data_3VAG
# 
_entry.id   3VAG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VAG         
NDB   NA1512       
RCSB  RCSB069798   
WWPDB D_1000069798 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2G4B 'U2AF65 variant with polyuridine tract' unspecified 
PDB 2HZC 'N-terminal RRM of U2AF65'              unspecified 
PDB 3VAF .                                       unspecified 
PDB 3VAH .                                       unspecified 
PDB 3VAI .                                       unspecified 
PDB 3VAJ .                                       unspecified 
PDB 3VAK .                                       unspecified 
PDB 3VAL .                                       unspecified 
PDB 3VAM .                                       unspecified 
PDB 3VAN .                                       unspecified 
PDB 3VAO .                                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3VAG 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jenkins, J.L.'  1 
'Kielkopf, C.L.' 2 
# 
_citation.id                        primary 
_citation.title                     
'U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            41 
_citation.page_first                3859 
_citation.page_last                 3873 
_citation.year                      2013 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23376934 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jenkins, J.L.'  1 
primary 'Agrawal, A.A.'  2 
primary 'Gupta, A.'      3 
primary 'Green, M.R.'    4 
primary 'Kielkopf, C.L.' 5 
# 
_cell.entry_id           3VAG 
_cell.length_a           166.825 
_cell.length_b           37.499 
_cell.length_c           100.925 
_cell.angle_alpha        90.00 
_cell.angle_beta         125.35 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3VAG 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Splicing factor U2AF 65 kDa subunit'          19075.754 2   ? ? 'RNA Binding Domains 1 and 2' ?            
2 polymer     syn 
;DNA 5'-D(*U*CP*(BRU)P*UP*UP*UP*U)-3'
;
2064.121  2   ? ? ?                             'BrU3C2 DNA' 
3 non-polymer syn '1,4-DIETHYLENE DIOXIDE'                       88.105    6   ? ? ?                             ?            
4 non-polymer syn 'SULFATE ION'                                  96.063    7   ? ? ?                             ?            
5 non-polymer syn GLYCEROL                                       92.094    2   ? ? ?                             ?            
6 non-polymer syn 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' 862.056   1   ? ? ?                             ?            
7 water       nat water                                          18.015    156 ? ? ?                             ?            
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U2 auxiliary factor 65 kDa subunit, hU2AF(65), hU2AF65, U2 snRNP auxiliary factor large subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ
SLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNG
MQLGDKKLLVQRAS
;
;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ
SLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNG
MQLGDKKLLVQRAS
;
A,B ? 
2 polydeoxyribonucleotide no yes '(DU)(DC)(BRU)(DU)(DU)(DU)(DU)' UCUUUUU P,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   ALA n 
1 7   ARG n 
1 8   ARG n 
1 9   LEU n 
1 10  TYR n 
1 11  VAL n 
1 12  GLY n 
1 13  ASN n 
1 14  ILE n 
1 15  PRO n 
1 16  PHE n 
1 17  GLY n 
1 18  ILE n 
1 19  THR n 
1 20  GLU n 
1 21  GLU n 
1 22  ALA n 
1 23  MET n 
1 24  MET n 
1 25  ASP n 
1 26  PHE n 
1 27  PHE n 
1 28  ASN n 
1 29  ALA n 
1 30  GLN n 
1 31  MET n 
1 32  ARG n 
1 33  LEU n 
1 34  GLY n 
1 35  GLY n 
1 36  LEU n 
1 37  THR n 
1 38  GLN n 
1 39  ALA n 
1 40  PRO n 
1 41  GLY n 
1 42  ASN n 
1 43  PRO n 
1 44  VAL n 
1 45  LEU n 
1 46  ALA n 
1 47  VAL n 
1 48  GLN n 
1 49  ILE n 
1 50  ASN n 
1 51  GLN n 
1 52  ASP n 
1 53  LYS n 
1 54  ASN n 
1 55  PHE n 
1 56  ALA n 
1 57  PHE n 
1 58  LEU n 
1 59  GLU n 
1 60  PHE n 
1 61  ARG n 
1 62  SER n 
1 63  VAL n 
1 64  ASP n 
1 65  GLU n 
1 66  THR n 
1 67  THR n 
1 68  GLN n 
1 69  ALA n 
1 70  MET n 
1 71  ALA n 
1 72  PHE n 
1 73  ASP n 
1 74  GLY n 
1 75  ILE n 
1 76  ILE n 
1 77  PHE n 
1 78  GLN n 
1 79  GLY n 
1 80  GLN n 
1 81  SER n 
1 82  LEU n 
1 83  LYS n 
1 84  ILE n 
1 85  ARG n 
1 86  ARG n 
1 87  PRO n 
1 88  HIS n 
1 89  ASP n 
1 90  TYR n 
1 91  GLN n 
1 92  PRO n 
1 93  LEU n 
1 94  PRO n 
1 95  GLY n 
1 96  ALA n 
1 97  HIS n 
1 98  LYS n 
1 99  LEU n 
1 100 PHE n 
1 101 ILE n 
1 102 GLY n 
1 103 GLY n 
1 104 LEU n 
1 105 PRO n 
1 106 ASN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASN n 
1 110 ASP n 
1 111 ASP n 
1 112 GLN n 
1 113 VAL n 
1 114 LYS n 
1 115 GLU n 
1 116 LEU n 
1 117 LEU n 
1 118 THR n 
1 119 SER n 
1 120 PHE n 
1 121 GLY n 
1 122 PRO n 
1 123 LEU n 
1 124 LYS n 
1 125 ALA n 
1 126 PHE n 
1 127 ASN n 
1 128 LEU n 
1 129 VAL n 
1 130 LYS n 
1 131 ASP n 
1 132 SER n 
1 133 ALA n 
1 134 THR n 
1 135 GLY n 
1 136 LEU n 
1 137 SER n 
1 138 LYS n 
1 139 GLY n 
1 140 TYR n 
1 141 ALA n 
1 142 PHE n 
1 143 CYS n 
1 144 GLU n 
1 145 TYR n 
1 146 VAL n 
1 147 ASP n 
1 148 ILE n 
1 149 ASN n 
1 150 VAL n 
1 151 THR n 
1 152 ASP n 
1 153 GLN n 
1 154 ALA n 
1 155 ILE n 
1 156 ALA n 
1 157 GLY n 
1 158 LEU n 
1 159 ASN n 
1 160 GLY n 
1 161 MET n 
1 162 GLN n 
1 163 LEU n 
1 164 GLY n 
1 165 ASP n 
1 166 LYS n 
1 167 LYS n 
1 168 LEU n 
1 169 LEU n 
1 170 VAL n 
1 171 GLN n 
1 172 ARG n 
1 173 ALA n 
1 174 SER n 
2 1   DU  n 
2 2   DC  n 
2 3   BRU n 
2 4   DU  n 
2 5   DU  n 
2 6   DU  n 
2 7   DU  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 6  95  human ? 'U2AF2, U2AF65' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
BL21 ? ? ? ? ? ? ? plasmid ? ? ? PGEX-6P ? ? 
1 2 sample ? 96 174 human ? 'U2AF2, U2AF65' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
BL21 ? ? ? ? ? ? ? plasmid ? ? ? PGEX-6P ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                DNA 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP U2AF2_HUMAN P26368 1 
;ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIR
RPHDYQPLPG
;
148 ? 
2 UNP U2AF2_HUMAN P26368 1 AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS               258 ? 
3 PDB 3VAG        3VAG   2 UCUUUUU                                                                                       1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VAG A 6  ? 95  ? P26368 148 ? 237 ? 148 237 
2 2 3VAG A 96 ? 174 ? P26368 258 ? 336 ? 258 336 
3 1 3VAG B 6  ? 95  ? P26368 148 ? 237 ? 148 237 
4 2 3VAG B 96 ? 174 ? P26368 258 ? 336 ? 258 336 
5 3 3VAG P 1  ? 7   ? 3VAG   1   ? 7   ? 1   7   
6 3 3VAG E 1  ? 7   ? 3VAG   2   ? 8   ? 2   8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VAG GLY A 1 ? UNP P26368 ? ? 'EXPRESSION TAG' 143 1  
1 3VAG PRO A 2 ? UNP P26368 ? ? 'EXPRESSION TAG' 144 2  
1 3VAG LEU A 3 ? UNP P26368 ? ? 'EXPRESSION TAG' 145 3  
1 3VAG GLY A 4 ? UNP P26368 ? ? 'EXPRESSION TAG' 146 4  
1 3VAG SER A 5 ? UNP P26368 ? ? 'EXPRESSION TAG' 147 5  
3 3VAG GLY B 1 ? UNP P26368 ? ? 'EXPRESSION TAG' 143 6  
3 3VAG PRO B 2 ? UNP P26368 ? ? 'EXPRESSION TAG' 144 7  
3 3VAG LEU B 3 ? UNP P26368 ? ? 'EXPRESSION TAG' 145 8  
3 3VAG GLY B 4 ? UNP P26368 ? ? 'EXPRESSION TAG' 146 9  
3 3VAG SER B 5 ? UNP P26368 ? ? 'EXPRESSION TAG' 147 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?                               'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                               'C4 H7 N O4'        
133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"     ?                               'C9 H12 Br N2 O8 P' 
387.078 
CPQ non-polymer         . 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' DEOXY-BIGCHAP                   'C42 H75 N3 O15'    
862.056 
CYS 'L-peptide linking' y CYSTEINE                                       ?                               'C3 H7 N O2 S'      
121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"            ?                               'C9 H14 N3 O7 P'    
307.197 
DIO non-polymer         . '1,4-DIETHYLENE DIOXIDE'                       ?                               'C4 H8 O2'          
88.105  
DU  'DNA linking'       y "2'-DEOXYURIDINE-5'-MONOPHOSPHATE"             ?                               'C9 H13 N2 O8 P'    
308.182 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                               'C2 H5 N O2'        
75.067  
GOL non-polymer         . GLYCEROL                                       'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          
92.094  
HIS 'L-peptide linking' y HISTIDINE                                      ?                               'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                          ?                               'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                               'C5 H11 N O2 S'     
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                         ?                               'C3 H7 N O3'        
105.093 
SO4 non-polymer         . 'SULFATE ION'                                  ?                               'O4 S -2'           
96.063  
THR 'L-peptide linking' y THREONINE                                      ?                               'C4 H9 N O3'        
119.119 
TYR 'L-peptide linking' y TYROSINE                                       ?                               'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                         ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.entry_id          3VAG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'1.6M Ammonium sulfate, 10% Dioxane, 0.1M MES pH 6.5, Deoxy-Big Chap, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-06-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.987 
# 
_reflns.entry_id                     3VAG 
_reflns.observed_criterion_sigma_I   -1.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.19 
_reflns.number_obs                   26702 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.098 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.19 2.27  94.6  0.441 ? ? 4.0 ? 2473 ? ? ? ? 1  1 
2.27 2.36  99.1  0.403 ? ? 4.9 ? 2666 ? ? ? ? 2  1 
2.36 2.47  99.8  0.316 ? ? 5.3 ? 2645 ? ? ? ? 3  1 
2.47 2.60  100.0 0.254 ? ? 5.5 ? 2663 ? ? ? ? 4  1 
2.60 2.76  100.0 0.197 ? ? 5.6 ? 2671 ? ? ? ? 5  1 
2.76 2.97  100.0 0.150 ? ? 5.6 ? 2669 ? ? ? ? 6  1 
2.97 3.27  100.0 0.111 ? ? 5.7 ? 2706 ? ? ? ? 7  1 
3.27 3.74  100.0 0.090 ? ? 5.6 ? 2700 ? ? ? ? 8  1 
3.74 4.72  99.9  0.077 ? ? 5.6 ? 2722 ? ? ? ? 9  1 
4.72 50.00 99.3  0.070 ? ? 5.4 ? 2787 ? ? ? ? 10 1 
# 
_refine.entry_id                                 3VAG 
_refine.ls_number_reflns_obs                     23012 
_refine.ls_number_reflns_all                     25547 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.88 
_refine.ls_d_res_high                            2.19 
_refine.ls_percent_reflns_obs                    95.41 
_refine.ls_R_factor_obs                          0.19525 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19130 
_refine.ls_R_factor_R_free                       0.23221 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2535 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.B_iso_mean                               41.296 
_refine.aniso_B[1][1]                            -1.24 
_refine.aniso_B[2][2]                            -0.46 
_refine.aniso_B[3][3]                            2.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.79 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.246 
_refine.pdbx_overall_ESU_R_Free                  0.199 
_refine.overall_SU_ML                            0.134 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.951 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2686 
_refine_hist.pdbx_number_atoms_nucleic_acid   224 
_refine_hist.pdbx_number_atoms_ligand         110 
_refine_hist.number_atoms_solvent             156 
_refine_hist.number_atoms_total               3176 
_refine_hist.d_res_high                       2.19 
_refine_hist.d_res_low                        41.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.022  ? 3107 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 2077 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.207  2.093  ? 4236 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.891  3.000  ? 5078 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.190  5.000  ? 350  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.081 24.885 ? 131  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.150 15.000 ? 462  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       11.511 15.000 ? 14   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.066  0.200  ? 459  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.003  0.020  ? 3242 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.001  0.020  ? 562  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                0.177  0.200  ? 433  ? 'X-RAY DIFFRACTION' 
r_nbd_other                  0.177  0.200  ? 1949 ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              0.174  0.200  ? 1403 ? 'X-RAY DIFFRACTION' 
r_nbtor_other                0.079  0.200  ? 1486 ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        0.159  0.200  ? 93   ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       0.192  0.200  ? 13   ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         0.278  0.200  ? 30   ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     0.110  0.200  ? 6    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.610  1.500  ? 2232 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               0.082  1.500  ? 715  ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 0.687  2.000  ? 2766 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.204  3.000  ? 1611 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 1.950  4.500  ? 1469 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.190 
_refine_ls_shell.d_res_low                        2.247 
_refine_ls_shell.number_reflns_R_work             1474 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               84.98 
_refine_ls_shell.R_factor_R_free                  0.280 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             173 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3VAG 
_struct.title                     'Structure of U2AF65 variant with BrU3C2 DNA' 
_struct.pdbx_descriptor           'Splicing factor U2AF 65 kDa subunit/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VAG 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'RNA SPLICING FACTOR, RNA RECOGNITION MOTIF, RNA BINDING PROTEIN, RNA BINDING PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 6 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 5 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
X N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 19  ? GLY A 34  ? THR A 161 GLY A 176 1 ? 16 
HELX_P HELX_P2  2  SER A 62  ? ALA A 69  ? SER A 204 ALA A 211 1 ? 8  
HELX_P HELX_P3  3  MET A 70  ? ASP A 73  ? MET A 212 ASP A 215 5 ? 4  
HELX_P HELX_P4  4  ASN A 109 ? SER A 119 ? ASN A 271 SER A 281 1 ? 11 
HELX_P HELX_P5  5  ASN A 149 ? ASN A 159 ? ASN A 311 ASN A 321 1 ? 11 
HELX_P HELX_P6  6  GLY B 1   ? ALA B 6   ? GLY B 143 ALA B 148 5 ? 6  
HELX_P HELX_P7  7  THR B 19  ? GLY B 35  ? THR B 161 GLY B 177 1 ? 17 
HELX_P HELX_P8  8  SER B 62  ? MET B 70  ? SER B 204 MET B 212 1 ? 9  
HELX_P HELX_P9  9  ALA B 71  ? ASP B 73  ? ALA B 213 ASP B 215 5 ? 3  
HELX_P HELX_P10 10 ASN B 109 ? THR B 118 ? ASN B 271 THR B 280 1 ? 10 
HELX_P HELX_P11 11 ASP B 147 ? ASN B 149 ? ASP B 309 ASN B 311 5 ? 3  
HELX_P HELX_P12 12 VAL B 150 ? ASN B 159 ? VAL B 312 ASN B 321 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C DC  2 "O3'" ? ? ? 1_555 C BRU 3 P ? ? P DC  2 P BRU 3 1_555 ? ? ? ? ? ? ? 1.607 ? 
covale2 covale ? ? C BRU 3 "O3'" ? ? ? 1_555 C DU  4 P ? ? P BRU 3 P DU  4 1_555 ? ? ? ? ? ? ? 1.608 ? 
covale3 covale ? ? D DC  2 "O3'" ? ? ? 1_555 D BRU 3 P ? ? E DC  3 E BRU 4 1_555 ? ? ? ? ? ? ? 1.605 ? 
covale4 covale ? ? D BRU 3 "O3'" ? ? ? 1_555 D DU  4 P ? ? E BRU 4 E DU  5 1_555 ? ? ? ? ? ? ? 1.609 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            143 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     144 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.79 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 44  ? ASN A 50  ? VAL A 186 ASN A 192 
A 2 PHE A 55  ? PHE A 60  ? PHE A 197 PHE A 202 
A 3 ARG A 8   ? GLY A 12  ? ARG A 150 GLY A 154 
A 4 LYS A 83  ? ARG A 85  ? LYS A 225 ARG A 227 
B 1 ILE A 76  ? PHE A 77  ? ILE A 218 PHE A 219 
B 2 GLN A 80  ? SER A 81  ? GLN A 222 SER A 223 
C 1 LEU A 123 ? ASP A 131 ? LEU A 285 ASP A 293 
C 2 LEU A 136 ? TYR A 145 ? LEU A 298 TYR A 307 
C 3 LEU A 99  ? GLY A 102 ? LEU A 261 GLY A 264 
C 4 LEU A 169 ? ARG A 172 ? LEU A 331 ARG A 334 
D 1 GLN A 162 ? LEU A 163 ? GLN A 324 LEU A 325 
D 2 LYS A 166 ? LYS A 167 ? LYS A 328 LYS A 329 
E 1 VAL B 44  ? ASN B 50  ? VAL B 186 ASN B 192 
E 2 PHE B 55  ? PHE B 60  ? PHE B 197 PHE B 202 
E 3 ARG B 8   ? GLY B 12  ? ARG B 150 GLY B 154 
E 4 LYS B 83  ? ARG B 85  ? LYS B 225 ARG B 227 
F 1 ILE B 76  ? PHE B 77  ? ILE B 218 PHE B 219 
F 2 GLN B 80  ? SER B 81  ? GLN B 222 SER B 223 
G 1 LEU B 123 ? ASP B 131 ? LEU B 285 ASP B 293 
G 2 LEU B 136 ? TYR B 145 ? LEU B 298 TYR B 307 
G 3 LEU B 99  ? GLY B 102 ? LEU B 261 GLY B 264 
G 4 LEU B 169 ? ARG B 172 ? LEU B 331 ARG B 334 
H 1 GLN B 162 ? LEU B 163 ? GLN B 324 LEU B 325 
H 2 LYS B 166 ? LYS B 167 ? LYS B 328 LYS B 329 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 50  ? N ASN A 192 O PHE A 55  ? O PHE A 197 
A 2 3 O ALA A 56  ? O ALA A 198 N VAL A 11  ? N VAL A 153 
A 3 4 N GLY A 12  ? N GLY A 154 O LYS A 83  ? O LYS A 225 
B 1 2 N PHE A 77  ? N PHE A 219 O GLN A 80  ? O GLN A 222 
C 1 2 N LYS A 124 ? N LYS A 286 O GLU A 144 ? O GLU A 306 
C 2 3 O CYS A 143 ? O CYS A 305 N LEU A 99  ? N LEU A 261 
C 3 4 N PHE A 100 ? N PHE A 262 O GLN A 171 ? O GLN A 333 
D 1 2 N LEU A 163 ? N LEU A 325 O LYS A 166 ? O LYS A 328 
E 1 2 N ASN B 50  ? N ASN B 192 O PHE B 55  ? O PHE B 197 
E 2 3 O ALA B 56  ? O ALA B 198 N VAL B 11  ? N VAL B 153 
E 3 4 N GLY B 12  ? N GLY B 154 O LYS B 83  ? O LYS B 225 
F 1 2 N PHE B 77  ? N PHE B 219 O GLN B 80  ? O GLN B 222 
G 1 2 N LYS B 124 ? N LYS B 286 O GLU B 144 ? O GLU B 306 
G 2 3 O ALA B 141 ? O ALA B 303 N ILE B 101 ? N ILE B 263 
G 3 4 N PHE B 100 ? N PHE B 262 O GLN B 171 ? O GLN B 333 
H 1 2 N LEU B 163 ? N LEU B 325 O LYS B 166 ? O LYS B 328 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE DIO A 401' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO A 402' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO A 403' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 404' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 405' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 406' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 407' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 408' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO B 401' 
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE DIO B 402' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO B 403' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 405' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 406' 
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 407' 
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 408' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASN A 106 ? ASN A 268 . ? 1_555 ? 
2  AC1 6 TYR A 107 ? TYR A 269 . ? 1_555 ? 
3  AC1 6 ASN A 109 ? ASN A 271 . ? 1_555 ? 
4  AC1 6 GLY A 135 ? GLY A 297 . ? 1_555 ? 
5  AC1 6 LEU A 136 ? LEU A 298 . ? 1_555 ? 
6  AC1 6 SER A 137 ? SER A 299 . ? 1_555 ? 
7  AC2 4 PRO A 2   ? PRO A 144 . ? 1_555 ? 
8  AC2 4 ALA A 6   ? ALA A 148 . ? 1_555 ? 
9  AC2 4 GLN A 91  ? GLN A 233 . ? 1_555 ? 
10 AC2 4 LEU A 163 ? LEU A 325 . ? 1_545 ? 
11 AC3 4 GLN A 38  ? GLN A 180 . ? 1_555 ? 
12 AC3 4 ALA A 39  ? ALA A 181 . ? 1_555 ? 
13 AC3 4 GLU A 65  ? GLU A 207 . ? 1_555 ? 
14 AC3 4 ALA A 156 ? ALA A 318 . ? 1_545 ? 
15 AC4 2 LYS A 83  ? LYS A 225 . ? 1_555 ? 
16 AC4 2 ARG A 85  ? ARG A 227 . ? 1_555 ? 
17 AC5 3 GLN A 48  ? GLN A 190 . ? 1_555 ? 
18 AC5 3 HOH U .   ? HOH A 527 . ? 1_555 ? 
19 AC5 3 DU  C 6   ? DU  P 6   . ? 1_555 ? 
20 AC6 6 ARG A 7   ? ARG A 149 . ? 1_555 ? 
21 AC6 6 ARG A 8   ? ARG A 150 . ? 1_555 ? 
22 AC6 6 GLU A 59  ? GLU A 201 . ? 1_555 ? 
23 AC6 6 SER A 119 ? SER A 281 . ? 1_545 ? 
24 AC6 6 HOH U .   ? HOH A 504 . ? 1_555 ? 
25 AC6 6 DU  C 7   ? DU  P 7   . ? 1_555 ? 
26 AC7 3 ARG A 86  ? ARG A 228 . ? 1_555 ? 
27 AC7 3 TYR A 90  ? TYR A 232 . ? 1_555 ? 
28 AC7 3 ILE A 148 ? ILE A 310 . ? 1_555 ? 
29 AC8 5 ILE A 49  ? ILE A 191 . ? 1_555 ? 
30 AC8 5 ASN A 50  ? ASN A 192 . ? 1_555 ? 
31 AC8 5 GLN A 51  ? GLN A 193 . ? 1_555 ? 
32 AC8 5 ASP A 52  ? ASP A 194 . ? 1_555 ? 
33 AC8 5 LYS B 167 ? LYS B 329 . ? 1_545 ? 
34 AC9 4 LEU B 123 ? LEU B 285 . ? 1_555 ? 
35 AC9 4 LYS B 124 ? LYS B 286 . ? 1_555 ? 
36 AC9 4 ALA B 125 ? ALA B 287 . ? 1_555 ? 
37 AC9 4 HOH V .   ? HOH B 543 . ? 1_555 ? 
38 BC1 2 GLY B 41  ? GLY B 183 . ? 1_555 ? 
39 BC1 2 HIS B 97  ? HIS B 259 . ? 1_545 ? 
40 BC2 4 ASN B 106 ? ASN B 268 . ? 1_555 ? 
41 BC2 4 LEU B 136 ? LEU B 298 . ? 1_555 ? 
42 BC2 4 SER B 137 ? SER B 299 . ? 1_555 ? 
43 BC2 4 HOH V .   ? HOH B 539 . ? 1_555 ? 
44 BC3 3 ARG B 7   ? ARG B 149 . ? 1_555 ? 
45 BC3 3 SER B 62  ? SER B 204 . ? 1_555 ? 
46 BC3 3 VAL B 63  ? VAL B 205 . ? 1_555 ? 
47 BC4 4 ARG A 32  ? ARG A 174 . ? 4_556 ? 
48 BC4 4 LYS B 83  ? LYS B 225 . ? 1_555 ? 
49 BC4 4 ARG B 85  ? ARG B 227 . ? 1_555 ? 
50 BC4 4 HOH X .   ? HOH E 103 . ? 1_555 ? 
51 BC5 2 ARG B 86  ? ARG B 228 . ? 1_555 ? 
52 BC5 2 HOH V .   ? HOH B 548 . ? 1_555 ? 
53 BC6 5 ALA B 39  ? ALA B 181 . ? 1_565 ? 
54 BC6 5 ILE B 155 ? ILE B 317 . ? 1_555 ? 
55 BC6 5 GLN B 171 ? GLN B 333 . ? 1_555 ? 
56 BC6 5 ARG B 172 ? ARG B 334 . ? 1_555 ? 
57 BC6 5 HOH V .   ? HOH B 506 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3VAG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3VAG 
_atom_sites.fract_transf_matrix[1][1]   0.005994 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004252 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026667 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012148 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -24.636 -19.537 19.234 1.00 51.03 ? 143 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -25.901 -19.266 19.980 1.00 51.62 ? 143 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -27.118 -19.874 19.311 1.00 53.93 ? 143 GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -26.992 -20.552 18.279 1.00 55.63 ? 143 GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? -28.315 -19.648 19.891 1.00 54.43 ? 144 PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? -28.567 -18.971 21.174 1.00 52.76 ? 144 PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? -28.013 -19.690 22.409 1.00 50.61 ? 144 PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? -27.745 -19.031 23.416 1.00 49.40 ? 144 PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? -30.104 -18.897 21.245 1.00 55.80 ? 144 PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? -30.574 -19.114 19.847 1.00 58.30 ? 144 PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? -29.573 -20.038 19.232 1.00 57.40 ? 144 PRO A CD    1 
ATOM   12   N  N     . LEU A 1 3   ? -27.827 -21.013 22.323 1.00 49.86 ? 145 LEU A N     1 
ATOM   13   C  CA    . LEU A 1 3   ? -27.383 -21.839 23.462 1.00 47.73 ? 145 LEU A CA    1 
ATOM   14   C  C     . LEU A 1 3   ? -25.945 -22.377 23.363 1.00 45.18 ? 145 LEU A C     1 
ATOM   15   O  O     . LEU A 1 3   ? -25.473 -23.087 24.261 1.00 43.86 ? 145 LEU A O     1 
ATOM   16   C  CB    . LEU A 1 3   ? -28.355 -23.008 23.652 1.00 49.65 ? 145 LEU A CB    1 
ATOM   17   C  CG    . LEU A 1 3   ? -29.760 -22.592 24.085 1.00 51.59 ? 145 LEU A CG    1 
ATOM   18   C  CD1   . LEU A 1 3   ? -30.723 -23.753 23.973 1.00 53.58 ? 145 LEU A CD1   1 
ATOM   19   C  CD2   . LEU A 1 3   ? -29.719 -22.045 25.513 1.00 50.97 ? 145 LEU A CD2   1 
ATOM   20   N  N     . GLY A 1 4   ? -25.246 -22.046 22.286 1.00 44.05 ? 146 GLY A N     1 
ATOM   21   C  CA    . GLY A 1 4   ? -23.828 -22.383 22.176 1.00 41.80 ? 146 GLY A CA    1 
ATOM   22   C  C     . GLY A 1 4   ? -22.898 -21.556 23.063 1.00 39.22 ? 146 GLY A C     1 
ATOM   23   O  O     . GLY A 1 4   ? -23.275 -20.482 23.572 1.00 38.57 ? 146 GLY A O     1 
ATOM   24   N  N     . SER A 1 5   ? -21.687 -22.091 23.249 1.00 37.00 ? 147 SER A N     1 
ATOM   25   C  CA    . SER A 1 5   ? -20.558 -21.418 23.902 1.00 34.82 ? 147 SER A CA    1 
ATOM   26   C  C     . SER A 1 5   ? -20.732 -21.161 25.405 1.00 33.29 ? 147 SER A C     1 
ATOM   27   O  O     . SER A 1 5   ? -20.032 -20.334 25.960 1.00 32.58 ? 147 SER A O     1 
ATOM   28   C  CB    . SER A 1 5   ? -20.200 -20.103 23.174 1.00 34.61 ? 147 SER A CB    1 
ATOM   29   O  OG    . SER A 1 5   ? -19.764 -20.327 21.837 1.00 34.28 ? 147 SER A OG    1 
ATOM   30   N  N     . ALA A 1 6   ? -21.616 -21.901 26.071 1.00 33.32 ? 148 ALA A N     1 
ATOM   31   C  CA    . ALA A 1 6   ? -21.920 -21.648 27.491 1.00 32.67 ? 148 ALA A CA    1 
ATOM   32   C  C     . ALA A 1 6   ? -20.898 -22.209 28.501 1.00 31.07 ? 148 ALA A C     1 
ATOM   33   O  O     . ALA A 1 6   ? -20.984 -21.904 29.680 1.00 30.30 ? 148 ALA A O     1 
ATOM   34   C  CB    . ALA A 1 6   ? -23.324 -22.174 27.819 1.00 33.84 ? 148 ALA A CB    1 
ATOM   35   N  N     . ARG A 1 7   ? -19.951 -23.029 28.041 1.00 30.51 ? 149 ARG A N     1 
ATOM   36   C  CA    . ARG A 1 7   ? -18.993 -23.697 28.918 1.00 29.93 ? 149 ARG A CA    1 
ATOM   37   C  C     . ARG A 1 7   ? -17.527 -23.435 28.514 1.00 28.53 ? 149 ARG A C     1 
ATOM   38   O  O     . ARG A 1 7   ? -16.631 -24.177 28.895 1.00 28.60 ? 149 ARG A O     1 
ATOM   39   C  CB    . ARG A 1 7   ? -19.306 -25.204 28.960 1.00 30.86 ? 149 ARG A CB    1 
ATOM   40   C  CG    . ARG A 1 7   ? -20.552 -25.523 29.788 1.00 32.78 ? 149 ARG A CG    1 
ATOM   41   C  CD    . ARG A 1 7   ? -21.124 -26.900 29.527 1.00 35.59 ? 149 ARG A CD    1 
ATOM   42   N  NE    . ARG A 1 7   ? -20.100 -27.924 29.647 1.00 38.43 ? 149 ARG A NE    1 
ATOM   43   C  CZ    . ARG A 1 7   ? -19.689 -28.737 28.677 1.00 39.10 ? 149 ARG A CZ    1 
ATOM   44   N  NH1   . ARG A 1 7   ? -20.236 -28.715 27.468 1.00 40.73 ? 149 ARG A NH1   1 
ATOM   45   N  NH2   . ARG A 1 7   ? -18.724 -29.607 28.938 1.00 40.84 ? 149 ARG A NH2   1 
ATOM   46   N  N     . ARG A 1 8   ? -17.290 -22.361 27.771 1.00 27.62 ? 150 ARG A N     1 
ATOM   47   C  CA    . ARG A 1 8   ? -15.949 -21.993 27.323 1.00 26.99 ? 150 ARG A CA    1 
ATOM   48   C  C     . ARG A 1 8   ? -15.663 -20.526 27.646 1.00 25.78 ? 150 ARG A C     1 
ATOM   49   O  O     . ARG A 1 8   ? -16.598 -19.698 27.683 1.00 25.22 ? 150 ARG A O     1 
ATOM   50   C  CB    . ARG A 1 8   ? -15.808 -22.234 25.807 1.00 27.79 ? 150 ARG A CB    1 
ATOM   51   C  CG    . ARG A 1 8   ? -15.879 -23.702 25.387 1.00 28.83 ? 150 ARG A CG    1 
ATOM   52   C  CD    . ARG A 1 8   ? -15.977 -23.852 23.861 1.00 30.98 ? 150 ARG A CD    1 
ATOM   53   N  NE    . ARG A 1 8   ? -14.782 -23.389 23.154 1.00 31.77 ? 150 ARG A NE    1 
ATOM   54   C  CZ    . ARG A 1 8   ? -13.672 -24.109 22.958 1.00 33.56 ? 150 ARG A CZ    1 
ATOM   55   N  NH1   . ARG A 1 8   ? -13.564 -25.348 23.423 1.00 34.15 ? 150 ARG A NH1   1 
ATOM   56   N  NH2   . ARG A 1 8   ? -12.647 -23.581 22.289 1.00 32.78 ? 150 ARG A NH2   1 
ATOM   57   N  N     . LEU A 1 9   ? -14.389 -20.205 27.906 1.00 24.75 ? 151 LEU A N     1 
ATOM   58   C  CA    . LEU A 1 9   ? -13.964 -18.797 28.109 1.00 24.29 ? 151 LEU A CA    1 
ATOM   59   C  C     . LEU A 1 9   ? -12.695 -18.477 27.335 1.00 23.92 ? 151 LEU A C     1 
ATOM   60   O  O     . LEU A 1 9   ? -11.816 -19.315 27.203 1.00 23.81 ? 151 LEU A O     1 
ATOM   61   C  CB    . LEU A 1 9   ? -13.721 -18.466 29.591 1.00 23.52 ? 151 LEU A CB    1 
ATOM   62   C  CG    . LEU A 1 9   ? -14.896 -18.316 30.559 1.00 23.71 ? 151 LEU A CG    1 
ATOM   63   C  CD1   . LEU A 1 9   ? -14.360 -17.973 31.965 1.00 20.64 ? 151 LEU A CD1   1 
ATOM   64   C  CD2   . LEU A 1 9   ? -15.901 -17.270 30.099 1.00 22.72 ? 151 LEU A CD2   1 
ATOM   65   N  N     . TYR A 1 10  ? -12.608 -17.244 26.849 1.00 24.27 ? 152 TYR A N     1 
ATOM   66   C  CA    . TYR A 1 10  ? -11.383 -16.718 26.236 1.00 24.75 ? 152 TYR A CA    1 
ATOM   67   C  C     . TYR A 1 10  ? -10.415 -16.207 27.316 1.00 24.75 ? 152 TYR A C     1 
ATOM   68   O  O     . TYR A 1 10  ? -10.822 -15.515 28.248 1.00 24.51 ? 152 TYR A O     1 
ATOM   69   C  CB    . TYR A 1 10  ? -11.730 -15.588 25.255 1.00 24.59 ? 152 TYR A CB    1 
ATOM   70   C  CG    . TYR A 1 10  ? -10.546 -14.788 24.711 1.00 25.13 ? 152 TYR A CG    1 
ATOM   71   C  CD1   . TYR A 1 10  ? -10.137 -13.601 25.322 1.00 26.08 ? 152 TYR A CD1   1 
ATOM   72   C  CD2   . TYR A 1 10  ? -9.864  -15.203 23.578 1.00 25.64 ? 152 TYR A CD2   1 
ATOM   73   C  CE1   . TYR A 1 10  ? -9.060  -12.856 24.822 1.00 25.91 ? 152 TYR A CE1   1 
ATOM   74   C  CE2   . TYR A 1 10  ? -8.800  -14.472 23.066 1.00 25.93 ? 152 TYR A CE2   1 
ATOM   75   C  CZ    . TYR A 1 10  ? -8.405  -13.304 23.681 1.00 25.99 ? 152 TYR A CZ    1 
ATOM   76   O  OH    . TYR A 1 10  ? -7.347  -12.598 23.160 1.00 25.99 ? 152 TYR A OH    1 
ATOM   77   N  N     . VAL A 1 11  ? -9.132  -16.542 27.165 1.00 25.78 ? 153 VAL A N     1 
ATOM   78   C  CA    . VAL A 1 11  ? -8.082  -16.021 28.044 1.00 26.19 ? 153 VAL A CA    1 
ATOM   79   C  C     . VAL A 1 11  ? -6.940  -15.401 27.230 1.00 26.95 ? 153 VAL A C     1 
ATOM   80   O  O     . VAL A 1 11  ? -6.243  -16.102 26.516 1.00 27.18 ? 153 VAL A O     1 
ATOM   81   C  CB    . VAL A 1 11  ? -7.522  -17.121 28.974 1.00 26.58 ? 153 VAL A CB    1 
ATOM   82   C  CG1   . VAL A 1 11  ? -6.503  -16.522 29.953 1.00 25.66 ? 153 VAL A CG1   1 
ATOM   83   C  CG2   . VAL A 1 11  ? -8.669  -17.804 29.726 1.00 24.91 ? 153 VAL A CG2   1 
ATOM   84   N  N     . GLY A 1 12  ? -6.761  -14.088 27.358 1.00 27.34 ? 154 GLY A N     1 
ATOM   85   C  CA    . GLY A 1 12  ? -5.674  -13.366 26.662 1.00 28.81 ? 154 GLY A CA    1 
ATOM   86   C  C     . GLY A 1 12  ? -4.531  -12.912 27.551 1.00 29.67 ? 154 GLY A C     1 
ATOM   87   O  O     . GLY A 1 12  ? -4.658  -12.869 28.774 1.00 29.46 ? 154 GLY A O     1 
ATOM   88   N  N     . ASN A 1 13  ? -3.410  -12.585 26.916 1.00 31.70 ? 155 ASN A N     1 
ATOM   89   C  CA    . ASN A 1 13  ? -2.190  -12.117 27.586 1.00 33.47 ? 155 ASN A CA    1 
ATOM   90   C  C     . ASN A 1 13  ? -1.512  -13.217 28.401 1.00 34.52 ? 155 ASN A C     1 
ATOM   91   O  O     . ASN A 1 13  ? -0.965  -12.947 29.468 1.00 35.17 ? 155 ASN A O     1 
ATOM   92   C  CB    . ASN A 1 13  ? -2.490  -10.898 28.474 1.00 33.35 ? 155 ASN A CB    1 
ATOM   93   C  CG    . ASN A 1 13  ? -1.260  -10.029 28.731 1.00 35.17 ? 155 ASN A CG    1 
ATOM   94   O  OD1   . ASN A 1 13  ? -0.363  -9.945  27.900 1.00 36.34 ? 155 ASN A OD1   1 
ATOM   95   N  ND2   . ASN A 1 13  ? -1.229  -9.373  29.883 1.00 32.97 ? 155 ASN A ND2   1 
ATOM   96   N  N     . ILE A 1 14  ? -1.554  -14.453 27.901 1.00 35.09 ? 156 ILE A N     1 
ATOM   97   C  CA    . ILE A 1 14  ? -0.966  -15.586 28.618 1.00 36.18 ? 156 ILE A CA    1 
ATOM   98   C  C     . ILE A 1 14  ? 0.556   -15.504 28.537 1.00 39.11 ? 156 ILE A C     1 
ATOM   99   O  O     . ILE A 1 14  ? 1.090   -15.032 27.528 1.00 40.28 ? 156 ILE A O     1 
ATOM   100  C  CB    . ILE A 1 14  ? -1.460  -16.975 28.103 1.00 35.84 ? 156 ILE A CB    1 
ATOM   101  C  CG1   . ILE A 1 14  ? -1.025  -17.244 26.655 1.00 37.13 ? 156 ILE A CG1   1 
ATOM   102  C  CG2   . ILE A 1 14  ? -2.984  -17.098 28.234 1.00 33.77 ? 156 ILE A CG2   1 
ATOM   103  C  CD1   . ILE A 1 14  ? -1.378  -18.630 26.149 1.00 35.97 ? 156 ILE A CD1   1 
ATOM   104  N  N     . PRO A 1 15  ? 1.256   -15.968 29.591 1.00 40.63 ? 157 PRO A N     1 
ATOM   105  C  CA    . PRO A 1 15  ? 2.717   -15.935 29.615 1.00 43.76 ? 157 PRO A CA    1 
ATOM   106  C  C     . PRO A 1 15  ? 3.370   -16.835 28.563 1.00 45.81 ? 157 PRO A C     1 
ATOM   107  O  O     . PRO A 1 15  ? 2.898   -17.939 28.309 1.00 45.76 ? 157 PRO A O     1 
ATOM   108  C  CB    . PRO A 1 15  ? 3.067   -16.392 31.042 1.00 44.22 ? 157 PRO A CB    1 
ATOM   109  C  CG    . PRO A 1 15  ? 1.910   -17.079 31.544 1.00 42.18 ? 157 PRO A CG    1 
ATOM   110  C  CD    . PRO A 1 15  ? 0.702   -16.534 30.833 1.00 40.20 ? 157 PRO A CD    1 
ATOM   111  N  N     . PHE A 1 16  ? 4.448   -16.347 27.959 1.00 48.57 ? 158 PHE A N     1 
ATOM   112  C  CA    . PHE A 1 16  ? 5.100   -17.037 26.845 1.00 50.42 ? 158 PHE A CA    1 
ATOM   113  C  C     . PHE A 1 16  ? 5.720   -18.383 27.261 1.00 52.42 ? 158 PHE A C     1 
ATOM   114  O  O     . PHE A 1 16  ? 6.379   -18.477 28.303 1.00 53.66 ? 158 PHE A O     1 
ATOM   115  C  CB    . PHE A 1 16  ? 6.168   -16.131 26.219 1.00 53.49 ? 158 PHE A CB    1 
ATOM   116  C  CG    . PHE A 1 16  ? 6.948   -16.795 25.116 1.00 55.64 ? 158 PHE A CG    1 
ATOM   117  C  CD1   . PHE A 1 16  ? 8.310   -17.017 25.246 1.00 60.00 ? 158 PHE A CD1   1 
ATOM   118  C  CD2   . PHE A 1 16  ? 6.301   -17.231 23.962 1.00 56.28 ? 158 PHE A CD2   1 
ATOM   119  C  CE1   . PHE A 1 16  ? 9.029   -17.648 24.232 1.00 63.10 ? 158 PHE A CE1   1 
ATOM   120  C  CE2   . PHE A 1 16  ? 7.006   -17.860 22.940 1.00 58.47 ? 158 PHE A CE2   1 
ATOM   121  C  CZ    . PHE A 1 16  ? 8.370   -18.071 23.073 1.00 62.10 ? 158 PHE A CZ    1 
ATOM   122  N  N     . GLY A 1 17  ? 5.496   -19.413 26.441 1.00 52.47 ? 159 GLY A N     1 
ATOM   123  C  CA    . GLY A 1 17  ? 6.002   -20.761 26.707 1.00 54.42 ? 159 GLY A CA    1 
ATOM   124  C  C     . GLY A 1 17  ? 5.174   -21.604 27.671 1.00 53.10 ? 159 GLY A C     1 
ATOM   125  O  O     . GLY A 1 17  ? 5.514   -22.763 27.928 1.00 55.10 ? 159 GLY A O     1 
ATOM   126  N  N     . ILE A 1 18  ? 4.092   -21.037 28.205 1.00 50.09 ? 160 ILE A N     1 
ATOM   127  C  CA    . ILE A 1 18  ? 3.237   -21.737 29.165 1.00 48.42 ? 160 ILE A CA    1 
ATOM   128  C  C     . ILE A 1 18  ? 2.568   -22.934 28.481 1.00 48.06 ? 160 ILE A C     1 
ATOM   129  O  O     . ILE A 1 18  ? 2.172   -22.839 27.321 1.00 47.66 ? 160 ILE A O     1 
ATOM   130  C  CB    . ILE A 1 18  ? 2.175   -20.773 29.778 1.00 45.90 ? 160 ILE A CB    1 
ATOM   131  C  CG1   . ILE A 1 18  ? 1.525   -21.378 31.031 1.00 45.63 ? 160 ILE A CG1   1 
ATOM   132  C  CG2   . ILE A 1 18  ? 1.114   -20.376 28.744 1.00 43.68 ? 160 ILE A CG2   1 
ATOM   133  C  CD1   . ILE A 1 18  ? 2.455   -21.412 32.237 1.00 48.42 ? 160 ILE A CD1   1 
ATOM   134  N  N     . THR A 1 19  ? 2.486   -24.063 29.189 1.00 48.37 ? 161 THR A N     1 
ATOM   135  C  CA    . THR A 1 19  ? 1.874   -25.281 28.655 1.00 48.34 ? 161 THR A CA    1 
ATOM   136  C  C     . THR A 1 19  ? 0.389   -25.364 29.024 1.00 45.53 ? 161 THR A C     1 
ATOM   137  O  O     . THR A 1 19  ? -0.068  -24.728 29.980 1.00 43.29 ? 161 THR A O     1 
ATOM   138  C  CB    . THR A 1 19  ? 2.552   -26.553 29.196 1.00 50.76 ? 161 THR A CB    1 
ATOM   139  O  OG1   . THR A 1 19  ? 2.250   -26.701 30.589 1.00 49.35 ? 161 THR A OG1   1 
ATOM   140  C  CG2   . THR A 1 19  ? 4.077   -26.516 28.986 1.00 54.04 ? 161 THR A CG2   1 
ATOM   141  N  N     . GLU A 1 20  ? -0.347  -26.173 28.270 1.00 45.42 ? 162 GLU A N     1 
ATOM   142  C  CA    . GLU A 1 20  ? -1.778  -26.376 28.515 1.00 43.98 ? 162 GLU A CA    1 
ATOM   143  C  C     . GLU A 1 20  ? -2.020  -26.987 29.909 1.00 43.90 ? 162 GLU A C     1 
ATOM   144  O  O     . GLU A 1 20  ? -2.949  -26.594 30.609 1.00 41.93 ? 162 GLU A O     1 
ATOM   145  C  CB    . GLU A 1 20  ? -2.396  -27.221 27.383 1.00 44.37 ? 162 GLU A CB    1 
ATOM   146  C  CG    . GLU A 1 20  ? -2.475  -26.437 26.050 1.00 44.67 ? 162 GLU A CG    1 
ATOM   147  C  CD    . GLU A 1 20  ? -2.806  -27.278 24.808 1.00 46.07 ? 162 GLU A CD    1 
ATOM   148  O  OE1   . GLU A 1 20  ? -2.788  -28.532 24.879 1.00 49.87 ? 162 GLU A OE1   1 
ATOM   149  O  OE2   . GLU A 1 20  ? -3.084  -26.663 23.745 1.00 45.08 ? 162 GLU A OE2   1 
ATOM   150  N  N     . GLU A 1 21  ? -1.146  -27.907 30.304 1.00 46.46 ? 163 GLU A N     1 
ATOM   151  C  CA    . GLU A 1 21  ? -1.163  -28.546 31.623 1.00 47.38 ? 163 GLU A CA    1 
ATOM   152  C  C     . GLU A 1 21  ? -1.005  -27.544 32.780 1.00 46.25 ? 163 GLU A C     1 
ATOM   153  O  O     . GLU A 1 21  ? -1.780  -27.574 33.740 1.00 44.91 ? 163 GLU A O     1 
ATOM   154  C  CB    . GLU A 1 21  ? -0.046  -29.603 31.679 1.00 50.77 ? 163 GLU A CB    1 
ATOM   155  C  CG    . GLU A 1 21  ? -0.048  -30.514 32.906 1.00 52.44 ? 163 GLU A CG    1 
ATOM   156  C  CD    . GLU A 1 21  ? 0.974   -31.656 32.809 1.00 57.09 ? 163 GLU A CD    1 
ATOM   157  O  OE1   . GLU A 1 21  ? 1.289   -32.104 31.678 1.00 60.76 ? 163 GLU A OE1   1 
ATOM   158  O  OE2   . GLU A 1 21  ? 1.460   -32.121 33.870 1.00 61.43 ? 163 GLU A OE2   1 
ATOM   159  N  N     . ALA A 1 22  ? -0.011  -26.661 32.678 1.00 46.83 ? 164 ALA A N     1 
ATOM   160  C  CA    . ALA A 1 22  ? 0.289   -25.677 33.727 1.00 46.44 ? 164 ALA A CA    1 
ATOM   161  C  C     . ALA A 1 22  ? -0.814  -24.633 33.890 1.00 43.73 ? 164 ALA A C     1 
ATOM   162  O  O     . ALA A 1 22  ? -1.100  -24.184 35.004 1.00 42.73 ? 164 ALA A O     1 
ATOM   163  C  CB    . ALA A 1 22  ? 1.628   -24.987 33.445 1.00 48.03 ? 164 ALA A CB    1 
ATOM   164  N  N     . MET A 1 23  ? -1.423  -24.241 32.778 1.00 42.75 ? 165 MET A N     1 
ATOM   165  C  CA    . MET A 1 23  ? -2.541  -23.308 32.807 1.00 40.76 ? 165 MET A CA    1 
ATOM   166  C  C     . MET A 1 23  ? -3.785  -23.930 33.453 1.00 38.85 ? 165 MET A C     1 
ATOM   167  O  O     . MET A 1 23  ? -4.466  -23.286 34.238 1.00 37.09 ? 165 MET A O     1 
ATOM   168  C  CB    . MET A 1 23  ? -2.866  -22.845 31.389 1.00 40.22 ? 165 MET A CB    1 
ATOM   169  C  CG    . MET A 1 23  ? -4.068  -21.923 31.308 1.00 39.13 ? 165 MET A CG    1 
ATOM   170  S  SD    . MET A 1 23  ? -3.795  -20.585 30.141 1.00 42.58 ? 165 MET A SD    1 
ATOM   171  C  CE    . MET A 1 23  ? -2.531  -19.651 31.013 1.00 41.96 ? 165 MET A CE    1 
ATOM   172  N  N     . MET A 1 24  ? -4.064  -25.182 33.108 1.00 38.95 ? 166 MET A N     1 
ATOM   173  C  CA    . MET A 1 24  ? -5.159  -25.953 33.701 1.00 38.32 ? 166 MET A CA    1 
ATOM   174  C  C     . MET A 1 24  ? -4.989  -26.112 35.218 1.00 38.05 ? 166 MET A C     1 
ATOM   175  O  O     . MET A 1 24  ? -5.951  -25.981 35.975 1.00 36.74 ? 166 MET A O     1 
ATOM   176  C  CB    . MET A 1 24  ? -5.211  -27.340 33.047 1.00 39.58 ? 166 MET A CB    1 
ATOM   177  C  CG    . MET A 1 24  ? -6.430  -28.172 33.368 1.00 39.38 ? 166 MET A CG    1 
ATOM   178  S  SD    . MET A 1 24  ? -6.484  -29.657 32.332 1.00 43.04 ? 166 MET A SD    1 
ATOM   179  C  CE    . MET A 1 24  ? -5.004  -30.504 32.870 1.00 46.05 ? 166 MET A CE    1 
ATOM   180  N  N     . ASP A 1 25  ? -3.764  -26.412 35.642 1.00 39.21 ? 167 ASP A N     1 
ATOM   181  C  CA    . ASP A 1 25  ? -3.432  -26.562 37.057 1.00 40.00 ? 167 ASP A CA    1 
ATOM   182  C  C     . ASP A 1 25  ? -3.601  -25.244 37.815 1.00 38.26 ? 167 ASP A C     1 
ATOM   183  O  O     . ASP A 1 25  ? -4.089  -25.237 38.945 1.00 37.55 ? 167 ASP A O     1 
ATOM   184  C  CB    . ASP A 1 25  ? -1.986  -27.053 37.229 1.00 42.77 ? 167 ASP A CB    1 
ATOM   185  C  CG    . ASP A 1 25  ? -1.787  -28.510 36.811 1.00 45.84 ? 167 ASP A CG    1 
ATOM   186  O  OD1   . ASP A 1 25  ? -2.765  -29.209 36.458 1.00 46.24 ? 167 ASP A OD1   1 
ATOM   187  O  OD2   . ASP A 1 25  ? -0.620  -28.959 36.843 1.00 50.01 ? 167 ASP A OD2   1 
ATOM   188  N  N     . PHE A 1 26  ? -3.179  -24.139 37.197 1.00 37.26 ? 168 PHE A N     1 
ATOM   189  C  CA    . PHE A 1 26  ? -3.335  -22.808 37.797 1.00 36.24 ? 168 PHE A CA    1 
ATOM   190  C  C     . PHE A 1 26  ? -4.798  -22.478 38.052 1.00 33.91 ? 168 PHE A C     1 
ATOM   191  O  O     . PHE A 1 26  ? -5.173  -22.099 39.162 1.00 32.96 ? 168 PHE A O     1 
ATOM   192  C  CB    . PHE A 1 26  ? -2.736  -21.723 36.900 1.00 36.34 ? 168 PHE A CB    1 
ATOM   193  C  CG    . PHE A 1 26  ? -2.844  -20.335 37.472 1.00 35.68 ? 168 PHE A CG    1 
ATOM   194  C  CD1   . PHE A 1 26  ? -2.086  -19.966 38.580 1.00 37.84 ? 168 PHE A CD1   1 
ATOM   195  C  CD2   . PHE A 1 26  ? -3.696  -19.399 36.902 1.00 34.59 ? 168 PHE A CD2   1 
ATOM   196  C  CE1   . PHE A 1 26  ? -2.180  -18.675 39.117 1.00 37.71 ? 168 PHE A CE1   1 
ATOM   197  C  CE2   . PHE A 1 26  ? -3.796  -18.111 37.425 1.00 35.08 ? 168 PHE A CE2   1 
ATOM   198  C  CZ    . PHE A 1 26  ? -3.041  -17.752 38.540 1.00 36.07 ? 168 PHE A CZ    1 
ATOM   199  N  N     . PHE A 1 27  ? -5.616  -22.621 37.014 1.00 32.53 ? 169 PHE A N     1 
ATOM   200  C  CA    . PHE A 1 27  ? -7.035  -22.266 37.096 1.00 31.19 ? 169 PHE A CA    1 
ATOM   201  C  C     . PHE A 1 27  ? -7.839  -23.155 38.041 1.00 30.98 ? 169 PHE A C     1 
ATOM   202  O  O     . PHE A 1 27  ? -8.708  -22.667 38.763 1.00 30.74 ? 169 PHE A O     1 
ATOM   203  C  CB    . PHE A 1 27  ? -7.671  -22.224 35.704 1.00 31.25 ? 169 PHE A CB    1 
ATOM   204  C  CG    . PHE A 1 27  ? -7.540  -20.891 35.047 1.00 31.27 ? 169 PHE A CG    1 
ATOM   205  C  CD1   . PHE A 1 27  ? -8.452  -19.883 35.327 1.00 32.24 ? 169 PHE A CD1   1 
ATOM   206  C  CD2   . PHE A 1 27  ? -6.472  -20.614 34.202 1.00 33.10 ? 169 PHE A CD2   1 
ATOM   207  C  CE1   . PHE A 1 27  ? -8.331  -18.631 34.736 1.00 31.89 ? 169 PHE A CE1   1 
ATOM   208  C  CE2   . PHE A 1 27  ? -6.336  -19.366 33.610 1.00 32.16 ? 169 PHE A CE2   1 
ATOM   209  C  CZ    . PHE A 1 27  ? -7.256  -18.368 33.883 1.00 31.56 ? 169 PHE A CZ    1 
ATOM   210  N  N     . ASN A 1 28  ? -7.537  -24.445 38.053 1.00 31.12 ? 170 ASN A N     1 
ATOM   211  C  CA    . ASN A 1 28  ? -8.190  -25.353 38.972 1.00 31.75 ? 170 ASN A CA    1 
ATOM   212  C  C     . ASN A 1 28  ? -7.850  -25.036 40.442 1.00 32.70 ? 170 ASN A C     1 
ATOM   213  O  O     . ASN A 1 28  ? -8.737  -25.078 41.294 1.00 32.55 ? 170 ASN A O     1 
ATOM   214  C  CB    . ASN A 1 28  ? -7.887  -26.811 38.587 1.00 32.80 ? 170 ASN A CB    1 
ATOM   215  C  CG    . ASN A 1 28  ? -8.814  -27.319 37.475 1.00 31.35 ? 170 ASN A CG    1 
ATOM   216  O  OD1   . ASN A 1 28  ? -9.964  -26.885 37.374 1.00 28.43 ? 170 ASN A OD1   1 
ATOM   217  N  ND2   . ASN A 1 28  ? -8.321  -28.235 36.649 1.00 28.81 ? 170 ASN A ND2   1 
ATOM   218  N  N     . ALA A 1 29  ? -6.598  -24.649 40.713 1.00 33.39 ? 171 ALA A N     1 
ATOM   219  C  CA    . ALA A 1 29  ? -6.169  -24.266 42.063 1.00 34.43 ? 171 ALA A CA    1 
ATOM   220  C  C     . ALA A 1 29  ? -6.826  -22.962 42.537 1.00 33.44 ? 171 ALA A C     1 
ATOM   221  O  O     . ALA A 1 29  ? -7.252  -22.865 43.687 1.00 33.43 ? 171 ALA A O     1 
ATOM   222  C  CB    . ALA A 1 29  ? -4.652  -24.149 42.127 1.00 35.90 ? 171 ALA A CB    1 
ATOM   223  N  N     . GLN A 1 30  ? -6.893  -21.962 41.659 1.00 32.68 ? 172 GLN A N     1 
ATOM   224  C  CA    . GLN A 1 30  ? -7.580  -20.705 41.968 1.00 32.34 ? 172 GLN A CA    1 
ATOM   225  C  C     . GLN A 1 30  ? -9.093  -20.858 42.238 1.00 31.58 ? 172 GLN A C     1 
ATOM   226  O  O     . GLN A 1 30  ? -9.622  -20.228 43.151 1.00 31.78 ? 172 GLN A O     1 
ATOM   227  C  CB    . GLN A 1 30  ? -7.359  -19.672 40.852 1.00 31.71 ? 172 GLN A CB    1 
ATOM   228  C  CG    . GLN A 1 30  ? -5.935  -19.107 40.755 1.00 33.41 ? 172 GLN A CG    1 
ATOM   229  C  CD    . GLN A 1 30  ? -5.470  -18.411 42.026 1.00 36.16 ? 172 GLN A CD    1 
ATOM   230  O  OE1   . GLN A 1 30  ? -6.267  -18.110 42.920 1.00 37.56 ? 172 GLN A OE1   1 
ATOM   231  N  NE2   . GLN A 1 30  ? -4.174  -18.161 42.114 1.00 36.96 ? 172 GLN A NE2   1 
ATOM   232  N  N     . MET A 1 31  ? -9.788  -21.676 41.448 1.00 31.20 ? 173 MET A N     1 
ATOM   233  C  CA    . MET A 1 31  ? -11.200 -21.972 41.706 1.00 31.08 ? 173 MET A CA    1 
ATOM   234  C  C     . MET A 1 31  ? -11.416 -22.498 43.143 1.00 32.35 ? 173 MET A C     1 
ATOM   235  O  O     . MET A 1 31  ? -12.370 -22.092 43.813 1.00 32.15 ? 173 MET A O     1 
ATOM   236  C  CB    . MET A 1 31  ? -11.754 -22.984 40.690 1.00 31.32 ? 173 MET A CB    1 
ATOM   237  C  CG    . MET A 1 31  ? -11.893 -22.480 39.233 1.00 31.95 ? 173 MET A CG    1 
ATOM   238  S  SD    . MET A 1 31  ? -13.237 -21.289 38.979 1.00 34.99 ? 173 MET A SD    1 
ATOM   239  C  CE    . MET A 1 31  ? -14.700 -22.341 38.991 1.00 31.24 ? 173 MET A CE    1 
ATOM   240  N  N     . ARG A 1 32  ? -10.530 -23.386 43.611 1.00 33.11 ? 174 ARG A N     1 
ATOM   241  C  CA    . ARG A 1 32  ? -10.631 -23.951 44.965 1.00 34.89 ? 174 ARG A CA    1 
ATOM   242  C  C     . ARG A 1 32  ? -10.299 -22.934 46.057 1.00 35.05 ? 174 ARG A C     1 
ATOM   243  O  O     . ARG A 1 32  ? -11.083 -22.737 46.985 1.00 35.21 ? 174 ARG A O     1 
ATOM   244  C  CB    . ARG A 1 32  ? -9.724  -25.175 45.126 1.00 36.48 ? 174 ARG A CB    1 
ATOM   245  C  CG    . ARG A 1 32  ? -10.210 -26.419 44.416 1.00 38.33 ? 174 ARG A CG    1 
ATOM   246  C  CD    . ARG A 1 32  ? -9.145  -27.530 44.453 1.00 40.54 ? 174 ARG A CD    1 
ATOM   247  N  NE    . ARG A 1 32  ? -9.532  -28.679 43.636 1.00 42.37 ? 174 ARG A NE    1 
ATOM   248  C  CZ    . ARG A 1 32  ? -8.798  -29.778 43.470 1.00 45.99 ? 174 ARG A CZ    1 
ATOM   249  N  NH1   . ARG A 1 32  ? -7.612  -29.910 44.069 1.00 49.14 ? 174 ARG A NH1   1 
ATOM   250  N  NH2   . ARG A 1 32  ? -9.256  -30.764 42.704 1.00 47.60 ? 174 ARG A NH2   1 
ATOM   251  N  N     . LEU A 1 33  ? -9.134  -22.302 45.945 1.00 34.81 ? 175 LEU A N     1 
ATOM   252  C  CA    . LEU A 1 33  ? -8.702  -21.296 46.920 1.00 35.83 ? 175 LEU A CA    1 
ATOM   253  C  C     . LEU A 1 33  ? -9.658  -20.096 47.038 1.00 34.86 ? 175 LEU A C     1 
ATOM   254  O  O     . LEU A 1 33  ? -9.819  -19.541 48.121 1.00 35.87 ? 175 LEU A O     1 
ATOM   255  C  CB    . LEU A 1 33  ? -7.285  -20.806 46.598 1.00 36.20 ? 175 LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 33  ? -6.143  -21.785 46.882 1.00 37.82 ? 175 LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 33  ? -4.841  -21.219 46.333 1.00 39.76 ? 175 LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 33  ? -6.026  -22.070 48.370 1.00 40.11 ? 175 LEU A CD2   1 
ATOM   259  N  N     . GLY A 1 34  ? -10.279 -19.709 45.930 1.00 33.19 ? 176 GLY A N     1 
ATOM   260  C  CA    . GLY A 1 34  ? -11.205 -18.578 45.905 1.00 33.37 ? 176 GLY A CA    1 
ATOM   261  C  C     . GLY A 1 34  ? -12.654 -18.900 46.246 1.00 33.57 ? 176 GLY A C     1 
ATOM   262  O  O     . GLY A 1 34  ? -13.479 -17.991 46.341 1.00 33.99 ? 176 GLY A O     1 
ATOM   263  N  N     . GLY A 1 35  ? -12.965 -20.183 46.430 1.00 33.95 ? 177 GLY A N     1 
ATOM   264  C  CA    . GLY A 1 35  ? -14.310 -20.624 46.782 1.00 34.54 ? 177 GLY A CA    1 
ATOM   265  C  C     . GLY A 1 35  ? -15.324 -20.535 45.651 1.00 33.85 ? 177 GLY A C     1 
ATOM   266  O  O     . GLY A 1 35  ? -16.515 -20.363 45.906 1.00 34.49 ? 177 GLY A O     1 
ATOM   267  N  N     . LEU A 1 36  ? -14.870 -20.663 44.405 1.00 32.77 ? 178 LEU A N     1 
ATOM   268  C  CA    . LEU A 1 36  ? -15.767 -20.577 43.240 1.00 32.35 ? 178 LEU A CA    1 
ATOM   269  C  C     . LEU A 1 36  ? -16.246 -21.947 42.716 1.00 32.58 ? 178 LEU A C     1 
ATOM   270  O  O     . LEU A 1 36  ? -17.164 -22.008 41.891 1.00 32.84 ? 178 LEU A O     1 
ATOM   271  C  CB    . LEU A 1 36  ? -15.091 -19.788 42.110 1.00 31.24 ? 178 LEU A CB    1 
ATOM   272  C  CG    . LEU A 1 36  ? -14.605 -18.362 42.401 1.00 31.62 ? 178 LEU A CG    1 
ATOM   273  C  CD1   . LEU A 1 36  ? -13.944 -17.793 41.174 1.00 30.98 ? 178 LEU A CD1   1 
ATOM   274  C  CD2   . LEU A 1 36  ? -15.733 -17.440 42.874 1.00 31.37 ? 178 LEU A CD2   1 
ATOM   275  N  N     . THR A 1 37  ? -15.618 -23.032 43.174 1.00 33.32 ? 179 THR A N     1 
ATOM   276  C  CA    A THR A 1 37  ? -16.042 -24.374 42.800 0.50 33.78 ? 179 THR A CA    1 
ATOM   277  C  CA    B THR A 1 37  ? -16.037 -24.391 42.826 0.50 33.77 ? 179 THR A CA    1 
ATOM   278  C  C     . THR A 1 37  ? -17.334 -24.730 43.534 1.00 34.94 ? 179 THR A C     1 
ATOM   279  O  O     . THR A 1 37  ? -17.513 -24.389 44.713 1.00 35.71 ? 179 THR A O     1 
ATOM   280  C  CB    A THR A 1 37  ? -14.956 -25.429 43.116 0.50 34.51 ? 179 THR A CB    1 
ATOM   281  C  CB    B THR A 1 37  ? -14.994 -25.461 43.244 0.50 34.55 ? 179 THR A CB    1 
ATOM   282  O  OG1   A THR A 1 37  ? -13.685 -24.987 42.609 0.50 34.85 ? 179 THR A OG1   1 
ATOM   283  O  OG1   B THR A 1 37  ? -14.604 -25.256 44.611 0.50 35.10 ? 179 THR A OG1   1 
ATOM   284  C  CG2   A THR A 1 37  ? -15.303 -26.754 42.485 0.50 34.35 ? 179 THR A CG2   1 
ATOM   285  C  CG2   B THR A 1 37  ? -13.760 -25.397 42.353 0.50 34.33 ? 179 THR A CG2   1 
ATOM   286  N  N     . GLN A 1 38  ? -18.228 -25.410 42.822 1.00 35.18 ? 180 GLN A N     1 
ATOM   287  C  CA    . GLN A 1 38  ? -19.520 -25.812 43.361 1.00 36.80 ? 180 GLN A CA    1 
ATOM   288  C  C     . GLN A 1 38  ? -19.606 -27.321 43.615 1.00 37.33 ? 180 GLN A C     1 
ATOM   289  O  O     . GLN A 1 38  ? -20.669 -27.811 43.943 1.00 38.77 ? 180 GLN A O     1 
ATOM   290  C  CB    . GLN A 1 38  ? -20.640 -25.357 42.412 1.00 36.89 ? 180 GLN A CB    1 
ATOM   291  C  CG    . GLN A 1 38  ? -20.531 -23.867 42.029 1.00 37.35 ? 180 GLN A CG    1 
ATOM   292  C  CD    . GLN A 1 38  ? -21.729 -23.347 41.234 1.00 38.63 ? 180 GLN A CD    1 
ATOM   293  O  OE1   . GLN A 1 38  ? -22.170 -22.203 41.435 1.00 41.89 ? 180 GLN A OE1   1 
ATOM   294  N  NE2   . GLN A 1 38  ? -22.259 -24.179 40.328 1.00 41.19 ? 180 GLN A NE2   1 
ATOM   295  N  N     . ALA A 1 39  ? -18.500 -28.052 43.472 1.00 36.81 ? 181 ALA A N     1 
ATOM   296  C  CA    . ALA A 1 39  ? -18.474 -29.483 43.810 1.00 38.52 ? 181 ALA A CA    1 
ATOM   297  C  C     . ALA A 1 39  ? -17.049 -30.025 43.919 1.00 38.75 ? 181 ALA A C     1 
ATOM   298  O  O     . ALA A 1 39  ? -16.110 -29.406 43.427 1.00 37.43 ? 181 ALA A O     1 
ATOM   299  C  CB    . ALA A 1 39  ? -19.254 -30.294 42.783 1.00 38.43 ? 181 ALA A CB    1 
ATOM   300  N  N     . PRO A 1 40  ? -16.880 -31.194 44.571 1.00 40.71 ? 182 PRO A N     1 
ATOM   301  C  CA    . PRO A 1 40  ? -15.565 -31.836 44.563 1.00 41.53 ? 182 PRO A CA    1 
ATOM   302  C  C     . PRO A 1 40  ? -15.073 -32.111 43.144 1.00 41.36 ? 182 PRO A C     1 
ATOM   303  O  O     . PRO A 1 40  ? -15.867 -32.454 42.266 1.00 41.42 ? 182 PRO A O     1 
ATOM   304  C  CB    . PRO A 1 40  ? -15.818 -33.154 45.297 1.00 43.76 ? 182 PRO A CB    1 
ATOM   305  C  CG    . PRO A 1 40  ? -16.983 -32.868 46.173 1.00 44.15 ? 182 PRO A CG    1 
ATOM   306  C  CD    . PRO A 1 40  ? -17.854 -31.967 45.353 1.00 42.21 ? 182 PRO A CD    1 
ATOM   307  N  N     . GLY A 1 41  ? -13.772 -31.969 42.926 1.00 41.46 ? 183 GLY A N     1 
ATOM   308  C  CA    . GLY A 1 41  ? -13.184 -32.268 41.624 1.00 40.97 ? 183 GLY A CA    1 
ATOM   309  C  C     . GLY A 1 41  ? -12.789 -30.986 40.935 1.00 39.05 ? 183 GLY A C     1 
ATOM   310  O  O     . GLY A 1 41  ? -12.948 -29.896 41.490 1.00 38.79 ? 183 GLY A O     1 
ATOM   311  N  N     . ASN A 1 42  ? -12.278 -31.123 39.718 1.00 38.64 ? 184 ASN A N     1 
ATOM   312  C  CA    . ASN A 1 42  ? -11.750 -29.997 38.956 1.00 36.87 ? 184 ASN A CA    1 
ATOM   313  C  C     . ASN A 1 42  ? -12.806 -29.394 38.025 1.00 34.81 ? 184 ASN A C     1 
ATOM   314  O  O     . ASN A 1 42  ? -13.353 -30.110 37.189 1.00 35.20 ? 184 ASN A O     1 
ATOM   315  C  CB    . ASN A 1 42  ? -10.539 -30.457 38.130 1.00 37.84 ? 184 ASN A CB    1 
ATOM   316  C  CG    . ASN A 1 42  ? -9.294  -30.685 38.980 1.00 40.54 ? 184 ASN A CG    1 
ATOM   317  O  OD1   . ASN A 1 42  ? -9.050  -29.999 39.982 1.00 41.75 ? 184 ASN A OD1   1 
ATOM   318  N  ND2   . ASN A 1 42  ? -8.486  -31.640 38.565 1.00 44.69 ? 184 ASN A ND2   1 
ATOM   319  N  N     . PRO A 1 43  ? -13.088 -28.085 38.158 1.00 32.86 ? 185 PRO A N     1 
ATOM   320  C  CA    . PRO A 1 43  ? -13.982 -27.387 37.220 1.00 31.85 ? 185 PRO A CA    1 
ATOM   321  C  C     . PRO A 1 43  ? -13.485 -27.250 35.775 1.00 31.17 ? 185 PRO A C     1 
ATOM   322  O  O     . PRO A 1 43  ? -14.316 -27.242 34.870 1.00 30.65 ? 185 PRO A O     1 
ATOM   323  C  CB    . PRO A 1 43  ? -14.127 -25.983 37.832 1.00 30.74 ? 185 PRO A CB    1 
ATOM   324  C  CG    . PRO A 1 43  ? -13.644 -26.091 39.212 1.00 31.73 ? 185 PRO A CG    1 
ATOM   325  C  CD    . PRO A 1 43  ? -12.624 -27.177 39.224 1.00 33.14 ? 185 PRO A CD    1 
ATOM   326  N  N     . VAL A 1 44  ? -12.171 -27.104 35.564 1.00 31.12 ? 186 VAL A N     1 
ATOM   327  C  CA    . VAL A 1 44  ? -11.600 -26.974 34.211 1.00 31.09 ? 186 VAL A CA    1 
ATOM   328  C  C     . VAL A 1 44  ? -11.176 -28.350 33.690 1.00 32.57 ? 186 VAL A C     1 
ATOM   329  O  O     . VAL A 1 44  ? -10.353 -29.033 34.305 1.00 33.85 ? 186 VAL A O     1 
ATOM   330  C  CB    . VAL A 1 44  ? -10.385 -25.998 34.150 1.00 30.80 ? 186 VAL A CB    1 
ATOM   331  C  CG1   . VAL A 1 44  ? -9.825  -25.898 32.713 1.00 30.42 ? 186 VAL A CG1   1 
ATOM   332  C  CG2   . VAL A 1 44  ? -10.765 -24.607 34.646 1.00 29.01 ? 186 VAL A CG2   1 
ATOM   333  N  N     . LEU A 1 45  ? -11.751 -28.745 32.557 1.00 33.04 ? 187 LEU A N     1 
ATOM   334  C  CA    . LEU A 1 45  ? -11.546 -30.078 31.972 1.00 34.86 ? 187 LEU A CA    1 
ATOM   335  C  C     . LEU A 1 45  ? -10.433 -30.102 30.929 1.00 35.49 ? 187 LEU A C     1 
ATOM   336  O  O     . LEU A 1 45  ? -9.837  -31.151 30.684 1.00 37.50 ? 187 LEU A O     1 
ATOM   337  C  CB    . LEU A 1 45  ? -12.835 -30.574 31.294 1.00 35.12 ? 187 LEU A CB    1 
ATOM   338  C  CG    . LEU A 1 45  ? -14.094 -30.731 32.143 1.00 35.68 ? 187 LEU A CG    1 
ATOM   339  C  CD1   . LEU A 1 45  ? -15.244 -31.208 31.281 1.00 36.78 ? 187 LEU A CD1   1 
ATOM   340  C  CD2   . LEU A 1 45  ? -13.866 -31.691 33.311 1.00 37.86 ? 187 LEU A CD2   1 
ATOM   341  N  N     . ALA A 1 46  ? -10.184 -28.961 30.290 1.00 34.42 ? 188 ALA A N     1 
ATOM   342  C  CA    . ALA A 1 46  ? -9.193  -28.876 29.221 1.00 34.88 ? 188 ALA A CA    1 
ATOM   343  C  C     . ALA A 1 46  ? -8.855  -27.427 28.858 1.00 33.32 ? 188 ALA A C     1 
ATOM   344  O  O     . ALA A 1 46  ? -9.623  -26.503 29.139 1.00 31.37 ? 188 ALA A O     1 
ATOM   345  C  CB    . ALA A 1 46  ? -9.685  -29.638 27.990 1.00 36.18 ? 188 ALA A CB    1 
ATOM   346  N  N     . VAL A 1 47  ? -7.684  -27.254 28.248 1.00 34.16 ? 189 VAL A N     1 
ATOM   347  C  CA    . VAL A 1 47  ? -7.178  -25.954 27.797 1.00 33.21 ? 189 VAL A CA    1 
ATOM   348  C  C     . VAL A 1 47  ? -6.598  -26.114 26.385 1.00 34.42 ? 189 VAL A C     1 
ATOM   349  O  O     . VAL A 1 47  ? -5.909  -27.096 26.108 1.00 36.02 ? 189 VAL A O     1 
ATOM   350  C  CB    . VAL A 1 47  ? -6.073  -25.420 28.748 1.00 33.71 ? 189 VAL A CB    1 
ATOM   351  C  CG1   . VAL A 1 47  ? -5.535  -24.059 28.262 1.00 32.72 ? 189 VAL A CG1   1 
ATOM   352  C  CG2   . VAL A 1 47  ? -6.592  -25.324 30.200 1.00 31.76 ? 189 VAL A CG2   1 
ATOM   353  N  N     . GLN A 1 48  ? -6.894  -25.165 25.497 1.00 33.49 ? 190 GLN A N     1 
ATOM   354  C  CA    . GLN A 1 48  ? -6.332  -25.145 24.133 1.00 34.94 ? 190 GLN A CA    1 
ATOM   355  C  C     . GLN A 1 48  ? -5.582  -23.833 23.912 1.00 33.70 ? 190 GLN A C     1 
ATOM   356  O  O     . GLN A 1 48  ? -6.168  -22.770 24.074 1.00 31.58 ? 190 GLN A O     1 
ATOM   357  C  CB    . GLN A 1 48  ? -7.448  -25.234 23.086 1.00 35.00 ? 190 GLN A CB    1 
ATOM   358  C  CG    . GLN A 1 48  ? -8.302  -26.509 23.127 1.00 37.33 ? 190 GLN A CG    1 
ATOM   359  C  CD    . GLN A 1 48  ? -9.656  -26.333 22.429 1.00 37.31 ? 190 GLN A CD    1 
ATOM   360  O  OE1   . GLN A 1 48  ? -10.350 -25.333 22.637 1.00 39.58 ? 190 GLN A OE1   1 
ATOM   361  N  NE2   . GLN A 1 48  ? -10.032 -27.302 21.607 1.00 41.11 ? 190 GLN A NE2   1 
ATOM   362  N  N     . ILE A 1 49  ? -4.312  -23.906 23.507 1.00 35.01 ? 191 ILE A N     1 
ATOM   363  C  CA    . ILE A 1 49  ? -3.478  -22.707 23.330 1.00 35.07 ? 191 ILE A CA    1 
ATOM   364  C  C     . ILE A 1 49  ? -3.084  -22.435 21.869 1.00 36.00 ? 191 ILE A C     1 
ATOM   365  O  O     . ILE A 1 49  ? -2.666  -23.338 21.141 1.00 37.13 ? 191 ILE A O     1 
ATOM   366  C  CB    . ILE A 1 49  ? -2.190  -22.787 24.202 1.00 36.07 ? 191 ILE A CB    1 
ATOM   367  C  CG1   . ILE A 1 49  ? -2.555  -22.730 25.691 1.00 35.46 ? 191 ILE A CG1   1 
ATOM   368  C  CG2   . ILE A 1 49  ? -1.237  -21.656 23.886 1.00 36.29 ? 191 ILE A CG2   1 
ATOM   369  C  CD1   . ILE A 1 49  ? -1.337  -22.803 26.619 1.00 36.92 ? 191 ILE A CD1   1 
ATOM   370  N  N     . ASN A 1 50  ? -3.230  -21.171 21.467 1.00 35.07 ? 192 ASN A N     1 
ATOM   371  C  CA    . ASN A 1 50  ? -2.631  -20.645 20.253 1.00 36.42 ? 192 ASN A CA    1 
ATOM   372  C  C     . ASN A 1 50  ? -1.350  -19.888 20.622 1.00 37.45 ? 192 ASN A C     1 
ATOM   373  O  O     . ASN A 1 50  ? -1.405  -18.776 21.146 1.00 35.67 ? 192 ASN A O     1 
ATOM   374  C  CB    . ASN A 1 50  ? -3.612  -19.722 19.523 1.00 35.07 ? 192 ASN A CB    1 
ATOM   375  C  CG    . ASN A 1 50  ? -3.079  -19.248 18.165 1.00 36.54 ? 192 ASN A CG    1 
ATOM   376  O  OD1   . ASN A 1 50  ? -1.921  -18.872 18.036 1.00 36.72 ? 192 ASN A OD1   1 
ATOM   377  N  ND2   . ASN A 1 50  ? -3.933  -19.277 17.151 1.00 36.85 ? 192 ASN A ND2   1 
ATOM   378  N  N     . GLN A 1 51  ? -0.204  -20.498 20.331 1.00 40.11 ? 193 GLN A N     1 
ATOM   379  C  CA    . GLN A 1 51  ? 1.101   -19.966 20.746 1.00 42.02 ? 193 GLN A CA    1 
ATOM   380  C  C     . GLN A 1 51  ? 1.500   -18.734 19.939 1.00 42.59 ? 193 GLN A C     1 
ATOM   381  O  O     . GLN A 1 51  ? 2.062   -17.790 20.482 1.00 43.25 ? 193 GLN A O     1 
ATOM   382  C  CB    . GLN A 1 51  ? 2.214   -21.018 20.596 1.00 45.27 ? 193 GLN A CB    1 
ATOM   383  C  CG    . GLN A 1 51  ? 1.800   -22.448 20.939 1.00 47.15 ? 193 GLN A CG    1 
ATOM   384  C  CD    . GLN A 1 51  ? 2.664   -23.065 22.003 1.00 50.15 ? 193 GLN A CD    1 
ATOM   385  O  OE1   . GLN A 1 51  ? 2.297   -23.065 23.189 1.00 50.19 ? 193 GLN A OE1   1 
ATOM   386  N  NE2   . GLN A 1 51  ? 3.824   -23.594 21.598 1.00 52.83 ? 193 GLN A NE2   1 
ATOM   387  N  N     . ASP A 1 52  ? 1.230   -18.765 18.639 1.00 43.05 ? 194 ASP A N     1 
ATOM   388  C  CA    . ASP A 1 52  ? 1.547   -17.646 17.757 1.00 43.47 ? 194 ASP A CA    1 
ATOM   389  C  C     . ASP A 1 52  ? 0.868   -16.335 18.198 1.00 40.84 ? 194 ASP A C     1 
ATOM   390  O  O     . ASP A 1 52  ? 1.519   -15.294 18.235 1.00 41.26 ? 194 ASP A O     1 
ATOM   391  C  CB    . ASP A 1 52  ? 1.200   -18.002 16.302 1.00 44.96 ? 194 ASP A CB    1 
ATOM   392  C  CG    . ASP A 1 52  ? 2.071   -19.143 15.747 1.00 50.06 ? 194 ASP A CG    1 
ATOM   393  O  OD1   . ASP A 1 52  ? 2.352   -20.115 16.489 1.00 53.84 ? 194 ASP A OD1   1 
ATOM   394  O  OD2   . ASP A 1 52  ? 2.484   -19.076 14.565 1.00 55.51 ? 194 ASP A OD2   1 
ATOM   395  N  N     . LYS A 1 53  ? -0.409  -16.399 18.585 1.00 37.98 ? 195 LYS A N     1 
ATOM   396  C  CA    . LYS A 1 53  ? -1.190  -15.202 18.952 1.00 35.96 ? 195 LYS A CA    1 
ATOM   397  C  C     . LYS A 1 53  ? -1.435  -15.046 20.451 1.00 34.04 ? 195 LYS A C     1 
ATOM   398  O  O     . LYS A 1 53  ? -2.224  -14.203 20.866 1.00 32.16 ? 195 LYS A O     1 
ATOM   399  C  CB    . LYS A 1 53  ? -2.535  -15.194 18.205 1.00 34.44 ? 195 LYS A CB    1 
ATOM   400  C  CG    . LYS A 1 53  ? -2.392  -15.090 16.696 1.00 36.44 ? 195 LYS A CG    1 
ATOM   401  C  CD    . LYS A 1 53  ? -3.718  -15.197 15.971 1.00 35.84 ? 195 LYS A CD    1 
ATOM   402  C  CE    . LYS A 1 53  ? -4.634  -14.017 16.266 1.00 34.98 ? 195 LYS A CE    1 
ATOM   403  N  NZ    . LYS A 1 53  ? -5.799  -13.990 15.322 1.00 35.47 ? 195 LYS A NZ    1 
ATOM   404  N  N     . ASN A 1 54  ? -0.789  -15.872 21.263 1.00 34.81 ? 196 ASN A N     1 
ATOM   405  C  CA    . ASN A 1 54  ? -0.802  -15.701 22.715 1.00 34.20 ? 196 ASN A CA    1 
ATOM   406  C  C     . ASN A 1 54  ? -2.173  -15.684 23.406 1.00 32.09 ? 196 ASN A C     1 
ATOM   407  O  O     . ASN A 1 54  ? -2.446  -14.813 24.264 1.00 30.82 ? 196 ASN A O     1 
ATOM   408  C  CB    . ASN A 1 54  ? -0.068  -14.412 23.067 1.00 35.58 ? 196 ASN A CB    1 
ATOM   409  C  CG    . ASN A 1 54  ? 0.809   -14.563 24.271 1.00 38.43 ? 196 ASN A CG    1 
ATOM   410  O  OD1   . ASN A 1 54  ? 1.753   -15.369 24.268 1.00 44.75 ? 196 ASN A OD1   1 
ATOM   411  N  ND2   . ASN A 1 54  ? 0.546   -13.762 25.298 1.00 38.83 ? 196 ASN A ND2   1 
ATOM   412  N  N     . PHE A 1 55  ? -3.026  -16.648 23.066 1.00 30.83 ? 197 PHE A N     1 
ATOM   413  C  CA    . PHE A 1 55  ? -4.316  -16.765 23.743 1.00 28.95 ? 197 PHE A CA    1 
ATOM   414  C  C     . PHE A 1 55  ? -4.724  -18.226 23.934 1.00 28.62 ? 197 PHE A C     1 
ATOM   415  O  O     . PHE A 1 55  ? -4.189  -19.115 23.284 1.00 28.72 ? 197 PHE A O     1 
ATOM   416  C  CB    . PHE A 1 55  ? -5.396  -15.958 22.999 1.00 28.16 ? 197 PHE A CB    1 
ATOM   417  C  CG    . PHE A 1 55  ? -5.852  -16.586 21.704 1.00 28.62 ? 197 PHE A CG    1 
ATOM   418  C  CD1   . PHE A 1 55  ? -6.889  -17.508 21.697 1.00 28.02 ? 197 PHE A CD1   1 
ATOM   419  C  CD2   . PHE A 1 55  ? -5.256  -16.241 20.494 1.00 30.50 ? 197 PHE A CD2   1 
ATOM   420  C  CE1   . PHE A 1 55  ? -7.321  -18.088 20.509 1.00 29.32 ? 197 PHE A CE1   1 
ATOM   421  C  CE2   . PHE A 1 55  ? -5.679  -16.823 19.298 1.00 30.44 ? 197 PHE A CE2   1 
ATOM   422  C  CZ    . PHE A 1 55  ? -6.706  -17.746 19.307 1.00 29.97 ? 197 PHE A CZ    1 
ATOM   423  N  N     . ALA A 1 56  ? -5.661  -18.445 24.857 1.00 27.58 ? 198 ALA A N     1 
ATOM   424  C  CA    . ALA A 1 56  ? -6.180  -19.773 25.178 1.00 27.76 ? 198 ALA A CA    1 
ATOM   425  C  C     . ALA A 1 56  ? -7.706  -19.766 25.286 1.00 26.44 ? 198 ALA A C     1 
ATOM   426  O  O     . ALA A 1 56  ? -8.324  -18.711 25.432 1.00 25.21 ? 198 ALA A O     1 
ATOM   427  C  CB    . ALA A 1 56  ? -5.561  -20.277 26.485 1.00 28.01 ? 198 ALA A CB    1 
ATOM   428  N  N     . PHE A 1 57  ? -8.297  -20.952 25.153 1.00 27.13 ? 199 PHE A N     1 
ATOM   429  C  CA    . PHE A 1 57  ? -9.689  -21.205 25.520 1.00 26.83 ? 199 PHE A CA    1 
ATOM   430  C  C     . PHE A 1 57  ? -9.724  -22.283 26.604 1.00 27.34 ? 199 PHE A C     1 
ATOM   431  O  O     . PHE A 1 57  ? -9.090  -23.327 26.458 1.00 28.19 ? 199 PHE A O     1 
ATOM   432  C  CB    . PHE A 1 57  ? -10.528 -21.630 24.302 1.00 27.73 ? 199 PHE A CB    1 
ATOM   433  C  CG    . PHE A 1 57  ? -11.113 -20.468 23.546 1.00 27.33 ? 199 PHE A CG    1 
ATOM   434  C  CD1   . PHE A 1 57  ? -12.376 -19.987 23.851 1.00 26.67 ? 199 PHE A CD1   1 
ATOM   435  C  CD2   . PHE A 1 57  ? -10.380 -19.823 22.570 1.00 28.48 ? 199 PHE A CD2   1 
ATOM   436  C  CE1   . PHE A 1 57  ? -12.909 -18.903 23.170 1.00 27.04 ? 199 PHE A CE1   1 
ATOM   437  C  CE2   . PHE A 1 57  ? -10.907 -18.735 21.894 1.00 28.19 ? 199 PHE A CE2   1 
ATOM   438  C  CZ    . PHE A 1 57  ? -12.170 -18.279 22.191 1.00 26.56 ? 199 PHE A CZ    1 
ATOM   439  N  N     . LEU A 1 58  ? -10.425 -21.988 27.699 1.00 26.63 ? 200 LEU A N     1 
ATOM   440  C  CA    . LEU A 1 58  ? -10.677 -22.945 28.776 1.00 27.06 ? 200 LEU A CA    1 
ATOM   441  C  C     . LEU A 1 58  ? -12.023 -23.609 28.551 1.00 27.21 ? 200 LEU A C     1 
ATOM   442  O  O     . LEU A 1 58  ? -12.961 -22.939 28.136 1.00 26.60 ? 200 LEU A O     1 
ATOM   443  C  CB    . LEU A 1 58  ? -10.739 -22.250 30.134 1.00 26.15 ? 200 LEU A CB    1 
ATOM   444  C  CG    . LEU A 1 58  ? -9.616  -21.338 30.591 1.00 26.93 ? 200 LEU A CG    1 
ATOM   445  C  CD1   . LEU A 1 58  ? -9.988  -20.750 31.949 1.00 25.74 ? 200 LEU A CD1   1 
ATOM   446  C  CD2   . LEU A 1 58  ? -8.282  -22.051 30.647 1.00 27.24 ? 200 LEU A CD2   1 
ATOM   447  N  N     . GLU A 1 59  ? -12.115 -24.901 28.872 1.00 28.29 ? 201 GLU A N     1 
ATOM   448  C  CA    . GLU A 1 59  ? -13.364 -25.685 28.772 1.00 28.95 ? 201 GLU A CA    1 
ATOM   449  C  C     . GLU A 1 59  ? -13.767 -26.148 30.176 1.00 28.43 ? 201 GLU A C     1 
ATOM   450  O  O     . GLU A 1 59  ? -12.983 -26.810 30.864 1.00 28.43 ? 201 GLU A O     1 
ATOM   451  C  CB    . GLU A 1 59  ? -13.137 -26.887 27.841 1.00 30.48 ? 201 GLU A CB    1 
ATOM   452  C  CG    . GLU A 1 59  ? -14.260 -27.918 27.753 1.00 32.92 ? 201 GLU A CG    1 
ATOM   453  C  CD    . GLU A 1 59  ? -13.849 -29.159 26.947 1.00 36.85 ? 201 GLU A CD    1 
ATOM   454  O  OE1   . GLU A 1 59  ? -14.461 -30.248 27.139 1.00 42.70 ? 201 GLU A OE1   1 
ATOM   455  O  OE2   . GLU A 1 59  ? -12.898 -29.049 26.124 1.00 42.21 ? 201 GLU A OE2   1 
ATOM   456  N  N     . PHE A 1 60  ? -14.981 -25.792 30.600 1.00 27.70 ? 202 PHE A N     1 
ATOM   457  C  CA    . PHE A 1 60  ? -15.456 -26.092 31.962 1.00 27.73 ? 202 PHE A CA    1 
ATOM   458  C  C     . PHE A 1 60  ? -16.461 -27.248 31.984 1.00 28.58 ? 202 PHE A C     1 
ATOM   459  O  O     . PHE A 1 60  ? -17.138 -27.533 30.988 1.00 29.19 ? 202 PHE A O     1 
ATOM   460  C  CB    . PHE A 1 60  ? -16.118 -24.856 32.581 1.00 26.98 ? 202 PHE A CB    1 
ATOM   461  C  CG    . PHE A 1 60  ? -15.159 -23.736 32.900 1.00 26.48 ? 202 PHE A CG    1 
ATOM   462  C  CD1   . PHE A 1 60  ? -14.774 -23.486 34.212 1.00 26.74 ? 202 PHE A CD1   1 
ATOM   463  C  CD2   . PHE A 1 60  ? -14.660 -22.916 31.889 1.00 26.20 ? 202 PHE A CD2   1 
ATOM   464  C  CE1   . PHE A 1 60  ? -13.898 -22.453 34.506 1.00 25.88 ? 202 PHE A CE1   1 
ATOM   465  C  CE2   . PHE A 1 60  ? -13.787 -21.890 32.178 1.00 25.25 ? 202 PHE A CE2   1 
ATOM   466  C  CZ    . PHE A 1 60  ? -13.405 -21.663 33.492 1.00 26.09 ? 202 PHE A CZ    1 
ATOM   467  N  N     . ARG A 1 61  ? -16.577 -27.890 33.139 1.00 28.83 ? 203 ARG A N     1 
ATOM   468  C  CA    . ARG A 1 61  ? -17.505 -28.998 33.306 1.00 30.10 ? 203 ARG A CA    1 
ATOM   469  C  C     . ARG A 1 61  ? -18.964 -28.556 33.423 1.00 30.01 ? 203 ARG A C     1 
ATOM   470  O  O     . ARG A 1 61  ? -19.858 -29.353 33.153 1.00 30.86 ? 203 ARG A O     1 
ATOM   471  C  CB    . ARG A 1 61  ? -17.130 -29.838 34.522 1.00 30.91 ? 203 ARG A CB    1 
ATOM   472  C  CG    . ARG A 1 61  ? -17.327 -29.131 35.844 1.00 30.14 ? 203 ARG A CG    1 
ATOM   473  C  CD    . ARG A 1 61  ? -16.994 -30.043 36.988 1.00 31.33 ? 203 ARG A CD    1 
ATOM   474  N  NE    . ARG A 1 61  ? -16.891 -29.297 38.237 1.00 30.92 ? 203 ARG A NE    1 
ATOM   475  C  CZ    . ARG A 1 61  ? -16.522 -29.821 39.394 1.00 31.26 ? 203 ARG A CZ    1 
ATOM   476  N  NH1   . ARG A 1 61  ? -16.211 -31.107 39.485 1.00 32.99 ? 203 ARG A NH1   1 
ATOM   477  N  NH2   . ARG A 1 61  ? -16.452 -29.045 40.464 1.00 32.16 ? 203 ARG A NH2   1 
ATOM   478  N  N     . SER A 1 62  ? -19.201 -27.303 33.827 1.00 28.90 ? 204 SER A N     1 
ATOM   479  C  CA    . SER A 1 62  ? -20.563 -26.826 34.077 1.00 29.59 ? 204 SER A CA    1 
ATOM   480  C  C     . SER A 1 62  ? -20.765 -25.388 33.618 1.00 28.89 ? 204 SER A C     1 
ATOM   481  O  O     . SER A 1 62  ? -19.806 -24.638 33.467 1.00 27.56 ? 204 SER A O     1 
ATOM   482  C  CB    . SER A 1 62  ? -20.911 -26.980 35.563 1.00 30.19 ? 204 SER A CB    1 
ATOM   483  O  OG    . SER A 1 62  ? -20.376 -25.935 36.356 1.00 29.51 ? 204 SER A OG    1 
ATOM   484  N  N     . VAL A 1 63  ? -22.027 -25.036 33.369 1.00 30.01 ? 205 VAL A N     1 
ATOM   485  C  CA    . VAL A 1 63  ? -22.440 -23.685 32.958 1.00 29.80 ? 205 VAL A CA    1 
ATOM   486  C  C     . VAL A 1 63  ? -22.184 -22.590 34.029 1.00 29.49 ? 205 VAL A C     1 
ATOM   487  O  O     . VAL A 1 63  ? -21.655 -21.523 33.713 1.00 28.57 ? 205 VAL A O     1 
ATOM   488  C  CB    . VAL A 1 63  ? -23.959 -23.686 32.561 1.00 31.69 ? 205 VAL A CB    1 
ATOM   489  C  CG1   . VAL A 1 63  ? -24.512 -22.264 32.441 1.00 31.56 ? 205 VAL A CG1   1 
ATOM   490  C  CG2   . VAL A 1 63  ? -24.187 -24.484 31.256 1.00 31.71 ? 205 VAL A CG2   1 
ATOM   491  N  N     . ASP A 1 64  ? -22.583 -22.853 35.275 1.00 30.17 ? 206 ASP A N     1 
ATOM   492  C  CA    . ASP A 1 64  ? -22.500 -21.879 36.370 1.00 30.34 ? 206 ASP A CA    1 
ATOM   493  C  C     . ASP A 1 64  ? -21.054 -21.615 36.806 1.00 29.17 ? 206 ASP A C     1 
ATOM   494  O  O     . ASP A 1 64  ? -20.721 -20.491 37.187 1.00 28.55 ? 206 ASP A O     1 
ATOM   495  C  CB    . ASP A 1 64  ? -23.323 -22.330 37.598 1.00 31.70 ? 206 ASP A CB    1 
ATOM   496  C  CG    . ASP A 1 64  ? -24.862 -22.214 37.398 1.00 34.89 ? 206 ASP A CG    1 
ATOM   497  O  OD1   . ASP A 1 64  ? -25.591 -22.592 38.341 1.00 37.79 ? 206 ASP A OD1   1 
ATOM   498  O  OD2   . ASP A 1 64  ? -25.362 -21.762 36.334 1.00 36.49 ? 206 ASP A OD2   1 
ATOM   499  N  N     . GLU A 1 65  ? -20.210 -22.647 36.785 1.00 28.71 ? 207 GLU A N     1 
ATOM   500  C  CA    . GLU A 1 65  ? -18.791 -22.479 37.095 1.00 28.30 ? 207 GLU A CA    1 
ATOM   501  C  C     . GLU A 1 65  ? -18.054 -21.638 36.030 1.00 27.29 ? 207 GLU A C     1 
ATOM   502  O  O     . GLU A 1 65  ? -17.133 -20.891 36.356 1.00 26.57 ? 207 GLU A O     1 
ATOM   503  C  CB    . GLU A 1 65  ? -18.104 -23.840 37.310 1.00 28.58 ? 207 GLU A CB    1 
ATOM   504  C  CG    . GLU A 1 65  ? -18.447 -24.467 38.678 1.00 29.95 ? 207 GLU A CG    1 
ATOM   505  C  CD    . GLU A 1 65  ? -17.959 -25.904 38.852 1.00 31.27 ? 207 GLU A CD    1 
ATOM   506  O  OE1   . GLU A 1 65  ? -18.029 -26.684 37.875 1.00 32.80 ? 207 GLU A OE1   1 
ATOM   507  O  OE2   . GLU A 1 65  ? -17.524 -26.260 39.979 1.00 31.53 ? 207 GLU A OE2   1 
ATOM   508  N  N     . THR A 1 66  ? -18.470 -21.749 34.769 1.00 27.46 ? 208 THR A N     1 
ATOM   509  C  CA    . THR A 1 66  ? -17.949 -20.887 33.695 1.00 27.01 ? 208 THR A CA    1 
ATOM   510  C  C     . THR A 1 66  ? -18.233 -19.409 34.003 1.00 27.53 ? 208 THR A C     1 
ATOM   511  O  O     . THR A 1 66  ? -17.361 -18.547 33.834 1.00 26.58 ? 208 THR A O     1 
ATOM   512  C  CB    . THR A 1 66  ? -18.557 -21.265 32.313 1.00 27.10 ? 208 THR A CB    1 
ATOM   513  O  OG1   . THR A 1 66  ? -18.324 -22.652 32.052 1.00 26.08 ? 208 THR A OG1   1 
ATOM   514  C  CG2   . THR A 1 66  ? -17.944 -20.425 31.177 1.00 26.74 ? 208 THR A CG2   1 
ATOM   515  N  N     . THR A 1 67  ? -19.447 -19.135 34.482 1.00 28.46 ? 209 THR A N     1 
ATOM   516  C  CA    . THR A 1 67  ? -19.865 -17.772 34.823 1.00 29.49 ? 209 THR A CA    1 
ATOM   517  C  C     . THR A 1 67  ? -19.084 -17.201 36.009 1.00 29.83 ? 209 THR A C     1 
ATOM   518  O  O     . THR A 1 67  ? -18.626 -16.055 35.966 1.00 29.72 ? 209 THR A O     1 
ATOM   519  C  CB    . THR A 1 67  ? -21.391 -17.722 35.113 1.00 30.65 ? 209 THR A CB    1 
ATOM   520  O  OG1   . THR A 1 67  ? -22.087 -18.136 33.939 1.00 31.14 ? 209 THR A OG1   1 
ATOM   521  C  CG2   . THR A 1 67  ? -21.853 -16.303 35.518 1.00 31.29 ? 209 THR A CG2   1 
ATOM   522  N  N     . GLN A 1 68  ? -18.936 -18.008 37.056 1.00 30.81 ? 210 GLN A N     1 
ATOM   523  C  CA    . GLN A 1 68  ? -18.169 -17.617 38.239 1.00 31.27 ? 210 GLN A CA    1 
ATOM   524  C  C     . GLN A 1 68  ? -16.713 -17.247 37.907 1.00 30.33 ? 210 GLN A C     1 
ATOM   525  O  O     . GLN A 1 68  ? -16.197 -16.269 38.439 1.00 30.42 ? 210 GLN A O     1 
ATOM   526  C  CB    . GLN A 1 68  ? -18.178 -18.745 39.280 1.00 32.29 ? 210 GLN A CB    1 
ATOM   527  C  CG    . GLN A 1 68  ? -19.538 -19.057 39.889 1.00 36.20 ? 210 GLN A CG    1 
ATOM   528  C  CD    . GLN A 1 68  ? -20.105 -17.911 40.710 1.00 41.61 ? 210 GLN A CD    1 
ATOM   529  O  OE1   . GLN A 1 68  ? -20.769 -17.018 40.173 1.00 45.91 ? 210 GLN A OE1   1 
ATOM   530  N  NE2   . GLN A 1 68  ? -19.866 -17.937 42.017 1.00 43.72 ? 210 GLN A NE2   1 
ATOM   531  N  N     . ALA A 1 69  ? -16.070 -18.022 37.027 1.00 29.70 ? 211 ALA A N     1 
ATOM   532  C  CA    . ALA A 1 69  ? -14.654 -17.832 36.665 1.00 29.51 ? 211 ALA A CA    1 
ATOM   533  C  C     . ALA A 1 69  ? -14.314 -16.492 35.988 1.00 29.76 ? 211 ALA A C     1 
ATOM   534  O  O     . ALA A 1 69  ? -13.137 -16.106 35.916 1.00 29.61 ? 211 ALA A O     1 
ATOM   535  C  CB    . ALA A 1 69  ? -14.166 -18.998 35.792 1.00 28.85 ? 211 ALA A CB    1 
ATOM   536  N  N     . MET A 1 70  ? -15.329 -15.792 35.492 1.00 30.22 ? 212 MET A N     1 
ATOM   537  C  CA    . MET A 1 70  ? -15.163 -14.426 34.959 1.00 31.10 ? 212 MET A CA    1 
ATOM   538  C  C     . MET A 1 70  ? -14.682 -13.393 35.987 1.00 31.28 ? 212 MET A C     1 
ATOM   539  O  O     . MET A 1 70  ? -14.165 -12.331 35.614 1.00 30.76 ? 212 MET A O     1 
ATOM   540  C  CB    . MET A 1 70  ? -16.479 -13.939 34.355 1.00 31.73 ? 212 MET A CB    1 
ATOM   541  C  CG    . MET A 1 70  ? -17.067 -14.907 33.325 1.00 32.49 ? 212 MET A CG    1 
ATOM   542  S  SD    . MET A 1 70  ? -17.349 -14.106 31.754 1.00 36.31 ? 212 MET A SD    1 
ATOM   543  C  CE    . MET A 1 70  ? -15.693 -13.908 31.152 1.00 30.97 ? 212 MET A CE    1 
ATOM   544  N  N     . ALA A 1 71  ? -14.871 -13.702 37.272 1.00 31.59 ? 213 ALA A N     1 
ATOM   545  C  CA    . ALA A 1 71  ? -14.392 -12.860 38.374 1.00 32.41 ? 213 ALA A CA    1 
ATOM   546  C  C     . ALA A 1 71  ? -12.855 -12.807 38.466 1.00 32.03 ? 213 ALA A C     1 
ATOM   547  O  O     . ALA A 1 71  ? -12.309 -11.948 39.159 1.00 32.83 ? 213 ALA A O     1 
ATOM   548  C  CB    . ALA A 1 71  ? -14.982 -13.358 39.711 1.00 33.06 ? 213 ALA A CB    1 
ATOM   549  N  N     . PHE A 1 72  ? -12.173 -13.728 37.782 1.00 30.83 ? 214 PHE A N     1 
ATOM   550  C  CA    . PHE A 1 72  ? -10.704 -13.739 37.707 1.00 30.74 ? 214 PHE A CA    1 
ATOM   551  C  C     . PHE A 1 72  ? -10.094 -12.780 36.676 1.00 30.69 ? 214 PHE A C     1 
ATOM   552  O  O     . PHE A 1 72  ? -8.867  -12.728 36.565 1.00 30.92 ? 214 PHE A O     1 
ATOM   553  C  CB    . PHE A 1 72  ? -10.185 -15.156 37.407 1.00 30.48 ? 214 PHE A CB    1 
ATOM   554  C  CG    . PHE A 1 72  ? -10.391 -16.142 38.523 1.00 30.55 ? 214 PHE A CG    1 
ATOM   555  C  CD1   . PHE A 1 72  ? -10.828 -17.427 38.244 1.00 31.75 ? 214 PHE A CD1   1 
ATOM   556  C  CD2   . PHE A 1 72  ? -10.134 -15.802 39.846 1.00 32.61 ? 214 PHE A CD2   1 
ATOM   557  C  CE1   . PHE A 1 72  ? -11.015 -18.350 39.255 1.00 32.15 ? 214 PHE A CE1   1 
ATOM   558  C  CE2   . PHE A 1 72  ? -10.321 -16.716 40.867 1.00 32.63 ? 214 PHE A CE2   1 
ATOM   559  C  CZ    . PHE A 1 72  ? -10.764 -17.996 40.571 1.00 33.25 ? 214 PHE A CZ    1 
ATOM   560  N  N     . ASP A 1 73  ? -10.912 -12.034 35.922 1.00 29.93 ? 215 ASP A N     1 
ATOM   561  C  CA    . ASP A 1 73  ? -10.375 -11.034 34.975 1.00 30.00 ? 215 ASP A CA    1 
ATOM   562  C  C     . ASP A 1 73  ? -9.373  -10.109 35.675 1.00 30.65 ? 215 ASP A C     1 
ATOM   563  O  O     . ASP A 1 73  ? -9.661  -9.554  36.738 1.00 31.10 ? 215 ASP A O     1 
ATOM   564  C  CB    . ASP A 1 73  ? -11.500 -10.202 34.314 1.00 29.98 ? 215 ASP A CB    1 
ATOM   565  C  CG    . ASP A 1 73  ? -10.977 -9.237  33.234 1.00 30.98 ? 215 ASP A CG    1 
ATOM   566  O  OD1   . ASP A 1 73  ? -11.459 -8.072  33.184 1.00 32.85 ? 215 ASP A OD1   1 
ATOM   567  O  OD2   . ASP A 1 73  ? -10.077 -9.624  32.442 1.00 29.92 ? 215 ASP A OD2   1 
ATOM   568  N  N     . GLY A 1 74  ? -8.189  -9.969  35.086 1.00 30.54 ? 216 GLY A N     1 
ATOM   569  C  CA    . GLY A 1 74  ? -7.114  -9.172  35.685 1.00 32.00 ? 216 GLY A CA    1 
ATOM   570  C  C     . GLY A 1 74  ? -6.103  -9.960  36.516 1.00 32.29 ? 216 GLY A C     1 
ATOM   571  O  O     . GLY A 1 74  ? -5.052  -9.428  36.865 1.00 33.72 ? 216 GLY A O     1 
ATOM   572  N  N     . ILE A 1 75  ? -6.389  -11.221 36.835 1.00 31.30 ? 217 ILE A N     1 
ATOM   573  C  CA    . ILE A 1 75  ? -5.503  -11.985 37.721 1.00 32.19 ? 217 ILE A CA    1 
ATOM   574  C  C     . ILE A 1 75  ? -4.088  -12.098 37.121 1.00 33.14 ? 217 ILE A C     1 
ATOM   575  O  O     . ILE A 1 75  ? -3.917  -12.304 35.916 1.00 31.93 ? 217 ILE A O     1 
ATOM   576  C  CB    . ILE A 1 75  ? -6.059  -13.390 38.035 1.00 31.15 ? 217 ILE A CB    1 
ATOM   577  C  CG1   . ILE A 1 75  ? -5.351  -14.007 39.253 1.00 32.86 ? 217 ILE A CG1   1 
ATOM   578  C  CG2   . ILE A 1 75  ? -5.949  -14.305 36.818 1.00 30.54 ? 217 ILE A CG2   1 
ATOM   579  C  CD1   . ILE A 1 75  ? -5.890  -15.404 39.640 1.00 31.58 ? 217 ILE A CD1   1 
ATOM   580  N  N     . ILE A 1 76  ? -3.084  -11.971 37.976 1.00 34.74 ? 218 ILE A N     1 
ATOM   581  C  CA    . ILE A 1 76  ? -1.689  -12.016 37.531 1.00 36.58 ? 218 ILE A CA    1 
ATOM   582  C  C     . ILE A 1 76  ? -1.129  -13.439 37.606 1.00 37.12 ? 218 ILE A C     1 
ATOM   583  O  O     . ILE A 1 76  ? -1.160  -14.082 38.663 1.00 38.16 ? 218 ILE A O     1 
ATOM   584  C  CB    . ILE A 1 76  ? -0.825  -11.026 38.327 1.00 38.40 ? 218 ILE A CB    1 
ATOM   585  C  CG1   . ILE A 1 76  ? -1.224  -9.597  37.954 1.00 38.81 ? 218 ILE A CG1   1 
ATOM   586  C  CG2   . ILE A 1 76  ? 0.680   -11.226 38.043 1.00 40.33 ? 218 ILE A CG2   1 
ATOM   587  C  CD1   . ILE A 1 76  ? -1.252  -8.658  39.128 1.00 41.77 ? 218 ILE A CD1   1 
ATOM   588  N  N     . PHE A 1 77  ? -0.623  -13.906 36.464 1.00 37.28 ? 219 PHE A N     1 
ATOM   589  C  CA    . PHE A 1 77  ? -0.055  -15.238 36.308 1.00 37.63 ? 219 PHE A CA    1 
ATOM   590  C  C     . PHE A 1 77  ? 1.325   -15.091 35.672 1.00 39.43 ? 219 PHE A C     1 
ATOM   591  O  O     . PHE A 1 77  ? 1.432   -14.618 34.535 1.00 38.43 ? 219 PHE A O     1 
ATOM   592  C  CB    . PHE A 1 77  ? -0.981  -16.067 35.410 1.00 36.55 ? 219 PHE A CB    1 
ATOM   593  C  CG    . PHE A 1 77  ? -0.547  -17.501 35.208 1.00 37.02 ? 219 PHE A CG    1 
ATOM   594  C  CD1   . PHE A 1 77  ? 0.000   -18.247 36.244 1.00 39.04 ? 219 PHE A CD1   1 
ATOM   595  C  CD2   . PHE A 1 77  ? -0.750  -18.120 33.987 1.00 37.62 ? 219 PHE A CD2   1 
ATOM   596  C  CE1   . PHE A 1 77  ? 0.375   -19.580 36.051 1.00 40.45 ? 219 PHE A CE1   1 
ATOM   597  C  CE2   . PHE A 1 77  ? -0.378  -19.453 33.787 1.00 39.15 ? 219 PHE A CE2   1 
ATOM   598  C  CZ    . PHE A 1 77  ? 0.186   -20.181 34.822 1.00 39.71 ? 219 PHE A CZ    1 
ATOM   599  N  N     . GLN A 1 78  ? 2.365   -15.484 36.415 1.00 41.51 ? 220 GLN A N     1 
ATOM   600  C  CA    . GLN A 1 78  ? 3.778   -15.315 36.017 1.00 44.00 ? 220 GLN A CA    1 
ATOM   601  C  C     . GLN A 1 78  ? 4.103   -13.915 35.476 1.00 43.94 ? 220 GLN A C     1 
ATOM   602  O  O     . GLN A 1 78  ? 4.747   -13.780 34.439 1.00 44.30 ? 220 GLN A O     1 
ATOM   603  C  CB    . GLN A 1 78  ? 4.178   -16.377 34.985 1.00 44.74 ? 220 GLN A CB    1 
ATOM   604  C  CG    . GLN A 1 78  ? 3.924   -17.815 35.442 1.00 45.42 ? 220 GLN A CG    1 
ATOM   605  C  CD    . GLN A 1 78  ? 4.555   -18.867 34.529 1.00 47.12 ? 220 GLN A CD    1 
ATOM   606  O  OE1   . GLN A 1 78  ? 5.277   -18.548 33.576 1.00 51.15 ? 220 GLN A OE1   1 
ATOM   607  N  NE2   . GLN A 1 78  ? 4.296   -20.133 34.834 1.00 48.35 ? 220 GLN A NE2   1 
ATOM   608  N  N     . GLY A 1 79  ? 3.640   -12.884 36.175 1.00 43.39 ? 221 GLY A N     1 
ATOM   609  C  CA    . GLY A 1 79  ? 3.902   -11.490 35.789 1.00 44.16 ? 221 GLY A CA    1 
ATOM   610  C  C     . GLY A 1 79  ? 2.902   -10.867 34.815 1.00 41.97 ? 221 GLY A C     1 
ATOM   611  O  O     . GLY A 1 79  ? 2.939   -9.651  34.598 1.00 42.23 ? 221 GLY A O     1 
ATOM   612  N  N     . GLN A 1 80  ? 2.017   -11.682 34.236 1.00 39.54 ? 222 GLN A N     1 
ATOM   613  C  CA    . GLN A 1 80  ? 1.056   -11.222 33.227 1.00 38.05 ? 222 GLN A CA    1 
ATOM   614  C  C     . GLN A 1 80  ? -0.367  -11.114 33.785 1.00 35.84 ? 222 GLN A C     1 
ATOM   615  O  O     . GLN A 1 80  ? -0.885  -12.062 34.380 1.00 34.53 ? 222 GLN A O     1 
ATOM   616  C  CB    . GLN A 1 80  ? 1.027   -12.179 32.020 1.00 37.63 ? 222 GLN A CB    1 
ATOM   617  C  CG    . GLN A 1 80  ? 2.346   -12.328 31.280 1.00 41.20 ? 222 GLN A CG    1 
ATOM   618  C  CD    . GLN A 1 80  ? 2.693   -11.113 30.457 1.00 44.02 ? 222 GLN A CD    1 
ATOM   619  O  OE1   . GLN A 1 80  ? 3.500   -10.284 30.872 1.00 46.65 ? 222 GLN A OE1   1 
ATOM   620  N  NE2   . GLN A 1 80  ? 2.076   -10.993 29.281 1.00 44.76 ? 222 GLN A NE2   1 
ATOM   621  N  N     . SER A 1 81  ? -1.000  -9.965  33.554 1.00 35.37 ? 223 SER A N     1 
ATOM   622  C  CA    . SER A 1 81  ? -2.409  -9.758  33.897 1.00 34.19 ? 223 SER A CA    1 
ATOM   623  C  C     . SER A 1 81  ? -3.314  -10.346 32.807 1.00 31.93 ? 223 SER A C     1 
ATOM   624  O  O     . SER A 1 81  ? -3.344  -9.847  31.688 1.00 31.59 ? 223 SER A O     1 
ATOM   625  C  CB    . SER A 1 81  ? -2.688  -8.258  34.086 1.00 35.27 ? 223 SER A CB    1 
ATOM   626  O  OG    . SER A 1 81  ? -4.019  -8.053  34.529 1.00 35.84 ? 223 SER A OG    1 
ATOM   627  N  N     . LEU A 1 82  ? -4.044  -11.407 33.134 1.00 30.61 ? 224 LEU A N     1 
ATOM   628  C  CA    . LEU A 1 82  ? -4.840  -12.139 32.137 1.00 29.47 ? 224 LEU A CA    1 
ATOM   629  C  C     . LEU A 1 82  ? -6.165  -11.427 31.782 1.00 28.30 ? 224 LEU A C     1 
ATOM   630  O  O     . LEU A 1 82  ? -6.839  -10.888 32.655 1.00 27.61 ? 224 LEU A O     1 
ATOM   631  C  CB    . LEU A 1 82  ? -5.144  -13.554 32.638 1.00 28.89 ? 224 LEU A CB    1 
ATOM   632  C  CG    . LEU A 1 82  ? -3.963  -14.452 33.031 1.00 30.40 ? 224 LEU A CG    1 
ATOM   633  C  CD1   . LEU A 1 82  ? -4.482  -15.829 33.516 1.00 29.62 ? 224 LEU A CD1   1 
ATOM   634  C  CD2   . LEU A 1 82  ? -2.949  -14.614 31.883 1.00 29.88 ? 224 LEU A CD2   1 
ATOM   635  N  N     . LYS A 1 83  ? -6.516  -11.441 30.495 1.00 28.05 ? 225 LYS A N     1 
ATOM   636  C  CA    . LYS A 1 83  ? -7.761  -10.851 29.981 1.00 27.72 ? 225 LYS A CA    1 
ATOM   637  C  C     . LYS A 1 83  ? -8.791  -11.967 29.762 1.00 26.50 ? 225 LYS A C     1 
ATOM   638  O  O     . LYS A 1 83  ? -8.693  -12.710 28.801 1.00 26.35 ? 225 LYS A O     1 
ATOM   639  C  CB    . LYS A 1 83  ? -7.473  -10.096 28.672 1.00 28.23 ? 225 LYS A CB    1 
ATOM   640  C  CG    . LYS A 1 83  ? -8.654  -9.365  28.037 1.00 28.55 ? 225 LYS A CG    1 
ATOM   641  C  CD    . LYS A 1 83  ? -8.209  -8.609  26.785 1.00 30.26 ? 225 LYS A CD    1 
ATOM   642  C  CE    . LYS A 1 83  ? -9.236  -7.569  26.314 1.00 31.93 ? 225 LYS A CE    1 
ATOM   643  N  NZ    . LYS A 1 83  ? -8.773  -6.823  25.097 1.00 31.56 ? 225 LYS A NZ    1 
ATOM   644  N  N     . ILE A 1 84  ? -9.768  -12.072 30.666 1.00 26.33 ? 226 ILE A N     1 
ATOM   645  C  CA    . ILE A 1 84  ? -10.789 -13.132 30.641 1.00 25.62 ? 226 ILE A CA    1 
ATOM   646  C  C     . ILE A 1 84  ? -12.113 -12.605 30.075 1.00 25.39 ? 226 ILE A C     1 
ATOM   647  O  O     . ILE A 1 84  ? -12.668 -11.647 30.619 1.00 25.78 ? 226 ILE A O     1 
ATOM   648  C  CB    . ILE A 1 84  ? -11.076 -13.694 32.063 1.00 25.75 ? 226 ILE A CB    1 
ATOM   649  C  CG1   . ILE A 1 84  ? -9.780  -14.053 32.819 1.00 26.80 ? 226 ILE A CG1   1 
ATOM   650  C  CG2   . ILE A 1 84  ? -12.035 -14.886 31.979 1.00 24.65 ? 226 ILE A CG2   1 
ATOM   651  C  CD1   . ILE A 1 84  ? -9.154  -15.346 32.430 1.00 29.59 ? 226 ILE A CD1   1 
ATOM   652  N  N     . ARG A 1 85  ? -12.619 -13.246 29.012 1.00 24.92 ? 227 ARG A N     1 
ATOM   653  C  CA    . ARG A 1 85  ? -13.831 -12.796 28.282 1.00 25.33 ? 227 ARG A CA    1 
ATOM   654  C  C     . ARG A 1 85  ? -14.729 -13.964 27.817 1.00 25.07 ? 227 ARG A C     1 
ATOM   655  O  O     . ARG A 1 85  ? -14.278 -15.111 27.692 1.00 23.84 ? 227 ARG A O     1 
ATOM   656  C  CB    . ARG A 1 85  ? -13.436 -12.001 27.026 1.00 25.76 ? 227 ARG A CB    1 
ATOM   657  C  CG    . ARG A 1 85  ? -12.622 -10.724 27.265 1.00 26.89 ? 227 ARG A CG    1 
ATOM   658  C  CD    . ARG A 1 85  ? -13.475 -9.605  27.881 1.00 28.68 ? 227 ARG A CD    1 
ATOM   659  N  NE    . ARG A 1 85  ? -12.734 -8.341  27.965 1.00 29.24 ? 227 ARG A NE    1 
ATOM   660  C  CZ    . ARG A 1 85  ? -12.070 -7.908  29.036 1.00 29.91 ? 227 ARG A CZ    1 
ATOM   661  N  NH1   . ARG A 1 85  ? -12.014 -8.611  30.154 1.00 30.11 ? 227 ARG A NH1   1 
ATOM   662  N  NH2   . ARG A 1 85  ? -11.448 -6.749  28.990 1.00 31.61 ? 227 ARG A NH2   1 
ATOM   663  N  N     . ARG A 1 86  ? -15.994 -13.665 27.527 1.00 25.31 ? 228 ARG A N     1 
ATOM   664  C  CA    . ARG A 1 86  ? -16.867 -14.649 26.871 1.00 25.63 ? 228 ARG A CA    1 
ATOM   665  C  C     . ARG A 1 86  ? -16.379 -14.909 25.450 1.00 25.60 ? 228 ARG A C     1 
ATOM   666  O  O     . ARG A 1 86  ? -15.768 -14.037 24.838 1.00 25.44 ? 228 ARG A O     1 
ATOM   667  C  CB    . ARG A 1 86  ? -18.320 -14.156 26.815 1.00 26.60 ? 228 ARG A CB    1 
ATOM   668  C  CG    . ARG A 1 86  ? -19.008 -14.046 28.168 1.00 26.78 ? 228 ARG A CG    1 
ATOM   669  C  CD    . ARG A 1 86  ? -19.331 -15.402 28.748 1.00 25.90 ? 228 ARG A CD    1 
ATOM   670  N  NE    . ARG A 1 86  ? -20.140 -15.268 29.959 1.00 26.86 ? 228 ARG A NE    1 
ATOM   671  C  CZ    . ARG A 1 86  ? -20.624 -16.286 30.666 1.00 26.97 ? 228 ARG A CZ    1 
ATOM   672  N  NH1   . ARG A 1 86  ? -20.382 -17.538 30.299 1.00 26.28 ? 228 ARG A NH1   1 
ATOM   673  N  NH2   . ARG A 1 86  ? -21.354 -16.051 31.756 1.00 27.98 ? 228 ARG A NH2   1 
ATOM   674  N  N     . PRO A 1 87  ? -16.648 -16.111 24.912 1.00 25.97 ? 229 PRO A N     1 
ATOM   675  C  CA    . PRO A 1 87  ? -16.413 -16.338 23.482 1.00 26.71 ? 229 PRO A CA    1 
ATOM   676  C  C     . PRO A 1 87  ? -17.256 -15.413 22.612 1.00 27.99 ? 229 PRO A C     1 
ATOM   677  O  O     . PRO A 1 87  ? -18.369 -15.074 23.001 1.00 27.95 ? 229 PRO A O     1 
ATOM   678  C  CB    . PRO A 1 87  ? -16.853 -17.791 23.280 1.00 27.03 ? 229 PRO A CB    1 
ATOM   679  C  CG    . PRO A 1 87  ? -16.808 -18.405 24.647 1.00 26.46 ? 229 PRO A CG    1 
ATOM   680  C  CD    . PRO A 1 87  ? -17.164 -17.314 25.586 1.00 25.37 ? 229 PRO A CD    1 
ATOM   681  N  N     A HIS A 1 88  ? -16.711 -15.028 21.455 0.50 28.68 ? 230 HIS A N     1 
ATOM   682  N  N     B HIS A 1 88  ? -16.740 -15.004 21.449 0.50 28.69 ? 230 HIS A N     1 
ATOM   683  C  CA    A HIS A 1 88  ? -17.384 -14.165 20.474 0.50 29.97 ? 230 HIS A CA    1 
ATOM   684  C  CA    B HIS A 1 88  ? -17.479 -14.088 20.567 0.50 29.98 ? 230 HIS A CA    1 
ATOM   685  C  C     A HIS A 1 88  ? -18.786 -14.672 20.126 0.50 31.34 ? 230 HIS A C     1 
ATOM   686  C  C     B HIS A 1 88  ? -18.831 -14.667 20.138 0.50 31.37 ? 230 HIS A C     1 
ATOM   687  O  O     A HIS A 1 88  ? -19.725 -13.889 20.003 0.50 32.45 ? 230 HIS A O     1 
ATOM   688  O  O     B HIS A 1 88  ? -19.790 -13.919 19.954 0.50 32.53 ? 230 HIS A O     1 
ATOM   689  C  CB    A HIS A 1 88  ? -16.514 -14.087 19.204 0.50 30.59 ? 230 HIS A CB    1 
ATOM   690  C  CB    B HIS A 1 88  ? -16.668 -13.717 19.312 0.50 30.65 ? 230 HIS A CB    1 
ATOM   691  C  CG    A HIS A 1 88  ? -17.144 -13.349 18.062 0.50 31.81 ? 230 HIS A CG    1 
ATOM   692  C  CG    B HIS A 1 88  ? -15.613 -12.676 19.543 0.50 30.31 ? 230 HIS A CG    1 
ATOM   693  N  ND1   A HIS A 1 88  ? -17.193 -11.975 18.000 0.50 32.45 ? 230 HIS A ND1   1 
ATOM   694  N  ND1   B HIS A 1 88  ? -15.714 -11.704 20.517 0.50 30.26 ? 230 HIS A ND1   1 
ATOM   695  C  CD2   A HIS A 1 88  ? -17.723 -13.797 16.922 0.50 33.82 ? 230 HIS A CD2   1 
ATOM   696  C  CD2   B HIS A 1 88  ? -14.452 -12.432 18.890 0.50 30.96 ? 230 HIS A CD2   1 
ATOM   697  C  CE1   A HIS A 1 88  ? -17.791 -11.606 16.881 0.50 34.05 ? 230 HIS A CE1   1 
ATOM   698  C  CE1   B HIS A 1 88  ? -14.649 -10.924 20.469 0.50 30.40 ? 230 HIS A CE1   1 
ATOM   699  N  NE2   A HIS A 1 88  ? -18.121 -12.693 16.208 0.50 34.81 ? 230 HIS A NE2   1 
ATOM   700  N  NE2   B HIS A 1 88  ? -13.868 -11.344 19.490 0.50 30.36 ? 230 HIS A NE2   1 
ATOM   701  N  N     . ASP A 1 89  ? -18.911 -15.987 19.973 1.00 31.60 ? 231 ASP A N     1 
ATOM   702  C  CA    . ASP A 1 89  ? -20.180 -16.637 19.626 1.00 33.31 ? 231 ASP A CA    1 
ATOM   703  C  C     . ASP A 1 89  ? -21.181 -16.773 20.794 1.00 33.26 ? 231 ASP A C     1 
ATOM   704  O  O     . ASP A 1 89  ? -22.265 -17.274 20.580 1.00 34.91 ? 231 ASP A O     1 
ATOM   705  C  CB    . ASP A 1 89  ? -19.920 -18.043 19.050 1.00 34.13 ? 231 ASP A CB    1 
ATOM   706  C  CG    . ASP A 1 89  ? -19.160 -18.021 17.744 1.00 37.18 ? 231 ASP A CG    1 
ATOM   707  O  OD1   . ASP A 1 89  ? -19.022 -16.932 17.138 1.00 39.20 ? 231 ASP A OD1   1 
ATOM   708  O  OD2   . ASP A 1 89  ? -18.692 -19.110 17.320 1.00 40.29 ? 231 ASP A OD2   1 
ATOM   709  N  N     . TYR A 1 90  ? -20.810 -16.397 22.019 1.00 32.09 ? 232 TYR A N     1 
ATOM   710  C  CA    . TYR A 1 90  ? -21.738 -16.421 23.152 1.00 32.71 ? 232 TYR A CA    1 
ATOM   711  C  C     . TYR A 1 90  ? -22.625 -15.173 23.129 1.00 34.37 ? 232 TYR A C     1 
ATOM   712  O  O     . TYR A 1 90  ? -22.128 -14.059 22.955 1.00 33.94 ? 232 TYR A O     1 
ATOM   713  C  CB    . TYR A 1 90  ? -20.979 -16.497 24.487 1.00 31.18 ? 232 TYR A CB    1 
ATOM   714  C  CG    . TYR A 1 90  ? -21.852 -16.408 25.732 1.00 30.84 ? 232 TYR A CG    1 
ATOM   715  C  CD1   . TYR A 1 90  ? -22.287 -17.557 26.386 1.00 31.16 ? 232 TYR A CD1   1 
ATOM   716  C  CD2   . TYR A 1 90  ? -22.219 -15.176 26.258 1.00 30.19 ? 232 TYR A CD2   1 
ATOM   717  C  CE1   . TYR A 1 90  ? -23.070 -17.479 27.530 1.00 31.87 ? 232 TYR A CE1   1 
ATOM   718  C  CE2   . TYR A 1 90  ? -22.999 -15.085 27.396 1.00 32.53 ? 232 TYR A CE2   1 
ATOM   719  C  CZ    . TYR A 1 90  ? -23.424 -16.237 28.029 1.00 32.22 ? 232 TYR A CZ    1 
ATOM   720  O  OH    . TYR A 1 90  ? -24.206 -16.141 29.154 1.00 34.28 ? 232 TYR A OH    1 
ATOM   721  N  N     . GLN A 1 91  ? -23.929 -15.377 23.315 1.00 36.31 ? 233 GLN A N     1 
ATOM   722  C  CA    . GLN A 1 91  ? -24.905 -14.295 23.385 1.00 38.86 ? 233 GLN A CA    1 
ATOM   723  C  C     . GLN A 1 91  ? -25.925 -14.577 24.493 1.00 40.00 ? 233 GLN A C     1 
ATOM   724  O  O     . GLN A 1 91  ? -26.452 -15.693 24.583 1.00 40.48 ? 233 GLN A O     1 
ATOM   725  C  CB    . GLN A 1 91  ? -25.660 -14.177 22.061 1.00 41.41 ? 233 GLN A CB    1 
ATOM   726  C  CG    . GLN A 1 91  ? -24.824 -13.665 20.888 1.00 43.71 ? 233 GLN A CG    1 
ATOM   727  C  CD    . GLN A 1 91  ? -24.569 -12.166 20.951 1.00 47.60 ? 233 GLN A CD    1 
ATOM   728  O  OE1   . GLN A 1 91  ? -25.390 -11.403 21.475 1.00 51.25 ? 233 GLN A OE1   1 
ATOM   729  N  NE2   . GLN A 1 91  ? -23.430 -11.732 20.402 1.00 48.09 ? 233 GLN A NE2   1 
ATOM   730  N  N     . PRO A 1 92  ? -26.231 -13.564 25.326 1.00 40.77 ? 234 PRO A N     1 
ATOM   731  C  CA    . PRO A 1 92  ? -27.284 -13.738 26.327 1.00 41.95 ? 234 PRO A CA    1 
ATOM   732  C  C     . PRO A 1 92  ? -28.654 -13.758 25.661 1.00 44.27 ? 234 PRO A C     1 
ATOM   733  O  O     . PRO A 1 92  ? -28.783 -13.316 24.522 1.00 45.23 ? 234 PRO A O     1 
ATOM   734  C  CB    . PRO A 1 92  ? -27.120 -12.509 27.228 1.00 42.56 ? 234 PRO A CB    1 
ATOM   735  C  CG    . PRO A 1 92  ? -26.503 -11.477 26.363 1.00 42.78 ? 234 PRO A CG    1 
ATOM   736  C  CD    . PRO A 1 92  ? -25.633 -12.216 25.378 1.00 40.84 ? 234 PRO A CD    1 
ATOM   737  N  N     . LEU A 1 93  ? -29.662 -14.287 26.346 1.00 45.40 ? 235 LEU A N     1 
ATOM   738  C  CA    . LEU A 1 93  ? -30.991 -14.404 25.750 1.00 48.30 ? 235 LEU A CA    1 
ATOM   739  C  C     . LEU A 1 93  ? -31.596 -13.013 25.482 1.00 50.14 ? 235 LEU A C     1 
ATOM   740  O  O     . LEU A 1 93  ? -31.214 -12.038 26.141 1.00 49.08 ? 235 LEU A O     1 
ATOM   741  C  CB    . LEU A 1 93  ? -31.914 -15.263 26.629 1.00 49.98 ? 235 LEU A CB    1 
ATOM   742  C  CG    . LEU A 1 93  ? -31.590 -16.770 26.626 1.00 49.66 ? 235 LEU A CG    1 
ATOM   743  C  CD1   . LEU A 1 93  ? -32.278 -17.488 27.779 1.00 51.01 ? 235 LEU A CD1   1 
ATOM   744  C  CD2   . LEU A 1 93  ? -31.978 -17.405 25.287 1.00 51.06 ? 235 LEU A CD2   1 
ATOM   745  N  N     . PRO A 1 94  ? -32.518 -12.914 24.497 1.00 52.24 ? 236 PRO A N     1 
ATOM   746  C  CA    . PRO A 1 94  ? -33.072 -11.615 24.080 1.00 54.55 ? 236 PRO A CA    1 
ATOM   747  C  C     . PRO A 1 94  ? -33.837 -10.883 25.190 1.00 56.23 ? 236 PRO A C     1 
ATOM   748  O  O     . PRO A 1 94  ? -34.723 -11.467 25.819 1.00 57.69 ? 236 PRO A O     1 
ATOM   749  C  CB    . PRO A 1 94  ? -34.022 -11.982 22.925 1.00 57.27 ? 236 PRO A CB    1 
ATOM   750  C  CG    . PRO A 1 94  ? -33.606 -13.339 22.483 1.00 55.74 ? 236 PRO A CG    1 
ATOM   751  C  CD    . PRO A 1 94  ? -33.091 -14.021 23.710 1.00 53.55 ? 236 PRO A CD    1 
ATOM   752  N  N     . GLY A 1 95  ? -33.487 -9.615  25.415 1.00 56.03 ? 237 GLY A N     1 
ATOM   753  C  CA    . GLY A 1 95  ? -34.097 -8.806  26.474 1.00 57.83 ? 237 GLY A CA    1 
ATOM   754  C  C     . GLY A 1 95  ? -33.531 -9.024  27.873 1.00 55.51 ? 237 GLY A C     1 
ATOM   755  O  O     . GLY A 1 95  ? -34.068 -8.492  28.844 1.00 56.97 ? 237 GLY A O     1 
ATOM   756  N  N     . ALA A 1 96  ? -32.444 -9.791  27.981 1.00 46.62 ? 258 ALA A N     1 
ATOM   757  C  CA    . ALA A 1 96  ? -31.831 -10.097 29.279 1.00 47.68 ? 258 ALA A CA    1 
ATOM   758  C  C     . ALA A 1 96  ? -31.356 -8.849  30.032 1.00 44.72 ? 258 ALA A C     1 
ATOM   759  O  O     . ALA A 1 96  ? -31.396 -8.822  31.259 1.00 45.07 ? 258 ALA A O     1 
ATOM   760  C  CB    . ALA A 1 96  ? -30.665 -11.067 29.100 1.00 50.95 ? 258 ALA A CB    1 
ATOM   761  N  N     . HIS A 1 97  ? -30.890 -7.835  29.300 1.00 42.23 ? 259 HIS A N     1 
ATOM   762  C  CA    . HIS A 1 97  ? -30.342 -6.620  29.905 1.00 39.98 ? 259 HIS A CA    1 
ATOM   763  C  C     . HIS A 1 97  ? -30.989 -5.350  29.340 1.00 36.84 ? 259 HIS A C     1 
ATOM   764  O  O     . HIS A 1 97  ? -30.322 -4.340  29.118 1.00 34.89 ? 259 HIS A O     1 
ATOM   765  C  CB    . HIS A 1 97  ? -28.818 -6.590  29.728 1.00 40.93 ? 259 HIS A CB    1 
ATOM   766  C  CG    . HIS A 1 97  ? -28.132 -7.795  30.290 1.00 44.74 ? 259 HIS A CG    1 
ATOM   767  N  ND1   . HIS A 1 97  ? -27.854 -8.914  29.534 1.00 48.03 ? 259 HIS A ND1   1 
ATOM   768  C  CD2   . HIS A 1 97  ? -27.700 -8.070  31.543 1.00 46.04 ? 259 HIS A CD2   1 
ATOM   769  C  CE1   . HIS A 1 97  ? -27.270 -9.822  30.294 1.00 50.77 ? 259 HIS A CE1   1 
ATOM   770  N  NE2   . HIS A 1 97  ? -27.168 -9.336  31.519 1.00 50.18 ? 259 HIS A NE2   1 
ATOM   771  N  N     . LYS A 1 98  ? -32.301 -5.406  29.141 1.00 36.36 ? 260 LYS A N     1 
ATOM   772  C  CA    . LYS A 1 98  ? -33.065 -4.278  28.611 1.00 34.34 ? 260 LYS A CA    1 
ATOM   773  C  C     . LYS A 1 98  ? -33.100 -3.156  29.632 1.00 32.50 ? 260 LYS A C     1 
ATOM   774  O  O     . LYS A 1 98  ? -33.276 -3.414  30.825 1.00 32.99 ? 260 LYS A O     1 
ATOM   775  C  CB    . LYS A 1 98  ? -34.495 -4.737  28.278 1.00 34.87 ? 260 LYS A CB    1 
ATOM   776  C  CG    . LYS A 1 98  ? -35.358 -3.713  27.551 1.00 32.97 ? 260 LYS A CG    1 
ATOM   777  C  CD    . LYS A 1 98  ? -36.637 -4.388  27.078 1.00 34.97 ? 260 LYS A CD    1 
ATOM   778  C  CE    . LYS A 1 98  ? -37.512 -3.454  26.290 1.00 34.82 ? 260 LYS A CE    1 
ATOM   779  N  NZ    . LYS A 1 98  ? -38.574 -4.222  25.581 1.00 36.33 ? 260 LYS A NZ    1 
ATOM   780  N  N     . LEU A 1 99  ? -32.910 -1.924  29.159 1.00 30.86 ? 261 LEU A N     1 
ATOM   781  C  CA    . LEU A 1 99  ? -32.938 -0.725  29.999 1.00 30.00 ? 261 LEU A CA    1 
ATOM   782  C  C     . LEU A 1 99  ? -34.156 0.169   29.716 1.00 28.51 ? 261 LEU A C     1 
ATOM   783  O  O     . LEU A 1 99  ? -34.601 0.279   28.585 1.00 28.19 ? 261 LEU A O     1 
ATOM   784  C  CB    . LEU A 1 99  ? -31.669 0.114   29.781 1.00 29.88 ? 261 LEU A CB    1 
ATOM   785  C  CG    . LEU A 1 99  ? -30.335 -0.413  30.321 1.00 31.83 ? 261 LEU A CG    1 
ATOM   786  C  CD1   . LEU A 1 99  ? -29.257 0.554   29.938 1.00 31.78 ? 261 LEU A CD1   1 
ATOM   787  C  CD2   . LEU A 1 99  ? -30.353 -0.620  31.836 1.00 33.07 ? 261 LEU A CD2   1 
ATOM   788  N  N     . PHE A 1 100 ? -34.678 0.792   30.769 1.00 28.34 ? 262 PHE A N     1 
ATOM   789  C  CA    . PHE A 1 100 ? -35.694 1.845   30.670 1.00 27.96 ? 262 PHE A CA    1 
ATOM   790  C  C     . PHE A 1 100 ? -35.001 3.198   30.854 1.00 27.73 ? 262 PHE A C     1 
ATOM   791  O  O     . PHE A 1 100 ? -34.250 3.374   31.812 1.00 28.47 ? 262 PHE A O     1 
ATOM   792  C  CB    . PHE A 1 100 ? -36.754 1.632   31.750 1.00 28.28 ? 262 PHE A CB    1 
ATOM   793  C  CG    . PHE A 1 100 ? -37.718 2.785   31.929 1.00 28.04 ? 262 PHE A CG    1 
ATOM   794  C  CD1   . PHE A 1 100 ? -38.791 2.951   31.070 1.00 27.05 ? 262 PHE A CD1   1 
ATOM   795  C  CD2   . PHE A 1 100 ? -37.566 3.685   32.989 1.00 28.45 ? 262 PHE A CD2   1 
ATOM   796  C  CE1   . PHE A 1 100 ? -39.698 3.994   31.240 1.00 28.00 ? 262 PHE A CE1   1 
ATOM   797  C  CE2   . PHE A 1 100 ? -38.471 4.744   33.165 1.00 29.27 ? 262 PHE A CE2   1 
ATOM   798  C  CZ    . PHE A 1 100 ? -39.538 4.896   32.291 1.00 28.72 ? 262 PHE A CZ    1 
ATOM   799  N  N     . ILE A 1 101 ? -35.253 4.137   29.939 1.00 27.73 ? 263 ILE A N     1 
ATOM   800  C  CA    . ILE A 1 101 ? -34.756 5.522   30.038 1.00 27.96 ? 263 ILE A CA    1 
ATOM   801  C  C     . ILE A 1 101 ? -35.920 6.503   30.216 1.00 28.26 ? 263 ILE A C     1 
ATOM   802  O  O     . ILE A 1 101 ? -36.738 6.644   29.321 1.00 27.52 ? 263 ILE A O     1 
ATOM   803  C  CB    . ILE A 1 101 ? -33.978 5.961   28.759 1.00 28.59 ? 263 ILE A CB    1 
ATOM   804  C  CG1   . ILE A 1 101 ? -33.145 4.803   28.174 1.00 30.06 ? 263 ILE A CG1   1 
ATOM   805  C  CG2   . ILE A 1 101 ? -33.141 7.218   29.039 1.00 28.68 ? 263 ILE A CG2   1 
ATOM   806  C  CD1   . ILE A 1 101 ? -32.129 4.216   29.139 1.00 33.17 ? 263 ILE A CD1   1 
ATOM   807  N  N     . GLY A 1 102 ? -35.961 7.198   31.357 1.00 29.00 ? 264 GLY A N     1 
ATOM   808  C  CA    . GLY A 1 102 ? -37.020 8.147   31.679 1.00 30.33 ? 264 GLY A CA    1 
ATOM   809  C  C     . GLY A 1 102 ? -36.519 9.561   31.963 1.00 31.72 ? 264 GLY A C     1 
ATOM   810  O  O     . GLY A 1 102 ? -35.349 9.770   32.318 1.00 31.59 ? 264 GLY A O     1 
ATOM   811  N  N     . GLY A 1 103 ? -37.416 10.528  31.783 1.00 32.81 ? 265 GLY A N     1 
ATOM   812  C  CA    . GLY A 1 103 ? -37.117 11.939  32.016 1.00 35.28 ? 265 GLY A CA    1 
ATOM   813  C  C     . GLY A 1 103 ? -36.455 12.660  30.851 1.00 35.77 ? 265 GLY A C     1 
ATOM   814  O  O     . GLY A 1 103 ? -35.665 13.581  31.072 1.00 37.25 ? 265 GLY A O     1 
ATOM   815  N  N     . LEU A 1 104 ? -36.775 12.254  29.620 1.00 35.13 ? 266 LEU A N     1 
ATOM   816  C  CA    . LEU A 1 104 ? -36.234 12.904  28.417 1.00 36.30 ? 266 LEU A CA    1 
ATOM   817  C  C     . LEU A 1 104 ? -37.136 14.066  27.972 1.00 38.81 ? 266 LEU A C     1 
ATOM   818  O  O     . LEU A 1 104 ? -38.357 13.991  28.101 1.00 39.02 ? 266 LEU A O     1 
ATOM   819  C  CB    . LEU A 1 104 ? -36.101 11.889  27.267 1.00 34.87 ? 266 LEU A CB    1 
ATOM   820  C  CG    . LEU A 1 104 ? -35.208 10.656  27.480 1.00 33.47 ? 266 LEU A CG    1 
ATOM   821  C  CD1   . LEU A 1 104 ? -35.444 9.620   26.379 1.00 32.00 ? 266 LEU A CD1   1 
ATOM   822  C  CD2   . LEU A 1 104 ? -33.737 11.029  27.555 1.00 32.28 ? 266 LEU A CD2   1 
ATOM   823  N  N     . PRO A 1 105 ? -36.541 15.157  27.464 1.00 41.15 ? 267 PRO A N     1 
ATOM   824  C  CA    . PRO A 1 105 ? -37.357 16.195  26.825 1.00 44.23 ? 267 PRO A CA    1 
ATOM   825  C  C     . PRO A 1 105 ? -38.172 15.645  25.653 1.00 44.14 ? 267 PRO A C     1 
ATOM   826  O  O     . PRO A 1 105 ? -37.618 14.979  24.782 1.00 43.07 ? 267 PRO A O     1 
ATOM   827  C  CB    . PRO A 1 105 ? -36.313 17.203  26.330 1.00 46.40 ? 267 PRO A CB    1 
ATOM   828  C  CG    . PRO A 1 105 ? -35.118 16.968  27.188 1.00 44.59 ? 267 PRO A CG    1 
ATOM   829  C  CD    . PRO A 1 105 ? -35.111 15.517  27.480 1.00 41.67 ? 267 PRO A CD    1 
ATOM   830  N  N     . ASN A 1 106 ? -39.474 15.926  25.635 1.00 45.85 ? 268 ASN A N     1 
ATOM   831  C  CA    . ASN A 1 106 ? -40.378 15.340  24.636 1.00 46.04 ? 268 ASN A CA    1 
ATOM   832  C  C     . ASN A 1 106 ? -40.312 15.959  23.228 1.00 48.48 ? 268 ASN A C     1 
ATOM   833  O  O     . ASN A 1 106 ? -41.037 15.524  22.330 1.00 48.74 ? 268 ASN A O     1 
ATOM   834  C  CB    . ASN A 1 106 ? -41.828 15.341  25.152 1.00 47.37 ? 268 ASN A CB    1 
ATOM   835  C  CG    . ASN A 1 106 ? -42.309 16.719  25.548 1.00 51.92 ? 268 ASN A CG    1 
ATOM   836  O  OD1   . ASN A 1 106 ? -42.228 17.669  24.771 1.00 57.44 ? 268 ASN A OD1   1 
ATOM   837  N  ND2   . ASN A 1 106 ? -42.813 16.836  26.772 1.00 54.88 ? 268 ASN A ND2   1 
ATOM   838  N  N     . TYR A 1 107 ? -39.458 16.963  23.032 1.00 50.30 ? 269 TYR A N     1 
ATOM   839  C  CA    . TYR A 1 107 ? -39.280 17.570  21.701 1.00 53.29 ? 269 TYR A CA    1 
ATOM   840  C  C     . TYR A 1 107 ? -38.130 16.933  20.905 1.00 51.94 ? 269 TYR A C     1 
ATOM   841  O  O     . TYR A 1 107 ? -37.964 17.229  19.724 1.00 53.95 ? 269 TYR A O     1 
ATOM   842  C  CB    . TYR A 1 107 ? -39.113 19.097  21.783 1.00 57.42 ? 269 TYR A CB    1 
ATOM   843  C  CG    . TYR A 1 107 ? -38.135 19.603  22.823 1.00 57.05 ? 269 TYR A CG    1 
ATOM   844  C  CD1   . TYR A 1 107 ? -36.766 19.658  22.561 1.00 57.12 ? 269 TYR A CD1   1 
ATOM   845  C  CD2   . TYR A 1 107 ? -38.585 20.050  24.063 1.00 57.47 ? 269 TYR A CD2   1 
ATOM   846  C  CE1   . TYR A 1 107 ? -35.865 20.138  23.521 1.00 57.17 ? 269 TYR A CE1   1 
ATOM   847  C  CE2   . TYR A 1 107 ? -37.700 20.529  25.025 1.00 57.66 ? 269 TYR A CE2   1 
ATOM   848  C  CZ    . TYR A 1 107 ? -36.345 20.572  24.750 1.00 57.62 ? 269 TYR A CZ    1 
ATOM   849  O  OH    . TYR A 1 107 ? -35.482 21.047  25.710 1.00 58.00 ? 269 TYR A OH    1 
ATOM   850  N  N     . LEU A 1 108 ? -37.360 16.051  21.547 1.00 48.56 ? 270 LEU A N     1 
ATOM   851  C  CA    . LEU A 1 108 ? -36.248 15.348  20.891 1.00 47.71 ? 270 LEU A CA    1 
ATOM   852  C  C     . LEU A 1 108 ? -36.724 14.102  20.126 1.00 46.50 ? 270 LEU A C     1 
ATOM   853  O  O     . LEU A 1 108 ? -37.541 13.327  20.633 1.00 44.45 ? 270 LEU A O     1 
ATOM   854  C  CB    . LEU A 1 108 ? -35.200 14.927  21.931 1.00 45.06 ? 270 LEU A CB    1 
ATOM   855  C  CG    . LEU A 1 108 ? -34.475 16.061  22.658 1.00 46.63 ? 270 LEU A CG    1 
ATOM   856  C  CD1   . LEU A 1 108 ? -33.725 15.524  23.859 1.00 44.38 ? 270 LEU A CD1   1 
ATOM   857  C  CD2   . LEU A 1 108 ? -33.532 16.797  21.721 1.00 49.07 ? 270 LEU A CD2   1 
ATOM   858  N  N     . ASN A 1 109 ? -36.197 13.907  18.916 1.00 48.15 ? 271 ASN A N     1 
ATOM   859  C  CA    . ASN A 1 109 ? -36.550 12.740  18.096 1.00 47.97 ? 271 ASN A CA    1 
ATOM   860  C  C     . ASN A 1 109 ? -35.700 11.515  18.454 1.00 45.45 ? 271 ASN A C     1 
ATOM   861  O  O     . ASN A 1 109 ? -34.867 11.581  19.355 1.00 43.67 ? 271 ASN A O     1 
ATOM   862  C  CB    . ASN A 1 109 ? -36.472 13.070  16.591 1.00 51.45 ? 271 ASN A CB    1 
ATOM   863  C  CG    . ASN A 1 109 ? -35.056 13.380  16.115 1.00 53.07 ? 271 ASN A CG    1 
ATOM   864  O  OD1   . ASN A 1 109 ? -34.072 12.875  16.659 1.00 51.70 ? 271 ASN A OD1   1 
ATOM   865  N  ND2   . ASN A 1 109 ? -34.953 14.213  15.083 1.00 56.10 ? 271 ASN A ND2   1 
ATOM   866  N  N     . ASP A 1 110 ? -35.937 10.406  17.753 1.00 45.68 ? 272 ASP A N     1 
ATOM   867  C  CA    . ASP A 1 110 ? -35.244 9.135   17.999 1.00 43.94 ? 272 ASP A CA    1 
ATOM   868  C  C     . ASP A 1 110 ? -33.719 9.237   17.919 1.00 43.90 ? 272 ASP A C     1 
ATOM   869  O  O     . ASP A 1 110 ? -33.016 8.812   18.831 1.00 41.71 ? 272 ASP A O     1 
ATOM   870  C  CB    . ASP A 1 110 ? -35.723 8.069   17.002 1.00 45.45 ? 272 ASP A CB    1 
ATOM   871  C  CG    . ASP A 1 110 ? -37.185 7.697   17.199 1.00 47.18 ? 272 ASP A CG    1 
ATOM   872  O  OD1   . ASP A 1 110 ? -37.562 6.537   16.917 1.00 50.12 ? 272 ASP A OD1   1 
ATOM   873  O  OD2   . ASP A 1 110 ? -37.965 8.567   17.645 1.00 50.94 ? 272 ASP A OD2   1 
ATOM   874  N  N     . ASP A 1 111 ? -33.215 9.799   16.829 1.00 46.58 ? 273 ASP A N     1 
ATOM   875  C  CA    . ASP A 1 111 ? -31.767 9.846   16.586 1.00 47.64 ? 273 ASP A CA    1 
ATOM   876  C  C     . ASP A 1 111 ? -31.020 10.761  17.573 1.00 46.48 ? 273 ASP A C     1 
ATOM   877  O  O     . ASP A 1 111 ? -29.884 10.468  17.967 1.00 45.37 ? 273 ASP A O     1 
ATOM   878  C  CB    . ASP A 1 111 ? -31.487 10.260  15.142 1.00 51.61 ? 273 ASP A CB    1 
ATOM   879  C  CG    . ASP A 1 111 ? -32.067 9.271   14.132 1.00 54.63 ? 273 ASP A CG    1 
ATOM   880  O  OD1   . ASP A 1 111 ? -31.281 8.646   13.390 1.00 58.45 ? 273 ASP A OD1   1 
ATOM   881  O  OD2   . ASP A 1 111 ? -33.311 9.109   14.087 1.00 56.23 ? 273 ASP A OD2   1 
ATOM   882  N  N     . GLN A 1 112 ? -31.666 11.857  17.967 1.00 46.72 ? 274 GLN A N     1 
ATOM   883  C  CA    . GLN A 1 112 ? -31.131 12.747  18.998 1.00 46.28 ? 274 GLN A CA    1 
ATOM   884  C  C     . GLN A 1 112 ? -31.035 12.050  20.364 1.00 42.85 ? 274 GLN A C     1 
ATOM   885  O  O     . GLN A 1 112 ? -30.087 12.286  21.117 1.00 41.69 ? 274 GLN A O     1 
ATOM   886  C  CB    . GLN A 1 112 ? -31.980 14.020  19.100 1.00 48.02 ? 274 GLN A CB    1 
ATOM   887  C  CG    . GLN A 1 112 ? -31.858 14.934  17.883 1.00 51.99 ? 274 GLN A CG    1 
ATOM   888  C  CD    . GLN A 1 112 ? -32.910 16.033  17.840 1.00 54.49 ? 274 GLN A CD    1 
ATOM   889  O  OE1   . GLN A 1 112 ? -34.012 15.876  18.361 1.00 54.71 ? 274 GLN A OE1   1 
ATOM   890  N  NE2   . GLN A 1 112 ? -32.577 17.146  17.200 1.00 57.77 ? 274 GLN A NE2   1 
ATOM   891  N  N     . VAL A 1 113 ? -32.006 11.190  20.680 1.00 41.05 ? 275 VAL A N     1 
ATOM   892  C  CA    . VAL A 1 113 ? -31.960 10.413  21.929 1.00 38.73 ? 275 VAL A CA    1 
ATOM   893  C  C     . VAL A 1 113 ? -30.925 9.269   21.841 1.00 38.36 ? 275 VAL A C     1 
ATOM   894  O  O     . VAL A 1 113 ? -30.201 8.993   22.811 1.00 37.13 ? 275 VAL A O     1 
ATOM   895  C  CB    . VAL A 1 113 ? -33.357 9.858   22.321 1.00 37.38 ? 275 VAL A CB    1 
ATOM   896  C  CG1   . VAL A 1 113 ? -33.246 8.917   23.523 1.00 34.42 ? 275 VAL A CG1   1 
ATOM   897  C  CG2   . VAL A 1 113 ? -34.335 11.002  22.626 1.00 37.53 ? 275 VAL A CG2   1 
ATOM   898  N  N     . LYS A 1 114 ? -30.854 8.617   20.681 1.00 39.95 ? 276 LYS A N     1 
ATOM   899  C  CA    . LYS A 1 114 ? -29.848 7.572   20.420 1.00 40.65 ? 276 LYS A CA    1 
ATOM   900  C  C     . LYS A 1 114 ? -28.410 8.079   20.543 1.00 41.82 ? 276 LYS A C     1 
ATOM   901  O  O     . LYS A 1 114 ? -27.502 7.304   20.863 1.00 41.89 ? 276 LYS A O     1 
ATOM   902  C  CB    . LYS A 1 114 ? -30.035 6.962   19.024 1.00 42.51 ? 276 LYS A CB    1 
ATOM   903  C  CG    . LYS A 1 114 ? -30.846 5.689   19.014 1.00 42.37 ? 276 LYS A CG    1 
ATOM   904  C  CD    . LYS A 1 114 ? -30.902 5.063   17.617 1.00 45.06 ? 276 LYS A CD    1 
ATOM   905  C  CE    . LYS A 1 114 ? -31.932 5.757   16.716 1.00 47.43 ? 276 LYS A CE    1 
ATOM   906  N  NZ    . LYS A 1 114 ? -32.266 4.950   15.496 1.00 50.36 ? 276 LYS A NZ    1 
ATOM   907  N  N     . GLU A 1 115 ? -28.209 9.368   20.273 1.00 43.37 ? 277 GLU A N     1 
ATOM   908  C  CA    . GLU A 1 115 ? -26.899 9.997   20.382 1.00 44.58 ? 277 GLU A CA    1 
ATOM   909  C  C     . GLU A 1 115 ? -26.345 9.897   21.811 1.00 42.90 ? 277 GLU A C     1 
ATOM   910  O  O     . GLU A 1 115 ? -25.182 9.534   22.010 1.00 43.76 ? 277 GLU A O     1 
ATOM   911  C  CB    . GLU A 1 115 ? -26.985 11.462  19.926 1.00 46.80 ? 277 GLU A CB    1 
ATOM   912  C  CG    . GLU A 1 115 ? -25.654 12.182  19.840 1.00 49.06 ? 277 GLU A CG    1 
ATOM   913  C  CD    . GLU A 1 115 ? -25.731 13.505  19.072 1.00 52.87 ? 277 GLU A CD    1 
ATOM   914  O  OE1   . GLU A 1 115 ? -26.853 14.007  18.830 1.00 55.51 ? 277 GLU A OE1   1 
ATOM   915  O  OE2   . GLU A 1 115 ? -24.663 14.046  18.715 1.00 55.57 ? 277 GLU A OE2   1 
ATOM   916  N  N     . LEU A 1 116 ? -27.177 10.198  22.802 1.00 40.93 ? 278 LEU A N     1 
ATOM   917  C  CA    . LEU A 1 116 ? -26.749 10.139  24.200 1.00 39.40 ? 278 LEU A CA    1 
ATOM   918  C  C     . LEU A 1 116 ? -26.342 8.714   24.603 1.00 37.91 ? 278 LEU A C     1 
ATOM   919  O  O     . LEU A 1 116 ? -25.355 8.514   25.306 1.00 38.38 ? 278 LEU A O     1 
ATOM   920  C  CB    . LEU A 1 116 ? -27.860 10.664  25.119 1.00 38.44 ? 278 LEU A CB    1 
ATOM   921  C  CG    . LEU A 1 116 ? -27.529 10.879  26.600 1.00 38.13 ? 278 LEU A CG    1 
ATOM   922  C  CD1   . LEU A 1 116 ? -26.384 11.865  26.784 1.00 39.62 ? 278 LEU A CD1   1 
ATOM   923  C  CD2   . LEU A 1 116 ? -28.755 11.352  27.353 1.00 37.85 ? 278 LEU A CD2   1 
ATOM   924  N  N     . LEU A 1 117 ? -27.089 7.728   24.126 1.00 36.98 ? 279 LEU A N     1 
ATOM   925  C  CA    . LEU A 1 117 ? -26.910 6.326   24.541 1.00 35.79 ? 279 LEU A CA    1 
ATOM   926  C  C     . LEU A 1 117 ? -25.711 5.627   23.893 1.00 36.77 ? 279 LEU A C     1 
ATOM   927  O  O     . LEU A 1 117 ? -25.001 4.863   24.551 1.00 36.53 ? 279 LEU A O     1 
ATOM   928  C  CB    . LEU A 1 117 ? -28.172 5.534   24.228 1.00 34.92 ? 279 LEU A CB    1 
ATOM   929  C  CG    . LEU A 1 117 ? -29.438 6.014   24.926 1.00 34.79 ? 279 LEU A CG    1 
ATOM   930  C  CD1   . LEU A 1 117 ? -30.635 5.209   24.406 1.00 34.22 ? 279 LEU A CD1   1 
ATOM   931  C  CD2   . LEU A 1 117 ? -29.304 5.867   26.444 1.00 34.76 ? 279 LEU A CD2   1 
ATOM   932  N  N     . THR A 1 118 ? -25.495 5.897   22.608 1.00 37.85 ? 280 THR A N     1 
ATOM   933  C  CA    . THR A 1 118 ? -24.424 5.266   21.848 1.00 39.49 ? 280 THR A CA    1 
ATOM   934  C  C     . THR A 1 118 ? -23.025 5.808   22.187 1.00 40.02 ? 280 THR A C     1 
ATOM   935  O  O     . THR A 1 118 ? -22.023 5.257   21.739 1.00 41.39 ? 280 THR A O     1 
ATOM   936  C  CB    . THR A 1 118 ? -24.693 5.358   20.328 1.00 41.45 ? 280 THR A CB    1 
ATOM   937  O  OG1   . THR A 1 118 ? -24.823 6.728   19.945 1.00 43.55 ? 280 THR A OG1   1 
ATOM   938  C  CG2   . THR A 1 118 ? -25.980 4.628   19.972 1.00 40.22 ? 280 THR A CG2   1 
ATOM   939  N  N     . SER A 1 119 ? -22.950 6.866   22.995 1.00 38.96 ? 281 SER A N     1 
ATOM   940  C  CA    . SER A 1 119 ? -21.668 7.341   23.505 1.00 39.59 ? 281 SER A CA    1 
ATOM   941  C  C     . SER A 1 119 ? -20.976 6.319   24.429 1.00 38.94 ? 281 SER A C     1 
ATOM   942  O  O     . SER A 1 119 ? -19.756 6.354   24.582 1.00 40.31 ? 281 SER A O     1 
ATOM   943  C  CB    . SER A 1 119 ? -21.825 8.702   24.211 1.00 39.25 ? 281 SER A CB    1 
ATOM   944  O  OG    . SER A 1 119 ? -22.521 8.594   25.432 1.00 36.91 ? 281 SER A OG    1 
ATOM   945  N  N     . PHE A 1 120 ? -21.751 5.421   25.032 1.00 37.24 ? 282 PHE A N     1 
ATOM   946  C  CA    . PHE A 1 120 ? -21.208 4.343   25.868 1.00 37.73 ? 282 PHE A CA    1 
ATOM   947  C  C     . PHE A 1 120 ? -20.869 3.075   25.069 1.00 39.36 ? 282 PHE A C     1 
ATOM   948  O  O     . PHE A 1 120 ? -20.096 2.242   25.533 1.00 41.01 ? 282 PHE A O     1 
ATOM   949  C  CB    . PHE A 1 120 ? -22.191 3.990   26.992 1.00 35.87 ? 282 PHE A CB    1 
ATOM   950  C  CG    . PHE A 1 120 ? -22.427 5.114   27.956 1.00 34.80 ? 282 PHE A CG    1 
ATOM   951  C  CD1   . PHE A 1 120 ? -23.380 6.086   27.692 1.00 34.17 ? 282 PHE A CD1   1 
ATOM   952  C  CD2   . PHE A 1 120 ? -21.676 5.216   29.116 1.00 34.63 ? 282 PHE A CD2   1 
ATOM   953  C  CE1   . PHE A 1 120 ? -23.583 7.144   28.579 1.00 33.97 ? 282 PHE A CE1   1 
ATOM   954  C  CE2   . PHE A 1 120 ? -21.880 6.261   29.997 1.00 34.38 ? 282 PHE A CE2   1 
ATOM   955  C  CZ    . PHE A 1 120 ? -22.835 7.222   29.728 1.00 33.71 ? 282 PHE A CZ    1 
ATOM   956  N  N     . GLY A 1 121 ? -21.438 2.936   23.875 1.00 39.63 ? 283 GLY A N     1 
ATOM   957  C  CA    . GLY A 1 121 ? -21.188 1.769   23.017 1.00 41.42 ? 283 GLY A CA    1 
ATOM   958  C  C     . GLY A 1 121 ? -22.394 1.465   22.145 1.00 40.79 ? 283 GLY A C     1 
ATOM   959  O  O     . GLY A 1 121 ? -23.451 2.054   22.345 1.00 38.85 ? 283 GLY A O     1 
ATOM   960  N  N     . PRO A 1 122 ? -22.242 0.554   21.167 1.00 42.97 ? 284 PRO A N     1 
ATOM   961  C  CA    . PRO A 1 122 ? -23.319 0.233   20.216 1.00 43.47 ? 284 PRO A CA    1 
ATOM   962  C  C     . PRO A 1 122 ? -24.546 -0.477  20.816 1.00 41.67 ? 284 PRO A C     1 
ATOM   963  O  O     . PRO A 1 122 ? -24.424 -1.276  21.744 1.00 41.48 ? 284 PRO A O     1 
ATOM   964  C  CB    . PRO A 1 122 ? -22.626 -0.661  19.176 1.00 47.12 ? 284 PRO A CB    1 
ATOM   965  C  CG    . PRO A 1 122 ? -21.429 -1.209  19.854 1.00 48.49 ? 284 PRO A CG    1 
ATOM   966  C  CD    . PRO A 1 122 ? -21.009 -0.206  20.888 1.00 46.16 ? 284 PRO A CD    1 
ATOM   967  N  N     . LEU A 1 123 ? -25.718 -0.173  20.269 1.00 40.85 ? 285 LEU A N     1 
ATOM   968  C  CA    . LEU A 1 123 ? -26.975 -0.768  20.722 1.00 39.53 ? 285 LEU A CA    1 
ATOM   969  C  C     . LEU A 1 123 ? -27.412 -1.885  19.760 1.00 41.68 ? 285 LEU A C     1 
ATOM   970  O  O     . LEU A 1 123 ? -27.154 -1.811  18.555 1.00 43.59 ? 285 LEU A O     1 
ATOM   971  C  CB    . LEU A 1 123 ? -28.068 0.305   20.784 1.00 37.51 ? 285 LEU A CB    1 
ATOM   972  C  CG    . LEU A 1 123 ? -27.869 1.492   21.727 1.00 35.88 ? 285 LEU A CG    1 
ATOM   973  C  CD1   . LEU A 1 123 ? -28.880 2.582   21.404 1.00 35.93 ? 285 LEU A CD1   1 
ATOM   974  C  CD2   . LEU A 1 123 ? -27.996 1.058   23.180 1.00 33.92 ? 285 LEU A CD2   1 
ATOM   975  N  N     . LYS A 1 124 ? -28.083 -2.907  20.289 1.00 41.38 ? 286 LYS A N     1 
ATOM   976  C  CA    . LYS A 1 124 ? -28.711 -3.922  19.438 1.00 43.90 ? 286 LYS A CA    1 
ATOM   977  C  C     . LYS A 1 124 ? -30.241 -3.809  19.384 1.00 42.20 ? 286 LYS A C     1 
ATOM   978  O  O     . LYS A 1 124 ? -30.879 -4.547  18.658 1.00 44.03 ? 286 LYS A O     1 
ATOM   979  C  CB    . LYS A 1 124 ? -28.278 -5.338  19.842 1.00 46.29 ? 286 LYS A CB    1 
ATOM   980  C  CG    . LYS A 1 124 ? -28.636 -5.766  21.257 1.00 45.43 ? 286 LYS A CG    1 
ATOM   981  C  CD    . LYS A 1 124 ? -28.458 -7.276  21.400 1.00 48.50 ? 286 LYS A CD    1 
ATOM   982  C  CE    . LYS A 1 124 ? -28.365 -7.705  22.856 1.00 48.32 ? 286 LYS A CE    1 
ATOM   983  N  NZ    . LYS A 1 124 ? -28.148 -9.180  22.955 1.00 53.36 ? 286 LYS A NZ    1 
ATOM   984  N  N     . ALA A 1 125 ? -30.818 -2.893  20.157 1.00 39.28 ? 287 ALA A N     1 
ATOM   985  C  CA    . ALA A 1 125 ? -32.242 -2.564  20.049 1.00 37.93 ? 287 ALA A CA    1 
ATOM   986  C  C     . ALA A 1 125 ? -32.490 -1.202  20.676 1.00 34.81 ? 287 ALA A C     1 
ATOM   987  O  O     . ALA A 1 125 ? -31.763 -0.796  21.570 1.00 32.85 ? 287 ALA A O     1 
ATOM   988  C  CB    . ALA A 1 125 ? -33.109 -3.628  20.729 1.00 37.84 ? 287 ALA A CB    1 
ATOM   989  N  N     . PHE A 1 126 ? -33.526 -0.515  20.199 1.00 34.27 ? 288 PHE A N     1 
ATOM   990  C  CA    . PHE A 1 126 ? -33.902 0.802   20.703 1.00 32.66 ? 288 PHE A CA    1 
ATOM   991  C  C     . PHE A 1 126 ? -35.313 1.164   20.259 1.00 32.55 ? 288 PHE A C     1 
ATOM   992  O  O     . PHE A 1 126 ? -35.667 0.933   19.110 1.00 34.60 ? 288 PHE A O     1 
ATOM   993  C  CB    . PHE A 1 126 ? -32.925 1.878   20.202 1.00 33.05 ? 288 PHE A CB    1 
ATOM   994  C  CG    . PHE A 1 126 ? -33.334 3.291   20.570 1.00 32.07 ? 288 PHE A CG    1 
ATOM   995  C  CD1   . PHE A 1 126 ? -33.087 3.793   21.838 1.00 30.39 ? 288 PHE A CD1   1 
ATOM   996  C  CD2   . PHE A 1 126 ? -33.999 4.102   19.653 1.00 33.78 ? 288 PHE A CD2   1 
ATOM   997  C  CE1   . PHE A 1 126 ? -33.481 5.067   22.188 1.00 29.60 ? 288 PHE A CE1   1 
ATOM   998  C  CE2   . PHE A 1 126 ? -34.396 5.387   19.997 1.00 32.78 ? 288 PHE A CE2   1 
ATOM   999  C  CZ    . PHE A 1 126 ? -34.130 5.873   21.264 1.00 31.24 ? 288 PHE A CZ    1 
ATOM   1000 N  N     . ASN A 1 127 ? -36.115 1.725   21.163 1.00 30.96 ? 289 ASN A N     1 
ATOM   1001 C  CA    . ASN A 1 127 ? -37.372 2.356   20.768 1.00 31.45 ? 289 ASN A CA    1 
ATOM   1002 C  C     . ASN A 1 127 ? -37.794 3.522   21.673 1.00 30.27 ? 289 ASN A C     1 
ATOM   1003 O  O     . ASN A 1 127 ? -37.816 3.412   22.906 1.00 29.11 ? 289 ASN A O     1 
ATOM   1004 C  CB    . ASN A 1 127 ? -38.510 1.327   20.554 1.00 32.25 ? 289 ASN A CB    1 
ATOM   1005 C  CG    . ASN A 1 127 ? -39.052 0.734   21.842 1.00 30.80 ? 289 ASN A CG    1 
ATOM   1006 O  OD1   . ASN A 1 127 ? -38.379 -0.048  22.500 1.00 30.81 ? 289 ASN A OD1   1 
ATOM   1007 N  ND2   . ASN A 1 127 ? -40.314 1.042   22.161 1.00 29.95 ? 289 ASN A ND2   1 
ATOM   1008 N  N     . LEU A 1 128 ? -38.082 4.652   21.032 1.00 31.19 ? 290 LEU A N     1 
ATOM   1009 C  CA    . LEU A 1 128 ? -38.583 5.839   21.714 1.00 31.13 ? 290 LEU A CA    1 
ATOM   1010 C  C     . LEU A 1 128 ? -40.100 5.792   21.610 1.00 32.04 ? 290 LEU A C     1 
ATOM   1011 O  O     . LEU A 1 128 ? -40.641 5.764   20.508 1.00 34.04 ? 290 LEU A O     1 
ATOM   1012 C  CB    . LEU A 1 128 ? -38.019 7.115   21.069 1.00 32.28 ? 290 LEU A CB    1 
ATOM   1013 C  CG    . LEU A 1 128 ? -38.537 8.470   21.568 1.00 33.03 ? 290 LEU A CG    1 
ATOM   1014 C  CD1   . LEU A 1 128 ? -37.995 8.791   22.956 1.00 30.70 ? 290 LEU A CD1   1 
ATOM   1015 C  CD2   . LEU A 1 128 ? -38.180 9.579   20.574 1.00 34.53 ? 290 LEU A CD2   1 
ATOM   1016 N  N     . VAL A 1 129 ? -40.774 5.772   22.760 1.00 31.34 ? 291 VAL A N     1 
ATOM   1017 C  CA    . VAL A 1 129 ? -42.228 5.619   22.809 1.00 32.37 ? 291 VAL A CA    1 
ATOM   1018 C  C     . VAL A 1 129 ? -42.909 6.928   22.406 1.00 34.29 ? 291 VAL A C     1 
ATOM   1019 O  O     . VAL A 1 129 ? -42.614 7.994   22.964 1.00 34.32 ? 291 VAL A O     1 
ATOM   1020 C  CB    . VAL A 1 129 ? -42.717 5.184   24.216 1.00 31.00 ? 291 VAL A CB    1 
ATOM   1021 C  CG1   . VAL A 1 129 ? -44.224 5.042   24.229 1.00 31.93 ? 291 VAL A CG1   1 
ATOM   1022 C  CG2   . VAL A 1 129 ? -42.047 3.873   24.633 1.00 29.16 ? 291 VAL A CG2   1 
ATOM   1023 N  N     . LYS A 1 130 ? -43.817 6.826   21.438 1.00 36.58 ? 292 LYS A N     1 
ATOM   1024 C  CA    . LYS A 1 130 ? -44.507 7.974   20.860 1.00 39.51 ? 292 LYS A CA    1 
ATOM   1025 C  C     . LYS A 1 130 ? -46.006 7.736   20.834 1.00 41.23 ? 292 LYS A C     1 
ATOM   1026 O  O     . LYS A 1 130 ? -46.463 6.593   20.866 1.00 40.90 ? 292 LYS A O     1 
ATOM   1027 C  CB    . LYS A 1 130 ? -44.003 8.228   19.431 1.00 41.16 ? 292 LYS A CB    1 
ATOM   1028 C  CG    . LYS A 1 130 ? -42.516 8.579   19.368 1.00 40.77 ? 292 LYS A CG    1 
ATOM   1029 C  CD    . LYS A 1 130 ? -42.051 8.879   17.952 1.00 43.82 ? 292 LYS A CD    1 
ATOM   1030 C  CE    . LYS A 1 130 ? -41.618 7.626   17.219 1.00 45.26 ? 292 LYS A CE    1 
ATOM   1031 N  NZ    . LYS A 1 130 ? -40.338 7.056   17.762 1.00 43.81 ? 292 LYS A NZ    1 
ATOM   1032 N  N     . ASP A 1 131 ? -46.766 8.825   20.780 1.00 43.94 ? 293 ASP A N     1 
ATOM   1033 C  CA    . ASP A 1 131 ? -48.204 8.761   20.566 1.00 46.02 ? 293 ASP A CA    1 
ATOM   1034 C  C     . ASP A 1 131 ? -48.437 8.479   19.087 1.00 48.50 ? 293 ASP A C     1 
ATOM   1035 O  O     . ASP A 1 131 ? -48.098 9.308   18.241 1.00 50.52 ? 293 ASP A O     1 
ATOM   1036 C  CB    . ASP A 1 131 ? -48.859 10.085  20.964 1.00 48.22 ? 293 ASP A CB    1 
ATOM   1037 C  CG    . ASP A 1 131 ? -50.357 10.094  20.721 1.00 51.40 ? 293 ASP A CG    1 
ATOM   1038 O  OD1   . ASP A 1 131 ? -50.793 10.459  19.605 1.00 55.71 ? 293 ASP A OD1   1 
ATOM   1039 O  OD2   . ASP A 1 131 ? -51.105 9.741   21.656 1.00 53.73 ? 293 ASP A OD2   1 
ATOM   1040 N  N     . SER A 1 132 ? -49.018 7.322   18.767 1.00 48.62 ? 294 SER A N     1 
ATOM   1041 C  CA    . SER A 1 132 ? -49.095 6.889   17.368 1.00 50.67 ? 294 SER A CA    1 
ATOM   1042 C  C     . SER A 1 132 ? -50.032 7.763   16.531 1.00 54.37 ? 294 SER A C     1 
ATOM   1043 O  O     . SER A 1 132 ? -49.805 7.927   15.337 1.00 56.82 ? 294 SER A O     1 
ATOM   1044 C  CB    . SER A 1 132 ? -49.472 5.404   17.258 1.00 50.44 ? 294 SER A CB    1 
ATOM   1045 O  OG    . SER A 1 132 ? -50.596 5.090   18.050 1.00 50.61 ? 294 SER A OG    1 
ATOM   1046 N  N     . ALA A 1 133 ? -51.061 8.332   17.161 1.00 55.19 ? 295 ALA A N     1 
ATOM   1047 C  CA    . ALA A 1 133 ? -52.009 9.209   16.469 1.00 59.09 ? 295 ALA A CA    1 
ATOM   1048 C  C     . ALA A 1 133 ? -51.382 10.529  16.003 1.00 60.92 ? 295 ALA A C     1 
ATOM   1049 O  O     . ALA A 1 133 ? -51.693 11.004  14.911 1.00 64.61 ? 295 ALA A O     1 
ATOM   1050 C  CB    . ALA A 1 133 ? -53.232 9.482   17.356 1.00 60.03 ? 295 ALA A CB    1 
ATOM   1051 N  N     . THR A 1 134 ? -50.508 11.108  16.828 1.00 58.82 ? 296 THR A N     1 
ATOM   1052 C  CA    . THR A 1 134 ? -49.834 12.378  16.517 1.00 60.70 ? 296 THR A CA    1 
ATOM   1053 C  C     . THR A 1 134 ? -48.350 12.228  16.142 1.00 59.04 ? 296 THR A C     1 
ATOM   1054 O  O     . THR A 1 134 ? -47.784 13.109  15.502 1.00 61.53 ? 296 THR A O     1 
ATOM   1055 C  CB    . THR A 1 134 ? -49.907 13.351  17.714 1.00 60.60 ? 296 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 134 ? -49.244 12.772  18.847 1.00 56.44 ? 296 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 134 ? -51.357 13.667  18.072 1.00 63.09 ? 296 THR A CG2   1 
ATOM   1058 N  N     . GLY A 1 135 ? -47.719 11.133  16.555 1.00 55.42 ? 297 GLY A N     1 
ATOM   1059 C  CA    . GLY A 1 135 ? -46.293 10.905  16.303 1.00 53.74 ? 297 GLY A CA    1 
ATOM   1060 C  C     . GLY A 1 135 ? -45.343 11.602  17.272 1.00 51.88 ? 297 GLY A C     1 
ATOM   1061 O  O     . GLY A 1 135 ? -44.139 11.692  17.004 1.00 51.10 ? 297 GLY A O     1 
ATOM   1062 N  N     . LEU A 1 136 ? -45.870 12.069  18.405 1.00 51.15 ? 298 LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 136 ? -45.095 12.873  19.361 1.00 50.00 ? 298 LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 136 ? -44.577 12.045  20.546 1.00 46.20 ? 298 LEU A C     1 
ATOM   1065 O  O     . LEU A 1 136 ? -45.295 11.213  21.093 1.00 45.20 ? 298 LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 136 ? -45.946 14.044  19.860 1.00 52.55 ? 298 LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 136 ? -46.315 15.065  18.769 1.00 56.96 ? 298 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 136 ? -47.581 15.854  19.125 1.00 59.81 ? 298 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 136 ? -45.142 15.998  18.486 1.00 57.39 ? 298 LEU A CD2   1 
ATOM   1070 N  N     . SER A 1 137 ? -43.329 12.299  20.938 1.00 44.64 ? 299 SER A N     1 
ATOM   1071 C  CA    . SER A 1 137 ? -42.646 11.550  21.996 1.00 41.33 ? 299 SER A CA    1 
ATOM   1072 C  C     . SER A 1 137 ? -43.331 11.685  23.359 1.00 40.62 ? 299 SER A C     1 
ATOM   1073 O  O     . SER A 1 137 ? -43.835 12.757  23.701 1.00 42.37 ? 299 SER A O     1 
ATOM   1074 C  CB    . SER A 1 137 ? -41.181 12.008  22.096 1.00 40.78 ? 299 SER A CB    1 
ATOM   1075 O  OG    . SER A 1 137 ? -40.583 11.606  23.313 1.00 37.89 ? 299 SER A OG    1 
ATOM   1076 N  N     . LYS A 1 138 ? -43.350 10.580  24.111 1.00 38.16 ? 300 LYS A N     1 
ATOM   1077 C  CA    . LYS A 1 138 ? -43.897 10.539  25.477 1.00 37.64 ? 300 LYS A CA    1 
ATOM   1078 C  C     . LYS A 1 138 ? -42.818 10.723  26.543 1.00 36.27 ? 300 LYS A C     1 
ATOM   1079 O  O     . LYS A 1 138 ? -43.108 10.673  27.745 1.00 36.15 ? 300 LYS A O     1 
ATOM   1080 C  CB    . LYS A 1 138 ? -44.646 9.219   25.733 1.00 36.72 ? 300 LYS A CB    1 
ATOM   1081 C  CG    . LYS A 1 138 ? -45.852 9.000   24.820 1.00 38.21 ? 300 LYS A CG    1 
ATOM   1082 C  CD    . LYS A 1 138 ? -46.832 8.011   25.412 1.00 37.78 ? 300 LYS A CD    1 
ATOM   1083 C  CE    . LYS A 1 138 ? -47.956 7.715   24.439 1.00 39.37 ? 300 LYS A CE    1 
ATOM   1084 N  NZ    . LYS A 1 138 ? -48.993 6.836   25.044 1.00 39.17 ? 300 LYS A NZ    1 
ATOM   1085 N  N     . GLY A 1 139 ? -41.577 10.927  26.109 1.00 35.49 ? 301 GLY A N     1 
ATOM   1086 C  CA    . GLY A 1 139 ? -40.481 11.264  27.028 1.00 34.52 ? 301 GLY A CA    1 
ATOM   1087 C  C     . GLY A 1 139 ? -39.770 10.091  27.679 1.00 32.05 ? 301 GLY A C     1 
ATOM   1088 O  O     . GLY A 1 139 ? -39.040 10.280  28.655 1.00 31.60 ? 301 GLY A O     1 
ATOM   1089 N  N     . TYR A 1 140 ? -39.999 8.877   27.170 1.00 30.66 ? 302 TYR A N     1 
ATOM   1090 C  CA    . TYR A 1 140 ? -39.277 7.695   27.653 1.00 28.89 ? 302 TYR A CA    1 
ATOM   1091 C  C     . TYR A 1 140 ? -38.982 6.705   26.531 1.00 28.45 ? 302 TYR A C     1 
ATOM   1092 O  O     . TYR A 1 140 ? -39.614 6.729   25.474 1.00 28.92 ? 302 TYR A O     1 
ATOM   1093 C  CB    . TYR A 1 140 ? -39.988 7.013   28.837 1.00 28.61 ? 302 TYR A CB    1 
ATOM   1094 C  CG    . TYR A 1 140 ? -41.428 6.579   28.607 1.00 28.58 ? 302 TYR A CG    1 
ATOM   1095 C  CD1   . TYR A 1 140 ? -41.733 5.261   28.277 1.00 28.29 ? 302 TYR A CD1   1 
ATOM   1096 C  CD2   . TYR A 1 140 ? -42.480 7.476   28.762 1.00 29.68 ? 302 TYR A CD2   1 
ATOM   1097 C  CE1   . TYR A 1 140 ? -43.056 4.847   28.073 1.00 28.99 ? 302 TYR A CE1   1 
ATOM   1098 C  CE2   . TYR A 1 140 ? -43.810 7.079   28.567 1.00 30.73 ? 302 TYR A CE2   1 
ATOM   1099 C  CZ    . TYR A 1 140 ? -44.089 5.764   28.219 1.00 30.61 ? 302 TYR A CZ    1 
ATOM   1100 O  OH    . TYR A 1 140 ? -45.391 5.359   28.033 1.00 30.86 ? 302 TYR A OH    1 
ATOM   1101 N  N     . ALA A 1 141 ? -37.980 5.866   26.772 1.00 27.64 ? 303 ALA A N     1 
ATOM   1102 C  CA    . ALA A 1 141 ? -37.442 4.966   25.771 1.00 27.76 ? 303 ALA A CA    1 
ATOM   1103 C  C     . ALA A 1 141 ? -36.947 3.667   26.412 1.00 27.53 ? 303 ALA A C     1 
ATOM   1104 O  O     . ALA A 1 141 ? -36.794 3.583   27.629 1.00 26.80 ? 303 ALA A O     1 
ATOM   1105 C  CB    . ALA A 1 141 ? -36.299 5.641   25.019 1.00 27.60 ? 303 ALA A CB    1 
ATOM   1106 N  N     . PHE A 1 142 ? -36.710 2.671   25.558 1.00 28.47 ? 304 PHE A N     1 
ATOM   1107 C  CA    . PHE A 1 142 ? -36.117 1.387   25.928 1.00 29.14 ? 304 PHE A CA    1 
ATOM   1108 C  C     . PHE A 1 142 ? -34.920 1.091   25.028 1.00 30.30 ? 304 PHE A C     1 
ATOM   1109 O  O     . PHE A 1 142 ? -34.908 1.493   23.864 1.00 31.18 ? 304 PHE A O     1 
ATOM   1110 C  CB    . PHE A 1 142 ? -37.141 0.268   25.768 1.00 29.32 ? 304 PHE A CB    1 
ATOM   1111 C  CG    . PHE A 1 142 ? -38.323 0.417   26.654 1.00 28.93 ? 304 PHE A CG    1 
ATOM   1112 C  CD1   . PHE A 1 142 ? -38.343 -0.183  27.906 1.00 29.01 ? 304 PHE A CD1   1 
ATOM   1113 C  CD2   . PHE A 1 142 ? -39.410 1.183   26.258 1.00 27.91 ? 304 PHE A CD2   1 
ATOM   1114 C  CE1   . PHE A 1 142 ? -39.426 -0.021  28.739 1.00 29.07 ? 304 PHE A CE1   1 
ATOM   1115 C  CE2   . PHE A 1 142 ? -40.491 1.348   27.092 1.00 27.88 ? 304 PHE A CE2   1 
ATOM   1116 C  CZ    . PHE A 1 142 ? -40.501 0.747   28.328 1.00 28.15 ? 304 PHE A CZ    1 
ATOM   1117 N  N     . CYS A 1 143 ? -33.920 0.390   25.557 1.00 31.05 ? 305 CYS A N     1 
ATOM   1118 C  CA    . CYS A 1 143 ? -32.768 -0.009  24.744 1.00 32.71 ? 305 CYS A CA    1 
ATOM   1119 C  C     . CYS A 1 143 ? -32.031 -1.226  25.310 1.00 33.70 ? 305 CYS A C     1 
ATOM   1120 O  O     . CYS A 1 143 ? -32.287 -1.645  26.436 1.00 33.27 ? 305 CYS A O     1 
ATOM   1121 C  CB    . CYS A 1 143 ? -31.805 1.175   24.562 1.00 32.35 ? 305 CYS A CB    1 
ATOM   1122 S  SG    . CYS A 1 143 ? -30.732 1.587   25.962 1.00 35.28 ? 305 CYS A SG    1 
ATOM   1123 N  N     . GLU A 1 144 ? -31.138 -1.800  24.505 1.00 35.41 ? 306 GLU A N     1 
ATOM   1124 C  CA    . GLU A 1 144 ? -30.226 -2.847  24.970 1.00 37.03 ? 306 GLU A CA    1 
ATOM   1125 C  C     . GLU A 1 144 ? -28.862 -2.753  24.255 1.00 38.05 ? 306 GLU A C     1 
ATOM   1126 O  O     . GLU A 1 144 ? -28.800 -2.620  23.040 1.00 38.18 ? 306 GLU A O     1 
ATOM   1127 C  CB    . GLU A 1 144 ? -30.855 -4.226  24.776 1.00 38.97 ? 306 GLU A CB    1 
ATOM   1128 C  CG    . GLU A 1 144 ? -30.236 -5.291  25.673 1.00 41.36 ? 306 GLU A CG    1 
ATOM   1129 C  CD    . GLU A 1 144 ? -30.905 -6.661  25.558 1.00 44.41 ? 306 GLU A CD    1 
ATOM   1130 O  OE1   . GLU A 1 144 ? -31.977 -6.770  24.907 1.00 46.18 ? 306 GLU A OE1   1 
ATOM   1131 O  OE2   . GLU A 1 144 ? -30.345 -7.631  26.129 1.00 48.55 ? 306 GLU A OE2   1 
ATOM   1132 N  N     . TYR A 1 145 ? -27.776 -2.802  25.021 1.00 38.41 ? 307 TYR A N     1 
ATOM   1133 C  CA    . TYR A 1 145 ? -26.428 -2.723  24.443 1.00 40.36 ? 307 TYR A CA    1 
ATOM   1134 C  C     . TYR A 1 145 ? -25.947 -4.086  23.906 1.00 43.64 ? 307 TYR A C     1 
ATOM   1135 O  O     . TYR A 1 145 ? -26.313 -5.140  24.437 1.00 43.99 ? 307 TYR A O     1 
ATOM   1136 C  CB    . TYR A 1 145 ? -25.429 -2.147  25.458 1.00 39.38 ? 307 TYR A CB    1 
ATOM   1137 C  CG    . TYR A 1 145 ? -25.632 -0.662  25.755 1.00 36.42 ? 307 TYR A CG    1 
ATOM   1138 C  CD1   . TYR A 1 145 ? -25.036 0.315   24.961 1.00 36.77 ? 307 TYR A CD1   1 
ATOM   1139 C  CD2   . TYR A 1 145 ? -26.414 -0.244  26.828 1.00 34.10 ? 307 TYR A CD2   1 
ATOM   1140 C  CE1   . TYR A 1 145 ? -25.208 1.673   25.226 1.00 35.29 ? 307 TYR A CE1   1 
ATOM   1141 C  CE2   . TYR A 1 145 ? -26.605 1.112   27.103 1.00 33.13 ? 307 TYR A CE2   1 
ATOM   1142 C  CZ    . TYR A 1 145 ? -25.996 2.069   26.302 1.00 34.06 ? 307 TYR A CZ    1 
ATOM   1143 O  OH    . TYR A 1 145 ? -26.172 3.414   26.572 1.00 32.67 ? 307 TYR A OH    1 
ATOM   1144 N  N     . VAL A 1 146 ? -25.141 -4.040  22.841 1.00 46.14 ? 308 VAL A N     1 
ATOM   1145 C  CA    . VAL A 1 146 ? -24.488 -5.231  22.277 1.00 50.54 ? 308 VAL A CA    1 
ATOM   1146 C  C     . VAL A 1 146 ? -23.622 -5.917  23.331 1.00 52.44 ? 308 VAL A C     1 
ATOM   1147 O  O     . VAL A 1 146 ? -23.744 -7.124  23.567 1.00 54.77 ? 308 VAL A O     1 
ATOM   1148 C  CB    . VAL A 1 146 ? -23.595 -4.882  21.055 1.00 52.47 ? 308 VAL A CB    1 
ATOM   1149 C  CG1   . VAL A 1 146 ? -22.804 -6.100  20.610 1.00 57.38 ? 308 VAL A CG1   1 
ATOM   1150 C  CG2   . VAL A 1 146 ? -24.440 -4.374  19.901 1.00 52.35 ? 308 VAL A CG2   1 
ATOM   1151 N  N     . ASP A 1 147 ? -22.743 -5.140  23.953 1.00 52.11 ? 309 ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 147 ? -21.925 -5.628  25.059 1.00 53.61 ? 309 ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 147 ? -22.716 -5.410  26.335 1.00 51.49 ? 309 ASP A C     1 
ATOM   1154 O  O     . ASP A 1 147 ? -23.007 -4.270  26.705 1.00 48.52 ? 309 ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 147 ? -20.591 -4.876  25.130 1.00 54.21 ? 309 ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 147 ? -19.618 -5.480  26.148 1.00 57.20 ? 309 ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 147 ? -18.514 -4.905  26.324 1.00 58.78 ? 309 ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 147 ? -19.942 -6.526  26.765 1.00 60.47 ? 309 ASP A OD2   1 
ATOM   1159 N  N     . ILE A 1 148 ? -23.056 -6.501  27.015 1.00 53.22 ? 310 ILE A N     1 
ATOM   1160 C  CA    . ILE A 1 148 ? -23.865 -6.411  28.237 1.00 51.66 ? 310 ILE A CA    1 
ATOM   1161 C  C     . ILE A 1 148 ? -23.098 -5.817  29.435 1.00 51.16 ? 310 ILE A C     1 
ATOM   1162 O  O     . ILE A 1 148 ? -23.704 -5.465  30.446 1.00 49.87 ? 310 ILE A O     1 
ATOM   1163 C  CB    . ILE A 1 148 ? -24.541 -7.781  28.605 1.00 54.45 ? 310 ILE A CB    1 
ATOM   1164 C  CG1   . ILE A 1 148 ? -23.525 -8.929  28.659 1.00 58.90 ? 310 ILE A CG1   1 
ATOM   1165 C  CG2   . ILE A 1 148 ? -25.668 -8.099  27.612 1.00 54.32 ? 310 ILE A CG2   1 
ATOM   1166 C  CD1   . ILE A 1 148 ? -24.143 -10.281 28.987 1.00 61.45 ? 310 ILE A CD1   1 
ATOM   1167 N  N     . ASN A 1 149 ? -21.781 -5.673  29.298 1.00 52.41 ? 311 ASN A N     1 
ATOM   1168 C  CA    . ASN A 1 149 ? -20.941 -5.066  30.331 1.00 52.05 ? 311 ASN A CA    1 
ATOM   1169 C  C     . ASN A 1 149 ? -20.995 -3.529  30.303 1.00 48.48 ? 311 ASN A C     1 
ATOM   1170 O  O     . ASN A 1 149 ? -20.685 -2.865  31.295 1.00 47.82 ? 311 ASN A O     1 
ATOM   1171 C  CB    . ASN A 1 149 ? -19.504 -5.559  30.177 1.00 55.83 ? 311 ASN A CB    1 
ATOM   1172 C  CG    . ASN A 1 149 ? -19.417 -7.087  30.083 1.00 60.66 ? 311 ASN A CG    1 
ATOM   1173 O  OD1   . ASN A 1 149 ? -20.242 -7.806  30.653 1.00 63.23 ? 311 ASN A OD1   1 
ATOM   1174 N  ND2   . ASN A 1 149 ? -18.424 -7.581  29.355 1.00 65.30 ? 311 ASN A ND2   1 
ATOM   1175 N  N     . VAL A 1 150 ? -21.399 -2.984  29.158 1.00 46.21 ? 312 VAL A N     1 
ATOM   1176 C  CA    . VAL A 1 150 ? -21.660 -1.553  28.994 1.00 42.97 ? 312 VAL A CA    1 
ATOM   1177 C  C     . VAL A 1 150 ? -22.926 -1.106  29.741 1.00 40.20 ? 312 VAL A C     1 
ATOM   1178 O  O     . VAL A 1 150 ? -23.042 0.056   30.131 1.00 38.10 ? 312 VAL A O     1 
ATOM   1179 C  CB    . VAL A 1 150 ? -21.786 -1.197  27.491 1.00 42.57 ? 312 VAL A CB    1 
ATOM   1180 C  CG1   . VAL A 1 150 ? -22.219 0.253   27.298 1.00 40.29 ? 312 VAL A CG1   1 
ATOM   1181 C  CG2   . VAL A 1 150 ? -20.464 -1.465  26.781 1.00 45.02 ? 312 VAL A CG2   1 
ATOM   1182 N  N     . THR A 1 151 ? -23.866 -2.034  29.934 1.00 39.68 ? 313 THR A N     1 
ATOM   1183 C  CA    . THR A 1 151 ? -25.126 -1.756  30.620 1.00 37.78 ? 313 THR A CA    1 
ATOM   1184 C  C     . THR A 1 151 ? -24.922 -1.003  31.947 1.00 37.02 ? 313 THR A C     1 
ATOM   1185 O  O     . THR A 1 151 ? -25.552 0.017   32.186 1.00 34.20 ? 313 THR A O     1 
ATOM   1186 C  CB    . THR A 1 151 ? -25.901 -3.064  30.904 1.00 39.04 ? 313 THR A CB    1 
ATOM   1187 O  OG1   . THR A 1 151 ? -26.108 -3.783  29.679 1.00 39.31 ? 313 THR A OG1   1 
ATOM   1188 C  CG2   . THR A 1 151 ? -27.237 -2.766  31.560 1.00 36.92 ? 313 THR A CG2   1 
ATOM   1189 N  N     . ASP A 1 152 ? -24.042 -1.525  32.797 1.00 39.11 ? 314 ASP A N     1 
ATOM   1190 C  CA    . ASP A 1 152 ? -23.750 -0.902  34.094 1.00 39.70 ? 314 ASP A CA    1 
ATOM   1191 C  C     . ASP A 1 152 ? -22.988 0.423   33.999 1.00 38.60 ? 314 ASP A C     1 
ATOM   1192 O  O     . ASP A 1 152 ? -23.127 1.271   34.883 1.00 38.25 ? 314 ASP A O     1 
ATOM   1193 C  CB    . ASP A 1 152 ? -22.980 -1.874  34.993 1.00 43.01 ? 314 ASP A CB    1 
ATOM   1194 C  CG    . ASP A 1 152 ? -23.851 -3.011  35.492 1.00 45.71 ? 314 ASP A CG    1 
ATOM   1195 O  OD1   . ASP A 1 152 ? -23.320 -4.118  35.712 1.00 51.01 ? 314 ASP A OD1   1 
ATOM   1196 O  OD2   . ASP A 1 152 ? -25.070 -2.796  35.666 1.00 46.13 ? 314 ASP A OD2   1 
ATOM   1197 N  N     . GLN A 1 153 ? -22.185 0.588   32.948 1.00 38.25 ? 315 GLN A N     1 
ATOM   1198 C  CA    . GLN A 1 153 ? -21.482 1.850   32.690 1.00 37.84 ? 315 GLN A CA    1 
ATOM   1199 C  C     . GLN A 1 153 ? -22.475 2.973   32.318 1.00 35.26 ? 315 GLN A C     1 
ATOM   1200 O  O     . GLN A 1 153 ? -22.323 4.121   32.748 1.00 34.68 ? 315 GLN A O     1 
ATOM   1201 C  CB    . GLN A 1 153 ? -20.437 1.664   31.581 1.00 38.96 ? 315 GLN A CB    1 
ATOM   1202 C  CG    . GLN A 1 153 ? -19.306 0.697   31.956 1.00 42.39 ? 315 GLN A CG    1 
ATOM   1203 C  CD    . GLN A 1 153 ? -18.327 0.412   30.815 1.00 44.23 ? 315 GLN A CD    1 
ATOM   1204 O  OE1   . GLN A 1 153 ? -18.599 0.693   29.644 1.00 44.78 ? 315 GLN A OE1   1 
ATOM   1205 N  NE2   . GLN A 1 153 ? -17.180 -0.161  31.162 1.00 47.59 ? 315 GLN A NE2   1 
ATOM   1206 N  N     . ALA A 1 154 ? -23.488 2.625   31.531 1.00 33.33 ? 316 ALA A N     1 
ATOM   1207 C  CA    . ALA A 1 154 ? -24.533 3.561   31.124 1.00 31.66 ? 316 ALA A CA    1 
ATOM   1208 C  C     . ALA A 1 154 ? -25.415 3.974   32.301 1.00 30.93 ? 316 ALA A C     1 
ATOM   1209 O  O     . ALA A 1 154 ? -25.748 5.144   32.441 1.00 30.46 ? 316 ALA A O     1 
ATOM   1210 C  CB    . ALA A 1 154 ? -25.379 2.956   30.015 1.00 30.77 ? 316 ALA A CB    1 
ATOM   1211 N  N     . ILE A 1 155 ? -25.788 3.008   33.138 1.00 31.29 ? 317 ILE A N     1 
ATOM   1212 C  CA    . ILE A 1 155 ? -26.554 3.275   34.353 1.00 31.49 ? 317 ILE A CA    1 
ATOM   1213 C  C     . ILE A 1 155 ? -25.799 4.214   35.292 1.00 32.58 ? 317 ILE A C     1 
ATOM   1214 O  O     . ILE A 1 155 ? -26.348 5.218   35.745 1.00 32.66 ? 317 ILE A O     1 
ATOM   1215 C  CB    . ILE A 1 155 ? -26.889 1.970   35.108 1.00 32.70 ? 317 ILE A CB    1 
ATOM   1216 C  CG1   . ILE A 1 155 ? -27.873 1.134   34.294 1.00 31.46 ? 317 ILE A CG1   1 
ATOM   1217 C  CG2   . ILE A 1 155 ? -27.474 2.280   36.490 1.00 33.49 ? 317 ILE A CG2   1 
ATOM   1218 C  CD1   . ILE A 1 155 ? -27.999 -0.315  34.767 1.00 33.81 ? 317 ILE A CD1   1 
ATOM   1219 N  N     . ALA A 1 156 ? -24.542 3.880   35.572 1.00 33.79 ? 318 ALA A N     1 
ATOM   1220 C  CA    . ALA A 1 156 ? -23.670 4.705   36.406 1.00 35.27 ? 318 ALA A CA    1 
ATOM   1221 C  C     . ALA A 1 156 ? -23.473 6.126   35.855 1.00 34.54 ? 318 ALA A C     1 
ATOM   1222 O  O     . ALA A 1 156 ? -23.466 7.091   36.614 1.00 35.58 ? 318 ALA A O     1 
ATOM   1223 C  CB    . ALA A 1 156 ? -22.304 4.016   36.577 1.00 36.98 ? 318 ALA A CB    1 
ATOM   1224 N  N     . GLY A 1 157 ? -23.315 6.248   34.539 1.00 33.40 ? 319 GLY A N     1 
ATOM   1225 C  CA    . GLY A 1 157 ? -23.013 7.531   33.904 1.00 33.54 ? 319 GLY A CA    1 
ATOM   1226 C  C     . GLY A 1 157 ? -24.192 8.464   33.656 1.00 32.55 ? 319 GLY A C     1 
ATOM   1227 O  O     . GLY A 1 157 ? -23.991 9.668   33.463 1.00 32.90 ? 319 GLY A O     1 
ATOM   1228 N  N     . LEU A 1 158 ? -25.408 7.913   33.646 1.00 31.49 ? 320 LEU A N     1 
ATOM   1229 C  CA    . LEU A 1 158 ? -26.631 8.655   33.286 1.00 31.27 ? 320 LEU A CA    1 
ATOM   1230 C  C     . LEU A 1 158 ? -27.735 8.693   34.362 1.00 31.61 ? 320 LEU A C     1 
ATOM   1231 O  O     . LEU A 1 158 ? -28.534 9.633   34.381 1.00 31.29 ? 320 LEU A O     1 
ATOM   1232 C  CB    . LEU A 1 158 ? -27.239 8.081   32.003 1.00 29.90 ? 320 LEU A CB    1 
ATOM   1233 C  CG    . LEU A 1 158 ? -26.411 8.166   30.716 1.00 30.58 ? 320 LEU A CG    1 
ATOM   1234 C  CD1   . LEU A 1 158 ? -27.112 7.427   29.585 1.00 29.43 ? 320 LEU A CD1   1 
ATOM   1235 C  CD2   . LEU A 1 158 ? -26.132 9.612   30.328 1.00 30.43 ? 320 LEU A CD2   1 
ATOM   1236 N  N     . ASN A 1 159 ? -27.800 7.690   35.237 1.00 32.26 ? 321 ASN A N     1 
ATOM   1237 C  CA    . ASN A 1 159 ? -28.853 7.659   36.263 1.00 33.38 ? 321 ASN A CA    1 
ATOM   1238 C  C     . ASN A 1 159 ? -28.681 8.754   37.305 1.00 35.76 ? 321 ASN A C     1 
ATOM   1239 O  O     . ASN A 1 159 ? -27.587 8.968   37.828 1.00 37.41 ? 321 ASN A O     1 
ATOM   1240 C  CB    . ASN A 1 159 ? -28.945 6.295   36.957 1.00 33.71 ? 321 ASN A CB    1 
ATOM   1241 C  CG    . ASN A 1 159 ? -30.146 6.199   37.891 1.00 34.14 ? 321 ASN A CG    1 
ATOM   1242 O  OD1   . ASN A 1 159 ? -31.271 6.554   37.523 1.00 31.90 ? 321 ASN A OD1   1 
ATOM   1243 N  ND2   . ASN A 1 159 ? -29.908 5.744   39.109 1.00 33.13 ? 321 ASN A ND2   1 
ATOM   1244 N  N     . GLY A 1 160 ? -29.772 9.462   37.579 1.00 37.17 ? 322 GLY A N     1 
ATOM   1245 C  CA    . GLY A 1 160 ? -29.789 10.543  38.562 1.00 39.97 ? 322 GLY A CA    1 
ATOM   1246 C  C     . GLY A 1 160 ? -29.111 11.825  38.106 1.00 41.36 ? 322 GLY A C     1 
ATOM   1247 O  O     . GLY A 1 160 ? -28.881 12.711  38.918 1.00 43.95 ? 322 GLY A O     1 
ATOM   1248 N  N     . MET A 1 161 ? -28.818 11.937  36.812 1.00 40.45 ? 323 MET A N     1 
ATOM   1249 C  CA    . MET A 1 161 ? -28.023 13.051  36.275 1.00 42.07 ? 323 MET A CA    1 
ATOM   1250 C  C     . MET A 1 161 ? -28.927 14.113  35.648 1.00 43.20 ? 323 MET A C     1 
ATOM   1251 O  O     . MET A 1 161 ? -30.015 13.803  35.171 1.00 41.35 ? 323 MET A O     1 
ATOM   1252 C  CB    . MET A 1 161 ? -27.035 12.533  35.220 1.00 40.45 ? 323 MET A CB    1 
ATOM   1253 C  CG    . MET A 1 161 ? -26.213 11.316  35.654 1.00 40.20 ? 323 MET A CG    1 
ATOM   1254 S  SD    . MET A 1 161 ? -24.940 11.650  36.880 1.00 42.19 ? 323 MET A SD    1 
ATOM   1255 C  CE    . MET A 1 161 ? -23.670 12.211  35.806 1.00 43.30 ? 323 MET A CE    1 
ATOM   1256 N  N     . GLN A 1 162 ? -28.461 15.358  35.627 1.00 46.66 ? 324 GLN A N     1 
ATOM   1257 C  CA    . GLN A 1 162 ? -29.273 16.470  35.123 1.00 48.85 ? 324 GLN A CA    1 
ATOM   1258 C  C     . GLN A 1 162 ? -29.266 16.506  33.589 1.00 48.55 ? 324 GLN A C     1 
ATOM   1259 O  O     . GLN A 1 162 ? -28.219 16.336  32.954 1.00 47.86 ? 324 GLN A O     1 
ATOM   1260 C  CB    . GLN A 1 162 ? -28.790 17.799  35.689 1.00 52.56 ? 324 GLN A CB    1 
ATOM   1261 C  CG    . GLN A 1 162 ? -29.856 18.904  35.662 1.00 55.60 ? 324 GLN A CG    1 
ATOM   1262 C  CD    . GLN A 1 162 ? -30.561 19.097  36.996 1.00 58.55 ? 324 GLN A CD    1 
ATOM   1263 O  OE1   . GLN A 1 162 ? -30.007 19.697  37.917 1.00 63.92 ? 324 GLN A OE1   1 
ATOM   1264 N  NE2   . GLN A 1 162 ? -31.789 18.614  37.098 1.00 58.23 ? 324 GLN A NE2   1 
ATOM   1265 N  N     . LEU A 1 163 ? -30.457 16.682  33.013 1.00 49.24 ? 325 LEU A N     1 
ATOM   1266 C  CA    . LEU A 1 163 ? -30.637 16.860  31.572 1.00 49.29 ? 325 LEU A CA    1 
ATOM   1267 C  C     . LEU A 1 163 ? -31.680 17.952  31.388 1.00 52.45 ? 325 LEU A C     1 
ATOM   1268 O  O     . LEU A 1 163 ? -32.879 17.683  31.365 1.00 52.31 ? 325 LEU A O     1 
ATOM   1269 C  CB    . LEU A 1 163 ? -31.085 15.553  30.909 1.00 46.61 ? 325 LEU A CB    1 
ATOM   1270 C  CG    . LEU A 1 163 ? -31.006 15.485  29.380 1.00 46.30 ? 325 LEU A CG    1 
ATOM   1271 C  CD1   . LEU A 1 163 ? -29.553 15.533  28.905 1.00 47.89 ? 325 LEU A CD1   1 
ATOM   1272 C  CD2   . LEU A 1 163 ? -31.690 14.238  28.858 1.00 43.91 ? 325 LEU A CD2   1 
ATOM   1273 N  N     . GLY A 1 164 ? -31.209 19.195  31.291 1.00 55.84 ? 326 GLY A N     1 
ATOM   1274 C  CA    . GLY A 1 164 ? -32.083 20.356  31.274 1.00 59.27 ? 326 GLY A CA    1 
ATOM   1275 C  C     . GLY A 1 164 ? -32.518 20.679  32.692 1.00 61.23 ? 326 GLY A C     1 
ATOM   1276 O  O     . GLY A 1 164 ? -31.682 20.838  33.583 1.00 62.12 ? 326 GLY A O     1 
ATOM   1277 N  N     . ASP A 1 165 ? -33.830 20.769  32.897 1.00 62.24 ? 327 ASP A N     1 
ATOM   1278 C  CA    . ASP A 1 165 ? -34.406 20.955  34.232 1.00 63.95 ? 327 ASP A CA    1 
ATOM   1279 C  C     . ASP A 1 165 ? -34.970 19.630  34.764 1.00 60.70 ? 327 ASP A C     1 
ATOM   1280 O  O     . ASP A 1 165 ? -35.616 19.591  35.813 1.00 61.93 ? 327 ASP A O     1 
ATOM   1281 C  CB    . ASP A 1 165 ? -35.473 22.068  34.221 1.00 68.44 ? 327 ASP A CB    1 
ATOM   1282 C  CG    . ASP A 1 165 ? -36.281 22.110  32.922 1.00 68.86 ? 327 ASP A CG    1 
ATOM   1283 O  OD1   . ASP A 1 165 ? -36.820 23.196  32.600 1.00 73.99 ? 327 ASP A OD1   1 
ATOM   1284 O  OD2   . ASP A 1 165 ? -36.361 21.069  32.227 1.00 65.93 ? 327 ASP A OD2   1 
ATOM   1285 N  N     . LYS A 1 166 ? -34.698 18.548  34.034 1.00 56.96 ? 328 LYS A N     1 
ATOM   1286 C  CA    . LYS A 1 166 ? -35.121 17.205  34.407 1.00 53.76 ? 328 LYS A CA    1 
ATOM   1287 C  C     . LYS A 1 166 ? -33.919 16.396  34.904 1.00 51.71 ? 328 LYS A C     1 
ATOM   1288 O  O     . LYS A 1 166 ? -32.772 16.683  34.547 1.00 51.72 ? 328 LYS A O     1 
ATOM   1289 C  CB    . LYS A 1 166 ? -35.748 16.502  33.202 1.00 51.95 ? 328 LYS A CB    1 
ATOM   1290 C  CG    . LYS A 1 166 ? -37.202 16.872  32.921 1.00 54.01 ? 328 LYS A CG    1 
ATOM   1291 C  CD    . LYS A 1 166 ? -38.178 16.042  33.757 1.00 54.12 ? 328 LYS A CD    1 
ATOM   1292 C  CE    . LYS A 1 166 ? -39.563 15.983  33.112 1.00 54.73 ? 328 LYS A CE    1 
ATOM   1293 N  NZ    . LYS A 1 166 ? -40.585 15.303  33.966 1.00 54.59 ? 328 LYS A NZ    1 
ATOM   1294 N  N     . LYS A 1 167 ? -34.200 15.398  35.741 1.00 49.98 ? 329 LYS A N     1 
ATOM   1295 C  CA    . LYS A 1 167 ? -33.212 14.412  36.167 1.00 47.88 ? 329 LYS A CA    1 
ATOM   1296 C  C     . LYS A 1 167 ? -33.511 13.099  35.459 1.00 44.30 ? 329 LYS A C     1 
ATOM   1297 O  O     . LYS A 1 167 ? -34.657 12.630  35.480 1.00 43.73 ? 329 LYS A O     1 
ATOM   1298 C  CB    . LYS A 1 167 ? -33.291 14.220  37.680 1.00 49.66 ? 329 LYS A CB    1 
ATOM   1299 C  CG    . LYS A 1 167 ? -32.225 13.296  38.250 1.00 49.54 ? 329 LYS A CG    1 
ATOM   1300 C  CD    . LYS A 1 167 ? -31.991 13.531  39.747 1.00 52.51 ? 329 LYS A CD    1 
ATOM   1301 C  CE    . LYS A 1 167 ? -33.108 12.947  40.588 1.00 54.38 ? 329 LYS A CE    1 
ATOM   1302 N  NZ    . LYS A 1 167 ? -32.910 13.262  42.031 1.00 57.39 ? 329 LYS A NZ    1 
ATOM   1303 N  N     . LEU A 1 168 ? -32.504 12.510  34.822 1.00 41.73 ? 330 LEU A N     1 
ATOM   1304 C  CA    . LEU A 1 168 ? -32.690 11.227  34.141 1.00 39.35 ? 330 LEU A CA    1 
ATOM   1305 C  C     . LEU A 1 168 ? -32.853 10.050  35.108 1.00 38.29 ? 330 LEU A C     1 
ATOM   1306 O  O     . LEU A 1 168 ? -32.222 9.998   36.166 1.00 38.77 ? 330 LEU A O     1 
ATOM   1307 C  CB    . LEU A 1 168 ? -31.530 10.915  33.195 1.00 38.68 ? 330 LEU A CB    1 
ATOM   1308 C  CG    . LEU A 1 168 ? -31.549 11.478  31.776 1.00 39.64 ? 330 LEU A CG    1 
ATOM   1309 C  CD1   . LEU A 1 168 ? -30.253 11.068  31.063 1.00 40.64 ? 330 LEU A CD1   1 
ATOM   1310 C  CD2   . LEU A 1 168 ? -32.747 10.985  31.003 1.00 39.14 ? 330 LEU A CD2   1 
ATOM   1311 N  N     . LEU A 1 169 ? -33.716 9.115   34.721 1.00 36.40 ? 331 LEU A N     1 
ATOM   1312 C  CA    . LEU A 1 169 ? -33.809 7.809   35.360 1.00 35.86 ? 331 LEU A CA    1 
ATOM   1313 C  C     . LEU A 1 169 ? -33.365 6.777   34.335 1.00 33.86 ? 331 LEU A C     1 
ATOM   1314 O  O     . LEU A 1 169 ? -33.901 6.734   33.232 1.00 32.33 ? 331 LEU A O     1 
ATOM   1315 C  CB    . LEU A 1 169 ? -35.241 7.506   35.807 1.00 36.30 ? 331 LEU A CB    1 
ATOM   1316 C  CG    . LEU A 1 169 ? -35.440 6.151   36.504 1.00 36.75 ? 331 LEU A CG    1 
ATOM   1317 C  CD1   . LEU A 1 169 ? -34.924 6.187   37.925 1.00 38.58 ? 331 LEU A CD1   1 
ATOM   1318 C  CD2   . LEU A 1 169 ? -36.900 5.744   36.490 1.00 37.03 ? 331 LEU A CD2   1 
ATOM   1319 N  N     . VAL A 1 170 ? -32.362 5.979   34.696 1.00 33.60 ? 332 VAL A N     1 
ATOM   1320 C  CA    . VAL A 1 170 ? -31.892 4.880   33.864 1.00 32.71 ? 332 VAL A CA    1 
ATOM   1321 C  C     . VAL A 1 170 ? -31.785 3.645   34.765 1.00 33.85 ? 332 VAL A C     1 
ATOM   1322 O  O     . VAL A 1 170 ? -31.031 3.648   35.744 1.00 34.45 ? 332 VAL A O     1 
ATOM   1323 C  CB    . VAL A 1 170 ? -30.532 5.200   33.175 1.00 32.31 ? 332 VAL A CB    1 
ATOM   1324 C  CG1   . VAL A 1 170 ? -30.077 4.034   32.289 1.00 31.28 ? 332 VAL A CG1   1 
ATOM   1325 C  CG2   . VAL A 1 170 ? -30.642 6.452   32.338 1.00 31.08 ? 332 VAL A CG2   1 
ATOM   1326 N  N     . GLN A 1 171 ? -32.584 2.618   34.459 1.00 33.98 ? 333 GLN A N     1 
ATOM   1327 C  CA    . GLN A 1 171 ? -32.609 1.390   35.253 1.00 35.65 ? 333 GLN A CA    1 
ATOM   1328 C  C     . GLN A 1 171 ? -32.998 0.195   34.397 1.00 36.02 ? 333 GLN A C     1 
ATOM   1329 O  O     . GLN A 1 171 ? -33.510 0.354   33.285 1.00 34.62 ? 333 GLN A O     1 
ATOM   1330 C  CB    . GLN A 1 171 ? -33.567 1.530   36.452 1.00 36.73 ? 333 GLN A CB    1 
ATOM   1331 C  CG    . GLN A 1 171 ? -35.030 1.795   36.116 1.00 35.13 ? 333 GLN A CG    1 
ATOM   1332 C  CD    . GLN A 1 171 ? -35.939 1.866   37.355 1.00 37.56 ? 333 GLN A CD    1 
ATOM   1333 O  OE1   . GLN A 1 171 ? -37.163 1.718   37.255 1.00 36.44 ? 333 GLN A OE1   1 
ATOM   1334 N  NE2   . GLN A 1 171 ? -35.344 2.080   38.518 1.00 37.11 ? 333 GLN A NE2   1 
ATOM   1335 N  N     . ARG A 1 172 ? -32.746 -1.005  34.913 1.00 38.47 ? 334 ARG A N     1 
ATOM   1336 C  CA    . ARG A 1 172 ? -33.140 -2.223  34.206 1.00 40.01 ? 334 ARG A CA    1 
ATOM   1337 C  C     . ARG A 1 172 ? -34.660 -2.289  34.067 1.00 39.83 ? 334 ARG A C     1 
ATOM   1338 O  O     . ARG A 1 172 ? -35.403 -1.977  35.005 1.00 39.76 ? 334 ARG A O     1 
ATOM   1339 C  CB    . ARG A 1 172 ? -32.579 -3.479  34.886 1.00 42.83 ? 334 ARG A CB    1 
ATOM   1340 C  CG    . ARG A 1 172 ? -31.074 -3.637  34.663 1.00 44.14 ? 334 ARG A CG    1 
ATOM   1341 C  CD    . ARG A 1 172 ? -30.549 -5.004  35.105 1.00 48.19 ? 334 ARG A CD    1 
ATOM   1342 N  NE    . ARG A 1 172 ? -29.249 -5.311  34.502 1.00 50.08 ? 334 ARG A NE    1 
ATOM   1343 C  CZ    . ARG A 1 172 ? -28.086 -4.768  34.869 1.00 51.67 ? 334 ARG A CZ    1 
ATOM   1344 N  NH1   . ARG A 1 172 ? -26.968 -5.118  34.238 1.00 52.64 ? 334 ARG A NH1   1 
ATOM   1345 N  NH2   . ARG A 1 172 ? -28.024 -3.877  35.860 1.00 51.56 ? 334 ARG A NH2   1 
ATOM   1346 N  N     . ALA A 1 173 ? -35.105 -2.671  32.873 1.00 39.95 ? 335 ALA A N     1 
ATOM   1347 C  CA    . ALA A 1 173 ? -36.517 -2.754  32.563 1.00 40.54 ? 335 ALA A CA    1 
ATOM   1348 C  C     . ALA A 1 173 ? -37.168 -3.905  33.316 1.00 43.43 ? 335 ALA A C     1 
ATOM   1349 O  O     . ALA A 1 173 ? -36.557 -4.956  33.518 1.00 45.37 ? 335 ALA A O     1 
ATOM   1350 C  CB    . ALA A 1 173 ? -36.722 -2.917  31.064 1.00 39.78 ? 335 ALA A CB    1 
ATOM   1351 N  N     . SER A 1 174 ? -38.398 -3.673  33.760 1.00 44.55 ? 336 SER A N     1 
ATOM   1352 C  CA    . SER A 1 174 ? -39.254 -4.702  34.352 1.00 47.97 ? 336 SER A CA    1 
ATOM   1353 C  C     . SER A 1 174 ? -40.406 -4.040  35.099 1.00 48.84 ? 336 SER A C     1 
ATOM   1354 O  O     . SER A 1 174 ? -40.190 -3.297  36.064 1.00 49.88 ? 336 SER A O     1 
ATOM   1355 C  CB    . SER A 1 174 ? -38.483 -5.637  35.297 1.00 51.07 ? 336 SER A CB    1 
ATOM   1356 O  OG    . SER A 1 174 ? -37.738 -6.616  34.574 1.00 53.82 ? 336 SER A OG    1 
ATOM   1357 O  OXT   . SER A 1 174 ? -41.568 -4.222  34.744 1.00 49.50 ? 336 SER A OXT   1 
ATOM   1358 N  N     . GLY B 1 1   ? 10.194  -18.768 19.590 1.00 87.59 ? 143 GLY B N     1 
ATOM   1359 C  CA    . GLY B 1 1   ? 10.577  -17.432 20.138 1.00 87.43 ? 143 GLY B CA    1 
ATOM   1360 C  C     . GLY B 1 1   ? 11.986  -17.434 20.709 1.00 82.01 ? 143 GLY B C     1 
ATOM   1361 O  O     . GLY B 1 1   ? 12.850  -18.161 20.210 1.00 79.50 ? 143 GLY B O     1 
ATOM   1362 N  N     . PRO B 1 2   ? 12.237  -16.616 21.756 1.00 80.78 ? 144 PRO B N     1 
ATOM   1363 C  CA    . PRO B 1 2   ? 13.565  -16.502 22.390 1.00 75.68 ? 144 PRO B CA    1 
ATOM   1364 C  C     . PRO B 1 2   ? 14.021  -17.650 23.317 1.00 71.01 ? 144 PRO B C     1 
ATOM   1365 O  O     . PRO B 1 2   ? 15.040  -17.498 24.019 1.00 67.70 ? 144 PRO B O     1 
ATOM   1366 C  CB    . PRO B 1 2   ? 13.438  -15.205 23.201 1.00 77.68 ? 144 PRO B CB    1 
ATOM   1367 C  CG    . PRO B 1 2   ? 12.009  -15.123 23.549 1.00 81.57 ? 144 PRO B CG    1 
ATOM   1368 C  CD    . PRO B 1 2   ? 11.266  -15.692 22.373 1.00 84.64 ? 144 PRO B CD    1 
ATOM   1369 N  N     . LEU B 1 3   ? 13.316  -18.785 23.311 1.00 70.51 ? 145 LEU B N     1 
ATOM   1370 C  CA    . LEU B 1 3   ? 13.665  -19.911 24.195 1.00 66.23 ? 145 LEU B CA    1 
ATOM   1371 C  C     . LEU B 1 3   ? 14.756  -20.854 23.645 1.00 62.36 ? 145 LEU B C     1 
ATOM   1372 O  O     . LEU B 1 3   ? 15.032  -21.892 24.248 1.00 60.21 ? 145 LEU B O     1 
ATOM   1373 C  CB    . LEU B 1 3   ? 12.406  -20.714 24.566 1.00 68.36 ? 145 LEU B CB    1 
ATOM   1374 C  CG    . LEU B 1 3   ? 11.511  -20.064 25.629 1.00 70.95 ? 145 LEU B CG    1 
ATOM   1375 C  CD1   . LEU B 1 3   ? 10.071  -20.562 25.533 1.00 74.89 ? 145 LEU B CD1   1 
ATOM   1376 C  CD2   . LEU B 1 3   ? 12.076  -20.304 27.028 1.00 67.65 ? 145 LEU B CD2   1 
ATOM   1377 N  N     . GLY B 1 4   ? 15.385  -20.506 22.524 1.00 61.90 ? 146 GLY B N     1 
ATOM   1378 C  CA    . GLY B 1 4   ? 16.504  -21.302 22.000 1.00 58.29 ? 146 GLY B CA    1 
ATOM   1379 C  C     . GLY B 1 4   ? 17.731  -21.166 22.886 1.00 53.87 ? 146 GLY B C     1 
ATOM   1380 O  O     . GLY B 1 4   ? 18.430  -22.150 23.167 1.00 50.93 ? 146 GLY B O     1 
ATOM   1381 N  N     . SER B 1 5   ? 17.979  -19.933 23.326 1.00 53.13 ? 147 SER B N     1 
ATOM   1382 C  CA    . SER B 1 5   ? 19.060  -19.616 24.251 1.00 49.45 ? 147 SER B CA    1 
ATOM   1383 C  C     . SER B 1 5   ? 18.795  -20.118 25.673 1.00 47.11 ? 147 SER B C     1 
ATOM   1384 O  O     . SER B 1 5   ? 19.723  -20.191 26.475 1.00 44.78 ? 147 SER B O     1 
ATOM   1385 C  CB    . SER B 1 5   ? 19.298  -18.103 24.272 1.00 50.95 ? 147 SER B CB    1 
ATOM   1386 O  OG    . SER B 1 5   ? 18.110  -17.405 24.607 1.00 54.07 ? 147 SER B OG    1 
ATOM   1387 N  N     . ALA B 1 6   ? 17.540  -20.463 25.976 1.00 47.82 ? 148 ALA B N     1 
ATOM   1388 C  CA    . ALA B 1 6   ? 17.164  -21.053 27.270 1.00 46.27 ? 148 ALA B CA    1 
ATOM   1389 C  C     . ALA B 1 6   ? 17.386  -22.574 27.332 1.00 43.43 ? 148 ALA B C     1 
ATOM   1390 O  O     . ALA B 1 6   ? 17.096  -23.205 28.356 1.00 41.77 ? 148 ALA B O     1 
ATOM   1391 C  CB    . ALA B 1 6   ? 15.711  -20.723 27.595 1.00 49.33 ? 148 ALA B CB    1 
ATOM   1392 N  N     . ARG B 1 7   ? 17.905  -23.148 26.241 1.00 42.19 ? 149 ARG B N     1 
ATOM   1393 C  CA    . ARG B 1 7   ? 18.253  -24.569 26.176 1.00 40.44 ? 149 ARG B CA    1 
ATOM   1394 C  C     . ARG B 1 7   ? 19.731  -24.800 25.805 1.00 37.62 ? 149 ARG B C     1 
ATOM   1395 O  O     . ARG B 1 7   ? 20.086  -25.878 25.334 1.00 37.22 ? 149 ARG B O     1 
ATOM   1396 C  CB    . ARG B 1 7   ? 17.332  -25.286 25.178 1.00 42.69 ? 149 ARG B CB    1 
ATOM   1397 C  CG    . ARG B 1 7   ? 15.886  -25.419 25.646 1.00 45.55 ? 149 ARG B CG    1 
ATOM   1398 C  CD    . ARG B 1 7   ? 15.057  -26.249 24.673 1.00 48.52 ? 149 ARG B CD    1 
ATOM   1399 N  NE    . ARG B 1 7   ? 14.943  -25.586 23.375 1.00 51.51 ? 149 ARG B NE    1 
ATOM   1400 C  CZ    . ARG B 1 7   ? 13.935  -24.795 22.992 1.00 57.48 ? 149 ARG B CZ    1 
ATOM   1401 N  NH1   . ARG B 1 7   ? 12.884  -24.553 23.786 1.00 60.15 ? 149 ARG B NH1   1 
ATOM   1402 N  NH2   . ARG B 1 7   ? 13.963  -24.248 21.778 1.00 60.01 ? 149 ARG B NH2   1 
ATOM   1403 N  N     . ARG B 1 8   ? 20.584  -23.802 26.040 1.00 35.87 ? 150 ARG B N     1 
ATOM   1404 C  CA    . ARG B 1 8   ? 22.024  -23.900 25.764 1.00 33.74 ? 150 ARG B CA    1 
ATOM   1405 C  C     . ARG B 1 8   ? 22.847  -23.457 26.979 1.00 31.30 ? 150 ARG B C     1 
ATOM   1406 O  O     . ARG B 1 8   ? 22.409  -22.595 27.749 1.00 31.84 ? 150 ARG B O     1 
ATOM   1407 C  CB    . ARG B 1 8   ? 22.399  -23.040 24.543 1.00 34.83 ? 150 ARG B CB    1 
ATOM   1408 C  CG    . ARG B 1 8   ? 22.136  -23.730 23.217 1.00 36.99 ? 150 ARG B CG    1 
ATOM   1409 C  CD    . ARG B 1 8   ? 22.055  -22.770 22.025 1.00 40.32 ? 150 ARG B CD    1 
ATOM   1410 N  NE    . ARG B 1 8   ? 23.364  -22.392 21.484 1.00 42.16 ? 150 ARG B NE    1 
ATOM   1411 C  CZ    . ARG B 1 8   ? 24.152  -23.186 20.751 1.00 43.17 ? 150 ARG B CZ    1 
ATOM   1412 N  NH1   . ARG B 1 8   ? 25.319  -22.733 20.285 1.00 42.10 ? 150 ARG B NH1   1 
ATOM   1413 N  NH2   . ARG B 1 8   ? 23.789  -24.434 20.475 1.00 44.03 ? 150 ARG B NH2   1 
ATOM   1414 N  N     . LEU B 1 9   ? 24.023  -24.059 27.158 1.00 28.79 ? 151 LEU B N     1 
ATOM   1415 C  CA    . LEU B 1 9   ? 24.987  -23.598 28.171 1.00 26.99 ? 151 LEU B CA    1 
ATOM   1416 C  C     . LEU B 1 9   ? 26.400  -23.505 27.591 1.00 25.66 ? 151 LEU B C     1 
ATOM   1417 O  O     . LEU B 1 9   ? 26.792  -24.318 26.754 1.00 25.04 ? 151 LEU B O     1 
ATOM   1418 C  CB    . LEU B 1 9   ? 25.003  -24.513 29.399 1.00 26.03 ? 151 LEU B CB    1 
ATOM   1419 C  CG    . LEU B 1 9   ? 23.753  -24.599 30.288 1.00 27.22 ? 151 LEU B CG    1 
ATOM   1420 C  CD1   . LEU B 1 9   ? 24.012  -25.543 31.428 1.00 26.19 ? 151 LEU B CD1   1 
ATOM   1421 C  CD2   . LEU B 1 9   ? 23.326  -23.234 30.820 1.00 29.23 ? 151 LEU B CD2   1 
ATOM   1422 N  N     . TYR B 1 10  ? 27.147  -22.504 28.058 1.00 24.87 ? 152 TYR B N     1 
ATOM   1423 C  CA    . TYR B 1 10  ? 28.560  -22.344 27.733 1.00 24.49 ? 152 TYR B CA    1 
ATOM   1424 C  C     . TYR B 1 10  ? 29.416  -23.198 28.685 1.00 23.51 ? 152 TYR B C     1 
ATOM   1425 O  O     . TYR B 1 10  ? 29.151  -23.239 29.894 1.00 22.82 ? 152 TYR B O     1 
ATOM   1426 C  CB    . TYR B 1 10  ? 28.947  -20.871 27.858 1.00 24.72 ? 152 TYR B CB    1 
ATOM   1427 C  CG    . TYR B 1 10  ? 30.433  -20.615 27.831 1.00 24.70 ? 152 TYR B CG    1 
ATOM   1428 C  CD1   . TYR B 1 10  ? 31.183  -20.573 29.015 1.00 23.51 ? 152 TYR B CD1   1 
ATOM   1429 C  CD2   . TYR B 1 10  ? 31.094  -20.417 26.630 1.00 24.44 ? 152 TYR B CD2   1 
ATOM   1430 C  CE1   . TYR B 1 10  ? 32.560  -20.327 28.982 1.00 24.17 ? 152 TYR B CE1   1 
ATOM   1431 C  CE2   . TYR B 1 10  ? 32.460  -20.170 26.587 1.00 25.32 ? 152 TYR B CE2   1 
ATOM   1432 C  CZ    . TYR B 1 10  ? 33.191  -20.128 27.759 1.00 25.11 ? 152 TYR B CZ    1 
ATOM   1433 O  OH    . TYR B 1 10  ? 34.555  -19.892 27.688 1.00 25.73 ? 152 TYR B OH    1 
ATOM   1434 N  N     . VAL B 1 11  ? 30.429  -23.869 28.135 1.00 23.54 ? 153 VAL B N     1 
ATOM   1435 C  CA    . VAL B 1 11  ? 31.368  -24.690 28.914 1.00 23.78 ? 153 VAL B CA    1 
ATOM   1436 C  C     . VAL B 1 11  ? 32.815  -24.273 28.617 1.00 24.70 ? 153 VAL B C     1 
ATOM   1437 O  O     . VAL B 1 11  ? 33.288  -24.423 27.484 1.00 24.76 ? 153 VAL B O     1 
ATOM   1438 C  CB    . VAL B 1 11  ? 31.222  -26.187 28.590 1.00 23.93 ? 153 VAL B CB    1 
ATOM   1439 C  CG1   . VAL B 1 11  ? 32.140  -27.028 29.488 1.00 23.51 ? 153 VAL B CG1   1 
ATOM   1440 C  CG2   . VAL B 1 11  ? 29.771  -26.632 28.756 1.00 24.35 ? 153 VAL B CG2   1 
ATOM   1441 N  N     . GLY B 1 12  ? 33.498  -23.744 29.634 1.00 25.39 ? 154 GLY B N     1 
ATOM   1442 C  CA    . GLY B 1 12  ? 34.895  -23.312 29.519 1.00 26.75 ? 154 GLY B CA    1 
ATOM   1443 C  C     . GLY B 1 12  ? 35.892  -24.257 30.170 1.00 28.14 ? 154 GLY B C     1 
ATOM   1444 O  O     . GLY B 1 12  ? 35.522  -25.122 30.977 1.00 27.84 ? 154 GLY B O     1 
ATOM   1445 N  N     . ASN B 1 13  ? 37.166  -24.067 29.823 1.00 30.07 ? 155 ASN B N     1 
ATOM   1446 C  CA    . ASN B 1 13  ? 38.292  -24.833 30.384 1.00 31.80 ? 155 ASN B CA    1 
ATOM   1447 C  C     . ASN B 1 13  ? 38.294  -26.314 29.995 1.00 32.88 ? 155 ASN B C     1 
ATOM   1448 O  O     . ASN B 1 13  ? 38.685  -27.180 30.783 1.00 33.98 ? 155 ASN B O     1 
ATOM   1449 C  CB    . ASN B 1 13  ? 38.376  -24.684 31.919 1.00 32.37 ? 155 ASN B CB    1 
ATOM   1450 C  CG    . ASN B 1 13  ? 39.770  -25.033 32.473 1.00 34.69 ? 155 ASN B CG    1 
ATOM   1451 O  OD1   . ASN B 1 13  ? 40.788  -24.720 31.857 1.00 36.47 ? 155 ASN B OD1   1 
ATOM   1452 N  ND2   . ASN B 1 13  ? 39.810  -25.669 33.639 1.00 36.34 ? 155 ASN B ND2   1 
ATOM   1453 N  N     . ILE B 1 14  ? 37.881  -26.598 28.768 1.00 33.27 ? 156 ILE B N     1 
ATOM   1454 C  CA    . ILE B 1 14  ? 37.804  -27.976 28.297 1.00 34.65 ? 156 ILE B CA    1 
ATOM   1455 C  C     . ILE B 1 14  ? 39.230  -28.472 28.024 1.00 37.11 ? 156 ILE B C     1 
ATOM   1456 O  O     . ILE B 1 14  ? 40.069  -27.695 27.586 1.00 38.15 ? 156 ILE B O     1 
ATOM   1457 C  CB    . ILE B 1 14  ? 36.916  -28.119 27.025 1.00 34.55 ? 156 ILE B CB    1 
ATOM   1458 C  CG1   . ILE B 1 14  ? 37.601  -27.524 25.796 1.00 35.88 ? 156 ILE B CG1   1 
ATOM   1459 C  CG2   . ILE B 1 14  ? 35.545  -27.472 27.227 1.00 32.43 ? 156 ILE B CG2   1 
ATOM   1460 C  CD1   . ILE B 1 14  ? 36.693  -27.437 24.589 1.00 36.54 ? 156 ILE B CD1   1 
ATOM   1461 N  N     . PRO B 1 15  ? 39.511  -29.758 28.305 1.00 38.96 ? 157 PRO B N     1 
ATOM   1462 C  CA    . PRO B 1 15  ? 40.839  -30.339 28.076 1.00 41.58 ? 157 PRO B CA    1 
ATOM   1463 C  C     . PRO B 1 15  ? 41.209  -30.514 26.597 1.00 43.04 ? 157 PRO B C     1 
ATOM   1464 O  O     . PRO B 1 15  ? 40.329  -30.718 25.758 1.00 42.12 ? 157 PRO B O     1 
ATOM   1465 C  CB    . PRO B 1 15  ? 40.741  -31.705 28.764 1.00 42.92 ? 157 PRO B CB    1 
ATOM   1466 C  CG    . PRO B 1 15  ? 39.299  -32.046 28.705 1.00 41.43 ? 157 PRO B CG    1 
ATOM   1467 C  CD    . PRO B 1 15  ? 38.579  -30.745 28.881 1.00 38.77 ? 157 PRO B CD    1 
ATOM   1468 N  N     . PHE B 1 16  ? 42.509  -30.443 26.301 1.00 45.35 ? 158 PHE B N     1 
ATOM   1469 C  CA    . PHE B 1 16  ? 43.026  -30.630 24.935 1.00 47.57 ? 158 PHE B CA    1 
ATOM   1470 C  C     . PHE B 1 16  ? 42.594  -31.974 24.338 1.00 48.85 ? 158 PHE B C     1 
ATOM   1471 O  O     . PHE B 1 16  ? 42.571  -32.987 25.029 1.00 49.67 ? 158 PHE B O     1 
ATOM   1472 C  CB    . PHE B 1 16  ? 44.565  -30.534 24.917 1.00 50.42 ? 158 PHE B CB    1 
ATOM   1473 C  CG    . PHE B 1 16  ? 45.183  -30.871 23.580 1.00 53.42 ? 158 PHE B CG    1 
ATOM   1474 C  CD1   . PHE B 1 16  ? 45.332  -29.894 22.602 1.00 53.63 ? 158 PHE B CD1   1 
ATOM   1475 C  CD2   . PHE B 1 16  ? 45.598  -32.165 23.294 1.00 55.98 ? 158 PHE B CD2   1 
ATOM   1476 C  CE1   . PHE B 1 16  ? 45.890  -30.201 21.365 1.00 56.58 ? 158 PHE B CE1   1 
ATOM   1477 C  CE2   . PHE B 1 16  ? 46.150  -32.481 22.061 1.00 59.82 ? 158 PHE B CE2   1 
ATOM   1478 C  CZ    . PHE B 1 16  ? 46.301  -31.495 21.096 1.00 59.90 ? 158 PHE B CZ    1 
ATOM   1479 N  N     . GLY B 1 17  ? 42.249  -31.967 23.052 1.00 49.61 ? 159 GLY B N     1 
ATOM   1480 C  CA    . GLY B 1 17  ? 41.952  -33.201 22.316 1.00 51.96 ? 159 GLY B CA    1 
ATOM   1481 C  C     . GLY B 1 17  ? 40.600  -33.858 22.564 1.00 50.24 ? 159 GLY B C     1 
ATOM   1482 O  O     . GLY B 1 17  ? 40.350  -34.940 22.049 1.00 52.46 ? 159 GLY B O     1 
ATOM   1483 N  N     . ILE B 1 18  ? 39.722  -33.214 23.335 1.00 46.96 ? 160 ILE B N     1 
ATOM   1484 C  CA    . ILE B 1 18  ? 38.390  -33.764 23.629 1.00 45.34 ? 160 ILE B CA    1 
ATOM   1485 C  C     . ILE B 1 18  ? 37.507  -33.688 22.385 1.00 45.55 ? 160 ILE B C     1 
ATOM   1486 O  O     . ILE B 1 18  ? 37.608  -32.738 21.599 1.00 45.71 ? 160 ILE B O     1 
ATOM   1487 C  CB    . ILE B 1 18  ? 37.706  -33.024 24.813 1.00 42.33 ? 160 ILE B CB    1 
ATOM   1488 C  CG1   . ILE B 1 18  ? 36.454  -33.760 25.297 1.00 41.56 ? 160 ILE B CG1   1 
ATOM   1489 C  CG2   . ILE B 1 18  ? 37.311  -31.609 24.416 1.00 40.88 ? 160 ILE B CG2   1 
ATOM   1490 C  CD1   . ILE B 1 18  ? 36.705  -35.185 25.791 1.00 44.35 ? 160 ILE B CD1   1 
ATOM   1491 N  N     . THR B 1 19  ? 36.668  -34.708 22.209 1.00 45.97 ? 161 THR B N     1 
ATOM   1492 C  CA    . THR B 1 19  ? 35.735  -34.802 21.092 1.00 46.64 ? 161 THR B CA    1 
ATOM   1493 C  C     . THR B 1 19  ? 34.316  -34.464 21.565 1.00 43.98 ? 161 THR B C     1 
ATOM   1494 O  O     . THR B 1 19  ? 34.019  -34.524 22.758 1.00 41.93 ? 161 THR B O     1 
ATOM   1495 C  CB    . THR B 1 19  ? 35.723  -36.226 20.502 1.00 50.09 ? 161 THR B CB    1 
ATOM   1496 O  OG1   . THR B 1 19  ? 35.338  -37.168 21.516 1.00 49.19 ? 161 THR B OG1   1 
ATOM   1497 C  CG2   . THR B 1 19  ? 37.097  -36.601 19.957 1.00 53.27 ? 161 THR B CG2   1 
ATOM   1498 N  N     . GLU B 1 20  ? 33.455  -34.101 20.620 1.00 44.30 ? 162 GLU B N     1 
ATOM   1499 C  CA    . GLU B 1 20  ? 32.074  -33.719 20.912 1.00 42.75 ? 162 GLU B CA    1 
ATOM   1500 C  C     . GLU B 1 20  ? 31.273  -34.893 21.499 1.00 43.09 ? 162 GLU B C     1 
ATOM   1501 O  O     . GLU B 1 20  ? 30.511  -34.721 22.450 1.00 41.17 ? 162 GLU B O     1 
ATOM   1502 C  CB    . GLU B 1 20  ? 31.404  -33.147 19.649 1.00 43.84 ? 162 GLU B CB    1 
ATOM   1503 C  CG    . GLU B 1 20  ? 31.990  -31.783 19.235 1.00 43.75 ? 162 GLU B CG    1 
ATOM   1504 C  CD    . GLU B 1 20  ? 31.765  -31.375 17.772 1.00 46.49 ? 162 GLU B CD    1 
ATOM   1505 O  OE1   . GLU B 1 20  ? 32.172  -30.235 17.420 1.00 45.75 ? 162 GLU B OE1   1 
ATOM   1506 O  OE2   . GLU B 1 20  ? 31.196  -32.166 16.983 1.00 48.93 ? 162 GLU B OE2   1 
ATOM   1507 N  N     . GLU B 1 21  ? 31.475  -36.084 20.955 1.00 46.10 ? 163 GLU B N     1 
ATOM   1508 C  CA    . GLU B 1 21  ? 30.810  -37.297 21.470 1.00 47.45 ? 163 GLU B CA    1 
ATOM   1509 C  C     . GLU B 1 21  ? 31.220  -37.649 22.915 1.00 46.10 ? 163 GLU B C     1 
ATOM   1510 O  O     . GLU B 1 21  ? 30.379  -38.073 23.714 1.00 45.35 ? 163 GLU B O     1 
ATOM   1511 C  CB    . GLU B 1 21  ? 31.022  -38.505 20.537 1.00 51.37 ? 163 GLU B CB    1 
ATOM   1512 C  CG    . GLU B 1 21  ? 32.405  -38.601 19.873 1.00 55.09 ? 163 GLU B CG    1 
ATOM   1513 C  CD    . GLU B 1 21  ? 32.422  -38.080 18.432 1.00 57.97 ? 163 GLU B CD    1 
ATOM   1514 O  OE1   . GLU B 1 21  ? 32.144  -38.880 17.517 1.00 63.10 ? 163 GLU B OE1   1 
ATOM   1515 O  OE2   . GLU B 1 21  ? 32.724  -36.884 18.212 1.00 57.11 ? 163 GLU B OE2   1 
ATOM   1516 N  N     . ALA B 1 22  ? 32.495  -37.461 23.247 1.00 46.06 ? 164 ALA B N     1 
ATOM   1517 C  CA    . ALA B 1 22  ? 32.988  -37.734 24.603 1.00 45.57 ? 164 ALA B CA    1 
ATOM   1518 C  C     . ALA B 1 22  ? 32.392  -36.772 25.646 1.00 42.59 ? 164 ALA B C     1 
ATOM   1519 O  O     . ALA B 1 22  ? 32.058  -37.183 26.762 1.00 42.21 ? 164 ALA B O     1 
ATOM   1520 C  CB    . ALA B 1 22  ? 34.514  -37.682 24.635 1.00 46.63 ? 164 ALA B CB    1 
ATOM   1521 N  N     . MET B 1 23  ? 32.268  -35.497 25.283 1.00 40.96 ? 165 MET B N     1 
ATOM   1522 C  CA    . MET B 1 23  ? 31.646  -34.506 26.159 1.00 38.55 ? 165 MET B CA    1 
ATOM   1523 C  C     . MET B 1 23  ? 30.136  -34.737 26.312 1.00 37.39 ? 165 MET B C     1 
ATOM   1524 O  O     . MET B 1 23  ? 29.583  -34.533 27.388 1.00 35.75 ? 165 MET B O     1 
ATOM   1525 C  CB    . MET B 1 23  ? 31.923  -33.097 25.649 1.00 37.24 ? 165 MET B CB    1 
ATOM   1526 C  CG    . MET B 1 23  ? 31.345  -32.010 26.528 1.00 36.42 ? 165 MET B CG    1 
ATOM   1527 S  SD    . MET B 1 23  ? 32.362  -30.522 26.587 1.00 38.49 ? 165 MET B SD    1 
ATOM   1528 C  CE    . MET B 1 23  ? 33.550  -30.977 27.862 1.00 39.19 ? 165 MET B CE    1 
ATOM   1529 N  N     . MET B 1 24  ? 29.483  -35.190 25.246 1.00 38.41 ? 166 MET B N     1 
ATOM   1530 C  CA    . MET B 1 24  ? 28.054  -35.497 25.285 1.00 38.49 ? 166 MET B CA    1 
ATOM   1531 C  C     . MET B 1 24  ? 27.750  -36.690 26.208 1.00 38.12 ? 166 MET B C     1 
ATOM   1532 O  O     . MET B 1 24  ? 26.774  -36.665 26.946 1.00 37.39 ? 166 MET B O     1 
ATOM   1533 C  CB    . MET B 1 24  ? 27.530  -35.761 23.870 1.00 40.56 ? 166 MET B CB    1 
ATOM   1534 C  CG    . MET B 1 24  ? 26.017  -35.771 23.755 1.00 41.63 ? 166 MET B CG    1 
ATOM   1535 S  SD    . MET B 1 24  ? 25.445  -36.114 22.077 1.00 47.10 ? 166 MET B SD    1 
ATOM   1536 C  CE    . MET B 1 24  ? 26.099  -37.758 21.800 1.00 49.98 ? 166 MET B CE    1 
ATOM   1537 N  N     . ASP B 1 25  ? 28.599  -37.715 26.170 1.00 39.12 ? 167 ASP B N     1 
ATOM   1538 C  CA    . ASP B 1 25  ? 28.479  -38.886 27.058 1.00 39.78 ? 167 ASP B CA    1 
ATOM   1539 C  C     . ASP B 1 25  ? 28.711  -38.534 28.538 1.00 37.35 ? 167 ASP B C     1 
ATOM   1540 O  O     . ASP B 1 25  ? 28.016  -39.041 29.415 1.00 37.21 ? 167 ASP B O     1 
ATOM   1541 C  CB    . ASP B 1 25  ? 29.476  -39.975 26.646 1.00 42.78 ? 167 ASP B CB    1 
ATOM   1542 C  CG    . ASP B 1 25  ? 29.133  -40.625 25.311 1.00 47.00 ? 167 ASP B CG    1 
ATOM   1543 O  OD1   . ASP B 1 25  ? 28.243  -40.110 24.591 1.00 49.60 ? 167 ASP B OD1   1 
ATOM   1544 O  OD2   . ASP B 1 25  ? 29.759  -41.661 24.977 1.00 51.12 ? 167 ASP B OD2   1 
ATOM   1545 N  N     . PHE B 1 26  ? 29.698  -37.678 28.802 1.00 34.89 ? 168 PHE B N     1 
ATOM   1546 C  CA    . PHE B 1 26  ? 30.009  -37.218 30.156 1.00 33.51 ? 168 PHE B CA    1 
ATOM   1547 C  C     . PHE B 1 26  ? 28.812  -36.516 30.803 1.00 31.34 ? 168 PHE B C     1 
ATOM   1548 O  O     . PHE B 1 26  ? 28.423  -36.850 31.914 1.00 31.23 ? 168 PHE B O     1 
ATOM   1549 C  CB    . PHE B 1 26  ? 31.229  -36.277 30.134 1.00 32.44 ? 168 PHE B CB    1 
ATOM   1550 C  CG    . PHE B 1 26  ? 31.536  -35.627 31.470 1.00 31.50 ? 168 PHE B CG    1 
ATOM   1551 C  CD1   . PHE B 1 26  ? 32.172  -36.341 32.475 1.00 32.97 ? 168 PHE B CD1   1 
ATOM   1552 C  CD2   . PHE B 1 26  ? 31.188  -34.309 31.712 1.00 28.81 ? 168 PHE B CD2   1 
ATOM   1553 C  CE1   . PHE B 1 26  ? 32.447  -35.759 33.695 1.00 32.47 ? 168 PHE B CE1   1 
ATOM   1554 C  CE2   . PHE B 1 26  ? 31.467  -33.712 32.935 1.00 28.58 ? 168 PHE B CE2   1 
ATOM   1555 C  CZ    . PHE B 1 26  ? 32.095  -34.442 33.927 1.00 30.72 ? 168 PHE B CZ    1 
ATOM   1556 N  N     . PHE B 1 27  ? 28.241  -35.542 30.101 1.00 29.66 ? 169 PHE B N     1 
ATOM   1557 C  CA    . PHE B 1 27  ? 27.120  -34.754 30.638 1.00 29.02 ? 169 PHE B CA    1 
ATOM   1558 C  C     . PHE B 1 27  ? 25.803  -35.537 30.805 1.00 29.62 ? 169 PHE B C     1 
ATOM   1559 O  O     . PHE B 1 27  ? 25.107  -35.362 31.802 1.00 29.37 ? 169 PHE B O     1 
ATOM   1560 C  CB    . PHE B 1 27  ? 26.919  -33.476 29.821 1.00 28.26 ? 169 PHE B CB    1 
ATOM   1561 C  CG    . PHE B 1 27  ? 27.862  -32.372 30.204 1.00 27.83 ? 169 PHE B CG    1 
ATOM   1562 C  CD1   . PHE B 1 27  ? 28.982  -32.086 29.438 1.00 27.97 ? 169 PHE B CD1   1 
ATOM   1563 C  CD2   . PHE B 1 27  ? 27.637  -31.622 31.346 1.00 29.00 ? 169 PHE B CD2   1 
ATOM   1564 C  CE1   . PHE B 1 27  ? 29.855  -31.068 29.801 1.00 26.65 ? 169 PHE B CE1   1 
ATOM   1565 C  CE2   . PHE B 1 27  ? 28.512  -30.595 31.712 1.00 27.81 ? 169 PHE B CE2   1 
ATOM   1566 C  CZ    . PHE B 1 27  ? 29.619  -30.324 30.933 1.00 26.78 ? 169 PHE B CZ    1 
ATOM   1567 N  N     . ASN B 1 28  ? 25.491  -36.424 29.867 1.00 30.79 ? 170 ASN B N     1 
ATOM   1568 C  CA    . ASN B 1 28  ? 24.337  -37.322 30.019 1.00 32.81 ? 170 ASN B CA    1 
ATOM   1569 C  C     . ASN B 1 28  ? 24.467  -38.250 31.247 1.00 34.03 ? 170 ASN B C     1 
ATOM   1570 O  O     . ASN B 1 28  ? 23.488  -38.491 31.957 1.00 34.08 ? 170 ASN B O     1 
ATOM   1571 C  CB    . ASN B 1 28  ? 24.125  -38.175 28.755 1.00 34.38 ? 170 ASN B CB    1 
ATOM   1572 C  CG    . ASN B 1 28  ? 23.583  -37.374 27.586 1.00 34.15 ? 170 ASN B CG    1 
ATOM   1573 O  OD1   . ASN B 1 28  ? 22.778  -36.461 27.757 1.00 34.35 ? 170 ASN B OD1   1 
ATOM   1574 N  ND2   . ASN B 1 28  ? 24.009  -37.727 26.388 1.00 36.11 ? 170 ASN B ND2   1 
ATOM   1575 N  N     . ALA B 1 29  ? 25.676  -38.761 31.481 1.00 35.07 ? 171 ALA B N     1 
ATOM   1576 C  CA    . ALA B 1 29  ? 25.947  -39.646 32.615 1.00 37.14 ? 171 ALA B CA    1 
ATOM   1577 C  C     . ALA B 1 29  ? 25.857  -38.907 33.955 1.00 36.71 ? 171 ALA B C     1 
ATOM   1578 O  O     . ALA B 1 29  ? 25.363  -39.457 34.927 1.00 37.98 ? 171 ALA B O     1 
ATOM   1579 C  CB    . ALA B 1 29  ? 27.313  -40.307 32.462 1.00 38.10 ? 171 ALA B CB    1 
ATOM   1580 N  N     . GLN B 1 30  ? 26.333  -37.665 33.998 1.00 35.54 ? 172 GLN B N     1 
ATOM   1581 C  CA    . GLN B 1 30  ? 26.219  -36.837 35.204 1.00 35.94 ? 172 GLN B CA    1 
ATOM   1582 C  C     . GLN B 1 30  ? 24.754  -36.530 35.561 1.00 36.65 ? 172 GLN B C     1 
ATOM   1583 O  O     . GLN B 1 30  ? 24.354  -36.635 36.728 1.00 37.57 ? 172 GLN B O     1 
ATOM   1584 C  CB    . GLN B 1 30  ? 27.014  -35.536 35.036 1.00 34.10 ? 172 GLN B CB    1 
ATOM   1585 C  CG    . GLN B 1 30  ? 28.540  -35.720 35.100 1.00 34.84 ? 172 GLN B CG    1 
ATOM   1586 C  CD    . GLN B 1 30  ? 29.065  -35.972 36.511 1.00 36.78 ? 172 GLN B CD    1 
ATOM   1587 O  OE1   . GLN B 1 30  ? 28.321  -35.898 37.493 1.00 37.74 ? 172 GLN B OE1   1 
ATOM   1588 N  NE2   . GLN B 1 30  ? 30.354  -36.272 36.615 1.00 37.10 ? 172 GLN B NE2   1 
ATOM   1589 N  N     . MET B 1 31  ? 23.963  -36.169 34.553 1.00 36.78 ? 173 MET B N     1 
ATOM   1590 C  CA    . MET B 1 31  ? 22.533  -35.879 34.737 1.00 38.55 ? 173 MET B CA    1 
ATOM   1591 C  C     . MET B 1 31  ? 21.758  -37.085 35.274 1.00 41.13 ? 173 MET B C     1 
ATOM   1592 O  O     . MET B 1 31  ? 20.941  -36.947 36.182 1.00 42.18 ? 173 MET B O     1 
ATOM   1593 C  CB    . MET B 1 31  ? 21.898  -35.428 33.416 1.00 38.37 ? 173 MET B CB    1 
ATOM   1594 C  CG    . MET B 1 31  ? 22.368  -34.070 32.918 1.00 38.56 ? 173 MET B CG    1 
ATOM   1595 S  SD    . MET B 1 31  ? 21.606  -32.673 33.763 1.00 42.79 ? 173 MET B SD    1 
ATOM   1596 C  CE    . MET B 1 31  ? 19.861  -32.910 33.429 1.00 44.47 ? 173 MET B CE    1 
ATOM   1597 N  N     . ARG B 1 32  ? 22.011  -38.258 34.703 1.00 42.92 ? 174 ARG B N     1 
ATOM   1598 C  CA    . ARG B 1 32  ? 21.372  -39.498 35.160 1.00 46.44 ? 174 ARG B CA    1 
ATOM   1599 C  C     . ARG B 1 32  ? 21.819  -39.887 36.573 1.00 47.75 ? 174 ARG B C     1 
ATOM   1600 O  O     . ARG B 1 32  ? 21.022  -40.383 37.372 1.00 49.50 ? 174 ARG B O     1 
ATOM   1601 C  CB    . ARG B 1 32  ? 21.673  -40.651 34.191 1.00 47.80 ? 174 ARG B CB    1 
ATOM   1602 C  CG    . ARG B 1 32  ? 20.961  -40.545 32.842 1.00 49.08 ? 174 ARG B CG    1 
ATOM   1603 C  CD    . ARG B 1 32  ? 21.090  -41.827 31.998 1.00 52.39 ? 174 ARG B CD    1 
ATOM   1604 N  NE    . ARG B 1 32  ? 22.163  -41.741 30.996 1.00 54.30 ? 174 ARG B NE    1 
ATOM   1605 C  CZ    . ARG B 1 32  ? 23.409  -42.221 31.133 1.00 55.67 ? 174 ARG B CZ    1 
ATOM   1606 N  NH1   . ARG B 1 32  ? 23.804  -42.851 32.243 1.00 57.55 ? 174 ARG B NH1   1 
ATOM   1607 N  NH2   . ARG B 1 32  ? 24.280  -42.075 30.136 1.00 55.13 ? 174 ARG B NH2   1 
ATOM   1608 N  N     . LEU B 1 33  ? 23.099  -39.670 36.867 1.00 47.38 ? 175 LEU B N     1 
ATOM   1609 C  CA    . LEU B 1 33  ? 23.674  -40.016 38.175 1.00 49.44 ? 175 LEU B CA    1 
ATOM   1610 C  C     . LEU B 1 33  ? 23.096  -39.134 39.296 1.00 49.85 ? 175 LEU B C     1 
ATOM   1611 O  O     . LEU B 1 33  ? 22.779  -39.625 40.383 1.00 52.24 ? 175 LEU B O     1 
ATOM   1612 C  CB    . LEU B 1 33  ? 25.208  -39.903 38.120 1.00 48.71 ? 175 LEU B CB    1 
ATOM   1613 C  CG    . LEU B 1 33  ? 26.023  -40.028 39.413 1.00 50.39 ? 175 LEU B CG    1 
ATOM   1614 C  CD1   . LEU B 1 33  ? 26.025  -41.459 39.941 1.00 52.97 ? 175 LEU B CD1   1 
ATOM   1615 C  CD2   . LEU B 1 33  ? 27.441  -39.530 39.167 1.00 49.65 ? 175 LEU B CD2   1 
ATOM   1616 N  N     . GLY B 1 34  ? 22.952  -37.840 39.019 1.00 48.18 ? 176 GLY B N     1 
ATOM   1617 C  CA    . GLY B 1 34  ? 22.389  -36.896 39.982 1.00 48.93 ? 176 GLY B CA    1 
ATOM   1618 C  C     . GLY B 1 34  ? 20.882  -36.995 40.159 1.00 50.91 ? 176 GLY B C     1 
ATOM   1619 O  O     . GLY B 1 34  ? 20.335  -36.451 41.121 1.00 52.59 ? 176 GLY B O     1 
ATOM   1620 N  N     . GLY B 1 35  ? 20.207  -37.700 39.246 1.00 51.34 ? 177 GLY B N     1 
ATOM   1621 C  CA    . GLY B 1 35  ? 18.746  -37.740 39.220 1.00 52.68 ? 177 GLY B CA    1 
ATOM   1622 C  C     . GLY B 1 35  ? 18.151  -36.396 38.814 1.00 51.57 ? 177 GLY B C     1 
ATOM   1623 O  O     . GLY B 1 35  ? 17.105  -35.993 39.324 1.00 53.56 ? 177 GLY B O     1 
ATOM   1624 N  N     . LEU B 1 36  ? 18.815  -35.706 37.892 1.00 48.99 ? 178 LEU B N     1 
ATOM   1625 C  CA    . LEU B 1 36  ? 18.397  -34.369 37.466 1.00 48.07 ? 178 LEU B CA    1 
ATOM   1626 C  C     . LEU B 1 36  ? 17.567  -34.386 36.175 1.00 48.19 ? 178 LEU B C     1 
ATOM   1627 O  O     . LEU B 1 36  ? 17.220  -33.328 35.645 1.00 48.10 ? 178 LEU B O     1 
ATOM   1628 C  CB    . LEU B 1 36  ? 19.624  -33.461 37.294 1.00 45.64 ? 178 LEU B CB    1 
ATOM   1629 C  CG    . LEU B 1 36  ? 20.563  -33.345 38.499 1.00 45.55 ? 178 LEU B CG    1 
ATOM   1630 C  CD1   . LEU B 1 36  ? 21.677  -32.378 38.202 1.00 43.45 ? 178 LEU B CD1   1 
ATOM   1631 C  CD2   . LEU B 1 36  ? 19.804  -32.927 39.770 1.00 48.23 ? 178 LEU B CD2   1 
ATOM   1632 N  N     . THR B 1 37  ? 17.244  -35.579 35.683 1.00 49.23 ? 179 THR B N     1 
ATOM   1633 C  CA    . THR B 1 37  ? 16.441  -35.737 34.473 1.00 49.80 ? 179 THR B CA    1 
ATOM   1634 C  C     . THR B 1 37  ? 14.954  -35.847 34.833 1.00 52.59 ? 179 THR B C     1 
ATOM   1635 O  O     . THR B 1 37  ? 14.605  -36.268 35.936 1.00 54.34 ? 179 THR B O     1 
ATOM   1636 C  CB    . THR B 1 37  ? 16.866  -36.994 33.674 1.00 50.10 ? 179 THR B CB    1 
ATOM   1637 O  OG1   . THR B 1 37  ? 16.416  -38.176 34.352 1.00 52.26 ? 179 THR B OG1   1 
ATOM   1638 C  CG2   . THR B 1 37  ? 18.386  -37.049 33.515 1.00 47.61 ? 179 THR B CG2   1 
ATOM   1639 N  N     . GLN B 1 38  ? 14.091  -35.475 33.890 1.00 53.26 ? 180 GLN B N     1 
ATOM   1640 C  CA    . GLN B 1 38  ? 12.640  -35.452 34.116 1.00 56.23 ? 180 GLN B CA    1 
ATOM   1641 C  C     . GLN B 1 38  ? 11.876  -36.420 33.200 1.00 57.62 ? 180 GLN B C     1 
ATOM   1642 O  O     . GLN B 1 38  ? 10.644  -36.462 33.215 1.00 60.62 ? 180 GLN B O     1 
ATOM   1643 C  CB    . GLN B 1 38  ? 12.090  -34.018 33.987 1.00 56.98 ? 180 GLN B CB    1 
ATOM   1644 C  CG    . GLN B 1 38  ? 12.577  -33.225 32.774 1.00 56.36 ? 180 GLN B CG    1 
ATOM   1645 C  CD    . GLN B 1 38  ? 12.176  -31.762 32.841 1.00 57.42 ? 180 GLN B CD    1 
ATOM   1646 O  OE1   . GLN B 1 38  ? 12.450  -31.078 33.834 1.00 59.89 ? 180 GLN B OE1   1 
ATOM   1647 N  NE2   . GLN B 1 38  ? 11.531  -31.270 31.781 1.00 61.08 ? 180 GLN B NE2   1 
ATOM   1648 N  N     . ALA B 1 39  ? 12.618  -37.208 32.427 1.00 55.63 ? 181 ALA B N     1 
ATOM   1649 C  CA    . ALA B 1 39  ? 12.045  -38.249 31.597 1.00 57.07 ? 181 ALA B CA    1 
ATOM   1650 C  C     . ALA B 1 39  ? 13.124  -39.285 31.316 1.00 55.27 ? 181 ALA B C     1 
ATOM   1651 O  O     . ALA B 1 39  ? 14.299  -39.048 31.600 1.00 52.73 ? 181 ALA B O     1 
ATOM   1652 C  CB    . ALA B 1 39  ? 11.532  -37.658 30.293 1.00 57.98 ? 181 ALA B CB    1 
ATOM   1653 N  N     . PRO B 1 40  ? 12.733  -40.442 30.764 1.00 56.62 ? 182 PRO B N     1 
ATOM   1654 C  CA    . PRO B 1 40  ? 13.744  -41.365 30.256 1.00 55.78 ? 182 PRO B CA    1 
ATOM   1655 C  C     . PRO B 1 40  ? 14.497  -40.766 29.072 1.00 53.44 ? 182 PRO B C     1 
ATOM   1656 O  O     . PRO B 1 40  ? 13.952  -39.926 28.359 1.00 53.17 ? 182 PRO B O     1 
ATOM   1657 C  CB    . PRO B 1 40  ? 12.922  -42.577 29.801 1.00 59.33 ? 182 PRO B CB    1 
ATOM   1658 C  CG    . PRO B 1 40  ? 11.572  -42.418 30.447 1.00 61.62 ? 182 PRO B CG    1 
ATOM   1659 C  CD    . PRO B 1 40  ? 11.364  -40.961 30.595 1.00 60.03 ? 182 PRO B CD    1 
ATOM   1660 N  N     . GLY B 1 41  ? 15.735  -41.200 28.868 1.00 51.72 ? 183 GLY B N     1 
ATOM   1661 C  CA    . GLY B 1 41  ? 16.529  -40.761 27.721 1.00 50.37 ? 183 GLY B CA    1 
ATOM   1662 C  C     . GLY B 1 41  ? 17.617  -39.772 28.090 1.00 46.77 ? 183 GLY B C     1 
ATOM   1663 O  O     . GLY B 1 41  ? 17.865  -39.505 29.274 1.00 45.38 ? 183 GLY B O     1 
ATOM   1664 N  N     . ASN B 1 42  ? 18.260  -39.224 27.061 1.00 45.45 ? 184 ASN B N     1 
ATOM   1665 C  CA    . ASN B 1 42  ? 19.432  -38.361 27.225 1.00 42.42 ? 184 ASN B CA    1 
ATOM   1666 C  C     . ASN B 1 42  ? 19.087  -36.875 27.060 1.00 40.57 ? 184 ASN B C     1 
ATOM   1667 O  O     . ASN B 1 42  ? 18.593  -36.475 26.008 1.00 41.86 ? 184 ASN B O     1 
ATOM   1668 C  CB    . ASN B 1 42  ? 20.531  -38.776 26.234 1.00 42.77 ? 184 ASN B CB    1 
ATOM   1669 C  CG    . ASN B 1 42  ? 21.238  -40.079 26.639 1.00 45.27 ? 184 ASN B CG    1 
ATOM   1670 O  OD1   . ASN B 1 42  ? 21.377  -40.402 27.830 1.00 46.68 ? 184 ASN B OD1   1 
ATOM   1671 N  ND2   . ASN B 1 42  ? 21.692  -40.830 25.643 1.00 48.84 ? 184 ASN B ND2   1 
ATOM   1672 N  N     . PRO B 1 43  ? 19.335  -36.052 28.106 1.00 37.99 ? 185 PRO B N     1 
ATOM   1673 C  CA    . PRO B 1 43  ? 19.005  -34.623 28.059 1.00 36.59 ? 185 PRO B CA    1 
ATOM   1674 C  C     . PRO B 1 43  ? 19.800  -33.768 27.067 1.00 34.84 ? 185 PRO B C     1 
ATOM   1675 O  O     . PRO B 1 43  ? 19.268  -32.778 26.590 1.00 34.46 ? 185 PRO B O     1 
ATOM   1676 C  CB    . PRO B 1 43  ? 19.288  -34.136 29.490 1.00 35.21 ? 185 PRO B CB    1 
ATOM   1677 C  CG    . PRO B 1 43  ? 19.450  -35.330 30.311 1.00 36.25 ? 185 PRO B CG    1 
ATOM   1678 C  CD    . PRO B 1 43  ? 19.895  -36.433 29.415 1.00 37.32 ? 185 PRO B CD    1 
ATOM   1679 N  N     . VAL B 1 44  ? 21.060  -34.121 26.803 1.00 33.80 ? 186 VAL B N     1 
ATOM   1680 C  CA    . VAL B 1 44  ? 21.915  -33.365 25.877 1.00 33.07 ? 186 VAL B CA    1 
ATOM   1681 C  C     . VAL B 1 44  ? 21.730  -33.897 24.452 1.00 35.01 ? 186 VAL B C     1 
ATOM   1682 O  O     . VAL B 1 44  ? 22.032  -35.045 24.167 1.00 35.74 ? 186 VAL B O     1 
ATOM   1683 C  CB    . VAL B 1 44  ? 23.429  -33.409 26.266 1.00 31.42 ? 186 VAL B CB    1 
ATOM   1684 C  CG1   . VAL B 1 44  ? 24.256  -32.532 25.337 1.00 30.17 ? 186 VAL B CG1   1 
ATOM   1685 C  CG2   . VAL B 1 44  ? 23.648  -32.953 27.702 1.00 29.91 ? 186 VAL B CG2   1 
ATOM   1686 N  N     . LEU B 1 45  ? 21.234  -33.036 23.568 1.00 36.13 ? 187 LEU B N     1 
ATOM   1687 C  CA    . LEU B 1 45  ? 21.004  -33.373 22.160 1.00 38.77 ? 187 LEU B CA    1 
ATOM   1688 C  C     . LEU B 1 45  ? 22.248  -33.220 21.275 1.00 39.10 ? 187 LEU B C     1 
ATOM   1689 O  O     . LEU B 1 45  ? 22.417  -33.958 20.301 1.00 41.45 ? 187 LEU B O     1 
ATOM   1690 C  CB    . LEU B 1 45  ? 19.895  -32.478 21.603 1.00 40.31 ? 187 LEU B CB    1 
ATOM   1691 C  CG    . LEU B 1 45  ? 18.517  -32.575 22.263 1.00 41.04 ? 187 LEU B CG    1 
ATOM   1692 C  CD1   . LEU B 1 45  ? 17.579  -31.513 21.695 1.00 43.16 ? 187 LEU B CD1   1 
ATOM   1693 C  CD2   . LEU B 1 45  ? 17.927  -33.964 22.091 1.00 42.09 ? 187 LEU B CD2   1 
ATOM   1694 N  N     . ALA B 1 46  ? 23.105  -32.251 21.594 1.00 37.41 ? 188 ALA B N     1 
ATOM   1695 C  CA    . ALA B 1 46  ? 24.272  -31.948 20.756 1.00 37.77 ? 188 ALA B CA    1 
ATOM   1696 C  C     . ALA B 1 46  ? 25.280  -31.078 21.485 1.00 35.42 ? 188 ALA B C     1 
ATOM   1697 O  O     . ALA B 1 46  ? 24.927  -30.377 22.430 1.00 33.91 ? 188 ALA B O     1 
ATOM   1698 C  CB    . ALA B 1 46  ? 23.831  -31.252 19.466 1.00 39.79 ? 188 ALA B CB    1 
ATOM   1699 N  N     . VAL B 1 47  ? 26.524  -31.121 20.996 1.00 35.97 ? 189 VAL B N     1 
ATOM   1700 C  CA    . VAL B 1 47  ? 27.653  -30.351 21.498 1.00 34.08 ? 189 VAL B CA    1 
ATOM   1701 C  C     . VAL B 1 47  ? 28.476  -29.757 20.343 1.00 35.68 ? 189 VAL B C     1 
ATOM   1702 O  O     . VAL B 1 47  ? 28.770  -30.456 19.380 1.00 37.26 ? 189 VAL B O     1 
ATOM   1703 C  CB    . VAL B 1 47  ? 28.582  -31.253 22.339 1.00 33.18 ? 189 VAL B CB    1 
ATOM   1704 C  CG1   . VAL B 1 47  ? 29.839  -30.515 22.728 1.00 31.30 ? 189 VAL B CG1   1 
ATOM   1705 C  CG2   . VAL B 1 47  ? 27.861  -31.743 23.572 1.00 32.27 ? 189 VAL B CG2   1 
ATOM   1706 N  N     . GLN B 1 48  ? 28.848  -28.477 20.453 1.00 35.17 ? 190 GLN B N     1 
ATOM   1707 C  CA    . GLN B 1 48  ? 29.761  -27.833 19.496 1.00 37.01 ? 190 GLN B CA    1 
ATOM   1708 C  C     . GLN B 1 48  ? 31.003  -27.300 20.208 1.00 35.29 ? 190 GLN B C     1 
ATOM   1709 O  O     . GLN B 1 48  ? 30.890  -26.528 21.162 1.00 33.73 ? 190 GLN B O     1 
ATOM   1710 C  CB    . GLN B 1 48  ? 29.083  -26.680 18.746 1.00 38.73 ? 190 GLN B CB    1 
ATOM   1711 C  CG    . GLN B 1 48  ? 27.884  -27.086 17.888 1.00 43.72 ? 190 GLN B CG    1 
ATOM   1712 C  CD    . GLN B 1 48  ? 26.550  -26.742 18.547 1.00 47.06 ? 190 GLN B CD    1 
ATOM   1713 O  OE1   . GLN B 1 48  ? 26.388  -25.647 19.095 1.00 48.31 ? 190 GLN B OE1   1 
ATOM   1714 N  NE2   . GLN B 1 48  ? 25.587  -27.674 18.491 1.00 48.62 ? 190 GLN B NE2   1 
ATOM   1715 N  N     . ILE B 1 49  ? 32.178  -27.694 19.720 1.00 36.28 ? 191 ILE B N     1 
ATOM   1716 C  CA    . ILE B 1 49  ? 33.452  -27.346 20.347 1.00 35.23 ? 191 ILE B CA    1 
ATOM   1717 C  C     . ILE B 1 49  ? 34.313  -26.429 19.461 1.00 36.35 ? 191 ILE B C     1 
ATOM   1718 O  O     . ILE B 1 49  ? 34.470  -26.690 18.268 1.00 38.40 ? 191 ILE B O     1 
ATOM   1719 C  CB    . ILE B 1 49  ? 34.269  -28.621 20.668 1.00 35.90 ? 191 ILE B CB    1 
ATOM   1720 C  CG1   . ILE B 1 49  ? 33.578  -29.431 21.770 1.00 35.08 ? 191 ILE B CG1   1 
ATOM   1721 C  CG2   . ILE B 1 49  ? 35.693  -28.250 21.089 1.00 36.39 ? 191 ILE B CG2   1 
ATOM   1722 C  CD1   . ILE B 1 49  ? 34.308  -30.703 22.158 1.00 35.67 ? 191 ILE B CD1   1 
ATOM   1723 N  N     . ASN B 1 50  ? 34.854  -25.367 20.062 1.00 34.42 ? 192 ASN B N     1 
ATOM   1724 C  CA    . ASN B 1 50  ? 35.909  -24.541 19.460 1.00 36.14 ? 192 ASN B CA    1 
ATOM   1725 C  C     . ASN B 1 50  ? 37.260  -24.985 20.031 1.00 35.92 ? 192 ASN B C     1 
ATOM   1726 O  O     . ASN B 1 50  ? 37.543  -24.766 21.207 1.00 33.81 ? 192 ASN B O     1 
ATOM   1727 C  CB    . ASN B 1 50  ? 35.656  -23.051 19.750 1.00 34.79 ? 192 ASN B CB    1 
ATOM   1728 C  CG    . ASN B 1 50  ? 36.676  -22.114 19.079 1.00 36.37 ? 192 ASN B CG    1 
ATOM   1729 O  OD1   . ASN B 1 50  ? 37.881  -22.343 19.113 1.00 36.46 ? 192 ASN B OD1   1 
ATOM   1730 N  ND2   . ASN B 1 50  ? 36.182  -21.035 18.494 1.00 35.27 ? 192 ASN B ND2   1 
ATOM   1731 N  N     . GLN B 1 51  ? 38.075  -25.623 19.196 1.00 38.55 ? 193 GLN B N     1 
ATOM   1732 C  CA    . GLN B 1 51  ? 39.365  -26.176 19.625 1.00 40.30 ? 193 GLN B CA    1 
ATOM   1733 C  C     . GLN B 1 51  ? 40.390  -25.088 19.954 1.00 40.39 ? 193 GLN B C     1 
ATOM   1734 O  O     . GLN B 1 51  ? 41.082  -25.173 20.969 1.00 40.10 ? 193 GLN B O     1 
ATOM   1735 C  CB    . GLN B 1 51  ? 39.946  -27.095 18.542 1.00 43.88 ? 193 GLN B CB    1 
ATOM   1736 C  CG    . GLN B 1 51  ? 39.389  -28.509 18.580 1.00 45.42 ? 193 GLN B CG    1 
ATOM   1737 C  CD    . GLN B 1 51  ? 39.074  -29.056 17.209 1.00 49.25 ? 193 GLN B CD    1 
ATOM   1738 O  OE1   . GLN B 1 51  ? 39.743  -28.731 16.218 1.00 55.98 ? 193 GLN B OE1   1 
ATOM   1739 N  NE2   . GLN B 1 51  ? 38.049  -29.905 17.139 1.00 52.73 ? 193 GLN B NE2   1 
ATOM   1740 N  N     . ASP B 1 52  ? 40.478  -24.074 19.097 1.00 41.04 ? 194 ASP B N     1 
ATOM   1741 C  CA    . ASP B 1 52  ? 41.470  -23.011 19.268 1.00 41.66 ? 194 ASP B CA    1 
ATOM   1742 C  C     . ASP B 1 52  ? 41.291  -22.244 20.588 1.00 38.46 ? 194 ASP B C     1 
ATOM   1743 O  O     . ASP B 1 52  ? 42.277  -21.852 21.202 1.00 38.68 ? 194 ASP B O     1 
ATOM   1744 C  CB    . ASP B 1 52  ? 41.440  -22.043 18.074 1.00 43.93 ? 194 ASP B CB    1 
ATOM   1745 C  CG    . ASP B 1 52  ? 41.814  -22.716 16.751 1.00 48.85 ? 194 ASP B CG    1 
ATOM   1746 O  OD1   . ASP B 1 52  ? 41.752  -22.029 15.710 1.00 54.64 ? 194 ASP B OD1   1 
ATOM   1747 O  OD2   . ASP B 1 52  ? 42.169  -23.919 16.736 1.00 51.48 ? 194 ASP B OD2   1 
ATOM   1748 N  N     . LYS B 1 53  ? 40.044  -22.068 21.035 1.00 35.78 ? 195 LYS B N     1 
ATOM   1749 C  CA    . LYS B 1 53  ? 39.743  -21.254 22.225 1.00 33.34 ? 195 LYS B CA    1 
ATOM   1750 C  C     . LYS B 1 53  ? 39.219  -22.034 23.447 1.00 30.90 ? 195 LYS B C     1 
ATOM   1751 O  O     . LYS B 1 53  ? 38.795  -21.433 24.424 1.00 29.14 ? 195 LYS B O     1 
ATOM   1752 C  CB    . LYS B 1 53  ? 38.758  -20.132 21.850 1.00 33.09 ? 195 LYS B CB    1 
ATOM   1753 C  CG    . LYS B 1 53  ? 39.391  -19.008 21.036 1.00 34.64 ? 195 LYS B CG    1 
ATOM   1754 C  CD    . LYS B 1 53  ? 38.366  -17.963 20.576 1.00 35.07 ? 195 LYS B CD    1 
ATOM   1755 C  CE    . LYS B 1 53  ? 37.884  -17.085 21.729 1.00 32.68 ? 195 LYS B CE    1 
ATOM   1756 N  NZ    . LYS B 1 53  ? 37.101  -15.883 21.263 1.00 33.17 ? 195 LYS B NZ    1 
ATOM   1757 N  N     . ASN B 1 54  ? 39.248  -23.360 23.387 1.00 30.80 ? 196 ASN B N     1 
ATOM   1758 C  CA    . ASN B 1 54  ? 38.950  -24.228 24.538 1.00 29.57 ? 196 ASN B CA    1 
ATOM   1759 C  C     . ASN B 1 54  ? 37.579  -24.003 25.202 1.00 27.51 ? 196 ASN B C     1 
ATOM   1760 O  O     . ASN B 1 54  ? 37.463  -23.978 26.424 1.00 26.13 ? 196 ASN B O     1 
ATOM   1761 C  CB    . ASN B 1 54  ? 40.085  -24.165 25.576 1.00 30.27 ? 196 ASN B CB    1 
ATOM   1762 C  CG    . ASN B 1 54  ? 41.387  -24.781 25.067 1.00 34.04 ? 196 ASN B CG    1 
ATOM   1763 O  OD1   . ASN B 1 54  ? 42.385  -24.089 24.891 1.00 37.06 ? 196 ASN B OD1   1 
ATOM   1764 N  ND2   . ASN B 1 54  ? 41.371  -26.083 24.811 1.00 37.70 ? 196 ASN B ND2   1 
ATOM   1765 N  N     . PHE B 1 55  ? 36.538  -23.852 24.390 1.00 27.23 ? 197 PHE B N     1 
ATOM   1766 C  CA    . PHE B 1 55  ? 35.176  -23.802 24.911 1.00 26.06 ? 197 PHE B CA    1 
ATOM   1767 C  C     . PHE B 1 55  ? 34.227  -24.616 24.025 1.00 26.51 ? 197 PHE B C     1 
ATOM   1768 O  O     . PHE B 1 55  ? 34.542  -24.945 22.872 1.00 27.09 ? 197 PHE B O     1 
ATOM   1769 C  CB    . PHE B 1 55  ? 34.681  -22.346 25.073 1.00 25.63 ? 197 PHE B CB    1 
ATOM   1770 C  CG    . PHE B 1 55  ? 34.324  -21.662 23.773 1.00 26.96 ? 197 PHE B CG    1 
ATOM   1771 C  CD1   . PHE B 1 55  ? 33.030  -21.715 23.275 1.00 27.60 ? 197 PHE B CD1   1 
ATOM   1772 C  CD2   . PHE B 1 55  ? 35.279  -20.955 23.058 1.00 27.27 ? 197 PHE B CD2   1 
ATOM   1773 C  CE1   . PHE B 1 55  ? 32.700  -21.093 22.062 1.00 29.20 ? 197 PHE B CE1   1 
ATOM   1774 C  CE2   . PHE B 1 55  ? 34.958  -20.328 21.866 1.00 29.79 ? 197 PHE B CE2   1 
ATOM   1775 C  CZ    . PHE B 1 55  ? 33.663  -20.395 21.368 1.00 30.19 ? 197 PHE B CZ    1 
ATOM   1776 N  N     . ALA B 1 56  ? 33.079  -24.953 24.596 1.00 25.76 ? 198 ALA B N     1 
ATOM   1777 C  CA    . ALA B 1 56  ? 32.034  -25.656 23.880 1.00 27.25 ? 198 ALA B CA    1 
ATOM   1778 C  C     . ALA B 1 56  ? 30.686  -25.061 24.234 1.00 27.04 ? 198 ALA B C     1 
ATOM   1779 O  O     . ALA B 1 56  ? 30.567  -24.355 25.233 1.00 25.73 ? 198 ALA B O     1 
ATOM   1780 C  CB    . ALA B 1 56  ? 32.052  -27.129 24.228 1.00 26.87 ? 198 ALA B CB    1 
ATOM   1781 N  N     . PHE B 1 57  ? 29.688  -25.335 23.394 1.00 28.74 ? 199 PHE B N     1 
ATOM   1782 C  CA    . PHE B 1 57  ? 28.280  -25.133 23.750 1.00 29.37 ? 199 PHE B CA    1 
ATOM   1783 C  C     . PHE B 1 57  ? 27.546  -26.473 23.780 1.00 30.23 ? 199 PHE B C     1 
ATOM   1784 O  O     . PHE B 1 57  ? 27.747  -27.318 22.907 1.00 30.66 ? 199 PHE B O     1 
ATOM   1785 C  CB    . PHE B 1 57  ? 27.587  -24.165 22.784 1.00 31.70 ? 199 PHE B CB    1 
ATOM   1786 C  CG    . PHE B 1 57  ? 27.700  -22.729 23.202 1.00 31.85 ? 199 PHE B CG    1 
ATOM   1787 C  CD1   . PHE B 1 57  ? 26.756  -22.169 24.054 1.00 32.12 ? 199 PHE B CD1   1 
ATOM   1788 C  CD2   . PHE B 1 57  ? 28.772  -21.952 22.785 1.00 31.99 ? 199 PHE B CD2   1 
ATOM   1789 C  CE1   . PHE B 1 57  ? 26.876  -20.861 24.475 1.00 32.09 ? 199 PHE B CE1   1 
ATOM   1790 C  CE2   . PHE B 1 57  ? 28.894  -20.643 23.196 1.00 32.44 ? 199 PHE B CE2   1 
ATOM   1791 C  CZ    . PHE B 1 57  ? 27.949  -20.094 24.047 1.00 32.49 ? 199 PHE B CZ    1 
ATOM   1792 N  N     . LEU B 1 58  ? 26.731  -26.668 24.824 1.00 30.30 ? 200 LEU B N     1 
ATOM   1793 C  CA    . LEU B 1 58  ? 25.833  -27.816 24.935 1.00 30.75 ? 200 LEU B CA    1 
ATOM   1794 C  C     . LEU B 1 58  ? 24.425  -27.357 24.640 1.00 32.43 ? 200 LEU B C     1 
ATOM   1795 O  O     . LEU B 1 58  ? 24.013  -26.299 25.113 1.00 32.48 ? 200 LEU B O     1 
ATOM   1796 C  CB    . LEU B 1 58  ? 25.819  -28.363 26.354 1.00 29.83 ? 200 LEU B CB    1 
ATOM   1797 C  CG    . LEU B 1 58  ? 27.093  -28.753 27.073 1.00 29.56 ? 200 LEU B CG    1 
ATOM   1798 C  CD1   . LEU B 1 58  ? 26.722  -29.061 28.511 1.00 29.75 ? 200 LEU B CD1   1 
ATOM   1799 C  CD2   . LEU B 1 58  ? 27.760  -29.949 26.406 1.00 31.27 ? 200 LEU B CD2   1 
ATOM   1800 N  N     . GLU B 1 59  ? 23.681  -28.166 23.887 1.00 34.55 ? 201 GLU B N     1 
ATOM   1801 C  CA    . GLU B 1 59  ? 22.269  -27.923 23.626 1.00 35.85 ? 201 GLU B CA    1 
ATOM   1802 C  C     . GLU B 1 59  ? 21.443  -29.027 24.306 1.00 35.96 ? 201 GLU B C     1 
ATOM   1803 O  O     . GLU B 1 59  ? 21.751  -30.216 24.176 1.00 35.87 ? 201 GLU B O     1 
ATOM   1804 C  CB    . GLU B 1 59  ? 22.017  -27.883 22.107 1.00 38.85 ? 201 GLU B CB    1 
ATOM   1805 C  CG    . GLU B 1 59  ? 20.559  -27.626 21.685 1.00 43.13 ? 201 GLU B CG    1 
ATOM   1806 C  CD    . GLU B 1 59  ? 20.278  -26.210 21.156 1.00 49.78 ? 201 GLU B CD    1 
ATOM   1807 O  OE1   . GLU B 1 59  ? 19.219  -25.639 21.522 1.00 53.63 ? 201 GLU B OE1   1 
ATOM   1808 O  OE2   . GLU B 1 59  ? 21.075  -25.678 20.344 1.00 52.27 ? 201 GLU B OE2   1 
ATOM   1809 N  N     . PHE B 1 60  ? 20.392  -28.618 25.015 1.00 36.13 ? 202 PHE B N     1 
ATOM   1810 C  CA    . PHE B 1 60  ? 19.531  -29.523 25.782 1.00 36.16 ? 202 PHE B CA    1 
ATOM   1811 C  C     . PHE B 1 60  ? 18.144  -29.694 25.156 1.00 38.59 ? 202 PHE B C     1 
ATOM   1812 O  O     . PHE B 1 60  ? 17.704  -28.862 24.360 1.00 40.07 ? 202 PHE B O     1 
ATOM   1813 C  CB    . PHE B 1 60  ? 19.353  -28.989 27.200 1.00 35.61 ? 202 PHE B CB    1 
ATOM   1814 C  CG    . PHE B 1 60  ? 20.569  -29.118 28.057 1.00 33.24 ? 202 PHE B CG    1 
ATOM   1815 C  CD1   . PHE B 1 60  ? 21.565  -28.143 28.030 1.00 33.74 ? 202 PHE B CD1   1 
ATOM   1816 C  CD2   . PHE B 1 60  ? 20.715  -30.199 28.909 1.00 33.30 ? 202 PHE B CD2   1 
ATOM   1817 C  CE1   . PHE B 1 60  ? 22.693  -28.254 28.826 1.00 31.34 ? 202 PHE B CE1   1 
ATOM   1818 C  CE2   . PHE B 1 60  ? 21.833  -30.327 29.713 1.00 32.59 ? 202 PHE B CE2   1 
ATOM   1819 C  CZ    . PHE B 1 60  ? 22.827  -29.349 29.677 1.00 31.75 ? 202 PHE B CZ    1 
ATOM   1820 N  N     . ARG B 1 61  ? 17.455  -30.770 25.541 1.00 38.90 ? 203 ARG B N     1 
ATOM   1821 C  CA    . ARG B 1 61  ? 16.090  -31.037 25.077 1.00 41.44 ? 203 ARG B CA    1 
ATOM   1822 C  C     . ARG B 1 61  ? 14.998  -30.238 25.812 1.00 42.37 ? 203 ARG B C     1 
ATOM   1823 O  O     . ARG B 1 61  ? 13.903  -30.079 25.275 1.00 45.19 ? 203 ARG B O     1 
ATOM   1824 C  CB    . ARG B 1 61  ? 15.763  -32.544 25.171 1.00 42.42 ? 203 ARG B CB    1 
ATOM   1825 C  CG    . ARG B 1 61  ? 15.663  -33.065 26.596 1.00 41.06 ? 203 ARG B CG    1 
ATOM   1826 C  CD    . ARG B 1 61  ? 15.282  -34.525 26.651 1.00 42.51 ? 203 ARG B CD    1 
ATOM   1827 N  NE    . ARG B 1 61  ? 15.377  -35.033 28.017 1.00 40.61 ? 203 ARG B NE    1 
ATOM   1828 C  CZ    . ARG B 1 61  ? 15.174  -36.296 28.373 1.00 41.86 ? 203 ARG B CZ    1 
ATOM   1829 N  NH1   . ARG B 1 61  ? 14.852  -37.219 27.474 1.00 43.52 ? 203 ARG B NH1   1 
ATOM   1830 N  NH2   . ARG B 1 61  ? 15.299  -36.636 29.646 1.00 41.73 ? 203 ARG B NH2   1 
ATOM   1831 N  N     . SER B 1 62  ? 15.263  -29.769 27.034 1.00 40.36 ? 204 SER B N     1 
ATOM   1832 C  CA    . SER B 1 62  ? 14.262  -28.988 27.772 1.00 41.95 ? 204 SER B CA    1 
ATOM   1833 C  C     . SER B 1 62  ? 14.837  -27.801 28.538 1.00 40.16 ? 204 SER B C     1 
ATOM   1834 O  O     . SER B 1 62  ? 16.020  -27.767 28.870 1.00 37.54 ? 204 SER B O     1 
ATOM   1835 C  CB    . SER B 1 62  ? 13.441  -29.886 28.719 1.00 43.27 ? 204 SER B CB    1 
ATOM   1836 O  OG    . SER B 1 62  ? 14.124  -30.166 29.931 1.00 41.53 ? 204 SER B OG    1 
ATOM   1837 N  N     . VAL B 1 63  ? 13.970  -26.828 28.814 1.00 42.08 ? 205 VAL B N     1 
ATOM   1838 C  CA    . VAL B 1 63  ? 14.342  -25.624 29.547 1.00 41.54 ? 205 VAL B CA    1 
ATOM   1839 C  C     . VAL B 1 63  ? 14.722  -25.944 30.998 1.00 40.15 ? 205 VAL B C     1 
ATOM   1840 O  O     . VAL B 1 63  ? 15.729  -25.456 31.488 1.00 37.72 ? 205 VAL B O     1 
ATOM   1841 C  CB    . VAL B 1 63  ? 13.219  -24.561 29.497 1.00 44.76 ? 205 VAL B CB    1 
ATOM   1842 C  CG1   . VAL B 1 63  ? 13.487  -23.430 30.477 1.00 44.75 ? 205 VAL B CG1   1 
ATOM   1843 C  CG2   . VAL B 1 63  ? 13.080  -24.014 28.088 1.00 45.60 ? 205 VAL B CG2   1 
ATOM   1844 N  N     . ASP B 1 64  ? 13.939  -26.778 31.672 1.00 41.79 ? 206 ASP B N     1 
ATOM   1845 C  CA    . ASP B 1 64  ? 14.205  -27.099 33.083 1.00 41.65 ? 206 ASP B CA    1 
ATOM   1846 C  C     . ASP B 1 64  ? 15.482  -27.936 33.326 1.00 38.92 ? 206 ASP B C     1 
ATOM   1847 O  O     . ASP B 1 64  ? 16.176  -27.716 34.314 1.00 37.75 ? 206 ASP B O     1 
ATOM   1848 C  CB    . ASP B 1 64  ? 12.988  -27.777 33.712 1.00 44.82 ? 206 ASP B CB    1 
ATOM   1849 C  CG    . ASP B 1 64  ? 11.780  -26.833 33.838 1.00 49.41 ? 206 ASP B CG    1 
ATOM   1850 O  OD1   . ASP B 1 64  ? 10.687  -27.320 34.199 1.00 53.57 ? 206 ASP B OD1   1 
ATOM   1851 O  OD2   . ASP B 1 64  ? 11.916  -25.611 33.583 1.00 51.82 ? 206 ASP B OD2   1 
ATOM   1852 N  N     . GLU B 1 65  ? 15.794  -28.872 32.430 1.00 37.97 ? 207 GLU B N     1 
ATOM   1853 C  CA    . GLU B 1 65  ? 17.013  -29.684 32.546 1.00 35.95 ? 207 GLU B CA    1 
ATOM   1854 C  C     . GLU B 1 65  ? 18.279  -28.865 32.300 1.00 33.69 ? 207 GLU B C     1 
ATOM   1855 O  O     . GLU B 1 65  ? 19.323  -29.154 32.870 1.00 32.24 ? 207 GLU B O     1 
ATOM   1856 C  CB    . GLU B 1 65  ? 16.963  -30.884 31.592 1.00 36.19 ? 207 GLU B CB    1 
ATOM   1857 C  CG    . GLU B 1 65  ? 16.146  -32.051 32.149 1.00 38.65 ? 207 GLU B CG    1 
ATOM   1858 C  CD    . GLU B 1 65  ? 15.771  -33.098 31.104 1.00 40.47 ? 207 GLU B CD    1 
ATOM   1859 O  OE1   . GLU B 1 65  ? 15.728  -32.770 29.891 1.00 41.78 ? 207 GLU B OE1   1 
ATOM   1860 O  OE2   . GLU B 1 65  ? 15.493  -34.250 31.513 1.00 42.85 ? 207 GLU B OE2   1 
ATOM   1861 N  N     . THR B 1 66  ? 18.175  -27.840 31.460 1.00 33.66 ? 208 THR B N     1 
ATOM   1862 C  CA    . THR B 1 66  ? 19.263  -26.896 31.236 1.00 32.17 ? 208 THR B CA    1 
ATOM   1863 C  C     . THR B 1 66  ? 19.594  -26.138 32.519 1.00 32.26 ? 208 THR B C     1 
ATOM   1864 O  O     . THR B 1 66  ? 20.758  -25.980 32.883 1.00 30.31 ? 208 THR B O     1 
ATOM   1865 C  CB    . THR B 1 66  ? 18.883  -25.875 30.141 1.00 33.24 ? 208 THR B CB    1 
ATOM   1866 O  OG1   . THR B 1 66  ? 18.455  -26.579 28.972 1.00 32.86 ? 208 THR B OG1   1 
ATOM   1867 C  CG2   . THR B 1 66  ? 20.072  -24.943 29.796 1.00 31.11 ? 208 THR B CG2   1 
ATOM   1868 N  N     . THR B 1 67  ? 18.548  -25.675 33.192 1.00 34.53 ? 209 THR B N     1 
ATOM   1869 C  CA    . THR B 1 67  ? 18.680  -24.953 34.451 1.00 35.75 ? 209 THR B CA    1 
ATOM   1870 C  C     . THR B 1 67  ? 19.275  -25.843 35.548 1.00 35.69 ? 209 THR B C     1 
ATOM   1871 O  O     . THR B 1 67  ? 20.122  -25.390 36.325 1.00 35.53 ? 209 THR B O     1 
ATOM   1872 C  CB    . THR B 1 67  ? 17.320  -24.391 34.863 1.00 38.45 ? 209 THR B CB    1 
ATOM   1873 O  OG1   . THR B 1 67  ? 16.841  -23.552 33.803 1.00 38.78 ? 209 THR B OG1   1 
ATOM   1874 C  CG2   . THR B 1 67  ? 17.406  -23.588 36.156 1.00 39.82 ? 209 THR B CG2   1 
ATOM   1875 N  N     . GLN B 1 68  ? 18.860  -27.109 35.572 1.00 36.37 ? 210 GLN B N     1 
ATOM   1876 C  CA    . GLN B 1 68  ? 19.442  -28.121 36.467 1.00 36.54 ? 210 GLN B CA    1 
ATOM   1877 C  C     . GLN B 1 68  ? 20.938  -28.362 36.240 1.00 34.23 ? 210 GLN B C     1 
ATOM   1878 O  O     . GLN B 1 68  ? 21.673  -28.567 37.193 1.00 34.29 ? 210 GLN B O     1 
ATOM   1879 C  CB    . GLN B 1 68  ? 18.707  -29.461 36.315 1.00 37.78 ? 210 GLN B CB    1 
ATOM   1880 C  CG    . GLN B 1 68  ? 17.245  -29.447 36.750 1.00 42.56 ? 210 GLN B CG    1 
ATOM   1881 C  CD    . GLN B 1 68  ? 17.082  -29.337 38.252 1.00 48.31 ? 210 GLN B CD    1 
ATOM   1882 O  OE1   . GLN B 1 68  ? 17.809  -29.975 39.011 1.00 50.89 ? 210 GLN B OE1   1 
ATOM   1883 N  NE2   . GLN B 1 68  ? 16.116  -28.526 38.691 1.00 52.52 ? 210 GLN B NE2   1 
ATOM   1884 N  N     . ALA B 1 69  ? 21.376  -28.357 34.981 1.00 33.15 ? 211 ALA B N     1 
ATOM   1885 C  CA    . ALA B 1 69  ? 22.774  -28.639 34.619 1.00 31.82 ? 211 ALA B CA    1 
ATOM   1886 C  C     . ALA B 1 69  ? 23.729  -27.522 35.047 1.00 31.53 ? 211 ALA B C     1 
ATOM   1887 O  O     . ALA B 1 69  ? 24.950  -27.701 35.083 1.00 31.31 ? 211 ALA B O     1 
ATOM   1888 C  CB    . ALA B 1 69  ? 22.884  -28.869 33.127 1.00 30.87 ? 211 ALA B CB    1 
ATOM   1889 N  N     . MET B 1 70  ? 23.171  -26.369 35.367 1.00 32.48 ? 212 MET B N     1 
ATOM   1890 C  CA    . MET B 1 70  ? 23.933  -25.255 35.925 1.00 33.24 ? 212 MET B CA    1 
ATOM   1891 C  C     . MET B 1 70  ? 24.655  -25.618 37.249 1.00 33.55 ? 212 MET B C     1 
ATOM   1892 O  O     . MET B 1 70  ? 25.658  -24.988 37.604 1.00 33.17 ? 212 MET B O     1 
ATOM   1893 C  CB    . MET B 1 70  ? 22.987  -24.074 36.153 1.00 35.76 ? 212 MET B CB    1 
ATOM   1894 C  CG    . MET B 1 70  ? 23.640  -22.734 36.119 1.00 38.85 ? 212 MET B CG    1 
ATOM   1895 S  SD    . MET B 1 70  ? 23.925  -22.118 34.445 1.00 41.94 ? 212 MET B SD    1 
ATOM   1896 C  CE    . MET B 1 70  ? 24.787  -20.618 34.899 1.00 39.71 ? 212 MET B CE    1 
ATOM   1897 N  N     . ALA B 1 71  ? 24.146  -26.624 37.962 1.00 34.10 ? 213 ALA B N     1 
ATOM   1898 C  CA    . ALA B 1 71  ? 24.750  -27.099 39.220 1.00 35.22 ? 213 ALA B CA    1 
ATOM   1899 C  C     . ALA B 1 71  ? 26.093  -27.809 39.039 1.00 34.02 ? 213 ALA B C     1 
ATOM   1900 O  O     . ALA B 1 71  ? 26.770  -28.114 40.030 1.00 34.72 ? 213 ALA B O     1 
ATOM   1901 C  CB    . ALA B 1 71  ? 23.786  -28.032 39.948 1.00 36.73 ? 213 ALA B CB    1 
ATOM   1902 N  N     . PHE B 1 72  ? 26.459  -28.086 37.788 1.00 32.35 ? 214 PHE B N     1 
ATOM   1903 C  CA    . PHE B 1 72  ? 27.721  -28.737 37.456 1.00 31.92 ? 214 PHE B CA    1 
ATOM   1904 C  C     . PHE B 1 72  ? 28.893  -27.765 37.320 1.00 31.22 ? 214 PHE B C     1 
ATOM   1905 O  O     . PHE B 1 72  ? 30.002  -28.188 36.988 1.00 31.05 ? 214 PHE B O     1 
ATOM   1906 C  CB    . PHE B 1 72  ? 27.594  -29.537 36.147 1.00 31.30 ? 214 PHE B CB    1 
ATOM   1907 C  CG    . PHE B 1 72  ? 26.601  -30.681 36.200 1.00 32.11 ? 214 PHE B CG    1 
ATOM   1908 C  CD1   . PHE B 1 72  ? 25.920  -31.059 35.050 1.00 32.03 ? 214 PHE B CD1   1 
ATOM   1909 C  CD2   . PHE B 1 72  ? 26.353  -31.384 37.374 1.00 34.18 ? 214 PHE B CD2   1 
ATOM   1910 C  CE1   . PHE B 1 72  ? 25.009  -32.116 35.071 1.00 33.08 ? 214 PHE B CE1   1 
ATOM   1911 C  CE2   . PHE B 1 72  ? 25.441  -32.440 37.401 1.00 35.84 ? 214 PHE B CE2   1 
ATOM   1912 C  CZ    . PHE B 1 72  ? 24.769  -32.803 36.246 1.00 34.81 ? 214 PHE B CZ    1 
ATOM   1913 N  N     . ASP B 1 73  ? 28.684  -26.477 37.573 1.00 31.19 ? 215 ASP B N     1 
ATOM   1914 C  CA    . ASP B 1 73  ? 29.820  -25.538 37.572 1.00 31.03 ? 215 ASP B CA    1 
ATOM   1915 C  C     . ASP B 1 73  ? 30.918  -26.052 38.513 1.00 31.97 ? 215 ASP B C     1 
ATOM   1916 O  O     . ASP B 1 73  ? 30.642  -26.380 39.658 1.00 33.77 ? 215 ASP B O     1 
ATOM   1917 C  CB    . ASP B 1 73  ? 29.383  -24.138 38.012 1.00 31.90 ? 215 ASP B CB    1 
ATOM   1918 C  CG    . ASP B 1 73  ? 30.487  -23.098 37.848 1.00 32.73 ? 215 ASP B CG    1 
ATOM   1919 O  OD1   . ASP B 1 73  ? 31.218  -23.139 36.822 1.00 31.98 ? 215 ASP B OD1   1 
ATOM   1920 O  OD2   . ASP B 1 73  ? 30.623  -22.234 38.747 1.00 34.67 ? 215 ASP B OD2   1 
ATOM   1921 N  N     . GLY B 1 74  ? 32.150  -26.130 38.016 1.00 31.54 ? 216 GLY B N     1 
ATOM   1922 C  CA    . GLY B 1 74  ? 33.293  -26.636 38.779 1.00 32.84 ? 216 GLY B CA    1 
ATOM   1923 C  C     . GLY B 1 74  ? 33.538  -28.142 38.683 1.00 33.20 ? 216 GLY B C     1 
ATOM   1924 O  O     . GLY B 1 74  ? 34.559  -28.628 39.177 1.00 34.45 ? 216 GLY B O     1 
ATOM   1925 N  N     . ILE B 1 75  ? 32.615  -28.880 38.054 1.00 31.97 ? 217 ILE B N     1 
ATOM   1926 C  CA    . ILE B 1 75  ? 32.718  -30.348 37.912 1.00 32.75 ? 217 ILE B CA    1 
ATOM   1927 C  C     . ILE B 1 75  ? 34.019  -30.762 37.214 1.00 32.84 ? 217 ILE B C     1 
ATOM   1928 O  O     . ILE B 1 75  ? 34.488  -30.082 36.303 1.00 31.23 ? 217 ILE B O     1 
ATOM   1929 C  CB    . ILE B 1 75  ? 31.489  -30.944 37.141 1.00 31.68 ? 217 ILE B CB    1 
ATOM   1930 C  CG1   . ILE B 1 75  ? 31.334  -32.447 37.385 1.00 33.28 ? 217 ILE B CG1   1 
ATOM   1931 C  CG2   . ILE B 1 75  ? 31.585  -30.672 35.615 1.00 30.16 ? 217 ILE B CG2   1 
ATOM   1932 C  CD1   . ILE B 1 75  ? 31.097  -32.830 38.829 1.00 34.35 ? 217 ILE B CD1   1 
ATOM   1933 N  N     . ILE B 1 76  ? 34.588  -31.881 37.647 1.00 35.17 ? 218 ILE B N     1 
ATOM   1934 C  CA    . ILE B 1 76  ? 35.883  -32.354 37.152 1.00 36.93 ? 218 ILE B CA    1 
ATOM   1935 C  C     . ILE B 1 76  ? 35.708  -33.296 35.944 1.00 37.05 ? 218 ILE B C     1 
ATOM   1936 O  O     . ILE B 1 76  ? 35.029  -34.326 36.040 1.00 37.85 ? 218 ILE B O     1 
ATOM   1937 C  CB    . ILE B 1 76  ? 36.678  -33.083 38.270 1.00 40.09 ? 218 ILE B CB    1 
ATOM   1938 C  CG1   . ILE B 1 76  ? 36.774  -32.218 39.535 1.00 41.44 ? 218 ILE B CG1   1 
ATOM   1939 C  CG2   . ILE B 1 76  ? 38.087  -33.448 37.799 1.00 41.59 ? 218 ILE B CG2   1 
ATOM   1940 C  CD1   . ILE B 1 76  ? 37.446  -30.863 39.330 1.00 39.60 ? 218 ILE B CD1   1 
ATOM   1941 N  N     . PHE B 1 77  ? 36.323  -32.932 34.817 1.00 36.82 ? 219 PHE B N     1 
ATOM   1942 C  CA    . PHE B 1 77  ? 36.359  -33.766 33.616 1.00 37.62 ? 219 PHE B CA    1 
ATOM   1943 C  C     . PHE B 1 77  ? 37.820  -33.897 33.167 1.00 39.86 ? 219 PHE B C     1 
ATOM   1944 O  O     . PHE B 1 77  ? 38.522  -32.890 33.026 1.00 39.06 ? 219 PHE B O     1 
ATOM   1945 C  CB    . PHE B 1 77  ? 35.482  -33.130 32.520 1.00 36.21 ? 219 PHE B CB    1 
ATOM   1946 C  CG    . PHE B 1 77  ? 35.283  -33.985 31.280 1.00 36.35 ? 219 PHE B CG    1 
ATOM   1947 C  CD1   . PHE B 1 77  ? 35.240  -35.368 31.341 1.00 39.42 ? 219 PHE B CD1   1 
ATOM   1948 C  CD2   . PHE B 1 77  ? 35.092  -33.380 30.050 1.00 37.26 ? 219 PHE B CD2   1 
ATOM   1949 C  CE1   . PHE B 1 77  ? 35.050  -36.128 30.193 1.00 40.91 ? 219 PHE B CE1   1 
ATOM   1950 C  CE2   . PHE B 1 77  ? 34.893  -34.142 28.895 1.00 38.34 ? 219 PHE B CE2   1 
ATOM   1951 C  CZ    . PHE B 1 77  ? 34.874  -35.507 28.970 1.00 39.71 ? 219 PHE B CZ    1 
ATOM   1952 N  N     . GLN B 1 78  ? 38.276  -35.140 32.979 1.00 42.73 ? 220 GLN B N     1 
ATOM   1953 C  CA    . GLN B 1 78  ? 39.674  -35.453 32.638 1.00 45.95 ? 220 GLN B CA    1 
ATOM   1954 C  C     . GLN B 1 78  ? 40.672  -34.648 33.470 1.00 46.92 ? 220 GLN B C     1 
ATOM   1955 O  O     . GLN B 1 78  ? 41.591  -34.011 32.938 1.00 47.10 ? 220 GLN B O     1 
ATOM   1956 C  CB    . GLN B 1 78  ? 39.939  -35.270 31.138 1.00 45.68 ? 220 GLN B CB    1 
ATOM   1957 C  CG    . GLN B 1 78  ? 39.007  -36.097 30.254 1.00 46.44 ? 220 GLN B CG    1 
ATOM   1958 C  CD    . GLN B 1 78  ? 39.623  -36.543 28.928 1.00 49.25 ? 220 GLN B CD    1 
ATOM   1959 O  OE1   . GLN B 1 78  ? 40.718  -36.107 28.534 1.00 52.66 ? 220 GLN B OE1   1 
ATOM   1960 N  NE2   . GLN B 1 78  ? 38.918  -37.436 28.235 1.00 51.31 ? 220 GLN B NE2   1 
ATOM   1961 N  N     . GLY B 1 79  ? 40.474  -34.677 34.786 1.00 47.71 ? 221 GLY B N     1 
ATOM   1962 C  CA    . GLY B 1 79  ? 41.349  -33.968 35.716 1.00 49.22 ? 221 GLY B CA    1 
ATOM   1963 C  C     . GLY B 1 79  ? 41.153  -32.460 35.840 1.00 46.93 ? 221 GLY B C     1 
ATOM   1964 O  O     . GLY B 1 79  ? 41.776  -31.841 36.704 1.00 48.58 ? 221 GLY B O     1 
ATOM   1965 N  N     . GLN B 1 80  ? 40.288  -31.869 35.010 1.00 43.96 ? 222 GLN B N     1 
ATOM   1966 C  CA    . GLN B 1 80  ? 40.111  -30.405 34.963 1.00 42.08 ? 222 GLN B CA    1 
ATOM   1967 C  C     . GLN B 1 80  ? 38.714  -29.938 35.387 1.00 39.28 ? 222 GLN B C     1 
ATOM   1968 O  O     . GLN B 1 80  ? 37.724  -30.598 35.112 1.00 38.40 ? 222 GLN B O     1 
ATOM   1969 C  CB    . GLN B 1 80  ? 40.390  -29.877 33.550 1.00 41.24 ? 222 GLN B CB    1 
ATOM   1970 C  CG    . GLN B 1 80  ? 41.738  -30.345 32.989 1.00 44.95 ? 222 GLN B CG    1 
ATOM   1971 C  CD    . GLN B 1 80  ? 42.405  -29.329 32.080 1.00 44.84 ? 222 GLN B CD    1 
ATOM   1972 O  OE1   . GLN B 1 80  ? 41.856  -28.251 31.804 1.00 47.30 ? 222 GLN B OE1   1 
ATOM   1973 N  NE2   . GLN B 1 80  ? 43.597  -29.665 31.608 1.00 48.47 ? 222 GLN B NE2   1 
ATOM   1974 N  N     . SER B 1 81  ? 38.663  -28.768 36.014 1.00 38.27 ? 223 SER B N     1 
ATOM   1975 C  CA    . SER B 1 81  ? 37.438  -28.185 36.537 1.00 36.61 ? 223 SER B CA    1 
ATOM   1976 C  C     . SER B 1 81  ? 36.751  -27.319 35.477 1.00 33.79 ? 223 SER B C     1 
ATOM   1977 O  O     . SER B 1 81  ? 37.328  -26.354 34.994 1.00 33.70 ? 223 SER B O     1 
ATOM   1978 C  CB    . SER B 1 81  ? 37.769  -27.365 37.796 1.00 38.29 ? 223 SER B CB    1 
ATOM   1979 O  OG    . SER B 1 81  ? 36.688  -26.532 38.167 1.00 39.12 ? 223 SER B OG    1 
ATOM   1980 N  N     . LEU B 1 82  ? 35.526  -27.681 35.102 1.00 31.59 ? 224 LEU B N     1 
ATOM   1981 C  CA    . LEU B 1 82  ? 34.810  -26.987 34.029 1.00 29.76 ? 224 LEU B CA    1 
ATOM   1982 C  C     . LEU B 1 82  ? 34.030  -25.764 34.532 1.00 28.75 ? 224 LEU B C     1 
ATOM   1983 O  O     . LEU B 1 82  ? 33.494  -25.761 35.647 1.00 29.03 ? 224 LEU B O     1 
ATOM   1984 C  CB    . LEU B 1 82  ? 33.847  -27.939 33.303 1.00 28.82 ? 224 LEU B CB    1 
ATOM   1985 C  CG    . LEU B 1 82  ? 34.446  -29.207 32.697 1.00 29.40 ? 224 LEU B CG    1 
ATOM   1986 C  CD1   . LEU B 1 82  ? 33.355  -30.067 32.035 1.00 27.73 ? 224 LEU B CD1   1 
ATOM   1987 C  CD2   . LEU B 1 82  ? 35.553  -28.889 31.712 1.00 29.24 ? 224 LEU B CD2   1 
ATOM   1988 N  N     . LYS B 1 83  ? 33.986  -24.730 33.695 1.00 27.33 ? 225 LYS B N     1 
ATOM   1989 C  CA    . LYS B 1 83  ? 33.263  -23.497 33.994 1.00 27.17 ? 225 LYS B CA    1 
ATOM   1990 C  C     . LYS B 1 83  ? 31.961  -23.489 33.199 1.00 25.65 ? 225 LYS B C     1 
ATOM   1991 O  O     . LYS B 1 83  ? 31.985  -23.472 31.962 1.00 24.36 ? 225 LYS B O     1 
ATOM   1992 C  CB    . LYS B 1 83  ? 34.140  -22.281 33.637 1.00 27.76 ? 225 LYS B CB    1 
ATOM   1993 C  CG    . LYS B 1 83  ? 33.459  -20.929 33.697 1.00 28.16 ? 225 LYS B CG    1 
ATOM   1994 C  CD    . LYS B 1 83  ? 34.489  -19.819 33.571 1.00 29.29 ? 225 LYS B CD    1 
ATOM   1995 C  CE    . LYS B 1 83  ? 33.852  -18.452 33.642 1.00 30.38 ? 225 LYS B CE    1 
ATOM   1996 N  NZ    . LYS B 1 83  ? 34.865  -17.361 33.623 1.00 31.15 ? 225 LYS B NZ    1 
ATOM   1997 N  N     . ILE B 1 84  ? 30.839  -23.504 33.917 1.00 25.35 ? 226 ILE B N     1 
ATOM   1998 C  CA    . ILE B 1 84  ? 29.500  -23.597 33.318 1.00 25.61 ? 226 ILE B CA    1 
ATOM   1999 C  C     . ILE B 1 84  ? 28.750  -22.283 33.534 1.00 26.01 ? 226 ILE B C     1 
ATOM   2000 O  O     . ILE B 1 84  ? 28.596  -21.840 34.674 1.00 27.24 ? 226 ILE B O     1 
ATOM   2001 C  CB    . ILE B 1 84  ? 28.647  -24.739 33.961 1.00 25.60 ? 226 ILE B CB    1 
ATOM   2002 C  CG1   . ILE B 1 84  ? 29.419  -26.065 33.990 1.00 26.52 ? 226 ILE B CG1   1 
ATOM   2003 C  CG2   . ILE B 1 84  ? 27.329  -24.903 33.222 1.00 24.78 ? 226 ILE B CG2   1 
ATOM   2004 C  CD1   . ILE B 1 84  ? 29.534  -26.744 32.669 1.00 27.22 ? 226 ILE B CD1   1 
ATOM   2005 N  N     . ARG B 1 85  ? 28.281  -21.684 32.446 1.00 25.97 ? 227 ARG B N     1 
ATOM   2006 C  CA    . ARG B 1 85  ? 27.605  -20.387 32.465 1.00 27.44 ? 227 ARG B CA    1 
ATOM   2007 C  C     . ARG B 1 85  ? 26.467  -20.360 31.444 1.00 27.79 ? 227 ARG B C     1 
ATOM   2008 O  O     . ARG B 1 85  ? 26.431  -21.174 30.515 1.00 27.00 ? 227 ARG B O     1 
ATOM   2009 C  CB    . ARG B 1 85  ? 28.599  -19.269 32.118 1.00 27.99 ? 227 ARG B CB    1 
ATOM   2010 C  CG    . ARG B 1 85  ? 29.752  -19.056 33.111 1.00 28.48 ? 227 ARG B CG    1 
ATOM   2011 C  CD    . ARG B 1 85  ? 29.253  -18.393 34.372 1.00 30.61 ? 227 ARG B CD    1 
ATOM   2012 N  NE    . ARG B 1 85  ? 30.318  -18.061 35.323 1.00 32.13 ? 227 ARG B NE    1 
ATOM   2013 C  CZ    . ARG B 1 85  ? 30.904  -18.932 36.136 1.00 31.74 ? 227 ARG B CZ    1 
ATOM   2014 N  NH1   . ARG B 1 85  ? 30.559  -20.210 36.127 1.00 32.32 ? 227 ARG B NH1   1 
ATOM   2015 N  NH2   . ARG B 1 85  ? 31.843  -18.526 36.971 1.00 32.49 ? 227 ARG B NH2   1 
ATOM   2016 N  N     . ARG B 1 86  ? 25.552  -19.409 31.616 1.00 29.61 ? 228 ARG B N     1 
ATOM   2017 C  CA    . ARG B 1 86  ? 24.515  -19.118 30.623 1.00 31.21 ? 228 ARG B CA    1 
ATOM   2018 C  C     . ARG B 1 86  ? 25.116  -18.477 29.376 1.00 31.53 ? 228 ARG B C     1 
ATOM   2019 O  O     . ARG B 1 86  ? 26.167  -17.850 29.456 1.00 31.75 ? 228 ARG B O     1 
ATOM   2020 C  CB    . ARG B 1 86  ? 23.487  -18.143 31.192 1.00 33.63 ? 228 ARG B CB    1 
ATOM   2021 C  CG    . ARG B 1 86  ? 22.682  -18.672 32.358 1.00 34.72 ? 228 ARG B CG    1 
ATOM   2022 C  CD    . ARG B 1 86  ? 21.710  -19.743 31.921 1.00 34.47 ? 228 ARG B CD    1 
ATOM   2023 N  NE    . ARG B 1 86  ? 20.790  -20.084 32.995 1.00 35.23 ? 228 ARG B NE    1 
ATOM   2024 C  CZ    . ARG B 1 86  ? 19.752  -20.905 32.865 1.00 36.90 ? 228 ARG B CZ    1 
ATOM   2025 N  NH1   . ARG B 1 86  ? 19.494  -21.504 31.713 1.00 36.41 ? 228 ARG B NH1   1 
ATOM   2026 N  NH2   . ARG B 1 86  ? 18.969  -21.139 33.910 1.00 38.97 ? 228 ARG B NH2   1 
ATOM   2027 N  N     . PRO B 1 87  ? 24.451  -18.624 28.218 1.00 32.59 ? 229 PRO B N     1 
ATOM   2028 C  CA    . PRO B 1 87  ? 24.857  -17.836 27.059 1.00 33.80 ? 229 PRO B CA    1 
ATOM   2029 C  C     . PRO B 1 87  ? 24.677  -16.341 27.315 1.00 36.26 ? 229 PRO B C     1 
ATOM   2030 O  O     . PRO B 1 87  ? 23.812  -15.960 28.108 1.00 37.21 ? 229 PRO B O     1 
ATOM   2031 C  CB    . PRO B 1 87  ? 23.901  -18.306 25.951 1.00 35.34 ? 229 PRO B CB    1 
ATOM   2032 C  CG    . PRO B 1 87  ? 23.294  -19.557 26.414 1.00 33.90 ? 229 PRO B CG    1 
ATOM   2033 C  CD    . PRO B 1 87  ? 23.328  -19.525 27.913 1.00 33.03 ? 229 PRO B CD    1 
ATOM   2034 N  N     . HIS B 1 88  ? 25.473  -15.504 26.643 1.00 37.41 ? 230 HIS B N     1 
ATOM   2035 C  CA    . HIS B 1 88  ? 25.397  -14.052 26.842 1.00 39.95 ? 230 HIS B CA    1 
ATOM   2036 C  C     . HIS B 1 88  ? 24.058  -13.446 26.395 1.00 43.06 ? 230 HIS B C     1 
ATOM   2037 O  O     . HIS B 1 88  ? 23.693  -12.373 26.868 1.00 45.52 ? 230 HIS B O     1 
ATOM   2038 C  CB    . HIS B 1 88  ? 26.562  -13.310 26.148 1.00 40.66 ? 230 HIS B CB    1 
ATOM   2039 C  CG    . HIS B 1 88  ? 27.860  -13.356 26.904 1.00 39.90 ? 230 HIS B CG    1 
ATOM   2040 N  ND1   . HIS B 1 88  ? 29.082  -13.160 26.293 1.00 39.62 ? 230 HIS B ND1   1 
ATOM   2041 C  CD2   . HIS B 1 88  ? 28.130  -13.592 28.211 1.00 39.57 ? 230 HIS B CD2   1 
ATOM   2042 C  CE1   . HIS B 1 88  ? 30.046  -13.264 27.192 1.00 39.14 ? 230 HIS B CE1   1 
ATOM   2043 N  NE2   . HIS B 1 88  ? 29.495  -13.532 28.362 1.00 38.77 ? 230 HIS B NE2   1 
ATOM   2044 N  N     . ASP B 1 89  ? 23.332  -14.108 25.493 1.00 43.53 ? 231 ASP B N     1 
ATOM   2045 C  CA    . ASP B 1 89  ? 22.000  -13.627 25.099 1.00 46.89 ? 231 ASP B CA    1 
ATOM   2046 C  C     . ASP B 1 89  ? 20.831  -14.403 25.729 1.00 46.61 ? 231 ASP B C     1 
ATOM   2047 O  O     . ASP B 1 89  ? 19.707  -14.360 25.225 1.00 49.30 ? 231 ASP B O     1 
ATOM   2048 C  CB    . ASP B 1 89  ? 21.870  -13.556 23.567 1.00 49.48 ? 231 ASP B CB    1 
ATOM   2049 C  CG    . ASP B 1 89  ? 22.001  -14.905 22.888 1.00 49.12 ? 231 ASP B CG    1 
ATOM   2050 O  OD1   . ASP B 1 89  ? 21.930  -15.944 23.572 1.00 48.70 ? 231 ASP B OD1   1 
ATOM   2051 O  OD2   . ASP B 1 89  ? 22.164  -14.916 21.646 1.00 54.51 ? 231 ASP B OD2   1 
ATOM   2052 N  N     . TYR B 1 90  ? 21.090  -15.090 26.839 1.00 43.34 ? 232 TYR B N     1 
ATOM   2053 C  CA    . TYR B 1 90  ? 20.027  -15.728 27.618 1.00 43.70 ? 232 TYR B CA    1 
ATOM   2054 C  C     . TYR B 1 90  ? 19.044  -14.671 28.153 1.00 47.18 ? 232 TYR B C     1 
ATOM   2055 O  O     . TYR B 1 90  ? 19.452  -13.595 28.584 1.00 47.78 ? 232 TYR B O     1 
ATOM   2056 C  CB    . TYR B 1 90  ? 20.642  -16.531 28.766 1.00 40.22 ? 232 TYR B CB    1 
ATOM   2057 C  CG    . TYR B 1 90  ? 19.676  -17.017 29.823 1.00 40.37 ? 232 TYR B CG    1 
ATOM   2058 C  CD1   . TYR B 1 90  ? 18.755  -18.018 29.549 1.00 40.04 ? 232 TYR B CD1   1 
ATOM   2059 C  CD2   . TYR B 1 90  ? 19.715  -16.501 31.110 1.00 40.03 ? 232 TYR B CD2   1 
ATOM   2060 C  CE1   . TYR B 1 90  ? 17.870  -18.468 30.527 1.00 41.17 ? 232 TYR B CE1   1 
ATOM   2061 C  CE2   . TYR B 1 90  ? 18.844  -16.952 32.094 1.00 41.51 ? 232 TYR B CE2   1 
ATOM   2062 C  CZ    . TYR B 1 90  ? 17.925  -17.929 31.796 1.00 41.37 ? 232 TYR B CZ    1 
ATOM   2063 O  OH    . TYR B 1 90  ? 17.073  -18.370 32.772 1.00 43.36 ? 232 TYR B OH    1 
ATOM   2064 N  N     . GLN B 1 91  ? 17.753  -14.990 28.104 1.00 49.51 ? 233 GLN B N     1 
ATOM   2065 C  CA    . GLN B 1 91  ? 16.707  -14.106 28.612 1.00 53.85 ? 233 GLN B CA    1 
ATOM   2066 C  C     . GLN B 1 91  ? 16.075  -14.701 29.873 1.00 54.12 ? 233 GLN B C     1 
ATOM   2067 O  O     . GLN B 1 91  ? 15.320  -15.674 29.787 1.00 54.01 ? 233 GLN B O     1 
ATOM   2068 C  CB    . GLN B 1 91  ? 15.643  -13.879 27.543 1.00 57.40 ? 233 GLN B CB    1 
ATOM   2069 C  CG    . GLN B 1 91  ? 16.115  -13.000 26.401 1.00 58.61 ? 233 GLN B CG    1 
ATOM   2070 C  CD    . GLN B 1 91  ? 15.026  -12.720 25.375 1.00 63.27 ? 233 GLN B CD    1 
ATOM   2071 O  OE1   . GLN B 1 91  ? 15.258  -12.837 24.172 1.00 63.58 ? 233 GLN B OE1   1 
ATOM   2072 N  NE2   . GLN B 1 91  ? 13.831  -12.350 25.846 1.00 66.58 ? 233 GLN B NE2   1 
ATOM   2073 N  N     . PRO B 1 92  ? 16.412  -14.141 31.054 1.00 54.84 ? 234 PRO B N     1 
ATOM   2074 C  CA    . PRO B 1 92  ? 15.790  -14.563 32.315 1.00 55.91 ? 234 PRO B CA    1 
ATOM   2075 C  C     . PRO B 1 92  ? 14.275  -14.387 32.306 1.00 60.47 ? 234 PRO B C     1 
ATOM   2076 O  O     . PRO B 1 92  ? 13.551  -15.289 32.730 1.00 60.93 ? 234 PRO B O     1 
ATOM   2077 C  CB    . PRO B 1 92  ? 16.429  -13.631 33.357 1.00 56.78 ? 234 PRO B CB    1 
ATOM   2078 C  CG    . PRO B 1 92  ? 17.682  -13.157 32.737 1.00 54.67 ? 234 PRO B CG    1 
ATOM   2079 C  CD    . PRO B 1 92  ? 17.426  -13.092 31.272 1.00 54.67 ? 234 PRO B CD    1 
ATOM   2080 N  N     . LEU B 1 93  ? 13.817  -13.229 31.825 1.00 64.41 ? 235 LEU B N     1 
ATOM   2081 C  CA    . LEU B 1 93  ? 12.398  -12.937 31.663 1.00 69.27 ? 235 LEU B CA    1 
ATOM   2082 C  C     . LEU B 1 93  ? 11.998  -13.039 30.183 1.00 70.27 ? 235 LEU B C     1 
ATOM   2083 O  O     . LEU B 1 93  ? 12.153  -12.070 29.432 1.00 72.39 ? 235 LEU B O     1 
ATOM   2084 C  CB    . LEU B 1 93  ? 12.080  -11.536 32.205 1.00 74.22 ? 235 LEU B CB    1 
ATOM   2085 C  CG    . LEU B 1 93  ? 12.366  -11.271 33.690 1.00 74.91 ? 235 LEU B CG    1 
ATOM   2086 C  CD1   . LEU B 1 93  ? 11.951  -9.854  34.059 1.00 80.10 ? 235 LEU B CD1   1 
ATOM   2087 C  CD2   . LEU B 1 93  ? 11.657  -12.287 34.590 1.00 75.74 ? 235 LEU B CD2   1 
ATOM   2088 N  N     . PRO B 1 94  ? 11.507  -14.221 29.748 1.00 68.99 ? 236 PRO B N     1 
ATOM   2089 C  CA    . PRO B 1 94  ? 11.037  -14.385 28.359 1.00 70.29 ? 236 PRO B CA    1 
ATOM   2090 C  C     . PRO B 1 94  ? 9.948   -13.400 27.934 1.00 75.90 ? 236 PRO B C     1 
ATOM   2091 O  O     . PRO B 1 94  ? 9.127   -12.991 28.754 1.00 79.00 ? 236 PRO B O     1 
ATOM   2092 C  CB    . PRO B 1 94  ? 10.488  -15.821 28.328 1.00 69.20 ? 236 PRO B CB    1 
ATOM   2093 C  CG    . PRO B 1 94  ? 10.388  -16.255 29.750 1.00 68.47 ? 236 PRO B CG    1 
ATOM   2094 C  CD    . PRO B 1 94  ? 11.410  -15.484 30.504 1.00 66.54 ? 236 PRO B CD    1 
ATOM   2095 N  N     . GLY B 1 95  ? 9.963   -13.030 26.655 1.00 77.34 ? 237 GLY B N     1 
ATOM   2096 C  CA    . GLY B 1 95  ? 8.986   -12.097 26.090 1.00 83.50 ? 237 GLY B CA    1 
ATOM   2097 C  C     . GLY B 1 95  ? 9.209   -10.632 26.431 1.00 86.17 ? 237 GLY B C     1 
ATOM   2098 O  O     . GLY B 1 95  ? 8.394   -9.781  26.074 1.00 91.99 ? 237 GLY B O     1 
ATOM   2099 N  N     . ALA B 1 96  ? 10.318  -10.325 27.099 1.00 37.65 ? 258 ALA B N     1 
ATOM   2100 C  CA    . ALA B 1 96  ? 10.603  -8.963  27.557 1.00 37.35 ? 258 ALA B CA    1 
ATOM   2101 C  C     . ALA B 1 96  ? 10.835  -7.967  26.408 1.00 35.53 ? 258 ALA B C     1 
ATOM   2102 O  O     . ALA B 1 96  ? 10.721  -6.764  26.610 1.00 35.58 ? 258 ALA B O     1 
ATOM   2103 C  CB    . ALA B 1 96  ? 11.799  -8.961  28.493 1.00 40.18 ? 258 ALA B CB    1 
ATOM   2104 N  N     . HIS B 1 97  ? 11.164  -8.457  25.215 1.00 34.44 ? 259 HIS B N     1 
ATOM   2105 C  CA    . HIS B 1 97  ? 11.501  -7.573  24.094 1.00 33.05 ? 259 HIS B CA    1 
ATOM   2106 C  C     . HIS B 1 97  ? 10.581  -7.773  22.896 1.00 31.03 ? 259 HIS B C     1 
ATOM   2107 O  O     . HIS B 1 97  ? 10.900  -7.368  21.775 1.00 30.52 ? 259 HIS B O     1 
ATOM   2108 C  CB    . HIS B 1 97  ? 12.970  -7.758  23.720 1.00 34.43 ? 259 HIS B CB    1 
ATOM   2109 C  CG    . HIS B 1 97  ? 13.895  -7.620  24.890 1.00 36.40 ? 259 HIS B CG    1 
ATOM   2110 N  ND1   . HIS B 1 97  ? 14.066  -6.430  25.563 1.00 36.13 ? 259 HIS B ND1   1 
ATOM   2111 C  CD2   . HIS B 1 97  ? 14.670  -8.527  25.529 1.00 37.43 ? 259 HIS B CD2   1 
ATOM   2112 C  CE1   . HIS B 1 97  ? 14.910  -6.606  26.561 1.00 38.09 ? 259 HIS B CE1   1 
ATOM   2113 N  NE2   . HIS B 1 97  ? 15.290  -7.870  26.564 1.00 39.75 ? 259 HIS B NE2   1 
ATOM   2114 N  N     . LYS B 1 98  ? 9.435   -8.403  23.147 1.00 30.71 ? 260 LYS B N     1 
ATOM   2115 C  CA    . LYS B 1 98  ? 8.363   -8.477  22.173 1.00 29.65 ? 260 LYS B CA    1 
ATOM   2116 C  C     . LYS B 1 98  ? 7.753   -7.086  22.033 1.00 28.41 ? 260 LYS B C     1 
ATOM   2117 O  O     . LYS B 1 98  ? 7.519   -6.411  23.034 1.00 28.38 ? 260 LYS B O     1 
ATOM   2118 C  CB    . LYS B 1 98  ? 7.311   -9.484  22.630 1.00 30.23 ? 260 LYS B CB    1 
ATOM   2119 C  CG    . LYS B 1 98  ? 6.222   -9.732  21.639 1.00 29.09 ? 260 LYS B CG    1 
ATOM   2120 C  CD    . LYS B 1 98  ? 5.171   -10.677 22.207 1.00 31.40 ? 260 LYS B CD    1 
ATOM   2121 C  CE    . LYS B 1 98  ? 4.172   -11.032 21.133 1.00 31.70 ? 260 LYS B CE    1 
ATOM   2122 N  NZ    . LYS B 1 98  ? 3.258   -12.065 21.603 1.00 33.48 ? 260 LYS B NZ    1 
ATOM   2123 N  N     . LEU B 1 99  ? 7.533   -6.662  20.785 1.00 28.06 ? 261 LEU B N     1 
ATOM   2124 C  CA    . LEU B 1 99  ? 6.975   -5.337  20.482 1.00 27.56 ? 261 LEU B CA    1 
ATOM   2125 C  C     . LEU B 1 99  ? 5.519   -5.406  19.995 1.00 26.96 ? 261 LEU B C     1 
ATOM   2126 O  O     . LEU B 1 99  ? 5.125   -6.351  19.319 1.00 26.68 ? 261 LEU B O     1 
ATOM   2127 C  CB    . LEU B 1 99  ? 7.810   -4.639  19.409 1.00 28.18 ? 261 LEU B CB    1 
ATOM   2128 C  CG    . LEU B 1 99  ? 9.255   -4.214  19.700 1.00 29.21 ? 261 LEU B CG    1 
ATOM   2129 C  CD1   . LEU B 1 99  ? 9.846   -3.571  18.465 1.00 30.17 ? 261 LEU B CD1   1 
ATOM   2130 C  CD2   . LEU B 1 99  ? 9.339   -3.270  20.880 1.00 30.75 ? 261 LEU B CD2   1 
ATOM   2131 N  N     . PHE B 1 100 ? 4.741   -4.396  20.377 1.00 27.25 ? 262 PHE B N     1 
ATOM   2132 C  CA    . PHE B 1 100 ? 3.417   -4.116  19.834 1.00 27.17 ? 262 PHE B CA    1 
ATOM   2133 C  C     . PHE B 1 100 ? 3.573   -2.978  18.816 1.00 27.88 ? 262 PHE B C     1 
ATOM   2134 O  O     . PHE B 1 100 ? 4.254   -1.969  19.103 1.00 28.16 ? 262 PHE B O     1 
ATOM   2135 C  CB    . PHE B 1 100 ? 2.464   -3.694  20.970 1.00 28.33 ? 262 PHE B CB    1 
ATOM   2136 C  CG    . PHE B 1 100 ? 1.101   -3.231  20.504 1.00 28.84 ? 262 PHE B CG    1 
ATOM   2137 C  CD1   . PHE B 1 100 ? 0.146   -4.145  20.085 1.00 28.72 ? 262 PHE B CD1   1 
ATOM   2138 C  CD2   . PHE B 1 100 ? 0.775   -1.881  20.492 1.00 30.33 ? 262 PHE B CD2   1 
ATOM   2139 C  CE1   . PHE B 1 100 ? -1.110  -3.722  19.653 1.00 29.94 ? 262 PHE B CE1   1 
ATOM   2140 C  CE2   . PHE B 1 100 ? -0.482  -1.449  20.068 1.00 31.12 ? 262 PHE B CE2   1 
ATOM   2141 C  CZ    . PHE B 1 100 ? -1.420  -2.366  19.651 1.00 31.06 ? 262 PHE B CZ    1 
ATOM   2142 N  N     . ILE B 1 101 ? 2.984   -3.162  17.627 1.00 27.16 ? 263 ILE B N     1 
ATOM   2143 C  CA    . ILE B 1 101 ? 2.934   -2.125  16.595 1.00 28.28 ? 263 ILE B CA    1 
ATOM   2144 C  C     . ILE B 1 101 ? 1.467   -1.789  16.282 1.00 28.90 ? 263 ILE B C     1 
ATOM   2145 O  O     . ILE B 1 101 ? 0.730   -2.618  15.758 1.00 28.38 ? 263 ILE B O     1 
ATOM   2146 C  CB    . ILE B 1 101 ? 3.691   -2.536  15.297 1.00 28.28 ? 263 ILE B CB    1 
ATOM   2147 C  CG1   . ILE B 1 101 ? 5.162   -2.875  15.599 1.00 29.40 ? 263 ILE B CG1   1 
ATOM   2148 C  CG2   . ILE B 1 101 ? 3.647   -1.394  14.257 1.00 29.40 ? 263 ILE B CG2   1 
ATOM   2149 C  CD1   . ILE B 1 101 ? 5.461   -4.368  15.696 1.00 30.28 ? 263 ILE B CD1   1 
ATOM   2150 N  N     . GLY B 1 102 ? 1.049   -0.576  16.632 1.00 30.53 ? 264 GLY B N     1 
ATOM   2151 C  CA    . GLY B 1 102 ? -0.338  -0.142  16.452 1.00 32.23 ? 264 GLY B CA    1 
ATOM   2152 C  C     . GLY B 1 102 ? -0.435  1.079   15.553 1.00 34.48 ? 264 GLY B C     1 
ATOM   2153 O  O     . GLY B 1 102 ? 0.552   1.777   15.335 1.00 35.31 ? 264 GLY B O     1 
ATOM   2154 N  N     . GLY B 1 103 ? -1.631  1.340   15.032 1.00 35.98 ? 265 GLY B N     1 
ATOM   2155 C  CA    . GLY B 1 103 ? -1.866  2.507   14.184 1.00 38.52 ? 265 GLY B CA    1 
ATOM   2156 C  C     . GLY B 1 103 ? -1.452  2.309   12.733 1.00 38.20 ? 265 GLY B C     1 
ATOM   2157 O  O     . GLY B 1 103 ? -1.188  3.279   12.022 1.00 40.41 ? 265 GLY B O     1 
ATOM   2158 N  N     . LEU B 1 104 ? -1.389  1.052   12.301 1.00 35.95 ? 266 LEU B N     1 
ATOM   2159 C  CA    . LEU B 1 104 ? -1.065  0.713   10.919 1.00 36.18 ? 266 LEU B CA    1 
ATOM   2160 C  C     . LEU B 1 104 ? -2.258  0.964   9.998  1.00 38.59 ? 266 LEU B C     1 
ATOM   2161 O  O     . LEU B 1 104 ? -3.398  0.680   10.377 1.00 38.75 ? 266 LEU B O     1 
ATOM   2162 C  CB    . LEU B 1 104 ? -0.696  -0.767  10.805 1.00 33.78 ? 266 LEU B CB    1 
ATOM   2163 C  CG    . LEU B 1 104 ? 0.538   -1.278  11.548 1.00 30.86 ? 266 LEU B CG    1 
ATOM   2164 C  CD1   . LEU B 1 104 ? 0.595   -2.782  11.449 1.00 27.75 ? 266 LEU B CD1   1 
ATOM   2165 C  CD2   . LEU B 1 104 ? 1.819   -0.651  11.002 1.00 31.22 ? 266 LEU B CD2   1 
ATOM   2166 N  N     . PRO B 1 105 ? -2.004  1.490   8.781  1.00 40.93 ? 267 PRO B N     1 
ATOM   2167 C  CA    . PRO B 1 105 ? -3.051  1.507   7.749  1.00 43.34 ? 267 PRO B CA    1 
ATOM   2168 C  C     . PRO B 1 105 ? -3.623  0.108   7.512  1.00 41.98 ? 267 PRO B C     1 
ATOM   2169 O  O     . PRO B 1 105 ? -2.864  -0.854  7.436  1.00 40.11 ? 267 PRO B O     1 
ATOM   2170 C  CB    . PRO B 1 105 ? -2.309  2.008   6.508  1.00 45.35 ? 267 PRO B CB    1 
ATOM   2171 C  CG    . PRO B 1 105 ? -1.171  2.800   7.039  1.00 45.17 ? 267 PRO B CG    1 
ATOM   2172 C  CD    . PRO B 1 105 ? -0.756  2.113   8.302  1.00 41.84 ? 267 PRO B CD    1 
ATOM   2173 N  N     . ASN B 1 106 ? -4.945  0.003   7.391  1.00 43.94 ? 268 ASN B N     1 
ATOM   2174 C  CA    . ASN B 1 106 ? -5.630  -1.302  7.334  1.00 43.32 ? 268 ASN B CA    1 
ATOM   2175 C  C     . ASN B 1 106 ? -5.496  -2.079  6.009  1.00 43.98 ? 268 ASN B C     1 
ATOM   2176 O  O     . ASN B 1 106 ? -5.951  -3.225  5.914  1.00 43.90 ? 268 ASN B O     1 
ATOM   2177 C  CB    . ASN B 1 106 ? -7.122  -1.139  7.697  1.00 45.70 ? 268 ASN B CB    1 
ATOM   2178 C  CG    . ASN B 1 106 ? -7.938  -0.417  6.616  1.00 50.66 ? 268 ASN B CG    1 
ATOM   2179 O  OD1   . ASN B 1 106 ? -7.396  0.143   5.654  1.00 54.93 ? 268 ASN B OD1   1 
ATOM   2180 N  ND2   . ASN B 1 106 ? -9.261  -0.429  6.780  1.00 53.14 ? 268 ASN B ND2   1 
ATOM   2181 N  N     . TYR B 1 107 ? -4.893  -1.459  4.995  1.00 44.94 ? 269 TYR B N     1 
ATOM   2182 C  CA    . TYR B 1 107 ? -4.706  -2.103  3.689  1.00 46.28 ? 269 TYR B CA    1 
ATOM   2183 C  C     . TYR B 1 107 ? -3.347  -2.801  3.554  1.00 44.66 ? 269 TYR B C     1 
ATOM   2184 O  O     . TYR B 1 107 ? -3.136  -3.566  2.615  1.00 46.00 ? 269 TYR B O     1 
ATOM   2185 C  CB    . TYR B 1 107 ? -4.897  -1.093  2.548  1.00 49.26 ? 269 TYR B CB    1 
ATOM   2186 C  CG    . TYR B 1 107 ? -4.067  0.168   2.668  1.00 49.36 ? 269 TYR B CG    1 
ATOM   2187 C  CD1   . TYR B 1 107 ? -2.725  0.178   2.298  1.00 48.65 ? 269 TYR B CD1   1 
ATOM   2188 C  CD2   . TYR B 1 107 ? -4.621  1.350   3.152  1.00 50.00 ? 269 TYR B CD2   1 
ATOM   2189 C  CE1   . TYR B 1 107 ? -1.958  1.324   2.405  1.00 49.45 ? 269 TYR B CE1   1 
ATOM   2190 C  CE2   . TYR B 1 107 ? -3.857  2.505   3.265  1.00 51.30 ? 269 TYR B CE2   1 
ATOM   2191 C  CZ    . TYR B 1 107 ? -2.527  2.482   2.885  1.00 50.63 ? 269 TYR B CZ    1 
ATOM   2192 O  OH    . TYR B 1 107 ? -1.753  3.609   2.989  1.00 52.47 ? 269 TYR B OH    1 
ATOM   2193 N  N     . LEU B 1 108 ? -2.428  -2.533  4.480  1.00 42.50 ? 270 LEU B N     1 
ATOM   2194 C  CA    . LEU B 1 108 ? -1.097  -3.148  4.453  1.00 41.56 ? 270 LEU B CA    1 
ATOM   2195 C  C     . LEU B 1 108 ? -1.167  -4.620  4.856  1.00 40.17 ? 270 LEU B C     1 
ATOM   2196 O  O     . LEU B 1 108 ? -1.857  -4.967  5.819  1.00 39.22 ? 270 LEU B O     1 
ATOM   2197 C  CB    . LEU B 1 108 ? -0.131  -2.411  5.395  1.00 39.95 ? 270 LEU B CB    1 
ATOM   2198 C  CG    . LEU B 1 108 ? 0.181   -0.940  5.091  1.00 41.36 ? 270 LEU B CG    1 
ATOM   2199 C  CD1   . LEU B 1 108 ? 1.097   -0.361  6.180  1.00 38.72 ? 270 LEU B CD1   1 
ATOM   2200 C  CD2   . LEU B 1 108 ? 0.798   -0.773  3.718  1.00 42.83 ? 270 LEU B CD2   1 
ATOM   2201 N  N     . ASN B 1 109 ? -0.443  -5.467  4.124  1.00 41.46 ? 271 ASN B N     1 
ATOM   2202 C  CA    . ASN B 1 109 ? -0.375  -6.909  4.397  1.00 41.10 ? 271 ASN B CA    1 
ATOM   2203 C  C     . ASN B 1 109 ? 0.910   -7.279  5.157  1.00 39.71 ? 271 ASN B C     1 
ATOM   2204 O  O     . ASN B 1 109 ? 1.712   -6.399  5.479  1.00 38.58 ? 271 ASN B O     1 
ATOM   2205 C  CB    . ASN B 1 109 ? -0.522  -7.715  3.093  1.00 44.00 ? 271 ASN B CB    1 
ATOM   2206 C  CG    . ASN B 1 109 ? 0.772   -7.806  2.290  1.00 45.95 ? 271 ASN B CG    1 
ATOM   2207 O  OD1   . ASN B 1 109 ? 1.608   -6.905  2.313  1.00 45.50 ? 271 ASN B OD1   1 
ATOM   2208 N  ND2   . ASN B 1 109 ? 0.935   -8.909  1.570  1.00 48.07 ? 271 ASN B ND2   1 
ATOM   2209 N  N     . ASP B 1 110 ? 1.079   -8.576  5.446  1.00 40.11 ? 272 ASP B N     1 
ATOM   2210 C  CA    . ASP B 1 110 ? 2.210   -9.101  6.245  1.00 38.91 ? 272 ASP B CA    1 
ATOM   2211 C  C     . ASP B 1 110 ? 3.588   -8.674  5.743  1.00 39.78 ? 272 ASP B C     1 
ATOM   2212 O  O     . ASP B 1 110 ? 4.368   -8.113  6.498  1.00 37.99 ? 272 ASP B O     1 
ATOM   2213 C  CB    . ASP B 1 110 ? 2.183   -10.636 6.293  1.00 40.54 ? 272 ASP B CB    1 
ATOM   2214 C  CG    . ASP B 1 110 ? 1.076   -11.187 7.181  1.00 41.09 ? 272 ASP B CG    1 
ATOM   2215 O  OD1   . ASP B 1 110 ? -0.108  -11.097 6.797  1.00 43.33 ? 272 ASP B OD1   1 
ATOM   2216 O  OD2   . ASP B 1 110 ? 1.395   -11.741 8.258  1.00 44.66 ? 272 ASP B OD2   1 
ATOM   2217 N  N     . ASP B 1 111 ? 3.892   -8.955  4.477  1.00 42.80 ? 273 ASP B N     1 
ATOM   2218 C  CA    . ASP B 1 111 ? 5.209   -8.628  3.917  1.00 44.91 ? 273 ASP B CA    1 
ATOM   2219 C  C     . ASP B 1 111 ? 5.505   -7.122  3.851  1.00 44.23 ? 273 ASP B C     1 
ATOM   2220 O  O     . ASP B 1 111 ? 6.668   -6.707  3.937  1.00 44.66 ? 273 ASP B O     1 
ATOM   2221 C  CB    . ASP B 1 111 ? 5.371   -9.249  2.521  1.00 49.54 ? 273 ASP B CB    1 
ATOM   2222 C  CG    . ASP B 1 111 ? 5.665   -10.743 2.573  1.00 53.04 ? 273 ASP B CG    1 
ATOM   2223 O  OD1   . ASP B 1 111 ? 6.276   -11.215 3.567  1.00 55.11 ? 273 ASP B OD1   1 
ATOM   2224 O  OD2   . ASP B 1 111 ? 5.290   -11.446 1.611  1.00 58.69 ? 273 ASP B OD2   1 
ATOM   2225 N  N     . GLN B 1 112 ? 4.458   -6.316  3.690  1.00 43.37 ? 274 GLN B N     1 
ATOM   2226 C  CA    . GLN B 1 112 ? 4.594   -4.862  3.666  1.00 43.55 ? 274 GLN B CA    1 
ATOM   2227 C  C     . GLN B 1 112 ? 4.952   -4.330  5.054  1.00 40.70 ? 274 GLN B C     1 
ATOM   2228 O  O     . GLN B 1 112 ? 5.872   -3.525  5.190  1.00 40.50 ? 274 GLN B O     1 
ATOM   2229 C  CB    . GLN B 1 112 ? 3.320   -4.201  3.105  1.00 44.30 ? 274 GLN B CB    1 
ATOM   2230 C  CG    . GLN B 1 112 ? 3.220   -4.317  1.574  1.00 47.97 ? 274 GLN B CG    1 
ATOM   2231 C  CD    . GLN B 1 112 ? 1.835   -4.015  1.005  1.00 48.98 ? 274 GLN B CD    1 
ATOM   2232 O  OE1   . GLN B 1 112 ? 0.843   -3.926  1.727  1.00 47.31 ? 274 GLN B OE1   1 
ATOM   2233 N  NE2   . GLN B 1 112 ? 1.770   -3.865  -0.300 1.00 51.86 ? 274 GLN B NE2   1 
ATOM   2234 N  N     . VAL B 1 113 ? 4.244   -4.803  6.082  1.00 38.54 ? 275 VAL B N     1 
ATOM   2235 C  CA    . VAL B 1 113 ? 4.545   -4.412  7.467  1.00 36.64 ? 275 VAL B CA    1 
ATOM   2236 C  C     . VAL B 1 113 ? 5.954   -4.887  7.922  1.00 36.86 ? 275 VAL B C     1 
ATOM   2237 O  O     . VAL B 1 113 ? 6.660   -4.147  8.607  1.00 36.29 ? 275 VAL B O     1 
ATOM   2238 C  CB    . VAL B 1 113 ? 3.452   -4.900  8.468  1.00 34.61 ? 275 VAL B CB    1 
ATOM   2239 C  CG1   . VAL B 1 113 ? 3.812   -4.498  9.896  1.00 32.60 ? 275 VAL B CG1   1 
ATOM   2240 C  CG2   . VAL B 1 113 ? 2.083   -4.330  8.104  1.00 35.12 ? 275 VAL B CG2   1 
ATOM   2241 N  N     . LYS B 1 114 ? 6.359   -6.096  7.524  1.00 38.06 ? 276 LYS B N     1 
ATOM   2242 C  CA    . LYS B 1 114 ? 7.708   -6.611  7.822  1.00 39.54 ? 276 LYS B CA    1 
ATOM   2243 C  C     . LYS B 1 114 ? 8.820   -5.769  7.194  1.00 42.24 ? 276 LYS B C     1 
ATOM   2244 O  O     . LYS B 1 114 ? 9.888   -5.616  7.782  1.00 42.91 ? 276 LYS B O     1 
ATOM   2245 C  CB    . LYS B 1 114 ? 7.860   -8.068  7.356  1.00 41.17 ? 276 LYS B CB    1 
ATOM   2246 C  CG    . LYS B 1 114 ? 7.457   -9.095  8.403  1.00 40.06 ? 276 LYS B CG    1 
ATOM   2247 C  CD    . LYS B 1 114 ? 6.797   -10.319 7.789  1.00 41.93 ? 276 LYS B CD    1 
ATOM   2248 C  CE    . LYS B 1 114 ? 7.772   -11.210 7.076  1.00 45.34 ? 276 LYS B CE    1 
ATOM   2249 N  NZ    . LYS B 1 114 ? 7.057   -12.394 6.543  1.00 48.03 ? 276 LYS B NZ    1 
ATOM   2250 N  N     . GLU B 1 115 ? 8.566   -5.228  6.004  1.00 44.70 ? 277 GLU B N     1 
ATOM   2251 C  CA    . GLU B 1 115 ? 9.542   -4.401  5.296  1.00 47.74 ? 277 GLU B CA    1 
ATOM   2252 C  C     . GLU B 1 115 ? 9.831   -3.090  6.039  1.00 47.06 ? 277 GLU B C     1 
ATOM   2253 O  O     . GLU B 1 115 ? 10.961  -2.616  6.059  1.00 49.10 ? 277 GLU B O     1 
ATOM   2254 C  CB    . GLU B 1 115 ? 9.054   -4.120  3.875  1.00 50.47 ? 277 GLU B CB    1 
ATOM   2255 C  CG    . GLU B 1 115 ? 10.116  -3.514  2.979  1.00 55.19 ? 277 GLU B CG    1 
ATOM   2256 C  CD    . GLU B 1 115 ? 9.761   -3.571  1.502  1.00 59.36 ? 277 GLU B CD    1 
ATOM   2257 O  OE1   . GLU B 1 115 ? 10.450  -2.890  0.707  1.00 64.96 ? 277 GLU B OE1   1 
ATOM   2258 O  OE2   . GLU B 1 115 ? 8.796   -4.286  1.134  1.00 61.36 ? 277 GLU B OE2   1 
ATOM   2259 N  N     . LEU B 1 116 ? 8.800   -2.517  6.647  1.00 44.73 ? 278 LEU B N     1 
ATOM   2260 C  CA    . LEU B 1 116 ? 8.949   -1.395  7.574  1.00 44.05 ? 278 LEU B CA    1 
ATOM   2261 C  C     . LEU B 1 116 ? 9.813   -1.765  8.796  1.00 42.52 ? 278 LEU B C     1 
ATOM   2262 O  O     . LEU B 1 116 ? 10.650  -0.976  9.236  1.00 43.90 ? 278 LEU B O     1 
ATOM   2263 C  CB    . LEU B 1 116 ? 7.562   -0.948  8.049  1.00 42.38 ? 278 LEU B CB    1 
ATOM   2264 C  CG    . LEU B 1 116 ? 7.394   0.423   8.694  1.00 42.63 ? 278 LEU B CG    1 
ATOM   2265 C  CD1   . LEU B 1 116 ? 7.665   1.545   7.709  1.00 45.31 ? 278 LEU B CD1   1 
ATOM   2266 C  CD2   . LEU B 1 116 ? 5.982   0.504   9.239  1.00 41.39 ? 278 LEU B CD2   1 
ATOM   2267 N  N     . LEU B 1 117 ? 9.617   -2.966  9.332  1.00 40.29 ? 279 LEU B N     1 
ATOM   2268 C  CA    . LEU B 1 117 ? 10.342  -3.411  10.530 1.00 39.07 ? 279 LEU B CA    1 
ATOM   2269 C  C     . LEU B 1 117 ? 11.795  -3.858  10.270 1.00 41.50 ? 279 LEU B C     1 
ATOM   2270 O  O     . LEU B 1 117 ? 12.686  -3.562  11.072 1.00 42.17 ? 279 LEU B O     1 
ATOM   2271 C  CB    . LEU B 1 117 ? 9.566   -4.534  11.221 1.00 36.67 ? 279 LEU B CB    1 
ATOM   2272 C  CG    . LEU B 1 117 ? 8.202   -4.154  11.807 1.00 34.57 ? 279 LEU B CG    1 
ATOM   2273 C  CD1   . LEU B 1 117 ? 7.415   -5.397  12.258 1.00 32.00 ? 279 LEU B CD1   1 
ATOM   2274 C  CD2   . LEU B 1 117 ? 8.391   -3.190  12.962 1.00 34.12 ? 279 LEU B CD2   1 
ATOM   2275 N  N     . THR B 1 118 ? 12.039  -4.546  9.155  1.00 43.28 ? 280 THR B N     1 
ATOM   2276 C  CA    . THR B 1 118 ? 13.347  -5.162  8.897  1.00 45.97 ? 280 THR B CA    1 
ATOM   2277 C  C     . THR B 1 118 ? 14.428  -4.192  8.403  1.00 49.24 ? 280 THR B C     1 
ATOM   2278 O  O     . THR B 1 118 ? 15.549  -4.617  8.115  1.00 51.96 ? 280 THR B O     1 
ATOM   2279 C  CB    . THR B 1 118 ? 13.243  -6.344  7.896  1.00 47.82 ? 280 THR B CB    1 
ATOM   2280 O  OG1   . THR B 1 118 ? 12.769  -5.873  6.628  1.00 49.81 ? 280 THR B OG1   1 
ATOM   2281 C  CG2   . THR B 1 118 ? 12.305  -7.416  8.427  1.00 44.40 ? 280 THR B CG2   1 
ATOM   2282 N  N     . SER B 1 119 ? 14.109  -2.901  8.311  1.00 49.24 ? 281 SER B N     1 
ATOM   2283 C  CA    . SER B 1 119 ? 15.134  -1.882  8.051  1.00 52.55 ? 281 SER B CA    1 
ATOM   2284 C  C     . SER B 1 119 ? 16.115  -1.763  9.226  1.00 52.63 ? 281 SER B C     1 
ATOM   2285 O  O     . SER B 1 119 ? 17.246  -1.323  9.042  1.00 56.54 ? 281 SER B O     1 
ATOM   2286 C  CB    . SER B 1 119 ? 14.501  -0.518  7.738  1.00 53.01 ? 281 SER B CB    1 
ATOM   2287 O  OG    . SER B 1 119 ? 13.652  -0.078  8.784  1.00 50.74 ? 281 SER B OG    1 
ATOM   2288 N  N     . PHE B 1 120 ? 15.681  -2.172  10.419 1.00 49.16 ? 282 PHE B N     1 
ATOM   2289 C  CA    . PHE B 1 120 ? 16.522  -2.161  11.616 1.00 49.15 ? 282 PHE B CA    1 
ATOM   2290 C  C     . PHE B 1 120 ? 17.271  -3.467  11.881 1.00 49.90 ? 282 PHE B C     1 
ATOM   2291 O  O     . PHE B 1 120 ? 18.191  -3.490  12.694 1.00 51.91 ? 282 PHE B O     1 
ATOM   2292 C  CB    . PHE B 1 120 ? 15.673  -1.809  12.835 1.00 45.82 ? 282 PHE B CB    1 
ATOM   2293 C  CG    . PHE B 1 120 ? 15.016  -0.475  12.728 1.00 45.87 ? 282 PHE B CG    1 
ATOM   2294 C  CD1   . PHE B 1 120 ? 13.712  -0.365  12.267 1.00 44.36 ? 282 PHE B CD1   1 
ATOM   2295 C  CD2   . PHE B 1 120 ? 15.714  0.682   13.052 1.00 48.55 ? 282 PHE B CD2   1 
ATOM   2296 C  CE1   . PHE B 1 120 ? 13.105  0.874   12.149 1.00 45.26 ? 282 PHE B CE1   1 
ATOM   2297 C  CE2   . PHE B 1 120 ? 15.116  1.929   12.936 1.00 49.62 ? 282 PHE B CE2   1 
ATOM   2298 C  CZ    . PHE B 1 120 ? 13.808  2.027   12.487 1.00 47.67 ? 282 PHE B CZ    1 
ATOM   2299 N  N     . GLY B 1 121 ? 16.886  -4.546  11.208 1.00 49.24 ? 283 GLY B N     1 
ATOM   2300 C  CA    . GLY B 1 121 ? 17.550  -5.840  11.376 1.00 50.26 ? 283 GLY B CA    1 
ATOM   2301 C  C     . GLY B 1 121 ? 16.580  -6.997  11.201 1.00 47.99 ? 283 GLY B C     1 
ATOM   2302 O  O     . GLY B 1 121 ? 15.370  -6.784  11.144 1.00 44.62 ? 283 GLY B O     1 
ATOM   2303 N  N     . PRO B 1 122 ? 17.106  -8.233  11.122 1.00 49.87 ? 284 PRO B N     1 
ATOM   2304 C  CA    . PRO B 1 122 ? 16.244  -9.403  10.911 1.00 48.95 ? 284 PRO B CA    1 
ATOM   2305 C  C     . PRO B 1 122 ? 15.337  -9.729  12.104 1.00 45.13 ? 284 PRO B C     1 
ATOM   2306 O  O     . PRO B 1 122 ? 15.713  -9.485  13.251 1.00 44.32 ? 284 PRO B O     1 
ATOM   2307 C  CB    . PRO B 1 122 ? 17.235  -10.551 10.659 1.00 53.15 ? 284 PRO B CB    1 
ATOM   2308 C  CG    . PRO B 1 122 ? 18.594  -9.954  10.655 1.00 56.31 ? 284 PRO B CG    1 
ATOM   2309 C  CD    . PRO B 1 122 ? 18.530  -8.593  11.231 1.00 53.87 ? 284 PRO B CD    1 
ATOM   2310 N  N     . LEU B 1 123 ? 14.159  -10.280 11.813 1.00 43.28 ? 285 LEU B N     1 
ATOM   2311 C  CA    . LEU B 1 123 ? 13.179  -10.676 12.829 1.00 40.33 ? 285 LEU B CA    1 
ATOM   2312 C  C     . LEU B 1 123 ? 13.248  -12.172 13.134 1.00 41.96 ? 285 LEU B C     1 
ATOM   2313 O  O     . LEU B 1 123 ? 13.544  -12.974 12.248 1.00 44.45 ? 285 LEU B O     1 
ATOM   2314 C  CB    . LEU B 1 123 ? 11.762  -10.338 12.346 1.00 38.00 ? 285 LEU B CB    1 
ATOM   2315 C  CG    . LEU B 1 123 ? 11.428  -8.859  12.148 1.00 36.32 ? 285 LEU B CG    1 
ATOM   2316 C  CD1   . LEU B 1 123 ? 10.076  -8.704  11.461 1.00 35.74 ? 285 LEU B CD1   1 
ATOM   2317 C  CD2   . LEU B 1 123 ? 11.445  -8.130  13.479 1.00 33.47 ? 285 LEU B CD2   1 
ATOM   2318 N  N     . LYS B 1 124 ? 12.972  -12.548 14.385 1.00 40.73 ? 286 LYS B N     1 
ATOM   2319 C  CA    . LYS B 1 124 ? 12.786  -13.967 14.722 1.00 42.91 ? 286 LYS B CA    1 
ATOM   2320 C  C     . LYS B 1 124 ? 11.311  -14.381 14.831 1.00 40.91 ? 286 LYS B C     1 
ATOM   2321 O  O     . LYS B 1 124 ? 10.994  -15.565 14.675 1.00 42.82 ? 286 LYS B O     1 
ATOM   2322 C  CB    . LYS B 1 124 ? 13.569  -14.380 15.977 1.00 44.51 ? 286 LYS B CB    1 
ATOM   2323 C  CG    . LYS B 1 124 ? 13.109  -13.814 17.302 1.00 42.32 ? 286 LYS B CG    1 
ATOM   2324 C  CD    . LYS B 1 124 ? 14.060  -14.310 18.413 1.00 45.25 ? 286 LYS B CD    1 
ATOM   2325 C  CE    . LYS B 1 124 ? 14.063  -13.389 19.634 1.00 44.06 ? 286 LYS B CE    1 
ATOM   2326 N  NZ    . LYS B 1 124 ? 15.440  -13.089 20.147 1.00 46.34 ? 286 LYS B NZ    1 
ATOM   2327 N  N     . ALA B 1 125 ? 10.430  -13.409 15.083 1.00 37.04 ? 287 ALA B N     1 
ATOM   2328 C  CA    . ALA B 1 125 ? 8.988   -13.648 15.130 1.00 35.53 ? 287 ALA B CA    1 
ATOM   2329 C  C     . ALA B 1 125 ? 8.208   -12.439 14.601 1.00 32.57 ? 287 ALA B C     1 
ATOM   2330 O  O     . ALA B 1 125 ? 8.627   -11.290 14.778 1.00 30.69 ? 287 ALA B O     1 
ATOM   2331 C  CB    . ALA B 1 125 ? 8.541   -13.992 16.571 1.00 35.19 ? 287 ALA B CB    1 
ATOM   2332 N  N     . PHE B 1 126 ? 7.085   -12.712 13.940 1.00 32.10 ? 288 PHE B N     1 
ATOM   2333 C  CA    . PHE B 1 126 ? 6.176   -11.661 13.465 1.00 30.32 ? 288 PHE B CA    1 
ATOM   2334 C  C     . PHE B 1 126 ? 4.753   -12.204 13.265 1.00 30.12 ? 288 PHE B C     1 
ATOM   2335 O  O     . PHE B 1 126 ? 4.580   -13.318 12.792 1.00 31.68 ? 288 PHE B O     1 
ATOM   2336 C  CB    . PHE B 1 126 ? 6.667   -11.057 12.138 1.00 30.86 ? 288 PHE B CB    1 
ATOM   2337 C  CG    . PHE B 1 126 ? 5.698   -10.063 11.536 1.00 30.04 ? 288 PHE B CG    1 
ATOM   2338 C  CD1   . PHE B 1 126 ? 5.723   -8.730  11.916 1.00 29.32 ? 288 PHE B CD1   1 
ATOM   2339 C  CD2   . PHE B 1 126 ? 4.739   -10.467 10.627 1.00 30.61 ? 288 PHE B CD2   1 
ATOM   2340 C  CE1   . PHE B 1 126 ? 4.814   -7.814  11.382 1.00 28.26 ? 288 PHE B CE1   1 
ATOM   2341 C  CE2   . PHE B 1 126 ? 3.831   -9.556  10.094 1.00 30.44 ? 288 PHE B CE2   1 
ATOM   2342 C  CZ    . PHE B 1 126 ? 3.866   -8.235  10.476 1.00 28.30 ? 288 PHE B CZ    1 
ATOM   2343 N  N     . ASN B 1 127 ? 3.748   -11.410 13.629 1.00 28.54 ? 289 ASN B N     1 
ATOM   2344 C  CA    . ASN B 1 127 ? 2.368   -11.674 13.219 1.00 29.14 ? 289 ASN B CA    1 
ATOM   2345 C  C     . ASN B 1 127 ? 1.524   -10.390 13.077 1.00 28.02 ? 289 ASN B C     1 
ATOM   2346 O  O     . ASN B 1 127 ? 1.640   -9.458  13.884 1.00 25.85 ? 289 ASN B O     1 
ATOM   2347 C  CB    . ASN B 1 127 ? 1.697   -12.744 14.107 1.00 30.12 ? 289 ASN B CB    1 
ATOM   2348 C  CG    . ASN B 1 127 ? 1.277   -12.232 15.492 1.00 29.75 ? 289 ASN B CG    1 
ATOM   2349 O  OD1   . ASN B 1 127 ? 2.112   -11.969 16.365 1.00 30.04 ? 289 ASN B OD1   1 
ATOM   2350 N  ND2   . ASN B 1 127 ? -0.030  -12.168 15.715 1.00 29.23 ? 289 ASN B ND2   1 
ATOM   2351 N  N     . LEU B 1 128 ? 0.725   -10.333 12.007 1.00 28.76 ? 290 LEU B N     1 
ATOM   2352 C  CA    . LEU B 1 128 ? -0.262  -9.266  11.810 1.00 28.80 ? 290 LEU B CA    1 
ATOM   2353 C  C     . LEU B 1 128 ? -1.650  -9.816  12.174 1.00 30.29 ? 290 LEU B C     1 
ATOM   2354 O  O     . LEU B 1 128 ? -2.053  -10.875 11.689 1.00 32.51 ? 290 LEU B O     1 
ATOM   2355 C  CB    . LEU B 1 128 ? -0.230  -8.744  10.369 1.00 29.80 ? 290 LEU B CB    1 
ATOM   2356 C  CG    . LEU B 1 128 ? -1.252  -7.672  9.937  1.00 30.19 ? 290 LEU B CG    1 
ATOM   2357 C  CD1   . LEU B 1 128 ? -1.055  -6.326  10.621 1.00 29.31 ? 290 LEU B CD1   1 
ATOM   2358 C  CD2   . LEU B 1 128 ? -1.201  -7.502  8.439  1.00 31.53 ? 290 LEU B CD2   1 
ATOM   2359 N  N     . VAL B 1 129 ? -2.359  -9.117  13.061 1.00 30.03 ? 291 VAL B N     1 
ATOM   2360 C  CA    . VAL B 1 129 ? -3.668  -9.566  13.518 1.00 31.45 ? 291 VAL B CA    1 
ATOM   2361 C  C     . VAL B 1 129 ? -4.751  -9.225  12.489 1.00 33.34 ? 291 VAL B C     1 
ATOM   2362 O  O     . VAL B 1 129 ? -4.887  -8.080  12.063 1.00 32.86 ? 291 VAL B O     1 
ATOM   2363 C  CB    . VAL B 1 129 ? -4.022  -8.972  14.895 1.00 30.93 ? 291 VAL B CB    1 
ATOM   2364 C  CG1   . VAL B 1 129 ? -5.430  -9.396  15.326 1.00 32.80 ? 291 VAL B CG1   1 
ATOM   2365 C  CG2   . VAL B 1 129 ? -2.993  -9.405  15.930 1.00 28.97 ? 291 VAL B CG2   1 
ATOM   2366 N  N     . LYS B 1 130 ? -5.514  -10.244 12.102 1.00 35.91 ? 292 LYS B N     1 
ATOM   2367 C  CA    . LYS B 1 130 ? -6.580  -10.103 11.114 1.00 38.60 ? 292 LYS B CA    1 
ATOM   2368 C  C     . LYS B 1 130 ? -7.900  -10.651 11.659 1.00 40.98 ? 292 LYS B C     1 
ATOM   2369 O  O     . LYS B 1 130 ? -7.907  -11.516 12.529 1.00 40.90 ? 292 LYS B O     1 
ATOM   2370 C  CB    . LYS B 1 130 ? -6.171  -10.821 9.822  1.00 39.71 ? 292 LYS B CB    1 
ATOM   2371 C  CG    . LYS B 1 130 ? -4.859  -10.280 9.232  1.00 38.48 ? 292 LYS B CG    1 
ATOM   2372 C  CD    . LYS B 1 130 ? -4.438  -11.017 7.979  1.00 41.64 ? 292 LYS B CD    1 
ATOM   2373 C  CE    . LYS B 1 130 ? -3.523  -12.189 8.289  1.00 43.85 ? 292 LYS B CE    1 
ATOM   2374 N  NZ    . LYS B 1 130 ? -2.160  -11.746 8.695  1.00 41.12 ? 292 LYS B NZ    1 
ATOM   2375 N  N     . ASP B 1 131 ? -9.010  -10.117 11.153 1.00 43.62 ? 293 ASP B N     1 
ATOM   2376 C  CA    . ASP B 1 131 ? -10.344 -10.627 11.465 1.00 46.58 ? 293 ASP B CA    1 
ATOM   2377 C  C     . ASP B 1 131 ? -10.554 -11.959 10.752 1.00 48.93 ? 293 ASP B C     1 
ATOM   2378 O  O     . ASP B 1 131 ? -10.457 -12.038 9.526  1.00 49.59 ? 293 ASP B O     1 
ATOM   2379 C  CB    . ASP B 1 131 ? -11.419 -9.620  11.038 1.00 48.94 ? 293 ASP B CB    1 
ATOM   2380 C  CG    . ASP B 1 131 ? -12.848 -10.108 11.326 1.00 53.38 ? 293 ASP B CG    1 
ATOM   2381 O  OD1   . ASP B 1 131 ? -13.789 -9.624  10.659 1.00 57.30 ? 293 ASP B OD1   1 
ATOM   2382 O  OD2   . ASP B 1 131 ? -13.036 -10.969 12.216 1.00 56.13 ? 293 ASP B OD2   1 
ATOM   2383 N  N     . SER B 1 132 ? -10.864 -12.997 11.528 1.00 50.57 ? 294 SER B N     1 
ATOM   2384 C  CA    . SER B 1 132 ? -10.994 -14.364 11.008 1.00 53.25 ? 294 SER B CA    1 
ATOM   2385 C  C     . SER B 1 132 ? -12.083 -14.532 9.945  1.00 56.82 ? 294 SER B C     1 
ATOM   2386 O  O     . SER B 1 132 ? -11.980 -15.411 9.093  1.00 58.84 ? 294 SER B O     1 
ATOM   2387 C  CB    . SER B 1 132 ? -11.279 -15.337 12.156 1.00 55.15 ? 294 SER B CB    1 
ATOM   2388 O  OG    . SER B 1 132 ? -12.609 -15.184 12.637 1.00 57.59 ? 294 SER B OG    1 
ATOM   2389 N  N     . ALA B 1 133 ? -13.119 -13.698 10.014 1.00 58.16 ? 295 ALA B N     1 
ATOM   2390 C  CA    . ALA B 1 133 ? -14.279 -13.807 9.133  1.00 62.32 ? 295 ALA B CA    1 
ATOM   2391 C  C     . ALA B 1 133 ? -14.026 -13.236 7.734  1.00 62.18 ? 295 ALA B C     1 
ATOM   2392 O  O     . ALA B 1 133 ? -14.488 -13.801 6.736  1.00 65.37 ? 295 ALA B O     1 
ATOM   2393 C  CB    . ALA B 1 133 ? -15.485 -13.117 9.774  1.00 64.53 ? 295 ALA B CB    1 
ATOM   2394 N  N     . THR B 1 134 ? -13.315 -12.112 7.670  1.00 58.82 ? 296 THR B N     1 
ATOM   2395 C  CA    . THR B 1 134 ? -13.063 -11.412 6.404  1.00 59.02 ? 296 THR B CA    1 
ATOM   2396 C  C     . THR B 1 134 ? -11.609 -11.496 5.928  1.00 56.23 ? 296 THR B C     1 
ATOM   2397 O  O     . THR B 1 134 ? -11.317 -11.158 4.782  1.00 57.01 ? 296 THR B O     1 
ATOM   2398 C  CB    . THR B 1 134 ? -13.438 -9.917  6.517  1.00 58.74 ? 296 THR B CB    1 
ATOM   2399 O  OG1   . THR B 1 134 ? -12.566 -9.267  7.452  1.00 55.22 ? 296 THR B OG1   1 
ATOM   2400 C  CG2   . THR B 1 134 ? -14.885 -9.755  6.971  1.00 62.00 ? 296 THR B CG2   1 
ATOM   2401 N  N     . GLY B 1 135 ? -10.703 -11.928 6.802  1.00 53.41 ? 297 GLY B N     1 
ATOM   2402 C  CA    . GLY B 1 135 ? -9.272  -11.975 6.484  1.00 51.03 ? 297 GLY B CA    1 
ATOM   2403 C  C     . GLY B 1 135 ? -8.607  -10.604 6.460  1.00 48.39 ? 297 GLY B C     1 
ATOM   2404 O  O     . GLY B 1 135 ? -7.525  -10.436 5.887  1.00 47.25 ? 297 GLY B O     1 
ATOM   2405 N  N     . LEU B 1 136 ? -9.245  -9.634  7.111  1.00 47.92 ? 298 LEU B N     1 
ATOM   2406 C  CA    . LEU B 1 136 ? -8.875  -8.229  7.002  1.00 46.26 ? 298 LEU B CA    1 
ATOM   2407 C  C     . LEU B 1 136 ? -8.124  -7.751  8.239  1.00 42.76 ? 298 LEU B C     1 
ATOM   2408 O  O     . LEU B 1 136 ? -8.533  -8.028  9.371  1.00 42.12 ? 298 LEU B O     1 
ATOM   2409 C  CB    . LEU B 1 136 ? -10.150 -7.406  6.806  1.00 49.17 ? 298 LEU B CB    1 
ATOM   2410 C  CG    . LEU B 1 136 ? -10.087 -5.913  6.462  1.00 50.37 ? 298 LEU B CG    1 
ATOM   2411 C  CD1   . LEU B 1 136 ? -8.781  -5.502  5.765  1.00 50.63 ? 298 LEU B CD1   1 
ATOM   2412 C  CD2   . LEU B 1 136 ? -11.310 -5.546  5.604  1.00 53.80 ? 298 LEU B CD2   1 
ATOM   2413 N  N     . SER B 1 137 ? -7.039  -7.015  8.009  1.00 40.47 ? 299 SER B N     1 
ATOM   2414 C  CA    . SER B 1 137 ? -6.213  -6.458  9.078  1.00 37.51 ? 299 SER B CA    1 
ATOM   2415 C  C     . SER B 1 137 ? -7.007  -5.652  10.114 1.00 37.40 ? 299 SER B C     1 
ATOM   2416 O  O     . SER B 1 137 ? -7.827  -4.804  9.765  1.00 39.05 ? 299 SER B O     1 
ATOM   2417 C  CB    . SER B 1 137 ? -5.111  -5.570  8.485  1.00 36.70 ? 299 SER B CB    1 
ATOM   2418 O  OG    . SER B 1 137 ? -4.315  -4.984  9.507  1.00 34.04 ? 299 SER B OG    1 
ATOM   2419 N  N     . LYS B 1 138 ? -6.745  -5.934  11.390 1.00 35.54 ? 300 LYS B N     1 
ATOM   2420 C  CA    . LYS B 1 138 ? -7.295  -5.152  12.494 1.00 35.95 ? 300 LYS B CA    1 
ATOM   2421 C  C     . LYS B 1 138 ? -6.417  -3.931  12.792 1.00 34.74 ? 300 LYS B C     1 
ATOM   2422 O  O     . LYS B 1 138 ? -6.747  -3.110  13.641 1.00 35.82 ? 300 LYS B O     1 
ATOM   2423 C  CB    . LYS B 1 138 ? -7.443  -6.019  13.742 1.00 35.34 ? 300 LYS B CB    1 
ATOM   2424 C  CG    . LYS B 1 138 ? -8.455  -7.143  13.582 1.00 36.87 ? 300 LYS B CG    1 
ATOM   2425 C  CD    . LYS B 1 138 ? -8.812  -7.780  14.918 1.00 37.41 ? 300 LYS B CD    1 
ATOM   2426 C  CE    . LYS B 1 138 ? -9.819  -8.926  14.725 1.00 40.13 ? 300 LYS B CE    1 
ATOM   2427 N  NZ    . LYS B 1 138 ? -10.395 -9.411  16.007 1.00 40.61 ? 300 LYS B NZ    1 
ATOM   2428 N  N     . GLY B 1 139 ? -5.293  -3.821  12.094 1.00 33.33 ? 301 GLY B N     1 
ATOM   2429 C  CA    . GLY B 1 139 ? -4.458  -2.635  12.173 1.00 32.99 ? 301 GLY B CA    1 
ATOM   2430 C  C     . GLY B 1 139 ? -3.387  -2.639  13.245 1.00 30.74 ? 301 GLY B C     1 
ATOM   2431 O  O     . GLY B 1 139 ? -2.852  -1.584  13.568 1.00 31.03 ? 301 GLY B O     1 
ATOM   2432 N  N     . TYR B 1 140 ? -3.062  -3.810  13.787 1.00 29.11 ? 302 TYR B N     1 
ATOM   2433 C  CA    . TYR B 1 140 ? -1.932  -3.937  14.700 1.00 27.70 ? 302 TYR B CA    1 
ATOM   2434 C  C     . TYR B 1 140 ? -1.203  -5.273  14.566 1.00 26.69 ? 302 TYR B C     1 
ATOM   2435 O  O     . TYR B 1 140 ? -1.752  -6.258  14.069 1.00 26.98 ? 302 TYR B O     1 
ATOM   2436 C  CB    . TYR B 1 140 ? -2.356  -3.687  16.162 1.00 28.02 ? 302 TYR B CB    1 
ATOM   2437 C  CG    . TYR B 1 140 ? -3.493  -4.542  16.688 1.00 28.34 ? 302 TYR B CG    1 
ATOM   2438 C  CD1   . TYR B 1 140 ? -3.246  -5.771  17.291 1.00 27.85 ? 302 TYR B CD1   1 
ATOM   2439 C  CD2   . TYR B 1 140 ? -4.802  -4.099  16.628 1.00 30.01 ? 302 TYR B CD2   1 
ATOM   2440 C  CE1   . TYR B 1 140 ? -4.284  -6.547  17.800 1.00 29.51 ? 302 TYR B CE1   1 
ATOM   2441 C  CE2   . TYR B 1 140 ? -5.847  -4.867  17.129 1.00 32.82 ? 302 TYR B CE2   1 
ATOM   2442 C  CZ    . TYR B 1 140 ? -5.579  -6.092  17.710 1.00 31.29 ? 302 TYR B CZ    1 
ATOM   2443 O  OH    . TYR B 1 140 ? -6.606  -6.855  18.198 1.00 32.80 ? 302 TYR B OH    1 
ATOM   2444 N  N     . ALA B 1 141 ? 0.043   -5.279  15.030 1.00 26.08 ? 303 ALA B N     1 
ATOM   2445 C  CA    . ALA B 1 141 ? 0.975   -6.394  14.836 1.00 25.99 ? 303 ALA B CA    1 
ATOM   2446 C  C     . ALA B 1 141 ? 1.903   -6.571  16.040 1.00 25.62 ? 303 ALA B C     1 
ATOM   2447 O  O     . ALA B 1 141 ? 1.991   -5.697  16.907 1.00 25.04 ? 303 ALA B O     1 
ATOM   2448 C  CB    . ALA B 1 141 ? 1.815   -6.163  13.578 1.00 25.68 ? 303 ALA B CB    1 
ATOM   2449 N  N     . PHE B 1 142 ? 2.591   -7.711  16.075 1.00 26.19 ? 304 PHE B N     1 
ATOM   2450 C  CA    . PHE B 1 142 ? 3.596   -7.996  17.102 1.00 26.89 ? 304 PHE B CA    1 
ATOM   2451 C  C     . PHE B 1 142 ? 4.858   -8.532  16.436 1.00 27.79 ? 304 PHE B C     1 
ATOM   2452 O  O     . PHE B 1 142 ? 4.765   -9.162  15.387 1.00 28.65 ? 304 PHE B O     1 
ATOM   2453 C  CB    . PHE B 1 142 ? 3.054   -9.009  18.120 1.00 26.49 ? 304 PHE B CB    1 
ATOM   2454 C  CG    . PHE B 1 142 ? 1.799   -8.558  18.822 1.00 26.25 ? 304 PHE B CG    1 
ATOM   2455 C  CD1   . PHE B 1 142 ? 1.855   -8.009  20.098 1.00 26.06 ? 304 PHE B CD1   1 
ATOM   2456 C  CD2   . PHE B 1 142 ? 0.555   -8.711  18.220 1.00 27.28 ? 304 PHE B CD2   1 
ATOM   2457 C  CE1   . PHE B 1 142 ? 0.700   -7.598  20.758 1.00 26.71 ? 304 PHE B CE1   1 
ATOM   2458 C  CE2   . PHE B 1 142 ? -0.614  -8.301  18.866 1.00 27.32 ? 304 PHE B CE2   1 
ATOM   2459 C  CZ    . PHE B 1 142 ? -0.537  -7.744  20.141 1.00 28.26 ? 304 PHE B CZ    1 
ATOM   2460 N  N     . CYS B 1 143 ? 6.029   -8.268  17.019 1.00 28.83 ? 305 CYS B N     1 
ATOM   2461 C  CA    . CYS B 1 143 ? 7.284   -8.869  16.522 1.00 30.88 ? 305 CYS B CA    1 
ATOM   2462 C  C     . CYS B 1 143 ? 8.401   -9.012  17.578 1.00 32.00 ? 305 CYS B C     1 
ATOM   2463 O  O     . CYS B 1 143 ? 8.279   -8.514  18.697 1.00 32.29 ? 305 CYS B O     1 
ATOM   2464 C  CB    . CYS B 1 143 ? 7.796   -8.101  15.298 1.00 31.70 ? 305 CYS B CB    1 
ATOM   2465 S  SG    . CYS B 1 143 ? 8.565   -6.523  15.661 1.00 34.35 ? 305 CYS B SG    1 
ATOM   2466 N  N     . GLU B 1 144 ? 9.466   -9.731  17.218 1.00 33.79 ? 306 GLU B N     1 
ATOM   2467 C  CA    . GLU B 1 144 ? 10.686  -9.831  18.040 1.00 35.32 ? 306 GLU B CA    1 
ATOM   2468 C  C     . GLU B 1 144 ? 11.918  -9.888  17.131 1.00 36.61 ? 306 GLU B C     1 
ATOM   2469 O  O     . GLU B 1 144 ? 11.958  -10.697 16.212 1.00 37.49 ? 306 GLU B O     1 
ATOM   2470 C  CB    . GLU B 1 144 ? 10.665  -11.076 18.942 1.00 36.66 ? 306 GLU B CB    1 
ATOM   2471 C  CG    . GLU B 1 144 ? 10.241  -10.828 20.379 1.00 38.19 ? 306 GLU B CG    1 
ATOM   2472 C  CD    . GLU B 1 144 ? 10.852  -11.814 21.396 1.00 40.85 ? 306 GLU B CD    1 
ATOM   2473 O  OE1   . GLU B 1 144 ? 12.095  -11.929 21.468 1.00 45.55 ? 306 GLU B OE1   1 
ATOM   2474 O  OE2   . GLU B 1 144 ? 10.086  -12.457 22.152 1.00 45.90 ? 306 GLU B OE2   1 
ATOM   2475 N  N     . TYR B 1 145 ? 12.915  -9.042  17.400 1.00 36.77 ? 307 TYR B N     1 
ATOM   2476 C  CA    . TYR B 1 145 ? 14.158  -9.028  16.618 1.00 39.25 ? 307 TYR B CA    1 
ATOM   2477 C  C     . TYR B 1 145 ? 15.092  -10.179 17.013 1.00 41.94 ? 307 TYR B C     1 
ATOM   2478 O  O     . TYR B 1 145 ? 15.075  -10.646 18.158 1.00 41.80 ? 307 TYR B O     1 
ATOM   2479 C  CB    . TYR B 1 145 ? 14.874  -7.671  16.751 1.00 39.40 ? 307 TYR B CB    1 
ATOM   2480 C  CG    . TYR B 1 145 ? 14.183  -6.557  15.992 1.00 37.83 ? 307 TYR B CG    1 
ATOM   2481 C  CD1   . TYR B 1 145 ? 14.461  -6.329  14.644 1.00 39.03 ? 307 TYR B CD1   1 
ATOM   2482 C  CD2   . TYR B 1 145 ? 13.230  -5.755  16.605 1.00 35.62 ? 307 TYR B CD2   1 
ATOM   2483 C  CE1   . TYR B 1 145 ? 13.815  -5.321  13.932 1.00 38.34 ? 307 TYR B CE1   1 
ATOM   2484 C  CE2   . TYR B 1 145 ? 12.577  -4.738  15.898 1.00 35.10 ? 307 TYR B CE2   1 
ATOM   2485 C  CZ    . TYR B 1 145 ? 12.873  -4.533  14.564 1.00 36.11 ? 307 TYR B CZ    1 
ATOM   2486 O  OH    . TYR B 1 145 ? 12.238  -3.538  13.861 1.00 36.00 ? 307 TYR B OH    1 
ATOM   2487 N  N     . VAL B 1 146 ? 15.897  -10.635 16.055 1.00 44.80 ? 308 VAL B N     1 
ATOM   2488 C  CA    . VAL B 1 146 ? 16.883  -11.698 16.296 1.00 48.54 ? 308 VAL B CA    1 
ATOM   2489 C  C     . VAL B 1 146 ? 17.924  -11.247 17.327 1.00 50.07 ? 308 VAL B C     1 
ATOM   2490 O  O     . VAL B 1 146 ? 18.248  -11.992 18.250 1.00 51.63 ? 308 VAL B O     1 
ATOM   2491 C  CB    . VAL B 1 146 ? 17.582  -12.137 14.981 1.00 52.01 ? 308 VAL B CB    1 
ATOM   2492 C  CG1   . VAL B 1 146 ? 18.774  -13.059 15.266 1.00 56.60 ? 308 VAL B CG1   1 
ATOM   2493 C  CG2   . VAL B 1 146 ? 16.590  -12.826 14.054 1.00 51.50 ? 308 VAL B CG2   1 
ATOM   2494 N  N     . ASP B 1 147 ? 18.440  -10.031 17.154 1.00 50.12 ? 309 ASP B N     1 
ATOM   2495 C  CA    . ASP B 1 147 ? 19.328  -9.394  18.125 1.00 51.51 ? 309 ASP B CA    1 
ATOM   2496 C  C     . ASP B 1 147 ? 18.500  -8.454  18.995 1.00 48.25 ? 309 ASP B C     1 
ATOM   2497 O  O     . ASP B 1 147 ? 17.988  -7.453  18.506 1.00 46.17 ? 309 ASP B O     1 
ATOM   2498 C  CB    . ASP B 1 147 ? 20.425  -8.614  17.383 1.00 54.49 ? 309 ASP B CB    1 
ATOM   2499 C  CG    . ASP B 1 147 ? 21.411  -7.923  18.318 1.00 56.36 ? 309 ASP B CG    1 
ATOM   2500 O  OD1   . ASP B 1 147 ? 21.420  -8.209  19.541 1.00 56.40 ? 309 ASP B OD1   1 
ATOM   2501 O  OD2   . ASP B 1 147 ? 22.194  -7.088  17.812 1.00 59.40 ? 309 ASP B OD2   1 
ATOM   2502 N  N     . ILE B 1 148 ? 18.367  -8.773  20.282 1.00 48.43 ? 310 ILE B N     1 
ATOM   2503 C  CA    . ILE B 1 148 ? 17.499  -7.993  21.180 1.00 46.24 ? 310 ILE B CA    1 
ATOM   2504 C  C     . ILE B 1 148 ? 17.990  -6.558  21.433 1.00 46.75 ? 310 ILE B C     1 
ATOM   2505 O  O     . ILE B 1 148 ? 17.213  -5.708  21.872 1.00 44.67 ? 310 ILE B O     1 
ATOM   2506 C  CB    . ILE B 1 148 ? 17.256  -8.708  22.551 1.00 46.92 ? 310 ILE B CB    1 
ATOM   2507 C  CG1   . ILE B 1 148 ? 18.541  -8.803  23.380 1.00 50.54 ? 310 ILE B CG1   1 
ATOM   2508 C  CG2   . ILE B 1 148 ? 16.662  -10.087 22.335 1.00 46.94 ? 310 ILE B CG2   1 
ATOM   2509 C  CD1   . ILE B 1 148 ? 18.478  -9.846  24.502 1.00 52.33 ? 310 ILE B CD1   1 
ATOM   2510 N  N     . ASN B 1 149 ? 19.264  -6.291  21.147 1.00 50.05 ? 311 ASN B N     1 
ATOM   2511 C  CA    . ASN B 1 149 ? 19.844  -4.954  21.326 1.00 51.67 ? 311 ASN B CA    1 
ATOM   2512 C  C     . ASN B 1 149 ? 19.366  -3.930  20.292 1.00 50.54 ? 311 ASN B C     1 
ATOM   2513 O  O     . ASN B 1 149 ? 19.658  -2.741  20.430 1.00 52.33 ? 311 ASN B O     1 
ATOM   2514 C  CB    . ASN B 1 149 ? 21.374  -5.024  21.287 1.00 56.24 ? 311 ASN B CB    1 
ATOM   2515 C  CG    . ASN B 1 149 ? 21.951  -5.902  22.382 1.00 58.84 ? 311 ASN B CG    1 
ATOM   2516 O  OD1   . ASN B 1 149 ? 21.445  -5.938  23.505 1.00 59.87 ? 311 ASN B OD1   1 
ATOM   2517 N  ND2   . ASN B 1 149 ? 23.016  -6.615  22.059 1.00 62.90 ? 311 ASN B ND2   1 
ATOM   2518 N  N     . VAL B 1 150 ? 18.668  -4.405  19.258 1.00 48.60 ? 312 VAL B N     1 
ATOM   2519 C  CA    . VAL B 1 150 ? 18.072  -3.574  18.195 1.00 47.75 ? 312 VAL B CA    1 
ATOM   2520 C  C     . VAL B 1 150 ? 16.668  -3.050  18.567 1.00 44.59 ? 312 VAL B C     1 
ATOM   2521 O  O     . VAL B 1 150 ? 16.169  -2.108  17.949 1.00 43.84 ? 312 VAL B O     1 
ATOM   2522 C  CB    . VAL B 1 150 ? 17.976  -4.396  16.857 1.00 47.97 ? 312 VAL B CB    1 
ATOM   2523 C  CG1   . VAL B 1 150 ? 16.981  -3.792  15.874 1.00 46.78 ? 312 VAL B CG1   1 
ATOM   2524 C  CG2   . VAL B 1 150 ? 19.354  -4.530  16.205 1.00 52.19 ? 312 VAL B CG2   1 
ATOM   2525 N  N     . THR B 1 151 ? 16.052  -3.660  19.583 1.00 42.83 ? 313 THR B N     1 
ATOM   2526 C  CA    . THR B 1 151 ? 14.679  -3.351  19.995 1.00 40.26 ? 313 THR B CA    1 
ATOM   2527 C  C     . THR B 1 151 ? 14.442  -1.858  20.265 1.00 40.62 ? 313 THR B C     1 
ATOM   2528 O  O     . THR B 1 151 ? 13.477  -1.275  19.767 1.00 38.82 ? 313 THR B O     1 
ATOM   2529 C  CB    . THR B 1 151 ? 14.290  -4.159  21.265 1.00 39.73 ? 313 THR B CB    1 
ATOM   2530 O  OG1   . THR B 1 151 ? 14.481  -5.566  21.024 1.00 39.90 ? 313 THR B OG1   1 
ATOM   2531 C  CG2   . THR B 1 151 ? 12.834  -3.903  21.648 1.00 37.57 ? 313 THR B CG2   1 
ATOM   2532 N  N     . ASP B 1 152 ? 15.327  -1.248  21.048 1.00 42.83 ? 314 ASP B N     1 
ATOM   2533 C  CA    . ASP B 1 152 ? 15.169  0.158   21.428 1.00 44.38 ? 314 ASP B CA    1 
ATOM   2534 C  C     . ASP B 1 152 ? 15.520  1.127   20.294 1.00 45.94 ? 314 ASP B C     1 
ATOM   2535 O  O     . ASP B 1 152 ? 15.023  2.253   20.280 1.00 46.64 ? 314 ASP B O     1 
ATOM   2536 C  CB    . ASP B 1 152 ? 15.976  0.470   22.689 1.00 46.76 ? 314 ASP B CB    1 
ATOM   2537 C  CG    . ASP B 1 152 ? 15.306  -0.066  23.950 1.00 46.79 ? 314 ASP B CG    1 
ATOM   2538 O  OD1   . ASP B 1 152 ? 14.167  0.367   24.238 1.00 46.38 ? 314 ASP B OD1   1 
ATOM   2539 O  OD2   . ASP B 1 152 ? 15.910  -0.909  24.653 1.00 47.97 ? 314 ASP B OD2   1 
ATOM   2540 N  N     . GLN B 1 153 ? 16.353  0.677   19.351 1.00 46.81 ? 315 GLN B N     1 
ATOM   2541 C  CA    . GLN B 1 153 ? 16.640  1.437   18.123 1.00 48.79 ? 315 GLN B CA    1 
ATOM   2542 C  C     . GLN B 1 153 ? 15.370  1.529   17.269 1.00 46.43 ? 315 GLN B C     1 
ATOM   2543 O  O     . GLN B 1 153 ? 15.067  2.583   16.714 1.00 47.87 ? 315 GLN B O     1 
ATOM   2544 C  CB    . GLN B 1 153 ? 17.759  0.786   17.278 1.00 51.04 ? 315 GLN B CB    1 
ATOM   2545 C  CG    . GLN B 1 153 ? 19.030  0.305   18.022 1.00 54.19 ? 315 GLN B CG    1 
ATOM   2546 C  CD    . GLN B 1 153 ? 19.920  1.423   18.528 1.00 59.26 ? 315 GLN B CD    1 
ATOM   2547 O  OE1   . GLN B 1 153 ? 19.598  2.601   18.390 1.00 62.84 ? 315 GLN B OE1   1 
ATOM   2548 N  NE2   . GLN B 1 153 ? 21.063  1.055   19.111 1.00 61.27 ? 315 GLN B NE2   1 
ATOM   2549 N  N     . ALA B 1 154 ? 14.634  0.420   17.169 1.00 43.16 ? 316 ALA B N     1 
ATOM   2550 C  CA    . ALA B 1 154 ? 13.394  0.373   16.392 1.00 40.92 ? 316 ALA B CA    1 
ATOM   2551 C  C     . ALA B 1 154 ? 12.280  1.231   17.002 1.00 39.92 ? 316 ALA B C     1 
ATOM   2552 O  O     . ALA B 1 154 ? 11.587  1.943   16.278 1.00 40.74 ? 316 ALA B O     1 
ATOM   2553 C  CB    . ALA B 1 154 ? 12.925  -1.068  16.228 1.00 38.55 ? 316 ALA B CB    1 
ATOM   2554 N  N     . ILE B 1 155 ? 12.105  1.163   18.319 1.00 38.69 ? 317 ILE B N     1 
ATOM   2555 C  CA    . ILE B 1 155 ? 11.125  2.008   19.019 1.00 38.72 ? 317 ILE B CA    1 
ATOM   2556 C  C     . ILE B 1 155 ? 11.420  3.496   18.797 1.00 41.85 ? 317 ILE B C     1 
ATOM   2557 O  O     . ILE B 1 155 ? 10.526  4.271   18.460 1.00 42.70 ? 317 ILE B O     1 
ATOM   2558 C  CB    . ILE B 1 155 ? 11.097  1.712   20.550 1.00 38.51 ? 317 ILE B CB    1 
ATOM   2559 C  CG1   . ILE B 1 155 ? 10.529  0.318   20.824 1.00 35.75 ? 317 ILE B CG1   1 
ATOM   2560 C  CG2   . ILE B 1 155 ? 10.286  2.770   21.308 1.00 39.91 ? 317 ILE B CG2   1 
ATOM   2561 C  CD1   . ILE B 1 155 ? 10.581  -0.087  22.287 1.00 35.59 ? 317 ILE B CD1   1 
ATOM   2562 N  N     . ALA B 1 156 ? 12.677  3.894   18.982 1.00 43.99 ? 318 ALA B N     1 
ATOM   2563 C  CA    . ALA B 1 156 ? 13.080  5.284   18.765 1.00 47.66 ? 318 ALA B CA    1 
ATOM   2564 C  C     . ALA B 1 156 ? 12.870  5.730   17.307 1.00 48.64 ? 318 ALA B C     1 
ATOM   2565 O  O     . ALA B 1 156 ? 12.464  6.868   17.052 1.00 50.81 ? 318 ALA B O     1 
ATOM   2566 C  CB    . ALA B 1 156 ? 14.528  5.480   19.177 1.00 50.24 ? 318 ALA B CB    1 
ATOM   2567 N  N     . GLY B 1 157 ? 13.134  4.831   16.361 1.00 47.15 ? 319 GLY B N     1 
ATOM   2568 C  CA    . GLY B 1 157 ? 12.981  5.140   14.931 1.00 48.80 ? 319 GLY B CA    1 
ATOM   2569 C  C     . GLY B 1 157 ? 11.551  5.123   14.401 1.00 47.00 ? 319 GLY B C     1 
ATOM   2570 O  O     . GLY B 1 157 ? 11.207  5.925   13.543 1.00 49.03 ? 319 GLY B O     1 
ATOM   2571 N  N     . LEU B 1 158 ? 10.718  4.217   14.908 1.00 43.88 ? 320 LEU B N     1 
ATOM   2572 C  CA    . LEU B 1 158 ? 9.350   4.032   14.387 1.00 42.98 ? 320 LEU B CA    1 
ATOM   2573 C  C     . LEU B 1 158 ? 8.245   4.686   15.211 1.00 43.37 ? 320 LEU B C     1 
ATOM   2574 O  O     . LEU B 1 158 ? 7.240   5.106   14.651 1.00 43.90 ? 320 LEU B O     1 
ATOM   2575 C  CB    . LEU B 1 158 ? 9.018   2.546   14.246 1.00 39.94 ? 320 LEU B CB    1 
ATOM   2576 C  CG    . LEU B 1 158 ? 9.709   1.762   13.127 1.00 40.68 ? 320 LEU B CG    1 
ATOM   2577 C  CD1   . LEU B 1 158 ? 9.340   0.288   13.222 1.00 37.35 ? 320 LEU B CD1   1 
ATOM   2578 C  CD2   . LEU B 1 158 ? 9.364   2.324   11.747 1.00 43.53 ? 320 LEU B CD2   1 
ATOM   2579 N  N     . ASN B 1 159 ? 8.405   4.750   16.532 1.00 43.52 ? 321 ASN B N     1 
ATOM   2580 C  CA    . ASN B 1 159 ? 7.328   5.242   17.396 1.00 44.41 ? 321 ASN B CA    1 
ATOM   2581 C  C     . ASN B 1 159 ? 6.992   6.704   17.108 1.00 48.73 ? 321 ASN B C     1 
ATOM   2582 O  O     . ASN B 1 159 ? 7.864   7.580   17.164 1.00 51.69 ? 321 ASN B O     1 
ATOM   2583 C  CB    . ASN B 1 159 ? 7.681   5.058   18.876 1.00 43.90 ? 321 ASN B CB    1 
ATOM   2584 C  CG    . ASN B 1 159 ? 6.527   5.389   19.800 1.00 44.21 ? 321 ASN B CG    1 
ATOM   2585 O  OD1   . ASN B 1 159 ? 5.380   5.043   19.531 1.00 41.28 ? 321 ASN B OD1   1 
ATOM   2586 N  ND2   . ASN B 1 159 ? 6.828   6.056   20.905 1.00 46.27 ? 321 ASN B ND2   1 
ATOM   2587 N  N     . GLY B 1 160 ? 5.727   6.959   16.781 1.00 49.82 ? 322 GLY B N     1 
ATOM   2588 C  CA    . GLY B 1 160 ? 5.263   8.313   16.471 1.00 54.63 ? 322 GLY B CA    1 
ATOM   2589 C  C     . GLY B 1 160 ? 5.425   8.729   15.015 1.00 56.98 ? 322 GLY B C     1 
ATOM   2590 O  O     . GLY B 1 160 ? 5.052   9.844   14.652 1.00 61.09 ? 322 GLY B O     1 
ATOM   2591 N  N     . MET B 1 161 ? 5.975   7.843   14.182 1.00 55.38 ? 323 MET B N     1 
ATOM   2592 C  CA    . MET B 1 161 ? 6.149   8.104   12.748 1.00 57.55 ? 323 MET B CA    1 
ATOM   2593 C  C     . MET B 1 161 ? 4.785   8.249   12.067 1.00 58.26 ? 323 MET B C     1 
ATOM   2594 O  O     . MET B 1 161 ? 3.895   7.418   12.256 1.00 54.97 ? 323 MET B O     1 
ATOM   2595 C  CB    . MET B 1 161 ? 6.946   6.953   12.091 1.00 55.03 ? 323 MET B CB    1 
ATOM   2596 C  CG    . MET B 1 161 ? 7.139   7.052   10.551 1.00 57.79 ? 323 MET B CG    1 
ATOM   2597 S  SD    . MET B 1 161 ? 7.774   5.522   9.767  1.00 57.00 ? 323 MET B SD    1 
ATOM   2598 C  CE    . MET B 1 161 ? 9.501   5.958   9.536  1.00 59.84 ? 323 MET B CE    1 
ATOM   2599 N  N     . GLN B 1 162 ? 4.631   9.321   11.286 1.00 62.87 ? 324 GLN B N     1 
ATOM   2600 C  CA    . GLN B 1 162 ? 3.452   9.512   10.437 1.00 64.31 ? 324 GLN B CA    1 
ATOM   2601 C  C     . GLN B 1 162 ? 3.543   8.549   9.257  1.00 62.35 ? 324 GLN B C     1 
ATOM   2602 O  O     . GLN B 1 162 ? 4.500   8.593   8.483  1.00 63.57 ? 324 GLN B O     1 
ATOM   2603 C  CB    . GLN B 1 162 ? 3.369   10.964  9.950  1.00 70.37 ? 324 GLN B CB    1 
ATOM   2604 C  CG    . GLN B 1 162 ? 2.227   11.279  8.966  1.00 73.54 ? 324 GLN B CG    1 
ATOM   2605 C  CD    . GLN B 1 162 ? 0.879   11.526  9.639  1.00 75.05 ? 324 GLN B CD    1 
ATOM   2606 O  OE1   . GLN B 1 162 ? 0.492   10.822  10.572 1.00 72.35 ? 324 GLN B OE1   1 
ATOM   2607 N  NE2   . GLN B 1 162 ? 0.152   12.524  9.148  1.00 80.81 ? 324 GLN B NE2   1 
ATOM   2608 N  N     . LEU B 1 163 ? 2.546   7.675   9.135  1.00 59.67 ? 325 LEU B N     1 
ATOM   2609 C  CA    . LEU B 1 163 ? 2.521   6.654   8.094  1.00 58.11 ? 325 LEU B CA    1 
ATOM   2610 C  C     . LEU B 1 163 ? 1.270   6.847   7.246  1.00 60.29 ? 325 LEU B C     1 
ATOM   2611 O  O     . LEU B 1 163 ? 0.233   6.227   7.487  1.00 58.58 ? 325 LEU B O     1 
ATOM   2612 C  CB    . LEU B 1 163 ? 2.566   5.254   8.728  1.00 53.35 ? 325 LEU B CB    1 
ATOM   2613 C  CG    . LEU B 1 163 ? 3.127   4.126   7.864  1.00 51.56 ? 325 LEU B CG    1 
ATOM   2614 C  CD1   . LEU B 1 163 ? 4.585   4.393   7.508  1.00 52.73 ? 325 LEU B CD1   1 
ATOM   2615 C  CD2   . LEU B 1 163 ? 2.985   2.787   8.571  1.00 47.57 ? 325 LEU B CD2   1 
ATOM   2616 N  N     . GLY B 1 164 ? 1.376   7.736   6.263  1.00 64.77 ? 326 GLY B N     1 
ATOM   2617 C  CA    . GLY B 1 164 ? 0.237   8.133   5.451  1.00 68.05 ? 326 GLY B CA    1 
ATOM   2618 C  C     . GLY B 1 164 ? -0.726  8.999   6.243  1.00 70.26 ? 326 GLY B C     1 
ATOM   2619 O  O     . GLY B 1 164 ? -0.432  10.155  6.542  1.00 73.75 ? 326 GLY B O     1 
ATOM   2620 N  N     . ASP B 1 165 ? -1.867  8.417   6.597  1.00 68.80 ? 327 ASP B N     1 
ATOM   2621 C  CA    . ASP B 1 165 ? -2.940  9.117   7.297  1.00 71.20 ? 327 ASP B CA    1 
ATOM   2622 C  C     . ASP B 1 165 ? -2.857  8.917   8.820  1.00 68.39 ? 327 ASP B C     1 
ATOM   2623 O  O     . ASP B 1 165 ? -3.538  9.604   9.583  1.00 70.89 ? 327 ASP B O     1 
ATOM   2624 C  CB    . ASP B 1 165 ? -4.289  8.591   6.781  1.00 71.90 ? 327 ASP B CB    1 
ATOM   2625 C  CG    . ASP B 1 165 ? -5.426  9.586   6.956  1.00 77.21 ? 327 ASP B CG    1 
ATOM   2626 O  OD1   . ASP B 1 165 ? -6.497  9.376   6.341  1.00 80.12 ? 327 ASP B OD1   1 
ATOM   2627 O  OD2   . ASP B 1 165 ? -5.260  10.580  7.693  1.00 81.44 ? 327 ASP B OD2   1 
ATOM   2628 N  N     . LYS B 1 166 ? -2.014  7.985   9.258  1.00 63.72 ? 328 LYS B N     1 
ATOM   2629 C  CA    . LYS B 1 166 ? -2.017  7.525   10.644 1.00 60.75 ? 328 LYS B CA    1 
ATOM   2630 C  C     . LYS B 1 166 ? -0.665  7.735   11.333 1.00 59.31 ? 328 LYS B C     1 
ATOM   2631 O  O     . LYS B 1 166 ? 0.361   7.890   10.671 1.00 59.89 ? 328 LYS B O     1 
ATOM   2632 C  CB    . LYS B 1 166 ? -2.433  6.046   10.679 1.00 56.87 ? 328 LYS B CB    1 
ATOM   2633 C  CG    . LYS B 1 166 ? -3.924  5.838   10.378 1.00 58.85 ? 328 LYS B CG    1 
ATOM   2634 C  CD    . LYS B 1 166 ? -4.269  4.432   9.894  1.00 55.99 ? 328 LYS B CD    1 
ATOM   2635 C  CE    . LYS B 1 166 ? -5.725  4.376   9.374  1.00 59.58 ? 328 LYS B CE    1 
ATOM   2636 N  NZ    . LYS B 1 166 ? -6.048  3.201   8.476  1.00 58.28 ? 328 LYS B NZ    1 
ATOM   2637 N  N     . LYS B 1 167 ? -0.686  7.763   12.665 1.00 57.99 ? 329 LYS B N     1 
ATOM   2638 C  CA    . LYS B 1 167 ? 0.535   7.820   13.483 1.00 56.36 ? 329 LYS B CA    1 
ATOM   2639 C  C     . LYS B 1 167 ? 0.778   6.460   14.147 1.00 51.25 ? 329 LYS B C     1 
ATOM   2640 O  O     . LYS B 1 167 ? -0.125  5.896   14.769 1.00 49.95 ? 329 LYS B O     1 
ATOM   2641 C  CB    . LYS B 1 167 ? 0.412   8.921   14.543 1.00 59.89 ? 329 LYS B CB    1 
ATOM   2642 C  CG    . LYS B 1 167 ? 1.726   9.294   15.236 1.00 60.28 ? 329 LYS B CG    1 
ATOM   2643 C  CD    . LYS B 1 167 ? 1.795   10.777  15.582 1.00 65.64 ? 329 LYS B CD    1 
ATOM   2644 C  CE    . LYS B 1 167 ? 2.131   11.637  14.359 1.00 69.55 ? 329 LYS B CE    1 
ATOM   2645 N  NZ    . LYS B 1 167 ? 1.941   13.103  14.600 1.00 75.11 ? 329 LYS B NZ    1 
ATOM   2646 N  N     . LEU B 1 168 ? 1.996   5.940   13.996 1.00 48.58 ? 330 LEU B N     1 
ATOM   2647 C  CA    . LEU B 1 168 ? 2.390   4.653   14.579 1.00 44.36 ? 330 LEU B CA    1 
ATOM   2648 C  C     . LEU B 1 168 ? 2.666   4.705   16.081 1.00 43.37 ? 330 LEU B C     1 
ATOM   2649 O  O     . LEU B 1 168 ? 3.305   5.634   16.570 1.00 45.29 ? 330 LEU B O     1 
ATOM   2650 C  CB    . LEU B 1 168 ? 3.664   4.135   13.917 1.00 43.33 ? 330 LEU B CB    1 
ATOM   2651 C  CG    . LEU B 1 168 ? 3.593   3.358   12.614 1.00 43.13 ? 330 LEU B CG    1 
ATOM   2652 C  CD1   . LEU B 1 168 ? 5.004   2.885   12.313 1.00 43.64 ? 330 LEU B CD1   1 
ATOM   2653 C  CD2   . LEU B 1 168 ? 2.624   2.172   12.704 1.00 41.79 ? 330 LEU B CD2   1 
ATOM   2654 N  N     . LEU B 1 169 ? 2.210   3.673   16.793 1.00 40.46 ? 331 LEU B N     1 
ATOM   2655 C  CA    . LEU B 1 169 ? 2.606   3.426   18.176 1.00 39.42 ? 331 LEU B CA    1 
ATOM   2656 C  C     . LEU B 1 169 ? 3.459   2.161   18.220 1.00 36.25 ? 331 LEU B C     1 
ATOM   2657 O  O     . LEU B 1 169 ? 2.981   1.077   17.883 1.00 34.55 ? 331 LEU B O     1 
ATOM   2658 C  CB    . LEU B 1 169 ? 1.380   3.249   19.070 1.00 40.05 ? 331 LEU B CB    1 
ATOM   2659 C  CG    . LEU B 1 169 ? 1.688   2.986   20.553 1.00 40.26 ? 331 LEU B CG    1 
ATOM   2660 C  CD1   . LEU B 1 169 ? 2.282   4.238   21.204 1.00 42.56 ? 331 LEU B CD1   1 
ATOM   2661 C  CD2   . LEU B 1 169 ? 0.439   2.523   21.302 1.00 40.68 ? 331 LEU B CD2   1 
ATOM   2662 N  N     . VAL B 1 170 ? 4.724   2.306   18.616 1.00 35.71 ? 332 VAL B N     1 
ATOM   2663 C  CA    . VAL B 1 170 ? 5.635   1.172   18.758 1.00 33.39 ? 332 VAL B CA    1 
ATOM   2664 C  C     . VAL B 1 170 ? 6.159   1.161   20.197 1.00 33.67 ? 332 VAL B C     1 
ATOM   2665 O  O     . VAL B 1 170 ? 6.825   2.108   20.627 1.00 34.67 ? 332 VAL B O     1 
ATOM   2666 C  CB    . VAL B 1 170 ? 6.809   1.241   17.750 1.00 33.63 ? 332 VAL B CB    1 
ATOM   2667 C  CG1   . VAL B 1 170 ? 7.736   0.060   17.922 1.00 32.30 ? 332 VAL B CG1   1 
ATOM   2668 C  CG2   . VAL B 1 170 ? 6.288   1.285   16.307 1.00 33.35 ? 332 VAL B CG2   1 
ATOM   2669 N  N     . GLN B 1 171 ? 5.830   0.097   20.929 1.00 32.01 ? 333 GLN B N     1 
ATOM   2670 C  CA    . GLN B 1 171 ? 6.215   -0.062  22.330 1.00 33.34 ? 333 GLN B CA    1 
ATOM   2671 C  C     . GLN B 1 171 ? 6.362   -1.550  22.682 1.00 32.21 ? 333 GLN B C     1 
ATOM   2672 O  O     . GLN B 1 171 ? 5.877   -2.418  21.948 1.00 30.47 ? 333 GLN B O     1 
ATOM   2673 C  CB    . GLN B 1 171 ? 5.176   0.615   23.252 1.00 34.97 ? 333 GLN B CB    1 
ATOM   2674 C  CG    . GLN B 1 171 ? 3.736   0.058   23.117 1.00 33.88 ? 333 GLN B CG    1 
ATOM   2675 C  CD    . GLN B 1 171 ? 2.714   0.766   24.005 1.00 36.55 ? 333 GLN B CD    1 
ATOM   2676 O  OE1   . GLN B 1 171 ? 2.962   1.855   24.530 1.00 39.63 ? 333 GLN B OE1   1 
ATOM   2677 N  NE2   . GLN B 1 171 ? 1.558   0.138   24.179 1.00 35.31 ? 333 GLN B NE2   1 
ATOM   2678 N  N     . ARG B 1 172 ? 7.026   -1.845  23.799 1.00 33.64 ? 334 ARG B N     1 
ATOM   2679 C  CA    . ARG B 1 172 ? 7.099   -3.227  24.299 1.00 33.59 ? 334 ARG B CA    1 
ATOM   2680 C  C     . ARG B 1 172 ? 5.690   -3.717  24.613 1.00 33.62 ? 334 ARG B C     1 
ATOM   2681 O  O     . ARG B 1 172 ? 4.899   -3.009  25.235 1.00 34.86 ? 334 ARG B O     1 
ATOM   2682 C  CB    . ARG B 1 172 ? 8.004   -3.353  25.544 1.00 35.17 ? 334 ARG B CB    1 
ATOM   2683 C  CG    . ARG B 1 172 ? 9.495   -3.458  25.197 1.00 35.57 ? 334 ARG B CG    1 
ATOM   2684 C  CD    . ARG B 1 172 ? 10.426  -3.593  26.423 1.00 37.42 ? 334 ARG B CD    1 
ATOM   2685 N  NE    . ARG B 1 172 ? 11.796  -3.897  25.989 1.00 37.72 ? 334 ARG B NE    1 
ATOM   2686 C  CZ    . ARG B 1 172 ? 12.631  -3.011  25.441 1.00 38.09 ? 334 ARG B CZ    1 
ATOM   2687 N  NH1   . ARG B 1 172 ? 12.270  -1.748  25.281 1.00 39.14 ? 334 ARG B NH1   1 
ATOM   2688 N  NH2   . ARG B 1 172 ? 13.844  -3.379  25.062 1.00 39.34 ? 334 ARG B NH2   1 
ATOM   2689 N  N     . ALA B 1 173 ? 5.382   -4.926  24.167 1.00 33.44 ? 335 ALA B N     1 
ATOM   2690 C  CA    . ALA B 1 173 ? 4.051   -5.492  24.340 1.00 34.57 ? 335 ALA B CA    1 
ATOM   2691 C  C     . ALA B 1 173 ? 3.779   -5.797  25.809 1.00 37.54 ? 335 ALA B C     1 
ATOM   2692 O  O     . ALA B 1 173 ? 2.641   -5.703  26.264 1.00 38.65 ? 335 ALA B O     1 
ATOM   2693 C  CB    . ALA B 1 173 ? 3.900   -6.746  23.503 1.00 33.06 ? 335 ALA B CB    1 
ATOM   2694 N  N     . SER B 1 174 ? 4.839   -6.130  26.540 1.00 39.58 ? 336 SER B N     1 
ATOM   2695 C  CA    . SER B 1 174 ? 4.761   -6.637  27.908 1.00 43.37 ? 336 SER B CA    1 
ATOM   2696 C  C     . SER B 1 174 ? 4.264   -8.083  27.861 1.00 45.15 ? 336 SER B C     1 
ATOM   2697 O  O     . SER B 1 174 ? 3.257   -8.459  28.482 1.00 47.68 ? 336 SER B O     1 
ATOM   2698 C  CB    . SER B 1 174 ? 3.894   -5.747  28.828 1.00 45.88 ? 336 SER B CB    1 
ATOM   2699 O  OG    . SER B 1 174 ? 2.564   -5.610  28.345 1.00 46.58 ? 336 SER B OG    1 
ATOM   2700 O  OXT   . SER B 1 174 ? 4.896   -8.905  27.167 1.00 45.39 ? 336 SER B OXT   1 
ATOM   2701 O  "O5'" . DC  C 2 2   ? -5.433  -0.418  16.079 1.00 54.77 ? 2   DC  P "O5'" 1 
ATOM   2702 C  "C5'" . DC  C 2 2   ? -6.236  -0.828  17.204 1.00 55.30 ? 2   DC  P "C5'" 1 
ATOM   2703 C  "C4'" . DC  C 2 2   ? -5.362  -1.227  18.386 1.00 54.58 ? 2   DC  P "C4'" 1 
ATOM   2704 O  "O4'" . DC  C 2 2   ? -4.201  -0.355  18.384 1.00 55.11 ? 2   DC  P "O4'" 1 
ATOM   2705 C  "C3'" . DC  C 2 2   ? -5.970  -1.108  19.786 1.00 53.84 ? 2   DC  P "C3'" 1 
ATOM   2706 O  "O3'" . DC  C 2 2   ? -5.373  -2.047  20.686 1.00 50.61 ? 2   DC  P "O3'" 1 
ATOM   2707 C  "C2'" . DC  C 2 2   ? -5.561  0.308   20.146 1.00 54.92 ? 2   DC  P "C2'" 1 
ATOM   2708 C  "C1'" . DC  C 2 2   ? -4.130  0.326   19.616 1.00 55.72 ? 2   DC  P "C1'" 1 
ATOM   2709 N  N1    . DC  C 2 2   ? -3.571  1.695   19.433 1.00 56.56 ? 2   DC  P N1    1 
ATOM   2710 C  C2    . DC  C 2 2   ? -3.329  2.469   20.579 1.00 57.73 ? 2   DC  P C2    1 
ATOM   2711 O  O2    . DC  C 2 2   ? -3.576  1.995   21.701 1.00 57.97 ? 2   DC  P O2    1 
ATOM   2712 N  N3    . DC  C 2 2   ? -2.824  3.724   20.432 1.00 57.67 ? 2   DC  P N3    1 
ATOM   2713 C  C4    . DC  C 2 2   ? -2.568  4.205   19.214 1.00 57.22 ? 2   DC  P C4    1 
ATOM   2714 N  N4    . DC  C 2 2   ? -2.067  5.445   19.127 1.00 57.21 ? 2   DC  P N4    1 
ATOM   2715 C  C5    . DC  C 2 2   ? -2.809  3.430   18.036 1.00 57.18 ? 2   DC  P C5    1 
ATOM   2716 C  C6    . DC  C 2 2   ? -3.303  2.195   18.187 1.00 56.61 ? 2   DC  P C6    1 
HETATM 2717 N  N1    . BRU C 2 3   ? -1.765  -5.217  23.521 1.00 30.95 ? 3   BRU P N1    1 
HETATM 2718 C  C2    . BRU C 2 3   ? -0.526  -5.625  24.083 1.00 31.00 ? 3   BRU P C2    1 
HETATM 2719 N  N3    . BRU C 2 3   ? 0.412   -4.712  24.398 1.00 30.50 ? 3   BRU P N3    1 
HETATM 2720 C  C4    . BRU C 2 3   ? 0.237   -3.405  24.182 1.00 31.28 ? 3   BRU P C4    1 
HETATM 2721 C  C5    . BRU C 2 3   ? -1.047  -2.959  23.586 1.00 30.29 ? 3   BRU P C5    1 
HETATM 2722 C  C6    . BRU C 2 3   ? -2.000  -3.916  23.280 1.00 30.83 ? 3   BRU P C6    1 
HETATM 2723 O  O2    . BRU C 2 3   ? -0.298  -6.841  24.310 1.00 29.75 ? 3   BRU P O2    1 
HETATM 2724 O  O4    . BRU C 2 3   ? 1.136   -2.569  24.472 1.00 31.23 ? 3   BRU P O4    1 
HETATM 2725 BR BR    . BRU C 2 3   ? -1.397  -1.085  23.245 1.00 30.40 ? 3   BRU P BR    1 
HETATM 2726 C  "C1'" . BRU C 2 3   ? -2.782  -6.219  23.174 1.00 31.39 ? 3   BRU P "C1'" 1 
HETATM 2727 C  "C2'" . BRU C 2 3   ? -4.084  -6.129  23.961 1.00 31.39 ? 3   BRU P "C2'" 1 
HETATM 2728 C  "C3'" . BRU C 2 3   ? -5.097  -6.718  22.992 1.00 31.57 ? 3   BRU P "C3'" 1 
HETATM 2729 C  "C4'" . BRU C 2 3   ? -4.539  -6.336  21.625 1.00 33.83 ? 3   BRU P "C4'" 1 
HETATM 2730 O  "O3'" . BRU C 2 3   ? -5.127  -8.152  23.142 1.00 30.31 ? 3   BRU P "O3'" 1 
HETATM 2731 O  "O4'" . BRU C 2 3   ? -3.147  -6.079  21.795 1.00 32.10 ? 3   BRU P "O4'" 1 
HETATM 2732 C  "C5'" . BRU C 2 3   ? -5.176  -5.087  21.039 1.00 36.92 ? 3   BRU P "C5'" 1 
HETATM 2733 O  "O5'" . BRU C 2 3   ? -5.209  -4.087  22.044 1.00 42.40 ? 3   BRU P "O5'" 1 
HETATM 2734 P  P     . BRU C 2 3   ? -6.112  -2.766  21.918 1.00 47.74 ? 3   BRU P P     1 
HETATM 2735 O  OP1   . BRU C 2 3   ? -7.497  -3.220  21.561 1.00 48.21 ? 3   BRU P OP1   1 
HETATM 2736 O  OP2   . BRU C 2 3   ? -5.888  -1.951  23.167 1.00 47.64 ? 3   BRU P OP2   1 
ATOM   2737 P  P     . DU  C 2 4   ? -6.420  -9.108  23.130 1.00 30.53 ? 4   DU  P P     1 
ATOM   2738 O  OP1   . DU  C 2 4   ? -7.633  -8.254  23.184 1.00 27.88 ? 4   DU  P OP1   1 
ATOM   2739 O  OP2   . DU  C 2 4   ? -6.234  -10.210 24.111 1.00 29.45 ? 4   DU  P OP2   1 
ATOM   2740 O  "O5'" . DU  C 2 4   ? -6.286  -9.837  21.716 1.00 29.41 ? 4   DU  P "O5'" 1 
ATOM   2741 C  "C5'" . DU  C 2 4   ? -6.755  -9.255  20.502 1.00 30.48 ? 4   DU  P "C5'" 1 
ATOM   2742 C  "C4'" . DU  C 2 4   ? -6.159  -10.017 19.327 1.00 29.91 ? 4   DU  P "C4'" 1 
ATOM   2743 O  "O4'" . DU  C 2 4   ? -4.728  -9.826  19.377 1.00 29.42 ? 4   DU  P "O4'" 1 
ATOM   2744 C  "C3'" . DU  C 2 4   ? -6.401  -11.524 19.378 1.00 30.12 ? 4   DU  P "C3'" 1 
ATOM   2745 O  "O3'" . DU  C 2 4   ? -6.762  -12.054 18.118 1.00 30.93 ? 4   DU  P "O3'" 1 
ATOM   2746 C  "C2'" . DU  C 2 4   ? -5.064  -12.102 19.838 1.00 29.55 ? 4   DU  P "C2'" 1 
ATOM   2747 C  "C1'" . DU  C 2 4   ? -4.075  -11.069 19.300 1.00 29.44 ? 4   DU  P "C1'" 1 
ATOM   2748 N  N1    . DU  C 2 4   ? -2.785  -11.047 20.075 1.00 28.73 ? 4   DU  P N1    1 
ATOM   2749 C  C2    . DU  C 2 4   ? -1.625  -11.506 19.490 1.00 28.79 ? 4   DU  P C2    1 
ATOM   2750 O  O2    . DU  C 2 4   ? -1.545  -11.918 18.344 1.00 28.51 ? 4   DU  P O2    1 
ATOM   2751 N  N3    . DU  C 2 4   ? -0.515  -11.458 20.290 1.00 30.20 ? 4   DU  P N3    1 
ATOM   2752 C  C4    . DU  C 2 4   ? -0.447  -11.020 21.601 1.00 30.71 ? 4   DU  P C4    1 
ATOM   2753 O  O4    . DU  C 2 4   ? 0.639   -11.049 22.183 1.00 29.46 ? 4   DU  P O4    1 
ATOM   2754 C  C5    . DU  C 2 4   ? -1.700  -10.558 22.160 1.00 30.06 ? 4   DU  P C5    1 
ATOM   2755 C  C6    . DU  C 2 4   ? -2.794  -10.599 21.382 1.00 29.72 ? 4   DU  P C6    1 
ATOM   2756 P  P     . DU  C 2 5   ? -8.271  -12.072 17.588 1.00 30.94 ? 5   DU  P P     1 
ATOM   2757 O  OP1   . DU  C 2 5   ? -8.191  -12.637 16.216 1.00 31.66 ? 5   DU  P OP1   1 
ATOM   2758 O  OP2   . DU  C 2 5   ? -8.892  -10.756 17.815 1.00 29.60 ? 5   DU  P OP2   1 
ATOM   2759 O  "O5'" . DU  C 2 5   ? -8.953  -13.134 18.564 1.00 32.18 ? 5   DU  P "O5'" 1 
ATOM   2760 C  "C5'" . DU  C 2 5   ? -8.455  -14.470 18.640 1.00 31.31 ? 5   DU  P "C5'" 1 
ATOM   2761 C  "C4'" . DU  C 2 5   ? -9.607  -15.453 18.743 1.00 32.07 ? 5   DU  P "C4'" 1 
ATOM   2762 O  "O4'" . DU  C 2 5   ? -10.246 -15.376 20.058 1.00 31.34 ? 5   DU  P "O4'" 1 
ATOM   2763 C  "C3'" . DU  C 2 5   ? -10.711 -15.235 17.721 1.00 32.10 ? 5   DU  P "C3'" 1 
ATOM   2764 O  "O3'" . DU  C 2 5   ? -11.243 -16.500 17.310 1.00 35.06 ? 5   DU  P "O3'" 1 
ATOM   2765 C  "C2'" . DU  C 2 5   ? -11.725 -14.398 18.496 1.00 32.04 ? 5   DU  P "C2'" 1 
ATOM   2766 C  "C1'" . DU  C 2 5   ? -11.603 -15.021 19.894 1.00 30.86 ? 5   DU  P "C1'" 1 
ATOM   2767 N  N1    . DU  C 2 5   ? -12.042 -14.112 20.986 1.00 30.57 ? 5   DU  P N1    1 
ATOM   2768 C  C2    . DU  C 2 5   ? -13.127 -14.450 21.783 1.00 30.65 ? 5   DU  P C2    1 
ATOM   2769 O  O2    . DU  C 2 5   ? -13.776 -15.485 21.666 1.00 30.06 ? 5   DU  P O2    1 
ATOM   2770 N  N3    . DU  C 2 5   ? -13.441 -13.514 22.739 1.00 29.98 ? 5   DU  P N3    1 
ATOM   2771 C  C4    . DU  C 2 5   ? -12.796 -12.305 22.980 1.00 31.01 ? 5   DU  P C4    1 
ATOM   2772 O  O4    . DU  C 2 5   ? -13.196 -11.574 23.877 1.00 29.42 ? 5   DU  P O4    1 
ATOM   2773 C  C5    . DU  C 2 5   ? -11.681 -12.017 22.112 1.00 30.43 ? 5   DU  P C5    1 
ATOM   2774 C  C6    . DU  C 2 5   ? -11.358 -12.918 21.176 1.00 31.49 ? 5   DU  P C6    1 
ATOM   2775 P  P     . DU  C 2 6   ? -11.212 -17.010 15.773 1.00 36.55 ? 6   DU  P P     1 
ATOM   2776 O  OP1   . DU  C 2 6   ? -9.963  -16.548 15.121 1.00 36.37 ? 6   DU  P OP1   1 
ATOM   2777 O  OP2   . DU  C 2 6   ? -12.521 -16.662 15.199 1.00 36.29 ? 6   DU  P OP2   1 
ATOM   2778 O  "O5'" . DU  C 2 6   ? -11.144 -18.582 15.982 1.00 35.63 ? 6   DU  P "O5'" 1 
ATOM   2779 C  "C5'" . DU  C 2 6   ? -9.960  -19.174 16.487 1.00 38.56 ? 6   DU  P "C5'" 1 
ATOM   2780 C  "C4'" . DU  C 2 6   ? -10.279 -20.290 17.465 1.00 40.11 ? 6   DU  P "C4'" 1 
ATOM   2781 O  "O4'" . DU  C 2 6   ? -10.899 -19.728 18.641 1.00 38.59 ? 6   DU  P "O4'" 1 
ATOM   2782 C  "C3'" . DU  C 2 6   ? -11.269 -21.331 16.961 1.00 41.70 ? 6   DU  P "C3'" 1 
ATOM   2783 O  "O3'" . DU  C 2 6   ? -10.573 -22.333 16.243 1.00 46.75 ? 6   DU  P "O3'" 1 
ATOM   2784 C  "C2'" . DU  C 2 6   ? -11.892 -21.861 18.245 1.00 39.98 ? 6   DU  P "C2'" 1 
ATOM   2785 C  "C1'" . DU  C 2 6   ? -11.900 -20.614 19.124 1.00 37.99 ? 6   DU  P "C1'" 1 
ATOM   2786 N  N1    . DU  C 2 6   ? -13.221 -19.862 19.262 1.00 35.78 ? 6   DU  P N1    1 
ATOM   2787 C  C2    . DU  C 2 6   ? -14.215 -20.419 20.048 1.00 34.72 ? 6   DU  P C2    1 
ATOM   2788 O  O2    . DU  C 2 6   ? -14.109 -21.490 20.619 1.00 35.29 ? 6   DU  P O2    1 
ATOM   2789 N  N3    . DU  C 2 6   ? -15.361 -19.674 20.170 1.00 33.62 ? 6   DU  P N3    1 
ATOM   2790 C  C4    . DU  C 2 6   ? -15.601 -18.451 19.589 1.00 34.95 ? 6   DU  P C4    1 
ATOM   2791 O  O4    . DU  C 2 6   ? -16.676 -17.915 19.798 1.00 35.97 ? 6   DU  P O4    1 
ATOM   2792 C  C5    . DU  C 2 6   ? -14.530 -17.914 18.787 1.00 35.40 ? 6   DU  P C5    1 
ATOM   2793 C  C6    . DU  C 2 6   ? -13.402 -18.629 18.654 1.00 35.47 ? 6   DU  P C6    1 
ATOM   2794 P  P     . DU  C 2 7   ? -11.317 -23.607 15.602 1.00 51.44 ? 7   DU  P P     1 
ATOM   2795 O  OP1   . DU  C 2 7   ? -10.345 -24.246 14.679 1.00 50.98 ? 7   DU  P OP1   1 
ATOM   2796 O  OP2   . DU  C 2 7   ? -12.643 -23.164 15.124 1.00 50.37 ? 7   DU  P OP2   1 
ATOM   2797 O  "O5'" . DU  C 2 7   ? -11.552 -24.579 16.852 1.00 53.18 ? 7   DU  P "O5'" 1 
ATOM   2798 C  "C5'" . DU  C 2 7   ? -10.475 -25.275 17.467 1.00 55.31 ? 7   DU  P "C5'" 1 
ATOM   2799 C  "C4'" . DU  C 2 7   ? -11.012 -26.532 18.124 1.00 56.97 ? 7   DU  P "C4'" 1 
ATOM   2800 O  "O4'" . DU  C 2 7   ? -12.003 -26.153 19.116 1.00 57.65 ? 7   DU  P "O4'" 1 
ATOM   2801 C  "C3'" . DU  C 2 7   ? -11.713 -27.495 17.164 1.00 57.54 ? 7   DU  P "C3'" 1 
ATOM   2802 O  "O3'" . DU  C 2 7   ? -11.263 -28.838 17.369 1.00 58.31 ? 7   DU  P "O3'" 1 
ATOM   2803 C  "C2'" . DU  C 2 7   ? -13.201 -27.309 17.472 1.00 57.75 ? 7   DU  P "C2'" 1 
ATOM   2804 C  "C1'" . DU  C 2 7   ? -13.156 -26.951 18.952 1.00 57.61 ? 7   DU  P "C1'" 1 
ATOM   2805 N  N1    . DU  C 2 7   ? -14.326 -26.162 19.457 1.00 57.81 ? 7   DU  P N1    1 
ATOM   2806 C  C2    . DU  C 2 7   ? -15.089 -26.645 20.509 1.00 57.68 ? 7   DU  P C2    1 
ATOM   2807 O  O2    . DU  C 2 7   ? -14.883 -27.709 21.074 1.00 57.51 ? 7   DU  P O2    1 
ATOM   2808 N  N3    . DU  C 2 7   ? -16.133 -25.830 20.883 1.00 57.28 ? 7   DU  P N3    1 
ATOM   2809 C  C4    . DU  C 2 7   ? -16.481 -24.608 20.337 1.00 57.51 ? 7   DU  P C4    1 
ATOM   2810 O  O4    . DU  C 2 7   ? -17.447 -24.001 20.795 1.00 57.62 ? 7   DU  P O4    1 
ATOM   2811 C  C5    . DU  C 2 7   ? -15.644 -24.164 19.248 1.00 57.33 ? 7   DU  P C5    1 
ATOM   2812 C  C6    . DU  C 2 7   ? -14.622 -24.944 18.862 1.00 57.78 ? 7   DU  P C6    1 
ATOM   2813 O  "O5'" . DU  D 2 1   ? 37.897  -9.034  33.025 1.00 50.94 ? 2   DU  E "O5'" 1 
ATOM   2814 C  "C5'" . DU  D 2 1   ? 38.862  -9.465  32.050 1.00 49.60 ? 2   DU  E "C5'" 1 
ATOM   2815 C  "C4'" . DU  D 2 1   ? 39.622  -10.707 32.497 1.00 48.54 ? 2   DU  E "C4'" 1 
ATOM   2816 O  "O4'" . DU  D 2 1   ? 41.009  -10.352 32.720 1.00 48.25 ? 2   DU  E "O4'" 1 
ATOM   2817 C  "C3'" . DU  D 2 1   ? 39.199  -11.362 33.809 1.00 47.06 ? 2   DU  E "C3'" 1 
ATOM   2818 O  "O3'" . DU  D 2 1   ? 39.574  -12.724 33.798 1.00 45.45 ? 2   DU  E "O3'" 1 
ATOM   2819 C  "C2'" . DU  D 2 1   ? 39.997  -10.583 34.858 1.00 47.49 ? 2   DU  E "C2'" 1 
ATOM   2820 C  "C1'" . DU  D 2 1   ? 41.316  -10.422 34.106 1.00 48.25 ? 2   DU  E "C1'" 1 
ATOM   2821 N  N1    . DU  D 2 1   ? 42.120  -9.192  34.361 1.00 48.18 ? 2   DU  E N1    1 
ATOM   2822 C  C2    . DU  D 2 1   ? 43.460  -9.316  34.659 1.00 48.22 ? 2   DU  E C2    1 
ATOM   2823 O  O2    . DU  D 2 1   ? 44.038  -10.384 34.776 1.00 47.67 ? 2   DU  E O2    1 
ATOM   2824 N  N3    . DU  D 2 1   ? 44.109  -8.120  34.843 1.00 49.20 ? 2   DU  E N3    1 
ATOM   2825 C  C4    . DU  D 2 1   ? 43.577  -6.847  34.745 1.00 48.36 ? 2   DU  E C4    1 
ATOM   2826 O  O4    . DU  D 2 1   ? 44.307  -5.884  34.933 1.00 48.65 ? 2   DU  E O4    1 
ATOM   2827 C  C5    . DU  D 2 1   ? 42.179  -6.792  34.417 1.00 48.19 ? 2   DU  E C5    1 
ATOM   2828 C  C6    . DU  D 2 1   ? 41.522  -7.947  34.234 1.00 48.64 ? 2   DU  E C6    1 
ATOM   2829 P  P     . DC  D 2 2   ? 38.526  -13.917 33.548 1.00 41.89 ? 3   DC  E P     1 
ATOM   2830 O  OP1   . DC  D 2 2   ? 37.496  -13.452 32.600 1.00 41.17 ? 3   DC  E OP1   1 
ATOM   2831 O  OP2   . DC  D 2 2   ? 38.169  -14.451 34.877 1.00 41.36 ? 3   DC  E OP2   1 
ATOM   2832 O  "O5'" . DC  D 2 2   ? 39.451  -15.001 32.826 1.00 38.90 ? 3   DC  E "O5'" 1 
ATOM   2833 C  "C5'" . DC  D 2 2   ? 39.598  -15.031 31.405 1.00 35.42 ? 3   DC  E "C5'" 1 
ATOM   2834 C  "C4'" . DC  D 2 2   ? 39.675  -16.472 30.926 1.00 33.53 ? 3   DC  E "C4'" 1 
ATOM   2835 O  "O4'" . DC  D 2 2   ? 40.991  -17.005 31.216 1.00 32.82 ? 3   DC  E "O4'" 1 
ATOM   2836 C  "C3'" . DC  D 2 2   ? 38.672  -17.407 31.591 1.00 32.41 ? 3   DC  E "C3'" 1 
ATOM   2837 O  "O3'" . DC  D 2 2   ? 38.095  -18.290 30.624 1.00 31.15 ? 3   DC  E "O3'" 1 
ATOM   2838 C  "C2'" . DC  D 2 2   ? 39.504  -18.144 32.643 1.00 32.44 ? 3   DC  E "C2'" 1 
ATOM   2839 C  "C1'" . DC  D 2 2   ? 40.853  -18.217 31.936 1.00 33.49 ? 3   DC  E "C1'" 1 
ATOM   2840 N  N1    . DC  D 2 2   ? 42.045  -18.374 32.822 1.00 33.04 ? 3   DC  E N1    1 
ATOM   2841 C  C2    . DC  D 2 2   ? 42.867  -19.499 32.682 1.00 33.44 ? 3   DC  E C2    1 
ATOM   2842 O  O2    . DC  D 2 2   ? 42.575  -20.332 31.819 1.00 34.36 ? 3   DC  E O2    1 
ATOM   2843 N  N3    . DC  D 2 2   ? 43.956  -19.633 33.488 1.00 33.00 ? 3   DC  E N3    1 
ATOM   2844 C  C4    . DC  D 2 2   ? 44.232  -18.692 34.405 1.00 33.72 ? 3   DC  E C4    1 
ATOM   2845 N  N4    . DC  D 2 2   ? 45.308  -18.848 35.184 1.00 33.62 ? 3   DC  E N4    1 
ATOM   2846 C  C5    . DC  D 2 2   ? 43.404  -17.547 34.577 1.00 33.05 ? 3   DC  E C5    1 
ATOM   2847 C  C6    . DC  D 2 2   ? 42.337  -17.427 33.771 1.00 33.85 ? 3   DC  E C6    1 
HETATM 2848 N  N1    . BRU D 2 3   ? 39.851  -18.860 26.135 1.00 23.09 ? 4   BRU E N1    1 
HETATM 2849 C  C2    . BRU D 2 3   ? 40.918  -19.203 25.273 1.00 22.70 ? 4   BRU E C2    1 
HETATM 2850 N  N3    . BRU D 2 3   ? 41.798  -20.143 25.629 1.00 21.61 ? 4   BRU E N3    1 
HETATM 2851 C  C4    . BRU D 2 3   ? 41.694  -20.790 26.805 1.00 23.44 ? 4   BRU E C4    1 
HETATM 2852 C  C5    . BRU D 2 3   ? 40.593  -20.460 27.730 1.00 22.36 ? 4   BRU E C5    1 
HETATM 2853 C  C6    . BRU D 2 3   ? 39.705  -19.479 27.326 1.00 23.31 ? 4   BRU E C6    1 
HETATM 2854 O  O2    . BRU D 2 3   ? 41.039  -18.616 24.165 1.00 23.87 ? 4   BRU E O2    1 
HETATM 2855 O  O4    . BRU D 2 3   ? 42.518  -21.678 27.138 1.00 24.03 ? 4   BRU E O4    1 
HETATM 2856 BR BR    . BRU D 2 3   ? 40.389  -21.375 29.434 1.00 21.56 ? 4   BRU E BR    1 
HETATM 2857 C  "C1'" . BRU D 2 3   ? 38.887  -17.832 25.739 1.00 23.76 ? 4   BRU E "C1'" 1 
HETATM 2858 C  "C2'" . BRU D 2 3   ? 37.473  -18.392 25.583 1.00 25.05 ? 4   BRU E "C2'" 1 
HETATM 2859 C  "C3'" . BRU D 2 3   ? 36.604  -17.181 25.837 1.00 26.01 ? 4   BRU E "C3'" 1 
HETATM 2860 C  "C4'" . BRU D 2 3   ? 37.416  -16.343 26.810 1.00 26.44 ? 4   BRU E "C4'" 1 
HETATM 2861 O  "O3'" . BRU D 2 3   ? 36.392  -16.488 24.595 1.00 26.20 ? 4   BRU E "O3'" 1 
HETATM 2862 O  "O4'" . BRU D 2 3   ? 38.763  -16.817 26.739 1.00 25.26 ? 4   BRU E "O4'" 1 
HETATM 2863 C  "C5'" . BRU D 2 3   ? 36.911  -16.440 28.243 1.00 28.01 ? 4   BRU E "C5'" 1 
HETATM 2864 O  "O5'" . BRU D 2 3   ? 36.742  -17.809 28.622 1.00 28.93 ? 4   BRU E "O5'" 1 
HETATM 2865 P  P     . BRU D 2 3   ? 36.560  -18.227 30.160 1.00 27.88 ? 4   BRU E P     1 
HETATM 2866 O  OP1   . BRU D 2 3   ? 35.798  -17.161 30.878 1.00 29.61 ? 4   BRU E OP1   1 
HETATM 2867 O  OP2   . BRU D 2 3   ? 36.000  -19.636 30.204 1.00 31.01 ? 4   BRU E OP2   1 
ATOM   2868 P  P     . DU  D 2 4   ? 35.162  -15.472 24.388 1.00 28.30 ? 5   DU  E P     1 
ATOM   2869 O  OP1   . DU  D 2 4   ? 35.312  -14.935 23.020 1.00 26.81 ? 5   DU  E OP1   1 
ATOM   2870 O  OP2   . DU  D 2 4   ? 35.056  -14.557 25.538 1.00 26.11 ? 5   DU  E OP2   1 
ATOM   2871 O  "O5'" . DU  D 2 4   ? 33.905  -16.475 24.486 1.00 28.63 ? 5   DU  E "O5'" 1 
ATOM   2872 C  "C5'" . DU  D 2 4   ? 33.621  -17.392 23.429 1.00 30.08 ? 5   DU  E "C5'" 1 
ATOM   2873 C  "C4'" . DU  D 2 4   ? 32.142  -17.389 23.088 1.00 30.81 ? 5   DU  E "C4'" 1 
ATOM   2874 O  "O4'" . DU  D 2 4   ? 31.406  -17.856 24.242 1.00 29.61 ? 5   DU  E "O4'" 1 
ATOM   2875 C  "C3'" . DU  D 2 4   ? 31.555  -16.022 22.739 1.00 32.37 ? 5   DU  E "C3'" 1 
ATOM   2876 O  "O3'" . DU  D 2 4   ? 30.656  -16.125 21.638 1.00 35.84 ? 5   DU  E "O3'" 1 
ATOM   2877 C  "C2'" . DU  D 2 4   ? 30.855  -15.588 24.030 1.00 30.35 ? 5   DU  E "C2'" 1 
ATOM   2878 C  "C1'" . DU  D 2 4   ? 30.401  -16.934 24.580 1.00 28.81 ? 5   DU  E "C1'" 1 
ATOM   2879 N  N1    . DU  D 2 4   ? 30.201  -16.958 26.084 1.00 28.70 ? 5   DU  E N1    1 
ATOM   2880 C  C2    . DU  D 2 4   ? 28.919  -17.063 26.588 1.00 27.07 ? 5   DU  E C2    1 
ATOM   2881 O  O2    . DU  D 2 4   ? 27.946  -17.125 25.866 1.00 29.63 ? 5   DU  E O2    1 
ATOM   2882 N  N3    . DU  D 2 4   ? 28.801  -17.065 27.951 1.00 25.16 ? 5   DU  E N3    1 
ATOM   2883 C  C4    . DU  D 2 4   ? 29.851  -16.981 28.850 1.00 27.20 ? 5   DU  E C4    1 
ATOM   2884 O  O4    . DU  D 2 4   ? 29.620  -16.995 30.053 1.00 28.73 ? 5   DU  E O4    1 
ATOM   2885 C  C5    . DU  D 2 4   ? 31.169  -16.872 28.271 1.00 27.45 ? 5   DU  E C5    1 
ATOM   2886 C  C6    . DU  D 2 4   ? 31.290  -16.866 26.937 1.00 27.63 ? 5   DU  E C6    1 
ATOM   2887 P  P     . DU  D 2 5   ? 31.006  -15.618 20.150 1.00 39.76 ? 6   DU  E P     1 
ATOM   2888 O  OP1   . DU  D 2 5   ? 32.469  -15.630 19.914 1.00 40.54 ? 6   DU  E OP1   1 
ATOM   2889 O  OP2   . DU  D 2 5   ? 30.218  -14.384 19.959 1.00 39.28 ? 6   DU  E OP2   1 
ATOM   2890 O  "O5'" . DU  D 2 5   ? 30.361  -16.754 19.237 1.00 41.29 ? 6   DU  E "O5'" 1 
ATOM   2891 C  "C5'" . DU  D 2 5   ? 30.902  -18.059 19.219 1.00 44.72 ? 6   DU  E "C5'" 1 
ATOM   2892 C  "C4'" . DU  D 2 5   ? 29.811  -19.101 19.017 1.00 46.69 ? 6   DU  E "C4'" 1 
ATOM   2893 O  "O4'" . DU  D 2 5   ? 29.031  -19.244 20.227 1.00 45.32 ? 6   DU  E "O4'" 1 
ATOM   2894 C  "C3'" . DU  D 2 5   ? 28.841  -18.773 17.883 1.00 49.24 ? 6   DU  E "C3'" 1 
ATOM   2895 O  "O3'" . DU  D 2 5   ? 28.948  -19.746 16.857 1.00 54.65 ? 6   DU  E "O3'" 1 
ATOM   2896 C  "C2'" . DU  D 2 5   ? 27.448  -18.770 18.505 1.00 48.07 ? 6   DU  E "C2'" 1 
ATOM   2897 C  "C1'" . DU  D 2 5   ? 27.646  -19.262 19.932 1.00 46.02 ? 6   DU  E "C1'" 1 
ATOM   2898 N  N1    . DU  D 2 5   ? 26.904  -18.411 20.923 1.00 45.34 ? 6   DU  E N1    1 
ATOM   2899 C  C2    . DU  D 2 5   ? 25.705  -18.858 21.440 1.00 44.48 ? 6   DU  E C2    1 
ATOM   2900 O  O2    . DU  D 2 5   ? 25.200  -19.918 21.154 1.00 43.95 ? 6   DU  E O2    1 
ATOM   2901 N  N3    . DU  D 2 5   ? 25.103  -18.022 22.338 1.00 44.16 ? 6   DU  E N3    1 
ATOM   2902 C  C4    . DU  D 2 5   ? 25.560  -16.792 22.753 1.00 44.38 ? 6   DU  E C4    1 
ATOM   2903 O  O4    . DU  D 2 5   ? 24.893  -16.161 23.568 1.00 45.60 ? 6   DU  E O4    1 
ATOM   2904 C  C5    . DU  D 2 5   ? 26.811  -16.375 22.180 1.00 44.31 ? 6   DU  E C5    1 
ATOM   2905 C  C6    . DU  D 2 5   ? 27.418  -17.183 21.299 1.00 44.59 ? 6   DU  E C6    1 
ATOM   2906 P  P     . DU  D 2 6   ? 28.474  -19.440 15.352 1.00 60.16 ? 7   DU  E P     1 
ATOM   2907 O  OP1   . DU  D 2 6   ? 29.690  -19.325 14.511 1.00 59.43 ? 7   DU  E OP1   1 
ATOM   2908 O  OP2   . DU  D 2 6   ? 27.481  -18.332 15.382 1.00 59.07 ? 7   DU  E OP2   1 
ATOM   2909 O  "O5'" . DU  D 2 6   ? 27.720  -20.815 14.981 1.00 62.16 ? 7   DU  E "O5'" 1 
ATOM   2910 C  "C5'" . DU  D 2 6   ? 26.291  -20.841 14.968 1.00 65.34 ? 7   DU  E "C5'" 1 
ATOM   2911 C  "C4'" . DU  D 2 6   ? 25.713  -22.253 14.915 1.00 67.16 ? 7   DU  E "C4'" 1 
ATOM   2912 O  "O4'" . DU  D 2 6   ? 25.224  -22.619 16.237 1.00 67.93 ? 7   DU  E "O4'" 1 
ATOM   2913 C  "C3'" . DU  D 2 6   ? 24.547  -22.425 13.933 1.00 68.07 ? 7   DU  E "C3'" 1 
ATOM   2914 O  "O3'" . DU  D 2 6   ? 24.800  -23.494 13.012 1.00 68.78 ? 7   DU  E "O3'" 1 
ATOM   2915 C  "C2'" . DU  D 2 6   ? 23.311  -22.693 14.795 1.00 68.62 ? 7   DU  E "C2'" 1 
ATOM   2916 C  "C1'" . DU  D 2 6   ? 23.828  -22.859 16.227 1.00 68.71 ? 7   DU  E "C1'" 1 
ATOM   2917 N  N1    . DU  D 2 6   ? 23.137  -21.946 17.217 1.00 68.93 ? 7   DU  E N1    1 
ATOM   2918 C  C2    . DU  D 2 6   ? 21.960  -22.371 17.818 1.00 69.54 ? 7   DU  E C2    1 
ATOM   2919 O  O2    . DU  D 2 6   ? 21.445  -23.459 17.600 1.00 69.67 ? 7   DU  E O2    1 
ATOM   2920 N  N3    . DU  D 2 6   ? 21.395  -21.475 18.704 1.00 69.53 ? 7   DU  E N3    1 
ATOM   2921 C  C4    . DU  D 2 6   ? 21.875  -20.218 19.045 1.00 69.25 ? 7   DU  E C4    1 
ATOM   2922 O  O4    . DU  D 2 6   ? 21.266  -19.526 19.861 1.00 69.06 ? 7   DU  E O4    1 
ATOM   2923 C  C5    . DU  D 2 6   ? 23.101  -19.846 18.379 1.00 69.16 ? 7   DU  E C5    1 
ATOM   2924 C  C6    . DU  D 2 6   ? 23.669  -20.697 17.508 1.00 69.05 ? 7   DU  E C6    1 
HETATM 2925 C  C1    . DIO E 3 .   ? -40.972 12.762  18.139 1.00 58.34 ? 401 DIO A C1    1 
HETATM 2926 C  C2    . DIO E 3 .   ? -41.198 14.883  19.164 1.00 58.46 ? 401 DIO A C2    1 
HETATM 2927 C  "C1'" . DIO E 3 .   ? -40.186 13.400  16.997 1.00 58.71 ? 401 DIO A "C1'" 1 
HETATM 2928 C  "C2'" . DIO E 3 .   ? -40.485 15.534  17.984 1.00 58.53 ? 401 DIO A "C2'" 1 
HETATM 2929 O  O1    . DIO E 3 .   ? -41.876 13.715  18.701 1.00 57.89 ? 401 DIO A O1    1 
HETATM 2930 O  "O1'" . DIO E 3 .   ? -39.551 14.602  17.442 1.00 58.39 ? 401 DIO A "O1'" 1 
HETATM 2931 C  C1    . DIO F 3 .   ? -27.790 -18.074 27.590 1.00 60.27 ? 402 DIO A C1    1 
HETATM 2932 C  C2    . DIO F 3 .   ? -26.188 -18.917 26.055 1.00 60.21 ? 402 DIO A C2    1 
HETATM 2933 C  "C1'" . DIO F 3 .   ? -27.034 -18.927 28.604 1.00 60.50 ? 402 DIO A "C1'" 1 
HETATM 2934 C  "C2'" . DIO F 3 .   ? -25.836 -20.122 26.919 1.00 60.36 ? 402 DIO A "C2'" 1 
HETATM 2935 O  O1    . DIO F 3 .   ? -27.548 -18.533 26.260 1.00 60.10 ? 402 DIO A O1    1 
HETATM 2936 O  "O1'" . DIO F 3 .   ? -26.709 -20.207 28.049 1.00 60.91 ? 402 DIO A "O1'" 1 
HETATM 2937 C  C1    . DIO G 3 .   ? -22.106 -28.214 40.807 1.00 66.15 ? 403 DIO A C1    1 
HETATM 2938 C  C2    . DIO G 3 .   ? -20.472 -28.424 39.102 1.00 65.34 ? 403 DIO A C2    1 
HETATM 2939 C  "C1'" . DIO G 3 .   ? -22.580 -29.642 40.548 1.00 66.10 ? 403 DIO A "C1'" 1 
HETATM 2940 C  "C2'" . DIO G 3 .   ? -20.889 -29.878 38.890 1.00 65.67 ? 403 DIO A "C2'" 1 
HETATM 2941 O  O1    . DIO G 3 .   ? -21.553 -27.648 39.616 1.00 65.81 ? 403 DIO A O1    1 
HETATM 2942 O  "O1'" . DIO G 3 .   ? -21.482 -30.425 40.071 1.00 65.96 ? 403 DIO A "O1'" 1 
HETATM 2943 S  S     . SO4 H 4 .   ? -12.481 -5.534  25.374 1.00 57.24 ? 404 SO4 A S     1 
HETATM 2944 O  O1    . SO4 H 4 .   ? -11.899 -5.163  26.658 1.00 57.11 ? 404 SO4 A O1    1 
HETATM 2945 O  O2    . SO4 H 4 .   ? -11.416 -5.757  24.400 1.00 56.20 ? 404 SO4 A O2    1 
HETATM 2946 O  O3    . SO4 H 4 .   ? -13.317 -6.726  25.492 1.00 56.27 ? 404 SO4 A O3    1 
HETATM 2947 O  O4    . SO4 H 4 .   ? -13.324 -4.425  24.934 1.00 58.02 ? 404 SO4 A O4    1 
HETATM 2948 S  S     . SO4 I 4 .   ? -7.512  -22.740 19.834 1.00 90.14 ? 405 SO4 A S     1 
HETATM 2949 O  O1    . SO4 I 4 .   ? -8.952  -22.567 19.633 1.00 89.89 ? 405 SO4 A O1    1 
HETATM 2950 O  O2    . SO4 I 4 .   ? -7.169  -24.144 19.617 1.00 89.49 ? 405 SO4 A O2    1 
HETATM 2951 O  O3    . SO4 I 4 .   ? -7.165  -22.333 21.197 1.00 89.48 ? 405 SO4 A O3    1 
HETATM 2952 O  O4    . SO4 I 4 .   ? -6.760  -21.924 18.879 1.00 89.79 ? 405 SO4 A O4    1 
HETATM 2953 S  S     . SO4 J 4 .   ? -17.244 -27.437 24.907 1.00 71.69 ? 406 SO4 A S     1 
HETATM 2954 O  O1    . SO4 J 4 .   ? -17.277 -28.867 25.224 1.00 72.22 ? 406 SO4 A O1    1 
HETATM 2955 O  O2    . SO4 J 4 .   ? -18.126 -26.729 25.832 1.00 71.39 ? 406 SO4 A O2    1 
HETATM 2956 O  O3    . SO4 J 4 .   ? -17.695 -27.229 23.531 1.00 71.20 ? 406 SO4 A O3    1 
HETATM 2957 O  O4    . SO4 J 4 .   ? -15.873 -26.949 25.051 1.00 71.40 ? 406 SO4 A O4    1 
HETATM 2958 S  S     . SO4 K 4 .   ? -22.113 -12.402 31.288 1.00 88.71 ? 407 SO4 A S     1 
HETATM 2959 O  O1    . SO4 K 4 .   ? -21.246 -12.238 30.121 1.00 88.23 ? 407 SO4 A O1    1 
HETATM 2960 O  O2    . SO4 K 4 .   ? -23.119 -13.429 31.009 1.00 88.98 ? 407 SO4 A O2    1 
HETATM 2961 O  O3    . SO4 K 4 .   ? -21.322 -12.770 32.466 1.00 88.30 ? 407 SO4 A O3    1 
HETATM 2962 O  O4    . SO4 K 4 .   ? -22.796 -11.140 31.557 1.00 89.04 ? 407 SO4 A O4    1 
HETATM 2963 C  C1    . GOL L 5 .   ? -1.922  -22.503 15.902 1.00 75.37 ? 408 GOL A C1    1 
HETATM 2964 O  O1    . GOL L 5 .   ? -3.213  -22.642 16.456 1.00 75.47 ? 408 GOL A O1    1 
HETATM 2965 C  C2    . GOL L 5 .   ? -0.892  -22.343 17.016 1.00 75.33 ? 408 GOL A C2    1 
HETATM 2966 O  O2    . GOL L 5 .   ? 0.091   -21.420 16.616 1.00 75.17 ? 408 GOL A O2    1 
HETATM 2967 C  C3    . GOL L 5 .   ? -0.234  -23.673 17.373 1.00 75.54 ? 408 GOL A C3    1 
HETATM 2968 O  O3    . GOL L 5 .   ? -0.002  -23.724 18.763 1.00 75.55 ? 408 GOL A O3    1 
HETATM 2969 C  C1    . DIO M 3 .   ? 9.126   -13.240 10.218 1.00 73.68 ? 401 DIO B C1    1 
HETATM 2970 C  C2    . DIO M 3 .   ? 11.300  -14.133 10.046 1.00 73.89 ? 401 DIO B C2    1 
HETATM 2971 C  "C1'" . DIO M 3 .   ? 8.702   -14.427 11.076 1.00 73.57 ? 401 DIO B "C1'" 1 
HETATM 2972 C  "C2'" . DIO M 3 .   ? 10.897  -15.285 10.967 1.00 74.05 ? 401 DIO B "C2'" 1 
HETATM 2973 O  O1    . DIO M 3 .   ? 10.164  -13.647 9.331  1.00 74.04 ? 401 DIO B O1    1 
HETATM 2974 O  "O1'" . DIO M 3 .   ? 9.824   -14.886 11.824 1.00 73.73 ? 401 DIO B "O1'" 1 
HETATM 2975 C  C1    . DIO N 3 .   ? 15.938  -44.961 30.393 1.00 64.84 ? 402 DIO B C1    1 
HETATM 2976 C  C2    . DIO N 3 .   ? 17.941  -43.627 30.509 1.00 65.02 ? 402 DIO B C2    1 
HETATM 2977 C  "C1'" . DIO N 3 .   ? 16.906  -45.981 29.799 1.00 65.46 ? 402 DIO B "C1'" 1 
HETATM 2978 C  "C2'" . DIO N 3 .   ? 18.031  -43.993 29.030 1.00 65.33 ? 402 DIO B "C2'" 1 
HETATM 2979 O  O1    . DIO N 3 .   ? 16.635  -43.887 31.026 1.00 64.50 ? 402 DIO B O1    1 
HETATM 2980 O  "O1'" . DIO N 3 .   ? 17.770  -45.383 28.825 1.00 65.75 ? 402 DIO B "O1'" 1 
HETATM 2981 C  C1    . DIO O 3 .   ? -4.556  -7.885  5.785  1.00 62.86 ? 403 DIO B C1    1 
HETATM 2982 C  C2    . DIO O 3 .   ? -5.349  -6.158  4.370  1.00 62.54 ? 403 DIO B C2    1 
HETATM 2983 C  "C1'" . DIO O 3 .   ? -4.152  -8.782  4.616  1.00 63.13 ? 403 DIO B "C1'" 1 
HETATM 2984 C  "C2'" . DIO O 3 .   ? -4.717  -6.931  3.214  1.00 63.10 ? 403 DIO B "C2'" 1 
HETATM 2985 O  O1    . DIO O 3 .   ? -5.663  -7.053  5.432  1.00 62.14 ? 403 DIO B O1    1 
HETATM 2986 O  "O1'" . DIO O 3 .   ? -4.811  -8.348  3.424  1.00 63.40 ? 403 DIO B "O1'" 1 
HETATM 2987 C  C1    . CPQ P 6 .   ? 6.778   0.105   0.857  1.00 44.73 ? 404 CPQ B C1    1 
HETATM 2988 C  C2    . CPQ P 6 .   ? 5.586   0.249   1.808  1.00 43.98 ? 404 CPQ B C2    1 
HETATM 2989 C  C3    . CPQ P 6 .   ? 4.629   2.271   0.492  1.00 43.73 ? 404 CPQ B C3    1 
HETATM 2990 C  C4    . CPQ P 6 .   ? 4.079   3.707   0.561  1.00 43.90 ? 404 CPQ B C4    1 
HETATM 2991 C  C5    . CPQ P 6 .   ? 2.965   3.842   1.591  1.00 44.28 ? 404 CPQ B C5    1 
HETATM 2992 C  C6    . CPQ P 6 .   ? 3.482   3.307   2.923  1.00 43.85 ? 404 CPQ B C6    1 
HETATM 2993 C  C7    . CPQ P 6 .   ? 2.390   3.682   3.914  1.00 44.25 ? 404 CPQ B C7    1 
HETATM 2994 C  C8    . CPQ P 6 .   ? 1.862   5.021   3.392  1.00 44.60 ? 404 CPQ B C8    1 
HETATM 2995 C  C9    . CPQ P 6 .   ? 2.515   5.252   2.019  1.00 45.31 ? 404 CPQ B C9    1 
HETATM 2996 C  C10   . CPQ P 6 .   ? 1.766   3.040   1.085  1.00 43.01 ? 404 CPQ B C10   1 
HETATM 2997 C  C11   . CPQ P 6 .   ? 4.485   -0.684  1.314  1.00 43.23 ? 404 CPQ B C11   1 
HETATM 2998 C  C12   . CPQ P 6 .   ? 8.083   0.730   1.363  1.00 45.06 ? 404 CPQ B C12   1 
HETATM 2999 C  C13   . CPQ P 6 .   ? 8.444   0.181   2.744  1.00 45.39 ? 404 CPQ B C13   1 
HETATM 3000 C  C14   . CPQ P 6 .   ? 7.295   0.456   3.704  1.00 45.00 ? 404 CPQ B C14   1 
HETATM 3001 C  C15   . CPQ P 6 .   ? 6.007   -0.209  3.212  1.00 44.27 ? 404 CPQ B C15   1 
HETATM 3002 C  C16   . CPQ P 6 .   ? 4.918   -0.014  4.270  1.00 43.56 ? 404 CPQ B C16   1 
HETATM 3003 C  C17   . CPQ P 6 .   ? 4.344   1.395   4.276  1.00 43.49 ? 404 CPQ B C17   1 
HETATM 3004 C  C18   . CPQ P 6 .   ? 3.922   1.852   2.882  1.00 43.72 ? 404 CPQ B C18   1 
HETATM 3005 C  C19   . CPQ P 6 .   ? 5.058   1.699   1.859  1.00 44.05 ? 404 CPQ B C19   1 
HETATM 3006 C  C20   . CPQ P 6 .   ? 1.601   6.047   1.068  1.00 47.44 ? 404 CPQ B C20   1 
HETATM 3007 C  C21   . CPQ P 6 .   ? 2.223   6.218   -0.322 1.00 47.58 ? 404 CPQ B C21   1 
HETATM 3008 C  C22   . CPQ P 6 .   ? 1.217   7.426   1.621  1.00 49.30 ? 404 CPQ B C22   1 
HETATM 3009 C  C23   . CPQ P 6 .   ? 2.265   8.502   1.323  1.00 51.07 ? 404 CPQ B C23   1 
HETATM 3010 O  O2    . CPQ P 6 .   ? 9.637   0.790   3.246  1.00 45.81 ? 404 CPQ B O2    1 
HETATM 3011 O  O4    . CPQ P 6 .   ? 5.136   4.617   0.873  1.00 44.66 ? 404 CPQ B O4    1 
HETATM 3012 C  C57   . CPQ P 6 .   ? 1.878   9.836   1.926  1.00 52.86 ? 404 CPQ B C57   1 
HETATM 3013 O  O58   . CPQ P 6 .   ? 2.690   10.761  1.903  1.00 54.64 ? 404 CPQ B O58   1 
HETATM 3014 S  S     . SO4 Q 4 .   ? 10.752  -27.019 27.130 1.00 84.73 ? 405 SO4 B S     1 
HETATM 3015 O  O1    . SO4 Q 4 .   ? 11.977  -26.619 26.444 1.00 84.71 ? 405 SO4 B O1    1 
HETATM 3016 O  O2    . SO4 Q 4 .   ? 9.750   -25.966 26.947 1.00 84.13 ? 405 SO4 B O2    1 
HETATM 3017 O  O3    . SO4 Q 4 .   ? 10.287  -28.278 26.547 1.00 84.46 ? 405 SO4 B O3    1 
HETATM 3018 O  O4    . SO4 Q 4 .   ? 10.998  -27.212 28.563 1.00 84.28 ? 405 SO4 B O4    1 
HETATM 3019 S  S     . SO4 R 4 .   ? 32.383  -14.879 35.279 1.00 58.95 ? 406 SO4 B S     1 
HETATM 3020 O  O1    . SO4 R 4 .   ? 33.576  -14.960 34.427 1.00 56.84 ? 406 SO4 B O1    1 
HETATM 3021 O  O2    . SO4 R 4 .   ? 32.633  -15.521 36.570 1.00 57.69 ? 406 SO4 B O2    1 
HETATM 3022 O  O3    . SO4 R 4 .   ? 31.262  -15.488 34.567 1.00 57.93 ? 406 SO4 B O3    1 
HETATM 3023 O  O4    . SO4 R 4 .   ? 32.044  -13.482 35.561 1.00 59.11 ? 406 SO4 B O4    1 
HETATM 3024 S  S     . SO4 S 4 .   ? 20.741  -18.567 36.413 1.00 92.64 ? 407 SO4 B S     1 
HETATM 3025 O  O1    . SO4 S 4 .   ? 20.783  -18.211 34.998 1.00 92.28 ? 407 SO4 B O1    1 
HETATM 3026 O  O2    . SO4 S 4 .   ? 19.567  -17.941 37.019 1.00 92.87 ? 407 SO4 B O2    1 
HETATM 3027 O  O3    . SO4 S 4 .   ? 20.652  -20.019 36.573 1.00 92.53 ? 407 SO4 B O3    1 
HETATM 3028 O  O4    . SO4 S 4 .   ? 21.955  -18.080 37.069 1.00 92.71 ? 407 SO4 B O4    1 
HETATM 3029 C  C1    . GOL T 5 .   ? 8.731   0.331   28.496 1.00 54.44 ? 408 GOL B C1    1 
HETATM 3030 O  O1    . GOL T 5 .   ? 8.508   -0.866  29.221 1.00 53.55 ? 408 GOL B O1    1 
HETATM 3031 C  C2    . GOL T 5 .   ? 9.054   0.028   27.026 1.00 54.09 ? 408 GOL B C2    1 
HETATM 3032 O  O2    . GOL T 5 .   ? 10.375  0.395   26.678 1.00 53.69 ? 408 GOL B O2    1 
HETATM 3033 C  C3    . GOL T 5 .   ? 8.057   0.747   26.120 1.00 53.56 ? 408 GOL B C3    1 
HETATM 3034 O  O3    . GOL T 5 .   ? 8.564   0.836   24.813 1.00 52.92 ? 408 GOL B O3    1 
HETATM 3035 O  O     . HOH U 7 .   ? -19.162 -18.911 27.995 1.00 25.14 ? 501 HOH A O     1 
HETATM 3036 O  O     . HOH U 7 .   ? 2.618   -20.920 24.829 1.00 39.34 ? 502 HOH A O     1 
HETATM 3037 O  O     . HOH U 7 .   ? -21.896 -20.066 31.274 1.00 22.08 ? 503 HOH A O     1 
HETATM 3038 O  O     . HOH U 7 .   ? -19.633 -24.647 25.321 1.00 36.61 ? 504 HOH A O     1 
HETATM 3039 O  O     . HOH U 7 .   ? -39.627 -2.194  23.517 1.00 31.18 ? 505 HOH A O     1 
HETATM 3040 O  O     . HOH U 7 .   ? -28.278 -3.272  27.958 1.00 35.84 ? 506 HOH A O     1 
HETATM 3041 O  O     . HOH U 7 .   ? -24.350 -18.803 30.763 1.00 30.23 ? 507 HOH A O     1 
HETATM 3042 O  O     . HOH U 7 .   ? -20.367 -24.532 22.670 1.00 54.64 ? 508 HOH A O     1 
HETATM 3043 O  O     . HOH U 7 .   ? -10.059 -5.925  31.692 1.00 51.62 ? 509 HOH A O     1 
HETATM 3044 O  O     . HOH U 7 .   ? -10.044 -33.499 31.866 1.00 47.17 ? 510 HOH A O     1 
HETATM 3045 O  O     . HOH U 7 .   ? -24.448 -18.897 35.002 1.00 35.46 ? 511 HOH A O     1 
HETATM 3046 O  O     . HOH U 7 .   ? -23.004 -4.384  32.596 1.00 37.55 ? 512 HOH A O     1 
HETATM 3047 O  O     . HOH U 7 .   ? 4.616   -24.164 31.620 1.00 43.63 ? 513 HOH A O     1 
HETATM 3048 O  O     . HOH U 7 .   ? -17.342 -21.418 21.665 1.00 39.77 ? 514 HOH A O     1 
HETATM 3049 O  O     . HOH U 7 .   ? -30.798 2.335   38.256 1.00 34.97 ? 515 HOH A O     1 
HETATM 3050 O  O     . HOH U 7 .   ? -40.007 13.364  30.459 1.00 54.43 ? 516 HOH A O     1 
HETATM 3051 O  O     . HOH U 7 .   ? -38.124 4.579   18.032 1.00 35.85 ? 517 HOH A O     1 
HETATM 3052 O  O     . HOH U 7 .   ? -27.395 5.025   39.946 1.00 40.75 ? 518 HOH A O     1 
HETATM 3053 O  O     . HOH U 7 .   ? -32.870 3.103   39.363 1.00 44.31 ? 519 HOH A O     1 
HETATM 3054 O  O     . HOH U 7 .   ? -41.690 2.894   20.115 1.00 30.84 ? 520 HOH A O     1 
HETATM 3055 O  O     . HOH U 7 .   ? -25.606 6.801   38.980 1.00 43.71 ? 521 HOH A O     1 
HETATM 3056 O  O     . HOH U 7 .   ? -18.114 -33.799 41.938 1.00 39.03 ? 522 HOH A O     1 
HETATM 3057 O  O     . HOH U 7 .   ? -3.548  -11.353 41.010 1.00 28.35 ? 523 HOH A O     1 
HETATM 3058 O  O     . HOH U 7 .   ? -44.224 4.263   20.080 1.00 32.72 ? 524 HOH A O     1 
HETATM 3059 O  O     . HOH U 7 .   ? -4.833  -13.050 12.850 1.00 30.25 ? 525 HOH A O     1 
HETATM 3060 O  O     . HOH U 7 .   ? -16.969 -11.016 27.819 1.00 27.98 ? 526 HOH A O     1 
HETATM 3061 O  O     . HOH U 7 .   ? -6.661  -20.419 16.753 1.00 53.98 ? 527 HOH A O     1 
HETATM 3062 O  O     . HOH U 7 .   ? -25.775 1.533   17.733 1.00 39.33 ? 528 HOH A O     1 
HETATM 3063 O  O     . HOH U 7 .   ? -35.890 10.374  13.617 1.00 56.71 ? 529 HOH A O     1 
HETATM 3064 O  O     . HOH U 7 .   ? -16.876 -11.913 23.697 1.00 43.28 ? 530 HOH A O     1 
HETATM 3065 O  O     . HOH U 7 .   ? -16.673 -9.965  25.329 1.00 48.61 ? 531 HOH A O     1 
HETATM 3066 O  O     . HOH U 7 .   ? -32.876 8.802   39.358 1.00 48.37 ? 532 HOH A O     1 
HETATM 3067 O  O     . HOH U 7 .   ? -38.091 12.575  23.260 1.00 40.52 ? 533 HOH A O     1 
HETATM 3068 O  O     . HOH U 7 .   ? 3.329   -13.488 39.194 1.00 36.78 ? 534 HOH A O     1 
HETATM 3069 O  O     . HOH U 7 .   ? -12.184 -18.963 49.547 1.00 44.27 ? 535 HOH A O     1 
HETATM 3070 O  O     . HOH U 7 .   ? -36.417 -1.708  21.916 1.00 34.83 ? 536 HOH A O     1 
HETATM 3071 O  O     . HOH U 7 .   ? -5.072  -7.927  30.545 1.00 34.76 ? 537 HOH A O     1 
HETATM 3072 O  O     . HOH U 7 .   ? -39.612 1.990   38.386 1.00 44.86 ? 538 HOH A O     1 
HETATM 3073 O  O     . HOH U 7 .   ? -8.237  -7.654  32.077 1.00 39.91 ? 539 HOH A O     1 
HETATM 3074 O  O     . HOH U 7 .   ? -2.233  -13.950 41.327 1.00 37.72 ? 540 HOH A O     1 
HETATM 3075 O  O     . HOH U 7 .   ? -23.254 -24.589 25.080 1.00 39.45 ? 541 HOH A O     1 
HETATM 3076 O  O     . HOH U 7 .   ? 6.517   -17.001 31.688 1.00 51.44 ? 542 HOH A O     1 
HETATM 3077 O  O     . HOH U 7 .   ? -17.467 -33.306 29.818 1.00 44.46 ? 543 HOH A O     1 
HETATM 3078 O  O     . HOH U 7 .   ? -29.292 -14.581 29.064 1.00 53.90 ? 544 HOH A O     1 
HETATM 3079 O  O     . HOH U 7 .   ? -22.550 -20.861 19.427 1.00 55.09 ? 545 HOH A O     1 
HETATM 3080 O  O     . HOH U 7 .   ? -24.212 0.528   37.253 1.00 47.16 ? 546 HOH A O     1 
HETATM 3081 O  O     . HOH U 7 .   ? -31.974 9.896   41.603 1.00 52.02 ? 547 HOH A O     1 
HETATM 3082 O  O     . HOH U 7 .   ? -26.333 -19.042 32.566 1.00 45.62 ? 548 HOH A O     1 
HETATM 3083 O  O     . HOH U 7 .   ? -34.705 -1.873  17.710 1.00 43.58 ? 549 HOH A O     1 
HETATM 3084 O  O     . HOH U 7 .   ? -33.826 -5.900  32.154 1.00 45.20 ? 550 HOH A O     1 
HETATM 3085 O  O     . HOH U 7 .   ? -16.165 -33.744 37.935 1.00 49.05 ? 551 HOH A O     1 
HETATM 3086 O  O     . HOH U 7 .   ? -38.389 10.233  15.911 1.00 46.47 ? 552 HOH A O     1 
HETATM 3087 O  O     . HOH U 7 .   ? -42.529 10.687  14.866 1.00 51.94 ? 553 HOH A O     1 
HETATM 3088 O  O     . HOH U 7 .   ? -40.150 9.915   31.335 1.00 40.17 ? 554 HOH A O     1 
HETATM 3089 O  O     . HOH U 7 .   ? -5.580  -29.774 28.347 1.00 40.95 ? 555 HOH A O     1 
HETATM 3090 O  O     . HOH U 7 .   ? 0.401   -7.503  32.301 1.00 38.43 ? 556 HOH A O     1 
HETATM 3091 O  O     . HOH U 7 .   ? -37.574 -2.728  37.052 1.00 56.72 ? 557 HOH A O     1 
HETATM 3092 O  O     . HOH U 7 .   ? -8.141  -5.253  29.505 1.00 47.23 ? 558 HOH A O     1 
HETATM 3093 O  O     . HOH U 7 .   ? 0.580   -23.654 36.916 1.00 47.60 ? 559 HOH A O     1 
HETATM 3094 O  O     . HOH U 7 .   ? 0.787   -25.308 23.487 1.00 52.58 ? 560 HOH A O     1 
HETATM 3095 O  O     . HOH U 7 .   ? -7.844  -32.343 28.750 1.00 50.12 ? 561 HOH A O     1 
HETATM 3096 O  O     . HOH U 7 .   ? -17.714 -33.116 32.191 1.00 46.39 ? 562 HOH A O     1 
HETATM 3097 O  O     . HOH U 7 .   ? -19.965 -32.137 33.448 1.00 38.17 ? 563 HOH A O     1 
HETATM 3098 O  O     . HOH U 7 .   ? -24.862 -18.149 23.021 1.00 36.03 ? 564 HOH A O     1 
HETATM 3099 O  O     . HOH U 7 .   ? -37.070 13.881  36.187 1.00 44.06 ? 565 HOH A O     1 
HETATM 3100 O  O     . HOH U 7 .   ? -19.217 -20.204 42.896 1.00 38.72 ? 566 HOH A O     1 
HETATM 3101 O  O     . HOH U 7 .   ? -13.995 -32.807 36.690 1.00 49.21 ? 567 HOH A O     1 
HETATM 3102 O  O     . HOH U 7 .   ? -30.970 -1.161  38.176 1.00 48.03 ? 568 HOH A O     1 
HETATM 3103 O  O     . HOH U 7 .   ? -21.087 -11.169 25.995 1.00 57.37 ? 569 HOH A O     1 
HETATM 3104 O  O     . HOH U 7 .   ? -30.322 -0.645  17.264 1.00 65.20 ? 570 HOH A O     1 
HETATM 3105 O  O     . HOH U 7 .   ? -34.844 4.217   16.041 1.00 56.99 ? 571 HOH A O     1 
HETATM 3106 O  O     . HOH U 7 .   ? -15.868 -21.251 17.263 1.00 46.15 ? 572 HOH A O     1 
HETATM 3107 O  O     . HOH V 7 .   ? -12.102 -11.936 14.908 1.00 37.25 ? 501 HOH B O     1 
HETATM 3108 O  O     . HOH V 7 .   ? 11.693  -11.101 24.276 1.00 33.25 ? 502 HOH B O     1 
HETATM 3109 O  O     . HOH V 7 .   ? 20.387  -21.169 28.970 1.00 26.82 ? 503 HOH B O     1 
HETATM 3110 O  O     . HOH V 7 .   ? 41.932  -29.533 21.605 1.00 54.04 ? 504 HOH B O     1 
HETATM 3111 O  O     . HOH V 7 .   ? 6.738   -15.716 13.609 1.00 48.06 ? 505 HOH B O     1 
HETATM 3112 O  O     . HOH V 7 .   ? 7.529   3.110   23.392 1.00 41.15 ? 506 HOH B O     1 
HETATM 3113 O  O     . HOH V 7 .   ? 34.720  -33.337 18.125 1.00 48.48 ? 507 HOH B O     1 
HETATM 3114 O  O     . HOH V 7 .   ? 31.129  -29.078 41.164 1.00 41.13 ? 508 HOH B O     1 
HETATM 3115 O  O     . HOH V 7 .   ? 14.723  -11.152 30.096 1.00 59.80 ? 509 HOH B O     1 
HETATM 3116 O  O     . HOH V 7 .   ? 16.672  4.586   15.452 1.00 48.71 ? 510 HOH B O     1 
HETATM 3117 O  O     . HOH V 7 .   ? 4.724   -12.500 16.632 1.00 43.31 ? 511 HOH B O     1 
HETATM 3118 O  O     . HOH V 7 .   ? 37.196  -25.499 16.006 1.00 52.80 ? 512 HOH B O     1 
HETATM 3119 O  O     . HOH V 7 .   ? -9.123  -5.983  18.589 1.00 33.15 ? 513 HOH B O     1 
HETATM 3120 O  O     . HOH V 7 .   ? -1.956  -13.076 13.420 1.00 34.43 ? 514 HOH B O     1 
HETATM 3121 O  O     . HOH V 7 .   ? 12.604  -7.339  19.744 1.00 32.35 ? 515 HOH B O     1 
HETATM 3122 O  O     . HOH V 7 .   ? 1.927   -12.609 19.070 1.00 26.55 ? 516 HOH B O     1 
HETATM 3123 O  O     . HOH V 7 .   ? 8.854   -8.339  3.760  1.00 39.77 ? 517 HOH B O     1 
HETATM 3124 O  O     . HOH V 7 .   ? 0.630   -12.714 10.357 1.00 40.38 ? 518 HOH B O     1 
HETATM 3125 O  O     . HOH V 7 .   ? 18.010  -8.638  14.728 1.00 35.24 ? 519 HOH B O     1 
HETATM 3126 O  O     . HOH V 7 .   ? 28.347  -26.156 41.345 1.00 30.94 ? 520 HOH B O     1 
HETATM 3127 O  O     . HOH V 7 .   ? 25.629  -17.678 34.209 1.00 38.02 ? 521 HOH B O     1 
HETATM 3128 O  O     . HOH V 7 .   ? 16.918  -22.918 30.990 1.00 27.81 ? 522 HOH B O     1 
HETATM 3129 O  O     . HOH V 7 .   ? -2.488  -3.518  8.123  1.00 34.14 ? 523 HOH B O     1 
HETATM 3130 O  O     . HOH V 7 .   ? 36.943  -17.163 35.391 1.00 43.49 ? 524 HOH B O     1 
HETATM 3131 O  O     . HOH V 7 .   ? 3.551   7.345   19.951 1.00 45.77 ? 525 HOH B O     1 
HETATM 3132 O  O     . HOH V 7 .   ? 25.971  -36.087 39.133 1.00 46.58 ? 526 HOH B O     1 
HETATM 3133 O  O     . HOH V 7 .   ? 20.382  -28.943 39.684 1.00 43.13 ? 527 HOH B O     1 
HETATM 3134 O  O     . HOH V 7 .   ? 41.500  -27.083 36.275 1.00 42.07 ? 528 HOH B O     1 
HETATM 3135 O  O     . HOH V 7 .   ? 33.882  -29.902 42.157 1.00 48.26 ? 529 HOH B O     1 
HETATM 3136 O  O     . HOH V 7 .   ? 33.057  -39.288 27.842 1.00 38.24 ? 530 HOH B O     1 
HETATM 3137 O  O     . HOH V 7 .   ? 2.090   -10.996 2.813  1.00 51.24 ? 531 HOH B O     1 
HETATM 3138 O  O     . HOH V 7 .   ? 12.387  2.335   24.663 1.00 45.96 ? 532 HOH B O     1 
HETATM 3139 O  O     . HOH V 7 .   ? 24.154  -15.789 19.437 1.00 58.09 ? 533 HOH B O     1 
HETATM 3140 O  O     . HOH V 7 .   ? 34.124  -22.747 37.576 1.00 40.84 ? 534 HOH B O     1 
HETATM 3141 O  O     . HOH V 7 .   ? 36.378  -23.562 36.723 1.00 42.80 ? 535 HOH B O     1 
HETATM 3142 O  O     . HOH V 7 .   ? 3.790   -13.307 8.285  1.00 40.61 ? 536 HOH B O     1 
HETATM 3143 O  O     . HOH V 7 .   ? -5.534  -4.329  1.191  1.00 50.35 ? 537 HOH B O     1 
HETATM 3144 O  O     . HOH V 7 .   ? 27.132  -33.327 18.934 1.00 40.92 ? 538 HOH B O     1 
HETATM 3145 O  O     . HOH V 7 .   ? -3.402  -7.731  0.679  1.00 55.28 ? 539 HOH B O     1 
HETATM 3146 O  O     . HOH V 7 .   ? 33.507  -35.602 38.083 1.00 40.57 ? 540 HOH B O     1 
HETATM 3147 O  O     . HOH V 7 .   ? 26.695  -15.185 31.449 1.00 52.52 ? 541 HOH B O     1 
HETATM 3148 O  O     . HOH V 7 .   ? 39.249  -29.888 21.870 1.00 50.33 ? 542 HOH B O     1 
HETATM 3149 O  O     . HOH V 7 .   ? 6.019   -14.215 9.561  1.00 57.57 ? 543 HOH B O     1 
HETATM 3150 O  O     . HOH V 7 .   ? 20.542  -24.572 39.007 1.00 41.21 ? 544 HOH B O     1 
HETATM 3151 O  O     . HOH V 7 .   ? -0.742  -15.403 13.030 1.00 60.23 ? 545 HOH B O     1 
HETATM 3152 O  O     . HOH V 7 .   ? 5.378   3.907   24.415 1.00 55.59 ? 546 HOH B O     1 
HETATM 3153 O  O     . HOH V 7 .   ? 6.426   -11.501 18.347 1.00 49.72 ? 547 HOH B O     1 
HETATM 3154 O  O     . HOH V 7 .   ? 19.795  -17.063 39.561 1.00 56.66 ? 548 HOH B O     1 
HETATM 3155 O  O     . HOH V 7 .   ? -2.590  6.378   3.523  1.00 53.66 ? 549 HOH B O     1 
HETATM 3156 O  O     . HOH V 7 .   ? -13.535 -18.355 9.821  1.00 55.89 ? 550 HOH B O     1 
HETATM 3157 O  O     . HOH V 7 .   ? 18.504  -13.440 21.706 1.00 52.27 ? 551 HOH B O     1 
HETATM 3158 O  O     . HOH V 7 .   ? 4.865   -0.432  27.218 1.00 51.60 ? 552 HOH B O     1 
HETATM 3159 O  O     . HOH V 7 .   ? -2.443  -14.995 8.761  1.00 59.71 ? 553 HOH B O     1 
HETATM 3160 O  O     . HOH V 7 .   ? 37.556  -21.757 28.092 1.00 37.02 ? 554 HOH B O     1 
HETATM 3161 O  O     . HOH V 7 .   ? 30.527  -23.267 19.954 1.00 46.84 ? 555 HOH B O     1 
HETATM 3162 O  O     . HOH V 7 .   ? 33.257  -27.589 42.990 1.00 51.88 ? 556 HOH B O     1 
HETATM 3163 O  O     . HOH V 7 .   ? -6.938  0.173   11.270 1.00 59.06 ? 557 HOH B O     1 
HETATM 3164 O  O     . HOH V 7 .   ? -8.907  -1.597  2.617  1.00 60.82 ? 558 HOH B O     1 
HETATM 3165 O  O     . HOH V 7 .   ? -8.580  2.672   1.809  1.00 49.11 ? 559 HOH B O     1 
HETATM 3166 O  O     . HOH V 7 .   ? 8.424   -5.823  28.510 1.00 46.63 ? 560 HOH B O     1 
HETATM 3167 O  O     . HOH V 7 .   ? 7.287   -7.137  25.983 1.00 47.13 ? 561 HOH B O     1 
HETATM 3168 O  O     . HOH V 7 .   ? 14.298  -11.180 21.791 1.00 89.64 ? 562 HOH B O     1 
HETATM 3169 O  O     . HOH W 7 .   ? -4.494  -9.271  26.149 1.00 32.09 ? 101 HOH P O     1 
HETATM 3170 O  O     . HOH W 7 .   ? -1.762  -9.486  24.995 1.00 26.87 ? 102 HOH P O     1 
HETATM 3171 O  O     . HOH W 7 .   ? -7.288  -16.603 15.711 1.00 33.17 ? 103 HOH P O     1 
HETATM 3172 O  O     . HOH W 7 .   ? -11.955 -9.036  23.933 1.00 40.17 ? 104 HOH P O     1 
HETATM 3173 O  O     . HOH W 7 .   ? -10.142 -8.804  22.111 1.00 36.40 ? 105 HOH P O     1 
HETATM 3174 O  O     . HOH W 7 .   ? -10.654 -9.818  19.615 1.00 38.76 ? 106 HOH P O     1 
HETATM 3175 O  O     . HOH W 7 .   ? -4.661  -7.203  27.820 1.00 34.50 ? 107 HOH P O     1 
HETATM 3176 O  O     . HOH W 7 .   ? -14.750 -15.444 16.268 1.00 39.57 ? 108 HOH P O     1 
HETATM 3177 O  O     . HOH W 7 .   ? -9.166  -5.802  21.253 1.00 50.83 ? 109 HOH P O     1 
HETATM 3178 O  O     . HOH W 7 .   ? -5.162  -2.905  25.869 1.00 44.47 ? 110 HOH P O     1 
HETATM 3179 O  O     . HOH W 7 .   ? -12.391 -28.780 21.656 1.00 50.02 ? 111 HOH P O     1 
HETATM 3180 O  O     . HOH W 7 .   ? -14.435 -19.049 14.597 1.00 52.25 ? 112 HOH P O     1 
HETATM 3181 O  O     . HOH W 7 .   ? -2.465  -5.423  27.141 1.00 39.32 ? 113 HOH P O     1 
HETATM 3182 O  O     . HOH X 7 .   ? 34.696  -17.213 19.836 1.00 27.83 ? 101 HOH E O     1 
HETATM 3183 O  O     . HOH X 7 .   ? 37.329  -21.353 31.655 1.00 32.11 ? 102 HOH E O     1 
HETATM 3184 O  O     . HOH X 7 .   ? 31.804  -16.093 31.677 1.00 40.99 ? 103 HOH E O     1 
HETATM 3185 O  O     . HOH X 7 .   ? 22.443  -19.235 22.538 1.00 40.20 ? 104 HOH E O     1 
HETATM 3186 O  O     . HOH X 7 .   ? 33.725  -13.312 21.464 1.00 34.41 ? 105 HOH E O     1 
HETATM 3187 O  O     . HOH X 7 .   ? 33.910  -15.398 30.036 1.00 35.80 ? 106 HOH E O     1 
HETATM 3188 O  O     . HOH X 7 .   ? 36.864  -13.309 36.995 1.00 45.77 ? 107 HOH E O     1 
HETATM 3189 O  O     . HOH X 7 .   ? 33.713  -14.397 27.612 1.00 39.85 ? 108 HOH E O     1 
HETATM 3190 O  O     . HOH X 7 .   ? 32.313  -12.110 23.248 1.00 41.73 ? 109 HOH E O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.5843 0.7649 0.5895 -0.1399 -0.0845 -0.0355 143 GLY A N   
2    C CA  . GLY A 1   ? 0.5608 0.7965 0.6041 -0.1307 -0.0918 -0.0203 143 GLY A CA  
3    C C   . GLY A 1   ? 0.5756 0.8515 0.6219 -0.1573 -0.1093 -0.0105 143 GLY A C   
4    O O   . GLY A 1   ? 0.6151 0.8702 0.6284 -0.1853 -0.1164 -0.0168 143 GLY A O   
5    N N   . PRO A 2   ? 0.5494 0.8844 0.6343 -0.1501 -0.1160 0.0054  144 PRO A N   
6    C CA  . PRO A 2   ? 0.5083 0.8674 0.6291 -0.1186 -0.1048 0.0117  144 PRO A CA  
7    C C   . PRO A 2   ? 0.4882 0.8232 0.6114 -0.1180 -0.0868 -0.0003 144 PRO A C   
8    O O   . PRO A 2   ? 0.4694 0.8008 0.6069 -0.0910 -0.0744 -0.0007 144 PRO A O   
9    C CB  . PRO A 2   ? 0.5089 0.9435 0.6677 -0.1205 -0.1173 0.0318  144 PRO A CB  
10   C CG  . PRO A 2   ? 0.5408 0.9908 0.6834 -0.1468 -0.1392 0.0393  144 PRO A CG  
11   C CD  . PRO A 2   ? 0.5664 0.9534 0.6612 -0.1746 -0.1360 0.0197  144 PRO A CD  
12   N N   . LEU A 3   ? 0.4917 0.8059 0.5968 -0.1476 -0.0856 -0.0097 145 LEU A N   
13   C CA  . LEU A 3   ? 0.4719 0.7636 0.5780 -0.1500 -0.0707 -0.0184 145 LEU A CA  
14   C C   . LEU A 3   ? 0.4724 0.6975 0.5465 -0.1526 -0.0598 -0.0357 145 LEU A C   
15   O O   . LEU A 3   ? 0.4638 0.6661 0.5367 -0.1535 -0.0487 -0.0419 145 LEU A O   
16   C CB  . LEU A 3   ? 0.4847 0.8043 0.5977 -0.1805 -0.0762 -0.0134 145 LEU A CB  
17   C CG  . LEU A 3   ? 0.4703 0.8653 0.6245 -0.1760 -0.0826 0.0051  145 LEU A CG  
18   C CD1 . LEU A 3   ? 0.4846 0.9096 0.6415 -0.2143 -0.0919 0.0113  145 LEU A CD1 
19   C CD2 . LEU A 3   ? 0.4501 0.8570 0.6297 -0.1465 -0.0662 0.0072  145 LEU A CD2 
20   N N   . GLY A 4   ? 0.4762 0.6721 0.5253 -0.1532 -0.0625 -0.0422 146 GLY A N   
21   C CA  . GLY A 4   ? 0.4745 0.6146 0.4990 -0.1502 -0.0500 -0.0570 146 GLY A CA  
22   C C   . GLY A 4   ? 0.4420 0.5694 0.4787 -0.1216 -0.0387 -0.0586 146 GLY A C   
23   O O   . GLY A 4   ? 0.4186 0.5717 0.4750 -0.1019 -0.0406 -0.0498 146 GLY A O   
24   N N   . SER A 5   ? 0.4320 0.5186 0.4554 -0.1201 -0.0269 -0.0694 147 SER A N   
25   C CA  . SER A 5   ? 0.4080 0.4777 0.4371 -0.0987 -0.0174 -0.0718 147 SER A CA  
26   C C   . SER A 5   ? 0.3762 0.4610 0.4276 -0.0845 -0.0136 -0.0661 147 SER A C   
27   O O   . SER A 5   ? 0.3685 0.4458 0.4237 -0.0680 -0.0094 -0.0657 147 SER A O   
28   C CB  . SER A 5   ? 0.4078 0.4771 0.4300 -0.0876 -0.0210 -0.0698 147 SER A CB  
29   O OG  . SER A 5   ? 0.4189 0.4679 0.4156 -0.1003 -0.0215 -0.0764 147 SER A OG  
30   N N   . ALA A 6   ? 0.3667 0.4701 0.4292 -0.0935 -0.0146 -0.0619 148 ALA A N   
31   C CA  . ALA A 6   ? 0.3469 0.4671 0.4274 -0.0816 -0.0100 -0.0561 148 ALA A CA  
32   C C   . ALA A 6   ? 0.3370 0.4290 0.4147 -0.0778 -0.0012 -0.0598 148 ALA A C   
33   O O   . ALA A 6   ? 0.3213 0.4219 0.4080 -0.0682 0.0026  -0.0557 148 ALA A O   
34   C CB  . ALA A 6   ? 0.3444 0.5021 0.4394 -0.0939 -0.0139 -0.0482 148 ALA A CB  
35   N N   . ARG A 7   ? 0.3454 0.4042 0.4097 -0.0847 0.0023  -0.0669 149 ARG A N   
36   C CA  . ARG A 7   ? 0.3463 0.3805 0.4103 -0.0807 0.0093  -0.0680 149 ARG A CA  
37   C C   . ARG A 7   ? 0.3382 0.3485 0.3973 -0.0705 0.0141  -0.0731 149 ARG A C   
38   O O   . ARG A 7   ? 0.3461 0.3352 0.4053 -0.0677 0.0196  -0.0738 149 ARG A O   
39   C CB  . ARG A 7   ? 0.3668 0.3837 0.4221 -0.0979 0.0109  -0.0691 149 ARG A CB  
40   C CG  . ARG A 7   ? 0.3795 0.4224 0.4434 -0.1084 0.0080  -0.0613 149 ARG A CG  
41   C CD  . ARG A 7   ? 0.4247 0.4523 0.4753 -0.1322 0.0069  -0.0621 149 ARG A CD  
42   N NE  . ARG A 7   ? 0.4814 0.4616 0.5172 -0.1317 0.0134  -0.0664 149 ARG A NE  
43   C CZ  . ARG A 7   ? 0.5096 0.4523 0.5237 -0.1404 0.0165  -0.0751 149 ARG A CZ  
44   N NH1 . ARG A 7   ? 0.5341 0.4792 0.5343 -0.1551 0.0120  -0.0811 149 ARG A NH1 
45   N NH2 . ARG A 7   ? 0.5489 0.4496 0.5533 -0.1338 0.0243  -0.0773 149 ARG A NH2 
46   N N   . ARG A 8   ? 0.3256 0.3418 0.3819 -0.0644 0.0120  -0.0749 150 ARG A N   
47   C CA  . ARG A 8   ? 0.3241 0.3244 0.3771 -0.0571 0.0168  -0.0786 150 ARG A CA  
48   C C   . ARG A 8   ? 0.3044 0.3148 0.3603 -0.0465 0.0134  -0.0747 150 ARG A C   
49   O O   . ARG A 8   ? 0.2925 0.3181 0.3478 -0.0438 0.0077  -0.0714 150 ARG A O   
50   C CB  . ARG A 8   ? 0.3438 0.3316 0.3805 -0.0655 0.0192  -0.0861 150 ARG A CB  
51   C CG  . ARG A 8   ? 0.3684 0.3337 0.3935 -0.0767 0.0249  -0.0925 150 ARG A CG  
52   C CD  . ARG A 8   ? 0.4080 0.3598 0.4091 -0.0883 0.0264  -0.1008 150 ARG A CD  
53   N NE  . ARG A 8   ? 0.4232 0.3647 0.4191 -0.0806 0.0352  -0.1054 150 ARG A NE  
54   C CZ  . ARG A 8   ? 0.4543 0.3732 0.4477 -0.0746 0.0492  -0.1112 150 ARG A CZ  
55   N NH1 . ARG A 8   ? 0.4689 0.3664 0.4621 -0.0738 0.0557  -0.1134 150 ARG A NH1 
56   N NH2 . ARG A 8   ? 0.4454 0.3633 0.4367 -0.0686 0.0578  -0.1140 150 ARG A NH2 
57   N N   . LEU A 9   ? 0.2932 0.2952 0.3521 -0.0407 0.0168  -0.0742 151 LEU A N   
58   C CA  . LEU A 9   ? 0.2879 0.2920 0.3431 -0.0349 0.0133  -0.0713 151 LEU A CA  
59   C C   . LEU A 9   ? 0.2865 0.2835 0.3390 -0.0363 0.0173  -0.0731 151 LEU A C   
60   O O   . LEU A 9   ? 0.2832 0.2772 0.3444 -0.0365 0.0242  -0.0745 151 LEU A O   
61   C CB  . LEU A 9   ? 0.2761 0.2816 0.3359 -0.0299 0.0111  -0.0660 151 LEU A CB  
62   C CG  . LEU A 9   ? 0.2760 0.2897 0.3350 -0.0264 0.0088  -0.0633 151 LEU A CG  
63   C CD1 . LEU A 9   ? 0.2398 0.2484 0.2960 -0.0239 0.0077  -0.0592 151 LEU A CD1 
64   C CD2 . LEU A 9   ? 0.2642 0.2838 0.3151 -0.0209 0.0061  -0.0634 151 LEU A CD2 
65   N N   . TYR A 10  ? 0.2958 0.2902 0.3363 -0.0366 0.0138  -0.0722 152 TYR A N   
66   C CA  . TYR A 10  ? 0.3043 0.2949 0.3412 -0.0403 0.0172  -0.0720 152 TYR A CA  
67   C C   . TYR A 10  ? 0.3012 0.2940 0.3451 -0.0400 0.0148  -0.0663 152 TYR A C   
68   O O   . TYR A 10  ? 0.3023 0.2901 0.3389 -0.0377 0.0084  -0.0633 152 TYR A O   
69   C CB  . TYR A 10  ? 0.3117 0.2944 0.3281 -0.0435 0.0132  -0.0719 152 TYR A CB  
70   C CG  . TYR A 10  ? 0.3230 0.3008 0.3312 -0.0503 0.0157  -0.0700 152 TYR A CG  
71   C CD1 . TYR A 10  ? 0.3410 0.3101 0.3399 -0.0522 0.0099  -0.0649 152 TYR A CD1 
72   C CD2 . TYR A 10  ? 0.3293 0.3093 0.3357 -0.0566 0.0246  -0.0736 152 TYR A CD2 
73   C CE1 . TYR A 10  ? 0.3428 0.3084 0.3331 -0.0625 0.0115  -0.0619 152 TYR A CE1 
74   C CE2 . TYR A 10  ? 0.3350 0.3151 0.3350 -0.0646 0.0281  -0.0709 152 TYR A CE2 
75   C CZ  . TYR A 10  ? 0.3400 0.3143 0.3330 -0.0687 0.0208  -0.0644 152 TYR A CZ  
76   O OH  . TYR A 10  ? 0.3420 0.3175 0.3279 -0.0805 0.0239  -0.0607 152 TYR A OH  
77   N N   . VAL A 11  ? 0.3070 0.3084 0.3640 -0.0427 0.0204  -0.0643 153 VAL A N   
78   C CA  . VAL A 11  ? 0.3072 0.3164 0.3717 -0.0465 0.0161  -0.0569 153 VAL A CA  
79   C C   . VAL A 11  ? 0.3141 0.3310 0.3787 -0.0552 0.0199  -0.0545 153 VAL A C   
80   O O   . VAL A 11  ? 0.3076 0.3375 0.3874 -0.0534 0.0304  -0.0556 153 VAL A O   
81   C CB  . VAL A 11  ? 0.2994 0.3222 0.3884 -0.0412 0.0172  -0.0518 153 VAL A CB  
82   C CG1 . VAL A 11  ? 0.2819 0.3162 0.3770 -0.0480 0.0091  -0.0421 153 VAL A CG1 
83   C CG2 . VAL A 11  ? 0.2818 0.2964 0.3684 -0.0353 0.0147  -0.0537 153 VAL A CG2 
84   N N   . GLY A 12  ? 0.3287 0.3357 0.3744 -0.0648 0.0125  -0.0514 154 GLY A N   
85   C CA  . GLY A 12  ? 0.3458 0.3601 0.3886 -0.0775 0.0149  -0.0474 154 GLY A CA  
86   C C   . GLY A 12  ? 0.3487 0.3779 0.4008 -0.0891 0.0081  -0.0379 154 GLY A C   
87   O O   . GLY A 12  ? 0.3476 0.3732 0.3987 -0.0890 -0.0009 -0.0347 154 GLY A O   
88   N N   . ASN A 13  ? 0.3653 0.4134 0.4255 -0.1010 0.0126  -0.0327 155 ASN A N   
89   C CA  . ASN A 13  ? 0.3764 0.4470 0.4482 -0.1168 0.0055  -0.0214 155 ASN A CA  
90   C C   . ASN A 13  ? 0.3644 0.4708 0.4762 -0.1082 0.0056  -0.0137 155 ASN A C   
91   O O   . ASN A 13  ? 0.3674 0.4852 0.4839 -0.1184 -0.0067 -0.0043 155 ASN A O   
92   C CB  . ASN A 13  ? 0.3972 0.4361 0.4337 -0.1308 -0.0098 -0.0197 155 ASN A CB  
93   C CG  . ASN A 13  ? 0.4167 0.4694 0.4500 -0.1567 -0.0179 -0.0090 155 ASN A CG  
94   O OD1 . ASN A 13  ? 0.4177 0.4971 0.4661 -0.1668 -0.0110 -0.0038 155 ASN A OD1 
95   N ND2 . ASN A 13  ? 0.4024 0.4366 0.4136 -0.1695 -0.0321 -0.0057 155 ASN A ND2 
96   N N   . ILE A 14  ? 0.3586 0.4790 0.4956 -0.0899 0.0190  -0.0173 156 ILE A N   
97   C CA  . ILE A 14  ? 0.3503 0.4995 0.5247 -0.0773 0.0201  -0.0092 156 ILE A CA  
98   C C   . ILE A 14  ? 0.3605 0.5572 0.5684 -0.0848 0.0224  0.0046  156 ILE A C   
99   O O   . ILE A 14  ? 0.3712 0.5802 0.5792 -0.0932 0.0322  0.0039  156 ILE A O   
100  C CB  . ILE A 14  ? 0.3443 0.4864 0.5312 -0.0549 0.0349  -0.0173 156 ILE A CB  
101  C CG1 . ILE A 14  ? 0.3558 0.5062 0.5486 -0.0507 0.0545  -0.0233 156 ILE A CG1 
102  C CG2 . ILE A 14  ? 0.3408 0.4438 0.4985 -0.0504 0.0312  -0.0286 156 ILE A CG2 
103  C CD1 . ILE A 14  ? 0.3427 0.4810 0.5429 -0.0306 0.0701  -0.0319 156 ILE A CD1 
104  N N   . PRO A 15  ? 0.3599 0.5867 0.5973 -0.0823 0.0133  0.0185  157 PRO A N   
105  C CA  . PRO A 15  ? 0.3681 0.6501 0.6446 -0.0887 0.0135  0.0350  157 PRO A CA  
106  C C   . PRO A 15  ? 0.3722 0.6838 0.6845 -0.0690 0.0373  0.0349  157 PRO A C   
107  O O   . PRO A 15  ? 0.3752 0.6701 0.6933 -0.0449 0.0498  0.0271  157 PRO A O   
108  C CB  . PRO A 15  ? 0.3604 0.6623 0.6573 -0.0867 -0.0034 0.0499  157 PRO A CB  
109  C CG  . PRO A 15  ? 0.3543 0.6158 0.6324 -0.0714 -0.0047 0.0404  157 PRO A CG  
110  C CD  . PRO A 15  ? 0.3596 0.5729 0.5949 -0.0744 0.0014  0.0212  157 PRO A CD  
111  N N   . PHE A 16  ? 0.3863 0.7397 0.7194 -0.0804 0.0443  0.0434  158 PHE A N   
112  C CA  . PHE A 16  ? 0.3906 0.7720 0.7531 -0.0630 0.0707  0.0420  158 PHE A CA  
113  C C   . PHE A 16  ? 0.3885 0.8028 0.8005 -0.0330 0.0792  0.0526  158 PHE A C   
114  O O   . PHE A 16  ? 0.3812 0.8330 0.8247 -0.0342 0.0635  0.0714  158 PHE A O   
115  C CB  . PHE A 16  ? 0.4104 0.8359 0.7859 -0.0850 0.0756  0.0514  158 PHE A CB  
116  C CG  . PHE A 16  ? 0.4149 0.8760 0.8229 -0.0673 0.1053  0.0512  158 PHE A CG  
117  C CD1 . PHE A 16  ? 0.4271 0.9612 0.8916 -0.0632 0.1117  0.0707  158 PHE A CD1 
118  C CD2 . PHE A 16  ? 0.4450 0.8672 0.8263 -0.0540 0.1275  0.0317  158 PHE A CD2 
119  C CE1 . PHE A 16  ? 0.4448 1.0125 0.9400 -0.0435 0.1428  0.0701  158 PHE A CE1 
120  C CE2 . PHE A 16  ? 0.4558 0.9050 0.8608 -0.0371 0.1576  0.0296  158 PHE A CE2 
121  C CZ  . PHE A 16  ? 0.4585 0.9800 0.9209 -0.0302 0.1669  0.0483  158 PHE A CZ  
122  N N   . GLY A 17  ? 0.3939 0.7905 0.8092 -0.0066 0.1034  0.0409  159 GLY A N   
123  C CA  . GLY A 17  ? 0.3987 0.8140 0.8549 0.0263  0.1152  0.0489  159 GLY A CA  
124  C C   . GLY A 17  ? 0.3985 0.7749 0.8442 0.0403  0.1029  0.0477  159 GLY A C   
125  O O   . GLY A 17  ? 0.4123 0.7945 0.8865 0.0684  0.1116  0.0546  159 GLY A O   
126  N N   . ILE A 18  ? 0.3876 0.7235 0.7919 0.0218  0.0837  0.0396  160 ILE A N   
127  C CA  . ILE A 18  ? 0.3828 0.6833 0.7737 0.0305  0.0715  0.0388  160 ILE A CA  
128  C C   . ILE A 18  ? 0.3974 0.6542 0.7746 0.0531  0.0915  0.0235  160 ILE A C   
129  O O   . ILE A 18  ? 0.4079 0.6417 0.7614 0.0511  0.1076  0.0068  160 ILE A O   
130  C CB  . ILE A 18  ? 0.3761 0.6441 0.7237 0.0058  0.0505  0.0318  160 ILE A CB  
131  C CG1 . ILE A 18  ? 0.3825 0.6286 0.7227 0.0111  0.0355  0.0365  160 ILE A CG1 
132  C CG2 . ILE A 18  ? 0.3761 0.6016 0.6820 -0.0013 0.0599  0.0105  160 ILE A CG2 
133  C CD1 . ILE A 18  ? 0.3941 0.6805 0.7651 0.0092  0.0179  0.0596  160 ILE A CD1 
134  N N   . THR A 19  ? 0.4013 0.6453 0.7911 0.0730  0.0900  0.0302  161 THR A N   
135  C CA  . THR A 19  ? 0.4224 0.6186 0.7955 0.0926  0.1077  0.0169  161 THR A CA  
136  C C   . THR A 19  ? 0.4184 0.5635 0.7480 0.0799  0.0960  0.0048  161 THR A C   
137  O O   . THR A 19  ? 0.3921 0.5405 0.7121 0.0636  0.0746  0.0105  161 THR A O   
138  C CB  . THR A 19  ? 0.4399 0.6420 0.8467 0.1225  0.1137  0.0314  161 THR A CB  
139  O OG1 . THR A 19  ? 0.4225 0.6221 0.8306 0.1181  0.0897  0.0452  161 THR A OG1 
140  C CG2 . THR A 19  ? 0.4431 0.7072 0.9029 0.1386  0.1242  0.0480  161 THR A CG2 
141  N N   . GLU A 20  ? 0.4413 0.5402 0.7442 0.0868  0.1110  -0.0115 162 GLU A N   
142  C CA  . GLU A 20  ? 0.4506 0.5053 0.7153 0.0745  0.1018  -0.0223 162 GLU A CA  
143  C C   . GLU A 20  ? 0.4498 0.4970 0.7212 0.0788  0.0865  -0.0090 162 GLU A C   
144  O O   . GLU A 20  ? 0.4347 0.4720 0.6862 0.0628  0.0707  -0.0098 162 GLU A O   
145  C CB  . GLU A 20  ? 0.4811 0.4891 0.7157 0.0789  0.1209  -0.0411 162 GLU A CB  
146  C CG  . GLU A 20  ? 0.4903 0.5010 0.7061 0.0669  0.1313  -0.0553 162 GLU A CG  
147  C CD  . GLU A 20  ? 0.5325 0.5001 0.7179 0.0712  0.1527  -0.0734 162 GLU A CD  
148  O OE1 . GLU A 20  ? 0.5933 0.5272 0.7743 0.0868  0.1636  -0.0756 162 GLU A OE1 
149  O OE2 . GLU A 20  ? 0.5290 0.4932 0.6908 0.0577  0.1583  -0.0853 162 GLU A OE2 
150  N N   . GLU A 21  ? 0.4704 0.5245 0.7702 0.1012  0.0918  0.0044  163 GLU A N   
151  C CA  . GLU A 21  ? 0.4805 0.5301 0.7894 0.1075  0.0773  0.0209  163 GLU A CA  
152  C C   . GLU A 21  ? 0.4507 0.5376 0.7690 0.0907  0.0529  0.0352  163 GLU A C   
153  O O   . GLU A 21  ? 0.4458 0.5160 0.7447 0.0794  0.0381  0.0383  163 GLU A O   
154  C CB  . GLU A 21  ? 0.5097 0.5666 0.8530 0.1385  0.0887  0.0350  163 GLU A CB  
155  C CG  . GLU A 21  ? 0.5335 0.5758 0.8830 0.1493  0.0761  0.0531  163 GLU A CG  
156  C CD  . GLU A 21  ? 0.5826 0.6233 0.9635 0.1851  0.0904  0.0663  163 GLU A CD  
157  O OE1 . GLU A 21  ? 0.6341 0.6587 1.0159 0.2026  0.1159  0.0541  163 GLU A OE1 
158  O OE2 . GLU A 21  ? 0.6256 0.6795 1.0288 0.1969  0.0767  0.0894  163 GLU A OE2 
159  N N   . ALA A 22  ? 0.4329 0.5684 0.7779 0.0873  0.0495  0.0436  164 ALA A N   
160  C CA  . ALA A 22  ? 0.4149 0.5841 0.7656 0.0690  0.0265  0.0573  164 ALA A CA  
161  C C   . ALA A 22  ? 0.4005 0.5498 0.7111 0.0435  0.0166  0.0438  164 ALA A C   
162  O O   . ALA A 22  ? 0.3919 0.5423 0.6893 0.0296  -0.0016 0.0510  164 ALA A O   
163  C CB  . ALA A 22  ? 0.4041 0.6298 0.7912 0.0681  0.0263  0.0690  164 ALA A CB  
164  N N   . MET A 23  ? 0.4011 0.5319 0.6912 0.0383  0.0289  0.0250  165 MET A N   
165  C CA  . MET A 23  ? 0.3947 0.5053 0.6486 0.0190  0.0218  0.0126  165 MET A CA  
166  C C   . MET A 23  ? 0.3899 0.4662 0.6199 0.0179  0.0177  0.0081  165 MET A C   
167  O O   . MET A 23  ? 0.3764 0.4470 0.5860 0.0048  0.0059  0.0078  165 MET A O   
168  C CB  . MET A 23  ? 0.3959 0.4965 0.6356 0.0155  0.0355  -0.0039 165 MET A CB  
169  C CG  . MET A 23  ? 0.4006 0.4807 0.6056 -0.0001 0.0290  -0.0155 165 MET A CG  
170  S SD  . MET A 23  ? 0.4447 0.5341 0.6390 -0.0121 0.0332  -0.0230 165 MET A SD  
171  C CE  . MET A 23  ? 0.4190 0.5442 0.6310 -0.0232 0.0195  -0.0066 165 MET A CE  
172  N N   . MET A 24  ? 0.3989 0.4512 0.6297 0.0311  0.0287  0.0046  166 MET A N   
173  C CA  . MET A 24  ? 0.4083 0.4290 0.6185 0.0287  0.0258  0.0025  166 MET A CA  
174  C C   . MET A 24  ? 0.4010 0.4294 0.6154 0.0266  0.0101  0.0193  166 MET A C   
175  O O   . MET A 24  ? 0.3961 0.4116 0.5881 0.0150  0.0025  0.0181  166 MET A O   
176  C CB  . MET A 24  ? 0.4346 0.4247 0.6446 0.0430  0.0407  -0.0021 166 MET A CB  
177  C CG  . MET A 24  ? 0.4530 0.4062 0.6371 0.0361  0.0400  -0.0068 166 MET A CG  
178  S SD  . MET A 24  ? 0.5183 0.4255 0.6915 0.0485  0.0593  -0.0164 166 MET A SD  
179  C CE  . MET A 24  ? 0.5434 0.4565 0.7498 0.0761  0.0626  0.0025  166 MET A CE  
180  N N   . ASP A 25  ? 0.3983 0.4498 0.6415 0.0380  0.0058  0.0360  167 ASP A N   
181  C CA  . ASP A 25  ? 0.4031 0.4655 0.6511 0.0355  -0.0112 0.0549  167 ASP A CA  
182  C C   . ASP A 25  ? 0.3813 0.4600 0.6123 0.0142  -0.0263 0.0556  167 ASP A C   
183  O O   . ASP A 25  ? 0.3819 0.4513 0.5933 0.0042  -0.0378 0.0616  167 ASP A O   
184  C CB  . ASP A 25  ? 0.4148 0.5076 0.7027 0.0528  -0.0138 0.0747  167 ASP A CB  
185  C CG  . ASP A 25  ? 0.4574 0.5258 0.7585 0.0779  0.0002  0.0777  167 ASP A CG  
186  O OD1 . ASP A 25  ? 0.4858 0.5099 0.7613 0.0783  0.0102  0.0649  167 ASP A OD1 
187  O OD2 . ASP A 25  ? 0.4896 0.5836 0.8270 0.0973  0.0012  0.0940  167 ASP A OD2 
188  N N   . PHE A 26  ? 0.3605 0.4599 0.5954 0.0066  -0.0255 0.0496  168 PHE A N   
189  C CA  . PHE A 26  ? 0.3529 0.4587 0.5654 -0.0140 -0.0380 0.0481  168 PHE A CA  
190  C C   . PHE A 26  ? 0.3463 0.4207 0.5214 -0.0227 -0.0360 0.0341  168 PHE A C   
191  O O   . PHE A 26  ? 0.3442 0.4116 0.4965 -0.0340 -0.0463 0.0376  168 PHE A O   
192  C CB  . PHE A 26  ? 0.3458 0.4707 0.5644 -0.0211 -0.0349 0.0424  168 PHE A CB  
193  C CG  . PHE A 26  ? 0.3475 0.4704 0.5378 -0.0427 -0.0471 0.0404  168 PHE A CG  
194  C CD1 . PHE A 26  ? 0.3690 0.5100 0.5587 -0.0561 -0.0649 0.0557  168 PHE A CD1 
195  C CD2 . PHE A 26  ? 0.3508 0.4511 0.5125 -0.0497 -0.0412 0.0240  168 PHE A CD2 
196  C CE1 . PHE A 26  ? 0.3822 0.5127 0.5378 -0.0779 -0.0755 0.0523  168 PHE A CE1 
197  C CE2 . PHE A 26  ? 0.3707 0.4606 0.5017 -0.0676 -0.0508 0.0215  168 PHE A CE2 
198  C CZ  . PHE A 26  ? 0.3811 0.4831 0.5064 -0.0824 -0.0673 0.0346  168 PHE A CZ  
199  N N   . PHE A 27  ? 0.3365 0.3941 0.5054 -0.0176 -0.0223 0.0188  169 PHE A N   
200  C CA  . PHE A 27  ? 0.3363 0.3725 0.4762 -0.0242 -0.0193 0.0064  169 PHE A CA  
201  C C   . PHE A 27  ? 0.3424 0.3634 0.4712 -0.0247 -0.0210 0.0107  169 PHE A C   
202  O O   . PHE A 27  ? 0.3497 0.3631 0.4550 -0.0331 -0.0236 0.0075  169 PHE A O   
203  C CB  . PHE A 27  ? 0.3407 0.3680 0.4786 -0.0204 -0.0068 -0.0084 169 PHE A CB  
204  C CG  . PHE A 27  ? 0.3418 0.3749 0.4713 -0.0263 -0.0069 -0.0154 169 PHE A CG  
205  C CD1 . PHE A 27  ? 0.3660 0.3889 0.4701 -0.0332 -0.0097 -0.0221 169 PHE A CD1 
206  C CD2 . PHE A 27  ? 0.3546 0.4027 0.5005 -0.0248 -0.0037 -0.0142 169 PHE A CD2 
207  C CE1 . PHE A 27  ? 0.3660 0.3875 0.4583 -0.0381 -0.0102 -0.0275 169 PHE A CE1 
208  C CE2 . PHE A 27  ? 0.3458 0.3959 0.4802 -0.0328 -0.0044 -0.0194 169 PHE A CE2 
209  C CZ  . PHE A 27  ? 0.3530 0.3870 0.4593 -0.0395 -0.0085 -0.0259 169 PHE A CZ  
210  N N   . ASN A 28  ? 0.3411 0.3560 0.4851 -0.0154 -0.0185 0.0183  170 ASN A N   
211  C CA  . ASN A 28  ? 0.3587 0.3570 0.4908 -0.0178 -0.0210 0.0247  170 ASN A CA  
212  C C   . ASN A 28  ? 0.3716 0.3776 0.4932 -0.0262 -0.0353 0.0385  170 ASN A C   
213  O O   . ASN A 28  ? 0.3812 0.3761 0.4794 -0.0354 -0.0368 0.0385  170 ASN A O   
214  C CB  . ASN A 28  ? 0.3727 0.3544 0.5193 -0.0052 -0.0147 0.0301  170 ASN A CB  
215  C CG  . ASN A 28  ? 0.3643 0.3246 0.5023 -0.0053 -0.0012 0.0147  170 ASN A CG  
216  O OD1 . ASN A 28  ? 0.3338 0.2921 0.4544 -0.0165 0.0008  0.0047  170 ASN A OD1 
217  N ND2 . ASN A 28  ? 0.3336 0.2783 0.4828 0.0071  0.0082  0.0134  170 ASN A ND2 
218  N N   . ALA A 29  ? 0.3681 0.3953 0.5052 -0.0252 -0.0456 0.0499  171 ALA A N   
219  C CA  . ALA A 29  ? 0.3829 0.4185 0.5068 -0.0368 -0.0618 0.0635  171 ALA A CA  
220  C C   . ALA A 29  ? 0.3840 0.4132 0.4734 -0.0527 -0.0637 0.0526  171 ALA A C   
221  O O   . ALA A 29  ? 0.3964 0.4155 0.4582 -0.0634 -0.0697 0.0566  171 ALA A O   
222  C CB  . ALA A 29  ? 0.3821 0.4478 0.5341 -0.0339 -0.0735 0.0794  171 ALA A CB  
223  N N   . GLN A 30  ? 0.3738 0.4059 0.4619 -0.0537 -0.0576 0.0393  172 GLN A N   
224  C CA  . GLN A 30  ? 0.3853 0.4042 0.4391 -0.0646 -0.0565 0.0276  172 GLN A CA  
225  C C   . GLN A 30  ? 0.3890 0.3899 0.4211 -0.0631 -0.0456 0.0176  172 GLN A C   
226  O O   . GLN A 30  ? 0.4061 0.3950 0.4063 -0.0715 -0.0462 0.0146  172 GLN A O   
227  C CB  . GLN A 30  ? 0.3752 0.3973 0.4325 -0.0641 -0.0519 0.0167  172 GLN A CB  
228  C CG  . GLN A 30  ? 0.3860 0.4276 0.4558 -0.0723 -0.0631 0.0259  172 GLN A CG  
229  C CD  . GLN A 30  ? 0.4313 0.4695 0.4733 -0.0908 -0.0785 0.0338  172 GLN A CD  
230  O OE1 . GLN A 30  ? 0.4685 0.4837 0.4748 -0.0971 -0.0783 0.0289  172 GLN A OE1 
231  N NE2 . GLN A 30  ? 0.4282 0.4907 0.4855 -0.1007 -0.0915 0.0465  172 GLN A NE2 
232  N N   . MET A 31  ? 0.3792 0.3789 0.4272 -0.0537 -0.0350 0.0124  173 MET A N   
233  C CA  . MET A 31  ? 0.3854 0.3764 0.4191 -0.0544 -0.0256 0.0060  173 MET A CA  
234  C C   . MET A 31  ? 0.4100 0.3943 0.4246 -0.0628 -0.0302 0.0164  173 MET A C   
235  O O   . MET A 31  ? 0.4173 0.3965 0.4077 -0.0677 -0.0242 0.0114  173 MET A O   
236  C CB  . MET A 31  ? 0.3822 0.3728 0.4352 -0.0478 -0.0169 0.0021  173 MET A CB  
237  C CG  . MET A 31  ? 0.3848 0.3800 0.4493 -0.0417 -0.0104 -0.0098 173 MET A CG  
238  S SD  . MET A 31  ? 0.4278 0.4262 0.4755 -0.0416 -0.0031 -0.0224 173 MET A SD  
239  C CE  . MET A 31  ? 0.3779 0.3809 0.4280 -0.0451 0.0048  -0.0232 173 MET A CE  
240  N N   . ARG A 32  ? 0.4160 0.4009 0.4412 -0.0634 -0.0401 0.0315  174 ARG A N   
241  C CA  . ARG A 32  ? 0.4477 0.4248 0.4533 -0.0724 -0.0467 0.0440  174 ARG A CA  
242  C C   . ARG A 32  ? 0.4606 0.4358 0.4352 -0.0847 -0.0557 0.0463  174 ARG A C   
243  O O   . ARG A 32  ? 0.4767 0.4417 0.4196 -0.0935 -0.0514 0.0442  174 ARG A O   
244  C CB  . ARG A 32  ? 0.4611 0.4377 0.4871 -0.0673 -0.0563 0.0619  174 ARG A CB  
245  C CG  . ARG A 32  ? 0.4834 0.4479 0.5252 -0.0590 -0.0470 0.0611  174 ARG A CG  
246  C CD  . ARG A 32  ? 0.5058 0.4656 0.5690 -0.0484 -0.0552 0.0786  174 ARG A CD  
247  N NE  . ARG A 32  ? 0.5323 0.4716 0.6060 -0.0399 -0.0446 0.0754  174 ARG A NE  
248  C CZ  . ARG A 32  ? 0.5771 0.5028 0.6674 -0.0266 -0.0465 0.0876  174 ARG A CZ  
249  N NH1 . ARG A 32  ? 0.6081 0.5459 0.7132 -0.0185 -0.0597 0.1064  174 ARG A NH1 
250  N NH2 . ARG A 32  ? 0.6065 0.5050 0.6973 -0.0214 -0.0353 0.0817  174 ARG A NH2 
251  N N   . LEU A 33  ? 0.4520 0.4369 0.4338 -0.0869 -0.0674 0.0507  175 LEU A N   
252  C CA  . LEU A 33  ? 0.4779 0.4574 0.4260 -0.1025 -0.0781 0.0527  175 LEU A CA  
253  C C   . LEU A 33  ? 0.4839 0.4448 0.3959 -0.1063 -0.0659 0.0343  175 LEU A C   
254  O O   . LEU A 33  ? 0.5159 0.4605 0.3865 -0.1191 -0.0685 0.0335  175 LEU A O   
255  C CB  . LEU A 33  ? 0.4705 0.4680 0.4368 -0.1064 -0.0929 0.0608  175 LEU A CB  
256  C CG  . LEU A 33  ? 0.4737 0.4932 0.4700 -0.1043 -0.1087 0.0837  175 LEU A CG  
257  C CD1 . LEU A 33  ? 0.4808 0.5270 0.5027 -0.1068 -0.1194 0.0901  175 LEU A CD1 
258  C CD2 . LEU A 33  ? 0.5150 0.5276 0.4814 -0.1191 -0.1231 0.0987  175 LEU A CD2 
259  N N   . GLY A 34  ? 0.4579 0.4195 0.3836 -0.0944 -0.0526 0.0201  176 GLY A N   
260  C CA  . GLY A 34  ? 0.4753 0.4202 0.3724 -0.0924 -0.0399 0.0038  176 GLY A CA  
261  C C   . GLY A 34  ? 0.4821 0.4245 0.3689 -0.0866 -0.0236 -0.0024 176 GLY A C   
262  O O   . GLY A 34  ? 0.4989 0.4298 0.3628 -0.0819 -0.0113 -0.0144 176 GLY A O   
263  N N   . GLY A 35  ? 0.4776 0.4309 0.3813 -0.0868 -0.0228 0.0066  177 GLY A N   
264  C CA  . GLY A 35  ? 0.4862 0.4430 0.3832 -0.0852 -0.0081 0.0034  177 GLY A CA  
265  C C   . GLY A 35  ? 0.4650 0.4359 0.3853 -0.0728 0.0051  -0.0070 177 GLY A C   
266  O O   . GLY A 35  ? 0.4734 0.4515 0.3855 -0.0699 0.0193  -0.0124 177 GLY A O   
267  N N   . LEU A 36  ? 0.4392 0.4171 0.3889 -0.0660 0.0009  -0.0088 178 LEU A N   
268  C CA  . LEU A 36  ? 0.4223 0.4139 0.3927 -0.0564 0.0105  -0.0175 178 LEU A CA  
269  C C   . LEU A 36  ? 0.4138 0.4164 0.4076 -0.0594 0.0122  -0.0129 178 LEU A C   
270  O O   . LEU A 36  ? 0.4076 0.4246 0.4155 -0.0559 0.0193  -0.0185 178 LEU A O   
271  C CB  . LEU A 36  ? 0.4056 0.3946 0.3867 -0.0492 0.0061  -0.0238 178 LEU A CB  
272  C CG  . LEU A 36  ? 0.4243 0.3969 0.3802 -0.0482 0.0038  -0.0291 178 LEU A CG  
273  C CD1 . LEU A 36  ? 0.4119 0.3838 0.3813 -0.0439 -0.0005 -0.0331 178 LEU A CD1 
274  C CD2 . LEU A 36  ? 0.4313 0.3976 0.3631 -0.0411 0.0166  -0.0375 178 LEU A CD2 
275  N N   . THR A 37  ? 0.4253 0.4192 0.4215 -0.0665 0.0049  -0.0021 179 THR A N   
276  C CA  A THR A 37  ? 0.4266 0.4203 0.4366 -0.0713 0.0067  0.0024  179 THR A CA  
277  C CA  B THR A 37  ? 0.4266 0.4201 0.4363 -0.0715 0.0066  0.0027  179 THR A CA  
278  C C   . THR A 37  ? 0.4420 0.4453 0.4404 -0.0809 0.0158  0.0045  179 THR A C   
279  O O   . THR A 37  ? 0.4594 0.4618 0.4357 -0.0854 0.0180  0.0079  179 THR A O   
280  C CB  A THR A 37  ? 0.4403 0.4167 0.4542 -0.0731 -0.0033 0.0150  179 THR A CB  
281  C CB  B THR A 37  ? 0.4416 0.4177 0.4536 -0.0741 -0.0034 0.0159  179 THR A CB  
282  O OG1 A THR A 37  ? 0.4407 0.4161 0.4672 -0.0641 -0.0110 0.0151  179 THR A OG1 
283  O OG1 B THR A 37  ? 0.4574 0.4283 0.4478 -0.0801 -0.0098 0.0252  179 THR A OG1 
284  C CG2 A THR A 37  ? 0.4381 0.4041 0.4629 -0.0764 -0.0005 0.0172  179 THR A CG2 
285  C CG2 B THR A 37  ? 0.4333 0.4061 0.4650 -0.0637 -0.0097 0.0154  179 THR A CG2 
286  N N   . GLN A 38  ? 0.4373 0.4503 0.4489 -0.0859 0.0212  0.0026  180 GLN A N   
287  C CA  . GLN A 38  ? 0.4540 0.4838 0.4604 -0.0974 0.0303  0.0056  180 GLN A CA  
288  C C   . GLN A 38  ? 0.4675 0.4809 0.4699 -0.1132 0.0274  0.0160  180 GLN A C   
289  O O   . GLN A 38  ? 0.4821 0.5096 0.4813 -0.1269 0.0343  0.0196  180 GLN A O   
290  C CB  . GLN A 38  ? 0.4392 0.4991 0.4633 -0.0946 0.0379  -0.0026 180 GLN A CB  
291  C CG  . GLN A 38  ? 0.4411 0.5103 0.4678 -0.0768 0.0402  -0.0121 180 GLN A CG  
292  C CD  . GLN A 38  ? 0.4401 0.5429 0.4847 -0.0716 0.0473  -0.0170 180 GLN A CD  
293  O OE1 . GLN A 38  ? 0.4777 0.5941 0.5198 -0.0579 0.0549  -0.0213 180 GLN A OE1 
294  N NE2 . GLN A 38  ? 0.4631 0.5780 0.5239 -0.0824 0.0445  -0.0156 180 GLN A NE2 
295  N N   . ALA A 39  ? 0.4709 0.4546 0.4732 -0.1110 0.0179  0.0216  181 ALA A N   
296  C CA  . ALA A 39  ? 0.5042 0.4622 0.4972 -0.1236 0.0148  0.0329  181 ALA A CA  
297  C C   . ALA A 39  ? 0.5173 0.4446 0.5105 -0.1137 0.0043  0.0415  181 ALA A C   
298  O O   . ALA A 39  ? 0.4954 0.4251 0.5017 -0.0986 0.0001  0.0371  181 ALA A O   
299  C CB  . ALA A 39  ? 0.5016 0.4565 0.5019 -0.1346 0.0187  0.0284  181 ALA A CB  
300  N N   . PRO A 40  ? 0.5559 0.4554 0.5354 -0.1220 0.0002  0.0554  182 PRO A N   
301  C CA  . PRO A 40  ? 0.5741 0.4453 0.5585 -0.1092 -0.0092 0.0655  182 PRO A CA  
302  C C   . PRO A 40  ? 0.5698 0.4285 0.5731 -0.0963 -0.0063 0.0559  182 PRO A C   
303  O O   . PRO A 40  ? 0.5726 0.4261 0.5751 -0.1046 0.0011  0.0457  182 PRO A O   
304  C CB  . PRO A 40  ? 0.6201 0.4589 0.5837 -0.1222 -0.0116 0.0808  182 PRO A CB  
305  C CG  . PRO A 40  ? 0.6245 0.4834 0.5695 -0.1420 -0.0061 0.0818  182 PRO A CG  
306  C CD  . PRO A 40  ? 0.5837 0.4770 0.5429 -0.1428 0.0039  0.0640  182 PRO A CD  
307  N N   . GLY A 41  ? 0.5667 0.4224 0.5861 -0.0774 -0.0120 0.0596  183 GLY A N   
308  C CA  . GLY A 41  ? 0.5594 0.4019 0.5953 -0.0633 -0.0070 0.0511  183 GLY A CA  
309  C C   . GLY A 41  ? 0.5185 0.3928 0.5724 -0.0541 -0.0058 0.0394  183 GLY A C   
310  O O   . GLY A 41  ? 0.5068 0.4082 0.5588 -0.0580 -0.0094 0.0381  183 GLY A O   
311  N N   . ASN A 42  ? 0.5114 0.3781 0.5787 -0.0426 0.0003  0.0306  184 ASN A N   
312  C CA  . ASN A 42  ? 0.4748 0.3676 0.5586 -0.0337 0.0017  0.0209  184 ASN A CA  
313  C C   . ASN A 42  ? 0.4471 0.3505 0.5250 -0.0433 0.0083  0.0043  184 ASN A C   
314  O O   . ASN A 42  ? 0.4611 0.3449 0.5315 -0.0488 0.0150  -0.0033 184 ASN A O   
315  C CB  . ASN A 42  ? 0.4844 0.3665 0.5867 -0.0150 0.0062  0.0216  184 ASN A CB  
316  C CG  . ASN A 42  ? 0.5111 0.3995 0.6297 -0.0015 -0.0025 0.0401  184 ASN A CG  
317  O OD1 . ASN A 42  ? 0.5186 0.4297 0.6379 -0.0063 -0.0139 0.0496  184 ASN A OD1 
318  N ND2 . ASN A 42  ? 0.5664 0.4344 0.6971 0.0159  0.0030  0.0457  184 ASN A ND2 
319  N N   . PRO A 43  ? 0.4126 0.3445 0.4916 -0.0456 0.0060  -0.0006 185 PRO A N   
320  C CA  . PRO A 43  ? 0.3959 0.3414 0.4730 -0.0506 0.0109  -0.0140 185 PRO A CA  
321  C C   . PRO A 43  ? 0.3858 0.3275 0.4711 -0.0436 0.0158  -0.0240 185 PRO A C   
322  O O   . PRO A 43  ? 0.3809 0.3233 0.4605 -0.0508 0.0195  -0.0334 185 PRO A O   
323  C CB  . PRO A 43  ? 0.3745 0.3442 0.4494 -0.0497 0.0073  -0.0146 185 PRO A CB  
324  C CG  . PRO A 43  ? 0.3898 0.3571 0.4586 -0.0506 0.0009  -0.0026 185 PRO A CG  
325  C CD  . PRO A 43  ? 0.4106 0.3600 0.4887 -0.0443 -0.0019 0.0067  185 PRO A CD  
326  N N   . VAL A 44  ? 0.3809 0.3224 0.4792 -0.0310 0.0156  -0.0213 186 VAL A N   
327  C CA  . VAL A 44  ? 0.3791 0.3180 0.4841 -0.0242 0.0226  -0.0304 186 VAL A CA  
328  C C   . VAL A 44  ? 0.4084 0.3165 0.5126 -0.0180 0.0309  -0.0309 186 VAL A C   
329  O O   . VAL A 44  ? 0.4245 0.3231 0.5384 -0.0074 0.0302  -0.0201 186 VAL A O   
330  C CB  . VAL A 44  ? 0.3633 0.3230 0.4841 -0.0150 0.0201  -0.0273 186 VAL A CB  
331  C CG1 . VAL A 44  ? 0.3573 0.3153 0.4833 -0.0092 0.0297  -0.0367 186 VAL A CG1 
332  C CG2 . VAL A 44  ? 0.3361 0.3158 0.4504 -0.0214 0.0126  -0.0279 186 VAL A CG2 
333  N N   . LEU A 45  ? 0.4248 0.3153 0.5152 -0.0245 0.0384  -0.0431 187 LEU A N   
334  C CA  . LEU A 45  ? 0.4650 0.3154 0.5440 -0.0213 0.0483  -0.0470 187 LEU A CA  
335  C C   . LEU A 45  ? 0.4726 0.3165 0.5593 -0.0059 0.0602  -0.0533 187 LEU A C   
336  O O   . LEU A 45  ? 0.5098 0.3216 0.5934 0.0058  0.0705  -0.0533 187 LEU A O   
337  C CB  . LEU A 45  ? 0.4838 0.3142 0.5364 -0.0415 0.0497  -0.0574 187 LEU A CB  
338  C CG  . LEU A 45  ? 0.4913 0.3290 0.5354 -0.0598 0.0410  -0.0519 187 LEU A CG  
339  C CD1 . LEU A 45  ? 0.5177 0.3412 0.5387 -0.0815 0.0418  -0.0615 187 LEU A CD1 
340  C CD2 . LEU A 45  ? 0.5269 0.3425 0.5692 -0.0572 0.0391  -0.0392 187 LEU A CD2 
341  N N   . ALA A 46  ? 0.4472 0.3191 0.5415 -0.0057 0.0603  -0.0587 188 ALA A N   
342  C CA  . ALA A 46  ? 0.4514 0.3221 0.5516 0.0060  0.0732  -0.0652 188 ALA A CA  
343  C C   . ALA A 46  ? 0.4158 0.3233 0.5269 0.0041  0.0694  -0.0663 188 ALA A C   
344  O O   . ALA A 46  ? 0.3869 0.3120 0.4931 -0.0074 0.0583  -0.0661 188 ALA A O   
345  C CB  . ALA A 46  ? 0.4903 0.3234 0.5610 -0.0012 0.0849  -0.0805 188 ALA A CB  
346  N N   . VAL A 47  ? 0.4183 0.3359 0.5438 0.0162  0.0799  -0.0666 189 VAL A N   
347  C CA  . VAL A 47  ? 0.3930 0.3417 0.5270 0.0133  0.0783  -0.0668 189 VAL A CA  
348  C C   . VAL A 47  ? 0.4135 0.3538 0.5406 0.0178  0.0961  -0.0774 189 VAL A C   
349  O O   . VAL A 47  ? 0.4369 0.3617 0.5702 0.0326  0.1112  -0.0785 189 VAL A O   
350  C CB  . VAL A 47  ? 0.3776 0.3603 0.5428 0.0214  0.0713  -0.0515 189 VAL A CB  
351  C CG1 . VAL A 47  ? 0.3542 0.3650 0.5240 0.0144  0.0694  -0.0515 189 VAL A CG1 
352  C CG2 . VAL A 47  ? 0.3511 0.3379 0.5176 0.0164  0.0547  -0.0413 189 VAL A CG2 
353  N N   . GLN A 48  ? 0.4043 0.3520 0.5161 0.0058  0.0954  -0.0848 190 GLN A N   
354  C CA  . GLN A 48  ? 0.4281 0.3704 0.5292 0.0070  0.1123  -0.0945 190 GLN A CA  
355  C C   . GLN A 48  ? 0.3964 0.3734 0.5106 0.0033  0.1101  -0.0889 190 GLN A C   
356  O O   . GLN A 48  ? 0.3694 0.3557 0.4747 -0.0092 0.0956  -0.0868 190 GLN A O   
357  C CB  . GLN A 48  ? 0.4509 0.3657 0.5130 -0.0087 0.1128  -0.1083 190 GLN A CB  
358  C CG  . GLN A 48  ? 0.5003 0.3767 0.5413 -0.0121 0.1143  -0.1153 190 GLN A CG  
359  C CD  . GLN A 48  ? 0.5156 0.3787 0.5232 -0.0338 0.1050  -0.1237 190 GLN A CD  
360  O OE1 . GLN A 48  ? 0.5358 0.4222 0.5458 -0.0430 0.0894  -0.1187 190 GLN A OE1 
361  N NE2 . GLN A 48  ? 0.5872 0.4121 0.5628 -0.0417 0.1142  -0.1357 190 GLN A NE2 
362  N N   . ILE A 49  ? 0.4006 0.3953 0.5342 0.0139  0.1253  -0.0862 191 ILE A N   
363  C CA  . ILE A 49  ? 0.3849 0.4151 0.5324 0.0076  0.1237  -0.0791 191 ILE A CA  
364  C C   . ILE A 49  ? 0.4030 0.4315 0.5333 0.0026  0.1411  -0.0884 191 ILE A C   
365  O O   . ILE A 49  ? 0.4228 0.4382 0.5499 0.0138  0.1625  -0.0964 191 ILE A O   
366  C CB  . ILE A 49  ? 0.3703 0.4385 0.5619 0.0201  0.1243  -0.0632 191 ILE A CB  
367  C CG1 . ILE A 49  ? 0.3573 0.4301 0.5601 0.0192  0.1032  -0.0523 191 ILE A CG1 
368  C CG2 . ILE A 49  ? 0.3559 0.4617 0.5611 0.0105  0.1249  -0.0559 191 ILE A CG2 
369  C CD1 . ILE A 49  ? 0.3488 0.4607 0.5932 0.0288  0.0994  -0.0343 191 ILE A CD1 
370  N N   . ASN A 50  ? 0.3928 0.4310 0.5086 -0.0144 0.1324  -0.0873 192 ASN A N   
371  C CA  . ASN A 50  ? 0.4114 0.4575 0.5149 -0.0221 0.1466  -0.0912 192 ASN A CA  
372  C C   . ASN A 50  ? 0.3986 0.4892 0.5350 -0.0238 0.1472  -0.0773 192 ASN A C   
373  O O   . ASN A 50  ? 0.3725 0.4746 0.5084 -0.0375 0.1295  -0.0687 192 ASN A O   
374  C CB  . ASN A 50  ? 0.4143 0.4403 0.4778 -0.0412 0.1354  -0.0968 192 ASN A CB  
375  C CG  . ASN A 50  ? 0.4392 0.4672 0.4820 -0.0515 0.1504  -0.1013 192 ASN A CG  
376  O OD1 . ASN A 50  ? 0.4249 0.4826 0.4877 -0.0518 0.1610  -0.0946 192 ASN A OD1 
377  N ND2 . ASN A 50  ? 0.4666 0.4651 0.4685 -0.0616 0.1509  -0.1117 192 ASN A ND2 
378  N N   . GLN A 51  ? 0.4152 0.5301 0.5788 -0.0103 0.1683  -0.0748 193 GLN A N   
379  C CA  . GLN A 51  ? 0.4087 0.5756 0.6122 -0.0111 0.1695  -0.0590 193 GLN A CA  
380  C C   . GLN A 51  ? 0.4158 0.5982 0.6041 -0.0333 0.1712  -0.0570 193 GLN A C   
381  O O   . GLN A 51  ? 0.4090 0.6214 0.6128 -0.0474 0.1583  -0.0437 193 GLN A O   
382  C CB  . GLN A 51  ? 0.4282 0.6222 0.6697 0.0133  0.1942  -0.0556 193 GLN A CB  
383  C CG  . GLN A 51  ? 0.4616 0.6243 0.7055 0.0376  0.2011  -0.0620 193 GLN A CG  
384  C CD  . GLN A 51  ? 0.4710 0.6683 0.7660 0.0585  0.1996  -0.0452 193 GLN A CD  
385  O OE1 . GLN A 51  ? 0.4687 0.6653 0.7729 0.0571  0.1770  -0.0361 193 GLN A OE1 
386  N NE2 . GLN A 51  ? 0.4828 0.7127 0.8119 0.0787  0.2239  -0.0400 193 GLN A NE2 
387  N N   . ASP A 52  ? 0.4405 0.6001 0.5950 -0.0384 0.1870  -0.0698 194 ASP A N   
388  C CA  . ASP A 52  ? 0.4500 0.6182 0.5833 -0.0605 0.1897  -0.0681 194 ASP A CA  
389  C C   . ASP A 52  ? 0.4296 0.5827 0.5394 -0.0821 0.1617  -0.0621 194 ASP A C   
390  O O   . ASP A 52  ? 0.4263 0.6017 0.5396 -0.0998 0.1562  -0.0514 194 ASP A O   
391  C CB  . ASP A 52  ? 0.4925 0.6305 0.5853 -0.0626 0.2098  -0.0838 194 ASP A CB  
392  C CG  . ASP A 52  ? 0.5460 0.6980 0.6579 -0.0419 0.2430  -0.0901 194 ASP A CG  
393  O OD1 . ASP A 52  ? 0.5796 0.7404 0.7256 -0.0185 0.2479  -0.0880 194 ASP A OD1 
394  O OD2 . ASP A 52  ? 0.6219 0.7743 0.7131 -0.0479 0.2654  -0.0969 194 ASP A OD2 
395  N N   . LYS A 53  ? 0.4133 0.5296 0.5004 -0.0800 0.1447  -0.0682 195 LYS A N   
396  C CA  . LYS A 53  ? 0.4031 0.4988 0.4645 -0.0953 0.1208  -0.0639 195 LYS A CA  
397  C C   . LYS A 53  ? 0.3715 0.4705 0.4513 -0.0911 0.1013  -0.0564 195 LYS A C   
398  O O   . LYS A 53  ? 0.3627 0.4390 0.4201 -0.0986 0.0834  -0.0549 195 LYS A O   
399  C CB  . LYS A 53  ? 0.4113 0.4664 0.4310 -0.0975 0.1154  -0.0745 195 LYS A CB  
400  C CG  . LYS A 53  ? 0.4497 0.4955 0.4393 -0.1076 0.1304  -0.0809 195 LYS A CG  
401  C CD  . LYS A 53  ? 0.4673 0.4771 0.4173 -0.1107 0.1229  -0.0897 195 LYS A CD  
402  C CE  . LYS A 53  ? 0.4693 0.4613 0.3987 -0.1189 0.0985  -0.0824 195 LYS A CE  
403  N NZ  . LYS A 53  ? 0.4972 0.4622 0.3884 -0.1243 0.0915  -0.0876 195 LYS A NZ  
404  N N   . ASN A 54  ? 0.3597 0.4849 0.4780 -0.0778 0.1053  -0.0515 196 ASN A N   
405  C CA  . ASN A 54  ? 0.3436 0.4768 0.4791 -0.0768 0.0873  -0.0424 196 ASN A CA  
406  C C   . ASN A 54  ? 0.3353 0.4343 0.4497 -0.0729 0.0716  -0.0476 196 ASN A C   
407  O O   . ASN A 54  ? 0.3254 0.4161 0.4293 -0.0816 0.0548  -0.0423 196 ASN A O   
408  C CB  . ASN A 54  ? 0.3559 0.5059 0.4903 -0.0979 0.0760  -0.0307 196 ASN A CB  
409  C CG  . ASN A 54  ? 0.3684 0.5534 0.5385 -0.0978 0.0676  -0.0173 196 ASN A CG  
410  O OD1 . ASN A 54  ? 0.4223 0.6461 0.6318 -0.0868 0.0794  -0.0109 196 ASN A OD1 
411  N ND2 . ASN A 54  ? 0.3825 0.5546 0.5382 -0.1100 0.0473  -0.0120 196 ASN A ND2 
412  N N   . PHE A 55  ? 0.3284 0.4075 0.4355 -0.0606 0.0778  -0.0578 197 PHE A N   
413  C CA  . PHE A 55  ? 0.3173 0.3723 0.4105 -0.0566 0.0648  -0.0614 197 PHE A CA  
414  C C   . PHE A 55  ? 0.3118 0.3595 0.4162 -0.0420 0.0719  -0.0670 197 PHE A C   
415  O O   . PHE A 55  ? 0.3090 0.3597 0.4224 -0.0342 0.0883  -0.0712 197 PHE A O   
416  C CB  . PHE A 55  ? 0.3278 0.3571 0.3849 -0.0649 0.0583  -0.0672 197 PHE A CB  
417  C CG  . PHE A 55  ? 0.3438 0.3599 0.3838 -0.0644 0.0694  -0.0774 197 PHE A CG  
418  C CD1 . PHE A 55  ? 0.3433 0.3442 0.3771 -0.0582 0.0686  -0.0846 197 PHE A CD1 
419  C CD2 . PHE A 55  ? 0.3717 0.3893 0.3980 -0.0730 0.0804  -0.0795 197 PHE A CD2 
420  C CE1 . PHE A 55  ? 0.3721 0.3575 0.3844 -0.0617 0.0773  -0.0942 197 PHE A CE1 
421  C CE2 . PHE A 55  ? 0.3836 0.3854 0.3876 -0.0749 0.0905  -0.0896 197 PHE A CE2 
422  C CZ  . PHE A 55  ? 0.3861 0.3707 0.3820 -0.0697 0.0883  -0.0972 197 PHE A CZ  
423  N N   . ALA A 56  ? 0.3035 0.3394 0.4049 -0.0387 0.0604  -0.0667 198 ALA A N   
424  C CA  . ALA A 56  ? 0.3076 0.3321 0.4151 -0.0285 0.0643  -0.0705 198 ALA A CA  
425  C C   . ALA A 56  ? 0.3044 0.3097 0.3906 -0.0324 0.0549  -0.0758 198 ALA A C   
426  O O   . ALA A 56  ? 0.2937 0.2978 0.3665 -0.0386 0.0443  -0.0743 198 ALA A O   
427  C CB  . ALA A 56  ? 0.2968 0.3359 0.4316 -0.0200 0.0600  -0.0601 198 ALA A CB  
428  N N   . PHE A 57  ? 0.3193 0.3094 0.4020 -0.0290 0.0600  -0.0817 199 PHE A N   
429  C CA  . PHE A 57  ? 0.3229 0.3027 0.3939 -0.0331 0.0511  -0.0838 199 PHE A CA  
430  C C   . PHE A 57  ? 0.3262 0.3016 0.4110 -0.0267 0.0509  -0.0797 199 PHE A C   
431  O O   . PHE A 57  ? 0.3381 0.3032 0.4300 -0.0196 0.0614  -0.0810 199 PHE A O   
432  C CB  . PHE A 57  ? 0.3476 0.3112 0.3950 -0.0415 0.0545  -0.0937 199 PHE A CB  
433  C CG  . PHE A 57  ? 0.3465 0.3149 0.3768 -0.0495 0.0469  -0.0942 199 PHE A CG  
434  C CD1 . PHE A 57  ? 0.3378 0.3124 0.3629 -0.0528 0.0343  -0.0912 199 PHE A CD1 
435  C CD2 . PHE A 57  ? 0.3643 0.3328 0.3849 -0.0526 0.0526  -0.0961 199 PHE A CD2 
436  C CE1 . PHE A 57  ? 0.3462 0.3245 0.3568 -0.0567 0.0267  -0.0894 199 PHE A CE1 
437  C CE2 . PHE A 57  ? 0.3665 0.3357 0.3689 -0.0596 0.0444  -0.0946 199 PHE A CE2 
438  C CZ  . PHE A 57  ? 0.3461 0.3192 0.3438 -0.0605 0.0309  -0.0909 199 PHE A CZ  
439  N N   . LEU A 58  ? 0.3144 0.2962 0.4014 -0.0280 0.0401  -0.0740 200 LEU A N   
440  C CA  . LEU A 58  ? 0.3190 0.2953 0.4137 -0.0252 0.0382  -0.0691 200 LEU A CA  
441  C C   . LEU A 58  ? 0.3296 0.2942 0.4099 -0.0339 0.0370  -0.0742 200 LEU A C   
442  O O   . LEU A 58  ? 0.3226 0.2952 0.3929 -0.0406 0.0318  -0.0771 200 LEU A O   
443  C CB  . LEU A 58  ? 0.3012 0.2908 0.4017 -0.0246 0.0280  -0.0603 200 LEU A CB  
444  C CG  . LEU A 58  ? 0.3032 0.3068 0.4131 -0.0222 0.0240  -0.0535 200 LEU A CG  
445  C CD1 . LEU A 58  ? 0.2886 0.2963 0.3931 -0.0248 0.0141  -0.0473 200 LEU A CD1 
446  C CD2 . LEU A 58  ? 0.2982 0.3079 0.4290 -0.0145 0.0291  -0.0473 200 LEU A CD2 
447  N N   . GLU A 59  ? 0.3494 0.2962 0.4292 -0.0341 0.0409  -0.0737 201 GLU A N   
448  C CA  . GLU A 59  ? 0.3667 0.3015 0.4319 -0.0466 0.0391  -0.0770 201 GLU A CA  
449  C C   . GLU A 59  ? 0.3573 0.2941 0.4287 -0.0476 0.0341  -0.0678 201 GLU A C   
450  O O   . GLU A 59  ? 0.3588 0.2837 0.4379 -0.0395 0.0364  -0.0616 201 GLU A O   
451  C CB  . GLU A 59  ? 0.4023 0.3037 0.4520 -0.0496 0.0494  -0.0854 201 GLU A CB  
452  C CG  . GLU A 59  ? 0.4464 0.3274 0.4768 -0.0664 0.0477  -0.0886 201 GLU A CG  
453  C CD  . GLU A 59  ? 0.5184 0.3544 0.5273 -0.0681 0.0597  -0.0976 201 GLU A CD  
454  O OE1 . GLU A 59  ? 0.6076 0.4154 0.5992 -0.0802 0.0597  -0.0983 201 GLU A OE1 
455  O OE2 . GLU A 59  ? 0.5902 0.4166 0.5970 -0.0575 0.0704  -0.1041 201 GLU A OE2 
456  N N   . PHE A 60  ? 0.3433 0.2973 0.4120 -0.0569 0.0275  -0.0658 202 PHE A N   
457  C CA  . PHE A 60  ? 0.3406 0.3004 0.4127 -0.0595 0.0239  -0.0570 202 PHE A CA  
458  C C   . PHE A 60  ? 0.3590 0.3069 0.4202 -0.0755 0.0243  -0.0568 202 PHE A C   
459  O O   . PHE A 60  ? 0.3711 0.3157 0.4221 -0.0875 0.0245  -0.0634 202 PHE A O   
460  C CB  . PHE A 60  ? 0.3198 0.3090 0.3964 -0.0575 0.0191  -0.0540 202 PHE A CB  
461  C CG  . PHE A 60  ? 0.3099 0.3050 0.3914 -0.0455 0.0173  -0.0525 202 PHE A CG  
462  C CD1 . PHE A 60  ? 0.3121 0.3096 0.3944 -0.0419 0.0145  -0.0451 202 PHE A CD1 
463  C CD2 . PHE A 60  ? 0.3058 0.3027 0.3871 -0.0410 0.0177  -0.0579 202 PHE A CD2 
464  C CE1 . PHE A 60  ? 0.2999 0.3008 0.3825 -0.0354 0.0112  -0.0435 202 PHE A CE1 
465  C CE2 . PHE A 60  ? 0.2919 0.2926 0.3750 -0.0342 0.0154  -0.0558 202 PHE A CE2 
466  C CZ  . PHE A 60  ? 0.3017 0.3042 0.3853 -0.0321 0.0117  -0.0488 202 PHE A CZ  
467  N N   . ARG A 61  ? 0.3645 0.3059 0.4252 -0.0784 0.0234  -0.0483 203 ARG A N   
468  C CA  . ARG A 61  ? 0.3888 0.3174 0.4373 -0.0965 0.0235  -0.0462 203 ARG A CA  
469  C C   . ARG A 61  ? 0.3748 0.3392 0.4261 -0.1104 0.0201  -0.0447 203 ARG A C   
470  O O   . ARG A 61  ? 0.3900 0.3507 0.4317 -0.1303 0.0192  -0.0446 203 ARG A O   
471  C CB  . ARG A 61  ? 0.4071 0.3155 0.4519 -0.0958 0.0235  -0.0356 203 ARG A CB  
472  C CG  . ARG A 61  ? 0.3858 0.3211 0.4381 -0.0925 0.0201  -0.0267 203 ARG A CG  
473  C CD  . ARG A 61  ? 0.4109 0.3241 0.4554 -0.0946 0.0187  -0.0150 203 ARG A CD  
474  N NE  . ARG A 61  ? 0.3979 0.3319 0.4452 -0.0899 0.0155  -0.0072 203 ARG A NE  
475  C CZ  . ARG A 61  ? 0.4091 0.3299 0.4488 -0.0908 0.0122  0.0049  203 ARG A CZ  
476  N NH1 . ARG A 61  ? 0.4456 0.3313 0.4766 -0.0940 0.0116  0.0118  203 ARG A NH1 
477  N NH2 . ARG A 61  ? 0.4154 0.3543 0.4523 -0.0885 0.0094  0.0103  203 ARG A NH2 
478  N N   . SER A 62  ? 0.3453 0.3435 0.4093 -0.1003 0.0188  -0.0430 204 SER A N   
479  C CA  . SER A 62  ? 0.3386 0.3757 0.4101 -0.1079 0.0178  -0.0396 204 SER A CA  
480  C C   . SER A 62  ? 0.3170 0.3818 0.3989 -0.0941 0.0166  -0.0428 204 SER A C   
481  O O   . SER A 62  ? 0.3040 0.3577 0.3853 -0.0793 0.0165  -0.0463 204 SER A O   
482  C CB  . SER A 62  ? 0.3429 0.3895 0.4145 -0.1100 0.0208  -0.0307 204 SER A CB  
483  O OG  . SER A 62  ? 0.3315 0.3844 0.4054 -0.0928 0.0224  -0.0296 204 SER A OG  
484  N N   . VAL A 63  ? 0.3158 0.4170 0.4073 -0.0996 0.0153  -0.0402 205 VAL A N   
485  C CA  . VAL A 63  ? 0.3006 0.4294 0.4024 -0.0849 0.0141  -0.0408 205 VAL A CA  
486  C C   . VAL A 63  ? 0.2952 0.4277 0.3977 -0.0653 0.0197  -0.0393 205 VAL A C   
487  O O   . VAL A 63  ? 0.2873 0.4120 0.3865 -0.0503 0.0188  -0.0429 205 VAL A O   
488  C CB  . VAL A 63  ? 0.3043 0.4785 0.4211 -0.0949 0.0112  -0.0349 205 VAL A CB  
489  C CG1 . VAL A 63  ? 0.2877 0.4933 0.4181 -0.0744 0.0118  -0.0321 205 VAL A CG1 
490  C CG2 . VAL A 63  ? 0.3087 0.4773 0.4188 -0.1156 0.0028  -0.0376 205 VAL A CG2 
491  N N   . ASP A 64  ? 0.3008 0.4423 0.4033 -0.0674 0.0258  -0.0342 206 ASP A N   
492  C CA  . ASP A 64  ? 0.3044 0.4475 0.4011 -0.0518 0.0327  -0.0336 206 ASP A CA  
493  C C   . ASP A 64  ? 0.3075 0.4131 0.3878 -0.0457 0.0304  -0.0370 206 ASP A C   
494  O O   . ASP A 64  ? 0.3054 0.4033 0.3761 -0.0324 0.0325  -0.0396 206 ASP A O   
495  C CB  . ASP A 64  ? 0.3150 0.4775 0.4121 -0.0586 0.0412  -0.0272 206 ASP A CB  
496  C CG  . ASP A 64  ? 0.3316 0.5444 0.4496 -0.0600 0.0462  -0.0219 206 ASP A CG  
497  O OD1 . ASP A 64  ? 0.3604 0.5947 0.4809 -0.0669 0.0548  -0.0160 206 ASP A OD1 
498  O OD2 . ASP A 64  ? 0.3396 0.5742 0.4725 -0.0549 0.0416  -0.0220 206 ASP A OD2 
499  N N   . GLU A 65  ? 0.3107 0.3930 0.3873 -0.0558 0.0260  -0.0359 207 GLU A N   
500  C CA  . GLU A 65  ? 0.3176 0.3725 0.3852 -0.0506 0.0222  -0.0365 207 GLU A CA  
501  C C   . GLU A 65  ? 0.3067 0.3540 0.3760 -0.0418 0.0187  -0.0427 207 GLU A C   
502  O O   . GLU A 65  ? 0.3043 0.3392 0.3659 -0.0355 0.0163  -0.0432 207 GLU A O   
503  C CB  . GLU A 65  ? 0.3283 0.3626 0.3952 -0.0598 0.0194  -0.0318 207 GLU A CB  
504  C CG  . GLU A 65  ? 0.3489 0.3822 0.4068 -0.0679 0.0213  -0.0234 207 GLU A CG  
505  C CD  . GLU A 65  ? 0.3743 0.3840 0.4299 -0.0769 0.0183  -0.0168 207 GLU A CD  
506  O OE1 . GLU A 65  ? 0.3957 0.3949 0.4557 -0.0821 0.0184  -0.0199 207 GLU A OE1 
507  O OE2 . GLU A 65  ? 0.3846 0.3830 0.4305 -0.0790 0.0160  -0.0081 207 GLU A OE2 
508  N N   . THR A 66  ? 0.3040 0.3587 0.3808 -0.0439 0.0176  -0.0466 208 THR A N   
509  C CA  . THR A 66  ? 0.3004 0.3499 0.3761 -0.0370 0.0150  -0.0517 208 THR A CA  
510  C C   . THR A 66  ? 0.3075 0.3623 0.3762 -0.0248 0.0158  -0.0522 208 THR A C   
511  O O   . THR A 66  ? 0.3036 0.3430 0.3634 -0.0194 0.0136  -0.0544 208 THR A O   
512  C CB  . THR A 66  ? 0.2972 0.3551 0.3774 -0.0439 0.0130  -0.0550 208 THR A CB  
513  O OG1 . THR A 66  ? 0.2890 0.3332 0.3687 -0.0558 0.0138  -0.0560 208 THR A OG1 
514  C CG2 . THR A 66  ? 0.2970 0.3468 0.3722 -0.0385 0.0105  -0.0595 208 THR A CG2 
515  N N   . THR A 67  ? 0.3113 0.3868 0.3831 -0.0205 0.0199  -0.0498 209 THR A N   
516  C CA  . THR A 67  ? 0.3267 0.4036 0.3900 -0.0053 0.0235  -0.0505 209 THR A CA  
517  C C   . THR A 67  ? 0.3461 0.3985 0.3888 -0.0021 0.0259  -0.0518 209 THR A C   
518  O O   . THR A 67  ? 0.3569 0.3893 0.3832 0.0059  0.0251  -0.0549 209 THR A O   
519  C CB  . THR A 67  ? 0.3261 0.4367 0.4017 0.0007  0.0301  -0.0464 209 THR A CB  
520  O OG1 . THR A 67  ? 0.3184 0.4534 0.4114 -0.0048 0.0247  -0.0440 209 THR A OG1 
521  C CG2 . THR A 67  ? 0.3386 0.4465 0.4039 0.0215  0.0370  -0.0473 209 THR A CG2 
522  N N   . GLN A 68  ? 0.3596 0.4112 0.3998 -0.0105 0.0278  -0.0488 210 GLN A N   
523  C CA  . GLN A 68  ? 0.3801 0.4096 0.3982 -0.0118 0.0277  -0.0487 210 GLN A CA  
524  C C   . GLN A 68  ? 0.3780 0.3855 0.3890 -0.0156 0.0187  -0.0496 210 GLN A C   
525  O O   . GLN A 68  ? 0.3933 0.3807 0.3817 -0.0144 0.0174  -0.0516 210 GLN A O   
526  C CB  . GLN A 68  ? 0.3919 0.4251 0.4098 -0.0228 0.0286  -0.0428 210 GLN A CB  
527  C CG  . GLN A 68  ? 0.4330 0.4887 0.4538 -0.0223 0.0390  -0.0406 210 GLN A CG  
528  C CD  . GLN A 68  ? 0.5095 0.5619 0.5098 -0.0104 0.0496  -0.0444 210 GLN A CD  
529  O OE1 . GLN A 68  ? 0.5598 0.6204 0.5639 0.0042  0.0551  -0.0481 210 GLN A OE1 
530  N NE2 . GLN A 68  ? 0.5490 0.5870 0.5251 -0.0160 0.0529  -0.0431 210 GLN A NE2 
531  N N   . ALA A 69  ? 0.3628 0.3741 0.3915 -0.0211 0.0135  -0.0482 211 ALA A N   
532  C CA  . ALA A 69  ? 0.3643 0.3637 0.3932 -0.0250 0.0065  -0.0473 211 ALA A CA  
533  C C   . ALA A 69  ? 0.3754 0.3631 0.3922 -0.0212 0.0048  -0.0517 211 ALA A C   
534  O O   . ALA A 69  ? 0.3778 0.3567 0.3906 -0.0270 -0.0008 -0.0500 211 ALA A O   
535  C CB  . ALA A 69  ? 0.3467 0.3526 0.3971 -0.0283 0.0055  -0.0458 211 ALA A CB  
536  N N   . MET A 70  ? 0.3826 0.3715 0.3943 -0.0122 0.0091  -0.0557 212 MET A N   
537  C CA  . MET A 70  ? 0.4055 0.3764 0.3997 -0.0071 0.0077  -0.0589 212 MET A CA  
538  C C   . MET A 70  ? 0.4271 0.3705 0.3907 -0.0089 0.0067  -0.0601 212 MET A C   
539  O O   . MET A 70  ? 0.4343 0.3553 0.3790 -0.0104 0.0035  -0.0618 212 MET A O   
540  C CB  . MET A 70  ? 0.4101 0.3893 0.4063 0.0062  0.0123  -0.0604 212 MET A CB  
541  C CG  . MET A 70  ? 0.4024 0.4083 0.4237 0.0042  0.0115  -0.0591 212 MET A CG  
542  S SD  . MET A 70  ? 0.4519 0.4566 0.4713 0.0096  0.0075  -0.0592 212 MET A SD  
543  C CE  . MET A 70  ? 0.3944 0.3779 0.4045 -0.0022 0.0031  -0.0611 212 MET A CE  
544  N N   . ALA A 71  ? 0.4346 0.3766 0.3890 -0.0110 0.0093  -0.0591 213 ALA A N   
545  C CA  . ALA A 71  ? 0.4664 0.3794 0.3857 -0.0166 0.0078  -0.0607 213 ALA A CA  
546  C C   . ALA A 71  ? 0.4653 0.3711 0.3805 -0.0341 -0.0043 -0.0563 213 ALA A C   
547  O O   . ALA A 71  ? 0.4953 0.3742 0.3778 -0.0435 -0.0085 -0.0574 213 ALA A O   
548  C CB  . ALA A 71  ? 0.4768 0.3930 0.3864 -0.0167 0.0138  -0.0600 213 ALA A CB  
549  N N   . PHE A 72  ? 0.4313 0.3614 0.3787 -0.0388 -0.0092 -0.0509 214 PHE A N   
550  C CA  . PHE A 72  ? 0.4267 0.3611 0.3801 -0.0529 -0.0194 -0.0446 214 PHE A CA  
551  C C   . PHE A 72  ? 0.4312 0.3561 0.3789 -0.0574 -0.0218 -0.0465 214 PHE A C   
552  O O   . PHE A 72  ? 0.4286 0.3625 0.3837 -0.0703 -0.0295 -0.0404 214 PHE A O   
553  C CB  . PHE A 72  ? 0.4011 0.3647 0.3922 -0.0525 -0.0209 -0.0376 214 PHE A CB  
554  C CG  . PHE A 72  ? 0.3985 0.3690 0.3935 -0.0532 -0.0222 -0.0318 214 PHE A CG  
555  C CD1 . PHE A 72  ? 0.4007 0.3856 0.4200 -0.0463 -0.0173 -0.0299 214 PHE A CD1 
556  C CD2 . PHE A 72  ? 0.4367 0.3958 0.4067 -0.0629 -0.0287 -0.0278 214 PHE A CD2 
557  C CE1 . PHE A 72  ? 0.4046 0.3923 0.4248 -0.0482 -0.0189 -0.0232 214 PHE A CE1 
558  C CE2 . PHE A 72  ? 0.4349 0.3993 0.4055 -0.0648 -0.0304 -0.0211 214 PHE A CE2 
559  C CZ  . PHE A 72  ? 0.4293 0.4082 0.4260 -0.0570 -0.0255 -0.0183 214 PHE A CZ  
560  N N   . ASP A 73  ? 0.4307 0.3402 0.3664 -0.0475 -0.0159 -0.0532 215 ASP A N   
561  C CA  . ASP A 73  ? 0.4407 0.3350 0.3641 -0.0532 -0.0185 -0.0540 215 ASP A CA  
562  C C   . ASP A 73  ? 0.4665 0.3376 0.3602 -0.0717 -0.0271 -0.0516 215 ASP A C   
563  O O   . ASP A 73  ? 0.4922 0.3361 0.3534 -0.0738 -0.0277 -0.0546 215 ASP A O   
564  C CB  . ASP A 73  ? 0.4529 0.3265 0.3597 -0.0385 -0.0125 -0.0597 215 ASP A CB  
565  C CG  . ASP A 73  ? 0.4763 0.3320 0.3689 -0.0449 -0.0156 -0.0590 215 ASP A CG  
566  O OD1 . ASP A 73  ? 0.5228 0.3425 0.3830 -0.0389 -0.0145 -0.0618 215 ASP A OD1 
567  O OD2 . ASP A 73  ? 0.4498 0.3253 0.3617 -0.0554 -0.0181 -0.0554 215 ASP A OD2 
568  N N   . GLY A 74  ? 0.4580 0.3407 0.3616 -0.0867 -0.0332 -0.0461 216 GLY A N   
569  C CA  . GLY A 74  ? 0.4895 0.3577 0.3687 -0.1099 -0.0437 -0.0415 216 GLY A CA  
570  C C   . GLY A 74  ? 0.4751 0.3755 0.3761 -0.1230 -0.0530 -0.0315 216 GLY A C   
571  O O   . GLY A 74  ? 0.4968 0.3978 0.3865 -0.1454 -0.0639 -0.0247 216 GLY A O   
572  N N   . ILE A 75  ? 0.4432 0.3710 0.3750 -0.1104 -0.0500 -0.0288 217 ILE A N   
573  C CA  . ILE A 75  ? 0.4388 0.3946 0.3897 -0.1199 -0.0599 -0.0171 217 ILE A CA  
574  C C   . ILE A 75  ? 0.4285 0.4202 0.4105 -0.1320 -0.0660 -0.0060 217 ILE A C   
575  O O   . ILE A 75  ? 0.3998 0.4075 0.4061 -0.1245 -0.0576 -0.0074 217 ILE A O   
576  C CB  . ILE A 75  ? 0.4099 0.3852 0.3886 -0.1031 -0.0547 -0.0151 217 ILE A CB  
577  C CG1 . ILE A 75  ? 0.4235 0.4161 0.4089 -0.1126 -0.0668 -0.0023 217 ILE A CG1 
578  C CG2 . ILE A 75  ? 0.3797 0.3814 0.3995 -0.0893 -0.0457 -0.0147 217 ILE A CG2 
579  C CD1 . ILE A 75  ? 0.3957 0.4010 0.4033 -0.0975 -0.0624 0.0012  217 ILE A CD1 
580  N N   . ILE A 76  ? 0.4441 0.4508 0.4250 -0.1513 -0.0804 0.0057  218 ILE A N   
581  C CA  . ILE A 76  ? 0.4426 0.4913 0.4560 -0.1644 -0.0871 0.0190  218 ILE A CA  
582  C C   . ILE A 76  ? 0.4159 0.5123 0.4823 -0.1500 -0.0866 0.0315  218 ILE A C   
583  O O   . ILE A 76  ? 0.4262 0.5283 0.4953 -0.1481 -0.0948 0.0391  218 ILE A O   
584  C CB  . ILE A 76  ? 0.4769 0.5206 0.4616 -0.1966 -0.1050 0.0272  218 ILE A CB  
585  C CG1 . ILE A 76  ? 0.5161 0.5088 0.4495 -0.2099 -0.1028 0.0151  218 ILE A CG1 
586  C CG2 . ILE A 76  ? 0.4678 0.5694 0.4953 -0.2112 -0.1138 0.0454  218 ILE A CG2 
587  C CD1 . ILE A 76  ? 0.5868 0.5373 0.4629 -0.2334 -0.1156 0.0130  218 ILE A CD1 
588  N N   . PHE A 77  ? 0.3948 0.5216 0.5001 -0.1393 -0.0759 0.0337  219 PHE A N   
589  C CA  . PHE A 77  ? 0.3688 0.5364 0.5248 -0.1212 -0.0711 0.0443  219 PHE A CA  
590  C C   . PHE A 77  ? 0.3633 0.5792 0.5556 -0.1293 -0.0711 0.0568  219 PHE A C   
591  O O   . PHE A 77  ? 0.3507 0.5666 0.5431 -0.1313 -0.0598 0.0497  219 PHE A O   
592  C CB  . PHE A 77  ? 0.3578 0.5091 0.5218 -0.0962 -0.0523 0.0312  219 PHE A CB  
593  C CG  . PHE A 77  ? 0.3400 0.5189 0.5478 -0.0747 -0.0442 0.0392  219 PHE A CG  
594  C CD1 . PHE A 77  ? 0.3512 0.5518 0.5802 -0.0709 -0.0551 0.0555  219 PHE A CD1 
595  C CD2 . PHE A 77  ? 0.3431 0.5202 0.5659 -0.0577 -0.0255 0.0300  219 PHE A CD2 
596  C CE1 . PHE A 77  ? 0.3503 0.5695 0.6172 -0.0479 -0.0467 0.0633  219 PHE A CE1 
597  C CE2 . PHE A 77  ? 0.3459 0.5387 0.6029 -0.0362 -0.0158 0.0357  219 PHE A CE2 
598  C CZ  . PHE A 77  ? 0.3387 0.5516 0.6186 -0.0299 -0.0260 0.0526  219 PHE A CZ  
599  N N   . GLN A 78  ? 0.3649 0.6242 0.5880 -0.1346 -0.0840 0.0766  220 GLN A N   
600  C CA  . GLN A 78  ? 0.3639 0.6809 0.6270 -0.1448 -0.0866 0.0930  220 GLN A CA  
601  C C   . GLN A 78  ? 0.3739 0.6848 0.6110 -0.1739 -0.0892 0.0889  220 GLN A C   
602  O O   . GLN A 78  ? 0.3603 0.7009 0.6222 -0.1746 -0.0775 0.0910  220 GLN A O   
603  C CB  . GLN A 78  ? 0.3457 0.6953 0.6589 -0.1158 -0.0656 0.0948  220 GLN A CB  
604  C CG  . GLN A 78  ? 0.3460 0.6964 0.6835 -0.0863 -0.0619 0.0996  220 GLN A CG  
605  C CD  . GLN A 78  ? 0.3397 0.7234 0.7273 -0.0577 -0.0414 0.1042  220 GLN A CD  
606  O OE1 . GLN A 78  ? 0.3730 0.7881 0.7824 -0.0597 -0.0293 0.1052  220 GLN A OE1 
607  N NE2 . GLN A 78  ? 0.3529 0.7275 0.7566 -0.0310 -0.0363 0.1072  220 GLN A NE2 
608  N N   . GLY A 79  ? 0.3990 0.6671 0.5826 -0.1978 -0.1030 0.0828  221 GLY A N   
609  C CA  . GLY A 79  ? 0.4263 0.6763 0.5752 -0.2280 -0.1075 0.0792  221 GLY A CA  
610  C C   . GLY A 79  ? 0.4284 0.6253 0.5407 -0.2213 -0.0924 0.0588  221 GLY A C   
611  O O   . GLY A 79  ? 0.4550 0.6219 0.5277 -0.2452 -0.0968 0.0547  221 GLY A O   
612  N N   . GLN A 80  ? 0.3984 0.5823 0.5216 -0.1904 -0.0758 0.0472  222 GLN A N   
613  C CA  . GLN A 80  ? 0.4030 0.5447 0.4978 -0.1818 -0.0622 0.0303  222 GLN A CA  
614  C C   . GLN A 80  ? 0.4058 0.4941 0.4618 -0.1699 -0.0626 0.0166  222 GLN A C   
615  O O   . GLN A 80  ? 0.3840 0.4751 0.4528 -0.1524 -0.0615 0.0157  222 GLN A O   
616  C CB  . GLN A 80  ? 0.3777 0.5428 0.5091 -0.1580 -0.0425 0.0264  222 GLN A CB  
617  C CG  . GLN A 80  ? 0.3916 0.6105 0.5631 -0.1645 -0.0357 0.0380  222 GLN A CG  
618  C CD  . GLN A 80  ? 0.4386 0.6482 0.5858 -0.1882 -0.0345 0.0369  222 GLN A CD  
619  O OE1 . GLN A 80  ? 0.4700 0.6928 0.6098 -0.2165 -0.0475 0.0476  222 GLN A OE1 
620  N NE2 . GLN A 80  ? 0.4614 0.6465 0.5928 -0.1793 -0.0199 0.0246  222 GLN A NE2 
621  N N   . SER A 81  ? 0.4313 0.4718 0.4406 -0.1785 -0.0630 0.0068  223 SER A N   
622  C CA  . SER A 81  ? 0.4437 0.4366 0.4186 -0.1640 -0.0598 -0.0062 223 SER A CA  
623  C C   . SER A 81  ? 0.4108 0.4024 0.4002 -0.1397 -0.0448 -0.0153 223 SER A C   
624  O O   . SER A 81  ? 0.4116 0.3949 0.3938 -0.1413 -0.0387 -0.0186 223 SER A O   
625  C CB  . SER A 81  ? 0.4940 0.4337 0.4124 -0.1804 -0.0656 -0.0117 223 SER A CB  
626  O OG  . SER A 81  ? 0.5253 0.4231 0.4135 -0.1635 -0.0612 -0.0230 223 SER A OG  
627  N N   . LEU A 82  ? 0.3858 0.3846 0.3926 -0.1201 -0.0399 -0.0186 224 LEU A N   
628  C CA  . LEU A 82  ? 0.3652 0.3670 0.3875 -0.1006 -0.0273 -0.0261 224 LEU A CA  
629  C C   . LEU A 82  ? 0.3735 0.3382 0.3636 -0.0923 -0.0242 -0.0362 224 LEU A C   
630  O O   . LEU A 82  ? 0.3823 0.3207 0.3460 -0.0908 -0.0281 -0.0393 224 LEU A O   
631  C CB  . LEU A 82  ? 0.3426 0.3628 0.3924 -0.0857 -0.0240 -0.0249 224 LEU A CB  
632  C CG  . LEU A 82  ? 0.3373 0.3946 0.4233 -0.0868 -0.0264 -0.0132 224 LEU A CG  
633  C CD1 . LEU A 82  ? 0.3195 0.3820 0.4240 -0.0705 -0.0228 -0.0127 224 LEU A CD1 
634  C CD2 . LEU A 82  ? 0.3126 0.3980 0.4249 -0.0880 -0.0181 -0.0097 224 LEU A CD2 
635  N N   . LYS A 83  ? 0.3697 0.3338 0.3624 -0.0862 -0.0166 -0.0407 225 LYS A N   
636  C CA  . LYS A 83  ? 0.3824 0.3192 0.3514 -0.0762 -0.0146 -0.0473 225 LYS A CA  
637  C C   . LYS A 83  ? 0.3563 0.3063 0.3441 -0.0601 -0.0085 -0.0519 225 LYS A C   
638  O O   . LYS A 83  ? 0.3435 0.3093 0.3482 -0.0580 -0.0024 -0.0536 225 LYS A O   
639  C CB  . LYS A 83  ? 0.3966 0.3239 0.3521 -0.0836 -0.0128 -0.0471 225 LYS A CB  
640  C CG  . LYS A 83  ? 0.4183 0.3178 0.3486 -0.0736 -0.0130 -0.0507 225 LYS A CG  
641  C CD  . LYS A 83  ? 0.4492 0.3376 0.3629 -0.0841 -0.0126 -0.0482 225 LYS A CD  
642  C CE  . LYS A 83  ? 0.4927 0.3458 0.3745 -0.0753 -0.0163 -0.0482 225 LYS A CE  
643  N NZ  . LYS A 83  ? 0.4997 0.3386 0.3610 -0.0876 -0.0169 -0.0441 225 LYS A NZ  
644  N N   . ILE A 84  ? 0.3587 0.3009 0.3407 -0.0505 -0.0095 -0.0540 226 ILE A N   
645  C CA  . ILE A 84  ? 0.3395 0.2958 0.3384 -0.0390 -0.0050 -0.0569 226 ILE A CA  
646  C C   . ILE A 84  ? 0.3436 0.2908 0.3303 -0.0286 -0.0041 -0.0600 226 ILE A C   
647  O O   . ILE A 84  ? 0.3619 0.2898 0.3280 -0.0224 -0.0055 -0.0602 226 ILE A O   
648  C CB  . ILE A 84  ? 0.3382 0.2985 0.3416 -0.0361 -0.0059 -0.0554 226 ILE A CB  
649  C CG1 . ILE A 84  ? 0.3453 0.3146 0.3583 -0.0461 -0.0102 -0.0493 226 ILE A CG1 
650  C CG2 . ILE A 84  ? 0.3131 0.2891 0.3344 -0.0286 -0.0012 -0.0572 226 ILE A CG2 
651  C CD1 . ILE A 84  ? 0.3629 0.3549 0.4063 -0.0452 -0.0068 -0.0463 226 ILE A CD1 
652  N N   . ARG A 85  ? 0.3294 0.2899 0.3276 -0.0265 -0.0016 -0.0618 227 ARG A N   
653  C CA  . ARG A 85  ? 0.3375 0.2969 0.3281 -0.0181 -0.0032 -0.0618 227 ARG A CA  
654  C C   . ARG A 85  ? 0.3208 0.3029 0.3290 -0.0172 -0.0017 -0.0633 227 ARG A C   
655  O O   . ARG A 85  ? 0.2979 0.2887 0.3193 -0.0242 0.0018  -0.0659 227 ARG A O   
656  C CB  . ARG A 85  ? 0.3526 0.2992 0.3272 -0.0232 -0.0057 -0.0607 227 ARG A CB  
657  C CG  . ARG A 85  ? 0.3836 0.3032 0.3348 -0.0279 -0.0083 -0.0584 227 ARG A CG  
658  C CD  . ARG A 85  ? 0.4214 0.3171 0.3514 -0.0149 -0.0108 -0.0568 227 ARG A CD  
659  N NE  . ARG A 85  ? 0.4504 0.3107 0.3498 -0.0220 -0.0138 -0.0551 227 ARG A NE  
660  C CZ  . ARG A 85  ? 0.4700 0.3117 0.3548 -0.0292 -0.0145 -0.0561 227 ARG A CZ  
661  N NH1 . ARG A 85  ? 0.4634 0.3192 0.3615 -0.0291 -0.0126 -0.0583 227 ARG A NH1 
662  N NH2 . ARG A 85  ? 0.5139 0.3203 0.3667 -0.0391 -0.0182 -0.0544 227 ARG A NH2 
663  N N   . ARG A 86  ? 0.3211 0.3120 0.3288 -0.0090 -0.0047 -0.0609 228 ARG A N   
664  C CA  . ARG A 86  ? 0.3134 0.3265 0.3339 -0.0133 -0.0060 -0.0610 228 ARG A CA  
665  C C   . ARG A 86  ? 0.3175 0.3256 0.3295 -0.0245 -0.0073 -0.0637 228 ARG A C   
666  O O   . ARG A 86  ? 0.3260 0.3184 0.3224 -0.0254 -0.0087 -0.0628 228 ARG A O   
667  C CB  . ARG A 86  ? 0.3182 0.3493 0.3431 -0.0023 -0.0105 -0.0550 228 ARG A CB  
668  C CG  . ARG A 86  ? 0.3139 0.3552 0.3483 0.0094  -0.0060 -0.0529 228 ARG A CG  
669  C CD  . ARG A 86  ? 0.2906 0.3516 0.3420 0.0003  -0.0027 -0.0543 228 ARG A CD  
670  N NE  . ARG A 86  ? 0.2953 0.3705 0.3547 0.0107  0.0027  -0.0513 228 ARG A NE  
671  C CZ  . ARG A 86  ? 0.2860 0.3800 0.3588 0.0039  0.0063  -0.0505 228 ARG A CZ  
672  N NH1 . ARG A 86  ? 0.2747 0.3709 0.3530 -0.0128 0.0044  -0.0525 228 ARG A NH1 
673  N NH2 . ARG A 86  ? 0.2927 0.4001 0.3703 0.0137  0.0130  -0.0476 228 ARG A NH2 
674  N N   . PRO A 87  ? 0.3170 0.3349 0.3348 -0.0347 -0.0062 -0.0672 229 PRO A N   
675  C CA  . PRO A 87  ? 0.3334 0.3449 0.3367 -0.0458 -0.0069 -0.0705 229 PRO A CA  
676  C C   . PRO A 87  ? 0.3515 0.3689 0.3431 -0.0441 -0.0170 -0.0639 229 PRO A C   
677  O O   . PRO A 87  ? 0.3416 0.3772 0.3432 -0.0353 -0.0235 -0.0571 229 PRO A O   
678  C CB  . PRO A 87  ? 0.3340 0.3515 0.3416 -0.0571 -0.0048 -0.0754 229 PRO A CB  
679  C CG  . PRO A 87  ? 0.3195 0.3410 0.3448 -0.0520 -0.0004 -0.0751 229 PRO A CG  
680  C CD  . PRO A 87  ? 0.3004 0.3306 0.3327 -0.0384 -0.0038 -0.0686 229 PRO A CD  
681  N N   A HIS A 88  ? 0.3717 0.3751 0.3429 -0.0516 -0.0177 -0.0650 230 HIS A N   
682  N N   B HIS A 88  ? 0.3717 0.3755 0.3428 -0.0515 -0.0180 -0.0647 230 HIS A N   
683  C CA  A HIS A 88  ? 0.3927 0.3979 0.3481 -0.0517 -0.0287 -0.0572 230 HIS A CA  
684  C CA  B HIS A 88  ? 0.3918 0.3984 0.3488 -0.0499 -0.0294 -0.0563 230 HIS A CA  
685  C C   A HIS A 88  ? 0.3986 0.4306 0.3616 -0.0555 -0.0392 -0.0521 230 HIS A C   
686  C C   B HIS A 88  ? 0.3984 0.4314 0.3620 -0.0553 -0.0395 -0.0518 230 HIS A C   
687  O O   A HIS A 88  ? 0.4065 0.4535 0.3730 -0.0457 -0.0498 -0.0410 230 HIS A O   
688  O O   B HIS A 88  ? 0.4070 0.4554 0.3735 -0.0463 -0.0505 -0.0407 230 HIS A O   
689  C CB  A HIS A 88  ? 0.4155 0.4019 0.3448 -0.0654 -0.0256 -0.0611 230 HIS A CB  
690  C CB  B HIS A 88  ? 0.4161 0.4028 0.3458 -0.0613 -0.0283 -0.0579 230 HIS A CB  
691  C CG  A HIS A 88  ? 0.4382 0.4240 0.3462 -0.0693 -0.0379 -0.0525 230 HIS A CG  
692  C CG  B HIS A 88  ? 0.4220 0.3874 0.3422 -0.0569 -0.0237 -0.0565 230 HIS A CG  
693  N ND1 A HIS A 88  ? 0.4538 0.4279 0.3513 -0.0588 -0.0446 -0.0425 230 HIS A ND1 
694  N ND1 B HIS A 88  ? 0.4223 0.3803 0.3472 -0.0424 -0.0262 -0.0510 230 HIS A ND1 
695  C CD2 A HIS A 88  ? 0.4670 0.4592 0.3587 -0.0836 -0.0455 -0.0516 230 HIS A CD2 
696  C CD2 B HIS A 88  ? 0.4414 0.3904 0.3446 -0.0673 -0.0166 -0.0595 230 HIS A CD2 
697  C CE1 A HIS A 88  ? 0.4799 0.4556 0.3584 -0.0645 -0.0564 -0.0343 230 HIS A CE1 
698  C CE1 B HIS A 88  ? 0.4364 0.3725 0.3463 -0.0464 -0.0225 -0.0507 230 HIS A CE1 
699  N NE2 A HIS A 88  ? 0.4865 0.4751 0.3611 -0.0807 -0.0577 -0.0396 230 HIS A NE2 
700  N NE2 B HIS A 88  ? 0.4402 0.3740 0.3393 -0.0615 -0.0166 -0.0550 230 HIS A NE2 
701  N N   . ASP A 89  ? 0.3993 0.4370 0.3645 -0.0701 -0.0361 -0.0593 231 ASP A N   
702  C CA  . ASP A 89  ? 0.4103 0.4744 0.3809 -0.0808 -0.0466 -0.0549 231 ASP A CA  
703  C C   . ASP A 89  ? 0.3892 0.4843 0.3904 -0.0706 -0.0489 -0.0483 231 ASP A C   
704  O O   . ASP A 89  ? 0.3976 0.5213 0.4074 -0.0805 -0.0580 -0.0426 231 ASP A O   
705  C CB  . ASP A 89  ? 0.4307 0.4809 0.3854 -0.1032 -0.0415 -0.0664 231 ASP A CB  
706  C CG  . ASP A 89  ? 0.4893 0.5130 0.4103 -0.1156 -0.0385 -0.0731 231 ASP A CG  
707  O OD1 . ASP A 89  ? 0.5197 0.5409 0.4289 -0.1109 -0.0441 -0.0665 231 ASP A OD1 
708  O OD2 . ASP A 89  ? 0.5417 0.5439 0.4453 -0.1301 -0.0291 -0.0850 231 ASP A OD2 
709  N N   . TYR A 90  ? 0.3709 0.4616 0.3867 -0.0538 -0.0403 -0.0489 232 TYR A N   
710  C CA  . TYR A 90  ? 0.3607 0.4797 0.4022 -0.0430 -0.0399 -0.0428 232 TYR A CA  
711  C C   . TYR A 90  ? 0.3719 0.5116 0.4224 -0.0235 -0.0472 -0.0302 232 TYR A C   
712  O O   . TYR A 90  ? 0.3785 0.4956 0.4155 -0.0105 -0.0471 -0.0285 232 TYR A O   
713  C CB  . TYR A 90  ? 0.3448 0.4473 0.3926 -0.0337 -0.0277 -0.0485 232 TYR A CB  
714  C CG  . TYR A 90  ? 0.3251 0.4526 0.3942 -0.0216 -0.0244 -0.0430 232 TYR A CG  
715  C CD1 . TYR A 90  ? 0.3193 0.4630 0.4015 -0.0324 -0.0211 -0.0440 232 TYR A CD1 
716  C CD2 . TYR A 90  ? 0.3145 0.4455 0.3869 0.0005  -0.0231 -0.0370 232 TYR A CD2 
717  C CE1 . TYR A 90  ? 0.3143 0.4823 0.4142 -0.0227 -0.0162 -0.0387 232 TYR A CE1 
718  C CE2 . TYR A 90  ? 0.3314 0.4841 0.4206 0.0128  -0.0168 -0.0330 232 TYR A CE2 
719  C CZ  . TYR A 90  ? 0.3155 0.4894 0.4194 0.0007  -0.0132 -0.0337 232 TYR A CZ  
720  O OH  . TYR A 90  ? 0.3284 0.5261 0.4478 0.0118  -0.0053 -0.0294 232 TYR A OH  
721  N N   . GLN A 91  ? 0.3745 0.5571 0.4480 -0.0215 -0.0529 -0.0206 233 GLN A N   
722  C CA  . GLN A 91  ? 0.3926 0.6023 0.4816 0.0012  -0.0582 -0.0067 233 GLN A CA  
723  C C   . GLN A 91  ? 0.3828 0.6336 0.5033 0.0107  -0.0522 -0.0010 233 GLN A C   
724  O O   . GLN A 91  ? 0.3749 0.6541 0.5091 -0.0088 -0.0541 -0.0008 233 GLN A O   
725  C CB  . GLN A 91  ? 0.4166 0.6520 0.5049 -0.0072 -0.0756 0.0049  233 GLN A CB  
726  C CG  . GLN A 91  ? 0.4694 0.6673 0.5242 -0.0139 -0.0820 0.0025  233 GLN A CG  
727  C CD  . GLN A 91  ? 0.5300 0.7036 0.5749 0.0125  -0.0811 0.0087  233 GLN A CD  
728  O OE1 . GLN A 91  ? 0.5631 0.7570 0.6271 0.0378  -0.0812 0.0198  233 GLN A OE1 
729  N NE2 . GLN A 91  ? 0.5617 0.6903 0.5752 0.0067  -0.0792 0.0021  233 GLN A NE2 
730  N N   . PRO A 92  ? 0.3890 0.6416 0.5186 0.0397  -0.0440 0.0036  234 PRO A N   
731  C CA  . PRO A 92  ? 0.3792 0.6755 0.5392 0.0510  -0.0360 0.0101  234 PRO A CA  
732  C C   . PRO A 92  ? 0.3781 0.7363 0.5679 0.0523  -0.0481 0.0273  234 PRO A C   
733  O O   . PRO A 92  ? 0.3913 0.7519 0.5751 0.0519  -0.0625 0.0352  234 PRO A O   
734  C CB  . PRO A 92  ? 0.3981 0.6686 0.5504 0.0832  -0.0229 0.0089  234 PRO A CB  
735  C CG  . PRO A 92  ? 0.4227 0.6535 0.5493 0.0922  -0.0304 0.0098  234 PRO A CG  
736  C CD  . PRO A 92  ? 0.4105 0.6220 0.5191 0.0623  -0.0404 0.0028  234 PRO A CD  
737  N N   . LEU A 93  ? 0.3642 0.7748 0.5860 0.0516  -0.0431 0.0342  235 LEU A N   
738  C CA  . LEU A 93  ? 0.3665 0.8465 0.6222 0.0492  -0.0557 0.0527  235 LEU A CA  
739  C C   . LEU A 93  ? 0.3794 0.8765 0.6493 0.0869  -0.0579 0.0676  235 LEU A C   
740  O O   . LEU A 93  ? 0.3821 0.8427 0.6400 0.1171  -0.0438 0.0628  235 LEU A O   
741  C CB  . LEU A 93  ? 0.3584 0.8940 0.6467 0.0392  -0.0479 0.0577  235 LEU A CB  
742  C CG  . LEU A 93  ? 0.3614 0.8879 0.6374 -0.0028 -0.0512 0.0482  235 LEU A CG  
743  C CD1 . LEU A 93  ? 0.3573 0.9230 0.6577 -0.0100 -0.0387 0.0509  235 LEU A CD1 
744  C CD2 . LEU A 93  ? 0.3725 0.9213 0.6463 -0.0340 -0.0736 0.0551  235 LEU A CD2 
745  N N   . PRO A 94  ? 0.3812 0.9302 0.6735 0.0846  -0.0764 0.0862  236 PRO A N   
746  C CA  . PRO A 94  ? 0.4015 0.9647 0.7064 0.1211  -0.0816 0.1032  236 PRO A CA  
747  C C   . PRO A 94  ? 0.4026 0.9951 0.7387 0.1624  -0.0619 0.1108  236 PRO A C   
748  O O   . PRO A 94  ? 0.3877 1.0428 0.7616 0.1596  -0.0548 0.1175  236 PRO A O   
749  C CB  . PRO A 94  ? 0.4063 1.0343 0.7354 0.1028  -0.1071 0.1236  236 PRO A CB  
750  C CG  . PRO A 94  ? 0.3962 1.0158 0.7058 0.0534  -0.1164 0.1119  236 PRO A CG  
751  C CD  . PRO A 94  ? 0.3784 0.9734 0.6827 0.0464  -0.0949 0.0935  236 PRO A CD  
752  N N   . GLY A 95  ? 0.4223 0.9670 0.7395 0.1993  -0.0521 0.1093  237 GLY A N   
753  C CA  . GLY A 95  ? 0.4349 0.9913 0.7712 0.2423  -0.0298 0.1134  237 GLY A CA  
754  C C   . GLY A 95  ? 0.4242 0.9431 0.7418 0.2427  -0.0046 0.0930  237 GLY A C   
755  O O   . GLY A 95  ? 0.4347 0.9644 0.7653 0.2747  0.0167  0.0943  237 GLY A O   
756  N N   . ALA A 96  ? 0.4615 0.2784 1.0313 -0.0477 -0.0659 -0.0482 258 ALA A N   
757  C CA  . ALA A 96  ? 0.4641 0.2832 1.0643 -0.0415 -0.0800 -0.0017 258 ALA A CA  
758  C C   . ALA A 96  ? 0.4336 0.2903 0.9752 -0.0415 -0.0742 0.0187  258 ALA A C   
759  O O   . ALA A 96  ? 0.4343 0.3056 0.9726 -0.0457 -0.0851 0.0642  258 ALA A O   
760  C CB  . ALA A 96  ? 0.4849 0.2867 1.1643 -0.0231 -0.0879 -0.0164 258 ALA A CB  
761  N N   . HIS A 97  ? 0.4107 0.2856 0.9083 -0.0388 -0.0577 -0.0151 259 HIS A N   
762  C CA  . HIS A 97  ? 0.3879 0.2942 0.8368 -0.0396 -0.0516 -0.0033 259 HIS A CA  
763  C C   . HIS A 97  ? 0.3675 0.2840 0.7482 -0.0490 -0.0364 -0.0203 259 HIS A C   
764  O O   . HIS A 97  ? 0.3478 0.2816 0.6962 -0.0485 -0.0260 -0.0339 259 HIS A O   
765  C CB  . HIS A 97  ? 0.3862 0.3069 0.8621 -0.0264 -0.0490 -0.0208 259 HIS A CB  
766  C CG  . HIS A 97  ? 0.4123 0.3240 0.9635 -0.0137 -0.0664 -0.0021 259 HIS A CG  
767  N ND1 . HIS A 97  ? 0.4401 0.3265 1.0582 -0.0021 -0.0691 -0.0286 259 HIS A ND1 
768  C CD2 . HIS A 97  ? 0.4165 0.3423 0.9905 -0.0110 -0.0836 0.0420  259 HIS A CD2 
769  C CE1 . HIS A 97  ? 0.4549 0.3344 1.1397 0.0094  -0.0882 0.0002  259 HIS A CE1 
770  N NE2 . HIS A 97  ? 0.4481 0.3532 1.1052 0.0035  -0.0982 0.0465  259 HIS A NE2 
771  N N   . LYS A 98  ? 0.3705 0.2767 0.7343 -0.0581 -0.0367 -0.0164 260 LYS A N   
772  C CA  . LYS A 98  ? 0.3608 0.2750 0.6690 -0.0652 -0.0260 -0.0277 260 LYS A CA  
773  C C   . LYS A 98  ? 0.3432 0.2783 0.6133 -0.0678 -0.0235 -0.0067 260 LYS A C   
774  O O   . LYS A 98  ? 0.3428 0.2895 0.6212 -0.0703 -0.0315 0.0225  260 LYS A O   
775  C CB  . LYS A 98  ? 0.3705 0.2740 0.6803 -0.0736 -0.0300 -0.0257 260 LYS A CB  
776  C CG  . LYS A 98  ? 0.3593 0.2712 0.6220 -0.0788 -0.0222 -0.0376 260 LYS A CG  
777  C CD  . LYS A 98  ? 0.3827 0.2878 0.6580 -0.0870 -0.0281 -0.0405 260 LYS A CD  
778  C CE  . LYS A 98  ? 0.3902 0.3074 0.6254 -0.0909 -0.0239 -0.0499 260 LYS A CE  
779  N NZ  . LYS A 98  ? 0.4046 0.3198 0.6561 -0.0999 -0.0305 -0.0608 260 LYS A NZ  
780  N N   . LEU A 99  ? 0.3334 0.2753 0.5640 -0.0687 -0.0128 -0.0220 261 LEU A N   
781  C CA  . LEU A 99  ? 0.3281 0.2862 0.5257 -0.0712 -0.0090 -0.0118 261 LEU A CA  
782  C C   . LEU A 99  ? 0.3202 0.2763 0.4866 -0.0744 -0.0043 -0.0140 261 LEU A C   
783  O O   . LEU A 99  ? 0.3228 0.2676 0.4806 -0.0753 -0.0018 -0.0268 261 LEU A O   
784  C CB  . LEU A 99  ? 0.3283 0.2931 0.5138 -0.0702 -0.0016 -0.0260 261 LEU A CB  
785  C CG  . LEU A 99  ? 0.3388 0.3171 0.5535 -0.0660 -0.0062 -0.0226 261 LEU A CG  
786  C CD1 . LEU A 99  ? 0.3400 0.3276 0.5398 -0.0685 0.0031  -0.0395 261 LEU A CD1 
787  C CD2 . LEU A 99  ? 0.3454 0.3448 0.5665 -0.0674 -0.0165 0.0046  261 LEU A CD2 
788  N N   . PHE A 100 ? 0.3173 0.2898 0.4697 -0.0761 -0.0037 -0.0022 262 PHE A N   
789  C CA  . PHE A 100 ? 0.3196 0.2935 0.4494 -0.0756 0.0013  -0.0068 262 PHE A CA  
790  C C   . PHE A 100 ? 0.3231 0.2969 0.4335 -0.0748 0.0082  -0.0182 262 PHE A C   
791  O O   . PHE A 100 ? 0.3272 0.3174 0.4371 -0.0770 0.0087  -0.0171 262 PHE A O   
792  C CB  . PHE A 100 ? 0.3143 0.3123 0.4480 -0.0782 -0.0004 0.0078  262 PHE A CB  
793  C CG  . PHE A 100 ? 0.3128 0.3205 0.4319 -0.0747 0.0057  -0.0005 262 PHE A CG  
794  C CD1 . PHE A 100 ? 0.3027 0.3015 0.4235 -0.0713 0.0046  -0.0035 262 PHE A CD1 
795  C CD2 . PHE A 100 ? 0.3144 0.3439 0.4227 -0.0744 0.0118  -0.0075 262 PHE A CD2 
796  C CE1 . PHE A 100 ? 0.3128 0.3210 0.4302 -0.0648 0.0087  -0.0107 262 PHE A CE1 
797  C CE2 . PHE A 100 ? 0.3232 0.3607 0.4281 -0.0685 0.0179  -0.0206 262 PHE A CE2 
798  C CZ  . PHE A 100 ? 0.3178 0.3433 0.4299 -0.0623 0.0161  -0.0207 262 PHE A CZ  
799  N N   . ILE A 101 ? 0.3336 0.2900 0.4302 -0.0732 0.0118  -0.0273 263 ILE A N   
800  C CA  . ILE A 101 ? 0.3431 0.2918 0.4273 -0.0740 0.0173  -0.0365 263 ILE A CA  
801  C C   . ILE A 101 ? 0.3487 0.2939 0.4312 -0.0680 0.0183  -0.0389 263 ILE A C   
802  O O   . ILE A 101 ? 0.3433 0.2771 0.4254 -0.0644 0.0150  -0.0340 263 ILE A O   
803  C CB  . ILE A 101 ? 0.3605 0.2904 0.4354 -0.0787 0.0199  -0.0405 263 ILE A CB  
804  C CG1 . ILE A 101 ? 0.3745 0.3103 0.4574 -0.0816 0.0196  -0.0431 263 ILE A CG1 
805  C CG2 . ILE A 101 ? 0.3662 0.2882 0.4355 -0.0838 0.0249  -0.0477 263 ILE A CG2 
806  C CD1 . ILE A 101 ? 0.4033 0.3553 0.5019 -0.0816 0.0189  -0.0440 263 ILE A CD1 
807  N N   . GLY A 102 ? 0.3528 0.3117 0.4372 -0.0668 0.0225  -0.0488 264 GLY A N   
808  C CA  . GLY A 102 ? 0.3669 0.3266 0.4590 -0.0586 0.0250  -0.0580 264 GLY A CA  
809  C C   . GLY A 102 ? 0.3885 0.3322 0.4844 -0.0584 0.0295  -0.0762 264 GLY A C   
810  O O   . GLY A 102 ? 0.3888 0.3328 0.4785 -0.0674 0.0319  -0.0838 264 GLY A O   
811  N N   . GLY A 103 ? 0.4019 0.3309 0.5137 -0.0481 0.0295  -0.0833 265 GLY A N   
812  C CA  . GLY A 103 ? 0.4359 0.3419 0.5626 -0.0463 0.0325  -0.1023 265 GLY A CA  
813  C C   . GLY A 103 ? 0.4569 0.3185 0.5837 -0.0518 0.0276  -0.0886 265 GLY A C   
814  O O   . GLY A 103 ? 0.4795 0.3216 0.6142 -0.0588 0.0302  -0.1013 265 GLY A O   
815  N N   . LEU A 104 ? 0.4555 0.3056 0.5738 -0.0511 0.0204  -0.0630 266 LEU A N   
816  C CA  . LEU A 104 ? 0.4827 0.2999 0.5967 -0.0593 0.0153  -0.0440 266 LEU A CA  
817  C C   . LEU A 104 ? 0.5153 0.3027 0.6566 -0.0479 0.0071  -0.0345 266 LEU A C   
818  O O   . LEU A 104 ? 0.5090 0.3068 0.6668 -0.0320 0.0029  -0.0351 266 LEU A O   
819  C CB  . LEU A 104 ? 0.4690 0.2976 0.5581 -0.0666 0.0115  -0.0233 266 LEU A CB  
820  C CG  . LEU A 104 ? 0.4487 0.3024 0.5204 -0.0753 0.0175  -0.0304 266 LEU A CG  
821  C CD1 . LEU A 104 ? 0.4310 0.2973 0.4876 -0.0783 0.0135  -0.0184 266 LEU A CD1 
822  C CD2 . LEU A 104 ? 0.4371 0.2858 0.5038 -0.0893 0.0239  -0.0364 266 LEU A CD2 
823  N N   . PRO A 105 ? 0.5537 0.3047 0.7053 -0.0560 0.0038  -0.0239 267 PRO A N   
824  C CA  . PRO A 105 ? 0.5934 0.3123 0.7748 -0.0456 -0.0083 -0.0042 267 PRO A CA  
825  C C   . PRO A 105 ? 0.5925 0.3254 0.7591 -0.0420 -0.0202 0.0281  267 PRO A C   
826  O O   . PRO A 105 ? 0.5859 0.3337 0.7170 -0.0576 -0.0205 0.0454  267 PRO A O   
827  C CB  . PRO A 105 ? 0.6317 0.3125 0.8186 -0.0632 -0.0100 0.0105  267 PRO A CB  
828  C CG  . PRO A 105 ? 0.6092 0.3018 0.7831 -0.0772 0.0035  -0.0179 267 PRO A CG  
829  C CD  . PRO A 105 ? 0.5675 0.3061 0.7097 -0.0758 0.0099  -0.0273 267 PRO A CD  
830  N N   . ASN A 106 ? 0.6042 0.3378 0.8002 -0.0219 -0.0298 0.0328  268 ASN A N   
831  C CA  . ASN A 106 ? 0.6029 0.3592 0.7871 -0.0180 -0.0425 0.0595  268 ASN A CA  
832  C C   . ASN A 106 ? 0.6416 0.3809 0.8194 -0.0274 -0.0589 0.1039  268 ASN A C   
833  O O   . ASN A 106 ? 0.6409 0.4047 0.8062 -0.0266 -0.0715 0.1270  268 ASN A O   
834  C CB  . ASN A 106 ? 0.6018 0.3755 0.8224 0.0065  -0.0472 0.0484  268 ASN A CB  
835  C CG  . ASN A 106 ? 0.6517 0.3920 0.9290 0.0255  -0.0527 0.0434  268 ASN A CG  
836  O OD1 . ASN A 106 ? 0.7272 0.4322 1.0232 0.0253  -0.0666 0.0734  268 ASN A OD1 
837  N ND2 . ASN A 106 ? 0.6747 0.4280 0.9825 0.0414  -0.0417 0.0051  268 ASN A ND2 
838  N N   . TYR A 107 ? 0.6746 0.3761 0.8606 -0.0387 -0.0596 0.1176  269 TYR A N   
839  C CA  . TYR A 107 ? 0.7196 0.4088 0.8963 -0.0530 -0.0749 0.1665  269 TYR A CA  
840  C C   . TYR A 107 ? 0.7128 0.4265 0.8343 -0.0826 -0.0665 0.1770  269 TYR A C   
841  O O   . TYR A 107 ? 0.7426 0.4630 0.8444 -0.0993 -0.0772 0.2174  269 TYR A O   
842  C CB  . TYR A 107 ? 0.7748 0.4076 0.9993 -0.0505 -0.0837 0.1845  269 TYR A CB  
843  C CG  . TYR A 107 ? 0.7747 0.3765 1.0164 -0.0567 -0.0678 0.1500  269 TYR A CG  
844  C CD1 . TYR A 107 ? 0.7867 0.3841 0.9997 -0.0855 -0.0583 0.1559  269 TYR A CD1 
845  C CD2 . TYR A 107 ? 0.7707 0.3539 1.0590 -0.0350 -0.0621 0.1092  269 TYR A CD2 
846  C CE1 . TYR A 107 ? 0.7893 0.3626 1.0202 -0.0928 -0.0454 0.1233  269 TYR A CE1 
847  C CE2 . TYR A 107 ? 0.7756 0.3364 1.0787 -0.0427 -0.0486 0.0740  269 TYR A CE2 
848  C CZ  . TYR A 107 ? 0.7866 0.3414 1.0613 -0.0717 -0.0414 0.0821  269 TYR A CZ  
849  O OH  . TYR A 107 ? 0.7918 0.3291 1.0829 -0.0807 -0.0297 0.0461  269 TYR A OH  
850  N N   . LEU A 108 ? 0.6713 0.4038 0.7702 -0.0891 -0.0480 0.1412  270 LEU A N   
851  C CA  . LEU A 108 ? 0.6656 0.4267 0.7204 -0.1136 -0.0375 0.1419  270 LEU A CA  
852  C C   . LEU A 108 ? 0.6455 0.4540 0.6672 -0.1155 -0.0397 0.1408  270 LEU A C   
853  O O   . LEU A 108 ? 0.6125 0.4346 0.6418 -0.0992 -0.0404 0.1206  270 LEU A O   
854  C CB  . LEU A 108 ? 0.6320 0.3942 0.6858 -0.1173 -0.0191 0.1043  270 LEU A CB  
855  C CG  . LEU A 108 ? 0.6556 0.3790 0.7373 -0.1223 -0.0147 0.0980  270 LEU A CG  
856  C CD1 . LEU A 108 ? 0.6230 0.3576 0.7057 -0.1212 0.0001  0.0579  270 LEU A CD1 
857  C CD2 . LEU A 108 ? 0.6933 0.4069 0.7643 -0.1488 -0.0152 0.1288  270 LEU A CD2 
858  N N   . ASN A 109 ? 0.6689 0.5057 0.6550 -0.1376 -0.0400 0.1602  271 ASN A N   
859  C CA  . ASN A 109 ? 0.6609 0.5463 0.6154 -0.1430 -0.0413 0.1529  271 ASN A CA  
860  C C   . ASN A 109 ? 0.6257 0.5337 0.5674 -0.1473 -0.0227 0.1119  271 ASN A C   
861  O O   . ASN A 109 ? 0.6047 0.4942 0.5602 -0.1455 -0.0104 0.0933  271 ASN A O   
862  C CB  . ASN A 109 ? 0.7056 0.6225 0.6265 -0.1657 -0.0507 0.1899  271 ASN A CB  
863  C CG  . ASN A 109 ? 0.7300 0.6580 0.6283 -0.1925 -0.0368 0.1965  271 ASN A CG  
864  O OD1 . ASN A 109 ? 0.7117 0.6423 0.6103 -0.1956 -0.0182 0.1636  271 ASN A OD1 
865  N ND2 . ASN A 109 ? 0.7707 0.7099 0.6510 -0.2130 -0.0467 0.2423  271 ASN A ND2 
866  N N   . ASP A 110 ? 0.6224 0.5710 0.5423 -0.1525 -0.0223 0.0974  272 ASP A N   
867  C CA  . ASP A 110 ? 0.5945 0.5634 0.5117 -0.1539 -0.0073 0.0579  272 ASP A CA  
868  C C   . ASP A 110 ? 0.5938 0.5713 0.5029 -0.1689 0.0094  0.0480  272 ASP A C   
869  O O   . ASP A 110 ? 0.5632 0.5304 0.4912 -0.1619 0.0200  0.0243  272 ASP A O   
870  C CB  . ASP A 110 ? 0.6057 0.6183 0.5027 -0.1611 -0.0106 0.0432  272 ASP A CB  
871  C CG  . ASP A 110 ? 0.6239 0.6340 0.5348 -0.1467 -0.0257 0.0450  272 ASP A CG  
872  O OD1 . ASP A 110 ? 0.6532 0.6875 0.5636 -0.1478 -0.0261 0.0197  272 ASP A OD1 
873  O OD2 . ASP A 110 ? 0.6744 0.6591 0.6020 -0.1344 -0.0370 0.0698  272 ASP A OD2 
874  N N   . ASP A 111 ? 0.6288 0.6307 0.5106 -0.1909 0.0111  0.0684  273 ASP A N   
875  C CA  . ASP A 111 ? 0.6379 0.6610 0.5111 -0.2089 0.0286  0.0583  273 ASP A CA  
876  C C   . ASP A 111 ? 0.6284 0.6120 0.5256 -0.2078 0.0334  0.0659  273 ASP A C   
877  O O   . ASP A 111 ? 0.6076 0.6018 0.5145 -0.2122 0.0480  0.0434  273 ASP A O   
878  C CB  . ASP A 111 ? 0.6859 0.7539 0.5210 -0.2369 0.0295  0.0823  273 ASP A CB  
879  C CG  . ASP A 111 ? 0.7159 0.8354 0.5246 -0.2418 0.0271  0.0650  273 ASP A CG  
880  O OD1 . ASP A 111 ? 0.7528 0.9254 0.5428 -0.2579 0.0424  0.0392  273 ASP A OD1 
881  O OD2 . ASP A 111 ? 0.7386 0.8496 0.5482 -0.2299 0.0102  0.0734  273 ASP A OD2 
882  N N   . GLN A 112 ? 0.6413 0.5816 0.5524 -0.2015 0.0205  0.0947  274 GLN A N   
883  C CA  . GLN A 112 ? 0.6401 0.5392 0.5791 -0.1991 0.0232  0.0956  274 GLN A CA  
884  C C   . GLN A 112 ? 0.5924 0.4808 0.5550 -0.1791 0.0289  0.0591  274 GLN A C   
885  O O   . GLN A 112 ? 0.5752 0.4563 0.5526 -0.1830 0.0375  0.0453  274 GLN A O   
886  C CB  . GLN A 112 ? 0.6711 0.5251 0.6282 -0.1935 0.0071  0.1289  274 GLN A CB  
887  C CG  . GLN A 112 ? 0.7254 0.5840 0.6659 -0.2171 -0.0005 0.1753  274 GLN A CG  
888  C CD  . GLN A 112 ? 0.7632 0.5787 0.7283 -0.2069 -0.0213 0.2121  274 GLN A CD  
889  O OE1 . GLN A 112 ? 0.7647 0.5642 0.7496 -0.1812 -0.0311 0.2030  274 GLN A OE1 
890  N NE2 . GLN A 112 ? 0.8094 0.6080 0.7778 -0.2274 -0.0286 0.2555  274 GLN A NE2 
891  N N   . VAL A 113 ? 0.5672 0.4590 0.5334 -0.1602 0.0232  0.0459  275 VAL A N   
892  C CA  . VAL A 113 ? 0.5321 0.4211 0.5182 -0.1441 0.0273  0.0177  275 VAL A CA  
893  C C   . VAL A 113 ? 0.5173 0.4387 0.5014 -0.1489 0.0389  -0.0067 275 VAL A C   
894  O O   . VAL A 113 ? 0.4957 0.4175 0.4976 -0.1444 0.0443  -0.0230 275 VAL A O   
895  C CB  . VAL A 113 ? 0.5138 0.3983 0.5084 -0.1252 0.0176  0.0149  275 VAL A CB  
896  C CG1 . VAL A 113 ? 0.4688 0.3585 0.4805 -0.1134 0.0218  -0.0084 275 VAL A CG1 
897  C CG2 . VAL A 113 ? 0.5209 0.3752 0.5297 -0.1156 0.0073  0.0328  275 VAL A CG2 
898  N N   . LYS A 114 ? 0.5333 0.4856 0.4991 -0.1576 0.0419  -0.0105 276 LYS A N   
899  C CA  . LYS A 114 ? 0.5293 0.5152 0.5000 -0.1614 0.0539  -0.0378 276 LYS A CA  
900  C C   . LYS A 114 ? 0.5382 0.5361 0.5147 -0.1744 0.0659  -0.0413 276 LYS A C   
901  O O   . LYS A 114 ? 0.5256 0.5441 0.5220 -0.1707 0.0743  -0.0652 276 LYS A O   
902  C CB  . LYS A 114 ? 0.5479 0.5712 0.4961 -0.1719 0.0566  -0.0459 276 LYS A CB  
903  C CG  . LYS A 114 ? 0.5409 0.5689 0.5000 -0.1588 0.0510  -0.0670 276 LYS A CG  
904  C CD  . LYS A 114 ? 0.5673 0.6394 0.5053 -0.1717 0.0553  -0.0845 276 LYS A CD  
905  C CE  . LYS A 114 ? 0.6061 0.6866 0.5094 -0.1824 0.0434  -0.0563 276 LYS A CE  
906  N NZ  . LYS A 114 ? 0.6342 0.7618 0.5175 -0.1936 0.0439  -0.0784 276 LYS A NZ  
907  N N   . GLU A 115 ? 0.5660 0.5517 0.5303 -0.1901 0.0657  -0.0163 277 GLU A N   
908  C CA  . GLU A 115 ? 0.5756 0.5716 0.5468 -0.2067 0.0763  -0.0162 277 GLU A CA  
909  C C   . GLU A 115 ? 0.5487 0.5309 0.5503 -0.1950 0.0765  -0.0332 277 GLU A C   
910  O O   . GLU A 115 ? 0.5451 0.5555 0.5621 -0.1996 0.0860  -0.0506 277 GLU A O   
911  C CB  . GLU A 115 ? 0.6152 0.5891 0.5740 -0.2259 0.0721  0.0192  277 GLU A CB  
912  C CG  . GLU A 115 ? 0.6371 0.6248 0.6021 -0.2499 0.0833  0.0237  277 GLU A CG  
913  C CD  . GLU A 115 ? 0.6952 0.6664 0.6471 -0.2743 0.0790  0.0652  277 GLU A CD  
914  O OE1 . GLU A 115 ? 0.7416 0.6810 0.6867 -0.2680 0.0644  0.0913  277 GLU A OE1 
915  O OE2 . GLU A 115 ? 0.7226 0.7140 0.6749 -0.3004 0.0893  0.0740  277 GLU A OE2 
916  N N   . LEU A 116 ? 0.5326 0.4787 0.5436 -0.1803 0.0658  -0.0293 278 LEU A N   
917  C CA  . LEU A 116 ? 0.5074 0.4480 0.5416 -0.1714 0.0646  -0.0443 278 LEU A CA  
918  C C   . LEU A 116 ? 0.4737 0.4430 0.5237 -0.1584 0.0663  -0.0643 278 LEU A C   
919  O O   . LEU A 116 ? 0.4671 0.4547 0.5365 -0.1589 0.0688  -0.0760 278 LEU A O   
920  C CB  . LEU A 116 ? 0.5051 0.4113 0.5441 -0.1584 0.0544  -0.0397 278 LEU A CB  
921  C CG  . LEU A 116 ? 0.4957 0.4004 0.5528 -0.1536 0.0527  -0.0548 278 LEU A CG  
922  C CD1 . LEU A 116 ? 0.5117 0.4157 0.5779 -0.1724 0.0577  -0.0589 278 LEU A CD1 
923  C CD2 . LEU A 116 ? 0.4993 0.3790 0.5600 -0.1407 0.0455  -0.0548 278 LEU A CD2 
924  N N   . LEU A 117 ? 0.4618 0.4355 0.5077 -0.1475 0.0635  -0.0674 279 LEU A N   
925  C CA  . LEU A 117 ? 0.4334 0.4237 0.5026 -0.1331 0.0619  -0.0834 279 LEU A CA  
926  C C   . LEU A 117 ? 0.4285 0.4548 0.5140 -0.1370 0.0723  -0.1027 279 LEU A C   
927  O O   . LEU A 117 ? 0.4098 0.4512 0.5272 -0.1272 0.0710  -0.1140 279 LEU A O   
928  C CB  . LEU A 117 ? 0.4276 0.4071 0.4922 -0.1225 0.0549  -0.0821 279 LEU A CB  
929  C CG  . LEU A 117 ? 0.4376 0.3902 0.4941 -0.1153 0.0452  -0.0666 279 LEU A CG  
930  C CD1 . LEU A 117 ? 0.4325 0.3817 0.4859 -0.1085 0.0390  -0.0661 279 LEU A CD1 
931  C CD2 . LEU A 117 ? 0.4316 0.3830 0.5062 -0.1069 0.0405  -0.0664 279 LEU A CD2 
932  N N   . THR A 118 ? 0.4424 0.4872 0.5084 -0.1515 0.0821  -0.1057 280 THR A N   
933  C CA  . THR A 118 ? 0.4438 0.5320 0.5246 -0.1564 0.0953  -0.1296 280 THR A CA  
934  C C   . THR A 118 ? 0.4369 0.5494 0.5342 -0.1668 0.1039  -0.1328 280 THR A C   
935  O O   . THR A 118 ? 0.4330 0.5873 0.5525 -0.1682 0.1154  -0.1554 280 THR A O   
936  C CB  . THR A 118 ? 0.4711 0.5836 0.5202 -0.1719 0.1043  -0.1331 280 THR A CB  
937  O OG1 . THR A 118 ? 0.5119 0.6152 0.5276 -0.1922 0.1046  -0.1038 280 THR A OG1 
938  C CG2 . THR A 118 ? 0.4636 0.5614 0.5032 -0.1617 0.0951  -0.1367 280 THR A CG2 
939  N N   . SER A 119 ? 0.4329 0.5227 0.5245 -0.1738 0.0985  -0.1142 281 SER A N   
940  C CA  . SER A 119 ? 0.4266 0.5390 0.5386 -0.1839 0.1037  -0.1187 281 SER A CA  
941  C C   . SER A 119 ? 0.3970 0.5306 0.5519 -0.1652 0.0986  -0.1352 281 SER A C   
942  O O   . SER A 119 ? 0.3937 0.5635 0.5744 -0.1711 0.1045  -0.1457 281 SER A O   
943  C CB  . SER A 119 ? 0.4371 0.5172 0.5370 -0.1963 0.0976  -0.1000 281 SER A CB  
944  O OG  . SER A 119 ? 0.4148 0.4673 0.5203 -0.1801 0.0841  -0.0975 281 SER A OG  
945  N N   . PHE A 120 ? 0.3784 0.4923 0.5441 -0.1441 0.0866  -0.1343 282 PHE A N   
946  C CA  . PHE A 120 ? 0.3641 0.4953 0.5740 -0.1254 0.0781  -0.1422 282 PHE A CA  
947  C C   . PHE A 120 ? 0.3661 0.5199 0.6096 -0.1124 0.0842  -0.1655 282 PHE A C   
948  O O   . PHE A 120 ? 0.3635 0.5392 0.6553 -0.0980 0.0794  -0.1746 282 PHE A O   
949  C CB  . PHE A 120 ? 0.3510 0.4524 0.5595 -0.1118 0.0613  -0.1252 282 PHE A CB  
950  C CG  . PHE A 120 ? 0.3497 0.4377 0.5350 -0.1216 0.0556  -0.1112 282 PHE A CG  
951  C CD1 . PHE A 120 ? 0.3645 0.4207 0.5133 -0.1307 0.0579  -0.1030 282 PHE A CD1 
952  C CD2 . PHE A 120 ? 0.3337 0.4447 0.5375 -0.1218 0.0473  -0.1087 282 PHE A CD2 
953  C CE1 . PHE A 120 ? 0.3706 0.4140 0.5059 -0.1385 0.0538  -0.0975 282 PHE A CE1 
954  C CE2 . PHE A 120 ? 0.3398 0.4431 0.5233 -0.1324 0.0432  -0.1039 282 PHE A CE2 
955  C CZ  . PHE A 120 ? 0.3540 0.4216 0.5054 -0.1401 0.0474  -0.1008 282 PHE A CZ  
956  N N   . GLY A 121 ? 0.3778 0.5288 0.5992 -0.1175 0.0937  -0.1765 283 GLY A N   
957  C CA  . GLY A 121 ? 0.3823 0.5568 0.6347 -0.1071 0.1015  -0.2075 283 GLY A CA  
958  C C   . GLY A 121 ? 0.3905 0.5458 0.6137 -0.1091 0.1022  -0.2126 283 GLY A C   
959  O O   . GLY A 121 ? 0.3896 0.5115 0.5752 -0.1144 0.0939  -0.1882 283 GLY A O   
960  N N   . PRO A 122 ? 0.4030 0.5836 0.6463 -0.1050 0.1119  -0.2475 284 PRO A N   
961  C CA  . PRO A 122 ? 0.4211 0.5943 0.6364 -0.1101 0.1128  -0.2584 284 PRO A CA  
962  C C   . PRO A 122 ? 0.4107 0.5365 0.6362 -0.0961 0.0947  -0.2467 284 PRO A C   
963  O O   . PRO A 122 ? 0.3993 0.5052 0.6718 -0.0781 0.0836  -0.2437 284 PRO A O   
964  C CB  . PRO A 122 ? 0.4412 0.6614 0.6876 -0.1081 0.1288  -0.3081 284 PRO A CB  
965  C CG  . PRO A 122 ? 0.4323 0.6673 0.7427 -0.0907 0.1298  -0.3218 284 PRO A CG  
966  C CD  . PRO A 122 ? 0.4109 0.6346 0.7083 -0.0955 0.1229  -0.2831 284 PRO A CD  
967  N N   . LEU A 123 ? 0.4190 0.5311 0.6019 -0.1061 0.0910  -0.2371 285 LEU A N   
968  C CA  . LEU A 123 ? 0.4130 0.4869 0.6021 -0.0971 0.0754  -0.2260 285 LEU A CA  
969  C C   . LEU A 123 ? 0.4309 0.5151 0.6377 -0.0961 0.0773  -0.2634 285 LEU A C   
970  O O   . LEU A 123 ? 0.4488 0.5722 0.6353 -0.1086 0.0904  -0.2910 285 LEU A O   
971  C CB  . LEU A 123 ? 0.4111 0.4655 0.5485 -0.1074 0.0683  -0.1923 285 LEU A CB  
972  C CG  . LEU A 123 ? 0.4015 0.4403 0.5215 -0.1094 0.0654  -0.1595 285 LEU A CG  
973  C CD1 . LEU A 123 ? 0.4217 0.4472 0.4965 -0.1198 0.0609  -0.1347 285 LEU A CD1 
974  C CD2 . LEU A 123 ? 0.3747 0.3889 0.5254 -0.0946 0.0537  -0.1449 285 LEU A CD2 
975  N N   . LYS A 124 ? 0.4251 0.4776 0.6695 -0.0840 0.0644  -0.2647 286 LYS A N   
976  C CA  . LYS A 124 ? 0.4503 0.5056 0.7121 -0.0856 0.0635  -0.2999 286 LYS A CA  
977  C C   . LYS A 124 ? 0.4458 0.4806 0.6771 -0.0938 0.0510  -0.2803 286 LYS A C   
978  O O   . LYS A 124 ? 0.4645 0.5040 0.7046 -0.0989 0.0487  -0.3081 286 LYS A O   
979  C CB  . LYS A 124 ? 0.4602 0.4972 0.8012 -0.0677 0.0586  -0.3246 286 LYS A CB  
980  C CG  . LYS A 124 ? 0.4527 0.4448 0.8287 -0.0553 0.0403  -0.2856 286 LYS A CG  
981  C CD  . LYS A 124 ? 0.4717 0.4413 0.9296 -0.0409 0.0324  -0.3095 286 LYS A CD  
982  C CE  . LYS A 124 ? 0.4663 0.4028 0.9669 -0.0281 0.0149  -0.2660 286 LYS A CE  
983  N NZ  . LYS A 124 ? 0.5094 0.4195 1.0986 -0.0138 0.0049  -0.2849 286 LYS A NZ  
984  N N   . ALA A 125 ? 0.4256 0.4413 0.6256 -0.0951 0.0431  -0.2360 287 ALA A N   
985  C CA  . ALA A 125 ? 0.4223 0.4277 0.5913 -0.1026 0.0327  -0.2162 287 ALA A CA  
986  C C   . ALA A 125 ? 0.3983 0.3950 0.5295 -0.1038 0.0304  -0.1757 287 ALA A C   
987  O O   . ALA A 125 ? 0.3737 0.3614 0.5129 -0.0972 0.0327  -0.1605 287 ALA A O   
988  C CB  . ALA A 125 ? 0.4174 0.3931 0.6273 -0.0961 0.0195  -0.2119 287 ALA A CB  
989  N N   . PHE A 126 ? 0.4021 0.4033 0.4968 -0.1120 0.0248  -0.1603 288 PHE A N   
990  C CA  . PHE A 126 ? 0.3947 0.3849 0.4611 -0.1117 0.0215  -0.1255 288 PHE A CA  
991  C C   . PHE A 126 ? 0.3994 0.3923 0.4449 -0.1158 0.0106  -0.1108 288 PHE A C   
992  O O   . PHE A 126 ? 0.4228 0.4400 0.4518 -0.1261 0.0086  -0.1242 288 PHE A O   
993  C CB  . PHE A 126 ? 0.4043 0.4093 0.4423 -0.1204 0.0316  -0.1202 288 PHE A CB  
994  C CG  . PHE A 126 ? 0.4048 0.3940 0.4197 -0.1211 0.0271  -0.0870 288 PHE A CG  
995  C CD1 . PHE A 126 ? 0.3867 0.3532 0.4149 -0.1124 0.0270  -0.0739 288 PHE A CD1 
996  C CD2 . PHE A 126 ? 0.4336 0.4324 0.4173 -0.1305 0.0216  -0.0698 288 PHE A CD2 
997  C CE1 . PHE A 126 ? 0.3865 0.3363 0.4017 -0.1119 0.0234  -0.0509 288 PHE A CE1 
998  C CE2 . PHE A 126 ? 0.4310 0.4096 0.4049 -0.1286 0.0159  -0.0401 288 PHE A CE2 
999  C CZ  . PHE A 126 ? 0.4144 0.3665 0.4060 -0.1189 0.0177  -0.0339 288 PHE A CZ  
1000 N N   . ASN A 127 ? 0.3847 0.3591 0.4326 -0.1080 0.0034  -0.0856 289 ASN A N   
1001 C CA  . ASN A 127 ? 0.3947 0.3746 0.4258 -0.1094 -0.0071 -0.0678 289 ASN A CA  
1002 C C   . ASN A 127 ? 0.3858 0.3479 0.4163 -0.0998 -0.0097 -0.0419 289 ASN A C   
1003 O O   . ASN A 127 ? 0.3690 0.3179 0.4191 -0.0911 -0.0076 -0.0390 289 ASN A O   
1004 C CB  . ASN A 127 ? 0.3961 0.3853 0.4438 -0.1113 -0.0167 -0.0776 289 ASN A CB  
1005 C CG  . ASN A 127 ? 0.3724 0.3451 0.4528 -0.1029 -0.0194 -0.0709 289 ASN A CG  
1006 O OD1 . ASN A 127 ? 0.3685 0.3292 0.4729 -0.1003 -0.0149 -0.0792 289 ASN A OD1 
1007 N ND2 . ASN A 127 ? 0.3585 0.3363 0.4432 -0.0997 -0.0277 -0.0549 289 ASN A ND2 
1008 N N   . LEU A 128 ? 0.4037 0.3681 0.4133 -0.1023 -0.0144 -0.0237 290 LEU A N   
1009 C CA  . LEU A 128 ? 0.4068 0.3530 0.4230 -0.0919 -0.0182 -0.0032 290 LEU A CA  
1010 C C   . LEU A 128 ? 0.4109 0.3682 0.4381 -0.0851 -0.0309 0.0061  290 LEU A C   
1011 O O   . LEU A 128 ? 0.4343 0.4112 0.4479 -0.0919 -0.0409 0.0131  290 LEU A O   
1012 C CB  . LEU A 128 ? 0.4305 0.3682 0.4278 -0.0983 -0.0184 0.0151  290 LEU A CB  
1013 C CG  . LEU A 128 ? 0.4434 0.3570 0.4547 -0.0875 -0.0243 0.0353  290 LEU A CG  
1014 C CD1 . LEU A 128 ? 0.4148 0.3074 0.4444 -0.0796 -0.0142 0.0230  290 LEU A CD1 
1015 C CD2 . LEU A 128 ? 0.4700 0.3771 0.4648 -0.0978 -0.0297 0.0612  290 LEU A CD2 
1016 N N   . VAL A 129 ? 0.3957 0.3478 0.4474 -0.0733 -0.0304 0.0057  291 VAL A N   
1017 C CA  . VAL A 129 ? 0.3971 0.3664 0.4664 -0.0668 -0.0405 0.0116  291 VAL A CA  
1018 C C   . VAL A 129 ? 0.4208 0.3877 0.4945 -0.0572 -0.0507 0.0319  291 VAL A C   
1019 O O   . VAL A 129 ? 0.4255 0.3704 0.5079 -0.0480 -0.0468 0.0371  291 VAL A O   
1020 C CB  . VAL A 129 ? 0.3697 0.3433 0.4647 -0.0593 -0.0344 0.0049  291 VAL A CB  
1021 C CG1 . VAL A 129 ? 0.3661 0.3646 0.4824 -0.0542 -0.0434 0.0103  291 VAL A CG1 
1022 C CG2 . VAL A 129 ? 0.3458 0.3188 0.4432 -0.0686 -0.0279 -0.0075 291 VAL A CG2 
1023 N N   . LYS A 130 ? 0.4427 0.4327 0.5144 -0.0596 -0.0652 0.0427  292 LYS A N   
1024 C CA  . LYS A 130 ? 0.4766 0.4684 0.5562 -0.0507 -0.0800 0.0681  292 LYS A CA  
1025 C C   . LYS A 130 ? 0.4793 0.5016 0.5855 -0.0421 -0.0928 0.0722  292 LYS A C   
1026 O O   . LYS A 130 ? 0.4664 0.5125 0.5749 -0.0502 -0.0925 0.0573  292 LYS A O   
1027 C CB  . LYS A 130 ? 0.5061 0.5068 0.5511 -0.0661 -0.0890 0.0857  292 LYS A CB  
1028 C CG  . LYS A 130 ? 0.5170 0.4938 0.5383 -0.0764 -0.0760 0.0842  292 LYS A CG  
1029 C CD  . LYS A 130 ? 0.5614 0.5568 0.5468 -0.0948 -0.0835 0.1043  292 LYS A CD  
1030 C CE  . LYS A 130 ? 0.5779 0.6073 0.5343 -0.1132 -0.0774 0.0791  292 LYS A CE  
1031 N NZ  . LYS A 130 ? 0.5659 0.5802 0.5186 -0.1179 -0.0567 0.0513  292 LYS A NZ  
1032 N N   . ASP A 131 ? 0.5052 0.5266 0.6375 -0.0258 -0.1048 0.0923  293 ASP A N   
1033 C CA  . ASP A 131 ? 0.5100 0.5669 0.6715 -0.0164 -0.1203 0.1004  293 ASP A CA  
1034 C C   . ASP A 131 ? 0.5405 0.6276 0.6749 -0.0318 -0.1395 0.1182  293 ASP A C   
1035 O O   . ASP A 131 ? 0.5737 0.6535 0.6922 -0.0341 -0.1510 0.1456  293 ASP A O   
1036 C CB  . ASP A 131 ? 0.5269 0.5722 0.7329 0.0091  -0.1277 0.1152  293 ASP A CB  
1037 C CG  . ASP A 131 ? 0.5406 0.6280 0.7843 0.0214  -0.1451 0.1248  293 ASP A CG  
1038 O OD1 . ASP A 131 ? 0.5900 0.6948 0.8319 0.0207  -0.1681 0.1539  293 ASP A OD1 
1039 O OD2 . ASP A 131 ? 0.5522 0.6611 0.8282 0.0308  -0.1362 0.1048  293 ASP A OD2 
1040 N N   . SER A 132 ? 0.5313 0.6552 0.6609 -0.0445 -0.1436 0.1035  294 SER A N   
1041 C CA  . SER A 132 ? 0.5563 0.7156 0.6533 -0.0642 -0.1592 0.1104  294 SER A CA  
1042 C C   . SER A 132 ? 0.5892 0.7785 0.6981 -0.0564 -0.1861 0.1464  294 SER A C   
1043 O O   . SER A 132 ? 0.6240 0.8366 0.6983 -0.0714 -0.2000 0.1652  294 SER A O   
1044 C CB  . SER A 132 ? 0.5442 0.7330 0.6392 -0.0813 -0.1571 0.0799  294 SER A CB  
1045 O OG  . SER A 132 ? 0.5266 0.7312 0.6649 -0.0714 -0.1586 0.0742  294 SER A OG  
1046 N N   . ALA A 133 ? 0.5814 0.7748 0.7409 -0.0330 -0.1935 0.1565  295 ALA A N   
1047 C CA  . ALA A 133 ? 0.6133 0.8343 0.7976 -0.0204 -0.2214 0.1932  295 ALA A CA  
1048 C C   . ALA A 133 ? 0.6497 0.8376 0.8273 -0.0135 -0.2308 0.2317  295 ALA A C   
1049 O O   . ALA A 133 ? 0.6906 0.9059 0.8585 -0.0184 -0.2563 0.2694  295 ALA A O   
1050 C CB  . ALA A 133 ? 0.5987 0.8335 0.8486 0.0057  -0.2241 0.1888  295 ALA A CB  
1051 N N   . THR A 134 ? 0.6398 0.7716 0.8234 -0.0044 -0.2115 0.2241  296 THR A N   
1052 C CA  . THR A 134 ? 0.6769 0.7685 0.8610 0.0001  -0.2181 0.2586  296 THR A CA  
1053 C C   . THR A 134 ? 0.6822 0.7515 0.8094 -0.0251 -0.2031 0.2562  296 THR A C   
1054 O O   . THR A 134 ? 0.7239 0.7755 0.8383 -0.0321 -0.2122 0.2922  296 THR A O   
1055 C CB  . THR A 134 ? 0.6728 0.7158 0.9141 0.0288  -0.2085 0.2505  296 THR A CB  
1056 O OG1 . THR A 134 ? 0.6304 0.6520 0.8622 0.0262  -0.1788 0.2066  296 THR A OG1 
1057 C CG2 . THR A 134 ? 0.6741 0.7421 0.9808 0.0570  -0.2226 0.2525  296 THR A CG2 
1058 N N   . GLY A 135 ? 0.6454 0.7167 0.7437 -0.0387 -0.1805 0.2159  297 GLY A N   
1059 C CA  . GLY A 135 ? 0.6449 0.6999 0.6971 -0.0601 -0.1638 0.2068  297 GLY A CA  
1060 C C   . GLY A 135 ? 0.6353 0.6346 0.7015 -0.0520 -0.1456 0.1992  297 GLY A C   
1061 O O   . GLY A 135 ? 0.6406 0.6259 0.6750 -0.0688 -0.1345 0.1997  297 GLY A O   
1062 N N   . LEU A 136 ? 0.6186 0.5923 0.7327 -0.0277 -0.1417 0.1884  298 LEU A N   
1063 C CA  . LEU A 136 ? 0.6141 0.5382 0.7474 -0.0192 -0.1271 0.1789  298 LEU A CA  
1064 C C   . LEU A 136 ? 0.5691 0.4883 0.6978 -0.0198 -0.1030 0.1360  298 LEU A C   
1065 O O   . LEU A 136 ? 0.5444 0.4886 0.6845 -0.0137 -0.0991 0.1154  298 LEU A O   
1066 C CB  . LEU A 136 ? 0.6340 0.5353 0.8274 0.0080  -0.1380 0.1908  298 LEU A CB  
1067 C CG  . LEU A 136 ? 0.6871 0.5824 0.8948 0.0104  -0.1647 0.2417  298 LEU A CG  
1068 C CD1 . LEU A 136 ? 0.7012 0.5927 0.9785 0.0421  -0.1805 0.2505  298 LEU A CD1 
1069 C CD2 . LEU A 136 ? 0.7111 0.5615 0.9078 -0.0029 -0.1627 0.2644  298 LEU A CD2 
1070 N N   . SER A 137 ? 0.5639 0.4538 0.6782 -0.0286 -0.0882 0.1263  299 SER A N   
1071 C CA  . SER A 137 ? 0.5254 0.4129 0.6322 -0.0317 -0.0678 0.0918  299 SER A CA  
1072 C C   . SER A 137 ? 0.5040 0.3908 0.6485 -0.0124 -0.0606 0.0694  299 SER A C   
1073 O O   . SER A 137 ? 0.5198 0.3893 0.7008 0.0042  -0.0653 0.0729  299 SER A O   
1074 C CB  . SER A 137 ? 0.5335 0.3930 0.6231 -0.0445 -0.0564 0.0895  299 SER A CB  
1075 O OG  . SER A 137 ? 0.4972 0.3521 0.5904 -0.0431 -0.0399 0.0597  299 SER A OG  
1076 N N   . LYS A 138 ? 0.4678 0.3762 0.6058 -0.0155 -0.0494 0.0468  300 LYS A N   
1077 C CA  . LYS A 138 ? 0.4480 0.3687 0.6133 -0.0030 -0.0395 0.0248  300 LYS A CA  
1078 C C   . LYS A 138 ? 0.4377 0.3435 0.5968 -0.0070 -0.0239 0.0047  300 LYS A C   
1079 O O   . LYS A 138 ? 0.4253 0.3483 0.5999 -0.0006 -0.0140 -0.0153 300 LYS A O   
1080 C CB  . LYS A 138 ? 0.4240 0.3825 0.5888 -0.0072 -0.0383 0.0182  300 LYS A CB  
1081 C CG  . LYS A 138 ? 0.4311 0.4135 0.6073 -0.0038 -0.0541 0.0333  300 LYS A CG  
1082 C CD  . LYS A 138 ? 0.4073 0.4282 0.6001 -0.0048 -0.0514 0.0238  300 LYS A CD  
1083 C CE  . LYS A 138 ? 0.4146 0.4634 0.6181 -0.0050 -0.0684 0.0370  300 LYS A CE  
1084 N NZ  . LYS A 138 ? 0.3911 0.4798 0.6175 -0.0074 -0.0657 0.0287  300 LYS A NZ  
1085 N N   . GLY A 139 ? 0.4438 0.3253 0.5796 -0.0195 -0.0217 0.0097  301 GLY A N   
1086 C CA  . GLY A 139 ? 0.4370 0.3052 0.5694 -0.0244 -0.0094 -0.0081 301 GLY A CA  
1087 C C   . GLY A 139 ? 0.4052 0.2939 0.5186 -0.0348 -0.0002 -0.0198 301 GLY A C   
1088 O O   . GLY A 139 ? 0.3991 0.2889 0.5125 -0.0377 0.0085  -0.0354 301 GLY A O   
1089 N N   . TYR A 140 ? 0.3857 0.2920 0.4871 -0.0406 -0.0037 -0.0125 302 TYR A N   
1090 C CA  . TYR A 140 ? 0.3621 0.2821 0.4535 -0.0497 0.0020  -0.0190 302 TYR A CA  
1091 C C   . TYR A 140 ? 0.3605 0.2820 0.4385 -0.0590 -0.0023 -0.0135 302 TYR A C   
1092 O O   . TYR A 140 ? 0.3676 0.2906 0.4408 -0.0597 -0.0103 -0.0051 302 TYR A O   
1093 C CB  . TYR A 140 ? 0.3447 0.2928 0.4495 -0.0465 0.0052  -0.0239 302 TYR A CB  
1094 C CG  . TYR A 140 ? 0.3333 0.3004 0.4521 -0.0419 -0.0008 -0.0175 302 TYR A CG  
1095 C CD1 . TYR A 140 ? 0.3253 0.3042 0.4455 -0.0500 -0.0053 -0.0111 302 TYR A CD1 
1096 C CD2 . TYR A 140 ? 0.3385 0.3133 0.4760 -0.0293 -0.0021 -0.0199 302 TYR A CD2 
1097 C CE1 . TYR A 140 ? 0.3220 0.3217 0.4576 -0.0488 -0.0113 -0.0059 302 TYR A CE1 
1098 C CE2 . TYR A 140 ? 0.3379 0.3373 0.4925 -0.0253 -0.0078 -0.0144 302 TYR A CE2 
1099 C CZ  . TYR A 140 ? 0.3328 0.3457 0.4844 -0.0365 -0.0124 -0.0067 302 TYR A CZ  
1100 O OH  . TYR A 140 ? 0.3206 0.3606 0.4912 -0.0355 -0.0184 -0.0020 302 TYR A OH  
1101 N N   . ALA A 141 ? 0.3505 0.2748 0.4250 -0.0660 0.0024  -0.0201 303 ALA A N   
1102 C CA  . ALA A 141 ? 0.3538 0.2799 0.4211 -0.0741 0.0014  -0.0240 303 ALA A CA  
1103 C C   . ALA A 141 ? 0.3430 0.2764 0.4266 -0.0757 0.0029  -0.0303 303 ALA A C   
1104 O O   . ALA A 141 ? 0.3287 0.2676 0.4221 -0.0730 0.0048  -0.0269 303 ALA A O   
1105 C CB  . ALA A 141 ? 0.3603 0.2780 0.4105 -0.0814 0.0063  -0.0258 303 ALA A CB  
1106 N N   . PHE A 142 ? 0.3527 0.2882 0.4410 -0.0807 0.0013  -0.0395 304 PHE A N   
1107 C CA  . PHE A 142 ? 0.3525 0.2887 0.4658 -0.0811 0.0009  -0.0463 304 PHE A CA  
1108 C C   . PHE A 142 ? 0.3668 0.3045 0.4799 -0.0845 0.0066  -0.0648 304 PHE A C   
1109 O O   . PHE A 142 ? 0.3828 0.3269 0.4749 -0.0905 0.0093  -0.0734 304 PHE A O   
1110 C CB  . PHE A 142 ? 0.3475 0.2852 0.4811 -0.0836 -0.0068 -0.0466 304 PHE A CB  
1111 C CG  . PHE A 142 ? 0.3386 0.2838 0.4768 -0.0821 -0.0108 -0.0294 304 PHE A CG  
1112 C CD1 . PHE A 142 ? 0.3312 0.2816 0.4894 -0.0824 -0.0124 -0.0152 304 PHE A CD1 
1113 C CD2 . PHE A 142 ? 0.3277 0.2807 0.4521 -0.0808 -0.0132 -0.0255 304 PHE A CD2 
1114 C CE1 . PHE A 142 ? 0.3253 0.2929 0.4862 -0.0833 -0.0135 -0.0008 304 PHE A CE1 
1115 C CE2 . PHE A 142 ? 0.3196 0.2867 0.4529 -0.0785 -0.0149 -0.0135 304 PHE A CE2 
1116 C CZ  . PHE A 142 ? 0.3145 0.2911 0.4642 -0.0807 -0.0136 -0.0028 304 PHE A CZ  
1117 N N   . CYS A 143 ? 0.3680 0.3056 0.5062 -0.0811 0.0082  -0.0699 305 CYS A N   
1118 C CA  . CYS A 143 ? 0.3833 0.3286 0.5310 -0.0824 0.0150  -0.0924 305 CYS A CA  
1119 C C   . CYS A 143 ? 0.3812 0.3238 0.5756 -0.0747 0.0115  -0.0981 305 CYS A C   
1120 O O   . CYS A 143 ? 0.3715 0.3071 0.5855 -0.0705 0.0031  -0.0777 305 CYS A O   
1121 C CB  . CYS A 143 ? 0.3839 0.3383 0.5071 -0.0868 0.0243  -0.0924 305 CYS A CB  
1122 S SG  . CYS A 143 ? 0.4158 0.3732 0.5517 -0.0824 0.0249  -0.0812 305 CYS A SG  
1123 N N   . GLU A 144 ? 0.3931 0.3448 0.6077 -0.0733 0.0177  -0.1252 306 GLU A N   
1124 C CA  . GLU A 144 ? 0.3964 0.3465 0.6642 -0.0628 0.0143  -0.1323 306 GLU A CA  
1125 C C   . GLU A 144 ? 0.3980 0.3720 0.6759 -0.0610 0.0267  -0.1606 306 GLU A C   
1126 O O   . GLU A 144 ? 0.4000 0.3905 0.6601 -0.0684 0.0374  -0.1876 306 GLU A O   
1127 C CB  . GLU A 144 ? 0.4128 0.3445 0.7236 -0.0594 0.0056  -0.1426 306 GLU A CB  
1128 C CG  . GLU A 144 ? 0.4264 0.3457 0.7994 -0.0473 -0.0051 -0.1316 306 GLU A CG  
1129 C CD  . GLU A 144 ? 0.4568 0.3497 0.8807 -0.0457 -0.0158 -0.1376 306 GLU A CD  
1130 O OE1 . GLU A 144 ? 0.4871 0.3735 0.8940 -0.0557 -0.0155 -0.1489 306 GLU A OE1 
1131 O OE2 . GLU A 144 ? 0.4935 0.3724 0.9788 -0.0350 -0.0260 -0.1295 306 GLU A OE2 
1132 N N   . TYR A 145 ? 0.3903 0.3732 0.6957 -0.0528 0.0252  -0.1534 307 TYR A N   
1133 C CA  . TYR A 145 ? 0.3997 0.4120 0.7217 -0.0508 0.0375  -0.1799 307 TYR A CA  
1134 C C   . TYR A 145 ? 0.4192 0.4347 0.8044 -0.0380 0.0382  -0.2138 307 TYR A C   
1135 O O   . TYR A 145 ? 0.4168 0.4064 0.8482 -0.0272 0.0243  -0.2060 307 TYR A O   
1136 C CB  . TYR A 145 ? 0.3802 0.4075 0.7086 -0.0480 0.0349  -0.1604 307 TYR A CB  
1137 C CG  . TYR A 145 ? 0.3611 0.3904 0.6324 -0.0623 0.0388  -0.1409 307 TYR A CG  
1138 C CD1 . TYR A 145 ? 0.3684 0.4186 0.6103 -0.0754 0.0535  -0.1532 307 TYR A CD1 
1139 C CD2 . TYR A 145 ? 0.3441 0.3561 0.5952 -0.0637 0.0282  -0.1114 307 TYR A CD2 
1140 C CE1 . TYR A 145 ? 0.3655 0.4106 0.5649 -0.0885 0.0556  -0.1353 307 TYR A CE1 
1141 C CE2 . TYR A 145 ? 0.3465 0.3577 0.5546 -0.0749 0.0320  -0.1000 307 TYR A CE2 
1142 C CZ  . TYR A 145 ? 0.3619 0.3852 0.5470 -0.0868 0.0447  -0.1114 307 TYR A CZ  
1143 O OH  . TYR A 145 ? 0.3580 0.3736 0.5096 -0.0979 0.0469  -0.0998 307 TYR A OH  
1144 N N   . VAL A 146 ? 0.4383 0.4872 0.8274 -0.0405 0.0549  -0.2521 308 VAL A N   
1145 C CA  . VAL A 146 ? 0.4680 0.5288 0.9234 -0.0268 0.0594  -0.2949 308 VAL A CA  
1146 C C   . VAL A 146 ? 0.4708 0.5248 0.9967 -0.0061 0.0466  -0.2813 308 VAL A C   
1147 O O   . VAL A 146 ? 0.4871 0.5157 1.0782 0.0093  0.0346  -0.2876 308 VAL A O   
1148 C CB  . VAL A 146 ? 0.4786 0.5923 0.9225 -0.0350 0.0829  -0.3381 308 VAL A CB  
1149 C CG1 . VAL A 146 ? 0.5086 0.6396 1.0320 -0.0171 0.0887  -0.3875 308 VAL A CG1 
1150 C CG2 . VAL A 146 ? 0.4941 0.6213 0.8736 -0.0561 0.0931  -0.3514 308 VAL A CG2 
1151 N N   . ASP A 147 ? 0.4621 0.5397 0.9780 -0.0068 0.0477  -0.2613 309 ASP A N   
1152 C CA  . ASP A 147 ? 0.4610 0.5402 1.0359 0.0106  0.0323  -0.2399 309 ASP A CA  
1153 C C   . ASP A 147 ? 0.4521 0.5021 1.0023 0.0068  0.0128  -0.1869 309 ASP A C   
1154 O O   . ASP A 147 ? 0.4335 0.4886 0.9213 -0.0083 0.0154  -0.1656 309 ASP A O   
1155 C CB  . ASP A 147 ? 0.4522 0.5795 1.0280 0.0087  0.0423  -0.2458 309 ASP A CB  
1156 C CG  . ASP A 147 ? 0.4623 0.6020 1.1091 0.0287  0.0252  -0.2283 309 ASP A CG  
1157 O OD1 . ASP A 147 ? 0.4659 0.6484 1.1192 0.0272  0.0306  -0.2309 309 ASP A OD1 
1158 O OD2 . ASP A 147 ? 0.4966 0.6058 1.1953 0.0447  0.0052  -0.2096 309 ASP A OD2 
1159 N N   . ILE A 148 ? 0.4661 0.4876 1.0685 0.0197  -0.0067 -0.1661 310 ILE A N   
1160 C CA  . ILE A 148 ? 0.4602 0.4620 1.0404 0.0138  -0.0246 -0.1149 310 ILE A CA  
1161 C C   . ILE A 148 ? 0.4464 0.4781 1.0194 0.0134  -0.0347 -0.0813 310 ILE A C   
1162 O O   . ILE A 148 ? 0.4418 0.4716 0.9814 0.0042  -0.0453 -0.0435 310 ILE A O   
1163 C CB  . ILE A 148 ? 0.4894 0.4526 1.1270 0.0227  -0.0434 -0.0961 310 ILE A CB  
1164 C CG1 . ILE A 148 ? 0.5139 0.4760 1.2481 0.0457  -0.0546 -0.1046 310 ILE A CG1 
1165 C CG2 . ILE A 148 ? 0.5024 0.4367 1.1247 0.0146  -0.0349 -0.1231 310 ILE A CG2 
1166 C CD1 . ILE A 148 ? 0.5389 0.4568 1.3390 0.0534  -0.0746 -0.0842 310 ILE A CD1 
1167 N N   . ASN A 149 ? 0.4408 0.5068 1.0439 0.0217  -0.0302 -0.0984 311 ASN A N   
1168 C CA  . ASN A 149 ? 0.4257 0.5283 1.0235 0.0194  -0.0394 -0.0730 311 ASN A CA  
1169 C C   . ASN A 149 ? 0.4004 0.5205 0.9210 -0.0019 -0.0246 -0.0782 311 ASN A C   
1170 O O   . ASN A 149 ? 0.3912 0.5354 0.8903 -0.0101 -0.0327 -0.0557 311 ASN A O   
1171 C CB  . ASN A 149 ? 0.4386 0.5747 1.1080 0.0371  -0.0416 -0.0904 311 ASN A CB  
1172 C CG  . ASN A 149 ? 0.4777 0.5906 1.2365 0.0612  -0.0559 -0.0912 311 ASN A CG  
1173 O OD1 . ASN A 149 ? 0.5171 0.5951 1.2902 0.0635  -0.0735 -0.0585 311 ASN A OD1 
1174 N ND2 . ASN A 149 ? 0.5082 0.6413 1.3316 0.0785  -0.0478 -0.1297 311 ASN A ND2 
1175 N N   . VAL A 150 ? 0.3883 0.4972 0.8704 -0.0118 -0.0041 -0.1078 312 VAL A N   
1176 C CA  . VAL A 150 ? 0.3689 0.4818 0.7820 -0.0323 0.0088  -0.1098 312 VAL A CA  
1177 C C   . VAL A 150 ? 0.3578 0.4454 0.7241 -0.0411 0.0011  -0.0825 312 VAL A C   
1178 O O   . VAL A 150 ? 0.3440 0.4372 0.6663 -0.0547 0.0050  -0.0767 312 VAL A O   
1179 C CB  . VAL A 150 ? 0.3728 0.4833 0.7614 -0.0407 0.0302  -0.1429 312 VAL A CB  
1180 C CG1 . VAL A 150 ? 0.3679 0.4730 0.6902 -0.0614 0.0401  -0.1373 312 VAL A CG1 
1181 C CG2 . VAL A 150 ? 0.3772 0.5262 0.8074 -0.0355 0.0419  -0.1738 312 VAL A CG2 
1182 N N   . THR A 151 ? 0.3552 0.4164 0.7362 -0.0337 -0.0091 -0.0683 313 THR A N   
1183 C CA  . THR A 151 ? 0.3493 0.3933 0.6929 -0.0415 -0.0152 -0.0439 313 THR A CA  
1184 C C   . THR A 151 ? 0.3389 0.4087 0.6590 -0.0494 -0.0228 -0.0214 313 THR A C   
1185 O O   . THR A 151 ? 0.3194 0.3870 0.5930 -0.0606 -0.0166 -0.0215 313 THR A O   
1186 C CB  . THR A 151 ? 0.3609 0.3826 0.7397 -0.0334 -0.0291 -0.0247 313 THR A CB  
1187 O OG1 . THR A 151 ? 0.3637 0.3629 0.7671 -0.0274 -0.0223 -0.0522 313 THR A OG1 
1188 C CG2 . THR A 151 ? 0.3500 0.3624 0.6905 -0.0435 -0.0327 -0.0013 313 THR A CG2 
1189 N N   . ASP A 152 ? 0.3442 0.4412 0.7006 -0.0432 -0.0371 -0.0040 314 ASP A N   
1190 C CA  . ASP A 152 ? 0.3466 0.4794 0.6823 -0.0524 -0.0462 0.0153  314 ASP A CA  
1191 C C   . ASP A 152 ? 0.3353 0.4886 0.6428 -0.0639 -0.0347 -0.0079 314 ASP A C   
1192 O O   . ASP A 152 ? 0.3352 0.5086 0.6095 -0.0763 -0.0364 -0.0038 314 ASP A O   
1193 C CB  . ASP A 152 ? 0.3624 0.5244 0.7475 -0.0433 -0.0681 0.0449  314 ASP A CB  
1194 C CG  . ASP A 152 ? 0.3948 0.5406 0.8015 -0.0387 -0.0834 0.0803  314 ASP A CG  
1195 O OD1 . ASP A 152 ? 0.4412 0.5895 0.9073 -0.0258 -0.1006 0.1020  314 ASP A OD1 
1196 O OD2 . ASP A 152 ? 0.4176 0.5486 0.7865 -0.0483 -0.0788 0.0875  314 ASP A OD2 
1197 N N   . GLN A 153 ? 0.3262 0.4777 0.6495 -0.0617 -0.0227 -0.0337 315 GLN A N   
1198 C CA  . GLN A 153 ? 0.3237 0.4903 0.6237 -0.0760 -0.0103 -0.0544 315 GLN A CA  
1199 C C   . GLN A 153 ? 0.3189 0.4545 0.5663 -0.0889 0.0023  -0.0633 315 GLN A C   
1200 O O   . GLN A 153 ? 0.3175 0.4607 0.5396 -0.1030 0.0058  -0.0698 315 GLN A O   
1201 C CB  . GLN A 153 ? 0.3236 0.5017 0.6548 -0.0723 0.0010  -0.0776 315 GLN A CB  
1202 C CG  . GLN A 153 ? 0.3345 0.5484 0.7276 -0.0575 -0.0114 -0.0729 315 GLN A CG  
1203 C CD  . GLN A 153 ? 0.3393 0.5708 0.7703 -0.0515 0.0024  -0.1018 315 GLN A CD  
1204 O OE1 . GLN A 153 ? 0.3585 0.5742 0.7688 -0.0577 0.0210  -0.1236 315 GLN A OE1 
1205 N NE2 . GLN A 153 ? 0.3497 0.6207 0.8379 -0.0397 -0.0071 -0.1017 315 GLN A NE2 
1206 N N   . ALA A 154 ? 0.3094 0.4109 0.5461 -0.0837 0.0078  -0.0641 316 ALA A N   
1207 C CA  . ALA A 154 ? 0.3119 0.3841 0.5069 -0.0922 0.0166  -0.0682 316 ALA A CA  
1208 C C   . ALA A 154 ? 0.3099 0.3824 0.4829 -0.0949 0.0097  -0.0560 316 ALA A C   
1209 O O   . ALA A 154 ? 0.3156 0.3791 0.4625 -0.1042 0.0156  -0.0643 316 ALA A O   
1210 C CB  . ALA A 154 ? 0.3102 0.3554 0.5033 -0.0858 0.0213  -0.0715 316 ALA A CB  
1211 N N   . ILE A 155 ? 0.3057 0.3906 0.4928 -0.0876 -0.0026 -0.0366 317 ILE A N   
1212 C CA  . ILE A 155 ? 0.3096 0.4101 0.4766 -0.0922 -0.0084 -0.0247 317 ILE A CA  
1213 C C   . ILE A 155 ? 0.3163 0.4503 0.4713 -0.1035 -0.0096 -0.0342 317 ILE A C   
1214 O O   . ILE A 155 ? 0.3258 0.4605 0.4547 -0.1114 -0.0039 -0.0469 317 ILE A O   
1215 C CB  . ILE A 155 ? 0.3127 0.4291 0.5007 -0.0861 -0.0229 0.0048  317 ILE A CB  
1216 C CG1 . ILE A 155 ? 0.3050 0.3866 0.5036 -0.0784 -0.0217 0.0108  317 ILE A CG1 
1217 C CG2 . ILE A 155 ? 0.3190 0.4702 0.4833 -0.0952 -0.0281 0.0176  317 ILE A CG2 
1218 C CD1 . ILE A 155 ? 0.3211 0.4077 0.5558 -0.0726 -0.0370 0.0408  317 ILE A CD1 
1219 N N   . ALA A 156 ? 0.3137 0.4774 0.4927 -0.1040 -0.0174 -0.0307 318 ALA A N   
1220 C CA  . ALA A 156 ? 0.3221 0.5238 0.4942 -0.1168 -0.0204 -0.0418 318 ALA A CA  
1221 C C   . ALA A 156 ? 0.3258 0.5063 0.4804 -0.1288 -0.0059 -0.0713 318 ALA A C   
1222 O O   . ALA A 156 ? 0.3394 0.5355 0.4767 -0.1413 -0.0049 -0.0870 318 ALA A O   
1223 C CB  . ALA A 156 ? 0.3194 0.5568 0.5291 -0.1130 -0.0321 -0.0322 318 ALA A CB  
1224 N N   . GLY A 157 ? 0.3204 0.4672 0.4812 -0.1266 0.0049  -0.0786 319 GLY A N   
1225 C CA  . GLY A 157 ? 0.3328 0.4588 0.4826 -0.1403 0.0169  -0.0981 319 GLY A CA  
1226 C C   . GLY A 157 ? 0.3422 0.4275 0.4671 -0.1426 0.0244  -0.1049 319 GLY A C   
1227 O O   . GLY A 157 ? 0.3541 0.4221 0.4740 -0.1556 0.0308  -0.1191 319 GLY A O   
1228 N N   . LEU A 158 ? 0.3372 0.4069 0.4526 -0.1303 0.0226  -0.0938 320 LEU A N   
1229 C CA  . LEU A 158 ? 0.3520 0.3852 0.4511 -0.1280 0.0284  -0.0976 320 LEU A CA  
1230 C C   . LEU A 158 ? 0.3557 0.4007 0.4447 -0.1228 0.0254  -0.0997 320 LEU A C   
1231 O O   . LEU A 158 ? 0.3609 0.3846 0.4436 -0.1224 0.0304  -0.1120 320 LEU A O   
1232 C CB  . LEU A 158 ? 0.3444 0.3498 0.4417 -0.1194 0.0313  -0.0852 320 LEU A CB  
1233 C CG  . LEU A 158 ? 0.3550 0.3510 0.4560 -0.1261 0.0379  -0.0857 320 LEU A CG  
1234 C CD1 . LEU A 158 ? 0.3471 0.3276 0.4436 -0.1181 0.0393  -0.0771 320 LEU A CD1 
1235 C CD2 . LEU A 158 ? 0.3624 0.3371 0.4565 -0.1407 0.0442  -0.0922 320 LEU A CD2 
1236 N N   . ASN A 159 ? 0.3514 0.4324 0.4422 -0.1191 0.0174  -0.0868 321 ASN A N   
1237 C CA  . ASN A 159 ? 0.3618 0.4654 0.4409 -0.1174 0.0163  -0.0868 321 ASN A CA  
1238 C C   . ASN A 159 ? 0.3864 0.5161 0.4562 -0.1281 0.0193  -0.1140 321 ASN A C   
1239 O O   . ASN A 159 ? 0.3973 0.5547 0.4693 -0.1388 0.0152  -0.1223 321 ASN A O   
1240 C CB  . ASN A 159 ? 0.3527 0.4918 0.4365 -0.1147 0.0056  -0.0593 321 ASN A CB  
1241 C CG  . ASN A 159 ? 0.3534 0.5205 0.4234 -0.1157 0.0066  -0.0555 321 ASN A CG  
1242 O OD1 . ASN A 159 ? 0.3337 0.4791 0.3994 -0.1099 0.0144  -0.0631 321 ASN A OD1 
1243 N ND2 . ASN A 159 ? 0.3243 0.5463 0.3882 -0.1240 -0.0014 -0.0428 321 ASN A ND2 
1244 N N   . GLY A 160 ? 0.4086 0.5316 0.4720 -0.1250 0.0266  -0.1313 322 GLY A N   
1245 C CA  . GLY A 160 ? 0.4375 0.5847 0.4966 -0.1337 0.0316  -0.1664 322 GLY A CA  
1246 C C   . GLY A 160 ? 0.4630 0.5735 0.5347 -0.1410 0.0360  -0.1926 322 GLY A C   
1247 O O   . GLY A 160 ? 0.4889 0.6186 0.5624 -0.1510 0.0389  -0.2263 322 GLY A O   
1248 N N   . MET A 161 ? 0.4652 0.5255 0.5464 -0.1381 0.0366  -0.1781 323 MET A N   
1249 C CA  . MET A 161 ? 0.4926 0.5185 0.5873 -0.1495 0.0395  -0.1931 323 MET A CA  
1250 C C   . MET A 161 ? 0.5202 0.4923 0.6290 -0.1426 0.0446  -0.2021 323 MET A C   
1251 O O   . MET A 161 ? 0.5030 0.4583 0.6100 -0.1275 0.0450  -0.1875 323 MET A O   
1252 C CB  . MET A 161 ? 0.4755 0.4892 0.5724 -0.1541 0.0376  -0.1691 323 MET A CB  
1253 C CG  . MET A 161 ? 0.4573 0.5191 0.5510 -0.1549 0.0305  -0.1547 323 MET A CG  
1254 S SD  . MET A 161 ? 0.4630 0.5789 0.5612 -0.1729 0.0248  -0.1756 323 MET A SD  
1255 C CE  . MET A 161 ? 0.4791 0.5714 0.5948 -0.1868 0.0290  -0.1763 323 MET A CE  
1256 N N   . GLN A 162 ? 0.5670 0.5115 0.6944 -0.1541 0.0469  -0.2242 324 GLN A N   
1257 C CA  . GLN A 162 ? 0.6050 0.4951 0.7560 -0.1470 0.0491  -0.2320 324 GLN A CA  
1258 C C   . GLN A 162 ? 0.6161 0.4599 0.7686 -0.1463 0.0465  -0.1946 324 GLN A C   
1259 O O   . GLN A 162 ? 0.6099 0.4530 0.7557 -0.1609 0.0463  -0.1781 324 GLN A O   
1260 C CB  . GLN A 162 ? 0.6485 0.5218 0.8266 -0.1608 0.0511  -0.2700 324 GLN A CB  
1261 C CG  . GLN A 162 ? 0.6905 0.5186 0.9033 -0.1479 0.0528  -0.2904 324 GLN A CG  
1262 C CD  . GLN A 162 ? 0.7124 0.5799 0.9322 -0.1394 0.0587  -0.3372 324 GLN A CD  
1263 O OE1 . GLN A 162 ? 0.7702 0.6583 1.0001 -0.1532 0.0616  -0.3796 324 GLN A OE1 
1264 N NE2 . GLN A 162 ? 0.7045 0.5878 0.9200 -0.1186 0.0612  -0.3323 324 GLN A NE2 
1265 N N   . LEU A 163 ? 0.6320 0.4461 0.7926 -0.1297 0.0446  -0.1816 325 LEU A N   
1266 C CA  . LEU A 163 ? 0.6457 0.4198 0.8072 -0.1295 0.0403  -0.1457 325 LEU A CA  
1267 C C   . LEU A 163 ? 0.6895 0.4191 0.8844 -0.1168 0.0362  -0.1487 325 LEU A C   
1268 O O   . LEU A 163 ? 0.6852 0.4185 0.8839 -0.0969 0.0338  -0.1450 325 LEU A O   
1269 C CB  . LEU A 163 ? 0.6135 0.4096 0.7479 -0.1199 0.0385  -0.1186 325 LEU A CB  
1270 C CG  . LEU A 163 ? 0.6202 0.3948 0.7442 -0.1255 0.0349  -0.0830 325 LEU A CG  
1271 C CD1 . LEU A 163 ? 0.6411 0.4217 0.7568 -0.1481 0.0391  -0.0763 325 LEU A CD1 
1272 C CD2 . LEU A 163 ? 0.5894 0.3866 0.6924 -0.1141 0.0326  -0.0668 325 LEU A CD2 
1273 N N   . GLY A 164 ? 0.7362 0.4242 0.9613 -0.1284 0.0346  -0.1560 326 GLY A N   
1274 C CA  . GLY A 164 ? 0.7801 0.4211 1.0508 -0.1156 0.0295  -0.1643 326 GLY A CA  
1275 C C   . GLY A 164 ? 0.7908 0.4519 1.0838 -0.1048 0.0362  -0.2189 326 GLY A C   
1276 O O   . GLY A 164 ? 0.7955 0.4781 1.0865 -0.1198 0.0421  -0.2529 326 GLY A O   
1277 N N   . ASP A 165 ? 0.7963 0.4577 1.1108 -0.0797 0.0354  -0.2288 327 ASP A N   
1278 C CA  . ASP A 165 ? 0.8006 0.4958 1.1333 -0.0679 0.0445  -0.2830 327 ASP A CA  
1279 C C   . ASP A 165 ? 0.7503 0.5132 1.0427 -0.0596 0.0504  -0.2817 327 ASP A C   
1280 O O   . ASP A 165 ? 0.7493 0.5544 1.0493 -0.0500 0.0589  -0.3197 327 ASP A O   
1281 C CB  . ASP A 165 ? 0.8501 0.5044 1.2460 -0.0454 0.0414  -0.3027 327 ASP A CB  
1282 C CG  . ASP A 165 ? 0.8635 0.4791 1.2737 -0.0297 0.0282  -0.2508 327 ASP A CG  
1283 O OD1 . ASP A 165 ? 0.9261 0.4899 1.3953 -0.0159 0.0200  -0.2518 327 ASP A OD1 
1284 O OD2 . ASP A 165 ? 0.8337 0.4717 1.1994 -0.0317 0.0247  -0.2099 327 ASP A OD2 
1285 N N   . LYS A 166 ? 0.7124 0.4875 0.9645 -0.0652 0.0462  -0.2388 328 LYS A N   
1286 C CA  . LYS A 166 ? 0.6648 0.4957 0.8821 -0.0607 0.0494  -0.2294 328 LYS A CA  
1287 C C   . LYS A 166 ? 0.6383 0.5068 0.8197 -0.0800 0.0516  -0.2281 328 LYS A C   
1288 O O   . LYS A 166 ? 0.6462 0.4949 0.8241 -0.0961 0.0495  -0.2223 328 LYS A O   
1289 C CB  . LYS A 166 ? 0.6502 0.4676 0.8559 -0.0517 0.0416  -0.1850 328 LYS A CB  
1290 C CG  . LYS A 166 ? 0.6698 0.4762 0.9063 -0.0291 0.0381  -0.1833 328 LYS A CG  
1291 C CD  . LYS A 166 ? 0.6544 0.5179 0.8841 -0.0189 0.0449  -0.1967 328 LYS A CD  
1292 C CE  . LYS A 166 ? 0.6560 0.5160 0.9077 0.0010  0.0387  -0.1798 328 LYS A CE  
1293 N NZ  . LYS A 166 ? 0.6343 0.5532 0.8866 0.0094  0.0468  -0.1950 328 LYS A NZ  
1294 N N   . LYS A 167 ? 0.6049 0.5305 0.7637 -0.0789 0.0551  -0.2315 329 LYS A N   
1295 C CA  . LYS A 167 ? 0.5751 0.5402 0.7038 -0.0933 0.0535  -0.2203 329 LYS A CA  
1296 C C   . LYS A 167 ? 0.5341 0.5041 0.6450 -0.0879 0.0485  -0.1807 329 LYS A C   
1297 O O   . LYS A 167 ? 0.5223 0.5050 0.6343 -0.0762 0.0492  -0.1730 329 LYS A O   
1298 C CB  . LYS A 167 ? 0.5796 0.6093 0.6978 -0.0987 0.0587  -0.2483 329 LYS A CB  
1299 C CG  . LYS A 167 ? 0.5717 0.6465 0.6642 -0.1137 0.0538  -0.2348 329 LYS A CG  
1300 C CD  . LYS A 167 ? 0.5911 0.7300 0.6738 -0.1255 0.0573  -0.2683 329 LYS A CD  
1301 C CE  . LYS A 167 ? 0.6004 0.7945 0.6712 -0.1204 0.0623  -0.2691 329 LYS A CE  
1302 N NZ  . LYS A 167 ? 0.6190 0.8848 0.6767 -0.1345 0.0669  -0.3050 329 LYS A NZ  
1303 N N   . LEU A 168 ? 0.5083 0.4703 0.6072 -0.0967 0.0441  -0.1589 330 LEU A N   
1304 C CA  . LEU A 168 ? 0.4806 0.4465 0.5682 -0.0922 0.0395  -0.1281 330 LEU A CA  
1305 C C   . LEU A 168 ? 0.4539 0.4692 0.5316 -0.0926 0.0374  -0.1201 330 LEU A C   
1306 O O   . LEU A 168 ? 0.4495 0.5022 0.5214 -0.1014 0.0370  -0.1302 330 LEU A O   
1307 C CB  . LEU A 168 ? 0.4790 0.4284 0.5622 -0.1007 0.0372  -0.1130 330 LEU A CB  
1308 C CG  . LEU A 168 ? 0.5047 0.4111 0.5902 -0.1015 0.0372  -0.1011 330 LEU A CG  
1309 C CD1 . LEU A 168 ? 0.5183 0.4275 0.5983 -0.1130 0.0380  -0.0919 330 LEU A CD1 
1310 C CD2 . LEU A 168 ? 0.5029 0.3987 0.5857 -0.0897 0.0338  -0.0842 330 LEU A CD2 
1311 N N   . LEU A 169 ? 0.4298 0.4464 0.5068 -0.0850 0.0346  -0.0997 331 LEU A N   
1312 C CA  . LEU A 169 ? 0.4122 0.4655 0.4851 -0.0873 0.0299  -0.0810 331 LEU A CA  
1313 C C   . LEU A 169 ? 0.3922 0.4239 0.4702 -0.0859 0.0237  -0.0596 331 LEU A C   
1314 O O   . LEU A 169 ? 0.3820 0.3840 0.4625 -0.0803 0.0237  -0.0550 331 LEU A O   
1315 C CB  . LEU A 169 ? 0.4097 0.4853 0.4844 -0.0821 0.0322  -0.0771 331 LEU A CB  
1316 C CG  . LEU A 169 ? 0.4032 0.5168 0.4765 -0.0881 0.0265  -0.0514 331 LEU A CG  
1317 C CD1 . LEU A 169 ? 0.4123 0.5794 0.4739 -0.0991 0.0265  -0.0550 331 LEU A CD1 
1318 C CD2 . LEU A 169 ? 0.4007 0.5260 0.4805 -0.0843 0.0287  -0.0426 331 LEU A CD2 
1319 N N   . VAL A 170 ? 0.3815 0.4315 0.4637 -0.0909 0.0178  -0.0487 332 VAL A N   
1320 C CA  . VAL A 170 ? 0.3706 0.4057 0.4666 -0.0880 0.0124  -0.0338 332 VAL A CA  
1321 C C   . VAL A 170 ? 0.3706 0.4359 0.4797 -0.0894 0.0025  -0.0110 332 VAL A C   
1322 O O   . VAL A 170 ? 0.3674 0.4653 0.4761 -0.0950 -0.0022 -0.0067 332 VAL A O   
1323 C CB  . VAL A 170 ? 0.3680 0.3910 0.4685 -0.0908 0.0144  -0.0437 332 VAL A CB  
1324 C CG1 . VAL A 170 ? 0.3518 0.3649 0.4718 -0.0861 0.0109  -0.0359 332 VAL A CG1 
1325 C CG2 . VAL A 170 ? 0.3661 0.3604 0.4543 -0.0932 0.0226  -0.0584 332 VAL A CG2 
1326 N N   . GLN A 171 ? 0.3709 0.4270 0.4930 -0.0862 -0.0019 0.0056  333 GLN A N   
1327 C CA  . GLN A 171 ? 0.3785 0.4569 0.5193 -0.0890 -0.0131 0.0341  333 GLN A CA  
1328 C C   . GLN A 171 ? 0.3837 0.4329 0.5521 -0.0846 -0.0187 0.0448  333 GLN A C   
1329 O O   . GLN A 171 ? 0.3764 0.3973 0.5419 -0.0809 -0.0130 0.0291  333 GLN A O   
1330 C CB  . GLN A 171 ? 0.3842 0.5021 0.5094 -0.0972 -0.0122 0.0461  333 GLN A CB  
1331 C CG  . GLN A 171 ? 0.3689 0.4792 0.4867 -0.0961 -0.0044 0.0394  333 GLN A CG  
1332 C CD  . GLN A 171 ? 0.3867 0.5477 0.4927 -0.1053 -0.0013 0.0493  333 GLN A CD  
1333 O OE1 . GLN A 171 ? 0.3698 0.5359 0.4789 -0.1062 0.0027  0.0525  333 GLN A OE1 
1334 N NE2 . GLN A 171 ? 0.3706 0.5764 0.4631 -0.1138 -0.0029 0.0532  333 GLN A NE2 
1335 N N   . ARG A 172 ? 0.4022 0.4594 0.6001 -0.0859 -0.0312 0.0719  334 ARG A N   
1336 C CA  . ARG A 172 ? 0.4199 0.4474 0.6530 -0.0831 -0.0378 0.0801  334 ARG A CA  
1337 C C   . ARG A 172 ? 0.4217 0.4462 0.6455 -0.0894 -0.0342 0.0837  334 ARG A C   
1338 O O   . ARG A 172 ? 0.4163 0.4726 0.6219 -0.0977 -0.0324 0.0982  334 ARG A O   
1339 C CB  . ARG A 172 ? 0.4394 0.4728 0.7151 -0.0832 -0.0545 0.1132  334 ARG A CB  
1340 C CG  . ARG A 172 ? 0.4486 0.4788 0.7497 -0.0725 -0.0592 0.1045  334 ARG A CG  
1341 C CD  . ARG A 172 ? 0.4820 0.5082 0.8407 -0.0681 -0.0783 0.1366  334 ARG A CD  
1342 N NE  . ARG A 172 ? 0.4969 0.5119 0.8942 -0.0533 -0.0807 0.1181  334 ARG A NE  
1343 C CZ  . ARG A 172 ? 0.5087 0.5524 0.9021 -0.0493 -0.0818 0.1142  334 ARG A CZ  
1344 N NH1 . ARG A 172 ? 0.5095 0.5462 0.9445 -0.0354 -0.0826 0.0950  334 ARG A NH1 
1345 N NH2 . ARG A 172 ? 0.5081 0.5919 0.8590 -0.0597 -0.0816 0.1258  334 ARG A NH2 
1346 N N   . ALA A 173 ? 0.4295 0.4222 0.6661 -0.0863 -0.0327 0.0674  335 ALA A N   
1347 C CA  . ALA A 173 ? 0.4392 0.4298 0.6714 -0.0921 -0.0306 0.0677  335 ALA A CA  
1348 C C   . ALA A 173 ? 0.4630 0.4623 0.7248 -0.1029 -0.0408 0.1008  335 ALA A C   
1349 O O   . ALA A 173 ? 0.4795 0.4656 0.7788 -0.1032 -0.0521 0.1185  335 ALA A O   
1350 C CB  . ALA A 173 ? 0.4376 0.3984 0.6756 -0.0884 -0.0285 0.0408  335 ALA A CB  
1351 N N   . SER A 174 ? 0.4734 0.4973 0.7220 -0.1119 -0.0370 0.1108  336 SER A N   
1352 C CA  . SER A 174 ? 0.5038 0.5398 0.7789 -0.1268 -0.0448 0.1430  336 SER A CA  
1353 C C   . SER A 174 ? 0.5076 0.5907 0.7573 -0.1356 -0.0355 0.1497  336 SER A C   
1354 O O   . SER A 174 ? 0.5169 0.6389 0.7393 -0.1364 -0.0291 0.1533  336 SER A O   
1355 C CB  . SER A 174 ? 0.5321 0.5737 0.8346 -0.1329 -0.0579 0.1811  336 SER A CB  
1356 O OG  . SER A 174 ? 0.5674 0.5630 0.9146 -0.1258 -0.0687 0.1775  336 SER A OG  
1357 O OXT . SER A 174 ? 0.5117 0.5991 0.7700 -0.1422 -0.0336 0.1479  336 SER A OXT 
1358 N N   . GLY B 1   ? 0.7020 1.2152 1.4107 -0.0400 -0.4582 0.4323  143 GLY B N   
1359 C CA  . GLY B 1   ? 0.6977 1.1740 1.4503 0.0029  -0.4367 0.4364  143 GLY B CA  
1360 C C   . GLY B 1   ? 0.6800 1.0883 1.3476 0.0056  -0.3927 0.3958  143 GLY B C   
1361 O O   . GLY B 1   ? 0.6916 1.0727 1.2561 -0.0269 -0.3929 0.3801  143 GLY B O   
1362 N N   . PRO B 2   ? 0.6586 1.0397 1.3708 0.0434  -0.3542 0.3774  144 PRO B N   
1363 C CA  . PRO B 2   ? 0.6380 0.9582 1.2793 0.0472  -0.3147 0.3403  144 PRO B CA  
1364 C C   . PRO B 2   ? 0.5962 0.9121 1.1899 0.0370  -0.2761 0.2938  144 PRO B C   
1365 O O   . PRO B 2   ? 0.5833 0.8553 1.1338 0.0442  -0.2434 0.2641  144 PRO B O   
1366 C CB  . PRO B 2   ? 0.6451 0.9441 1.3624 0.0894  -0.2908 0.3386  144 PRO B CB  
1367 C CG  . PRO B 2   ? 0.6372 0.9939 1.4683 0.1109  -0.2941 0.3522  144 PRO B CG  
1368 C CD  . PRO B 2   ? 0.6575 1.0641 1.4942 0.0843  -0.3465 0.3908  144 PRO B CD  
1369 N N   . LEU B 3   ? 0.5733 0.9325 1.1734 0.0184  -0.2820 0.2894  145 LEU B N   
1370 C CA  . LEU B 3   ? 0.5340 0.8881 1.0942 0.0085  -0.2475 0.2507  145 LEU B CA  
1371 C C   . LEU B 3   ? 0.5315 0.8523 0.9855 -0.0238 -0.2494 0.2347  145 LEU B C   
1372 O O   . LEU B 3   ? 0.5169 0.8326 0.9384 -0.0342 -0.2264 0.2075  145 LEU B O   
1373 C CB  . LEU B 3   ? 0.5214 0.9336 1.1423 0.0033  -0.2469 0.2511  145 LEU B CB  
1374 C CG  . LEU B 3   ? 0.5108 0.9522 1.2328 0.0377  -0.2204 0.2477  145 LEU B CG  
1375 C CD1 . LEU B 3   ? 0.5095 1.0220 1.3139 0.0314  -0.2351 0.2646  145 LEU B CD1 
1376 C CD2 . LEU B 3   ? 0.4875 0.9006 1.1824 0.0485  -0.1691 0.2075  145 LEU B CD2 
1377 N N   . GLY B 4   ? 0.5512 0.8480 0.9527 -0.0397 -0.2742 0.2513  146 GLY B N   
1378 C CA  . GLY B 4   ? 0.5490 0.8116 0.8541 -0.0678 -0.2692 0.2327  146 GLY B CA  
1379 C C   . GLY B 4   ? 0.5179 0.7376 0.7913 -0.0529 -0.2318 0.2028  146 GLY B C   
1380 O O   . GLY B 4   ? 0.5022 0.7053 0.7274 -0.0652 -0.2124 0.1765  146 GLY B O   
1381 N N   . SER B 5   ? 0.5042 0.7059 0.8087 -0.0266 -0.2232 0.2079  147 SER B N   
1382 C CA  . SER B 5   ? 0.4768 0.6417 0.7603 -0.0122 -0.1910 0.1813  147 SER B CA  
1383 C C   . SER B 5   ? 0.4352 0.6106 0.7442 0.0023  -0.1607 0.1552  147 SER B C   
1384 O O   . SER B 5   ? 0.4243 0.5734 0.7036 0.0070  -0.1366 0.1313  147 SER B O   
1385 C CB  . SER B 5   ? 0.4949 0.6351 0.8060 0.0082  -0.1921 0.1945  147 SER B CB  
1386 O OG  . SER B 5   ? 0.4987 0.6633 0.8924 0.0319  -0.1969 0.2102  147 SER B OG  
1387 N N   . ALA B 6   ? 0.4126 0.6284 0.7758 0.0069  -0.1628 0.1614  148 ALA B N   
1388 C CA  . ALA B 6   ? 0.3817 0.6113 0.7649 0.0151  -0.1333 0.1391  148 ALA B CA  
1389 C C   . ALA B 6   ? 0.3605 0.5928 0.6969 -0.0089 -0.1289 0.1258  148 ALA B C   
1390 O O   . ALA B 6   ? 0.3334 0.5754 0.6781 -0.0070 -0.1063 0.1109  148 ALA B O   
1391 C CB  . ALA B 6   ? 0.3769 0.6511 0.8465 0.0303  -0.1327 0.1511  148 ALA B CB  
1392 N N   . ARG B 7   ? 0.3656 0.5859 0.6516 -0.0322 -0.1485 0.1310  149 ARG B N   
1393 C CA  . ARG B 7   ? 0.3614 0.5737 0.6013 -0.0548 -0.1432 0.1165  149 ARG B CA  
1394 C C   . ARG B 7   ? 0.3614 0.5321 0.5361 -0.0630 -0.1373 0.1030  149 ARG B C   
1395 O O   . ARG B 7   ? 0.3731 0.5325 0.5085 -0.0837 -0.1375 0.0937  149 ARG B O   
1396 C CB  . ARG B 7   ? 0.3789 0.6198 0.6235 -0.0805 -0.1690 0.1303  149 ARG B CB  
1397 C CG  . ARG B 7   ? 0.3761 0.6649 0.6897 -0.0770 -0.1715 0.1404  149 ARG B CG  
1398 C CD  . ARG B 7   ? 0.4041 0.7214 0.7178 -0.1083 -0.1992 0.1521  149 ARG B CD  
1399 N NE  . ARG B 7   ? 0.4422 0.7670 0.7479 -0.1187 -0.2350 0.1756  149 ARG B NE  
1400 C CZ  . ARG B 7   ? 0.4831 0.8492 0.8519 -0.1114 -0.2617 0.2047  149 ARG B CZ  
1401 N NH1 . ARG B 7   ? 0.4745 0.8828 0.9284 -0.0923 -0.2539 0.2114  149 ARG B NH1 
1402 N NH2 . ARG B 7   ? 0.5216 0.8884 0.8701 -0.1244 -0.2970 0.2290  149 ARG B NH2 
1403 N N   . ARG B 8   ? 0.3490 0.4970 0.5170 -0.0473 -0.1298 0.1004  150 ARG B N   
1404 C CA  . ARG B 8   ? 0.3499 0.4644 0.4678 -0.0533 -0.1219 0.0880  150 ARG B CA  
1405 C C   . ARG B 8   ? 0.3240 0.4211 0.4443 -0.0345 -0.1009 0.0731  150 ARG B C   
1406 O O   . ARG B 8   ? 0.3176 0.4202 0.4718 -0.0168 -0.0948 0.0742  150 ARG B O   
1407 C CB  . ARG B 8   ? 0.3737 0.4774 0.4722 -0.0617 -0.1390 0.1031  150 ARG B CB  
1408 C CG  . ARG B 8   ? 0.4107 0.5201 0.4748 -0.0904 -0.1571 0.1108  150 ARG B CG  
1409 C CD  . ARG B 8   ? 0.4577 0.5656 0.5085 -0.1008 -0.1810 0.1356  150 ARG B CD  
1410 N NE  . ARG B 8   ? 0.5065 0.5838 0.5114 -0.1090 -0.1714 0.1298  150 ARG B NE  
1411 C CZ  . ARG B 8   ? 0.5427 0.6047 0.4928 -0.1324 -0.1620 0.1145  150 ARG B CZ  
1412 N NH1 . ARG B 8   ? 0.5479 0.5869 0.4648 -0.1391 -0.1504 0.1102  150 ARG B NH1 
1413 N NH2 . ARG B 8   ? 0.5579 0.6265 0.4885 -0.1503 -0.1614 0.1018  150 ARG B NH2 
1414 N N   . LEU B 9   ? 0.3100 0.3870 0.3968 -0.0393 -0.0897 0.0583  151 LEU B N   
1415 C CA  . LEU B 9   ? 0.2935 0.3551 0.3771 -0.0264 -0.0758 0.0463  151 LEU B CA  
1416 C C   . LEU B 9   ? 0.2924 0.3344 0.3482 -0.0334 -0.0740 0.0404  151 LEU B C   
1417 O O   . LEU B 9   ? 0.2934 0.3309 0.3271 -0.0473 -0.0742 0.0378  151 LEU B O   
1418 C CB  . LEU B 9   ? 0.2808 0.3451 0.3630 -0.0226 -0.0630 0.0358  151 LEU B CB  
1419 C CG  . LEU B 9   ? 0.2806 0.3646 0.3890 -0.0162 -0.0565 0.0377  151 LEU B CG  
1420 C CD1 . LEU B 9   ? 0.2737 0.3541 0.3672 -0.0173 -0.0444 0.0301  151 LEU B CD1 
1421 C CD2 . LEU B 9   ? 0.2961 0.3832 0.4313 -0.0009 -0.0510 0.0369  151 LEU B CD2 
1422 N N   . TYR B 10  ? 0.2852 0.3156 0.3443 -0.0250 -0.0697 0.0364  152 TYR B N   
1423 C CA  . TYR B 10  ? 0.2906 0.3075 0.3326 -0.0310 -0.0653 0.0298  152 TYR B CA  
1424 C C   . TYR B 10  ? 0.2787 0.2963 0.3182 -0.0275 -0.0565 0.0171  152 TYR B C   
1425 O O   . TYR B 10  ? 0.2664 0.2879 0.3129 -0.0187 -0.0541 0.0132  152 TYR B O   
1426 C CB  . TYR B 10  ? 0.2949 0.2991 0.3452 -0.0263 -0.0665 0.0320  152 TYR B CB  
1427 C CG  . TYR B 10  ? 0.3008 0.2958 0.3418 -0.0326 -0.0605 0.0236  152 TYR B CG  
1428 C CD1 . TYR B 10  ? 0.2837 0.2791 0.3303 -0.0271 -0.0557 0.0110  152 TYR B CD1 
1429 C CD2 . TYR B 10  ? 0.3045 0.2932 0.3308 -0.0465 -0.0598 0.0289  152 TYR B CD2 
1430 C CE1 . TYR B 10  ? 0.2928 0.2862 0.3394 -0.0342 -0.0527 0.0048  152 TYR B CE1 
1431 C CE2 . TYR B 10  ? 0.3171 0.3025 0.3425 -0.0533 -0.0518 0.0211  152 TYR B CE2 
1432 C CZ  . TYR B 10  ? 0.3081 0.2977 0.3482 -0.0464 -0.0493 0.0095  152 TYR B CZ  
1433 O OH  . TYR B 10  ? 0.3126 0.3053 0.3598 -0.0546 -0.0435 0.0033  152 TYR B OH  
1434 N N   . VAL B 11  ? 0.2832 0.2975 0.3136 -0.0349 -0.0513 0.0116  153 VAL B N   
1435 C CA  . VAL B 11  ? 0.2834 0.2996 0.3207 -0.0301 -0.0459 0.0040  153 VAL B CA  
1436 C C   . VAL B 11  ? 0.2928 0.3086 0.3369 -0.0334 -0.0412 -0.0015 153 VAL B C   
1437 O O   . VAL B 11  ? 0.2966 0.3093 0.3348 -0.0430 -0.0332 -0.0044 153 VAL B O   
1438 C CB  . VAL B 11  ? 0.2869 0.3007 0.3215 -0.0334 -0.0405 0.0015  153 VAL B CB  
1439 C CG1 . VAL B 11  ? 0.2763 0.2909 0.3261 -0.0251 -0.0380 -0.0008 153 VAL B CG1 
1440 C CG2 . VAL B 11  ? 0.2927 0.3096 0.3229 -0.0348 -0.0449 0.0074  153 VAL B CG2 
1441 N N   . GLY B 12  ? 0.2964 0.3169 0.3514 -0.0281 -0.0455 -0.0037 154 GLY B N   
1442 C CA  . GLY B 12  ? 0.3067 0.3330 0.3765 -0.0324 -0.0431 -0.0082 154 GLY B CA  
1443 C C   . GLY B 12  ? 0.3121 0.3521 0.4051 -0.0266 -0.0443 -0.0096 154 GLY B C   
1444 O O   . GLY B 12  ? 0.3079 0.3491 0.4008 -0.0189 -0.0499 -0.0053 154 GLY B O   
1445 N N   . ASN B 13  ? 0.3246 0.3763 0.4416 -0.0307 -0.0395 -0.0134 155 ASN B N   
1446 C CA  . ASN B 13  ? 0.3279 0.3987 0.4817 -0.0239 -0.0428 -0.0121 155 ASN B CA  
1447 C C   . ASN B 13  ? 0.3374 0.4049 0.5070 -0.0149 -0.0321 -0.0122 155 ASN B C   
1448 O O   . ASN B 13  ? 0.3404 0.4158 0.5350 -0.0042 -0.0407 -0.0046 155 ASN B O   
1449 C CB  . ASN B 13  ? 0.3323 0.4121 0.4855 -0.0204 -0.0643 -0.0051 155 ASN B CB  
1450 C CG  . ASN B 13  ? 0.3382 0.4448 0.5352 -0.0176 -0.0750 0.0001  155 ASN B CG  
1451 O OD1 . ASN B 13  ? 0.3443 0.4671 0.5743 -0.0221 -0.0672 -0.0046 155 ASN B OD1 
1452 N ND2 . ASN B 13  ? 0.3559 0.4698 0.5551 -0.0116 -0.0936 0.0121  155 ASN B ND2 
1453 N N   . ILE B 14  ? 0.3521 0.4057 0.5061 -0.0209 -0.0141 -0.0203 156 ILE B N   
1454 C CA  . ILE B 14  ? 0.3700 0.4128 0.5339 -0.0157 -0.0003 -0.0255 156 ILE B CA  
1455 C C   . ILE B 14  ? 0.3790 0.4367 0.5942 -0.0093 0.0144  -0.0322 156 ILE B C   
1456 O O   . ILE B 14  ? 0.3821 0.4558 0.6117 -0.0166 0.0223  -0.0373 156 ILE B O   
1457 C CB  . ILE B 14  ? 0.3885 0.4113 0.5131 -0.0293 0.0139  -0.0349 156 ILE B CB  
1458 C CG1 . ILE B 14  ? 0.4063 0.4321 0.5247 -0.0436 0.0327  -0.0456 156 ILE B CG1 
1459 C CG2 . ILE B 14  ? 0.3764 0.3923 0.4634 -0.0347 -0.0018 -0.0259 156 ILE B CG2 
1460 C CD1 . ILE B 14  ? 0.4371 0.4454 0.5057 -0.0622 0.0398  -0.0504 156 ILE B CD1 
1461 N N   . PRO B 15  ? 0.3929 0.4458 0.6415 0.0046  0.0188  -0.0310 157 PRO B N   
1462 C CA  . PRO B 15  ? 0.3999 0.4683 0.7115 0.0152  0.0345  -0.0368 157 PRO B CA  
1463 C C   . PRO B 15  ? 0.4211 0.4815 0.7326 0.0053  0.0716  -0.0607 157 PRO B C   
1464 O O   . PRO B 15  ? 0.4349 0.4688 0.6965 -0.0078 0.0843  -0.0723 157 PRO B O   
1465 C CB  . PRO B 15  ? 0.4118 0.4666 0.7524 0.0332  0.0282  -0.0265 157 PRO B CB  
1466 C CG  . PRO B 15  ? 0.4223 0.4460 0.7058 0.0251  0.0252  -0.0267 157 PRO B CG  
1467 C CD  . PRO B 15  ? 0.4023 0.4340 0.6368 0.0115  0.0098  -0.0226 157 PRO B CD  
1468 N N   . PHE B 16  ? 0.4233 0.5090 0.7906 0.0095  0.0888  -0.0679 158 PHE B N   
1469 C CA  . PHE B 16  ? 0.4517 0.5329 0.8229 -0.0011 0.1303  -0.0931 158 PHE B CA  
1470 C C   . PHE B 16  ? 0.4821 0.5277 0.8462 0.0028  0.1548  -0.1109 158 PHE B C   
1471 O O   . PHE B 16  ? 0.4835 0.5186 0.8849 0.0229  0.1469  -0.1033 158 PHE B O   
1472 C CB  . PHE B 16  ? 0.4478 0.5677 0.9001 0.0076  0.1464  -0.0969 158 PHE B CB  
1473 C CG  . PHE B 16  ? 0.4829 0.5997 0.9473 -0.0018 0.1962  -0.1259 158 PHE B CG  
1474 C CD1 . PHE B 16  ? 0.4975 0.6199 0.9203 -0.0287 0.2159  -0.1367 158 PHE B CD1 
1475 C CD2 . PHE B 16  ? 0.5025 0.6072 1.0174 0.0149  0.2256  -0.1427 158 PHE B CD2 
1476 C CE1 . PHE B 16  ? 0.5354 0.6544 0.9602 -0.0415 0.2652  -0.1648 158 PHE B CE1 
1477 C CE2 . PHE B 16  ? 0.5505 0.6498 1.0725 0.0045  0.2772  -0.1743 158 PHE B CE2 
1478 C CZ  . PHE B 16  ? 0.5647 0.6728 1.0385 -0.0251 0.2977  -0.1859 158 PHE B CZ  
1479 N N   . GLY B 17  ? 0.5161 0.5405 0.8286 -0.0193 0.1835  -0.1338 159 GLY B N   
1480 C CA  . GLY B 17  ? 0.5616 0.5496 0.8630 -0.0218 0.2131  -0.1583 159 GLY B CA  
1481 C C   . GLY B 17  ? 0.5672 0.5202 0.8216 -0.0251 0.1943  -0.1533 159 GLY B C   
1482 O O   . GLY B 17  ? 0.6088 0.5280 0.8565 -0.0281 0.2168  -0.1738 159 GLY B O   
1483 N N   . ILE B 18  ? 0.5336 0.4937 0.7571 -0.0262 0.1558  -0.1282 160 ILE B N   
1484 C CA  . ILE B 18  ? 0.5351 0.4689 0.7190 -0.0309 0.1376  -0.1213 160 ILE B CA  
1485 C C   . ILE B 18  ? 0.5687 0.4817 0.6804 -0.0613 0.1486  -0.1386 160 ILE B C   
1486 O O   . ILE B 18  ? 0.5785 0.5033 0.6549 -0.0795 0.1534  -0.1422 160 ILE B O   
1487 C CB  . ILE B 18  ? 0.4942 0.4455 0.6685 -0.0241 0.0979  -0.0917 160 ILE B CB  
1488 C CG1 . ILE B 18  ? 0.4999 0.4288 0.6504 -0.0256 0.0826  -0.0832 160 ILE B CG1 
1489 C CG2 . ILE B 18  ? 0.4852 0.4525 0.6155 -0.0408 0.0865  -0.0861 160 ILE B CG2 
1490 C CD1 . ILE B 18  ? 0.5292 0.4347 0.7210 -0.0097 0.0903  -0.0834 160 ILE B CD1 
1491 N N   . THR B 19  ? 0.5917 0.4732 0.6817 -0.0689 0.1512  -0.1477 161 THR B N   
1492 C CA  . THR B 19  ? 0.6300 0.4916 0.6506 -0.1009 0.1564  -0.1633 161 THR B CA  
1493 C C   . THR B 19  ? 0.6050 0.4725 0.5936 -0.1084 0.1200  -0.1406 161 THR B C   
1494 O O   . THR B 19  ? 0.5659 0.4422 0.5850 -0.0891 0.0992  -0.1196 161 THR B O   
1495 C CB  . THR B 19  ? 0.6884 0.5084 0.7063 -0.1092 0.1859  -0.1934 161 THR B CB  
1496 O OG1 . THR B 19  ? 0.6705 0.4733 0.7250 -0.0909 0.1736  -0.1817 161 THR B OG1 
1497 C CG2 . THR B 19  ? 0.7185 0.5319 0.7738 -0.1013 0.2286  -0.2202 161 THR B CG2 
1498 N N   . GLU B 20  ? 0.6298 0.4950 0.5582 -0.1376 0.1129  -0.1443 162 GLU B N   
1499 C CA  . GLU B 20  ? 0.6143 0.4911 0.5190 -0.1461 0.0796  -0.1231 162 GLU B CA  
1500 C C   . GLU B 20  ? 0.6206 0.4786 0.5379 -0.1445 0.0742  -0.1236 162 GLU B C   
1501 O O   . GLU B 20  ? 0.5858 0.4587 0.5196 -0.1342 0.0513  -0.1017 162 GLU B O   
1502 C CB  . GLU B 20  ? 0.6482 0.5281 0.4895 -0.1797 0.0714  -0.1251 162 GLU B CB  
1503 C CG  . GLU B 20  ? 0.6446 0.5446 0.4730 -0.1814 0.0691  -0.1139 162 GLU B CG  
1504 C CD  . GLU B 20  ? 0.7037 0.5990 0.4636 -0.2180 0.0707  -0.1196 162 GLU B CD  
1505 O OE1 . GLU B 20  ? 0.6942 0.6031 0.4410 -0.2218 0.0670  -0.1062 162 GLU B OE1 
1506 O OE2 . GLU B 20  ? 0.7552 0.6321 0.4717 -0.2454 0.0745  -0.1363 162 GLU B OE2 
1507 N N   . GLU B 21  ? 0.6725 0.4957 0.5833 -0.1554 0.0984  -0.1499 163 GLU B N   
1508 C CA  . GLU B 21  ? 0.6936 0.4910 0.6182 -0.1560 0.0968  -0.1517 163 GLU B CA  
1509 C C   . GLU B 21  ? 0.6564 0.4549 0.6405 -0.1222 0.0919  -0.1318 163 GLU B C   
1510 O O   . GLU B 21  ? 0.6447 0.4410 0.6374 -0.1207 0.0758  -0.1155 163 GLU B O   
1511 C CB  . GLU B 21  ? 0.7650 0.5166 0.6704 -0.1757 0.1276  -0.1880 163 GLU B CB  
1512 C CG  . GLU B 21  ? 0.8131 0.5508 0.7293 -0.1693 0.1651  -0.2148 163 GLU B CG  
1513 C CD  . GLU B 21  ? 0.8715 0.6104 0.7205 -0.2035 0.1777  -0.2368 163 GLU B CD  
1514 O OE1 . GLU B 21  ? 0.9624 0.6665 0.7688 -0.2329 0.1970  -0.2679 163 GLU B OE1 
1515 O OE2 . GLU B 21  ? 0.8543 0.6259 0.6896 -0.2035 0.1689  -0.2231 163 GLU B OE2 
1516 N N   . ALA B 22  ? 0.6405 0.4451 0.6645 -0.0977 0.1045  -0.1315 164 ALA B N   
1517 C CA  . ALA B 22  ? 0.6147 0.4241 0.6926 -0.0676 0.0952  -0.1092 164 ALA B CA  
1518 C C   . ALA B 22  ? 0.5667 0.4109 0.6407 -0.0603 0.0640  -0.0791 164 ALA B C   
1519 O O   . ALA B 22  ? 0.5567 0.3989 0.6483 -0.0496 0.0505  -0.0591 164 ALA B O   
1520 C CB  . ALA B 22  ? 0.6101 0.4256 0.7362 -0.0455 0.1130  -0.1151 164 ALA B CB  
1521 N N   . MET B 23  ? 0.5446 0.4174 0.5943 -0.0672 0.0545  -0.0764 165 MET B N   
1522 C CA  . MET B 23  ? 0.5060 0.4078 0.5511 -0.0616 0.0297  -0.0534 165 MET B CA  
1523 C C   . MET B 23  ? 0.4985 0.4004 0.5216 -0.0760 0.0164  -0.0453 165 MET B C   
1524 O O   . MET B 23  ? 0.4703 0.3859 0.5021 -0.0679 0.0026  -0.0272 165 MET B O   
1525 C CB  . MET B 23  ? 0.4865 0.4122 0.5162 -0.0652 0.0251  -0.0530 165 MET B CB  
1526 C CG  . MET B 23  ? 0.4680 0.4185 0.4972 -0.0580 0.0038  -0.0335 165 MET B CG  
1527 S SD  . MET B 23  ? 0.4846 0.4558 0.5221 -0.0498 0.0009  -0.0301 165 MET B SD  
1528 C CE  . MET B 23  ? 0.4776 0.4533 0.5582 -0.0280 0.0004  -0.0241 165 MET B CE  
1529 N N   . MET B 24  ? 0.5255 0.4136 0.5205 -0.0995 0.0215  -0.0598 166 MET B N   
1530 C CA  . MET B 24  ? 0.5298 0.4220 0.5105 -0.1166 0.0084  -0.0530 166 MET B CA  
1531 C C   . MET B 24  ? 0.5252 0.3966 0.5265 -0.1123 0.0115  -0.0465 166 MET B C   
1532 O O   . MET B 24  ? 0.5093 0.3959 0.5155 -0.1146 -0.0006 -0.0304 166 MET B O   
1533 C CB  . MET B 24  ? 0.5723 0.4541 0.5149 -0.1474 0.0108  -0.0709 166 MET B CB  
1534 C CG  . MET B 24  ? 0.5837 0.4832 0.5149 -0.1681 -0.0091 -0.0609 166 MET B CG  
1535 S SD  . MET B 24  ? 0.6737 0.5626 0.5534 -0.2101 -0.0120 -0.0809 166 MET B SD  
1536 C CE  . MET B 24  ? 0.7312 0.5629 0.6047 -0.2193 0.0188  -0.1125 166 MET B CE  
1537 N N   . ASP B 25  ? 0.5444 0.3809 0.5611 -0.1058 0.0292  -0.0581 167 ASP B N   
1538 C CA  . ASP B 25  ? 0.5542 0.3636 0.5936 -0.0998 0.0321  -0.0481 167 ASP B CA  
1539 C C   . ASP B 25  ? 0.5096 0.3380 0.5714 -0.0774 0.0190  -0.0198 167 ASP B C   
1540 O O   . ASP B 25  ? 0.5084 0.3324 0.5729 -0.0804 0.0124  -0.0025 167 ASP B O   
1541 C CB  . ASP B 25  ? 0.5999 0.3656 0.6599 -0.0933 0.0551  -0.0661 167 ASP B CB  
1542 C CG  . ASP B 25  ? 0.6731 0.4083 0.7043 -0.1209 0.0721  -0.0977 167 ASP B CG  
1543 O OD1 . ASP B 25  ? 0.7127 0.4666 0.7052 -0.1460 0.0623  -0.1041 167 ASP B OD1 
1544 O OD2 . ASP B 25  ? 0.7342 0.4258 0.7825 -0.1184 0.0952  -0.1165 167 ASP B OD2 
1545 N N   . PHE B 26  ? 0.4676 0.3163 0.5419 -0.0585 0.0158  -0.0157 168 PHE B N   
1546 C CA  . PHE B 26  ? 0.4392 0.3075 0.5265 -0.0412 0.0016  0.0082  168 PHE B CA  
1547 C C   . PHE B 26  ? 0.4102 0.3048 0.4758 -0.0497 -0.0107 0.0207  168 PHE B C   
1548 O O   . PHE B 26  ? 0.4089 0.3035 0.4742 -0.0483 -0.0167 0.0391  168 PHE B O   
1549 C CB  . PHE B 26  ? 0.4138 0.3030 0.5159 -0.0254 -0.0004 0.0059  168 PHE B CB  
1550 C CG  . PHE B 26  ? 0.3927 0.3048 0.4993 -0.0131 -0.0176 0.0270  168 PHE B CG  
1551 C CD1 . PHE B 26  ? 0.4069 0.3098 0.5360 -0.0006 -0.0257 0.0464  168 PHE B CD1 
1552 C CD2 . PHE B 26  ? 0.3558 0.2961 0.4428 -0.0155 -0.0263 0.0277  168 PHE B CD2 
1553 C CE1 . PHE B 26  ? 0.3955 0.3192 0.5191 0.0054  -0.0435 0.0652  168 PHE B CE1 
1554 C CE2 . PHE B 26  ? 0.3482 0.3056 0.4323 -0.0083 -0.0399 0.0423  168 PHE B CE2 
1555 C CZ  . PHE B 26  ? 0.3729 0.3232 0.4712 0.0003  -0.0492 0.0606  168 PHE B CZ  
1556 N N   . PHE B 27  ? 0.3868 0.3039 0.4363 -0.0585 -0.0133 0.0114  169 PHE B N   
1557 C CA  . PHE B 27  ? 0.3723 0.3176 0.4127 -0.0631 -0.0221 0.0211  169 PHE B CA  
1558 C C   . PHE B 27  ? 0.3812 0.3246 0.4194 -0.0799 -0.0212 0.0267  169 PHE B C   
1559 O O   . PHE B 27  ? 0.3723 0.3319 0.4116 -0.0797 -0.0229 0.0397  169 PHE B O   
1560 C CB  . PHE B 27  ? 0.3576 0.3258 0.3904 -0.0653 -0.0271 0.0136  169 PHE B CB  
1561 C CG  . PHE B 27  ? 0.3472 0.3268 0.3833 -0.0496 -0.0303 0.0148  169 PHE B CG  
1562 C CD1 . PHE B 27  ? 0.3507 0.3240 0.3881 -0.0462 -0.0261 0.0046  169 PHE B CD1 
1563 C CD2 . PHE B 27  ? 0.3562 0.3525 0.3934 -0.0409 -0.0351 0.0240  169 PHE B CD2 
1564 C CE1 . PHE B 27  ? 0.3281 0.3129 0.3715 -0.0350 -0.0296 0.0058  169 PHE B CE1 
1565 C CE2 . PHE B 27  ? 0.3381 0.3422 0.3764 -0.0302 -0.0387 0.0228  169 PHE B CE2 
1566 C CZ  . PHE B 27  ? 0.3251 0.3242 0.3683 -0.0275 -0.0373 0.0147  169 PHE B CZ  
1567 N N   . ASN B 28  ? 0.4042 0.3272 0.4385 -0.0967 -0.0165 0.0156  170 ASN B N   
1568 C CA  . ASN B 28  ? 0.4313 0.3487 0.4666 -0.1161 -0.0154 0.0204  170 ASN B CA  
1569 C C   . ASN B 28  ? 0.4514 0.3472 0.4943 -0.1112 -0.0105 0.0372  170 ASN B C   
1570 O O   . ASN B 28  ? 0.4477 0.3549 0.4922 -0.1217 -0.0103 0.0501  170 ASN B O   
1571 C CB  . ASN B 28  ? 0.4631 0.3551 0.4880 -0.1385 -0.0110 0.0016  170 ASN B CB  
1572 C CG  . ASN B 28  ? 0.4564 0.3743 0.4668 -0.1531 -0.0209 -0.0086 170 ASN B CG  
1573 O OD1 . ASN B 28  ? 0.4432 0.4004 0.4615 -0.1528 -0.0328 0.0025  170 ASN B OD1 
1574 N ND2 . ASN B 28  ? 0.4960 0.3908 0.4853 -0.1669 -0.0156 -0.0292 170 ASN B ND2 
1575 N N   . ALA B 29  ? 0.4720 0.3384 0.5220 -0.0960 -0.0068 0.0390  171 ALA B N   
1576 C CA  . ALA B 29  ? 0.5036 0.3463 0.5611 -0.0901 -0.0065 0.0603  171 ALA B CA  
1577 C C   . ALA B 29  ? 0.4921 0.3632 0.5396 -0.0816 -0.0147 0.0810  171 ALA B C   
1578 O O   . ALA B 29  ? 0.5127 0.3774 0.5528 -0.0892 -0.0144 0.1006  171 ALA B O   
1579 C CB  . ALA B 29  ? 0.5204 0.3288 0.5985 -0.0730 -0.0029 0.0589  171 ALA B CB  
1580 N N   . GLN B 30  ? 0.4690 0.3688 0.5126 -0.0688 -0.0204 0.0755  172 GLN B N   
1581 C CA  . GLN B 30  ? 0.4707 0.3961 0.4989 -0.0639 -0.0257 0.0882  172 GLN B CA  
1582 C C   . GLN B 30  ? 0.4745 0.4242 0.4937 -0.0788 -0.0183 0.0896  172 GLN B C   
1583 O O   . GLN B 30  ? 0.4897 0.4448 0.4932 -0.0843 -0.0150 0.1046  172 GLN B O   
1584 C CB  . GLN B 30  ? 0.4403 0.3869 0.4684 -0.0497 -0.0317 0.0776  172 GLN B CB  
1585 C CG  . GLN B 30  ? 0.4495 0.3830 0.4912 -0.0343 -0.0398 0.0815  172 GLN B CG  
1586 C CD  . GLN B 30  ? 0.4779 0.4095 0.5099 -0.0300 -0.0516 0.1052  172 GLN B CD  
1587 O OE1 . GLN B 30  ? 0.4965 0.4355 0.5021 -0.0399 -0.0513 0.1166  172 GLN B OE1 
1588 N NE2 . GLN B 30  ? 0.4775 0.4010 0.5312 -0.0166 -0.0620 0.1134  172 GLN B NE2 
1589 N N   . MET B 31  ? 0.4671 0.4330 0.4975 -0.0866 -0.0156 0.0750  173 MET B N   
1590 C CA  . MET B 31  ? 0.4773 0.4729 0.5144 -0.0994 -0.0090 0.0761  173 MET B CA  
1591 C C   . MET B 31  ? 0.5143 0.4976 0.5509 -0.1183 -0.0011 0.0893  173 MET B C   
1592 O O   . MET B 31  ? 0.5214 0.5254 0.5557 -0.1257 0.0087  0.0982  173 MET B O   
1593 C CB  . MET B 31  ? 0.4631 0.4776 0.5173 -0.1060 -0.0139 0.0625  173 MET B CB  
1594 C CG  . MET B 31  ? 0.4593 0.4905 0.5154 -0.0906 -0.0206 0.0533  173 MET B CG  
1595 S SD  . MET B 31  ? 0.4955 0.5655 0.5647 -0.0803 -0.0145 0.0551  173 MET B SD  
1596 C CE  . MET B 31  ? 0.4943 0.5985 0.5971 -0.0973 -0.0118 0.0593  173 MET B CE  
1597 N N   . ARG B 32  ? 0.5479 0.4957 0.5870 -0.1273 -0.0026 0.0892  174 ARG B N   
1598 C CA  . ARG B 32  ? 0.5995 0.5262 0.6386 -0.1471 0.0045  0.1029  174 ARG B CA  
1599 C C   . ARG B 32  ? 0.6282 0.5382 0.6479 -0.1426 0.0066  0.1271  174 ARG B C   
1600 O O   . ARG B 32  ? 0.6521 0.5641 0.6645 -0.1596 0.0156  0.1428  174 ARG B O   
1601 C CB  . ARG B 32  ? 0.6291 0.5121 0.6749 -0.1568 0.0038  0.0939  174 ARG B CB  
1602 C CG  . ARG B 32  ? 0.6377 0.5345 0.6927 -0.1736 0.0011  0.0725  174 ARG B CG  
1603 C CD  . ARG B 32  ? 0.6960 0.5441 0.7507 -0.1909 0.0049  0.0603  174 ARG B CD  
1604 N NE  . ARG B 32  ? 0.7299 0.5547 0.7786 -0.1793 0.0048  0.0395  174 ARG B NE  
1605 C CZ  . ARG B 32  ? 0.7590 0.5446 0.8118 -0.1603 0.0105  0.0394  174 ARG B CZ  
1606 N NH1 . ARG B 32  ? 0.7880 0.5496 0.8489 -0.1498 0.0121  0.0627  174 ARG B NH1 
1607 N NH2 . ARG B 32  ? 0.7575 0.5289 0.8082 -0.1525 0.0148  0.0171  174 ARG B NH2 
1608 N N   . LEU B 33  ? 0.6312 0.5265 0.6424 -0.1221 -0.0028 0.1318  175 LEU B N   
1609 C CA  . LEU B 33  ? 0.6695 0.5495 0.6594 -0.1184 -0.0078 0.1583  175 LEU B CA  
1610 C C   . LEU B 33  ? 0.6722 0.5876 0.6342 -0.1240 -0.0013 0.1641  175 LEU B C   
1611 O O   . LEU B 33  ? 0.7133 0.6216 0.6500 -0.1375 0.0031  0.1864  175 LEU B O   
1612 C CB  . LEU B 33  ? 0.6634 0.5277 0.6599 -0.0952 -0.0228 0.1609  175 LEU B CB  
1613 C CG  . LEU B 33  ? 0.6940 0.5507 0.6699 -0.0888 -0.0367 0.1895  175 LEU B CG  
1614 C CD1 . LEU B 33  ? 0.7403 0.5552 0.7170 -0.0973 -0.0396 0.2197  175 LEU B CD1 
1615 C CD2 . LEU B 33  ? 0.6777 0.5380 0.6708 -0.0657 -0.0519 0.1849  175 LEU B CD2 
1616 N N   . GLY B 34  ? 0.6383 0.5887 0.6035 -0.1151 0.0012  0.1436  176 GLY B N   
1617 C CA  . GLY B 34  ? 0.6446 0.6266 0.5879 -0.1190 0.0125  0.1415  176 GLY B CA  
1618 C C   . GLY B 34  ? 0.6583 0.6646 0.6115 -0.1375 0.0334  0.1399  176 GLY B C   
1619 O O   . GLY B 34  ? 0.6786 0.7070 0.6126 -0.1442 0.0495  0.1397  176 GLY B O   
1620 N N   . GLY B 35  ? 0.6544 0.6579 0.6384 -0.1480 0.0347  0.1374  177 GLY B N   
1621 C CA  . GLY B 35  ? 0.6529 0.6882 0.6604 -0.1659 0.0518  0.1345  177 GLY B CA  
1622 C C   . GLY B 35  ? 0.6141 0.6949 0.6504 -0.1546 0.0574  0.1148  177 GLY B C   
1623 O O   . GLY B 35  ? 0.6220 0.7384 0.6745 -0.1620 0.0770  0.1125  177 GLY B O   
1624 N N   . LEU B 36  ? 0.5787 0.6578 0.6248 -0.1365 0.0416  0.1016  178 LEU B N   
1625 C CA  . LEU B 36  ? 0.5459 0.6609 0.6197 -0.1230 0.0432  0.0865  178 LEU B CA  
1626 C C   . LEU B 36  ? 0.5255 0.6633 0.6422 -0.1296 0.0335  0.0818  178 LEU B C   
1627 O O   . LEU B 36  ? 0.5054 0.6712 0.6508 -0.1180 0.0295  0.0740  178 LEU B O   
1628 C CB  . LEU B 36  ? 0.5259 0.6264 0.5818 -0.1016 0.0314  0.0775  178 LEU B CB  
1629 C CG  . LEU B 36  ? 0.5457 0.6267 0.5583 -0.0966 0.0341  0.0820  178 LEU B CG  
1630 C CD1 . LEU B 36  ? 0.5243 0.5975 0.5292 -0.0784 0.0216  0.0714  178 LEU B CD1 
1631 C CD2 . LEU B 36  ? 0.5773 0.6788 0.5764 -0.1036 0.0579  0.0810  178 LEU B CD2 
1632 N N   . THR B 37  ? 0.5419 0.6662 0.6624 -0.1499 0.0284  0.0878  179 THR B N   
1633 C CA  . THR B 37  ? 0.5309 0.6762 0.6849 -0.1635 0.0159  0.0839  179 THR B CA  
1634 C C   . THR B 37  ? 0.5372 0.7278 0.7331 -0.1799 0.0284  0.0902  179 THR B C   
1635 O O   . THR B 37  ? 0.5609 0.7530 0.7505 -0.1884 0.0491  0.0981  179 THR B O   
1636 C CB  . THR B 37  ? 0.5548 0.6586 0.6901 -0.1809 0.0050  0.0821  179 THR B CB  
1637 O OG1 . THR B 37  ? 0.5888 0.6766 0.7203 -0.2017 0.0170  0.0929  179 THR B OG1 
1638 C CG2 . THR B 37  ? 0.5497 0.6088 0.6504 -0.1640 -0.0008 0.0767  179 THR B CG2 
1639 N N   . GLN B 38  ? 0.5182 0.7477 0.7577 -0.1861 0.0152  0.0884  180 GLN B N   
1640 C CA  . GLN B 38  ? 0.5190 0.8029 0.8145 -0.1998 0.0248  0.0948  180 GLN B CA  
1641 C C   . GLN B 38  ? 0.5260 0.8206 0.8426 -0.2322 0.0082  0.0982  180 GLN B C   
1642 O O   . GLN B 38  ? 0.5288 0.8745 0.9001 -0.2472 0.0112  0.1046  180 GLN B O   
1643 C CB  . GLN B 38  ? 0.4950 0.8285 0.8416 -0.1772 0.0242  0.0932  180 GLN B CB  
1644 C CG  . GLN B 38  ? 0.4883 0.8185 0.8347 -0.1636 -0.0049 0.0907  180 GLN B CG  
1645 C CD  . GLN B 38  ? 0.4730 0.8407 0.8680 -0.1369 -0.0026 0.0915  180 GLN B CD  
1646 O OE1 . GLN B 38  ? 0.5077 0.8702 0.8978 -0.1168 0.0214  0.0844  180 GLN B OE1 
1647 N NE2 . GLN B 38  ? 0.4920 0.8955 0.9334 -0.1378 -0.0285 0.1007  180 GLN B NE2 
1648 N N   . ALA B 39  ? 0.5306 0.7773 0.8056 -0.2443 -0.0075 0.0923  181 ALA B N   
1649 C CA  . ALA B 39  ? 0.5482 0.7911 0.8290 -0.2794 -0.0214 0.0909  181 ALA B CA  
1650 C C   . ALA B 39  ? 0.5684 0.7384 0.7930 -0.2872 -0.0219 0.0817  181 ALA B C   
1651 O O   . ALA B 39  ? 0.5602 0.6932 0.7500 -0.2629 -0.0167 0.0782  181 ALA B O   
1652 C CB  . ALA B 39  ? 0.5384 0.8192 0.8454 -0.2866 -0.0511 0.0888  181 ALA B CB  
1653 N N   . PRO B 40  ? 0.5939 0.7431 0.8142 -0.3214 -0.0275 0.0771  182 PRO B N   
1654 C CA  . PRO B 40  ? 0.6225 0.7007 0.7961 -0.3279 -0.0279 0.0636  182 PRO B CA  
1655 C C   . PRO B 40  ? 0.6047 0.6731 0.7528 -0.3178 -0.0449 0.0476  182 PRO B C   
1656 O O   . PRO B 40  ? 0.5799 0.6950 0.7455 -0.3203 -0.0638 0.0480  182 PRO B O   
1657 C CB  . PRO B 40  ? 0.6692 0.7351 0.8500 -0.3715 -0.0312 0.0590  182 PRO B CB  
1658 C CG  . PRO B 40  ? 0.6602 0.7886 0.8923 -0.3856 -0.0268 0.0756  182 PRO B CG  
1659 C CD  . PRO B 40  ? 0.6103 0.7989 0.8716 -0.3565 -0.0319 0.0825  182 PRO B CD  
1660 N N   . GLY B 41  ? 0.6154 0.6246 0.7254 -0.3070 -0.0378 0.0353  183 GLY B N   
1661 C CA  . GLY B 41  ? 0.6129 0.6072 0.6936 -0.3015 -0.0482 0.0177  183 GLY B CA  
1662 C C   . GLY B 41  ? 0.5704 0.5640 0.6426 -0.2629 -0.0437 0.0208  183 GLY B C   
1663 O O   . GLY B 41  ? 0.5477 0.5456 0.6311 -0.2402 -0.0328 0.0347  183 GLY B O   
1664 N N   . ASN B 42  ? 0.5634 0.5515 0.6120 -0.2591 -0.0521 0.0074  184 ASN B N   
1665 C CA  . ASN B 42  ? 0.5308 0.5123 0.5688 -0.2270 -0.0475 0.0068  184 ASN B CA  
1666 C C   . ASN B 42  ? 0.4862 0.5174 0.5380 -0.2138 -0.0623 0.0172  184 ASN B C   
1667 O O   . ASN B 42  ? 0.4974 0.5496 0.5434 -0.2302 -0.0799 0.0153  184 ASN B O   
1668 C CB  . ASN B 42  ? 0.5615 0.4984 0.5653 -0.2308 -0.0407 -0.0157 184 ASN B CB  
1669 C CG  . ASN B 42  ? 0.6127 0.4934 0.6138 -0.2291 -0.0210 -0.0243 184 ASN B CG  
1670 O OD1 . ASN B 42  ? 0.6272 0.4997 0.6469 -0.2136 -0.0136 -0.0084 184 ASN B OD1 
1671 N ND2 . ASN B 42  ? 0.6797 0.5194 0.6568 -0.2458 -0.0119 -0.0491 184 ASN B ND2 
1672 N N   . PRO B 43  ? 0.4422 0.4901 0.5113 -0.1856 -0.0560 0.0290  185 PRO B N   
1673 C CA  . PRO B 43  ? 0.4045 0.4931 0.4928 -0.1705 -0.0666 0.0382  185 PRO B CA  
1674 C C   . PRO B 43  ? 0.3918 0.4740 0.4579 -0.1639 -0.0765 0.0325  185 PRO B C   
1675 O O   . PRO B 43  ? 0.3716 0.4851 0.4526 -0.1621 -0.0919 0.0418  185 PRO B O   
1676 C CB  . PRO B 43  ? 0.3811 0.4745 0.4822 -0.1451 -0.0518 0.0457  185 PRO B CB  
1677 C CG  . PRO B 43  ? 0.4062 0.4723 0.4986 -0.1511 -0.0380 0.0469  185 PRO B CG  
1678 C CD  . PRO B 43  ? 0.4401 0.4677 0.5103 -0.1688 -0.0395 0.0350  185 PRO B CD  
1679 N N   . VAL B 44  ? 0.4018 0.4450 0.4375 -0.1595 -0.0667 0.0192  186 VAL B N   
1680 C CA  . VAL B 44  ? 0.4030 0.4385 0.4150 -0.1559 -0.0711 0.0128  186 VAL B CA  
1681 C C   . VAL B 44  ? 0.4422 0.4663 0.4219 -0.1866 -0.0792 0.0010  186 VAL B C   
1682 O O   . VAL B 44  ? 0.4685 0.4599 0.4293 -0.2013 -0.0674 -0.0156 186 VAL B O   
1683 C CB  . VAL B 44  ? 0.3957 0.4010 0.3970 -0.1365 -0.0544 0.0034  186 VAL B CB  
1684 C CG1 . VAL B 44  ? 0.3877 0.3903 0.3684 -0.1349 -0.0566 -0.0020 186 VAL B CG1 
1685 C CG2 . VAL B 44  ? 0.3659 0.3806 0.3898 -0.1117 -0.0491 0.0141  186 VAL B CG2 
1686 N N   . LEU B 45  ? 0.4504 0.4998 0.4227 -0.1970 -0.0995 0.0102  187 LEU B N   
1687 C CA  . LEU B 45  ? 0.4994 0.5425 0.4311 -0.2309 -0.1119 0.0016  187 LEU B CA  
1688 C C   . LEU B 45  ? 0.5295 0.5417 0.4144 -0.2354 -0.0996 -0.0148 187 LEU B C   
1689 O O   . LEU B 45  ? 0.5818 0.5699 0.4232 -0.2641 -0.0946 -0.0344 187 LEU B O   
1690 C CB  . LEU B 45  ? 0.4995 0.5870 0.4452 -0.2412 -0.1439 0.0249  187 LEU B CB  
1691 C CG  . LEU B 45  ? 0.4773 0.6054 0.4766 -0.2412 -0.1571 0.0414  187 LEU B CG  
1692 C CD1 . LEU B 45  ? 0.4802 0.6546 0.5052 -0.2444 -0.1897 0.0680  187 LEU B CD1 
1693 C CD2 . LEU B 45  ? 0.4968 0.6156 0.4868 -0.2723 -0.1560 0.0282  187 LEU B CD2 
1694 N N   . ALA B 46  ? 0.5051 0.5182 0.3979 -0.2099 -0.0930 -0.0086 188 ALA B N   
1695 C CA  . ALA B 46  ? 0.5301 0.5210 0.3842 -0.2148 -0.0802 -0.0213 188 ALA B CA  
1696 C C   . ALA B 46  ? 0.4924 0.4835 0.3697 -0.1834 -0.0691 -0.0160 188 ALA B C   
1697 O O   . ALA B 46  ? 0.4543 0.4658 0.3684 -0.1614 -0.0777 0.0008  188 ALA B O   
1698 C CB  . ALA B 46  ? 0.5642 0.5686 0.3790 -0.2412 -0.1025 -0.0106 188 ALA B CB  
1699 N N   . VAL B 47  ? 0.5143 0.4832 0.3692 -0.1844 -0.0485 -0.0324 189 VAL B N   
1700 C CA  . VAL B 47  ? 0.4842 0.4530 0.3578 -0.1611 -0.0371 -0.0305 189 VAL B CA  
1701 C C   . VAL B 47  ? 0.5196 0.4805 0.3557 -0.1766 -0.0283 -0.0365 189 VAL B C   
1702 O O   . VAL B 47  ? 0.5582 0.5005 0.3569 -0.1995 -0.0132 -0.0563 189 VAL B O   
1703 C CB  . VAL B 47  ? 0.4695 0.4207 0.3705 -0.1426 -0.0145 -0.0455 189 VAL B CB  
1704 C CG1 . VAL B 47  ? 0.4381 0.3928 0.3584 -0.1235 -0.0042 -0.0450 189 VAL B CG1 
1705 C CG2 . VAL B 47  ? 0.4451 0.4029 0.3781 -0.1283 -0.0225 -0.0356 189 VAL B CG2 
1706 N N   . GLN B 48  ? 0.5065 0.4790 0.3508 -0.1660 -0.0352 -0.0207 190 GLN B N   
1707 C CA  . GLN B 48  ? 0.5428 0.5078 0.3556 -0.1799 -0.0238 -0.0239 190 GLN B CA  
1708 C C   . GLN B 48  ? 0.5092 0.4756 0.3562 -0.1578 -0.0080 -0.0269 190 GLN B C   
1709 O O   . GLN B 48  ? 0.4745 0.4522 0.3548 -0.1371 -0.0205 -0.0123 190 GLN B O   
1710 C CB  . GLN B 48  ? 0.5702 0.5452 0.3563 -0.1948 -0.0493 0.0021  190 GLN B CB  
1711 C CG  . GLN B 48  ? 0.6438 0.6236 0.3937 -0.2219 -0.0711 0.0094  190 GLN B CG  
1712 C CD  . GLN B 48  ? 0.6651 0.6689 0.4541 -0.2083 -0.1014 0.0334  190 GLN B CD  
1713 O OE1 . GLN B 48  ? 0.6659 0.6808 0.4888 -0.1877 -0.1134 0.0541  190 GLN B OE1 
1714 N NE2 . GLN B 48  ? 0.6828 0.6942 0.4703 -0.2207 -0.1117 0.0291  190 GLN B NE2 
1715 N N   . ILE B 49  ? 0.5277 0.4836 0.3673 -0.1642 0.0203  -0.0472 191 ILE B N   
1716 C CA  . ILE B 49  ? 0.4991 0.4613 0.3781 -0.1458 0.0359  -0.0518 191 ILE B CA  
1717 C C   . ILE B 49  ? 0.5203 0.4834 0.3775 -0.1621 0.0489  -0.0510 191 ILE B C   
1718 O O   . ILE B 49  ? 0.5648 0.5173 0.3770 -0.1880 0.0653  -0.0624 191 ILE B O   
1719 C CB  . ILE B 49  ? 0.4998 0.4545 0.4096 -0.1347 0.0615  -0.0753 191 ILE B CB  
1720 C CG1 . ILE B 49  ? 0.4807 0.4337 0.4183 -0.1163 0.0480  -0.0709 191 ILE B CG1 
1721 C CG2 . ILE B 49  ? 0.4873 0.4549 0.4404 -0.1203 0.0773  -0.0793 191 ILE B CG2 
1722 C CD1 . ILE B 49  ? 0.4802 0.4216 0.4533 -0.1030 0.0688  -0.0879 191 ILE B CD1 
1723 N N   . ASN B 50  ? 0.4827 0.4567 0.3683 -0.1499 0.0425  -0.0382 192 ASN B N   
1724 C CA  . ASN B 50  ? 0.5057 0.4822 0.3852 -0.1629 0.0588  -0.0383 192 ASN B CA  
1725 C C   . ASN B 50  ? 0.4810 0.4707 0.4131 -0.1482 0.0824  -0.0558 192 ASN B C   
1726 O O   . ASN B 50  ? 0.4350 0.4369 0.4128 -0.1266 0.0705  -0.0503 192 ASN B O   
1727 C CB  . ASN B 50  ? 0.4876 0.4651 0.3693 -0.1610 0.0361  -0.0129 192 ASN B CB  
1728 C CG  . ASN B 50  ? 0.5111 0.4879 0.3829 -0.1789 0.0515  -0.0092 192 ASN B CG  
1729 O OD1 . ASN B 50  ? 0.4998 0.4877 0.3980 -0.1791 0.0767  -0.0253 192 ASN B OD1 
1730 N ND2 . ASN B 50  ? 0.5121 0.4769 0.3511 -0.1938 0.0355  0.0145  192 ASN B ND2 
1731 N N   . GLN B 51  ? 0.5167 0.5050 0.4431 -0.1609 0.1157  -0.0771 193 GLN B N   
1732 C CA  . GLN B 51  ? 0.5132 0.5177 0.5004 -0.1458 0.1405  -0.0941 193 GLN B CA  
1733 C C   . GLN B 51  ? 0.4952 0.5217 0.5179 -0.1449 0.1415  -0.0851 193 GLN B C   
1734 O O   . GLN B 51  ? 0.4643 0.5112 0.5482 -0.1242 0.1362  -0.0843 193 GLN B O   
1735 C CB  . GLN B 51  ? 0.5656 0.5618 0.5400 -0.1607 0.1822  -0.1226 193 GLN B CB  
1736 C CG  . GLN B 51  ? 0.5923 0.5687 0.5648 -0.1529 0.1884  -0.1396 193 GLN B CG  
1737 C CD  . GLN B 51  ? 0.6708 0.6229 0.5774 -0.1835 0.2140  -0.1618 193 GLN B CD  
1738 O OE1 . GLN B 51  ? 0.7647 0.7180 0.6444 -0.2065 0.2438  -0.1745 193 GLN B OE1 
1739 N NE2 . GLN B 51  ? 0.7324 0.6619 0.6092 -0.1875 0.2035  -0.1677 193 GLN B NE2 
1740 N N   . ASP B 52  ? 0.5182 0.5402 0.5010 -0.1698 0.1463  -0.0767 194 ASP B N   
1741 C CA  . ASP B 52  ? 0.5103 0.5497 0.5229 -0.1752 0.1504  -0.0691 194 ASP B CA  
1742 C C   . ASP B 52  ? 0.4565 0.5025 0.5024 -0.1566 0.1164  -0.0520 194 ASP B C   
1743 O O   . ASP B 52  ? 0.4351 0.5032 0.5312 -0.1516 0.1179  -0.0530 194 ASP B O   
1744 C CB  . ASP B 52  ? 0.5630 0.5888 0.5173 -0.2084 0.1594  -0.0584 194 ASP B CB  
1745 C CG  . ASP B 52  ? 0.6398 0.6609 0.5552 -0.2331 0.1990  -0.0788 194 ASP B CG  
1746 O OD1 . ASP B 52  ? 0.7369 0.7455 0.5937 -0.2643 0.2068  -0.0689 194 ASP B OD1 
1747 O OD2 . ASP B 52  ? 0.6625 0.6898 0.6036 -0.2228 0.2235  -0.1046 194 ASP B OD2 
1748 N N   . LYS B 53  ? 0.4369 0.4656 0.4568 -0.1478 0.0873  -0.0386 195 LYS B N   
1749 C CA  . LYS B 53  ? 0.3990 0.4279 0.4398 -0.1335 0.0591  -0.0255 195 LYS B CA  
1750 C C   . LYS B 53  ? 0.3586 0.3927 0.4228 -0.1084 0.0420  -0.0280 195 LYS B C   
1751 O O   . LYS B 53  ? 0.3351 0.3663 0.4060 -0.0984 0.0209  -0.0199 195 LYS B O   
1752 C CB  . LYS B 53  ? 0.4177 0.4225 0.4172 -0.1435 0.0408  -0.0055 195 LYS B CB  
1753 C CG  . LYS B 53  ? 0.4450 0.4420 0.4291 -0.1674 0.0504  0.0041  195 LYS B CG  
1754 C CD  . LYS B 53  ? 0.4724 0.4416 0.4184 -0.1759 0.0304  0.0289  195 LYS B CD  
1755 C CE  . LYS B 53  ? 0.4371 0.3955 0.4092 -0.1581 0.0075  0.0369  195 LYS B CE  
1756 N NZ  . LYS B 53  ? 0.4605 0.3895 0.4103 -0.1652 -0.0088 0.0625  195 LYS B NZ  
1757 N N   . ASN B 54  ? 0.3525 0.3910 0.4267 -0.0999 0.0533  -0.0398 196 ASN B N   
1758 C CA  . ASN B 54  ? 0.3268 0.3703 0.4266 -0.0780 0.0400  -0.0403 196 ASN B CA  
1759 C C   . ASN B 54  ? 0.3132 0.3438 0.3883 -0.0707 0.0161  -0.0288 196 ASN B C   
1760 O O   . ASN B 54  ? 0.2878 0.3245 0.3804 -0.0573 0.0006  -0.0243 196 ASN B O   
1761 C CB  . ASN B 54  ? 0.3093 0.3777 0.4632 -0.0665 0.0346  -0.0404 196 ASN B CB  
1762 C CG  . ASN B 54  ? 0.3358 0.4239 0.5336 -0.0668 0.0599  -0.0525 196 ASN B CG  
1763 O OD1 . ASN B 54  ? 0.3593 0.4663 0.5827 -0.0760 0.0679  -0.0540 196 ASN B OD1 
1764 N ND2 . ASN B 54  ? 0.3795 0.4626 0.5902 -0.0574 0.0748  -0.0622 196 ASN B ND2 
1765 N N   . PHE B 55  ? 0.3283 0.3432 0.3632 -0.0811 0.0136  -0.0237 197 PHE B N   
1766 C CA  . PHE B 55  ? 0.3205 0.3283 0.3415 -0.0736 -0.0053 -0.0138 197 PHE B CA  
1767 C C   . PHE B 55  ? 0.3393 0.3379 0.3301 -0.0834 -0.0035 -0.0149 197 PHE B C   
1768 O O   . PHE B 55  ? 0.3563 0.3490 0.3240 -0.1001 0.0112  -0.0226 197 PHE B O   
1769 C CB  . PHE B 55  ? 0.3195 0.3210 0.3332 -0.0749 -0.0198 -0.0005 197 PHE B CB  
1770 C CG  . PHE B 55  ? 0.3505 0.3407 0.3331 -0.0926 -0.0206 0.0104  197 PHE B CG  
1771 C CD1 . PHE B 55  ? 0.3674 0.3525 0.3286 -0.0963 -0.0337 0.0223  197 PHE B CD1 
1772 C CD2 . PHE B 55  ? 0.3580 0.3445 0.3335 -0.1077 -0.0100 0.0116  197 PHE B CD2 
1773 C CE1 . PHE B 55  ? 0.4014 0.3772 0.3310 -0.1147 -0.0396 0.0374  197 PHE B CE1 
1774 C CE2 . PHE B 55  ? 0.4059 0.3799 0.3461 -0.1269 -0.0123 0.0257  197 PHE B CE2 
1775 C CZ  . PHE B 55  ? 0.4211 0.3892 0.3367 -0.1303 -0.0291 0.0399  197 PHE B CZ  
1776 N N   . ALA B 56  ? 0.3300 0.3285 0.3202 -0.0755 -0.0171 -0.0087 198 ALA B N   
1777 C CA  . ALA B 56  ? 0.3590 0.3522 0.3243 -0.0867 -0.0207 -0.0079 198 ALA B CA  
1778 C C   . ALA B 56  ? 0.3536 0.3532 0.3207 -0.0822 -0.0411 0.0083  198 ALA B C   
1779 O O   . ALA B 56  ? 0.3280 0.3325 0.3171 -0.0671 -0.0475 0.0140  198 ALA B O   
1780 C CB  . ALA B 56  ? 0.3525 0.3412 0.3274 -0.0822 -0.0112 -0.0203 198 ALA B CB  
1781 N N   . PHE B 57  ? 0.3821 0.3825 0.3274 -0.0967 -0.0506 0.0146  199 PHE B N   
1782 C CA  . PHE B 57  ? 0.3812 0.3943 0.3403 -0.0917 -0.0687 0.0289  199 PHE B CA  
1783 C C   . PHE B 57  ? 0.3921 0.4083 0.3481 -0.0990 -0.0684 0.0220  199 PHE B C   
1784 O O   . PHE B 57  ? 0.4105 0.4162 0.3384 -0.1176 -0.0617 0.0109  199 PHE B O   
1785 C CB  . PHE B 57  ? 0.4135 0.4309 0.3600 -0.1029 -0.0875 0.0491  199 PHE B CB  
1786 C CG  . PHE B 57  ? 0.4088 0.4240 0.3774 -0.0883 -0.0933 0.0620  199 PHE B CG  
1787 C CD1 . PHE B 57  ? 0.3960 0.4220 0.4023 -0.0700 -0.1020 0.0713  199 PHE B CD1 
1788 C CD2 . PHE B 57  ? 0.4202 0.4207 0.3745 -0.0936 -0.0864 0.0625  199 PHE B CD2 
1789 C CE1 . PHE B 57  ? 0.3913 0.4087 0.4194 -0.0564 -0.1035 0.0790  199 PHE B CE1 
1790 C CE2 . PHE B 57  ? 0.4216 0.4143 0.3968 -0.0820 -0.0906 0.0727  199 PHE B CE2 
1791 C CZ  . PHE B 57  ? 0.4082 0.4067 0.4197 -0.0628 -0.0991 0.0799  199 PHE B CZ  
1792 N N   . LEU B 58  ? 0.3796 0.4080 0.3635 -0.0861 -0.0726 0.0265  200 LEU B N   
1793 C CA  . LEU B 58  ? 0.3827 0.4164 0.3692 -0.0946 -0.0743 0.0241  200 LEU B CA  
1794 C C   . LEU B 58  ? 0.3911 0.4488 0.3922 -0.1002 -0.0939 0.0409  200 LEU B C   
1795 O O   . LEU B 58  ? 0.3781 0.4495 0.4065 -0.0849 -0.1003 0.0530  200 LEU B O   
1796 C CB  . LEU B 58  ? 0.3633 0.3976 0.3726 -0.0789 -0.0648 0.0208  200 LEU B CB  
1797 C CG  . LEU B 58  ? 0.3649 0.3831 0.3751 -0.0673 -0.0509 0.0110  200 LEU B CG  
1798 C CD1 . LEU B 58  ? 0.3596 0.3837 0.3869 -0.0554 -0.0485 0.0157  200 LEU B CD1 
1799 C CD2 . LEU B 58  ? 0.3984 0.3956 0.3941 -0.0780 -0.0396 -0.0024 200 LEU B CD2 
1800 N N   . GLU B 59  ? 0.4208 0.4838 0.4083 -0.1222 -0.1030 0.0408  201 GLU B N   
1801 C CA  . GLU B 59  ? 0.4196 0.5128 0.4297 -0.1298 -0.1245 0.0583  201 GLU B CA  
1802 C C   . GLU B 59  ? 0.4105 0.5145 0.4412 -0.1346 -0.1198 0.0535  201 GLU B C   
1803 O O   . GLU B 59  ? 0.4241 0.5073 0.4313 -0.1489 -0.1094 0.0380  201 GLU B O   
1804 C CB  . GLU B 59  ? 0.4690 0.5642 0.4431 -0.1584 -0.1448 0.0653  201 GLU B CB  
1805 C CG  . GLU B 59  ? 0.5019 0.6342 0.5028 -0.1694 -0.1745 0.0881  201 GLU B CG  
1806 C CD  . GLU B 59  ? 0.5760 0.7236 0.5918 -0.1622 -0.1976 0.1157  201 GLU B CD  
1807 O OE1 . GLU B 59  ? 0.5948 0.7753 0.6676 -0.1488 -0.2129 0.1358  201 GLU B OE1 
1808 O OE2 . GLU B 59  ? 0.6283 0.7553 0.6023 -0.1708 -0.2003 0.1188  201 GLU B OE2 
1809 N N   . PHE B 60  ? 0.3868 0.5219 0.4641 -0.1230 -0.1252 0.0666  202 PHE B N   
1810 C CA  . PHE B 60  ? 0.3737 0.5239 0.4764 -0.1275 -0.1182 0.0650  202 PHE B CA  
1811 C C   . PHE B 60  ? 0.3831 0.5705 0.5127 -0.1471 -0.1402 0.0785  202 PHE B C   
1812 O O   . PHE B 60  ? 0.3907 0.5995 0.5322 -0.1496 -0.1632 0.0947  202 PHE B O   
1813 C CB  . PHE B 60  ? 0.3510 0.5128 0.4893 -0.1018 -0.1018 0.0671  202 PHE B CB  
1814 C CG  . PHE B 60  ? 0.3396 0.4698 0.4535 -0.0878 -0.0823 0.0546  202 PHE B CG  
1815 C CD1 . PHE B 60  ? 0.3551 0.4700 0.4567 -0.0729 -0.0808 0.0519  202 PHE B CD1 
1816 C CD2 . PHE B 60  ? 0.3476 0.4644 0.4532 -0.0910 -0.0676 0.0482  202 PHE B CD2 
1817 C CE1 . PHE B 60  ? 0.3384 0.4302 0.4221 -0.0621 -0.0668 0.0421  202 PHE B CE1 
1818 C CE2 . PHE B 60  ? 0.3535 0.4450 0.4398 -0.0787 -0.0549 0.0413  202 PHE B CE2 
1819 C CZ  . PHE B 60  ? 0.3493 0.4309 0.4261 -0.0644 -0.0553 0.0378  202 PHE B CZ  
1820 N N   . ARG B 61  ? 0.3800 0.5761 0.5219 -0.1619 -0.1348 0.0745  203 ARG B N   
1821 C CA  . ARG B 61  ? 0.3872 0.6246 0.5627 -0.1831 -0.1553 0.0869  203 ARG B CA  
1822 C C   . ARG B 61  ? 0.3580 0.6452 0.6069 -0.1641 -0.1559 0.1039  203 ARG B C   
1823 O O   . ARG B 61  ? 0.3653 0.6963 0.6553 -0.1762 -0.1791 0.1201  203 ARG B O   
1824 C CB  . ARG B 61  ? 0.4080 0.6335 0.5703 -0.2105 -0.1479 0.0749  203 ARG B CB  
1825 C CG  . ARG B 61  ? 0.3849 0.6062 0.5690 -0.1982 -0.1204 0.0714  203 ARG B CG  
1826 C CD  . ARG B 61  ? 0.4115 0.6179 0.5857 -0.2270 -0.1144 0.0634  203 ARG B CD  
1827 N NE  . ARG B 61  ? 0.3886 0.5822 0.5720 -0.2159 -0.0878 0.0630  203 ARG B NE  
1828 C CZ  . ARG B 61  ? 0.4141 0.5863 0.5900 -0.2360 -0.0767 0.0589  203 ARG B CZ  
1829 N NH1 . ARG B 61  ? 0.4445 0.6037 0.6056 -0.2689 -0.0882 0.0508  203 ARG B NH1 
1830 N NH2 . ARG B 61  ? 0.4151 0.5758 0.5948 -0.2255 -0.0543 0.0634  203 ARG B NH2 
1831 N N   . SER B 62  ? 0.3277 0.6103 0.5953 -0.1363 -0.1302 0.0996  204 SER B N   
1832 C CA  . SER B 62  ? 0.3099 0.6363 0.6477 -0.1172 -0.1231 0.1104  204 SER B CA  
1833 C C   . SER B 62  ? 0.2892 0.6021 0.6347 -0.0842 -0.1054 0.1062  204 SER B C   
1834 O O   . SER B 62  ? 0.2861 0.5574 0.5827 -0.0765 -0.0932 0.0935  204 SER B O   
1835 C CB  . SER B 62  ? 0.3100 0.6581 0.6759 -0.1272 -0.1028 0.1068  204 SER B CB  
1836 O OG  . SER B 62  ? 0.3081 0.6253 0.6446 -0.1163 -0.0718 0.0932  204 SER B OG  
1837 N N   . VAL B 63  ? 0.2791 0.6285 0.6914 -0.0653 -0.1038 0.1166  205 VAL B N   
1838 C CA  . VAL B 63  ? 0.2714 0.6080 0.6988 -0.0350 -0.0850 0.1103  205 VAL B CA  
1839 C C   . VAL B 63  ? 0.2677 0.5860 0.6718 -0.0289 -0.0482 0.0898  205 VAL B C   
1840 O O   . VAL B 63  ? 0.2613 0.5439 0.6278 -0.0169 -0.0366 0.0775  205 VAL B O   
1841 C CB  . VAL B 63  ? 0.2688 0.6483 0.7838 -0.0152 -0.0891 0.1253  205 VAL B CB  
1842 C CG1 . VAL B 63  ? 0.2681 0.6306 0.8017 0.0147  -0.0601 0.1118  205 VAL B CG1 
1843 C CG2 . VAL B 63  ? 0.2717 0.6605 0.8002 -0.0187 -0.1298 0.1502  205 VAL B CG2 
1844 N N   . ASP B 64  ? 0.2739 0.6169 0.6969 -0.0403 -0.0316 0.0876  206 ASP B N   
1845 C CA  . ASP B 64  ? 0.2861 0.6139 0.6824 -0.0384 0.0026  0.0719  206 ASP B CA  
1846 C C   . ASP B 64  ? 0.2940 0.5735 0.6115 -0.0493 0.0025  0.0642  206 ASP B C   
1847 O O   . ASP B 64  ? 0.2985 0.5539 0.5819 -0.0413 0.0210  0.0530  206 ASP B O   
1848 C CB  . ASP B 64  ? 0.2990 0.6672 0.7367 -0.0509 0.0218  0.0743  206 ASP B CB  
1849 C CG  . ASP B 64  ? 0.3107 0.7294 0.8372 -0.0338 0.0329  0.0780  206 ASP B CG  
1850 O OD1 . ASP B 64  ? 0.3331 0.7946 0.9077 -0.0444 0.0475  0.0817  206 ASP B OD1 
1851 O OD2 . ASP B 64  ? 0.3333 0.7490 0.8866 -0.0097 0.0285  0.0777  206 ASP B OD2 
1852 N N   . GLU B 65  ? 0.2953 0.5610 0.5865 -0.0679 -0.0183 0.0699  207 GLU B N   
1853 C CA  . GLU B 65  ? 0.3053 0.5260 0.5348 -0.0752 -0.0187 0.0637  207 GLU B CA  
1854 C C   . GLU B 65  ? 0.2965 0.4876 0.4959 -0.0595 -0.0253 0.0572  207 GLU B C   
1855 O O   . GLU B 65  ? 0.3013 0.4622 0.4617 -0.0568 -0.0187 0.0509  207 GLU B O   
1856 C CB  . GLU B 65  ? 0.3165 0.5274 0.5310 -0.0992 -0.0348 0.0672  207 GLU B CB  
1857 C CG  . GLU B 65  ? 0.3411 0.5621 0.5654 -0.1192 -0.0234 0.0712  207 GLU B CG  
1858 C CD  . GLU B 65  ? 0.3660 0.5839 0.5876 -0.1466 -0.0402 0.0730  207 GLU B CD  
1859 O OE1 . GLU B 65  ? 0.3795 0.6046 0.6032 -0.1522 -0.0626 0.0735  207 GLU B OE1 
1860 O OE2 . GLU B 65  ? 0.4023 0.6089 0.6168 -0.1652 -0.0309 0.0742  207 GLU B OE2 
1861 N N   . THR B 66  ? 0.2855 0.4868 0.5064 -0.0503 -0.0396 0.0612  208 THR B N   
1862 C CA  . THR B 66  ? 0.2822 0.4585 0.4816 -0.0367 -0.0441 0.0563  208 THR B CA  
1863 C C   . THR B 66  ? 0.2870 0.4549 0.4837 -0.0202 -0.0233 0.0455  208 THR B C   
1864 O O   . THR B 66  ? 0.2834 0.4239 0.4443 -0.0164 -0.0207 0.0372  208 THR B O   
1865 C CB  . THR B 66  ? 0.2818 0.4717 0.5096 -0.0312 -0.0634 0.0677  208 THR B CB  
1866 O OG1 . THR B 66  ? 0.2741 0.4753 0.4991 -0.0516 -0.0845 0.0778  208 THR B OG1 
1867 C CG2 . THR B 66  ? 0.2733 0.4334 0.4752 -0.0216 -0.0681 0.0642  208 THR B CG2 
1868 N N   . THR B 67  ? 0.2938 0.4877 0.5304 -0.0122 -0.0077 0.0444  209 THR B N   
1869 C CA  . THR B 67  ? 0.3132 0.4998 0.5453 -0.0001 0.0168  0.0298  209 THR B CA  
1870 C C   . THR B 67  ? 0.3350 0.5047 0.5165 -0.0113 0.0297  0.0231  209 THR B C   
1871 O O   . THR B 67  ? 0.3517 0.4993 0.4988 -0.0073 0.0373  0.0118  209 THR B O   
1872 C CB  . THR B 67  ? 0.3160 0.5370 0.6081 0.0096  0.0355  0.0284  209 THR B CB  
1873 O OG1 . THR B 67  ? 0.2983 0.5339 0.6413 0.0214  0.0176  0.0403  209 THR B OG1 
1874 C CG2 . THR B 67  ? 0.3395 0.5497 0.6236 0.0202  0.0663  0.0078  209 THR B CG2 
1875 N N   . GLN B 68  ? 0.3424 0.5208 0.5185 -0.0271 0.0293  0.0320  210 GLN B N   
1876 C CA  . GLN B 68  ? 0.3667 0.5256 0.4959 -0.0392 0.0358  0.0331  210 GLN B CA  
1877 C C   . GLN B 68  ? 0.3621 0.4873 0.4510 -0.0381 0.0191  0.0334  210 GLN B C   
1878 O O   . GLN B 68  ? 0.3807 0.4893 0.4330 -0.0402 0.0231  0.0323  210 GLN B O   
1879 C CB  . GLN B 68  ? 0.3763 0.5456 0.5136 -0.0575 0.0358  0.0450  210 GLN B CB  
1880 C CG  . GLN B 68  ? 0.4104 0.6178 0.5888 -0.0630 0.0557  0.0462  210 GLN B CG  
1881 C CD  . GLN B 68  ? 0.4907 0.6991 0.6456 -0.0657 0.0848  0.0395  210 GLN B CD  
1882 O OE1 . GLN B 68  ? 0.5497 0.7317 0.6523 -0.0750 0.0863  0.0434  210 GLN B OE1 
1883 N NE2 . GLN B 68  ? 0.5206 0.7599 0.7149 -0.0584 0.1088  0.0298  210 GLN B NE2 
1884 N N   . ALA B 69  ? 0.3483 0.4663 0.4451 -0.0364 0.0007  0.0358  211 ALA B N   
1885 C CA  . ALA B 69  ? 0.3497 0.4404 0.4189 -0.0353 -0.0118 0.0350  211 ALA B CA  
1886 C C   . ALA B 69  ? 0.3540 0.4346 0.4095 -0.0240 -0.0122 0.0262  211 ALA B C   
1887 O O   . ALA B 69  ? 0.3635 0.4269 0.3994 -0.0229 -0.0202 0.0256  211 ALA B O   
1888 C CB  . ALA B 69  ? 0.3358 0.4231 0.4142 -0.0399 -0.0259 0.0368  211 ALA B CB  
1889 N N   . MET B 70  ? 0.3572 0.4488 0.4282 -0.0158 -0.0030 0.0186  212 MET B N   
1890 C CA  . MET B 70  ? 0.3757 0.4547 0.4326 -0.0083 -0.0003 0.0069  212 MET B CA  
1891 C C   . MET B 70  ? 0.3968 0.4652 0.4129 -0.0150 0.0038  0.0035  212 MET B C   
1892 O O   . MET B 70  ? 0.4025 0.4583 0.3995 -0.0140 -0.0018 -0.0042 212 MET B O   
1893 C CB  . MET B 70  ? 0.3946 0.4841 0.4802 0.0015  0.0145  -0.0024 212 MET B CB  
1894 C CG  . MET B 70  ? 0.4397 0.5116 0.5250 0.0101  0.0137  -0.0137 212 MET B CG  
1895 S SD  . MET B 70  ? 0.4720 0.5384 0.5832 0.0158  -0.0067 -0.0024 212 MET B SD  
1896 C CE  . MET B 70  ? 0.4557 0.4951 0.5579 0.0216  -0.0018 -0.0185 212 MET B CE  
1897 N N   . ALA B 71  ? 0.4064 0.4806 0.4087 -0.0243 0.0113  0.0112  213 ALA B N   
1898 C CA  . ALA B 71  ? 0.4382 0.5029 0.3970 -0.0339 0.0114  0.0146  213 ALA B CA  
1899 C C   . ALA B 71  ? 0.4322 0.4825 0.3780 -0.0348 -0.0107 0.0265  213 ALA B C   
1900 O O   . ALA B 71  ? 0.4542 0.4979 0.3670 -0.0420 -0.0178 0.0332  213 ALA B O   
1901 C CB  . ALA B 71  ? 0.4580 0.5313 0.4062 -0.0457 0.0258  0.0241  213 ALA B CB  
1902 N N   . PHE B 72  ? 0.4033 0.4500 0.3757 -0.0285 -0.0210 0.0296  214 PHE B N   
1903 C CA  . PHE B 72  ? 0.4014 0.4364 0.3748 -0.0264 -0.0370 0.0378  214 PHE B CA  
1904 C C   . PHE B 72  ? 0.3925 0.4267 0.3671 -0.0212 -0.0467 0.0290  214 PHE B C   
1905 O O   . PHE B 72  ? 0.3881 0.4182 0.3734 -0.0181 -0.0582 0.0345  214 PHE B O   
1906 C CB  . PHE B 72  ? 0.3872 0.4166 0.3853 -0.0251 -0.0383 0.0408  214 PHE B CB  
1907 C CG  . PHE B 72  ? 0.3979 0.4246 0.3975 -0.0337 -0.0316 0.0502  214 PHE B CG  
1908 C CD1 . PHE B 72  ? 0.3905 0.4180 0.4084 -0.0382 -0.0291 0.0471  214 PHE B CD1 
1909 C CD2 . PHE B 72  ? 0.4320 0.4547 0.4118 -0.0409 -0.0288 0.0630  214 PHE B CD2 
1910 C CE1 . PHE B 72  ? 0.4036 0.4284 0.4249 -0.0496 -0.0236 0.0545  214 PHE B CE1 
1911 C CE2 . PHE B 72  ? 0.4535 0.4720 0.4364 -0.0515 -0.0215 0.0726  214 PHE B CE2 
1912 C CZ  . PHE B 72  ? 0.4322 0.4520 0.4384 -0.0558 -0.0188 0.0672  214 PHE B CZ  
1913 N N   . ASP B 73  ? 0.3931 0.4306 0.3616 -0.0205 -0.0407 0.0150  215 ASP B N   
1914 C CA  . ASP B 73  ? 0.3924 0.4269 0.3596 -0.0198 -0.0500 0.0065  215 ASP B CA  
1915 C C   . ASP B 73  ? 0.4099 0.4460 0.3588 -0.0258 -0.0659 0.0157  215 ASP B C   
1916 O O   . ASP B 73  ? 0.4428 0.4793 0.3609 -0.0340 -0.0661 0.0209  215 ASP B O   
1917 C CB  . ASP B 73  ? 0.4078 0.4387 0.3657 -0.0206 -0.0393 -0.0111 215 ASP B CB  
1918 C CG  . ASP B 73  ? 0.4198 0.4441 0.3798 -0.0225 -0.0481 -0.0209 215 ASP B CG  
1919 O OD1 . ASP B 73  ? 0.4025 0.4277 0.3851 -0.0194 -0.0562 -0.0160 215 ASP B OD1 
1920 O OD2 . ASP B 73  ? 0.4542 0.4715 0.3917 -0.0296 -0.0450 -0.0351 215 ASP B OD2 
1921 N N   . GLY B 74  ? 0.3964 0.4358 0.3662 -0.0229 -0.0793 0.0194  216 GLY B N   
1922 C CA  . GLY B 74  ? 0.4113 0.4582 0.3784 -0.0265 -0.0992 0.0322  216 GLY B CA  
1923 C C   . GLY B 74  ? 0.4102 0.4554 0.3958 -0.0202 -0.1062 0.0532  216 GLY B C   
1924 O O   . GLY B 74  ? 0.4197 0.4729 0.4166 -0.0196 -0.1252 0.0683  216 GLY B O   
1925 N N   . ILE B 75  ? 0.3958 0.4304 0.3883 -0.0160 -0.0921 0.0551  217 ILE B N   
1926 C CA  . ILE B 75  ? 0.4032 0.4276 0.4135 -0.0110 -0.0948 0.0725  217 ILE B CA  
1927 C C   . ILE B 75  ? 0.3887 0.4156 0.4433 -0.0003 -0.1016 0.0753  217 ILE B C   
1928 O O   . ILE B 75  ? 0.3599 0.3935 0.4333 0.0024  -0.0954 0.0601  217 ILE B O   
1929 C CB  . ILE B 75  ? 0.3933 0.4050 0.4054 -0.0121 -0.0770 0.0683  217 ILE B CB  
1930 C CG1 . ILE B 75  ? 0.4173 0.4117 0.4354 -0.0122 -0.0784 0.0869  217 ILE B CG1 
1931 C CG2 . ILE B 75  ? 0.3665 0.3766 0.4028 -0.0079 -0.0670 0.0522  217 ILE B CG2 
1932 C CD1 . ILE B 75  ? 0.4418 0.4348 0.4286 -0.0205 -0.0875 0.1073  217 ILE B CD1 
1933 N N   . ILE B 76  ? 0.4138 0.4351 0.4876 0.0056  -0.1130 0.0959  218 ILE B N   
1934 C CA  . ILE B 76  ? 0.4165 0.4433 0.5434 0.0186  -0.1187 0.1006  218 ILE B CA  
1935 C C   . ILE B 76  ? 0.4154 0.4206 0.5718 0.0266  -0.0976 0.0916  218 ILE B C   
1936 O O   . ILE B 76  ? 0.4354 0.4169 0.5859 0.0261  -0.0927 0.1007  218 ILE B O   
1937 C CB  . ILE B 76  ? 0.4493 0.4819 0.5919 0.0231  -0.1449 0.1310  218 ILE B CB  
1938 C CG1 . ILE B 76  ? 0.4745 0.5258 0.5741 0.0088  -0.1669 0.1388  218 ILE B CG1 
1939 C CG2 . ILE B 76  ? 0.4407 0.4870 0.6525 0.0391  -0.1511 0.1359  218 ILE B CG2 
1940 C CD1 . ILE B 76  ? 0.4419 0.5173 0.5455 0.0037  -0.1702 0.1194  218 ILE B CD1 
1941 N N   . PHE B 77  ? 0.4010 0.4126 0.5853 0.0308  -0.0839 0.0725  219 PHE B N   
1942 C CA  . PHE B 77  ? 0.4095 0.4007 0.6191 0.0357  -0.0614 0.0590  219 PHE B CA  
1943 C C   . PHE B 77  ? 0.4137 0.4188 0.6821 0.0487  -0.0567 0.0552  219 PHE B C   
1944 O O   . PHE B 77  ? 0.3915 0.4231 0.6694 0.0466  -0.0596 0.0484  219 PHE B O   
1945 C CB  . PHE B 77  ? 0.4047 0.3904 0.5809 0.0227  -0.0440 0.0363  219 PHE B CB  
1946 C CG  . PHE B 77  ? 0.4122 0.3732 0.5956 0.0200  -0.0209 0.0194  219 PHE B CG  
1947 C CD1 . PHE B 77  ? 0.4537 0.3872 0.6571 0.0257  -0.0145 0.0242  219 PHE B CD1 
1948 C CD2 . PHE B 77  ? 0.4296 0.3916 0.5945 0.0086  -0.0059 -0.0013 219 PHE B CD2 
1949 C CE1 . PHE B 77  ? 0.4810 0.3876 0.6859 0.0197  0.0090  0.0035  219 PHE B CE1 
1950 C CE2 . PHE B 77  ? 0.4526 0.3909 0.6133 0.0007  0.0155  -0.0197 219 PHE B CE2 
1951 C CZ  . PHE B 77  ? 0.4728 0.3829 0.6530 0.0058  0.0240  -0.0197 219 PHE B CZ  
1952 N N   . GLN B 78  ? 0.4413 0.4281 0.7540 0.0620  -0.0484 0.0600  220 GLN B N   
1953 C CA  . GLN B 78  ? 0.4535 0.4548 0.8376 0.0784  -0.0413 0.0582  220 GLN B CA  
1954 C C   . GLN B 78  ? 0.4427 0.4868 0.8534 0.0821  -0.0677 0.0746  220 GLN B C   
1955 O O   . GLN B 78  ? 0.4245 0.4959 0.8692 0.0830  -0.0593 0.0621  220 GLN B O   
1956 C CB  . GLN B 78  ? 0.4486 0.4457 0.8415 0.0741  -0.0062 0.0249  220 GLN B CB  
1957 C CG  . GLN B 78  ? 0.4821 0.4369 0.8456 0.0660  0.0187  0.0060  220 GLN B CG  
1958 C CD  . GLN B 78  ? 0.5123 0.4541 0.9050 0.0674  0.0565  -0.0240 220 GLN B CD  
1959 O OE1 . GLN B 78  ? 0.5329 0.5011 0.9670 0.0734  0.0686  -0.0330 220 GLN B OE1 
1960 N NE2 . GLN B 78  ? 0.5594 0.4601 0.9299 0.0594  0.0773  -0.0413 220 GLN B NE2 
1961 N N   . GLY B 79  ? 0.4572 0.5071 0.8485 0.0805  -0.0995 0.1024  221 GLY B N   
1962 C CA  . GLY B 79  ? 0.4581 0.5471 0.8651 0.0789  -0.1303 0.1197  221 GLY B CA  
1963 C C   . GLY B 79  ? 0.4385 0.5473 0.7974 0.0598  -0.1357 0.1052  221 GLY B C   
1964 O O   . GLY B 79  ? 0.4490 0.5866 0.8102 0.0533  -0.1628 0.1175  221 GLY B O   
1965 N N   . GLN B 80  ? 0.4207 0.5129 0.7368 0.0496  -0.1121 0.0805  222 GLN B N   
1966 C CA  . GLN B 80  ? 0.4051 0.5098 0.6839 0.0338  -0.1132 0.0657  222 GLN B CA  
1967 C C   . GLN B 80  ? 0.3991 0.4844 0.6091 0.0222  -0.1134 0.0621  222 GLN B C   
1968 O O   . GLN B 80  ? 0.4026 0.4642 0.5923 0.0235  -0.1013 0.0612  222 GLN B O   
1969 C CB  . GLN B 80  ? 0.3891 0.4951 0.6827 0.0311  -0.0861 0.0419  222 GLN B CB  
1970 C CG  . GLN B 80  ? 0.4047 0.5314 0.7716 0.0424  -0.0764 0.0403  222 GLN B CG  
1971 C CD  . GLN B 80  ? 0.3928 0.5377 0.7731 0.0323  -0.0599 0.0221  222 GLN B CD  
1972 O OE1 . GLN B 80  ? 0.4420 0.5796 0.7755 0.0172  -0.0570 0.0121  222 GLN B OE1 
1973 N NE2 . GLN B 80  ? 0.4083 0.5766 0.8567 0.0407  -0.0477 0.0190  222 GLN B NE2 
1974 N N   . SER B 81  ? 0.3929 0.4891 0.5720 0.0099  -0.1250 0.0578  223 SER B N   
1975 C CA  . SER B 81  ? 0.3957 0.4775 0.5178 0.0000  -0.1230 0.0523  223 SER B CA  
1976 C C   . SER B 81  ? 0.3681 0.4390 0.4766 -0.0036 -0.1024 0.0324  223 SER B C   
1977 O O   . SER B 81  ? 0.3611 0.4397 0.4798 -0.0085 -0.1000 0.0217  223 SER B O   
1978 C CB  . SER B 81  ? 0.4218 0.5165 0.5167 -0.0125 -0.1440 0.0551  223 SER B CB  
1979 O OG  . SER B 81  ? 0.4532 0.5341 0.4992 -0.0220 -0.1349 0.0419  223 SER B OG  
1980 N N   . LEU B 82  ? 0.3529 0.4066 0.4409 -0.0027 -0.0894 0.0300  224 LEU B N   
1981 C CA  . LEU B 82  ? 0.3356 0.3807 0.4144 -0.0059 -0.0744 0.0168  224 LEU B CA  
1982 C C   . LEU B 82  ? 0.3330 0.3753 0.3840 -0.0115 -0.0745 0.0098  224 LEU B C   
1983 O O   . LEU B 82  ? 0.3443 0.3861 0.3727 -0.0137 -0.0786 0.0124  224 LEU B O   
1984 C CB  . LEU B 82  ? 0.3294 0.3612 0.4045 -0.0045 -0.0629 0.0178  224 LEU B CB  
1985 C CG  . LEU B 82  ? 0.3302 0.3554 0.4314 0.0007  -0.0565 0.0198  224 LEU B CG  
1986 C CD1 . LEU B 82  ? 0.3187 0.3267 0.4081 -0.0034 -0.0458 0.0175  224 LEU B CD1 
1987 C CD2 . LEU B 82  ? 0.3176 0.3494 0.4438 0.0009  -0.0478 0.0097  224 LEU B CD2 
1988 N N   . LYS B 83  ? 0.3156 0.3540 0.3688 -0.0145 -0.0682 0.0008  225 LYS B N   
1989 C CA  . LYS B 83  ? 0.3214 0.3521 0.3587 -0.0170 -0.0656 -0.0067 225 LYS B CA  
1990 C C   . LYS B 83  ? 0.3047 0.3290 0.3408 -0.0139 -0.0569 -0.0047 225 LYS B C   
1991 O O   . LYS B 83  ? 0.2867 0.3085 0.3304 -0.0160 -0.0542 -0.0025 225 LYS B O   
1992 C CB  . LYS B 83  ? 0.3272 0.3550 0.3725 -0.0231 -0.0673 -0.0140 225 LYS B CB  
1993 C CG  . LYS B 83  ? 0.3405 0.3524 0.3772 -0.0243 -0.0624 -0.0219 225 LYS B CG  
1994 C CD  . LYS B 83  ? 0.3546 0.3604 0.3979 -0.0337 -0.0655 -0.0287 225 LYS B CD  
1995 C CE  . LYS B 83  ? 0.3778 0.3600 0.4163 -0.0341 -0.0595 -0.0367 225 LYS B CE  
1996 N NZ  . LYS B 83  ? 0.3895 0.3610 0.4329 -0.0465 -0.0624 -0.0444 225 LYS B NZ  
1997 N N   . ILE B 84  ? 0.3040 0.3284 0.3307 -0.0111 -0.0526 -0.0050 226 ILE B N   
1998 C CA  . ILE B 84  ? 0.3043 0.3306 0.3384 -0.0083 -0.0468 -0.0007 226 ILE B CA  
1999 C C   . ILE B 84  ? 0.3083 0.3300 0.3499 -0.0034 -0.0411 -0.0065 226 ILE B C   
2000 O O   . ILE B 84  ? 0.3281 0.3470 0.3601 -0.0022 -0.0343 -0.0162 226 ILE B O   
2001 C CB  . ILE B 84  ? 0.3033 0.3373 0.3320 -0.0088 -0.0427 0.0046  226 ILE B CB  
2002 C CG1 . ILE B 84  ? 0.3171 0.3491 0.3415 -0.0116 -0.0477 0.0111  226 ILE B CG1 
2003 C CG2 . ILE B 84  ? 0.2853 0.3273 0.3289 -0.0088 -0.0395 0.0100  226 ILE B CG2 
2004 C CD1 . ILE B 84  ? 0.3240 0.3521 0.3584 -0.0145 -0.0478 0.0132  226 ILE B CD1 
2005 N N   . ARG B 85  ? 0.3032 0.3225 0.3610 -0.0014 -0.0435 -0.0004 227 ARG B N   
2006 C CA  . ARG B 85  ? 0.3185 0.3298 0.3945 0.0063  -0.0394 -0.0023 227 ARG B CA  
2007 C C   . ARG B 85  ? 0.3114 0.3331 0.4116 0.0098  -0.0451 0.0129  227 ARG B C   
2008 O O   . ARG B 85  ? 0.3007 0.3309 0.3944 0.0017  -0.0540 0.0230  227 ARG B O   
2009 C CB  . ARG B 85  ? 0.3327 0.3241 0.4065 0.0032  -0.0430 -0.0056 227 ARG B CB  
2010 C CG  . ARG B 85  ? 0.3479 0.3315 0.4029 -0.0030 -0.0412 -0.0206 227 ARG B CG  
2011 C CD  . ARG B 85  ? 0.3793 0.3537 0.4300 0.0010  -0.0295 -0.0367 227 ARG B CD  
2012 N NE  . ARG B 85  ? 0.4092 0.3752 0.4364 -0.0097 -0.0311 -0.0517 227 ARG B NE  
2013 C CZ  . ARG B 85  ? 0.4075 0.3869 0.4115 -0.0174 -0.0371 -0.0531 227 ARG B CZ  
2014 N NH1 . ARG B 85  ? 0.4099 0.4068 0.4113 -0.0146 -0.0394 -0.0412 227 ARG B NH1 
2015 N NH2 . ARG B 85  ? 0.4255 0.3997 0.4091 -0.0294 -0.0429 -0.0648 227 ARG B NH2 
2016 N N   . ARG B 86  ? 0.3249 0.3455 0.4547 0.0212  -0.0403 0.0141  228 ARG B N   
2017 C CA  . ARG B 86  ? 0.3306 0.3626 0.4927 0.0258  -0.0510 0.0331  228 ARG B CA  
2018 C C   . ARG B 86  ? 0.3425 0.3586 0.4969 0.0191  -0.0666 0.0477  228 ARG B C   
2019 O O   . ARG B 86  ? 0.3584 0.3517 0.4963 0.0159  -0.0637 0.0405  228 ARG B O   
2020 C CB  . ARG B 86  ? 0.3459 0.3792 0.5527 0.0434  -0.0400 0.0307  228 ARG B CB  
2021 C CG  . ARG B 86  ? 0.3495 0.4020 0.5679 0.0486  -0.0204 0.0172  228 ARG B CG  
2022 C CD  . ARG B 86  ? 0.3293 0.4159 0.5645 0.0436  -0.0280 0.0313  228 ARG B CD  
2023 N NE  . ARG B 86  ? 0.3254 0.4325 0.5808 0.0485  -0.0063 0.0207  228 ARG B NE  
2024 C CZ  . ARG B 86  ? 0.3269 0.4673 0.6079 0.0444  -0.0072 0.0304  228 ARG B CZ  
2025 N NH1 . ARG B 86  ? 0.3139 0.4696 0.5999 0.0342  -0.0310 0.0495  228 ARG B NH1 
2026 N NH2 . ARG B 86  ? 0.3411 0.4997 0.6398 0.0474  0.0172  0.0195  228 ARG B NH2 
2027 N N   . PRO B 87  ? 0.3484 0.3774 0.5124 0.0140  -0.0838 0.0694  229 PRO B N   
2028 C CA  . PRO B 87  ? 0.3722 0.3845 0.5276 0.0066  -0.0987 0.0874  229 PRO B CA  
2029 C C   . PRO B 87  ? 0.3994 0.3897 0.5887 0.0221  -0.0968 0.0929  229 PRO B C   
2030 O O   . PRO B 87  ? 0.3956 0.3918 0.6264 0.0402  -0.0874 0.0875  229 PRO B O   
2031 C CB  . PRO B 87  ? 0.3821 0.4175 0.5431 -0.0026 -0.1200 0.1109  229 PRO B CB  
2032 C CG  . PRO B 87  ? 0.3544 0.4160 0.5178 -0.0049 -0.1149 0.1009  229 PRO B CG  
2033 C CD  . PRO B 87  ? 0.3387 0.3984 0.5180 0.0107  -0.0921 0.0793  229 PRO B CD  
2034 N N   . HIS B 88  ? 0.4281 0.3914 0.6018 0.0142  -0.1030 0.1027  230 HIS B N   
2035 C CA  . HIS B 88  ? 0.4598 0.3930 0.6650 0.0273  -0.1008 0.1082  230 HIS B CA  
2036 C C   . HIS B 88  ? 0.4789 0.4197 0.7376 0.0434  -0.1156 0.1354  230 HIS B C   
2037 O O   . HIS B 88  ? 0.5028 0.4218 0.8048 0.0621  -0.1079 0.1348  230 HIS B O   
2038 C CB  . HIS B 88  ? 0.4891 0.3904 0.6653 0.0116  -0.1047 0.1162  230 HIS B CB  
2039 C CG  . HIS B 88  ? 0.4928 0.3810 0.6422 0.0028  -0.0875 0.0879  230 HIS B CG  
2040 N ND1 . HIS B 88  ? 0.5043 0.3785 0.6225 -0.0171 -0.0878 0.0902  230 HIS B ND1 
2041 C CD2 . HIS B 88  ? 0.4879 0.3783 0.6372 0.0089  -0.0710 0.0584  230 HIS B CD2 
2042 C CE1 . HIS B 88  ? 0.5027 0.3741 0.6105 -0.0213 -0.0742 0.0641  230 HIS B CE1 
2043 N NE2 . HIS B 88  ? 0.4902 0.3703 0.6126 -0.0065 -0.0657 0.0453  230 HIS B NE2 
2044 N N   . ASP B 89  ? 0.4745 0.4456 0.7338 0.0358  -0.1372 0.1588  231 ASP B N   
2045 C CA  . ASP B 89  ? 0.4913 0.4797 0.8106 0.0511  -0.1558 0.1877  231 ASP B CA  
2046 C C   . ASP B 89  ? 0.4594 0.4909 0.8206 0.0630  -0.1502 0.1796  231 ASP B C   
2047 O O   . ASP B 89  ? 0.4677 0.5286 0.8767 0.0695  -0.1707 0.2060  231 ASP B O   
2048 C CB  . ASP B 89  ? 0.5295 0.5224 0.8280 0.0324  -0.1906 0.2275  231 ASP B CB  
2049 C CG  . ASP B 89  ? 0.5343 0.5543 0.7778 0.0050  -0.2008 0.2255  231 ASP B CG  
2050 O OD1 . ASP B 89  ? 0.5244 0.5647 0.7611 0.0046  -0.1849 0.1992  231 ASP B OD1 
2051 O OD2 . ASP B 89  ? 0.6163 0.6340 0.8207 -0.0178 -0.2243 0.2507  231 ASP B OD2 
2052 N N   . TYR B 90  ? 0.4214 0.4583 0.7671 0.0644  -0.1235 0.1456  232 TYR B N   
2053 C CA  . TYR B 90  ? 0.4005 0.4740 0.7859 0.0750  -0.1111 0.1352  232 TYR B CA  
2054 C C   . TYR B 90  ? 0.4171 0.4927 0.8830 0.1040  -0.1000 0.1384  232 TYR B C   
2055 O O   . TYR B 90  ? 0.4334 0.4714 0.9106 0.1172  -0.0855 0.1282  232 TYR B O   
2056 C CB  . TYR B 90  ? 0.3710 0.4410 0.7161 0.0693  -0.0841 0.1005  232 TYR B CB  
2057 C CG  . TYR B 90  ? 0.3517 0.4507 0.7316 0.0794  -0.0626 0.0855  232 TYR B CG  
2058 C CD1 . TYR B 90  ? 0.3276 0.4682 0.7256 0.0718  -0.0718 0.0965  232 TYR B CD1 
2059 C CD2 . TYR B 90  ? 0.3493 0.4331 0.7387 0.0925  -0.0314 0.0585  232 TYR B CD2 
2060 C CE1 . TYR B 90  ? 0.3216 0.4903 0.7523 0.0785  -0.0493 0.0835  232 TYR B CE1 
2061 C CE2 . TYR B 90  ? 0.3505 0.4609 0.7658 0.0986  -0.0074 0.0438  232 TYR B CE2 
2062 C CZ  . TYR B 90  ? 0.3267 0.4804 0.7648 0.0920  -0.0158 0.0575  232 TYR B CZ  
2063 O OH  . TYR B 90  ? 0.3341 0.5151 0.7984 0.0955  0.0105  0.0438  232 TYR B OH  
2064 N N   . GLN B 91  ? 0.4119 0.5317 0.9376 0.1129  -0.1059 0.1517  233 GLN B N   
2065 C CA  . GLN B 91  ? 0.4331 0.5635 1.0494 0.1427  -0.0920 0.1540  233 GLN B CA  
2066 C C   . GLN B 91  ? 0.4198 0.5778 1.0587 0.1495  -0.0562 0.1239  233 GLN B C   
2067 O O   . GLN B 91  ? 0.3976 0.6024 1.0522 0.1405  -0.0624 0.1309  233 GLN B O   
2068 C CB  . GLN B 91  ? 0.4438 0.6100 1.1272 0.1493  -0.1280 0.1976  233 GLN B CB  
2069 C CG  . GLN B 91  ? 0.4734 0.6078 1.1455 0.1466  -0.1607 0.2314  233 GLN B CG  
2070 C CD  . GLN B 91  ? 0.4974 0.6687 1.2379 0.1528  -0.2014 0.2797  233 GLN B CD  
2071 O OE1 . GLN B 91  ? 0.5146 0.6861 1.2149 0.1309  -0.2401 0.3121  233 GLN B OE1 
2072 N NE2 . GLN B 91  ? 0.4933 0.6981 1.3382 0.1812  -0.1926 0.2853  233 GLN B NE2 
2073 N N   . PRO B 92  ? 0.4409 0.5682 1.0748 0.1612  -0.0179 0.0895  234 PRO B N   
2074 C CA  . PRO B 92  ? 0.4409 0.5907 1.0928 0.1665  0.0209  0.0600  234 PRO B CA  
2075 C C   . PRO B 92  ? 0.4476 0.6456 1.2045 0.1874  0.0275  0.0731  234 PRO B C   
2076 O O   . PRO B 92  ? 0.4336 0.6759 1.2057 0.1803  0.0398  0.0680  234 PRO B O   
2077 C CB  . PRO B 92  ? 0.4755 0.5752 1.1068 0.1755  0.0558  0.0243  234 PRO B CB  
2078 C CG  . PRO B 92  ? 0.4821 0.5360 1.0589 0.1654  0.0335  0.0314  234 PRO B CG  
2079 C CD  . PRO B 92  ? 0.4681 0.5366 1.0725 0.1656  -0.0085 0.0750  234 PRO B CD  
2080 N N   . LEU B 93  ? 0.4751 0.6644 1.3078 0.2127  0.0191  0.0917  235 LEU B N   
2081 C CA  . LEU B 93  ? 0.4816 0.7193 1.4310 0.2365  0.0193  0.1109  235 LEU B CA  
2082 C C   . LEU B 93  ? 0.4734 0.7416 1.4550 0.2320  -0.0375 0.1633  235 LEU B C   
2083 O O   . LEU B 93  ? 0.5004 0.7416 1.5084 0.2450  -0.0622 0.1901  235 LEU B O   
2084 C CB  . LEU B 93  ? 0.5295 0.7360 1.5545 0.2713  0.0507  0.0965  235 LEU B CB  
2085 C CG  . LEU B 93  ? 0.5584 0.7325 1.5552 0.2751  0.1101  0.0416  235 LEU B CG  
2086 C CD1 . LEU B 93  ? 0.6067 0.7480 1.6888 0.3104  0.1401  0.0284  235 LEU B CD1 
2087 C CD2 . LEU B 93  ? 0.5509 0.7759 1.5510 0.2655  0.1426  0.0194  235 LEU B CD2 
2088 N N   . PRO B 94  ? 0.4422 0.7636 1.4156 0.2101  -0.0598 0.1786  236 PRO B N   
2089 C CA  . PRO B 94  ? 0.4386 0.7941 1.4382 0.2003  -0.1154 0.2270  236 PRO B CA  
2090 C C   . PRO B 94  ? 0.4575 0.8426 1.5840 0.2315  -0.1326 0.2615  236 PRO B C   
2091 O O   . PRO B 94  ? 0.4585 0.8660 1.6771 0.2593  -0.0980 0.2470  236 PRO B O   
2092 C CB  . PRO B 94  ? 0.4110 0.8217 1.3964 0.1734  -0.1225 0.2260  236 PRO B CB  
2093 C CG  . PRO B 94  ? 0.4022 0.8161 1.3834 0.1771  -0.0685 0.1833  236 PRO B CG  
2094 C CD  . PRO B 94  ? 0.4160 0.7642 1.3480 0.1892  -0.0363 0.1525  236 PRO B CD  
2095 N N   . GLY B 95  ? 0.4746 0.8591 1.6048 0.2259  -0.1852 0.3076  237 GLY B N   
2096 C CA  . GLY B 95  ? 0.5035 0.9154 1.7537 0.2542  -0.2128 0.3510  237 GLY B CA  
2097 C C   . GLY B 95  ? 0.5386 0.8951 1.8404 0.2914  -0.1917 0.3490  237 GLY B C   
2098 O O   . GLY B 95  ? 0.5691 0.9430 1.9831 0.3209  -0.2098 0.3841  237 GLY B O   
2099 N N   . ALA B 96  ? 0.4318 0.5426 0.4563 -0.1030 -0.0961 0.1195  258 ALA B N   
2100 C CA  . ALA B 96  ? 0.4246 0.5618 0.4325 -0.1127 -0.0963 0.1015  258 ALA B CA  
2101 C C   . ALA B 96  ? 0.3990 0.5279 0.4230 -0.1068 -0.0801 0.0755  258 ALA B C   
2102 O O   . ALA B 96  ? 0.4053 0.5375 0.4090 -0.1160 -0.0781 0.0570  258 ALA B O   
2103 C CB  . ALA B 96  ? 0.4468 0.6141 0.4658 -0.1174 -0.1210 0.1171  258 ALA B CB  
2104 N N   . HIS B 97  ? 0.3786 0.4945 0.4357 -0.0923 -0.0697 0.0741  259 HIS B N   
2105 C CA  . HIS B 97  ? 0.3565 0.4717 0.4275 -0.0905 -0.0550 0.0562  259 HIS B CA  
2106 C C   . HIS B 97  ? 0.3420 0.4311 0.4058 -0.0823 -0.0356 0.0452  259 HIS B C   
2107 O O   . HIS B 97  ? 0.3311 0.4206 0.4078 -0.0788 -0.0229 0.0357  259 HIS B O   
2108 C CB  . HIS B 97  ? 0.3486 0.4931 0.4664 -0.0833 -0.0592 0.0621  259 HIS B CB  
2109 C CG  . HIS B 97  ? 0.3590 0.5363 0.4876 -0.0923 -0.0824 0.0750  259 HIS B CG  
2110 N ND1 . HIS B 97  ? 0.3593 0.5467 0.4669 -0.1142 -0.0921 0.0673  259 HIS B ND1 
2111 C CD2 . HIS B 97  ? 0.3552 0.5555 0.5114 -0.0821 -0.1013 0.0948  259 HIS B CD2 
2112 C CE1 . HIS B 97  ? 0.3689 0.5897 0.4886 -0.1203 -0.1153 0.0811  259 HIS B CE1 
2113 N NE2 . HIS B 97  ? 0.3761 0.6076 0.5267 -0.1001 -0.1217 0.1002  259 HIS B NE2 
2114 N N   . LYS B 98  ? 0.3508 0.4233 0.3928 -0.0828 -0.0344 0.0484  260 LYS B N   
2115 C CA  . LYS B 98  ? 0.3477 0.4014 0.3775 -0.0799 -0.0198 0.0374  260 LYS B CA  
2116 C C   . LYS B 98  ? 0.3391 0.3938 0.3464 -0.0844 -0.0132 0.0226  260 LYS B C   
2117 O O   . LYS B 98  ? 0.3422 0.4059 0.3303 -0.0907 -0.0197 0.0193  260 LYS B O   
2118 C CB  . LYS B 98  ? 0.3631 0.4072 0.3784 -0.0857 -0.0233 0.0479  260 LYS B CB  
2119 C CG  . LYS B 98  ? 0.3560 0.3863 0.3632 -0.0858 -0.0121 0.0380  260 LYS B CG  
2120 C CD  . LYS B 98  ? 0.3903 0.4180 0.3849 -0.0998 -0.0175 0.0517  260 LYS B CD  
2121 C CE  . LYS B 98  ? 0.3990 0.4153 0.3904 -0.1027 -0.0097 0.0414  260 LYS B CE  
2122 N NZ  . LYS B 98  ? 0.4251 0.4377 0.4092 -0.1225 -0.0170 0.0574  260 LYS B NZ  
2123 N N   . LEU B 99  ? 0.3382 0.3819 0.3462 -0.0798 -0.0018 0.0130  261 LEU B N   
2124 C CA  . LEU B 99  ? 0.3411 0.3755 0.3305 -0.0804 0.0009  0.0021  261 LEU B CA  
2125 C C   . LEU B 99  ? 0.3398 0.3710 0.3137 -0.0744 0.0071  -0.0042 261 LEU B C   
2126 O O   . LEU B 99  ? 0.3345 0.3659 0.3132 -0.0734 0.0122  -0.0019 261 LEU B O   
2127 C CB  . LEU B 99  ? 0.3479 0.3758 0.3470 -0.0832 0.0058  0.0023  261 LEU B CB  
2128 C CG  . LEU B 99  ? 0.3504 0.3908 0.3688 -0.0939 0.0000  0.0082  261 LEU B CG  
2129 C CD1 . LEU B 99  ? 0.3601 0.4013 0.3850 -0.1015 0.0085  0.0120  261 LEU B CD1 
2130 C CD2 . LEU B 99  ? 0.3772 0.4095 0.3817 -0.1032 -0.0146 0.0033  261 LEU B CD2 
2131 N N   . PHE B 100 ? 0.3495 0.3791 0.3066 -0.0694 0.0047  -0.0142 262 PHE B N   
2132 C CA  . PHE B 100 ? 0.3502 0.3839 0.2984 -0.0595 0.0084  -0.0211 262 PHE B CA  
2133 C C   . PHE B 100 ? 0.3698 0.3762 0.3133 -0.0536 0.0062  -0.0229 262 PHE B C   
2134 O O   . PHE B 100 ? 0.3826 0.3656 0.3216 -0.0557 -0.0008 -0.0255 262 PHE B O   
2135 C CB  . PHE B 100 ? 0.3615 0.4174 0.2976 -0.0520 0.0070  -0.0329 262 PHE B CB  
2136 C CG  . PHE B 100 ? 0.3636 0.4342 0.2980 -0.0362 0.0094  -0.0421 262 PHE B CG  
2137 C CD1 . PHE B 100 ? 0.3491 0.4507 0.2914 -0.0405 0.0144  -0.0359 262 PHE B CD1 
2138 C CD2 . PHE B 100 ? 0.3910 0.4434 0.3181 -0.0167 0.0038  -0.0570 262 PHE B CD2 
2139 C CE1 . PHE B 100 ? 0.3547 0.4816 0.3012 -0.0256 0.0145  -0.0432 262 PHE B CE1 
2140 C CE2 . PHE B 100 ? 0.3935 0.4642 0.3249 0.0038  0.0034  -0.0648 262 PHE B CE2 
2141 C CZ  . PHE B 100 ? 0.3744 0.4886 0.3172 -0.0006 0.0092  -0.0574 262 PHE B CZ  
2142 N N   . ILE B 101 ? 0.3607 0.3682 0.3029 -0.0501 0.0096  -0.0192 263 ILE B N   
2143 C CA  . ILE B 101 ? 0.3860 0.3698 0.3186 -0.0454 0.0051  -0.0147 263 ILE B CA  
2144 C C   . ILE B 101 ? 0.3920 0.3864 0.3196 -0.0283 0.0001  -0.0194 263 ILE B C   
2145 O O   . ILE B 101 ? 0.3755 0.3969 0.3060 -0.0294 0.0036  -0.0185 263 ILE B O   
2146 C CB  . ILE B 101 ? 0.3865 0.3697 0.3182 -0.0573 0.0123  -0.0036 263 ILE B CB  
2147 C CG1 . ILE B 101 ? 0.3950 0.3814 0.3407 -0.0701 0.0181  -0.0001 263 ILE B CG1 
2148 C CG2 . ILE B 101 ? 0.4138 0.3737 0.3295 -0.0577 0.0058  0.0082  263 ILE B CG2 
2149 C CD1 . ILE B 101 ? 0.3942 0.4016 0.3546 -0.0706 0.0264  -0.0042 263 ILE B CD1 
2150 N N   . GLY B 102 ? 0.4213 0.3949 0.3438 -0.0115 -0.0100 -0.0261 264 GLY B N   
2151 C CA  . GLY B 102 ? 0.4364 0.4264 0.3616 0.0123  -0.0166 -0.0325 264 GLY B CA  
2152 C C   . GLY B 102 ? 0.4826 0.4295 0.3980 0.0248  -0.0320 -0.0223 264 GLY B C   
2153 O O   . GLY B 102 ? 0.5127 0.4118 0.4172 0.0132  -0.0379 -0.0125 264 GLY B O   
2154 N N   . GLY B 103 ? 0.4935 0.4593 0.4143 0.0467  -0.0407 -0.0215 265 GLY B N   
2155 C CA  . GLY B 103 ? 0.5432 0.4658 0.4548 0.0626  -0.0603 -0.0075 265 GLY B CA  
2156 C C   . GLY B 103 ? 0.5476 0.4625 0.4413 0.0409  -0.0631 0.0205  265 GLY B C   
2157 O O   . GLY B 103 ? 0.5967 0.4641 0.4746 0.0410  -0.0789 0.0411  265 GLY B O   
2158 N N   . LEU B 104 ? 0.5043 0.4640 0.3977 0.0212  -0.0487 0.0210  266 LEU B N   
2159 C CA  . LEU B 104 ? 0.5126 0.4774 0.3848 0.0017  -0.0482 0.0402  266 LEU B CA  
2160 C C   . LEU B 104 ? 0.5379 0.5237 0.4047 0.0167  -0.0657 0.0513  266 LEU B C   
2161 O O   . LEU B 104 ? 0.5194 0.5456 0.4074 0.0348  -0.0699 0.0386  266 LEU B O   
2162 C CB  . LEU B 104 ? 0.4696 0.4707 0.3433 -0.0191 -0.0292 0.0292  266 LEU B CB  
2163 C CG  . LEU B 104 ? 0.4332 0.4245 0.3149 -0.0339 -0.0129 0.0209  266 LEU B CG  
2164 C CD1 . LEU B 104 ? 0.3821 0.4034 0.2689 -0.0456 0.0000  0.0084  266 LEU B CD1 
2165 C CD2 . LEU B 104 ? 0.4515 0.4153 0.3193 -0.0499 -0.0097 0.0371  266 LEU B CD2 
2166 N N   . PRO B 105 ? 0.5832 0.5498 0.4222 0.0073  -0.0766 0.0775  267 PRO B N   
2167 C CA  . PRO B 105 ? 0.6070 0.6038 0.4358 0.0157  -0.0943 0.0908  267 PRO B CA  
2168 C C   . PRO B 105 ? 0.5675 0.6264 0.4013 0.0041  -0.0842 0.0724  267 PRO B C   
2169 O O   . PRO B 105 ? 0.5446 0.6104 0.3691 -0.0194 -0.0645 0.0605  267 PRO B O   
2170 C CB  . PRO B 105 ? 0.6547 0.6257 0.4428 -0.0059 -0.1001 0.1225  267 PRO B CB  
2171 C CG  . PRO B 105 ? 0.6721 0.5857 0.4587 -0.0150 -0.0954 0.1311  267 PRO B CG  
2172 C CD  . PRO B 105 ? 0.6172 0.5403 0.4320 -0.0149 -0.0745 0.0993  267 PRO B CD  
2173 N N   . ASN B 106 ? 0.5720 0.6749 0.4226 0.0205  -0.0996 0.0696  268 ASN B N   
2174 C CA  . ASN B 106 ? 0.5413 0.7022 0.4024 0.0060  -0.0938 0.0512  268 ASN B CA  
2175 C C   . ASN B 106 ? 0.5560 0.7345 0.3806 -0.0214 -0.0953 0.0536  268 ASN B C   
2176 O O   . ASN B 106 ? 0.5417 0.7559 0.3704 -0.0386 -0.0922 0.0356  268 ASN B O   
2177 C CB  . ASN B 106 ? 0.5409 0.7572 0.4385 0.0301  -0.1099 0.0473  268 ASN B CB  
2178 C CG  . ASN B 106 ? 0.6000 0.8356 0.4892 0.0461  -0.1393 0.0699  268 ASN B CG  
2179 O OD1 . ASN B 106 ? 0.6787 0.8775 0.5308 0.0404  -0.1495 0.0929  268 ASN B OD1 
2180 N ND2 . ASN B 106 ? 0.5976 0.8983 0.5229 0.0653  -0.1541 0.0660  268 ASN B ND2 
2181 N N   . TYR B 107 ? 0.5891 0.7428 0.3756 -0.0277 -0.1010 0.0753  269 TYR B N   
2182 C CA  . TYR B 107 ? 0.6136 0.7881 0.3568 -0.0529 -0.1009 0.0754  269 TYR B CA  
2183 C C   . TYR B 107 ? 0.6066 0.7617 0.3284 -0.0746 -0.0725 0.0600  269 TYR B C   
2184 O O   . TYR B 107 ? 0.6283 0.8033 0.3163 -0.0935 -0.0666 0.0475  269 TYR B O   
2185 C CB  . TYR B 107 ? 0.6638 0.8364 0.3713 -0.0503 -0.1239 0.1109  269 TYR B CB  
2186 C CG  . TYR B 107 ? 0.6864 0.8037 0.3854 -0.0438 -0.1249 0.1404  269 TYR B CG  
2187 C CD1 . TYR B 107 ? 0.6946 0.7905 0.3634 -0.0680 -0.1040 0.1468  269 TYR B CD1 
2188 C CD2 . TYR B 107 ? 0.6967 0.7836 0.4196 -0.0139 -0.1476 0.1604  269 TYR B CD2 
2189 C CE1 . TYR B 107 ? 0.7236 0.7698 0.3855 -0.0700 -0.1068 0.1765  269 TYR B CE1 
2190 C CE2 . TYR B 107 ? 0.7375 0.7612 0.4504 -0.0122 -0.1525 0.1869  269 TYR B CE2 
2191 C CZ  . TYR B 107 ? 0.7459 0.7498 0.4279 -0.0441 -0.1326 0.1968  269 TYR B CZ  
2192 O OH  . TYR B 107 ? 0.7925 0.7358 0.4655 -0.0504 -0.1388 0.2256  269 TYR B OH  
2193 N N   . LEU B 108 ? 0.5841 0.7046 0.3262 -0.0700 -0.0559 0.0584  270 LEU B N   
2194 C CA  . LEU B 108 ? 0.5787 0.6889 0.3114 -0.0854 -0.0296 0.0445  270 LEU B CA  
2195 C C   . LEU B 108 ? 0.5522 0.6738 0.3003 -0.0908 -0.0179 0.0100  270 LEU B C   
2196 O O   . LEU B 108 ? 0.5289 0.6520 0.3093 -0.0835 -0.0231 0.0010  270 LEU B O   
2197 C CB  . LEU B 108 ? 0.5629 0.6375 0.3173 -0.0804 -0.0199 0.0545  270 LEU B CB  
2198 C CG  . LEU B 108 ? 0.5954 0.6409 0.3350 -0.0806 -0.0319 0.0896  270 LEU B CG  
2199 C CD1 . LEU B 108 ? 0.5658 0.5748 0.3305 -0.0795 -0.0243 0.0918  270 LEU B CD1 
2200 C CD2 . LEU B 108 ? 0.6238 0.6854 0.3184 -0.1027 -0.0268 0.1087  270 LEU B CD2 
2201 N N   . ASN B 109 ? 0.5741 0.7032 0.2981 -0.1035 -0.0024 -0.0091 271 ASN B N   
2202 C CA  . ASN B 109 ? 0.5673 0.6924 0.3021 -0.1079 0.0064  -0.0431 271 ASN B CA  
2203 C C   . ASN B 109 ? 0.5485 0.6525 0.3076 -0.1019 0.0276  -0.0530 271 ASN B C   
2204 O O   . ASN B 109 ? 0.5329 0.6318 0.3010 -0.0979 0.0355  -0.0342 271 ASN B O   
2205 C CB  . ASN B 109 ? 0.6118 0.7555 0.3045 -0.1209 0.0061  -0.0662 271 ASN B CB  
2206 C CG  . ASN B 109 ? 0.6430 0.7955 0.3076 -0.1227 0.0296  -0.0768 271 ASN B CG  
2207 O OD1 . ASN B 109 ? 0.6354 0.7926 0.3009 -0.1209 0.0408  -0.0538 271 ASN B OD1 
2208 N ND2 . ASN B 109 ? 0.6765 0.8338 0.3161 -0.1275 0.0369  -0.1139 271 ASN B ND2 
2209 N N   . ASP B 110 ? 0.5545 0.6443 0.3253 -0.1023 0.0332  -0.0811 272 ASP B N   
2210 C CA  . ASP B 110 ? 0.5361 0.6064 0.3359 -0.0928 0.0483  -0.0908 272 ASP B CA  
2211 C C   . ASP B 110 ? 0.5431 0.6313 0.3371 -0.0879 0.0691  -0.0893 272 ASP B C   
2212 O O   . ASP B 110 ? 0.5122 0.5991 0.3323 -0.0833 0.0754  -0.0737 272 ASP B O   
2213 C CB  . ASP B 110 ? 0.5634 0.6088 0.3681 -0.0927 0.0476  -0.1226 272 ASP B CB  
2214 C CG  . ASP B 110 ? 0.5705 0.5969 0.3939 -0.1024 0.0292  -0.1187 272 ASP B CG  
2215 O OD1 . ASP B 110 ? 0.5982 0.6406 0.4076 -0.1156 0.0144  -0.1159 272 ASP B OD1 
2216 O OD2 . ASP B 110 ? 0.6143 0.6156 0.4670 -0.0986 0.0289  -0.1167 272 ASP B OD2 
2217 N N   . ASP B 111 ? 0.5851 0.6965 0.3445 -0.0913 0.0799  -0.1065 273 ASP B N   
2218 C CA  . ASP B 111 ? 0.6024 0.7475 0.3567 -0.0892 0.1035  -0.1064 273 ASP B CA  
2219 C C   . ASP B 111 ? 0.5898 0.7523 0.3384 -0.1018 0.1035  -0.0652 273 ASP B C   
2220 O O   . ASP B 111 ? 0.5823 0.7681 0.3465 -0.1039 0.1200  -0.0554 273 ASP B O   
2221 C CB  . ASP B 111 ? 0.6656 0.8403 0.3763 -0.0910 0.1165  -0.1368 273 ASP B CB  
2222 C CG  . ASP B 111 ? 0.7128 0.8669 0.4355 -0.0732 0.1231  -0.1840 273 ASP B CG  
2223 O OD1 . ASP B 111 ? 0.7310 0.8629 0.5001 -0.0570 0.1260  -0.1888 273 ASP B OD1 
2224 O OD2 . ASP B 111 ? 0.7964 0.9531 0.4803 -0.0752 0.1228  -0.2167 273 ASP B OD2 
2225 N N   . GLN B 112 ? 0.5894 0.7404 0.3178 -0.1104 0.0831  -0.0409 274 GLN B N   
2226 C CA  . GLN B 112 ? 0.5947 0.7436 0.3165 -0.1210 0.0760  -0.0003 274 GLN B CA  
2227 C C   . GLN B 112 ? 0.5539 0.6730 0.3194 -0.1149 0.0716  0.0121  274 GLN B C   
2228 O O   . GLN B 112 ? 0.5477 0.6700 0.3212 -0.1253 0.0780  0.0326  274 GLN B O   
2229 C CB  . GLN B 112 ? 0.6169 0.7583 0.3081 -0.1249 0.0513  0.0205  274 GLN B CB  
2230 C CG  . GLN B 112 ? 0.6692 0.8477 0.3055 -0.1388 0.0543  0.0208  274 GLN B CG  
2231 C CD  . GLN B 112 ? 0.6911 0.8699 0.3000 -0.1396 0.0261  0.0341  274 GLN B CD  
2232 O OE1 . GLN B 112 ? 0.6680 0.8260 0.3036 -0.1270 0.0062  0.0359  274 GLN B OE1 
2233 N NE2 . GLN B 112 ? 0.7345 0.9457 0.2903 -0.1546 0.0243  0.0438  274 GLN B NE2 
2234 N N   . VAL B 113 ? 0.5261 0.6204 0.3178 -0.1017 0.0607  -0.0005 275 VAL B N   
2235 C CA  . VAL B 113 ? 0.4979 0.5685 0.3258 -0.0956 0.0566  0.0062  275 VAL B CA  
2236 C C   . VAL B 113 ? 0.4871 0.5710 0.3424 -0.0956 0.0743  -0.0030 275 VAL B C   
2237 O O   . VAL B 113 ? 0.4757 0.5533 0.3499 -0.1008 0.0734  0.0116  275 VAL B O   
2238 C CB  . VAL B 113 ? 0.4716 0.5254 0.3179 -0.0839 0.0435  -0.0048 275 VAL B CB  
2239 C CG1 . VAL B 113 ? 0.4424 0.4781 0.3181 -0.0787 0.0405  0.0000  275 VAL B CG1 
2240 C CG2 . VAL B 113 ? 0.4838 0.5370 0.3136 -0.0804 0.0253  0.0051  275 VAL B CG2 
2241 N N   . LYS B 114 ? 0.4950 0.5974 0.3536 -0.0888 0.0881  -0.0283 276 LYS B N   
2242 C CA  . LYS B 114 ? 0.4962 0.6205 0.3855 -0.0825 0.1045  -0.0388 276 LYS B CA  
2243 C C   . LYS B 114 ? 0.5177 0.6826 0.4046 -0.0969 0.1197  -0.0220 276 LYS B C   
2244 O O   . LYS B 114 ? 0.5083 0.6928 0.4292 -0.0980 0.1262  -0.0166 276 LYS B O   
2245 C CB  . LYS B 114 ? 0.5142 0.6450 0.4049 -0.0668 0.1149  -0.0735 276 LYS B CB  
2246 C CG  . LYS B 114 ? 0.5047 0.5971 0.4202 -0.0540 0.1023  -0.0861 276 LYS B CG  
2247 C CD  . LYS B 114 ? 0.5416 0.6132 0.4384 -0.0479 0.0995  -0.1159 276 LYS B CD  
2248 C CE  . LYS B 114 ? 0.5776 0.6660 0.4792 -0.0301 0.1172  -0.1477 276 LYS B CE  
2249 N NZ  . LYS B 114 ? 0.6304 0.6841 0.5103 -0.0261 0.1097  -0.1803 276 LYS B NZ  
2250 N N   . GLU B 115 ? 0.5564 0.7390 0.4029 -0.1112 0.1238  -0.0111 277 GLU B N   
2251 C CA  . GLU B 115 ? 0.5836 0.8094 0.4210 -0.1326 0.1382  0.0109  277 GLU B CA  
2252 C C   . GLU B 115 ? 0.5784 0.7793 0.4305 -0.1515 0.1240  0.0460  277 GLU B C   
2253 O O   . GLU B 115 ? 0.5866 0.8218 0.4574 -0.1692 0.1346  0.0608  277 GLU B O   
2254 C CB  . GLU B 115 ? 0.6299 0.8757 0.4121 -0.1464 0.1416  0.0196  277 GLU B CB  
2255 C CG  . GLU B 115 ? 0.6746 0.9805 0.4418 -0.1716 0.1621  0.0404  277 GLU B CG  
2256 C CD  . GLU B 115 ? 0.7355 1.0769 0.4430 -0.1828 0.1707  0.0409  277 GLU B CD  
2257 O OE1 . GLU B 115 ? 0.7979 1.1880 0.4824 -0.2105 0.1845  0.0681  277 GLU B OE1 
2258 O OE2 . GLU B 115 ? 0.7752 1.0993 0.4568 -0.1678 0.1627  0.0160  277 GLU B OE2 
2259 N N   . LEU B 116 ? 0.5704 0.7140 0.4153 -0.1477 0.0993  0.0565  278 LEU B N   
2260 C CA  . LEU B 116 ? 0.5697 0.6744 0.4298 -0.1584 0.0820  0.0785  278 LEU B CA  
2261 C C   . LEU B 116 ? 0.5323 0.6453 0.4381 -0.1533 0.0852  0.0659  278 LEU B C   
2262 O O   . LEU B 116 ? 0.5442 0.6574 0.4664 -0.1728 0.0812  0.0826  278 LEU B O   
2263 C CB  . LEU B 116 ? 0.5713 0.6204 0.4186 -0.1439 0.0576  0.0802  278 LEU B CB  
2264 C CG  . LEU B 116 ? 0.5924 0.5879 0.4395 -0.1508 0.0352  0.1010  278 LEU B CG  
2265 C CD1 . LEU B 116 ? 0.6404 0.6230 0.4584 -0.1765 0.0282  0.1371  278 LEU B CD1 
2266 C CD2 . LEU B 116 ? 0.5895 0.5498 0.4334 -0.1249 0.0172  0.0900  278 LEU B CD2 
2267 N N   . LEU B 117 ? 0.4958 0.6143 0.4208 -0.1299 0.0895  0.0388  279 LEU B N   
2268 C CA  . LEU B 117 ? 0.4644 0.5898 0.4302 -0.1224 0.0883  0.0298  279 LEU B CA  
2269 C C   . LEU B 117 ? 0.4641 0.6506 0.4622 -0.1252 0.1073  0.0262  279 LEU B C   
2270 O O   . LEU B 117 ? 0.4565 0.6588 0.4870 -0.1334 0.1028  0.0339  279 LEU B O   
2271 C CB  . LEU B 117 ? 0.4386 0.5431 0.4116 -0.0989 0.0824  0.0086  279 LEU B CB  
2272 C CG  . LEU B 117 ? 0.4328 0.4936 0.3872 -0.0946 0.0646  0.0105  279 LEU B CG  
2273 C CD1 . LEU B 117 ? 0.4017 0.4535 0.3607 -0.0791 0.0618  -0.0068 279 LEU B CD1 
2274 C CD2 . LEU B 117 ? 0.4310 0.4702 0.3950 -0.1015 0.0504  0.0205  279 LEU B CD2 
2275 N N   . THR B 118 ? 0.4759 0.7026 0.4659 -0.1178 0.1279  0.0125  280 THR B N   
2276 C CA  . THR B 118 ? 0.4753 0.7698 0.5014 -0.1102 0.1489  0.0009  280 THR B CA  
2277 C C   . THR B 118 ? 0.4942 0.8474 0.5295 -0.1409 0.1614  0.0251  280 THR B C   
2278 O O   . THR B 118 ? 0.4926 0.9197 0.5620 -0.1358 0.1816  0.0164  280 THR B O   
2279 C CB  . THR B 118 ? 0.4949 0.8134 0.5087 -0.0862 0.1683  -0.0315 280 THR B CB  
2280 O OG1 . THR B 118 ? 0.5330 0.8627 0.4967 -0.1030 0.1777  -0.0254 280 THR B OG1 
2281 C CG2 . THR B 118 ? 0.4719 0.7325 0.4828 -0.0609 0.1542  -0.0542 280 THR B CG2 
2282 N N   . SER B 119 ? 0.5136 0.8359 0.5215 -0.1728 0.1484  0.0560  281 SER B N   
2283 C CA  . SER B 119 ? 0.5372 0.9032 0.5562 -0.2112 0.1536  0.0860  281 SER B CA  
2284 C C   . SER B 119 ? 0.5133 0.8999 0.5863 -0.2173 0.1445  0.0889  281 SER B C   
2285 O O   . SER B 119 ? 0.5320 0.9839 0.6325 -0.2445 0.1543  0.1057  281 SER B O   
2286 C CB  . SER B 119 ? 0.5769 0.8851 0.5521 -0.2435 0.1350  0.1203  281 SER B CB  
2287 O OG  . SER B 119 ? 0.5781 0.8021 0.5479 -0.2348 0.1062  0.1195  281 SER B OG  
2288 N N   . PHE B 120 ? 0.4806 0.8192 0.5679 -0.1945 0.1256  0.0740  282 PHE B N   
2289 C CA  . PHE B 120 ? 0.4590 0.8159 0.5927 -0.1975 0.1128  0.0751  282 PHE B CA  
2290 C C   . PHE B 120 ? 0.4320 0.8490 0.6148 -0.1642 0.1246  0.0533  282 PHE B C   
2291 O O   . PHE B 120 ? 0.4297 0.8849 0.6577 -0.1675 0.1159  0.0576  282 PHE B O   
2292 C CB  . PHE B 120 ? 0.4491 0.7254 0.5665 -0.1936 0.0842  0.0731  282 PHE B CB  
2293 C CG  . PHE B 120 ? 0.4844 0.6968 0.5616 -0.2199 0.0683  0.0910  282 PHE B CG  
2294 C CD1 . PHE B 120 ? 0.4981 0.6552 0.5322 -0.2067 0.0652  0.0879  282 PHE B CD1 
2295 C CD2 . PHE B 120 ? 0.5179 0.7244 0.6022 -0.2582 0.0540  0.1115  282 PHE B CD2 
2296 C CE1 . PHE B 120 ? 0.5412 0.6365 0.5420 -0.2246 0.0478  0.1048  282 PHE B CE1 
2297 C CE2 . PHE B 120 ? 0.5681 0.7022 0.6151 -0.2800 0.0358  0.1276  282 PHE B CE2 
2298 C CZ  . PHE B 120 ? 0.5759 0.6534 0.5820 -0.2599 0.0326  0.1242  282 PHE B CZ  
2299 N N   . GLY B 121 ? 0.4248 0.8471 0.5992 -0.1315 0.1412  0.0295  283 GLY B N   
2300 C CA  . GLY B 121 ? 0.4077 0.8744 0.6277 -0.0934 0.1504  0.0058  283 GLY B CA  
2301 C C   . GLY B 121 ? 0.4046 0.8174 0.6015 -0.0584 0.1503  -0.0209 283 GLY B C   
2302 O O   . GLY B 121 ? 0.3992 0.7462 0.5498 -0.0654 0.1407  -0.0191 283 GLY B O   
2303 N N   . PRO B 122 ? 0.4077 0.8477 0.6394 -0.0203 0.1589  -0.0461 284 PRO B N   
2304 C CA  . PRO B 122 ? 0.4225 0.8045 0.6328 0.0098  0.1564  -0.0730 284 PRO B CA  
2305 C C   . PRO B 122 ? 0.4041 0.7062 0.6044 0.0119  0.1272  -0.0639 284 PRO B C   
2306 O O   . PRO B 122 ? 0.3850 0.6878 0.6112 0.0067  0.1093  -0.0450 284 PRO B O   
2307 C CB  . PRO B 122 ? 0.4437 0.8732 0.7024 0.0520  0.1693  -0.1011 284 PRO B CB  
2308 C CG  . PRO B 122 ? 0.4346 0.9629 0.7421 0.0439  0.1822  -0.0885 284 PRO B CG  
2309 C CD  . PRO B 122 ? 0.4084 0.9339 0.7043 -0.0027 0.1690  -0.0510 284 PRO B CD  
2310 N N   . LEU B 123 ? 0.4139 0.6550 0.5754 0.0166  0.1226  -0.0770 285 LEU B N   
2311 C CA  . LEU B 123 ? 0.4034 0.5769 0.5520 0.0151  0.0983  -0.0684 285 LEU B CA  
2312 C C   . LEU B 123 ? 0.4286 0.5676 0.5983 0.0458  0.0885  -0.0847 285 LEU B C   
2313 O O   . LEU B 123 ? 0.4566 0.6006 0.6318 0.0695  0.1012  -0.1136 285 LEU B O   
2314 C CB  . LEU B 123 ? 0.4048 0.5376 0.5014 -0.0031 0.0965  -0.0691 285 LEU B CB  
2315 C CG  . LEU B 123 ? 0.3883 0.5327 0.4590 -0.0309 0.0984  -0.0496 285 LEU B CG  
2316 C CD1 . LEU B 123 ? 0.4064 0.5199 0.4317 -0.0402 0.0966  -0.0538 285 LEU B CD1 
2317 C CD2 . LEU B 123 ? 0.3525 0.4855 0.4337 -0.0434 0.0810  -0.0277 285 LEU B CD2 
2318 N N   . LYS B 124 ? 0.4224 0.5239 0.6012 0.0451  0.0649  -0.0667 286 LYS B N   
2319 C CA  . LYS B 124 ? 0.4642 0.5124 0.6537 0.0673  0.0492  -0.0747 286 LYS B CA  
2320 C C   . LYS B 124 ? 0.4740 0.4579 0.6224 0.0486  0.0374  -0.0727 286 LYS B C   
2321 O O   . LYS B 124 ? 0.5162 0.4476 0.6631 0.0610  0.0276  -0.0860 286 LYS B O   
2322 C CB  . LYS B 124 ? 0.4701 0.5211 0.7000 0.0810  0.0280  -0.0529 286 LYS B CB  
2323 C CG  . LYS B 124 ? 0.4499 0.4925 0.6655 0.0542  0.0090  -0.0198 286 LYS B CG  
2324 C CD  . LYS B 124 ? 0.4697 0.5239 0.7258 0.0706  -0.0132 0.0010  286 LYS B CD  
2325 C CE  . LYS B 124 ? 0.4499 0.5284 0.6959 0.0439  -0.0269 0.0289  286 LYS B CE  
2326 N NZ  . LYS B 124 ? 0.4433 0.5823 0.7351 0.0538  -0.0354 0.0397  286 LYS B NZ  
2327 N N   . ALA B 125 ? 0.4335 0.4225 0.5513 0.0194  0.0373  -0.0573 287 ALA B N   
2328 C CA  . ALA B 125 ? 0.4392 0.3883 0.5225 -0.0005 0.0289  -0.0549 287 ALA B CA  
2329 C C   . ALA B 125 ? 0.4040 0.3769 0.4566 -0.0201 0.0394  -0.0540 287 ALA B C   
2330 O O   . ALA B 125 ? 0.3682 0.3744 0.4233 -0.0257 0.0452  -0.0434 287 ALA B O   
2331 C CB  . ALA B 125 ? 0.4423 0.3676 0.5274 -0.0129 0.0077  -0.0274 287 ALA B CB  
2332 N N   . PHE B 126 ? 0.4139 0.3671 0.4388 -0.0308 0.0387  -0.0646 288 PHE B N   
2333 C CA  . PHE B 126 ? 0.3940 0.3665 0.3914 -0.0463 0.0432  -0.0611 288 PHE B CA  
2334 C C   . PHE B 126 ? 0.4052 0.3576 0.3817 -0.0614 0.0333  -0.0651 288 PHE B C   
2335 O O   . PHE B 126 ? 0.4361 0.3589 0.4087 -0.0611 0.0288  -0.0815 288 PHE B O   
2336 C CB  . PHE B 126 ? 0.3962 0.3959 0.3806 -0.0417 0.0599  -0.0741 288 PHE B CB  
2337 C CG  . PHE B 126 ? 0.3916 0.4039 0.3459 -0.0554 0.0597  -0.0676 288 PHE B CG  
2338 C CD1 . PHE B 126 ? 0.3782 0.4047 0.3313 -0.0611 0.0586  -0.0483 288 PHE B CD1 
2339 C CD2 . PHE B 126 ? 0.4096 0.4158 0.3378 -0.0620 0.0567  -0.0807 288 PHE B CD2 
2340 C CE1 . PHE B 126 ? 0.3712 0.4028 0.2998 -0.0683 0.0544  -0.0406 288 PHE B CE1 
2341 C CE2 . PHE B 126 ? 0.4102 0.4318 0.3145 -0.0715 0.0525  -0.0715 288 PHE B CE2 
2342 C CZ  . PHE B 126 ? 0.3789 0.4116 0.2849 -0.0723 0.0511  -0.0506 288 PHE B CZ  
2343 N N   . ASN B 127 ? 0.3829 0.3530 0.3483 -0.0740 0.0290  -0.0518 289 ASN B N   
2344 C CA  . ASN B 127 ? 0.3955 0.3675 0.3441 -0.0892 0.0214  -0.0555 289 ASN B CA  
2345 C C   . ASN B 127 ? 0.3736 0.3798 0.3113 -0.0910 0.0216  -0.0469 289 ASN B C   
2346 O O   . ASN B 127 ? 0.3393 0.3587 0.2841 -0.0854 0.0227  -0.0347 289 ASN B O   
2347 C CB  . ASN B 127 ? 0.4116 0.3643 0.3685 -0.1056 0.0082  -0.0468 289 ASN B CB  
2348 C CG  . ASN B 127 ? 0.3958 0.3733 0.3614 -0.1124 0.0052  -0.0244 289 ASN B CG  
2349 O OD1 . ASN B 127 ? 0.3963 0.3729 0.3722 -0.1038 0.0067  -0.0142 289 ASN B OD1 
2350 N ND2 . ASN B 127 ? 0.3811 0.3867 0.3427 -0.1289 0.0004  -0.0180 289 ASN B ND2 
2351 N N   . LEU B 128 ? 0.3851 0.4031 0.3046 -0.0968 0.0184  -0.0552 290 LEU B N   
2352 C CA  . LEU B 128 ? 0.3773 0.4269 0.2899 -0.0955 0.0132  -0.0463 290 LEU B CA  
2353 C C   . LEU B 128 ? 0.3860 0.4585 0.3063 -0.1106 0.0021  -0.0444 290 LEU B C   
2354 O O   . LEU B 128 ? 0.4191 0.4826 0.3336 -0.1275 -0.0047 -0.0544 290 LEU B O   
2355 C CB  . LEU B 128 ? 0.3958 0.4531 0.2831 -0.0926 0.0140  -0.0509 290 LEU B CB  
2356 C CG  . LEU B 128 ? 0.3942 0.4796 0.2731 -0.0878 0.0034  -0.0393 290 LEU B CG  
2357 C CD1 . LEU B 128 ? 0.3807 0.4636 0.2693 -0.0719 0.0035  -0.0242 290 LEU B CD1 
2358 C CD2 . LEU B 128 ? 0.4197 0.5115 0.2668 -0.0913 0.0015  -0.0420 290 LEU B CD2 
2359 N N   . VAL B 129 ? 0.3675 0.4716 0.3017 -0.1057 0.0002  -0.0334 291 VAL B N   
2360 C CA  . VAL B 129 ? 0.3679 0.5119 0.3153 -0.1212 -0.0073 -0.0293 291 VAL B CA  
2361 C C   . VAL B 129 ? 0.3805 0.5619 0.3243 -0.1217 -0.0177 -0.0323 291 VAL B C   
2362 O O   . VAL B 129 ? 0.3712 0.5659 0.3113 -0.1002 -0.0198 -0.0295 291 VAL B O   
2363 C CB  . VAL B 129 ? 0.3447 0.5217 0.3086 -0.1131 -0.0023 -0.0204 291 VAL B CB  
2364 C CG1 . VAL B 129 ? 0.3426 0.5800 0.3234 -0.1307 -0.0068 -0.0152 291 VAL B CG1 
2365 C CG2 . VAL B 129 ? 0.3305 0.4755 0.2948 -0.1168 0.0039  -0.0147 291 VAL B CG2 
2366 N N   . LYS B 130 ? 0.4082 0.6033 0.3529 -0.1480 -0.0277 -0.0363 292 LYS B N   
2367 C CA  . LYS B 130 ? 0.4291 0.6664 0.3713 -0.1542 -0.0417 -0.0390 292 LYS B CA  
2368 C C   . LYS B 130 ? 0.4304 0.7274 0.3992 -0.1787 -0.0503 -0.0324 292 LYS B C   
2369 O O   . LYS B 130 ? 0.4287 0.7178 0.4075 -0.2019 -0.0473 -0.0269 292 LYS B O   
2370 C CB  . LYS B 130 ? 0.4660 0.6656 0.3773 -0.1678 -0.0482 -0.0552 292 LYS B CB  
2371 C CG  . LYS B 130 ? 0.4728 0.6300 0.3591 -0.1462 -0.0364 -0.0606 292 LYS B CG  
2372 C CD  . LYS B 130 ? 0.5332 0.6629 0.3861 -0.1572 -0.0388 -0.0818 292 LYS B CD  
2373 C CE  . LYS B 130 ? 0.5799 0.6541 0.4322 -0.1637 -0.0309 -0.0985 292 LYS B CE  
2374 N NZ  . LYS B 130 ? 0.5520 0.6014 0.4091 -0.1406 -0.0126 -0.0949 292 LYS B NZ  
2375 N N   . ASP B 131 ? 0.4379 0.7998 0.4197 -0.1741 -0.0620 -0.0297 293 ASP B N   
2376 C CA  . ASP B 131 ? 0.4406 0.8772 0.4522 -0.2007 -0.0716 -0.0235 293 ASP B CA  
2377 C C   . ASP B 131 ? 0.4833 0.8959 0.4798 -0.2453 -0.0870 -0.0316 293 ASP B C   
2378 O O   . ASP B 131 ? 0.5073 0.8992 0.4775 -0.2473 -0.0993 -0.0442 293 ASP B O   
2379 C CB  . ASP B 131 ? 0.4358 0.9534 0.4702 -0.1770 -0.0825 -0.0194 293 ASP B CB  
2380 C CG  . ASP B 131 ? 0.4464 1.0620 0.5198 -0.2046 -0.0921 -0.0128 293 ASP B CG  
2381 O OD1 . ASP B 131 ? 0.4669 1.1510 0.5591 -0.1944 -0.1084 -0.0109 293 ASP B OD1 
2382 O OD2 . ASP B 131 ? 0.4723 1.1013 0.5590 -0.2381 -0.0847 -0.0065 293 ASP B OD2 
2383 N N   . SER B 132 ? 0.4988 0.9134 0.5092 -0.2831 -0.0878 -0.0242 294 SER B N   
2384 C CA  . SER B 132 ? 0.5519 0.9240 0.5473 -0.3294 -0.1048 -0.0326 294 SER B CA  
2385 C C   . SER B 132 ? 0.5786 1.0043 0.5761 -0.3533 -0.1281 -0.0404 294 SER B C   
2386 O O   . SER B 132 ? 0.6301 1.0053 0.6004 -0.3806 -0.1444 -0.0585 294 SER B O   
2387 C CB  . SER B 132 ? 0.5702 0.9414 0.5838 -0.3697 -0.1045 -0.0141 294 SER B CB  
2388 O OG  . SER B 132 ? 0.5521 1.0328 0.6034 -0.3917 -0.1075 0.0032  294 SER B OG  
2389 N N   . ALA B 133 ? 0.5500 1.0793 0.5806 -0.3414 -0.1310 -0.0288 295 ALA B N   
2390 C CA  . ALA B 133 ? 0.5746 1.1762 0.6170 -0.3646 -0.1559 -0.0313 295 ALA B CA  
2391 C C   . ALA B 133 ? 0.5904 1.1741 0.5979 -0.3401 -0.1687 -0.0461 295 ALA B C   
2392 O O   . ALA B 133 ? 0.6346 1.2252 0.6240 -0.3705 -0.1925 -0.0584 295 ALA B O   
2393 C CB  . ALA B 133 ? 0.5411 1.2716 0.6393 -0.3554 -0.1542 -0.0129 295 ALA B CB  
2394 N N   . THR B 134 ? 0.5588 1.1215 0.5545 -0.2891 -0.1546 -0.0434 296 THR B N   
2395 C CA  . THR B 134 ? 0.5764 1.1286 0.5374 -0.2652 -0.1657 -0.0489 296 THR B CA  
2396 C C   . THR B 134 ? 0.5910 1.0443 0.5010 -0.2531 -0.1514 -0.0636 296 THR B C   
2397 O O   . THR B 134 ? 0.6181 1.0589 0.4890 -0.2444 -0.1596 -0.0698 296 THR B O   
2398 C CB  . THR B 134 ? 0.5460 1.1539 0.5320 -0.2163 -0.1657 -0.0302 296 THR B CB  
2399 O OG1 . THR B 134 ? 0.5147 1.0781 0.5054 -0.1834 -0.1405 -0.0253 296 THR B OG1 
2400 C CG2 . THR B 134 ? 0.5302 1.2516 0.5738 -0.2195 -0.1779 -0.0184 296 THR B CG2 
2401 N N   . GLY B 135 ? 0.5755 0.9672 0.4866 -0.2523 -0.1305 -0.0674 297 GLY B N   
2402 C CA  . GLY B 135 ? 0.5849 0.8954 0.4586 -0.2366 -0.1143 -0.0807 297 GLY B CA  
2403 C C   . GLY B 135 ? 0.5543 0.8618 0.4225 -0.1948 -0.1014 -0.0667 297 GLY B C   
2404 O O   . GLY B 135 ? 0.5663 0.8277 0.4013 -0.1831 -0.0906 -0.0745 297 GLY B O   
2405 N N   . LEU B 136 ? 0.5207 0.8776 0.4226 -0.1731 -0.1025 -0.0471 298 LEU B N   
2406 C CA  . LEU B 136 ? 0.5020 0.8557 0.4001 -0.1353 -0.0988 -0.0323 298 LEU B CA  
2407 C C   . LEU B 136 ? 0.4622 0.7845 0.3781 -0.1148 -0.0783 -0.0276 298 LEU B C   
2408 O O   . LEU B 136 ? 0.4357 0.7817 0.3831 -0.1186 -0.0720 -0.0270 298 LEU B O   
2409 C CB  . LEU B 136 ? 0.5059 0.9325 0.4298 -0.1184 -0.1188 -0.0177 298 LEU B CB  
2410 C CG  . LEU B 136 ? 0.5232 0.9474 0.4431 -0.0789 -0.1266 0.0009  298 LEU B CG  
2411 C CD1 . LEU B 136 ? 0.5653 0.9203 0.4381 -0.0752 -0.1183 0.0054  298 LEU B CD1 
2412 C CD2 . LEU B 136 ? 0.5410 1.0332 0.4699 -0.0729 -0.1561 0.0125  298 LEU B CD2 
2413 N N   . SER B 137 ? 0.4563 0.7311 0.3501 -0.0966 -0.0690 -0.0230 299 SER B N   
2414 C CA  . SER B 137 ? 0.4258 0.6676 0.3317 -0.0790 -0.0529 -0.0193 299 SER B CA  
2415 C C   . SER B 137 ? 0.4007 0.6793 0.3412 -0.0558 -0.0551 -0.0134 299 SER B C   
2416 O O   . SER B 137 ? 0.4073 0.7187 0.3578 -0.0349 -0.0695 -0.0054 299 SER B O   
2417 C CB  . SER B 137 ? 0.4395 0.6368 0.3182 -0.0660 -0.0483 -0.0107 299 SER B CB  
2418 O OG  . SER B 137 ? 0.4122 0.5785 0.3029 -0.0525 -0.0363 -0.0079 299 SER B OG  
2419 N N   . LYS B 138 ? 0.3726 0.6474 0.3302 -0.0576 -0.0412 -0.0183 300 LYS B N   
2420 C CA  . LYS B 138 ? 0.3582 0.6655 0.3423 -0.0335 -0.0381 -0.0190 300 LYS B CA  
2421 C C   . LYS B 138 ? 0.3634 0.6194 0.3371 -0.0065 -0.0349 -0.0180 300 LYS B C   
2422 O O   . LYS B 138 ? 0.3675 0.6367 0.3570 0.0190  -0.0337 -0.0240 300 LYS B O   
2423 C CB  . LYS B 138 ? 0.3365 0.6695 0.3369 -0.0523 -0.0255 -0.0230 300 LYS B CB  
2424 C CG  . LYS B 138 ? 0.3329 0.7198 0.3481 -0.0836 -0.0312 -0.0209 300 LYS B CG  
2425 C CD  . LYS B 138 ? 0.3206 0.7467 0.3539 -0.1020 -0.0200 -0.0179 300 LYS B CD  
2426 C CE  . LYS B 138 ? 0.3330 0.8102 0.3816 -0.1419 -0.0282 -0.0115 300 LYS B CE  
2427 N NZ  . LYS B 138 ? 0.3129 0.8486 0.3816 -0.1627 -0.0178 -0.0026 300 LYS B NZ  
2428 N N   . GLY B 139 ? 0.3732 0.5729 0.3201 -0.0138 -0.0336 -0.0123 301 GLY B N   
2429 C CA  . GLY B 139 ? 0.3894 0.5389 0.3250 0.0037  -0.0347 -0.0068 301 GLY B CA  
2430 C C   . GLY B 139 ? 0.3718 0.4887 0.3076 -0.0009 -0.0215 -0.0131 301 GLY B C   
2431 O O   . GLY B 139 ? 0.3894 0.4691 0.3205 0.0126  -0.0246 -0.0118 301 GLY B O   
2432 N N   . TYR B 140 ? 0.3462 0.4733 0.2866 -0.0212 -0.0101 -0.0186 302 TYR B N   
2433 C CA  . TYR B 140 ? 0.3378 0.4372 0.2776 -0.0277 -0.0006 -0.0210 302 TYR B CA  
2434 C C   . TYR B 140 ? 0.3285 0.4190 0.2667 -0.0498 0.0071  -0.0205 302 TYR B C   
2435 O O   . TYR B 140 ? 0.3267 0.4329 0.2653 -0.0627 0.0058  -0.0224 302 TYR B O   
2436 C CB  . TYR B 140 ? 0.3303 0.4523 0.2819 -0.0181 0.0023  -0.0298 302 TYR B CB  
2437 C CG  . TYR B 140 ? 0.3105 0.4899 0.2766 -0.0263 0.0055  -0.0320 302 TYR B CG  
2438 C CD1 . TYR B 140 ? 0.3013 0.4878 0.2691 -0.0511 0.0114  -0.0267 302 TYR B CD1 
2439 C CD2 . TYR B 140 ? 0.3103 0.5391 0.2907 -0.0101 0.0012  -0.0370 302 TYR B CD2 
2440 C CE1 . TYR B 140 ? 0.3007 0.5400 0.2804 -0.0662 0.0133  -0.0234 302 TYR B CE1 
2441 C CE2 . TYR B 140 ? 0.3184 0.6127 0.3157 -0.0227 0.0054  -0.0368 302 TYR B CE2 
2442 C CZ  . TYR B 140 ? 0.2987 0.5965 0.2936 -0.0542 0.0116  -0.0285 302 TYR B CZ  
2443 O OH  . TYR B 140 ? 0.2913 0.6533 0.3016 -0.0742 0.0146  -0.0231 302 TYR B OH  
2444 N N   . ALA B 141 ? 0.3297 0.3934 0.2679 -0.0531 0.0129  -0.0192 303 ALA B N   
2445 C CA  . ALA B 141 ? 0.3325 0.3818 0.2732 -0.0654 0.0190  -0.0198 303 ALA B CA  
2446 C C   . ALA B 141 ? 0.3271 0.3676 0.2789 -0.0672 0.0209  -0.0167 303 ALA B C   
2447 O O   . ALA B 141 ? 0.3192 0.3612 0.2710 -0.0614 0.0185  -0.0161 303 ALA B O   
2448 C CB  . ALA B 141 ? 0.3371 0.3720 0.2667 -0.0656 0.0238  -0.0196 303 ALA B CB  
2449 N N   . PHE B 142 ? 0.3349 0.3647 0.2954 -0.0736 0.0231  -0.0163 304 PHE B N   
2450 C CA  . PHE B 142 ? 0.3415 0.3652 0.3150 -0.0741 0.0215  -0.0100 304 PHE B CA  
2451 C C   . PHE B 142 ? 0.3527 0.3646 0.3388 -0.0694 0.0266  -0.0131 304 PHE B C   
2452 O O   . PHE B 142 ? 0.3672 0.3718 0.3495 -0.0678 0.0312  -0.0229 304 PHE B O   
2453 C CB  . PHE B 142 ? 0.3343 0.3615 0.3109 -0.0841 0.0150  -0.0016 304 PHE B CB  
2454 C CG  . PHE B 142 ? 0.3246 0.3811 0.2918 -0.0890 0.0138  0.0000  304 PHE B CG  
2455 C CD1 . PHE B 142 ? 0.3177 0.3922 0.2801 -0.0885 0.0123  0.0035  304 PHE B CD1 
2456 C CD2 . PHE B 142 ? 0.3328 0.4069 0.2966 -0.0938 0.0143  -0.0039 304 PHE B CD2 
2457 C CE1 . PHE B 142 ? 0.3162 0.4282 0.2707 -0.0891 0.0147  0.0002  304 PHE B CE1 
2458 C CE2 . PHE B 142 ? 0.3200 0.4359 0.2822 -0.0951 0.0151  -0.0038 304 PHE B CE2 
2459 C CZ  . PHE B 142 ? 0.3266 0.4627 0.2843 -0.0911 0.0171  -0.0030 304 PHE B CZ  
2460 N N   . CYS B 143 ? 0.3593 0.3755 0.3607 -0.0664 0.0257  -0.0075 305 CYS B N   
2461 C CA  . CYS B 143 ? 0.3770 0.3961 0.4001 -0.0579 0.0312  -0.0111 305 CYS B CA  
2462 C C   . CYS B 143 ? 0.3793 0.4091 0.4276 -0.0548 0.0232  -0.0007 305 CYS B C   
2463 O O   . CYS B 143 ? 0.3833 0.4172 0.4263 -0.0626 0.0134  0.0089  305 CYS B O   
2464 C CB  . CYS B 143 ? 0.3838 0.4181 0.4025 -0.0577 0.0442  -0.0170 305 CYS B CB  
2465 S SG  . CYS B 143 ? 0.4115 0.4605 0.4333 -0.0689 0.0425  -0.0049 305 CYS B SG  
2466 N N   . GLU B 144 ? 0.3898 0.4284 0.4656 -0.0414 0.0266  -0.0047 306 GLU B N   
2467 C CA  . GLU B 144 ? 0.3911 0.4519 0.4989 -0.0354 0.0179  0.0058  306 GLU B CA  
2468 C C   . GLU B 144 ? 0.3854 0.4814 0.5243 -0.0220 0.0314  -0.0039 306 GLU B C   
2469 O O   . GLU B 144 ? 0.3967 0.4868 0.5407 -0.0057 0.0417  -0.0204 306 GLU B O   
2470 C CB  . GLU B 144 ? 0.4117 0.4501 0.5311 -0.0264 0.0011  0.0165  306 GLU B CB  
2471 C CG  . GLU B 144 ? 0.4370 0.4737 0.5403 -0.0419 -0.0155 0.0358  306 GLU B CG  
2472 C CD  . GLU B 144 ? 0.4655 0.4974 0.5891 -0.0340 -0.0362 0.0559  306 GLU B CD  
2473 O OE1 . GLU B 144 ? 0.5047 0.5617 0.6643 -0.0193 -0.0417 0.0590  306 GLU B OE1 
2474 O OE2 . GLU B 144 ? 0.5438 0.5517 0.6483 -0.0440 -0.0484 0.0717  306 GLU B OE2 
2475 N N   . TYR B 145 ? 0.3670 0.5035 0.5265 -0.0303 0.0311  0.0046  307 TYR B N   
2476 C CA  . TYR B 145 ? 0.3691 0.5582 0.5642 -0.0213 0.0455  -0.0017 307 TYR B CA  
2477 C C   . TYR B 145 ? 0.3804 0.5902 0.6228 0.0076  0.0381  -0.0033 307 TYR B C   
2478 O O   . TYR B 145 ? 0.3823 0.5734 0.6326 0.0119  0.0161  0.0105  307 TYR B O   
2479 C CB  . TYR B 145 ? 0.3555 0.5834 0.5580 -0.0475 0.0457  0.0111  307 TYR B CB  
2480 C CG  . TYR B 145 ? 0.3552 0.5643 0.5179 -0.0704 0.0551  0.0122  307 TYR B CG  
2481 C CD1 . TYR B 145 ? 0.3620 0.6001 0.5210 -0.0743 0.0766  0.0076  307 TYR B CD1 
2482 C CD2 . TYR B 145 ? 0.3540 0.5179 0.4815 -0.0856 0.0419  0.0179  307 TYR B CD2 
2483 C CE1 . TYR B 145 ? 0.3732 0.5902 0.4934 -0.0952 0.0810  0.0145  307 TYR B CE1 
2484 C CE2 . TYR B 145 ? 0.3663 0.5071 0.4602 -0.1010 0.0464  0.0205  307 TYR B CE2 
2485 C CZ  . TYR B 145 ? 0.3725 0.5370 0.4625 -0.1068 0.0642  0.0216  307 TYR B CZ  
2486 O OH  . TYR B 145 ? 0.3912 0.5302 0.4465 -0.1223 0.0646  0.0300  307 TYR B OH  
2487 N N   . VAL B 146 ? 0.3930 0.6436 0.6656 0.0291  0.0560  -0.0201 308 VAL B N   
2488 C CA  . VAL B 146 ? 0.4141 0.6904 0.7399 0.0651  0.0498  -0.0257 308 VAL B CA  
2489 C C   . VAL B 146 ? 0.4019 0.7313 0.7693 0.0584  0.0329  -0.0030 308 VAL B C   
2490 O O   . VAL B 146 ? 0.4160 0.7361 0.8096 0.0775  0.0096  0.0085  308 VAL B O   
2491 C CB  . VAL B 146 ? 0.4334 0.7583 0.7844 0.0919  0.0774  -0.0546 308 VAL B CB  
2492 C CG1 . VAL B 146 ? 0.4551 0.8225 0.8729 0.1344  0.0710  -0.0613 308 VAL B CG1 
2493 C CG2 . VAL B 146 ? 0.4602 0.7269 0.7698 0.1024  0.0881  -0.0811 308 VAL B CG2 
2494 N N   . ASP B 147 ? 0.3832 0.7663 0.7549 0.0288  0.0418  0.0053  309 ASP B N   
2495 C CA  . ASP B 147 ? 0.3741 0.8060 0.7772 0.0108  0.0232  0.0262  309 ASP B CA  
2496 C C   . ASP B 147 ? 0.3662 0.7476 0.7193 -0.0253 0.0060  0.0403  309 ASP B C   
2497 O O   . ASP B 147 ? 0.3578 0.7213 0.6751 -0.0527 0.0167  0.0386  309 ASP B O   
2498 C CB  . ASP B 147 ? 0.3697 0.8917 0.8088 -0.0055 0.0422  0.0265  309 ASP B CB  
2499 C CG  . ASP B 147 ? 0.3619 0.9418 0.8375 -0.0299 0.0213  0.0473  309 ASP B CG  
2500 O OD1 . ASP B 147 ? 0.3674 0.9281 0.8473 -0.0256 -0.0083 0.0594  309 ASP B OD1 
2501 O OD2 . ASP B 147 ? 0.3699 1.0186 0.8686 -0.0571 0.0336  0.0530  309 ASP B OD2 
2502 N N   . ILE B 148 ? 0.3772 0.7364 0.7266 -0.0238 -0.0213 0.0537  310 ILE B N   
2503 C CA  . ILE B 148 ? 0.3817 0.6952 0.6798 -0.0524 -0.0361 0.0608  310 ILE B CA  
2504 C C   . ILE B 148 ? 0.3809 0.7206 0.6747 -0.0895 -0.0419 0.0648  310 ILE B C   
2505 O O   . ILE B 148 ? 0.3844 0.6809 0.6320 -0.1114 -0.0482 0.0620  310 ILE B O   
2506 C CB  . ILE B 148 ? 0.4006 0.6925 0.6896 -0.0450 -0.0636 0.0759  310 ILE B CB  
2507 C CG1 . ILE B 148 ? 0.4111 0.7635 0.7459 -0.0435 -0.0871 0.0919  310 ILE B CG1 
2508 C CG2 . ILE B 148 ? 0.4154 0.6651 0.7030 -0.0154 -0.0620 0.0754  310 ILE B CG2 
2509 C CD1 . ILE B 148 ? 0.4388 0.7756 0.7738 -0.0271 -0.1147 0.1121  310 ILE B CD1 
2510 N N   . ASN B 149 ? 0.3826 0.7931 0.7260 -0.0966 -0.0403 0.0700  311 ASN B N   
2511 C CA  . ASN B 149 ? 0.3944 0.8302 0.7385 -0.1382 -0.0483 0.0759  311 ASN B CA  
2512 C C   . ASN B 149 ? 0.4008 0.8067 0.7130 -0.1626 -0.0290 0.0711  311 ASN B C   
2513 O O   . ASN B 149 ? 0.4274 0.8307 0.7301 -0.2007 -0.0386 0.0766  311 ASN B O   
2514 C CB  . ASN B 149 ? 0.3966 0.9303 0.8101 -0.1422 -0.0523 0.0861  311 ASN B CB  
2515 C CG  . ASN B 149 ? 0.4066 0.9740 0.8551 -0.1198 -0.0786 0.0959  311 ASN B CG  
2516 O OD1 . ASN B 149 ? 0.4452 0.9708 0.8590 -0.1242 -0.1026 0.1003  311 ASN B OD1 
2517 N ND2 . ASN B 149 ? 0.4082 1.0560 0.9255 -0.0943 -0.0745 0.0997  311 ASN B ND2 
2518 N N   . VAL B 150 ? 0.3898 0.7715 0.6852 -0.1420 -0.0051 0.0621  312 VAL B N   
2519 C CA  . VAL B 150 ? 0.4014 0.7516 0.6612 -0.1601 0.0119  0.0607  312 VAL B CA  
2520 C C   . VAL B 150 ? 0.4098 0.6737 0.6106 -0.1633 0.0024  0.0545  312 VAL B C   
2521 O O   . VAL B 150 ? 0.4226 0.6510 0.5922 -0.1813 0.0066  0.0569  312 VAL B O   
2522 C CB  . VAL B 150 ? 0.3941 0.7673 0.6611 -0.1350 0.0414  0.0514  312 VAL B CB  
2523 C CG1 . VAL B 150 ? 0.4117 0.7373 0.6284 -0.1458 0.0541  0.0501  312 VAL B CG1 
2524 C CG2 . VAL B 150 ? 0.3975 0.8667 0.7187 -0.1374 0.0577  0.0555  312 VAL B CG2 
2525 N N   . THR B 151 ? 0.4015 0.6371 0.5889 -0.1456 -0.0110 0.0483  313 THR B N   
2526 C CA  . THR B 151 ? 0.4068 0.5781 0.5449 -0.1426 -0.0166 0.0395  313 THR B CA  
2527 C C   . THR B 151 ? 0.4341 0.5671 0.5424 -0.1689 -0.0287 0.0371  313 THR B C   
2528 O O   . THR B 151 ? 0.4374 0.5246 0.5131 -0.1674 -0.0241 0.0318  313 THR B O   
2529 C CB  . THR B 151 ? 0.4046 0.5690 0.5358 -0.1283 -0.0312 0.0381  313 THR B CB  
2530 O OG1 . THR B 151 ? 0.3913 0.5755 0.5494 -0.1033 -0.0247 0.0419  313 THR B OG1 
2531 C CG2 . THR B 151 ? 0.4093 0.5247 0.4936 -0.1243 -0.0323 0.0278  313 THR B CG2 
2532 N N   . ASP B 152 ? 0.4523 0.6019 0.5730 -0.1919 -0.0470 0.0404  314 ASP B N   
2533 C CA  . ASP B 152 ? 0.4976 0.5998 0.5888 -0.2177 -0.0635 0.0338  314 ASP B CA  
2534 C C   . ASP B 152 ? 0.5213 0.6099 0.6144 -0.2433 -0.0578 0.0462  314 ASP B C   
2535 O O   . ASP B 152 ? 0.5619 0.5873 0.6229 -0.2567 -0.0692 0.0414  314 ASP B O   
2536 C CB  . ASP B 152 ? 0.5188 0.6403 0.6175 -0.2379 -0.0887 0.0306  314 ASP B CB  
2537 C CG  . ASP B 152 ? 0.5306 0.6439 0.6032 -0.2191 -0.0990 0.0172  314 ASP B CG  
2538 O OD1 . ASP B 152 ? 0.5566 0.6190 0.5866 -0.2087 -0.0988 -0.0005 314 ASP B OD1 
2539 O OD2 . ASP B 152 ? 0.5220 0.6837 0.6169 -0.2142 -0.1077 0.0257  314 ASP B OD2 
2540 N N   . GLN B 153 ? 0.5004 0.6482 0.6299 -0.2487 -0.0406 0.0622  315 GLN B N   
2541 C CA  . GLN B 153 ? 0.5263 0.6734 0.6541 -0.2742 -0.0301 0.0795  315 GLN B CA  
2542 C C   . GLN B 153 ? 0.5276 0.6211 0.6156 -0.2553 -0.0189 0.0771  315 GLN B C   
2543 O O   . GLN B 153 ? 0.5708 0.6157 0.6325 -0.2749 -0.0251 0.0882  315 GLN B O   
2544 C CB  . GLN B 153 ? 0.5080 0.7482 0.6830 -0.2789 -0.0083 0.0932  315 GLN B CB  
2545 C CG  . GLN B 153 ? 0.5034 0.8225 0.7330 -0.2842 -0.0158 0.0952  315 GLN B CG  
2546 C CD  . GLN B 153 ? 0.5601 0.8888 0.8028 -0.3334 -0.0384 0.1077  315 GLN B CD  
2547 O OE1 . GLN B 153 ? 0.6386 0.9024 0.8468 -0.3647 -0.0506 0.1139  315 GLN B OE1 
2548 N NE2 . GLN B 153 ? 0.5416 0.9503 0.8361 -0.3410 -0.0469 0.1119  315 GLN B NE2 
2549 N N   . ALA B 154 ? 0.4850 0.5859 0.5692 -0.2187 -0.0054 0.0646  316 ALA B N   
2550 C CA  . ALA B 154 ? 0.4809 0.5425 0.5313 -0.2000 0.0035  0.0611  316 ALA B CA  
2551 C C   . ALA B 154 ? 0.5046 0.4932 0.5190 -0.1941 -0.0148 0.0512  316 ALA B C   
2552 O O   . ALA B 154 ? 0.5376 0.4845 0.5259 -0.1947 -0.0171 0.0579  316 ALA B O   
2553 C CB  . ALA B 154 ? 0.4398 0.5271 0.4977 -0.1676 0.0189  0.0487  316 ALA B CB  
2554 N N   . ILE B 155 ? 0.4935 0.4706 0.5060 -0.1862 -0.0283 0.0349  317 ILE B N   
2555 C CA  . ILE B 155 ? 0.5246 0.4415 0.5050 -0.1771 -0.0443 0.0186  317 ILE B CA  
2556 C C   . ILE B 155 ? 0.5878 0.4488 0.5537 -0.2023 -0.0619 0.0253  317 ILE B C   
2557 O O   . ILE B 155 ? 0.6260 0.4300 0.5665 -0.1914 -0.0695 0.0223  317 ILE B O   
2558 C CB  . ILE B 155 ? 0.5198 0.4461 0.4973 -0.1702 -0.0551 -0.0007 317 ILE B CB  
2559 C CG1 . ILE B 155 ? 0.4701 0.4346 0.4538 -0.1459 -0.0418 -0.0039 317 ILE B CG1 
2560 C CG2 . ILE B 155 ? 0.5680 0.4367 0.5118 -0.1626 -0.0712 -0.0238 317 ILE B CG2 
2561 C CD1 . ILE B 155 ? 0.4636 0.4468 0.4419 -0.1436 -0.0520 -0.0147 317 ILE B CD1 
2562 N N   . ALA B 156 ? 0.6035 0.4801 0.5877 -0.2369 -0.0709 0.0360  318 ALA B N   
2563 C CA  . ALA B 156 ? 0.6732 0.4926 0.6451 -0.2701 -0.0907 0.0465  318 ALA B CA  
2564 C C   . ALA B 156 ? 0.6960 0.4946 0.6577 -0.2796 -0.0833 0.0745  318 ALA B C   
2565 O O   . ALA B 156 ? 0.7579 0.4786 0.6940 -0.2881 -0.1019 0.0808  318 ALA B O   
2566 C CB  . ALA B 156 ? 0.6837 0.5415 0.6837 -0.3114 -0.1006 0.0563  318 ALA B CB  
2567 N N   . GLY B 157 ? 0.6489 0.5146 0.6280 -0.2767 -0.0579 0.0904  319 GLY B N   
2568 C CA  . GLY B 157 ? 0.6762 0.5374 0.6407 -0.2878 -0.0485 0.1181  319 GLY B CA  
2569 C C   . GLY B 157 ? 0.6775 0.4972 0.6112 -0.2534 -0.0481 0.1136  319 GLY B C   
2570 O O   . GLY B 157 ? 0.7257 0.5021 0.6352 -0.2636 -0.0569 0.1363  319 GLY B O   
2571 N N   . LEU B 158 ? 0.6322 0.4676 0.5677 -0.2153 -0.0399 0.0876  320 LEU B N   
2572 C CA  . LEU B 158 ? 0.6343 0.4505 0.5483 -0.1834 -0.0380 0.0827  320 LEU B CA  
2573 C C   . LEU B 158 ? 0.6643 0.4206 0.5628 -0.1564 -0.0572 0.0619  320 LEU B C   
2574 O O   . LEU B 158 ? 0.6876 0.4120 0.5686 -0.1373 -0.0649 0.0664  320 LEU B O   
2575 C CB  . LEU B 158 ? 0.5715 0.4483 0.4976 -0.1613 -0.0160 0.0693  320 LEU B CB  
2576 C CG  . LEU B 158 ? 0.5585 0.4941 0.4931 -0.1730 0.0062  0.0822  320 LEU B CG  
2577 C CD1 . LEU B 158 ? 0.4988 0.4749 0.4454 -0.1483 0.0219  0.0619  320 LEU B CD1 
2578 C CD2 . LEU B 158 ? 0.6081 0.5317 0.5141 -0.1829 0.0066  0.1058  320 LEU B CD2 
2579 N N   . ASN B 159 ? 0.6668 0.4151 0.5718 -0.1523 -0.0648 0.0378  321 ASN B N   
2580 C CA  . ASN B 159 ? 0.6964 0.4038 0.5870 -0.1215 -0.0779 0.0102  321 ASN B CA  
2581 C C   . ASN B 159 ? 0.7865 0.4080 0.6572 -0.1197 -0.1025 0.0148  321 ASN B C   
2582 O O   . ASN B 159 ? 0.8410 0.4159 0.7071 -0.1507 -0.1190 0.0249  321 ASN B O   
2583 C CB  . ASN B 159 ? 0.6844 0.4047 0.5788 -0.1221 -0.0813 -0.0168 321 ASN B CB  
2584 C CG  . ASN B 159 ? 0.7007 0.3999 0.5792 -0.0873 -0.0879 -0.0501 321 ASN B CG  
2585 O OD1 . ASN B 159 ? 0.6578 0.3750 0.5358 -0.0576 -0.0793 -0.0553 321 ASN B OD1 
2586 N ND2 . ASN B 159 ? 0.7414 0.4095 0.6073 -0.0915 -0.1030 -0.0751 321 ASN B ND2 
2587 N N   . GLY B 160 ? 0.8105 0.4106 0.6717 -0.0842 -0.1075 0.0090  322 GLY B N   
2588 C CA  . GLY B 160 ? 0.9063 0.4185 0.7508 -0.0727 -0.1344 0.0138  322 GLY B CA  
2589 C C   . GLY B 160 ? 0.9478 0.4352 0.7821 -0.0923 -0.1418 0.0588  322 GLY B C   
2590 O O   . GLY B 160 ? 1.0313 0.4392 0.8506 -0.0842 -0.1679 0.0709  322 GLY B O   
2591 N N   . MET B 161 ? 0.9034 0.4573 0.7433 -0.1169 -0.1202 0.0832  323 MET B N   
2592 C CA  . MET B 161 ? 0.9376 0.4868 0.7621 -0.1386 -0.1225 0.1264  323 MET B CA  
2593 C C   . MET B 161 ? 0.9550 0.4913 0.7674 -0.1015 -0.1329 0.1325  323 MET B C   
2594 O O   . MET B 161 ? 0.8928 0.4797 0.7161 -0.0696 -0.1205 0.1100  323 MET B O   
2595 C CB  . MET B 161 ? 0.8730 0.5114 0.7065 -0.1642 -0.0921 0.1392  323 MET B CB  
2596 C CG  . MET B 161 ? 0.9096 0.5650 0.7214 -0.1880 -0.0880 0.1807  323 MET B CG  
2597 S SD  . MET B 161 ? 0.8592 0.6271 0.6796 -0.2008 -0.0488 0.1796  323 MET B SD  
2598 C CE  . MET B 161 ? 0.8845 0.6753 0.7139 -0.2564 -0.0406 0.2072  323 MET B CE  
2599 N N   . GLN B 162 ? 1.0428 0.5119 0.8340 -0.1080 -0.1584 0.1660  324 GLN B N   
2600 C CA  . GLN B 162 ? 1.0677 0.5290 0.8469 -0.0772 -0.1726 0.1821  324 GLN B CA  
2601 C C   . GLN B 162 ? 1.0197 0.5621 0.7874 -0.0958 -0.1508 0.2050  324 GLN B C   
2602 O O   . GLN B 162 ? 1.0365 0.5917 0.7873 -0.1391 -0.1432 0.2373  324 GLN B O   
2603 C CB  . GLN B 162 ? 1.1863 0.5434 0.9441 -0.0813 -0.2107 0.2170  324 GLN B CB  
2604 C CG  . GLN B 162 ? 1.2349 0.5801 0.9791 -0.0509 -0.2320 0.2433  324 GLN B CG  
2605 C CD  . GLN B 162 ? 1.2527 0.5800 1.0189 0.0147  -0.2478 0.2077  324 GLN B CD  
2606 O OE1 . GLN B 162 ? 1.1923 0.5730 0.9837 0.0401  -0.2275 0.1616  324 GLN B OE1 
2607 N NE2 . GLN B 162 ? 1.3519 0.6088 1.1098 0.0429  -0.2846 0.2312  324 GLN B NE2 
2608 N N   . LEU B 163 ? 0.9632 0.5643 0.7396 -0.0646 -0.1406 0.1859  325 LEU B N   
2609 C CA  . LEU B 163 ? 0.9225 0.5993 0.6861 -0.0784 -0.1210 0.1968  325 LEU B CA  
2610 C C   . LEU B 163 ? 0.9535 0.6341 0.7032 -0.0526 -0.1413 0.2128  325 LEU B C   
2611 O O   . LEU B 163 ? 0.9123 0.6341 0.6794 -0.0214 -0.1394 0.1881  325 LEU B O   
2612 C CB  . LEU B 163 ? 0.8310 0.5778 0.6182 -0.0724 -0.0916 0.1583  325 LEU B CB  
2613 C CG  . LEU B 163 ? 0.7892 0.6043 0.5654 -0.0964 -0.0656 0.1610  325 LEU B CG  
2614 C CD1 . LEU B 163 ? 0.8067 0.6230 0.5740 -0.1365 -0.0538 0.1824  325 LEU B CD1 
2615 C CD2 . LEU B 163 ? 0.7138 0.5788 0.5149 -0.0845 -0.0445 0.1235  325 LEU B CD2 
2616 N N   . GLY B 164 ? 1.0341 0.6738 0.7530 -0.0683 -0.1631 0.2578  326 GLY B N   
2617 C CA  . GLY B 164 ? 1.0826 0.7159 0.7872 -0.0432 -0.1907 0.2810  326 GLY B CA  
2618 C C   . GLY B 164 ? 1.1218 0.6952 0.8525 0.0064  -0.2197 0.2668  326 GLY B C   
2619 O O   . GLY B 164 ? 1.1975 0.6801 0.9246 0.0080  -0.2433 0.2815  326 GLY B O   
2620 N N   . ASP B 165 ? 1.0763 0.7030 0.8346 0.0463  -0.2175 0.2359  327 ASP B N   
2621 C CA  . ASP B 165 ? 1.1072 0.7024 0.8959 0.1014  -0.2413 0.2167  327 ASP B CA  
2622 C C   . ASP B 165 ? 1.0604 0.6572 0.8809 0.1192  -0.2224 0.1654  327 ASP B C   
2623 O O   . ASP B 165 ? 1.0953 0.6593 0.9389 0.1642  -0.2380 0.1419  327 ASP B O   
2624 C CB  . ASP B 165 ? 1.0853 0.7571 0.8896 0.1325  -0.2495 0.2144  327 ASP B CB  
2625 C CG  . ASP B 165 ? 1.1552 0.7933 0.9851 0.1911  -0.2851 0.2147  327 ASP B CG  
2626 O OD1 . ASP B 165 ? 1.1687 0.8649 1.0105 0.2153  -0.3004 0.2242  327 ASP B OD1 
2627 O OD2 . ASP B 165 ? 1.2335 0.7881 1.0727 0.2147  -0.2995 0.2039  327 ASP B OD2 
2628 N N   . LYS B 166 ? 0.9882 0.6247 0.8083 0.0858  -0.1897 0.1476  328 LYS B N   
2629 C CA  . LYS B 166 ? 0.9337 0.5943 0.7800 0.0986  -0.1697 0.1020  328 LYS B CA  
2630 C C   . LYS B 166 ? 0.9334 0.5490 0.7710 0.0663  -0.1596 0.0958  328 LYS B C   
2631 O O   . LYS B 166 ? 0.9560 0.5475 0.7722 0.0263  -0.1589 0.1257  328 LYS B O   
2632 C CB  . LYS B 166 ? 0.8470 0.6067 0.7073 0.0927  -0.1431 0.0846  328 LYS B CB  
2633 C CG  . LYS B 166 ? 0.8466 0.6625 0.7269 0.1279  -0.1536 0.0798  328 LYS B CG  
2634 C CD  . LYS B 166 ? 0.7810 0.6824 0.6638 0.1080  -0.1356 0.0771  328 LYS B CD  
2635 C CE  . LYS B 166 ? 0.8016 0.7592 0.7028 0.1368  -0.1529 0.0805  328 LYS B CE  
2636 N NZ  . LYS B 166 ? 0.7659 0.7908 0.6578 0.1106  -0.1462 0.0870  328 LYS B NZ  
2637 N N   . LYS B 167 ? 0.9123 0.5243 0.7667 0.0829  -0.1526 0.0572  329 LYS B N   
2638 C CA  . LYS B 167 ? 0.9023 0.4871 0.7520 0.0529  -0.1435 0.0457  329 LYS B CA  
2639 C C   . LYS B 167 ? 0.8062 0.4714 0.6697 0.0407  -0.1130 0.0243  329 LYS B C   
2640 O O   . LYS B 167 ? 0.7674 0.4836 0.6468 0.0670  -0.1034 -0.0011 329 LYS B O   
2641 C CB  . LYS B 167 ? 0.9704 0.4838 0.8211 0.0782  -0.1623 0.0167  329 LYS B CB  
2642 C CG  . LYS B 167 ? 0.9945 0.4612 0.8349 0.0419  -0.1637 0.0107  329 LYS B CG  
2643 C CD  . LYS B 167 ? 1.1039 0.4586 0.9316 0.0533  -0.1964 0.0024  329 LYS B CD  
2644 C CE  . LYS B 167 ? 1.1838 0.4649 0.9940 0.0306  -0.2216 0.0522  329 LYS B CE  
2645 N NZ  . LYS B 167 ? 1.2991 0.4566 1.0979 0.0501  -0.2599 0.0459  329 LYS B NZ  
2646 N N   . LEU B 168 ? 0.7694 0.4479 0.6284 0.0005  -0.0989 0.0372  330 LEU B N   
2647 C CA  . LEU B 168 ? 0.6900 0.4332 0.5623 -0.0118 -0.0742 0.0220  330 LEU B CA  
2648 C C   . LEU B 168 ? 0.6763 0.4157 0.5557 -0.0076 -0.0725 -0.0077 330 LEU B C   
2649 O O   . LEU B 168 ? 0.7214 0.4062 0.5931 -0.0169 -0.0863 -0.0122 330 LEU B O   
2650 C CB  . LEU B 168 ? 0.6717 0.4333 0.5416 -0.0503 -0.0612 0.0438  330 LEU B CB  
2651 C CG  . LEU B 168 ? 0.6574 0.4610 0.5204 -0.0600 -0.0491 0.0625  330 LEU B CG  
2652 C CD1 . LEU B 168 ? 0.6543 0.4827 0.5213 -0.0928 -0.0330 0.0734  330 LEU B CD1 
2653 C CD2 . LEU B 168 ? 0.6192 0.4763 0.4922 -0.0413 -0.0376 0.0448  330 LEU B CD2 
2654 N N   . LEU B 169 ? 0.6161 0.4140 0.5071 0.0018  -0.0568 -0.0261 331 LEU B N   
2655 C CA  . LEU B 169 ? 0.5975 0.4093 0.4908 -0.0019 -0.0519 -0.0484 331 LEU B CA  
2656 C C   . LEU B 169 ? 0.5390 0.3955 0.4427 -0.0274 -0.0361 -0.0375 331 LEU B C   
2657 O O   . LEU B 169 ? 0.5001 0.4005 0.4122 -0.0254 -0.0237 -0.0328 331 LEU B O   
2658 C CB  . LEU B 169 ? 0.5923 0.4406 0.4888 0.0284  -0.0472 -0.0752 331 LEU B CB  
2659 C CG  . LEU B 169 ? 0.5893 0.4600 0.4802 0.0239  -0.0419 -0.0978 331 LEU B CG  
2660 C CD1 . LEU B 169 ? 0.6448 0.4532 0.5191 0.0245  -0.0591 -0.1169 331 LEU B CD1 
2661 C CD2 . LEU B 169 ? 0.5731 0.5047 0.4679 0.0472  -0.0306 -0.1176 331 LEU B CD2 
2662 N N   . VAL B 170 ? 0.5359 0.3795 0.4413 -0.0511 -0.0391 -0.0336 332 VAL B N   
2663 C CA  . VAL B 170 ? 0.4875 0.3728 0.4084 -0.0696 -0.0274 -0.0245 332 VAL B CA  
2664 C C   . VAL B 170 ? 0.4887 0.3818 0.4087 -0.0760 -0.0335 -0.0388 332 VAL B C   
2665 O O   . VAL B 170 ? 0.5146 0.3750 0.4278 -0.0884 -0.0473 -0.0444 332 VAL B O   
2666 C CB  . VAL B 170 ? 0.4881 0.3714 0.4184 -0.0937 -0.0244 -0.0023 332 VAL B CB  
2667 C CG1 . VAL B 170 ? 0.4483 0.3782 0.4009 -0.1040 -0.0130 0.0028  332 VAL B CG1 
2668 C CG2 . VAL B 170 ? 0.4886 0.3678 0.4108 -0.0898 -0.0191 0.0125  332 VAL B CG2 
2669 N N   . GLN B 171 ? 0.4526 0.3873 0.3764 -0.0705 -0.0256 -0.0432 333 GLN B N   
2670 C CA  . GLN B 171 ? 0.4658 0.4178 0.3831 -0.0768 -0.0317 -0.0533 333 GLN B CA  
2671 C C   . GLN B 171 ? 0.4325 0.4287 0.3626 -0.0813 -0.0240 -0.0396 333 GLN B C   
2672 O O   . GLN B 171 ? 0.4028 0.4116 0.3433 -0.0760 -0.0135 -0.0296 333 GLN B O   
2673 C CB  . GLN B 171 ? 0.4961 0.4436 0.3890 -0.0586 -0.0351 -0.0804 333 GLN B CB  
2674 C CG  . GLN B 171 ? 0.4712 0.4519 0.3640 -0.0384 -0.0220 -0.0841 333 GLN B CG  
2675 C CD  . GLN B 171 ? 0.5080 0.4988 0.3819 -0.0159 -0.0221 -0.1143 333 GLN B CD  
2676 O OE1 . GLN B 171 ? 0.5645 0.5196 0.4216 -0.0097 -0.0335 -0.1373 333 GLN B OE1 
2677 N NE2 . GLN B 171 ? 0.4741 0.5164 0.3513 -0.0043 -0.0094 -0.1162 333 GLN B NE2 
2678 N N   . ARG B 172 ? 0.4450 0.4605 0.3727 -0.0919 -0.0323 -0.0385 334 ARG B N   
2679 C CA  . ARG B 172 ? 0.4303 0.4797 0.3665 -0.0951 -0.0303 -0.0220 334 ARG B CA  
2680 C C   . ARG B 172 ? 0.4295 0.4981 0.3498 -0.0866 -0.0210 -0.0256 334 ARG B C   
2681 O O   . ARG B 172 ? 0.4503 0.5265 0.3479 -0.0793 -0.0197 -0.0448 334 ARG B O   
2682 C CB  . ARG B 172 ? 0.4452 0.5146 0.3767 -0.1082 -0.0454 -0.0173 334 ARG B CB  
2683 C CG  . ARG B 172 ? 0.4383 0.5115 0.4016 -0.1182 -0.0541 -0.0037 334 ARG B CG  
2684 C CD  . ARG B 172 ? 0.4530 0.5532 0.4154 -0.1314 -0.0736 0.0035  334 ARG B CD  
2685 N NE  . ARG B 172 ? 0.4367 0.5553 0.4411 -0.1367 -0.0803 0.0193  334 ARG B NE  
2686 C CZ  . ARG B 172 ? 0.4365 0.5521 0.4587 -0.1492 -0.0830 0.0149  334 ARG B CZ  
2687 N NH1 . ARG B 172 ? 0.4695 0.5498 0.4678 -0.1581 -0.0835 -0.0034 334 ARG B NH1 
2688 N NH2 . ARG B 172 ? 0.4266 0.5758 0.4923 -0.1530 -0.0862 0.0298  334 ARG B NH2 
2689 N N   . ALA B 173 ? 0.4194 0.4977 0.3533 -0.0879 -0.0148 -0.0087 335 ALA B N   
2690 C CA  . ALA B 173 ? 0.4291 0.5308 0.3534 -0.0871 -0.0066 -0.0074 335 ALA B CA  
2691 C C   . ALA B 173 ? 0.4621 0.5995 0.3647 -0.0974 -0.0101 -0.0024 335 ALA B C   
2692 O O   . ALA B 173 ? 0.4699 0.6413 0.3574 -0.0962 -0.0016 -0.0101 335 ALA B O   
2693 C CB  . ALA B 173 ? 0.4066 0.5004 0.3491 -0.0916 -0.0034 0.0093  335 ALA B CB  
2694 N N   . SER B 174 ? 0.4884 0.6258 0.3899 -0.1076 -0.0228 0.0111  336 SER B N   
2695 C CA  . SER B 174 ? 0.5328 0.7044 0.4106 -0.1221 -0.0298 0.0251  336 SER B CA  
2696 C C   . SER B 174 ? 0.5510 0.7283 0.4362 -0.1349 -0.0297 0.0555  336 SER B C   
2697 O O   . SER B 174 ? 0.5775 0.7910 0.4431 -0.1476 -0.0234 0.0639  336 SER B O   
2698 C CB  . SER B 174 ? 0.5640 0.7727 0.4067 -0.1195 -0.0221 0.0002  336 SER B CB  
2699 O OG  . SER B 174 ? 0.5659 0.7930 0.4110 -0.1097 -0.0052 -0.0119 336 SER B OG  
2700 O OXT . SER B 174 ? 0.5562 0.7005 0.4681 -0.1333 -0.0364 0.0717  336 SER B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   143 143 GLY GLY A . n 
A 1 2   PRO 2   144 144 PRO PRO A . n 
A 1 3   LEU 3   145 145 LEU LEU A . n 
A 1 4   GLY 4   146 146 GLY GLY A . n 
A 1 5   SER 5   147 147 SER SER A . n 
A 1 6   ALA 6   148 148 ALA ALA A . n 
A 1 7   ARG 7   149 149 ARG ARG A . n 
A 1 8   ARG 8   150 150 ARG ARG A . n 
A 1 9   LEU 9   151 151 LEU LEU A . n 
A 1 10  TYR 10  152 152 TYR TYR A . n 
A 1 11  VAL 11  153 153 VAL VAL A . n 
A 1 12  GLY 12  154 154 GLY GLY A . n 
A 1 13  ASN 13  155 155 ASN ASN A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  PRO 15  157 157 PRO PRO A . n 
A 1 16  PHE 16  158 158 PHE PHE A . n 
A 1 17  GLY 17  159 159 GLY GLY A . n 
A 1 18  ILE 18  160 160 ILE ILE A . n 
A 1 19  THR 19  161 161 THR THR A . n 
A 1 20  GLU 20  162 162 GLU GLU A . n 
A 1 21  GLU 21  163 163 GLU GLU A . n 
A 1 22  ALA 22  164 164 ALA ALA A . n 
A 1 23  MET 23  165 165 MET MET A . n 
A 1 24  MET 24  166 166 MET MET A . n 
A 1 25  ASP 25  167 167 ASP ASP A . n 
A 1 26  PHE 26  168 168 PHE PHE A . n 
A 1 27  PHE 27  169 169 PHE PHE A . n 
A 1 28  ASN 28  170 170 ASN ASN A . n 
A 1 29  ALA 29  171 171 ALA ALA A . n 
A 1 30  GLN 30  172 172 GLN GLN A . n 
A 1 31  MET 31  173 173 MET MET A . n 
A 1 32  ARG 32  174 174 ARG ARG A . n 
A 1 33  LEU 33  175 175 LEU LEU A . n 
A 1 34  GLY 34  176 176 GLY GLY A . n 
A 1 35  GLY 35  177 177 GLY GLY A . n 
A 1 36  LEU 36  178 178 LEU LEU A . n 
A 1 37  THR 37  179 179 THR THR A . n 
A 1 38  GLN 38  180 180 GLN GLN A . n 
A 1 39  ALA 39  181 181 ALA ALA A . n 
A 1 40  PRO 40  182 182 PRO PRO A . n 
A 1 41  GLY 41  183 183 GLY GLY A . n 
A 1 42  ASN 42  184 184 ASN ASN A . n 
A 1 43  PRO 43  185 185 PRO PRO A . n 
A 1 44  VAL 44  186 186 VAL VAL A . n 
A 1 45  LEU 45  187 187 LEU LEU A . n 
A 1 46  ALA 46  188 188 ALA ALA A . n 
A 1 47  VAL 47  189 189 VAL VAL A . n 
A 1 48  GLN 48  190 190 GLN GLN A . n 
A 1 49  ILE 49  191 191 ILE ILE A . n 
A 1 50  ASN 50  192 192 ASN ASN A . n 
A 1 51  GLN 51  193 193 GLN GLN A . n 
A 1 52  ASP 52  194 194 ASP ASP A . n 
A 1 53  LYS 53  195 195 LYS LYS A . n 
A 1 54  ASN 54  196 196 ASN ASN A . n 
A 1 55  PHE 55  197 197 PHE PHE A . n 
A 1 56  ALA 56  198 198 ALA ALA A . n 
A 1 57  PHE 57  199 199 PHE PHE A . n 
A 1 58  LEU 58  200 200 LEU LEU A . n 
A 1 59  GLU 59  201 201 GLU GLU A . n 
A 1 60  PHE 60  202 202 PHE PHE A . n 
A 1 61  ARG 61  203 203 ARG ARG A . n 
A 1 62  SER 62  204 204 SER SER A . n 
A 1 63  VAL 63  205 205 VAL VAL A . n 
A 1 64  ASP 64  206 206 ASP ASP A . n 
A 1 65  GLU 65  207 207 GLU GLU A . n 
A 1 66  THR 66  208 208 THR THR A . n 
A 1 67  THR 67  209 209 THR THR A . n 
A 1 68  GLN 68  210 210 GLN GLN A . n 
A 1 69  ALA 69  211 211 ALA ALA A . n 
A 1 70  MET 70  212 212 MET MET A . n 
A 1 71  ALA 71  213 213 ALA ALA A . n 
A 1 72  PHE 72  214 214 PHE PHE A . n 
A 1 73  ASP 73  215 215 ASP ASP A . n 
A 1 74  GLY 74  216 216 GLY GLY A . n 
A 1 75  ILE 75  217 217 ILE ILE A . n 
A 1 76  ILE 76  218 218 ILE ILE A . n 
A 1 77  PHE 77  219 219 PHE PHE A . n 
A 1 78  GLN 78  220 220 GLN GLN A . n 
A 1 79  GLY 79  221 221 GLY GLY A . n 
A 1 80  GLN 80  222 222 GLN GLN A . n 
A 1 81  SER 81  223 223 SER SER A . n 
A 1 82  LEU 82  224 224 LEU LEU A . n 
A 1 83  LYS 83  225 225 LYS LYS A . n 
A 1 84  ILE 84  226 226 ILE ILE A . n 
A 1 85  ARG 85  227 227 ARG ARG A . n 
A 1 86  ARG 86  228 228 ARG ARG A . n 
A 1 87  PRO 87  229 229 PRO PRO A . n 
A 1 88  HIS 88  230 230 HIS HIS A . n 
A 1 89  ASP 89  231 231 ASP ASP A . n 
A 1 90  TYR 90  232 232 TYR TYR A . n 
A 1 91  GLN 91  233 233 GLN GLN A . n 
A 1 92  PRO 92  234 234 PRO PRO A . n 
A 1 93  LEU 93  235 235 LEU LEU A . n 
A 1 94  PRO 94  236 236 PRO PRO A . n 
A 1 95  GLY 95  237 237 GLY GLY A . n 
A 1 96  ALA 96  258 258 ALA ALA A . n 
A 1 97  HIS 97  259 259 HIS HIS A . n 
A 1 98  LYS 98  260 260 LYS LYS A . n 
A 1 99  LEU 99  261 261 LEU LEU A . n 
A 1 100 PHE 100 262 262 PHE PHE A . n 
A 1 101 ILE 101 263 263 ILE ILE A . n 
A 1 102 GLY 102 264 264 GLY GLY A . n 
A 1 103 GLY 103 265 265 GLY GLY A . n 
A 1 104 LEU 104 266 266 LEU LEU A . n 
A 1 105 PRO 105 267 267 PRO PRO A . n 
A 1 106 ASN 106 268 268 ASN ASN A . n 
A 1 107 TYR 107 269 269 TYR TYR A . n 
A 1 108 LEU 108 270 270 LEU LEU A . n 
A 1 109 ASN 109 271 271 ASN ASN A . n 
A 1 110 ASP 110 272 272 ASP ASP A . n 
A 1 111 ASP 111 273 273 ASP ASP A . n 
A 1 112 GLN 112 274 274 GLN GLN A . n 
A 1 113 VAL 113 275 275 VAL VAL A . n 
A 1 114 LYS 114 276 276 LYS LYS A . n 
A 1 115 GLU 115 277 277 GLU GLU A . n 
A 1 116 LEU 116 278 278 LEU LEU A . n 
A 1 117 LEU 117 279 279 LEU LEU A . n 
A 1 118 THR 118 280 280 THR THR A . n 
A 1 119 SER 119 281 281 SER SER A . n 
A 1 120 PHE 120 282 282 PHE PHE A . n 
A 1 121 GLY 121 283 283 GLY GLY A . n 
A 1 122 PRO 122 284 284 PRO PRO A . n 
A 1 123 LEU 123 285 285 LEU LEU A . n 
A 1 124 LYS 124 286 286 LYS LYS A . n 
A 1 125 ALA 125 287 287 ALA ALA A . n 
A 1 126 PHE 126 288 288 PHE PHE A . n 
A 1 127 ASN 127 289 289 ASN ASN A . n 
A 1 128 LEU 128 290 290 LEU LEU A . n 
A 1 129 VAL 129 291 291 VAL VAL A . n 
A 1 130 LYS 130 292 292 LYS LYS A . n 
A 1 131 ASP 131 293 293 ASP ASP A . n 
A 1 132 SER 132 294 294 SER SER A . n 
A 1 133 ALA 133 295 295 ALA ALA A . n 
A 1 134 THR 134 296 296 THR THR A . n 
A 1 135 GLY 135 297 297 GLY GLY A . n 
A 1 136 LEU 136 298 298 LEU LEU A . n 
A 1 137 SER 137 299 299 SER SER A . n 
A 1 138 LYS 138 300 300 LYS LYS A . n 
A 1 139 GLY 139 301 301 GLY GLY A . n 
A 1 140 TYR 140 302 302 TYR TYR A . n 
A 1 141 ALA 141 303 303 ALA ALA A . n 
A 1 142 PHE 142 304 304 PHE PHE A . n 
A 1 143 CYS 143 305 305 CYS CYS A . n 
A 1 144 GLU 144 306 306 GLU GLU A . n 
A 1 145 TYR 145 307 307 TYR TYR A . n 
A 1 146 VAL 146 308 308 VAL VAL A . n 
A 1 147 ASP 147 309 309 ASP ASP A . n 
A 1 148 ILE 148 310 310 ILE ILE A . n 
A 1 149 ASN 149 311 311 ASN ASN A . n 
A 1 150 VAL 150 312 312 VAL VAL A . n 
A 1 151 THR 151 313 313 THR THR A . n 
A 1 152 ASP 152 314 314 ASP ASP A . n 
A 1 153 GLN 153 315 315 GLN GLN A . n 
A 1 154 ALA 154 316 316 ALA ALA A . n 
A 1 155 ILE 155 317 317 ILE ILE A . n 
A 1 156 ALA 156 318 318 ALA ALA A . n 
A 1 157 GLY 157 319 319 GLY GLY A . n 
A 1 158 LEU 158 320 320 LEU LEU A . n 
A 1 159 ASN 159 321 321 ASN ASN A . n 
A 1 160 GLY 160 322 322 GLY GLY A . n 
A 1 161 MET 161 323 323 MET MET A . n 
A 1 162 GLN 162 324 324 GLN GLN A . n 
A 1 163 LEU 163 325 325 LEU LEU A . n 
A 1 164 GLY 164 326 326 GLY GLY A . n 
A 1 165 ASP 165 327 327 ASP ASP A . n 
A 1 166 LYS 166 328 328 LYS LYS A . n 
A 1 167 LYS 167 329 329 LYS LYS A . n 
A 1 168 LEU 168 330 330 LEU LEU A . n 
A 1 169 LEU 169 331 331 LEU LEU A . n 
A 1 170 VAL 170 332 332 VAL VAL A . n 
A 1 171 GLN 171 333 333 GLN GLN A . n 
A 1 172 ARG 172 334 334 ARG ARG A . n 
A 1 173 ALA 173 335 335 ALA ALA A . n 
A 1 174 SER 174 336 336 SER SER A . n 
B 1 1   GLY 1   143 143 GLY GLY B . n 
B 1 2   PRO 2   144 144 PRO PRO B . n 
B 1 3   LEU 3   145 145 LEU LEU B . n 
B 1 4   GLY 4   146 146 GLY GLY B . n 
B 1 5   SER 5   147 147 SER SER B . n 
B 1 6   ALA 6   148 148 ALA ALA B . n 
B 1 7   ARG 7   149 149 ARG ARG B . n 
B 1 8   ARG 8   150 150 ARG ARG B . n 
B 1 9   LEU 9   151 151 LEU LEU B . n 
B 1 10  TYR 10  152 152 TYR TYR B . n 
B 1 11  VAL 11  153 153 VAL VAL B . n 
B 1 12  GLY 12  154 154 GLY GLY B . n 
B 1 13  ASN 13  155 155 ASN ASN B . n 
B 1 14  ILE 14  156 156 ILE ILE B . n 
B 1 15  PRO 15  157 157 PRO PRO B . n 
B 1 16  PHE 16  158 158 PHE PHE B . n 
B 1 17  GLY 17  159 159 GLY GLY B . n 
B 1 18  ILE 18  160 160 ILE ILE B . n 
B 1 19  THR 19  161 161 THR THR B . n 
B 1 20  GLU 20  162 162 GLU GLU B . n 
B 1 21  GLU 21  163 163 GLU GLU B . n 
B 1 22  ALA 22  164 164 ALA ALA B . n 
B 1 23  MET 23  165 165 MET MET B . n 
B 1 24  MET 24  166 166 MET MET B . n 
B 1 25  ASP 25  167 167 ASP ASP B . n 
B 1 26  PHE 26  168 168 PHE PHE B . n 
B 1 27  PHE 27  169 169 PHE PHE B . n 
B 1 28  ASN 28  170 170 ASN ASN B . n 
B 1 29  ALA 29  171 171 ALA ALA B . n 
B 1 30  GLN 30  172 172 GLN GLN B . n 
B 1 31  MET 31  173 173 MET MET B . n 
B 1 32  ARG 32  174 174 ARG ARG B . n 
B 1 33  LEU 33  175 175 LEU LEU B . n 
B 1 34  GLY 34  176 176 GLY GLY B . n 
B 1 35  GLY 35  177 177 GLY GLY B . n 
B 1 36  LEU 36  178 178 LEU LEU B . n 
B 1 37  THR 37  179 179 THR THR B . n 
B 1 38  GLN 38  180 180 GLN GLN B . n 
B 1 39  ALA 39  181 181 ALA ALA B . n 
B 1 40  PRO 40  182 182 PRO PRO B . n 
B 1 41  GLY 41  183 183 GLY GLY B . n 
B 1 42  ASN 42  184 184 ASN ASN B . n 
B 1 43  PRO 43  185 185 PRO PRO B . n 
B 1 44  VAL 44  186 186 VAL VAL B . n 
B 1 45  LEU 45  187 187 LEU LEU B . n 
B 1 46  ALA 46  188 188 ALA ALA B . n 
B 1 47  VAL 47  189 189 VAL VAL B . n 
B 1 48  GLN 48  190 190 GLN GLN B . n 
B 1 49  ILE 49  191 191 ILE ILE B . n 
B 1 50  ASN 50  192 192 ASN ASN B . n 
B 1 51  GLN 51  193 193 GLN GLN B . n 
B 1 52  ASP 52  194 194 ASP ASP B . n 
B 1 53  LYS 53  195 195 LYS LYS B . n 
B 1 54  ASN 54  196 196 ASN ASN B . n 
B 1 55  PHE 55  197 197 PHE PHE B . n 
B 1 56  ALA 56  198 198 ALA ALA B . n 
B 1 57  PHE 57  199 199 PHE PHE B . n 
B 1 58  LEU 58  200 200 LEU LEU B . n 
B 1 59  GLU 59  201 201 GLU GLU B . n 
B 1 60  PHE 60  202 202 PHE PHE B . n 
B 1 61  ARG 61  203 203 ARG ARG B . n 
B 1 62  SER 62  204 204 SER SER B . n 
B 1 63  VAL 63  205 205 VAL VAL B . n 
B 1 64  ASP 64  206 206 ASP ASP B . n 
B 1 65  GLU 65  207 207 GLU GLU B . n 
B 1 66  THR 66  208 208 THR THR B . n 
B 1 67  THR 67  209 209 THR THR B . n 
B 1 68  GLN 68  210 210 GLN GLN B . n 
B 1 69  ALA 69  211 211 ALA ALA B . n 
B 1 70  MET 70  212 212 MET MET B . n 
B 1 71  ALA 71  213 213 ALA ALA B . n 
B 1 72  PHE 72  214 214 PHE PHE B . n 
B 1 73  ASP 73  215 215 ASP ASP B . n 
B 1 74  GLY 74  216 216 GLY GLY B . n 
B 1 75  ILE 75  217 217 ILE ILE B . n 
B 1 76  ILE 76  218 218 ILE ILE B . n 
B 1 77  PHE 77  219 219 PHE PHE B . n 
B 1 78  GLN 78  220 220 GLN GLN B . n 
B 1 79  GLY 79  221 221 GLY GLY B . n 
B 1 80  GLN 80  222 222 GLN GLN B . n 
B 1 81  SER 81  223 223 SER SER B . n 
B 1 82  LEU 82  224 224 LEU LEU B . n 
B 1 83  LYS 83  225 225 LYS LYS B . n 
B 1 84  ILE 84  226 226 ILE ILE B . n 
B 1 85  ARG 85  227 227 ARG ARG B . n 
B 1 86  ARG 86  228 228 ARG ARG B . n 
B 1 87  PRO 87  229 229 PRO PRO B . n 
B 1 88  HIS 88  230 230 HIS HIS B . n 
B 1 89  ASP 89  231 231 ASP ASP B . n 
B 1 90  TYR 90  232 232 TYR TYR B . n 
B 1 91  GLN 91  233 233 GLN GLN B . n 
B 1 92  PRO 92  234 234 PRO PRO B . n 
B 1 93  LEU 93  235 235 LEU LEU B . n 
B 1 94  PRO 94  236 236 PRO PRO B . n 
B 1 95  GLY 95  237 237 GLY GLY B . n 
B 1 96  ALA 96  258 258 ALA ALA B . n 
B 1 97  HIS 97  259 259 HIS HIS B . n 
B 1 98  LYS 98  260 260 LYS LYS B . n 
B 1 99  LEU 99  261 261 LEU LEU B . n 
B 1 100 PHE 100 262 262 PHE PHE B . n 
B 1 101 ILE 101 263 263 ILE ILE B . n 
B 1 102 GLY 102 264 264 GLY GLY B . n 
B 1 103 GLY 103 265 265 GLY GLY B . n 
B 1 104 LEU 104 266 266 LEU LEU B . n 
B 1 105 PRO 105 267 267 PRO PRO B . n 
B 1 106 ASN 106 268 268 ASN ASN B . n 
B 1 107 TYR 107 269 269 TYR TYR B . n 
B 1 108 LEU 108 270 270 LEU LEU B . n 
B 1 109 ASN 109 271 271 ASN ASN B . n 
B 1 110 ASP 110 272 272 ASP ASP B . n 
B 1 111 ASP 111 273 273 ASP ASP B . n 
B 1 112 GLN 112 274 274 GLN GLN B . n 
B 1 113 VAL 113 275 275 VAL VAL B . n 
B 1 114 LYS 114 276 276 LYS LYS B . n 
B 1 115 GLU 115 277 277 GLU GLU B . n 
B 1 116 LEU 116 278 278 LEU LEU B . n 
B 1 117 LEU 117 279 279 LEU LEU B . n 
B 1 118 THR 118 280 280 THR THR B . n 
B 1 119 SER 119 281 281 SER SER B . n 
B 1 120 PHE 120 282 282 PHE PHE B . n 
B 1 121 GLY 121 283 283 GLY GLY B . n 
B 1 122 PRO 122 284 284 PRO PRO B . n 
B 1 123 LEU 123 285 285 LEU LEU B . n 
B 1 124 LYS 124 286 286 LYS LYS B . n 
B 1 125 ALA 125 287 287 ALA ALA B . n 
B 1 126 PHE 126 288 288 PHE PHE B . n 
B 1 127 ASN 127 289 289 ASN ASN B . n 
B 1 128 LEU 128 290 290 LEU LEU B . n 
B 1 129 VAL 129 291 291 VAL VAL B . n 
B 1 130 LYS 130 292 292 LYS LYS B . n 
B 1 131 ASP 131 293 293 ASP ASP B . n 
B 1 132 SER 132 294 294 SER SER B . n 
B 1 133 ALA 133 295 295 ALA ALA B . n 
B 1 134 THR 134 296 296 THR THR B . n 
B 1 135 GLY 135 297 297 GLY GLY B . n 
B 1 136 LEU 136 298 298 LEU LEU B . n 
B 1 137 SER 137 299 299 SER SER B . n 
B 1 138 LYS 138 300 300 LYS LYS B . n 
B 1 139 GLY 139 301 301 GLY GLY B . n 
B 1 140 TYR 140 302 302 TYR TYR B . n 
B 1 141 ALA 141 303 303 ALA ALA B . n 
B 1 142 PHE 142 304 304 PHE PHE B . n 
B 1 143 CYS 143 305 305 CYS CYS B . n 
B 1 144 GLU 144 306 306 GLU GLU B . n 
B 1 145 TYR 145 307 307 TYR TYR B . n 
B 1 146 VAL 146 308 308 VAL VAL B . n 
B 1 147 ASP 147 309 309 ASP ASP B . n 
B 1 148 ILE 148 310 310 ILE ILE B . n 
B 1 149 ASN 149 311 311 ASN ASN B . n 
B 1 150 VAL 150 312 312 VAL VAL B . n 
B 1 151 THR 151 313 313 THR THR B . n 
B 1 152 ASP 152 314 314 ASP ASP B . n 
B 1 153 GLN 153 315 315 GLN GLN B . n 
B 1 154 ALA 154 316 316 ALA ALA B . n 
B 1 155 ILE 155 317 317 ILE ILE B . n 
B 1 156 ALA 156 318 318 ALA ALA B . n 
B 1 157 GLY 157 319 319 GLY GLY B . n 
B 1 158 LEU 158 320 320 LEU LEU B . n 
B 1 159 ASN 159 321 321 ASN ASN B . n 
B 1 160 GLY 160 322 322 GLY GLY B . n 
B 1 161 MET 161 323 323 MET MET B . n 
B 1 162 GLN 162 324 324 GLN GLN B . n 
B 1 163 LEU 163 325 325 LEU LEU B . n 
B 1 164 GLY 164 326 326 GLY GLY B . n 
B 1 165 ASP 165 327 327 ASP ASP B . n 
B 1 166 LYS 166 328 328 LYS LYS B . n 
B 1 167 LYS 167 329 329 LYS LYS B . n 
B 1 168 LEU 168 330 330 LEU LEU B . n 
B 1 169 LEU 169 331 331 LEU LEU B . n 
B 1 170 VAL 170 332 332 VAL VAL B . n 
B 1 171 GLN 171 333 333 GLN GLN B . n 
B 1 172 ARG 172 334 334 ARG ARG B . n 
B 1 173 ALA 173 335 335 ALA ALA B . n 
B 1 174 SER 174 336 336 SER SER B . n 
C 2 1   DU  1   1   ?   ?   ?   P . n 
C 2 2   DC  2   2   2   DC  DC  P . n 
C 2 3   BRU 3   3   3   BRU BRU P . n 
C 2 4   DU  4   4   4   DU  DU  P . n 
C 2 5   DU  5   5   5   DU  DU  P . n 
C 2 6   DU  6   6   6   DU  DU  P . n 
C 2 7   DU  7   7   7   DU  DU  P . n 
D 2 1   DU  1   2   2   DU  DU  E . n 
D 2 2   DC  2   3   3   DC  DC  E . n 
D 2 3   BRU 3   4   4   BRU BRU E . n 
D 2 4   DU  4   5   5   DU  DU  E . n 
D 2 5   DU  5   6   6   DU  DU  E . n 
D 2 6   DU  6   7   7   DU  DU  E . n 
D 2 7   DU  7   8   ?   ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 DIO 1  401 6   DIO DIO A . 
F 3 DIO 1  402 8   DIO DIO A . 
G 3 DIO 1  403 9   DIO DIO A . 
H 4 SO4 1  404 5   SO4 SO4 A . 
I 4 SO4 1  405 7   SO4 SO4 A . 
J 4 SO4 1  406 8   SO4 SO4 A . 
K 4 SO4 1  407 11  SO4 SO4 A . 
L 5 GOL 1  408 1   GOL GOL A . 
M 3 DIO 1  401 1   DIO DIO B . 
N 3 DIO 1  402 4   DIO DIO B . 
O 3 DIO 1  403 7   DIO DIO B . 
P 6 CPQ 1  404 101 CPQ CPQ B . 
Q 4 SO4 1  405 1   SO4 SO4 B . 
R 4 SO4 1  406 6   SO4 SO4 B . 
S 4 SO4 1  407 9   SO4 SO4 B . 
T 5 GOL 1  408 2   GOL GOL B . 
U 7 HOH 1  501 1   HOH HOH A . 
U 7 HOH 2  502 2   HOH HOH A . 
U 7 HOH 3  503 7   HOH HOH A . 
U 7 HOH 4  504 9   HOH HOH A . 
U 7 HOH 5  505 10  HOH HOH A . 
U 7 HOH 6  506 11  HOH HOH A . 
U 7 HOH 7  507 14  HOH HOH A . 
U 7 HOH 8  508 15  HOH HOH A . 
U 7 HOH 9  509 16  HOH HOH A . 
U 7 HOH 10 510 20  HOH HOH A . 
U 7 HOH 11 511 22  HOH HOH A . 
U 7 HOH 12 512 26  HOH HOH A . 
U 7 HOH 13 513 27  HOH HOH A . 
U 7 HOH 14 514 34  HOH HOH A . 
U 7 HOH 15 515 39  HOH HOH A . 
U 7 HOH 16 516 40  HOH HOH A . 
U 7 HOH 17 517 41  HOH HOH A . 
U 7 HOH 18 518 43  HOH HOH A . 
U 7 HOH 19 519 45  HOH HOH A . 
U 7 HOH 20 520 53  HOH HOH A . 
U 7 HOH 21 521 54  HOH HOH A . 
U 7 HOH 22 522 55  HOH HOH A . 
U 7 HOH 23 523 57  HOH HOH A . 
U 7 HOH 24 524 58  HOH HOH A . 
U 7 HOH 25 525 60  HOH HOH A . 
U 7 HOH 26 526 61  HOH HOH A . 
U 7 HOH 27 527 65  HOH HOH A . 
U 7 HOH 28 528 67  HOH HOH A . 
U 7 HOH 29 529 68  HOH HOH A . 
U 7 HOH 30 530 69  HOH HOH A . 
U 7 HOH 31 531 70  HOH HOH A . 
U 7 HOH 32 532 72  HOH HOH A . 
U 7 HOH 33 533 76  HOH HOH A . 
U 7 HOH 34 534 77  HOH HOH A . 
U 7 HOH 35 535 78  HOH HOH A . 
U 7 HOH 36 536 79  HOH HOH A . 
U 7 HOH 37 537 80  HOH HOH A . 
U 7 HOH 38 538 83  HOH HOH A . 
U 7 HOH 39 539 88  HOH HOH A . 
U 7 HOH 40 540 91  HOH HOH A . 
U 7 HOH 41 541 92  HOH HOH A . 
U 7 HOH 42 542 93  HOH HOH A . 
U 7 HOH 43 543 94  HOH HOH A . 
U 7 HOH 44 544 95  HOH HOH A . 
U 7 HOH 45 545 96  HOH HOH A . 
U 7 HOH 46 546 98  HOH HOH A . 
U 7 HOH 47 547 99  HOH HOH A . 
U 7 HOH 48 548 101 HOH HOH A . 
U 7 HOH 49 549 104 HOH HOH A . 
U 7 HOH 50 550 105 HOH HOH A . 
U 7 HOH 51 551 106 HOH HOH A . 
U 7 HOH 52 552 108 HOH HOH A . 
U 7 HOH 53 553 111 HOH HOH A . 
U 7 HOH 54 554 115 HOH HOH A . 
U 7 HOH 55 555 116 HOH HOH A . 
U 7 HOH 56 556 122 HOH HOH A . 
U 7 HOH 57 557 124 HOH HOH A . 
U 7 HOH 58 558 126 HOH HOH A . 
U 7 HOH 59 559 128 HOH HOH A . 
U 7 HOH 60 560 130 HOH HOH A . 
U 7 HOH 61 561 133 HOH HOH A . 
U 7 HOH 62 562 137 HOH HOH A . 
U 7 HOH 63 563 138 HOH HOH A . 
U 7 HOH 64 564 139 HOH HOH A . 
U 7 HOH 65 565 141 HOH HOH A . 
U 7 HOH 66 566 145 HOH HOH A . 
U 7 HOH 67 567 146 HOH HOH A . 
U 7 HOH 68 568 147 HOH HOH A . 
U 7 HOH 69 569 148 HOH HOH A . 
U 7 HOH 70 570 149 HOH HOH A . 
U 7 HOH 71 571 150 HOH HOH A . 
U 7 HOH 72 572 49  HOH HOH A . 
V 7 HOH 1  501 5   HOH HOH B . 
V 7 HOH 2  502 6   HOH HOH B . 
V 7 HOH 3  503 8   HOH HOH B . 
V 7 HOH 4  504 12  HOH HOH B . 
V 7 HOH 5  505 17  HOH HOH B . 
V 7 HOH 6  506 18  HOH HOH B . 
V 7 HOH 7  507 19  HOH HOH B . 
V 7 HOH 8  508 21  HOH HOH B . 
V 7 HOH 9  509 23  HOH HOH B . 
V 7 HOH 10 510 24  HOH HOH B . 
V 7 HOH 11 511 25  HOH HOH B . 
V 7 HOH 12 512 28  HOH HOH B . 
V 7 HOH 13 513 29  HOH HOH B . 
V 7 HOH 14 514 30  HOH HOH B . 
V 7 HOH 15 515 31  HOH HOH B . 
V 7 HOH 16 516 32  HOH HOH B . 
V 7 HOH 17 517 33  HOH HOH B . 
V 7 HOH 18 518 35  HOH HOH B . 
V 7 HOH 19 519 36  HOH HOH B . 
V 7 HOH 20 520 42  HOH HOH B . 
V 7 HOH 21 521 48  HOH HOH B . 
V 7 HOH 22 522 51  HOH HOH B . 
V 7 HOH 23 523 52  HOH HOH B . 
V 7 HOH 24 524 56  HOH HOH B . 
V 7 HOH 25 525 62  HOH HOH B . 
V 7 HOH 26 526 63  HOH HOH B . 
V 7 HOH 27 527 66  HOH HOH B . 
V 7 HOH 28 528 71  HOH HOH B . 
V 7 HOH 29 529 73  HOH HOH B . 
V 7 HOH 30 530 75  HOH HOH B . 
V 7 HOH 31 531 81  HOH HOH B . 
V 7 HOH 32 532 82  HOH HOH B . 
V 7 HOH 33 533 84  HOH HOH B . 
V 7 HOH 34 534 85  HOH HOH B . 
V 7 HOH 35 535 86  HOH HOH B . 
V 7 HOH 36 536 89  HOH HOH B . 
V 7 HOH 37 537 97  HOH HOH B . 
V 7 HOH 38 538 102 HOH HOH B . 
V 7 HOH 39 539 107 HOH HOH B . 
V 7 HOH 40 540 110 HOH HOH B . 
V 7 HOH 41 541 112 HOH HOH B . 
V 7 HOH 42 542 113 HOH HOH B . 
V 7 HOH 43 543 117 HOH HOH B . 
V 7 HOH 44 544 118 HOH HOH B . 
V 7 HOH 45 545 119 HOH HOH B . 
V 7 HOH 46 546 121 HOH HOH B . 
V 7 HOH 47 547 127 HOH HOH B . 
V 7 HOH 48 548 129 HOH HOH B . 
V 7 HOH 49 549 131 HOH HOH B . 
V 7 HOH 50 550 132 HOH HOH B . 
V 7 HOH 51 551 134 HOH HOH B . 
V 7 HOH 52 552 136 HOH HOH B . 
V 7 HOH 53 553 140 HOH HOH B . 
V 7 HOH 54 554 142 HOH HOH B . 
V 7 HOH 55 555 143 HOH HOH B . 
V 7 HOH 56 556 144 HOH HOH B . 
V 7 HOH 57 557 151 HOH HOH B . 
V 7 HOH 58 558 152 HOH HOH B . 
V 7 HOH 59 559 153 HOH HOH B . 
V 7 HOH 60 560 154 HOH HOH B . 
V 7 HOH 61 561 155 HOH HOH B . 
V 7 HOH 62 562 156 HOH HOH B . 
W 7 HOH 1  101 3   HOH HOH P . 
W 7 HOH 2  102 4   HOH HOH P . 
W 7 HOH 3  103 13  HOH HOH P . 
W 7 HOH 4  104 38  HOH HOH P . 
W 7 HOH 5  105 47  HOH HOH P . 
W 7 HOH 6  106 50  HOH HOH P . 
W 7 HOH 7  107 100 HOH HOH P . 
W 7 HOH 8  108 109 HOH HOH P . 
W 7 HOH 9  109 114 HOH HOH P . 
W 7 HOH 10 110 120 HOH HOH P . 
W 7 HOH 11 111 123 HOH HOH P . 
W 7 HOH 12 112 125 HOH HOH P . 
W 7 HOH 13 113 135 HOH HOH P . 
X 7 HOH 1  101 37  HOH HOH E . 
X 7 HOH 2  102 44  HOH HOH E . 
X 7 HOH 3  103 46  HOH HOH E . 
X 7 HOH 4  104 59  HOH HOH E . 
X 7 HOH 5  105 64  HOH HOH E . 
X 7 HOH 6  106 74  HOH HOH E . 
X 7 HOH 7  107 87  HOH HOH E . 
X 7 HOH 8  108 90  HOH HOH E . 
X 7 HOH 9  109 103 HOH HOH E . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C BRU 3 P BRU 3 ? DU ? 
2 D BRU 3 E BRU 4 ? DU ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-02-13 
2 'Structure model' 1 1 2013-05-22 
3 'Structure model' 1 2 2017-08-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Source and taxonomy' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -11.0359 -19.8399 31.1886 -0.2014 -0.1970 -0.1140 -0.0281 0.0139  -0.0553 1.7054 2.7574 4.4728 
1.0372 -0.2247 -1.1320 -0.0723 -0.0131 -0.2738 -0.0329 -0.0488 -0.2241 0.0468  0.0756  0.1211  
'X-RAY DIFFRACTION' 2 ? refined -32.7624 5.7772   26.8913 -0.1366 -0.2132 -0.0722 -0.0890 0.0244  -0.0457 8.1398 2.4989 3.3487 
1.5999 0.7488  0.4020  -0.0399 0.1547  -0.0075 -0.2380 0.1762  -0.0510 -0.2543 0.1398  -0.1363 
'X-RAY DIFFRACTION' 3 ? refined 26.1570  -27.8794 28.7470 -0.1832 -0.1432 -0.1451 -0.0486 -0.0547 0.0226  4.9897 5.4589 3.5134 
2.4561 -0.5846 -0.4918 -0.2394 0.1626  -0.0272 -0.2313 0.2775  0.2387  0.1757  -0.3415 -0.0382 
'X-RAY DIFFRACTION' 4 ? refined 4.9510   -3.7552  13.8095 -0.1270 -0.1236 -0.1908 -0.0717 0.0300  0.0014  6.9215 3.6839 7.3955 
1.0584 2.1572  -0.2306 -0.1571 0.3996  0.1658  -0.2880 -0.0093 -0.2420 -0.3684 0.0768  0.1664  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 143 ? ? A 237 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 258 ? ? A 336 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 B 143 ? ? B 237 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 B 258 ? ? B 336 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
REFMAC    refinement        5.2.0019 ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DC  2 ? ? "C1'" P DC  2 ? ? N1 P DC 2 ? ? 110.82 108.30 2.52 0.30 N 
2 1 "C3'" P BRU 3 ? ? "O3'" P BRU 3 ? ? P  P DU 4 ? ? 127.38 119.70 7.68 1.20 Y 
3 1 "O4'" P DU  4 ? ? "C1'" P DU  4 ? ? N1 P DU 4 ? ? 110.91 108.30 2.61 0.30 N 
4 1 "O4'" P DU  5 ? ? "C1'" P DU  5 ? ? N1 P DU 5 ? ? 110.61 108.30 2.31 0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 P DC  2   ? P   ? C DC  2 P   
2  1 Y 1 P DC  2   ? OP1 ? C DC  2 OP1 
3  1 Y 1 P DC  2   ? OP2 ? C DC  2 OP2 
4  1 N 1 B CPQ 404 ? N59 ? P CPQ 1 N59 
5  1 N 1 B CPQ 404 ? C74 ? P CPQ 1 C74 
6  1 N 1 B CPQ 404 ? C75 ? P CPQ 1 C75 
7  1 N 1 B CPQ 404 ? C76 ? P CPQ 1 C76 
8  1 N 1 B CPQ 404 ? N77 ? P CPQ 1 N77 
9  1 N 1 B CPQ 404 ? C78 ? P CPQ 1 C78 
10 1 N 1 B CPQ 404 ? C80 ? P CPQ 1 C80 
11 1 N 1 B CPQ 404 ? O86 ? P CPQ 1 O86 
12 1 N 1 B CPQ 404 ? C81 ? P CPQ 1 C81 
13 1 N 1 B CPQ 404 ? O87 ? P CPQ 1 O87 
14 1 N 1 B CPQ 404 ? C82 ? P CPQ 1 C82 
15 1 N 1 B CPQ 404 ? O88 ? P CPQ 1 O88 
16 1 N 1 B CPQ 404 ? C83 ? P CPQ 1 C83 
17 1 N 1 B CPQ 404 ? O89 ? P CPQ 1 O89 
18 1 N 1 B CPQ 404 ? C84 ? P CPQ 1 C84 
19 1 N 1 B CPQ 404 ? O85 ? P CPQ 1 O85 
20 1 N 1 B CPQ 404 ? O79 ? P CPQ 1 O79 
21 1 N 1 B CPQ 404 ? C68 ? P CPQ 1 C68 
22 1 N 1 B CPQ 404 ? C69 ? P CPQ 1 C69 
23 1 N 1 B CPQ 404 ? C70 ? P CPQ 1 C70 
24 1 N 1 B CPQ 404 ? N71 ? P CPQ 1 N71 
25 1 N 1 B CPQ 404 ? C72 ? P CPQ 1 C72 
26 1 N 1 B CPQ 404 ? C90 ? P CPQ 1 C90 
27 1 N 1 B CPQ 404 ? O96 ? P CPQ 1 O96 
28 1 N 1 B CPQ 404 ? C91 ? P CPQ 1 C91 
29 1 N 1 B CPQ 404 ? O97 ? P CPQ 1 O97 
30 1 N 1 B CPQ 404 ? C92 ? P CPQ 1 C92 
31 1 N 1 B CPQ 404 ? O98 ? P CPQ 1 O98 
32 1 N 1 B CPQ 404 ? C93 ? P CPQ 1 C93 
33 1 N 1 B CPQ 404 ? O99 ? P CPQ 1 O99 
34 1 N 1 B CPQ 404 ? C94 ? P CPQ 1 C94 
35 1 N 1 B CPQ 404 ? O95 ? P CPQ 1 O95 
36 1 N 1 B CPQ 404 ? O73 ? P CPQ 1 O73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 P DU 1 ? C DU 1 
2 1 Y 1 E DU 8 ? D DU 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '1,4-DIETHYLENE DIOXIDE'                       DIO 
4 'SULFATE ION'                                  SO4 
5 GLYCEROL                                       GOL 
6 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' CPQ 
7 water                                          HOH 
#