850 1.1720 0.1267  0.5906  -0.0434 91  LEU B N   
1384 C CA  . LEU B 76  ? 2.1718 0.9552 1.1614 0.1237  0.5666  -0.0347 91  LEU B CA  
1385 C C   . LEU B 76  ? 2.1557 0.9932 1.2696 0.1653  0.5674  -0.0376 91  LEU B C   
1386 O O   . LEU B 76  ? 2.1127 1.0271 1.3195 0.1636  0.5659  -0.0284 91  LEU B O   
1387 C CB  . LEU B 76  ? 2.1443 0.8735 1.0767 0.1143  0.5237  -0.0365 91  LEU B CB  
1388 C CG  . LEU B 76  ? 2.0739 0.7671 0.9002 0.0680  0.5192  -0.0298 91  LEU B CG  
1389 C CD1 . LEU B 76  ? 2.0957 0.7306 0.8595 0.0615  0.4782  -0.0309 91  LEU B CD1 
1390 C CD2 . LEU B 76  ? 1.9434 0.7123 0.8107 0.0359  0.5308  -0.0191 91  LEU B CD2 
1391 N N   . SER B 77  ? 2.1498 0.9467 1.2701 0.2028  0.5687  -0.0504 92  SER B N   
1392 C CA  . SER B 77  ? 2.1558 0.9996 1.3949 0.2446  0.5712  -0.0536 92  SER B CA  
1393 C C   . SER B 77  ? 2.0761 0.9985 1.3831 0.2461  0.6166  -0.0466 92  SER B C   
1394 O O   . SER B 77  ? 1.8144 0.8096 1.2375 0.2638  0.6188  -0.0389 92  SER B O   
1395 C CB  . SER B 77  ? 2.2917 1.0675 1.5185 0.2834  0.5615  -0.0704 92  SER B CB  
1396 O OG  . SER B 77  ? 2.3329 1.1538 1.6799 0.3246  0.5628  -0.0733 92  SER B OG  
1397 N N   . LEU B 78  ? 1.9966 0.9042 1.2298 0.2258  0.6512  -0.0480 93  LEU B N   
1398 C CA  . LEU B 78  ? 1.9902 0.9709 1.2698 0.2194  0.6951  -0.0386 93  LEU B CA  
1399 C C   . LEU B 78  ? 1.9466 1.0030 1.2774 0.1859  0.6920  -0.0149 93  LEU B C   
1400 O O   . LEU B 78  ? 1.8826 1.0216 1.3133 0.1913  0.7094  -0.0011 93  LEU B O   
1401 C CB  . LEU B 78  ? 2.0744 1.0138 1.2492 0.2026  0.7290  -0.0473 93  LEU B CB  
1402 C CG  . LEU B 78  ? 2.2621 1.1458 1.4070 0.2375  0.7417  -0.0728 93  LEU B CG  
1403 C CD1 . LEU B 78  ? 2.2729 1.1357 1.3317 0.2071  0.7495  -0.0740 93  LEU B CD1 
1404 C CD2 . LEU B 78  ? 2.0056 0.9506 1.2626 0.2784  0.7689  -0.0784 93  LEU B CD2 
1405 N N   . ILE B 79  ? 1.9364 0.9652 1.2025 0.1511  0.6692  -0.0099 94  ILE B N   
1406 C CA  . ILE B 79  ? 1.9298 1.0241 1.2453 0.1190  0.6616  0.0090  94  ILE B CA  
1407 C C   . ILE B 79  ? 1.8248 0.9782 1.2673 0.1414  0.6367  0.0128  94  ILE B C   
1408 O O   . ILE B 79  ? 1.7146 0.9474 1.2481 0.1303  0.6412  0.0293  94  ILE B O   
1409 C CB  . ILE B 79  ? 1.9499 0.9986 1.1722 0.0805  0.6403  0.0093  94  ILE B CB  
1410 C CG1 . ILE B 79  ? 1.9206 0.9410 1.0541 0.0485  0.6540  0.0131  94  ILE B CG1 
1411 C CG2 . ILE B 79  ? 1.8768 0.9907 1.1685 0.0560  0.6232  0.0220  94  ILE B CG2 
1412 C CD1 . ILE B 79  ? 1.9380 0.9283 1.0141 0.0115  0.6123  0.0125  94  ILE B CD1 
1413 N N   . LYS B 80  ? 1.8003 0.9134 1.2507 0.1724  0.6080  -0.0017 95  LYS B N   
1414 C CA  . LYS B 80  ? 1.7008 0.8611 1.2672 0.1969  0.5805  -0.0006 95  LYS B CA  
1415 C C   . LYS B 80  ? 1.5997 0.8381 1.2882 0.2194  0.6044  0.0108  95  LYS B C   
1416 O O   . LYS B 80  ? 1.6090 0.9195 1.4025 0.2168  0.5937  0.0233  95  LYS B O   
1417 C CB  . LYS B 80  ? 1.7615 0.8581 1.3085 0.2280  0.5472  -0.0168 95  LYS B CB  
1418 C CG  . LYS B 80  ? 1.8582 1.0005 1.5307 0.2603  0.5215  -0.0163 95  LYS B CG  
1419 C CD  . LYS B 80  ? 1.9942 1.0714 1.6486 0.2913  0.4877  -0.0299 95  LYS B CD  
1420 C CE  . LYS B 80  ? 1.9864 1.1102 1.7747 0.3283  0.4686  -0.0282 95  LYS B CE  
1421 N NZ  . LYS B 80  ? 1.9141 1.1124 1.7907 0.3153  0.4513  -0.0197 95  LYS B NZ  
1422 N N   . LYS B 81  ? 1.6063 0.8315 1.2829 0.2410  0.6368  0.0061  96  LYS B N   
1423 C CA  . LYS B 81  ? 1.8753 1.1753 1.6643 0.2634  0.6635  0.0168  96  LYS B CA  
1424 C C   . LYS B 81  ? 1.8040 1.1759 1.6173 0.2306  0.6955  0.0399  96  LYS B C   
1425 O O   . LYS B 81  ? 1.7818 1.2299 1.6983 0.2412  0.7145  0.0557  96  LYS B O   
1426 C CB  . LYS B 81  ? 1.9707 1.2371 1.7465 0.3002  0.6886  0.0005  96  LYS B CB  
1427 C CG  . LYS B 81  ? 2.0382 1.2595 1.8459 0.3403  0.6538  -0.0154 96  LYS B CG  
1428 C CD  . LYS B 81  ? 2.0601 1.2835 1.9162 0.3827  0.6801  -0.0273 96  LYS B CD  
1429 C CE  . LYS B 81  ? 2.0775 1.2681 1.9914 0.4224  0.6406  -0.0381 96  LYS B CE  
1430 N NZ  . LYS B 81  ? 2.1220 1.3201 2.1005 0.4661  0.6650  -0.0502 96  LYS B NZ  
1431 N N   . TYR B 82  ? 1.7192 1.0677 1.4398 0.1895  0.7000  0.0443  97  TYR B N   
1432 C CA  . TYR B 82  ? 1.5833 0.9999 1.3339 0.1528  0.7183  0.0698  97  TYR B CA  
1433 C C   . TYR B 82  ? 1.5103 0.9790 1.3562 0.1413  0.6828  0.0820  97  TYR B C   
1434 O O   . TYR B 82  ? 1.4510 1.0010 1.3980 0.1314  0.6883  0.1053  97  TYR B O   
1435 C CB  . TYR B 82  ? 1.6458 1.0181 1.2688 0.1122  0.7328  0.0707  97  TYR B CB  
1436 C CG  . TYR B 82  ? 1.7537 1.1869 1.4076 0.0685  0.7356  0.0978  97  TYR B CG  
1437 C CD1 . TYR B 82  ? 1.8330 1.3503 1.5715 0.0611  0.7541  0.1224  97  TYR B CD1 
1438 C CD2 . TYR B 82  ? 1.7830 1.1931 1.3889 0.0336  0.7109  0.0986  97  TYR B CD2 
1439 C CE1 . TYR B 82  ? 1.8550 1.4327 1.6360 0.0217  0.7249  0.1431  97  TYR B CE1 
1440 C CE2 . TYR B 82  ? 1.7914 1.2659 1.4482 -0.0031 0.6835  0.1163  97  TYR B CE2 
1441 C CZ  . TYR B 82  ? 1.8594 1.4155 1.6016 -0.0083 0.6897  0.1385  97  TYR B CZ  
1442 O OH  . TYR B 82  ? 1.8214 1.4404 1.6116 -0.0431 0.6585  0.1558  97  TYR B OH  
1443 N N   . ILE B 83  ? 1.4441 0.8658 1.2576 0.1423  0.6454  0.0656  98  ILE B N   
1444 C CA  . ILE B 83  ? 1.4520 0.9162 1.3512 0.1357  0.6090  0.0688  98  ILE B CA  
1445 C C   . ILE B 83  ? 1.4809 0.9928 1.5118 0.1740  0.5939  0.0707  98  ILE B C   
1446 O O   . ILE B 83  ? 1.4558 1.0396 1.6017 0.1692  0.5802  0.0850  98  ILE B O   
1447 C CB  . ILE B 83  ? 1.4105 0.8111 1.2291 0.1262  0.5756  0.0482  98  ILE B CB  
1448 C CG1 . ILE B 83  ? 1.4445 0.8094 1.1499 0.0838  0.5886  0.0504  98  ILE B CG1 
1449 C CG2 . ILE B 83  ? 1.3311 0.7756 1.2416 0.1257  0.5375  0.0447  98  ILE B CG2 
1450 C CD1 . ILE B 83  ? 1.5679 0.8780 1.1935 0.0691  0.5595  0.0331  98  ILE B CD1 
1451 N N   . ASP B 84  ? 1.5288 1.0000 1.5476 0.2118  0.5945  0.0566  99  ASP B N   
1452 C CA  . ASP B 84  ? 1.5038 1.0173 1.6469 0.2504  0.5837  0.0595  99  ASP B CA  
1453 C C   . ASP B 84  ? 1.4548 1.0535 1.6941 0.2491  0.6171  0.0852  99  ASP B C   
1454 O O   . ASP B 84  ? 1.3281 0.9914 1.6990 0.2652  0.6043  0.0979  99  ASP B O   
1455 C CB  . ASP B 84  ? 1.6353 1.0860 1.7424 0.2895  0.5831  0.0407  99  ASP B CB  
1456 C CG  . ASP B 84  ? 1.7667 1.1543 1.8334 0.2998  0.5362  0.0214  99  ASP B CG  
1457 O OD1 . ASP B 84  ? 1.8375 1.2032 1.8417 0.2702  0.5161  0.0166  99  ASP B OD1 
1458 O OD2 . ASP B 84  ? 1.7994 1.1609 1.8981 0.3367  0.5194  0.0117  99  ASP B OD2 
1459 N N   . GLY B 85  ? 1.4741 1.0732 1.6457 0.2280  0.6589  0.0940  100 GLY B N   
1460 C CA  . GLY B 85  ? 1.3930 1.0737 1.6389 0.2192  0.6932  0.1214  100 GLY B CA  
1461 C C   . GLY B 85  ? 1.3123 1.0636 1.6418 0.1870  0.6759  0.1472  100 GLY B C   
1462 O O   . GLY B 85  ? 1.3655 1.1954 1.8243 0.1937  0.6752  0.1698  100 GLY B O   
1463 N N   . GLN B 86  ? 1.2575 0.9811 1.5183 0.1517  0.6607  0.1442  101 GLN B N   
1464 C CA  . GLN B 86  ? 1.2419 1.0260 1.5794 0.1195  0.6413  0.1652  101 GLN B CA  
1465 C C   . GLN B 86  ? 1.1585 0.9774 1.6209 0.1398  0.5981  0.1608  101 GLN B C   
1466 O O   . GLN B 86  ? 1.0002 0.8915 1.5786 0.1267  0.5843  0.1828  101 GLN B O   
1467 C CB  . GLN B 86  ? 1.2943 1.0344 1.5298 0.0807  0.6329  0.1575  101 GLN B CB  
1468 C CG  . GLN B 86  ? 1.3866 1.0931 1.5001 0.0547  0.6709  0.1638  101 GLN B CG  
1469 C CD  . GLN B 86  ? 1.4374 1.2165 1.6016 0.0278  0.6972  0.2000  101 GLN B CD  
1470 O OE1 . GLN B 86  ? 1.4348 1.2585 1.6537 0.0451  0.7221  0.2143  101 GLN B OE1 
1471 N NE2 . GLN B 86  ? 1.4370 1.2310 1.5803 -0.0131 0.6682  0.2081  101 GLN B NE2 
1472 N N   . LYS B 87  ? 1.2239 0.9900 1.6629 0.1710  0.5743  0.1329  102 LYS B N   
1473 C CA  . LYS B 87  ? 1.2279 1.0178 1.7721 0.1914  0.5301  0.1242  102 LYS B CA  
1474 C C   . LYS B 87  ? 1.2599 1.1271 1.9568 0.2139  0.5306  0.1468  102 LYS B C   
1475 O O   . LYS B 87  ? 1.2731 1.1994 2.0879 0.2082  0.5031  0.1580  102 LYS B O   
1476 C CB  . LYS B 87  ? 1.4089 1.1237 1.8885 0.2204  0.5063  0.0930  102 LYS B CB  
1477 C CG  . LYS B 87  ? 1.4858 1.2179 2.0583 0.2396  0.4575  0.0807  102 LYS B CG  
1478 C CD  . LYS B 87  ? 1.6161 1.2722 2.1179 0.2660  0.4334  0.0537  102 LYS B CD  
1479 C CE  . LYS B 87  ? 1.6407 1.2710 2.1361 0.3010  0.4550  0.0559  102 LYS B CE  
1480 N NZ  . LYS B 87  ? 1.6044 1.1604 2.0409 0.3261  0.4258  0.0329  102 LYS B NZ  
1481 N N   . LYS B 88  ? 1.3227 1.1902 2.0209 0.2395  0.5617  0.1526  103 LYS B N   
1482 C CA  . LYS B 88  ? 1.2899 1.2324 2.1309 0.2612  0.5672  0.1758  103 LYS B CA  
1483 C C   . LYS B 88  ? 1.2402 1.2645 2.1463 0.2291  0.5903  0.2137  103 LYS B C   
1484 O O   . LYS B 88  ? 1.1665 1.2660 2.2086 0.2375  0.5871  0.2392  103 LYS B O   
1485 C CB  . LYS B 88  ? 1.3657 1.2875 2.1915 0.2984  0.5967  0.1689  103 LYS B CB  
1486 C CG  . LYS B 88  ? 1.4394 1.3133 2.2824 0.3390  0.5622  0.1435  103 LYS B CG  
1487 C CD  . LYS B 88  ? 1.4615 1.3529 2.3669 0.3788  0.5852  0.1468  103 LYS B CD  
1488 C CE  . LYS B 88  ? 1.4885 1.3490 2.4200 0.4040  0.5294  0.1274  103 LYS B CE  
1489 N NZ  . LYS B 88  ? 1.5095 1.3970 2.4941 0.4271  0.5340  0.1306  103 LYS B NZ  
1490 N N   . LYS B 89  ? 1.7691 1.3739 2.7175 0.0525  1.0723  0.2152  104 LYS B N   
1491 C CA  . LYS B 89  ? 1.6740 1.2483 2.5705 0.0493  1.0737  0.1504  104 LYS B CA  
1492 C C   . LYS B 89  ? 1.7018 1.2344 2.4560 0.0489  1.0460  0.1343  104 LYS B C   
1493 O O   . LYS B 89  ? 1.5609 1.0587 2.2443 0.0484  1.0162  0.0842  104 LYS B O   
1494 C CB  . LYS B 89  ? 1.6213 1.1819 2.5920 0.0628  1.0745  0.0895  104 LYS B CB  
1495 C CG  . LYS B 89  ? 1.6789 1.2446 2.7323 0.0546  1.0720  0.0798  104 LYS B CG  
1496 C CD  . LYS B 89  ? 1.6949 1.2383 2.7826 0.0468  1.0691  0.0175  104 LYS B CD  
1497 C CE  . LYS B 89  ? 1.7204 1.2565 2.8675 0.0294  1.0761  -0.0017 104 LYS B CE  
1498 N NZ  . LYS B 89  ? 1.8082 1.3253 2.9753 0.0091  1.0766  -0.0619 104 LYS B NZ  
1499 N N   . CYS B 90  ? 1.7059 1.2387 2.4170 0.0461  1.0541  0.1770  105 CYS B N   
1500 C CA  . CYS B 90  ? 1.7377 1.2223 2.3098 0.0433  1.0351  0.1608  105 CYS B CA  
1501 C C   . CYS B 90  ? 1.8586 1.3176 2.2918 0.0147  0.9895  0.1823  105 CYS B C   
1502 O O   . CYS B 90  ? 1.8315 1.2398 2.1507 0.0127  0.9637  0.1481  105 CYS B O   
1503 C CB  . CYS B 90  ? 1.6891 1.1780 2.2546 0.0434  1.0677  0.1933  105 CYS B CB  
1504 S SG  . CYS B 90  ? 1.6497 1.1592 2.3578 0.0782  1.1192  0.1633  105 CYS B SG  
1505 N N   . GLY B 91  ? 1.9477 1.4424 2.3997 -0.0077 0.9795  0.2421  106 GLY B N   
1506 C CA  . GLY B 91  ? 2.0583 1.5352 2.3848 -0.0394 0.9346  0.2736  106 GLY B CA  
1507 C C   . GLY B 91  ? 2.0586 1.5764 2.4437 -0.0543 0.9190  0.3137  106 GLY B C   
1508 O O   . GLY B 91  ? 2.1144 1.6644 2.5062 -0.0795 0.9107  0.3899  106 GLY B O   
1509 N N   . GLU B 92  ? 1.9964 1.5135 2.4259 -0.0425 0.9155  0.2648  107 GLU B N   
1510 C CA  . GLU B 92  ? 2.0187 1.5665 2.4935 -0.0573 0.9050  0.2912  107 GLU B CA  
1511 C C   . GLU B 92  ? 2.1076 1.6241 2.5173 -0.0602 0.8761  0.2286  107 GLU B C   
1512 O O   . GLU B 92  ? 2.0673 1.5998 2.4857 -0.0758 0.8634  0.2399  107 GLU B O   
1513 C CB  . GLU B 92  ? 1.9060 1.5048 2.5674 -0.0437 0.9556  0.3090  107 GLU B CB  
1514 C CG  . GLU B 92  ? 1.8215 1.4114 2.5660 -0.0198 0.9906  0.2335  107 GLU B CG  
1515 C CD  . GLU B 92  ? 1.8165 1.4447 2.7253 -0.0028 1.0230  0.2421  107 GLU B CD  
1516 O OE1 . GLU B 92  ? 1.8103 1.4761 2.7707 -0.0021 1.0071  0.3045  107 GLU B OE1 
1517 O OE2 . GLU B 92  ? 1.8456 1.4597 2.8163 0.0118  1.0443  0.1822  107 GLU B OE2 
1518 N N   . GLU B 93  ? 2.1583 1.6323 2.5087 -0.0470 0.8658  0.1663  108 GLU B N   
1519 C CA  . GLU B 93  ? 2.1183 1.5597 2.3926 -0.0549 0.8283  0.1134  108 GLU B CA  
1520 C C   . GLU B 93  ? 2.1303 1.5201 2.2516 -0.0630 0.7842  0.1109  108 GLU B C   
1521 O O   . GLU B 93  ? 2.1244 1.4814 2.2189 -0.0464 0.7901  0.0840  108 GLU B O   
1522 C CB  . GLU B 93  ? 2.1180 1.5517 2.4574 -0.0387 0.8451  0.0464  108 GLU B CB  
1523 C CG  . GLU B 93  ? 2.1814 1.5796 2.4362 -0.0509 0.7984  -0.0034 108 GLU B CG  
1524 C CD  . GLU B 93  ? 2.1923 1.5876 2.5131 -0.0441 0.8084  -0.0604 108 GLU B CD  
1525 O OE1 . GLU B 93  ? 2.1970 1.5598 2.4643 -0.0434 0.7731  -0.0917 108 GLU B OE1 
1526 O OE2 . GLU B 93  ? 2.1874 1.6122 2.6178 -0.0423 0.8505  -0.0714 108 GLU B OE2 
1527 N N   . ARG B 94  ? 2.1742 1.5551 2.2007 -0.0891 0.7436  0.1394  109 ARG B N   
1528 C CA  . ARG B 94  ? 2.1735 1.4981 2.0498 -0.1012 0.7007  0.1332  109 ARG B CA  
1529 C C   . ARG B 94  ? 2.1331 1.4248 1.9715 -0.0985 0.6675  0.0736  109 ARG B C   
1530 O O   . ARG B 94  ? 2.1451 1.4555 1.9983 -0.1122 0.6488  0.0619  109 ARG B O   
1531 C CB  . ARG B 94  ? 2.1780 1.5059 1.9654 -0.1352 0.6660  0.1923  109 ARG B CB  
1532 C CG  . ARG B 94  ? 2.2661 1.6238 2.0745 -0.1477 0.6872  0.2625  109 ARG B CG  
1533 C CD  . ARG B 94  ? 2.3668 1.7262 2.0795 -0.1883 0.6444  0.3265  109 ARG B CD  
1534 N NE  . ARG B 94  ? 2.5017 1.8920 2.2315 -0.2088 0.6575  0.4021  109 ARG B NE  
1535 C CZ  . ARG B 94  ? 2.5060 1.9648 2.3721 -0.2096 0.6792  0.4597  109 ARG B CZ  
1536 N NH1 . ARG B 94  ? 2.4566 1.9540 2.4495 -0.1896 0.6983  0.4424  109 ARG B NH1 
1537 N NH2 . ARG B 94  ? 2.5258 2.0128 2.4034 -0.2337 0.6835  0.5357  109 ARG B NH2 
1538 N N   . ARG B 95  ? 2.1311 1.3746 1.9267 -0.0830 0.6621  0.0383  110 ARG B N   
1539 C CA  . ARG B 95  ? 2.1728 1.3854 1.9415 -0.0821 0.6250  -0.0092 110 ARG B CA  
1540 C C   . ARG B 95  ? 2.2180 1.3658 1.8568 -0.0902 0.5878  -0.0121 110 ARG B C   
1541 O O   . ARG B 95  ? 2.1939 1.3175 1.7517 -0.1006 0.5928  0.0186  110 ARG B O   
1542 C CB  . ARG B 95  ? 2.2573 1.4747 2.1279 -0.0554 0.6500  -0.0513 110 ARG B CB  
1543 C CG  . ARG B 95  ? 2.2803 1.5503 2.2633 -0.0580 0.6722  -0.0641 110 ARG B CG  
1544 C CD  . ARG B 95  ? 2.3713 1.6528 2.3188 -0.0896 0.6346  -0.0722 110 ARG B CD  
1545 N NE  . ARG B 95  ? 2.3852 1.7103 2.4292 -0.0988 0.6660  -0.0866 110 ARG B NE  
1546 C CZ  . ARG B 95  ? 2.3727 1.7029 2.4654 -0.1081 0.6634  -0.1300 110 ARG B CZ  
1547 N NH1 . ARG B 95  ? 2.4124 1.7142 2.4789 -0.1074 0.6255  -0.1555 110 ARG B NH1 
1548 N NH2 . ARG B 95  ? 2.3027 1.6650 2.4736 -0.1215 0.6995  -0.1462 110 ARG B NH2 
1549 N N   . ARG B 96  ? 2.3235 1.4416 1.9433 -0.0897 0.5499  -0.0476 111 ARG B N   
1550 C CA  . ARG B 96  ? 2.4329 1.4891 1.9343 -0.1018 0.5078  -0.0500 111 ARG B CA  
1551 C C   . ARG B 96  ? 2.5163 1.5117 1.9983 -0.0787 0.5311  -0.0706 111 ARG B C   
1552 O O   . ARG B 96  ? 2.4576 1.4512 2.0291 -0.0513 0.5511  -0.0996 111 ARG B O   
1553 C CB  . ARG B 96  ? 2.3800 1.4327 1.8689 -0.1176 0.4504  -0.0706 111 ARG B CB  
1554 C CG  . ARG B 96  ? 2.3758 1.3746 1.7379 -0.1389 0.3990  -0.0623 111 ARG B CG  
1555 C CD  . ARG B 96  ? 2.4000 1.4009 1.7580 -0.1573 0.3400  -0.0785 111 ARG B CD  
1556 N NE  . ARG B 96  ? 2.4030 1.4689 1.8107 -0.1768 0.3368  -0.0768 111 ARG B NE  
1557 C CZ  . ARG B 96  ? 2.4473 1.5388 1.8024 -0.2067 0.3166  -0.0529 111 ARG B CZ  
1558 N NH1 . ARG B 96  ? 2.4746 1.5355 1.7231 -0.2222 0.2898  -0.0239 111 ARG B NH1 
1559 N NH2 . ARG B 96  ? 2.4175 1.5629 1.8273 -0.2237 0.3260  -0.0588 111 ARG B NH2 
1560 N N   . VAL B 97  ? 2.6226 1.5670 1.9870 -0.0936 0.5306  -0.0545 112 VAL B N   
1561 C CA  . VAL B 97  ? 2.7051 1.5737 2.0229 -0.0801 0.5504  -0.0798 112 VAL B CA  
1562 C C   . VAL B 97  ? 2.7489 1.5855 2.0936 -0.0688 0.5100  -0.1117 112 VAL B C   
1563 O O   . VAL B 97  ? 2.7796 1.6078 2.0649 -0.0920 0.4522  -0.1049 112 VAL B O   
1564 C CB  . VAL B 97  ? 2.8140 1.6268 1.9732 -0.1135 0.5445  -0.0578 112 VAL B CB  
1565 C CG1 . VAL B 97  ? 2.9905 1.7087 2.0765 -0.1103 0.5422  -0.0916 112 VAL B CG1 
1566 C CG2 . VAL B 97  ? 2.7401 1.5681 1.8798 -0.1227 0.5959  -0.0303 112 VAL B CG2 
1567 N N   . ASN B 98  ? 2.4843 1.7925 1.3946 -0.5194 -0.0352 0.0385  113 ASN B N   
1568 C CA  . ASN B 98  ? 2.3283 1.6658 1.3736 -0.4580 -0.0309 0.0327  113 ASN B CA  
1569 C C   . ASN B 98  ? 2.0948 1.5647 1.2850 -0.4051 -0.0639 0.0221  113 ASN B C   
1570 O O   . ASN B 98  ? 1.9978 1.4363 1.2096 -0.3462 -0.0727 0.0633  113 ASN B O   
1571 C CB  . ASN B 98  ? 2.5932 1.7566 1.5754 -0.4135 0.0057  0.0775  113 ASN B CB  
1572 C CG  . ASN B 98  ? 2.7799 1.8312 1.6660 -0.4663 0.0451  0.0705  113 ASN B CG  
1573 O OD1 . ASN B 98  ? 2.7170 1.8510 1.6712 -0.4975 0.0405  0.0392  113 ASN B OD1 
1574 N ND2 . ASN B 98  ? 2.9970 1.8598 1.7217 -0.4830 0.0877  0.1036  113 ASN B ND2 
1575 N N   . GLN B 99  ? 2.0350 1.6513 1.3244 -0.4299 -0.0770 -0.0280 114 GLN B N   
1576 C CA  . GLN B 99  ? 1.9771 1.7121 1.4110 -0.3880 -0.0971 -0.0497 114 GLN B CA  
1577 C C   . GLN B 99  ? 1.7720 1.5143 1.3216 -0.3447 -0.0795 -0.0604 114 GLN B C   
1578 O O   . GLN B 99  ? 1.6685 1.4626 1.3318 -0.2897 -0.0908 -0.0628 114 GLN B O   
1579 C CB  . GLN B 99  ? 1.9674 1.8355 1.4501 -0.4377 -0.1007 -0.1032 114 GLN B CB  
1580 C CG  . GLN B 99  ? 2.0972 1.9646 1.4611 -0.4924 -0.1157 -0.1002 114 GLN B CG  
1581 C CD  . GLN B 99  ? 2.1190 2.0916 1.5178 -0.5501 -0.0993 -0.1567 114 GLN B CD  
1582 O OE1 . GLN B 99  ? 2.2323 2.1908 1.5474 -0.6059 -0.0870 -0.1624 114 GLN B OE1 
1583 N NE2 . GLN B 99  ? 1.9896 2.0617 1.5116 -0.5379 -0.0921 -0.1980 114 GLN B NE2 
1584 N N   . PHE B 100 ? 1.6882 1.3826 1.2031 -0.3773 -0.0539 -0.0634 115 PHE B N   
1585 C CA  . PHE B 100 ? 1.6242 1.3184 1.2286 -0.3513 -0.0363 -0.0681 115 PHE B CA  
1586 C C   . PHE B 100 ? 1.6417 1.2171 1.2310 -0.2859 -0.0282 -0.0319 115 PHE B C   
1587 O O   . PHE B 100 ? 1.5385 1.1509 1.2501 -0.2311 -0.0283 -0.0380 115 PHE B O   
1588 C CB  . PHE B 100 ? 1.6858 1.3492 1.2243 -0.4198 -0.0152 -0.0647 115 PHE B CB  
1589 C CG  . PHE B 100 ? 1.6821 1.3375 1.2894 -0.4078 0.0010  -0.0609 115 PHE B CG  
1590 C CD1 . PHE B 100 ? 1.5467 1.3470 1.3282 -0.3947 0.0009  -0.0839 115 PHE B CD1 
1591 C CD2 . PHE B 100 ? 1.7772 1.2738 1.2710 -0.4138 0.0230  -0.0335 115 PHE B CD2 
1592 C CE1 . PHE B 100 ? 1.4534 1.2551 1.3006 -0.3868 0.0126  -0.0755 115 PHE B CE1 
1593 C CE2 . PHE B 100 ? 1.6609 1.1480 1.2064 -0.4127 0.0381  -0.0310 115 PHE B CE2 
1594 C CZ  . PHE B 100 ? 1.5179 1.1651 1.2431 -0.3989 0.0279  -0.0500 115 PHE B CZ  
1595 N N   . LEU B 101 ? 1.8171 1.2449 1.2599 -0.2898 -0.0141 0.0085  116 LEU B N   
1596 C CA  . LEU B 101 ? 1.8753 1.1719 1.3011 -0.2247 0.0097  0.0523  116 LEU B CA  
1597 C C   . LEU B 101 ? 1.7917 1.1620 1.3296 -0.1503 -0.0191 0.0762  116 LEU B C   
1598 O O   . LEU B 101 ? 1.7889 1.1201 1.3982 -0.0826 -0.0059 0.1024  116 LEU B O   
1599 C CB  . LEU B 101 ? 2.0338 1.1440 1.2764 -0.2475 0.0462  0.0940  116 LEU B CB  
1600 C CG  . LEU B 101 ? 2.1172 1.1079 1.2269 -0.3206 0.0861  0.0816  116 LEU B CG  
1601 C CD1 . LEU B 101 ? 2.3184 1.0900 1.2537 -0.3263 0.1398  0.1249  116 LEU B CD1 
1602 C CD2 . LEU B 101 ? 2.0646 1.0607 1.2504 -0.3133 0.1020  0.0617  116 LEU B CD2 
1603 N N   . ASP B 102 ? 1.7350 1.2142 1.2845 -0.1697 -0.0578 0.0700  117 ASP B N   
1604 C CA  . ASP B 102 ? 1.7282 1.3044 1.3784 -0.1210 -0.0940 0.0932  117 ASP B CA  
1605 C C   . ASP B 102 ? 1.6047 1.2849 1.4159 -0.0860 -0.1023 0.0546  117 ASP B C   
1606 O O   . ASP B 102 ? 1.6052 1.3021 1.5068 -0.0215 -0.1121 0.0876  117 ASP B O   
1607 C CB  . ASP B 102 ? 1.7893 1.4725 1.4084 -0.1738 -0.1324 0.0789  117 ASP B CB  
1608 C CG  . ASP B 102 ? 1.9329 1.5253 1.3955 -0.2122 -0.1270 0.1144  117 ASP B CG  
1609 O OD1 . ASP B 102 ? 2.0573 1.5019 1.4452 -0.1831 -0.0946 0.1669  117 ASP B OD1 
1610 O OD2 . ASP B 102 ? 1.8938 1.5554 1.3055 -0.2730 -0.1488 0.0890  117 ASP B OD2 
1611 N N   . TYR B 103 ? 1.5390 1.2924 1.3921 -0.1285 -0.0953 -0.0091 118 TYR B N   
1612 C CA  . TYR B 103 ? 1.4628 1.3145 1.4707 -0.1008 -0.0946 -0.0492 118 TYR B CA  
1613 C C   . TYR B 103 ? 1.3847 1.1484 1.4318 -0.0454 -0.0705 -0.0268 118 TYR B C   
1614 O O   . TYR B 103 ? 1.3022 1.1183 1.4753 0.0086  -0.0768 -0.0311 118 TYR B O   
1615 C CB  . TYR B 103 ? 1.5215 1.4574 1.5641 -0.1588 -0.0790 -0.1062 118 TYR B CB  
1616 C CG  . TYR B 103 ? 1.5034 1.5507 1.7151 -0.1339 -0.0703 -0.1474 118 TYR B CG  
1617 C CD1 . TYR B 103 ? 1.5136 1.6655 1.8153 -0.1214 -0.0852 -0.1762 118 TYR B CD1 
1618 C CD2 . TYR B 103 ? 1.4545 1.5036 1.7309 -0.1308 -0.0454 -0.1552 118 TYR B CD2 
1619 C CE1 . TYR B 103 ? 1.4433 1.6874 1.8972 -0.0992 -0.0690 -0.2155 118 TYR B CE1 
1620 C CE2 . TYR B 103 ? 1.3961 1.5497 1.8363 -0.1049 -0.0338 -0.1874 118 TYR B CE2 
1621 C CZ  . TYR B 103 ? 1.3949 1.6405 1.9244 -0.0858 -0.0424 -0.2196 118 TYR B CZ  
1622 O OH  . TYR B 103 ? 1.2706 1.6104 1.9603 -0.0604 -0.0229 -0.2533 118 TYR B OH  
1623 N N   . LEU B 104 ? 1.4839 1.1068 1.4128 -0.0651 -0.0394 -0.0043 119 LEU B N   
1624 C CA  . LEU B 104 ? 1.4525 0.9682 1.3878 -0.0303 -0.0056 0.0120  119 LEU B CA  
1625 C C   . LEU B 104 ? 1.5467 0.9896 1.5149 0.0538  0.0019  0.0651  119 LEU B C   
1626 O O   . LEU B 104 ? 1.4509 0.8718 1.5017 0.1045  0.0182  0.0686  119 LEU B O   
1627 C CB  . LEU B 104 ? 1.5101 0.8792 1.2810 -0.0911 0.0317  0.0214  119 LEU B CB  
1628 C CG  . LEU B 104 ? 1.4990 0.7382 1.2383 -0.0831 0.0757  0.0309  119 LEU B CG  
1629 C CD1 . LEU B 104 ? 1.2809 0.6398 1.1654 -0.0789 0.0646  -0.0043 119 LEU B CD1 
1630 C CD2 . LEU B 104 ? 1.6430 0.7408 1.1923 -0.1670 0.1111  0.0369  119 LEU B CD2 
1631 N N   . GLN B 105 ? 1.7066 1.1194 1.6183 0.0688  -0.0088 0.1136  120 GLN B N   
1632 C CA  . GLN B 105 ? 1.8491 1.2123 1.8091 0.1503  -0.0013 0.1839  120 GLN B CA  
1633 C C   . GLN B 105 ? 1.7091 1.2256 1.8443 0.1992  -0.0413 0.1757  120 GLN B C   
1634 O O   . GLN B 105 ? 1.6820 1.1645 1.9011 0.2692  -0.0245 0.2085  120 GLN B O   
1635 C CB  . GLN B 105 ? 2.1563 1.4951 2.0400 0.1494  -0.0128 0.2479  120 GLN B CB  
1636 C CG  . GLN B 105 ? 2.4676 1.6726 2.1721 0.0914  0.0206  0.2511  120 GLN B CG  
1637 C CD  . GLN B 105 ? 2.7129 1.6966 2.3214 0.1114  0.0990  0.2815  120 GLN B CD  
1638 O OE1 . GLN B 105 ? 2.7859 1.7057 2.4632 0.1767  0.1331  0.3082  120 GLN B OE1 
1639 N NE2 . GLN B 105 ? 2.8239 1.6812 2.2644 0.0498  0.1333  0.2761  120 GLN B NE2 
1640 N N   . GLU B 106 ? 1.6516 1.3289 1.8352 0.1581  -0.0882 0.1311  121 GLU B N   
1641 C CA  . GLU B 106 ? 1.5875 1.4129 1.9216 0.1857  -0.1232 0.1108  121 GLU B CA  
1642 C C   . GLU B 106 ? 1.5178 1.3446 1.9512 0.2163  -0.0998 0.0688  121 GLU B C   
1643 O O   . GLU B 106 ? 1.5349 1.3961 2.0827 0.2774  -0.1067 0.0865  121 GLU B O   
1644 C CB  . GLU B 106 ? 1.5977 1.5662 1.9381 0.1176  -0.1577 0.0543  121 GLU B CB  
1645 C CG  . GLU B 106 ? 1.7644 1.7682 2.0259 0.0821  -0.1928 0.0947  121 GLU B CG  
1646 C CD  . GLU B 106 ? 1.7717 1.8986 2.0250 0.0050  -0.2143 0.0284  121 GLU B CD  
1647 O OE1 . GLU B 106 ? 1.6948 1.8483 1.9759 -0.0250 -0.1883 -0.0443 121 GLU B OE1 
1648 O OE2 . GLU B 106 ? 1.8137 2.0108 2.0345 -0.0287 -0.2525 0.0536  121 GLU B OE2 
1649 N N   . PHE B 107 ? 1.4127 1.2097 1.8042 0.1701  -0.0740 0.0199  122 PHE B N   
1650 C CA  . PHE B 107 ? 1.2020 1.0099 1.6816 0.1854  -0.0527 -0.0156 122 PHE B CA  
1651 C C   . PHE B 107 ? 1.2401 0.9236 1.7294 0.2504  -0.0228 0.0268  122 PHE B C   
1652 O O   . PHE B 107 ? 1.1413 0.8778 1.7370 0.2955  -0.0244 0.0198  122 PHE B O   
1653 C CB  . PHE B 107 ? 1.2102 1.0025 1.6231 0.1134  -0.0314 -0.0510 122 PHE B CB  
1654 C CG  . PHE B 107 ? 1.1873 0.9780 1.6697 0.1184  -0.0086 -0.0699 122 PHE B CG  
1655 C CD1 . PHE B 107 ? 1.1112 1.0316 1.7614 0.1470  -0.0175 -0.1034 122 PHE B CD1 
1656 C CD2 . PHE B 107 ? 1.2676 0.9263 1.6403 0.0859  0.0240  -0.0532 122 PHE B CD2 
1657 C CE1 . PHE B 107 ? 1.0525 0.9812 1.7725 0.1498  0.0014  -0.1137 122 PHE B CE1 
1658 C CE2 . PHE B 107 ? 1.2042 0.8699 1.6333 0.0782  0.0410  -0.0654 122 PHE B CE2 
1659 C CZ  . PHE B 107 ? 1.0561 0.8625 1.6652 0.1131  0.0274  -0.0928 122 PHE B CZ  
1660 N N   . LEU B 108 ? 0.9464 1.0373 1.9507 0.2306  -0.0727 -0.3018 123 LEU B N   
1661 C CA  . LEU B 108 ? 1.0013 1.1465 2.0127 0.2525  -0.0465 -0.2457 123 LEU B CA  
1662 C C   . LEU B 108 ? 1.0267 1.3207 2.1483 0.2529  -0.0473 -0.2189 123 LEU B C   
1663 O O   . LEU B 108 ? 1.0949 1.4414 2.2269 0.2377  -0.0389 -0.1700 123 LEU B O   
1664 C CB  . LEU B 108 ? 0.9964 1.1288 1.8718 0.2803  -0.0026 -0.2109 123 LEU B CB  
1665 C CG  . LEU B 108 ? 0.9320 0.9596 1.6935 0.2735  0.0006  -0.2112 123 LEU B CG  
1666 C CD1 . LEU B 108 ? 0.7872 0.8188 1.4279 0.3041  0.0376  -0.1723 123 LEU B CD1 
1667 C CD2 . LEU B 108 ? 0.9745 0.9524 1.7753 0.2574  -0.0159 -0.2088 123 LEU B CD2 
1668 N N   . GLY B 109 ? 0.9242 1.2773 2.0554 0.2404  -0.0565 -0.2340 124 GLY B N   
1669 C CA  . GLY B 109 ? 0.8202 1.2979 1.9788 0.2068  -0.0632 -0.1892 124 GLY B CA  
1670 C C   . GLY B 109 ? 0.8424 1.3152 2.0124 0.1403  -0.1031 -0.1782 124 GLY B C   
1671 O O   . GLY B 109 ? 0.7801 1.3406 1.9729 0.1165  -0.1031 -0.1231 124 GLY B O   
1672 N N   . VAL B 110 ? 0.8537 1.2246 2.0159 0.1100  -0.1385 -0.2315 125 VAL B N   
1673 C CA  . VAL B 110 ? 0.9205 1.2681 2.1003 0.0456  -0.1848 -0.2261 125 VAL B CA  
1674 C C   . VAL B 110 ? 0.8497 1.1806 2.0324 0.0371  -0.1874 -0.1765 125 VAL B C   
1675 O O   . VAL B 110 ? 0.7988 1.1933 1.9960 -0.0076 -0.2055 -0.1285 125 VAL B O   
1676 C CB  . VAL B 110 ? 1.0476 1.2761 2.2358 0.0219  -0.2214 -0.3019 125 VAL B CB  
1677 C CG1 . VAL B 110 ? 1.1214 1.3003 2.3389 -0.0375 -0.2741 -0.2917 125 VAL B CG1 
1678 C CG2 . VAL B 110 ? 1.1574 1.4226 2.3399 0.0046  -0.2235 -0.3522 125 VAL B CG2 
1679 N N   . MET B 111 ? 0.8494 1.0987 2.0146 0.0752  -0.1697 -0.1870 126 MET B N   
1680 C CA  . MET B 111 ? 0.8699 1.0992 2.0255 0.0634  -0.1686 -0.1432 126 MET B CA  
1681 C C   . MET B 111 ? 0.8459 1.2099 2.0033 0.0666  -0.1307 -0.0818 126 MET B C   
1682 O O   . MET B 111 ? 0.8233 1.2174 1.9807 0.0259  -0.1399 -0.0372 126 MET B O   
1683 C CB  . MET B 111 ? 0.9154 1.0491 2.0441 0.1110  -0.1458 -0.1652 126 MET B CB  
1684 C CG  . MET B 111 ? 0.9771 1.0567 2.0888 0.0837  -0.1585 -0.1308 126 MET B CG  
1685 S SD  . MET B 111 ? 0.8782 0.8490 1.9530 0.1381  -0.1311 -0.1542 126 MET B SD  
1686 C CE  . MET B 111 ? 0.7535 0.6562 1.8483 0.1792  -0.1389 -0.2301 126 MET B CE  
1687 N N   . ASN B 112 ? 0.9474 1.3957 2.1137 0.1124  -0.0897 -0.0796 127 ASN B N   
1688 C CA  . ASN B 112 ? 1.0398 1.6222 2.2305 0.1243  -0.0504 -0.0274 127 ASN B CA  
1689 C C   . ASN B 112 ? 1.0580 1.7383 2.2814 0.0684  -0.0784 0.0106  127 ASN B C   
1690 O O   . ASN B 112 ? 1.0956 1.8518 2.3352 0.0410  -0.0698 0.0580  127 ASN B O   
1691 C CB  . ASN B 112 ? 1.0565 1.6904 2.2627 0.1908  -0.0070 -0.0351 127 ASN B CB  
1692 C CG  . ASN B 112 ? 1.1005 1.8620 2.3506 0.2149  0.0395  0.0125  127 ASN B CG  
1693 O OD1 . ASN B 112 ? 1.1495 1.9487 2.4040 0.1917  0.0539  0.0424  127 ASN B OD1 
1694 N ND2 . ASN B 112 ? 1.0771 1.9090 2.3665 0.2587  0.0622  0.0194  127 ASN B ND2 
1695 N N   . THR B 113 ? 1.0680 1.7490 2.2983 0.0471  -0.1111 -0.0117 128 THR B N   
1696 C CA  . THR B 113 ? 1.1055 1.8765 2.3628 -0.0084 -0.1411 0.0234  128 THR B CA  
1697 C C   . THR B 113 ? 1.1823 1.9003 2.4329 -0.0774 -0.1942 0.0279  128 THR B C   
1698 O O   . THR B 113 ? 1.1929 1.9828 2.4602 -0.1167 -0.2029 0.0809  128 THR B O   
1699 C CB  . THR B 113 ? 1.0293 1.8258 2.2894 -0.0165 -0.1581 -0.0022 128 THR B CB  
1700 O OG1 . THR B 113 ? 1.0520 1.7284 2.2827 -0.0323 -0.1892 -0.0709 128 THR B OG1 
1701 C CG2 . THR B 113 ? 0.9598 1.8125 2.2328 0.0444  -0.1159 0.0016  128 THR B CG2 
1702 N N   . GLU B 114 ? 1.1843 1.7783 2.4182 -0.0926 -0.2311 -0.0281 129 GLU B N   
1703 C CA  . GLU B 114 ? 1.2561 1.7920 2.4992 -0.1603 -0.2923 -0.0311 129 GLU B CA  
1704 C C   . GLU B 114 ? 1.3419 1.8241 2.5809 -0.1840 -0.3102 -0.0001 129 GLU B C   
1705 O O   . GLU B 114 ? 1.4574 1.9918 2.7068 -0.2379 -0.3364 0.0518  129 GLU B O   
1706 C CB  . GLU B 114 ? 1.2877 1.7141 2.5332 -0.1693 -0.3256 -0.1094 129 GLU B CB  
1707 C CG  . GLU B 114 ? 1.3041 1.7876 2.5447 -0.1687 -0.3167 -0.1415 129 GLU B CG  
1708 C CD  . GLU B 114 ? 1.4314 1.8175 2.6776 -0.1917 -0.3486 -0.2260 129 GLU B CD  
1709 O OE1 . GLU B 114 ? 1.4853 1.7695 2.7571 -0.2198 -0.3906 -0.2508 129 GLU B OE1 
1710 O OE2 . GLU B 114 ? 1.4637 1.8780 2.6938 -0.1849 -0.3325 -0.2684 129 GLU B OE2 
1711 N N   . TRP B 115 ? 1.3284 1.7098 2.5505 -0.1494 -0.2988 -0.0286 130 TRP B N   
1712 C CA  . TRP B 115 ? 1.3794 1.6917 2.5937 -0.1799 -0.3245 -0.0023 130 TRP B CA  
1713 C C   . TRP B 115 ? 1.4563 1.8743 2.6574 -0.2085 -0.3046 0.0703  130 TRP B C   
1714 O O   . TRP B 115 ? 1.4478 1.9812 2.6461 -0.1760 -0.2484 0.0929  130 TRP B O   
1715 C CB  . TRP B 115 ? 1.3798 1.5930 2.5709 -0.1292 -0.2999 -0.0343 130 TRP B CB  
1716 C CG  . TRP B 115 ? 1.3582 1.4520 2.5673 -0.1055 -0.3216 -0.1068 130 TRP B CG  
1717 C CD1 . TRP B 115 ? 1.3864 1.4757 2.6195 -0.1060 -0.3359 -0.1585 130 TRP B CD1 
1718 C CD2 . TRP B 115 ? 1.3008 1.2675 2.5077 -0.0810 -0.3289 -0.1379 130 TRP B CD2 
1719 N NE1 . TRP B 115 ? 1.4049 1.3763 2.6545 -0.0816 -0.3474 -0.2252 130 TRP B NE1 
1720 C CE2 . TRP B 115 ? 1.3518 1.2449 2.5901 -0.0638 -0.3452 -0.2113 130 TRP B CE2 
1721 C CE3 . TRP B 115 ? 1.2777 1.1887 2.4587 -0.0764 -0.3232 -0.1107 130 TRP B CE3 
1722 C CZ2 . TRP B 115 ? 1.3431 1.1102 2.5978 -0.0372 -0.3558 -0.2570 130 TRP B CZ2 
1723 C CZ3 . TRP B 115 ? 1.3025 1.0841 2.4942 -0.0525 -0.3382 -0.1504 130 TRP B CZ3 
1724 C CH2 . TRP B 115 ? 1.3186 1.0298 2.5520 -0.0307 -0.3543 -0.2224 130 TRP B CH2 
1725 N N   . ILE B 116 ? 1.5765 1.9572 2.7766 -0.2727 -0.3526 0.1061  131 ILE B N   
1726 C CA  . ILE B 116 ? 1.6712 2.1404 2.8488 -0.3070 -0.3320 0.1696  131 ILE B CA  
1727 C C   . ILE B 116 ? 1.8877 2.2987 3.0239 -0.2821 -0.2995 0.1652  131 ILE B C   
1728 O O   . ILE B 116 ? 1.8998 2.1786 3.0317 -0.2902 -0.3392 0.1444  131 ILE B O   
1729 C CB  . ILE B 116 ? 1.5926 2.0589 2.7831 -0.4008 -0.4050 0.2187  131 ILE B CB  
1730 C CG1 . ILE B 116 ? 1.6123 2.1628 2.8367 -0.4300 -0.4288 0.2342  131 ILE B CG1 
1731 C CG2 . ILE B 116 ? 1.5427 2.0815 2.6983 -0.4447 -0.3856 0.2789  131 ILE B CG2 
1732 C CD1 . ILE B 116 ? 1.5716 2.2891 2.7977 -0.4085 -0.3649 0.2676  131 ILE B CD1 
1741 N N   . LYS C 14  ? 1.8645 3.1594 1.7145 0.6352  -0.3358 -0.2585 27  LYS C N   
1742 C CA  . LYS C 14  ? 1.8788 3.0757 1.6512 0.6240  -0.3486 -0.2794 27  LYS C CA  
1743 C C   . LYS C 14  ? 1.8745 3.0074 1.6356 0.5822  -0.3368 -0.3007 27  LYS C C   
1744 O O   . LYS C 14  ? 1.8863 3.0450 1.6849 0.5312  -0.3635 -0.3182 27  LYS C O   
1745 C CB  . LYS C 14  ? 1.8471 3.0825 1.6296 0.6005  -0.4000 -0.2873 27  LYS C CB  
1746 C CG  . LYS C 14  ? 1.8459 3.1270 1.6247 0.6442  -0.4158 -0.2668 27  LYS C CG  
1747 C CD  . LYS C 14  ? 1.8408 3.0226 1.5235 0.6951  -0.3896 -0.2612 27  LYS C CD  
1748 C CE  . LYS C 14  ? 1.8673 3.0879 1.5403 0.7384  -0.4085 -0.2424 27  LYS C CE  
1749 N NZ  . LYS C 14  ? 1.8818 2.9998 1.4608 0.7853  -0.3836 -0.2362 27  LYS C NZ  
1750 N N   . ILE C 15  ? 1.8362 2.8808 1.5457 0.6023  -0.2980 -0.2977 28  ILE C N   
1751 C CA  . ILE C 15  ? 1.7567 2.7350 1.4558 0.5667  -0.2831 -0.3133 28  ILE C CA  
1752 C C   . ILE C 15  ? 1.6552 2.5104 1.2816 0.5816  -0.2547 -0.3079 28  ILE C C   
1753 O O   . ILE C 15  ? 1.5956 2.4134 1.1953 0.6198  -0.2291 -0.2870 28  ILE C O   
1754 C CB  . ILE C 15  ? 1.4784 2.4995 1.2323 0.5556  -0.2633 -0.3079 28  ILE C CB  
1755 C CG1 . ILE C 15  ? 1.4612 2.5822 1.3014 0.5099  -0.2935 -0.3173 28  ILE C CG1 
1756 C CG2 . ILE C 15  ? 1.4077 2.3353 1.1311 0.5373  -0.2369 -0.3147 28  ILE C CG2 
1757 C CD1 . ILE C 15  ? 1.3765 2.5323 1.2750 0.4877  -0.2757 -0.3132 28  ILE C CD1 
1758 N N   . SER C 16  ? 1.5740 2.3645 1.1722 0.5480  -0.2600 -0.3238 29  SER C N   
1759 C CA  . SER C 16  ? 1.4580 2.1392 1.0092 0.5461  -0.2315 -0.3136 29  SER C CA  
1760 C C   . SER C 16  ? 1.3324 1.9846 0.9071 0.5073  -0.2167 -0.3239 29  SER C C   
1761 O O   . SER C 16  ? 1.3130 1.9781 0.9002 0.4729  -0.2342 -0.3492 29  SER C O   
1762 C CB  . SER C 16  ? 1.5101 2.1365 1.0043 0.5406  -0.2436 -0.3196 29  SER C CB  
1763 O OG  . SER C 16  ? 1.5440 2.0755 1.0015 0.5315  -0.2156 -0.3067 29  SER C OG  
1764 N N   . LEU C 17  ? 1.2472 1.8546 0.8259 0.5108  -0.1869 -0.3036 30  LEU C N   
1765 C CA  . LEU C 17  ? 1.0903 1.6752 0.6954 0.4765  -0.1726 -0.3104 30  LEU C CA  
1766 C C   . LEU C 17  ? 1.1291 1.6372 0.7072 0.4473  -0.1633 -0.3176 30  LEU C C   
1767 O O   . LEU C 17  ? 1.2724 1.7143 0.8138 0.4522  -0.1472 -0.2982 30  LEU C O   
1768 C CB  . LEU C 17  ? 1.0994 1.6591 0.7160 0.4855  -0.1474 -0.2835 30  LEU C CB  
1769 C CG  . LEU C 17  ? 1.0610 1.7015 0.7198 0.4953  -0.1492 -0.2862 30  LEU C CG  
1770 C CD1 . LEU C 17  ? 1.0035 1.5952 0.6659 0.4902  -0.1237 -0.2623 30  LEU C CD1 
1771 C CD2 . LEU C 17  ? 0.9942 1.7028 0.6925 0.4632  -0.1691 -0.3191 30  LEU C CD2 
1772 N N   . LEU C 18  ? 1.1382 1.6572 0.7341 0.4164  -0.1732 -0.3458 31  LEU C N   
1773 C CA  . LEU C 18  ? 1.2044 1.6535 0.7764 0.3921  -0.1610 -0.3554 31  LEU C CA  
1774 C C   . LEU C 18  ? 1.2193 1.6358 0.8186 0.3745  -0.1359 -0.3470 31  LEU C C   
1775 O O   . LEU C 18  ? 1.1311 1.5874 0.7713 0.3664  -0.1385 -0.3527 31  LEU C O   
1776 C CB  . LEU C 18  ? 1.2116 1.6748 0.7783 0.3688  -0.1875 -0.3922 31  LEU C CB  
1777 C CG  . LEU C 18  ? 1.2056 1.7012 0.7442 0.3795  -0.2191 -0.4018 31  LEU C CG  
1778 C CD1 . LEU C 18  ? 1.1718 1.6621 0.6972 0.3479  -0.2478 -0.4366 31  LEU C CD1 
1779 C CD2 . LEU C 18  ? 1.1898 1.6336 0.6724 0.4029  -0.2053 -0.3816 31  LEU C CD2 
1780 N N   . PRO C 19  ? 1.3193 1.6674 0.8957 0.3681  -0.1117 -0.3327 32  PRO C N   
1781 C CA  . PRO C 19  ? 1.2888 1.6043 0.8894 0.3515  -0.0893 -0.3233 32  PRO C CA  
1782 C C   . PRO C 19  ? 1.2198 1.5357 0.8427 0.3283  -0.0940 -0.3552 32  PRO C C   
1783 O O   . PRO C 19  ? 1.2376 1.5544 0.8422 0.3217  -0.1102 -0.3829 32  PRO C O   
1784 C CB  . PRO C 19  ? 1.2531 1.5090 0.8203 0.3518  -0.0667 -0.3048 32  PRO C CB  
1785 C CG  . PRO C 19  ? 1.1501 1.3996 0.6746 0.3595  -0.0765 -0.3192 32  PRO C CG  
1786 C CD  . PRO C 19  ? 1.2695 1.5729 0.7956 0.3754  -0.1044 -0.3258 32  PRO C CD  
1787 N N   . PRO C 20  ? 1.1478 1.4560 0.8051 0.3151  -0.0818 -0.3522 33  PRO C N   
1788 C CA  . PRO C 20  ? 1.0414 1.3397 0.7190 0.2932  -0.0860 -0.3833 33  PRO C CA  
1789 C C   . PRO C 20  ? 1.1116 1.3491 0.7618 0.2900  -0.0710 -0.3916 33  PRO C C   
1790 O O   . PRO C 20  ? 1.1156 1.3247 0.7400 0.3018  -0.0524 -0.3693 33  PRO C O   
1791 C CB  . PRO C 20  ? 1.0467 1.3428 0.7618 0.2850  -0.0720 -0.3706 33  PRO C CB  
1792 C CG  . PRO C 20  ? 1.0511 1.3272 0.7528 0.2994  -0.0541 -0.3304 33  PRO C CG  
1793 C CD  . PRO C 20  ? 1.0893 1.3888 0.7625 0.3186  -0.0655 -0.3209 33  PRO C CD  
1794 N N   . VAL C 21  ? 1.1345 1.3511 0.7881 0.2737  -0.0789 -0.4242 34  VAL C N   
1795 C CA  . VAL C 21  ? 1.1946 1.3502 0.8185 0.2748  -0.0621 -0.4347 34  VAL C CA  
1796 C C   . VAL C 21  ? 1.2076 1.3279 0.8626 0.2643  -0.0495 -0.4450 34  VAL C C   
1797 O O   . VAL C 21  ? 1.0207 1.1626 0.7179 0.2522  -0.0573 -0.4472 34  VAL C O   
1798 C CB  . VAL C 21  ? 1.2962 1.4366 0.8760 0.2686  -0.0840 -0.4667 34  VAL C CB  
1799 C CG1 . VAL C 21  ? 1.3252 1.4899 0.8677 0.2836  -0.0931 -0.4545 34  VAL C CG1 
1800 C CG2 . VAL C 21  ? 1.2469 1.4121 0.8503 0.2428  -0.1187 -0.4984 34  VAL C CG2 
1801 N N   . ASN C 22  ? 1.2380 1.3038 0.8711 0.2710  -0.0287 -0.4516 35  ASN C N   
1802 C CA  . ASN C 22  ? 1.1879 1.2126 0.8482 0.2674  -0.0151 -0.4611 35  ASN C CA  
1803 C C   . ASN C 22  ? 1.1584 1.2019 0.8704 0.2689  -0.0026 -0.4342 35  ASN C C   
1804 O O   . ASN C 22  ? 1.1286 1.1614 0.8772 0.2574  -0.0089 -0.4451 35  ASN C O   
1805 C CB  . ASN C 22  ? 1.2428 1.2459 0.9058 0.2445  -0.0429 -0.5000 35  ASN C CB  
1806 C CG  . ASN C 22  ? 1.5701 1.5364 1.1734 0.2405  -0.0562 -0.5286 35  ASN C CG  
1807 O OD1 . ASN C 22  ? 1.7242 1.6521 1.2862 0.2585  -0.0327 -0.5264 35  ASN C OD1 
1808 N ND2 . ASN C 22  ? 1.6256 1.6050 1.2238 0.2143  -0.0945 -0.5557 35  ASN C ND2 
1809 N N   . PHE C 23  ? 1.1186 1.1842 0.8297 0.2807  0.0128  -0.3999 36  PHE C N   
1810 C CA  . PHE C 23  ? 1.0643 1.1430 0.8138 0.2810  0.0219  -0.3727 36  PHE C CA  
1811 C C   . PHE C 23  ? 1.1556 1.2026 0.9305 0.2910  0.0464  -0.3654 36  PHE C C   
1812 O O   . PHE C 23  ? 1.1707 1.2085 0.9316 0.3050  0.0690  -0.3530 36  PHE C O   
1813 C CB  . PHE C 23  ? 0.9736 1.0786 0.7063 0.2873  0.0252  -0.3400 36  PHE C CB  
1814 C CG  . PHE C 23  ? 1.0016 1.1110 0.7605 0.2868  0.0323  -0.3126 36  PHE C CG  
1815 C CD1 . PHE C 23  ? 1.0271 1.1406 0.8194 0.2771  0.0231  -0.3178 36  PHE C CD1 
1816 C CD2 . PHE C 23  ? 0.9908 1.0974 0.7360 0.2952  0.0469  -0.2835 36  PHE C CD2 
1817 C CE1 . PHE C 23  ? 0.9991 1.1099 0.8064 0.2779  0.0280  -0.2936 36  PHE C CE1 
1818 C CE2 . PHE C 23  ? 0.9316 1.0368 0.6920 0.2948  0.0500  -0.2605 36  PHE C CE2 
1819 C CZ  . PHE C 23  ? 0.9285 1.0338 0.7177 0.2870  0.0402  -0.2652 36  PHE C CZ  
1820 N N   . THR C 24  ? 1.2107 1.2438 1.0266 0.2849  0.0419  -0.3731 37  THR C N   
1821 C CA  . THR C 24  ? 1.1683 1.1732 1.0181 0.2981  0.0617  -0.3660 37  THR C CA  
1822 C C   . THR C 24  ? 1.0813 1.0991 0.9764 0.2928  0.0616  -0.3329 37  THR C C   
1823 O O   . THR C 24  ? 1.1247 1.1597 1.0252 0.2722  0.0446  -0.3188 37  THR C O   
1824 C CB  . THR C 24  ? 1.2396 1.1975 1.1018 0.2943  0.0547  -0.3977 37  THR C CB  
1825 O OG1 . THR C 24  ? 1.3412 1.2940 1.2485 0.2665  0.0370  -0.3839 37  THR C OG1 
1826 C CG2 . THR C 24  ? 1.0695 1.0129 0.8846 0.2827  0.0387  -0.4307 37  THR C CG2 
1827 N N   . ILE C 25  ? 1.0916 1.1008 1.0204 0.3064  0.0803  -0.3120 38  ILE C N   
1828 C CA  . ILE C 25  ? 1.0364 1.0474 1.0148 0.2919  0.0749  -0.2729 38  ILE C CA  
1829 C C   . ILE C 25  ? 1.1361 1.1201 1.1625 0.3023  0.0844  -0.2691 38  ILE C C   
1830 O O   . ILE C 25  ? 1.2725 1.2613 1.3072 0.3305  0.1092  -0.2690 38  ILE C O   
1831 C CB  . ILE C 25  ? 0.9574 0.9975 0.9345 0.2975  0.0850  -0.2380 38  ILE C CB  
1832 C CG1 . ILE C 25  ? 0.9427 1.0019 0.8632 0.2952  0.0785  -0.2417 38  ILE C CG1 
1833 C CG2 . ILE C 25  ? 0.8559 0.8920 0.8774 0.2776  0.0723  -0.1984 38  ILE C CG2 
1834 C CD1 . ILE C 25  ? 0.9370 1.0124 0.8452 0.2979  0.0866  -0.2083 38  ILE C CD1 
1835 N N   . LYS C 26  ? 1.0399 0.9954 1.0967 0.2821  0.0667  -0.2645 39  LYS C N   
1836 C CA  . LYS C 26  ? 1.0080 0.9334 1.1110 0.2939  0.0727  -0.2566 39  LYS C CA  
1837 C C   . LYS C 26  ? 1.0063 0.9304 1.1559 0.2742  0.0563  -0.2154 39  LYS C C   
1838 O O   . LYS C 26  ? 0.9238 0.8456 1.0628 0.2446  0.0359  -0.2050 39  LYS C O   
1839 C CB  . LYS C 26  ? 0.9847 0.8567 1.0739 0.2925  0.0666  -0.2932 39  LYS C CB  
1840 C CG  . LYS C 26  ? 1.1824 1.0376 1.2604 0.2534  0.0393  -0.3013 39  LYS C CG  
1841 C CD  . LYS C 26  ? 1.2905 1.0826 1.3634 0.2475  0.0312  -0.3295 39  LYS C CD  
1842 C CE  . LYS C 26  ? 1.3396 1.1219 1.4043 0.2041  0.0055  -0.3365 39  LYS C CE  
1843 N NZ  . LYS C 26  ? 1.3596 1.0705 1.4235 0.1917  -0.0053 -0.3555 39  LYS C NZ  
1844 N N   . VAL C 27  ? 1.0161 0.9434 1.2158 0.2926  0.0657  -0.1909 40  VAL C N   
1845 C CA  . VAL C 27  ? 0.9807 0.9024 1.2259 0.2760  0.0465  -0.1511 40  VAL C CA  
1846 C C   . VAL C 27  ? 1.0138 0.8792 1.2657 0.2626  0.0296  -0.1610 40  VAL C C   
1847 O O   . VAL C 27  ? 0.9813 0.8120 1.2399 0.2835  0.0394  -0.1833 40  VAL C O   
1848 C CB  . VAL C 27  ? 0.9496 0.8999 1.2558 0.3019  0.0602  -0.1206 40  VAL C CB  
1849 C CG1 . VAL C 27  ? 0.8838 0.8336 1.2338 0.2807  0.0336  -0.0755 40  VAL C CG1 
1850 C CG2 . VAL C 27  ? 0.9572 0.9615 1.2553 0.3153  0.0822  -0.1133 40  VAL C CG2 
1851 N N   . THR C 28  ? 0.9742 0.8246 1.2173 0.2282  0.0055  -0.1443 41  THR C N   
1852 C CA  . THR C 28  ? 1.0076 0.8038 1.2518 0.2091  -0.0108 -0.1499 41  THR C CA  
1853 C C   . THR C 28  ? 0.9822 0.7565 1.2662 0.2019  -0.0288 -0.1094 41  THR C C   
1854 O O   . THR C 28  ? 0.9918 0.7147 1.2802 0.1895  -0.0422 -0.1079 41  THR C O   
1855 C CB  . THR C 28  ? 0.9456 0.7384 1.1475 0.1742  -0.0226 -0.1623 41  THR C CB  
1856 O OG1 . THR C 28  ? 0.9035 0.7204 1.0937 0.1567  -0.0322 -0.1322 41  THR C OG1 
1857 C CG2 . THR C 28  ? 0.8636 0.6801 1.0294 0.1809  -0.0102 -0.2013 41  THR C CG2 
1858 N N   . GLY C 29  ? 0.9778 0.7893 1.2886 0.2077  -0.0316 -0.0752 42  GLY C N   
1859 C CA  . GLY C 29  ? 0.9752 0.7733 1.3257 0.2011  -0.0532 -0.0334 42  GLY C CA  
1860 C C   . GLY C 29  ? 0.9458 0.7936 1.3192 0.2006  -0.0584 0.0021  42  GLY C C   
1861 O O   . GLY C 29  ? 0.8788 0.7689 1.2383 0.2083  -0.0414 -0.0062 42  GLY C O   
1862 N N   . LEU C 30  ? 0.8862 0.7262 1.2923 0.1894  -0.0843 0.0432  43  LEU C N   
1863 C CA  . LEU C 30  ? 0.8663 0.7488 1.2948 0.1807  -0.0970 0.0814  43  LEU C CA  
1864 C C   . LEU C 30  ? 0.9331 0.8153 1.2931 0.1528  -0.1022 0.0789  43  LEU C C   
1865 O O   . LEU C 30  ? 1.0847 0.9236 1.3924 0.1273  -0.1179 0.0777  43  LEU C O   
1866 C CB  . LEU C 30  ? 0.8928 0.7578 1.3581 0.1669  -0.1326 0.1258  43  LEU C CB  
1867 C CG  . LEU C 30  ? 0.9990 0.8716 1.5430 0.1983  -0.1331 0.1410  43  LEU C CG  
1868 C CD1 . LEU C 30  ? 0.9140 0.7903 1.4981 0.1819  -0.1732 0.1934  43  LEU C CD1 
1869 C CD2 . LEU C 30  ? 1.1039 1.0390 1.7008 0.2383  -0.0977 0.1314  43  LEU C CD2 
1870 N N   . ALA C 31  ? 0.8807 0.8086 1.2385 0.1600  -0.0867 0.0790  44  ALA C N   
1871 C CA  . ALA C 31  ? 0.9372 0.8620 1.2271 0.1397  -0.0896 0.0769  44  ALA C CA  
1872 C C   . ALA C 31  ? 0.9752 0.8709 1.2007 0.1356  -0.0802 0.0398  44  ALA C C   
1873 O O   . ALA C 31  ? 1.0332 0.9018 1.2000 0.1143  -0.0927 0.0442  44  ALA C O   
1874 C CB  . ALA C 31  ? 0.8529 0.7541 1.1239 0.1071  -0.1252 0.1175  44  ALA C CB  
1875 N N   . GLN C 32  ? 0.8961 0.7979 1.1322 0.1565  -0.0582 0.0040  45  GLN C N   
1876 C CA  . GLN C 32  ? 0.8692 0.7515 1.0585 0.1499  -0.0523 -0.0293 45  GLN C CA  
1877 C C   . GLN C 32  ? 0.8864 0.7908 1.0743 0.1744  -0.0269 -0.0696 45  GLN C C   
1878 O O   . GLN C 32  ? 1.0078 0.9073 1.2319 0.1937  -0.0166 -0.0825 45  GLN C O   
1879 C CB  . GLN C 32  ? 0.8415 0.6786 1.0386 0.1335  -0.0673 -0.0266 45  GLN C CB  
1880 C CG  . GLN C 32  ? 0.8208 0.6424 0.9735 0.1168  -0.0651 -0.0503 45  GLN C CG  
1881 C CD  . GLN C 32  ? 1.0643 0.8389 1.2218 0.0956  -0.0796 -0.0409 45  GLN C CD  
1882 O OE1 . GLN C 32  ? 1.1746 0.9291 1.2959 0.0725  -0.0892 -0.0265 45  GLN C OE1 
1883 N NE2 . GLN C 32  ? 1.0384 0.7899 1.2350 0.1049  -0.0795 -0.0485 45  GLN C NE2 
1884 N N   . VAL C 33  ? 0.7743 0.6980 0.9147 0.1753  -0.0179 -0.0892 46  VAL C N   
1885 C CA  . VAL C 33  ? 0.8909 0.8323 1.0174 0.1952  0.0012  -0.1281 46  VAL C CA  
1886 C C   . VAL C 33  ? 0.8669 0.8045 0.9560 0.1817  -0.0033 -0.1551 46  VAL C C   
1887 O O   . VAL C 33  ? 0.8097 0.7437 0.8746 0.1626  -0.0143 -0.1427 46  VAL C O   
1888 C CB  . VAL C 33  ? 0.7723 0.7498 0.8779 0.2136  0.0173  -0.1280 46  VAL C CB  
1889 C CG1 . VAL C 33  ? 0.7206 0.7143 0.8713 0.2240  0.0237  -0.0976 46  VAL C CG1 
1890 C CG2 . VAL C 33  ? 0.7212 0.7049 0.7747 0.2008  0.0090  -0.1186 46  VAL C CG2 
1891 N N   . LEU C 34  ? 0.7890 0.7281 0.8729 0.1920  0.0051  -0.1913 47  LEU C N   
1892 C CA  . LEU C 34  ? 0.8544 0.8038 0.9095 0.1788  -0.0007 -0.2171 47  LEU C CA  
1893 C C   . LEU C 34  ? 0.8626 0.8443 0.8825 0.1988  0.0096  -0.2418 47  LEU C C   
1894 O O   . LEU C 34  ? 0.8903 0.8667 0.9078 0.2189  0.0211  -0.2631 47  LEU C O   
1895 C CB  . LEU C 34  ? 0.8991 0.8158 0.9711 0.1647  -0.0079 -0.2393 47  LEU C CB  
1896 C CG  . LEU C 34  ? 0.9144 0.8494 0.9663 0.1453  -0.0168 -0.2644 47  LEU C CG  
1897 C CD1 . LEU C 34  ? 0.7227 0.6797 0.7695 0.1236  -0.0237 -0.2419 47  LEU C CD1 
1898 C CD2 . LEU C 34  ? 0.8832 0.7780 0.9472 0.1286  -0.0256 -0.2881 47  LEU C CD2 
1899 N N   . LEU C 35  ? 0.8813 0.8927 0.8687 0.1964  0.0061  -0.2384 48  LEU C N   
1900 C CA  . LEU C 35  ? 0.8129 0.8541 0.7625 0.2144  0.0114  -0.2611 48  LEU C CA  
1901 C C   . LEU C 35  ? 0.8391 0.8908 0.7855 0.2024  0.0001  -0.2936 48  LEU C C   
1902 O O   . LEU C 35  ? 0.8053 0.8640 0.7669 0.1788  -0.0113 -0.2898 48  LEU C O   
1903 C CB  . LEU C 35  ? 0.8195 0.8840 0.7330 0.2205  0.0109  -0.2428 48  LEU C CB  
1904 C CG  . LEU C 35  ? 0.9145 0.9632 0.8236 0.2227  0.0152  -0.2068 48  LEU C CG  
1905 C CD1 . LEU C 35  ? 0.8501 0.9111 0.7069 0.2337  0.0152  -0.1970 48  LEU C CD1 
1906 C CD2 . LEU C 35  ? 1.1006 1.1430 1.0298 0.2362  0.0287  -0.2019 48  LEU C CD2 
1907 N N   . GLN C 36  ? 0.7534 0.8054 0.6783 0.2168  0.0030  -0.3243 49  GLN C N   
1908 C CA  . GLN C 36  ? 0.9123 0.9718 0.8296 0.2022  -0.0130 -0.3564 49  GLN C CA  
1909 C C   . GLN C 36  ? 0.9070 0.9930 0.7771 0.2217  -0.0150 -0.3798 49  GLN C C   
1910 O O   . GLN C 36  ? 0.9237 0.9974 0.7646 0.2481  0.0007  -0.3849 49  GLN C O   
1911 C CB  . GLN C 36  ? 1.0693 1.0767 1.0020 0.1928  -0.0153 -0.3770 49  GLN C CB  
1912 C CG  . GLN C 36  ? 1.0980 1.0803 1.0729 0.1632  -0.0239 -0.3610 49  GLN C CG  
1913 C CD  . GLN C 36  ? 1.1420 1.0604 1.1251 0.1596  -0.0252 -0.3796 49  GLN C CD  
1914 O OE1 . GLN C 36  ? 1.1673 1.0555 1.1431 0.1883  -0.0090 -0.3852 49  GLN C OE1 
1915 N NE2 . GLN C 36  ? 1.2801 1.1763 1.2771 0.1251  -0.0430 -0.3881 49  GLN C NE2 
1916 N N   . TRP C 37  ? 0.8304 0.9562 0.6943 0.2087  -0.0341 -0.3915 50  TRP C N   
1917 C CA  . TRP C 37  ? 0.9111 1.0631 0.7298 0.2245  -0.0432 -0.4144 50  TRP C CA  
1918 C C   . TRP C 37  ? 0.9240 1.1043 0.7550 0.1970  -0.0717 -0.4361 50  TRP C C   
1919 O O   . TRP C 37  ? 0.8498 1.0350 0.7254 0.1660  -0.0804 -0.4290 50  TRP C O   
1920 C CB  . TRP C 37  ? 0.9832 1.1736 0.7768 0.2473  -0.0371 -0.3920 50  TRP C CB  
1921 C CG  . TRP C 37  ? 0.8966 1.1276 0.7172 0.2366  -0.0435 -0.3698 50  TRP C CG  
1922 C CD1 . TRP C 37  ? 0.8730 1.1607 0.7004 0.2316  -0.0610 -0.3741 50  TRP C CD1 
1923 C CD2 . TRP C 37  ? 0.9097 1.1277 0.7529 0.2309  -0.0315 -0.3378 50  TRP C CD2 
1924 N NE1 . TRP C 37  ? 0.8233 1.1342 0.6754 0.2266  -0.0557 -0.3470 50  TRP C NE1 
1925 C CE2 . TRP C 37  ? 0.8780 1.1411 0.7340 0.2251  -0.0386 -0.3255 50  TRP C CE2 
1926 C CE3 . TRP C 37  ? 0.8786 1.0524 0.7318 0.2305  -0.0166 -0.3172 50  TRP C CE3 
1927 C CZ2 . TRP C 37  ? 0.7983 1.0536 0.6654 0.2199  -0.0293 -0.2959 50  TRP C CZ2 
1928 C CZ3 . TRP C 37  ? 0.8184 0.9856 0.6849 0.2215  -0.0131 -0.2873 50  TRP C CZ3 
1929 C CH2 . TRP C 37  ? 0.8040 1.0067 0.6717 0.2168  -0.0184 -0.2781 50  TRP C CH2 
1930 N N   . LYS C 38  ? 0.9404 1.1393 0.7313 0.2057  -0.0875 -0.4608 51  LYS C N   
1931 C CA  . LYS C 38  ? 1.1140 1.3499 0.9181 0.1774  -0.1200 -0.4795 51  LYS C CA  
1932 C C   . LYS C 38  ? 1.1409 1.4419 0.9206 0.1962  -0.1346 -0.4787 51  LYS C C   
1933 O O   . LYS C 38  ? 1.2178 1.5063 0.9519 0.2271  -0.1224 -0.4715 51  LYS C O   
1934 C CB  . LYS C 38  ? 1.1746 1.3537 0.9494 0.1616  -0.1359 -0.5177 51  LYS C CB  
1935 C CG  . LYS C 38  ? 1.2297 1.3615 1.0429 0.1261  -0.1396 -0.5214 51  LYS C CG  
1936 C CD  . LYS C 38  ? 1.3900 1.4602 1.2085 0.1442  -0.1078 -0.5087 51  LYS C CD  
1937 C CE  . LYS C 38  ? 1.5138 1.5356 1.3699 0.1105  -0.1133 -0.5082 51  LYS C CE  
1938 N NZ  . LYS C 38  ? 1.5512 1.5179 1.4183 0.1303  -0.0856 -0.4930 51  LYS C NZ  
1939 N N   . PRO C 39  ? 1.0227 1.3928 0.8423 0.1748  -0.1582 -0.4741 52  PRO C N   
1940 C CA  . PRO C 39  ? 1.0397 1.4790 0.8430 0.1949  -0.1756 -0.4718 52  PRO C CA  
1941 C C   . PRO C 39  ? 1.0626 1.4809 0.8025 0.2042  -0.1971 -0.5037 52  PRO C C   
1942 O O   . PRO C 39  ? 1.1571 1.5352 0.8865 0.1771  -0.2146 -0.5314 52  PRO C O   
1943 C CB  . PRO C 39  ? 1.0287 1.5451 0.9002 0.1611  -0.1988 -0.4644 52  PRO C CB  
1944 C CG  . PRO C 39  ? 0.9945 1.4660 0.8975 0.1158  -0.2038 -0.4762 52  PRO C CG  
1945 C CD  . PRO C 39  ? 0.9394 1.3290 0.8226 0.1301  -0.1705 -0.4698 52  PRO C CD  
1946 N N   . ASN C 40  ? 1.0446 1.4715 0.7516 0.2367  -0.1896 -0.4825 53  ASN C N   
1947 C CA  . ASN C 40  ? 1.2756 1.6737 0.9312 0.2421  -0.2029 -0.4922 53  ASN C CA  
1948 C C   . ASN C 40  ? 1.3694 1.8157 1.0366 0.2133  -0.2499 -0.5180 53  ASN C C   
1949 O O   . ASN C 40  ? 1.3663 1.9011 1.0700 0.2141  -0.2722 -0.5098 53  ASN C O   
1950 C CB  . ASN C 40  ? 1.2693 1.6768 0.8957 0.2789  -0.1901 -0.4623 53  ASN C CB  
1951 C CG  . ASN C 40  ? 1.3478 1.7025 0.9106 0.2868  -0.1908 -0.4674 53  ASN C CG  
1952 O OD1 . ASN C 40  ? 1.4201 1.7568 0.9567 0.2675  -0.2149 -0.4955 53  ASN C OD1 
1953 N ND2 . ASN C 40  ? 1.3529 1.6786 0.8869 0.3119  -0.1653 -0.4395 53  ASN C ND2 
1954 N N   . PRO C 41  ? 1.3785 1.7658 1.0162 0.1862  -0.2657 -0.5463 54  PRO C N   
1955 C CA  . PRO C 41  ? 1.4665 1.8868 1.1139 0.1486  -0.3148 -0.5680 54  PRO C CA  
1956 C C   . PRO C 41  ? 1.5821 2.0415 1.1989 0.1654  -0.3382 -0.5601 54  PRO C C   
1957 O O   . PRO C 41  ? 1.5307 2.0491 1.1731 0.1384  -0.3816 -0.5663 54  PRO C O   
1958 C CB  . PRO C 41  ? 1.4429 1.7587 1.0403 0.1249  -0.3171 -0.5968 54  PRO C CB  
1959 C CG  . PRO C 41  ? 1.4104 1.6517 0.9556 0.1632  -0.2704 -0.5864 54  PRO C CG  
1960 C CD  . PRO C 41  ? 1.3940 1.6780 0.9849 0.1898  -0.2382 -0.5560 54  PRO C CD  
1961 N N   . ASP C 42  ? 1.7211 2.1487 1.2884 0.2066  -0.3104 -0.5429 55  ASP C N   
1962 C CA  . ASP C 42  ? 1.8351 2.2897 1.3677 0.2266  -0.3293 -0.5335 55  ASP C CA  
1963 C C   . ASP C 42  ? 1.7420 2.2954 1.3270 0.2512  -0.3329 -0.5070 55  ASP C C   
1964 O O   . ASP C 42  ? 1.7077 2.2985 1.2773 0.2696  -0.3521 -0.4968 55  ASP C O   
1965 C CB  . ASP C 42  ? 1.9365 2.3121 1.3951 0.2560  -0.2973 -0.5240 55  ASP C CB  
1966 C CG  . ASP C 42  ? 2.0692 2.4467 1.4729 0.2663  -0.3224 -0.5239 55  ASP C CG  
1967 O OD1 . ASP C 42  ? 2.1108 2.5086 1.5075 0.2390  -0.3672 -0.5434 55  ASP C OD1 
1968 O OD2 . ASP C 42  ? 2.1242 2.4809 1.4919 0.2982  -0.2994 -0.5028 55  ASP C OD2 
1969 N N   . GLN C 43  ? 1.7254 2.3172 1.3680 0.2533  -0.3136 -0.4956 56  GLN C N   
1970 C CA  . GLN C 43  ? 1.6730 2.3576 1.3638 0.2778  -0.3138 -0.4709 56  GLN C CA  
1971 C C   . GLN C 43  ? 1.7319 2.5165 1.4807 0.2511  -0.3595 -0.4756 56  GLN C C   
1972 O O   . GLN C 43  ? 1.5966 2.3957 1.3853 0.2039  -0.3814 -0.4929 56  GLN C O   
1973 C CB  . GLN C 43  ? 1.5507 2.2443 1.2804 0.2828  -0.2821 -0.4582 56  GLN C CB  
1974 C CG  . GLN C 43  ? 1.4906 2.2565 1.2487 0.3189  -0.2714 -0.4291 56  GLN C CG  
1975 C CD  . GLN C 43  ? 1.4889 2.2000 1.1930 0.3640  -0.2429 -0.4048 56  GLN C CD  
1976 O OE1 . GLN C 43  ? 1.3892 2.0320 1.0743 0.3715  -0.2091 -0.3908 56  GLN C OE1 
1977 N NE2 . GLN C 43  ? 1.5555 2.2946 1.2399 0.3900  -0.2588 -0.3962 56  GLN C NE2 
1978 N N   . GLU C 44  ? 1.9381 2.7885 1.6951 0.2798  -0.3731 -0.4565 57  GLU C N   
1979 C CA  . GLU C 44  ? 2.0841 3.0388 1.9035 0.2591  -0.4154 -0.4512 57  GLU C CA  
1980 C C   . GLU C 44  ? 2.1126 3.1434 2.0275 0.2175  -0.4233 -0.4490 57  GLU C C   
1981 O O   . GLU C 44  ? 2.0423 3.0895 1.9893 0.2286  -0.3915 -0.4376 57  GLU C O   
1982 C CB  . GLU C 44  ? 2.0492 3.0712 1.8779 0.3087  -0.4134 -0.4226 57  GLU C CB  
1983 C CG  . GLU C 44  ? 2.0055 2.9840 1.7933 0.3631  -0.3668 -0.4047 57  GLU C CG  
1984 C CD  . GLU C 44  ? 2.0701 2.9393 1.7642 0.3839  -0.3522 -0.4098 57  GLU C CD  
1985 O OE1 . GLU C 44  ? 2.1066 2.9707 1.7667 0.4252  -0.3461 -0.3922 57  GLU C OE1 
1986 O OE2 . GLU C 44  ? 2.0666 2.8543 1.7239 0.3587  -0.3446 -0.4290 57  GLU C OE2 
1987 N N   . GLN C 45  ? 2.1831 3.2555 2.1406 0.1667  -0.4662 -0.4575 58  GLN C N   
1988 C CA  . GLN C 45  ? 2.1153 3.2455 2.1628 0.1126  -0.4764 -0.4558 58  GLN C CA  
1989 C C   . GLN C 45  ? 1.9857 3.2061 2.1138 0.1310  -0.4437 -0.4258 58  GLN C C   
1990 O O   . GLN C 45  ? 1.9315 3.2416 2.1009 0.1640  -0.4393 -0.3967 58  GLN C O   
1991 C CB  . GLN C 45  ? 2.1471 3.3369 2.2423 0.0620  -0.5294 -0.4543 58  GLN C CB  
1992 C CG  . GLN C 45  ? 2.2294 3.3166 2.2595 0.0151  -0.5633 -0.4887 58  GLN C CG  
1993 C CD  . GLN C 45  ? 2.3167 3.4585 2.4064 -0.0504 -0.6167 -0.4849 58  GLN C CD  
1994 O OE1 . GLN C 45  ? 2.3008 3.5204 2.4885 -0.0879 -0.6178 -0.4670 58  GLN C OE1 
1995 N NE2 . GLN C 45  ? 2.4013 3.5002 2.4304 -0.0666 -0.6614 -0.4989 58  GLN C NE2 
1996 N N   . ARG C 46  ? 1.9306 3.1193 2.0758 0.1106  -0.4195 -0.4327 59  ARG C N   
1997 C CA  . ARG C 46  ? 1.8359 3.0637 2.0313 0.1313  -0.3747 -0.4018 59  ARG C CA  
1998 C C   . ARG C 46  ? 1.8217 3.1985 2.1243 0.1233  -0.3812 -0.3707 59  ARG C C   
1999 O O   . ARG C 46  ? 1.8598 3.2828 2.2377 0.0664  -0.3911 -0.3650 59  ARG C O   
2000 C CB  . ARG C 46  ? 1.7551 2.8932 1.9520 0.0947  -0.3451 -0.4061 59  ARG C CB  
2001 C CG  . ARG C 46  ? 1.7573 2.7661 1.8737 0.0796  -0.3530 -0.4422 59  ARG C CG  
2002 C CD  . ARG C 46  ? 1.7708 2.7044 1.7974 0.1371  -0.3287 -0.4475 59  ARG C CD  
2003 N NE  . ARG C 46  ? 1.7698 2.6517 1.7914 0.1568  -0.2796 -0.4276 59  ARG C NE  
2004 C CZ  . ARG C 46  ? 1.7584 2.5430 1.7560 0.1404  -0.2593 -0.4376 59  ARG C CZ  
2005 N NH1 . ARG C 46  ? 1.8204 2.5437 1.7932 0.1078  -0.2801 -0.4686 59  ARG C NH1 
2006 N NH2 . ARG C 46  ? 1.7029 2.4486 1.6984 0.1578  -0.2199 -0.4164 59  ARG C NH2 
2007 N N   . ASN C 47  ? 1.7589 3.1940 2.0629 0.1802  -0.3688 -0.3460 60  ASN C N   
2008 C CA  . ASN C 47  ? 1.6611 3.2186 2.0574 0.1859  -0.3581 -0.3087 60  ASN C CA  
2009 C C   . ASN C 47  ? 1.5244 3.0902 1.9175 0.2408  -0.3049 -0.2832 60  ASN C C   
2010 O O   . ASN C 47  ? 1.4464 3.0973 1.9073 0.2504  -0.2812 -0.2508 60  ASN C O   
2011 C CB  . ASN C 47  ? 1.7026 3.3164 2.1040 0.2067  -0.3878 -0.2977 60  ASN C CB  
2012 C CG  . ASN C 47  ? 1.7675 3.3642 2.1626 0.1530  -0.4437 -0.3212 60  ASN C CG  
2013 O OD1 . ASN C 47  ? 1.7691 3.3349 2.1805 0.0912  -0.4604 -0.3395 60  ASN C OD1 
2014 N ND2 . ASN C 47  ? 1.8267 3.4347 2.1919 0.1757  -0.4737 -0.3203 60  ASN C ND2 
2015 N N   . VAL C 48  ? 1.4821 2.9465 1.7888 0.2757  -0.2843 -0.2964 61  VAL C N   
2016 C CA  . VAL C 48  ? 1.3683 2.7974 1.6479 0.3221  -0.2324 -0.2732 61  VAL C CA  
2017 C C   . VAL C 48  ? 1.1854 2.4821 1.4139 0.2984  -0.2041 -0.2833 61  VAL C C   
2018 O O   . VAL C 48  ? 1.1699 2.3784 1.3451 0.2786  -0.2195 -0.3101 61  VAL C O   
2019 C CB  . VAL C 48  ? 1.3596 2.7692 1.5669 0.3962  -0.2267 -0.2661 61  VAL C CB  
2020 C CG1 . VAL C 48  ? 1.3254 2.6326 1.4374 0.4028  -0.2467 -0.2944 61  VAL C CG1 
2021 C CG2 . VAL C 48  ? 1.3157 2.6920 1.4937 0.4438  -0.1771 -0.2418 61  VAL C CG2 
2022 N N   . ASN C 49  ? 1.0331 2.3181 1.2780 0.3015  -0.1628 -0.2609 62  ASN C N   
2023 C CA  . ASN C 49  ? 1.1109 2.2822 1.3195 0.2758  -0.1387 -0.2657 62  ASN C CA  
2024 C C   . ASN C 49  ? 1.1487 2.2054 1.2580 0.3140  -0.1242 -0.2723 62  ASN C C   
2025 O O   . ASN C 49  ? 1.1612 2.2030 1.2295 0.3633  -0.1003 -0.2543 62  ASN C O   
2026 C CB  . ASN C 49  ? 1.0774 2.2709 1.3278 0.2669  -0.1012 -0.2378 62  ASN C CB  
2027 C CG  . ASN C 49  ? 1.0712 2.3779 1.4246 0.2216  -0.1117 -0.2275 62  ASN C CG  
2028 O OD1 . ASN C 49  ? 1.0889 2.4788 1.4888 0.2066  -0.1482 -0.2364 62  ASN C OD1 
2029 N ND2 . ASN C 49  ? 1.0080 2.3181 1.3961 0.1968  -0.0813 -0.2070 62  ASN C ND2 
2030 N N   . LEU C 50  ? 1.0526 2.0271 1.1223 0.2907  -0.1382 -0.2972 63  LEU C N   
2031 C CA  . LEU C 50  ? 0.9785 1.8497 0.9630 0.3192  -0.1243 -0.3017 63  LEU C CA  
2032 C C   . LEU C 50  ? 0.9838 1.7743 0.9566 0.3032  -0.0946 -0.2904 63  LEU C C   
2033 O O   . LEU C 50  ? 1.0060 1.7965 1.0268 0.2603  -0.0918 -0.2900 63  LEU C O   
2034 C CB  . LEU C 50  ? 0.9349 1.7605 0.8799 0.3078  -0.1495 -0.3321 63  LEU C CB  
2035 C CG  . LEU C 50  ? 0.9721 1.8550 0.9031 0.3278  -0.1828 -0.3451 63  LEU C CG  
2036 C CD1 . LEU C 50  ? 0.9807 1.7956 0.8519 0.3203  -0.1998 -0.3747 63  LEU C CD1 
2037 C CD2 . LEU C 50  ? 0.9684 1.8750 0.8629 0.3869  -0.1731 -0.3246 63  LEU C CD2 
2038 N N   . GLU C 51  ? 0.8255 1.1391 0.9733 0.1940  -0.0950 -0.1986 64  GLU C N   
2039 C CA  . GLU C 51  ? 0.6970 0.9776 0.8259 0.1772  -0.0700 -0.1849 64  GLU C CA  
2040 C C   . GLU C 51  ? 0.6959 0.9313 0.7623 0.1977  -0.0644 -0.1855 64  GLU C C   
2041 O O   . GLU C 51  ? 0.7790 1.0099 0.8158 0.2231  -0.0791 -0.1957 64  GLU C O   
2042 C CB  . GLU C 51  ? 0.7327 1.0325 0.8721 0.1725  -0.0392 -0.1681 64  GLU C CB  
2043 C CG  . GLU C 51  ? 0.9376 1.2915 1.1404 0.1512  -0.0376 -0.1637 64  GLU C CG  
2044 C CD  . GLU C 51  ? 1.1190 1.4968 1.3250 0.1553  -0.0062 -0.1513 64  GLU C CD  
2045 O OE1 . GLU C 51  ? 1.1826 1.5638 1.3677 0.1858  0.0003  -0.1545 64  GLU C OE1 
2046 O OE2 . GLU C 51  ? 1.2077 1.5981 1.4336 0.1296  0.0109  -0.1386 64  GLU C OE2 
2047 N N   . TYR C 52  ? 0.7495 0.9550 0.7965 0.1866  -0.0435 -0.1732 65  TYR C N   
2048 C CA  . TYR C 52  ? 0.7823 0.9525 0.7796 0.2020  -0.0365 -0.1710 65  TYR C CA  
2049 C C   . TYR C 52  ? 0.7347 0.8861 0.7115 0.1990  -0.0084 -0.1512 65  TYR C C   
2050 O O   . TYR C 52  ? 0.8008 0.9565 0.7978 0.1805  0.0046  -0.1419 65  TYR C O   
2051 C CB  . TYR C 52  ? 0.6706 0.8175 0.6664 0.1928  -0.0499 -0.1819 65  TYR C CB  
2052 C CG  . TYR C 52  ? 0.7735 0.9303 0.7885 0.1945  -0.0832 -0.2044 65  TYR C CG  
2053 C CD1 . TYR C 52  ? 0.7291 0.8848 0.7106 0.2232  -0.1004 -0.2210 65  TYR C CD1 
2054 C CD2 . TYR C 52  ? 0.8100 0.9766 0.8754 0.1665  -0.0993 -0.2080 65  TYR C CD2 
2055 C CE1 . TYR C 52  ? 0.7666 0.9275 0.7628 0.2256  -0.1359 -0.2448 65  TYR C CE1 
2056 C CE2 . TYR C 52  ? 0.8571 1.0289 0.9440 0.1652  -0.1348 -0.2289 65  TYR C CE2 
2057 C CZ  . TYR C 52  ? 0.9130 1.0804 0.9645 0.1957  -0.1545 -0.2494 65  TYR C CZ  
2058 O OH  . TYR C 52  ? 0.9616 1.1305 1.0321 0.1951  -0.1945 -0.2731 65  TYR C OH  
2059 N N   . GLN C 53  ? 0.7790 0.9103 0.7146 0.2169  -0.0001 -0.1440 66  GLN C N   
2060 C CA  . GLN C 53  ? 0.8140 0.9231 0.7315 0.2124  0.0216  -0.1251 66  GLN C CA  
2061 C C   . GLN C 53  ? 0.7832 0.8711 0.6811 0.2105  0.0274  -0.1197 66  GLN C C   
2062 O O   . GLN C 53  ? 0.8687 0.9565 0.7403 0.2289  0.0247  -0.1215 66  GLN C O   
2063 C CB  . GLN C 53  ? 0.8902 0.9951 0.7826 0.2330  0.0272  -0.1151 66  GLN C CB  
2064 C CG  . GLN C 53  ? 0.8146 0.8899 0.6882 0.2273  0.0445  -0.0957 66  GLN C CG  
2065 C CD  . GLN C 53  ? 0.9013 0.9632 0.7493 0.2470  0.0455  -0.0843 66  GLN C CD  
2066 O OE1 . GLN C 53  ? 0.9938 1.0701 0.8356 0.2672  0.0341  -0.0899 66  GLN C OE1 
2067 N NE2 . GLN C 53  ? 0.9411 0.9721 0.7744 0.2410  0.0559  -0.0676 66  GLN C NE2 
2068 N N   . VAL C 54  ? 0.7052 0.7786 0.6154 0.1896  0.0357  -0.1127 67  VAL C N   
2069 C CA  . VAL C 54  ? 0.7384 0.7963 0.6378 0.1878  0.0416  -0.1065 67  VAL C CA  
2070 C C   . VAL C 54  ? 0.8303 0.8734 0.7117 0.1874  0.0581  -0.0850 67  VAL C C   
2071 O O   . VAL C 54  ? 0.7944 0.8260 0.6787 0.1766  0.0641  -0.0762 67  VAL C O   
2072 C CB  . VAL C 54  ? 0.7752 0.8225 0.6992 0.1656  0.0372  -0.1091 67  VAL C CB  
2073 C CG1 . VAL C 54  ? 0.7448 0.7801 0.6624 0.1673  0.0420  -0.1037 67  VAL C CG1 
2074 C CG2 . VAL C 54  ? 0.7328 0.7888 0.6787 0.1618  0.0172  -0.1280 67  VAL C CG2 
2075 N N   . LYS C 55  ? 0.8775 0.9217 0.7400 0.1994  0.0647  -0.0766 68  LYS C N   
2076 C CA  . LYS C 55  ? 0.9128 0.9439 0.7651 0.1943  0.0781  -0.0529 68  LYS C CA  
2077 C C   . LYS C 55  ? 0.8920 0.9278 0.7530 0.1897  0.0848  -0.0465 68  LYS C C   
2078 O O   . LYS C 55  ? 1.0150 1.0694 0.8690 0.2057  0.0854  -0.0548 68  LYS C O   
2079 C CB  . LYS C 55  ? 1.0705 1.1043 0.8945 0.2122  0.0824  -0.0401 68  LYS C CB  
2080 C CG  . LYS C 55  ? 1.2844 1.3007 1.1010 0.2034  0.0932  -0.0118 68  LYS C CG  
2081 C CD  . LYS C 55  ? 1.4986 1.5154 1.2853 0.2203  0.0959  0.0046  68  LYS C CD  
2082 C CE  . LYS C 55  ? 1.6563 1.6504 1.4395 0.2074  0.1032  0.0361  68  LYS C CE  
2083 N NZ  . LYS C 55  ? 1.7272 1.7183 1.4798 0.2218  0.1049  0.0573  68  LYS C NZ  
2084 N N   . ILE C 56  ? 0.8228 0.8432 0.6987 0.1701  0.0886  -0.0337 69  ILE C N   
2085 C CA  . ILE C 56  ? 0.8602 0.8890 0.7513 0.1655  0.0940  -0.0255 69  ILE C CA  
2086 C C   . ILE C 56  ? 0.8957 0.9268 0.7833 0.1617  0.1063  0.0020  69  ILE C C   
2087 O O   . ILE C 56  ? 0.9231 0.9300 0.8114 0.1458  0.1046  0.0160  69  ILE C O   
2088 C CB  . ILE C 56  ? 0.8350 0.8470 0.7489 0.1451  0.0858  -0.0287 69  ILE C CB  
2089 C CG1 . ILE C 56  ? 0.8530 0.8644 0.7744 0.1468  0.0732  -0.0515 69  ILE C CG1 
2090 C CG2 . ILE C 56  ? 0.6907 0.7123 0.6248 0.1409  0.0896  -0.0177 69  ILE C CG2 
2091 C CD1 . ILE C 56  ? 0.9136 0.9043 0.8475 0.1248  0.0648  -0.0518 69  ILE C CD1 
2092 N N   . ASN C 57  ? 0.8653 0.9259 0.7483 0.1764  0.1180  0.0098  70  ASN C N   
2093 C CA  . ASN C 57  ? 0.9523 1.0226 0.8334 0.1720  0.1316  0.0409  70  ASN C CA  
2094 C C   . ASN C 57  ? 0.9678 1.0481 0.8838 0.1542  0.1363  0.0584  70  ASN C C   
2095 O O   . ASN C 57  ? 0.9126 0.9858 0.8375 0.1374  0.1399  0.0859  70  ASN C O   
2096 C CB  . ASN C 57  ? 0.9877 1.0921 0.8436 0.1968  0.1452  0.0455  70  ASN C CB  
2097 C CG  . ASN C 57  ? 0.9799 1.0764 0.8019 0.2160  0.1364  0.0272  70  ASN C CG  
2098 O OD1 . ASN C 57  ? 0.9170 0.9908 0.7227 0.2132  0.1313  0.0366  70  ASN C OD1 
2099 N ND2 . ASN C 57  ? 0.8399 0.9536 0.6525 0.2366  0.1315  -0.0001 70  ASN C ND2 
2100 N N   . ALA C 58  ? 0.9646 1.0596 0.9029 0.1575  0.1333  0.0427  71  ALA C N   
2101 C CA  . ALA C 58  ? 0.8613 0.9730 0.8378 0.1446  0.1359  0.0572  71  ALA C CA  
2102 C C   . ALA C 58  ? 0.8870 0.9929 0.8834 0.1457  0.1224  0.0346  71  ALA C C   
2103 O O   . ALA C 58  ? 0.9518 1.0553 0.9348 0.1627  0.1166  0.0090  71  ALA C O   
2104 C CB  . ALA C 58  ? 0.8020 0.9664 0.7877 0.1588  0.1577  0.0744  71  ALA C CB  
2105 N N   . PRO C 59  ? 0.8970 0.9979 0.9258 0.1271  0.1142  0.0448  72  PRO C N   
2106 C CA  . PRO C 59  ? 0.8902 0.9915 0.9410 0.1040  0.1152  0.0738  72  PRO C CA  
2107 C C   . PRO C 59  ? 0.9738 1.0240 1.0051 0.0822  0.1015  0.0781  72  PRO C C   
2108 O O   . PRO C 59  ? 0.9663 1.0073 1.0050 0.0650  0.1005  0.1010  72  PRO C O   
2109 C CB  . PRO C 59  ? 0.7298 0.8453 0.8225 0.0977  0.1056  0.0745  72  PRO C CB  
2110 C CG  . PRO C 59  ? 0.7326 0.8236 0.8140 0.1061  0.0910  0.0465  72  PRO C CG  
2111 C CD  . PRO C 59  ? 0.7768 0.8720 0.8257 0.1291  0.0999  0.0275  72  PRO C CD  
2112 N N   . LYS C 60  ? 1.0495 1.0678 1.0572 0.0834  0.0906  0.0565  73  LYS C N   
2113 C CA  . LYS C 60  ? 1.1645 1.1390 1.1491 0.0691  0.0802  0.0563  73  LYS C CA  
2114 C C   . LYS C 60  ? 1.1370 1.1026 1.0887 0.0836  0.0852  0.0428  73  LYS C C   
2115 O O   . LYS C 60  ? 1.2225 1.1974 1.1681 0.0958  0.0854  0.0236  73  LYS C O   
2116 C CB  . LYS C 60  ? 1.3089 1.2564 1.2951 0.0551  0.0633  0.0463  73  LYS C CB  
2117 C CG  . LYS C 60  ? 1.4176 1.3433 1.4158 0.0331  0.0494  0.0616  73  LYS C CG  
2118 C CD  . LYS C 60  ? 1.4095 1.3073 1.3991 0.0217  0.0320  0.0515  73  LYS C CD  
2119 C CE  . LYS C 60  ? 1.5096 1.3793 1.5027 0.0012  0.0137  0.0632  73  LYS C CE  
2120 N NZ  . LYS C 60  ? 1.5274 1.3646 1.4937 -0.0023 0.0118  0.0656  73  LYS C NZ  
2121 N N   . GLU C 61  ? 1.1366 1.0826 1.0700 0.0819  0.0863  0.0533  74  GLU C N   
2122 C CA  . GLU C 61  ? 1.1627 1.1037 1.0684 0.0983  0.0898  0.0428  74  GLU C CA  
2123 C C   . GLU C 61  ? 1.0948 1.0169 0.9869 0.0986  0.0822  0.0215  74  GLU C C   
2124 O O   . GLU C 61  ? 1.0333 0.9282 0.9216 0.0851  0.0735  0.0201  74  GLU C O   
2125 C CB  . GLU C 61  ? 1.2264 1.1476 1.1173 0.0980  0.0904  0.0620  74  GLU C CB  
2126 C CG  . GLU C 61  ? 1.4094 1.3582 1.3093 0.1000  0.1027  0.0870  74  GLU C CG  
2127 C CD  . GLU C 61  ? 1.6186 1.5434 1.5004 0.0996  0.1015  0.1087  74  GLU C CD  
2128 O OE1 . GLU C 61  ? 1.6660 1.5451 1.5382 0.0909  0.0873  0.1080  74  GLU C OE1 
2129 O OE2 . GLU C 61  ? 1.6997 1.6491 1.5737 0.1093  0.1139  0.1265  74  GLU C OE2 
2130 N N   . ASP C 62  ? 0.9710 0.9105 0.8555 0.1143  0.0851  0.0055  75  ASP C N   
2131 C CA  . ASP C 62  ? 0.8611 0.7947 0.7386 0.1149  0.0810  -0.0119 75  ASP C CA  
2132 C C   . ASP C 62  ? 0.8234 0.7785 0.6947 0.1343  0.0829  -0.0238 75  ASP C C   
2133 O O   . ASP C 62  ? 0.8414 0.8149 0.7109 0.1470  0.0857  -0.0221 75  ASP C O   
2134 C CB  . ASP C 62  ? 0.8783 0.8159 0.7715 0.1020  0.0763  -0.0201 75  ASP C CB  
2135 C CG  . ASP C 62  ? 1.0029 0.9353 0.8897 0.0963  0.0746  -0.0308 75  ASP C CG  
2136 O OD1 . ASP C 62  ? 1.0141 0.9418 0.8859 0.1048  0.0777  -0.0347 75  ASP C OD1 
2137 O OD2 . ASP C 62  ? 0.9662 0.9003 0.8633 0.0840  0.0703  -0.0341 75  ASP C OD2 
2138 N N   . ASP C 63  ? 0.7709 0.7265 0.6382 0.1380  0.0810  -0.0358 76  ASP C N   
2139 C CA  . ASP C 63  ? 0.7955 0.7761 0.6651 0.1540  0.0788  -0.0490 76  ASP C CA  
2140 C C   . ASP C 63  ? 0.7622 0.7548 0.6429 0.1499  0.0780  -0.0616 76  ASP C C   
2141 O O   . ASP C 63  ? 0.7178 0.6964 0.5911 0.1445  0.0819  -0.0603 76  ASP C O   
2142 C CB  . ASP C 63  ? 0.8232 0.8010 0.6736 0.1740  0.0789  -0.0428 76  ASP C CB  
2143 C CG  . ASP C 63  ? 1.0191 0.9818 0.8597 0.1818  0.0778  -0.0449 76  ASP C CG  
2144 O OD1 . ASP C 63  ? 1.2574 1.1953 1.0933 0.1711  0.0792  -0.0418 76  ASP C OD1 
2145 O OD2 . ASP C 63  ? 0.9731 0.9484 0.8097 0.2011  0.0736  -0.0513 76  ASP C OD2 
2146 N N   . TYR C 64  ? 0.7355 0.7558 0.6342 0.1524  0.0724  -0.0739 77  TYR C N   
2147 C CA  . TYR C 64  ? 0.7291 0.7711 0.6476 0.1446  0.0727  -0.0823 77  TYR C CA  
2148 C C   . TYR C 64  ? 0.7809 0.8543 0.7206 0.1523  0.0618  -0.0951 77  TYR C C   
2149 O O   . TYR C 64  ? 0.7575 0.8311 0.6900 0.1647  0.0532  -0.0996 77  TYR C O   
2150 C CB  . TYR C 64  ? 0.7625 0.7970 0.6916 0.1198  0.0737  -0.0777 77  TYR C CB  
2151 C CG  . TYR C 64  ? 0.7231 0.7507 0.6625 0.1122  0.0636  -0.0787 77  TYR C CG  
2152 C CD1 . TYR C 64  ? 0.7179 0.7612 0.6820 0.1053  0.0518  -0.0880 77  TYR C CD1 
2153 C CD2 . TYR C 64  ? 0.6946 0.7005 0.6218 0.1130  0.0643  -0.0710 77  TYR C CD2 
2154 C CE1 . TYR C 64  ? 0.7368 0.7680 0.7079 0.1028  0.0398  -0.0926 77  TYR C CE1 
2155 C CE2 . TYR C 64  ? 0.6428 0.6455 0.5802 0.1116  0.0558  -0.0745 77  TYR C CE2 
2156 C CZ  . TYR C 64  ? 0.7355 0.7478 0.6922 0.1082  0.0429  -0.0868 77  TYR C CZ  
2157 O OH  . TYR C 64  ? 0.6851 0.6883 0.6493 0.1107  0.0318  -0.0937 77  TYR C OH  
2158 N N   . GLU C 65  ? 0.7919 0.8943 0.7576 0.1450  0.0617  -0.1005 78  GLU C N   
2159 C CA  . GLU C 65  ? 0.7762 0.9110 0.7697 0.1488  0.0475  -0.1125 78  GLU C CA  
2160 C C   . GLU C 65  ? 0.8383 0.9837 0.8645 0.1221  0.0398  -0.1130 78  GLU C C   
2161 O O   . GLU C 65  ? 0.7776 0.9150 0.8062 0.1020  0.0496  -0.1021 78  GLU C O   
2162 C CB  . GLU C 65  ? 0.8548 1.0238 0.8622 0.1635  0.0511  -0.1170 78  GLU C CB  
2163 C CG  . GLU C 65  ? 1.0031 1.1540 0.9781 0.1890  0.0575  -0.1144 78  GLU C CG  
2164 C CD  . GLU C 65  ? 1.1659 1.3489 1.1563 0.2058  0.0618  -0.1202 78  GLU C CD  
2165 O OE1 . GLU C 65  ? 1.2131 1.4420 1.2439 0.1987  0.0596  -0.1260 78  GLU C OE1 
2166 O OE2 . GLU C 65  ? 1.2471 1.4101 1.2122 0.2264  0.0663  -0.1184 78  GLU C OE2 
2167 N N   . THR C 66  ? 0.8264 0.9862 0.8756 0.1215  0.0195  -0.1248 79  THR C N   
2168 C CA  . THR C 66  ? 0.7070 0.8730 0.7920 0.0944  0.0065  -0.1247 79  THR C CA  
2169 C C   . THR C 66  ? 0.6875 0.8879 0.8098 0.0947  -0.0145 -0.1373 79  THR C C   
2170 O O   . THR C 66  ? 0.6957 0.9033 0.8068 0.1191  -0.0256 -0.1507 79  THR C O   
2171 C CB  . THR C 66  ? 0.7094 0.8344 0.7820 0.0880  -0.0061 -0.1276 79  THR C CB  
2172 O OG1 . THR C 66  ? 0.8907 1.0140 0.9986 0.0606  -0.0225 -0.1260 79  THR C OG1 
2173 C CG2 . THR C 66  ? 0.6896 0.8036 0.7409 0.1141  -0.0212 -0.1455 79  THR C CG2 
2174 N N   . ARG C 67  ? 0.6780 0.9004 0.8451 0.0662  -0.0213 -0.1310 80  ARG C N   
2175 C CA  . ARG C 67  ? 0.6485 0.9065 0.8614 0.0604  -0.0449 -0.1411 80  ARG C CA  
2176 C C   . ARG C 67  ? 0.7850 1.0097 1.0026 0.0545  -0.0795 -0.1567 80  ARG C C   
2177 O O   . ARG C 67  ? 0.7889 1.0302 1.0317 0.0574  -0.1071 -0.1723 80  ARG C O   
2178 C CB  . ARG C 67  ? 0.7217 1.0258 0.9879 0.0296  -0.0361 -0.1238 80  ARG C CB  
2179 C CG  . ARG C 67  ? 0.9898 1.3318 1.2524 0.0377  -0.0015 -0.1113 80  ARG C CG  
2180 C CD  . ARG C 67  ? 1.1051 1.4968 1.4188 0.0054  0.0101  -0.0916 80  ARG C CD  
2181 N NE  . ARG C 67  ? 1.2037 1.5670 1.5348 -0.0311 -0.0058 -0.0795 80  ARG C NE  
2182 C CZ  . ARG C 67  ? 1.2109 1.5926 1.5653 -0.0644 0.0080  -0.0541 80  ARG C CZ  
2183 N NH1 . ARG C 67  ? 1.2025 1.6368 1.5637 -0.0641 0.0412  -0.0397 80  ARG C NH1 
2184 N NH2 . ARG C 67  ? 1.1291 1.4754 1.4972 -0.0964 -0.0116 -0.0426 80  ARG C NH2 
2185 N N   . ILE C 68  ? 0.8260 1.0028 1.0194 0.0479  -0.0802 -0.1543 81  ILE C N   
2186 C CA  . ILE C 68  ? 0.8288 0.9675 1.0242 0.0450  -0.1134 -0.1712 81  ILE C CA  
2187 C C   . ILE C 68  ? 0.7354 0.8420 0.8785 0.0801  -0.1168 -0.1902 81  ILE C C   
2188 O O   . ILE C 68  ? 0.7487 0.8644 0.8571 0.1041  -0.0951 -0.1877 81  ILE C O   
2189 C CB  . ILE C 68  ? 0.8435 0.9505 1.0563 0.0129  -0.1184 -0.1561 81  ILE C CB  
2190 C CG1 . ILE C 68  ? 0.7103 0.7896 0.8839 0.0190  -0.0927 -0.1432 81  ILE C CG1 
2191 C CG2 . ILE C 68  ? 0.6588 0.8028 0.9230 -0.0241 -0.1132 -0.1332 81  ILE C CG2 
2192 C CD1 . ILE C 68  ? 0.6619 0.7061 0.8473 -0.0092 -0.1001 -0.1277 81  ILE C CD1 
2193 N N   . THR C 69  ? 0.8262 0.8954 0.9640 0.0834  -0.1444 -0.2084 82  THR C N   
2194 C CA  . THR C 69  ? 0.8605 0.9081 0.9506 0.1198  -0.1495 -0.2298 82  THR C CA  
2195 C C   . THR C 69  ? 0.8784 0.8888 0.9457 0.1252  -0.1407 -0.2274 82  THR C C   
2196 O O   . THR C 69  ? 0.9353 0.9267 0.9709 0.1533  -0.1492 -0.2477 82  THR C O   
2197 C CB  . THR C 69  ? 0.8958 0.9324 0.9872 0.1327  -0.1904 -0.2615 82  THR C CB  
2198 O OG1 . THR C 69  ? 0.9030 0.9119 1.0344 0.1041  -0.2206 -0.2656 82  THR C OG1 
2199 C CG2 . THR C 69  ? 0.8093 0.8872 0.9139 0.1380  -0.1992 -0.2666 82  THR C CG2 
2200 N N   . GLU C 70  ? 0.8687 0.8721 0.9517 0.1001  -0.1239 -0.2031 83  GLU C N   
2201 C CA  . GLU C 70  ? 0.8892 0.8632 0.9541 0.1050  -0.1139 -0.1971 83  GLU C CA  
2202 C C   . GLU C 70  ? 0.8939 0.8761 0.9603 0.0860  -0.0846 -0.1672 83  GLU C C   
2203 O O   . GLU C 70  ? 0.9499 0.9536 1.0364 0.0638  -0.0759 -0.1516 83  GLU C O   
2204 C CB  . GLU C 70  ? 0.9326 0.8640 1.0155 0.0949  -0.1449 -0.2079 83  GLU C CB  
2205 C CG  . GLU C 70  ? 1.0053 0.9256 1.1270 0.0530  -0.1531 -0.1859 83  GLU C CG  
2206 C CD  . GLU C 70  ? 1.1488 1.0176 1.2863 0.0438  -0.1875 -0.1948 83  GLU C CD  
2207 O OE1 . GLU C 70  ? 1.1577 1.0079 1.3176 0.0119  -0.1912 -0.1712 83  GLU C OE1 
2208 O OE2 . GLU C 70  ? 1.2386 1.0834 1.3633 0.0701  -0.2121 -0.2257 83  GLU C OE2 
2209 N N   . SER C 71  ? 0.8405 0.8081 0.8858 0.0960  -0.0700 -0.1601 84  SER C N   
2210 C CA  . SER C 71  ? 0.7826 0.7532 0.8234 0.0807  -0.0462 -0.1347 84  SER C CA  
2211 C C   . SER C 71  ? 0.8886 0.8342 0.9205 0.0848  -0.0440 -0.1288 84  SER C C   
2212 O O   . SER C 71  ? 0.8557 0.8012 0.8727 0.1105  -0.0421 -0.1401 84  SER C O   
2213 C CB  . SER C 71  ? 0.7811 0.7792 0.8010 0.0938  -0.0219 -0.1285 84  SER C CB  
2214 O OG  . SER C 71  ? 0.7727 0.7665 0.7829 0.0829  -0.0026 -0.1082 84  SER C OG  
2215 N N   . LYS C 72  ? 0.9258 0.8542 0.9671 0.0604  -0.0438 -0.1101 85  LYS C N   
2216 C CA  . LYS C 72  ? 0.9401 0.8471 0.9761 0.0629  -0.0434 -0.1020 85  LYS C CA  
2217 C C   . LYS C 72  ? 0.8955 0.8170 0.9126 0.0666  -0.0189 -0.0878 85  LYS C C   
2218 O O   . LYS C 72  ? 0.9002 0.8322 0.9089 0.0534  -0.0051 -0.0755 85  LYS C O   
2219 C CB  . LYS C 72  ? 0.9627 0.8403 1.0130 0.0355  -0.0580 -0.0864 85  LYS C CB  
2220 C CG  . LYS C 72  ? 1.0933 0.9555 1.1349 0.0318  -0.0532 -0.0700 85  LYS C CG  
2221 C CD  . LYS C 72  ? 1.2386 1.0620 1.2944 0.0204  -0.0785 -0.0642 85  LYS C CD  
2222 C CE  . LYS C 72  ? 1.4404 1.2506 1.5059 -0.0120 -0.0885 -0.0487 85  LYS C CE  
2223 N NZ  . LYS C 72  ? 1.5553 1.3203 1.6344 -0.0231 -0.1176 -0.0415 85  LYS C NZ  
2224 N N   . CYS C 73  ? 0.8674 0.7903 0.8794 0.0852  -0.0144 -0.0900 86  CYS C N   
2225 C CA  . CYS C 73  ? 0.7922 0.7239 0.7925 0.0849  0.0036  -0.0744 86  CYS C CA  
2226 C C   . CYS C 73  ? 0.8860 0.8023 0.8971 0.0810  -0.0035 -0.0648 86  CYS C C   
2227 O O   . CYS C 73  ? 0.8633 0.7801 0.8874 0.0980  -0.0119 -0.0746 86  CYS C O   
2228 C CB  . CYS C 73  ? 0.6354 0.5926 0.6238 0.1084  0.0185  -0.0796 86  CYS C CB  
2229 S SG  . CYS C 73  ? 1.1601 1.1247 1.1406 0.1052  0.0364  -0.0579 86  CYS C SG  
2230 N N   . VAL C 74  ? 0.7621 0.6658 0.7669 0.0610  -0.0016 -0.0472 87  VAL C N   
2231 C CA  . VAL C 74  ? 0.7341 0.6255 0.7488 0.0568  -0.0101 -0.0362 87  VAL C CA  
2232 C C   . VAL C 74  ? 0.7674 0.6776 0.7820 0.0638  0.0035  -0.0279 87  VAL C C   
2233 O O   . VAL C 74  ? 0.6999 0.6100 0.6970 0.0548  0.0138  -0.0196 87  VAL C O   
2234 C CB  . VAL C 74  ? 0.7518 0.6165 0.7557 0.0312  -0.0194 -0.0210 87  VAL C CB  
2235 C CG1 . VAL C 74  ? 0.7977 0.6520 0.8068 0.0268  -0.0282 -0.0082 87  VAL C CG1 
2236 C CG2 . VAL C 74  ? 0.7218 0.5658 0.7342 0.0218  -0.0366 -0.0232 87  VAL C CG2 
2237 N N   . THR C 75  ? 0.7362 0.6635 0.7725 0.0803  0.0027  -0.0302 88  THR C N   
2238 C CA  . THR C 75  ? 0.7804 0.7343 0.8246 0.0865  0.0170  -0.0196 88  THR C CA  
2239 C C   . THR C 75  ? 0.8371 0.8115 0.9145 0.0996  0.0125  -0.0178 88  THR C C   
2240 O O   . THR C 75  ? 0.8724 0.8465 0.9620 0.1162  0.0028  -0.0325 88  THR C O   
2241 C CB  . THR C 75  ? 0.7449 0.7241 0.7759 0.1033  0.0356  -0.0260 88  THR C CB  
2242 O OG1 . THR C 75  ? 0.8311 0.8376 0.8729 0.1072  0.0496  -0.0109 88  THR C OG1 
2243 C CG2 . THR C 75  ? 0.5846 0.5755 0.6180 0.1279  0.0329  -0.0476 88  THR C CG2 
2244 N N   . ILE C 76  ? 0.7929 0.7858 0.8879 0.0931  0.0179  -0.0004 89  ILE C N   
2245 C CA  . ILE C 76  ? 0.7657 0.7925 0.9001 0.1075  0.0177  0.0032  89  ILE C CA  
2246 C C   . ILE C 76  ? 0.8312 0.8987 0.9683 0.1374  0.0373  -0.0082 89  ILE C C   
2247 O O   . ILE C 76  ? 0.8168 0.8908 0.9275 0.1412  0.0530  -0.0097 89  ILE C O   
2248 C CB  . ILE C 76  ? 0.7155 0.7587 0.8747 0.0901  0.0184  0.0272  89  ILE C CB  
2249 C CG1 . ILE C 76  ? 0.6126 0.6726 0.7598 0.0845  0.0393  0.0403  89  ILE C CG1 
2250 C CG2 . ILE C 76  ? 0.8063 0.8063 0.9555 0.0639  -0.0043 0.0350  89  ILE C CG2 
2251 C CD1 . ILE C 76  ? 0.6301 0.7019 0.8047 0.0637  0.0367  0.0654  89  ILE C CD1 
2252 N N   . LEU C 77  ? 0.8126 0.9073 0.9785 0.1613  0.0355  -0.0172 90  LEU C N   
2253 C CA  . LEU C 77  ? 0.7899 0.9218 0.9510 0.1953  0.0528  -0.0332 90  LEU C CA  
2254 C C   . LEU C 77  ? 0.8251 1.0219 1.0225 0.2113  0.0729  -0.0200 90  LEU C C   
2255 O O   . LEU C 77  ? 0.9296 1.1673 1.1180 0.2387  0.0942  -0.0274 90  LEU C O   
2256 C CB  . LEU C 77  ? 0.8367 0.9443 0.9928 0.2189  0.0339  -0.0637 90  LEU C CB  
2257 C CG  . LEU C 77  ? 0.8616 0.9130 0.9867 0.2039  0.0153  -0.0762 90  LEU C CG  
2258 C CD1 . LEU C 77  ? 0.9402 0.9626 1.0687 0.2237  -0.0090 -0.1029 90  LEU C CD1 
2259 C CD2 . LEU C 77  ? 0.8734 0.9313 0.9633 0.2053  0.0312  -0.0804 90  LEU C CD2 
2260 N N   . HIS C 78  ? 0.8277 1.0371 1.0657 0.1938  0.0662  0.0006  91  HIS C N   
2261 C CA  . HIS C 78  ? 0.9285 1.2069 1.2146 0.2068  0.0829  0.0153  91  HIS C CA  
2262 C C   . HIS C 78  ? 0.9622 1.2862 1.2460 0.2000  0.1140  0.0399  91  HIS C C   
2263 O O   . HIS C 78  ? 1.0668 1.4585 1.3889 0.2117  0.1344  0.0549  91  HIS C O   
2264 C CB  . HIS C 78  ? 0.9503 1.2295 1.2853 0.1871  0.0623  0.0316  91  HIS C CB  
2265 C CG  . HIS C 78  ? 0.9269 1.1879 1.2636 0.1459  0.0571  0.0594  91  HIS C CG  
2266 N ND1 . HIS C 78  ? 0.9212 1.1151 1.2242 0.1196  0.0352  0.0581  91  HIS C ND1 
2267 C CD2 . HIS C 78  ? 0.8906 1.1907 1.2588 0.1267  0.0695  0.0889  91  HIS C CD2 
2268 C CE1 . HIS C 78  ? 0.9121 1.1006 1.2215 0.0895  0.0329  0.0814  91  HIS C CE1 
2269 N NE2 . HIS C 78  ? 0.8613 1.1107 1.2120 0.0913  0.0517  0.1013  91  HIS C NE2 
2270 N N   . LYS C 79  ? 0.9068 1.1955 1.1477 0.1815  0.1174  0.0459  92  LYS C N   
2271 C CA  . LYS C 79  ? 0.8843 1.2051 1.1150 0.1755  0.1436  0.0700  92  LYS C CA  
2272 C C   . LYS C 79  ? 0.9533 1.2778 1.1335 0.2031  0.1596  0.0520  92  LYS C C   
2273 O O   . LYS C 79  ? 0.9354 1.2804 1.0954 0.2017  0.1803  0.0704  92  LYS C O   
2274 C CB  . LYS C 79  ? 0.8266 1.1032 1.0451 0.1368  0.1335  0.0912  92  LYS C CB  
2275 C CG  . LYS C 79  ? 0.8304 1.1026 1.0944 0.1072  0.1157  0.1112  92  LYS C CG  
2276 C CD  . LYS C 79  ? 0.8836 1.1051 1.1270 0.0734  0.1034  0.1269  92  LYS C CD  
2277 C CE  . LYS C 79  ? 0.9741 1.1918 1.2617 0.0442  0.0830  0.1465  92  LYS C CE  
2278 N NZ  . LYS C 79  ? 1.0987 1.2602 1.3617 0.0145  0.0671  0.1570  92  LYS C NZ  
2279 N N   . GLY C 80  ? 0.9731 1.2749 1.1327 0.2275  0.1470  0.0169  93  GLY C N   
2280 C CA  . GLY C 80  ? 0.9127 1.2060 1.0217 0.2509  0.1530  -0.0048 93  GLY C CA  
2281 C C   . GLY C 80  ? 0.9545 1.1878 1.0297 0.2284  0.1368  -0.0091 93  GLY C C   
2282 O O   . GLY C 80  ? 1.0315 1.2326 1.1188 0.1973  0.1243  0.0048  93  GLY C O   
2283 N N   . PHE C 81  ? 0.9474 1.1680 0.9804 0.2457  0.1362  -0.0293 94  PHE C N   
2284 C CA  . PHE C 81  ? 0.8873 1.0606 0.8931 0.2279  0.1222  -0.0346 94  PHE C CA  
2285 C C   . PHE C 81  ? 0.9579 1.1384 0.9199 0.2467  0.1304  -0.0429 94  PHE C C   
2286 O O   . PHE C 81  ? 0.9541 1.1581 0.8983 0.2783  0.1352  -0.0619 94  PHE C O   
2287 C CB  . PHE C 81  ? 0.8640 0.9960 0.8758 0.2236  0.0954  -0.0592 94  PHE C CB  
2288 C CG  . PHE C 81  ? 0.8476 0.9405 0.8383 0.2055  0.0828  -0.0644 94  PHE C CG  
2289 C CD1 . PHE C 81  ? 0.8196 0.8878 0.8162 0.1753  0.0789  -0.0469 94  PHE C CD1 
2290 C CD2 . PHE C 81  ? 0.8251 0.9083 0.7914 0.2202  0.0735  -0.0882 94  PHE C CD2 
2291 C CE1 . PHE C 81  ? 0.9160 0.9566 0.8954 0.1621  0.0704  -0.0522 94  PHE C CE1 
2292 C CE2 . PHE C 81  ? 0.8726 0.9293 0.8278 0.2037  0.0628  -0.0917 94  PHE C CE2 
2293 C CZ  . PHE C 81  ? 0.9367 0.9750 0.8991 0.1756  0.0634  -0.0734 94  PHE C CZ  
2294 N N   . SER C 82  ? 0.9749 1.1340 0.9175 0.2296  0.1300  -0.0303 95  SER C N   
2295 C CA  . SER C 82  ? 0.9546 1.1181 0.8561 0.2460  0.1346  -0.0351 95  SER C CA  
2296 C C   . SER C 82  ? 0.8865 1.0116 0.7756 0.2312  0.1183  -0.0424 95  SER C C   
2297 O O   . SER C 82  ? 0.9058 1.0083 0.8068 0.2062  0.1158  -0.0268 95  SER C O   
2298 C CB  . SER C 82  ? 0.9326 1.1249 0.8222 0.2463  0.1581  -0.0023 95  SER C CB  
2299 O OG  . SER C 82  ? 0.9388 1.1306 0.7851 0.2614  0.1599  -0.0038 95  SER C OG  
2300 N N   . ALA C 83  ? 0.7900 0.9101 0.6560 0.2481  0.1063  -0.0671 96  ALA C N   
2301 C CA  . ALA C 83  ? 0.7063 0.8009 0.5664 0.2368  0.0915  -0.0749 96  ALA C CA  
2302 C C   . ALA C 83  ? 0.7629 0.8667 0.5884 0.2593  0.0866  -0.0871 96  ALA C C   
2303 O O   . ALA C 83  ? 0.9110 1.0348 0.7136 0.2853  0.0890  -0.0988 96  ALA C O   
2304 C CB  . ALA C 83  ? 0.7130 0.7853 0.5972 0.2239  0.0718  -0.0948 96  ALA C CB  
2305 N N   . SER C 84  ? 0.8780 0.9685 0.6987 0.2514  0.0786  -0.0857 97  SER C N   
2306 C CA  . SER C 84  ? 0.9431 1.0413 0.7345 0.2716  0.0693  -0.0967 97  SER C CA  
2307 C C   . SER C 84  ? 0.9346 1.0210 0.7443 0.2608  0.0499  -0.1120 97  SER C C   
2308 O O   . SER C 84  ? 0.8372 0.9106 0.6725 0.2381  0.0513  -0.1045 97  SER C O   
2309 C CB  . SER C 84  ? 0.9465 1.0496 0.7099 0.2783  0.0835  -0.0694 97  SER C CB  
2310 O OG  . SER C 84  ? 0.9686 1.0899 0.7202 0.2848  0.1041  -0.0499 97  SER C OG  
2311 N N   . VAL C 85  ? 1.0127 1.1070 0.8098 0.2772  0.0316  -0.1333 98  VAL C N   
2312 C CA  . VAL C 85  ? 0.9425 1.0351 0.7655 0.2660  0.0126  -0.1470 98  VAL C CA  
2313 C C   . VAL C 85  ? 0.8998 1.0054 0.7037 0.2848  -0.0010 -0.1539 98  VAL C C   
2314 O O   . VAL C 85  ? 0.9386 1.0517 0.7093 0.3090  -0.0101 -0.1655 98  VAL C O   
2315 C CB  . VAL C 85  ? 0.8469 0.9324 0.6974 0.2559  -0.0072 -0.1706 98  VAL C CB  
2316 C CG1 . VAL C 85  ? 0.9795 1.0665 0.8036 0.2815  -0.0214 -0.1943 98  VAL C CG1 
2317 C CG2 . VAL C 85  ? 0.7388 0.8300 0.6231 0.2398  -0.0250 -0.1794 98  VAL C CG2 
2318 N N   . ARG C 86  ? 0.9395 1.0489 0.7626 0.2761  -0.0026 -0.1471 99  ARG C N   
2319 C CA  . ARG C 86  ? 0.9007 1.0242 0.7134 0.2939  -0.0173 -0.1521 99  ARG C CA  
2320 C C   . ARG C 86  ? 0.9527 1.0936 0.8050 0.2856  -0.0416 -0.1739 99  ARG C C   
2321 O O   . ARG C 86  ? 0.9938 1.1338 0.8834 0.2618  -0.0434 -0.1795 99  ARG C O   
2322 C CB  . ARG C 86  ? 0.9055 1.0243 0.7173 0.2938  -0.0045 -0.1308 99  ARG C CB  
2323 C CG  . ARG C 86  ? 0.8583 0.9641 0.6252 0.3108  0.0069  -0.1084 99  ARG C CG  
2324 C CD  . ARG C 86  ? 0.8621 0.9534 0.6345 0.3084  0.0143  -0.0908 99  ARG C CD  
2325 N NE  . ARG C 86  ? 1.0674 1.1406 0.8001 0.3227  0.0203  -0.0662 99  ARG C NE  
2326 C CZ  . ARG C 86  ? 1.0946 1.1426 0.8251 0.3205  0.0262  -0.0477 99  ARG C CZ  
2327 N NH1 . ARG C 86  ? 0.9180 0.9598 0.6798 0.3080  0.0287  -0.0545 99  ARG C NH1 
2328 N NH2 . ARG C 86  ? 1.3001 1.3276 0.9953 0.3311  0.0286  -0.0222 99  ARG C NH2 
2329 N N   . THR C 87  ? 0.8598 1.0175 0.7053 0.3040  -0.0616 -0.1839 100 THR C N   
2330 C CA  . THR C 87  ? 0.8946 1.0779 0.7876 0.2948  -0.0828 -0.1979 100 THR C CA  
2331 C C   . THR C 87  ? 0.8765 1.0745 0.7813 0.3006  -0.0731 -0.1834 100 THR C C   
2332 O O   . THR C 87  ? 0.8056 0.9959 0.6730 0.3237  -0.0703 -0.1728 100 THR C O   
2333 C CB  . THR C 87  ? 1.0184 1.2138 0.9014 0.3132  -0.1174 -0.2213 100 THR C CB  
2334 O OG1 . THR C 87  ? 1.1134 1.2889 0.9723 0.3164  -0.1273 -0.2381 100 THR C OG1 
2335 C CG2 . THR C 87  ? 0.8742 1.1009 0.8189 0.2978  -0.1411 -0.2342 100 THR C CG2 
2336 N N   . ILE C 88  ? 0.8926 1.1110 0.8472 0.2812  -0.0673 -0.1818 101 ILE C N   
2337 C CA  . ILE C 88  ? 0.9104 1.1457 0.8781 0.2915  -0.0585 -0.1725 101 ILE C CA  
2338 C C   . ILE C 88  ? 0.8224 1.1066 0.8449 0.2903  -0.0768 -0.1850 101 ILE C C   
2339 O O   . ILE C 88  ? 0.6623 0.9678 0.7287 0.2662  -0.0852 -0.1932 101 ILE C O   
2340 C CB  . ILE C 88  ? 0.8836 1.1042 0.8551 0.2768  -0.0290 -0.1569 101 ILE C CB  
2341 C CG1 . ILE C 88  ? 0.9671 1.2007 0.9792 0.2446  -0.0225 -0.1593 101 ILE C CG1 
2342 C CG2 . ILE C 88  ? 0.6631 0.8390 0.5853 0.2798  -0.0134 -0.1417 101 ILE C CG2 
2343 C CD1 . ILE C 88  ? 0.9931 1.2158 1.0058 0.2318  0.0039  -0.1460 101 ILE C CD1 
2344 N N   . LEU C 89  ? 0.8671 1.1691 0.8891 0.3162  -0.0849 -0.1847 102 LEU C N   
2345 C CA  . LEU C 89  ? 0.9260 1.2829 1.0059 0.3191  -0.1006 -0.1946 102 LEU C CA  
2346 C C   . LEU C 89  ? 0.9091 1.2791 0.9966 0.3384  -0.0844 -0.1862 102 LEU C C   
2347 O O   . LEU C 89  ? 0.9221 1.2675 0.9695 0.3672  -0.0879 -0.1803 102 LEU C O   
2348 C CB  . LEU C 89  ? 1.0327 1.4028 1.1066 0.3391  -0.1376 -0.2088 102 LEU C CB  
2349 C CG  . LEU C 89  ? 1.0267 1.4584 1.1648 0.3450  -0.1593 -0.2190 102 LEU C CG  
2350 C CD1 . LEU C 89  ? 0.9724 1.4438 1.1807 0.3081  -0.1596 -0.2237 102 LEU C CD1 
2351 C CD2 . LEU C 89  ? 1.0824 1.5190 1.2034 0.3681  -0.1997 -0.2330 102 LEU C CD2 
2352 N N   . GLN C 90  ? 0.9308 1.3382 1.0675 0.3239  -0.0670 -0.1851 103 GLN C N   
2353 C CA  . GLN C 90  ? 1.0503 1.4694 1.1921 0.3450  -0.0494 -0.1810 103 GLN C CA  
2354 C C   . GLN C 90  ? 1.0278 1.5234 1.2423 0.3440  -0.0466 -0.1876 103 GLN C C   
2355 O O   . GLN C 90  ? 0.9132 1.4471 1.1749 0.3129  -0.0424 -0.1874 103 GLN C O   
2356 C CB  . GLN C 90  ? 1.1850 1.5604 1.2921 0.3345  -0.0190 -0.1697 103 GLN C CB  
2357 C CG  . GLN C 90  ? 1.2156 1.5943 1.3396 0.2955  -0.0041 -0.1657 103 GLN C CG  
2358 C CD  . GLN C 90  ? 1.2010 1.5352 1.2876 0.2868  0.0215  -0.1553 103 GLN C CD  
2359 O OE1 . GLN C 90  ? 1.2663 1.5725 1.3221 0.3089  0.0295  -0.1527 103 GLN C OE1 
2360 N NE2 . GLN C 90  ? 1.0995 1.4234 1.1888 0.2547  0.0309  -0.1495 103 GLN C NE2 
2361 N N   . ASN C 91  ? 1.1295 1.6480 1.3545 0.3789  -0.0494 -0.1919 104 ASN C N   
2362 C CA  . ASN C 91  ? 1.2036 1.8005 1.4969 0.3854  -0.0406 -0.1976 104 ASN C CA  
2363 C C   . ASN C 91  ? 1.4095 1.9962 1.6834 0.4121  -0.0145 -0.1976 104 ASN C C   
2364 O O   . ASN C 91  ? 1.4325 1.9965 1.6846 0.3963  0.0132  -0.1918 104 ASN C O   
2365 C CB  . ASN C 91  ? 1.0996 1.7479 1.4372 0.4074  -0.0735 -0.2078 104 ASN C CB  
2366 C CG  . ASN C 91  ? 1.0943 1.6903 1.3757 0.4429  -0.0986 -0.2092 104 ASN C CG  
2367 O OD1 . ASN C 91  ? 1.1845 1.7259 1.4124 0.4646  -0.0873 -0.2032 104 ASN C OD1 
2368 N ND2 . ASN C 91  ? 0.9539 1.5645 1.2457 0.4481  -0.1350 -0.2159 104 ASN C ND2 
2369 N N   . ASP C 92  ? 1.5607 2.1610 1.8406 0.4543  -0.0263 -0.2054 105 ASP C N   
2370 C CA  . ASP C 92  ? 1.6460 2.2193 1.8968 0.4873  -0.0095 -0.2089 105 ASP C CA  
2371 C C   . ASP C 92  ? 1.6625 2.1861 1.8741 0.5259  -0.0371 -0.2093 105 ASP C C   
2372 O O   . ASP C 92  ? 1.7082 2.1592 1.8623 0.5417  -0.0338 -0.2047 105 ASP C O   
2373 C CB  . ASP C 92  ? 1.6929 2.3515 2.0060 0.5058  0.0087  -0.2199 105 ASP C CB  
2374 C CG  . ASP C 92  ? 1.6748 2.4139 2.0542 0.4669  0.0232  -0.2157 105 ASP C CG  
2375 O OD1 . ASP C 92  ? 1.6463 2.3710 2.0098 0.4336  0.0477  -0.2070 105 ASP C OD1 
2376 O OD2 . ASP C 92  ? 1.6492 2.4653 2.0982 0.4686  0.0079  -0.2195 105 ASP C OD2 
2377 N N   . HIS C 93  ? 1.5941 2.1559 1.8376 0.5393  -0.0670 -0.2134 106 HIS C N   
2378 C CA  . HIS C 93  ? 1.5816 2.1006 1.7880 0.5750  -0.0976 -0.2109 106 HIS C CA  
2379 C C   . HIS C 93  ? 1.5715 2.0013 1.6991 0.5611  -0.1032 -0.1945 106 HIS C C   
2380 O O   . HIS C 93  ? 1.6261 1.9928 1.7023 0.5860  -0.1130 -0.1852 106 HIS C O   
2381 C CB  . HIS C 93  ? 1.6193 2.1984 1.8733 0.5855  -0.1316 -0.2181 106 HIS C CB  
2382 C CG  . HIS C 93  ? 1.8172 2.4772 2.1460 0.5934  -0.1283 -0.2281 106 HIS C CG  
2383 N ND1 . HIS C 93  ? 1.9572 2.6116 2.2862 0.6259  -0.1380 -0.2303 106 HIS C ND1 
2384 C CD2 . HIS C 93  ? 1.8537 2.6019 2.2606 0.5712  -0.1156 -0.2341 106 HIS C CD2 
2385 C CE1 . HIS C 93  ? 1.9419 2.6798 2.3456 0.6251  -0.1298 -0.2383 106 HIS C CE1 
2386 N NE2 . HIS C 93  ? 1.9128 2.7104 2.3659 0.5909  -0.1154 -0.2390 106 HIS C NE2 
2387 N N   . SER C 94  ? 1.4371 1.8627 1.5572 0.5216  -0.0970 -0.1899 107 SER C N   
2388 C CA  . SER C 94  ? 1.2485 1.6037 1.3005 0.5093  -0.1012 -0.1749 107 SER C CA  
2389 C C   . SER C 94  ? 1.1023 1.4455 1.1463 0.4666  -0.0813 -0.1711 107 SER C C   
2390 O O   . SER C 94  ? 0.9466 1.3378 1.0393 0.4421  -0.0715 -0.1796 107 SER C O   
2391 C CB  . SER C 94  ? 1.1776 1.5340 1.2117 0.5238  -0.1357 -0.1740 107 SER C CB  
2392 O OG  . SER C 94  ? 1.1416 1.5587 1.2259 0.5073  -0.1502 -0.1884 107 SER C OG  
2393 N N   . LEU C 95  ? 1.1047 1.3845 1.0888 0.4579  -0.0761 -0.1561 108 LEU C N   
2394 C CA  . LEU C 95  ? 1.0268 1.2918 0.9985 0.4226  -0.0627 -0.1523 108 LEU C CA  
2395 C C   . LEU C 95  ? 1.0921 1.3288 1.0163 0.4252  -0.0783 -0.1447 108 LEU C C   
2396 O O   . LEU C 95  ? 1.0900 1.2853 0.9660 0.4437  -0.0830 -0.1291 108 LEU C O   
2397 C CB  . LEU C 95  ? 0.9951 1.2165 0.9435 0.4073  -0.0356 -0.1413 108 LEU C CB  
2398 C CG  . LEU C 95  ? 0.9749 1.1777 0.9102 0.3732  -0.0221 -0.1356 108 LEU C CG  
2399 C CD1 . LEU C 95  ? 0.9876 1.1884 0.9386 0.3524  0.0019  -0.1358 108 LEU C CD1 
2400 C CD2 . LEU C 95  ? 0.9520 1.1008 0.8308 0.3744  -0.0215 -0.1173 108 LEU C CD2 
2401 N N   . LEU C 96  ? 1.1184 1.3768 1.0550 0.4074  -0.0870 -0.1553 109 LEU C N   
2402 C CA  . LEU C 96  ? 1.0733 1.3090 0.9614 0.4118  -0.0996 -0.1522 109 LEU C CA  
2403 C C   . LEU C 96  ? 0.9961 1.2090 0.8679 0.3850  -0.0810 -0.1487 109 LEU C C   
2404 O O   . LEU C 96  ? 1.0018 1.2318 0.9122 0.3597  -0.0737 -0.1582 109 LEU C O   
2405 C CB  . LEU C 96  ? 1.0762 1.3494 0.9828 0.4207  -0.1326 -0.1718 109 LEU C CB  
2406 C CG  . LEU C 96  ? 1.1451 1.4375 1.0545 0.4536  -0.1591 -0.1742 109 LEU C CG  
2407 C CD1 . LEU C 96  ? 1.1849 1.5161 1.1186 0.4570  -0.1949 -0.1961 109 LEU C CD1 
2408 C CD2 . LEU C 96  ? 1.2132 1.4596 1.0512 0.4786  -0.1607 -0.1534 109 LEU C CD2 
2409 N N   . ALA C 97  ? 0.8917 1.0680 0.7076 0.3908  -0.0733 -0.1328 110 ALA C N   
2410 C CA  . ALA C 97  ? 0.9334 1.0921 0.7329 0.3708  -0.0567 -0.1292 110 ALA C CA  
2411 C C   . ALA C 97  ? 1.0302 1.1820 0.7786 0.3862  -0.0657 -0.1286 110 ALA C C   
2412 O O   . ALA C 97  ? 1.0000 1.1374 0.7042 0.4070  -0.0682 -0.1118 110 ALA C O   
2413 C CB  . ALA C 97  ? 0.9472 1.0724 0.7346 0.3587  -0.0304 -0.1067 110 ALA C CB  
2414 N N   . SER C 98  ? 1.0076 1.1682 0.7594 0.3773  -0.0709 -0.1466 111 SER C N   
2415 C CA  . SER C 98  ? 1.0128 1.1701 0.7133 0.3952  -0.0784 -0.1516 111 SER C CA  
2416 C C   . SER C 98  ? 1.0469 1.1841 0.7106 0.3924  -0.0492 -0.1279 111 SER C C   
2417 O O   . SER C 98  ? 1.0423 1.1647 0.7233 0.3743  -0.0274 -0.1090 111 SER C O   
2418 C CB  . SER C 98  ? 0.9957 1.1648 0.7139 0.3892  -0.0976 -0.1832 111 SER C CB  
2419 O OG  . SER C 98  ? 0.9708 1.1302 0.7134 0.3649  -0.0799 -0.1841 111 SER C OG  
2420 N N   . SER C 99  ? 1.1009 1.2403 0.7140 0.4109  -0.0493 -0.1292 112 SER C N   
2421 C CA  . SER C 99  ? 1.1608 1.2931 0.7440 0.4089  -0.0201 -0.1068 112 SER C CA  
2422 C C   . SER C 99  ? 1.0869 1.2191 0.7056 0.3876  -0.0078 -0.1186 112 SER C C   
2423 O O   . SER C 99  ? 0.9039 1.0389 0.5602 0.3770  -0.0243 -0.1450 112 SER C O   
2424 C CB  . SER C 99  ? 1.1599 1.3033 0.6778 0.4381  -0.0217 -0.1072 112 SER C CB  
2425 O OG  . SER C 99  ? 1.2509 1.4051 0.7644 0.4500  -0.0432 -0.1458 112 SER C OG  
2426 N N   . TRP C 100 ? 1.1228 1.2526 0.7319 0.3805  0.0196  -0.0970 113 TRP C N   
2427 C CA  . TRP C 100 ? 1.1080 1.2363 0.7516 0.3613  0.0310  -0.1043 113 TRP C CA  
2428 C C   . TRP C 100 ? 1.2121 1.3533 0.8391 0.3778  0.0266  -0.1301 113 TRP C C   
2429 O O   . TRP C 100 ? 1.2506 1.4069 0.8296 0.4031  0.0334  -0.1280 113 TRP C O   
2430 C CB  . TRP C 100 ? 0.9486 1.0709 0.5986 0.3448  0.0596  -0.0701 113 TRP C CB  
2431 C CG  . TRP C 100 ? 0.9506 1.0509 0.6225 0.3258  0.0618  -0.0500 113 TRP C CG  
2432 C CD1 . TRP C 100 ? 0.9944 1.0815 0.6444 0.3293  0.0664  -0.0218 113 TRP C CD1 
2433 C CD2 . TRP C 100 ? 0.9871 1.0730 0.7031 0.3024  0.0583  -0.0573 113 TRP C CD2 
2434 N NE1 . TRP C 100 ? 1.0389 1.1019 0.7168 0.3121  0.0644  -0.0150 113 TRP C NE1 
2435 C CE2 . TRP C 100 ? 0.9326 0.9976 0.6492 0.2960  0.0611  -0.0366 113 TRP C CE2 
2436 C CE3 . TRP C 100 ? 0.9898 1.0769 0.7420 0.2870  0.0523  -0.0784 113 TRP C CE3 
2437 C CZ2 . TRP C 100 ? 0.8975 0.9465 0.6460 0.2778  0.0601  -0.0395 113 TRP C CZ2 
2438 C CZ3 . TRP C 100 ? 0.9285 1.0020 0.7125 0.2660  0.0527  -0.0766 113 TRP C CZ3 
2439 C CH2 . TRP C 100 ? 0.9344 0.9909 0.7148 0.2629  0.0574  -0.0588 113 TRP C CH2 
2440 N N   . ALA C 101 ? 1.1650 1.2988 0.8300 0.3646  0.0146  -0.1542 114 ALA C N   
2441 C CA  . ALA C 101 ? 1.1082 1.2457 0.7654 0.3779  0.0114  -0.1780 114 ALA C CA  
2442 C C   . ALA C 101 ? 1.1387 1.2743 0.8264 0.3594  0.0341  -0.1622 114 ALA C C   
2443 O O   . ALA C 101 ? 1.2031 1.3230 0.9341 0.3314  0.0319  -0.1576 114 ALA C O   
2444 C CB  . ALA C 101 ? 0.9805 1.1045 0.6607 0.3751  -0.0229 -0.2147 114 ALA C CB  
2445 N N   . SER C 102 ? 1.0454 1.2005 0.7104 0.3757  0.0560  -0.1529 115 SER C N   
2446 C CA  . SER C 102 ? 1.0413 1.2015 0.7375 0.3592  0.0781  -0.1335 115 SER C CA  
2447 C C   . SER C 102 ? 1.0048 1.1731 0.7088 0.3748  0.0774  -0.1567 115 SER C C   
2448 O O   . SER C 102 ? 1.0078 1.1831 0.6796 0.4055  0.0669  -0.1850 115 SER C O   
2449 C CB  . SER C 102 ? 1.0905 1.2724 0.7696 0.3586  0.1081  -0.0936 115 SER C CB  
2450 O OG  . SER C 102 ? 1.1170 1.2821 0.7938 0.3430  0.1059  -0.0718 115 SER C OG  
2451 N N   . ALA C 103 ? 1.0162 1.1811 0.7615 0.3554  0.0863  -0.1460 116 ALA C N   
2452 C CA  . ALA C 103 ? 0.9769 1.1493 0.7364 0.3705  0.0861  -0.1647 116 ALA C CA  
2453 C C   . ALA C 103 ? 1.0510 1.2340 0.8509 0.3496  0.1052  -0.1370 116 ALA C C   
2454 O O   . ALA C 103 ? 1.0438 1.2083 0.8688 0.3172  0.1050  -0.1159 116 ALA C O   
2455 C CB  . ALA C 103 ? 0.9715 1.1073 0.7488 0.3673  0.0522  -0.1993 116 ALA C CB  
2456 N N   . GLU C 104 ? 1.1488 1.3634 0.9553 0.3698  0.1207  -0.1384 117 GLU C N   
2457 C CA  . GLU C 104 ? 1.1353 1.3669 0.9848 0.3513  0.1372  -0.1116 117 GLU C CA  
2458 C C   . GLU C 104 ? 1.0988 1.3427 0.9749 0.3704  0.1340  -0.1312 117 GLU C C   
2459 O O   . GLU C 104 ? 1.1880 1.4473 1.0406 0.4081  0.1327  -0.1596 117 GLU C O   
2460 C CB  . GLU C 104 ? 1.2281 1.5037 1.0695 0.3498  0.1699  -0.0734 117 GLU C CB  
2461 C CG  . GLU C 104 ? 1.4742 1.7992 1.2783 0.3896  0.1911  -0.0789 117 GLU C CG  
2462 C CD  . GLU C 104 ? 1.6159 1.9874 1.4174 0.3827  0.2250  -0.0336 117 GLU C CD  
2463 O OE1 . GLU C 104 ? 1.6308 2.0414 1.3908 0.4109  0.2445  -0.0301 117 GLU C OE1 
2464 O OE2 . GLU C 104 ? 1.6092 1.9765 1.4494 0.3478  0.2305  -0.0005 117 GLU C OE2 
2465 N N   . LEU C 105 ? 1.0509 1.2859 0.9739 0.3465  0.1304  -0.1173 118 LEU C N   
2466 C CA  . LEU C 105 ? 1.1056 1.3573 1.0612 0.3640  0.1287  -0.1293 118 LEU C CA  
2467 C C   . LEU C 105 ? 1.1150 1.4252 1.0993 0.3619  0.1596  -0.0960 118 LEU C C   
2468 O O   . LEU C 105 ? 1.1594 1.4667 1.1712 0.3270  0.1637  -0.0641 118 LEU C O   
2469 C CB  . LEU C 105 ? 1.0448 1.2477 1.0348 0.3396  0.1003  -0.1352 118 LEU C CB  
2470 C CG  . LEU C 105 ? 1.0494 1.1963 1.0230 0.3378  0.0676  -0.1653 118 LEU C CG  
2471 C CD1 . LEU C 105 ? 0.9693 1.0728 0.9766 0.3087  0.0441  -0.1608 118 LEU C CD1 
2472 C CD2 . LEU C 105 ? 1.0680 1.2160 1.0216 0.3809  0.0563  -0.2046 118 LEU C CD2 
2473 N N   . HIS C 106 ? 1.0044 1.3695 0.9824 0.3995  0.1807  -0.1036 119 HIS C N   
2474 C CA  . HIS C 106 ? 1.0457 1.4793 1.0549 0.3988  0.2136  -0.0694 119 HIS C CA  
2475 C C   . HIS C 106 ? 0.9738 1.4123 1.0493 0.3785  0.2056  -0.0558 119 HIS C C   
2476 O O   . HIS C 106 ? 1.0599 1.4665 1.1540 0.3863  0.1800  -0.0818 119 HIS C O   
2477 C CB  . HIS C 106 ? 1.2285 1.7221 1.2169 0.4447  0.2371  -0.0831 119 HIS C CB  
2478 C CG  . HIS C 106 ? 1.4549 1.9454 1.3780 0.4513  0.2441  -0.0825 119 HIS C CG  
2479 N ND1 . HIS C 106 ? 1.5518 1.9875 1.4264 0.4589  0.2173  -0.1140 119 HIS C ND1 
2480 C CD2 . HIS C 106 ? 1.5628 2.0990 1.4630 0.4510  0.2724  -0.0524 119 HIS C CD2 
2481 C CE1 . HIS C 106 ? 1.6083 2.0567 1.4327 0.4656  0.2279  -0.1045 119 HIS C CE1 
2482 N NE2 . HIS C 106 ? 1.6324 2.1397 1.4687 0.4615  0.2616  -0.0669 119 HIS C NE2 
2483 N N   . ALA C 107 ? 0.8492 1.3245 0.9600 0.3514  0.2244  -0.0139 120 ALA C N   
2484 C CA  . ALA C 107 ? 0.9131 1.3982 1.0887 0.3299  0.2156  0.0028  120 ALA C CA  
2485 C C   . ALA C 107 ? 1.0143 1.5452 1.2252 0.3681  0.2186  -0.0180 120 ALA C C   
2486 O O   . ALA C 107 ? 0.9584 1.5447 1.1544 0.4078  0.2434  -0.0287 120 ALA C O   
2487 C CB  . ALA C 107 ? 0.8267 1.3518 1.0344 0.2973  0.2362  0.0514  120 ALA C CB  
2488 N N   . PRO C 108 ? 0.9900 1.4976 1.2450 0.3591  0.1925  -0.0244 121 PRO C N   
2489 C CA  . PRO C 108 ? 0.9956 1.5404 1.2898 0.3966  0.1896  -0.0450 121 PRO C CA  
2490 C C   . PRO C 108 ? 1.0486 1.6974 1.3865 0.4137  0.2272  -0.0216 121 PRO C C   
2491 O O   . PRO C 108 ? 0.9333 1.6167 1.3034 0.3789  0.2425  0.0206  121 PRO C O   
2492 C CB  . PRO C 108 ? 0.9066 1.4080 1.2438 0.3689  0.1552  -0.0398 121 PRO C CB  
2493 C CG  . PRO C 108 ? 0.9300 1.3520 1.2279 0.3299  0.1348  -0.0355 121 PRO C CG  
2494 C CD  . PRO C 108 ? 0.9417 1.3830 1.2067 0.3157  0.1623  -0.0140 121 PRO C CD  
2495 N N   . PRO C 109 ? 1.1148 1.8141 1.4546 0.4675  0.2415  -0.0488 122 PRO C N   
2496 C CA  . PRO C 109 ? 1.0814 1.8663 1.4561 0.4741  0.2731  -0.0282 122 PRO C CA  
2497 C C   . PRO C 109 ? 1.1035 1.9375 1.5709 0.4609  0.2687  -0.0037 122 PRO C C   
2498 O O   . PRO C 109 ? 1.0170 1.8139 1.5142 0.4659  0.2354  -0.0204 122 PRO C O   
2499 C CB  . PRO C 109 ? 1.1152 1.8915 1.4560 0.5180  0.2691  -0.0719 122 PRO C CB  
2500 C CG  . PRO C 109 ? 1.1287 1.8189 1.4501 0.5304  0.2270  -0.1114 122 PRO C CG  
2501 C CD  . PRO C 109 ? 1.1449 1.7846 1.4406 0.5003  0.2158  -0.0997 122 PRO C CD  
2502 N N   . GLY C 110 ? 1.1767 2.0883 1.6880 0.4408  0.2982  0.0372  123 GLY C N   
2503 C CA  . GLY C 110 ? 1.1472 2.1119 1.7522 0.4227  0.2929  0.0647  123 GLY C CA  
2504 C C   . GLY C 110 ? 1.1627 2.1719 1.8070 0.3734  0.3117  0.1223  123 GLY C C   
2505 O O   . GLY C 110 ? 1.1687 2.1480 1.7656 0.3490  0.3217  0.1408  123 GLY C O   
2506 N N   . SER C 111 ? 1.2092 2.2809 1.9390 0.3555  0.3117  0.1496  124 SER C N   
2507 C CA  . SER C 111 ? 1.1888 2.2988 1.9676 0.3029  0.3222  0.2057  124 SER C CA  
2508 C C   . SER C 111 ? 1.2075 2.2305 1.9923 0.2537  0.2783  0.2158  124 SER C C   
2509 O O   . SER C 111 ? 1.2668 2.2304 2.0513 0.2598  0.2402  0.1868  124 SER C O   
2510 C CB  . SER C 111 ? 1.1053 2.3025 1.9647 0.2980  0.3328  0.2252  124 SER C CB  
2511 O OG  . SER C 111 ? 1.0234 2.2451 1.9441 0.2419  0.3286  0.2771  124 SER C OG  
2512 N N   . PRO C 112 ? 1.1530 2.1556 1.9328 0.2034  0.2799  0.2546  125 PRO C N   
2513 C CA  . PRO C 112 ? 1.0625 1.9733 1.8360 0.1550  0.2366  0.2615  125 PRO C CA  
2514 C C   . PRO C 112 ? 0.9633 1.8825 1.8126 0.1396  0.2013  0.2646  125 PRO C C   
2515 O O   . PRO C 112 ? 0.9632 1.7975 1.7884 0.1273  0.1606  0.2444  125 PRO C O   
2516 C CB  . PRO C 112 ? 1.0616 1.9795 1.8380 0.1098  0.2511  0.3088  125 PRO C CB  
2517 C CG  . PRO C 112 ? 1.1180 2.1509 1.9269 0.1289  0.3016  0.3359  125 PRO C CG  
2518 C CD  . PRO C 112 ? 1.1651 2.2220 1.9350 0.1917  0.3214  0.2927  125 PRO C CD  
2519 N N   . GLY C 113 ? 0.8883 1.9120 1.8280 0.1411  0.2168  0.2903  126 GLY C N   
2520 C CA  . GLY C 113 ? 0.8468 1.8875 1.8665 0.1254  0.1816  0.2966  126 GLY C CA  
2521 C C   . GLY C 113 ? 0.7647 1.8066 1.7967 0.1721  0.1636  0.2565  126 GLY C C   
2522 O O   . GLY C 113 ? 0.6253 1.6936 1.7288 0.1677  0.1358  0.2606  126 GLY C O   
2523 N N   . THR C 114 ? 0.8244 1.8346 1.7876 0.2167  0.1759  0.2177  127 THR C N   
2524 C CA  . THR C 114 ? 0.9150 1.9121 1.8814 0.2629  0.1558  0.1773  127 THR C CA  
2525 C C   . THR C 114 ? 0.9436 1.8171 1.8565 0.2471  0.1070  0.1542  127 THR C C   
2526 O O   . THR C 114 ? 0.8541 1.7030 1.7796 0.2714  0.0774  0.1298  127 THR C O   
2527 C CB  . THR C 114 ? 0.9673 1.9898 1.8881 0.3217  0.1890  0.1439  127 THR C CB  
2528 O OG1 . THR C 114 ? 0.9904 1.9411 1.8169 0.3133  0.1980  0.1337  127 THR C OG1 
2529 C CG2 . THR C 114 ? 0.9438 2.0924 1.9137 0.3435  0.2374  0.1625  127 THR C CG2 
2530 N N   . SER C 115 ? 0.9741 1.7715 1.8271 0.2073  0.0993  0.1636  128 SER C N   
2531 C CA  . SER C 115 ? 0.9230 1.6080 1.7181 0.1904  0.0594  0.1449  128 SER C CA  
2532 C C   . SER C 115 ? 0.8516 1.5132 1.6901 0.1590  0.0160  0.1591  128 SER C C   
2533 O O   . SER C 115 ? 0.7951 1.5186 1.7058 0.1381  0.0150  0.1883  128 SER C O   
2534 C CB  . SER C 115 ? 0.9537 1.5743 1.6737 0.1617  0.0678  0.1499  128 SER C CB  
2535 O OG  . SER C 115 ? 0.9677 1.4935 1.6455 0.1348  0.0303  0.1424  128 SER C OG  
2536 N N   . ILE C 116 ? 0.8420 1.4151 1.6359 0.1547  -0.0209 0.1399  129 ILE C N   
2537 C CA  . ILE C 116 ? 0.8191 1.3565 1.6356 0.1245  -0.0653 0.1517  129 ILE C CA  
2538 C C   . ILE C 116 ? 0.8505 1.3534 1.6453 0.0747  -0.0711 0.1750  129 ILE C C   
2539 O O   . ILE C 116 ? 0.8684 1.3600 1.6210 0.0652  -0.0436 0.1790  129 ILE C O   
2540 C CB  . ILE C 116 ? 0.8039 1.2522 1.5675 0.1322  -0.1013 0.1279  129 ILE C CB  
2541 C CG1 . ILE C 116 ? 0.7340 1.1015 1.4049 0.1183  -0.0944 0.1163  129 ILE C CG1 
2542 C CG2 . ILE C 116 ? 0.8744 1.3431 1.6577 0.1817  -0.1026 0.1033  129 ILE C CG2 
2543 C CD1 . ILE C 116 ? 0.6170 0.8957 1.2359 0.1103  -0.1311 0.1042  129 ILE C CD1 
2544 N N   . VAL C 117 ? 0.8788 1.3614 1.7005 0.0449  -0.1099 0.1888  130 VAL C N   
2545 C CA  . VAL C 117 ? 0.9445 1.3898 1.7491 -0.0011 -0.1228 0.2083  130 VAL C CA  
2546 C C   . VAL C 117 ? 0.9743 1.3301 1.7301 -0.0210 -0.1692 0.1990  130 VAL C C   
2547 O O   . VAL C 117 ? 1.0258 1.3765 1.8037 -0.0117 -0.2015 0.1933  130 VAL C O   
2548 C CB  . VAL C 117 ? 1.0049 1.5269 1.9024 -0.0258 -0.1250 0.2413  130 VAL C CB  
2549 C CG1 . VAL C 117 ? 0.9994 1.4728 1.8768 -0.0735 -0.1423 0.2598  130 VAL C CG1 
2550 C CG2 . VAL C 117 ? 0.9645 1.5856 1.9117 -0.0055 -0.0754 0.2547  130 VAL C CG2 
2551 N N   . ASN C 118 ? 0.9558 1.2421 1.6427 -0.0455 -0.1722 0.1973  131 ASN C N   
2552 C CA  . ASN C 118 ? 0.9772 1.1810 1.6099 -0.0658 -0.2128 0.1899  131 ASN C CA  
2553 C C   . ASN C 118 ? 0.9516 1.1095 1.5382 -0.0440 -0.2287 0.1690  131 ASN C C   
2554 O O   . ASN C 118 ? 0.8875 1.0281 1.4850 -0.0469 -0.2671 0.1698  131 ASN C O   
2555 C CB  . ASN C 118 ? 1.0342 1.2496 1.7220 -0.0940 -0.2532 0.2078  131 ASN C CB  
2556 C CG  . ASN C 118 ? 1.2671 1.5088 1.9922 -0.1246 -0.2449 0.2310  131 ASN C CG  
2557 O OD1 . ASN C 118 ? 1.3684 1.6174 2.0737 -0.1240 -0.2082 0.2349  131 ASN C OD1 
2558 N ND2 . ASN C 118 ? 1.3930 1.6473 2.1733 -0.1525 -0.2817 0.2479  131 ASN C ND2 
2559 N N   . LEU C 119 ? 0.9288 1.0656 1.4643 -0.0236 -0.2015 0.1522  132 LEU C N   
2560 C CA  . LEU C 119 ? 0.9232 1.0104 1.4121 -0.0075 -0.2159 0.1355  132 LEU C CA  
2561 C C   . LEU C 119 ? 1.0371 1.0466 1.4547 -0.0316 -0.2420 0.1341  132 LEU C C   
2562 O O   . LEU C 119 ? 1.1896 1.1650 1.5528 -0.0445 -0.2271 0.1301  132 LEU C O   
2563 C CB  . LEU C 119 ? 0.8636 0.9489 1.3200 0.0171  -0.1820 0.1184  132 LEU C CB  
2564 C CG  . LEU C 119 ? 0.9177 0.9465 1.3243 0.0289  -0.1955 0.1035  132 LEU C CG  
2565 C CD1 . LEU C 119 ? 0.9648 1.0014 1.4126 0.0462  -0.2257 0.1036  132 LEU C CD1 
2566 C CD2 . LEU C 119 ? 0.9267 0.9550 1.3064 0.0497  -0.1646 0.0863  132 LEU C CD2 
2567 N N   . THR C 120 ? 1.0022 0.9855 1.4187 -0.0352 -0.2813 0.1371  133 THR C N   
2568 C CA  . THR C 120 ? 1.0405 0.9529 1.3840 -0.0546 -0.3071 0.1360  133 THR C CA  
2569 C C   . THR C 120 ? 1.0065 0.8798 1.3145 -0.0415 -0.3241 0.1317  133 THR C C   
2570 O O   . THR C 120 ? 1.0889 0.9786 1.4403 -0.0276 -0.3474 0.1358  133 THR C O   
2571 C CB  . THR C 120 ? 1.0996 1.0067 1.4631 -0.0773 -0.3467 0.1472  133 THR C CB  
2572 O OG1 . THR C 120 ? 1.1225 1.0711 1.5349 -0.0912 -0.3339 0.1556  133 THR C OG1 
2573 C CG2 . THR C 120 ? 1.0973 0.9306 1.3731 -0.0952 -0.3689 0.1426  133 THR C CG2 
2574 N N   . CYS C 121 ? 1.0324 0.8557 1.2646 -0.0460 -0.3127 0.1251  134 CYS C N   
2575 C CA  . CYS C 121 ? 1.0296 0.8119 1.2239 -0.0385 -0.3268 0.1256  134 CYS C CA  
2576 C C   . CYS C 121 ? 1.0087 0.7321 1.1236 -0.0584 -0.3470 0.1314  134 CYS C C   
2577 O O   . CYS C 121 ? 1.0441 0.7522 1.1161 -0.0732 -0.3366 0.1274  134 CYS C O   
2578 C CB  . CYS C 121 ? 0.9713 0.7534 1.1520 -0.0244 -0.2938 0.1148  134 CYS C CB  
2579 S SG  . CYS C 121 ? 1.1875 1.0329 1.4483 0.0069  -0.2730 0.1043  134 CYS C SG  
2580 N N   . THR C 122 ? 1.1318 0.8214 1.2247 -0.0565 -0.3761 0.1409  135 THR C N   
2581 C CA  . THR C 122 ? 1.1878 0.8243 1.2012 -0.0732 -0.3966 0.1494  135 THR C CA  
2582 C C   . THR C 122 ? 1.1336 0.7322 1.1071 -0.0707 -0.4016 0.1600  135 THR C C   
2583 O O   . THR C 122 ? 1.2174 0.8151 1.2288 -0.0572 -0.4215 0.1664  135 THR C O   
2584 C CB  . THR C 122 ? 1.1571 0.7850 1.1789 -0.0803 -0.4432 0.1577  135 THR C CB  
2585 O OG1 . THR C 122 ? 1.1166 0.7781 1.1810 -0.0872 -0.4424 0.1507  135 THR C OG1 
2586 C CG2 . THR C 122 ? 1.2066 0.7787 1.1347 -0.0950 -0.4638 0.1648  135 THR C CG2 
2587 N N   . THR C 123 ? 1.1076 0.6760 1.0071 -0.0833 -0.3838 0.1627  136 THR C N   
2588 C CA  . THR C 123 ? 1.2150 0.7465 1.0722 -0.0875 -0.3884 0.1787  136 THR C CA  
2589 C C   . THR C 123 ? 1.3532 0.8430 1.1348 -0.1016 -0.4153 0.1952  136 THR C C   
2590 O O   . THR C 123 ? 1.4122 0.8981 1.1511 -0.1096 -0.4151 0.1883  136 THR C O   
2591 C CB  . THR C 123 ? 1.2582 0.7927 1.0908 -0.0923 -0.3467 0.1743  136 THR C CB  
2592 O OG1 . THR C 123 ? 1.2282 0.7702 1.0163 -0.1010 -0.3220 0.1642  136 THR C OG1 
2593 C CG2 . THR C 123 ? 1.2985 0.8668 1.1992 -0.0759 -0.3260 0.1590  136 THR C CG2 
2594 N N   . ASN C 124 ? 1.4052 0.8607 1.1677 -0.1034 -0.4407 0.2169  137 ASN C N   
2595 C CA  . ASN C 124 ? 1.4675 0.8816 1.1499 -0.1161 -0.4661 0.2370  137 ASN C CA  
2596 C C   . ASN C 124 ? 1.5072 0.8870 1.1487 -0.1258 -0.4641 0.2637  137 ASN C C   
2597 O O   . ASN C 124 ? 1.3557 0.7305 1.0449 -0.1194 -0.4677 0.2696  137 ASN C O   
2598 C CB  . ASN C 124 ? 1.5324 0.9352 1.2343 -0.1096 -0.5180 0.2427  137 ASN C CB  
2599 C CG  . ASN C 124 ? 1.7018 1.0626 1.3123 -0.1212 -0.5464 0.2599  137 ASN C CG  
2600 O OD1 . ASN C 124 ? 1.7292 1.0835 1.2687 -0.1308 -0.5282 0.2541  137 ASN C OD1 
2601 N ND2 . ASN C 124 ? 1.7892 1.1208 1.3980 -0.1178 -0.5921 0.2803  137 ASN C ND2 
2602 N N   . THR C 125 ? 1.5645 0.9204 1.1168 -0.1412 -0.4589 0.2802  138 THR C N   
2603 C CA  . THR C 125 ? 1.5304 0.8571 1.0399 -0.1557 -0.4543 0.3116  138 THR C CA  
2604 C C   . THR C 125 ? 1.6645 0.9451 1.1251 -0.1601 -0.5004 0.3415  138 THR C C   
2605 O O   . THR C 125 ? 1.8191 1.0895 1.2229 -0.1604 -0.5191 0.3408  138 THR C O   
2606 C CB  . THR C 125 ? 1.5295 0.8697 0.9720 -0.1703 -0.4098 0.3149  138 THR C CB  
2607 O OG1 . THR C 125 ? 1.5559 0.9371 1.0455 -0.1651 -0.3698 0.2885  138 THR C OG1 
2608 C CG2 . THR C 125 ? 1.6929 1.0089 1.0964 -0.1897 -0.4041 0.3531  138 THR C CG2 
2609 N N   . THR C 126 ? 1.6731 0.9222 1.1549 -0.1626 -0.5221 0.3669  139 THR C N   
2610 C CA  . THR C 126 ? 1.8511 1.0703 1.3000 -0.1663 -0.5545 0.3879  139 THR C CA  
2611 C C   . THR C 126 ? 1.9202 1.1222 1.3422 -0.1856 -0.5373 0.4172  139 THR C C   
2612 O O   . THR C 126 ? 1.8367 1.0499 1.2744 -0.1958 -0.5049 0.4203  139 THR C O   
2613 C CB  . THR C 126 ? 1.8397 1.0518 1.3630 -0.1464 -0.5980 0.3793  139 THR C CB  
2614 O OG1 . THR C 126 ? 1.8878 1.0979 1.4808 -0.1392 -0.5937 0.3770  139 THR C OG1 
2615 C CG2 . THR C 126 ? 1.8026 1.0413 1.3673 -0.1291 -0.6144 0.3530  139 THR C CG2 
2616 N N   . GLU C 127 ? 2.0789 1.2548 1.4627 -0.1917 -0.5602 0.4397  140 GLU C N   
2617 C CA  . GLU C 127 ? 2.1229 1.2823 1.4816 -0.2120 -0.5471 0.4723  140 GLU C CA  
2618 C C   . GLU C 127 ? 2.0859 1.2215 1.5172 -0.2074 -0.5707 0.4763  140 GLU C C   
2619 O O   . GLU C 127 ? 2.0039 1.1232 1.4751 -0.1889 -0.6101 0.4665  140 GLU C O   
2620 C CB  . GLU C 127 ? 2.2100 1.3521 1.4848 -0.2211 -0.5572 0.4980  140 GLU C CB  
2621 C CG  . GLU C 127 ? 2.3101 1.4769 1.4999 -0.2314 -0.5187 0.5027  140 GLU C CG  
2622 C CD  . GLU C 127 ? 2.4565 1.6093 1.5622 -0.2301 -0.5346 0.5162  140 GLU C CD  
2623 O OE1 . GLU C 127 ? 2.5549 1.6829 1.6714 -0.2177 -0.5795 0.5111  140 GLU C OE1 
2624 O OE2 . GLU C 127 ? 2.4539 1.6235 1.4835 -0.2396 -0.5018 0.5311  140 GLU C OE2 
2625 N N   . ASP C 128 ? 2.0859 1.2210 1.5353 -0.2237 -0.5471 0.4893  141 ASP C N   
2626 C CA  . ASP C 128 ? 2.0850 1.1949 1.6008 -0.2195 -0.5682 0.4894  141 ASP C CA  
2627 C C   . ASP C 128 ? 2.1062 1.1810 1.5921 -0.2388 -0.5828 0.5271  141 ASP C C   
2628 O O   . ASP C 128 ? 2.0544 1.1340 1.5112 -0.2652 -0.5551 0.5535  141 ASP C O   
2629 C CB  . ASP C 128 ? 2.0451 1.1734 1.6092 -0.2239 -0.5391 0.4753  141 ASP C CB  
2630 C CG  . ASP C 128 ? 2.1324 1.2419 1.7771 -0.2040 -0.5650 0.4545  141 ASP C CG  
2631 O OD1 . ASP C 128 ? 2.0666 1.1856 1.7525 -0.2053 -0.5470 0.4409  141 ASP C OD1 
2632 O OD2 . ASP C 128 ? 2.2623 1.3484 1.9282 -0.1853 -0.6039 0.4500  141 ASP C OD2 
2633 N N   . ASN C 129 ? 2.1778 1.2197 1.6733 -0.2256 -0.6264 0.5308  142 ASN C N   
2634 C CA  . ASN C 129 ? 2.3985 1.4006 1.8692 -0.2415 -0.6464 0.5669  142 ASN C CA  
2635 C C   . ASN C 129 ? 2.4953 1.4653 2.0369 -0.2333 -0.6737 0.5596  142 ASN C C   
2636 O O   . ASN C 129 ? 2.5878 1.5247 2.1234 -0.2514 -0.6842 0.5883  142 ASN C O   
2637 C CB  . ASN C 129 ? 2.4990 1.4809 1.9237 -0.2329 -0.6792 0.5786  142 ASN C CB  
2638 C CG  . ASN C 129 ? 2.4871 1.4983 1.8421 -0.2347 -0.6587 0.5771  142 ASN C CG  
2639 O OD1 . ASN C 129 ? 2.5762 1.5922 1.8583 -0.2545 -0.6352 0.6056  142 ASN C OD1 
2640 N ND2 . ASN C 129 ? 2.3249 1.3571 1.7022 -0.2127 -0.6677 0.5433  142 ASN C ND2 
2641 N N   . TYR C 130 ? 2.5538 1.5349 2.1620 -0.2046 -0.6850 0.5205  143 TYR C N   
2642 C CA  . TYR C 130 ? 2.6923 1.6478 2.3695 -0.1892 -0.7091 0.5040  143 TYR C CA  
2643 C C   . TYR C 130 ? 2.7059 1.6589 2.3982 -0.2115 -0.6848 0.5114  143 TYR C C   
2644 O O   . TYR C 130 ? 2.8001 1.7185 2.5293 -0.2104 -0.7071 0.5113  143 TYR C O   
2645 C CB  . TYR C 130 ? 2.7076 1.6889 2.4484 -0.1516 -0.7164 0.4590  143 TYR C CB  
2646 C CG  . TYR C 130 ? 2.7757 1.7428 2.5870 -0.1308 -0.7300 0.4327  143 TYR C CG  
2647 C CD1 . TYR C 130 ? 2.8717 1.8051 2.7185 -0.1076 -0.7727 0.4249  143 TYR C CD1 
2648 C CD2 . TYR C 130 ? 2.7194 1.7067 2.5598 -0.1320 -0.7009 0.4132  143 TYR C CD2 
2649 C CE1 . TYR C 130 ? 2.8881 1.8076 2.7941 -0.0851 -0.7856 0.3973  143 TYR C CE1 
2650 C CE2 . TYR C 130 ? 2.7460 1.7191 2.6450 -0.1105 -0.7145 0.3860  143 TYR C CE2 
2651 C CZ  . TYR C 130 ? 2.8467 1.7858 2.7768 -0.0864 -0.7565 0.3773  143 TYR C CZ  
2652 O OH  . TYR C 130 ? 2.8848 1.8087 2.8680 -0.0619 -0.7705 0.3471  143 TYR C OH  
2653 N N   . SER C 131 ? 2.5957 1.5852 2.2599 -0.2314 -0.6408 0.5169  144 SER C N   
2654 C CA  . SER C 131 ? 2.4938 1.4911 2.1785 -0.2524 -0.6148 0.5207  144 SER C CA  
2655 C C   . SER C 131 ? 2.5666 1.5842 2.1928 -0.2899 -0.5779 0.5585  144 SER C C   
2656 O O   . SER C 131 ? 2.5962 1.6520 2.1818 -0.2931 -0.5461 0.5577  144 SER C O   
2657 C CB  . SER C 131 ? 2.2952 1.3275 2.0242 -0.2338 -0.5927 0.4805  144 SER C CB  
2658 O OG  . SER C 131 ? 2.2399 1.2830 1.9871 -0.2549 -0.5672 0.4833  144 SER C OG  
2659 N N   . ARG C 132 ? 2.5718 1.5653 2.1950 -0.3172 -0.5823 0.5914  145 ARG C N   
2660 C CA  . ARG C 132 ? 2.5645 1.5845 2.1438 -0.3534 -0.5438 0.6285  145 ARG C CA  
2661 C C   . ARG C 132 ? 2.6011 1.6591 2.2168 -0.3651 -0.5083 0.6144  145 ARG C C   
2662 O O   . ARG C 132 ? 2.6718 1.7657 2.2616 -0.3925 -0.4697 0.6390  145 ARG C O   
2663 C CB  . ARG C 132 ? 2.5870 1.5688 2.1556 -0.3802 -0.5624 0.6721  145 ARG C CB  
2664 C CG  . ARG C 132 ? 2.6542 1.5977 2.1794 -0.3730 -0.5958 0.6932  145 ARG C CG  
2665 C CD  . ARG C 132 ? 2.7831 1.6858 2.3017 -0.4009 -0.6147 0.7379  145 ARG C CD  
2666 N NE  . ARG C 132 ? 2.8676 1.7292 2.3450 -0.3935 -0.6497 0.7592  145 ARG C NE  
2667 C CZ  . ARG C 132 ? 2.9187 1.7342 2.3870 -0.4124 -0.6757 0.7976  145 ARG C CZ  
2668 N NH1 . ARG C 132 ? 2.9888 1.7679 2.4177 -0.4031 -0.7079 0.8154  145 ARG C NH1 
2669 N NH2 . ARG C 132 ? 2.9132 1.7181 2.4127 -0.4413 -0.6713 0.8189  145 ARG C NH2 
2670 N N   . LEU C 133 ? 2.5410 1.5937 2.2175 -0.3425 -0.5211 0.5742  146 LEU C N   
2671 C CA  . LEU C 133 ? 2.4259 1.5089 2.1425 -0.3505 -0.4940 0.5568  146 LEU C CA  
2672 C C   . LEU C 133 ? 2.3751 1.5134 2.0640 -0.3487 -0.4497 0.5453  146 LEU C C   
2673 O O   . LEU C 133 ? 2.3714 1.5471 2.0657 -0.3694 -0.4145 0.5515  146 LEU C O   
2674 C CB  . LEU C 133 ? 2.3579 1.4172 2.1410 -0.3218 -0.5220 0.5145  146 LEU C CB  
2675 C CG  . LEU C 133 ? 2.3177 1.3710 2.1522 -0.3356 -0.5231 0.5072  146 LEU C CG  
2676 C CD1 . LEU C 133 ? 2.2089 1.2915 2.0807 -0.3148 -0.5054 0.4638  146 LEU C CD1 
2677 C CD2 . LEU C 133 ? 2.3282 1.4018 2.1456 -0.3807 -0.4969 0.5493  146 LEU C CD2 
2678 N N   . ARG C 134 ? 2.3662 1.5099 2.0272 -0.3240 -0.4534 0.5286  147 ARG C N   
2679 C CA  . ARG C 134 ? 2.2848 1.4741 1.9187 -0.3185 -0.4172 0.5138  147 ARG C CA  
2680 C C   . ARG C 134 ? 2.2650 1.4614 1.8268 -0.3142 -0.4138 0.5261  147 ARG C C   
2681 O O   . ARG C 134 ? 2.1823 1.3462 1.7249 -0.3065 -0.4463 0.5366  147 ARG C O   
2682 C CB  . ARG C 134 ? 2.1867 1.3811 1.8700 -0.2879 -0.4233 0.4689  147 ARG C CB  
2683 C CG  . ARG C 134 ? 2.2150 1.3769 1.9245 -0.2558 -0.4660 0.4486  147 ARG C CG  
2684 C CD  . ARG C 134 ? 2.2016 1.3654 1.9786 -0.2278 -0.4735 0.4074  147 ARG C CD  
2685 N NE  . ARG C 134 ? 2.2910 1.4430 2.1095 -0.2385 -0.4741 0.4040  147 ARG C NE  
2686 C CZ  . ARG C 134 ? 2.3299 1.5085 2.1650 -0.2503 -0.4443 0.3950  147 ARG C CZ  
2687 N NH1 . ARG C 134 ? 2.3330 1.4977 2.2071 -0.2603 -0.4514 0.3913  147 ARG C NH1 
2688 N NH2 . ARG C 134 ? 2.3161 1.5340 2.1286 -0.2522 -0.4099 0.3889  147 ARG C NH2 
2689 N N   . SER C 135 ? 2.3338 1.5721 1.8545 -0.3180 -0.3759 0.5229  148 SER C N   
2690 C CA  . SER C 135 ? 2.3793 1.6259 1.8279 -0.3096 -0.3725 0.5258  148 SER C CA  
2691 C C   . SER C 135 ? 2.2821 1.5323 1.7447 -0.2811 -0.3829 0.4878  148 SER C C   
2692 O O   . SER C 135 ? 2.2157 1.4904 1.7053 -0.2758 -0.3610 0.4653  148 SER C O   
2693 C CB  . SER C 135 ? 2.3405 1.6318 1.7269 -0.3279 -0.3249 0.5442  148 SER C CB  
2694 O OG  . SER C 135 ? 2.2870 1.5786 1.6551 -0.3535 -0.3157 0.5842  148 SER C OG  
2695 N N   . TYR C 136 ? 2.1641 1.3903 1.6116 -0.2635 -0.4180 0.4824  149 TYR C N   
2696 C CA  . TYR C 136 ? 1.9042 1.1353 1.3637 -0.2377 -0.4326 0.4506  149 TYR C CA  
2697 C C   . TYR C 136 ? 1.7479 0.9758 1.2947 -0.2165 -0.4485 0.4218  149 TYR C C   
2698 O O   . TYR C 136 ? 1.7674 1.0032 1.3582 -0.2206 -0.4311 0.4147  149 TYR C O   
2699 C CB  . TYR C 136 ? 1.7214 0.9856 1.1303 -0.2387 -0.3986 0.4388  149 TYR C CB  
2700 C CG  . TYR C 136 ? 1.7875 1.0628 1.1065 -0.2537 -0.3775 0.4612  149 TYR C CG  
2701 C CD1 . TYR C 136 ? 1.8805 1.1384 1.1432 -0.2467 -0.4022 0.4665  149 TYR C CD1 
2702 C CD2 . TYR C 136 ? 1.7377 1.0451 1.0301 -0.2730 -0.3323 0.4761  149 TYR C CD2 
2703 C CE1 . TYR C 136 ? 1.9099 1.1791 1.0874 -0.2561 -0.3818 0.4847  149 TYR C CE1 
2704 C CE2 . TYR C 136 ? 1.7481 1.0731 0.9601 -0.2823 -0.3093 0.4954  149 TYR C CE2 
2705 C CZ  . TYR C 136 ? 1.9276 1.2321 1.0796 -0.2726 -0.3337 0.4990  149 TYR C CZ  
2706 O OH  . TYR C 136 ? 1.8859 1.2096 0.9546 -0.2776 -0.3093 0.5163  149 TYR C OH  
2707 N N   . GLN C 137 ? 1.7219 0.9422 1.2946 -0.1924 -0.4816 0.4044  150 GLN C N   
2708 C CA  . GLN C 137 ? 1.7486 0.9765 1.4016 -0.1664 -0.4938 0.3747  150 GLN C CA  
2709 C C   . GLN C 137 ? 1.7207 0.9965 1.3818 -0.1555 -0.4667 0.3436  150 GLN C C   
2710 O O   . GLN C 137 ? 1.8418 1.1321 1.4449 -0.1641 -0.4526 0.3449  150 GLN C O   
2711 C CB  . GLN C 137 ? 1.9068 1.1193 1.5955 -0.1443 -0.5388 0.3686  150 GLN C CB  
2712 C CG  . GLN C 137 ? 2.1403 1.3162 1.8303 -0.1502 -0.5644 0.3884  150 GLN C CG  
2713 C CD  . GLN C 137 ? 2.2722 1.4330 1.9645 -0.1356 -0.6068 0.3908  150 GLN C CD  
2714 O OE1 . GLN C 137 ? 2.2331 1.4081 1.9008 -0.1312 -0.6152 0.3866  150 GLN C OE1 
2715 N NE2 . GLN C 137 ? 2.3939 1.5246 2.1162 -0.1281 -0.6361 0.3965  150 GLN C NE2 
2716 N N   . VAL C 138 ? 1.5394 0.8458 1.2734 -0.1348 -0.4565 0.3111  151 VAL C N   
2717 C CA  . VAL C 138 ? 1.4953 0.8529 1.2517 -0.1215 -0.4338 0.2789  151 VAL C CA  
2718 C C   . VAL C 138 ? 1.3990 0.7741 1.2334 -0.0927 -0.4549 0.2573  151 VAL C C   
2719 O O   . VAL C 138 ? 1.3177 0.6919 1.2045 -0.0777 -0.4565 0.2466  151 VAL C O   
2720 C CB  . VAL C 138 ? 1.5129 0.9076 1.2750 -0.1268 -0.3851 0.2604  151 VAL C CB  
2721 C CG1 . VAL C 138 ? 1.1581 0.6001 0.9517 -0.1111 -0.3667 0.2291  151 VAL C CG1 
2722 C CG2 . VAL C 138 ? 1.2585 0.6497 0.9469 -0.1521 -0.3602 0.2795  151 VAL C CG2 
2723 N N   . SER C 139 ? 1.3068 0.6993 1.1491 -0.0843 -0.4723 0.2506  152 SER C N   
2724 C CA  . SER C 139 ? 1.2884 0.7083 1.2087 -0.0575 -0.4917 0.2335  152 SER C CA  
2725 C C   . SER C 139 ? 1.2829 0.7628 1.2462 -0.0484 -0.4591 0.2056  152 SER C C   
2726 O O   . SER C 139 ? 1.2345 0.7289 1.1611 -0.0631 -0.4325 0.2002  152 SER C O   
2727 C CB  . SER C 139 ? 1.3399 0.7444 1.2562 -0.0542 -0.5383 0.2472  152 SER C CB  
2728 O OG  . SER C 139 ? 1.5084 0.9134 1.3666 -0.0723 -0.5369 0.2513  152 SER C OG  
2729 N N   . LEU C 140 ? 1.2877 0.8025 1.3278 -0.0226 -0.4614 0.1886  153 LEU C N   
2730 C CA  . LEU C 140 ? 1.2762 0.8508 1.3608 -0.0135 -0.4302 0.1664  153 LEU C CA  
2731 C C   . LEU C 140 ? 1.2245 0.8425 1.3811 0.0057  -0.4504 0.1607  153 LEU C C   
2732 O O   . LEU C 140 ? 1.1951 0.8215 1.4045 0.0314  -0.4677 0.1563  153 LEU C O   
2733 C CB  . LEU C 140 ? 1.2305 0.8213 1.3378 -0.0004 -0.3972 0.1487  153 LEU C CB  
2734 C CG  . LEU C 140 ? 1.1198 0.7713 1.2671 0.0101  -0.3619 0.1280  153 LEU C CG  
2735 C CD1 . LEU C 140 ? 1.1378 0.7982 1.2449 -0.0133 -0.3421 0.1304  153 LEU C CD1 
2736 C CD2 . LEU C 140 ? 0.9332 0.5924 1.0917 0.0242  -0.3347 0.1106  153 LEU C CD2 
2737 N N   . HIS C 141 ? 1.1102 0.7565 1.2713 -0.0064 -0.4491 0.1605  154 HIS C N   
2738 C CA  . HIS C 141 ? 1.0936 0.7906 1.3297 0.0062  -0.4662 0.1580  154 HIS C CA  
2739 C C   . HIS C 141 ? 1.0987 0.8545 1.3728 0.0046  -0.4295 0.1458  154 HIS C C   
2740 O O   . HIS C 141 ? 1.0414 0.7908 1.2769 -0.0176 -0.4159 0.1459  154 HIS C O   
2741 C CB  . HIS C 141 ? 1.1545 0.8307 1.3710 -0.0096 -0.5091 0.1729  154 HIS C CB  
2742 C CG  . HIS C 141 ? 1.2454 0.9762 1.5453 -0.0002 -0.5316 0.1731  154 HIS C CG  
2743 N ND1 . HIS C 141 ? 1.2875 1.0620 1.6695 0.0301  -0.5374 0.1683  154 HIS C ND1 
2744 C CD2 . HIS C 141 ? 1.2482 0.9995 1.5657 -0.0169 -0.5510 0.1774  154 HIS C CD2 
2745 C CE1 . HIS C 141 ? 1.2883 1.1152 1.7388 0.0308  -0.5565 0.1720  154 HIS C CE1 
2746 N NE2 . HIS C 141 ? 1.2746 1.0866 1.6891 0.0005  -0.5668 0.1782  154 HIS C NE2 
2747 N N   . CYS C 142 ? 1.1226 0.9346 1.4699 0.0298  -0.4137 0.1355  155 CYS C N   
2748 C CA  . CYS C 142 ? 1.0636 0.9345 1.4474 0.0294  -0.3767 0.1279  155 CYS C CA  
2749 C C   . CYS C 142 ? 0.9969 0.9397 1.4719 0.0410  -0.3850 0.1319  155 CYS C C   
2750 O O   . CYS C 142 ? 0.9879 0.9544 1.5154 0.0679  -0.4018 0.1297  155 CYS C O   
2751 C CB  . CYS C 142 ? 1.0468 0.9288 1.4258 0.0478  -0.3372 0.1117  155 CYS C CB  
2752 S SG  . CYS C 142 ? 1.4288 1.2489 1.7142 0.0279  -0.3166 0.1081  155 CYS C SG  
2753 N N   . THR C 143 ? 0.9482 0.9260 1.4440 0.0208  -0.3734 0.1384  156 THR C N   
2754 C CA  . THR C 143 ? 0.9338 0.9885 1.5218 0.0249  -0.3773 0.1468  156 THR C CA  
2755 C C   . THR C 143 ? 0.9066 1.0197 1.5252 0.0231  -0.3314 0.1468  156 THR C C   
2756 O O   . THR C 143 ? 0.9500 1.0345 1.5127 0.0095  -0.3055 0.1425  156 THR C O   
2757 C CB  . THR C 143 ? 0.9950 1.0398 1.5933 -0.0040 -0.4187 0.1618  156 THR C CB  
2758 O OG1 . THR C 143 ? 1.0579 1.0346 1.5691 -0.0323 -0.4225 0.1611  156 THR C OG1 
2759 C CG2 . THR C 143 ? 0.9592 0.9869 1.5739 0.0079  -0.4673 0.1662  156 THR C CG2 
2760 N N   . TRP C 144 ? 0.8345 1.0321 1.5425 0.0376  -0.3215 0.1531  157 TRP C N   
2761 C CA  . TRP C 144 ? 0.8343 1.0956 1.5768 0.0348  -0.2783 0.1591  157 TRP C CA  
2762 C C   . TRP C 144 ? 0.8331 1.1916 1.6832 0.0404  -0.2785 0.1750  157 TRP C C   
2763 O O   . TRP C 144 ? 0.8442 1.2239 1.7453 0.0530  -0.3106 0.1769  157 TRP C O   
2764 C CB  . TRP C 144 ? 0.8377 1.1064 1.5521 0.0653  -0.2365 0.1409  157 TRP C CB  
2765 C CG  . TRP C 144 ? 0.9184 1.2173 1.6700 0.1094  -0.2381 0.1258  157 TRP C CG  
2766 C CD1 . TRP C 144 ? 0.8697 1.2592 1.6991 0.1394  -0.2185 0.1256  157 TRP C CD1 
2767 C CD2 . TRP C 144 ? 0.9462 1.1833 1.6581 0.1302  -0.2609 0.1086  157 TRP C CD2 
2768 N NE1 . TRP C 144 ? 0.8761 1.2606 1.7147 0.1812  -0.2294 0.1052  157 TRP C NE1 
2769 C CE2 . TRP C 144 ? 0.9343 1.2223 1.7024 0.1746  -0.2572 0.0956  157 TRP C CE2 
2770 C CE3 . TRP C 144 ? 0.9096 1.0546 1.5446 0.1155  -0.2837 0.1044  157 TRP C CE3 
2771 C CZ2 . TRP C 144 ? 0.9525 1.1930 1.7018 0.2039  -0.2801 0.0777  157 TRP C CZ2 
2772 C CZ3 . TRP C 144 ? 0.8339 0.9366 1.4525 0.1407  -0.3041 0.0912  157 TRP C CZ3 
2773 C CH2 . TRP C 144 ? 0.8988 1.0448 1.5743 0.1841  -0.3043 0.0775  157 TRP C CH2 
2774 N N   . LEU C 145 ? 0.8509 1.2710 1.7373 0.0306  -0.2427 0.1884  158 LEU C N   
2775 C CA  . LEU C 145 ? 0.7545 1.2809 1.7484 0.0350  -0.2340 0.2073  158 LEU C CA  
2776 C C   . LEU C 145 ? 0.6554 1.2545 1.6749 0.0769  -0.1850 0.1980  158 LEU C C   
2777 O O   . LEU C 145 ? 0.6806 1.2440 1.6321 0.0931  -0.1575 0.1801  158 LEU C O   
2778 C CB  . LEU C 145 ? 0.8147 1.3642 1.8402 -0.0106 -0.2327 0.2358  158 LEU C CB  
2779 C CG  . LEU C 145 ? 0.8574 1.3736 1.9021 -0.0483 -0.2877 0.2488  158 LEU C CG  
2780 C CD1 . LEU C 145 ? 0.9748 1.3728 1.9151 -0.0607 -0.3194 0.2315  158 LEU C CD1 
2781 C CD2 . LEU C 145 ? 0.7949 1.3458 1.8879 -0.0909 -0.2848 0.2782  158 LEU C CD2 
2782 N N   . VAL C 146 ? 0.7035 1.4066 1.8206 0.0958  -0.1749 0.2090  159 VAL C N   
2783 C CA  . VAL C 146 ? 0.7597 1.5370 1.9017 0.1440  -0.1311 0.1962  159 VAL C CA  
2784 C C   . VAL C 146 ? 0.7659 1.5908 1.8981 0.1362  -0.0774 0.2102  159 VAL C C   
2785 O O   . VAL C 146 ? 0.7013 1.5152 1.7779 0.1648  -0.0448 0.1902  159 VAL C O   
2786 C CB  . VAL C 146 ? 0.7487 1.6304 2.0016 0.1724  -0.1365 0.2022  159 VAL C CB  
2787 C CG1 . VAL C 146 ? 0.7596 1.6979 2.0210 0.2339  -0.0996 0.1774  159 VAL C CG1 
2788 C CG2 . VAL C 146 ? 0.6198 1.4561 1.8900 0.1720  -0.1963 0.1962  159 VAL C CG2 
2789 N N   . GLY C 147 ? 0.8127 1.6883 1.9990 0.0965  -0.0711 0.2459  160 GLY C N   
2790 C CA  . GLY C 147 ? 0.8430 1.7661 2.0258 0.0847  -0.0227 0.2669  160 GLY C CA  
2791 C C   . GLY C 147 ? 0.9602 2.0171 2.2542 0.0823  0.0025  0.3002  160 GLY C C   
2792 O O   . GLY C 147 ? 0.9589 2.0914 2.3266 0.1141  0.0000  0.2950  160 GLY C O   
2793 N N   . THR C 148 ? 1.0125 2.1004 2.3210 0.0448  0.0268  0.3359  161 THR C N   
2794 C CA  . THR C 148 ? 1.1068 2.3163 2.5142 0.0327  0.0522  0.3730  161 THR C CA  
2795 C C   . THR C 148 ? 1.1286 2.4188 2.5305 0.0859  0.1049  0.3564  161 THR C C   
2796 O O   . THR C 148 ? 1.1279 2.4935 2.5890 0.1033  0.1110  0.3539  161 THR C O   
2797 C CB  . THR C 148 ? 1.1778 2.3783 2.5803 -0.0231 0.0640  0.4140  161 THR C CB  
2798 O OG1 . THR C 148 ? 1.2116 2.3269 2.6105 -0.0716 0.0106  0.4228  161 THR C OG1 
2799 C CG2 . THR C 148 ? 1.1726 2.4630 2.6399 -0.0388 0.0861  0.4435  161 THR C CG2 
2800 N N   . ASP C 149 ? 1.1155 2.3877 2.4434 0.1123  0.1409  0.3425  162 ASP C N   
2801 C CA  . ASP C 149 ? 1.1076 2.4414 2.4116 0.1636  0.1883  0.3210  162 ASP C CA  
2802 C C   . ASP C 149 ? 0.9338 2.2474 2.2167 0.2237  0.1759  0.2707  162 ASP C C   
2803 O O   . ASP C 149 ? 0.8884 2.2300 2.1363 0.2715  0.2078  0.2420  162 ASP C O   
2804 C CB  . ASP C 149 ? 1.2503 2.5699 2.4762 0.1635  0.2304  0.3288  162 ASP C CB  
2805 C CG  . ASP C 149 ? 1.3787 2.7248 2.6239 0.1103  0.2475  0.3795  162 ASP C CG  
2806 O OD1 . ASP C 149 ? 1.4421 2.7950 2.7540 0.0656  0.2189  0.4081  162 ASP C OD1 
2807 O OD2 . ASP C 149 ? 1.4259 2.7804 2.6164 0.1133  0.2860  0.3905  162 ASP C OD2 
2808 N N   . ALA C 150 ? 0.8612 2.1176 2.1613 0.2202  0.1259  0.2598  163 ALA C N   
2809 C CA  . ALA C 150 ? 0.8463 2.0725 2.1299 0.2739  0.1061  0.2159  163 ALA C CA  
2810 C C   . ALA C 150 ? 0.9593 2.2656 2.3008 0.3106  0.1133  0.1984  163 ALA C C   
2811 O O   . ALA C 150 ? 0.9609 2.3168 2.3791 0.2873  0.0967  0.2192  163 ALA C O   
2812 C CB  . ALA C 150 ? 0.7450 1.8654 2.0086 0.2507  0.0456  0.2062  163 ALA C CB  
2813 N N   . PRO C 151 ? 0.9966 2.3129 2.3014 0.3680  0.1365  0.1583  164 PRO C N   
2814 C CA  . PRO C 151 ? 1.0317 2.4169 2.3879 0.4107  0.1447  0.1343  164 PRO C CA  
2815 C C   . PRO C 151 ? 1.0912 2.4702 2.5119 0.4192  0.0925  0.1254  164 PRO C C   
2816 O O   . PRO C 151 ? 1.0915 2.3985 2.5018 0.3975  0.0483  0.1332  164 PRO C O   
2817 C CB  . PRO C 151 ? 1.0395 2.3849 2.3231 0.4666  0.1623  0.0878  164 PRO C CB  
2818 C CG  . PRO C 151 ? 1.0058 2.3085 2.2054 0.4466  0.1871  0.0979  164 PRO C CG  
2819 C CD  . PRO C 151 ? 0.9866 2.2460 2.1956 0.3934  0.1575  0.1328  164 PRO C CD  
2820 N N   . GLU C 152 ? 1.1324 2.5838 2.6178 0.4505  0.0971  0.1104  165 GLU C N   
2821 C CA  . GLU C 152 ? 1.1242 2.5795 2.6727 0.4618  0.0473  0.1016  165 GLU C CA  
2822 C C   . GLU C 152 ? 1.1355 2.5217 2.6539 0.5190  0.0193  0.0538  165 GLU C C   
2823 O O   . GLU C 152 ? 1.2137 2.5767 2.7561 0.5333  -0.0310 0.0432  165 GLU C O   
2824 C CB  . GLU C 152 ? 1.1253 2.6962 2.7682 0.4669  0.0641  0.1098  165 GLU C CB  
2825 C CG  . GLU C 152 ? 1.1193 2.7589 2.7948 0.4109  0.0961  0.1587  165 GLU C CG  
2826 C CD  . GLU C 152 ? 1.1990 2.9581 2.9474 0.4260  0.1347  0.1631  165 GLU C CD  
2827 O OE1 . GLU C 152 ? 1.1998 3.0093 2.9416 0.4017  0.1820  0.1918  165 GLU C OE1 
2828 O OE2 . GLU C 152 ? 1.2404 3.0425 3.0525 0.4625  0.1174  0.1396  165 GLU C OE2 
2829 N N   . ASP C 153 ? 1.1068 2.2051 2.5276 0.6068  0.0909  -0.0217 166 ASP C N   
2830 C CA  . ASP C 153 ? 1.0685 2.1084 2.4673 0.6506  0.1015  -0.0416 166 ASP C CA  
2831 C C   . ASP C 153 ? 1.0017 1.9412 2.3227 0.6352  0.0917  -0.0434 166 ASP C C   
2832 O O   . ASP C 153 ? 1.0101 1.8748 2.3131 0.6592  0.0925  -0.0581 166 ASP C O   
2833 C CB  . ASP C 153 ? 1.1135 2.2172 2.5161 0.6898  0.1562  -0.0764 166 ASP C CB  
2834 C CG  . ASP C 153 ? 1.0886 2.1883 2.4149 0.6690  0.1910  -0.0938 166 ASP C CG  
2835 O OD1 . ASP C 153 ? 1.0878 2.2426 2.4257 0.6241  0.1898  -0.1091 166 ASP C OD1 
2836 O OD2 . ASP C 153 ? 0.9935 2.0187 2.2764 0.6889  0.2208  -0.0970 166 ASP C OD2 
2837 N N   . THR C 154 ? 0.9315 1.8653 2.2122 0.5922  0.0806  -0.0311 167 THR C N   
2838 C CA  . THR C 154 ? 0.9174 1.7690 2.1262 0.5761  0.0754  -0.0355 167 THR C CA  
2839 C C   . THR C 154 ? 0.9217 1.6706 2.1159 0.5654  0.0288  -0.0186 167 THR C C   
2840 O O   . THR C 154 ? 0.9102 1.6515 2.1400 0.5565  -0.0056 0.0078  167 THR C O   
2841 C CB  . THR C 154 ? 0.9055 1.7837 2.0789 0.5330  0.0769  -0.0277 167 THR C CB  
2842 O OG1 . THR C 154 ? 0.9219 1.7185 2.0308 0.5176  0.0675  -0.0292 167 THR C OG1 
2843 C CG2 . THR C 154 ? 0.9333 1.8287 2.1362 0.4971  0.0421  0.0099  167 THR C CG2 
2844 N N   . GLN C 155 ? 0.9230 1.5926 2.0634 0.5633  0.0269  -0.0349 168 GLN C N   
2845 C CA  . GLN C 155 ? 0.9451 1.5183 2.0643 0.5501  -0.0177 -0.0239 168 GLN C CA  
2846 C C   . GLN C 155 ? 0.9698 1.4923 2.0219 0.5189  -0.0266 -0.0243 168 GLN C C   
2847 O O   . GLN C 155 ? 0.9528 1.4922 1.9726 0.5180  0.0055  -0.0456 168 GLN C O   
2848 C CB  . GLN C 155 ? 0.8877 1.4033 2.0178 0.5838  -0.0200 -0.0488 168 GLN C CB  
2849 C CG  . GLN C 155 ? 0.9249 1.3463 2.0398 0.5699  -0.0697 -0.0356 168 GLN C CG  
2850 C CD  . GLN C 155 ? 1.0504 1.4786 2.1989 0.5503  -0.1077 0.0042  168 GLN C CD  
2851 O OE1 . GLN C 155 ? 1.0331 1.4651 2.1573 0.5154  -0.1248 0.0301  168 GLN C OE1 
2852 N NE2 . GLN C 155 ? 1.1082 1.5349 2.3117 0.5721  -0.1220 0.0084  168 GLN C NE2 
2853 N N   . TYR C 156 ? 1.0170 1.4790 2.0473 0.4924  -0.0696 -0.0007 169 TYR C N   
2854 C CA  . TYR C 156 ? 0.9545 1.3688 1.9233 0.4636  -0.0812 0.0008  169 TYR C CA  
2855 C C   . TYR C 156 ? 1.0314 1.3510 1.9665 0.4645  -0.1081 -0.0089 169 TYR C C   
2856 O O   . TYR C 156 ? 0.9684 1.2523 1.9276 0.4763  -0.1315 -0.0035 169 TYR C O   
2857 C CB  . TYR C 156 ? 0.8924 1.3172 1.8499 0.4264  -0.1078 0.0371  169 TYR C CB  
2858 C CG  . TYR C 156 ? 0.8503 1.3605 1.8283 0.4162  -0.0862 0.0471  169 TYR C CG  
2859 C CD1 . TYR C 156 ? 0.7874 1.3362 1.7449 0.4119  -0.0527 0.0308  169 TYR C CD1 
2860 C CD2 . TYR C 156 ? 0.7224 1.2720 1.7393 0.4074  -0.1019 0.0736  169 TYR C CD2 
2861 C CE1 . TYR C 156 ? 0.6239 1.2497 1.5992 0.3979  -0.0366 0.0416  169 TYR C CE1 
2862 C CE2 . TYR C 156 ? 0.7725 1.3957 1.8074 0.3941  -0.0864 0.0832  169 TYR C CE2 
2863 C CZ  . TYR C 156 ? 0.8137 1.4749 1.8276 0.3884  -0.0547 0.0675  169 TYR C CZ  
2864 O OH  . TYR C 156 ? 0.8983 1.6292 1.9301 0.3699  -0.0425 0.0783  169 TYR C OH  
2865 N N   . PHE C 157 ? 1.0701 1.3504 1.9505 0.4503  -0.1064 -0.0222 170 PHE C N   
2866 C CA  . PHE C 157 ? 1.1328 1.3244 1.9740 0.4459  -0.1342 -0.0289 170 PHE C CA  
2867 C C   . PHE C 157 ? 1.0237 1.1842 1.8113 0.4113  -0.1542 -0.0128 170 PHE C C   
2868 O O   . PHE C 157 ? 0.8864 1.0767 1.6474 0.3989  -0.1321 -0.0205 170 PHE C O   
2869 C CB  . PHE C 157 ? 1.2478 1.4110 2.0705 0.4707  -0.1107 -0.0712 170 PHE C CB  
2870 C CG  . PHE C 157 ? 1.2884 1.4898 2.1575 0.5070  -0.0825 -0.0927 170 PHE C CG  
2871 C CD1 . PHE C 157 ? 1.2646 1.5333 2.1399 0.5206  -0.0359 -0.1145 170 PHE C CD1 
2872 C CD2 . PHE C 157 ? 1.3717 1.5437 2.2776 0.5268  -0.1026 -0.0903 170 PHE C CD2 
2873 C CE1 . PHE C 157 ? 1.2717 1.5785 2.1864 0.5546  -0.0074 -0.1336 170 PHE C CE1 
2874 C CE2 . PHE C 157 ? 1.3677 1.5765 2.3182 0.5629  -0.0758 -0.1110 170 PHE C CE2 
2875 C CZ  . PHE C 157 ? 1.3363 1.6132 2.2900 0.5777  -0.0270 -0.1328 170 PHE C CZ  
2876 N N   . LEU C 158 ? 1.0981 1.2000 1.8637 0.3929  -0.1948 0.0102  171 LEU C N   
2877 C CA  . LEU C 158 ? 1.0500 1.1211 1.7586 0.3597  -0.2145 0.0273  171 LEU C CA  
2878 C C   . LEU C 158 ? 1.0271 1.0293 1.6694 0.3495  -0.2178 0.0126  171 LEU C C   
2879 O O   . LEU C 158 ? 1.0447 0.9984 1.7021 0.3668  -0.2357 0.0048  171 LEU C O   
2880 C CB  . LEU C 158 ? 1.0875 1.1415 1.7936 0.3366  -0.2531 0.0646  171 LEU C CB  
2881 C CG  . LEU C 158 ? 0.9529 0.9889 1.6014 0.3007  -0.2731 0.0867  171 LEU C CG  
2882 C CD1 . LEU C 158 ? 0.7550 0.7211 1.3343 0.2808  -0.2893 0.0881  171 LEU C CD1 
2883 C CD2 . LEU C 158 ? 0.8680 0.9509 1.4880 0.2873  -0.2399 0.0766  171 LEU C CD2 
2884 N N   . TYR C 159 ? 0.9757 0.9742 1.5487 0.3211  -0.2027 0.0101  172 TYR C N   
2885 C CA  . TYR C 159 ? 1.0152 0.9526 1.5223 0.3036  -0.2089 0.0039  172 TYR C CA  
2886 C C   . TYR C 159 ? 0.9972 0.9336 1.4433 0.2650  -0.2127 0.0230  172 TYR C C   
2887 O O   . TYR C 159 ? 1.0757 1.0607 1.5206 0.2553  -0.1965 0.0262  172 TYR C O   
2888 C CB  . TYR C 159 ? 0.9501 0.8868 1.4364 0.3155  -0.1757 -0.0312 172 TYR C CB  
2889 C CG  . TYR C 159 ? 0.9134 0.8689 1.4574 0.3570  -0.1595 -0.0586 172 TYR C CG  
2890 C CD1 . TYR C 159 ? 0.9717 1.0015 1.5593 0.3736  -0.1298 -0.0674 172 TYR C CD1 
2891 C CD2 . TYR C 159 ? 0.9763 0.8766 1.5316 0.3796  -0.1739 -0.0763 172 TYR C CD2 
2892 C CE1 . TYR C 159 ? 1.0008 1.0554 1.6413 0.4129  -0.1106 -0.0942 172 TYR C CE1 
2893 C CE2 . TYR C 159 ? 1.0302 0.9483 1.6389 0.4212  -0.1573 -0.1062 172 TYR C CE2 
2894 C CZ  . TYR C 159 ? 1.0303 1.0285 1.6810 0.4384  -0.1234 -0.1158 172 TYR C CZ  
2895 O OH  . TYR C 159 ? 0.8907 0.9141 1.5904 0.4789  -0.1015 -0.1459 172 TYR C OH  
2896 N N   . TYR C 160 ? 0.9640 0.8469 1.3616 0.2430  -0.2347 0.0360  173 TYR C N   
2897 C CA  . TYR C 160 ? 0.9534 0.8363 1.2900 0.2087  -0.2334 0.0491  173 TYR C CA  
2898 C C   . TYR C 160 ? 1.0298 0.8714 1.3116 0.1923  -0.2287 0.0420  173 TYR C C   
2899 O O   . TYR C 160 ? 1.0921 0.8927 1.3796 0.2037  -0.2376 0.0333  173 TYR C O   
2900 C CB  . TYR C 160 ? 0.8929 0.7630 1.2197 0.1906  -0.2668 0.0802  173 TYR C CB  
2901 C CG  . TYR C 160 ? 0.9440 0.7551 1.2398 0.1755  -0.2972 0.0979  173 TYR C CG  
2902 C CD1 . TYR C 160 ? 0.8912 0.6830 1.1205 0.1446  -0.2970 0.1071  173 TYR C CD1 
2903 C CD2 . TYR C 160 ? 0.9688 0.7464 1.3053 0.1911  -0.3273 0.1075  173 TYR C CD2 
2904 C CE1 . TYR C 160 ? 1.0176 0.7607 1.2185 0.1271  -0.3253 0.1275  173 TYR C CE1 
2905 C CE2 . TYR C 160 ? 1.1070 0.8301 1.4161 0.1738  -0.3593 0.1277  173 TYR C CE2 
2906 C CZ  . TYR C 160 ? 1.0928 0.8001 1.3325 0.1405  -0.3579 0.1389  173 TYR C CZ  
2907 O OH  . TYR C 160 ? 1.1579 0.8156 1.3705 0.1200  -0.3902 0.1630  173 TYR C OH  
2908 N N   . ARG C 161 ? 0.9705 0.8228 1.2026 0.1658  -0.2167 0.0459  174 ARG C N   
2909 C CA  . ARG C 161 ? 1.0140 0.8329 1.1962 0.1460  -0.2136 0.0446  174 ARG C CA  
2910 C C   . ARG C 161 ? 1.0299 0.8534 1.1636 0.1146  -0.2175 0.0636  174 ARG C C   
2911 O O   . ARG C 161 ? 0.9622 0.8247 1.0890 0.1079  -0.2029 0.0614  174 ARG C O   
2912 C CB  . ARG C 161 ? 0.9958 0.8300 1.1701 0.1509  -0.1822 0.0184  174 ARG C CB  
2913 C CG  . ARG C 161 ? 1.0287 0.8210 1.1623 0.1351  -0.1835 0.0159  174 ARG C CG  
2914 C CD  . ARG C 161 ? 0.9302 0.7453 1.0393 0.1243  -0.1551 0.0006  174 ARG C CD  
2915 N NE  . ARG C 161 ? 1.0781 0.9094 1.1531 0.0961  -0.1516 0.0162  174 ARG C NE  
2916 C CZ  . ARG C 161 ? 1.0216 0.8965 1.0939 0.0892  -0.1319 0.0110  174 ARG C CZ  
2917 N NH1 . ARG C 161 ? 0.8891 0.7970 0.9884 0.1048  -0.1147 -0.0055 174 ARG C NH1 
2918 N NH2 . ARG C 161 ? 1.1171 1.0039 1.1610 0.0667  -0.1298 0.0227  174 ARG C NH2 
2919 N N   . TYR C 162 ? 1.0434 0.8281 1.1445 0.0954  -0.2378 0.0822  175 TYR C N   
2920 C CA  . TYR C 162 ? 1.0826 0.8748 1.1328 0.0653  -0.2351 0.0969  175 TYR C CA  
2921 C C   . TYR C 162 ? 1.1553 0.9199 1.1731 0.0474  -0.2327 0.1003  175 TYR C C   
2922 O O   . TYR C 162 ? 1.1330 0.8541 1.1488 0.0430  -0.2566 0.1136  175 TYR C O   
2923 C CB  . TYR C 162 ? 1.1423 0.9254 1.1756 0.0513  -0.2625 0.1236  175 TYR C CB  
2924 C CG  . TYR C 162 ? 1.1304 0.9325 1.1109 0.0241  -0.2532 0.1329  175 TYR C CG  
2925 C CD1 . TYR C 162 ? 1.1720 0.9545 1.1105 -0.0018 -0.2598 0.1513  175 TYR C CD1 
2926 C CD2 . TYR C 162 ? 1.0714 0.9128 1.0459 0.0247  -0.2375 0.1226  175 TYR C CD2 
2927 C CE1 . TYR C 162 ? 1.1651 0.9720 1.0574 -0.0244 -0.2470 0.1576  175 TYR C CE1 
2928 C CE2 . TYR C 162 ? 1.0954 0.9546 1.0235 0.0039  -0.2275 0.1262  175 TYR C CE2 
2929 C CZ  . TYR C 162 ? 1.0707 0.9153 0.9580 -0.0197 -0.2301 0.1428  175 TYR C CZ  
2930 O OH  . TYR C 162 ? 1.0710 0.9400 0.9141 -0.0384 -0.2163 0.1446  175 TYR C OH  
2931 N N   . GLY C 163 ? 1.1554 0.9448 1.1514 0.0359  -0.2067 0.0902  176 GLY C N   
2932 C CA  . GLY C 163 ? 1.1633 0.9321 1.1339 0.0184  -0.2029 0.0934  176 GLY C CA  
2933 C C   . GLY C 163 ? 1.0870 0.8257 1.0788 0.0357  -0.2030 0.0749  176 GLY C C   
2934 O O   . GLY C 163 ? 1.1378 0.8971 1.1484 0.0527  -0.1823 0.0507  176 GLY C O   
2935 N N   . SER C 164 ? 1.0258 0.7144 1.0130 0.0307  -0.2279 0.0864  177 SER C N   
2936 C CA  . SER C 164 ? 1.1705 0.8216 1.1728 0.0477  -0.2318 0.0665  177 SER C CA  
2937 C C   . SER C 164 ? 1.1814 0.7996 1.2206 0.0745  -0.2555 0.0617  177 SER C C   
2938 O O   . SER C 164 ? 1.1266 0.7072 1.1797 0.0923  -0.2627 0.0431  177 SER C O   
2939 C CB  . SER C 164 ? 1.2298 0.8424 1.2025 0.0230  -0.2444 0.0791  177 SER C CB  
2940 O OG  . SER C 164 ? 1.2632 0.8650 1.2150 -0.0041 -0.2666 0.1145  177 SER C OG  
2941 N N   . TRP C 165 ? 1.2418 0.8733 1.2979 0.0784  -0.2687 0.0773  178 TRP C N   
2942 C CA  . TRP C 165 ? 1.3417 0.9443 1.4401 0.1031  -0.2948 0.0769  178 TRP C CA  
2943 C C   . TRP C 165 ? 1.2162 0.8604 1.3599 0.1340  -0.2779 0.0579  178 TRP C C   
2944 O O   . TRP C 165 ? 1.1118 0.8032 1.2527 0.1281  -0.2629 0.0628  178 TRP C O   
2945 C CB  . TRP C 165 ? 1.4187 0.9972 1.5081 0.0830  -0.3315 0.1139  178 TRP C CB  
2946 C CG  . TRP C 165 ? 1.5641 1.1078 1.6112 0.0494  -0.3493 0.1382  178 TRP C CG  
2947 C CD1 . TRP C 165 ? 1.6671 1.1538 1.7151 0.0473  -0.3734 0.1401  178 TRP C CD1 
2948 C CD2 . TRP C 165 ? 1.6766 1.2423 1.6759 0.0124  -0.3451 0.1648  178 TRP C CD2 
2949 N NE1 . TRP C 165 ? 1.7339 1.2078 1.7395 0.0087  -0.3857 0.1702  178 TRP C NE1 
2950 C CE2 . TRP C 165 ? 1.7731 1.2983 1.7485 -0.0126 -0.3663 0.1853  178 TRP C CE2 
2951 C CE3 . TRP C 165 ? 1.7173 1.3333 1.6919 -0.0013 -0.3259 0.1722  178 TRP C CE3 
2952 C CZ2 . TRP C 165 ? 1.8673 1.4083 1.7975 -0.0511 -0.3654 0.2146  178 TRP C CZ2 
2953 C CZ3 . TRP C 165 ? 1.7791 1.4076 1.7065 -0.0365 -0.3241 0.1967  178 TRP C CZ3 
2954 C CH2 . TRP C 165 ? 1.8597 1.4545 1.7663 -0.0614 -0.3421 0.2185  178 TRP C CH2 
2955 N N   . THR C 166 ? 1.2093 0.8364 1.3962 0.1670  -0.2814 0.0362  179 THR C N   
2956 C CA  . THR C 166 ? 1.1370 0.8075 1.3746 0.1981  -0.2650 0.0192  179 THR C CA  
2957 C C   . THR C 166 ? 1.1946 0.8383 1.4868 0.2236  -0.2953 0.0236  179 THR C C   
2958 O O   . THR C 166 ? 1.1437 0.7318 1.4430 0.2324  -0.3184 0.0190  179 THR C O   
2959 C CB  . THR C 166 ? 1.0840 0.7769 1.3282 0.2192  -0.2293 -0.0183 179 THR C CB  
2960 O OG1 . THR C 166 ? 1.1048 0.8221 1.3031 0.1946  -0.2045 -0.0202 179 THR C OG1 
2961 C CG2 . THR C 166 ? 1.0545 0.8014 1.3532 0.2490  -0.2105 -0.0322 179 THR C CG2 
2962 N N   . GLU C 167 ? 1.1959 0.8772 1.5295 0.2349  -0.2984 0.0336  180 GLU C N   
2963 C CA  . GLU C 167 ? 1.1263 0.7894 1.5218 0.2605  -0.3273 0.0392  180 GLU C CA  
2964 C C   . GLU C 167 ? 1.1649 0.8878 1.6231 0.2913  -0.3066 0.0256  180 GLU C C   
2965 O O   . GLU C 167 ? 1.2000 0.9777 1.6511 0.2822  -0.2834 0.0282  180 GLU C O   
2966 C CB  . GLU C 167 ? 1.1583 0.7961 1.5443 0.2353  -0.3691 0.0803  180 GLU C CB  
2967 C CG  . GLU C 167 ? 1.3708 0.9454 1.7116 0.2086  -0.3989 0.0991  180 GLU C CG  
2968 C CD  . GLU C 167 ? 1.5665 1.1207 1.8955 0.1819  -0.4400 0.1415  180 GLU C CD  
2969 O OE1 . GLU C 167 ? 1.5901 1.0906 1.9363 0.1813  -0.4810 0.1580  180 GLU C OE1 
2970 O OE2 . GLU C 167 ? 1.6379 1.2276 1.9384 0.1607  -0.4334 0.1582  180 GLU C OE2 
2971 N N   . GLU C 168 ? 1.2238 0.9369 1.7465 0.3278  -0.3163 0.0115  181 GLU C N   
2972 C CA  . GLU C 168 ? 1.1056 0.8785 1.6992 0.3584  -0.3001 0.0028  181 GLU C CA  
2973 C C   . GLU C 168 ? 1.1480 0.9231 1.7726 0.3487  -0.3311 0.0357  181 GLU C C   
2974 O O   . GLU C 168 ? 1.2608 0.9831 1.8764 0.3365  -0.3656 0.0519  181 GLU C O   
2975 C CB  . GLU C 168 ? 1.0518 0.8284 1.6828 0.3969  -0.2774 -0.0357 181 GLU C CB  
2976 C CG  . GLU C 168 ? 1.0874 0.9360 1.7817 0.4223  -0.2516 -0.0430 181 GLU C CG  
2977 C CD  . GLU C 168 ? 1.2298 1.0840 1.9527 0.4597  -0.2257 -0.0818 181 GLU C CD  
2978 O OE1 . GLU C 168 ? 1.3510 1.1523 2.0403 0.4655  -0.2266 -0.1066 181 GLU C OE1 
2979 O OE2 . GLU C 168 ? 1.2100 1.1210 1.9863 0.4826  -0.2049 -0.0870 181 GLU C OE2 
2980 N N   . CYS C 169 ? 1.1049 0.9414 1.7627 0.3503  -0.3197 0.0465  182 CYS C N   
2981 C CA  . CYS C 169 ? 1.1331 0.9747 1.8173 0.3389  -0.3473 0.0765  182 CYS C CA  
2982 C C   . CYS C 169 ? 1.1057 0.9339 1.8440 0.3637  -0.3565 0.0680  182 CYS C C   
2983 O O   . CYS C 169 ? 1.0977 0.9388 1.8658 0.3963  -0.3304 0.0364  182 CYS C O   
2984 C CB  . CYS C 169 ? 1.1645 1.0748 1.8728 0.3357  -0.3319 0.0878  182 CYS C CB  
2985 S SG  . CYS C 169 ? 1.1583 1.0738 1.8943 0.3187  -0.3664 0.1239  182 CYS C SG  
2986 N N   . GLN C 170 ? 1.1705 0.9728 1.9196 0.3477  -0.3939 0.0956  183 GLN C N   
2987 C CA  . GLN C 170 ? 1.2010 0.9895 2.0063 0.3684  -0.4090 0.0917  183 GLN C CA  
2988 C C   . GLN C 170 ? 1.2120 1.0239 2.0540 0.3571  -0.4310 0.1211  183 GLN C C   
2989 O O   . GLN C 170 ? 1.3077 1.1188 2.2063 0.3742  -0.4437 0.1214  183 GLN C O   
2990 C CB  . GLN C 170 ? 1.1444 0.8574 1.9256 0.3578  -0.4428 0.0943  183 GLN C CB  
2991 C CG  . GLN C 170 ? 1.2611 0.9532 2.0756 0.3935  -0.4331 0.0601  183 GLN C CG  
2992 C CD  . GLN C 170 ? 1.2609 0.9605 2.0477 0.4116  -0.3942 0.0244  183 GLN C CD  
2993 O OE1 . GLN C 170 ? 1.1319 0.8235 1.8624 0.3903  -0.3878 0.0283  183 GLN C OE1 
2994 N NE2 . GLN C 170 ? 1.2818 0.9966 2.1066 0.4507  -0.3678 -0.0112 183 GLN C NE2 
2995 N N   . GLU C 171 ? 1.2276 1.0580 2.0363 0.3277  -0.4367 0.1450  184 GLU C N   
2996 C CA  . GLU C 171 ? 1.2896 1.1405 2.1245 0.3127  -0.4576 0.1727  184 GLU C CA  
2997 C C   . GLU C 171 ? 1.2218 1.1418 2.0749 0.3181  -0.4289 0.1720  184 GLU C C   
2998 O O   . GLU C 171 ? 1.1372 1.0673 1.9459 0.2920  -0.4301 0.1856  184 GLU C O   
2999 C CB  . GLU C 171 ? 1.3819 1.1897 2.1580 0.2689  -0.4957 0.2038  184 GLU C CB  
3000 C CG  . GLU C 171 ? 1.4871 1.2307 2.2518 0.2567  -0.5320 0.2135  184 GLU C CG  
3001 C CD  . GLU C 171 ? 1.6213 1.3467 2.3955 0.2302  -0.5736 0.2454  184 GLU C CD  
3002 O OE1 . GLU C 171 ? 1.6356 1.3953 2.4632 0.2395  -0.5742 0.2516  184 GLU C OE1 
3003 O OE2 . GLU C 171 ? 1.6950 1.3730 2.4227 0.1985  -0.6059 0.2653  184 GLU C OE2 
3004 N N   . TYR C 172 ? 1.2387 1.2074 2.1567 0.3513  -0.4037 0.1563  185 TYR C N   
3005 C CA  . TYR C 172 ? 1.0939 1.1337 2.0346 0.3566  -0.3760 0.1567  185 TYR C CA  
3006 C C   . TYR C 172 ? 1.1485 1.2134 2.1325 0.3474  -0.3961 0.1830  185 TYR C C   
3007 O O   . TYR C 172 ? 1.2123 1.2680 2.2473 0.3606  -0.4131 0.1879  185 TYR C O   
3008 C CB  . TYR C 172 ? 1.0094 1.0986 1.9926 0.3967  -0.3324 0.1250  185 TYR C CB  
3009 C CG  . TYR C 172 ? 1.0317 1.1075 1.9733 0.4056  -0.3058 0.0962  185 TYR C CG  
3010 C CD1 . TYR C 172 ? 0.9628 0.9940 1.9030 0.4264  -0.3046 0.0718  185 TYR C CD1 
3011 C CD2 . TYR C 172 ? 0.8640 0.9700 1.7688 0.3923  -0.2835 0.0928  185 TYR C CD2 
3012 C CE1 . TYR C 172 ? 1.0948 1.1098 1.9950 0.4329  -0.2818 0.0446  185 TYR C CE1 
3013 C CE2 . TYR C 172 ? 0.9238 1.0173 1.7929 0.3992  -0.2602 0.0665  185 TYR C CE2 
3014 C CZ  . TYR C 172 ? 1.0680 1.1151 1.9335 0.4192  -0.2592 0.0421  185 TYR C CZ  
3015 O OH  . TYR C 172 ? 1.1716 1.2019 1.9984 0.4242  -0.2378 0.0148  185 TYR C OH  
3016 N N   . SER C 173 ? 1.2297 1.3237 2.1935 0.3241  -0.3959 0.1996  186 SER C N   
3017 C CA  . SER C 173 ? 1.2365 1.3673 2.2463 0.3185  -0.4066 0.2207  186 SER C CA  
3018 C C   . SER C 173 ? 1.2531 1.4612 2.3118 0.3457  -0.3665 0.2062  186 SER C C   
3019 O O   . SER C 173 ? 1.2175 1.4510 2.2523 0.3527  -0.3349 0.1873  186 SER C O   
3020 C CB  . SER C 173 ? 1.1897 1.3083 2.1497 0.2782  -0.4287 0.2446  186 SER C CB  
3021 O OG  . SER C 173 ? 1.2087 1.2621 2.1248 0.2519  -0.4663 0.2599  186 SER C OG  
3022 N N   . LYS C 174 ? 1.2841 1.5320 2.4120 0.3600  -0.3678 0.2157  187 LYS C N   
3023 C CA  . LYS C 174 ? 1.1604 1.4880 2.3391 0.3872  -0.3294 0.2025  187 LYS C CA  
3024 C C   . LYS C 174 ? 1.0822 1.4594 2.2961 0.3722  -0.3363 0.2280  187 LYS C C   
3025 O O   . LYS C 174 ? 1.0072 1.3538 2.2163 0.3450  -0.3724 0.2551  187 LYS C O   
3026 C CB  . LYS C 174 ? 1.0649 1.4075 2.3046 0.4304  -0.3138 0.1814  187 LYS C CB  
3027 C CG  . LYS C 174 ? 1.0504 1.3506 2.2587 0.4496  -0.3001 0.1508  187 LYS C CG  
3028 C CD  . LYS C 174 ? 1.0933 1.4086 2.3616 0.4943  -0.2835 0.1271  187 LYS C CD  
3029 C CE  . LYS C 174 ? 1.1389 1.3972 2.3726 0.5100  -0.2769 0.0972  187 LYS C CE  
3030 N NZ  . LYS C 174 ? 1.0415 1.2138 2.2300 0.4803  -0.3208 0.1128  187 LYS C NZ  
3031 N N   . ASP C 175 ? 1.0420 1.4957 2.2900 0.3884  -0.3019 0.2192  188 ASP C N   
3032 C CA  . ASP C 175 ? 1.0501 1.5574 2.3391 0.3760  -0.3060 0.2428  188 ASP C CA  
3033 C C   . ASP C 175 ? 1.1178 1.6776 2.4956 0.4093  -0.2958 0.2413  188 ASP C C   
3034 O O   . ASP C 175 ? 0.9260 1.4668 2.3308 0.4387  -0.2943 0.2252  188 ASP C O   
3035 C CB  . ASP C 175 ? 1.0403 1.6010 2.3074 0.3647  -0.2784 0.2386  188 ASP C CB  
3036 C CG  . ASP C 175 ? 1.0036 1.6190 2.2865 0.3979  -0.2318 0.2059  188 ASP C CG  
3037 O OD1 . ASP C 175 ? 0.9298 1.5315 2.2297 0.4303  -0.2205 0.1835  188 ASP C OD1 
3038 O OD2 . ASP C 175 ? 0.7534 1.4226 2.0293 0.3901  -0.2073 0.2021  188 ASP C OD2 
3039 N N   . THR C 176 ? 1.1642 1.7896 2.5879 0.4044  -0.2895 0.2580  189 THR C N   
3040 C CA  . THR C 176 ? 1.1613 1.8487 2.6744 0.4344  -0.2786 0.2590  189 THR C CA  
3041 C C   . THR C 176 ? 1.2271 1.9574 2.7685 0.4823  -0.2366 0.2204  189 THR C C   
3042 O O   . THR C 176 ? 1.3393 2.0775 2.9384 0.5149  -0.2361 0.2120  189 THR C O   
3043 C CB  . THR C 176 ? 1.0969 1.8553 2.6478 0.4176  -0.2737 0.2825  189 THR C CB  
3044 O OG1 . THR C 176 ? 1.1278 1.8524 2.6937 0.3886  -0.3167 0.3196  189 THR C OG1 
3045 C CG2 . THR C 176 ? 1.1051 1.9575 2.7379 0.4552  -0.2394 0.2692  189 THR C CG2 
3046 N N   . LEU C 177 ? 1.2188 1.9733 2.7180 0.4863  -0.2023 0.1961  190 LEU C N   
3047 C CA  . LEU C 177 ? 1.1660 1.9675 2.6853 0.5296  -0.1581 0.1575  190 LEU C CA  
3048 C C   . LEU C 177 ? 1.0929 1.8226 2.5719 0.5496  -0.1562 0.1304  190 LEU C C   
3049 O O   . LEU C 177 ? 1.0908 1.8445 2.5694 0.5832  -0.1193 0.0960  190 LEU C O   
3050 C CB  . LEU C 177 ? 1.1141 1.9856 2.6137 0.5231  -0.1198 0.1440  190 LEU C CB  
3051 C CG  . LEU C 177 ? 1.0888 2.0692 2.6592 0.5415  -0.0894 0.1392  190 LEU C CG  
3052 C CD1 . LEU C 177 ? 0.9569 1.9969 2.5030 0.5199  -0.0607 0.1334  190 LEU C CD1 
3053 C CD2 . LEU C 177 ? 1.1407 2.1536 2.7529 0.5957  -0.0590 0.1039  190 LEU C CD2 
3054 N N   . GLY C 178 ? 1.0159 1.6564 2.4589 0.5273  -0.1962 0.1458  191 GLY C N   
3055 C CA  . GLY C 178 ? 1.0408 1.6064 2.4487 0.5408  -0.2014 0.1241  191 GLY C CA  
3056 C C   . GLY C 178 ? 1.1387 1.6855 2.4758 0.5343  -0.1780 0.1019  191 GLY C C   
3057 O O   . GLY C 178 ? 1.2311 1.7297 2.5433 0.5520  -0.1708 0.0762  191 GLY C O   
3058 N N   . ARG C 179 ? 1.0903 1.6722 2.3961 0.5075  -0.1678 0.1117  192 ARG C N   
3059 C CA  . ARG C 179 ? 1.1266 1.6897 2.3658 0.4959  -0.1497 0.0949  192 ARG C CA  
3060 C C   . ARG C 179 ? 1.0543 1.5456 2.2332 0.4558  -0.1866 0.1161  192 ARG C C   
3061 O O   . ARG C 179 ? 0.7992 1.2883 1.9780 0.4272  -0.2142 0.1462  192 ARG C O   
3062 C CB  . ARG C 179 ? 1.1596 1.8071 2.4008 0.4917  -0.1138 0.0891  192 ARG C CB  
3063 C CG  . ARG C 179 ? 1.1579 1.8671 2.4437 0.4751  -0.1229 0.1172  192 ARG C CG  
3064 C CD  . ARG C 179 ? 1.0803 1.8755 2.3738 0.4705  -0.0873 0.1091  192 ARG C CD  
3065 N NE  . ARG C 179 ? 0.9830 1.8220 2.3091 0.4444  -0.1025 0.1408  192 ARG C NE  
3066 C CZ  . ARG C 179 ? 0.9377 1.8479 2.2766 0.4297  -0.0811 0.1438  192 ARG C CZ  
3067 N NH1 . ARG C 179 ? 0.9485 1.8983 2.2704 0.4375  -0.0424 0.1155  192 ARG C NH1 
3068 N NH2 . ARG C 179 ? 0.9073 1.8453 2.2750 0.4044  -0.0994 0.1764  192 ARG C NH2 
3069 N N   . ASN C 180 ? 0.9761 1.4080 2.1022 0.4540  -0.1868 0.0992  193 ASN C N   
3070 C CA  . ASN C 180 ? 0.9620 1.3226 2.0296 0.4201  -0.2215 0.1157  193 ASN C CA  
3071 C C   . ASN C 180 ? 0.9323 1.3103 1.9635 0.3841  -0.2279 0.1359  193 ASN C C   
3072 O O   . ASN C 180 ? 0.8430 1.2703 1.8667 0.3823  -0.1995 0.1271  193 ASN C O   
3073 C CB  . ASN C 180 ? 0.9702 1.2729 1.9908 0.4262  -0.2161 0.0913  193 ASN C CB  
3074 C CG  . ASN C 180 ? 0.9729 1.2422 2.0224 0.4579  -0.2174 0.0717  193 ASN C CG  
3075 O OD1 . ASN C 180 ? 1.0045 1.2604 2.0936 0.4635  -0.2420 0.0855  193 ASN C OD1 
3076 N ND2 . ASN C 180 ? 0.8756 1.1287 1.9052 0.4779  -0.1923 0.0385  193 ASN C ND2 
3077 N N   . ILE C 181 ? 0.9683 1.3039 1.9747 0.3544  -0.2662 0.1623  194 ILE C N   
3078 C CA  . ILE C 181 ? 0.8976 1.2437 1.8703 0.3207  -0.2766 0.1814  194 ILE C CA  
3079 C C   . ILE C 181 ? 0.8309 1.1080 1.7340 0.2908  -0.3066 0.1914  194 ILE C C   
3080 O O   . ILE C 181 ? 0.7633 1.0399 1.6252 0.2645  -0.3128 0.2004  194 ILE C O   
3081 C CB  . ILE C 181 ? 1.2477 1.6294 2.2659 0.3119  -0.2913 0.2063  194 ILE C CB  
3082 C CG1 . ILE C 181 ? 1.3695 1.7991 2.3787 0.2927  -0.2794 0.2141  194 ILE C CG1 
3083 C CG2 . ILE C 181 ? 1.2005 1.5246 2.2026 0.2887  -0.3353 0.2303  194 ILE C CG2 
3084 C CD1 . ILE C 181 ? 1.5031 1.9756 2.5641 0.2863  -0.2888 0.2368  194 ILE C CD1 
3085 N N   . ALA C 182 ? 0.9084 1.1278 1.7972 0.2947  -0.3252 0.1890  195 ALA C N   
3086 C CA  . ALA C 182 ? 0.9297 1.0864 1.7513 0.2668  -0.3531 0.1986  195 ALA C CA  
3087 C C   . ALA C 182 ? 1.1011 1.2037 1.9071 0.2772  -0.3610 0.1873  195 ALA C C   
3088 O O   . ALA C 182 ? 1.0686 1.1711 1.9214 0.3035  -0.3562 0.1772  195 ALA C O   
3089 C CB  . ALA C 182 ? 0.9063 1.0418 1.7211 0.2405  -0.3895 0.2263  195 ALA C CB  
3090 N N   . CYS C 183 ? 1.2211 1.2774 1.9607 0.2563  -0.3741 0.1890  196 CYS C N   
3091 C CA  . CYS C 183 ? 1.2259 1.2275 1.9429 0.2611  -0.3839 0.1807  196 CYS C CA  
3092 C C   . CYS C 183 ? 1.1679 1.1129 1.8278 0.2283  -0.4217 0.2030  196 CYS C C   
3093 O O   . CYS C 183 ? 1.1298 1.0768 1.7524 0.2023  -0.4341 0.2185  196 CYS C O   
3094 C CB  . CYS C 183 ? 1.2149 1.2182 1.9054 0.2716  -0.3556 0.1560  196 CYS C CB  
3095 S SG  . CYS C 183 ? 1.8587 1.7955 2.5275 0.2811  -0.3645 0.1419  196 CYS C SG  
3096 N N   . TRP C 184 ? 1.2477 1.1424 1.8987 0.2288  -0.4401 0.2041  197 TRP C N   
3097 C CA  . TRP C 184 ? 1.2498 1.0928 1.8452 0.1958  -0.4757 0.2270  197 TRP C CA  
3098 C C   . TRP C 184 ? 1.2708 1.0624 1.8340 0.1934  -0.4844 0.2226  197 TRP C C   
3099 O O   . TRP C 184 ? 1.2782 1.0517 1.8812 0.2140  -0.4867 0.2120  197 TRP C O   
3100 C CB  . TRP C 184 ? 1.2023 1.0344 1.8287 0.1853  -0.5078 0.2491  197 TRP C CB  
3101 C CG  . TRP C 184 ? 1.2863 1.0643 1.8610 0.1521  -0.5454 0.2721  197 TRP C CG  
3102 C CD1 . TRP C 184 ? 1.3649 1.1023 1.9564 0.1488  -0.5732 0.2818  197 TRP C CD1 
3103 C CD2 . TRP C 184 ? 1.2704 1.0312 1.7667 0.1167  -0.5589 0.2880  197 TRP C CD2 
3104 N NE1 . TRP C 184 ? 1.3277 1.0261 1.8559 0.1110  -0.6031 0.3052  197 TRP C NE1 
3105 C CE2 . TRP C 184 ? 1.2491 0.9619 1.7161 0.0917  -0.5933 0.3085  197 TRP C CE2 
3106 C CE3 . TRP C 184 ? 1.2531 1.0351 1.7004 0.1037  -0.5454 0.2859  197 TRP C CE3 
3107 C CZ2 . TRP C 184 ? 1.2311 0.9202 1.6189 0.0545  -0.6113 0.3270  197 TRP C CZ2 
3108 C CZ3 . TRP C 184 ? 1.2584 1.0140 1.6279 0.0695  -0.5638 0.3015  197 TRP C CZ3 
3109 C CH2 . TRP C 184 ? 1.3014 1.0127 1.6400 0.0452  -0.5948 0.3220  197 TRP C CH2 
3110 N N   . PHE C 185 ? 1.2161 0.9842 1.7059 0.1676  -0.4898 0.2310  198 PHE C N   
3111 C CA  . PHE C 185 ? 1.0780 0.7959 1.5270 0.1563  -0.5022 0.2341  198 PHE C CA  
3112 C C   . PHE C 185 ? 1.0970 0.7819 1.4888 0.1164  -0.5360 0.2649  198 PHE C C   
3113 O O   . PHE C 185 ? 1.1473 0.8393 1.4788 0.0932  -0.5344 0.2742  198 PHE C O   
3114 C CB  . PHE C 185 ? 1.0425 0.7640 1.4484 0.1576  -0.4770 0.2193  198 PHE C CB  
3115 C CG  . PHE C 185 ? 1.1141 0.8517 1.5642 0.1936  -0.4466 0.1873  198 PHE C CG  
3116 C CD1 . PHE C 185 ? 1.1322 0.8296 1.5892 0.2055  -0.4495 0.1749  198 PHE C CD1 
3117 C CD2 . PHE C 185 ? 1.1413 0.9339 1.6218 0.2130  -0.4153 0.1690  198 PHE C CD2 
3118 C CE1 . PHE C 185 ? 1.1428 0.8524 1.6330 0.2383  -0.4204 0.1415  198 PHE C CE1 
3119 C CE2 . PHE C 185 ? 1.1254 0.9360 1.6414 0.2442  -0.3852 0.1381  198 PHE C CE2 
3120 C CZ  . PHE C 185 ? 1.1675 0.9353 1.6862 0.2578  -0.3869 0.1226  198 PHE C CZ  
3121 N N   . PRO C 186 ? 1.2164 0.8665 1.6258 0.1076  -0.5669 0.2798  199 PRO C N   
3122 C CA  . PRO C 186 ? 1.2727 0.8915 1.6221 0.0662  -0.5982 0.3095  199 PRO C CA  
3123 C C   . PRO C 186 ? 1.3388 0.9328 1.6170 0.0452  -0.5944 0.3148  199 PRO C C   
3124 O O   . PRO C 186 ? 1.3152 0.9039 1.5238 0.0114  -0.6029 0.3339  199 PRO C O   
3125 C CB  . PRO C 186 ? 1.2807 0.8688 1.6770 0.0651  -0.6315 0.3214  199 PRO C CB  
3126 C CG  . PRO C 186 ? 1.3171 0.9081 1.7811 0.1057  -0.6154 0.2946  199 PRO C CG  
3127 C CD  . PRO C 186 ? 1.2745 0.9152 1.7584 0.1335  -0.5753 0.2706  199 PRO C CD  
3128 N N   . ARG C 187 ? 1.3724 0.9528 1.6669 0.0649  -0.5805 0.2973  200 ARG C N   
3129 C CA  . ARG C 187 ? 1.4166 0.9739 1.6500 0.0459  -0.5756 0.3024  200 ARG C CA  
3130 C C   . ARG C 187 ? 1.3279 0.9024 1.5642 0.0712  -0.5401 0.2750  200 ARG C C   
3131 O O   . ARG C 187 ? 1.2999 0.8848 1.5962 0.1073  -0.5243 0.2487  200 ARG C O   
3132 C CB  . ARG C 187 ? 1.5549 1.0646 1.7963 0.0357  -0.6024 0.3125  200 ARG C CB  
3133 C CG  . ARG C 187 ? 1.6524 1.1419 1.8816 0.0030  -0.6407 0.3434  200 ARG C CG  
3134 C CD  . ARG C 187 ? 1.8226 1.2664 2.0562 -0.0109 -0.6686 0.3545  200 ARG C CD  
3135 N NE  . ARG C 187 ? 1.9301 1.3606 2.0956 -0.0597 -0.6883 0.3879  200 ARG C NE  
3136 C CZ  . ARG C 187 ? 2.0508 1.4736 2.2080 -0.0879 -0.7195 0.4137  200 ARG C CZ  
3137 N NH1 . ARG C 187 ? 2.0158 1.4407 2.2310 -0.0724 -0.7365 0.4112  200 ARG C NH1 
3138 N NH2 . ARG C 187 ? 2.2062 1.6219 2.2979 -0.1328 -0.7326 0.4424  200 ARG C NH2 
3139 N N   . THR C 188 ? 1.3208 0.9015 1.4913 0.0512  -0.5257 0.2802  201 THR C N   
3140 C CA  . THR C 188 ? 1.2757 0.8846 1.4395 0.0644  -0.4777 0.2452  201 THR C CA  
3141 C C   . THR C 188 ? 1.3363 0.9298 1.4389 0.0370  -0.4663 0.2492  201 THR C C   
3142 O O   . THR C 188 ? 1.3656 0.9328 1.4268 0.0057  -0.4926 0.2801  201 THR C O   
3143 C CB  . THR C 188 ? 1.1719 0.8369 1.3258 0.0682  -0.4449 0.2285  201 THR C CB  
3144 O OG1 . THR C 188 ? 1.1600 0.8331 1.2495 0.0354  -0.4512 0.2481  201 THR C OG1 
3145 C CG2 . THR C 188 ? 1.1754 0.8629 1.3974 0.0964  -0.4520 0.2235  201 THR C CG2 
3146 N N   . PHE C 189 ? 1.3491 0.9614 1.4473 0.0471  -0.4280 0.2201  202 PHE C N   
3147 C CA  . PHE C 189 ? 1.4481 1.0553 1.4929 0.0216  -0.4126 0.2225  202 PHE C CA  
3148 C C   . PHE C 189 ? 1.4429 1.0966 1.4378 0.0021  -0.3840 0.2208  202 PHE C C   
3149 O O   . PHE C 189 ? 1.5372 1.1988 1.4886 -0.0199 -0.3669 0.2233  202 PHE C O   
3150 C CB  . PHE C 189 ? 1.4046 1.0045 1.4691 0.0410  -0.3891 0.1925  202 PHE C CB  
3151 C CG  . PHE C 189 ? 1.4537 0.9969 1.5497 0.0533  -0.4186 0.1939  202 PHE C CG  
3152 C CD1 . PHE C 189 ? 1.4909 1.0222 1.6501 0.0901  -0.4289 0.1773  202 PHE C CD1 
3153 C CD2 . PHE C 189 ? 1.4714 0.9740 1.5368 0.0287  -0.4367 0.2115  202 PHE C CD2 
3154 C CE1 . PHE C 189 ? 1.5645 1.0405 1.7551 0.1048  -0.4573 0.1745  202 PHE C CE1 
3155 C CE2 . PHE C 189 ? 1.5613 1.0056 1.6566 0.0403  -0.4684 0.2117  202 PHE C CE2 
3156 C CZ  . PHE C 189 ? 1.5865 1.0154 1.7439 0.0798  -0.4788 0.1913  202 PHE C CZ  
3157 N N   . ILE C 190 ? 1.3268 1.0109 1.3318 0.0110  -0.3804 0.2163  203 ILE C N   
3158 C CA  . ILE C 190 ? 1.2214 0.9468 1.1850 -0.0022 -0.3561 0.2098  203 ILE C CA  
3159 C C   . ILE C 190 ? 1.3173 1.0377 1.2151 -0.0380 -0.3674 0.2360  203 ILE C C   
3160 O O   . ILE C 190 ? 1.4074 1.1061 1.2930 -0.0512 -0.4012 0.2625  203 ILE C O   
3161 C CB  . ILE C 190 ? 1.1600 0.9108 1.1509 0.0138  -0.3594 0.2031  203 ILE C CB  
3162 C CG1 . ILE C 190 ? 1.2104 0.9758 1.2680 0.0481  -0.3452 0.1792  203 ILE C CG1 
3163 C CG2 . ILE C 190 ? 1.0507 0.8378 0.9989 0.0017  -0.3380 0.1936  203 ILE C CG2 
3164 C CD1 . ILE C 190 ? 1.1916 0.9783 1.2916 0.0644  -0.3568 0.1800  203 ILE C CD1 
3165 N N   . LEU C 191 ? 1.3740 1.1171 1.2304 -0.0543 -0.3390 0.2295  204 LEU C N   
3166 C CA  . LEU C 191 ? 1.4467 1.1963 1.2388 -0.0879 -0.3420 0.2518  204 LEU C CA  
3167 C C   . LEU C 191 ? 1.5241 1.2984 1.2842 -0.0920 -0.3412 0.2487  204 LEU C C   
3168 O O   . LEU C 191 ? 1.5056 1.3086 1.2776 -0.0751 -0.3193 0.2221  204 LEU C O   
3169 C CB  . LEU C 191 ? 1.4887 1.2606 1.2542 -0.1020 -0.3101 0.2452  204 LEU C CB  
3170 C CG  . LEU C 191 ? 1.6093 1.3510 1.3766 -0.1172 -0.3215 0.2646  204 LEU C CG  
3171 C CD1 . LEU C 191 ? 1.6605 1.3729 1.4844 -0.0902 -0.3259 0.2475  204 LEU C CD1 
3172 C CD2 . LEU C 191 ? 1.5662 1.3377 1.2989 -0.1392 -0.2933 0.2669  204 LEU C CD2 
3173 N N   . SER C 192 ? 1.6742 1.4344 1.3921 -0.1158 -0.3683 0.2767  205 SER C N   
3174 C CA  . SER C 192 ? 1.7188 1.4923 1.4004 -0.1215 -0.3759 0.2760  205 SER C CA  
3175 C C   . SER C 192 ? 1.6938 1.5088 1.3271 -0.1278 -0.3398 0.2542  205 SER C C   
3176 O O   . SER C 192 ? 1.7626 1.5921 1.3831 -0.1197 -0.3372 0.2373  205 SER C O   
3177 C CB  . SER C 192 ? 1.8697 1.6155 1.5115 -0.1494 -0.4156 0.3137  205 SER C CB  
3178 O OG  . SER C 192 ? 1.9163 1.6515 1.5318 -0.1755 -0.4191 0.3391  205 SER C OG  
3179 N N   . LYS C 193 ? 1.6440 1.4772 1.2535 -0.1420 -0.3139 0.2550  206 LYS C N   
3180 C CA  . LYS C 193 ? 1.5285 1.4049 1.1074 -0.1426 -0.2755 0.2306  206 LYS C CA  
3181 C C   . LYS C 193 ? 1.3491 1.2412 0.9776 -0.1223 -0.2467 0.2059  206 LYS C C   
3182 O O   . LYS C 193 ? 1.3096 1.2342 0.9243 -0.1263 -0.2150 0.1926  206 LYS C O   
3183 C CB  . LYS C 193 ? 1.5847 1.4812 1.1011 -0.1746 -0.2639 0.2497  206 LYS C CB  
3184 C CG  . LYS C 193 ? 1.6794 1.5679 1.1327 -0.1977 -0.2879 0.2712  206 LYS C CG  
3185 C CD  . LYS C 193 ? 1.6827 1.6081 1.0682 -0.2262 -0.2650 0.2810  206 LYS C CD  
3186 C CE  . LYS C 193 ? 1.5926 1.5225 0.9879 -0.2466 -0.2587 0.3077  206 LYS C CE  
3187 N NZ  . LYS C 193 ? 1.5761 1.5513 0.9094 -0.2756 -0.2339 0.3202  206 LYS C NZ  
3188 N N   . GLY C 194 ? 1.2404 1.1108 0.9272 -0.1007 -0.2580 0.2000  207 GLY C N   
3189 C CA  . GLY C 194 ? 1.1147 0.9960 0.8462 -0.0827 -0.2344 0.1783  207 GLY C CA  
3190 C C   . GLY C 194 ? 1.1619 1.0783 0.8994 -0.0687 -0.2091 0.1479  207 GLY C C   
3191 O O   . GLY C 194 ? 1.2342 1.1578 0.9593 -0.0635 -0.2167 0.1398  207 GLY C O   
3192 N N   . ARG C 195 ? 1.1579 1.0930 0.9154 -0.0636 -0.1825 0.1320  208 ARG C N   
3193 C CA  . ARG C 195 ? 1.1568 1.1245 0.9245 -0.0520 -0.1599 0.1047  208 ARG C CA  
3194 C C   . ARG C 195 ? 1.1369 1.1081 0.9559 -0.0358 -0.1482 0.0894  208 ARG C C   
3195 O O   . ARG C 195 ? 1.1653 1.1623 0.9957 -0.0318 -0.1274 0.0714  208 ARG C O   
3196 C CB  . ARG C 195 ? 1.0933 1.0911 0.8245 -0.0670 -0.1356 0.1006  208 ARG C CB  
3197 C CG  . ARG C 195 ? 1.1318 1.1350 0.8053 -0.0819 -0.1421 0.1099  208 ARG C CG  
3198 C CD  . ARG C 195 ? 1.1273 1.1654 0.7672 -0.0975 -0.1148 0.1090  208 ARG C CD  
3199 N NE  . ARG C 195 ? 1.2197 1.2778 0.8117 -0.0996 -0.1092 0.0966  208 ARG C NE  
3200 C CZ  . ARG C 195 ? 1.3725 1.4245 0.9090 -0.1174 -0.1219 0.1143  208 ARG C CZ  
3201 N NH1 . ARG C 195 ? 1.4773 1.5032 1.0044 -0.1355 -0.1435 0.1481  208 ARG C NH1 
3202 N NH2 . ARG C 195 ? 1.4433 1.5135 0.9325 -0.1176 -0.1149 0.0979  208 ARG C NH2 
3203 N N   . ASP C 196 ? 1.0690 1.0142 0.9186 -0.0264 -0.1626 0.0965  209 ASP C N   
3204 C CA  . ASP C 196 ? 0.9889 0.9369 0.8822 -0.0108 -0.1520 0.0816  209 ASP C CA  
3205 C C   . ASP C 196 ? 0.9155 0.8634 0.8467 0.0095  -0.1648 0.0761  209 ASP C C   
3206 O O   . ASP C 196 ? 0.9346 0.8729 0.8616 0.0109  -0.1861 0.0870  209 ASP C O   
3207 C CB  . ASP C 196 ? 1.0648 0.9849 0.9639 -0.0148 -0.1541 0.0903  209 ASP C CB  
3208 C CG  . ASP C 196 ? 1.1863 1.1155 1.1072 -0.0094 -0.1341 0.0736  209 ASP C CG  
3209 O OD1 . ASP C 196 ? 1.0869 1.0417 1.0303 0.0019  -0.1223 0.0565  209 ASP C OD1 
3210 O OD2 . ASP C 196 ? 1.3153 1.2246 1.2297 -0.0185 -0.1328 0.0793  209 ASP C OD2 
3211 N N   . TRP C 197 ? 0.8491 0.8101 0.8176 0.0235  -0.1525 0.0611  210 TRP C N   
3212 C CA  . TRP C 197 ? 0.8546 0.8262 0.8647 0.0421  -0.1604 0.0566  210 TRP C CA  
3213 C C   . TRP C 197 ? 0.9232 0.8686 0.9557 0.0538  -0.1787 0.0673  210 TRP C C   
3214 O O   . TRP C 197 ? 0.9542 0.8706 0.9780 0.0510  -0.1818 0.0726  210 TRP C O   
3215 C CB  . TRP C 197 ? 0.8137 0.8102 0.8546 0.0512  -0.1405 0.0396  210 TRP C CB  
3216 C CG  . TRP C 197 ? 0.9178 0.9419 0.9510 0.0429  -0.1279 0.0294  210 TRP C CG  
3217 C CD1 . TRP C 197 ? 0.8623 0.8936 0.8827 0.0327  -0.1100 0.0213  210 TRP C CD1 
3218 C CD2 . TRP C 197 ? 0.9020 0.9477 0.9437 0.0445  -0.1358 0.0265  210 TRP C CD2 
3219 N NE1 . TRP C 197 ? 0.9010 0.9578 0.9243 0.0292  -0.1056 0.0127  210 TRP C NE1 
3220 C CE2 . TRP C 197 ? 0.9178 0.9820 0.9526 0.0365  -0.1219 0.0148  210 TRP C CE2 
3221 C CE3 . TRP C 197 ? 0.8524 0.9016 0.9090 0.0513  -0.1562 0.0334  210 TRP C CE3 
3222 C CZ2 . TRP C 197 ? 0.7768 0.8596 0.8186 0.0365  -0.1286 0.0079  210 TRP C CZ2 
3223 C CZ3 . TRP C 197 ? 0.8787 0.9460 0.9391 0.0495  -0.1632 0.0277  210 TRP C CZ3 
3224 C CH2 . TRP C 197 ? 0.8146 0.8971 0.8673 0.0428  -0.1498 0.0140  210 TRP C CH2 
3225 N N   . LEU C 198 ? 0.9254 0.8805 0.9905 0.0669  -0.1932 0.0714  211 LEU C N   
3226 C CA  . LEU C 198 ? 0.9242 0.8630 1.0274 0.0838  -0.2082 0.0780  211 LEU C CA  
3227 C C   . LEU C 198 ? 0.8625 0.8318 1.0166 0.1048  -0.1923 0.0630  211 LEU C C   
3228 O O   . LEU C 198 ? 0.8221 0.8233 1.0042 0.1105  -0.1943 0.0640  211 LEU C O   
3229 C CB  . LEU C 198 ? 0.7916 0.7207 0.9004 0.0829  -0.2390 0.0976  211 LEU C CB  
3230 C CG  . LEU C 198 ? 0.8468 0.7634 1.0069 0.1028  -0.2573 0.1056  211 LEU C CG  
3231 C CD1 . LEU C 198 ? 0.9738 0.8475 1.1235 0.1020  -0.2660 0.1105  211 LEU C CD1 
3232 C CD2 . LEU C 198 ? 0.9566 0.8712 1.1299 0.1012  -0.2889 0.1259  211 LEU C CD2 
3233 N N   . ALA C 199 ? 0.7931 0.7534 0.9571 0.1148  -0.1771 0.0498  212 ALA C N   
3234 C CA  . ALA C 199 ? 0.7981 0.7893 1.0053 0.1347  -0.1592 0.0344  212 ALA C CA  
3235 C C   . ALA C 199 ? 0.8742 0.8630 1.1312 0.1582  -0.1735 0.0390  212 ALA C C   
3236 O O   . ALA C 199 ? 0.9295 0.8788 1.1875 0.1652  -0.1878 0.0417  212 ALA C O   
3237 C CB  . ALA C 199 ? 0.7155 0.6965 0.9072 0.1358  -0.1374 0.0157  212 ALA C CB  
3238 N N   . VAL C 200 ? 0.8243 0.8561 1.1266 0.1698  -0.1715 0.0413  213 VAL C N   
3239 C CA  . VAL C 200 ? 0.8886 0.9292 1.2495 0.1939  -0.1831 0.0464  213 VAL C CA  
3240 C C   . VAL C 200 ? 0.8243 0.9123 1.2302 0.2151  -0.1552 0.0292  213 VAL C C   
3241 O O   . VAL C 200 ? 0.6920 0.8226 1.0989 0.2070  -0.1380 0.0264  213 VAL C O   
3242 C CB  . VAL C 200 ? 0.8771 0.9307 1.2593 0.1882  -0.2104 0.0706  213 VAL C CB  
3243 C CG1 . VAL C 200 ? 0.7977 0.8725 1.2527 0.2136  -0.2203 0.0774  213 VAL C CG1 
3244 C CG2 . VAL C 200 ? 0.9246 0.9306 1.2600 0.1685  -0.2386 0.0875  213 VAL C CG2 
3245 N N   . LEU C 201 ? 0.8732 0.9546 1.3158 0.2420  -0.1513 0.0173  214 LEU C N   
3246 C CA  . LEU C 201 ? 0.8996 1.0286 1.3812 0.2641  -0.1212 -0.0021 214 LEU C CA  
3247 C C   . LEU C 201 ? 0.9663 1.1216 1.5235 0.2936  -0.1281 0.0022  214 LEU C C   
3248 O O   . LEU C 201 ? 1.0793 1.1952 1.6560 0.3099  -0.1479 0.0023  214 LEU C O   
3249 C CB  . LEU C 201 ? 0.9178 1.0180 1.3669 0.2720  -0.1002 -0.0311 214 LEU C CB  
3250 C CG  . LEU C 201 ? 0.9290 1.0726 1.3934 0.2894  -0.0637 -0.0572 214 LEU C CG  
3251 C CD1 . LEU C 201 ? 0.9782 1.1270 1.4966 0.3279  -0.0587 -0.0740 214 LEU C CD1 
3252 C CD2 . LEU C 201 ? 0.9195 1.1342 1.4034 0.2783  -0.0477 -0.0462 214 LEU C CD2 
3253 N N   . VAL C 202 ? 0.9070 1.1306 1.5105 0.2996  -0.1136 0.0078  215 VAL C N   
3254 C CA  . VAL C 202 ? 0.9662 1.2296 1.6503 0.3291  -0.1139 0.0113  215 VAL C CA  
3255 C C   . VAL C 202 ? 0.9548 1.2726 1.6647 0.3512  -0.0718 -0.0147 215 VAL C C   
3256 O O   . VAL C 202 ? 0.8802 1.2593 1.5977 0.3407  -0.0510 -0.0100 215 VAL C O   
3257 C CB  . VAL C 202 ? 0.8990 1.2057 1.6261 0.3179  -0.1337 0.0440  215 VAL C CB  
3258 C CG1 . VAL C 202 ? 0.8223 1.1641 1.6249 0.3443  -0.1360 0.0512  215 VAL C CG1 
3259 C CG2 . VAL C 202 ? 0.8749 1.1293 1.5619 0.2923  -0.1725 0.0669  215 VAL C CG2 
3260 N N   . ASN C 203 ? 1.0360 1.3303 1.7571 0.3810  -0.0608 -0.0424 216 ASN C N   
3261 C CA  . ASN C 203 ? 1.1423 1.4827 1.8785 0.4044  -0.0191 -0.0730 216 ASN C CA  
3262 C C   . ASN C 203 ? 1.1823 1.5866 2.0098 0.4381  -0.0085 -0.0721 216 ASN C C   
3263 O O   . ASN C 203 ? 1.1402 1.5355 1.9992 0.4389  -0.0357 -0.0459 216 ASN C O   
3264 C CB  . ASN C 203 ? 1.2664 1.5440 1.9586 0.4191  -0.0113 -0.1088 216 ASN C CB  
3265 C CG  . ASN C 203 ? 1.3529 1.6597 2.0075 0.4200  0.0302  -0.1386 216 ASN C CG  
3266 O OD1 . ASN C 203 ? 1.4326 1.8137 2.1243 0.4349  0.0614  -0.1469 216 ASN C OD1 
3267 N ND2 . ASN C 203 ? 1.3340 1.5848 1.9141 0.4018  0.0299  -0.1527 216 ASN C ND2 
3268 N N   . GLY C 204 ? 1.1786 1.6401 2.0167 0.4552  0.0339  -0.0946 217 GLY C N   
3269 C CA  . GLY C 204 ? 1.0812 1.6050 1.9762 0.4775  0.0520  -0.0869 217 GLY C CA  
3270 C C   . GLY C 204 ? 1.0237 1.5592 1.9186 0.5101  0.0918  -0.1245 217 GLY C C   
3271 O O   . GLY C 204 ? 0.9470 1.4467 1.7894 0.5118  0.1078  -0.1588 217 GLY C O   
3272 N N   . SER C 205 ? 1.1007 1.6858 2.0508 0.5358  0.1065  -0.1187 218 SER C N   
3273 C CA  . SER C 205 ? 1.1862 1.7850 2.1433 0.5689  0.1462  -0.1525 218 SER C CA  
3274 C C   . SER C 205 ? 1.2275 1.9081 2.2551 0.5916  0.1649  -0.1347 218 SER C C   
3275 O O   . SER C 205 ? 1.2414 1.9324 2.3117 0.5960  0.1325  -0.1086 218 SER C O   
3276 C CB  . SER C 205 ? 1.2121 1.7179 2.1498 0.5924  0.1276  -0.1822 218 SER C CB  
3277 O OG  . SER C 205 ? 1.2205 1.7032 2.2054 0.6043  0.0913  -0.1606 218 SER C OG  
3278 N N   . SER C 206 ? 1.2660 2.0033 2.3043 0.6028  0.2160  -0.1510 219 SER C N   
3279 C CA  . SER C 206 ? 1.2335 2.0489 2.3418 0.6289  0.2418  -0.1379 219 SER C CA  
3280 C C   . SER C 206 ? 1.2762 2.1102 2.3811 0.6455  0.2979  -0.1781 219 SER C C   
3281 O O   . SER C 206 ? 1.3056 2.1380 2.3556 0.6226  0.3214  -0.2026 219 SER C O   
3282 C CB  . SER C 206 ? 1.1683 2.0670 2.3068 0.5969  0.2365  -0.0931 219 SER C CB  
3283 O OG  . SER C 206 ? 1.2336 2.2066 2.4328 0.6140  0.2638  -0.0824 219 SER C OG  
3284 N N   . LYS C 207 ? 1.3712 2.2265 2.5246 0.6867  0.3155  -0.1879 220 LYS C N   
3285 C CA  . LYS C 207 ? 1.4776 2.3533 2.6265 0.7074  0.3679  -0.2296 220 LYS C CA  
3286 C C   . LYS C 207 ? 1.4085 2.3814 2.5948 0.6815  0.4116  -0.2196 220 LYS C C   
3287 O O   . LYS C 207 ? 1.4755 2.4740 2.6355 0.6881  0.4558  -0.2555 220 LYS C O   
3288 C CB  . LYS C 207 ? 1.5957 2.4663 2.7937 0.7604  0.3721  -0.2432 220 LYS C CB  
3289 C CG  . LYS C 207 ? 1.7049 2.4787 2.8492 0.7868  0.3635  -0.2947 220 LYS C CG  
3290 C CD  . LYS C 207 ? 1.7459 2.4586 2.9211 0.8108  0.3132  -0.2873 220 LYS C CD  
3291 C CE  . LYS C 207 ? 1.7159 2.3755 2.8639 0.7758  0.2582  -0.2593 220 LYS C CE  
3292 N NZ  . LYS C 207 ? 1.7293 2.3166 2.9009 0.7910  0.2073  -0.2561 220 LYS C NZ  
3293 N N   . HIS C 208 ? 1.2468 2.2671 2.4844 0.6445  0.3909  -0.1771 221 HIS C N   
3294 C CA  . HIS C 208 ? 1.1710 2.2867 2.4598 0.6137  0.4185  -0.1779 221 HIS C CA  
3295 C C   . HIS C 208 ? 1.0907 2.2336 2.3430 0.5611  0.4024  -0.1647 221 HIS C C   
3296 O O   . HIS C 208 ? 1.0915 2.3170 2.3701 0.5333  0.4101  -0.1524 221 HIS C O   
3297 C CB  . HIS C 208 ? 1.2482 2.4162 2.6500 0.6143  0.4023  -0.1616 221 HIS C CB  
3298 C CG  . HIS C 208 ? 1.3884 2.5224 2.8128 0.6722  0.4077  -0.1437 221 HIS C CG  
3299 N ND1 . HIS C 208 ? 1.4378 2.5379 2.8037 0.7089  0.3562  -0.1049 221 HIS C ND1 
3300 C CD2 . HIS C 208 ? 1.4230 2.5862 2.8741 0.7185  0.4487  -0.1639 221 HIS C CD2 
3301 C CE1 . HIS C 208 ? 1.4374 2.5410 2.8228 0.7646  0.3569  -0.1259 221 HIS C CE1 
3302 N NE2 . HIS C 208 ? 1.4558 2.5919 2.8906 0.7740  0.4183  -0.1478 221 HIS C NE2 
3303 N N   . SER C 209 ? 1.0748 2.1467 2.2490 0.5481  0.3765  -0.1616 222 SER C N   
3304 C CA  . SER C 209 ? 1.0459 2.1312 2.1649 0.5008  0.3588  -0.1433 222 SER C CA  
3305 C C   . SER C 209 ? 0.9683 1.9694 1.9985 0.4955  0.3385  -0.1513 222 SER C C   
3306 O O   . SER C 209 ? 0.9571 1.8870 1.9639 0.5267  0.3321  -0.1718 222 SER C O   
3307 C CB  . SER C 209 ? 0.9962 2.1178 2.1745 0.4727  0.3146  -0.1085 222 SER C CB  
3308 O OG  . SER C 209 ? 0.9918 2.0526 2.1935 0.4840  0.2659  -0.1057 222 SER C OG  
3309 N N   . ALA C 210 ? 0.8737 1.8838 1.8523 0.4556  0.3255  -0.1339 223 ALA C N   
3310 C CA  . ALA C 210 ? 0.9561 1.8956 1.8596 0.4451  0.3024  -0.1392 223 ALA C CA  
3311 C C   . ALA C 210 ? 0.8848 1.8097 1.8119 0.4216  0.2542  -0.1020 223 ALA C C   
3312 O O   . ALA C 210 ? 0.8360 1.8147 1.7973 0.3945  0.2424  -0.0710 223 ALA C O   
3313 C CB  . ALA C 210 ? 1.0144 1.9696 1.8354 0.4184  0.3249  -0.1494 223 ALA C CB  
3314 N N   . ILE C 211 ? 0.8782 1.7271 1.7799 0.4310  0.2240  -0.1055 224 ILE C N   
3315 C CA  . ILE C 211 ? 0.8167 1.6435 1.7355 0.4117  0.1769  -0.0728 224 ILE C CA  
3316 C C   . ILE C 211 ? 0.8978 1.6831 1.7407 0.3891  0.1605  -0.0705 224 ILE C C   
3317 O O   . ILE C 211 ? 0.9661 1.6913 1.7555 0.4014  0.1612  -0.1012 224 ILE C O   
3318 C CB  . ILE C 211 ? 0.7371 1.5102 1.6941 0.4396  0.1481  -0.0638 224 ILE C CB  
3319 C CG1 . ILE C 211 ? 0.6782 1.5141 1.6934 0.4590  0.1389  -0.0814 224 ILE C CG1 
3320 C CG2 . ILE C 211 ? 0.6925 1.4384 1.6236 0.4221  0.0939  -0.0413 224 ILE C CG2 
3321 C CD1 . ILE C 211 ? 0.8307 1.6582 1.8681 0.4966  0.1962  -0.0780 224 ILE C CD1 
3322 N N   . ARG C 212 ? 0.9221 1.7326 1.7604 0.3529  0.1422  -0.0365 225 ARG C N   
3323 C CA  . ARG C 212 ? 0.8652 1.6216 1.6353 0.3233  0.1212  -0.0297 225 ARG C CA  
3324 C C   . ARG C 212 ? 0.7687 1.4432 1.5315 0.3245  0.0803  -0.0223 225 ARG C C   
3325 O O   . ARG C 212 ? 0.6692 1.3537 1.4830 0.3252  0.0533  0.0050  225 ARG C O   
3326 C CB  . ARG C 212 ? 0.9304 1.7352 1.7013 0.2843  0.1124  0.0047  225 ARG C CB  
3327 C CG  . ARG C 212 ? 1.0805 1.9280 1.8116 0.2660  0.1445  -0.0046 225 ARG C CG  
3328 C CD  . ARG C 212 ? 1.1714 2.0645 1.9124 0.2259  0.1315  0.0323  225 ARG C CD  
3329 N NE  . ARG C 212 ? 1.2218 2.0731 1.9611 0.2057  0.0876  0.0577  225 ARG C NE  
3330 C CZ  . ARG C 212 ? 1.1768 2.0338 1.9057 0.1681  0.0660  0.0837  225 ARG C CZ  
3331 N NH1 . ARG C 212 ? 1.1283 2.0336 1.8500 0.1452  0.0825  0.0927  225 ARG C NH1 
3332 N NH2 . ARG C 212 ? 1.1549 1.9634 1.8759 0.1534  0.0265  0.0995  225 ARG C NH2 
3333 N N   . PRO C 213 ? 0.8016 1.3959 1.4998 0.3231  0.0746  -0.0449 226 PRO C N   
3334 C CA  . PRO C 213 ? 0.8265 1.3421 1.5067 0.3200  0.0375  -0.0376 226 PRO C CA  
3335 C C   . PRO C 213 ? 0.6761 1.1774 1.3301 0.2836  0.0097  -0.0090 226 PRO C C   
3336 O O   . PRO C 213 ? 0.5757 1.1174 1.2190 0.2604  0.0185  0.0014  226 PRO C O   
3337 C CB  . PRO C 213 ? 0.8156 1.2631 1.4307 0.3240  0.0456  -0.0695 226 PRO C CB  
3338 C CG  . PRO C 213 ? 0.6882 1.1700 1.2655 0.3103  0.0776  -0.0838 226 PRO C CG  
3339 C CD  . PRO C 213 ? 0.7253 1.3005 1.3615 0.3215  0.1022  -0.0770 226 PRO C CD  
3340 N N   . PHE C 214 ? 0.6594 1.1038 1.3028 0.2787  -0.0242 0.0032  227 PHE C N   
3341 C CA  . PHE C 214 ? 0.6715 1.0936 1.2814 0.2471  -0.0500 0.0240  227 PHE C CA  
3342 C C   . PHE C 214 ? 0.7791 1.1211 1.3339 0.2395  -0.0699 0.0185  227 PHE C C   
3343 O O   . PHE C 214 ? 0.8547 1.1591 1.4208 0.2557  -0.0853 0.0177  227 PHE C O   
3344 C CB  . PHE C 214 ? 0.5185 0.9721 1.1805 0.2423  -0.0769 0.0555  227 PHE C CB  
3345 C CG  . PHE C 214 ? 0.6406 1.0693 1.2671 0.2125  -0.1047 0.0730  227 PHE C CG  
3346 C CD1 . PHE C 214 ? 0.6030 0.9756 1.2065 0.2073  -0.1364 0.0818  227 PHE C CD1 
3347 C CD2 . PHE C 214 ? 0.6766 1.1373 1.2916 0.1896  -0.1000 0.0798  227 PHE C CD2 
3348 C CE1 . PHE C 214 ? 0.6126 0.9631 1.1798 0.1824  -0.1595 0.0932  227 PHE C CE1 
3349 C CE2 . PHE C 214 ? 0.6370 1.0721 1.2213 0.1657  -0.1262 0.0916  227 PHE C CE2 
3350 C CZ  . PHE C 214 ? 0.6424 1.0232 1.2017 0.1634  -0.1543 0.0964  227 PHE C CZ  
3351 N N   . ASP C 215 ? 0.7780 1.0967 1.2763 0.2141  -0.0704 0.0165  228 ASP C N   
3352 C CA  . ASP C 215 ? 0.8391 1.0919 1.2853 0.2025  -0.0883 0.0157  228 ASP C CA  
3353 C C   . ASP C 215 ? 0.7448 0.9932 1.1650 0.1762  -0.1069 0.0315  228 ASP C C   
3354 O O   . ASP C 215 ? 0.6686 0.9577 1.1014 0.1644  -0.1033 0.0383  228 ASP C O   
3355 C CB  . ASP C 215 ? 0.8992 1.1180 1.2972 0.2005  -0.0692 -0.0075 228 ASP C CB  
3356 C CG  . ASP C 215 ? 0.9192 1.1734 1.3023 0.1887  -0.0437 -0.0178 228 ASP C CG  
3357 O OD1 . ASP C 215 ? 1.0048 1.3038 1.4064 0.1762  -0.0441 -0.0045 228 ASP C OD1 
3358 O OD2 . ASP C 215 ? 0.9179 1.1523 1.2696 0.1901  -0.0262 -0.0378 228 ASP C OD2 
3359 N N   . GLN C 216 ? 0.7850 0.9843 1.1689 0.1669  -0.1276 0.0371  229 GLN C N   
3360 C CA  . GLN C 216 ? 0.7452 0.9367 1.1006 0.1453  -0.1451 0.0478  229 GLN C CA  
3361 C C   . GLN C 216 ? 0.7388 0.8785 1.0363 0.1331  -0.1524 0.0447  229 GLN C C   
3362 O O   . GLN C 216 ? 0.8129 0.9175 1.1014 0.1401  -0.1598 0.0459  229 GLN C O   
3363 C CB  . GLN C 216 ? 0.7070 0.9117 1.0967 0.1466  -0.1732 0.0688  229 GLN C CB  
3364 C CG  . GLN C 216 ? 0.7494 0.9469 1.1112 0.1264  -0.1933 0.0768  229 GLN C CG  
3365 C CD  . GLN C 216 ? 0.8466 1.0591 1.2447 0.1264  -0.2231 0.0978  229 GLN C CD  
3366 O OE1 . GLN C 216 ? 0.9770 1.2207 1.4323 0.1401  -0.2249 0.1085  229 GLN C OE1 
3367 N NE2 . GLN C 216 ? 0.7853 0.9761 1.1509 0.1114  -0.2471 0.1032  229 GLN C NE2 
3368 N N   . LEU C 217 ? 0.7240 0.8611 0.9856 0.1146  -0.1510 0.0417  230 LEU C N   
3369 C CA  . LEU C 217 ? 0.7311 0.8297 0.9395 0.1013  -0.1557 0.0405  230 LEU C CA  
3370 C C   . LEU C 217 ? 0.7937 0.8809 0.9839 0.0923  -0.1811 0.0524  230 LEU C C   
3371 O O   . LEU C 217 ? 0.8930 0.9998 1.0889 0.0864  -0.1887 0.0530  230 LEU C O   
3372 C CB  . LEU C 217 ? 0.7014 0.8048 0.8818 0.0880  -0.1362 0.0276  230 LEU C CB  
3373 C CG  . LEU C 217 ? 0.8132 0.9122 0.9904 0.0912  -0.1138 0.0153  230 LEU C CG  
3374 C CD1 . LEU C 217 ? 0.7149 0.8257 0.8739 0.0762  -0.0990 0.0062  230 LEU C CD1 
3375 C CD2 . LEU C 217 ? 0.8693 0.9252 1.0206 0.0922  -0.1176 0.0167  230 LEU C CD2 
3376 N N   . PHE C 218 ? 0.7992 0.8524 0.9655 0.0902  -0.1967 0.0622  231 PHE C N   
3377 C CA  . PHE C 218 ? 0.7748 0.8133 0.9138 0.0799  -0.2215 0.0732  231 PHE C CA  
3378 C C   . PHE C 218 ? 0.9144 0.9300 0.9918 0.0635  -0.2160 0.0696  231 PHE C C   
3379 O O   . PHE C 218 ? 1.0456 1.0436 1.1059 0.0604  -0.2050 0.0693  231 PHE C O   
3380 C CB  . PHE C 218 ? 0.7884 0.8085 0.9467 0.0866  -0.2482 0.0920  231 PHE C CB  
3381 C CG  . PHE C 218 ? 0.7109 0.7593 0.9360 0.1034  -0.2548 0.0983  231 PHE C CG  
3382 C CD1 . PHE C 218 ? 0.6790 0.7403 0.9470 0.1215  -0.2383 0.0925  231 PHE C CD1 
3383 C CD2 . PHE C 218 ? 0.6633 0.7264 0.9087 0.1012  -0.2780 0.1101  231 PHE C CD2 
3384 C CE1 . PHE C 218 ? 0.7292 0.8246 1.0615 0.1378  -0.2408 0.0985  231 PHE C CE1 
3385 C CE2 . PHE C 218 ? 0.7281 0.8235 1.0401 0.1151  -0.2840 0.1196  231 PHE C CE2 
3386 C CZ  . PHE C 218 ? 0.7482 0.8633 1.1051 0.1338  -0.2635 0.1139  231 PHE C CZ  
3387 N N   . ALA C 219 ? 0.7937 0.8107 0.8388 0.0531  -0.2240 0.0666  232 ALA C N   
3388 C CA  . ALA C 219 ? 0.7238 0.7245 0.7092 0.0380  -0.2200 0.0648  232 ALA C CA  
3389 C C   . ALA C 219 ? 0.8947 0.8689 0.8519 0.0306  -0.2476 0.0831  232 ALA C C   
3390 O O   . ALA C 219 ? 0.9736 0.9458 0.9443 0.0338  -0.2721 0.0905  232 ALA C O   
3391 C CB  . ALA C 219 ? 0.6995 0.7164 0.6637 0.0331  -0.2125 0.0477  232 ALA C CB  
3392 N N   . LEU C 220 ? 0.9512 0.9051 0.8697 0.0183  -0.2462 0.0931  233 LEU C N   
3393 C CA  . LEU C 220 ? 0.9710 0.8974 0.8618 0.0078  -0.2745 0.1150  233 LEU C CA  
3394 C C   . LEU C 220 ? 1.0572 0.9819 0.9065 -0.0013 -0.2918 0.1139  233 LEU C C   
3395 O O   . LEU C 220 ? 1.1529 1.0599 1.0017 -0.0040 -0.3232 0.1303  233 LEU C O   
3396 C CB  . LEU C 220 ? 1.0378 0.9461 0.8903 -0.0085 -0.2694 0.1278  233 LEU C CB  
3397 C CG  . LEU C 220 ? 1.0702 0.9685 0.9582 -0.0009 -0.2601 0.1305  233 LEU C CG  
3398 C CD1 . LEU C 220 ? 1.1737 1.0533 1.0214 -0.0212 -0.2593 0.1462  233 LEU C CD1 
3399 C CD2 . LEU C 220 ? 1.0606 0.9427 1.0009 0.0153  -0.2832 0.1411  233 LEU C CD2 
3400 N N   . HIS C 221 ? 0.9380 0.8798 0.7544 -0.0052 -0.2729 0.0934  234 HIS C N   
3401 C CA  . HIS C 221 ? 0.9939 0.9318 0.7642 -0.0121 -0.2873 0.0859  234 HIS C CA  
3402 C C   . HIS C 221 ? 1.0896 1.0261 0.8959 -0.0015 -0.3133 0.0846  234 HIS C C   
3403 O O   . HIS C 221 ? 1.1033 1.0260 0.8749 -0.0076 -0.3368 0.0838  234 HIS C O   
3404 C CB  . HIS C 221 ? 0.9515 0.9103 0.6879 -0.0138 -0.2592 0.0598  234 HIS C CB  
3405 C CG  . HIS C 221 ? 1.0478 1.0296 0.8329 0.0011  -0.2427 0.0393  234 HIS C CG  
3406 N ND1 . HIS C 221 ? 1.0628 1.0483 0.8675 0.0101  -0.2577 0.0261  234 HIS C ND1 
3407 C CD2 . HIS C 221 ? 0.9874 0.9882 0.8046 0.0060  -0.2158 0.0320  234 HIS C CD2 
3408 C CE1 . HIS C 221 ? 1.0137 1.0210 0.8613 0.0193  -0.2405 0.0128  234 HIS C CE1 
3409 N NE2 . HIS C 221 ? 0.9344 0.9515 0.7890 0.0171  -0.2146 0.0156  234 HIS C NE2 
3410 N N   . ALA C 222 ? 1.0715 1.0232 0.9462 0.0131  -0.3097 0.0854  235 ALA C N   
3411 C CA  . ALA C 222 ? 0.9971 0.9559 0.9155 0.0219  -0.3324 0.0875  235 ALA C CA  
3412 C C   . ALA C 222 ? 1.0239 0.9705 0.9787 0.0247  -0.3615 0.1140  235 ALA C C   
3413 O O   . ALA C 222 ? 1.0221 0.9679 0.9995 0.0261  -0.3901 0.1227  235 ALA C O   
3414 C CB  . ALA C 222 ? 0.8970 0.8870 0.8697 0.0342  -0.3119 0.0746  235 ALA C CB  
3415 N N   . ILE C 223 ? 0.9641 0.9006 0.9283 0.0256  -0.3568 0.1276  236 ILE C N   
3416 C CA  . ILE C 223 ? 0.8694 0.7964 0.8803 0.0322  -0.3827 0.1514  236 ILE C CA  
3417 C C   . ILE C 223 ? 1.0276 0.9182 0.9964 0.0169  -0.4089 0.1732  236 ILE C C   
3418 O O   . ILE C 223 ? 1.0220 0.8996 1.0254 0.0197  -0.4385 0.1955  236 ILE C O   
3419 C CB  . ILE C 223 ? 0.8148 0.7576 0.8868 0.0502  -0.3619 0.1502  236 ILE C CB  
3420 C CG1 . ILE C 223 ? 0.9074 0.8319 0.9470 0.0446  -0.3431 0.1477  236 ILE C CG1 
3421 C CG2 . ILE C 223 ? 0.7687 0.7498 0.8798 0.0621  -0.3368 0.1319  236 ILE C CG2 
3422 C CD1 . ILE C 223 ? 0.8771 0.8089 0.9685 0.0625  -0.3250 0.1430  236 ILE C CD1 
3423 N N   . ASP C 224 ? 1.0864 0.9635 0.9833 -0.0002 -0.3986 0.1684  237 ASP C N   
3424 C CA  . ASP C 224 ? 1.1919 1.0371 1.0420 -0.0195 -0.4225 0.1917  237 ASP C CA  
3425 C C   . ASP C 224 ? 1.3302 1.1581 1.1455 -0.0322 -0.4592 0.2026  237 ASP C C   
3426 O O   . ASP C 224 ? 1.4045 1.2344 1.1621 -0.0414 -0.4548 0.1866  237 ASP C O   
3427 C CB  . ASP C 224 ? 1.2947 1.1384 1.0779 -0.0363 -0.3980 0.1856  237 ASP C CB  
3428 C CG  . ASP C 224 ? 1.5522 1.3660 1.2916 -0.0591 -0.4218 0.2146  237 ASP C CG  
3429 O OD1 . ASP C 224 ? 1.5680 1.3594 1.3445 -0.0574 -0.4529 0.2388  237 ASP C OD1 
3430 O OD2 . ASP C 224 ? 1.6698 1.4848 1.3397 -0.0793 -0.4097 0.2143  237 ASP C OD2 
3431 N N   . GLN C 225 ? 1.4756 1.1508 0.9845 -0.1629 -0.2530 0.2603  238 GLN C N   
3432 C CA  . GLN C 225 ? 1.4486 1.1409 0.9587 -0.1768 -0.2558 0.2774  238 GLN C CA  
3433 C C   . GLN C 225 ? 1.3808 1.0287 0.8470 -0.2226 -0.2632 0.2855  238 GLN C C   
3434 O O   . GLN C 225 ? 1.4626 1.0474 0.8891 -0.2250 -0.2835 0.2934  238 GLN C O   
3435 C CB  . GLN C 225 ? 1.5679 1.2523 1.0808 -0.1377 -0.2741 0.2925  238 GLN C CB  
3436 C CG  . GLN C 225 ? 1.7449 1.4417 1.2579 -0.1510 -0.2831 0.3111  238 GLN C CG  
3437 C CD  . GLN C 225 ? 1.8406 1.6076 1.3961 -0.1618 -0.2634 0.3086  238 GLN C CD  
3438 O OE1 . GLN C 225 ? 1.7896 1.5714 1.3422 -0.1982 -0.2483 0.2999  238 GLN C OE1 
3439 N NE2 . GLN C 225 ? 1.8920 1.7030 1.4900 -0.1298 -0.2637 0.3163  238 GLN C NE2 
3440 N N   . ILE C 226 ? 1.3639 1.0444 0.8366 -0.2587 -0.2465 0.2835  239 ILE C N   
3441 C CA  . ILE C 226 ? 1.4019 1.0478 0.8318 -0.3050 -0.2474 0.2907  239 ILE C CA  
3442 C C   . ILE C 226 ? 1.5289 1.1472 0.9249 -0.3076 -0.2684 0.3135  239 ILE C C   
3443 O O   . ILE C 226 ? 1.5562 1.2099 0.9740 -0.2914 -0.2713 0.3197  239 ILE C O   
3444 C CB  . ILE C 226 ? 1.4054 1.0984 0.8535 -0.3410 -0.2199 0.2780  239 ILE C CB  
3445 C CG1 . ILE C 226 ? 1.3857 1.1134 0.8769 -0.3342 -0.2016 0.2555  239 ILE C CG1 
3446 C CG2 . ILE C 226 ? 1.3050 0.9629 0.7072 -0.3895 -0.2159 0.2839  239 ILE C CG2 
3447 C CD1 . ILE C 226 ? 1.3936 1.0757 0.8684 -0.3398 -0.2074 0.2487  239 ILE C CD1 
3448 N N   . ASN C 227 ? 1.5599 1.1133 0.9038 -0.3284 -0.2853 0.3269  240 ASN C N   
3449 C CA  . ASN C 227 ? 1.5284 1.0474 0.8325 -0.3350 -0.3085 0.3503  240 ASN C CA  
3450 C C   . ASN C 227 ? 1.6135 1.1584 0.9003 -0.3733 -0.2946 0.3535  240 ASN C C   
3451 O O   . ASN C 227 ? 1.5941 1.1660 0.8869 -0.4034 -0.2675 0.3393  240 ASN C O   
3452 C CB  . ASN C 227 ? 1.5921 1.0297 0.8438 -0.3473 -0.3319 0.3650  240 ASN C CB  
3453 C CG  . ASN C 227 ? 1.6417 1.0470 0.9058 -0.3031 -0.3525 0.3625  240 ASN C CG  
3454 O OD1 . ASN C 227 ? 1.6009 1.0225 0.8906 -0.2613 -0.3647 0.3651  240 ASN C OD1 
3455 N ND2 . ASN C 227 ? 1.6033 0.9634 0.8509 -0.3117 -0.3563 0.3565  240 ASN C ND2 
3456 N N   . PRO C 228 ? 1.6406 1.1784 0.9074 -0.3710 -0.3139 0.3708  241 PRO C N   
3457 C CA  . PRO C 228 ? 1.5605 1.1206 0.8057 -0.4042 -0.3035 0.3724  241 PRO C CA  
3458 C C   . PRO C 228 ? 1.7231 1.2432 0.9090 -0.4521 -0.2948 0.3773  241 PRO C C   
3459 O O   . PRO C 228 ? 1.8472 1.3143 1.0078 -0.4568 -0.3058 0.3847  241 PRO C O   
3460 C CB  . PRO C 228 ? 1.6216 1.1707 0.8581 -0.3848 -0.3344 0.3907  241 PRO C CB  
3461 C CG  . PRO C 228 ? 1.7304 1.2791 1.0074 -0.3357 -0.3520 0.3942  241 PRO C CG  
3462 C CD  . PRO C 228 ? 1.7281 1.2428 0.9982 -0.3334 -0.3464 0.3871  241 PRO C CD  
3463 N N   . PRO C 229 ? 1.7870 1.3379 0.9615 -0.4835 -0.2727 0.3675  242 PRO C N   
3464 C CA  . PRO C 229 ? 1.8324 1.3553 0.9603 -0.5234 -0.2615 0.3672  242 PRO C CA  
3465 C C   . PRO C 229 ? 1.8924 1.3627 0.9814 -0.5187 -0.2921 0.3850  242 PRO C C   
3466 O O   . PRO C 229 ? 1.8800 1.3533 0.9778 -0.4934 -0.3151 0.3924  242 PRO C O   
3467 C CB  . PRO C 229 ? 1.8138 1.3849 0.9401 -0.5460 -0.2372 0.3526  242 PRO C CB  
3468 C CG  . PRO C 229 ? 1.8048 1.4309 0.9840 -0.5269 -0.2267 0.3417  242 PRO C CG  
3469 C CD  . PRO C 229 ? 1.7538 1.3691 0.9622 -0.4825 -0.2555 0.3535  242 PRO C CD  
3470 N N   . LEU C 230 ? 1.9144 1.3384 0.9643 -0.5433 -0.2932 0.3923  243 LEU C N   
3471 C CA  . LEU C 230 ? 2.0259 1.3946 1.0401 -0.5385 -0.3248 0.4107  243 LEU C CA  
3472 C C   . LEU C 230 ? 2.0589 1.4181 1.0230 -0.5717 -0.3191 0.4141  243 LEU C C   
3473 O O   . LEU C 230 ? 2.0646 1.4515 1.0166 -0.6028 -0.2875 0.4020  243 LEU C O   
3474 C CB  . LEU C 230 ? 2.1605 1.4746 1.1644 -0.5385 -0.3383 0.4204  243 LEU C CB  
3475 C CG  . LEU C 230 ? 2.3697 1.6285 1.3613 -0.5127 -0.3788 0.4378  243 LEU C CG  
3476 C CD1 . LEU C 230 ? 2.3756 1.6580 1.3975 -0.4731 -0.3979 0.4391  243 LEU C CD1 
3477 C CD2 . LEU C 230 ? 2.3244 1.5433 1.3269 -0.4984 -0.3913 0.4405  243 LEU C CD2 
3478 N N   . ASN C 231 ? 2.0660 1.3862 1.0016 -0.5636 -0.3498 0.4299  244 ASN C N   
3479 C CA  . ASN C 231 ? 2.1390 1.4413 1.0199 -0.5926 -0.3500 0.4362  244 ASN C CA  
3480 C C   . ASN C 231 ? 2.0742 1.4260 0.9506 -0.6068 -0.3265 0.4208  244 ASN C C   
3481 O O   . ASN C 231 ? 2.1121 1.4657 0.9477 -0.6407 -0.3050 0.4166  244 ASN C O   
3482 C CB  . ASN C 231 ? 2.0945 1.3616 0.9347 -0.6284 -0.3378 0.4431  244 ASN C CB  
3483 C CG  . ASN C 231 ? 2.3084 1.5167 1.1442 -0.6170 -0.3673 0.4603  244 ASN C CG  
3484 O OD1 . ASN C 231 ? 2.1633 1.3414 0.9999 -0.5906 -0.4024 0.4723  244 ASN C OD1 
3485 N ND2 . ASN C 231 ? 2.3268 1.5187 1.1605 -0.6363 -0.3543 0.4609  244 ASN C ND2 
3486 N N   . VAL C 232 ? 1.9894 1.3814 0.9084 -0.5800 -0.3310 0.4124  245 VAL C N   
3487 C CA  . VAL C 232 ? 1.9904 1.4281 0.9095 -0.5896 -0.3140 0.3973  245 VAL C CA  
3488 C C   . VAL C 232 ? 2.1550 1.5680 1.0238 -0.6000 -0.3324 0.4055  245 VAL C C   
3489 O O   . VAL C 232 ? 2.1988 1.5947 1.0739 -0.5760 -0.3668 0.4173  245 VAL C O   
3490 C CB  . VAL C 232 ? 1.9205 1.4046 0.9001 -0.5569 -0.3199 0.3898  245 VAL C CB  
3491 C CG1 . VAL C 232 ? 1.7904 1.3170 0.7677 -0.5680 -0.3068 0.3747  245 VAL C CG1 
3492 C CG2 . VAL C 232 ? 1.8678 1.3770 0.8938 -0.5469 -0.3011 0.3815  245 VAL C CG2 
3493 N N   . THR C 233 ? 2.2503 1.6619 1.0696 -0.6352 -0.3092 0.3988  246 THR C N   
3494 C CA  . THR C 233 ? 2.4158 1.8027 1.1790 -0.6480 -0.3239 0.4054  246 THR C CA  
3495 C C   . THR C 233 ? 2.4541 1.8811 1.2008 -0.6659 -0.2979 0.3846  246 THR C C   
3496 O O   . THR C 233 ? 2.3700 1.8322 1.1272 -0.6833 -0.2600 0.3668  246 THR C O   
3497 C CB  . THR C 233 ? 2.5612 1.8960 1.2631 -0.6749 -0.3250 0.4211  246 THR C CB  
3498 O OG1 . THR C 233 ? 2.6234 1.9766 1.3097 -0.7068 -0.2831 0.4094  246 THR C OG1 
3499 C CG2 . THR C 233 ? 2.5440 1.8354 1.2602 -0.6584 -0.3521 0.4406  246 THR C CG2 
3500 N N   . ALA C 234 ? 2.5440 1.9649 1.2665 -0.6608 -0.3196 0.3860  247 ALA C N   
3501 C CA  . ALA C 234 ? 2.4279 1.8790 1.1260 -0.6769 -0.2999 0.3660  247 ALA C CA  
3502 C C   . ALA C 234 ? 2.4433 1.8542 1.0652 -0.6940 -0.3137 0.3743  247 ALA C C   
3503 O O   . ALA C 234 ? 2.3594 1.7365 0.9696 -0.6787 -0.3536 0.3909  247 ALA C O   
3504 C CB  . ALA C 234 ? 2.2142 1.7064 0.9642 -0.6518 -0.3131 0.3549  247 ALA C CB  
3505 N N   . GLU C 235 ? 2.5420 1.9573 1.1129 -0.7251 -0.2804 0.3626  248 GLU C N   
3506 C CA  . GLU C 235 ? 2.6490 2.0270 1.1405 -0.7433 -0.2891 0.3698  248 GLU C CA  
3507 C C   . GLU C 235 ? 2.6612 2.0688 1.1266 -0.7518 -0.2725 0.3453  248 GLU C C   
3508 O O   . GLU C 235 ? 2.5710 2.0257 1.0605 -0.7596 -0.2358 0.3211  248 GLU C O   
3509 C CB  . GLU C 235 ? 2.7077 2.0583 1.1492 -0.7737 -0.2655 0.3802  248 GLU C CB  
3510 C CG  . GLU C 235 ? 2.8732 2.1791 1.2277 -0.7924 -0.2768 0.3926  248 GLU C CG  
3511 C CD  . GLU C 235 ? 2.9774 2.2739 1.2816 -0.8271 -0.2404 0.3959  248 GLU C CD  
3512 O OE1 . GLU C 235 ? 3.0343 2.2806 1.2827 -0.8406 -0.2563 0.4195  248 GLU C OE1 
3513 O OE2 . GLU C 235 ? 2.9912 2.3316 1.3134 -0.8411 -0.1959 0.3753  248 GLU C OE2 
3514 N N   . ILE C 236 ? 2.7448 2.1235 1.1612 -0.7496 -0.3011 0.3506  249 ILE C N   
3515 C CA  . ILE C 236 ? 2.7589 2.1562 1.1374 -0.7582 -0.2890 0.3275  249 ILE C CA  
3516 C C   . ILE C 236 ? 2.9349 2.3029 1.2232 -0.7878 -0.2692 0.3297  249 ILE C C   
3517 O O   . ILE C 236 ? 3.0394 2.3568 1.2738 -0.7912 -0.2978 0.3511  249 ILE C O   
3518 C CB  . ILE C 236 ? 2.6880 2.0748 1.0706 -0.7352 -0.3354 0.3289  249 ILE C CB  
3519 C CG1 . ILE C 236 ? 2.5870 2.0084 1.0620 -0.7053 -0.3539 0.3270  249 ILE C CG1 
3520 C CG2 . ILE C 236 ? 2.6821 2.0805 1.0149 -0.7451 -0.3253 0.3042  249 ILE C CG2 
3521 C CD1 . ILE C 236 ? 2.4395 1.9030 0.9421 -0.6952 -0.3554 0.3013  249 ILE C CD1 
3522 N N   . GLU C 237 ? 3.0082 2.4092 1.2816 -0.8090 -0.2199 0.3078  250 GLU C N   
3523 C CA  . GLU C 237 ? 3.2095 2.5908 1.3976 -0.8362 -0.1961 0.3066  250 GLU C CA  
3524 C C   . GLU C 237 ? 3.3324 2.7351 1.4861 -0.8362 -0.1860 0.2773  250 GLU C C   
3525 O O   . GLU C 237 ? 3.3493 2.7927 1.5029 -0.8489 -0.1409 0.2502  250 GLU C O   
3526 C CB  . GLU C 237 ? 3.1938 2.5951 1.3852 -0.8612 -0.1463 0.3039  250 GLU C CB  
3527 C CG  . GLU C 237 ? 3.3151 2.6927 1.4184 -0.8899 -0.1225 0.3096  250 GLU C CG  
3528 C CD  . GLU C 237 ? 3.3100 2.6993 1.4216 -0.9139 -0.0819 0.3158  250 GLU C CD  
3529 O OE1 . GLU C 237 ? 3.3272 2.7425 1.4087 -0.9346 -0.0365 0.2991  250 GLU C OE1 
3530 O OE2 . GLU C 237 ? 3.2770 2.6497 1.4261 -0.9114 -0.0958 0.3370  250 GLU C OE2 
3531 N N   . GLY C 238 ? 3.3889 2.7643 1.5168 -0.8207 -0.2297 0.2816  251 GLY C N   
3532 C CA  . GLY C 238 ? 3.3850 2.7734 1.4777 -0.8174 -0.2292 0.2541  251 GLY C CA  
3533 C C   . GLY C 238 ? 3.2625 2.7065 1.4265 -0.8018 -0.2196 0.2237  251 GLY C C   
3534 O O   . GLY C 238 ? 3.1807 2.6300 1.3976 -0.7779 -0.2572 0.2263  251 GLY C O   
3535 N N   . THR C 239 ? 3.2149 2.7021 1.3835 -0.8154 -0.1688 0.1949  252 THR C N   
3536 C CA  . THR C 239 ? 3.0435 2.5839 1.2697 -0.8034 -0.1563 0.1608  252 THR C CA  
3537 C C   . THR C 239 ? 2.9716 2.5546 1.2878 -0.7994 -0.1364 0.1591  252 THR C C   
3538 O O   . THR C 239 ? 2.9180 2.5468 1.2883 -0.7899 -0.1265 0.1324  252 THR C O   
3539 C CB  . THR C 239 ? 2.9641 2.5308 1.1463 -0.8173 -0.1133 0.1236  252 THR C CB  
3540 O OG1 . THR C 239 ? 2.7679 2.3890 1.0147 -0.8068 -0.0981 0.0891  252 THR C OG1 
3541 C CG2 . THR C 239 ? 2.9989 2.5720 1.1532 -0.8441 -0.0619 0.1269  252 THR C CG2 
3542 N N   . ARG C 240 ? 2.9426 2.5097 1.2748 -0.8061 -0.1323 0.1866  253 ARG C N   
3543 C CA  . ARG C 240 ? 2.7492 2.3537 1.1623 -0.8024 -0.1135 0.1853  253 ARG C CA  
3544 C C   . ARG C 240 ? 2.6753 2.2534 1.1272 -0.7877 -0.1471 0.2189  253 ARG C C   
3545 O O   . ARG C 240 ? 2.6650 2.1927 1.0770 -0.7869 -0.1767 0.2462  253 ARG C O   
3546 C CB  . ARG C 240 ? 2.7199 2.3484 1.1297 -0.8276 -0.0582 0.1743  253 ARG C CB  
3547 C CG  . ARG C 240 ? 2.7249 2.4027 1.1372 -0.8361 -0.0161 0.1332  253 ARG C CG  
3548 C CD  . ARG C 240 ? 2.7761 2.4827 1.2039 -0.8582 0.0369  0.1246  253 ARG C CD  
3549 N NE  . ARG C 240 ? 2.9183 2.5827 1.3017 -0.8748 0.0371  0.1560  253 ARG C NE  
3550 C CZ  . ARG C 240 ? 2.9553 2.6330 1.3383 -0.8967 0.0777  0.1560  253 ARG C CZ  
3551 N NH1 . ARG C 240 ? 2.9114 2.6450 1.3390 -0.9036 0.1226  0.1255  253 ARG C NH1 
3552 N NH2 . ARG C 240 ? 3.0103 2.6459 1.3511 -0.9114 0.0722  0.1867  253 ARG C NH2 
3553 N N   . LEU C 241 ? 2.6440 2.2572 1.1740 -0.7753 -0.1418 0.2154  254 LEU C N   
3554 C CA  . LEU C 241 ? 2.5731 2.1681 1.1472 -0.7590 -0.1678 0.2430  254 LEU C CA  
3555 C C   . LEU C 241 ? 2.5220 2.1227 1.1152 -0.7739 -0.1354 0.2481  254 LEU C C   
3556 O O   . LEU C 241 ? 2.4819 2.1244 1.0986 -0.7868 -0.0942 0.2256  254 LEU C O   
3557 C CB  . LEU C 241 ? 2.3881 2.0167 1.0371 -0.7315 -0.1885 0.2380  254 LEU C CB  
3558 C CG  . LEU C 241 ? 2.3565 1.9578 1.0172 -0.7050 -0.2427 0.2592  254 LEU C CG  
3559 C CD1 . LEU C 241 ? 2.2222 1.8647 0.9623 -0.6793 -0.2582 0.2539  254 LEU C CD1 
3560 C CD2 . LEU C 241 ? 2.3746 1.9282 1.0249 -0.7003 -0.2636 0.2909  254 LEU C CD2 
3561 N N   . SER C 242 ? 2.4845 2.0426 1.0695 -0.7716 -0.1556 0.2768  255 SER C N   
3562 C CA  . SER C 242 ? 2.4376 1.9952 1.0429 -0.7835 -0.1326 0.2840  255 SER C CA  
3563 C C   . SER C 242 ? 2.2433 1.7888 0.9030 -0.7585 -0.1610 0.3025  255 SER C C   
3564 O O   . SER C 242 ? 2.2425 1.7449 0.8874 -0.7446 -0.1994 0.3258  255 SER C O   
3565 C CB  . SER C 242 ? 2.6704 2.1848 1.2075 -0.8087 -0.1261 0.3008  255 SER C CB  
3566 O OG  . SER C 242 ? 2.7560 2.2666 1.3153 -0.8194 -0.1093 0.3099  255 SER C OG  
3567 N N   . ILE C 243 ? 2.1455 1.7293 0.8685 -0.7517 -0.1418 0.2911  256 ILE C N   
3568 C CA  . ILE C 243 ? 2.1081 1.6852 0.8846 -0.7256 -0.1654 0.3054  256 ILE C CA  
3569 C C   . ILE C 243 ? 2.0795 1.6537 0.8780 -0.7357 -0.1450 0.3088  256 ILE C C   
3570 O O   . ILE C 243 ? 1.9852 1.5936 0.7985 -0.7543 -0.1065 0.2902  256 ILE C O   
3571 C CB  . ILE C 243 ? 2.0434 1.6678 0.8822 -0.7018 -0.1689 0.2915  256 ILE C CB  
3572 C CG1 . ILE C 243 ? 2.0371 1.6699 0.8566 -0.6951 -0.1869 0.2845  256 ILE C CG1 
3573 C CG2 . ILE C 243 ? 1.9647 1.5792 0.8531 -0.6708 -0.1965 0.3087  256 ILE C CG2 
3574 C CD1 . ILE C 243 ? 1.8998 1.5846 0.7762 -0.6779 -0.1863 0.2681  256 ILE C CD1 
3575 N N   . GLN C 244 ? 2.1405 1.6734 0.9431 -0.7226 -0.1722 0.3316  257 GLN C N   
3576 C CA  . GLN C 244 ? 2.1559 1.6807 0.9827 -0.7279 -0.1607 0.3363  257 GLN C CA  
3577 C C   . GLN C 244 ? 2.0241 1.5237 0.8849 -0.6963 -0.1945 0.3527  257 GLN C C   
3578 O O   . GLN C 244 ? 2.0191 1.4920 0.8701 -0.6754 -0.2297 0.3671  257 GLN C O   
3579 C CB  . GLN C 244 ? 2.3813 1.8688 1.1551 -0.7581 -0.1514 0.3485  257 GLN C CB  
3580 C CG  . GLN C 244 ? 2.5288 1.9601 1.2451 -0.7580 -0.1854 0.3721  257 GLN C CG  
3581 C CD  . GLN C 244 ? 2.5823 2.0175 1.2453 -0.7731 -0.1787 0.3660  257 GLN C CD  
3582 O OE1 . GLN C 244 ? 2.5724 2.0391 1.2213 -0.7961 -0.1415 0.3483  257 GLN C OE1 
3583 N NE2 . GLN C 244 ? 2.6007 2.0035 1.2347 -0.7593 -0.2152 0.3797  257 GLN C NE2 
3584 N N   . TRP C 245 ? 1.9232 1.4319 0.8252 -0.6921 -0.1837 0.3495  258 TRP C N   
3585 C CA  . TRP C 245 ? 1.9252 1.4094 0.8578 -0.6622 -0.2120 0.3629  258 TRP C CA  
3586 C C   . TRP C 245 ? 1.9853 1.4476 0.9246 -0.6749 -0.2027 0.3669  258 TRP C C   
3587 O O   . TRP C 245 ? 2.1446 1.6009 1.0570 -0.7070 -0.1815 0.3656  258 TRP C O   
3588 C CB  . TRP C 245 ? 1.9667 1.4951 0.9570 -0.6330 -0.2126 0.3519  258 TRP C CB  
3589 C CG  . TRP C 245 ? 1.9462 1.5291 0.9720 -0.6463 -0.1747 0.3287  258 TRP C CG  
3590 C CD1 . TRP C 245 ? 1.9312 1.5283 0.9976 -0.6447 -0.1597 0.3215  258 TRP C CD1 
3591 C CD2 . TRP C 245 ? 1.8918 1.5211 0.9174 -0.6628 -0.1482 0.3083  258 TRP C CD2 
3592 N NE1 . TRP C 245 ? 1.9162 1.5681 1.0128 -0.6588 -0.1252 0.2978  258 TRP C NE1 
3593 C CE2 . TRP C 245 ? 1.8967 1.5695 0.9688 -0.6697 -0.1169 0.2888  258 TRP C CE2 
3594 C CE3 . TRP C 245 ? 1.8586 1.4951 0.8489 -0.6719 -0.1488 0.3036  258 TRP C CE3 
3595 C CZ2 . TRP C 245 ? 1.8213 1.5461 0.9093 -0.6844 -0.0858 0.2641  258 TRP C CZ2 
3596 C CZ3 . TRP C 245 ? 1.8245 1.5099 0.8243 -0.6872 -0.1181 0.2791  258 TRP C CZ3 
3597 C CH2 . TRP C 245 ? 1.7883 1.5182 0.8381 -0.6929 -0.0865 0.2593  258 TRP C CH2 
3598 N N   . GLU C 246 ? 2.0367 1.4866 1.0114 -0.6499 -0.2187 0.3719  259 GLU C N   
3599 C CA  . GLU C 246 ? 2.1046 1.5323 1.0885 -0.6613 -0.2124 0.3743  259 GLU C CA  
3600 C C   . GLU C 246 ? 2.0534 1.5016 1.0913 -0.6385 -0.2103 0.3653  259 GLU C C   
3601 O O   . GLU C 246 ? 1.9911 1.4440 1.0514 -0.6039 -0.2298 0.3681  259 GLU C O   
3602 C CB  . GLU C 246 ? 2.2241 1.5825 1.1714 -0.6613 -0.2437 0.3974  259 GLU C CB  
3603 C CG  . GLU C 246 ? 2.3393 1.6766 1.2428 -0.7013 -0.2298 0.4044  259 GLU C CG  
3604 C CD  . GLU C 246 ? 2.4520 1.7325 1.3037 -0.7036 -0.2607 0.4272  259 GLU C CD  
3605 O OE1 . GLU C 246 ? 2.4998 1.7379 1.3545 -0.6777 -0.2963 0.4405  259 GLU C OE1 
3606 O OE2 . GLU C 246 ? 2.5381 1.8158 1.3458 -0.7307 -0.2495 0.4315  259 GLU C OE2 
3607 N N   . LYS C 247 ? 2.1025 1.5641 1.1623 -0.6579 -0.1863 0.3546  260 LYS C N   
3608 C CA  . LYS C 247 ? 2.1033 1.5827 1.2125 -0.6413 -0.1823 0.3450  260 LYS C CA  
3609 C C   . LYS C 247 ? 2.1016 1.5298 1.2088 -0.6090 -0.2192 0.3609  260 LYS C C   
3610 O O   . LYS C 247 ? 2.2912 1.6643 1.3754 -0.6153 -0.2371 0.3735  260 LYS C O   
3611 C CB  . LYS C 247 ? 2.2520 1.7465 1.3850 -0.6697 -0.1548 0.3320  260 LYS C CB  
3612 C CG  . LYS C 247 ? 2.4169 1.9530 1.5434 -0.7018 -0.1194 0.3181  260 LYS C CG  
3613 C CD  . LYS C 247 ? 2.3895 1.9939 1.5722 -0.7048 -0.0863 0.2906  260 LYS C CD  
3614 C CE  . LYS C 247 ? 2.4230 2.0694 1.5958 -0.7279 -0.0542 0.2753  260 LYS C CE  
3615 N NZ  . LYS C 247 ? 2.3757 2.0890 1.6080 -0.7282 -0.0233 0.2462  260 LYS C NZ  
3616 N N   . PRO C 248 ? 2.0045 1.4521 1.1372 -0.5728 -0.2309 0.3598  261 PRO C N   
3617 C CA  . PRO C 248 ? 2.0138 1.4224 1.1460 -0.5323 -0.2664 0.3731  261 PRO C CA  
3618 C C   . PRO C 248 ? 1.9921 1.3461 1.1211 -0.5269 -0.2827 0.3776  261 PRO C C   
3619 O O   . PRO C 248 ? 1.8024 1.1584 0.9447 -0.5506 -0.2650 0.3669  261 PRO C O   
3620 C CB  . PRO C 248 ? 1.8828 1.3532 1.0730 -0.4941 -0.2592 0.3555  261 PRO C CB  
3621 C CG  . PRO C 248 ? 1.8025 1.3334 1.0260 -0.5170 -0.2219 0.3328  261 PRO C CG  
3622 C CD  . PRO C 248 ? 1.8990 1.4150 1.0708 -0.5669 -0.2077 0.3428  261 PRO C CD  
3623 N N   . VAL C 249 ? 2.0272 1.3353 1.1450 -0.4928 -0.3173 0.3899  262 VAL C N   
3624 C CA  . VAL C 249 ? 1.9942 1.2478 1.1120 -0.4781 -0.3380 0.3898  262 VAL C CA  
3625 C C   . VAL C 249 ? 1.8830 1.1764 1.0573 -0.4553 -0.3220 0.3609  262 VAL C C   
3626 O O   . VAL C 249 ? 1.8211 1.1373 1.0289 -0.4084 -0.3285 0.3493  262 VAL C O   
3627 C CB  . VAL C 249 ? 2.0452 1.2507 1.1485 -0.4369 -0.3774 0.4040  262 VAL C CB  
3628 C CG1 . VAL C 249 ? 1.8570 0.9969 0.9525 -0.4256 -0.4009 0.4034  262 VAL C CG1 
3629 C CG2 . VAL C 249 ? 1.8566 1.0470 0.9313 -0.4481 -0.3898 0.4181  262 VAL C CG2 
3630 N N   . SER C 250 ? 1.9225 1.2255 1.1074 -0.4896 -0.3006 0.3502  263 SER C N   
3631 C CA  . SER C 250 ? 1.8794 1.2121 1.1134 -0.4740 -0.2887 0.3238  263 SER C CA  
3632 C C   . SER C 250 ? 1.9094 1.2092 1.1377 -0.5133 -0.2851 0.3228  263 SER C C   
3633 O O   . SER C 250 ? 1.9420 1.2152 1.1349 -0.5575 -0.2809 0.3411  263 SER C O   
3634 C CB  . SER C 250 ? 1.8560 1.2733 1.1358 -0.4724 -0.2565 0.3045  263 SER C CB  
3635 O OG  . SER C 250 ? 1.8920 1.3338 1.1703 -0.5213 -0.2290 0.3028  263 SER C OG  
3636 N N   . ALA C 251 ? 1.8757 1.1774 1.1385 -0.4983 -0.2869 0.3022  264 ALA C N   
3637 C CA  . ALA C 251 ? 1.8504 1.1237 1.1171 -0.5348 -0.2857 0.2998  264 ALA C CA  
3638 C C   . ALA C 251 ? 1.7372 1.0718 1.0359 -0.5748 -0.2479 0.2894  264 ALA C C   
3639 O O   . ALA C 251 ? 1.8289 1.1482 1.1289 -0.6170 -0.2400 0.2933  264 ALA C O   
3640 C CB  . ALA C 251 ? 1.8889 1.1379 1.1787 -0.5042 -0.3054 0.2806  264 ALA C CB  
3641 N N   . PHE C 252 ? 1.6733 1.0778 1.0009 -0.5610 -0.2248 0.2760  265 PHE C N   
3642 C CA  . PHE C 252 ? 1.5971 1.0635 0.9567 -0.5946 -0.1885 0.2639  265 PHE C CA  
3643 C C   . PHE C 252 ? 1.7554 1.2105 1.0730 -0.6425 -0.1733 0.2846  265 PHE C C   
3644 O O   . PHE C 252 ? 1.6273 1.0527 0.8953 -0.6401 -0.1859 0.3057  265 PHE C O   
3645 C CB  . PHE C 252 ? 1.5016 1.0384 0.8976 -0.5668 -0.1717 0.2469  265 PHE C CB  
3646 C CG  . PHE C 252 ? 1.5168 1.0829 0.9653 -0.5360 -0.1733 0.2226  265 PHE C CG  
3647 C CD1 . PHE C 252 ? 1.4379 1.0469 0.9351 -0.5559 -0.1521 0.2025  265 PHE C CD1 
3648 C CD2 . PHE C 252 ? 1.4561 1.0063 0.9044 -0.4870 -0.1959 0.2201  265 PHE C CD2 
3649 C CE1 . PHE C 252 ? 1.3164 0.9487 0.8580 -0.5282 -0.1566 0.1815  265 PHE C CE1 
3650 C CE2 . PHE C 252 ? 1.3749 0.9495 0.8637 -0.4592 -0.1972 0.1990  265 PHE C CE2 
3651 C CZ  . PHE C 252 ? 1.3793 0.9932 0.9133 -0.4803 -0.1790 0.1803  265 PHE C CZ  
3652 N N   . PRO C 253 ? 1.8010 1.2802 1.1388 -0.6859 -0.1462 0.2788  266 PRO C N   
3653 C CA  . PRO C 253 ? 1.8916 1.3782 1.2045 -0.7153 -0.1276 0.2860  266 PRO C CA  
3654 C C   . PRO C 253 ? 2.0094 1.5304 1.2945 -0.7161 -0.1106 0.2879  266 PRO C C   
3655 O O   . PRO C 253 ? 2.1062 1.5991 1.3511 -0.6986 -0.1314 0.3037  266 PRO C O   
3656 C CB  . PRO C 253 ? 1.7571 1.2931 1.1270 -0.7355 -0.0982 0.2642  266 PRO C CB  
3657 C CG  . PRO C 253 ? 1.6415 1.2153 1.0673 -0.7157 -0.0958 0.2417  266 PRO C CG  
3658 C CD  . PRO C 253 ? 1.6673 1.1871 1.0710 -0.6871 -0.1328 0.2525  266 PRO C CD  
3659 N N   . ILE C 254 ? 2.0122 1.5917 1.3197 -0.7345 -0.0747 0.2710  267 ILE C N   
3660 C CA  . ILE C 254 ? 1.9788 1.5873 1.2570 -0.7387 -0.0586 0.2699  267 ILE C CA  
3661 C C   . ILE C 254 ? 1.9568 1.6412 1.2857 -0.7380 -0.0253 0.2408  267 ILE C C   
3662 O O   . ILE C 254 ? 1.9673 1.6800 1.2904 -0.7270 -0.0205 0.2345  267 ILE C O   
3663 C CB  . ILE C 254 ? 1.9489 1.5344 1.1773 -0.7669 -0.0510 0.2842  267 ILE C CB  
3664 C CG1 . ILE C 254 ? 2.0186 1.5377 1.1844 -0.7591 -0.0868 0.3123  267 ILE C CG1 
3665 C CG2 . ILE C 254 ? 1.9878 1.6243 1.2088 -0.7810 -0.0179 0.2699  267 ILE C CG2 
3666 C CD1 . ILE C 254 ? 2.0004 1.5006 1.1103 -0.7836 -0.0814 0.3266  267 ILE C CD1 
3667 N N   . HIS C 255 ? 1.5234 1.2395 0.9061 -0.7478 -0.0051 0.2228  268 HIS C N   
3668 C CA  . HIS C 255 ? 1.5199 1.3069 0.9597 -0.7444 0.0246  0.1931  268 HIS C CA  
3669 C C   . HIS C 255 ? 1.5245 1.3346 1.0123 -0.7163 0.0135  0.1798  268 HIS C C   
3670 O O   . HIS C 255 ? 1.4912 1.3552 1.0398 -0.7095 0.0319  0.1543  268 HIS C O   
3671 C CB  . HIS C 255 ? 1.4660 1.2778 0.9517 -0.7623 0.0479  0.1797  268 HIS C CB  
3672 C CG  . HIS C 255 ? 1.5953 1.3809 1.1159 -0.7580 0.0286  0.1822  268 HIS C CG  
3673 N ND1 . HIS C 255 ? 1.6146 1.3368 1.0990 -0.7683 0.0049  0.2059  268 HIS C ND1 
3674 C CD2 . HIS C 255 ? 1.5348 1.3469 1.1224 -0.7439 0.0269  0.1628  268 HIS C CD2 
3675 C CE1 . HIS C 255 ? 1.5961 1.3052 1.1225 -0.7617 -0.0106 0.2003  268 HIS C CE1 
3676 N NE2 . HIS C 255 ? 1.6235 1.3865 1.2115 -0.7471 0.0021  0.1744  268 HIS C NE2 
3677 N N   . CYS C 256 ? 1.3804 1.1494 0.8419 -0.6988 -0.0172 0.1977  269 CYS C N   
3678 C CA  . CYS C 256 ? 1.3982 1.1827 0.9011 -0.6736 -0.0297 0.1892  269 CYS C CA  
3679 C C   . CYS C 256 ? 1.4369 1.2219 0.9191 -0.6410 -0.0462 0.1972  269 CYS C C   
3680 O O   . CYS C 256 ? 1.3566 1.1427 0.8630 -0.6014 -0.0655 0.1932  269 CYS C O   
3681 C CB  . CYS C 256 ? 1.3799 1.1194 0.8918 -0.6627 -0.0553 0.1942  269 CYS C CB  
3682 S SG  . CYS C 256 ? 1.5519 1.2999 1.1102 -0.6872 -0.0420 0.1791  269 CYS C SG  
3683 N N   . PHE C 257 ? 1.5251 1.3114 0.9641 -0.6544 -0.0391 0.2072  270 PHE C N   
3684 C CA  . PHE C 257 ? 1.5304 1.3174 0.9530 -0.6225 -0.0576 0.2152  270 PHE C CA  
3685 C C   . PHE C 257 ? 1.5638 1.4065 1.0046 -0.6228 -0.0393 0.1997  270 PHE C C   
3686 O O   . PHE C 257 ? 1.6824 1.5413 1.1046 -0.6558 -0.0150 0.1936  270 PHE C O   
3687 C CB  . PHE C 257 ? 1.5923 1.3179 0.9417 -0.6286 -0.0798 0.2451  270 PHE C CB  
3688 C CG  . PHE C 257 ? 1.6792 1.3542 1.0196 -0.5995 -0.1127 0.2598  270 PHE C CG  
3689 C CD1 . PHE C 257 ? 1.7023 1.3218 1.0155 -0.6176 -0.1230 0.2730  270 PHE C CD1 
3690 C CD2 . PHE C 257 ? 1.7587 1.4420 1.1197 -0.5538 -0.1329 0.2599  270 PHE C CD2 
3691 C CE1 . PHE C 257 ? 1.8054 1.3756 1.1097 -0.5886 -0.1546 0.2836  270 PHE C CE1 
3692 C CE2 . PHE C 257 ? 1.8011 1.4397 1.1539 -0.5244 -0.1611 0.2708  270 PHE C CE2 
3693 C CZ  . PHE C 257 ? 1.8565 1.4371 1.1798 -0.5408 -0.1727 0.2814  270 PHE C CZ  
3694 N N   . ASP C 258 ? 1.5141 1.3851 0.9908 -0.5856 -0.0511 0.1932  271 ASP C N   
3695 C CA  . ASP C 258 ? 1.4370 1.3532 0.9295 -0.5813 -0.0418 0.1814  271 ASP C CA  
3696 C C   . ASP C 258 ? 1.3941 1.2844 0.8394 -0.5700 -0.0648 0.2022  271 ASP C C   
3697 O O   . ASP C 258 ? 1.4246 1.2871 0.8637 -0.5418 -0.0911 0.2192  271 ASP C O   
3698 C CB  . ASP C 258 ? 1.4017 1.3667 0.9669 -0.5498 -0.0417 0.1636  271 ASP C CB  
3699 C CG  . ASP C 258 ? 1.4344 1.4403 1.0514 -0.5652 -0.0159 0.1373  271 ASP C CG  
3700 O OD1 . ASP C 258 ? 1.4694 1.4818 1.0714 -0.6004 0.0073  0.1285  271 ASP C OD1 
3701 O OD2 . ASP C 258 ? 1.4376 1.4700 1.1106 -0.5419 -0.0188 0.1256  271 ASP C OD2 
3702 N N   . TYR C 259 ? 1.3743 1.2737 0.7870 -0.5911 -0.0555 0.1999  272 TYR C N   
3703 C CA  . TYR C 259 ? 1.3180 1.1930 0.6853 -0.5828 -0.0796 0.2188  272 TYR C CA  
3704 C C   . TYR C 259 ? 1.3023 1.2215 0.6939 -0.5742 -0.0778 0.2041  272 TYR C C   
3705 O O   . TYR C 259 ? 1.3675 1.3251 0.7800 -0.5905 -0.0522 0.1801  272 TYR C O   
3706 C CB  . TYR C 259 ? 1.4639 1.2913 0.7480 -0.6180 -0.0790 0.2361  272 TYR C CB  
3707 C CG  . TYR C 259 ? 1.4085 1.1820 0.6623 -0.6265 -0.0885 0.2561  272 TYR C CG  
3708 C CD1 . TYR C 259 ? 1.6149 1.3468 0.8577 -0.5990 -0.1224 0.2778  272 TYR C CD1 
3709 C CD2 . TYR C 259 ? 1.4379 1.2049 0.6843 -0.6567 -0.0650 0.2491  272 TYR C CD2 
3710 C CE1 . TYR C 259 ? 1.7054 1.3840 0.9213 -0.6056 -0.1339 0.2947  272 TYR C CE1 
3711 C CE2 . TYR C 259 ? 1.7281 1.4466 0.9562 -0.6604 -0.0772 0.2639  272 TYR C CE2 
3712 C CZ  . TYR C 259 ? 1.7458 1.4176 0.9560 -0.6364 -0.1121 0.2870  272 TYR C CZ  
3713 O OH  . TYR C 259 ? 1.6634 1.2831 0.8549 -0.6401 -0.1265 0.3009  272 TYR C OH  
3714 N N   . GLU C 260 ? 1.3412 1.2542 0.7330 -0.5481 -0.1063 0.2183  273 GLU C N   
3715 C CA  . GLU C 260 ? 1.3499 1.2917 0.7507 -0.5438 -0.1122 0.2099  273 GLU C CA  
3716 C C   . GLU C 260 ? 1.4479 1.3459 0.7780 -0.5519 -0.1371 0.2318  273 GLU C C   
3717 O O   . GLU C 260 ? 1.5460 1.4075 0.8585 -0.5353 -0.1638 0.2563  273 GLU C O   
3718 C CB  . GLU C 260 ? 1.2186 1.1987 0.6928 -0.5059 -0.1256 0.2076  273 GLU C CB  
3719 C CG  . GLU C 260 ? 1.3226 1.3523 0.8667 -0.4997 -0.1027 0.1832  273 GLU C CG  
3720 C CD  . GLU C 260 ? 1.4017 1.4693 1.0138 -0.4652 -0.1157 0.1838  273 GLU C CD  
3721 O OE1 . GLU C 260 ? 1.4228 1.4778 1.0337 -0.4424 -0.1409 0.2050  273 GLU C OE1 
3722 O OE2 . GLU C 260 ? 1.3612 1.4717 1.0298 -0.4612 -0.1010 0.1639  273 GLU C OE2 
3723 N N   . VAL C 261 ? 1.4181 1.3185 0.7063 -0.5768 -0.1291 0.2219  274 VAL C N   
3724 C CA  . VAL C 261 ? 1.5318 1.3909 0.7483 -0.5861 -0.1545 0.2409  274 VAL C CA  
3725 C C   . VAL C 261 ? 1.5319 1.4186 0.7666 -0.5750 -0.1702 0.2303  274 VAL C C   
3726 O O   . VAL C 261 ? 1.4623 1.3850 0.7133 -0.5858 -0.1497 0.2033  274 VAL C O   
3727 C CB  . VAL C 261 ? 1.5632 1.3878 0.6939 -0.6280 -0.1359 0.2434  274 VAL C CB  
3728 C CG1 . VAL C 261 ? 1.5352 1.4021 0.6784 -0.6509 -0.0949 0.2108  274 VAL C CG1 
3729 C CG2 . VAL C 261 ? 1.6483 1.4326 0.7100 -0.6344 -0.1633 0.2585  274 VAL C CG2 
3730 N N   . LYS C 262 ? 1.5763 1.4464 0.8129 -0.5526 -0.2082 0.2512  275 LYS C N   
3731 C CA  . LYS C 262 ? 1.5281 1.4250 0.7955 -0.5383 -0.2290 0.2444  275 LYS C CA  
3732 C C   . LYS C 262 ? 1.5849 1.4424 0.7753 -0.5535 -0.2562 0.2556  275 LYS C C   
3733 O O   . LYS C 262 ? 1.4944 1.3092 0.6489 -0.5472 -0.2864 0.2834  275 LYS C O   
3734 C CB  . LYS C 262 ? 1.4371 1.3547 0.7796 -0.4989 -0.2524 0.2588  275 LYS C CB  
3735 C CG  . LYS C 262 ? 1.4562 1.4056 0.8445 -0.4834 -0.2752 0.2545  275 LYS C CG  
3736 C CD  . LYS C 262 ? 1.5456 1.4878 0.9648 -0.4529 -0.3113 0.2822  275 LYS C CD  
3737 C CE  . LYS C 262 ? 1.5103 1.4645 0.9806 -0.4262 -0.3018 0.2923  275 LYS C CE  
3738 N NZ  . LYS C 262 ? 1.5595 1.5080 1.0595 -0.3951 -0.3343 0.3184  275 LYS C NZ  
3739 N N   . ILE C 263 ? 1.6038 1.4743 0.7684 -0.5723 -0.2469 0.2329  276 ILE C N   
3740 C CA  . ILE C 263 ? 1.7148 1.5489 0.8025 -0.5869 -0.2734 0.2397  276 ILE C CA  
3741 C C   . ILE C 263 ? 1.6465 1.5058 0.7825 -0.5666 -0.3049 0.2336  276 ILE C C   
3742 O O   . ILE C 263 ? 1.5897 1.4902 0.7683 -0.5659 -0.2912 0.2054  276 ILE C O   
3743 C CB  . ILE C 263 ? 1.8136 1.6398 0.8270 -0.6229 -0.2429 0.2178  276 ILE C CB  
3744 C CG1 . ILE C 263 ? 1.8419 1.6772 0.8568 -0.6399 -0.1973 0.2100  276 ILE C CG1 
3745 C CG2 . ILE C 263 ? 1.8062 1.5769 0.7407 -0.6342 -0.2606 0.2309  276 ILE C CG2 
3746 C CD1 . ILE C 263 ? 1.9149 1.7518 0.8676 -0.6746 -0.1603 0.1870  276 ILE C CD1 
3747 N N   . HIS C 264 ? 1.6939 1.5283 0.8275 -0.5502 -0.3486 0.2601  277 HIS C N   
3748 C CA  . HIS C 264 ? 1.7302 1.5891 0.9191 -0.5302 -0.3824 0.2587  277 HIS C CA  
3749 C C   . HIS C 264 ? 1.8776 1.6980 0.9995 -0.5417 -0.4157 0.2613  277 HIS C C   
3750 O O   . HIS C 264 ? 1.9156 1.6884 0.9983 -0.5388 -0.4312 0.2811  277 HIS C O   
3751 C CB  . HIS C 264 ? 1.6858 1.5583 0.9510 -0.4957 -0.4060 0.2845  277 HIS C CB  
3752 C CG  . HIS C 264 ? 1.7241 1.6227 1.0519 -0.4761 -0.4420 0.2879  277 HIS C CG  
3753 N ND1 . HIS C 264 ? 1.8205 1.6990 1.1555 -0.4593 -0.4862 0.3156  277 HIS C ND1 
3754 C CD2 . HIS C 264 ? 1.7279 1.6710 1.1182 -0.4710 -0.4419 0.2678  277 HIS C CD2 
3755 C CE1 . HIS C 264 ? 1.8120 1.7238 1.2130 -0.4458 -0.5107 0.3130  277 HIS C CE1 
3756 N NE2 . HIS C 264 ? 1.7812 1.7311 1.2156 -0.4530 -0.4850 0.2846  277 HIS C NE2 
3757 N N   . ASN C 265 ? 1.8887 1.7297 1.0131 -0.5493 -0.4220 0.2366  278 ASN C N   
3758 C CA  . ASN C 265 ? 1.9494 1.7575 1.0314 -0.5519 -0.4505 0.2335  278 ASN C CA  
3759 C C   . ASN C 265 ? 1.9175 1.7282 1.0638 -0.5235 -0.4972 0.2558  278 ASN C C   
3760 O O   . ASN C 265 ? 1.8560 1.7109 1.0832 -0.5088 -0.5120 0.2507  278 ASN C O   
3761 C CB  . ASN C 265 ? 1.6856 1.5153 0.7557 -0.5663 -0.4419 0.1964  278 ASN C CB  
3762 C CG  . ASN C 265 ? 1.8944 1.6804 0.8883 -0.5762 -0.4583 0.1881  278 ASN C CG  
3763 O OD1 . ASN C 265 ? 1.9094 1.6630 0.8957 -0.5642 -0.4953 0.2091  278 ASN C OD1 
3764 N ND2 . ASN C 265 ? 1.8283 1.6141 0.7661 -0.5972 -0.4303 0.1563  278 ASN C ND2 
3765 N N   . THR C 266 ? 1.9806 1.7459 1.0972 -0.5157 -0.5195 0.2801  279 THR C N   
3766 C CA  . THR C 266 ? 1.9669 1.7350 1.1477 -0.4878 -0.5612 0.3019  279 THR C CA  
3767 C C   . THR C 266 ? 2.0020 1.7743 1.1986 -0.4850 -0.5943 0.2904  279 THR C C   
3768 O O   . THR C 266 ? 1.9638 1.7507 1.2310 -0.4624 -0.6271 0.3044  279 THR C O   
3769 C CB  . THR C 266 ? 2.0223 1.7387 1.1672 -0.4806 -0.5779 0.3279  279 THR C CB  
3770 O OG1 . THR C 266 ? 2.1131 1.7788 1.1653 -0.5011 -0.5847 0.3224  279 THR C OG1 
3771 C CG2 . THR C 266 ? 1.9697 1.6783 1.1053 -0.4809 -0.5483 0.3391  279 THR C CG2 
3772 N N   . ARG C 267 ? 2.0816 1.8416 1.2148 -0.5071 -0.5844 0.2637  280 ARG C N   
3773 C CA  . ARG C 267 ? 2.1215 1.8792 1.2595 -0.5056 -0.6154 0.2486  280 ARG C CA  
3774 C C   . ARG C 267 ? 2.0185 1.8340 1.2483 -0.4964 -0.6172 0.2312  280 ARG C C   
3775 O O   . ARG C 267 ? 2.0164 1.8553 1.3318 -0.4753 -0.6469 0.2435  280 ARG C O   
3776 C CB  . ARG C 267 ? 2.2381 1.9583 1.2687 -0.5306 -0.6029 0.2247  280 ARG C CB  
3777 C CG  . ARG C 267 ? 2.3162 2.0220 1.3356 -0.5283 -0.6386 0.2095  280 ARG C CG  
3778 C CD  . ARG C 267 ? 2.3875 2.0645 1.3026 -0.5516 -0.6188 0.1808  280 ARG C CD  
3779 N NE  . ARG C 267 ? 2.3629 2.0779 1.2982 -0.5583 -0.5968 0.1434  280 ARG C NE  
3780 C CZ  . ARG C 267 ? 2.3889 2.0994 1.2527 -0.5787 -0.5587 0.1146  280 ARG C CZ  
3781 N NH1 . ARG C 267 ? 2.5365 2.2075 1.3044 -0.5956 -0.5366 0.1216  280 ARG C NH1 
3782 N NH2 . ARG C 267 ? 2.2846 2.0315 1.1779 -0.5818 -0.5414 0.0786  280 ARG C NH2 
3783 N N   . ASN C 268 ? 1.9224 1.7618 1.1390 -0.5125 -0.5838 0.2023  281 ASN C N   
3784 C CA  . ASN C 268 ? 1.8003 1.6919 1.1027 -0.5059 -0.5838 0.1818  281 ASN C CA  
3785 C C   . ASN C 268 ? 1.6680 1.6110 1.0501 -0.4976 -0.5597 0.1896  281 ASN C C   
3786 O O   . ASN C 268 ? 1.5669 1.5562 1.0415 -0.4864 -0.5632 0.1820  281 ASN C O   
3787 C CB  . ASN C 268 ? 1.8088 1.6982 1.0608 -0.5255 -0.5661 0.1396  281 ASN C CB  
3788 C CG  . ASN C 268 ? 1.7851 1.6644 0.9568 -0.5491 -0.5186 0.1250  281 ASN C CG  
3789 O OD1 . ASN C 268 ? 1.7294 1.6041 0.8869 -0.5516 -0.4990 0.1465  281 ASN C OD1 
3790 N ND2 . ASN C 268 ? 1.8104 1.6868 0.9320 -0.5656 -0.4986 0.0873  281 ASN C ND2 
3791 N N   . GLY C 269 ? 1.6991 1.6324 1.0464 -0.5025 -0.5350 0.2050  282 GLY C N   
3792 C CA  . GLY C 269 ? 1.5870 1.5633 1.0105 -0.4882 -0.5052 0.2122  282 GLY C CA  
3793 C C   . GLY C 269 ? 1.5826 1.5790 0.9994 -0.5009 -0.4527 0.1825  282 GLY C C   
3794 O O   . GLY C 269 ? 1.5672 1.6036 1.0583 -0.4874 -0.4265 0.1815  282 GLY C O   
3795 N N   . TYR C 270 ? 1.6649 1.6344 0.9933 -0.5266 -0.4374 0.1584  283 TYR C N   
3796 C CA  . TYR C 270 ? 1.5603 1.5487 0.8793 -0.5404 -0.3866 0.1289  283 TYR C CA  
3797 C C   . TYR C 270 ? 1.4987 1.4863 0.8166 -0.5393 -0.3544 0.1460  283 TYR C C   
3798 O O   . TYR C 270 ? 1.4604 1.4085 0.7206 -0.5437 -0.3641 0.1721  283 TYR C O   
3799 C CB  . TYR C 270 ? 1.5325 1.4895 0.7473 -0.5683 -0.3757 0.1029  283 TYR C CB  
3800 C CG  . TYR C 270 ? 1.5834 1.5694 0.8046 -0.5804 -0.3270 0.0651  283 TYR C CG  
3801 C CD1 . TYR C 270 ? 1.5892 1.5707 0.7691 -0.5966 -0.2827 0.0630  283 TYR C CD1 
3802 C CD2 . TYR C 270 ? 1.4818 1.4999 0.7555 -0.5753 -0.3268 0.0315  283 TYR C CD2 
3803 C CE1 . TYR C 270 ? 1.5254 1.5370 0.7186 -0.6070 -0.2385 0.0282  283 TYR C CE1 
3804 C CE2 . TYR C 270 ? 1.4645 1.5099 0.7494 -0.5843 -0.2837 -0.0043 283 TYR C CE2 
3805 C CZ  . TYR C 270 ? 1.5132 1.5571 0.7592 -0.5998 -0.2391 -0.0059 283 TYR C CZ  
3806 O OH  . TYR C 270 ? 1.4817 1.5563 0.7459 -0.6081 -0.1965 -0.0419 283 TYR C OH  
3807 N N   . LEU C 271 ? 1.3379 1.3665 0.7203 -0.5332 -0.3193 0.1315  284 LEU C N   
3808 C CA  . LEU C 271 ? 1.3664 1.3974 0.7623 -0.5282 -0.2935 0.1474  284 LEU C CA  
3809 C C   . LEU C 271 ? 1.3627 1.4065 0.7437 -0.5464 -0.2450 0.1221  284 LEU C C   
3810 O O   . LEU C 271 ? 1.2657 1.3434 0.6846 -0.5491 -0.2263 0.0912  284 LEU C O   
3811 C CB  . LEU C 271 ? 1.2950 1.3636 0.7939 -0.4975 -0.3014 0.1628  284 LEU C CB  
3812 C CG  . LEU C 271 ? 1.3434 1.4081 0.8554 -0.4858 -0.2861 0.1841  284 LEU C CG  
3813 C CD1 . LEU C 271 ? 1.4871 1.5015 0.9339 -0.4869 -0.3095 0.2137  284 LEU C CD1 
3814 C CD2 . LEU C 271 ? 1.1754 1.2821 0.7871 -0.4554 -0.2900 0.1948  284 LEU C CD2 
3815 N N   . GLN C 272 ? 1.4201 1.4365 0.7499 -0.5589 -0.2263 0.1359  285 GLN C N   
3816 C CA  . GLN C 272 ? 1.4968 1.5251 0.8171 -0.5771 -0.1808 0.1165  285 GLN C CA  
3817 C C   . GLN C 272 ? 1.4613 1.4782 0.7905 -0.5722 -0.1694 0.1389  285 GLN C C   
3818 O O   . GLN C 272 ? 1.5394 1.5122 0.8120 -0.5770 -0.1838 0.1658  285 GLN C O   
3819 C CB  . GLN C 272 ? 1.6887 1.6889 0.9112 -0.6099 -0.1635 0.1031  285 GLN C CB  
3820 C CG  . GLN C 272 ? 1.8078 1.8194 1.0177 -0.6316 -0.1152 0.0869  285 GLN C CG  
3821 C CD  . GLN C 272 ? 2.0670 2.0505 1.1748 -0.6650 -0.0957 0.0783  285 GLN C CD  
3822 O OE1 . GLN C 272 ? 2.1521 2.0995 1.1875 -0.6723 -0.1209 0.0878  285 GLN C OE1 
3823 N NE2 . GLN C 272 ? 2.1285 2.1291 1.2303 -0.6858 -0.0506 0.0607  285 GLN C NE2 
3824 N N   . ILE C 273 ? 1.2307 1.2846 0.6308 -0.5621 -0.1461 0.1273  286 ILE C N   
3825 C CA  . ILE C 273 ? 1.3131 1.3571 0.7242 -0.5572 -0.1346 0.1436  286 ILE C CA  
3826 C C   . ILE C 273 ? 1.3438 1.4057 0.7610 -0.5774 -0.0930 0.1208  286 ILE C C   
3827 O O   . ILE C 273 ? 1.2991 1.4031 0.7683 -0.5763 -0.0750 0.0928  286 ILE C O   
3828 C CB  . ILE C 273 ? 1.1614 1.2315 0.6557 -0.5224 -0.1485 0.1548  286 ILE C CB  
3829 C CG1 . ILE C 273 ? 1.2183 1.2783 0.7190 -0.5015 -0.1883 0.1773  286 ILE C CG1 
3830 C CG2 . ILE C 273 ? 1.1198 1.1743 0.6179 -0.5162 -0.1388 0.1695  286 ILE C CG2 
3831 C CD1 . ILE C 273 ? 1.0632 1.1525 0.6448 -0.4673 -0.1995 0.1899  286 ILE C CD1 
3832 N N   . GLU C 274 ? 1.4272 1.4569 0.7943 -0.5962 -0.0793 0.1332  287 GLU C N   
3833 C CA  . GLU C 274 ? 1.5987 1.6446 0.9749 -0.6169 -0.0407 0.1150  287 GLU C CA  
3834 C C   . GLU C 274 ? 1.4363 1.4736 0.8430 -0.6072 -0.0385 0.1294  287 GLU C C   
3835 O O   . GLU C 274 ? 1.3211 1.3140 0.6855 -0.6075 -0.0543 0.1566  287 GLU C O   
3836 C CB  . GLU C 274 ? 1.8845 1.9022 1.1737 -0.6543 -0.0208 0.1145  287 GLU C CB  
3837 C CG  . GLU C 274 ? 2.0703 2.1150 1.3452 -0.6706 0.0007  0.0826  287 GLU C CG  
3838 C CD  . GLU C 274 ? 2.1096 2.2025 1.4442 -0.6781 0.0393  0.0507  287 GLU C CD  
3839 O OE1 . GLU C 274 ? 2.0611 2.1610 1.4362 -0.6769 0.0509  0.0557  287 GLU C OE1 
3840 O OE2 . GLU C 274 ? 2.1661 2.2889 1.5081 -0.6845 0.0565  0.0196  287 GLU C OE2 
3841 N N   . LYS C 275 ? 1.4301 1.5073 0.9095 -0.5979 -0.0214 0.1106  288 LYS C N   
3842 C CA  . LYS C 275 ? 1.4522 1.5206 0.9564 -0.5923 -0.0169 0.1194  288 LYS C CA  
3843 C C   . LYS C 275 ? 1.4225 1.4839 0.8994 -0.6274 0.0143  0.1109  288 LYS C C   
3844 O O   . LYS C 275 ? 1.4493 1.5480 0.9541 -0.6421 0.0424  0.0837  288 LYS C O   
3845 C CB  . LYS C 275 ? 1.4598 1.5706 1.0517 -0.5657 -0.0163 0.1057  288 LYS C CB  
3846 C CG  . LYS C 275 ? 1.5697 1.6642 1.1812 -0.5518 -0.0218 0.1187  288 LYS C CG  
3847 C CD  . LYS C 275 ? 1.5134 1.6487 1.2048 -0.5293 -0.0185 0.1037  288 LYS C CD  
3848 C CE  . LYS C 275 ? 1.4971 1.6112 1.1989 -0.5137 -0.0269 0.1161  288 LYS C CE  
3849 N NZ  . LYS C 275 ? 1.4208 1.5715 1.1932 -0.4962 -0.0220 0.1007  288 LYS C NZ  
3850 N N   . LEU C 276 ? 1.4070 1.4210 0.8319 -0.6408 0.0091  0.1346  289 LEU C N   
3851 C CA  . LEU C 276 ? 1.5367 1.5394 0.9294 -0.6780 0.0374  0.1324  289 LEU C CA  
3852 C C   . LEU C 276 ? 1.5330 1.4967 0.9191 -0.6803 0.0288  0.1532  289 LEU C C   
3853 O O   . LEU C 276 ? 1.4876 1.4297 0.8860 -0.6516 0.0005  0.1686  289 LEU C O   
3854 C CB  . LEU C 276 ? 1.6397 1.6166 0.9464 -0.7071 0.0441  0.1406  289 LEU C CB  
3855 C CG  . LEU C 276 ? 1.7865 1.7006 1.0204 -0.7056 0.0135  0.1730  289 LEU C CG  
3856 C CD1 . LEU C 276 ? 1.8957 1.7922 1.0603 -0.7291 0.0230  0.1704  289 LEU C CD1 
3857 C CD2 . LEU C 276 ? 1.7847 1.6878 1.0232 -0.6739 -0.0242 0.1886  289 LEU C CD2 
3858 N N   . MET C 277 ? 1.5922 1.5494 0.9705 -0.6999 0.0488  0.1459  290 MET C N   
3859 C CA  . MET C 277 ? 1.5946 1.5131 0.9692 -0.7010 0.0388  0.1618  290 MET C CA  
3860 C C   . MET C 277 ? 1.7118 1.5828 1.0156 -0.7224 0.0360  0.1802  290 MET C C   
3861 O O   . MET C 277 ? 1.8285 1.6528 1.1121 -0.7222 0.0174  0.2012  290 MET C O   
3862 C CB  . MET C 277 ? 1.5190 1.4703 0.9598 -0.7026 0.0599  0.1397  290 MET C CB  
3863 C CG  . MET C 277 ? 1.4925 1.4790 1.0056 -0.6773 0.0544  0.1259  290 MET C CG  
3864 S SD  . MET C 277 ? 1.4986 1.5086 1.0844 -0.6744 0.0679  0.1055  290 MET C SD  
3865 C CE  . MET C 277 ? 2.0894 2.1505 1.6991 -0.6902 0.1071  0.0748  290 MET C CE  
3866 N N   . THR C 278 ? 1.7595 1.6409 1.0254 -0.7411 0.0538  0.1720  291 THR C N   
3867 C CA  . THR C 278 ? 1.8319 1.6704 1.0290 -0.7624 0.0518  0.1894  291 THR C CA  
3868 C C   . THR C 278 ? 1.8708 1.6555 1.0149 -0.7500 0.0126  0.2183  291 THR C C   
3869 O O   . THR C 278 ? 1.7954 1.5845 0.9506 -0.7271 -0.0079 0.2219  291 THR C O   
3870 C CB  . THR C 278 ? 1.8183 1.6815 0.9844 -0.7844 0.0809  0.1725  291 THR C CB  
3871 O OG1 . THR C 278 ? 1.9977 1.8387 1.1055 -0.7820 0.0619  0.1827  291 THR C OG1 
3872 C CG2 . THR C 278 ? 1.5999 1.5290 0.8277 -0.7820 0.1113  0.1376  291 THR C CG2 
3873 N N   . ASN C 279 ? 1.9756 1.7110 1.0660 -0.7641 0.0017  0.2392  292 ASN C N   
3874 C CA  . ASN C 279 ? 2.0409 1.7208 1.0899 -0.7496 -0.0387 0.2669  292 ASN C CA  
3875 C C   . ASN C 279 ? 2.1428 1.8050 1.1314 -0.7547 -0.0501 0.2741  292 ASN C C   
3876 O O   . ASN C 279 ? 1.8242 1.4388 0.7769 -0.7445 -0.0836 0.2968  292 ASN C O   
3877 C CB  . ASN C 279 ? 2.0581 1.6874 1.0898 -0.7581 -0.0519 0.2878  292 ASN C CB  
3878 C CG  . ASN C 279 ? 1.9955 1.5723 1.0099 -0.7338 -0.0955 0.3123  292 ASN C CG  
3879 O OD1 . ASN C 279 ? 1.8883 1.4571 0.9382 -0.7130 -0.1102 0.3159  292 ASN C OD1 
3880 N ND2 . ASN C 279 ? 1.9961 1.5366 0.9567 -0.7350 -0.1168 0.3286  292 ASN C ND2 
3881 N N   . ALA C 280 ? 2.0986 1.7979 1.0772 -0.7694 -0.0233 0.2537  293 ALA C N   
3882 C CA  . ALA C 280 ? 2.1006 1.7847 1.0210 -0.7746 -0.0333 0.2575  293 ALA C CA  
3883 C C   . ALA C 280 ? 2.0186 1.7537 0.9538 -0.7740 -0.0142 0.2305  293 ALA C C   
3884 O O   . ALA C 280 ? 1.8854 1.6694 0.8722 -0.7758 0.0141  0.2073  293 ALA C O   
3885 C CB  . ALA C 280 ? 1.9377 1.5932 0.7981 -0.8038 -0.0204 0.2662  293 ALA C CB  
3886 N N   . PHE C 281 ? 2.0694 1.7920 0.9608 -0.7709 -0.0314 0.2330  294 PHE C N   
3887 C CA  . PHE C 281 ? 2.0134 1.7790 0.9126 -0.7701 -0.0180 0.2077  294 PHE C CA  
3888 C C   . PHE C 281 ? 2.0046 1.7467 0.8343 -0.7776 -0.0300 0.2093  294 PHE C C   
3889 O O   . PHE C 281 ? 2.0608 1.7550 0.8517 -0.7702 -0.0645 0.2336  294 PHE C O   
3890 C CB  . PHE C 281 ? 2.0230 1.8143 0.9784 -0.7420 -0.0377 0.2059  294 PHE C CB  
3891 C CG  . PHE C 281 ? 1.9677 1.8086 0.9415 -0.7423 -0.0223 0.1780  294 PHE C CG  
3892 C CD1 . PHE C 281 ? 1.8577 1.7496 0.8757 -0.7534 0.0178  0.1498  294 PHE C CD1 
3893 C CD2 . PHE C 281 ? 1.9597 1.7965 0.9109 -0.7304 -0.0501 0.1788  294 PHE C CD2 
3894 C CE1 . PHE C 281 ? 1.8024 1.7397 0.8382 -0.7536 0.0317  0.1222  294 PHE C CE1 
3895 C CE2 . PHE C 281 ? 1.8662 1.7469 0.8320 -0.7308 -0.0391 0.1514  294 PHE C CE2 
3896 C CZ  . PHE C 281 ? 1.8065 1.7376 0.8185 -0.7404 0.0020  0.1214  294 PHE C CZ  
3897 N N   . ILE C 282 ? 2.0801 1.8558 0.8959 -0.7912 -0.0019 0.1818  295 ILE C N   
3898 C CA  . ILE C 282 ? 2.2353 1.9914 0.9827 -0.7988 -0.0096 0.1783  295 ILE C CA  
3899 C C   . ILE C 282 ? 2.3086 2.1088 1.0699 -0.7942 0.0008  0.1462  295 ILE C C   
3900 O O   . ILE C 282 ? 2.2582 2.1078 1.0614 -0.8008 0.0366  0.1189  295 ILE C O   
3901 C CB  . ILE C 282 ? 2.2048 1.9445 0.8944 -0.8275 0.0198  0.1780  295 ILE C CB  
3902 C CG1 . ILE C 282 ? 2.1811 1.8642 0.8371 -0.8319 -0.0025 0.2134  295 ILE C CG1 
3903 C CG2 . ILE C 282 ? 2.2979 2.0329 0.9229 -0.8361 0.0242  0.1635  295 ILE C CG2 
3904 C CD1 . ILE C 282 ? 2.2223 1.8858 0.8168 -0.8606 0.0224  0.2185  295 ILE C CD1 
3905 N N   . SER C 283 ? 2.4072 2.1895 1.1372 -0.7820 -0.0324 0.1485  296 SER C N   
3906 C CA  . SER C 283 ? 2.4008 2.2194 1.1389 -0.7767 -0.0289 0.1171  296 SER C CA  
3907 C C   . SER C 283 ? 2.4526 2.2382 1.1249 -0.7741 -0.0565 0.1173  296 SER C C   
3908 O O   . SER C 283 ? 2.4618 2.1968 1.0870 -0.7741 -0.0823 0.1448  296 SER C O   
3909 C CB  . SER C 283 ? 2.3260 2.1769 1.1363 -0.7535 -0.0497 0.1147  296 SER C CB  
3910 O OG  . SER C 283 ? 2.3350 2.1532 1.1455 -0.7317 -0.1009 0.1420  296 SER C OG  
3911 N N   . ILE C 284 ? 2.5106 2.3242 1.1813 -0.7712 -0.0527 0.0850  297 ILE C N   
3912 C CA  . ILE C 284 ? 2.5652 2.3492 1.1774 -0.7666 -0.0809 0.0808  297 ILE C CA  
3913 C C   . ILE C 284 ? 2.4861 2.2557 1.1280 -0.7407 -0.1378 0.0979  297 ILE C C   
3914 O O   . ILE C 284 ? 2.3216 2.1173 1.0344 -0.7255 -0.1503 0.1035  297 ILE C O   
3915 C CB  . ILE C 284 ? 2.5475 2.3641 1.1448 -0.7720 -0.0558 0.0354  297 ILE C CB  
3916 C CG1 . ILE C 284 ? 2.4853 2.3355 1.1431 -0.7516 -0.0813 0.0131  297 ILE C CG1 
3917 C CG2 . ILE C 284 ? 2.4926 2.3472 1.1012 -0.7921 0.0050  0.0124  297 ILE C CG2 
3918 C CD1 . ILE C 284 ? 2.4843 2.3562 1.1255 -0.7521 -0.0691 -0.0326 297 ILE C CD1 
3919 N N   . ILE C 285 ? 2.5607 2.2898 1.1499 -0.7354 -0.1722 0.1067  298 ILE C N   
3920 C CA  . ILE C 285 ? 2.5477 2.2611 1.1647 -0.7110 -0.2283 0.1235  298 ILE C CA  
3921 C C   . ILE C 285 ? 2.6498 2.3379 1.2099 -0.7093 -0.2529 0.1102  298 ILE C C   
3922 O O   . ILE C 285 ? 2.6762 2.3844 1.2156 -0.7162 -0.2325 0.0746  298 ILE C O   
3923 C CB  . ILE C 285 ? 2.5508 2.2226 1.1669 -0.7033 -0.2555 0.1666  298 ILE C CB  
3924 C CG1 . ILE C 285 ? 2.6437 2.2740 1.1831 -0.7255 -0.2350 0.1800  298 ILE C CG1 
3925 C CG2 . ILE C 285 ? 2.4353 2.1330 1.1267 -0.6928 -0.2496 0.1804  298 ILE C CG2 
3926 C CD1 . ILE C 285 ? 2.6594 2.2420 1.1892 -0.7182 -0.2666 0.2187  298 ILE C CD1 
3927 N N   . ASP C 286 ? 2.6835 2.3271 1.2201 -0.6986 -0.2976 0.1375  299 ASP C N   
3928 C CA  . ASP C 286 ? 2.8032 2.4112 1.2708 -0.6995 -0.3217 0.1309  299 ASP C CA  
3929 C C   . ASP C 286 ? 2.9513 2.5023 1.3684 -0.7018 -0.3464 0.1676  299 ASP C C   
3930 O O   . ASP C 286 ? 2.9013 2.4425 1.3528 -0.6959 -0.3553 0.1969  299 ASP C O   
3931 C CB  . ASP C 286 ? 2.7174 2.3380 1.2291 -0.6778 -0.3660 0.1176  299 ASP C CB  
3932 C CG  . ASP C 286 ? 2.5949 2.2244 1.1913 -0.6549 -0.4046 0.1446  299 ASP C CG  
3933 O OD1 . ASP C 286 ? 2.6100 2.2195 1.2128 -0.6530 -0.4084 0.1770  299 ASP C OD1 
3934 O OD2 . ASP C 286 ? 2.4306 2.0879 1.0909 -0.6379 -0.4314 0.1327  299 ASP C OD2 
3935 N N   . ASP C 287 ? 3.0617 2.5744 1.3968 -0.7096 -0.3580 0.1650  300 ASP C N   
3936 C CA  . ASP C 287 ? 3.1586 2.6151 1.4464 -0.7102 -0.3894 0.1985  300 ASP C CA  
3937 C C   . ASP C 287 ? 3.1142 2.5599 1.4495 -0.6843 -0.4491 0.2121  300 ASP C C   
3938 O O   . ASP C 287 ? 3.1949 2.5993 1.5157 -0.6785 -0.4838 0.2411  300 ASP C O   
3939 C CB  . ASP C 287 ? 3.3620 2.7821 1.5429 -0.7276 -0.3821 0.1908  300 ASP C CB  
3940 C CG  . ASP C 287 ? 3.4047 2.8451 1.5431 -0.7518 -0.3204 0.1704  300 ASP C CG  
3941 O OD1 . ASP C 287 ? 3.3543 2.8221 1.5354 -0.7599 -0.2851 0.1738  300 ASP C OD1 
3942 O OD2 . ASP C 287 ? 3.4462 2.8759 1.5098 -0.7621 -0.3071 0.1505  300 ASP C OD2 
3943 N N   . LEU C 288 ? 2.9709 2.4562 1.3690 -0.6689 -0.4608 0.1905  301 LEU C N   
3944 C CA  . LEU C 288 ? 2.8982 2.3794 1.3426 -0.6456 -0.5165 0.1967  301 LEU C CA  
3945 C C   . LEU C 288 ? 2.7584 2.2573 1.2986 -0.6244 -0.5400 0.2225  301 LEU C C   
3946 O O   . LEU C 288 ? 2.7240 2.2001 1.2860 -0.6084 -0.5853 0.2440  301 LEU C O   
3947 C CB  . LEU C 288 ? 2.8751 2.3889 1.3426 -0.6393 -0.5217 0.1596  301 LEU C CB  
3948 C CG  . LEU C 288 ? 2.9851 2.4828 1.3640 -0.6531 -0.5081 0.1283  301 LEU C CG  
3949 C CD1 . LEU C 288 ? 3.0734 2.5109 1.3619 -0.6602 -0.5307 0.1471  301 LEU C CD1 
3950 C CD2 . LEU C 288 ? 2.9844 2.5083 1.3321 -0.6730 -0.4449 0.1031  301 LEU C CD2 
3951 N N   . SER C 289 ? 2.6992 2.2398 1.2977 -0.6233 -0.5090 0.2195  302 SER C N   
3952 C CA  . SER C 289 ? 2.5673 2.1342 1.2631 -0.6003 -0.5288 0.2388  302 SER C CA  
3953 C C   . SER C 289 ? 2.5610 2.1110 1.2643 -0.5988 -0.5186 0.2681  302 SER C C   
3954 O O   . SER C 289 ? 2.6036 2.1326 1.2492 -0.6188 -0.4863 0.2707  302 SER C O   
3955 C CB  . SER C 289 ? 2.3769 2.0048 1.1462 -0.5950 -0.5094 0.2166  302 SER C CB  
3956 O OG  . SER C 289 ? 2.3633 2.0064 1.1297 -0.5960 -0.5188 0.1861  302 SER C OG  
3957 N N   . LYS C 290 ? 2.4969 2.0577 1.2763 -0.5739 -0.5467 0.2893  303 LYS C N   
3958 C CA  . LYS C 290 ? 2.4744 2.0244 1.2756 -0.5664 -0.5400 0.3140  303 LYS C CA  
3959 C C   . LYS C 290 ? 2.4226 2.0234 1.2888 -0.5609 -0.5093 0.3070  303 LYS C C   
3960 O O   . LYS C 290 ? 2.3281 1.9749 1.2590 -0.5487 -0.5147 0.2953  303 LYS C O   
3961 C CB  . LYS C 290 ? 2.4650 1.9994 1.3135 -0.5396 -0.5865 0.3393  303 LYS C CB  
3962 C CG  . LYS C 290 ? 2.4803 1.9973 1.3476 -0.5287 -0.5842 0.3632  303 LYS C CG  
3963 C CD  . LYS C 290 ? 2.4989 2.0163 1.4338 -0.4973 -0.6268 0.3833  303 LYS C CD  
3964 C CE  . LYS C 290 ? 2.4900 1.9808 1.4320 -0.4860 -0.6282 0.4049  303 LYS C CE  
3965 N NZ  . LYS C 290 ? 2.4416 1.9450 1.4636 -0.4514 -0.6623 0.4212  303 LYS C NZ  
3966 N N   . TYR C 291 ? 2.4328 2.0248 1.2836 -0.5702 -0.4784 0.3142  304 TYR C N   
3967 C CA  . TYR C 291 ? 2.2544 1.8903 1.1606 -0.5661 -0.4485 0.3080  304 TYR C CA  
3968 C C   . TYR C 291 ? 2.2702 1.8941 1.2119 -0.5483 -0.4528 0.3321  304 TYR C C   
3969 O O   . TYR C 291 ? 2.3850 1.9615 1.2873 -0.5507 -0.4633 0.3492  304 TYR C O   
3970 C CB  . TYR C 291 ? 2.1058 1.7502 0.9651 -0.5960 -0.3994 0.2869  304 TYR C CB  
3971 C CG  . TYR C 291 ? 2.0537 1.7189 0.8854 -0.6115 -0.3875 0.2566  304 TYR C CG  
3972 C CD1 . TYR C 291 ? 1.9436 1.6631 0.8230 -0.6116 -0.3680 0.2324  304 TYR C CD1 
3973 C CD2 . TYR C 291 ? 2.0148 1.6447 0.7721 -0.6252 -0.3963 0.2505  304 TYR C CD2 
3974 C CE1 . TYR C 291 ? 1.8620 1.5999 0.7191 -0.6240 -0.3579 0.2008  304 TYR C CE1 
3975 C CE2 . TYR C 291 ? 2.0808 1.7281 0.8115 -0.6368 -0.3852 0.2198  304 TYR C CE2 
3976 C CZ  . TYR C 291 ? 2.1084 1.8096 0.8907 -0.6357 -0.3660 0.1939  304 TYR C CZ  
3977 O OH  . TYR C 291 ? 1.9806 1.6982 0.7394 -0.6454 -0.3558 0.1597  304 TYR C OH  
3978 N N   . ASP C 292 ? 2.1514 1.8179 1.1672 -0.5299 -0.4457 0.3328  305 ASP C N   
3979 C CA  . ASP C 292 ? 2.0910 1.7496 1.1380 -0.5133 -0.4420 0.3502  305 ASP C CA  
3980 C C   . ASP C 292 ? 1.8682 1.5556 0.9270 -0.5248 -0.3998 0.3375  305 ASP C C   
3981 O O   . ASP C 292 ? 1.7454 1.4794 0.8333 -0.5290 -0.3842 0.3198  305 ASP C O   
3982 C CB  . ASP C 292 ? 2.1099 1.7909 1.2378 -0.4758 -0.4728 0.3657  305 ASP C CB  
3983 C CG  . ASP C 292 ? 2.0071 1.7511 1.2051 -0.4647 -0.4697 0.3548  305 ASP C CG  
3984 O OD1 . ASP C 292 ? 1.8885 1.6642 1.1517 -0.4417 -0.4654 0.3623  305 ASP C OD1 
3985 O OD2 . ASP C 292 ? 2.1090 1.8706 1.2976 -0.4783 -0.4724 0.3382  305 ASP C OD2 
3986 N N   . VAL C 293 ? 1.8246 1.4834 0.8622 -0.5306 -0.3834 0.3457  306 VAL C N   
3987 C CA  . VAL C 293 ? 1.8297 1.5090 0.8732 -0.5448 -0.3432 0.3337  306 VAL C CA  
3988 C C   . VAL C 293 ? 1.7905 1.4686 0.8792 -0.5217 -0.3435 0.3469  306 VAL C C   
3989 O O   . VAL C 293 ? 1.8561 1.4936 0.9360 -0.5087 -0.3634 0.3646  306 VAL C O   
3990 C CB  . VAL C 293 ? 1.9280 1.5763 0.9003 -0.5802 -0.3157 0.3266  306 VAL C CB  
3991 C CG1 . VAL C 293 ? 1.7753 1.4441 0.7626 -0.5937 -0.2760 0.3156  306 VAL C CG1 
3992 C CG2 . VAL C 293 ? 1.7859 1.4400 0.7114 -0.6025 -0.3088 0.3093  306 VAL C CG2 
3993 N N   . GLN C 294 ? 1.6396 1.3615 0.7756 -0.5160 -0.3222 0.3372  307 GLN C N   
3994 C CA  . GLN C 294 ? 1.5133 1.2347 0.6875 -0.4952 -0.3183 0.3463  307 GLN C CA  
3995 C C   . GLN C 294 ? 1.5494 1.2867 0.7225 -0.5161 -0.2787 0.3314  307 GLN C C   
3996 O O   . GLN C 294 ? 1.5226 1.2941 0.6987 -0.5355 -0.2528 0.3095  307 GLN C O   
3997 C CB  . GLN C 294 ? 1.6009 1.3625 0.8485 -0.4588 -0.3360 0.3531  307 GLN C CB  
3998 C CG  . GLN C 294 ? 1.6137 1.3565 0.8767 -0.4314 -0.3754 0.3718  307 GLN C CG  
3999 C CD  . GLN C 294 ? 1.5700 1.3628 0.9140 -0.3973 -0.3890 0.3768  307 GLN C CD  
4000 O OE1 . GLN C 294 ? 1.6026 1.4428 0.9895 -0.3975 -0.3812 0.3614  307 GLN C OE1 
4001 N NE2 . GLN C 294 ? 1.5957 1.3813 0.9742 -0.3642 -0.4041 0.3928  307 GLN C NE2 
4002 N N   . VAL C 295 ? 1.5893 1.3028 0.7673 -0.5094 -0.2734 0.3387  308 VAL C N   
4003 C CA  . VAL C 295 ? 1.5994 1.3279 0.7873 -0.5263 -0.2385 0.3246  308 VAL C CA  
4004 C C   . VAL C 295 ? 1.5277 1.2742 0.7835 -0.4911 -0.2384 0.3224  308 VAL C C   
4005 O O   . VAL C 295 ? 1.5831 1.3102 0.8507 -0.4613 -0.2655 0.3397  308 VAL C O   
4006 C CB  . VAL C 295 ? 1.7376 1.4204 0.8731 -0.5549 -0.2261 0.3266  308 VAL C CB  
4007 C CG1 . VAL C 295 ? 1.6865 1.3955 0.8317 -0.5814 -0.1860 0.3075  308 VAL C CG1 
4008 C CG2 . VAL C 295 ? 1.7048 1.3618 0.7834 -0.5749 -0.2338 0.3289  308 VAL C CG2 
4009 N N   . ARG C 296 ? 1.4766 1.2603 0.7761 -0.4939 -0.2082 0.3005  309 ARG C N   
4010 C CA  . ARG C 296 ? 1.2781 1.0867 0.6427 -0.4608 -0.2053 0.2943  309 ARG C CA  
4011 C C   . ARG C 296 ? 1.3807 1.1877 0.7506 -0.4780 -0.1792 0.2802  309 ARG C C   
4012 O O   . ARG C 296 ? 1.3568 1.1841 0.7226 -0.5078 -0.1534 0.2635  309 ARG C O   
4013 C CB  . ARG C 296 ? 1.2025 1.0743 0.6339 -0.4415 -0.1989 0.2793  309 ARG C CB  
4014 C CG  . ARG C 296 ? 1.1369 1.0392 0.6349 -0.4039 -0.1981 0.2761  309 ARG C CG  
4015 C CD  . ARG C 296 ? 1.0692 1.0332 0.6285 -0.3949 -0.1883 0.2613  309 ARG C CD  
4016 N NE  . ARG C 296 ? 1.1808 1.1778 0.8029 -0.3587 -0.1884 0.2618  309 ARG C NE  
4017 C CZ  . ARG C 296 ? 1.1247 1.1745 0.8061 -0.3495 -0.1781 0.2500  309 ARG C CZ  
4018 N NH1 . ARG C 296 ? 1.0335 1.1076 0.7218 -0.3724 -0.1685 0.2344  309 ARG C NH1 
4019 N NH2 . ARG C 296 ? 1.3423 1.4193 1.0743 -0.3174 -0.1775 0.2537  309 ARG C NH2 
4020 N N   . ALA C 297 ? 1.3123 1.0958 0.6931 -0.4588 -0.1866 0.2858  310 ALA C N   
4021 C CA  . ALA C 297 ? 1.2826 1.0562 0.6656 -0.4761 -0.1678 0.2747  310 ALA C CA  
4022 C C   . ALA C 297 ? 1.2818 1.0851 0.7258 -0.4470 -0.1614 0.2601  310 ALA C C   
4023 O O   . ALA C 297 ? 1.2994 1.1080 0.7688 -0.4087 -0.1771 0.2660  310 ALA C O   
4024 C CB  . ALA C 297 ? 1.3486 1.0531 0.6749 -0.4896 -0.1832 0.2940  310 ALA C CB  
4025 N N   . ALA C 298 ? 1.1851 1.0081 0.6516 -0.4660 -0.1380 0.2411  311 ALA C N   
4026 C CA  . ALA C 298 ? 1.1417 0.9842 0.6571 -0.4439 -0.1332 0.2270  311 ALA C CA  
4027 C C   . ALA C 298 ? 1.3221 1.1552 0.8375 -0.4746 -0.1163 0.2145  311 ALA C C   
4028 O O   . ALA C 298 ? 1.2585 1.1032 0.7630 -0.5109 -0.0968 0.2079  311 ALA C O   
4029 C CB  . ALA C 298 ? 1.0624 0.9682 0.6369 -0.4259 -0.1223 0.2121  311 ALA C CB  
4030 N N   . VAL C 299 ? 1.3683 1.1808 0.8964 -0.4601 -0.1241 0.2107  312 VAL C N   
4031 C CA  . VAL C 299 ? 1.3412 1.1469 0.8794 -0.4873 -0.1113 0.1983  312 VAL C CA  
4032 C C   . VAL C 299 ? 1.2675 1.1355 0.8594 -0.4988 -0.0858 0.1748  312 VAL C C   
4033 O O   . VAL C 299 ? 1.2822 1.1898 0.9173 -0.4713 -0.0854 0.1646  312 VAL C O   
4034 C CB  . VAL C 299 ? 1.1682 0.9421 0.7146 -0.4642 -0.1284 0.1956  312 VAL C CB  
4035 C CG1 . VAL C 299 ? 1.1826 0.9483 0.7429 -0.4950 -0.1184 0.1836  312 VAL C CG1 
4036 C CG2 . VAL C 299 ? 1.2268 0.9383 0.7243 -0.4477 -0.1556 0.2166  312 VAL C CG2 
4037 N N   . SER C 300 ? 1.3037 1.1807 0.8938 -0.5393 -0.0643 0.1669  313 SER C N   
4038 C CA  . SER C 300 ? 1.2005 1.1363 0.8425 -0.5525 -0.0390 0.1429  313 SER C CA  
4039 C C   . SER C 300 ? 1.1638 1.1218 0.8635 -0.5320 -0.0422 0.1260  313 SER C C   
4040 O O   . SER C 300 ? 1.3355 1.2585 1.0296 -0.5197 -0.0592 0.1304  313 SER C O   
4041 C CB  . SER C 300 ? 1.3014 1.2392 0.9322 -0.5993 -0.0143 0.1376  313 SER C CB  
4042 O OG  . SER C 300 ? 1.2887 1.2821 0.9785 -0.6096 0.0093  0.1115  313 SER C OG  
4043 N N   . SER C 301 ? 1.2587 1.2722 1.0120 -0.5281 -0.0279 0.1061  314 SER C N   
4044 C CA  . SER C 301 ? 1.2474 1.2844 1.0564 -0.5100 -0.0316 0.0900  314 SER C CA  
4045 C C   . SER C 301 ? 1.2484 1.2792 1.0779 -0.5378 -0.0233 0.0780  314 SER C C   
4046 O O   . SER C 301 ? 1.3766 1.4218 1.2511 -0.5277 -0.0285 0.0639  314 SER C O   
4047 C CB  . SER C 301 ? 1.1631 1.2592 1.0251 -0.5009 -0.0200 0.0732  314 SER C CB  
4048 O OG  . SER C 301 ? 1.2424 1.3504 1.0840 -0.4979 -0.0172 0.0810  314 SER C OG  
4049 N N   . MET C 302 ? 1.2859 1.2954 1.0827 -0.5736 -0.0113 0.0850  315 MET C N   
4050 C CA  . MET C 302 ? 1.3685 1.3766 1.1885 -0.6016 0.0000  0.0750  315 MET C CA  
4051 C C   . MET C 302 ? 1.2375 1.1884 1.0343 -0.6067 -0.0221 0.0876  315 MET C C   
4052 O O   . MET C 302 ? 1.1447 1.0957 0.9744 -0.6174 -0.0202 0.0770  315 MET C O   
4053 C CB  . MET C 302 ? 1.4998 1.5203 1.3028 -0.6225 0.0273  0.0724  315 MET C CB  
4054 C CG  . MET C 302 ? 1.5037 1.5845 1.3622 -0.6153 0.0519  0.0455  315 MET C CG  
4055 S SD  . MET C 302 ? 4.2257 4.3341 4.1660 -0.5915 0.0417  0.0246  315 MET C SD  
4056 C CE  . MET C 302 ? 2.3124 2.3969 2.2679 -0.6117 0.0427  0.0247  315 MET C CE  
4057 N N   . CYS C 303 ? 1.2879 1.1904 1.0315 -0.5857 -0.0447 0.1076  316 CYS C N   
4058 C CA  . CYS C 303 ? 1.3241 1.1660 1.0415 -0.5824 -0.0694 0.1181  316 CYS C CA  
4059 C C   . CYS C 303 ? 1.2353 1.0673 0.9636 -0.5363 -0.0942 0.1123  316 CYS C C   
4060 O O   . CYS C 303 ? 1.1904 0.9955 0.9292 -0.5307 -0.1114 0.1058  316 CYS C O   
4061 C CB  . CYS C 303 ? 1.3727 1.1609 1.0207 -0.5913 -0.0792 0.1444  316 CYS C CB  
4062 S SG  . CYS C 303 ? 1.5451 1.3441 1.1657 -0.6436 -0.0487 0.1545  316 CYS C SG  
4063 N N   . ARG C 304 ? 1.0682 0.9229 0.7937 -0.5038 -0.0957 0.1148  317 ARG C N   
4064 C CA  . ARG C 304 ? 1.0578 0.9080 0.7893 -0.4585 -0.1149 0.1117  317 ARG C CA  
4065 C C   . ARG C 304 ? 1.2128 1.1241 0.9849 -0.4393 -0.1027 0.1026  317 ARG C C   
4066 O O   . ARG C 304 ? 1.2976 1.2497 1.0914 -0.4603 -0.0819 0.0974  317 ARG C O   
4067 C CB  . ARG C 304 ? 1.1205 0.9225 0.7977 -0.4328 -0.1348 0.1314  317 ARG C CB  
4068 C CG  . ARG C 304 ? 1.3088 1.0798 0.9772 -0.3933 -0.1583 0.1280  317 ARG C CG  
4069 C CD  . ARG C 304 ? 1.3857 1.0942 0.9993 -0.3783 -0.1797 0.1450  317 ARG C CD  
4070 N NE  . ARG C 304 ? 1.3305 1.0481 0.9236 -0.3645 -0.1774 0.1620  317 ARG C NE  
4071 C CZ  . ARG C 304 ? 1.4205 1.0946 0.9741 -0.3416 -0.1963 0.1768  317 ARG C CZ  
4072 N NH1 . ARG C 304 ? 1.4714 1.0877 0.9990 -0.3292 -0.2183 0.1756  317 ARG C NH1 
4073 N NH2 . ARG C 304 ? 1.4380 1.1253 0.9803 -0.3305 -0.1951 0.1919  317 ARG C NH2 
4074 N N   . GLU C 305 ? 1.2489 1.1657 1.0305 -0.3998 -0.1155 0.1005  318 GLU C N   
4075 C CA  . GLU C 305 ? 1.1832 1.1534 1.0005 -0.3798 -0.1066 0.0969  318 GLU C CA  
4076 C C   . GLU C 305 ? 1.2231 1.1971 1.0147 -0.3680 -0.1051 0.1149  318 GLU C C   
4077 O O   . GLU C 305 ? 1.4203 1.3517 1.1661 -0.3613 -0.1169 0.1302  318 GLU C O   
4078 C CB  . GLU C 305 ? 1.3146 1.2887 1.1468 -0.3428 -0.1198 0.0913  318 GLU C CB  
4079 C CG  . GLU C 305 ? 1.4889 1.5200 1.3673 -0.3280 -0.1107 0.0865  318 GLU C CG  
4080 C CD  . GLU C 305 ? 1.6298 1.6710 1.5378 -0.3130 -0.1192 0.0728  318 GLU C CD  
4081 O OE1 . GLU C 305 ? 1.6790 1.6972 1.5632 -0.2809 -0.1336 0.0771  318 GLU C OE1 
4082 O OE2 . GLU C 305 ? 1.6905 1.7622 1.6448 -0.3327 -0.1119 0.0571  318 GLU C OE2 
4083 N N   . ALA C 306 ? 1.0730 1.0967 0.8969 -0.3658 -0.0931 0.1129  319 ALA C N   
4084 C CA  . ALA C 306 ? 0.9631 0.9960 0.7711 -0.3575 -0.0928 0.1286  319 ALA C CA  
4085 C C   . ALA C 306 ? 0.9687 0.9737 0.7465 -0.3217 -0.1100 0.1468  319 ALA C C   
4086 O O   . ALA C 306 ? 1.0192 1.0260 0.8073 -0.2906 -0.1172 0.1459  319 ALA C O   
4087 C CB  . ALA C 306 ? 0.8920 0.9822 0.7482 -0.3525 -0.0825 0.1223  319 ALA C CB  
4088 N N   . GLY C 307 ? 1.0774 1.0568 0.8171 -0.3256 -0.1165 0.1629  320 GLY C N   
4089 C CA  . GLY C 307 ? 0.9231 0.8756 0.6367 -0.2921 -0.1332 0.1797  320 GLY C CA  
4090 C C   . GLY C 307 ? 1.0327 1.0012 0.7440 -0.2849 -0.1366 0.1961  320 GLY C C   
4091 O O   . GLY C 307 ? 0.9691 0.9802 0.7097 -0.2955 -0.1265 0.1932  320 GLY C O   
4092 N N   . LEU C 308 ? 0.9933 0.9260 0.6717 -0.2662 -0.1531 0.2126  321 LEU C N   
4093 C CA  . LEU C 308 ? 1.0180 0.9624 0.6958 -0.2565 -0.1610 0.2297  321 LEU C CA  
4094 C C   . LEU C 308 ? 0.9951 0.9168 0.6366 -0.2928 -0.1638 0.2358  321 LEU C C   
4095 O O   . LEU C 308 ? 1.1588 1.0416 0.7643 -0.3197 -0.1633 0.2328  321 LEU C O   
4096 C CB  . LEU C 308 ? 1.0373 0.9543 0.6995 -0.2184 -0.1787 0.2442  321 LEU C CB  
4097 C CG  . LEU C 308 ? 1.0504 0.9784 0.7331 -0.1801 -0.1761 0.2382  321 LEU C CG  
4098 C CD1 . LEU C 308 ? 1.1297 1.0195 0.7872 -0.1456 -0.1932 0.2490  321 LEU C CD1 
4099 C CD2 . LEU C 308 ? 0.9349 0.9273 0.6707 -0.1628 -0.1636 0.2394  321 LEU C CD2 
4100 N N   . TRP C 309 ? 1.0620 1.0080 0.7124 -0.2944 -0.1672 0.2448  322 TRP C N   
4101 C CA  . TRP C 309 ? 1.1596 1.0798 0.7669 -0.3238 -0.1740 0.2536  322 TRP C CA  
4102 C C   . TRP C 309 ? 1.2716 1.1439 0.8415 -0.3070 -0.1993 0.2748  322 TRP C C   
4103 O O   . TRP C 309 ? 1.3569 1.2311 0.9463 -0.2691 -0.2100 0.2823  322 TRP C O   
4104 C CB  . TRP C 309 ? 1.1393 1.1021 0.7700 -0.3316 -0.1713 0.2529  322 TRP C CB  
4105 C CG  . TRP C 309 ? 1.2178 1.2200 0.8767 -0.3548 -0.1483 0.2310  322 TRP C CG  
4106 C CD1 . TRP C 309 ? 1.2024 1.2542 0.9201 -0.3411 -0.1369 0.2187  322 TRP C CD1 
4107 C CD2 . TRP C 309 ? 1.2383 1.2343 0.8691 -0.3950 -0.1337 0.2189  322 TRP C CD2 
4108 N NE1 . TRP C 309 ? 1.2345 1.3100 0.9656 -0.3691 -0.1183 0.1983  322 TRP C NE1 
4109 C CE2 . TRP C 309 ? 1.2335 1.2776 0.9124 -0.4021 -0.1142 0.1971  322 TRP C CE2 
4110 C CE3 . TRP C 309 ? 1.2411 1.1957 0.8100 -0.4260 -0.1346 0.2251  322 TRP C CE3 
4111 C CZ2 . TRP C 309 ? 1.1519 1.2066 0.8226 -0.4367 -0.0944 0.1789  322 TRP C CZ2 
4112 C CZ3 . TRP C 309 ? 1.2132 1.1792 0.7700 -0.4620 -0.1128 0.2087  322 TRP C CZ3 
4113 C CH2 . TRP C 309 ? 1.1890 1.2059 0.7980 -0.4661 -0.0922 0.1847  322 TRP C CH2 
4114 N N   . SER C 310 ? 1.3116 1.1411 0.8275 -0.3346 -0.2088 0.2848  323 SER C N   
4115 C CA  . SER C 310 ? 1.3560 1.1392 0.8368 -0.3206 -0.2366 0.3065  323 SER C CA  
4116 C C   . SER C 310 ? 1.3053 1.1172 0.8059 -0.3069 -0.2498 0.3177  323 SER C C   
4117 O O   . SER C 310 ? 1.3264 1.1875 0.8598 -0.3141 -0.2372 0.3084  323 SER C O   
4118 C CB  . SER C 310 ? 1.3763 1.1019 0.7897 -0.3576 -0.2439 0.3162  323 SER C CB  
4119 O OG  . SER C 310 ? 1.3383 1.0759 0.7292 -0.3878 -0.2394 0.3179  323 SER C OG  
4120 N N   . GLU C 311 ? 1.2842 1.0649 0.7687 -0.2866 -0.2771 0.3372  324 GLU C N   
4121 C CA  . GLU C 311 ? 1.2201 1.0193 0.7175 -0.2787 -0.2951 0.3503  324 GLU C CA  
4122 C C   . GLU C 311 ? 1.2622 1.0419 0.7077 -0.3216 -0.2971 0.3520  324 GLU C C   
4123 O O   . GLU C 311 ? 1.3094 1.0480 0.7021 -0.3512 -0.2911 0.3510  324 GLU C O   
4124 C CB  . GLU C 311 ? 1.8784 1.6420 1.3676 -0.2488 -0.3261 0.3707  324 GLU C CB  
4125 C CG  . GLU C 311 ? 1.9086 1.6735 1.4292 -0.2075 -0.3243 0.3682  324 GLU C CG  
4126 C CD  . GLU C 311 ? 1.8903 1.7147 1.4808 -0.1693 -0.3218 0.3704  324 GLU C CD  
4127 O OE1 . GLU C 311 ? 1.8921 1.7344 1.5022 -0.1642 -0.3389 0.3837  324 GLU C OE1 
4128 O OE2 . GLU C 311 ? 1.8310 1.6841 1.4568 -0.1452 -0.3034 0.3598  324 GLU C OE2 
4129 N N   . TRP C 312 ? 1.3570 1.1656 0.8161 -0.3258 -0.3051 0.3544  325 TRP C N   
4130 C CA  . TRP C 312 ? 1.4001 1.1850 0.8011 -0.3631 -0.3109 0.3570  325 TRP C CA  
4131 C C   . TRP C 312 ? 1.5157 1.2330 0.8541 -0.3674 -0.3409 0.3805  325 TRP C C   
4132 O O   . TRP C 312 ? 1.4907 1.1925 0.8463 -0.3355 -0.3653 0.3958  325 TRP C O   
4133 C CB  . TRP C 312 ? 1.3715 1.1970 0.8004 -0.3628 -0.3194 0.3546  325 TRP C CB  
4134 C CG  . TRP C 312 ? 1.4503 1.3363 0.9333 -0.3654 -0.2917 0.3313  325 TRP C CG  
4135 C CD1 . TRP C 312 ? 1.3732 1.3107 0.9329 -0.3359 -0.2851 0.3268  325 TRP C CD1 
4136 C CD2 . TRP C 312 ? 1.4868 1.3877 0.9518 -0.3989 -0.2673 0.3100  325 TRP C CD2 
4137 N NE1 . TRP C 312 ? 1.3121 1.2922 0.9026 -0.3495 -0.2610 0.3049  325 TRP C NE1 
4138 C CE2 . TRP C 312 ? 1.3339 1.2934 0.8694 -0.3869 -0.2497 0.2927  325 TRP C CE2 
4139 C CE3 . TRP C 312 ? 1.5135 1.3845 0.9097 -0.4375 -0.2577 0.3039  325 TRP C CE3 
4140 C CZ2 . TRP C 312 ? 1.1379 1.1257 0.6807 -0.4105 -0.2251 0.2681  325 TRP C CZ2 
4141 C CZ3 . TRP C 312 ? 1.2347 1.1376 0.6378 -0.4607 -0.2298 0.2787  325 TRP C CZ3 
4142 C CH2 . TRP C 312 ? 1.1562 1.1162 0.6338 -0.4463 -0.2149 0.2602  325 TRP C CH2 
4143 N N   . SER C 313 ? 1.6114 1.2906 0.8831 -0.4049 -0.3370 0.3809  326 SER C N   
4144 C CA  . SER C 313 ? 1.6361 1.2561 0.8651 -0.4071 -0.3584 0.3931  326 SER C CA  
4145 C C   . SER C 313 ? 1.6857 1.3066 0.9261 -0.3890 -0.3896 0.4037  326 SER C C   
4146 O O   . SER C 313 ? 1.5438 1.2090 0.8159 -0.3839 -0.3920 0.3998  326 SER C O   
4147 C CB  . SER C 313 ? 1.6820 1.2725 0.8485 -0.4506 -0.3418 0.3870  326 SER C CB  
4148 O OG  . SER C 313 ? 1.7302 1.3430 0.8788 -0.4712 -0.3368 0.3788  326 SER C OG  
4149 N N   . GLN C 314 ? 1.8496 1.4214 1.0671 -0.3796 -0.4153 0.4172  327 GLN C N   
4150 C CA  . GLN C 314 ? 1.8925 1.4602 1.1188 -0.3645 -0.4469 0.4276  327 GLN C CA  
4151 C C   . GLN C 314 ? 1.8632 1.4374 1.0529 -0.3959 -0.4444 0.4207  327 GLN C C   
4152 O O   . GLN C 314 ? 1.8343 1.3803 0.9643 -0.4302 -0.4302 0.4160  327 GLN C O   
4153 C CB  . GLN C 314 ? 2.0238 1.5326 1.2248 -0.3538 -0.4741 0.4424  327 GLN C CB  
4154 C CG  . GLN C 314 ? 2.0062 1.5104 1.2508 -0.3133 -0.4849 0.4492  327 GLN C CG  
4155 C CD  . GLN C 314 ? 1.9718 1.5253 1.2882 -0.2749 -0.4976 0.4524  327 GLN C CD  
4156 O OE1 . GLN C 314 ? 1.8911 1.4895 1.2543 -0.2571 -0.4810 0.4469  327 GLN C OE1 
4157 N NE2 . GLN C 314 ? 2.0091 1.5556 1.3368 -0.2623 -0.5273 0.4623  327 GLN C NE2 
4158 N N   . PRO C 315 ? 1.7571 1.3695 0.9838 -0.3840 -0.4581 0.4198  328 PRO C N   
4159 C CA  . PRO C 315 ? 1.6945 1.3182 0.8922 -0.4100 -0.4577 0.4106  328 PRO C CA  
4160 C C   . PRO C 315 ? 1.9390 1.5078 1.0656 -0.4319 -0.4727 0.4164  328 PRO C C   
4161 O O   . PRO C 315 ? 1.9763 1.5185 1.1051 -0.4155 -0.5055 0.4304  328 PRO C O   
4162 C CB  . PRO C 315 ? 1.6166 1.2806 0.8779 -0.3836 -0.4822 0.4147  328 PRO C CB  
4163 C CG  . PRO C 315 ? 1.6469 1.3420 0.9779 -0.3487 -0.4789 0.4207  328 PRO C CG  
4164 C CD  . PRO C 315 ? 1.7052 1.3535 1.0079 -0.3434 -0.4758 0.4277  328 PRO C CD  
4165 N N   . ILE C 316 ? 2.0371 1.5905 1.1026 -0.4684 -0.4483 0.4061  329 ILE C N   
4166 C CA  . ILE C 316 ? 2.1544 1.6585 1.1480 -0.4916 -0.4597 0.4119  329 ILE C CA  
4167 C C   . ILE C 316 ? 2.2800 1.7968 1.2461 -0.5077 -0.4643 0.4012  329 ILE C C   
4168 O O   . ILE C 316 ? 2.3620 1.8964 1.2987 -0.5336 -0.4352 0.3838  329 ILE C O   
4169 C CB  . ILE C 316 ? 2.1239 1.5943 1.0616 -0.5214 -0.4333 0.4111  329 ILE C CB  
4170 C CG1 . ILE C 316 ? 2.1092 1.6176 1.0472 -0.5439 -0.3897 0.3907  329 ILE C CG1 
4171 C CG2 . ILE C 316 ? 2.1083 1.5495 1.0635 -0.5044 -0.4415 0.4249  329 ILE C CG2 
4172 C CD1 . ILE C 316 ? 2.1722 1.6524 1.0572 -0.5766 -0.3631 0.3892  329 ILE C CD1 
4173 N N   . TYR C 317 ? 2.2767 1.7847 1.2548 -0.4908 -0.5020 0.4105  330 TYR C N   
4174 C CA  . TYR C 317 ? 2.2805 1.7950 1.2342 -0.5022 -0.5142 0.4013  330 TYR C CA  
4175 C C   . TYR C 317 ? 2.3301 1.7982 1.1905 -0.5349 -0.5074 0.4002  330 TYR C C   
4176 O O   . TYR C 317 ? 2.4526 1.8719 1.2766 -0.5372 -0.5239 0.4169  330 TYR C O   
4177 C CB  . TYR C 317 ? 2.3230 1.8371 1.3187 -0.4747 -0.5592 0.4135  330 TYR C CB  
4178 C CG  . TYR C 317 ? 2.2773 1.8389 1.3695 -0.4403 -0.5665 0.4173  330 TYR C CG  
4179 C CD1 . TYR C 317 ? 2.2345 1.7894 1.3645 -0.4154 -0.5705 0.4312  330 TYR C CD1 
4180 C CD2 . TYR C 317 ? 2.2190 1.8323 1.3650 -0.4320 -0.5696 0.4069  330 TYR C CD2 
4181 C CE1 . TYR C 317 ? 2.1552 1.7554 1.3717 -0.3827 -0.5743 0.4348  330 TYR C CE1 
4182 C CE2 . TYR C 317 ? 2.1667 1.8265 1.4034 -0.4011 -0.5746 0.4123  330 TYR C CE2 
4183 C CZ  . TYR C 317 ? 2.1774 1.8314 1.4480 -0.3761 -0.5754 0.4264  330 TYR C CZ  
4184 O OH  . TYR C 317 ? 2.2014 1.9036 1.5608 -0.3440 -0.5773 0.4317  330 TYR C OH  
4185 N N   . VAL C 318 ? 2.3297 1.8136 1.1514 -0.5596 -0.4830 0.3805  331 VAL C N   
4186 C CA  . VAL C 318 ? 2.4407 1.8861 1.1729 -0.5911 -0.4704 0.3781  331 VAL C CA  
4187 C C   . VAL C 318 ? 2.4626 1.9153 1.1565 -0.6030 -0.4744 0.3608  331 VAL C C   
4188 O O   . VAL C 318 ? 2.3718 1.8676 1.1080 -0.5940 -0.4740 0.3443  331 VAL C O   
4189 C CB  . VAL C 318 ? 2.2836 1.7335 0.9903 -0.6163 -0.4231 0.3699  331 VAL C CB  
4190 C CG1 . VAL C 318 ? 2.1290 1.6187 0.8226 -0.6357 -0.3871 0.3419  331 VAL C CG1 
4191 C CG2 . VAL C 318 ? 2.2519 1.6472 0.8850 -0.6385 -0.4218 0.3843  331 VAL C CG2 
4192 N N   . GLY C 319 ? 2.5780 1.9870 1.1911 -0.6226 -0.4799 0.3647  332 GLY C N   
4193 C CA  . GLY C 319 ? 2.6219 2.0300 1.1865 -0.6340 -0.4843 0.3478  332 GLY C CA  
4194 C C   . GLY C 319 ? 2.6683 2.0664 1.2524 -0.6128 -0.5351 0.3540  332 GLY C C   
4195 O O   . GLY C 319 ? 2.6335 2.0237 1.2678 -0.5895 -0.5676 0.3735  332 GLY C O   
4196 N N   . ASN C 320 ? 2.7894 2.1888 1.3357 -0.6204 -0.5418 0.3359  333 ASN C N   
4197 C CA  . ASN C 320 ? 2.8547 2.2455 1.4185 -0.6026 -0.5907 0.3386  333 ASN C CA  
4198 C C   . ASN C 320 ? 2.9045 2.3128 1.4426 -0.6098 -0.5887 0.3095  333 ASN C C   
4199 O O   . ASN C 320 ? 3.0031 2.3902 1.4569 -0.6317 -0.5699 0.2966  333 ASN C O   
4200 C CB  . ASN C 320 ? 2.9109 2.2411 1.4201 -0.6045 -0.6252 0.3617  333 ASN C CB  
4201 C CG  . ASN C 320 ? 2.8276 2.1503 1.4047 -0.5777 -0.6633 0.3865  333 ASN C CG  
4202 O OD1 . ASN C 320 ? 2.8346 2.1606 1.4520 -0.5587 -0.7040 0.3897  333 ASN C OD1 
4203 N ND2 . ASN C 320 ? 2.7481 2.0616 1.3411 -0.5753 -0.6503 0.4029  333 ASN C ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   16  ?   ?   ?   A . n 
A 1 2   SER 2   17  ?   ?   ?   A . n 
A 1 3   SER 3   18  ?   ?   ?   A . n 
A 1 4   GLY 4   19  ?   ?   ?   A . n 
A 1 5   SER 5   20  ?   ?   ?   A . n 
A 1 6   SER 6   21  ?   ?   ?   A . n 
A 1 7   GLY 7   22  ?   ?   ?   A . n 
A 1 8   GLU 8   23  ?   ?   ?   A . n 
A 1 9   ILE 9   24  24  ILE ILE A . n 
A 1 10  PRO 10  25  25  PRO PRO A . n 
A 1 11  THR 11  26  26  THR THR A . n 
A 1 12  SER 12  27  27  SER SER A . n 
A 1 13  ALA 13  28  28  ALA ALA A . n 
A 1 14  LEU 14  29  29  LEU LEU A . n 
A 1 15  VAL 15  30  30  VAL VAL A . n 
A 1 16  LYS 16  31  31  LYS LYS A . n 
A 1 17  GLU 17  32  32  GLU GLU A . n 
A 1 18  THR 18  33  33  THR THR A . n 
A 1 19  LEU 19  34  34  LEU LEU A . n 
A 1 20  ALA 20  35  35  ALA ALA A . n 
A 1 21  LEU 21  36  36  LEU LEU A . n 
A 1 22  LEU 22  37  37  LEU LEU A . n 
A 1 23  SER 23  38  38  SER SER A . n 
A 1 24  THR 24  39  39  THR THR A . n 
A 1 25  HIS 25  40  40  HIS HIS A . n 
A 1 26  ARG 26  41  41  ARG ARG A . n 
A 1 27  THR 27  42  42  THR THR A . n 
A 1 28  LEU 28  43  43  LEU LEU A . n 
A 1 29  LEU 29  44  44  LEU LEU A . n 
A 1 30  ILE 30  45  45  ILE ILE A . n 
A 1 31  ALA 31  46  46  ALA ALA A . n 
A 1 32  ASN 32  47  47  ASN ASN A . n 
A 1 33  GLU 33  48  48  GLU GLU A . n 
A 1 34  THR 34  49  49  THR THR A . n 
A 1 35  LEU 35  50  50  LEU LEU A . n 
A 1 36  ARG 36  51  51  ARG ARG A . n 
A 1 37  ILE 37  52  52  ILE ILE A . n 
A 1 38  PRO 38  53  53  PRO PRO A . n 
A 1 39  VAL 39  54  54  VAL VAL A . n 
A 1 40  PRO 40  55  55  PRO PRO A . n 
A 1 41  VAL 41  56  56  VAL VAL A . n 
A 1 42  HIS 42  57  57  HIS HIS A . n 
A 1 43  LYS 43  58  58  LYS LYS A . n 
A 1 44  ASN 44  59  59  ASN ASN A . n 
A 1 45  HIS 45  60  60  HIS HIS A . n 
A 1 46  GLN 46  61  61  GLN GLN A . n 
A 1 47  LEU 47  62  62  LEU LEU A . n 
A 1 48  CYS 48  63  63  CYS CYS A . n 
A 1 49  THR 49  64  64  THR THR A . n 
A 1 50  GLU 50  65  65  GLU GLU A . n 
A 1 51  GLU 51  66  66  GLU GLU A . n 
A 1 52  ILE 52  67  67  ILE ILE A . n 
A 1 53  PHE 53  68  68  PHE PHE A . n 
A 1 54  GLN 54  69  69  GLN GLN A . n 
A 1 55  GLY 55  70  70  GLY GLY A . n 
A 1 56  ILE 56  71  71  ILE ILE A . n 
A 1 57  GLY 57  72  72  GLY GLY A . n 
A 1 58  THR 58  73  73  THR THR A . n 
A 1 59  LEU 59  74  74  LEU LEU A . n 
A 1 60  GLU 60  75  75  GLU GLU A . n 
A 1 61  SER 61  76  76  SER SER A . n 
A 1 62  GLN 62  77  77  GLN GLN A . n 
A 1 63  THR 63  78  78  THR THR A . n 
A 1 64  VAL 64  79  79  VAL VAL A . n 
A 1 65  GLN 65  80  80  GLN GLN A . n 
A 1 66  GLY 66  81  81  GLY GLY A . n 
A 1 67  GLY 67  82  82  GLY GLY A . n 
A 1 68  THR 68  83  83  THR THR A . n 
A 1 69  VAL 69  84  84  VAL VAL A . n 
A 1 70  GLU 70  85  85  GLU GLU A . n 
A 1 71  ARG 71  86  86  ARG ARG A . n 
A 1 72  LEU 72  87  87  LEU LEU A . n 
A 1 73  PHE 73  88  88  PHE PHE A . n 
A 1 74  LYS 74  89  89  LYS LYS A . n 
A 1 75  ASN 75  90  90  ASN ASN A . n 
A 1 76  LEU 76  91  91  LEU LEU A . n 
A 1 77  SER 77  92  92  SER SER A . n 
A 1 78  LEU 78  93  93  LEU LEU A . n 
A 1 79  ILE 79  94  94  ILE ILE A . n 
A 1 80  LYS 80  95  95  LYS LYS A . n 
A 1 81  LYS 81  96  96  LYS LYS A . n 
A 1 82  TYR 82  97  97  TYR TYR A . n 
A 1 83  ILE 83  98  98  ILE ILE A . n 
A 1 84  ASP 84  99  99  ASP ASP A . n 
A 1 85  GLY 85  100 100 GLY GLY A . n 
A 1 86  GLN 86  101 101 GLN GLN A . n 
A 1 87  LYS 87  102 102 LYS LYS A . n 
A 1 88  LYS 88  103 103 LYS LYS A . n 
A 1 89  LYS 89  104 104 LYS LYS A . n 
A 1 90  CYS 90  105 105 CYS CYS A . n 
A 1 91  GLY 91  106 106 GLY GLY A . n 
A 1 92  GLU 92  107 107 GLU GLU A . n 
A 1 93  GLU 93  108 108 GLU GLU A . n 
A 1 94  ARG 94  109 109 ARG ARG A . n 
A 1 95  ARG 95  110 110 ARG ARG A . n 
A 1 96  ARG 96  111 111 ARG ARG A . n 
A 1 97  VAL 97  112 112 VAL VAL A . n 
A 1 98  ASN 98  113 113 ASN ASN A . n 
A 1 99  GLN 99  114 114 GLN GLN A . n 
A 1 100 PHE 100 115 115 PHE PHE A . n 
A 1 101 LEU 101 116 116 LEU LEU A . n 
A 1 102 ASP 102 117 117 ASP ASP A . n 
A 1 103 TYR 103 118 118 TYR TYR A . n 
A 1 104 LEU 104 119 119 LEU LEU A . n 
A 1 105 GLN 105 120 120 GLN GLN A . n 
A 1 106 GLU 106 121 121 GLU GLU A . n 
A 1 107 PHE 107 122 122 PHE PHE A . n 
A 1 108 LEU 108 123 123 LEU LEU A . n 
A 1 109 GLY 109 124 124 GLY GLY A . n 
A 1 110 VAL 110 125 125 VAL VAL A . n 
A 1 111 MET 111 126 126 MET MET A . n 
A 1 112 ASN 112 127 127 ASN ASN A . n 
A 1 113 THR 113 128 128 THR THR A . n 
A 1 114 GLU 114 129 129 GLU GLU A . n 
A 1 115 TRP 115 130 130 TRP TRP A . n 
A 1 116 ILE 116 131 ?   ?   ?   A . n 
A 1 117 ILE 117 132 ?   ?   ?   A . n 
A 1 118 GLU 118 133 ?   ?   ?   A . n 
A 1 119 SER 119 134 ?   ?   ?   A . n 
B 1 1   GLY 1   16  ?   ?   ?   B . n 
B 1 2   SER 2   17  ?   ?   ?   B . n 
B 1 3   SER 3   18  ?   ?   ?   B . n 
B 1 4   GLY 4   19  ?   ?   ?   B . n 
B 1 5   SER 5   20  ?   ?   ?   B . n 
B 1 6   SER 6   21  ?   ?   ?   B . n 
B 1 7   GLY 7   22  ?   ?   ?   B . n 
B 1 8   GLU 8   23  ?   ?   ?   B . n 
B 1 9   ILE 9   24  24  ILE ILE B . n 
B 1 10  PRO 10  25  25  PRO PRO B . n 
B 1 11  THR 11  26  26  THR THR B . n 
B 1 12  SER 12  27  27  SER SER B . n 
B 1 13  ALA 13  28  28  ALA ALA B . n 
B 1 14  LEU 14  29  29  LEU LEU B . n 
B 1 15  VAL 15  30  30  VAL VAL B . n 
B 1 16  LYS 16  31  31  LYS LYS B . n 
B 1 17  GLU 17  32  32  GLU GLU B . n 
B 1 18  THR 18  33  33  THR THR B . n 
B 1 19  LEU 19  34  34  LEU LEU B . n 
B 1 20  ALA 20  35  35  ALA ALA B . n 
B 1 21  LEU 21  36  36  LEU LEU B . n 
B 1 22  LEU 22  37  37  LEU LEU B . n 
B 1 23  SER 23  38  38  SER SER B . n 
B 1 24  THR 24  39  39  THR THR B . n 
B 1 25  HIS 25  40  40  HIS HIS B . n 
B 1 26  ARG 26  41  41  ARG ARG B . n 
B 1 27  THR 27  42  42  THR THR B . n 
B 1 28  LEU 28  43  43  LEU LEU B . n 
B 1 29  LEU 29  44  44  LEU LEU B . n 
B 1 30  ILE 30  45  45  ILE ILE B . n 
B 1 31  ALA 31  46  46  ALA ALA B . n 
B 1 32  ASN 32  47  47  ASN ASN B . n 
B 1 33  GLU 33  48  48  GLU GLU B . n 
B 1 34  THR 34  49  49  THR THR B . n 
B 1 35  LEU 35  50  50  LEU LEU B . n 
B 1 36  ARG 36  51  51  ARG ARG B . n 
B 1 37  ILE 37  52  52  ILE ILE B . n 
B 1 38  PRO 38  53  53  PRO PRO B . n 
B 1 39  VAL 39  54  54  VAL VAL B . n 
B 1 40  PRO 40  55  55  PRO PRO B . n 
B 1 41  VAL 41  56  56  VAL VAL B . n 
B 1 42  HIS 42  57  57  HIS HIS B . n 
B 1 43  LYS 43  58  58  LYS LYS B . n 
B 1 44  ASN 44  59  59  ASN ASN B . n 
B 1 45  HIS 45  60  60  HIS HIS B . n 
B 1 46  GLN 46  61  61  GLN GLN B . n 
B 1 47  LEU 47  62  62  LEU LEU B . n 
B 1 48  CYS 48  63  63  CYS CYS B . n 
B 1 49  THR 49  64  64  THR THR B . n 
B 1 50  GLU 50  65  65  GLU GLU B . n 
B 1 51  GLU 51  66  66  GLU GLU B . n 
B 1 52  ILE 52  67  67  ILE ILE B . n 
B 1 53  PHE 53  68  68  PHE PHE B . n 
B 1 54  GLN 54  69  69  GLN GLN B . n 
B 1 55  GLY 55  70  70  GLY GLY B . n 
B 1 56  ILE 56  71  71  ILE ILE B . n 
B 1 57  GLY 57  72  72  GLY GLY B . n 
B 1 58  THR 58  73  73  THR THR B . n 
B 1 59  LEU 59  74  74  LEU LEU B . n 
B 1 60  GLU 60  75  75  GLU GLU B . n 
B 1 61  SER 61  76  76  SER SER B . n 
B 1 62  GLN 62  77  77  GLN GLN B . n 
B 1 63  THR 63  78  78  THR THR B . n 
B 1 64  VAL 64  79  79  VAL VAL B . n 
B 1 65  GLN 65  80  80  GLN GLN B . n 
B 1 66  GLY 66  81  81  GLY GLY B . n 
B 1 67  GLY 67  82  82  GLY GLY B . n 
B 1 68  THR 68  83  83  THR THR B . n 
B 1 69  VAL 69  84  84  VAL VAL B . n 
B 1 70  GLU 70  85  85  GLU GLU B . n 
B 1 71  ARG 71  86  86  ARG ARG B . n 
B 1 72  LEU 72  87  87  LEU LEU B . n 
B 1 73  PHE 73  88  88  PHE PHE B . n 
B 1 74  LYS 74  89  89  LYS LYS B . n 
B 1 75  ASN 75  90  90  ASN ASN B . n 
B 1 76  LEU 76  91  91  LEU LEU B . n 
B 1 77  SER 77  92  92  SER SER B . n 
B 1 78  LEU 78  93  93  LEU LEU B . n 
B 1 79  ILE 79  94  94  ILE ILE B . n 
B 1 80  LYS 80  95  95  LYS LYS B . n 
B 1 81  LYS 81  96  96  LYS LYS B . n 
B 1 82  TYR 82  97  97  TYR TYR B . n 
B 1 83  ILE 83  98  98  ILE ILE B . n 
B 1 84  ASP 84  99  99  ASP ASP B . n 
B 1 85  GLY 85  100 100 GLY GLY B . n 
B 1 86  GLN 86  101 101 GLN GLN B . n 
B 1 87  LYS 87  102 102 LYS LYS B . n 
B 1 88  LYS 88  103 103 LYS LYS B . n 
B 1 89  LYS 89  104 104 LYS LYS B . n 
B 1 90  CYS 90  105 105 CYS CYS B . n 
B 1 91  GLY 91  106 106 GLY GLY B . n 
B 1 92  GLU 92  107 107 GLU GLU B . n 
B 1 93  GLU 93  108 108 GLU GLU B . n 
B 1 94  ARG 94  109 109 ARG ARG B . n 
B 1 95  ARG 95  110 110 ARG ARG B . n 
B 1 96  ARG 96  111 111 ARG ARG B . n 
B 1 97  VAL 97  112 112 VAL VAL B . n 
B 1 98  ASN 98  113 113 ASN ASN B . n 
B 1 99  GLN 99  114 114 GLN GLN B . n 
B 1 100 PHE 100 115 115 PHE PHE B . n 
B 1 101 LEU 101 116 116 LEU LEU B . n 
B 1 102 ASP 102 117 117 ASP ASP B . n 
B 1 103 TYR 103 118 118 TYR TYR B . n 
B 1 104 LEU 104 119 119 LEU LEU B . n 
B 1 105 GLN 105 120 120 GLN GLN B . n 
B 1 106 GLU 106 121 121 GLU GLU B . n 
B 1 107 PHE 107 122 122 PHE PHE B . n 
B 1 108 LEU 108 123 123 LEU LEU B . n 
B 1 109 GLY 109 124 124 GLY GLY B . n 
B 1 110 VAL 110 125 125 VAL VAL B . n 
B 1 111 MET 111 126 126 MET MET B . n 
B 1 112 ASN 112 127 127 ASN ASN B . n 
B 1 113 THR 113 128 128 THR THR B . n 
B 1 114 GLU 114 129 129 GLU GLU B . n 
B 1 115 TRP 115 130 130 TRP TRP B . n 
B 1 116 ILE 116 131 131 ILE ILE B . n 
B 1 117 ILE 117 132 132 ILE ILE B . n 
B 1 118 GLU 118 133 ?   ?   ?   B . n 
B 1 119 SER 119 134 ?   ?   ?   B . n 
C 2 1   GLY 1   14  ?   ?   ?   C . n 
C 2 2   SER 2   15  ?   ?   ?   C . n 
C 2 3   SER 3   16  ?   ?   ?   C . n 
C 2 4   GLY 4   17  ?   ?   ?   C . n 
C 2 5   SER 5   18  ?   ?   ?   C . n 
C 2 6   SER 6   19  ?   ?   ?   C . n 
C 2 7   GLY 7   20  ?   ?   ?   C . n 
C 2 8   ASP 8   21  ?   ?   ?   C . n 
C 2 9   LEU 9   22  ?   ?   ?   C . n 
C 2 10  LEU 10  23  ?   ?   ?   C . n 
C 2 11  PRO 11  24  ?   ?   ?   C . n 
C 2 12  ASP 12  25  ?   ?   ?   C . n 
C 2 13  GLU 13  26  ?   ?   ?   C . n 
C 2 14  LYS 14  27  27  LYS LYS C . n 
C 2 15  ILE 15  28  28  ILE ILE C . n 
C 2 16  SER 16  29  29  SER SER C . n 
C 2 17  LEU 17  30  30  LEU LEU C . n 
C 2 18  LEU 18  31  31  LEU LEU C . n 
C 2 19  PRO 19  32  32  PRO PRO C . n 
C 2 20  PRO 20  33  33  PRO PRO C . n 
C 2 21  VAL 21  34  34  VAL VAL C . n 
C 2 22  ASN 22  35  35  ASN ASN C . n 
C 2 23  PHE 23  36  36  PHE PHE C . n 
C 2 24  THR 24  37  37  THR THR C . n 
C 2 25  ILE 25  38  38  ILE ILE C . n 
C 2 26  LYS 26  39  39  LYS LYS C . n 
C 2 27  VAL 27  40  40  VAL VAL C . n 
C 2 28  THR 28  41  41  THR THR C . n 
C 2 29  GLY 29  42  42  GLY GLY C . n 
C 2 30  LEU 30  43  43  LEU LEU C . n 
C 2 31  ALA 31  44  44  ALA ALA C . n 
C 2 32  GLN 32  45  45  GLN GLN C . n 
C 2 33  VAL 33  46  46  VAL VAL C . n 
C 2 34  LEU 34  47  47  LEU LEU C . n 
C 2 35  LEU 35  48  48  LEU LEU C . n 
C 2 36  GLN 36  49  49  GLN GLN C . n 
C 2 37  TRP 37  50  50  TRP TRP C . n 
C 2 38  LYS 38  51  51  LYS LYS C . n 
C 2 39  PRO 39  52  52  PRO PRO C . n 
C 2 40  ASN 40  53  53  ASN ASN C . n 
C 2 41  PRO 41  54  54  PRO PRO C . n 
C 2 42  ASP 42  55  55  ASP ASP C . n 
C 2 43  GLN 43  56  56  GLN GLN C . n 
C 2 44  GLU 44  57  57  GLU GLU C . n 
C 2 45  GLN 45  58  58  GLN GLN C . n 
C 2 46  ARG 46  59  59  ARG ARG C . n 
C 2 47  ASN 47  60  60  ASN ASN C . n 
C 2 48  VAL 48  61  61  VAL VAL C . n 
C 2 49  ASN 49  62  62  ASN ASN C . n 
C 2 50  LEU 50  63  63  LEU LEU C . n 
C 2 51  GLU 51  64  64  GLU GLU C . n 
C 2 52  TYR 52  65  65  TYR TYR C . n 
C 2 53  GLN 53  66  66  GLN GLN C . n 
C 2 54  VAL 54  67  67  VAL VAL C . n 
C 2 55  LYS 55  68  68  LYS LYS C . n 
C 2 56  ILE 56  69  69  ILE ILE C . n 
C 2 57  ASN 57  70  70  ASN ASN C . n 
C 2 58  ALA 58  71  71  ALA ALA C . n 
C 2 59  PRO 59  72  72  PRO PRO C . n 
C 2 60  LYS 60  73  73  LYS LYS C . n 
C 2 61  GLU 61  74  74  GLU GLU C . n 
C 2 62  ASP 62  75  75  ASP ASP C . n 
C 2 63  ASP 63  76  76  ASP ASP C . n 
C 2 64  TYR 64  77  77  TYR TYR C . n 
C 2 65  GLU 65  78  78  GLU GLU C . n 
C 2 66  THR 66  79  79  THR THR C . n 
C 2 67  ARG 67  80  80  ARG ARG C . n 
C 2 68  ILE 68  81  81  ILE ILE C . n 
C 2 69  THR 69  82  82  THR THR C . n 
C 2 70  GLU 70  83  83  GLU GLU C . n 
C 2 71  SER 71  84  84  SER SER C . n 
C 2 72  LYS 72  85  85  LYS LYS C . n 
C 2 73  CYS 73  86  86  CYS CYS C . n 
C 2 74  VAL 74  87  87  VAL VAL C . n 
C 2 75  THR 75  88  88  THR THR C . n 
C 2 76  ILE 76  89  89  ILE ILE C . n 
C 2 77  LEU 77  90  90  LEU LEU C . n 
C 2 78  HIS 78  91  91  HIS HIS C . n 
C 2 79  LYS 79  92  92  LYS LYS C . n 
C 2 80  GLY 80  93  93  GLY GLY C . n 
C 2 81  PHE 81  94  94  PHE PHE C . n 
C 2 82  SER 82  95  95  SER SER C . n 
C 2 83  ALA 83  96  96  ALA ALA C . n 
C 2 84  SER 84  97  97  SER SER C . n 
C 2 85  VAL 85  98  98  VAL VAL C . n 
C 2 86  ARG 86  99  99  ARG ARG C . n 
C 2 87  THR 87  100 100 THR THR C . n 
C 2 88  ILE 88  101 101 ILE ILE C . n 
C 2 89  LEU 89  102 102 LEU LEU C . n 
C 2 90  GLN 90  103 103 GLN GLN C . n 
C 2 91  ASN 91  104 104 ASN ASN C . n 
C 2 92  ASP 92  105 105 ASP ASP C . n 
C 2 93  HIS 93  106 106 HIS HIS C . n 
C 2 94  SER 94  107 107 SER SER C . n 
C 2 95  LEU 95  108 108 LEU LEU C . n 
C 2 96  LEU 96  109 109 LEU LEU C . n 
C 2 97  ALA 97  110 110 ALA ALA C . n 
C 2 98  SER 98  111 111 SER SER C . n 
C 2 99  SER 99  112 112 SER SER C . n 
C 2 100 TRP 100 113 113 TRP TRP C . n 
C 2 101 ALA 101 114 114 ALA ALA C . n 
C 2 102 SER 102 115 115 SER SER C . n 
C 2 103 ALA 103 116 116 ALA ALA C . n 
C 2 104 GLU 104 117 117 GLU GLU C . n 
C 2 105 LEU 105 118 118 LEU LEU C . n 
C 2 106 HIS 106 119 119 HIS HIS C . n 
C 2 107 ALA 107 120 120 ALA ALA C . n 
C 2 108 PRO 108 121 121 PRO PRO C . n 
C 2 109 PRO 109 122 122 PRO PRO C . n 
C 2 110 GLY 110 123 123 GLY GLY C . n 
C 2 111 SER 111 124 124 SER SER C . n 
C 2 112 PRO 112 125 125 PRO PRO C . n 
C 2 113 GLY 113 126 126 GLY GLY C . n 
C 2 114 THR 114 127 127 THR THR C . n 
C 2 115 SER 115 128 128 SER SER C . n 
C 2 116 ILE 116 129 129 ILE ILE C . n 
C 2 117 VAL 117 130 130 VAL VAL C . n 
C 2 118 ASN 118 131 131 ASN ASN C . n 
C 2 119 LEU 119 132 132 LEU LEU C . n 
C 2 120 THR 120 133 133 THR THR C . n 
C 2 121 CYS 121 134 134 CYS CYS C . n 
C 2 122 THR 122 135 135 THR THR C . n 
C 2 123 THR 123 136 136 THR THR C . n 
C 2 124 ASN 124 137 137 ASN ASN C . n 
C 2 125 THR 125 138 138 THR THR C . n 
C 2 126 THR 126 139 139 THR THR C . n 
C 2 127 GLU 127 140 140 GLU GLU C . n 
C 2 128 ASP 128 141 141 ASP ASP C . n 
C 2 129 ASN 129 142 142 ASN ASN C . n 
C 2 130 TYR 130 143 143 TYR TYR C . n 
C 2 131 SER 131 144 144 SER SER C . n 
C 2 132 ARG 132 145 145 ARG ARG C . n 
C 2 133 LEU 133 146 146 LEU LEU C . n 
C 2 134 ARG 134 147 147 ARG ARG C . n 
C 2 135 SER 135 148 148 SER SER C . n 
C 2 136 TYR 136 149 149 TYR TYR C . n 
C 2 137 GLN 137 150 150 GLN GLN C . n 
C 2 138 VAL 138 151 151 VAL VAL C . n 
C 2 139 SER 139 152 152 SER SER C . n 
C 2 140 LEU 140 153 153 LEU LEU C . n 
C 2 141 HIS 141 154 154 HIS HIS C . n 
C 2 142 CYS 142 155 155 CYS CYS C . n 
C 2 143 THR 143 156 156 THR THR C . n 
C 2 144 TRP 144 157 157 TRP TRP C . n 
C 2 145 LEU 145 158 158 LEU LEU C . n 
C 2 146 VAL 146 159 159 VAL VAL C . n 
C 2 147 GLY 147 160 160 GLY GLY C . n 
C 2 148 THR 148 161 161 THR THR C . n 
C 2 149 ASP 149 162 162 ASP ASP C . n 
C 2 150 ALA 150 163 163 ALA ALA C . n 
C 2 151 PRO 151 164 164 PRO PRO C . n 
C 2 152 GLU 152 165 165 GLU GLU C . n 
C 2 153 ASP 153 166 166 ASP ASP C . n 
C 2 154 THR 154 167 167 THR THR C . n 
C 2 155 GLN 155 168 168 GLN GLN C . n 
C 2 156 TYR 156 169 169 TYR TYR C . n 
C 2 157 PHE 157 170 170 PHE PHE C . n 
C 2 158 LEU 158 171 171 LEU LEU C . n 
C 2 159 TYR 159 172 172 TYR TYR C . n 
C 2 160 TYR 160 173 173 TYR TYR C . n 
C 2 161 ARG 161 174 174 ARG ARG C . n 
C 2 162 TYR 162 175 175 TYR TYR C . n 
C 2 163 GLY 163 176 176 GLY GLY C . n 
C 2 164 SER 164 177 177 SER SER C . n 
C 2 165 TRP 165 178 178 TRP TRP C . n 
C 2 166 THR 166 179 179 THR THR C . n 
C 2 167 GLU 167 180 180 GLU GLU C . n 
C 2 168 GLU 168 181 181 GLU GLU C . n 
C 2 169 CYS 169 182 182 CYS CYS C . n 
C 2 170 GLN 170 183 183 GLN GLN C . n 
C 2 171 GLU 171 184 184 GLU GLU C . n 
C 2 172 TYR 172 185 185 TYR TYR C . n 
C 2 173 SER 173 186 186 SER SER C . n 
C 2 174 LYS 174 187 187 LYS LYS C . n 
C 2 175 ASP 175 188 188 ASP ASP C . n 
C 2 176 THR 176 189 189 THR THR C . n 
C 2 177 LEU 177 190 190 LEU LEU C . n 
C 2 178 GLY 178 191 191 GLY GLY C . n 
C 2 179 ARG 179 192 192 ARG ARG C . n 
C 2 180 ASN 180 193 193 ASN ASN C . n 
C 2 181 ILE 181 194 194 ILE ILE C . n 
C 2 182 ALA 182 195 195 ALA ALA C . n 
C 2 183 CYS 183 196 196 CYS CYS C . n 
C 2 184 TRP 184 197 197 TRP TRP C . n 
C 2 185 PHE 185 198 198 PHE PHE C . n 
C 2 186 PRO 186 199 199 PRO PRO C . n 
C 2 187 ARG 187 200 200 ARG ARG C . n 
C 2 188 THR 188 201 201 THR THR C . n 
C 2 189 PHE 189 202 202 PHE PHE C . n 
C 2 190 ILE 190 203 203 ILE ILE C . n 
C 2 191 LEU 191 204 204 LEU LEU C . n 
C 2 192 SER 192 205 205 SER SER C . n 
C 2 193 LYS 193 206 206 LYS LYS C . n 
C 2 194 GLY 194 207 207 GLY GLY C . n 
C 2 195 ARG 195 208 208 ARG ARG C . n 
C 2 196 ASP 196 209 209 ASP ASP C . n 
C 2 197 TRP 197 210 210 TRP TRP C . n 
C 2 198 LEU 198 211 211 LEU LEU C . n 
C 2 199 ALA 199 212 212 ALA ALA C . n 
C 2 200 VAL 200 213 213 VAL VAL C . n 
C 2 201 LEU 201 214 214 LEU LEU C . n 
C 2 202 VAL 202 215 215 VAL VAL C . n 
C 2 203 ASN 203 216 216 ASN ASN C . n 
C 2 204 GLY 204 217 217 GLY GLY C . n 
C 2 205 SER 205 218 218 SER SER C . n 
C 2 206 SER 206 219 219 SER SER C . n 
C 2 207 LYS 207 220 220 LYS LYS C . n 
C 2 208 HIS 208 221 221 HIS HIS C . n 
C 2 209 SER 209 222 222 SER SER C . n 
C 2 210 ALA 210 223 223 ALA ALA C . n 
C 2 211 ILE 211 224 224 ILE ILE C . n 
C 2 212 ARG 212 225 225 ARG ARG C . n 
C 2 213 PRO 213 226 226 PRO PRO C . n 
C 2 214 PHE 214 227 227 PHE PHE C . n 
C 2 215 ASP 215 228 228 ASP ASP C . n 
C 2 216 GLN 216 229 229 GLN GLN C . n 
C 2 217 LEU 217 230 230 LEU LEU C . n 
C 2 218 PHE 218 231 231 PHE PHE C . n 
C 2 219 ALA 219 232 232 ALA ALA C . n 
C 2 220 LEU 220 233 233 LEU LEU C . n 
C 2 221 HIS 221 234 234 HIS HIS C . n 
C 2 222 ALA 222 235 235 ALA ALA C . n 
C 2 223 ILE 223 236 236 ILE ILE C . n 
C 2 224 ASP 224 237 237 ASP ASP C . n 
C 2 225 GLN 225 238 238 GLN GLN C . n 
C 2 226 ILE 226 239 239 ILE ILE C . n 
C 2 227 ASN 227 240 240 ASN ASN C . n 
C 2 228 PRO 228 241 241 PRO PRO C . n 
C 2 229 PRO 229 242 242 PRO PRO C . n 
C 2 230 LEU 230 243 243 LEU LEU C . n 
C 2 231 ASN 231 244 244 ASN ASN C . n 
C 2 232 VAL 232 245 245 VAL VAL C . n 
C 2 233 THR 233 246 246 THR THR C . n 
C 2 234 ALA 234 247 247 ALA ALA C . n 
C 2 235 GLU 235 248 248 GLU GLU C . n 
C 2 236 ILE 236 249 249 ILE ILE C . n 
C 2 237 GLU 237 250 250 GLU GLU C . n 
C 2 238 GLY 238 251 251 GLY GLY C . n 
C 2 239 THR 239 252 252 THR THR C . n 
C 2 240 ARG 240 253 253 ARG ARG C . n 
C 2 241 LEU 241 254 254 LEU LEU C . n 
C 2 242 SER 242 255 255 SER SER C . n 
C 2 243 ILE 243 256 256 ILE ILE C . n 
C 2 244 GLN 244 257 257 GLN GLN C . n 
C 2 245 TRP 245 258 258 TRP TRP C . n 
C 2 246 GLU 246 259 259 GLU GLU C . n 
C 2 247 LYS 247 260 260 LYS LYS C . n 
C 2 248 PRO 248 261 261 PRO PRO C . n 
C 2 249 VAL 249 262 262 VAL VAL C . n 
C 2 250 SER 250 263 263 SER SER C . n 
C 2 251 ALA 251 264 264 ALA ALA C . n 
C 2 252 PHE 252 265 265 PHE PHE C . n 
C 2 253 PRO 253 266 266 PRO PRO C . n 
C 2 254 ILE 254 267 267 ILE ILE C . n 
C 2 255 HIS 255 268 268 HIS HIS C . n 
C 2 256 CYS 256 269 269 CYS CYS C . n 
C 2 257 PHE 257 270 270 PHE PHE C . n 
C 2 258 ASP 258 271 271 ASP ASP C . n 
C 2 259 TYR 259 272 272 TYR TYR C . n 
C 2 260 GLU 260 273 273 GLU GLU C . n 
C 2 261 VAL 261 274 274 VAL VAL C . n 
C 2 262 LYS 262 275 275 LYS LYS C . n 
C 2 263 ILE 263 276 276 ILE ILE C . n 
C 2 264 HIS 264 277 277 HIS HIS C . n 
C 2 265 ASN 265 278 278 ASN ASN C . n 
C 2 266 THR 266 279 279 THR THR C . n 
C 2 267 ARG 267 280 280 ARG ARG C . n 
C 2 268 ASN 268 281 281 ASN ASN C . n 
C 2 269 GLY 269 282 282 GLY GLY C . n 
C 2 270 TYR 270 283 283 TYR TYR C . n 
C 2 271 LEU 271 284 284 LEU LEU C . n 
C 2 272 GLN 272 285 285 GLN GLN C . n 
C 2 273 ILE 273 286 286 ILE ILE C . n 
C 2 274 GLU 274 287 287 GLU GLU C . n 
C 2 275 LYS 275 288 288 LYS LYS C . n 
C 2 276 LEU 276 289 289 LEU LEU C . n 
C 2 277 MET 277 290 290 MET MET C . n 
C 2 278 THR 278 291 291 THR THR C . n 
C 2 279 ASN 279 292 292 ASN ASN C . n 
C 2 280 ALA 280 293 293 ALA ALA C . n 
C 2 281 PHE 281 294 294 PHE PHE C . n 
C 2 282 ILE 282 295 295 ILE ILE C . n 
C 2 283 SER 283 296 296 SER SER C . n 
C 2 284 ILE 284 297 297 ILE ILE C . n 
C 2 285 ILE 285 298 298 ILE ILE C . n 
C 2 286 ASP 286 299 299 ASP ASP C . n 
C 2 287 ASP 287 300 300 ASP ASP C . n 
C 2 288 LEU 288 301 301 LEU LEU C . n 
C 2 289 SER 289 302 302 SER SER C . n 
C 2 290 LYS 290 303 303 LYS LYS C . n 
C 2 291 TYR 291 304 304 TYR TYR C . n 
C 2 292 ASP 292 305 305 ASP ASP C . n 
C 2 293 VAL 293 306 306 VAL VAL C . n 
C 2 294 GLN 294 307 307 GLN GLN C . n 
C 2 295 VAL 295 308 308 VAL VAL C . n 
C 2 296 ARG 296 309 309 ARG ARG C . n 
C 2 297 ALA 297 310 310 ALA ALA C . n 
C 2 298 ALA 298 311 311 ALA ALA C . n 
C 2 299 VAL 299 312 312 VAL VAL C . n 
C 2 300 SER 300 313 313 SER SER C . n 
C 2 301 SER 301 314 314 SER SER C . n 
C 2 302 MET 302 315 315 MET MET C . n 
C 2 303 CYS 303 316 316 CYS CYS C . n 
C 2 304 ARG 304 317 317 ARG ARG C . n 
C 2 305 GLU 305 318 318 GLU GLU C . n 
C 2 306 ALA 306 319 319 ALA ALA C . n 
C 2 307 GLY 307 320 320 GLY GLY C . n 
C 2 308 LEU 308 321 321 LEU LEU C . n 
C 2 309 TRP 309 322 322 TRP TRP C . n 
C 2 310 SER 310 323 323 SER SER C . n 
C 2 311 GLU 311 324 324 GLU GLU C . n 
C 2 312 TRP 312 325 325 TRP TRP C . n 
C 2 313 SER 313 326 326 SER SER C . n 
C 2 314 GLN 314 327 327 GLN GLN C . n 
C 2 315 PRO 315 328 328 PRO PRO C . n 
C 2 316 ILE 316 329 329 ILE ILE C . n 
C 2 317 TYR 317 330 330 TYR TYR C . n 
C 2 318 VAL 318 331 331 VAL VAL C . n 
C 2 319 GLY 319 332 332 GLY GLY C . n 
C 2 320 ASN 320 333 333 ASN ASN C . n 
C 2 321 ASP 321 334 ?   ?   ?   C . n 
C 2 322 GLU 322 335 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9090  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  26690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 23.0654 18.2163  2.2948   0.9527 0.9710 1.4870 0.3172  -0.1741 -0.3014 5.7566 6.7859 9.1610 
-1.0222 3.2789  -4.0059 -0.5936 0.2257  -0.3216 -0.2542 -0.4581 1.5173  -1.9001 -1.4857 0.8180  
'X-RAY DIFFRACTION' 2  ? refined 31.8625 26.1508  -7.5312  2.4395 0.7901 1.6312 0.0428  -0.2361 -0.1433 6.7380 5.2066 4.3126 
5.3667  -3.0634 -3.1030 -0.0023 0.9587  0.1470  -3.0334 -0.3807 -0.1709 -1.8273 -1.3196 0.3453  
'X-RAY DIFFRACTION' 3  ? refined 44.8613 19.8868  -12.4886 1.9376 1.3095 1.7936 -0.4022 0.7123  -0.0583 8.8224 1.7851 1.3693 
-3.8951 -0.4324 0.5001  0.5959  1.7741  -0.2695 -1.0274 -0.5941 -2.3143 -2.7754 1.0190  0.3443  
'X-RAY DIFFRACTION' 4  ? refined 35.6285 7.3276   -6.9604  0.7329 0.8157 1.1864 -0.0509 0.2200  0.1083  3.4325 8.7149 3.2469 
2.6461  1.1576  5.3442  -0.7033 0.6944  -0.7044 -0.5336 0.1993  0.1976  0.6014  1.2717  0.5830  
'X-RAY DIFFRACTION' 5  ? refined 40.6309 24.9576  -0.7069  1.3849 1.2324 1.5206 -0.3843 0.1792  0.1399  4.4471 7.9916 4.5743 
-5.2991 0.9381  1.6645  -1.5680 -1.6259 -1.6055 -0.1107 0.7429  -0.7051 -2.3038 2.2268  0.7234  
'X-RAY DIFFRACTION' 6  ? refined 31.6522 13.3597  5.0200   0.4195 0.5380 0.9931 0.0216  -0.0111 -0.0140 7.4369 4.1902 9.5236 
5.0657  -2.3362 -3.6693 0.1128  -0.1099 -0.0116 0.6742  0.0214  -0.1467 -0.8366 0.1126  -0.1969 
'X-RAY DIFFRACTION' 7  ? refined 24.2408 -11.4141 5.7727   0.6839 0.6478 0.4493 -0.0141 0.0079  -0.0381 8.4362 7.1484 2.9596 
2.7223  -4.9753 -0.7262 -0.4882 -0.0381 -0.3693 -0.2315 0.2939  0.2368  -0.0651 -1.0100 0.2229  
'X-RAY DIFFRACTION' 8  ? refined 24.2068 -5.4556  -10.7818 0.9350 0.7098 0.6793 -0.2025 -0.0867 -0.0676 4.0783 3.9424 2.2578 
-3.9705 0.6935  0.0242  -0.4522 1.0429  0.7482  -0.6080 0.4133  0.7600  -0.9352 0.8075  0.5703  
'X-RAY DIFFRACTION' 9  ? refined 28.0966 -15.0681 -16.0073 2.1019 1.2375 1.0247 -0.1048 0.0935  -0.3347 7.8887 2.8521 5.7134 
-2.5810 0.4594  -0.8256 -0.3683 2.2717  -1.2541 -1.9762 -0.3964 -0.0069 0.0019  -1.8077 0.5321  
'X-RAY DIFFRACTION' 10 ? refined 24.9964 -14.5783 2.2596   0.9927 0.5712 0.6638 -0.1368 0.0514  -0.0739 3.4840 2.3908 3.9636 
-2.0810 -1.5180 1.4614  -0.5647 0.2700  -0.4832 -1.3235 0.4396  -0.1495 1.2841  -0.1326 0.1065  
'X-RAY DIFFRACTION' 11 ? refined 34.0506 -13.2485 1.7388   0.9737 0.7226 1.2816 0.1056  0.3462  -0.0252 2.4531 3.5395 9.1803 
0.0750  1.3383  -5.3292 -0.4504 -0.1232 -0.3036 -0.8928 -0.0783 -1.4177 1.2663  1.4866  0.1427  
'X-RAY DIFFRACTION' 12 ? refined 32.3341 -26.8408 -0.5686  2.3372 1.0505 1.5677 0.1832  0.3651  -0.0200 4.7323 5.8111 9.3621 
1.6417  -1.5096 4.7284  -2.3244 -0.2989 -1.3413 -0.6278 -0.7561 -1.9039 1.3594  -0.1997 2.1504  
'X-RAY DIFFRACTION' 13 ? refined 35.4449 -12.9119 -8.9787  1.7434 0.7930 1.1265 0.1962  0.6321  -0.0160 4.3754 3.3272 0.9729 
1.1896  1.8064  -0.2887 -0.1070 0.6886  0.2224  -0.1107 0.1719  -1.8241 1.7974  0.4559  -0.2721 
'X-RAY DIFFRACTION' 14 ? refined 42.3612 9.5971   -14.5595 1.7229 1.0687 1.7974 -0.0479 0.7761  0.0668  6.2328 7.0950 2.2876 
5.3094  -1.0256 -3.1353 -0.6438 -0.5962 -1.6844 0.7448  -0.5797 0.6512  -1.0368 0.4446  1.1898  
'X-RAY DIFFRACTION' 15 ? refined 32.7900 14.9979  -10.7994 1.3203 0.9399 1.1392 -0.1180 -0.0509 -0.0005 5.8904 6.3563 6.4277 
6.0777  -6.1300 -6.4359 0.0004  1.8876  0.0114  -0.3607 0.7319  1.2887  -3.0934 0.3546  -1.4952 
'X-RAY DIFFRACTION' 16 ? refined 22.2543 9.1159   -3.7017  0.7692 1.1196 1.9489 0.0123  -0.1853 -0.0993 7.9212 4.7319 2.0144 
5.7541  2.4844  -0.6413 0.8682  0.2409  -1.4274 0.2705  0.6956  0.2935  1.1296  -2.6004 -1.3314 
'X-RAY DIFFRACTION' 17 ? refined 26.6592 -3.8831  26.4263  0.8100 1.1252 0.5976 0.2427  -0.0833 -0.4082 2.1598 5.5125 6.5287 
-0.1977 0.6914  -1.8952 -0.3337 -0.8416 1.0708  0.9582  0.2745  -0.4125 -0.4794 1.2706  0.2690  
'X-RAY DIFFRACTION' 18 ? refined 11.1410 -5.8367  12.6085  0.5780 0.5055 0.6155 0.0756  0.0036  -0.0232 4.3899 4.1558 4.3622 
-1.0596 2.2452  -0.5494 -0.5275 -0.4515 0.4875  -0.1223 0.4202  0.4838  -0.2360 -0.2512 -0.0501 
'X-RAY DIFFRACTION' 19 ? refined -1.1100 1.4352   6.2766   0.6961 0.7185 1.2472 0.2688  -0.2487 0.0739  3.9246 3.6089 2.6629 
1.0902  2.5021  -1.1073 -0.4132 -0.3224 1.1491  -0.3750 0.3824  1.5623  -0.9298 -0.6877 0.0105  
'X-RAY DIFFRACTION' 20 ? refined 4.4521  -12.0647 -25.8361 1.5299 1.2735 0.6314 -0.6047 -0.1829 0.2944  2.8264 3.8988 1.9779 
-0.1054 1.4498  -0.0982 -0.5767 1.0573  0.2343  -1.5989 0.6298  0.0916  -1.1530 0.2753  -0.0806 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 24:34)'   
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 35:44)'   
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 45:53)'   
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 54:72)'   
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 73:84)'   
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 85:104)'  
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 105:121)' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 122:130)' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 24:33)'   
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 34:64)'   
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 65:75)'   
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 76:84)'   
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 85:103)'  
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 104:112)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 113:122)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(CHAIN B AND RESID 123:131)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(CHAIN C AND RESID 27:63)'   
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(CHAIN C AND RESID 64:165)'  
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(CHAIN C AND RESID 166:237)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(CHAIN C AND RESID 238:333)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .                            ? 1 
SOLVE     phasing           .                            ? 2 
PHENIX    refinement        '(phenix.refine: 1.7.3_928)' ? 3 
DENZO     'data reduction'  .                            ? 4 
SCALEPACK 'data scaling'    .                            ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 C GLN 229 ? ? O C HOH 413 ? ? 2.08 
2 1 OD1 A ASN 113 ? ? O A HOH 203 ? ? 2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 40  ? ? -95.20  32.58   
2  1 ALA A 46  ? ? -27.08  -92.20  
3  1 GLU A 129 ? ? -104.70 65.43   
4  1 PRO B 25  ? ? -86.23  -158.51 
5  1 THR B 26  ? ? -138.39 -48.94  
6  1 GLN B 77  ? ? -158.08 26.47   
7  1 VAL B 79  ? ? -59.98  105.32  
8  1 GLN B 80  ? ? -59.72  78.00   
9  1 GLU B 107 ? ? -144.99 -7.12   
10 1 ARG C 59  ? ? -55.58  97.24   
11 1 ASN C 104 ? ? -121.34 -105.83 
12 1 ASP C 105 ? ? -136.61 -41.09  
13 1 TYR C 149 ? ? 71.70   138.41  
14 1 ASP C 188 ? ? -103.20 -165.05 
15 1 GLU C 250 ? ? -105.15 74.86   
16 1 PRO C 261 ? ? -49.56  162.09  
17 1 VAL C 262 ? ? -60.73  90.21   
18 1 PRO C 266 ? ? -61.70  -118.23 
19 1 ILE C 267 ? ? -137.34 -37.71  
20 1 ARG C 280 ? ? -81.11  -72.08  
21 1 ILE C 298 ? ? -151.26 -133.40 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 16  ? A GLY 1   
2  1 Y 1 A SER 17  ? A SER 2   
3  1 Y 1 A SER 18  ? A SER 3   
4  1 Y 1 A GLY 19  ? A GLY 4   
5  1 Y 1 A SER 20  ? A SER 5   
6  1 Y 1 A SER 21  ? A SER 6   
7  1 Y 1 A GLY 22  ? A GLY 7   
8  1 Y 1 A GLU 23  ? A GLU 8   
9  1 Y 1 A ILE 131 ? A ILE 116 
10 1 Y 1 A ILE 132 ? A ILE 117 
11 1 Y 1 A GLU 133 ? A GLU 118 
12 1 Y 1 A SER 134 ? A SER 119 
13 1 Y 1 B GLY 16  ? B GLY 1   
14 1 Y 1 B SER 17  ? B SER 2   
15 1 Y 1 B SER 18  ? B SER 3   
16 1 Y 1 B GLY 19  ? B GLY 4   
17 1 Y 1 B SER 20  ? B SER 5   
18 1 Y 1 B SER 21  ? B SER 6   
19 1 Y 1 B GLY 22  ? B GLY 7   
20 1 Y 1 B GLU 23  ? B GLU 8   
21 1 Y 1 B GLU 133 ? B GLU 118 
22 1 Y 1 B SER 134 ? B SER 119 
23 1 Y 1 C GLY 14  ? C GLY 1   
24 1 Y 1 C SER 15  ? C SER 2   
25 1 Y 1 C SER 16  ? C SER 3   
26 1 Y 1 C GLY 17  ? C GLY 4   
27 1 Y 1 C SER 18  ? C SER 5   
28 1 Y 1 C SER 19  ? C SER 6   
29 1 Y 1 C GLY 20  ? C GLY 7   
30 1 Y 1 C ASP 21  ? C ASP 8   
31 1 Y 1 C LEU 22  ? C LEU 9   
32 1 Y 1 C LEU 23  ? C LEU 10  
33 1 Y 1 C PRO 24  ? C PRO 11  
34 1 Y 1 C ASP 25  ? C ASP 12  
35 1 Y 1 C GLU 26  ? C GLU 13  
36 1 Y 1 C ASP 334 ? C ASP 321 
37 1 Y 1 C GLU 335 ? C GLU 322 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1  201 1  HOH HOH A . 
D 3 HOH 2  202 2  HOH HOH A . 
D 3 HOH 3  203 12 HOH HOH A . 
D 3 HOH 4  204 17 HOH HOH A . 
D 3 HOH 5  205 20 HOH HOH A . 
E 3 HOH 1  201 14 HOH HOH B . 
E 3 HOH 2  202 15 HOH HOH B . 
E 3 HOH 3  203 24 HOH HOH B . 
E 3 HOH 4  204 28 HOH HOH B . 
E 3 HOH 5  205 29 HOH HOH B . 
E 3 HOH 6  206 30 HOH HOH B . 
F 3 HOH 1  401 3  HOH HOH C . 
F 3 HOH 2  402 4  HOH HOH C . 
F 3 HOH 3  403 5  HOH HOH C . 
F 3 HOH 4  404 6  HOH HOH C . 
F 3 HOH 5  405 7  HOH HOH C . 
F 3 HOH 6  406 8  HOH HOH C . 
F 3 HOH 7  407 9  HOH HOH C . 
F 3 HOH 8  408 10 HOH HOH C . 
F 3 HOH 9  409 11 HOH HOH C . 
F 3 HOH 10 410 13 HOH HOH C . 
F 3 HOH 11 411 16 HOH HOH C . 
F 3 HOH 12 412 18 HOH HOH C . 
F 3 HOH 13 413 19 HOH HOH C . 
F 3 HOH 14 414 21 HOH HOH C . 
F 3 HOH 15 415 22 HOH HOH C . 
F 3 HOH 16 416 23 HOH HOH C . 
F 3 HOH 17 417 25 HOH HOH C . 
F 3 HOH 18 418 26 HOH HOH C . 
F 3 HOH 19 419 27 HOH HOH C . 
F 3 HOH 20 420 31 HOH HOH C . 
F 3 HOH 21 421 32 HOH HOH C . 
#