data_3VAH
# 
_entry.id   3VAH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VAH         
NDB   NA1532       
RCSB  RCSB069799   
WWPDB D_1000069799 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2G4B 'U2AF65 variant with polyuridine tract' unspecified 
PDB 2HZC 'N-terminal RRM of U2AF65'              unspecified 
PDB 3VAF .                                       unspecified 
PDB 3VAG .                                       unspecified 
PDB 3VAI .                                       unspecified 
PDB 3VAJ .                                       unspecified 
PDB 3VAK .                                       unspecified 
PDB 3VAL .                                       unspecified 
PDB 3VAM .                                       unspecified 
PDB 3VAN .                                       unspecified 
PDB 3VAO .                                       unspecified 
# 
_pdbx_database_status.entry_id                        3VAH 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-29 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jenkins, J.L.'  1 
'Kielkopf, C.L.' 2 
# 
_citation.id                        primary 
_citation.title                     
'U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            41 
_citation.page_first                3859 
_citation.page_last                 3873 
_citation.year                      2013 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23376934 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jenkins, J.L.'  1 
primary 'Agrawal, A.A.'  2 
primary 'Gupta, A.'      3 
primary 'Green, M.R.'    4 
primary 'Kielkopf, C.L.' 5 
# 
_cell.length_a           166.238 
_cell.length_b           37.304 
_cell.length_c           101.310 
_cell.angle_alpha        90.000 
_cell.angle_beta         125.610 
_cell.angle_gamma        90.000 
_cell.entry_id           3VAH 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         3VAH 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Splicing factor U2AF 65 kDa subunit'          19075.754 2  ? ? 'RNA Binding Domains 1 and 2' ? 
2 polymer     syn 
;DNA 5'-D(P*UP*UP*(BRU)P*CP*UP*UP*U)-3'
;
2064.121  2  ? ? ?                             ? 
3 non-polymer syn '1,4-DIETHYLENE DIOXIDE'                       88.105    4  ? ? ?                             ? 
4 non-polymer syn 'SULFATE ION'                                  96.063    5  ? ? ?                             ? 
5 non-polymer syn 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' 862.056   1  ? ? ?                             ? 
6 non-polymer syn GLYCEROL                                       92.094    1  ? ? ?                             ? 
7 water       nat water                                          18.015    95 ? ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U2 auxiliary factor 65 kDa subunit, hU2AF(65), hU2AF65, U2 snRNP auxiliary factor large subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ
SLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNG
MQLGDKKLLVQRAS
;
;GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQ
SLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNG
MQLGDKKLLVQRAS
;
A,B ? 
2 polydeoxyribonucleotide no yes '(DU)(DU)(BRU)(DC)(DU)(DU)(DU)' UUUCUUU E,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   ALA n 
1 7   ARG n 
1 8   ARG n 
1 9   LEU n 
1 10  TYR n 
1 11  VAL n 
1 12  GLY n 
1 13  ASN n 
1 14  ILE n 
1 15  PRO n 
1 16  PHE n 
1 17  GLY n 
1 18  ILE n 
1 19  THR n 
1 20  GLU n 
1 21  GLU n 
1 22  ALA n 
1 23  MET n 
1 24  MET n 
1 25  ASP n 
1 26  PHE n 
1 27  PHE n 
1 28  ASN n 
1 29  ALA n 
1 30  GLN n 
1 31  MET n 
1 32  ARG n 
1 33  LEU n 
1 34  GLY n 
1 35  GLY n 
1 36  LEU n 
1 37  THR n 
1 38  GLN n 
1 39  ALA n 
1 40  PRO n 
1 41  GLY n 
1 42  ASN n 
1 43  PRO n 
1 44  VAL n 
1 45  LEU n 
1 46  ALA n 
1 47  VAL n 
1 48  GLN n 
1 49  ILE n 
1 50  ASN n 
1 51  GLN n 
1 52  ASP n 
1 53  LYS n 
1 54  ASN n 
1 55  PHE n 
1 56  ALA n 
1 57  PHE n 
1 58  LEU n 
1 59  GLU n 
1 60  PHE n 
1 61  ARG n 
1 62  SER n 
1 63  VAL n 
1 64  ASP n 
1 65  GLU n 
1 66  THR n 
1 67  THR n 
1 68  GLN n 
1 69  ALA n 
1 70  MET n 
1 71  ALA n 
1 72  PHE n 
1 73  ASP n 
1 74  GLY n 
1 75  ILE n 
1 76  ILE n 
1 77  PHE n 
1 78  GLN n 
1 79  GLY n 
1 80  GLN n 
1 81  SER n 
1 82  LEU n 
1 83  LYS n 
1 84  ILE n 
1 85  ARG n 
1 86  ARG n 
1 87  PRO n 
1 88  HIS n 
1 89  ASP n 
1 90  TYR n 
1 91  GLN n 
1 92  PRO n 
1 93  LEU n 
1 94  PRO n 
1 95  GLY n 
1 96  ALA n 
1 97  HIS n 
1 98  LYS n 
1 99  LEU n 
1 100 PHE n 
1 101 ILE n 
1 102 GLY n 
1 103 GLY n 
1 104 LEU n 
1 105 PRO n 
1 106 ASN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASN n 
1 110 ASP n 
1 111 ASP n 
1 112 GLN n 
1 113 VAL n 
1 114 LYS n 
1 115 GLU n 
1 116 LEU n 
1 117 LEU n 
1 118 THR n 
1 119 SER n 
1 120 PHE n 
1 121 GLY n 
1 122 PRO n 
1 123 LEU n 
1 124 LYS n 
1 125 ALA n 
1 126 PHE n 
1 127 ASN n 
1 128 LEU n 
1 129 VAL n 
1 130 LYS n 
1 131 ASP n 
1 132 SER n 
1 133 ALA n 
1 134 THR n 
1 135 GLY n 
1 136 LEU n 
1 137 SER n 
1 138 LYS n 
1 139 GLY n 
1 140 TYR n 
1 141 ALA n 
1 142 PHE n 
1 143 CYS n 
1 144 GLU n 
1 145 TYR n 
1 146 VAL n 
1 147 ASP n 
1 148 ILE n 
1 149 ASN n 
1 150 VAL n 
1 151 THR n 
1 152 ASP n 
1 153 GLN n 
1 154 ALA n 
1 155 ILE n 
1 156 ALA n 
1 157 GLY n 
1 158 LEU n 
1 159 ASN n 
1 160 GLY n 
1 161 MET n 
1 162 GLN n 
1 163 LEU n 
1 164 GLY n 
1 165 ASP n 
1 166 LYS n 
1 167 LYS n 
1 168 LEU n 
1 169 LEU n 
1 170 VAL n 
1 171 GLN n 
1 172 ARG n 
1 173 ALA n 
1 174 SER n 
2 1   DU  n 
2 2   DU  n 
2 3   BRU n 
2 4   DC  n 
2 5   DU  n 
2 6   DU  n 
2 7   DU  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 6  95  human ? 'U2AF2, U2AF65' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 
BL21 ? ? ? ? ? ? ? plasmid ? ? ? PGEX-6P ? ? 
1 2 sample ? 96 174 human ? 'U2AF2, U2AF65' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 
BL21 ? ? ? ? ? ? ? plasmid ? ? ? PGEX-6P ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                DNA 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP U2AF2_HUMAN P26368 1 
;ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIR
RPHDYQPLPG
;
148 ? 
2 UNP U2AF2_HUMAN P26368 1 AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS               258 ? 
3 PDB 3VAH        3VAH   2 UUUCUUU                                                                                       1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VAH A 6  ? 95  ? P26368 148 ? 237 ? 148 237 
2 2 3VAH A 96 ? 174 ? P26368 258 ? 336 ? 258 336 
3 1 3VAH B 6  ? 95  ? P26368 148 ? 237 ? 148 237 
4 2 3VAH B 96 ? 174 ? P26368 258 ? 336 ? 258 336 
5 3 3VAH E 1  ? 7   ? 3VAH   1   ? 7   ? 1   7   
6 3 3VAH P 1  ? 7   ? 3VAH   2   ? 8   ? 2   8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VAH GLY A 1 ? UNP P26368 ? ? 'EXPRESSION TAG' 143 1  
1 3VAH PRO A 2 ? UNP P26368 ? ? 'EXPRESSION TAG' 144 2  
1 3VAH LEU A 3 ? UNP P26368 ? ? 'EXPRESSION TAG' 145 3  
1 3VAH GLY A 4 ? UNP P26368 ? ? 'EXPRESSION TAG' 146 4  
1 3VAH SER A 5 ? UNP P26368 ? ? 'EXPRESSION TAG' 147 5  
3 3VAH GLY B 1 ? UNP P26368 ? ? 'EXPRESSION TAG' 143 6  
3 3VAH PRO B 2 ? UNP P26368 ? ? 'EXPRESSION TAG' 144 7  
3 3VAH LEU B 3 ? UNP P26368 ? ? 'EXPRESSION TAG' 145 8  
3 3VAH GLY B 4 ? UNP P26368 ? ? 'EXPRESSION TAG' 146 9  
3 3VAH SER B 5 ? UNP P26368 ? ? 'EXPRESSION TAG' 147 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?                               'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                               'C4 H7 N O4'        
133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"     ?                               'C9 H12 Br N2 O8 P' 
387.078 
CPQ non-polymer         . 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' DEOXY-BIGCHAP                   'C42 H75 N3 O15'    
862.056 
CYS 'L-peptide linking' y CYSTEINE                                       ?                               'C3 H7 N O2 S'      
121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"            ?                               'C9 H14 N3 O7 P'    
307.197 
DIO non-polymer         . '1,4-DIETHYLENE DIOXIDE'                       ?                               'C4 H8 O2'          
88.105  
DU  'DNA linking'       y "2'-DEOXYURIDINE-5'-MONOPHOSPHATE"             ?                               'C9 H13 N2 O8 P'    
308.182 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                               'C2 H5 N O2'        
75.067  
GOL non-polymer         . GLYCEROL                                       'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          
92.094  
HIS 'L-peptide linking' y HISTIDINE                                      ?                               'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                          ?                               'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                               'C5 H11 N O2 S'     
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                         ?                               'C3 H7 N O3'        
105.093 
SO4 non-polymer         . 'SULFATE ION'                                  ?                               'O4 S -2'           
96.063  
THR 'L-peptide linking' y THREONINE                                      ?                               'C4 H9 N O3'        
119.119 
TYR 'L-peptide linking' y TYROSINE                                       ?                               'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                         ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3VAH 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'1.6M Ammonium sulfate, 10% Dioxane, 0.1M MES pH 6.5, Deoxy-Big Chap, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-06-25 
_diffrn_detector.details                'Rh coated Si vertical focus mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Horizontal focusing 5.05? asymmetric cut Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_wavelength_list        0.987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
# 
_reflns.entry_id                     3VAH 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   17610 
_reflns.pdbx_Rmerge_I_obs            0.114 
_reflns.pdbx_netI_over_sigmaI        19.8 
_reflns.pdbx_chi_squared             1.895 
_reflns.pdbx_redundancy              4.600 
_reflns.percent_possible_obs         99.300 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -1.00 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.500 2.590  ? ? ? 0.435 ? ? 1.349 4.400 ? 1714 99.700 1  1 
2.590 2.690  ? ? ? 0.354 ? ? 1.557 4.500 ? 1739 99.700 2  1 
2.690 2.820  ? ? ? 0.300 ? ? 1.629 4.500 ? 1765 99.700 3  1 
2.820 2.960  ? ? ? 0.232 ? ? 1.771 4.700 ? 1727 99.900 4  1 
2.960 3.150  ? ? ? 0.187 ? ? 1.992 4.800 ? 1778 99.600 5  1 
3.150 3.390  ? ? ? 0.136 ? ? 2.005 4.800 ? 1764 99.600 6  1 
3.390 3.730  ? ? ? 0.113 ? ? 2.540 4.600 ? 1755 99.300 7  1 
3.730 4.270  ? ? ? 0.090 ? ? 2.285 4.500 ? 1758 98.800 8  1 
4.270 5.380  ? ? ? 0.075 ? ? 1.983 4.400 ? 1780 98.900 9  1 
5.380 50.000 ? ? ? 0.068 ? ? 1.785 4.300 ? 1830 97.800 10 1 
# 
_refine.entry_id                                 3VAH 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             41.1700 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    94.4200 
_refine.ls_number_reflns_obs                     16939 
_refine.ls_number_reflns_all                     18632 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2035 
_refine.ls_R_factor_R_work                       0.1976 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2592 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 10.0000 
_refine.ls_number_reflns_R_free                  1693 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               34.1778 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.4800 
_refine.aniso_B[2][2]                            -1.8900 
_refine.aniso_B[3][3]                            3.6100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            1.0700 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9390 
_refine.correlation_coeff_Fo_to_Fc_free          0.8960 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.5760 
_refine.pdbx_overall_ESU_R_Free                  0.3120 
_refine.overall_SU_ML                            0.2200 
_refine.overall_SU_B                             18.0820 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                80.500 
_refine.B_iso_min                                14.800 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.400 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2686 
_refine_hist.pdbx_number_atoms_nucleic_acid   208 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             95 
_refine_hist.number_atoms_total               3071 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        41.1700 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d         3147 0.011  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d           2083 0.013  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg      4300 1.361  2.117  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg        5090 0.944  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg   344  5.822  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg   130  32.901 24.923 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg   460  15.765 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg   14   12.267 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr           471  0.069  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined     3238 0.003  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other       557  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_nbd_refined            488  0.229  0.200  ? ? 'X-RAY DIFFRACTION' 
r_nbd_other              1944 0.193  0.200  ? ? 'X-RAY DIFFRACTION' 
r_nbtor_refined          1425 0.184  0.200  ? ? 'X-RAY DIFFRACTION' 
r_nbtor_other            1541 0.083  0.200  ? ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined    78   0.186  0.200  ? ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other      1    0.403  0.200  ? ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined   22   0.240  0.200  ? ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other     40   0.278  0.200  ? ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined 5    0.265  0.200  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it              2207 0.559  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other           712  0.085  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it             2742 0.656  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it              1684 1.232  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it             1558 1.936  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.5000 
_refine_ls_shell.d_res_low                        2.5650 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               74.5300 
_refine_ls_shell.number_reflns_R_work             840 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2740 
_refine_ls_shell.R_factor_R_free                  0.3610 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                942 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3VAH 
_struct.title                     'Structure of U2AF65 variant with BrU3C4 DNA' 
_struct.pdbx_descriptor           'Splicing factor U2AF 65 kDa subunit/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VAH 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'RNA SPLICING FACTOR, RNA RECOGNITION MOTIF, RNA BINDING PROTEIN, RNA BINDING PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 5 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 19  ? GLY A 34  ? THR A 161 GLY A 176 1 ? 16 
HELX_P HELX_P2  2  SER A 62  ? ALA A 69  ? SER A 204 ALA A 211 1 ? 8  
HELX_P HELX_P3  3  MET A 70  ? ASP A 73  ? MET A 212 ASP A 215 5 ? 4  
HELX_P HELX_P4  4  ASN A 109 ? THR A 118 ? ASN A 271 THR A 280 1 ? 10 
HELX_P HELX_P5  5  ASN A 149 ? ASN A 159 ? ASN A 311 ASN A 321 1 ? 11 
HELX_P HELX_P6  6  PRO B 2   ? ALA B 6   ? PRO B 144 ALA B 148 5 ? 5  
HELX_P HELX_P7  7  THR B 19  ? GLY B 34  ? THR B 161 GLY B 176 1 ? 16 
HELX_P HELX_P8  8  SER B 62  ? MET B 70  ? SER B 204 MET B 212 1 ? 9  
HELX_P HELX_P9  9  ALA B 71  ? ASP B 73  ? ALA B 213 ASP B 215 5 ? 3  
HELX_P HELX_P10 10 ASN B 109 ? THR B 118 ? ASN B 271 THR B 280 1 ? 10 
HELX_P HELX_P11 11 SER B 119 ? GLY B 121 ? SER B 281 GLY B 283 5 ? 3  
HELX_P HELX_P12 12 ASP B 147 ? ASN B 149 ? ASP B 309 ASN B 311 5 ? 3  
HELX_P HELX_P13 13 VAL B 150 ? ASN B 159 ? VAL B 312 ASN B 321 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C DU  2 "O3'" A ? ? 1_555 C BRU 3 P A ? E DU  2 E BRU 3 1_555 ? ? ? ? ? ? ? 1.591 ? 
covale2 covale ? ? C DU  2 "O3'" B ? ? 1_555 C BRU 3 P B ? E DU  2 E BRU 3 1_555 ? ? ? ? ? ? ? 1.595 ? 
covale3 covale ? ? C BRU 3 "O3'" A ? ? 1_555 C DC  4 P A ? E BRU 3 E DC  4 1_555 ? ? ? ? ? ? ? 1.595 ? 
covale4 covale ? ? C BRU 3 "O3'" B ? ? 1_555 C DC  4 P B ? E BRU 3 E DC  4 1_555 ? ? ? ? ? ? ? 1.605 ? 
covale5 covale ? ? D DU  2 "O3'" ? ? ? 1_555 D BRU 3 P ? ? P DU  3 P BRU 4 1_555 ? ? ? ? ? ? ? 1.600 ? 
covale6 covale ? ? D BRU 3 "O3'" ? ? ? 1_555 D DC  4 P ? ? P BRU 4 P DC  5 1_555 ? ? ? ? ? ? ? 1.600 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            143 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     144 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 44  ? ASN A 50  ? VAL A 186 ASN A 192 
A 2 PHE A 55  ? PHE A 60  ? PHE A 197 PHE A 202 
A 3 ARG A 8   ? GLY A 12  ? ARG A 150 GLY A 154 
A 4 LYS A 83  ? ARG A 85  ? LYS A 225 ARG A 227 
B 1 ILE A 76  ? PHE A 77  ? ILE A 218 PHE A 219 
B 2 GLN A 80  ? SER A 81  ? GLN A 222 SER A 223 
C 1 LEU A 123 ? LYS A 130 ? LEU A 285 LYS A 292 
C 2 SER A 137 ? TYR A 145 ? SER A 299 TYR A 307 
C 3 LEU A 99  ? GLY A 102 ? LEU A 261 GLY A 264 
C 4 LEU A 169 ? ARG A 172 ? LEU A 331 ARG A 334 
D 1 GLN A 162 ? LEU A 163 ? GLN A 324 LEU A 325 
D 2 LYS A 166 ? LYS A 167 ? LYS A 328 LYS A 329 
E 1 VAL B 44  ? ASN B 50  ? VAL B 186 ASN B 192 
E 2 PHE B 55  ? PHE B 60  ? PHE B 197 PHE B 202 
E 3 ARG B 8   ? GLY B 12  ? ARG B 150 GLY B 154 
E 4 LYS B 83  ? ARG B 85  ? LYS B 225 ARG B 227 
F 1 ILE B 76  ? PHE B 77  ? ILE B 218 PHE B 219 
F 2 GLN B 80  ? SER B 81  ? GLN B 222 SER B 223 
G 1 LEU B 123 ? LYS B 130 ? LEU B 285 LYS B 292 
G 2 SER B 137 ? TYR B 145 ? SER B 299 TYR B 307 
G 3 LEU B 99  ? GLY B 102 ? LEU B 261 GLY B 264 
G 4 LEU B 169 ? ARG B 172 ? LEU B 331 ARG B 334 
H 1 GLN B 162 ? LEU B 163 ? GLN B 324 LEU B 325 
H 2 LYS B 166 ? LYS B 167 ? LYS B 328 LYS B 329 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 45  ? N LEU A 187 O GLU A 59  ? O GLU A 201 
A 2 3 O ALA A 56  ? O ALA A 198 N VAL A 11  ? N VAL A 153 
A 3 4 N GLY A 12  ? N GLY A 154 O LYS A 83  ? O LYS A 225 
B 1 2 N PHE A 77  ? N PHE A 219 O GLN A 80  ? O GLN A 222 
C 1 2 N VAL A 129 ? N VAL A 291 O LYS A 138 ? O LYS A 300 
C 2 3 O CYS A 143 ? O CYS A 305 N LEU A 99  ? N LEU A 261 
C 3 4 N PHE A 100 ? N PHE A 262 O GLN A 171 ? O GLN A 333 
D 1 2 N LEU A 163 ? N LEU A 325 O LYS A 166 ? O LYS A 328 
E 1 2 N ASN B 50  ? N ASN B 192 O PHE B 55  ? O PHE B 197 
E 2 3 O ALA B 56  ? O ALA B 198 N VAL B 11  ? N VAL B 153 
E 3 4 N GLY B 12  ? N GLY B 154 O LYS B 83  ? O LYS B 225 
F 1 2 N PHE B 77  ? N PHE B 219 O GLN B 80  ? O GLN B 222 
G 1 2 N VAL B 129 ? N VAL B 291 O LYS B 138 ? O LYS B 300 
G 2 3 O ALA B 141 ? O ALA B 303 N ILE B 101 ? N ILE B 263 
G 3 4 N PHE B 100 ? N PHE B 262 O GLN B 171 ? O GLN B 333 
H 1 2 N LEU B 163 ? N LEU B 325 O LYS B 166 ? O LYS B 328 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO A 401' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 402' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 403' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DIO B 401' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE DIO B 402' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE DIO B 403' 
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CPQ B 404' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 405' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 406' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 407' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL B 408' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PRO A 2   ? PRO A 144 . ? 1_555 ? 
2  AC1 4 TYR A 90  ? TYR A 232 . ? 1_555 ? 
3  AC1 4 GLN A 91  ? GLN A 233 . ? 1_555 ? 
4  AC1 4 LEU A 163 ? LEU A 325 . ? 1_545 ? 
5  AC2 4 LYS A 83  ? LYS A 225 . ? 1_555 ? 
6  AC2 4 ARG A 85  ? ARG A 227 . ? 1_555 ? 
7  AC2 4 HOH P .   ? HOH A 502 . ? 1_555 ? 
8  AC2 4 HOH P .   ? HOH A 541 . ? 1_555 ? 
9  AC3 3 GLY A 4   ? GLY A 146 . ? 1_555 ? 
10 AC3 3 SER A 5   ? SER A 147 . ? 1_555 ? 
11 AC3 3 HOH P .   ? HOH A 511 . ? 1_555 ? 
12 AC4 4 LYS B 114 ? LYS B 276 . ? 1_555 ? 
13 AC4 4 LEU B 123 ? LEU B 285 . ? 1_555 ? 
14 AC4 4 LYS B 124 ? LYS B 286 . ? 1_555 ? 
15 AC4 4 PHE B 126 ? PHE B 288 . ? 1_555 ? 
16 AC5 1 HIS B 97  ? HIS B 259 . ? 1_545 ? 
17 AC6 5 ASN B 106 ? ASN B 268 . ? 1_555 ? 
18 AC6 5 GLY B 135 ? GLY B 297 . ? 1_555 ? 
19 AC6 5 LEU B 136 ? LEU B 298 . ? 1_555 ? 
20 AC6 5 SER B 137 ? SER B 299 . ? 1_555 ? 
21 AC6 5 HOH Q .   ? HOH B 523 . ? 2_555 ? 
22 AC7 2 TYR B 107 ? TYR B 269 . ? 2_555 ? 
23 AC7 2 GLY B 164 ? GLY B 326 . ? 1_555 ? 
24 AC8 4 ARG B 7   ? ARG B 149 . ? 1_555 ? 
25 AC8 4 VAL B 63  ? VAL B 205 . ? 1_555 ? 
26 AC8 4 HOH Q .   ? HOH B 507 . ? 1_555 ? 
27 AC8 4 HOH Q .   ? HOH B 529 . ? 1_555 ? 
28 AC9 3 LYS B 83  ? LYS B 225 . ? 1_555 ? 
29 AC9 3 ARG B 85  ? ARG B 227 . ? 1_555 ? 
30 AC9 3 HOH R .   ? HOH E 101 . ? 1_555 ? 
31 BC1 3 MET B 70  ? MET B 212 . ? 1_555 ? 
32 BC1 3 ARG B 86  ? ARG B 228 . ? 1_555 ? 
33 BC1 3 TYR B 90  ? TYR B 232 . ? 1_555 ? 
34 BC2 4 ALA B 39  ? ALA B 181 . ? 1_565 ? 
35 BC2 4 ARG B 172 ? ARG B 334 . ? 1_555 ? 
36 BC2 4 HOH Q .   ? HOH B 513 . ? 1_555 ? 
37 BC2 4 HOH Q .   ? HOH B 530 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3VAH 
_atom_sites.fract_transf_matrix[1][1]   0.006015 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004308 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026807 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012141 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -25.278 -18.177 19.962 1.00 40.03 ? 143 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -26.019 -19.401 20.419 1.00 40.17 ? 143 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -27.231 -19.785 19.587 1.00 42.51 ? 143 GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -27.080 -20.381 18.516 1.00 43.93 ? 143 GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? -28.454 -19.478 20.066 1.00 43.90 ? 144 PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? -28.824 -18.822 21.338 1.00 43.05 ? 144 PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? -28.352 -19.573 22.588 1.00 41.01 ? 144 PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? -28.025 -18.937 23.605 1.00 39.79 ? 144 PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? -30.359 -18.771 21.291 1.00 45.69 ? 144 PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? -30.723 -18.972 19.833 1.00 48.16 ? 144 PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? -29.642 -19.822 19.253 1.00 46.64 ? 144 PRO A CD    1 
ATOM   12   N  N     . LEU A 1 3   ? -28.294 -20.905 22.506 1.00 40.81 ? 145 LEU A N     1 
ATOM   13   C  CA    . LEU A 1 3   ? -27.808 -21.729 23.621 1.00 38.82 ? 145 LEU A CA    1 
ATOM   14   C  C     . LEU A 1 3   ? -26.326 -22.162 23.528 1.00 36.78 ? 145 LEU A C     1 
ATOM   15   O  O     . LEU A 1 3   ? -25.778 -22.705 24.478 1.00 35.60 ? 145 LEU A O     1 
ATOM   16   C  CB    . LEU A 1 3   ? -28.722 -22.942 23.790 1.00 40.08 ? 145 LEU A CB    1 
ATOM   17   C  CG    . LEU A 1 3   ? -30.147 -22.603 24.250 1.00 41.51 ? 145 LEU A CG    1 
ATOM   18   C  CD1   . LEU A 1 3   ? -30.965 -23.872 24.457 1.00 43.76 ? 145 LEU A CD1   1 
ATOM   19   C  CD2   . LEU A 1 3   ? -30.159 -21.794 25.528 1.00 39.41 ? 145 LEU A CD2   1 
ATOM   20   N  N     . GLY A 1 4   ? -25.683 -21.913 22.395 1.00 36.91 ? 146 GLY A N     1 
ATOM   21   C  CA    . GLY A 1 4   ? -24.264 -22.219 22.214 1.00 35.23 ? 146 GLY A CA    1 
ATOM   22   C  C     . GLY A 1 4   ? -23.294 -21.485 23.131 1.00 32.98 ? 146 GLY A C     1 
ATOM   23   O  O     . GLY A 1 4   ? -23.648 -20.481 23.752 1.00 33.04 ? 146 GLY A O     1 
ATOM   24   N  N     . SER A 1 5   ? -22.082 -22.039 23.225 1.00 31.34 ? 147 SER A N     1 
ATOM   25   C  CA    . SER A 1 5   ? -20.927 -21.468 23.931 1.00 29.33 ? 147 SER A CA    1 
ATOM   26   C  C     . SER A 1 5   ? -21.156 -21.188 25.428 1.00 28.09 ? 147 SER A C     1 
ATOM   27   O  O     . SER A 1 5   ? -20.560 -20.280 26.007 1.00 26.88 ? 147 SER A O     1 
ATOM   28   C  CB    . SER A 1 5   ? -20.421 -20.221 23.190 1.00 29.17 ? 147 SER A CB    1 
ATOM   29   O  OG    . SER A 1 5   ? -20.033 -20.533 21.853 1.00 30.01 ? 147 SER A OG    1 
ATOM   30   N  N     . ALA A 1 6   ? -21.980 -22.014 26.058 1.00 28.30 ? 148 ALA A N     1 
ATOM   31   C  CA    . ALA A 1 6   ? -22.317 -21.846 27.466 1.00 27.72 ? 148 ALA A CA    1 
ATOM   32   C  C     . ALA A 1 6   ? -21.223 -22.287 28.455 1.00 26.28 ? 148 ALA A C     1 
ATOM   33   O  O     . ALA A 1 6   ? -21.276 -21.896 29.619 1.00 25.28 ? 148 ALA A O     1 
ATOM   34   C  CB    . ALA A 1 6   ? -23.610 -22.583 27.766 1.00 28.58 ? 148 ALA A CB    1 
ATOM   35   N  N     . ARG A 1 7   ? -20.258 -23.095 28.008 1.00 26.18 ? 149 ARG A N     1 
ATOM   36   C  CA    . ARG A 1 7   ? -19.244 -23.671 28.905 1.00 25.89 ? 149 ARG A CA    1 
ATOM   37   C  C     . ARG A 1 7   ? -17.779 -23.432 28.449 1.00 25.50 ? 149 ARG A C     1 
ATOM   38   O  O     . ARG A 1 7   ? -16.890 -24.274 28.618 1.00 25.71 ? 149 ARG A O     1 
ATOM   39   C  CB    . ARG A 1 7   ? -19.535 -25.158 29.090 1.00 26.62 ? 149 ARG A CB    1 
ATOM   40   C  CG    . ARG A 1 7   ? -20.706 -25.398 30.025 1.00 27.92 ? 149 ARG A CG    1 
ATOM   41   C  CD    . ARG A 1 7   ? -21.322 -26.771 29.888 1.00 30.02 ? 149 ARG A CD    1 
ATOM   42   N  NE    . ARG A 1 7   ? -20.333 -27.831 29.694 1.00 31.31 ? 149 ARG A NE    1 
ATOM   43   C  CZ    . ARG A 1 7   ? -20.211 -28.579 28.608 1.00 32.27 ? 149 ARG A CZ    1 
ATOM   44   N  NH1   . ARG A 1 7   ? -21.017 -28.441 27.582 1.00 35.08 ? 149 ARG A NH1   1 
ATOM   45   N  NH2   . ARG A 1 7   ? -19.277 -29.506 28.555 1.00 35.45 ? 149 ARG A NH2   1 
ATOM   46   N  N     . ARG A 1 8   ? -17.531 -22.258 27.897 1.00 25.06 ? 150 ARG A N     1 
ATOM   47   C  CA    . ARG A 1 8   ? -16.222 -21.928 27.369 1.00 24.63 ? 150 ARG A CA    1 
ATOM   48   C  C     . ARG A 1 8   ? -15.966 -20.458 27.633 1.00 23.09 ? 150 ARG A C     1 
ATOM   49   O  O     . ARG A 1 8   ? -16.883 -19.661 27.557 1.00 22.89 ? 150 ARG A O     1 
ATOM   50   C  CB    . ARG A 1 8   ? -16.156 -22.202 25.852 1.00 25.86 ? 150 ARG A CB    1 
ATOM   51   C  CG    . ARG A 1 8   ? -16.295 -23.663 25.449 1.00 28.32 ? 150 ARG A CG    1 
ATOM   52   C  CD    . ARG A 1 8   ? -16.461 -23.828 23.919 1.00 30.37 ? 150 ARG A CD    1 
ATOM   53   N  NE    . ARG A 1 8   ? -15.308 -23.306 23.177 1.00 32.11 ? 150 ARG A NE    1 
ATOM   54   C  CZ    . ARG A 1 8   ? -14.196 -24.011 22.932 1.00 34.31 ? 150 ARG A CZ    1 
ATOM   55   N  NH1   . ARG A 1 8   ? -14.062 -25.268 23.372 1.00 35.64 ? 150 ARG A NH1   1 
ATOM   56   N  NH2   . ARG A 1 8   ? -13.196 -23.465 22.253 1.00 33.27 ? 150 ARG A NH2   1 
ATOM   57   N  N     . LEU A 1 9   ? -14.714 -20.120 27.933 1.00 22.17 ? 151 LEU A N     1 
ATOM   58   C  CA    . LEU A 1 9   ? -14.283 -18.748 28.134 1.00 21.19 ? 151 LEU A CA    1 
ATOM   59   C  C     . LEU A 1 9   ? -13.029 -18.527 27.321 1.00 21.26 ? 151 LEU A C     1 
ATOM   60   O  O     . LEU A 1 9   ? -12.216 -19.442 27.166 1.00 21.73 ? 151 LEU A O     1 
ATOM   61   C  CB    . LEU A 1 9   ? -13.960 -18.491 29.611 1.00 20.38 ? 151 LEU A CB    1 
ATOM   62   C  CG    . LEU A 1 9   ? -15.115 -18.588 30.602 1.00 19.92 ? 151 LEU A CG    1 
ATOM   63   C  CD1   . LEU A 1 9   ? -14.634 -18.253 32.006 1.00 18.90 ? 151 LEU A CD1   1 
ATOM   64   C  CD2   . LEU A 1 9   ? -16.238 -17.677 30.183 1.00 19.31 ? 151 LEU A CD2   1 
ATOM   65   N  N     . TYR A 1 10  ? -12.877 -17.308 26.810 1.00 21.07 ? 152 TYR A N     1 
ATOM   66   C  CA    . TYR A 1 10  ? -11.650 -16.862 26.129 1.00 21.06 ? 152 TYR A CA    1 
ATOM   67   C  C     . TYR A 1 10  ? -10.667 -16.328 27.175 1.00 20.28 ? 152 TYR A C     1 
ATOM   68   O  O     . TYR A 1 10  ? -11.058 -15.583 28.070 1.00 19.41 ? 152 TYR A O     1 
ATOM   69   C  CB    . TYR A 1 10  ? -11.983 -15.766 25.107 1.00 21.46 ? 152 TYR A CB    1 
ATOM   70   C  CG    . TYR A 1 10  ? -10.799 -14.982 24.590 1.00 21.78 ? 152 TYR A CG    1 
ATOM   71   C  CD1   . TYR A 1 10  ? -10.429 -13.780 25.180 1.00 21.95 ? 152 TYR A CD1   1 
ATOM   72   C  CD2   . TYR A 1 10  ? -10.071 -15.427 23.505 1.00 21.78 ? 152 TYR A CD2   1 
ATOM   73   C  CE1   . TYR A 1 10  ? -9.353  -13.059 24.718 1.00 22.14 ? 152 TYR A CE1   1 
ATOM   74   C  CE2   . TYR A 1 10  ? -8.995  -14.705 23.016 1.00 23.01 ? 152 TYR A CE2   1 
ATOM   75   C  CZ    . TYR A 1 10  ? -8.642  -13.521 23.630 1.00 23.15 ? 152 TYR A CZ    1 
ATOM   76   O  OH    . TYR A 1 10  ? -7.568  -12.808 23.183 1.00 22.99 ? 152 TYR A OH    1 
ATOM   77   N  N     . VAL A 1 11  ? -9.400  -16.725 27.060 1.00 20.54 ? 153 VAL A N     1 
ATOM   78   C  CA    . VAL A 1 11  ? -8.340  -16.243 27.942 1.00 20.50 ? 153 VAL A CA    1 
ATOM   79   C  C     . VAL A 1 11  ? -7.227  -15.614 27.090 1.00 21.84 ? 153 VAL A C     1 
ATOM   80   O  O     . VAL A 1 11  ? -6.493  -16.316 26.391 1.00 22.74 ? 153 VAL A O     1 
ATOM   81   C  CB    . VAL A 1 11  ? -7.753  -17.371 28.834 1.00 20.41 ? 153 VAL A CB    1 
ATOM   82   C  CG1   . VAL A 1 11  ? -6.826  -16.789 29.923 1.00 18.19 ? 153 VAL A CG1   1 
ATOM   83   C  CG2   . VAL A 1 11  ? -8.875  -18.182 29.466 1.00 19.42 ? 153 VAL A CG2   1 
ATOM   84   N  N     . GLY A 1 12  ? -7.109  -14.289 27.165 1.00 22.17 ? 154 GLY A N     1 
ATOM   85   C  CA    . GLY A 1 12  ? -6.078  -13.556 26.458 1.00 23.19 ? 154 GLY A CA    1 
ATOM   86   C  C     . GLY A 1 12  ? -4.868  -13.281 27.312 1.00 23.73 ? 154 GLY A C     1 
ATOM   87   O  O     . GLY A 1 12  ? -4.948  -13.315 28.547 1.00 22.99 ? 154 GLY A O     1 
ATOM   88   N  N     . ASN A 1 13  ? -3.749  -13.016 26.632 1.00 25.22 ? 155 ASN A N     1 
ATOM   89   C  CA    . ASN A 1 13  ? -2.477  -12.636 27.254 1.00 26.51 ? 155 ASN A CA    1 
ATOM   90   C  C     . ASN A 1 13  ? -1.798  -13.763 28.060 1.00 27.17 ? 155 ASN A C     1 
ATOM   91   O  O     . ASN A 1 13  ? -1.238  -13.531 29.118 1.00 27.43 ? 155 ASN A O     1 
ATOM   92   C  CB    . ASN A 1 13  ? -2.671  -11.388 28.128 1.00 26.32 ? 155 ASN A CB    1 
ATOM   93   C  CG    . ASN A 1 13  ? -1.379  -10.610 28.351 1.00 27.61 ? 155 ASN A CG    1 
ATOM   94   O  OD1   . ASN A 1 13  ? -0.478  -10.634 27.518 1.00 27.94 ? 155 ASN A OD1   1 
ATOM   95   N  ND2   . ASN A 1 13  ? -1.290  -9.914  29.487 1.00 27.14 ? 155 ASN A ND2   1 
ATOM   96   N  N     . ILE A 1 14  ? -1.825  -14.986 27.543 1.00 27.84 ? 156 ILE A N     1 
ATOM   97   C  CA    . ILE A 1 14  ? -1.148  -16.073 28.221 1.00 28.72 ? 156 ILE A CA    1 
ATOM   98   C  C     . ILE A 1 14  ? 0.364   -15.986 27.988 1.00 31.32 ? 156 ILE A C     1 
ATOM   99   O  O     . ILE A 1 14  ? 0.805   -15.578 26.908 1.00 32.56 ? 156 ILE A O     1 
ATOM   100  C  CB    . ILE A 1 14  ? -1.697  -17.478 27.801 1.00 28.81 ? 156 ILE A CB    1 
ATOM   101  C  CG1   . ILE A 1 14  ? -1.203  -17.885 26.415 1.00 29.70 ? 156 ILE A CG1   1 
ATOM   102  C  CG2   . ILE A 1 14  ? -3.240  -17.528 27.885 1.00 26.08 ? 156 ILE A CG2   1 
ATOM   103  C  CD1   . ILE A 1 14  ? -1.917  -19.074 25.870 1.00 29.51 ? 156 ILE A CD1   1 
ATOM   104  N  N     . PRO A 1 15  ? 1.165   -16.379 28.996 1.00 32.68 ? 157 PRO A N     1 
ATOM   105  C  CA    . PRO A 1 15  ? 2.629   -16.415 28.848 1.00 35.18 ? 157 PRO A CA    1 
ATOM   106  C  C     . PRO A 1 15  ? 3.062   -17.443 27.809 1.00 37.24 ? 157 PRO A C     1 
ATOM   107  O  O     . PRO A 1 15  ? 2.479   -18.522 27.744 1.00 37.68 ? 157 PRO A O     1 
ATOM   108  C  CB    . PRO A 1 15  ? 3.123   -16.830 30.240 1.00 35.51 ? 157 PRO A CB    1 
ATOM   109  C  CG    . PRO A 1 15  ? 1.984   -17.503 30.883 1.00 33.81 ? 157 PRO A CG    1 
ATOM   110  C  CD    . PRO A 1 15  ? 0.737   -16.845 30.328 1.00 32.10 ? 157 PRO A CD    1 
ATOM   111  N  N     . PHE A 1 16  ? 4.066   -17.113 27.004 1.00 39.60 ? 158 PHE A N     1 
ATOM   112  C  CA    . PHE A 1 16  ? 4.514   -18.015 25.948 1.00 41.63 ? 158 PHE A CA    1 
ATOM   113  C  C     . PHE A 1 16  ? 5.203   -19.238 26.564 1.00 43.56 ? 158 PHE A C     1 
ATOM   114  O  O     . PHE A 1 16  ? 5.835   -19.138 27.612 1.00 44.16 ? 158 PHE A O     1 
ATOM   115  C  CB    . PHE A 1 16  ? 5.472   -17.287 25.005 1.00 44.04 ? 158 PHE A CB    1 
ATOM   116  C  CG    . PHE A 1 16  ? 5.920   -18.111 23.811 1.00 46.69 ? 158 PHE A CG    1 
ATOM   117  C  CD1   . PHE A 1 16  ? 5.095   -18.258 22.690 1.00 47.05 ? 158 PHE A CD1   1 
ATOM   118  C  CD2   . PHE A 1 16  ? 7.180   -18.722 23.799 1.00 50.85 ? 158 PHE A CD2   1 
ATOM   119  C  CE1   . PHE A 1 16  ? 5.522   -19.006 21.575 1.00 49.20 ? 158 PHE A CE1   1 
ATOM   120  C  CE2   . PHE A 1 16  ? 7.615   -19.478 22.691 1.00 52.57 ? 158 PHE A CE2   1 
ATOM   121  C  CZ    . PHE A 1 16  ? 6.787   -19.620 21.584 1.00 51.91 ? 158 PHE A CZ    1 
ATOM   122  N  N     . GLY A 1 17  ? 5.054   -20.390 25.916 1.00 44.63 ? 159 GLY A N     1 
ATOM   123  C  CA    . GLY A 1 17  ? 5.680   -21.630 26.365 1.00 46.62 ? 159 GLY A CA    1 
ATOM   124  C  C     . GLY A 1 17  ? 4.814   -22.447 27.311 1.00 45.18 ? 159 GLY A C     1 
ATOM   125  O  O     . GLY A 1 17  ? 5.046   -23.645 27.486 1.00 46.93 ? 159 GLY A O     1 
ATOM   126  N  N     . ILE A 1 18  ? 3.807   -21.812 27.911 1.00 42.08 ? 160 ILE A N     1 
ATOM   127  C  CA    . ILE A 1 18  ? 3.026   -22.450 28.958 1.00 40.63 ? 160 ILE A CA    1 
ATOM   128  C  C     . ILE A 1 18  ? 2.263   -23.639 28.379 1.00 40.77 ? 160 ILE A C     1 
ATOM   129  O  O     . ILE A 1 18  ? 1.876   -23.609 27.216 1.00 41.10 ? 160 ILE A O     1 
ATOM   130  C  CB    . ILE A 1 18  ? 2.067   -21.436 29.616 1.00 37.94 ? 160 ILE A CB    1 
ATOM   131  C  CG1   . ILE A 1 18  ? 1.688   -21.897 31.025 1.00 37.87 ? 160 ILE A CG1   1 
ATOM   132  C  CG2   . ILE A 1 18  ? 0.858   -21.194 28.751 1.00 35.70 ? 160 ILE A CG2   1 
ATOM   133  C  CD1   . ILE A 1 18  ? 2.877   -21.834 32.002 1.00 39.99 ? 160 ILE A CD1   1 
ATOM   134  N  N     . THR A 1 19  ? 2.079   -24.692 29.171 1.00 41.13 ? 161 THR A N     1 
ATOM   135  C  CA    . THR A 1 19  ? 1.400   -25.898 28.700 1.00 41.81 ? 161 THR A CA    1 
ATOM   136  C  C     . THR A 1 19  ? -0.090  -25.876 29.001 1.00 39.28 ? 161 THR A C     1 
ATOM   137  O  O     . THR A 1 19  ? -0.569  -25.071 29.813 1.00 36.99 ? 161 THR A O     1 
ATOM   138  C  CB    . THR A 1 19  ? 1.957   -27.164 29.363 1.00 44.51 ? 161 THR A CB    1 
ATOM   139  O  OG1   . THR A 1 19  ? 1.607   -27.160 30.756 1.00 42.86 ? 161 THR A OG1   1 
ATOM   140  C  CG2   . THR A 1 19  ? 3.481   -27.259 29.174 1.00 46.92 ? 161 THR A CG2   1 
ATOM   141  N  N     . GLU A 1 20  ? -0.811  -26.786 28.348 1.00 39.82 ? 162 GLU A N     1 
ATOM   142  C  CA    . GLU A 1 20  ? -2.240  -26.970 28.593 1.00 38.20 ? 162 GLU A CA    1 
ATOM   143  C  C     . GLU A 1 20  ? -2.458  -27.526 30.003 1.00 37.78 ? 162 GLU A C     1 
ATOM   144  O  O     . GLU A 1 20  ? -3.432  -27.177 30.674 1.00 35.71 ? 162 GLU A O     1 
ATOM   145  C  CB    . GLU A 1 20  ? -2.883  -27.831 27.481 1.00 39.09 ? 162 GLU A CB    1 
ATOM   146  C  CG    . GLU A 1 20  ? -2.966  -27.016 26.159 1.00 40.17 ? 162 GLU A CG    1 
ATOM   147  C  CD    . GLU A 1 20  ? -3.403  -27.778 24.885 1.00 41.81 ? 162 GLU A CD    1 
ATOM   148  O  OE1   . GLU A 1 20  ? -3.380  -29.038 24.855 1.00 45.90 ? 162 GLU A OE1   1 
ATOM   149  O  OE2   . GLU A 1 20  ? -3.748  -27.077 23.891 1.00 40.85 ? 162 GLU A OE2   1 
ATOM   150  N  N     . GLU A 1 21  ? -1.512  -28.333 30.469 1.00 39.95 ? 163 GLU A N     1 
ATOM   151  C  CA    . GLU A 1 21  ? -1.566  -28.903 31.806 1.00 40.65 ? 163 GLU A CA    1 
ATOM   152  C  C     . GLU A 1 21  ? -1.384  -27.837 32.898 1.00 38.77 ? 163 GLU A C     1 
ATOM   153  O  O     . GLU A 1 21  ? -2.175  -27.764 33.853 1.00 36.94 ? 163 GLU A O     1 
ATOM   154  C  CB    . GLU A 1 21  ? -0.496  -29.986 31.952 1.00 44.05 ? 163 GLU A CB    1 
ATOM   155  C  CG    . GLU A 1 21  ? -0.914  -31.118 32.862 1.00 46.56 ? 163 GLU A CG    1 
ATOM   156  C  CD    . GLU A 1 21  ? 0.250   -31.982 33.331 1.00 50.48 ? 163 GLU A CD    1 
ATOM   157  O  OE1   . GLU A 1 21  ? 0.360   -32.173 34.565 1.00 53.85 ? 163 GLU A OE1   1 
ATOM   158  O  OE2   . GLU A 1 21  ? 1.048   -32.462 32.483 1.00 55.31 ? 163 GLU A OE2   1 
ATOM   159  N  N     . ALA A 1 22  ? -0.344  -27.014 32.746 1.00 39.12 ? 164 ALA A N     1 
ATOM   160  C  CA    . ALA A 1 22  ? -0.003  -25.985 33.735 1.00 38.17 ? 164 ALA A CA    1 
ATOM   161  C  C     . ALA A 1 22  ? -1.116  -24.953 33.878 1.00 35.38 ? 164 ALA A C     1 
ATOM   162  O  O     . ALA A 1 22  ? -1.389  -24.461 34.977 1.00 34.34 ? 164 ALA A O     1 
ATOM   163  C  CB    . ALA A 1 22  ? 1.291   -25.296 33.357 1.00 38.97 ? 164 ALA A CB    1 
ATOM   164  N  N     . MET A 1 23  ? -1.745  -24.619 32.756 1.00 34.62 ? 165 MET A N     1 
ATOM   165  C  CA    . MET A 1 23  ? -2.856  -23.675 32.745 1.00 32.39 ? 165 MET A CA    1 
ATOM   166  C  C     . MET A 1 23  ? -4.083  -24.304 33.387 1.00 30.66 ? 165 MET A C     1 
ATOM   167  O  O     . MET A 1 23  ? -4.820  -23.630 34.099 1.00 28.95 ? 165 MET A O     1 
ATOM   168  C  CB    . MET A 1 23  ? -3.149  -23.220 31.308 1.00 31.82 ? 165 MET A CB    1 
ATOM   169  C  CG    . MET A 1 23  ? -4.312  -22.245 31.194 1.00 31.02 ? 165 MET A CG    1 
ATOM   170  S  SD    . MET A 1 23  ? -3.963  -20.747 30.228 1.00 34.56 ? 165 MET A SD    1 
ATOM   171  C  CE    . MET A 1 23  ? -2.647  -20.026 31.219 1.00 35.49 ? 165 MET A CE    1 
ATOM   172  N  N     . MET A 1 24  ? -4.283  -25.598 33.145 1.00 31.35 ? 166 MET A N     1 
ATOM   173  C  CA    . MET A 1 24  ? -5.371  -26.342 33.775 1.00 31.04 ? 166 MET A CA    1 
ATOM   174  C  C     . MET A 1 24  ? -5.222  -26.389 35.297 1.00 30.50 ? 166 MET A C     1 
ATOM   175  O  O     . MET A 1 24  ? -6.172  -26.119 36.026 1.00 29.10 ? 166 MET A O     1 
ATOM   176  C  CB    . MET A 1 24  ? -5.431  -27.776 33.223 1.00 33.02 ? 166 MET A CB    1 
ATOM   177  C  CG    . MET A 1 24  ? -6.773  -28.451 33.384 1.00 32.63 ? 166 MET A CG    1 
ATOM   178  S  SD    . MET A 1 24  ? -6.983  -29.856 32.273 1.00 35.38 ? 166 MET A SD    1 
ATOM   179  C  CE    . MET A 1 24  ? -5.883  -31.060 33.008 1.00 39.28 ? 166 MET A CE    1 
ATOM   180  N  N     . ASP A 1 25  ? -4.030  -26.738 35.766 1.00 31.97 ? 167 ASP A N     1 
ATOM   181  C  CA    . ASP A 1 25  ? -3.764  -26.818 37.203 1.00 32.64 ? 167 ASP A CA    1 
ATOM   182  C  C     . ASP A 1 25  ? -3.990  -25.472 37.867 1.00 30.43 ? 167 ASP A C     1 
ATOM   183  O  O     . ASP A 1 25  ? -4.533  -25.408 38.967 1.00 29.57 ? 167 ASP A O     1 
ATOM   184  C  CB    . ASP A 1 25  ? -2.318  -27.254 37.488 1.00 35.37 ? 167 ASP A CB    1 
ATOM   185  C  CG    . ASP A 1 25  ? -2.046  -28.700 37.112 1.00 39.34 ? 167 ASP A CG    1 
ATOM   186  O  OD1   . ASP A 1 25  ? -3.004  -29.500 36.987 1.00 41.28 ? 167 ASP A OD1   1 
ATOM   187  O  OD2   . ASP A 1 25  ? -0.851  -29.042 36.952 1.00 44.06 ? 167 ASP A OD2   1 
ATOM   188  N  N     . PHE A 1 26  ? -3.564  -24.403 37.200 1.00 29.08 ? 168 PHE A N     1 
ATOM   189  C  CA    . PHE A 1 26  ? -3.684  -23.081 37.779 1.00 28.12 ? 168 PHE A CA    1 
ATOM   190  C  C     . PHE A 1 26  ? -5.133  -22.688 38.015 1.00 26.35 ? 168 PHE A C     1 
ATOM   191  O  O     . PHE A 1 26  ? -5.472  -22.217 39.099 1.00 26.23 ? 168 PHE A O     1 
ATOM   192  C  CB    . PHE A 1 26  ? -3.006  -22.036 36.916 1.00 27.62 ? 168 PHE A CB    1 
ATOM   193  C  CG    . PHE A 1 26  ? -3.039  -20.661 37.511 1.00 26.83 ? 168 PHE A CG    1 
ATOM   194  C  CD1   . PHE A 1 26  ? -2.283  -20.365 38.629 1.00 28.10 ? 168 PHE A CD1   1 
ATOM   195  C  CD2   . PHE A 1 26  ? -3.834  -19.668 36.961 1.00 25.64 ? 168 PHE A CD2   1 
ATOM   196  C  CE1   . PHE A 1 26  ? -2.304  -19.108 39.182 1.00 27.39 ? 168 PHE A CE1   1 
ATOM   197  C  CE2   . PHE A 1 26  ? -3.861  -18.408 37.514 1.00 25.31 ? 168 PHE A CE2   1 
ATOM   198  C  CZ    . PHE A 1 26  ? -3.095  -18.132 38.630 1.00 26.24 ? 168 PHE A CZ    1 
ATOM   199  N  N     . PHE A 1 27  ? -5.977  -22.893 37.009 1.00 25.46 ? 169 PHE A N     1 
ATOM   200  C  CA    . PHE A 1 27  ? -7.384  -22.509 37.105 1.00 24.55 ? 169 PHE A CA    1 
ATOM   201  C  C     . PHE A 1 27  ? -8.204  -23.406 37.994 1.00 24.55 ? 169 PHE A C     1 
ATOM   202  O  O     . PHE A 1 27  ? -9.182  -22.960 38.604 1.00 23.51 ? 169 PHE A O     1 
ATOM   203  C  CB    . PHE A 1 27  ? -8.038  -22.467 35.730 1.00 24.39 ? 169 PHE A CB    1 
ATOM   204  C  CG    . PHE A 1 27  ? -7.829  -21.186 35.032 1.00 23.45 ? 169 PHE A CG    1 
ATOM   205  C  CD1   . PHE A 1 27  ? -8.641  -20.119 35.304 1.00 23.13 ? 169 PHE A CD1   1 
ATOM   206  C  CD2   . PHE A 1 27  ? -6.793  -21.036 34.126 1.00 24.33 ? 169 PHE A CD2   1 
ATOM   207  C  CE1   . PHE A 1 27  ? -8.433  -18.910 34.671 1.00 23.82 ? 169 PHE A CE1   1 
ATOM   208  C  CE2   . PHE A 1 27  ? -6.582  -19.840 33.486 1.00 24.06 ? 169 PHE A CE2   1 
ATOM   209  C  CZ    . PHE A 1 27  ? -7.402  -18.770 33.759 1.00 23.03 ? 169 PHE A CZ    1 
ATOM   210  N  N     . ASN A 1 28  ? -7.830  -24.674 38.051 1.00 25.38 ? 170 ASN A N     1 
ATOM   211  C  CA    . ASN A 1 28  ? -8.492  -25.571 38.978 1.00 25.98 ? 170 ASN A CA    1 
ATOM   212  C  C     . ASN A 1 28  ? -8.130  -25.200 40.414 1.00 26.28 ? 170 ASN A C     1 
ATOM   213  O  O     . ASN A 1 28  ? -8.988  -25.182 41.280 1.00 26.19 ? 170 ASN A O     1 
ATOM   214  C  CB    . ASN A 1 28  ? -8.197  -27.039 38.629 1.00 27.53 ? 170 ASN A CB    1 
ATOM   215  C  CG    . ASN A 1 28  ? -9.160  -27.591 37.553 1.00 27.73 ? 170 ASN A CG    1 
ATOM   216  O  OD1   . ASN A 1 28  ? -10.280 -27.093 37.389 1.00 26.28 ? 170 ASN A OD1   1 
ATOM   217  N  ND2   . ASN A 1 28  ? -8.720  -28.606 36.823 1.00 28.32 ? 170 ASN A ND2   1 
ATOM   218  N  N     . ALA A 1 29  ? -6.872  -24.836 40.642 1.00 26.92 ? 171 ALA A N     1 
ATOM   219  C  CA    . ALA A 1 29  ? -6.414  -24.430 41.962 1.00 27.65 ? 171 ALA A CA    1 
ATOM   220  C  C     . ALA A 1 29  ? -7.122  -23.143 42.403 1.00 26.56 ? 171 ALA A C     1 
ATOM   221  O  O     . ALA A 1 29  ? -7.603  -23.055 43.538 1.00 26.79 ? 171 ALA A O     1 
ATOM   222  C  CB    . ALA A 1 29  ? -4.912  -24.250 41.971 1.00 28.44 ? 171 ALA A CB    1 
ATOM   223  N  N     . GLN A 1 30  ? -7.223  -22.167 41.506 1.00 25.15 ? 172 GLN A N     1 
ATOM   224  C  CA    . GLN A 1 30  ? -7.846  -20.890 41.859 1.00 24.73 ? 172 GLN A CA    1 
ATOM   225  C  C     . GLN A 1 30  ? -9.339  -20.988 42.164 1.00 24.37 ? 172 GLN A C     1 
ATOM   226  O  O     . GLN A 1 30  ? -9.812  -20.367 43.112 1.00 24.32 ? 172 GLN A O     1 
ATOM   227  C  CB    . GLN A 1 30  ? -7.618  -19.851 40.766 1.00 23.88 ? 172 GLN A CB    1 
ATOM   228  C  CG    . GLN A 1 30  ? -6.174  -19.394 40.641 1.00 25.33 ? 172 GLN A CG    1 
ATOM   229  C  CD    . GLN A 1 30  ? -5.679  -18.614 41.846 1.00 26.10 ? 172 GLN A CD    1 
ATOM   230  O  OE1   . GLN A 1 30  ? -6.408  -18.395 42.806 1.00 27.04 ? 172 GLN A OE1   1 
ATOM   231  N  NE2   . GLN A 1 30  ? -4.432  -18.193 41.794 1.00 26.89 ? 172 GLN A NE2   1 
ATOM   232  N  N     . MET A 1 31  ? -10.071 -21.767 41.371 1.00 24.13 ? 173 MET A N     1 
ATOM   233  C  CA    . MET A 1 31  ? -11.468 -22.063 41.665 1.00 24.38 ? 173 MET A CA    1 
ATOM   234  C  C     . MET A 1 31  ? -11.642 -22.598 43.091 1.00 25.67 ? 173 MET A C     1 
ATOM   235  O  O     . MET A 1 31  ? -12.602 -22.223 43.766 1.00 25.52 ? 173 MET A O     1 
ATOM   236  C  CB    . MET A 1 31  ? -12.049 -23.053 40.647 1.00 24.58 ? 173 MET A CB    1 
ATOM   237  C  CG    . MET A 1 31  ? -12.276 -22.488 39.206 1.00 24.39 ? 173 MET A CG    1 
ATOM   238  S  SD    . MET A 1 31  ? -13.782 -21.453 39.002 1.00 29.06 ? 173 MET A SD    1 
ATOM   239  C  CE    . MET A 1 31  ? -15.128 -22.642 39.135 1.00 24.05 ? 173 MET A CE    1 
ATOM   240  N  N     . ARG A 1 32  ? -10.720 -23.447 43.563 1.00 26.71 ? 174 ARG A N     1 
ATOM   241  C  CA    . ARG A 1 32  ? -10.853 -24.022 44.907 1.00 28.80 ? 174 ARG A CA    1 
ATOM   242  C  C     . ARG A 1 32  ? -10.518 -23.021 46.005 1.00 28.85 ? 174 ARG A C     1 
ATOM   243  O  O     . ARG A 1 32  ? -11.273 -22.858 46.962 1.00 29.36 ? 174 ARG A O     1 
ATOM   244  C  CB    . ARG A 1 32  ? -9.949  -25.236 45.098 1.00 30.86 ? 174 ARG A CB    1 
ATOM   245  C  CG    . ARG A 1 32  ? -10.284 -26.446 44.237 1.00 32.70 ? 174 ARG A CG    1 
ATOM   246  C  CD    . ARG A 1 32  ? -9.524  -27.676 44.750 1.00 35.44 ? 174 ARG A CD    1 
ATOM   247  N  NE    . ARG A 1 32  ? -9.677  -28.844 43.870 1.00 38.73 ? 174 ARG A NE    1 
ATOM   248  C  CZ    . ARG A 1 32  ? -8.776  -29.259 42.970 1.00 41.06 ? 174 ARG A CZ    1 
ATOM   249  N  NH1   . ARG A 1 32  ? -7.615  -28.618 42.791 1.00 41.71 ? 174 ARG A NH1   1 
ATOM   250  N  NH2   . ARG A 1 32  ? -9.030  -30.341 42.243 1.00 42.23 ? 174 ARG A NH2   1 
ATOM   251  N  N     . LEU A 1 33  ? -9.359  -22.390 45.882 1.00 28.25 ? 175 LEU A N     1 
ATOM   252  C  CA    . LEU A 1 33  ? -8.928  -21.397 46.844 1.00 29.28 ? 175 LEU A CA    1 
ATOM   253  C  C     . LEU A 1 33  ? -9.910  -20.227 46.942 1.00 28.83 ? 175 LEU A C     1 
ATOM   254  O  O     . LEU A 1 33  ? -10.142 -19.684 48.037 1.00 30.06 ? 175 LEU A O     1 
ATOM   255  C  CB    . LEU A 1 33  ? -7.522  -20.887 46.497 1.00 28.88 ? 175 LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 33  ? -6.398  -21.875 46.826 1.00 30.10 ? 175 LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 33  ? -5.050  -21.414 46.259 1.00 29.48 ? 175 LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 33  ? -6.304  -22.093 48.339 1.00 30.72 ? 175 LEU A CD2   1 
ATOM   259  N  N     . GLY A 1 34  ? -10.483 -19.847 45.804 1.00 27.31 ? 176 GLY A N     1 
ATOM   260  C  CA    . GLY A 1 34  ? -11.434 -18.742 45.748 1.00 27.19 ? 176 GLY A CA    1 
ATOM   261  C  C     . GLY A 1 34  ? -12.847 -19.122 46.156 1.00 27.79 ? 176 GLY A C     1 
ATOM   262  O  O     . GLY A 1 34  ? -13.704 -18.253 46.263 1.00 28.68 ? 176 GLY A O     1 
ATOM   263  N  N     . GLY A 1 35  ? -13.101 -20.411 46.361 1.00 28.10 ? 177 GLY A N     1 
ATOM   264  C  CA    . GLY A 1 35  ? -14.406 -20.888 46.804 1.00 28.89 ? 177 GLY A CA    1 
ATOM   265  C  C     . GLY A 1 35  ? -15.471 -20.810 45.731 1.00 28.15 ? 177 GLY A C     1 
ATOM   266  O  O     . GLY A 1 35  ? -16.643 -20.724 46.034 1.00 29.26 ? 177 GLY A O     1 
ATOM   267  N  N     . LEU A 1 36  ? -15.066 -20.840 44.470 1.00 27.18 ? 178 LEU A N     1 
ATOM   268  C  CA    . LEU A 1 36  ? -16.005 -20.731 43.358 1.00 26.83 ? 178 LEU A CA    1 
ATOM   269  C  C     . LEU A 1 36  ? -16.532 -22.084 42.858 1.00 27.38 ? 178 LEU A C     1 
ATOM   270  O  O     . LEU A 1 36  ? -17.542 -22.136 42.158 1.00 28.04 ? 178 LEU A O     1 
ATOM   271  C  CB    . LEU A 1 36  ? -15.348 -19.960 42.213 1.00 25.51 ? 178 LEU A CB    1 
ATOM   272  C  CG    . LEU A 1 36  ? -14.967 -18.506 42.536 1.00 25.76 ? 178 LEU A CG    1 
ATOM   273  C  CD1   . LEU A 1 36  ? -14.436 -17.851 41.292 1.00 23.24 ? 178 LEU A CD1   1 
ATOM   274  C  CD2   . LEU A 1 36  ? -16.157 -17.684 43.134 1.00 25.41 ? 178 LEU A CD2   1 
ATOM   275  N  N     . THR A 1 37  ? -15.847 -23.163 43.220 1.00 28.25 ? 179 THR A N     1 
ATOM   276  C  CA    . THR A 1 37  ? -16.226 -24.521 42.844 1.00 28.89 ? 179 THR A CA    1 
ATOM   277  C  C     . THR A 1 37  ? -17.533 -24.870 43.516 1.00 30.09 ? 179 THR A C     1 
ATOM   278  O  O     . THR A 1 37  ? -17.815 -24.396 44.630 1.00 30.92 ? 179 THR A O     1 
ATOM   279  C  CB    . THR A 1 37  ? -15.156 -25.532 43.329 1.00 29.92 ? 179 THR A CB    1 
ATOM   280  O  OG1   . THR A 1 37  ? -13.898 -25.214 42.722 1.00 32.63 ? 179 THR A OG1   1 
ATOM   281  C  CG2   . THR A 1 37  ? -15.508 -26.944 42.958 1.00 30.74 ? 179 THR A CG2   1 
ATOM   282  N  N     . GLN A 1 38  ? -18.326 -25.706 42.853 1.00 30.34 ? 180 GLN A N     1 
ATOM   283  C  CA    . GLN A 1 38  ? -19.641 -26.080 43.374 1.00 31.73 ? 180 GLN A CA    1 
ATOM   284  C  C     . GLN A 1 38  ? -19.770 -27.558 43.695 1.00 32.69 ? 180 GLN A C     1 
ATOM   285  O  O     . GLN A 1 38  ? -20.809 -27.987 44.186 1.00 34.78 ? 180 GLN A O     1 
ATOM   286  C  CB    . GLN A 1 38  ? -20.727 -25.636 42.400 1.00 31.33 ? 180 GLN A CB    1 
ATOM   287  C  CG    . GLN A 1 38  ? -20.642 -24.135 42.097 1.00 31.13 ? 180 GLN A CG    1 
ATOM   288  C  CD    . GLN A 1 38  ? -21.865 -23.590 41.366 1.00 32.02 ? 180 GLN A CD    1 
ATOM   289  O  OE1   . GLN A 1 38  ? -22.705 -24.349 40.876 1.00 35.48 ? 180 GLN A OE1   1 
ATOM   290  N  NE2   . GLN A 1 38  ? -21.960 -22.267 41.284 1.00 32.89 ? 180 GLN A NE2   1 
ATOM   291  N  N     . ALA A 1 39  ? -18.712 -28.321 43.455 1.00 32.25 ? 181 ALA A N     1 
ATOM   292  C  CA    . ALA A 1 39  ? -18.718 -29.763 43.686 1.00 34.02 ? 181 ALA A CA    1 
ATOM   293  C  C     . ALA A 1 39  ? -17.292 -30.292 43.765 1.00 34.17 ? 181 ALA A C     1 
ATOM   294  O  O     . ALA A 1 39  ? -16.368 -29.693 43.215 1.00 32.44 ? 181 ALA A O     1 
ATOM   295  C  CB    . ALA A 1 39  ? -19.463 -30.482 42.566 1.00 33.92 ? 181 ALA A CB    1 
ATOM   296  N  N     . PRO A 1 40  ? -17.106 -31.432 44.434 1.00 36.26 ? 182 PRO A N     1 
ATOM   297  C  CA    . PRO A 1 40  ? -15.812 -32.083 44.473 1.00 37.36 ? 182 PRO A CA    1 
ATOM   298  C  C     . PRO A 1 40  ? -15.225 -32.257 43.080 1.00 36.92 ? 182 PRO A C     1 
ATOM   299  O  O     . PRO A 1 40  ? -15.971 -32.485 42.127 1.00 36.78 ? 182 PRO A O     1 
ATOM   300  C  CB    . PRO A 1 40  ? -16.144 -33.464 45.061 1.00 40.04 ? 182 PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 40  ? -17.606 -33.582 44.980 1.00 40.41 ? 182 PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 40  ? -18.104 -32.211 45.173 1.00 38.27 ? 182 PRO A CD    1 
ATOM   303  N  N     . GLY A 1 41  ? -13.905 -32.160 42.968 1.00 36.72 ? 183 GLY A N     1 
ATOM   304  C  CA    . GLY A 1 41  ? -13.244 -32.441 41.705 1.00 36.64 ? 183 GLY A CA    1 
ATOM   305  C  C     . GLY A 1 41  ? -12.994 -31.195 40.890 1.00 34.48 ? 183 GLY A C     1 
ATOM   306  O  O     . GLY A 1 41  ? -13.081 -30.076 41.400 1.00 33.97 ? 183 GLY A O     1 
ATOM   307  N  N     . ASN A 1 42  ? -12.669 -31.388 39.618 1.00 33.90 ? 184 ASN A N     1 
ATOM   308  C  CA    . ASN A 1 42  ? -12.113 -30.324 38.814 1.00 31.85 ? 184 ASN A CA    1 
ATOM   309  C  C     . ASN A 1 42  ? -13.157 -29.680 37.916 1.00 30.30 ? 184 ASN A C     1 
ATOM   310  O  O     . ASN A 1 42  ? -13.734 -30.360 37.072 1.00 31.27 ? 184 ASN A O     1 
ATOM   311  C  CB    . ASN A 1 42  ? -10.940 -30.852 37.980 1.00 33.17 ? 184 ASN A CB    1 
ATOM   312  C  CG    . ASN A 1 42  ? -9.636  -30.972 38.792 1.00 34.59 ? 184 ASN A CG    1 
ATOM   313  O  OD1   . ASN A 1 42  ? -9.267  -30.077 39.559 1.00 33.40 ? 184 ASN A OD1   1 
ATOM   314  N  ND2   . ASN A 1 42  ? -8.934  -32.073 38.605 1.00 37.10 ? 184 ASN A ND2   1 
ATOM   315  N  N     . PRO A 1 43  ? -13.411 -28.368 38.102 1.00 28.20 ? 185 PRO A N     1 
ATOM   316  C  CA    . PRO A 1 43  ? -14.253 -27.586 37.187 1.00 26.87 ? 185 PRO A CA    1 
ATOM   317  C  C     . PRO A 1 43  ? -13.735 -27.432 35.751 1.00 26.32 ? 185 PRO A C     1 
ATOM   318  O  O     . PRO A 1 43  ? -14.550 -27.343 34.835 1.00 26.07 ? 185 PRO A O     1 
ATOM   319  C  CB    . PRO A 1 43  ? -14.315 -26.210 37.834 1.00 25.62 ? 185 PRO A CB    1 
ATOM   320  C  CG    . PRO A 1 43  ? -13.798 -26.372 39.210 1.00 26.31 ? 185 PRO A CG    1 
ATOM   321  C  CD    . PRO A 1 43  ? -12.922 -27.554 39.229 1.00 27.79 ? 185 PRO A CD    1 
ATOM   322  N  N     . VAL A 1 44  ? -12.419 -27.373 35.550 1.00 26.13 ? 186 VAL A N     1 
ATOM   323  C  CA    . VAL A 1 44  ? -11.868 -27.192 34.204 1.00 26.11 ? 186 VAL A CA    1 
ATOM   324  C  C     . VAL A 1 44  ? -11.545 -28.540 33.596 1.00 27.82 ? 186 VAL A C     1 
ATOM   325  O  O     . VAL A 1 44  ? -10.801 -29.312 34.180 1.00 29.56 ? 186 VAL A O     1 
ATOM   326  C  CB    . VAL A 1 44  ? -10.619 -26.294 34.210 1.00 25.76 ? 186 VAL A CB    1 
ATOM   327  C  CG1   . VAL A 1 44  ? -10.096 -26.071 32.789 1.00 24.51 ? 186 VAL A CG1   1 
ATOM   328  C  CG2   . VAL A 1 44  ? -10.949 -24.932 34.878 1.00 24.63 ? 186 VAL A CG2   1 
ATOM   329  N  N     . LEU A 1 45  ? -12.128 -28.826 32.434 1.00 28.13 ? 187 LEU A N     1 
ATOM   330  C  CA    . LEU A 1 45  ? -11.975 -30.138 31.774 1.00 30.06 ? 187 LEU A CA    1 
ATOM   331  C  C     . LEU A 1 45  ? -10.839 -30.147 30.777 1.00 30.76 ? 187 LEU A C     1 
ATOM   332  O  O     . LEU A 1 45  ? -10.260 -31.195 30.539 1.00 33.21 ? 187 LEU A O     1 
ATOM   333  C  CB    . LEU A 1 45  ? -13.239 -30.537 31.003 1.00 30.30 ? 187 LEU A CB    1 
ATOM   334  C  CG    . LEU A 1 45  ? -14.532 -30.839 31.761 1.00 30.76 ? 187 LEU A CG    1 
ATOM   335  C  CD1   . LEU A 1 45  ? -15.706 -30.744 30.815 1.00 30.87 ? 187 LEU A CD1   1 
ATOM   336  C  CD2   . LEU A 1 45  ? -14.506 -32.205 32.397 1.00 31.68 ? 187 LEU A CD2   1 
ATOM   337  N  N     . ALA A 1 46  ? -10.562 -29.002 30.154 1.00 29.32 ? 188 ALA A N     1 
ATOM   338  C  CA    . ALA A 1 46  ? -9.614  -28.942 29.034 1.00 30.18 ? 188 ALA A CA    1 
ATOM   339  C  C     . ALA A 1 46  ? -9.252  -27.513 28.663 1.00 28.53 ? 188 ALA A C     1 
ATOM   340  O  O     . ALA A 1 46  ? -9.971  -26.565 28.947 1.00 26.48 ? 188 ALA A O     1 
ATOM   341  C  CB    . ALA A 1 46  ? -10.172 -29.681 27.800 1.00 31.48 ? 188 ALA A CB    1 
ATOM   342  N  N     . VAL A 1 47  ? -8.109  -27.369 28.025 1.00 29.68 ? 189 VAL A N     1 
ATOM   343  C  CA    . VAL A 1 47  ? -7.642  -26.076 27.605 1.00 29.09 ? 189 VAL A CA    1 
ATOM   344  C  C     . VAL A 1 47  ? -7.085  -26.233 26.221 1.00 30.34 ? 189 VAL A C     1 
ATOM   345  O  O     . VAL A 1 47  ? -6.454  -27.229 25.917 1.00 32.88 ? 189 VAL A O     1 
ATOM   346  C  CB    . VAL A 1 47  ? -6.572  -25.534 28.577 1.00 29.18 ? 189 VAL A CB    1 
ATOM   347  C  CG1   . VAL A 1 47  ? -5.946  -24.236 28.034 1.00 28.75 ? 189 VAL A CG1   1 
ATOM   348  C  CG2   . VAL A 1 47  ? -7.197  -25.297 29.966 1.00 28.06 ? 189 VAL A CG2   1 
ATOM   349  N  N     . GLN A 1 48  ? -7.354  -25.269 25.363 1.00 29.85 ? 190 GLN A N     1 
ATOM   350  C  CA    . GLN A 1 48  ? -6.816  -25.296 24.009 1.00 31.85 ? 190 GLN A CA    1 
ATOM   351  C  C     . GLN A 1 48  ? -6.019  -24.021 23.780 1.00 30.58 ? 190 GLN A C     1 
ATOM   352  O  O     . GLN A 1 48  ? -6.544  -22.938 23.959 1.00 29.04 ? 190 GLN A O     1 
ATOM   353  C  CB    . GLN A 1 48  ? -7.951  -25.433 23.000 1.00 32.30 ? 190 GLN A CB    1 
ATOM   354  C  CG    . GLN A 1 48  ? -8.307  -26.873 22.666 1.00 35.65 ? 190 GLN A CG    1 
ATOM   355  C  CD    . GLN A 1 48  ? -9.815  -27.106 22.572 1.00 35.89 ? 190 GLN A CD    1 
ATOM   356  O  OE1   . GLN A 1 48  ? -10.538 -26.886 23.552 1.00 39.19 ? 190 GLN A OE1   1 
ATOM   357  N  NE2   . GLN A 1 48  ? -10.293 -27.570 21.404 1.00 37.37 ? 190 GLN A NE2   1 
ATOM   358  N  N     . ILE A 1 49  ? -4.749  -24.162 23.419 1.00 31.29 ? 191 ILE A N     1 
ATOM   359  C  CA    . ILE A 1 49  ? -3.868  -23.019 23.267 1.00 30.94 ? 191 ILE A CA    1 
ATOM   360  C  C     . ILE A 1 49  ? -3.444  -22.765 21.820 1.00 31.68 ? 191 ILE A C     1 
ATOM   361  O  O     . ILE A 1 49  ? -3.044  -23.679 21.115 1.00 33.43 ? 191 ILE A O     1 
ATOM   362  C  CB    . ILE A 1 49  ? -2.599  -23.203 24.128 1.00 31.85 ? 191 ILE A CB    1 
ATOM   363  C  CG1   . ILE A 1 49  ? -2.950  -23.045 25.610 1.00 30.38 ? 191 ILE A CG1   1 
ATOM   364  C  CG2   . ILE A 1 49  ? -1.490  -22.209 23.714 1.00 32.22 ? 191 ILE A CG2   1 
ATOM   365  C  CD1   . ILE A 1 49  ? -1.733  -23.057 26.521 1.00 31.29 ? 191 ILE A CD1   1 
ATOM   366  N  N     . ASN A 1 50  ? -3.565  -21.513 21.395 1.00 30.30 ? 192 ASN A N     1 
ATOM   367  C  CA    . ASN A 1 50  ? -2.823  -20.988 20.263 1.00 32.30 ? 192 ASN A CA    1 
ATOM   368  C  C     . ASN A 1 50  ? -1.522  -20.370 20.791 1.00 32.95 ? 192 ASN A C     1 
ATOM   369  O  O     . ASN A 1 50  ? -1.543  -19.283 21.357 1.00 30.99 ? 192 ASN A O     1 
ATOM   370  C  CB    . ASN A 1 50  ? -3.654  -19.924 19.540 1.00 30.92 ? 192 ASN A CB    1 
ATOM   371  C  CG    . ASN A 1 50  ? -3.087  -19.557 18.170 1.00 32.33 ? 192 ASN A CG    1 
ATOM   372  O  OD1   . ASN A 1 50  ? -1.886  -19.298 18.026 1.00 30.44 ? 192 ASN A OD1   1 
ATOM   373  N  ND2   . ASN A 1 50  ? -3.956  -19.516 17.164 1.00 27.73 ? 192 ASN A ND2   1 
ATOM   374  N  N     . GLN A 1 51  ? -0.395  -21.066 20.626 1.00 35.80 ? 193 GLN A N     1 
ATOM   375  C  CA    . GLN A 1 51  ? 0.879   -20.543 21.139 1.00 37.01 ? 193 GLN A CA    1 
ATOM   376  C  C     . GLN A 1 51  ? 1.279   -19.240 20.419 1.00 37.12 ? 193 GLN A C     1 
ATOM   377  O  O     . GLN A 1 51  ? 1.773   -18.321 21.052 1.00 36.58 ? 193 GLN A O     1 
ATOM   378  C  CB    . GLN A 1 51  ? 2.019   -21.589 21.062 1.00 40.65 ? 193 GLN A CB    1 
ATOM   379  C  CG    . GLN A 1 51  ? 1.868   -22.843 21.970 1.00 42.02 ? 193 GLN A CG    1 
ATOM   380  C  CD    . GLN A 1 51  ? 2.051   -22.587 23.501 1.00 43.04 ? 193 GLN A CD    1 
ATOM   381  O  OE1   . GLN A 1 51  ? 2.467   -21.503 23.951 1.00 43.75 ? 193 GLN A OE1   1 
ATOM   382  N  NE2   . GLN A 1 51  ? 1.736   -23.611 24.296 1.00 42.05 ? 193 GLN A NE2   1 
ATOM   383  N  N     . ASP A 1 52  ? 1.024   -19.157 19.117 1.00 37.91 ? 194 ASP A N     1 
ATOM   384  C  CA    . ASP A 1 52  ? 1.414   -17.990 18.314 1.00 38.83 ? 194 ASP A CA    1 
ATOM   385  C  C     . ASP A 1 52  ? 0.658   -16.678 18.605 1.00 36.44 ? 194 ASP A C     1 
ATOM   386  O  O     . ASP A 1 52  ? 1.241   -15.606 18.476 1.00 37.40 ? 194 ASP A O     1 
ATOM   387  C  CB    . ASP A 1 52  ? 1.331   -18.315 16.813 1.00 40.99 ? 194 ASP A CB    1 
ATOM   388  C  CG    . ASP A 1 52  ? 2.436   -19.274 16.361 1.00 45.81 ? 194 ASP A CG    1 
ATOM   389  O  OD1   . ASP A 1 52  ? 3.643   -18.987 16.612 1.00 47.97 ? 194 ASP A OD1   1 
ATOM   390  O  OD2   . ASP A 1 52  ? 2.101   -20.320 15.754 1.00 48.53 ? 194 ASP A OD2   1 
ATOM   391  N  N     . LYS A 1 53  ? -0.617  -16.752 18.983 1.00 33.89 ? 195 LYS A N     1 
ATOM   392  C  CA    . LYS A 1 53  ? -1.418  -15.558 19.271 1.00 31.89 ? 195 LYS A CA    1 
ATOM   393  C  C     . LYS A 1 53  ? -1.692  -15.402 20.780 1.00 29.59 ? 195 LYS A C     1 
ATOM   394  O  O     . LYS A 1 53  ? -2.499  -14.580 21.187 1.00 28.10 ? 195 LYS A O     1 
ATOM   395  C  CB    . LYS A 1 53  ? -2.732  -15.580 18.449 1.00 31.32 ? 195 LYS A CB    1 
ATOM   396  C  CG    . LYS A 1 53  ? -2.504  -15.455 16.923 1.00 33.75 ? 195 LYS A CG    1 
ATOM   397  C  CD    . LYS A 1 53  ? -3.741  -15.681 16.065 1.00 33.59 ? 195 LYS A CD    1 
ATOM   398  C  CE    . LYS A 1 53  ? -4.757  -14.555 16.248 1.00 33.19 ? 195 LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1 53  ? -6.003  -14.741 15.446 1.00 31.96 ? 195 LYS A NZ    1 
ATOM   400  N  N     . ASN A 1 54  ? -1.004  -16.184 21.603 1.00 29.74 ? 196 ASN A N     1 
ATOM   401  C  CA    . ASN A 1 54  ? -1.095  -16.069 23.063 1.00 28.33 ? 196 ASN A CA    1 
ATOM   402  C  C     . ASN A 1 54  ? -2.497  -15.984 23.613 1.00 26.07 ? 196 ASN A C     1 
ATOM   403  O  O     . ASN A 1 54  ? -2.802  -15.077 24.377 1.00 25.36 ? 196 ASN A O     1 
ATOM   404  C  CB    . ASN A 1 54  ? -0.298  -14.856 23.555 1.00 28.88 ? 196 ASN A CB    1 
ATOM   405  C  CG    . ASN A 1 54  ? 1.181   -14.984 23.267 1.00 32.18 ? 196 ASN A CG    1 
ATOM   406  O  OD1   . ASN A 1 54  ? 1.678   -14.489 22.252 1.00 34.38 ? 196 ASN A OD1   1 
ATOM   407  N  ND2   . ASN A 1 54  ? 1.890   -15.682 24.143 1.00 34.29 ? 196 ASN A ND2   1 
ATOM   408  N  N     . PHE A 1 55  ? -3.352  -16.922 23.222 1.00 25.76 ? 197 PHE A N     1 
ATOM   409  C  CA    . PHE A 1 55  ? -4.689  -17.043 23.809 1.00 23.88 ? 197 PHE A CA    1 
ATOM   410  C  C     . PHE A 1 55  ? -5.105  -18.500 23.911 1.00 23.80 ? 197 PHE A C     1 
ATOM   411  O  O     . PHE A 1 55  ? -4.492  -19.381 23.304 1.00 24.40 ? 197 PHE A O     1 
ATOM   412  C  CB    . PHE A 1 55  ? -5.739  -16.242 23.030 1.00 23.38 ? 197 PHE A CB    1 
ATOM   413  C  CG    . PHE A 1 55  ? -6.186  -16.904 21.752 1.00 24.56 ? 197 PHE A CG    1 
ATOM   414  C  CD1   . PHE A 1 55  ? -7.271  -17.777 21.745 1.00 24.13 ? 197 PHE A CD1   1 
ATOM   415  C  CD2   . PHE A 1 55  ? -5.520  -16.663 20.557 1.00 25.57 ? 197 PHE A CD2   1 
ATOM   416  C  CE1   . PHE A 1 55  ? -7.679  -18.398 20.574 1.00 24.81 ? 197 PHE A CE1   1 
ATOM   417  C  CE2   . PHE A 1 55  ? -5.929  -17.272 19.379 1.00 26.90 ? 197 PHE A CE2   1 
ATOM   418  C  CZ    . PHE A 1 55  ? -7.008  -18.149 19.389 1.00 26.74 ? 197 PHE A CZ    1 
ATOM   419  N  N     . ALA A 1 56  ? -6.146  -18.732 24.714 1.00 22.81 ? 198 ALA A N     1 
ATOM   420  C  CA    . ALA A 1 56  ? -6.682  -20.072 24.964 1.00 22.99 ? 198 ALA A CA    1 
ATOM   421  C  C     . ALA A 1 56  ? -8.185  -20.028 25.144 1.00 22.60 ? 198 ALA A C     1 
ATOM   422  O  O     . ALA A 1 56  ? -8.758  -18.968 25.426 1.00 21.76 ? 198 ALA A O     1 
ATOM   423  C  CB    . ALA A 1 56  ? -6.057  -20.668 26.188 1.00 22.21 ? 198 ALA A CB    1 
ATOM   424  N  N     . PHE A 1 57  ? -8.810  -21.191 24.976 1.00 23.33 ? 199 PHE A N     1 
ATOM   425  C  CA    . PHE A 1 57  ? -10.161 -21.412 25.438 1.00 22.96 ? 199 PHE A CA    1 
ATOM   426  C  C     . PHE A 1 57  ? -10.185 -22.496 26.499 1.00 23.01 ? 199 PHE A C     1 
ATOM   427  O  O     . PHE A 1 57  ? -9.544  -23.531 26.340 1.00 23.79 ? 199 PHE A O     1 
ATOM   428  C  CB    . PHE A 1 57  ? -11.049 -21.794 24.286 1.00 23.94 ? 199 PHE A CB    1 
ATOM   429  C  CG    . PHE A 1 57  ? -11.501 -20.630 23.480 1.00 23.95 ? 199 PHE A CG    1 
ATOM   430  C  CD1   . PHE A 1 57  ? -12.702 -19.996 23.765 1.00 24.72 ? 199 PHE A CD1   1 
ATOM   431  C  CD2   . PHE A 1 57  ? -10.745 -20.165 22.438 1.00 24.96 ? 199 PHE A CD2   1 
ATOM   432  C  CE1   . PHE A 1 57  ? -13.146 -18.919 23.018 1.00 24.56 ? 199 PHE A CE1   1 
ATOM   433  C  CE2   . PHE A 1 57  ? -11.182 -19.086 21.695 1.00 26.25 ? 199 PHE A CE2   1 
ATOM   434  C  CZ    . PHE A 1 57  ? -12.388 -18.464 21.993 1.00 25.29 ? 199 PHE A CZ    1 
ATOM   435  N  N     . LEU A 1 58  ? -10.892 -22.220 27.595 1.00 22.32 ? 200 LEU A N     1 
ATOM   436  C  CA    . LEU A 1 58  ? -11.159 -23.195 28.635 1.00 23.08 ? 200 LEU A CA    1 
ATOM   437  C  C     . LEU A 1 58  ? -12.519 -23.783 28.369 1.00 23.68 ? 200 LEU A C     1 
ATOM   438  O  O     . LEU A 1 58  ? -13.409 -23.035 28.000 1.00 23.47 ? 200 LEU A O     1 
ATOM   439  C  CB    . LEU A 1 58  ? -11.232 -22.535 30.002 1.00 21.75 ? 200 LEU A CB    1 
ATOM   440  C  CG    . LEU A 1 58  ? -10.091 -21.648 30.423 1.00 22.57 ? 200 LEU A CG    1 
ATOM   441  C  CD1   . LEU A 1 58  ? -10.447 -20.977 31.780 1.00 22.97 ? 200 LEU A CD1   1 
ATOM   442  C  CD2   . LEU A 1 58  ? -8.818  -22.440 30.493 1.00 24.29 ? 200 LEU A CD2   1 
ATOM   443  N  N     . GLU A 1 59  ? -12.673 -25.097 28.560 1.00 25.41 ? 201 GLU A N     1 
ATOM   444  C  CA    . GLU A 1 59  ? -13.984 -25.776 28.605 1.00 26.01 ? 201 GLU A CA    1 
ATOM   445  C  C     . GLU A 1 59  ? -14.273 -26.169 30.080 1.00 25.20 ? 201 GLU A C     1 
ATOM   446  O  O     . GLU A 1 59  ? -13.447 -26.820 30.727 1.00 25.91 ? 201 GLU A O     1 
ATOM   447  C  CB    . GLU A 1 59  ? -13.986 -27.007 27.678 1.00 28.15 ? 201 GLU A CB    1 
ATOM   448  C  CG    . GLU A 1 59  ? -15.354 -27.802 27.566 1.00 30.00 ? 201 GLU A CG    1 
ATOM   449  C  CD    . GLU A 1 59  ? -15.237 -29.214 26.870 1.00 34.42 ? 201 GLU A CD    1 
ATOM   450  O  OE1   . GLU A 1 59  ? -14.102 -29.650 26.499 1.00 39.70 ? 201 GLU A OE1   1 
ATOM   451  O  OE2   . GLU A 1 59  ? -16.290 -29.910 26.699 1.00 38.45 ? 201 GLU A OE2   1 
ATOM   452  N  N     . PHE A 1 60  ? -15.419 -25.760 30.620 1.00 23.90 ? 202 PHE A N     1 
ATOM   453  C  CA    . PHE A 1 60  ? -15.796 -26.135 31.990 1.00 23.81 ? 202 PHE A CA    1 
ATOM   454  C  C     . PHE A 1 60  ? -16.816 -27.277 31.998 1.00 24.78 ? 202 PHE A C     1 
ATOM   455  O  O     . PHE A 1 60  ? -17.508 -27.511 31.017 1.00 25.49 ? 202 PHE A O     1 
ATOM   456  C  CB    . PHE A 1 60  ? -16.385 -24.951 32.748 1.00 22.74 ? 202 PHE A CB    1 
ATOM   457  C  CG    . PHE A 1 60  ? -15.398 -23.863 33.051 1.00 21.87 ? 202 PHE A CG    1 
ATOM   458  C  CD1   . PHE A 1 60  ? -15.017 -23.597 34.353 1.00 20.99 ? 202 PHE A CD1   1 
ATOM   459  C  CD2   . PHE A 1 60  ? -14.875 -23.081 32.036 1.00 21.17 ? 202 PHE A CD2   1 
ATOM   460  C  CE1   . PHE A 1 60  ? -14.125 -22.595 34.626 1.00 21.35 ? 202 PHE A CE1   1 
ATOM   461  C  CE2   . PHE A 1 60  ? -13.978 -22.086 32.305 1.00 20.60 ? 202 PHE A CE2   1 
ATOM   462  C  CZ    . PHE A 1 60  ? -13.592 -21.838 33.596 1.00 20.33 ? 202 PHE A CZ    1 
ATOM   463  N  N     . ARG A 1 61  ? -16.908 -27.978 33.123 1.00 25.09 ? 203 ARG A N     1 
ATOM   464  C  CA    . ARG A 1 61  ? -17.840 -29.085 33.258 1.00 26.17 ? 203 ARG A CA    1 
ATOM   465  C  C     . ARG A 1 61  ? -19.293 -28.619 33.425 1.00 26.04 ? 203 ARG A C     1 
ATOM   466  O  O     . ARG A 1 61  ? -20.207 -29.379 33.142 1.00 27.08 ? 203 ARG A O     1 
ATOM   467  C  CB    . ARG A 1 61  ? -17.450 -29.966 34.440 1.00 26.92 ? 203 ARG A CB    1 
ATOM   468  C  CG    . ARG A 1 61  ? -17.759 -29.327 35.770 1.00 26.08 ? 203 ARG A CG    1 
ATOM   469  C  CD    . ARG A 1 61  ? -17.343 -30.198 36.909 1.00 26.45 ? 203 ARG A CD    1 
ATOM   470  N  NE    . ARG A 1 61  ? -17.208 -29.419 38.131 1.00 24.28 ? 203 ARG A NE    1 
ATOM   471  C  CZ    . ARG A 1 61  ? -16.884 -29.931 39.307 1.00 24.42 ? 203 ARG A CZ    1 
ATOM   472  N  NH1   . ARG A 1 61  ? -16.671 -31.227 39.435 1.00 25.82 ? 203 ARG A NH1   1 
ATOM   473  N  NH2   . ARG A 1 61  ? -16.757 -29.136 40.355 1.00 24.24 ? 203 ARG A NH2   1 
ATOM   474  N  N     . SER A 1 62  ? -19.506 -27.389 33.895 1.00 24.74 ? 204 SER A N     1 
ATOM   475  C  CA    . SER A 1 62  ? -20.864 -26.906 34.171 1.00 24.99 ? 204 SER A CA    1 
ATOM   476  C  C     . SER A 1 62  ? -21.104 -25.471 33.693 1.00 23.81 ? 204 SER A C     1 
ATOM   477  O  O     . SER A 1 62  ? -20.167 -24.727 33.466 1.00 23.46 ? 204 SER A O     1 
ATOM   478  C  CB    . SER A 1 62  ? -21.178 -27.069 35.664 1.00 25.12 ? 204 SER A CB    1 
ATOM   479  O  OG    . SER A 1 62  ? -20.739 -25.973 36.435 1.00 24.47 ? 204 SER A OG    1 
ATOM   480  N  N     . VAL A 1 63  ? -22.360 -25.101 33.500 1.00 24.41 ? 205 VAL A N     1 
ATOM   481  C  CA    . VAL A 1 63  ? -22.721 -23.745 33.089 1.00 24.52 ? 205 VAL A CA    1 
ATOM   482  C  C     . VAL A 1 63  ? -22.409 -22.654 34.156 1.00 24.19 ? 205 VAL A C     1 
ATOM   483  O  O     . VAL A 1 63  ? -21.812 -21.624 33.832 1.00 23.37 ? 205 VAL A O     1 
ATOM   484  C  CB    . VAL A 1 63  ? -24.215 -23.700 32.657 1.00 26.09 ? 205 VAL A CB    1 
ATOM   485  C  CG1   . VAL A 1 63  ? -24.692 -22.279 32.428 1.00 26.06 ? 205 VAL A CG1   1 
ATOM   486  C  CG2   . VAL A 1 63  ? -24.432 -24.556 31.380 1.00 27.65 ? 205 VAL A CG2   1 
ATOM   487  N  N     . ASP A 1 64  ? -22.784 -22.892 35.416 1.00 24.98 ? 206 ASP A N     1 
ATOM   488  C  CA    . ASP A 1 64  ? -22.684 -21.891 36.480 1.00 25.13 ? 206 ASP A CA    1 
ATOM   489  C  C     . ASP A 1 64  ? -21.232 -21.600 36.842 1.00 24.06 ? 206 ASP A C     1 
ATOM   490  O  O     . ASP A 1 64  ? -20.870 -20.452 37.117 1.00 23.11 ? 206 ASP A O     1 
ATOM   491  C  CB    . ASP A 1 64  ? -23.468 -22.325 37.731 1.00 26.27 ? 206 ASP A CB    1 
ATOM   492  C  CG    . ASP A 1 64  ? -25.002 -22.177 37.570 1.00 29.97 ? 206 ASP A CG    1 
ATOM   493  O  OD1   . ASP A 1 64  ? -25.718 -22.488 38.549 1.00 32.11 ? 206 ASP A OD1   1 
ATOM   494  O  OD2   . ASP A 1 64  ? -25.505 -21.762 36.480 1.00 31.32 ? 206 ASP A OD2   1 
ATOM   495  N  N     . GLU A 1 65  ? -20.402 -22.636 36.819 1.00 24.01 ? 207 GLU A N     1 
ATOM   496  C  CA    . GLU A 1 65  ? -18.988 -22.480 37.126 1.00 23.40 ? 207 GLU A CA    1 
ATOM   497  C  C     . GLU A 1 65  ? -18.282 -21.664 36.054 1.00 22.51 ? 207 GLU A C     1 
ATOM   498  O  O     . GLU A 1 65  ? -17.446 -20.832 36.397 1.00 22.67 ? 207 GLU A O     1 
ATOM   499  C  CB    . GLU A 1 65  ? -18.312 -23.838 37.366 1.00 24.01 ? 207 GLU A CB    1 
ATOM   500  C  CG    . GLU A 1 65  ? -18.762 -24.458 38.693 1.00 25.33 ? 207 GLU A CG    1 
ATOM   501  C  CD    . GLU A 1 65  ? -18.395 -25.917 38.852 1.00 25.80 ? 207 GLU A CD    1 
ATOM   502  O  OE1   . GLU A 1 65  ? -18.750 -26.734 37.979 1.00 28.38 ? 207 GLU A OE1   1 
ATOM   503  O  OE2   . GLU A 1 65  ? -17.788 -26.261 39.876 1.00 25.20 ? 207 GLU A OE2   1 
ATOM   504  N  N     . THR A 1 66  ? -18.633 -21.854 34.781 1.00 22.24 ? 208 THR A N     1 
ATOM   505  C  CA    . THR A 1 66  ? -18.177 -20.927 33.720 1.00 21.56 ? 208 THR A CA    1 
ATOM   506  C  C     . THR A 1 66  ? -18.532 -19.461 34.045 1.00 21.62 ? 208 THR A C     1 
ATOM   507  O  O     . THR A 1 66  ? -17.719 -18.565 33.910 1.00 21.53 ? 208 THR A O     1 
ATOM   508  C  CB    . THR A 1 66  ? -18.781 -21.270 32.339 1.00 21.84 ? 208 THR A CB    1 
ATOM   509  O  OG1   . THR A 1 66  ? -18.580 -22.661 32.050 1.00 21.30 ? 208 THR A OG1   1 
ATOM   510  C  CG2   . THR A 1 66  ? -18.137 -20.405 31.243 1.00 20.97 ? 208 THR A CG2   1 
ATOM   511  N  N     . THR A 1 67  ? -19.749 -19.223 34.484 1.00 22.20 ? 209 THR A N     1 
ATOM   512  C  CA    . THR A 1 67  ? -20.155 -17.888 34.877 1.00 23.27 ? 209 THR A CA    1 
ATOM   513  C  C     . THR A 1 67  ? -19.321 -17.340 36.053 1.00 23.22 ? 209 THR A C     1 
ATOM   514  O  O     . THR A 1 67  ? -18.897 -16.191 36.040 1.00 22.89 ? 209 THR A O     1 
ATOM   515  C  CB    . THR A 1 67  ? -21.662 -17.883 35.234 1.00 24.84 ? 209 THR A CB    1 
ATOM   516  O  OG1   . THR A 1 67  ? -22.397 -18.282 34.067 1.00 24.78 ? 209 THR A OG1   1 
ATOM   517  C  CG2   . THR A 1 67  ? -22.132 -16.510 35.731 1.00 24.49 ? 209 THR A CG2   1 
ATOM   518  N  N     . GLN A 1 68  ? -19.079 -18.180 37.050 1.00 23.49 ? 210 GLN A N     1 
ATOM   519  C  CA    . GLN A 1 68  ? -18.386 -17.758 38.249 1.00 23.67 ? 210 GLN A CA    1 
ATOM   520  C  C     . GLN A 1 68  ? -16.953 -17.346 37.911 1.00 22.80 ? 210 GLN A C     1 
ATOM   521  O  O     . GLN A 1 68  ? -16.461 -16.335 38.418 1.00 22.88 ? 210 GLN A O     1 
ATOM   522  C  CB    . GLN A 1 68  ? -18.355 -18.895 39.271 1.00 24.21 ? 210 GLN A CB    1 
ATOM   523  C  CG    . GLN A 1 68  ? -19.692 -19.334 39.800 1.00 27.15 ? 210 GLN A CG    1 
ATOM   524  C  CD    . GLN A 1 68  ? -20.072 -18.635 41.071 1.00 30.75 ? 210 GLN A CD    1 
ATOM   525  O  OE1   . GLN A 1 68  ? -20.262 -17.417 41.087 1.00 33.15 ? 210 GLN A OE1   1 
ATOM   526  N  NE2   . GLN A 1 68  ? -20.196 -19.401 42.155 1.00 33.39 ? 210 GLN A NE2   1 
ATOM   527  N  N     . ALA A 1 69  ? -16.312 -18.127 37.036 1.00 21.94 ? 211 ALA A N     1 
ATOM   528  C  CA    . ALA A 1 69  ? -14.916 -17.933 36.665 1.00 21.50 ? 211 ALA A CA    1 
ATOM   529  C  C     . ALA A 1 69  ? -14.610 -16.623 35.941 1.00 21.56 ? 211 ALA A C     1 
ATOM   530  O  O     . ALA A 1 69  ? -13.451 -16.280 35.780 1.00 21.60 ? 211 ALA A O     1 
ATOM   531  C  CB    . ALA A 1 69  ? -14.429 -19.092 35.836 1.00 20.78 ? 211 ALA A CB    1 
ATOM   532  N  N     . MET A 1 70  ? -15.631 -15.894 35.516 1.00 22.48 ? 212 MET A N     1 
ATOM   533  C  CA    . MET A 1 70  ? -15.445 -14.567 34.935 1.00 23.53 ? 212 MET A CA    1 
ATOM   534  C  C     . MET A 1 70  ? -14.872 -13.575 35.951 1.00 23.54 ? 212 MET A C     1 
ATOM   535  O  O     . MET A 1 70  ? -14.286 -12.558 35.563 1.00 23.32 ? 212 MET A O     1 
ATOM   536  C  CB    . MET A 1 70  ? -16.778 -14.020 34.409 1.00 24.37 ? 212 MET A CB    1 
ATOM   537  C  CG    . MET A 1 70  ? -17.457 -14.843 33.289 1.00 26.04 ? 212 MET A CG    1 
ATOM   538  S  SD    . MET A 1 70  ? -17.459 -13.983 31.674 1.00 29.81 ? 212 MET A SD    1 
ATOM   539  C  CE    . MET A 1 70  ? -15.786 -14.276 31.094 1.00 26.58 ? 212 MET A CE    1 
ATOM   540  N  N     . ALA A 1 71  ? -15.048 -13.857 37.246 1.00 23.94 ? 213 ALA A N     1 
ATOM   541  C  CA    . ALA A 1 71  ? -14.568 -12.947 38.297 1.00 24.67 ? 213 ALA A CA    1 
ATOM   542  C  C     . ALA A 1 71  ? -13.034 -12.924 38.369 1.00 24.15 ? 213 ALA A C     1 
ATOM   543  O  O     . ALA A 1 71  ? -12.453 -11.999 38.922 1.00 25.39 ? 213 ALA A O     1 
ATOM   544  C  CB    . ALA A 1 71  ? -15.175 -13.301 39.668 1.00 25.21 ? 213 ALA A CB    1 
ATOM   545  N  N     . PHE A 1 72  ? -12.384 -13.922 37.788 1.00 23.03 ? 214 PHE A N     1 
ATOM   546  C  CA    . PHE A 1 72  ? -10.941 -13.896 37.651 1.00 23.09 ? 214 PHE A CA    1 
ATOM   547  C  C     . PHE A 1 72  ? -10.396 -12.925 36.587 1.00 23.34 ? 214 PHE A C     1 
ATOM   548  O  O     . PHE A 1 72  ? -9.180  -12.841 36.449 1.00 23.14 ? 214 PHE A O     1 
ATOM   549  C  CB    . PHE A 1 72  ? -10.408 -15.296 37.342 1.00 23.14 ? 214 PHE A CB    1 
ATOM   550  C  CG    . PHE A 1 72  ? -10.703 -16.311 38.400 1.00 22.68 ? 214 PHE A CG    1 
ATOM   551  C  CD1   . PHE A 1 72  ? -11.239 -17.545 38.052 1.00 23.71 ? 214 PHE A CD1   1 
ATOM   552  C  CD2   . PHE A 1 72  ? -10.451 -16.035 39.739 1.00 23.81 ? 214 PHE A CD2   1 
ATOM   553  C  CE1   . PHE A 1 72  ? -11.517 -18.497 39.028 1.00 24.92 ? 214 PHE A CE1   1 
ATOM   554  C  CE2   . PHE A 1 72  ? -10.726 -16.957 40.728 1.00 24.26 ? 214 PHE A CE2   1 
ATOM   555  C  CZ    . PHE A 1 72  ? -11.248 -18.195 40.384 1.00 25.90 ? 214 PHE A CZ    1 
ATOM   556  N  N     . ASP A 1 73  ? -11.246 -12.212 35.831 1.00 23.48 ? 215 ASP A N     1 
ATOM   557  C  CA    . ASP A 1 73  ? -10.741 -11.253 34.833 1.00 23.46 ? 215 ASP A CA    1 
ATOM   558  C  C     . ASP A 1 73  ? -9.722  -10.299 35.470 1.00 24.17 ? 215 ASP A C     1 
ATOM   559  O  O     . ASP A 1 73  ? -10.035 -9.621  36.433 1.00 25.29 ? 215 ASP A O     1 
ATOM   560  C  CB    . ASP A 1 73  ? -11.886 -10.437 34.219 1.00 24.17 ? 215 ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 73  ? -11.414 -9.475  33.098 1.00 25.50 ? 215 ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 73  ? -11.984 -8.354  32.999 1.00 25.64 ? 215 ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 73  ? -10.478 -9.836  32.321 1.00 25.27 ? 215 ASP A OD2   1 
ATOM   564  N  N     . GLY A 1 74  ? -8.496  -10.288 34.949 1.00 24.31 ? 216 GLY A N     1 
ATOM   565  C  CA    . GLY A 1 74  ? -7.414  -9.429  35.459 1.00 24.91 ? 216 GLY A CA    1 
ATOM   566  C  C     . GLY A 1 74  ? -6.354  -10.111 36.315 1.00 24.81 ? 216 GLY A C     1 
ATOM   567  O  O     . GLY A 1 74  ? -5.322  -9.509  36.625 1.00 26.14 ? 216 GLY A O     1 
ATOM   568  N  N     . ILE A 1 75  ? -6.592  -11.361 36.697 1.00 23.66 ? 217 ILE A N     1 
ATOM   569  C  CA    . ILE A 1 75  ? -5.687  -12.099 37.580 1.00 23.93 ? 217 ILE A CA    1 
ATOM   570  C  C     . ILE A 1 75  ? -4.282  -12.242 36.974 1.00 24.68 ? 217 ILE A C     1 
ATOM   571  O  O     . ILE A 1 75  ? -4.122  -12.476 35.762 1.00 24.00 ? 217 ILE A O     1 
ATOM   572  C  CB    . ILE A 1 75  ? -6.286  -13.490 37.920 1.00 23.18 ? 217 ILE A CB    1 
ATOM   573  C  CG1   . ILE A 1 75  ? -5.581  -14.139 39.126 1.00 24.70 ? 217 ILE A CG1   1 
ATOM   574  C  CG2   . ILE A 1 75  ? -6.281  -14.414 36.697 1.00 20.84 ? 217 ILE A CG2   1 
ATOM   575  C  CD1   . ILE A 1 75  ? -6.198  -15.514 39.543 1.00 23.04 ? 217 ILE A CD1   1 
ATOM   576  N  N     . ILE A 1 76  ? -3.264  -12.079 37.815 1.00 26.20 ? 218 ILE A N     1 
ATOM   577  C  CA    . ILE A 1 76  ? -1.879  -12.179 37.360 1.00 27.69 ? 218 ILE A CA    1 
ATOM   578  C  C     . ILE A 1 76  ? -1.437  -13.650 37.332 1.00 28.26 ? 218 ILE A C     1 
ATOM   579  O  O     . ILE A 1 76  ? -1.670  -14.399 38.295 1.00 28.30 ? 218 ILE A O     1 
ATOM   580  C  CB    . ILE A 1 76  ? -0.895  -11.395 38.257 1.00 29.51 ? 218 ILE A CB    1 
ATOM   581  C  CG1   . ILE A 1 76  ? -1.236  -9.896  38.286 1.00 29.79 ? 218 ILE A CG1   1 
ATOM   582  C  CG2   . ILE A 1 76  ? 0.539   -11.611 37.771 1.00 30.09 ? 218 ILE A CG2   1 
ATOM   583  C  CD1   . ILE A 1 76  ? -1.054  -9.208  36.979 1.00 30.05 ? 218 ILE A CD1   1 
ATOM   584  N  N     . PHE A 1 77  ? -0.805  -14.044 36.227 1.00 28.65 ? 219 PHE A N     1 
ATOM   585  C  CA    . PHE A 1 77  ? -0.298  -15.396 36.060 1.00 29.17 ? 219 PHE A CA    1 
ATOM   586  C  C     . PHE A 1 77  ? 1.101   -15.344 35.438 1.00 30.85 ? 219 PHE A C     1 
ATOM   587  O  O     . PHE A 1 77  ? 1.245   -14.979 34.264 1.00 30.65 ? 219 PHE A O     1 
ATOM   588  C  CB    . PHE A 1 77  ? -1.256  -16.204 35.179 1.00 28.85 ? 219 PHE A CB    1 
ATOM   589  C  CG    . PHE A 1 77  ? -0.879  -17.656 35.039 1.00 29.89 ? 219 PHE A CG    1 
ATOM   590  C  CD1   . PHE A 1 77  ? -0.552  -18.419 36.162 1.00 32.10 ? 219 PHE A CD1   1 
ATOM   591  C  CD2   . PHE A 1 77  ? -0.868  -18.268 33.795 1.00 30.68 ? 219 PHE A CD2   1 
ATOM   592  C  CE1   . PHE A 1 77  ? -0.208  -19.764 36.036 1.00 33.18 ? 219 PHE A CE1   1 
ATOM   593  C  CE2   . PHE A 1 77  ? -0.518  -19.607 33.662 1.00 31.95 ? 219 PHE A CE2   1 
ATOM   594  C  CZ    . PHE A 1 77  ? -0.193  -20.359 34.779 1.00 32.76 ? 219 PHE A CZ    1 
ATOM   595  N  N     . GLN A 1 78  ? 2.115   -15.699 36.238 1.00 32.04 ? 220 GLN A N     1 
ATOM   596  C  CA    . GLN A 1 78  ? 3.528   -15.605 35.862 1.00 34.18 ? 220 GLN A CA    1 
ATOM   597  C  C     . GLN A 1 78  ? 3.863   -14.246 35.273 1.00 34.15 ? 220 GLN A C     1 
ATOM   598  O  O     . GLN A 1 78  ? 4.374   -14.139 34.163 1.00 34.27 ? 220 GLN A O     1 
ATOM   599  C  CB    . GLN A 1 78  ? 3.916   -16.725 34.909 1.00 34.78 ? 220 GLN A CB    1 
ATOM   600  C  CG    . GLN A 1 78  ? 3.771   -18.098 35.544 1.00 36.26 ? 220 GLN A CG    1 
ATOM   601  C  CD    . GLN A 1 78  ? 4.255   -19.218 34.648 1.00 38.56 ? 220 GLN A CD    1 
ATOM   602  O  OE1   . GLN A 1 78  ? 4.885   -18.979 33.604 1.00 42.59 ? 220 GLN A OE1   1 
ATOM   603  N  NE2   . GLN A 1 78  ? 3.970   -20.456 35.051 1.00 40.42 ? 220 GLN A NE2   1 
ATOM   604  N  N     . GLY A 1 79  ? 3.531   -13.211 36.038 1.00 33.86 ? 221 GLY A N     1 
ATOM   605  C  CA    . GLY A 1 79  ? 3.791   -11.836 35.662 1.00 34.52 ? 221 GLY A CA    1 
ATOM   606  C  C     . GLY A 1 79  ? 2.826   -11.178 34.685 1.00 33.10 ? 221 GLY A C     1 
ATOM   607  O  O     . GLY A 1 79  ? 2.911   -9.970  34.500 1.00 33.52 ? 221 GLY A O     1 
ATOM   608  N  N     . GLN A 1 80  ? 1.922   -11.939 34.064 1.00 31.70 ? 222 GLN A N     1 
ATOM   609  C  CA    . GLN A 1 80  ? 0.996   -11.387 33.041 1.00 30.74 ? 222 GLN A CA    1 
ATOM   610  C  C     . GLN A 1 80  ? -0.467  -11.296 33.520 1.00 28.78 ? 222 GLN A C     1 
ATOM   611  O  O     . GLN A 1 80  ? -0.995  -12.231 34.152 1.00 27.73 ? 222 GLN A O     1 
ATOM   612  C  CB    . GLN A 1 80  ? 1.044   -12.216 31.744 1.00 30.95 ? 222 GLN A CB    1 
ATOM   613  C  CG    . GLN A 1 80  ? 2.452   -12.411 31.193 1.00 35.76 ? 222 GLN A CG    1 
ATOM   614  C  CD    . GLN A 1 80  ? 2.602   -11.957 29.745 1.00 40.31 ? 222 GLN A CD    1 
ATOM   615  O  OE1   . GLN A 1 80  ? 2.026   -10.941 29.326 1.00 42.36 ? 222 GLN A OE1   1 
ATOM   616  N  NE2   . GLN A 1 80  ? 3.405   -12.698 28.974 1.00 43.88 ? 222 GLN A NE2   1 
ATOM   617  N  N     . SER A 1 81  ? -1.127  -10.186 33.178 1.00 28.14 ? 223 SER A N     1 
ATOM   618  C  CA    . SER A 1 81  ? -2.535  -9.982  33.537 1.00 26.83 ? 223 SER A CA    1 
ATOM   619  C  C     . SER A 1 81  ? -3.444  -10.678 32.538 1.00 25.49 ? 223 SER A C     1 
ATOM   620  O  O     . SER A 1 81  ? -3.393  -10.365 31.356 1.00 25.53 ? 223 SER A O     1 
ATOM   621  C  CB    . SER A 1 81  ? -2.868  -8.499  33.583 1.00 27.31 ? 223 SER A CB    1 
ATOM   622  O  OG    . SER A 1 81  ? -4.152  -8.320  34.144 1.00 26.54 ? 223 SER A OG    1 
ATOM   623  N  N     . LEU A 1 82  ? -4.262  -11.620 33.005 1.00 24.45 ? 224 LEU A N     1 
ATOM   624  C  CA    . LEU A 1 82  ? -5.092  -12.437 32.096 1.00 23.61 ? 224 LEU A CA    1 
ATOM   625  C  C     . LEU A 1 82  ? -6.402  -11.741 31.737 1.00 23.32 ? 224 LEU A C     1 
ATOM   626  O  O     . LEU A 1 82  ? -7.131  -11.272 32.622 1.00 23.02 ? 224 LEU A O     1 
ATOM   627  C  CB    . LEU A 1 82  ? -5.429  -13.804 32.697 1.00 22.37 ? 224 LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 82  ? -4.292  -14.803 32.934 1.00 23.60 ? 224 LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 82  ? -4.860  -16.202 33.267 1.00 21.83 ? 224 LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 82  ? -3.312  -14.874 31.752 1.00 23.27 ? 224 LEU A CD2   1 
ATOM   631  N  N     . LYS A 1 83  ? -6.697  -11.709 30.436 1.00 23.41 ? 225 LYS A N     1 
ATOM   632  C  CA    . LYS A 1 83  ? -7.951  -11.167 29.926 1.00 23.51 ? 225 LYS A CA    1 
ATOM   633  C  C     . LYS A 1 83  ? -9.013  -12.269 29.680 1.00 22.44 ? 225 LYS A C     1 
ATOM   634  O  O     . LYS A 1 83  ? -8.929  -13.009 28.708 1.00 22.40 ? 225 LYS A O     1 
ATOM   635  C  CB    . LYS A 1 83  ? -7.668  -10.376 28.644 1.00 24.46 ? 225 LYS A CB    1 
ATOM   636  C  CG    . LYS A 1 83  ? -8.884  -9.672  28.063 1.00 25.18 ? 225 LYS A CG    1 
ATOM   637  C  CD    . LYS A 1 83  ? -8.487  -8.794  26.895 1.00 26.97 ? 225 LYS A CD    1 
ATOM   638  C  CE    . LYS A 1 83  ? -9.715  -8.209  26.195 1.00 28.28 ? 225 LYS A CE    1 
ATOM   639  N  NZ    . LYS A 1 83  ? -9.337  -7.345  25.031 1.00 29.66 ? 225 LYS A NZ    1 
ATOM   640  N  N     . ILE A 1 84  ? -10.014 -12.341 30.560 1.00 22.02 ? 226 ILE A N     1 
ATOM   641  C  CA    . ILE A 1 84  ? -11.062 -13.386 30.551 1.00 21.21 ? 226 ILE A CA    1 
ATOM   642  C  C     . ILE A 1 84  ? -12.396 -12.811 30.040 1.00 21.53 ? 226 ILE A C     1 
ATOM   643  O  O     . ILE A 1 84  ? -12.943 -11.872 30.639 1.00 22.41 ? 226 ILE A O     1 
ATOM   644  C  CB    . ILE A 1 84  ? -11.326 -13.925 31.982 1.00 21.00 ? 226 ILE A CB    1 
ATOM   645  C  CG1   . ILE A 1 84  ? -10.017 -14.227 32.734 1.00 20.97 ? 226 ILE A CG1   1 
ATOM   646  C  CG2   . ILE A 1 84  ? -12.251 -15.142 31.950 1.00 20.38 ? 226 ILE A CG2   1 
ATOM   647  C  CD1   . ILE A 1 84  ? -9.339  -15.482 32.314 1.00 20.94 ? 226 ILE A CD1   1 
ATOM   648  N  N     . ARG A 1 85  ? -12.927 -13.381 28.955 1.00 21.50 ? 227 ARG A N     1 
ATOM   649  C  CA    . ARG A 1 85  ? -14.181 -12.908 28.331 1.00 22.04 ? 227 ARG A CA    1 
ATOM   650  C  C     . ARG A 1 85  ? -15.097 -14.046 27.885 1.00 21.90 ? 227 ARG A C     1 
ATOM   651  O  O     . ARG A 1 85  ? -14.670 -15.199 27.762 1.00 21.23 ? 227 ARG A O     1 
ATOM   652  C  CB    . ARG A 1 85  ? -13.853 -12.081 27.093 1.00 23.16 ? 227 ARG A CB    1 
ATOM   653  C  CG    . ARG A 1 85  ? -13.137 -10.761 27.373 1.00 24.26 ? 227 ARG A CG    1 
ATOM   654  C  CD    . ARG A 1 85  ? -14.056 -9.743  28.020 1.00 25.57 ? 227 ARG A CD    1 
ATOM   655  N  NE    . ARG A 1 85  ? -13.416 -8.428  28.115 1.00 27.91 ? 227 ARG A NE    1 
ATOM   656  C  CZ    . ARG A 1 85  ? -12.507 -8.099  29.030 1.00 26.92 ? 227 ARG A CZ    1 
ATOM   657  N  NH1   . ARG A 1 85  ? -12.122 -8.971  29.942 1.00 25.88 ? 227 ARG A NH1   1 
ATOM   658  N  NH2   . ARG A 1 85  ? -11.973 -6.896  29.030 1.00 28.21 ? 227 ARG A NH2   1 
ATOM   659  N  N     . ARG A 1 86  ? -16.360 -13.724 27.615 1.00 22.31 ? 228 ARG A N     1 
ATOM   660  C  CA    . ARG A 1 86  ? -17.225 -14.672 26.920 1.00 22.26 ? 228 ARG A CA    1 
ATOM   661  C  C     . ARG A 1 86  ? -16.755 -14.790 25.473 1.00 22.06 ? 228 ARG A C     1 
ATOM   662  O  O     . ARG A 1 86  ? -16.229 -13.846 24.933 1.00 21.68 ? 228 ARG A O     1 
ATOM   663  C  CB    . ARG A 1 86  ? -18.690 -14.226 26.930 1.00 23.26 ? 228 ARG A CB    1 
ATOM   664  C  CG    . ARG A 1 86  ? -19.329 -14.172 28.284 1.00 22.98 ? 228 ARG A CG    1 
ATOM   665  C  CD    . ARG A 1 86  ? -19.554 -15.554 28.918 1.00 21.94 ? 228 ARG A CD    1 
ATOM   666  N  NE    . ARG A 1 86  ? -20.447 -15.440 30.081 1.00 22.81 ? 228 ARG A NE    1 
ATOM   667  C  CZ    . ARG A 1 86  ? -20.978 -16.465 30.748 1.00 21.52 ? 228 ARG A CZ    1 
ATOM   668  N  NH1   . ARG A 1 86  ? -20.709 -17.719 30.394 1.00 20.19 ? 228 ARG A NH1   1 
ATOM   669  N  NH2   . ARG A 1 86  ? -21.777 -16.233 31.787 1.00 20.68 ? 228 ARG A NH2   1 
ATOM   670  N  N     . PRO A 1 87  ? -16.936 -15.964 24.855 1.00 22.52 ? 229 PRO A N     1 
ATOM   671  C  CA    . PRO A 1 87  ? -16.744 -16.143 23.407 1.00 23.74 ? 229 PRO A CA    1 
ATOM   672  C  C     . PRO A 1 87  ? -17.682 -15.274 22.576 1.00 25.65 ? 229 PRO A C     1 
ATOM   673  O  O     . PRO A 1 87  ? -18.815 -15.026 22.986 1.00 26.18 ? 229 PRO A O     1 
ATOM   674  C  CB    . PRO A 1 87  ? -17.095 -17.614 23.182 1.00 23.86 ? 229 PRO A CB    1 
ATOM   675  C  CG    . PRO A 1 87  ? -16.988 -18.279 24.535 1.00 22.54 ? 229 PRO A CG    1 
ATOM   676  C  CD    . PRO A 1 87  ? -17.311 -17.222 25.536 1.00 21.88 ? 229 PRO A CD    1 
ATOM   677  N  N     . HIS A 1 88  ? -17.223 -14.838 21.407 1.00 27.11 ? 230 HIS A N     1 
ATOM   678  C  CA    . HIS A 1 88  ? -18.015 -13.974 20.523 1.00 29.22 ? 230 HIS A CA    1 
ATOM   679  C  C     . HIS A 1 88  ? -19.347 -14.597 20.163 1.00 30.68 ? 230 HIS A C     1 
ATOM   680  O  O     . HIS A 1 88  ? -20.328 -13.892 19.996 1.00 32.15 ? 230 HIS A O     1 
ATOM   681  C  CB    . HIS A 1 88  ? -17.243 -13.641 19.230 1.00 30.39 ? 230 HIS A CB    1 
ATOM   682  C  CG    . HIS A 1 88  ? -16.091 -12.707 19.437 1.00 30.49 ? 230 HIS A CG    1 
ATOM   683  N  ND1   . HIS A 1 88  ? -15.963 -11.913 20.562 1.00 31.16 ? 230 HIS A ND1   1 
ATOM   684  C  CD2   . HIS A 1 88  ? -15.019 -12.429 18.659 1.00 31.59 ? 230 HIS A CD2   1 
ATOM   685  C  CE1   . HIS A 1 88  ? -14.855 -11.197 20.473 1.00 30.48 ? 230 HIS A CE1   1 
ATOM   686  N  NE2   . HIS A 1 88  ? -14.263 -11.492 19.327 1.00 31.69 ? 230 HIS A NE2   1 
ATOM   687  N  N     . ASP A 1 89  ? -19.346 -15.920 20.028 1.00 31.35 ? 231 ASP A N     1 
ATOM   688  C  CA    . ASP A 1 89  ? -20.540 -16.757 19.795 1.00 32.91 ? 231 ASP A CA    1 
ATOM   689  C  C     . ASP A 1 89  ? -21.618 -16.739 20.876 1.00 32.61 ? 231 ASP A C     1 
ATOM   690  O  O     . ASP A 1 89  ? -22.721 -17.192 20.627 1.00 34.28 ? 231 ASP A O     1 
ATOM   691  C  CB    . ASP A 1 89  ? -20.094 -18.236 19.666 1.00 33.20 ? 231 ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 89  ? -19.704 -18.604 18.268 1.00 36.97 ? 231 ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 89  ? -20.060 -17.839 17.352 1.00 41.54 ? 231 ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 89  ? -19.045 -19.657 18.075 1.00 40.65 ? 231 ASP A OD2   1 
ATOM   695  N  N     . TYR A 1 90  ? -21.276 -16.310 22.086 1.00 31.29 ? 232 TYR A N     1 
ATOM   696  C  CA    . TYR A 1 90  ? -22.191 -16.350 23.225 1.00 31.59 ? 232 TYR A CA    1 
ATOM   697  C  C     . TYR A 1 90  ? -23.088 -15.146 23.184 1.00 33.41 ? 232 TYR A C     1 
ATOM   698  O  O     . TYR A 1 90  ? -22.613 -14.039 22.996 1.00 33.43 ? 232 TYR A O     1 
ATOM   699  C  CB    . TYR A 1 90  ? -21.414 -16.329 24.536 1.00 29.69 ? 232 TYR A CB    1 
ATOM   700  C  CG    . TYR A 1 90  ? -22.261 -16.319 25.787 1.00 29.16 ? 232 TYR A CG    1 
ATOM   701  C  CD1   . TYR A 1 90  ? -22.661 -17.498 26.379 1.00 29.02 ? 232 TYR A CD1   1 
ATOM   702  C  CD2   . TYR A 1 90  ? -22.618 -15.130 26.399 1.00 29.33 ? 232 TYR A CD2   1 
ATOM   703  C  CE1   . TYR A 1 90  ? -23.422 -17.501 27.546 1.00 30.28 ? 232 TYR A CE1   1 
ATOM   704  C  CE2   . TYR A 1 90  ? -23.366 -15.118 27.569 1.00 30.71 ? 232 TYR A CE2   1 
ATOM   705  C  CZ    . TYR A 1 90  ? -23.774 -16.314 28.142 1.00 30.52 ? 232 TYR A CZ    1 
ATOM   706  O  OH    . TYR A 1 90  ? -24.543 -16.330 29.296 1.00 30.28 ? 232 TYR A OH    1 
ATOM   707  N  N     . GLN A 1 91  ? -24.383 -15.368 23.359 1.00 35.38 ? 233 GLN A N     1 
ATOM   708  C  CA    . GLN A 1 91  ? -25.340 -14.287 23.451 1.00 37.96 ? 233 GLN A CA    1 
ATOM   709  C  C     . GLN A 1 91  ? -26.347 -14.632 24.546 1.00 38.73 ? 233 GLN A C     1 
ATOM   710  O  O     . GLN A 1 91  ? -26.836 -15.766 24.621 1.00 38.89 ? 233 GLN A O     1 
ATOM   711  C  CB    . GLN A 1 91  ? -26.060 -14.081 22.115 1.00 41.03 ? 233 GLN A CB    1 
ATOM   712  C  CG    . GLN A 1 91  ? -25.229 -13.336 21.037 1.00 43.93 ? 233 GLN A CG    1 
ATOM   713  C  CD    . GLN A 1 91  ? -25.226 -11.795 21.194 1.00 48.29 ? 233 GLN A CD    1 
ATOM   714  O  OE1   . GLN A 1 91  ? -26.290 -11.151 21.250 1.00 52.47 ? 233 GLN A OE1   1 
ATOM   715  N  NE2   . GLN A 1 91  ? -24.021 -11.204 21.231 1.00 47.99 ? 233 GLN A NE2   1 
ATOM   716  N  N     . PRO A 1 92  ? -26.680 -13.651 25.390 1.00 39.49 ? 234 PRO A N     1 
ATOM   717  C  CA    . PRO A 1 92  ? -27.654 -13.872 26.447 1.00 40.10 ? 234 PRO A CA    1 
ATOM   718  C  C     . PRO A 1 92  ? -29.038 -13.887 25.831 1.00 42.62 ? 234 PRO A C     1 
ATOM   719  O  O     . PRO A 1 92  ? -29.195 -13.459 24.687 1.00 44.29 ? 234 PRO A O     1 
ATOM   720  C  CB    . PRO A 1 92  ? -27.470 -12.652 27.344 1.00 40.76 ? 234 PRO A CB    1 
ATOM   721  C  CG    . PRO A 1 92  ? -27.090 -11.572 26.384 1.00 41.97 ? 234 PRO A CG    1 
ATOM   722  C  CD    . PRO A 1 92  ? -26.198 -12.260 25.371 1.00 40.19 ? 234 PRO A CD    1 
ATOM   723  N  N     . LEU A 1 93  ? -30.032 -14.368 26.561 1.00 43.20 ? 235 LEU A N     1 
ATOM   724  C  CA    . LEU A 1 93  ? -31.351 -14.519 25.976 1.00 46.16 ? 235 LEU A CA    1 
ATOM   725  C  C     . LEU A 1 93  ? -32.011 -13.162 25.720 1.00 48.73 ? 235 LEU A C     1 
ATOM   726  O  O     . LEU A 1 93  ? -31.732 -12.202 26.436 1.00 48.65 ? 235 LEU A O     1 
ATOM   727  C  CB    . LEU A 1 93  ? -32.225 -15.404 26.867 1.00 47.01 ? 235 LEU A CB    1 
ATOM   728  C  CG    . LEU A 1 93  ? -31.836 -16.888 26.850 1.00 45.46 ? 235 LEU A CG    1 
ATOM   729  C  CD1   . LEU A 1 93  ? -32.582 -17.646 27.930 1.00 46.87 ? 235 LEU A CD1   1 
ATOM   730  C  CD2   . LEU A 1 93  ? -32.105 -17.501 25.479 1.00 46.51 ? 235 LEU A CD2   1 
ATOM   731  N  N     . PRO A 1 94  ? -32.901 -13.081 24.708 1.00 51.36 ? 236 PRO A N     1 
ATOM   732  C  CA    . PRO A 1 94  ? -33.530 -11.809 24.328 1.00 54.43 ? 236 PRO A CA    1 
ATOM   733  C  C     . PRO A 1 94  ? -34.116 -11.029 25.506 1.00 56.07 ? 236 PRO A C     1 
ATOM   734  O  O     . PRO A 1 94  ? -34.851 -11.598 26.321 1.00 56.86 ? 236 PRO A O     1 
ATOM   735  C  CB    . PRO A 1 94  ? -34.659 -12.244 23.385 1.00 57.34 ? 236 PRO A CB    1 
ATOM   736  C  CG    . PRO A 1 94  ? -34.186 -13.504 22.800 1.00 55.46 ? 236 PRO A CG    1 
ATOM   737  C  CD    . PRO A 1 94  ? -33.392 -14.193 23.873 1.00 51.96 ? 236 PRO A CD    1 
ATOM   738  N  N     . GLY A 1 95  ? -33.771 -9.766  25.615 1.00 56.70 ? 237 GLY A N     1 
ATOM   739  C  CA    . GLY A 1 95  ? -34.249 -8.938  26.694 1.00 58.83 ? 237 GLY A CA    1 
ATOM   740  C  C     . GLY A 1 95  ? -33.731 -9.174  28.087 1.00 56.56 ? 237 GLY A C     1 
ATOM   741  O  O     . GLY A 1 95  ? -34.248 -8.647  29.034 1.00 58.60 ? 237 GLY A O     1 
ATOM   742  N  N     . ALA A 1 96  ? -32.681 -9.945  28.214 1.00 46.43 ? 258 ALA A N     1 
ATOM   743  C  CA    . ALA A 1 96  ? -32.140 -10.218 29.505 1.00 47.78 ? 258 ALA A CA    1 
ATOM   744  C  C     . ALA A 1 96  ? -31.748 -8.964  30.182 1.00 43.86 ? 258 ALA A C     1 
ATOM   745  O  O     . ALA A 1 96  ? -31.835 -8.869  31.367 1.00 44.28 ? 258 ALA A O     1 
ATOM   746  C  CB    . ALA A 1 96  ? -30.960 -11.096 29.364 1.00 51.89 ? 258 ALA A CB    1 
ATOM   747  N  N     . HIS A 1 97  ? -31.258 -7.992  29.409 1.00 40.63 ? 259 HIS A N     1 
ATOM   748  C  CA    . HIS A 1 97  ? -30.696 -6.775  29.965 1.00 37.64 ? 259 HIS A CA    1 
ATOM   749  C  C     . HIS A 1 97  ? -31.346 -5.515  29.409 1.00 33.80 ? 259 HIS A C     1 
ATOM   750  O  O     . HIS A 1 97  ? -30.692 -4.499  29.235 1.00 31.62 ? 259 HIS A O     1 
ATOM   751  C  CB    . HIS A 1 97  ? -29.182 -6.750  29.718 1.00 38.87 ? 259 HIS A CB    1 
ATOM   752  C  CG    . HIS A 1 97  ? -28.470 -7.955  30.248 1.00 43.69 ? 259 HIS A CG    1 
ATOM   753  N  ND1   . HIS A 1 97  ? -27.829 -8.861  29.431 1.00 47.37 ? 259 HIS A ND1   1 
ATOM   754  C  CD2   . HIS A 1 97  ? -28.337 -8.426  31.511 1.00 46.54 ? 259 HIS A CD2   1 
ATOM   755  C  CE1   . HIS A 1 97  ? -27.319 -9.831  30.172 1.00 52.30 ? 259 HIS A CE1   1 
ATOM   756  N  NE2   . HIS A 1 97  ? -27.616 -9.593  31.436 1.00 51.13 ? 259 HIS A NE2   1 
ATOM   757  N  N     . LYS A 1 98  ? -32.646 -5.576  29.155 1.00 33.69 ? 260 LYS A N     1 
ATOM   758  C  CA    . LYS A 1 98  ? -33.405 -4.412  28.683 1.00 30.65 ? 260 LYS A CA    1 
ATOM   759  C  C     . LYS A 1 98  ? -33.355 -3.265  29.687 1.00 28.04 ? 260 LYS A C     1 
ATOM   760  O  O     . LYS A 1 98  ? -33.409 -3.492  30.900 1.00 28.79 ? 260 LYS A O     1 
ATOM   761  C  CB    . LYS A 1 98  ? -34.870 -4.807  28.458 1.00 31.57 ? 260 LYS A CB    1 
ATOM   762  C  CG    . LYS A 1 98  ? -35.709 -3.727  27.783 1.00 29.87 ? 260 LYS A CG    1 
ATOM   763  C  CD    . LYS A 1 98  ? -37.159 -4.181  27.635 1.00 30.97 ? 260 LYS A CD    1 
ATOM   764  C  CE    . LYS A 1 98  ? -37.781 -3.762  26.304 1.00 31.01 ? 260 LYS A CE    1 
ATOM   765  N  NZ    . LYS A 1 98  ? -38.944 -4.665  26.002 1.00 34.14 ? 260 LYS A NZ    1 
ATOM   766  N  N     . LEU A 1 99  ? -33.251 -2.041  29.180 1.00 25.57 ? 261 LEU A N     1 
ATOM   767  C  CA    . LEU A 1 99  ? -33.213 -0.850  30.033 1.00 23.81 ? 261 LEU A CA    1 
ATOM   768  C  C     . LEU A 1 99  ? -34.408 0.074   29.802 1.00 22.20 ? 261 LEU A C     1 
ATOM   769  O  O     . LEU A 1 99  ? -34.856 0.245   28.662 1.00 20.96 ? 261 LEU A O     1 
ATOM   770  C  CB    . LEU A 1 99  ? -31.929 -0.057  29.795 1.00 23.11 ? 261 LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 99  ? -30.608 -0.607  30.339 1.00 24.57 ? 261 LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 99  ? -29.466 0.338   29.878 1.00 22.68 ? 261 LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 99  ? -30.652 -0.758  31.861 1.00 23.04 ? 261 LEU A CD2   1 
ATOM   774  N  N     . PHE A 1 100 ? -34.902 0.660   30.900 1.00 21.80 ? 262 PHE A N     1 
ATOM   775  C  CA    . PHE A 1 100 ? -35.891 1.750   30.861 1.00 21.30 ? 262 PHE A CA    1 
ATOM   776  C  C     . PHE A 1 100 ? -35.177 3.097   31.050 1.00 20.08 ? 262 PHE A C     1 
ATOM   777  O  O     . PHE A 1 100 ? -34.341 3.217   31.914 1.00 20.55 ? 262 PHE A O     1 
ATOM   778  C  CB    . PHE A 1 100 ? -36.959 1.520   31.944 1.00 22.37 ? 262 PHE A CB    1 
ATOM   779  C  CG    . PHE A 1 100 ? -37.903 2.676   32.156 1.00 21.79 ? 262 PHE A CG    1 
ATOM   780  C  CD1   . PHE A 1 100 ? -38.972 2.885   31.309 1.00 23.04 ? 262 PHE A CD1   1 
ATOM   781  C  CD2   . PHE A 1 100 ? -37.752 3.521   33.238 1.00 22.76 ? 262 PHE A CD2   1 
ATOM   782  C  CE1   . PHE A 1 100 ? -39.871 3.963   31.516 1.00 23.46 ? 262 PHE A CE1   1 
ATOM   783  C  CE2   . PHE A 1 100 ? -38.646 4.593   33.454 1.00 24.22 ? 262 PHE A CE2   1 
ATOM   784  C  CZ    . PHE A 1 100 ? -39.706 4.807   32.589 1.00 23.16 ? 262 PHE A CZ    1 
ATOM   785  N  N     . ILE A 1 101 ? -35.503 4.087   30.226 1.00 19.87 ? 263 ILE A N     1 
ATOM   786  C  CA    . ILE A 1 101 ? -35.009 5.463   30.374 1.00 19.99 ? 263 ILE A CA    1 
ATOM   787  C  C     . ILE A 1 101 ? -36.170 6.448   30.547 1.00 20.50 ? 263 ILE A C     1 
ATOM   788  O  O     . ILE A 1 101 ? -36.897 6.699   29.608 1.00 21.04 ? 263 ILE A O     1 
ATOM   789  C  CB    . ILE A 1 101 ? -34.198 5.914   29.127 1.00 20.03 ? 263 ILE A CB    1 
ATOM   790  C  CG1   . ILE A 1 101 ? -33.048 4.932   28.854 1.00 21.45 ? 263 ILE A CG1   1 
ATOM   791  C  CG2   . ILE A 1 101 ? -33.652 7.360   29.315 1.00 20.01 ? 263 ILE A CG2   1 
ATOM   792  C  CD1   . ILE A 1 101 ? -33.430 3.742   27.950 1.00 22.34 ? 263 ILE A CD1   1 
ATOM   793  N  N     . GLY A 1 102 ? -36.328 7.002   31.742 1.00 21.44 ? 264 GLY A N     1 
ATOM   794  C  CA    . GLY A 1 102 ? -37.363 7.992   32.028 1.00 23.14 ? 264 GLY A CA    1 
ATOM   795  C  C     . GLY A 1 102 ? -36.846 9.397   32.303 1.00 24.34 ? 264 GLY A C     1 
ATOM   796  O  O     . GLY A 1 102 ? -35.665 9.591   32.589 1.00 24.21 ? 264 GLY A O     1 
ATOM   797  N  N     . GLY A 1 103 ? -37.746 10.376  32.201 1.00 26.30 ? 265 GLY A N     1 
ATOM   798  C  CA    . GLY A 1 103 ? -37.411 11.792  32.378 1.00 28.42 ? 265 GLY A CA    1 
ATOM   799  C  C     . GLY A 1 103 ? -36.764 12.510  31.194 1.00 28.65 ? 265 GLY A C     1 
ATOM   800  O  O     . GLY A 1 103 ? -36.003 13.453  31.393 1.00 29.76 ? 265 GLY A O     1 
ATOM   801  N  N     . LEU A 1 104 ? -37.059 12.076  29.966 1.00 28.05 ? 266 LEU A N     1 
ATOM   802  C  CA    . LEU A 1 104 ? -36.559 12.743  28.747 1.00 28.73 ? 266 LEU A CA    1 
ATOM   803  C  C     . LEU A 1 104 ? -37.469 13.904  28.342 1.00 31.72 ? 266 LEU A C     1 
ATOM   804  O  O     . LEU A 1 104 ? -38.684 13.817  28.482 1.00 33.08 ? 266 LEU A O     1 
ATOM   805  C  CB    . LEU A 1 104 ? -36.505 11.744  27.585 1.00 27.68 ? 266 LEU A CB    1 
ATOM   806  C  CG    . LEU A 1 104 ? -35.632 10.489  27.719 1.00 25.35 ? 266 LEU A CG    1 
ATOM   807  C  CD1   . LEU A 1 104 ? -36.094 9.446   26.718 1.00 23.61 ? 266 LEU A CD1   1 
ATOM   808  C  CD2   . LEU A 1 104 ? -34.136 10.817  27.543 1.00 23.53 ? 266 LEU A CD2   1 
ATOM   809  N  N     . PRO A 1 105 ? -36.897 15.002  27.838 1.00 34.03 ? 267 PRO A N     1 
ATOM   810  C  CA    . PRO A 1 105 ? -37.771 16.083  27.370 1.00 37.71 ? 267 PRO A CA    1 
ATOM   811  C  C     . PRO A 1 105 ? -38.618 15.637  26.174 1.00 38.14 ? 267 PRO A C     1 
ATOM   812  O  O     . PRO A 1 105 ? -38.081 15.067  25.238 1.00 37.31 ? 267 PRO A O     1 
ATOM   813  C  CB    . PRO A 1 105 ? -36.782 17.180  26.947 1.00 40.01 ? 267 PRO A CB    1 
ATOM   814  C  CG    . PRO A 1 105 ? -35.477 16.806  27.563 1.00 37.36 ? 267 PRO A CG    1 
ATOM   815  C  CD    . PRO A 1 105 ? -35.470 15.334  27.675 1.00 33.88 ? 267 PRO A CD    1 
ATOM   816  N  N     . ASN A 1 106 ? -39.919 15.900  26.193 1.00 40.29 ? 268 ASN A N     1 
ATOM   817  C  CA    . ASN A 1 106 ? -40.803 15.292  25.193 1.00 40.66 ? 268 ASN A CA    1 
ATOM   818  C  C     . ASN A 1 106 ? -40.774 15.891  23.776 1.00 43.36 ? 268 ASN A C     1 
ATOM   819  O  O     . ASN A 1 106 ? -41.368 15.322  22.854 1.00 43.82 ? 268 ASN A O     1 
ATOM   820  C  CB    . ASN A 1 106 ? -42.246 15.189  25.715 1.00 42.50 ? 268 ASN A CB    1 
ATOM   821  C  CG    . ASN A 1 106 ? -42.759 16.480  26.290 1.00 47.51 ? 268 ASN A CG    1 
ATOM   822  O  OD1   . ASN A 1 106 ? -42.293 17.560  25.938 1.00 52.64 ? 268 ASN A OD1   1 
ATOM   823  N  ND2   . ASN A 1 106 ? -43.730 16.375  27.193 1.00 50.31 ? 268 ASN A ND2   1 
ATOM   824  N  N     . TYR A 1 107 ? -40.089 17.016  23.591 1.00 45.38 ? 269 TYR A N     1 
ATOM   825  C  CA    . TYR A 1 107 ? -39.919 17.588  22.240 1.00 48.68 ? 269 TYR A CA    1 
ATOM   826  C  C     . TYR A 1 107 ? -38.789 16.898  21.440 1.00 46.29 ? 269 TYR A C     1 
ATOM   827  O  O     . TYR A 1 107 ? -38.586 17.206  20.263 1.00 48.46 ? 269 TYR A O     1 
ATOM   828  C  CB    . TYR A 1 107 ? -39.692 19.113  22.294 1.00 53.35 ? 269 TYR A CB    1 
ATOM   829  C  CG    . TYR A 1 107 ? -38.591 19.554  23.241 1.00 52.48 ? 269 TYR A CG    1 
ATOM   830  C  CD1   . TYR A 1 107 ? -37.254 19.529  22.855 1.00 51.42 ? 269 TYR A CD1   1 
ATOM   831  C  CD2   . TYR A 1 107 ? -38.893 19.987  24.531 1.00 52.77 ? 269 TYR A CD2   1 
ATOM   832  C  CE1   . TYR A 1 107 ? -36.256 19.928  23.724 1.00 50.96 ? 269 TYR A CE1   1 
ATOM   833  C  CE2   . TYR A 1 107 ? -37.906 20.373  25.406 1.00 52.08 ? 269 TYR A CE2   1 
ATOM   834  C  CZ    . TYR A 1 107 ? -36.591 20.346  25.000 1.00 51.39 ? 269 TYR A CZ    1 
ATOM   835  O  OH    . TYR A 1 107 ? -35.614 20.740  25.878 1.00 51.74 ? 269 TYR A OH    1 
ATOM   836  N  N     . LEU A 1 108 ? -38.075 15.961  22.073 1.00 41.77 ? 270 LEU A N     1 
ATOM   837  C  CA    . LEU A 1 108 ? -36.944 15.280  21.440 1.00 40.24 ? 270 LEU A CA    1 
ATOM   838  C  C     . LEU A 1 108 ? -37.369 14.060  20.630 1.00 39.21 ? 270 LEU A C     1 
ATOM   839  O  O     . LEU A 1 108 ? -38.229 13.285  21.064 1.00 37.25 ? 270 LEU A O     1 
ATOM   840  C  CB    . LEU A 1 108 ? -35.921 14.848  22.492 1.00 36.55 ? 270 LEU A CB    1 
ATOM   841  C  CG    . LEU A 1 108 ? -35.024 15.938  23.066 1.00 38.41 ? 270 LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1 108 ? -33.953 15.298  23.928 1.00 36.07 ? 270 LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1 108 ? -34.388 16.795  21.971 1.00 40.69 ? 270 LEU A CD2   1 
ATOM   844  N  N     . ASN A 1 109 ? -36.748 13.884  19.462 1.00 40.89 ? 271 ASN A N     1 
ATOM   845  C  CA    . ASN A 1 109 ? -37.058 12.748  18.593 1.00 41.07 ? 271 ASN A CA    1 
ATOM   846  C  C     . ASN A 1 109 ? -36.117 11.551  18.797 1.00 38.03 ? 271 ASN A C     1 
ATOM   847  O  O     . ASN A 1 109 ? -35.198 11.611  19.608 1.00 35.88 ? 271 ASN A O     1 
ATOM   848  C  CB    . ASN A 1 109 ? -37.134 13.180  17.119 1.00 45.39 ? 271 ASN A CB    1 
ATOM   849  C  CG    . ASN A 1 109 ? -35.767 13.350  16.464 1.00 46.71 ? 271 ASN A CG    1 
ATOM   850  O  OD1   . ASN A 1 109 ? -34.776 12.728  16.864 1.00 43.50 ? 271 ASN A OD1   1 
ATOM   851  N  ND2   . ASN A 1 109 ? -35.718 14.193  15.431 1.00 48.48 ? 271 ASN A ND2   1 
ATOM   852  N  N     . ASP A 1 110 ? -36.371 10.479  18.046 1.00 38.92 ? 272 ASP A N     1 
ATOM   853  C  CA    . ASP A 1 110 ? -35.692 9.189   18.204 1.00 37.09 ? 272 ASP A CA    1 
ATOM   854  C  C     . ASP A 1 110 ? -34.179 9.290   18.082 1.00 36.74 ? 272 ASP A C     1 
ATOM   855  O  O     . ASP A 1 110 ? -33.465 8.893   18.992 1.00 33.70 ? 272 ASP A O     1 
ATOM   856  C  CB    . ASP A 1 110 ? -36.226 8.151   17.186 1.00 39.41 ? 272 ASP A CB    1 
ATOM   857  C  CG    . ASP A 1 110 ? -37.722 7.858   17.367 1.00 42.01 ? 272 ASP A CG    1 
ATOM   858  O  OD1   . ASP A 1 110 ? -38.209 6.762   16.978 1.00 43.62 ? 272 ASP A OD1   1 
ATOM   859  O  OD2   . ASP A 1 110 ? -38.420 8.749   17.899 1.00 47.02 ? 272 ASP A OD2   1 
ATOM   860  N  N     . ASP A 1 111 ? -33.692 9.818   16.963 1.00 40.06 ? 273 ASP A N     1 
ATOM   861  C  CA    . ASP A 1 111 ? -32.244 9.919   16.747 1.00 41.02 ? 273 ASP A CA    1 
ATOM   862  C  C     . ASP A 1 111 ? -31.555 10.790  17.789 1.00 39.03 ? 273 ASP A C     1 
ATOM   863  O  O     . ASP A 1 111 ? -30.457 10.467  18.239 1.00 37.66 ? 273 ASP A O     1 
ATOM   864  C  CB    . ASP A 1 111 ? -31.935 10.440  15.342 1.00 46.03 ? 273 ASP A CB    1 
ATOM   865  C  CG    . ASP A 1 111 ? -32.429 9.499   14.260 1.00 50.71 ? 273 ASP A CG    1 
ATOM   866  O  OD1   . ASP A 1 111 ? -32.147 8.275   14.340 1.00 52.34 ? 273 ASP A OD1   1 
ATOM   867  O  OD2   . ASP A 1 111 ? -33.126 9.976   13.341 1.00 57.64 ? 273 ASP A OD2   1 
ATOM   868  N  N     . GLN A 1 112 ? -32.207 11.882  18.175 1.00 39.45 ? 274 GLN A N     1 
ATOM   869  C  CA    . GLN A 1 112 ? -31.658 12.781  19.185 1.00 38.66 ? 274 GLN A CA    1 
ATOM   870  C  C     . GLN A 1 112 ? -31.485 12.042  20.522 1.00 34.80 ? 274 GLN A C     1 
ATOM   871  O  O     . GLN A 1 112 ? -30.433 12.130  21.150 1.00 33.41 ? 274 GLN A O     1 
ATOM   872  C  CB    . GLN A 1 112 ? -32.525 14.045  19.321 1.00 40.49 ? 274 GLN A CB    1 
ATOM   873  C  CG    . GLN A 1 112 ? -32.410 14.996  18.112 1.00 45.15 ? 274 GLN A CG    1 
ATOM   874  C  CD    . GLN A 1 112 ? -33.523 16.045  18.025 1.00 48.15 ? 274 GLN A CD    1 
ATOM   875  O  OE1   . GLN A 1 112 ? -34.543 15.960  18.707 1.00 46.05 ? 274 GLN A OE1   1 
ATOM   876  N  NE2   . GLN A 1 112 ? -33.327 17.029  17.163 1.00 51.81 ? 274 GLN A NE2   1 
ATOM   877  N  N     . VAL A 1 113 ? -32.497 11.284  20.928 1.00 33.26 ? 275 VAL A N     1 
ATOM   878  C  CA    . VAL A 1 113 ? -32.414 10.493  22.157 1.00 30.61 ? 275 VAL A CA    1 
ATOM   879  C  C     . VAL A 1 113 ? -31.408 9.326   22.026 1.00 30.02 ? 275 VAL A C     1 
ATOM   880  O  O     . VAL A 1 113 ? -30.658 9.014   22.963 1.00 28.83 ? 275 VAL A O     1 
ATOM   881  C  CB    . VAL A 1 113 ? -33.801 9.951   22.548 1.00 29.57 ? 275 VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 113 ? -33.693 8.888   23.635 1.00 26.24 ? 275 VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 113 ? -34.695 11.098  22.992 1.00 30.84 ? 275 VAL A CG2   1 
ATOM   884  N  N     . LYS A 1 114 ? -31.393 8.698   20.856 1.00 31.79 ? 276 LYS A N     1 
ATOM   885  C  CA    . LYS A 1 114 ? -30.497 7.574   20.572 1.00 31.92 ? 276 LYS A CA    1 
ATOM   886  C  C     . LYS A 1 114 ? -29.025 8.007   20.671 1.00 32.42 ? 276 LYS A C     1 
ATOM   887  O  O     . LYS A 1 114 ? -28.164 7.197   20.996 1.00 31.95 ? 276 LYS A O     1 
ATOM   888  C  CB    . LYS A 1 114 ? -30.781 7.022   19.171 1.00 34.36 ? 276 LYS A CB    1 
ATOM   889  C  CG    . LYS A 1 114 ? -30.953 5.521   19.101 1.00 35.48 ? 276 LYS A CG    1 
ATOM   890  C  CD    . LYS A 1 114 ? -31.630 5.077   17.792 1.00 38.28 ? 276 LYS A CD    1 
ATOM   891  C  CE    . LYS A 1 114 ? -30.686 5.230   16.580 1.00 43.43 ? 276 LYS A CE    1 
ATOM   892  N  NZ    . LYS A 1 114 ? -31.324 4.819   15.277 1.00 46.41 ? 276 LYS A NZ    1 
ATOM   893  N  N     . GLU A 1 115 ? -28.755 9.280   20.381 1.00 33.81 ? 277 GLU A N     1 
ATOM   894  C  CA    . GLU A 1 115 ? -27.395 9.836   20.409 1.00 35.05 ? 277 GLU A CA    1 
ATOM   895  C  C     . GLU A 1 115 ? -26.788 9.813   21.817 1.00 32.67 ? 277 GLU A C     1 
ATOM   896  O  O     . GLU A 1 115 ? -25.601 9.524   21.983 1.00 33.85 ? 277 GLU A O     1 
ATOM   897  C  CB    . GLU A 1 115 ? -27.416 11.277  19.880 1.00 37.84 ? 277 GLU A CB    1 
ATOM   898  C  CG    . GLU A 1 115 ? -26.060 11.930  19.665 1.00 40.30 ? 277 GLU A CG    1 
ATOM   899  C  CD    . GLU A 1 115 ? -26.174 13.380  19.160 1.00 44.37 ? 277 GLU A CD    1 
ATOM   900  O  OE1   . GLU A 1 115 ? -27.296 13.943  19.211 1.00 48.16 ? 277 GLU A OE1   1 
ATOM   901  O  OE2   . GLU A 1 115 ? -25.147 13.956  18.716 1.00 46.48 ? 277 GLU A OE2   1 
ATOM   902  N  N     . LEU A 1 116 ? -27.592 10.123  22.826 1.00 29.82 ? 278 LEU A N     1 
ATOM   903  C  CA    . LEU A 1 116 ? -27.129 10.030  24.198 1.00 28.09 ? 278 LEU A CA    1 
ATOM   904  C  C     . LEU A 1 116 ? -26.751 8.596   24.586 1.00 26.75 ? 278 LEU A C     1 
ATOM   905  O  O     . LEU A 1 116 ? -25.768 8.391   25.280 1.00 27.65 ? 278 LEU A O     1 
ATOM   906  C  CB    . LEU A 1 116 ? -28.203 10.543  25.171 1.00 26.77 ? 278 LEU A CB    1 
ATOM   907  C  CG    . LEU A 1 116 ? -27.752 10.572  26.632 1.00 25.92 ? 278 LEU A CG    1 
ATOM   908  C  CD1   . LEU A 1 116 ? -26.626 11.638  26.842 1.00 27.35 ? 278 LEU A CD1   1 
ATOM   909  C  CD2   . LEU A 1 116 ? -28.919 10.806  27.592 1.00 25.08 ? 278 LEU A CD2   1 
ATOM   910  N  N     . LEU A 1 117 ? -27.549 7.613   24.169 1.00 25.63 ? 279 LEU A N     1 
ATOM   911  C  CA    . LEU A 1 117 ? -27.348 6.223   24.581 1.00 24.37 ? 279 LEU A CA    1 
ATOM   912  C  C     . LEU A 1 117 ? -26.177 5.562   23.877 1.00 25.69 ? 279 LEU A C     1 
ATOM   913  O  O     . LEU A 1 117 ? -25.421 4.846   24.520 1.00 25.90 ? 279 LEU A O     1 
ATOM   914  C  CB    . LEU A 1 117 ? -28.614 5.405   24.340 1.00 23.80 ? 279 LEU A CB    1 
ATOM   915  C  CG    . LEU A 1 117 ? -29.828 5.841   25.156 1.00 22.59 ? 279 LEU A CG    1 
ATOM   916  C  CD1   . LEU A 1 117 ? -31.119 5.156   24.668 1.00 21.12 ? 279 LEU A CD1   1 
ATOM   917  C  CD2   . LEU A 1 117 ? -29.582 5.573   26.652 1.00 21.50 ? 279 LEU A CD2   1 
ATOM   918  N  N     . THR A 1 118 ? -26.012 5.808   22.573 1.00 27.07 ? 280 THR A N     1 
ATOM   919  C  CA    . THR A 1 118 ? -24.879 5.241   21.824 1.00 29.26 ? 280 THR A CA    1 
ATOM   920  C  C     . THR A 1 118 ? -23.501 5.862   22.151 1.00 30.19 ? 280 THR A C     1 
ATOM   921  O  O     . THR A 1 118 ? -22.489 5.422   21.619 1.00 32.27 ? 280 THR A O     1 
ATOM   922  C  CB    . THR A 1 118 ? -25.119 5.246   20.290 1.00 31.34 ? 280 THR A CB    1 
ATOM   923  O  OG1   . THR A 1 118 ? -25.346 6.578   19.834 1.00 33.11 ? 280 THR A OG1   1 
ATOM   924  C  CG2   . THR A 1 118 ? -26.324 4.397   19.930 1.00 30.55 ? 280 THR A CG2   1 
ATOM   925  N  N     . SER A 1 119 ? -23.440 6.865   23.025 1.00 29.02 ? 281 SER A N     1 
ATOM   926  C  CA    . SER A 1 119 ? -22.136 7.349   23.493 1.00 30.23 ? 281 SER A CA    1 
ATOM   927  C  C     . SER A 1 119 ? -21.406 6.245   24.272 1.00 30.14 ? 281 SER A C     1 
ATOM   928  O  O     . SER A 1 119 ? -20.183 6.172   24.255 1.00 31.66 ? 281 SER A O     1 
ATOM   929  C  CB    . SER A 1 119 ? -22.290 8.586   24.382 1.00 29.38 ? 281 SER A CB    1 
ATOM   930  O  OG    . SER A 1 119 ? -23.020 8.266   25.553 1.00 27.28 ? 281 SER A OG    1 
ATOM   931  N  N     . PHE A 1 120 ? -22.178 5.403   24.955 1.00 28.49 ? 282 PHE A N     1 
ATOM   932  C  CA    . PHE A 1 120 ? -21.645 4.295   25.735 1.00 29.08 ? 282 PHE A CA    1 
ATOM   933  C  C     . PHE A 1 120 ? -21.326 3.067   24.907 1.00 30.92 ? 282 PHE A C     1 
ATOM   934  O  O     . PHE A 1 120 ? -20.620 2.196   25.383 1.00 32.58 ? 282 PHE A O     1 
ATOM   935  C  CB    . PHE A 1 120 ? -22.654 3.879   26.811 1.00 27.76 ? 282 PHE A CB    1 
ATOM   936  C  CG    . PHE A 1 120 ? -22.848 4.905   27.889 1.00 26.83 ? 282 PHE A CG    1 
ATOM   937  C  CD1   . PHE A 1 120 ? -23.839 5.883   27.765 1.00 25.59 ? 282 PHE A CD1   1 
ATOM   938  C  CD2   . PHE A 1 120 ? -22.031 4.908   29.010 1.00 28.11 ? 282 PHE A CD2   1 
ATOM   939  C  CE1   . PHE A 1 120 ? -24.031 6.834   28.736 1.00 24.90 ? 282 PHE A CE1   1 
ATOM   940  C  CE2   . PHE A 1 120 ? -22.201 5.877   29.993 1.00 28.77 ? 282 PHE A CE2   1 
ATOM   941  C  CZ    . PHE A 1 120 ? -23.224 6.843   29.853 1.00 27.06 ? 282 PHE A CZ    1 
ATOM   942  N  N     . GLY A 1 121 ? -21.874 2.968   23.700 1.00 31.43 ? 283 GLY A N     1 
ATOM   943  C  CA    . GLY A 1 121 ? -21.682 1.779   22.851 1.00 34.17 ? 283 GLY A CA    1 
ATOM   944  C  C     . GLY A 1 121 ? -22.896 1.451   21.993 1.00 33.79 ? 283 GLY A C     1 
ATOM   945  O  O     . GLY A 1 121 ? -23.962 1.993   22.203 1.00 31.36 ? 283 GLY A O     1 
ATOM   946  N  N     . PRO A 1 122 ? -22.738 0.556   21.015 1.00 37.00 ? 284 PRO A N     1 
ATOM   947  C  CA    . PRO A 1 122 ? -23.817 0.305   20.056 1.00 37.58 ? 284 PRO A CA    1 
ATOM   948  C  C     . PRO A 1 122 ? -25.003 -0.467  20.639 1.00 36.21 ? 284 PRO A C     1 
ATOM   949  O  O     . PRO A 1 122 ? -24.844 -1.220  21.603 1.00 35.88 ? 284 PRO A O     1 
ATOM   950  C  CB    . PRO A 1 122 ? -23.127 -0.499  18.947 1.00 41.81 ? 284 PRO A CB    1 
ATOM   951  C  CG    . PRO A 1 122 ? -21.985 -1.164  19.621 1.00 43.44 ? 284 PRO A CG    1 
ATOM   952  C  CD    . PRO A 1 122 ? -21.541 -0.255  20.730 1.00 40.81 ? 284 PRO A CD    1 
ATOM   953  N  N     . LEU A 1 123 ? -26.171 -0.271  20.019 1.00 35.77 ? 285 LEU A N     1 
ATOM   954  C  CA    . LEU A 1 123 ? -27.453 -0.795  20.492 1.00 34.17 ? 285 LEU A CA    1 
ATOM   955  C  C     . LEU A 1 123 ? -27.949 -1.912  19.562 1.00 37.23 ? 285 LEU A C     1 
ATOM   956  O  O     . LEU A 1 123 ? -27.842 -1.796  18.340 1.00 39.47 ? 285 LEU A O     1 
ATOM   957  C  CB    . LEU A 1 123 ? -28.502 0.327   20.493 1.00 31.66 ? 285 LEU A CB    1 
ATOM   958  C  CG    . LEU A 1 123 ? -28.369 1.554   21.404 1.00 28.83 ? 285 LEU A CG    1 
ATOM   959  C  CD1   . LEU A 1 123 ? -29.409 2.608   21.010 1.00 26.39 ? 285 LEU A CD1   1 
ATOM   960  C  CD2   . LEU A 1 123 ? -28.523 1.176   22.875 1.00 26.73 ? 285 LEU A CD2   1 
ATOM   961  N  N     . LYS A 1 124 ? -28.496 -2.979  20.135 1.00 37.35 ? 286 LYS A N     1 
ATOM   962  C  CA    . LYS A 1 124 ? -29.215 -3.974  19.333 1.00 40.61 ? 286 LYS A CA    1 
ATOM   963  C  C     . LYS A 1 124 ? -30.737 -3.798  19.397 1.00 38.74 ? 286 LYS A C     1 
ATOM   964  O  O     . LYS A 1 124 ? -31.443 -4.499  18.715 1.00 41.35 ? 286 LYS A O     1 
ATOM   965  C  CB    . LYS A 1 124 ? -28.822 -5.418  19.708 1.00 43.69 ? 286 LYS A CB    1 
ATOM   966  C  CG    . LYS A 1 124 ? -29.132 -5.841  21.143 1.00 42.49 ? 286 LYS A CG    1 
ATOM   967  C  CD    . LYS A 1 124 ? -28.725 -7.303  21.379 1.00 46.48 ? 286 LYS A CD    1 
ATOM   968  C  CE    . LYS A 1 124 ? -28.935 -7.723  22.846 1.00 45.64 ? 286 LYS A CE    1 
ATOM   969  N  NZ    . LYS A 1 124 ? -28.756 -9.195  23.058 1.00 50.47 ? 286 LYS A NZ    1 
ATOM   970  N  N     . ALA A 1 125 ? -31.240 -2.872  20.211 1.00 35.02 ? 287 ALA A N     1 
ATOM   971  C  CA    . ALA A 1 125 ? -32.678 -2.588  20.241 1.00 33.60 ? 287 ALA A CA    1 
ATOM   972  C  C     . ALA A 1 125 ? -32.925 -1.218  20.829 1.00 30.05 ? 287 ALA A C     1 
ATOM   973  O  O     . ALA A 1 125 ? -32.193 -0.774  21.710 1.00 27.87 ? 287 ALA A O     1 
ATOM   974  C  CB    . ALA A 1 125 ? -33.436 -3.658  21.049 1.00 33.65 ? 287 ALA A CB    1 
ATOM   975  N  N     . PHE A 1 126 ? -33.968 -0.558  20.336 1.00 29.66 ? 288 PHE A N     1 
ATOM   976  C  CA    . PHE A 1 126 ? -34.359 0.745   20.848 1.00 27.18 ? 288 PHE A CA    1 
ATOM   977  C  C     . PHE A 1 126 ? -35.777 1.121   20.399 1.00 27.55 ? 288 PHE A C     1 
ATOM   978  O  O     . PHE A 1 126 ? -36.179 0.843   19.280 1.00 29.92 ? 288 PHE A O     1 
ATOM   979  C  CB    . PHE A 1 126 ? -33.359 1.814   20.389 1.00 27.54 ? 288 PHE A CB    1 
ATOM   980  C  CG    . PHE A 1 126 ? -33.792 3.211   20.709 1.00 26.07 ? 288 PHE A CG    1 
ATOM   981  C  CD1   . PHE A 1 126 ? -33.591 3.736   21.968 1.00 23.63 ? 288 PHE A CD1   1 
ATOM   982  C  CD2   . PHE A 1 126 ? -34.456 3.977   19.767 1.00 28.50 ? 288 PHE A CD2   1 
ATOM   983  C  CE1   . PHE A 1 126 ? -34.022 5.006   22.276 1.00 23.67 ? 288 PHE A CE1   1 
ATOM   984  C  CE2   . PHE A 1 126 ? -34.885 5.255   20.073 1.00 28.01 ? 288 PHE A CE2   1 
ATOM   985  C  CZ    . PHE A 1 126 ? -34.658 5.770   21.329 1.00 25.20 ? 288 PHE A CZ    1 
ATOM   986  N  N     . ASN A 1 127 ? -36.538 1.743   21.289 1.00 25.74 ? 289 ASN A N     1 
ATOM   987  C  CA    . ASN A 1 127 ? -37.847 2.274   20.929 1.00 26.54 ? 289 ASN A CA    1 
ATOM   988  C  C     . ASN A 1 127 ? -38.227 3.418   21.862 1.00 24.68 ? 289 ASN A C     1 
ATOM   989  O  O     . ASN A 1 127 ? -38.192 3.248   23.084 1.00 22.56 ? 289 ASN A O     1 
ATOM   990  C  CB    . ASN A 1 127 ? -38.936 1.168   20.849 1.00 27.73 ? 289 ASN A CB    1 
ATOM   991  C  CG    . ASN A 1 127 ? -39.567 0.815   22.200 1.00 26.83 ? 289 ASN A CG    1 
ATOM   992  O  OD1   . ASN A 1 127 ? -38.937 0.197   23.048 1.00 28.21 ? 289 ASN A OD1   1 
ATOM   993  N  ND2   . ASN A 1 127 ? -40.838 1.144   22.369 1.00 26.83 ? 289 ASN A ND2   1 
ATOM   994  N  N     . LEU A 1 128 ? -38.534 4.583   21.263 1.00 25.37 ? 290 LEU A N     1 
ATOM   995  C  CA    . LEU A 1 128 ? -39.037 5.762   21.981 1.00 24.69 ? 290 LEU A CA    1 
ATOM   996  C  C     . LEU A 1 128 ? -40.567 5.768   21.948 1.00 26.16 ? 290 LEU A C     1 
ATOM   997  O  O     . LEU A 1 128 ? -41.176 5.769   20.880 1.00 28.09 ? 290 LEU A O     1 
ATOM   998  C  CB    . LEU A 1 128 ? -38.479 7.046   21.370 1.00 25.71 ? 290 LEU A CB    1 
ATOM   999  C  CG    . LEU A 1 128 ? -38.948 8.391   21.945 1.00 26.27 ? 290 LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1 128 ? -38.366 8.641   23.341 1.00 22.54 ? 290 LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1 128 ? -38.599 9.526   20.992 1.00 28.42 ? 290 LEU A CD2   1 
ATOM   1002 N  N     . VAL A 1 129 ? -41.183 5.778   23.126 1.00 25.44 ? 291 VAL A N     1 
ATOM   1003 C  CA    . VAL A 1 129 ? -42.624 5.619   23.230 1.00 27.26 ? 291 VAL A CA    1 
ATOM   1004 C  C     . VAL A 1 129 ? -43.345 6.910   22.826 1.00 30.04 ? 291 VAL A C     1 
ATOM   1005 O  O     . VAL A 1 129 ? -43.117 7.965   23.405 1.00 29.51 ? 291 VAL A O     1 
ATOM   1006 C  CB    . VAL A 1 129 ? -43.048 5.186   24.653 1.00 25.90 ? 291 VAL A CB    1 
ATOM   1007 C  CG1   . VAL A 1 129 ? -44.574 4.985   24.725 1.00 27.04 ? 291 VAL A CG1   1 
ATOM   1008 C  CG2   . VAL A 1 129 ? -42.309 3.922   25.071 1.00 23.13 ? 291 VAL A CG2   1 
ATOM   1009 N  N     . LYS A 1 130 ? -44.226 6.800   21.833 1.00 33.71 ? 292 LYS A N     1 
ATOM   1010 C  CA    . LYS A 1 130 ? -44.920 7.942   21.252 1.00 37.39 ? 292 LYS A CA    1 
ATOM   1011 C  C     . LYS A 1 130 ? -46.428 7.774   21.275 1.00 40.53 ? 292 LYS A C     1 
ATOM   1012 O  O     . LYS A 1 130 ? -46.945 6.674   21.127 1.00 41.22 ? 292 LYS A O     1 
ATOM   1013 C  CB    . LYS A 1 130 ? -44.464 8.123   19.808 1.00 39.34 ? 292 LYS A CB    1 
ATOM   1014 C  CG    . LYS A 1 130 ? -43.078 8.725   19.686 1.00 38.47 ? 292 LYS A CG    1 
ATOM   1015 C  CD    . LYS A 1 130 ? -42.676 8.905   18.232 1.00 41.76 ? 292 LYS A CD    1 
ATOM   1016 C  CE    . LYS A 1 130 ? -42.171 7.604   17.640 1.00 42.35 ? 292 LYS A CE    1 
ATOM   1017 N  NZ    . LYS A 1 130 ? -40.977 7.098   18.396 1.00 39.57 ? 292 LYS A NZ    1 
ATOM   1018 N  N     . ASP A 1 131 ? -47.138 8.879   21.453 1.00 44.06 ? 293 ASP A N     1 
ATOM   1019 C  CA    . ASP A 1 131 ? -48.586 8.888   21.260 1.00 47.71 ? 293 ASP A CA    1 
ATOM   1020 C  C     . ASP A 1 131 ? -48.884 8.605   19.780 1.00 51.34 ? 293 ASP A C     1 
ATOM   1021 O  O     . ASP A 1 131 ? -48.402 9.325   18.905 1.00 53.39 ? 293 ASP A O     1 
ATOM   1022 C  CB    . ASP A 1 131 ? -49.179 10.238  21.661 1.00 50.59 ? 293 ASP A CB    1 
ATOM   1023 C  CG    . ASP A 1 131 ? -50.695 10.207  21.702 1.00 54.75 ? 293 ASP A CG    1 
ATOM   1024 O  OD1   . ASP A 1 131 ? -51.344 10.779  20.788 1.00 60.92 ? 293 ASP A OD1   1 
ATOM   1025 O  OD2   . ASP A 1 131 ? -51.235 9.576   22.639 1.00 55.58 ? 293 ASP A OD2   1 
ATOM   1026 N  N     . SER A 1 132 ? -49.677 7.572   19.500 1.00 52.65 ? 294 SER A N     1 
ATOM   1027 C  CA    . SER A 1 132 ? -49.792 7.059   18.125 1.00 55.35 ? 294 SER A CA    1 
ATOM   1028 C  C     . SER A 1 132 ? -50.529 8.023   17.200 1.00 60.39 ? 294 SER A C     1 
ATOM   1029 O  O     . SER A 1 132 ? -50.032 8.355   16.116 1.00 62.59 ? 294 SER A O     1 
ATOM   1030 C  CB    . SER A 1 132 ? -50.468 5.678   18.107 1.00 56.04 ? 294 SER A CB    1 
ATOM   1031 O  OG    . SER A 1 132 ? -51.826 5.758   18.516 1.00 59.47 ? 294 SER A OG    1 
ATOM   1032 N  N     . ALA A 1 133 ? -51.708 8.464   17.642 1.00 62.59 ? 295 ALA A N     1 
ATOM   1033 C  CA    . ALA A 1 133 ? -52.560 9.369   16.864 1.00 67.87 ? 295 ALA A CA    1 
ATOM   1034 C  C     . ALA A 1 133 ? -51.899 10.727  16.581 1.00 68.99 ? 295 ALA A C     1 
ATOM   1035 O  O     . ALA A 1 133 ? -51.996 11.237  15.457 1.00 73.24 ? 295 ALA A O     1 
ATOM   1036 C  CB    . ALA A 1 133 ? -53.918 9.564   17.562 1.00 70.23 ? 295 ALA A CB    1 
ATOM   1037 N  N     . THR A 1 134 ? -51.231 11.304  17.582 1.00 65.47 ? 296 THR A N     1 
ATOM   1038 C  CA    . THR A 1 134 ? -50.539 12.582  17.389 1.00 66.75 ? 296 THR A CA    1 
ATOM   1039 C  C     . THR A 1 134 ? -49.121 12.346  16.842 1.00 64.00 ? 296 THR A C     1 
ATOM   1040 O  O     . THR A 1 134 ? -48.825 12.735  15.718 1.00 67.45 ? 296 THR A O     1 
ATOM   1041 C  CB    . THR A 1 134 ? -50.546 13.466  18.676 1.00 65.80 ? 296 THR A CB    1 
ATOM   1042 O  OG1   . THR A 1 134 ? -49.623 12.957  19.647 1.00 60.34 ? 296 THR A OG1   1 
ATOM   1043 C  CG2   . THR A 1 134 ? -51.955 13.534  19.279 1.00 68.01 ? 296 THR A CG2   1 
ATOM   1044 N  N     . GLY A 1 135 ? -48.266 11.690  17.620 1.00 58.58 ? 297 GLY A N     1 
ATOM   1045 C  CA    . GLY A 1 135 ? -46.891 11.351  17.185 1.00 55.84 ? 297 GLY A CA    1 
ATOM   1046 C  C     . GLY A 1 135 ? -45.757 11.829  18.092 1.00 51.98 ? 297 GLY A C     1 
ATOM   1047 O  O     . GLY A 1 135 ? -44.579 11.604  17.798 1.00 50.01 ? 297 GLY A O     1 
ATOM   1048 N  N     . LEU A 1 136 ? -46.112 12.471  19.201 1.00 51.08 ? 298 LEU A N     1 
ATOM   1049 C  CA    . LEU A 1 136 ? -45.156 13.221  20.012 1.00 48.92 ? 298 LEU A CA    1 
ATOM   1050 C  C     . LEU A 1 136 ? -44.787 12.391  21.235 1.00 43.81 ? 298 LEU A C     1 
ATOM   1051 O  O     . LEU A 1 136 ? -45.554 11.538  21.658 1.00 43.04 ? 298 LEU A O     1 
ATOM   1052 C  CB    . LEU A 1 136 ? -45.761 14.575  20.385 1.00 52.46 ? 298 LEU A CB    1 
ATOM   1053 C  CG    . LEU A 1 136 ? -46.328 15.276  19.134 1.00 58.15 ? 298 LEU A CG    1 
ATOM   1054 C  CD1   . LEU A 1 136 ? -47.675 15.994  19.395 1.00 61.80 ? 298 LEU A CD1   1 
ATOM   1055 C  CD2   . LEU A 1 136 ? -45.273 16.202  18.543 1.00 59.57 ? 298 LEU A CD2   1 
ATOM   1056 N  N     . SER A 1 137 ? -43.603 12.626  21.786 1.00 40.91 ? 299 SER A N     1 
ATOM   1057 C  CA    . SER A 1 137 ? -43.022 11.687  22.747 1.00 36.41 ? 299 SER A CA    1 
ATOM   1058 C  C     . SER A 1 137 ? -43.740 11.698  24.088 1.00 35.38 ? 299 SER A C     1 
ATOM   1059 O  O     . SER A 1 137 ? -44.299 12.699  24.481 1.00 38.05 ? 299 SER A O     1 
ATOM   1060 C  CB    . SER A 1 137 ? -41.532 11.971  22.950 1.00 34.46 ? 299 SER A CB    1 
ATOM   1061 O  OG    . SER A 1 137 ? -41.081 11.425  24.169 1.00 31.56 ? 299 SER A OG    1 
ATOM   1062 N  N     . LYS A 1 138 ? -43.716 10.561  24.770 1.00 32.39 ? 300 LYS A N     1 
ATOM   1063 C  CA    . LYS A 1 138 ? -44.258 10.429  26.116 1.00 31.62 ? 300 LYS A CA    1 
ATOM   1064 C  C     . LYS A 1 138 ? -43.170 10.643  27.166 1.00 29.08 ? 300 LYS A C     1 
ATOM   1065 O  O     . LYS A 1 138 ? -43.464 10.679  28.350 1.00 28.56 ? 300 LYS A O     1 
ATOM   1066 C  CB    . LYS A 1 138 ? -44.910 9.048   26.304 1.00 30.67 ? 300 LYS A CB    1 
ATOM   1067 C  CG    . LYS A 1 138 ? -46.022 8.771   25.329 1.00 32.75 ? 300 LYS A CG    1 
ATOM   1068 C  CD    . LYS A 1 138 ? -47.008 7.732   25.813 1.00 33.39 ? 300 LYS A CD    1 
ATOM   1069 C  CE    . LYS A 1 138 ? -48.103 7.567   24.760 1.00 36.21 ? 300 LYS A CE    1 
ATOM   1070 N  NZ    . LYS A 1 138 ? -49.169 6.629   25.148 1.00 36.73 ? 300 LYS A NZ    1 
ATOM   1071 N  N     . GLY A 1 139 ? -41.923 10.782  26.722 1.00 27.59 ? 301 GLY A N     1 
ATOM   1072 C  CA    . GLY A 1 139 ? -40.806 11.110  27.612 1.00 26.55 ? 301 GLY A CA    1 
ATOM   1073 C  C     . GLY A 1 139 ? -40.014 9.933   28.165 1.00 24.03 ? 301 GLY A C     1 
ATOM   1074 O  O     . GLY A 1 139 ? -39.193 10.111  29.078 1.00 23.35 ? 301 GLY A O     1 
ATOM   1075 N  N     . TYR A 1 140 ? -40.253 8.730   27.627 1.00 23.03 ? 302 TYR A N     1 
ATOM   1076 C  CA    . TYR A 1 140 ? -39.512 7.535   28.041 1.00 20.83 ? 302 TYR A CA    1 
ATOM   1077 C  C     . TYR A 1 140 ? -39.229 6.572   26.885 1.00 20.67 ? 302 TYR A C     1 
ATOM   1078 O  O     . TYR A 1 140 ? -39.929 6.559   25.854 1.00 21.43 ? 302 TYR A O     1 
ATOM   1079 C  CB    . TYR A 1 140 ? -40.186 6.817   29.233 1.00 20.21 ? 302 TYR A CB    1 
ATOM   1080 C  CG    . TYR A 1 140 ? -41.633 6.446   29.054 1.00 20.87 ? 302 TYR A CG    1 
ATOM   1081 C  CD1   . TYR A 1 140 ? -41.994 5.176   28.610 1.00 20.94 ? 302 TYR A CD1   1 
ATOM   1082 C  CD2   . TYR A 1 140 ? -42.642 7.333   29.377 1.00 21.76 ? 302 TYR A CD2   1 
ATOM   1083 C  CE1   . TYR A 1 140 ? -43.324 4.813   28.455 1.00 22.24 ? 302 TYR A CE1   1 
ATOM   1084 C  CE2   . TYR A 1 140 ? -43.972 6.987   29.220 1.00 24.46 ? 302 TYR A CE2   1 
ATOM   1085 C  CZ    . TYR A 1 140 ? -44.315 5.724   28.755 1.00 24.11 ? 302 TYR A CZ    1 
ATOM   1086 O  OH    . TYR A 1 140 ? -45.637 5.372   28.595 1.00 24.41 ? 302 TYR A OH    1 
ATOM   1087 N  N     . ALA A 1 141 ? -38.170 5.788   27.075 1.00 19.76 ? 303 ALA A N     1 
ATOM   1088 C  CA    . ALA A 1 141 ? -37.655 4.905   26.042 1.00 20.22 ? 303 ALA A CA    1 
ATOM   1089 C  C     . ALA A 1 141 ? -37.207 3.578   26.646 1.00 20.24 ? 303 ALA A C     1 
ATOM   1090 O  O     . ALA A 1 141 ? -37.029 3.453   27.858 1.00 20.32 ? 303 ALA A O     1 
ATOM   1091 C  CB    . ALA A 1 141 ? -36.500 5.579   25.327 1.00 19.77 ? 303 ALA A CB    1 
ATOM   1092 N  N     . PHE A 1 142 ? -37.053 2.581   25.788 1.00 21.44 ? 304 PHE A N     1 
ATOM   1093 C  CA    . PHE A 1 142 ? -36.468 1.297   26.167 1.00 21.85 ? 304 PHE A CA    1 
ATOM   1094 C  C     . PHE A 1 142 ? -35.308 0.981   25.250 1.00 22.68 ? 304 PHE A C     1 
ATOM   1095 O  O     . PHE A 1 142 ? -35.372 1.292   24.063 1.00 23.51 ? 304 PHE A O     1 
ATOM   1096 C  CB    . PHE A 1 142 ? -37.505 0.202   26.053 1.00 22.35 ? 304 PHE A CB    1 
ATOM   1097 C  CG    . PHE A 1 142 ? -38.653 0.395   26.962 1.00 21.90 ? 304 PHE A CG    1 
ATOM   1098 C  CD1   . PHE A 1 142 ? -38.664 -0.196  28.217 1.00 21.78 ? 304 PHE A CD1   1 
ATOM   1099 C  CD2   . PHE A 1 142 ? -39.723 1.180   26.582 1.00 21.33 ? 304 PHE A CD2   1 
ATOM   1100 C  CE1   . PHE A 1 142 ? -39.725 -0.011  29.075 1.00 21.82 ? 304 PHE A CE1   1 
ATOM   1101 C  CE2   . PHE A 1 142 ? -40.796 1.372   27.439 1.00 21.46 ? 304 PHE A CE2   1 
ATOM   1102 C  CZ    . PHE A 1 142 ? -40.799 0.783   28.683 1.00 21.71 ? 304 PHE A CZ    1 
ATOM   1103 N  N     . CYS A 1 143 ? -34.258 0.364   25.781 1.00 22.97 ? 305 CYS A N     1 
ATOM   1104 C  CA    . CYS A 1 143 ? -33.187 -0.080  24.920 1.00 25.36 ? 305 CYS A CA    1 
ATOM   1105 C  C     . CYS A 1 143 ? -32.368 -1.246  25.470 1.00 27.06 ? 305 CYS A C     1 
ATOM   1106 O  O     . CYS A 1 143 ? -32.537 -1.677  26.618 1.00 27.68 ? 305 CYS A O     1 
ATOM   1107 C  CB    . CYS A 1 143 ? -32.257 1.089   24.628 1.00 24.89 ? 305 CYS A CB    1 
ATOM   1108 S  SG    . CYS A 1 143 ? -31.103 1.377   25.944 1.00 27.20 ? 305 CYS A SG    1 
ATOM   1109 N  N     . GLU A 1 144 ? -31.460 -1.736  24.632 1.00 28.92 ? 306 GLU A N     1 
ATOM   1110 C  CA    . GLU A 1 144 ? -30.590 -2.847  24.990 1.00 31.05 ? 306 GLU A CA    1 
ATOM   1111 C  C     . GLU A 1 144 ? -29.276 -2.781  24.213 1.00 32.10 ? 306 GLU A C     1 
ATOM   1112 O  O     . GLU A 1 144 ? -29.268 -2.586  22.993 1.00 33.06 ? 306 GLU A O     1 
ATOM   1113 C  CB    . GLU A 1 144 ? -31.317 -4.160  24.718 1.00 33.47 ? 306 GLU A CB    1 
ATOM   1114 C  CG    . GLU A 1 144 ? -30.687 -5.355  25.395 1.00 36.72 ? 306 GLU A CG    1 
ATOM   1115 C  CD    . GLU A 1 144 ? -31.603 -6.570  25.406 1.00 40.54 ? 306 GLU A CD    1 
ATOM   1116 O  OE1   . GLU A 1 144 ? -32.788 -6.405  24.981 1.00 42.09 ? 306 GLU A OE1   1 
ATOM   1117 O  OE2   . GLU A 1 144 ? -31.138 -7.670  25.846 1.00 43.77 ? 306 GLU A OE2   1 
ATOM   1118 N  N     . TYR A 1 145 ? -28.170 -2.937  24.929 1.00 32.50 ? 307 TYR A N     1 
ATOM   1119 C  CA    . TYR A 1 145 ? -26.832 -2.762  24.351 1.00 34.00 ? 307 TYR A CA    1 
ATOM   1120 C  C     . TYR A 1 145 ? -26.279 -4.074  23.772 1.00 38.11 ? 307 TYR A C     1 
ATOM   1121 O  O     . TYR A 1 145 ? -26.468 -5.137  24.369 1.00 39.78 ? 307 TYR A O     1 
ATOM   1122 C  CB    . TYR A 1 145 ? -25.863 -2.237  25.417 1.00 32.57 ? 307 TYR A CB    1 
ATOM   1123 C  CG    . TYR A 1 145 ? -26.023 -0.783  25.731 1.00 29.07 ? 307 TYR A CG    1 
ATOM   1124 C  CD1   . TYR A 1 145 ? -25.466 0.188   24.907 1.00 29.29 ? 307 TYR A CD1   1 
ATOM   1125 C  CD2   . TYR A 1 145 ? -26.723 -0.366  26.857 1.00 26.56 ? 307 TYR A CD2   1 
ATOM   1126 C  CE1   . TYR A 1 145 ? -25.612 1.559   25.200 1.00 27.43 ? 307 TYR A CE1   1 
ATOM   1127 C  CE2   . TYR A 1 145 ? -26.874 0.980   27.151 1.00 24.48 ? 307 TYR A CE2   1 
ATOM   1128 C  CZ    . TYR A 1 145 ? -26.320 1.944   26.327 1.00 24.96 ? 307 TYR A CZ    1 
ATOM   1129 O  OH    . TYR A 1 145 ? -26.474 3.296   26.626 1.00 24.20 ? 307 TYR A OH    1 
ATOM   1130 N  N     . VAL A 1 146 ? -25.582 -3.987  22.632 1.00 40.37 ? 308 VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 146 ? -24.912 -5.147  22.021 1.00 45.27 ? 308 VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 146 ? -24.001 -5.830  23.035 1.00 47.40 ? 308 VAL A C     1 
ATOM   1133 O  O     . VAL A 1 146 ? -24.171 -7.004  23.344 1.00 50.25 ? 308 VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 146 ? -24.076 -4.748  20.770 1.00 47.41 ? 308 VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 146 ? -23.151 -5.880  20.333 1.00 52.06 ? 308 VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 146 ? -24.988 -4.341  19.621 1.00 47.27 ? 308 VAL A CG2   1 
ATOM   1137 N  N     . ASP A 1 147 ? -23.029 -5.089  23.550 1.00 47.10 ? 309 ASP A N     1 
ATOM   1138 C  CA    . ASP A 1 147 ? -22.199 -5.587  24.640 1.00 48.79 ? 309 ASP A CA    1 
ATOM   1139 C  C     . ASP A 1 147 ? -23.006 -5.408  25.918 1.00 45.96 ? 309 ASP A C     1 
ATOM   1140 O  O     . ASP A 1 147 ? -23.428 -4.308  26.237 1.00 42.31 ? 309 ASP A O     1 
ATOM   1141 C  CB    . ASP A 1 147 ? -20.860 -4.836  24.711 1.00 49.62 ? 309 ASP A CB    1 
ATOM   1142 C  CG    . ASP A 1 147 ? -19.845 -5.507  25.654 1.00 53.54 ? 309 ASP A CG    1 
ATOM   1143 O  OD1   . ASP A 1 147 ? -18.658 -5.083  25.671 1.00 55.74 ? 309 ASP A OD1   1 
ATOM   1144 O  OD2   . ASP A 1 147 ? -20.233 -6.458  26.378 1.00 58.06 ? 309 ASP A OD2   1 
ATOM   1145 N  N     . ILE A 1 148 ? -23.247 -6.501  26.630 1.00 48.38 ? 310 ILE A N     1 
ATOM   1146 C  CA    . ILE A 1 148 ? -24.070 -6.453  27.845 1.00 46.48 ? 310 ILE A CA    1 
ATOM   1147 C  C     . ILE A 1 148 ? -23.308 -5.908  29.060 1.00 45.78 ? 310 ILE A C     1 
ATOM   1148 O  O     . ILE A 1 148 ? -23.921 -5.542  30.059 1.00 43.98 ? 310 ILE A O     1 
ATOM   1149 C  CB    . ILE A 1 148 ? -24.715 -7.833  28.175 1.00 49.88 ? 310 ILE A CB    1 
ATOM   1150 C  CG1   . ILE A 1 148 ? -23.670 -8.950  28.218 1.00 54.94 ? 310 ILE A CG1   1 
ATOM   1151 C  CG2   . ILE A 1 148 ? -25.826 -8.151  27.159 1.00 50.34 ? 310 ILE A CG2   1 
ATOM   1152 C  CD1   . ILE A 1 148 ? -24.264 -10.332 28.382 1.00 59.72 ? 310 ILE A CD1   1 
ATOM   1153 N  N     . ASN A 1 149 ? -21.981 -5.841  28.967 1.00 47.55 ? 311 ASN A N     1 
ATOM   1154 C  CA    . ASN A 1 149 ? -21.162 -5.216  30.012 1.00 47.19 ? 311 ASN A CA    1 
ATOM   1155 C  C     . ASN A 1 149 ? -21.284 -3.681  29.989 1.00 42.60 ? 311 ASN A C     1 
ATOM   1156 O  O     . ASN A 1 149 ? -20.915 -3.006  30.947 1.00 42.18 ? 311 ASN A O     1 
ATOM   1157 C  CB    . ASN A 1 149 ? -19.693 -5.630  29.863 1.00 51.36 ? 311 ASN A CB    1 
ATOM   1158 C  CG    . ASN A 1 149 ? -19.513 -7.155  29.749 1.00 57.29 ? 311 ASN A CG    1 
ATOM   1159 O  OD1   . ASN A 1 149 ? -20.484 -7.913  29.853 1.00 59.17 ? 311 ASN A OD1   1 
ATOM   1160 N  ND2   . ASN A 1 149 ? -18.268 -7.603  29.523 1.00 60.77 ? 311 ASN A ND2   1 
ATOM   1161 N  N     . VAL A 1 150 ? -21.797 -3.145  28.884 1.00 39.72 ? 312 VAL A N     1 
ATOM   1162 C  CA    . VAL A 1 150 ? -22.059 -1.723  28.748 1.00 35.94 ? 312 VAL A CA    1 
ATOM   1163 C  C     . VAL A 1 150 ? -23.261 -1.331  29.603 1.00 32.95 ? 312 VAL A C     1 
ATOM   1164 O  O     . VAL A 1 150 ? -23.284 -0.269  30.194 1.00 31.51 ? 312 VAL A O     1 
ATOM   1165 C  CB    . VAL A 1 150 ? -22.286 -1.330  27.260 1.00 34.96 ? 312 VAL A CB    1 
ATOM   1166 C  CG1   . VAL A 1 150 ? -22.702 0.122   27.135 1.00 32.08 ? 312 VAL A CG1   1 
ATOM   1167 C  CG2   . VAL A 1 150 ? -21.026 -1.571  26.447 1.00 37.02 ? 312 VAL A CG2   1 
ATOM   1168 N  N     . THR A 1 151 ? -24.246 -2.212  29.678 1.00 33.13 ? 313 THR A N     1 
ATOM   1169 C  CA    . THR A 1 151 ? -25.445 -2.009  30.488 1.00 31.36 ? 313 THR A CA    1 
ATOM   1170 C  C     . THR A 1 151 ? -25.150 -1.305  31.820 1.00 30.77 ? 313 THR A C     1 
ATOM   1171 O  O     . THR A 1 151 ? -25.688 -0.251  32.088 1.00 28.17 ? 313 THR A O     1 
ATOM   1172 C  CB    . THR A 1 151 ? -26.157 -3.371  30.753 1.00 33.15 ? 313 THR A CB    1 
ATOM   1173 O  OG1   . THR A 1 151 ? -26.354 -4.050  29.510 1.00 33.46 ? 313 THR A OG1   1 
ATOM   1174 C  CG2   . THR A 1 151 ? -27.503 -3.178  31.459 1.00 31.32 ? 313 THR A CG2   1 
ATOM   1175 N  N     . ASP A 1 152 ? -24.288 -1.881  32.644 1.00 33.76 ? 314 ASP A N     1 
ATOM   1176 C  CA    . ASP A 1 152 ? -23.976 -1.267  33.944 1.00 34.55 ? 314 ASP A CA    1 
ATOM   1177 C  C     . ASP A 1 152 ? -23.288 0.103   33.854 1.00 33.01 ? 314 ASP A C     1 
ATOM   1178 O  O     . ASP A 1 152 ? -23.481 0.933   34.742 1.00 32.72 ? 314 ASP A O     1 
ATOM   1179 C  CB    . ASP A 1 152 ? -23.143 -2.213  34.810 1.00 38.46 ? 314 ASP A CB    1 
ATOM   1180 C  CG    . ASP A 1 152 ? -23.979 -3.334  35.413 1.00 41.19 ? 314 ASP A CG    1 
ATOM   1181 O  OD1   . ASP A 1 152 ? -23.396 -4.304  35.954 1.00 45.31 ? 314 ASP A OD1   1 
ATOM   1182 O  OD2   . ASP A 1 152 ? -25.223 -3.247  35.340 1.00 40.60 ? 314 ASP A OD2   1 
ATOM   1183 N  N     . GLN A 1 153 ? -22.511 0.336   32.796 1.00 32.52 ? 315 GLN A N     1 
ATOM   1184 C  CA    . GLN A 1 153 ? -21.840 1.619   32.594 1.00 31.71 ? 315 GLN A CA    1 
ATOM   1185 C  C     . GLN A 1 153 ? -22.835 2.737   32.210 1.00 28.56 ? 315 GLN A C     1 
ATOM   1186 O  O     . GLN A 1 153 ? -22.771 3.841   32.737 1.00 28.19 ? 315 GLN A O     1 
ATOM   1187 C  CB    . GLN A 1 153 ? -20.738 1.486   31.543 1.00 33.07 ? 315 GLN A CB    1 
ATOM   1188 C  CG    . GLN A 1 153 ? -19.559 0.611   31.987 1.00 37.16 ? 315 GLN A CG    1 
ATOM   1189 C  CD    . GLN A 1 153 ? -18.533 0.342   30.869 1.00 38.81 ? 315 GLN A CD    1 
ATOM   1190 O  OE1   . GLN A 1 153 ? -18.791 0.568   29.687 1.00 36.27 ? 315 GLN A OE1   1 
ATOM   1191 N  NE2   . GLN A 1 153 ? -17.362 -0.147  31.257 1.00 43.07 ? 315 GLN A NE2   1 
ATOM   1192 N  N     . ALA A 1 154 ? -23.748 2.451   31.294 1.00 26.67 ? 316 ALA A N     1 
ATOM   1193 C  CA    . ALA A 1 154 ? -24.842 3.377   30.985 1.00 24.33 ? 316 ALA A CA    1 
ATOM   1194 C  C     . ALA A 1 154 ? -25.597 3.808   32.254 1.00 23.47 ? 316 ALA A C     1 
ATOM   1195 O  O     . ALA A 1 154 ? -25.825 5.001   32.488 1.00 22.95 ? 316 ALA A O     1 
ATOM   1196 C  CB    . ALA A 1 154 ? -25.826 2.738   29.977 1.00 23.27 ? 316 ALA A CB    1 
ATOM   1197 N  N     . ILE A 1 155 ? -25.975 2.826   33.064 1.00 23.83 ? 317 ILE A N     1 
ATOM   1198 C  CA    . ILE A 1 155 ? -26.701 3.078   34.304 1.00 24.05 ? 317 ILE A CA    1 
ATOM   1199 C  C     . ILE A 1 155 ? -25.921 4.025   35.211 1.00 24.93 ? 317 ILE A C     1 
ATOM   1200 O  O     . ILE A 1 155 ? -26.468 5.010   35.686 1.00 24.32 ? 317 ILE A O     1 
ATOM   1201 C  CB    . ILE A 1 155 ? -26.975 1.780   35.058 1.00 25.76 ? 317 ILE A CB    1 
ATOM   1202 C  CG1   . ILE A 1 155 ? -27.966 0.916   34.271 1.00 25.54 ? 317 ILE A CG1   1 
ATOM   1203 C  CG2   . ILE A 1 155 ? -27.527 2.078   36.437 1.00 26.68 ? 317 ILE A CG2   1 
ATOM   1204 C  CD1   . ILE A 1 155 ? -28.135 -0.499  34.810 1.00 27.65 ? 317 ILE A CD1   1 
ATOM   1205 N  N     . ALA A 1 156 ? -24.637 3.731   35.416 1.00 26.27 ? 318 ALA A N     1 
ATOM   1206 C  CA    . ALA A 1 156 ? -23.787 4.516   36.311 1.00 28.01 ? 318 ALA A CA    1 
ATOM   1207 C  C     . ALA A 1 156 ? -23.547 5.922   35.782 1.00 26.64 ? 318 ALA A C     1 
ATOM   1208 O  O     . ALA A 1 156 ? -23.394 6.844   36.556 1.00 27.22 ? 318 ALA A O     1 
ATOM   1209 C  CB    . ALA A 1 156 ? -22.450 3.794   36.571 1.00 30.02 ? 318 ALA A CB    1 
ATOM   1210 N  N     . GLY A 1 157 ? -23.535 6.079   34.462 1.00 25.25 ? 319 GLY A N     1 
ATOM   1211 C  CA    . GLY A 1 157 ? -23.276 7.367   33.827 1.00 25.14 ? 319 GLY A CA    1 
ATOM   1212 C  C     . GLY A 1 157 ? -24.499 8.253   33.609 1.00 24.10 ? 319 GLY A C     1 
ATOM   1213 O  O     . GLY A 1 157 ? -24.338 9.460   33.384 1.00 24.73 ? 319 GLY A O     1 
ATOM   1214 N  N     . LEU A 1 158 ? -25.703 7.669   33.667 1.00 22.48 ? 320 LEU A N     1 
ATOM   1215 C  CA    . LEU A 1 158 ? -26.953 8.394   33.389 1.00 21.84 ? 320 LEU A CA    1 
ATOM   1216 C  C     . LEU A 1 158 ? -27.997 8.472   34.544 1.00 22.60 ? 320 LEU A C     1 
ATOM   1217 O  O     . LEU A 1 158 ? -28.753 9.437   34.633 1.00 22.95 ? 320 LEU A O     1 
ATOM   1218 C  CB    . LEU A 1 158 ? -27.617 7.795   32.149 1.00 19.84 ? 320 LEU A CB    1 
ATOM   1219 C  CG    . LEU A 1 158 ? -26.837 7.866   30.833 1.00 19.81 ? 320 LEU A CG    1 
ATOM   1220 C  CD1   . LEU A 1 158 ? -27.569 7.126   29.692 1.00 18.80 ? 320 LEU A CD1   1 
ATOM   1221 C  CD2   . LEU A 1 158 ? -26.605 9.301   30.429 1.00 19.91 ? 320 LEU A CD2   1 
ATOM   1222 N  N     . ASN A 1 159 ? -28.044 7.474   35.418 1.00 23.70 ? 321 ASN A N     1 
ATOM   1223 C  CA    . ASN A 1 159 ? -29.067 7.417   36.466 1.00 25.00 ? 321 ASN A CA    1 
ATOM   1224 C  C     . ASN A 1 159 ? -28.873 8.483   37.524 1.00 27.74 ? 321 ASN A C     1 
ATOM   1225 O  O     . ASN A 1 159 ? -27.781 8.636   38.048 1.00 30.00 ? 321 ASN A O     1 
ATOM   1226 C  CB    . ASN A 1 159 ? -29.060 6.050   37.136 1.00 25.65 ? 321 ASN A CB    1 
ATOM   1227 C  CG    . ASN A 1 159 ? -30.140 5.908   38.153 1.00 27.08 ? 321 ASN A CG    1 
ATOM   1228 O  OD1   . ASN A 1 159 ? -31.309 6.216   37.891 1.00 27.21 ? 321 ASN A OD1   1 
ATOM   1229 N  ND2   . ASN A 1 159 ? -29.771 5.436   39.328 1.00 27.79 ? 321 ASN A ND2   1 
ATOM   1230 N  N     . GLY A 1 160 ? -29.928 9.226   37.833 1.00 28.87 ? 322 GLY A N     1 
ATOM   1231 C  CA    . GLY A 1 160 ? -29.843 10.289  38.833 1.00 32.22 ? 322 GLY A CA    1 
ATOM   1232 C  C     . GLY A 1 160 ? -29.180 11.576  38.358 1.00 33.34 ? 322 GLY A C     1 
ATOM   1233 O  O     . GLY A 1 160 ? -28.891 12.452  39.175 1.00 36.97 ? 322 GLY A O     1 
ATOM   1234 N  N     . MET A 1 161 ? -28.978 11.712  37.045 1.00 31.51 ? 323 MET A N     1 
ATOM   1235 C  CA    . MET A 1 161 ? -28.233 12.834  36.450 1.00 32.75 ? 323 MET A CA    1 
ATOM   1236 C  C     . MET A 1 161 ? -29.174 13.880  35.860 1.00 33.89 ? 323 MET A C     1 
ATOM   1237 O  O     . MET A 1 161 ? -30.328 13.580  35.551 1.00 32.89 ? 323 MET A O     1 
ATOM   1238 C  CB    . MET A 1 161 ? -27.299 12.313  35.364 1.00 30.53 ? 323 MET A CB    1 
ATOM   1239 C  CG    . MET A 1 161 ? -26.474 11.089  35.795 1.00 30.08 ? 323 MET A CG    1 
ATOM   1240 S  SD    . MET A 1 161 ? -25.096 11.417  36.909 1.00 31.39 ? 323 MET A SD    1 
ATOM   1241 C  CE    . MET A 1 161 ? -23.950 12.033  35.738 1.00 32.06 ? 323 MET A CE    1 
ATOM   1242 N  N     . GLN A 1 162 ? -28.678 15.105  35.710 1.00 37.26 ? 324 GLN A N     1 
ATOM   1243 C  CA    . GLN A 1 162 ? -29.502 16.237  35.281 1.00 39.37 ? 324 GLN A CA    1 
ATOM   1244 C  C     . GLN A 1 162 ? -29.538 16.354  33.755 1.00 38.53 ? 324 GLN A C     1 
ATOM   1245 O  O     . GLN A 1 162 ? -28.510 16.225  33.087 1.00 37.86 ? 324 GLN A O     1 
ATOM   1246 C  CB    . GLN A 1 162 ? -28.971 17.523  35.885 1.00 43.59 ? 324 GLN A CB    1 
ATOM   1247 C  CG    . GLN A 1 162 ? -29.941 18.707  35.808 1.00 48.32 ? 324 GLN A CG    1 
ATOM   1248 C  CD    . GLN A 1 162 ? -31.057 18.696  36.878 1.00 53.80 ? 324 GLN A CD    1 
ATOM   1249 O  OE1   . GLN A 1 162 ? -30.868 18.231  38.008 1.00 56.62 ? 324 GLN A OE1   1 
ATOM   1250 N  NE2   . GLN A 1 162 ? -32.220 19.236  36.515 1.00 56.91 ? 324 GLN A NE2   1 
ATOM   1251 N  N     . LEU A 1 163 ? -30.737 16.571  33.219 1.00 39.15 ? 325 LEU A N     1 
ATOM   1252 C  CA    . LEU A 1 163 ? -30.961 16.782  31.790 1.00 38.94 ? 325 LEU A CA    1 
ATOM   1253 C  C     . LEU A 1 163 ? -32.044 17.835  31.677 1.00 42.63 ? 325 LEU A C     1 
ATOM   1254 O  O     . LEU A 1 163 ? -33.236 17.538  31.774 1.00 42.69 ? 325 LEU A O     1 
ATOM   1255 C  CB    . LEU A 1 163 ? -31.412 15.500  31.128 1.00 35.92 ? 325 LEU A CB    1 
ATOM   1256 C  CG    . LEU A 1 163 ? -31.277 15.354  29.610 1.00 35.77 ? 325 LEU A CG    1 
ATOM   1257 C  CD1   . LEU A 1 163 ? -29.809 15.352  29.183 1.00 37.18 ? 325 LEU A CD1   1 
ATOM   1258 C  CD2   . LEU A 1 163 ? -31.954 14.056  29.159 1.00 31.92 ? 325 LEU A CD2   1 
ATOM   1259 N  N     . GLY A 1 164 ? -31.618 19.084  31.527 1.00 46.49 ? 326 GLY A N     1 
ATOM   1260 C  CA    . GLY A 1 164 ? -32.529 20.201  31.531 1.00 50.57 ? 326 GLY A CA    1 
ATOM   1261 C  C     . GLY A 1 164 ? -32.947 20.509  32.955 1.00 53.15 ? 326 GLY A C     1 
ATOM   1262 O  O     . GLY A 1 164 ? -32.105 20.725  33.832 1.00 54.82 ? 326 GLY A O     1 
ATOM   1263 N  N     . ASP A 1 165 ? -34.254 20.549  33.180 1.00 54.35 ? 327 ASP A N     1 
ATOM   1264 C  CA    . ASP A 1 165 ? -34.799 20.686  34.523 1.00 56.43 ? 327 ASP A CA    1 
ATOM   1265 C  C     . ASP A 1 165 ? -35.448 19.351  34.926 1.00 52.83 ? 327 ASP A C     1 
ATOM   1266 O  O     . ASP A 1 165 ? -36.324 19.308  35.787 1.00 54.58 ? 327 ASP A O     1 
ATOM   1267 C  CB    . ASP A 1 165 ? -35.767 21.887  34.612 1.00 62.14 ? 327 ASP A CB    1 
ATOM   1268 C  CG    . ASP A 1 165 ? -36.317 22.328  33.241 1.00 63.78 ? 327 ASP A CG    1 
ATOM   1269 O  OD1   . ASP A 1 165 ? -36.454 21.455  32.338 1.00 60.48 ? 327 ASP A OD1   1 
ATOM   1270 O  OD2   . ASP A 1 165 ? -36.617 23.546  33.085 1.00 67.81 ? 327 ASP A OD2   1 
ATOM   1271 N  N     . LYS A 1 166 ? -34.985 18.269  34.295 1.00 48.37 ? 328 LYS A N     1 
ATOM   1272 C  CA    . LYS A 1 166 ? -35.412 16.904  34.607 1.00 45.12 ? 328 LYS A CA    1 
ATOM   1273 C  C     . LYS A 1 166 ? -34.208 16.077  35.050 1.00 42.78 ? 328 LYS A C     1 
ATOM   1274 O  O     . LYS A 1 166 ? -33.111 16.231  34.494 1.00 42.07 ? 328 LYS A O     1 
ATOM   1275 C  CB    . LYS A 1 166 ? -36.040 16.242  33.377 1.00 42.55 ? 328 LYS A CB    1 
ATOM   1276 C  CG    . LYS A 1 166 ? -37.498 16.641  33.113 1.00 45.52 ? 328 LYS A CG    1 
ATOM   1277 C  CD    . LYS A 1 166 ? -38.505 15.680  33.767 1.00 45.11 ? 328 LYS A CD    1 
ATOM   1278 C  CE    . LYS A 1 166 ? -39.904 15.843  33.171 1.00 46.86 ? 328 LYS A CE    1 
ATOM   1279 N  NZ    . LYS A 1 166 ? -40.901 14.878  33.726 1.00 46.30 ? 328 LYS A NZ    1 
ATOM   1280 N  N     . LYS A 1 167 ? -34.430 15.205  36.042 1.00 41.77 ? 329 LYS A N     1 
ATOM   1281 C  CA    . LYS A 1 167 ? -33.451 14.208  36.478 1.00 39.34 ? 329 LYS A CA    1 
ATOM   1282 C  C     . LYS A 1 167 ? -33.761 12.886  35.806 1.00 35.37 ? 329 LYS A C     1 
ATOM   1283 O  O     . LYS A 1 167 ? -34.897 12.430  35.846 1.00 35.29 ? 329 LYS A O     1 
ATOM   1284 C  CB    . LYS A 1 167 ? -33.524 14.036  37.993 1.00 41.64 ? 329 LYS A CB    1 
ATOM   1285 C  CG    . LYS A 1 167 ? -32.215 13.608  38.637 1.00 42.81 ? 329 LYS A CG    1 
ATOM   1286 C  CD    . LYS A 1 167 ? -32.315 13.593  40.164 1.00 46.58 ? 329 LYS A CD    1 
ATOM   1287 C  CE    . LYS A 1 167 ? -33.231 12.447  40.640 1.00 46.99 ? 329 LYS A CE    1 
ATOM   1288 N  NZ    . LYS A 1 167 ? -33.223 12.332  42.133 1.00 50.27 ? 329 LYS A NZ    1 
ATOM   1289 N  N     . LEU A 1 168 ? -32.772 12.254  35.190 1.00 32.90 ? 330 LEU A N     1 
ATOM   1290 C  CA    . LEU A 1 168 ? -33.020 11.002  34.467 1.00 30.19 ? 330 LEU A CA    1 
ATOM   1291 C  C     . LEU A 1 168 ? -33.150 9.792   35.401 1.00 29.99 ? 330 LEU A C     1 
ATOM   1292 O  O     . LEU A 1 168 ? -32.521 9.746   36.463 1.00 31.72 ? 330 LEU A O     1 
ATOM   1293 C  CB    . LEU A 1 168 ? -31.896 10.729  33.479 1.00 28.76 ? 330 LEU A CB    1 
ATOM   1294 C  CG    . LEU A 1 168 ? -31.838 11.553  32.188 1.00 29.27 ? 330 LEU A CG    1 
ATOM   1295 C  CD1   . LEU A 1 168 ? -30.505 11.316  31.516 1.00 28.80 ? 330 LEU A CD1   1 
ATOM   1296 C  CD2   . LEU A 1 168 ? -32.968 11.154  31.235 1.00 28.59 ? 330 LEU A CD2   1 
ATOM   1297 N  N     . LEU A 1 169 ? -33.969 8.821   35.001 1.00 28.34 ? 331 LEU A N     1 
ATOM   1298 C  CA    . LEU A 1 169 ? -34.005 7.512   35.646 1.00 28.26 ? 331 LEU A CA    1 
ATOM   1299 C  C     . LEU A 1 169 ? -33.546 6.514   34.600 1.00 26.42 ? 331 LEU A C     1 
ATOM   1300 O  O     . LEU A 1 169 ? -34.067 6.526   33.496 1.00 25.85 ? 331 LEU A O     1 
ATOM   1301 C  CB    . LEU A 1 169 ? -35.424 7.159   36.091 1.00 29.49 ? 331 LEU A CB    1 
ATOM   1302 C  CG    . LEU A 1 169 ? -35.590 5.925   36.989 1.00 30.52 ? 331 LEU A CG    1 
ATOM   1303 C  CD1   . LEU A 1 169 ? -35.279 6.249   38.462 1.00 33.53 ? 331 LEU A CD1   1 
ATOM   1304 C  CD2   . LEU A 1 169 ? -36.991 5.355   36.871 1.00 30.63 ? 331 LEU A CD2   1 
ATOM   1305 N  N     . VAL A 1 170 ? -32.541 5.699   34.923 1.00 26.24 ? 332 VAL A N     1 
ATOM   1306 C  CA    . VAL A 1 170 ? -32.094 4.597   34.050 1.00 24.51 ? 332 VAL A CA    1 
ATOM   1307 C  C     . VAL A 1 170 ? -31.891 3.353   34.928 1.00 25.96 ? 332 VAL A C     1 
ATOM   1308 O  O     . VAL A 1 170 ? -31.020 3.346   35.806 1.00 27.75 ? 332 VAL A O     1 
ATOM   1309 C  CB    . VAL A 1 170 ? -30.772 4.933   33.325 1.00 23.97 ? 332 VAL A CB    1 
ATOM   1310 C  CG1   . VAL A 1 170 ? -30.410 3.847   32.303 1.00 21.98 ? 332 VAL A CG1   1 
ATOM   1311 C  CG2   . VAL A 1 170 ? -30.849 6.303   32.666 1.00 21.96 ? 332 VAL A CG2   1 
ATOM   1312 N  N     . GLN A 1 171 ? -32.705 2.326   34.705 1.00 25.63 ? 333 GLN A N     1 
ATOM   1313 C  CA    . GLN A 1 171 ? -32.625 1.078   35.450 1.00 27.85 ? 333 GLN A CA    1 
ATOM   1314 C  C     . GLN A 1 171 ? -33.035 -0.067  34.533 1.00 28.04 ? 333 GLN A C     1 
ATOM   1315 O  O     . GLN A 1 171 ? -33.640 0.169   33.485 1.00 26.37 ? 333 GLN A O     1 
ATOM   1316 C  CB    . GLN A 1 171 ? -33.567 1.121   36.662 1.00 29.22 ? 333 GLN A CB    1 
ATOM   1317 C  CG    . GLN A 1 171 ? -35.065 1.176   36.293 1.00 28.32 ? 333 GLN A CG    1 
ATOM   1318 C  CD    . GLN A 1 171 ? -35.984 1.503   37.472 1.00 30.55 ? 333 GLN A CD    1 
ATOM   1319 O  OE1   . GLN A 1 171 ? -35.525 1.921   38.534 1.00 33.14 ? 333 GLN A OE1   1 
ATOM   1320 N  NE2   . GLN A 1 171 ? -37.291 1.302   37.287 1.00 28.72 ? 333 GLN A NE2   1 
ATOM   1321 N  N     . ARG A 1 172 ? -32.730 -1.300  34.943 1.00 30.81 ? 334 ARG A N     1 
ATOM   1322 C  CA    . ARG A 1 172 ? -33.237 -2.498  34.255 1.00 32.43 ? 334 ARG A CA    1 
ATOM   1323 C  C     . ARG A 1 172 ? -34.777 -2.548  34.172 1.00 32.23 ? 334 ARG A C     1 
ATOM   1324 O  O     . ARG A 1 172 ? -35.477 -2.324  35.174 1.00 32.78 ? 334 ARG A O     1 
ATOM   1325 C  CB    . ARG A 1 172 ? -32.698 -3.772  34.917 1.00 36.18 ? 334 ARG A CB    1 
ATOM   1326 C  CG    . ARG A 1 172 ? -31.249 -4.044  34.572 1.00 37.38 ? 334 ARG A CG    1 
ATOM   1327 C  CD    . ARG A 1 172 ? -30.768 -5.425  35.035 1.00 42.69 ? 334 ARG A CD    1 
ATOM   1328 N  NE    . ARG A 1 172 ? -29.449 -5.736  34.472 1.00 45.31 ? 334 ARG A NE    1 
ATOM   1329 C  CZ    . ARG A 1 172 ? -28.310 -5.112  34.806 1.00 46.94 ? 334 ARG A CZ    1 
ATOM   1330 N  NH1   . ARG A 1 172 ? -28.298 -4.144  35.729 1.00 45.93 ? 334 ARG A NH1   1 
ATOM   1331 N  NH2   . ARG A 1 172 ? -27.163 -5.453  34.212 1.00 47.75 ? 334 ARG A NH2   1 
ATOM   1332 N  N     . ALA A 1 173 ? -35.283 -2.835  32.967 1.00 31.77 ? 335 ALA A N     1 
ATOM   1333 C  CA    . ALA A 1 173 ? -36.733 -2.878  32.681 1.00 32.35 ? 335 ALA A CA    1 
ATOM   1334 C  C     . ALA A 1 173 ? -37.499 -3.926  33.501 1.00 35.71 ? 335 ALA A C     1 
ATOM   1335 O  O     . ALA A 1 173 ? -38.689 -3.783  33.745 1.00 36.04 ? 335 ALA A O     1 
ATOM   1336 C  CB    . ALA A 1 173 ? -36.977 -3.097  31.194 1.00 31.37 ? 335 ALA A CB    1 
ATOM   1337 N  N     . SER A 1 174 ? -36.827 -4.987  33.917 1.00 39.08 ? 336 SER A N     1 
ATOM   1338 C  CA    . SER A 1 174 ? -37.401 -5.868  34.915 1.00 43.42 ? 336 SER A CA    1 
ATOM   1339 C  C     . SER A 1 174 ? -36.346 -6.806  35.474 1.00 47.02 ? 336 SER A C     1 
ATOM   1340 O  O     . SER A 1 174 ? -36.584 -8.012  35.633 1.00 51.22 ? 336 SER A O     1 
ATOM   1341 C  CB    . SER A 1 174 ? -38.581 -6.646  34.322 1.00 45.70 ? 336 SER A CB    1 
ATOM   1342 O  OG    . SER A 1 174 ? -38.450 -6.724  32.912 1.00 47.01 ? 336 SER A OG    1 
ATOM   1343 O  OXT   . SER A 1 174 ? -35.239 -6.358  35.795 1.00 46.53 ? 336 SER A OXT   1 
ATOM   1344 N  N     . GLY B 1 1   ? 13.480  -20.880 19.655 1.00 56.58 ? 143 GLY B N     1 
ATOM   1345 C  CA    . GLY B 1 1   ? 12.795  -19.605 19.242 1.00 60.19 ? 143 GLY B CA    1 
ATOM   1346 C  C     . GLY B 1 1   ? 13.176  -18.555 20.273 1.00 59.26 ? 143 GLY B C     1 
ATOM   1347 O  O     . GLY B 1 1   ? 14.375  -18.385 20.552 1.00 56.63 ? 143 GLY B O     1 
ATOM   1348 N  N     . PRO B 1 2   ? 12.172  -17.861 20.862 1.00 61.47 ? 144 PRO B N     1 
ATOM   1349 C  CA    . PRO B 1 2   ? 12.425  -17.016 22.046 1.00 60.39 ? 144 PRO B CA    1 
ATOM   1350 C  C     . PRO B 1 2   ? 13.062  -17.841 23.166 1.00 55.88 ? 144 PRO B C     1 
ATOM   1351 O  O     . PRO B 1 2   ? 14.205  -17.558 23.607 1.00 54.05 ? 144 PRO B O     1 
ATOM   1352 C  CB    . PRO B 1 2   ? 11.024  -16.528 22.442 1.00 64.52 ? 144 PRO B CB    1 
ATOM   1353 C  CG    . PRO B 1 2   ? 10.206  -16.631 21.180 1.00 68.33 ? 144 PRO B CG    1 
ATOM   1354 C  CD    . PRO B 1 2   ? 10.758  -17.820 20.442 1.00 65.74 ? 144 PRO B CD    1 
ATOM   1355 N  N     . LEU B 1 3   ? 12.363  -18.900 23.567 1.00 54.45 ? 145 LEU B N     1 
ATOM   1356 C  CA    . LEU B 1 3   ? 12.865  -19.792 24.606 1.00 50.34 ? 145 LEU B CA    1 
ATOM   1357 C  C     . LEU B 1 3   ? 14.144  -20.556 24.235 1.00 46.55 ? 145 LEU B C     1 
ATOM   1358 O  O     . LEU B 1 3   ? 14.710  -21.236 25.095 1.00 44.57 ? 145 LEU B O     1 
ATOM   1359 C  CB    . LEU B 1 3   ? 11.769  -20.779 25.031 1.00 51.20 ? 145 LEU B CB    1 
ATOM   1360 C  CG    . LEU B 1 3   ? 10.768  -20.159 26.014 1.00 54.11 ? 145 LEU B CG    1 
ATOM   1361 C  CD1   . LEU B 1 3   ? 9.411   -20.827 25.909 1.00 55.75 ? 145 LEU B CD1   1 
ATOM   1362 C  CD2   . LEU B 1 3   ? 11.332  -20.229 27.453 1.00 51.10 ? 145 LEU B CD2   1 
ATOM   1363 N  N     . GLY B 1 4   ? 14.617  -20.448 22.993 1.00 46.34 ? 146 GLY B N     1 
ATOM   1364 C  CA    . GLY B 1 4   ? 15.849  -21.138 22.580 1.00 42.86 ? 146 GLY B CA    1 
ATOM   1365 C  C     . GLY B 1 4   ? 17.001  -20.952 23.557 1.00 39.30 ? 146 GLY B C     1 
ATOM   1366 O  O     . GLY B 1 4   ? 17.717  -21.903 23.904 1.00 36.54 ? 146 GLY B O     1 
ATOM   1367 N  N     . SER B 1 5   ? 17.171  -19.719 24.015 1.00 39.38 ? 147 SER B N     1 
ATOM   1368 C  CA    . SER B 1 5   ? 18.245  -19.395 24.936 1.00 36.64 ? 147 SER B CA    1 
ATOM   1369 C  C     . SER B 1 5   ? 17.965  -19.803 26.376 1.00 34.40 ? 147 SER B C     1 
ATOM   1370 O  O     . SER B 1 5   ? 18.835  -19.679 27.241 1.00 32.22 ? 147 SER B O     1 
ATOM   1371 C  CB    . SER B 1 5   ? 18.570  -17.911 24.862 1.00 38.93 ? 147 SER B CB    1 
ATOM   1372 O  OG    . SER B 1 5   ? 19.834  -17.761 24.233 1.00 40.88 ? 147 SER B OG    1 
ATOM   1373 N  N     . ALA B 1 6   ? 16.758  -20.295 26.635 1.00 34.56 ? 148 ALA B N     1 
ATOM   1374 C  CA    . ALA B 1 6   ? 16.452  -20.907 27.917 1.00 33.19 ? 148 ALA B CA    1 
ATOM   1375 C  C     . ALA B 1 6   ? 16.756  -22.409 27.902 1.00 30.04 ? 148 ALA B C     1 
ATOM   1376 O  O     . ALA B 1 6   ? 16.582  -23.069 28.910 1.00 28.69 ? 148 ALA B O     1 
ATOM   1377 C  CB    . ALA B 1 6   ? 15.019  -20.643 28.287 1.00 35.40 ? 148 ALA B CB    1 
ATOM   1378 N  N     . ARG B 1 7   ? 17.237  -22.923 26.767 1.00 29.20 ? 149 ARG B N     1 
ATOM   1379 C  CA    . ARG B 1 7   ? 17.573  -24.347 26.594 1.00 27.92 ? 149 ARG B CA    1 
ATOM   1380 C  C     . ARG B 1 7   ? 19.072  -24.598 26.278 1.00 25.30 ? 149 ARG B C     1 
ATOM   1381 O  O     . ARG B 1 7   ? 19.403  -25.592 25.643 1.00 24.96 ? 149 ARG B O     1 
ATOM   1382 C  CB    . ARG B 1 7   ? 16.694  -24.974 25.485 1.00 29.41 ? 149 ARG B CB    1 
ATOM   1383 C  CG    . ARG B 1 7   ? 15.172  -25.010 25.780 1.00 32.84 ? 149 ARG B CG    1 
ATOM   1384 C  CD    . ARG B 1 7   ? 14.339  -25.687 24.664 1.00 35.70 ? 149 ARG B CD    1 
ATOM   1385 N  NE    . ARG B 1 7   ? 13.837  -24.752 23.640 1.00 40.57 ? 149 ARG B NE    1 
ATOM   1386 C  CZ    . ARG B 1 7   ? 12.610  -24.187 23.612 1.00 44.65 ? 149 ARG B CZ    1 
ATOM   1387 N  NH1   . ARG B 1 7   ? 11.708  -24.435 24.557 1.00 45.37 ? 149 ARG B NH1   1 
ATOM   1388 N  NH2   . ARG B 1 7   ? 12.264  -23.356 22.623 1.00 46.52 ? 149 ARG B NH2   1 
ATOM   1389 N  N     . ARG B 1 8   ? 19.963  -23.715 26.726 1.00 24.18 ? 150 ARG B N     1 
ATOM   1390 C  CA    . ARG B 1 8   ? 21.399  -23.771 26.369 1.00 23.29 ? 150 ARG B CA    1 
ATOM   1391 C  C     . ARG B 1 8   ? 22.263  -23.328 27.540 1.00 21.58 ? 150 ARG B C     1 
ATOM   1392 O  O     . ARG B 1 8   ? 21.849  -22.483 28.342 1.00 21.85 ? 150 ARG B O     1 
ATOM   1393 C  CB    . ARG B 1 8   ? 21.723  -22.865 25.170 1.00 24.36 ? 150 ARG B CB    1 
ATOM   1394 C  CG    . ARG B 1 8   ? 21.346  -23.452 23.828 1.00 27.09 ? 150 ARG B CG    1 
ATOM   1395 C  CD    . ARG B 1 8   ? 21.319  -22.434 22.674 1.00 30.44 ? 150 ARG B CD    1 
ATOM   1396 N  NE    . ARG B 1 8   ? 22.658  -22.133 22.167 1.00 33.60 ? 150 ARG B NE    1 
ATOM   1397 C  CZ    . ARG B 1 8   ? 23.383  -22.955 21.402 1.00 34.32 ? 150 ARG B CZ    1 
ATOM   1398 N  NH1   . ARG B 1 8   ? 24.599  -22.611 20.979 1.00 34.03 ? 150 ARG B NH1   1 
ATOM   1399 N  NH2   . ARG B 1 8   ? 22.909  -24.142 21.059 1.00 36.51 ? 150 ARG B NH2   1 
ATOM   1400 N  N     . LEU B 1 9   ? 23.461  -23.889 27.637 1.00 19.92 ? 151 LEU B N     1 
ATOM   1401 C  CA    . LEU B 1 9   ? 24.423  -23.441 28.635 1.00 19.59 ? 151 LEU B CA    1 
ATOM   1402 C  C     . LEU B 1 9   ? 25.818  -23.348 28.049 1.00 19.18 ? 151 LEU B C     1 
ATOM   1403 O  O     . LEU B 1 9   ? 26.192  -24.126 27.173 1.00 19.83 ? 151 LEU B O     1 
ATOM   1404 C  CB    . LEU B 1 9   ? 24.450  -24.368 29.857 1.00 18.88 ? 151 LEU B CB    1 
ATOM   1405 C  CG    . LEU B 1 9   ? 23.158  -24.528 30.669 1.00 20.04 ? 151 LEU B CG    1 
ATOM   1406 C  CD1   . LEU B 1 9   ? 23.385  -25.488 31.828 1.00 18.55 ? 151 LEU B CD1   1 
ATOM   1407 C  CD2   . LEU B 1 9   ? 22.689  -23.175 31.199 1.00 21.05 ? 151 LEU B CD2   1 
ATOM   1408 N  N     . TYR B 1 10  ? 26.576  -22.383 28.552 1.00 19.14 ? 152 TYR B N     1 
ATOM   1409 C  CA    . TYR B 1 10  ? 27.978  -22.221 28.223 1.00 18.82 ? 152 TYR B CA    1 
ATOM   1410 C  C     . TYR B 1 10  ? 28.818  -23.070 29.179 1.00 17.87 ? 152 TYR B C     1 
ATOM   1411 O  O     . TYR B 1 10  ? 28.580  -23.080 30.395 1.00 17.18 ? 152 TYR B O     1 
ATOM   1412 C  CB    . TYR B 1 10  ? 28.381  -20.740 28.350 1.00 19.91 ? 152 TYR B CB    1 
ATOM   1413 C  CG    . TYR B 1 10  ? 29.875  -20.513 28.311 1.00 19.66 ? 152 TYR B CG    1 
ATOM   1414 C  CD1   . TYR B 1 10  ? 30.629  -20.522 29.480 1.00 19.03 ? 152 TYR B CD1   1 
ATOM   1415 C  CD2   . TYR B 1 10  ? 30.529  -20.306 27.106 1.00 19.20 ? 152 TYR B CD2   1 
ATOM   1416 C  CE1   . TYR B 1 10  ? 32.002  -20.327 29.444 1.00 19.92 ? 152 TYR B CE1   1 
ATOM   1417 C  CE2   . TYR B 1 10  ? 31.885  -20.120 27.052 1.00 20.63 ? 152 TYR B CE2   1 
ATOM   1418 C  CZ    . TYR B 1 10  ? 32.627  -20.126 28.219 1.00 21.09 ? 152 TYR B CZ    1 
ATOM   1419 O  OH    . TYR B 1 10  ? 33.987  -19.940 28.159 1.00 22.12 ? 152 TYR B OH    1 
ATOM   1420 N  N     . VAL B 1 11  ? 29.817  -23.755 28.624 1.00 17.86 ? 153 VAL B N     1 
ATOM   1421 C  CA    . VAL B 1 11  ? 30.740  -24.572 29.401 1.00 17.27 ? 153 VAL B CA    1 
ATOM   1422 C  C     . VAL B 1 11  ? 32.203  -24.229 29.094 1.00 18.46 ? 153 VAL B C     1 
ATOM   1423 O  O     . VAL B 1 11  ? 32.695  -24.484 27.971 1.00 19.09 ? 153 VAL B O     1 
ATOM   1424 C  CB    . VAL B 1 11  ? 30.539  -26.043 29.116 1.00 16.52 ? 153 VAL B CB    1 
ATOM   1425 C  CG1   . VAL B 1 11  ? 31.349  -26.855 30.076 1.00 16.50 ? 153 VAL B CG1   1 
ATOM   1426 C  CG2   . VAL B 1 11  ? 29.082  -26.413 29.258 1.00 16.89 ? 153 VAL B CG2   1 
ATOM   1427 N  N     . GLY B 1 12  ? 32.898  -23.673 30.089 1.00 18.35 ? 154 GLY B N     1 
ATOM   1428 C  CA    . GLY B 1 12  ? 34.301  -23.309 29.929 1.00 19.63 ? 154 GLY B CA    1 
ATOM   1429 C  C     . GLY B 1 12  ? 35.293  -24.273 30.566 1.00 20.34 ? 154 GLY B C     1 
ATOM   1430 O  O     . GLY B 1 12  ? 34.910  -25.185 31.306 1.00 19.86 ? 154 GLY B O     1 
ATOM   1431 N  N     . ASN B 1 13  ? 36.573  -24.061 30.257 1.00 21.78 ? 155 ASN B N     1 
ATOM   1432 C  CA    . ASN B 1 13  ? 37.688  -24.816 30.838 1.00 23.17 ? 155 ASN B CA    1 
ATOM   1433 C  C     . ASN B 1 13  ? 37.648  -26.279 30.436 1.00 23.77 ? 155 ASN B C     1 
ATOM   1434 O  O     . ASN B 1 13  ? 37.974  -27.156 31.233 1.00 24.68 ? 155 ASN B O     1 
ATOM   1435 C  CB    . ASN B 1 13  ? 37.718  -24.684 32.373 1.00 22.95 ? 155 ASN B CB    1 
ATOM   1436 C  CG    . ASN B 1 13  ? 39.044  -25.145 32.978 1.00 24.80 ? 155 ASN B CG    1 
ATOM   1437 O  OD1   . ASN B 1 13  ? 40.087  -25.003 32.359 1.00 27.64 ? 155 ASN B OD1   1 
ATOM   1438 N  ND2   . ASN B 1 13  ? 39.003  -25.689 34.193 1.00 24.45 ? 155 ASN B ND2   1 
ATOM   1439 N  N     . ILE B 1 14  ? 37.230  -26.543 29.201 1.00 23.99 ? 156 ILE B N     1 
ATOM   1440 C  CA    . ILE B 1 14  ? 37.096  -27.913 28.753 1.00 24.82 ? 156 ILE B CA    1 
ATOM   1441 C  C     . ILE B 1 14  ? 38.501  -28.444 28.487 1.00 27.17 ? 156 ILE B C     1 
ATOM   1442 O  O     . ILE B 1 14  ? 39.386  -27.668 28.145 1.00 28.07 ? 156 ILE B O     1 
ATOM   1443 C  CB    . ILE B 1 14  ? 36.183  -28.052 27.499 1.00 24.89 ? 156 ILE B CB    1 
ATOM   1444 C  CG1   . ILE B 1 14  ? 36.809  -27.396 26.264 1.00 26.89 ? 156 ILE B CG1   1 
ATOM   1445 C  CG2   . ILE B 1 14  ? 34.803  -27.447 27.756 1.00 22.18 ? 156 ILE B CG2   1 
ATOM   1446 C  CD1   . ILE B 1 14  ? 36.095  -27.743 24.989 1.00 27.02 ? 156 ILE B CD1   1 
ATOM   1447 N  N     . PRO B 1 15  ? 38.700  -29.765 28.641 1.00 28.47 ? 157 PRO B N     1 
ATOM   1448 C  CA    . PRO B 1 15  ? 39.999  -30.430 28.460 1.00 31.08 ? 157 PRO B CA    1 
ATOM   1449 C  C     . PRO B 1 15  ? 40.410  -30.652 27.002 1.00 32.78 ? 157 PRO B C     1 
ATOM   1450 O  O     . PRO B 1 15  ? 39.552  -30.893 26.151 1.00 32.17 ? 157 PRO B O     1 
ATOM   1451 C  CB    . PRO B 1 15  ? 39.786  -31.777 29.150 1.00 32.04 ? 157 PRO B CB    1 
ATOM   1452 C  CG    . PRO B 1 15  ? 38.351  -32.068 28.981 1.00 30.58 ? 157 PRO B CG    1 
ATOM   1453 C  CD    . PRO B 1 15  ? 37.643  -30.732 29.008 1.00 27.80 ? 157 PRO B CD    1 
ATOM   1454 N  N     . PHE B 1 16  ? 41.716  -30.598 26.733 1.00 35.13 ? 158 PHE B N     1 
ATOM   1455 C  CA    . PHE B 1 16  ? 42.229  -30.714 25.362 1.00 37.67 ? 158 PHE B CA    1 
ATOM   1456 C  C     . PHE B 1 16  ? 41.740  -31.995 24.677 1.00 39.12 ? 158 PHE B C     1 
ATOM   1457 O  O     . PHE B 1 16  ? 41.660  -33.045 25.305 1.00 39.77 ? 158 PHE B O     1 
ATOM   1458 C  CB    . PHE B 1 16  ? 43.776  -30.680 25.322 1.00 40.80 ? 158 PHE B CB    1 
ATOM   1459 C  CG    . PHE B 1 16  ? 44.348  -30.890 23.932 1.00 43.83 ? 158 PHE B CG    1 
ATOM   1460 C  CD1   . PHE B 1 16  ? 44.482  -29.824 23.049 1.00 43.79 ? 158 PHE B CD1   1 
ATOM   1461 C  CD2   . PHE B 1 16  ? 44.698  -32.159 23.494 1.00 46.75 ? 158 PHE B CD2   1 
ATOM   1462 C  CE1   . PHE B 1 16  ? 44.968  -30.015 21.765 1.00 47.26 ? 158 PHE B CE1   1 
ATOM   1463 C  CE2   . PHE B 1 16  ? 45.188  -32.366 22.208 1.00 50.59 ? 158 PHE B CE2   1 
ATOM   1464 C  CZ    . PHE B 1 16  ? 45.326  -31.289 21.343 1.00 51.37 ? 158 PHE B CZ    1 
ATOM   1465 N  N     . GLY B 1 17  ? 41.414  -31.901 23.390 1.00 39.99 ? 159 GLY B N     1 
ATOM   1466 C  CA    . GLY B 1 17  ? 41.156  -33.094 22.573 1.00 42.34 ? 159 GLY B CA    1 
ATOM   1467 C  C     . GLY B 1 17  ? 39.736  -33.641 22.614 1.00 40.44 ? 159 GLY B C     1 
ATOM   1468 O  O     . GLY B 1 17  ? 39.353  -34.412 21.746 1.00 42.77 ? 159 GLY B O     1 
ATOM   1469 N  N     . ILE B 1 18  ? 38.950  -33.234 23.605 1.00 37.05 ? 160 ILE B N     1 
ATOM   1470 C  CA    . ILE B 1 18  ? 37.619  -33.804 23.850 1.00 35.38 ? 160 ILE B CA    1 
ATOM   1471 C  C     . ILE B 1 18  ? 36.681  -33.566 22.672 1.00 35.35 ? 160 ILE B C     1 
ATOM   1472 O  O     . ILE B 1 18  ? 36.756  -32.536 22.023 1.00 34.91 ? 160 ILE B O     1 
ATOM   1473 C  CB    . ILE B 1 18  ? 37.007  -33.224 25.148 1.00 31.81 ? 160 ILE B CB    1 
ATOM   1474 C  CG1   . ILE B 1 18  ? 35.875  -34.102 25.670 1.00 31.96 ? 160 ILE B CG1   1 
ATOM   1475 C  CG2   . ILE B 1 18  ? 36.516  -31.827 24.931 1.00 29.95 ? 160 ILE B CG2   1 
ATOM   1476 C  CD1   . ILE B 1 18  ? 36.365  -35.395 26.300 1.00 34.80 ? 160 ILE B CD1   1 
ATOM   1477 N  N     . THR B 1 19  ? 35.810  -34.538 22.404 1.00 36.34 ? 161 THR B N     1 
ATOM   1478 C  CA    . THR B 1 19  ? 34.865  -34.486 21.287 1.00 37.15 ? 161 THR B CA    1 
ATOM   1479 C  C     . THR B 1 19  ? 33.452  -34.166 21.748 1.00 34.55 ? 161 THR B C     1 
ATOM   1480 O  O     . THR B 1 19  ? 33.164  -34.192 22.938 1.00 32.41 ? 161 THR B O     1 
ATOM   1481 C  CB    . THR B 1 19  ? 34.821  -35.830 20.573 1.00 40.66 ? 161 THR B CB    1 
ATOM   1482 O  OG1   . THR B 1 19  ? 34.437  -36.841 21.518 1.00 39.88 ? 161 THR B OG1   1 
ATOM   1483 C  CG2   . THR B 1 19  ? 36.194  -36.154 19.960 1.00 42.67 ? 161 THR B CG2   1 
ATOM   1484 N  N     . GLU B 1 20  ? 32.576  -33.875 20.792 1.00 35.66 ? 162 GLU B N     1 
ATOM   1485 C  CA    . GLU B 1 20  ? 31.200  -33.443 21.077 1.00 34.46 ? 162 GLU B CA    1 
ATOM   1486 C  C     . GLU B 1 20  ? 30.365  -34.575 21.671 1.00 34.58 ? 162 GLU B C     1 
ATOM   1487 O  O     . GLU B 1 20  ? 29.533  -34.355 22.561 1.00 32.39 ? 162 GLU B O     1 
ATOM   1488 C  CB    . GLU B 1 20  ? 30.541  -32.858 19.810 1.00 35.68 ? 162 GLU B CB    1 
ATOM   1489 C  CG    . GLU B 1 20  ? 31.301  -31.597 19.304 1.00 37.72 ? 162 GLU B CG    1 
ATOM   1490 C  CD    . GLU B 1 20  ? 30.762  -30.944 18.021 1.00 39.96 ? 162 GLU B CD    1 
ATOM   1491 O  OE1   . GLU B 1 20  ? 31.118  -29.742 17.818 1.00 43.07 ? 162 GLU B OE1   1 
ATOM   1492 O  OE2   . GLU B 1 20  ? 30.024  -31.603 17.231 1.00 42.18 ? 162 GLU B OE2   1 
ATOM   1493 N  N     . GLU B 1 21  ? 30.621  -35.789 21.199 1.00 37.70 ? 163 GLU B N     1 
ATOM   1494 C  CA    . GLU B 1 21  ? 29.916  -36.969 21.685 1.00 38.96 ? 163 GLU B CA    1 
ATOM   1495 C  C     . GLU B 1 21  ? 30.336  -37.340 23.139 1.00 37.73 ? 163 GLU B C     1 
ATOM   1496 O  O     . GLU B 1 21  ? 29.493  -37.750 23.963 1.00 36.54 ? 163 GLU B O     1 
ATOM   1497 C  CB    . GLU B 1 21  ? 30.077  -38.151 20.699 1.00 43.36 ? 163 GLU B CB    1 
ATOM   1498 C  CG    . GLU B 1 21  ? 31.482  -38.346 20.065 1.00 48.17 ? 163 GLU B CG    1 
ATOM   1499 C  CD    . GLU B 1 21  ? 31.726  -37.545 18.752 1.00 52.23 ? 163 GLU B CD    1 
ATOM   1500 O  OE1   . GLU B 1 21  ? 32.474  -38.050 17.868 1.00 56.19 ? 163 GLU B OE1   1 
ATOM   1501 O  OE2   . GLU B 1 21  ? 31.186  -36.414 18.615 1.00 50.92 ? 163 GLU B OE2   1 
ATOM   1502 N  N     . ALA B 1 22  ? 31.621  -37.171 23.455 1.00 37.65 ? 164 ALA B N     1 
ATOM   1503 C  CA    . ALA B 1 22  ? 32.120  -37.494 24.789 1.00 36.90 ? 164 ALA B CA    1 
ATOM   1504 C  C     . ALA B 1 22  ? 31.521  -36.546 25.822 1.00 33.70 ? 164 ALA B C     1 
ATOM   1505 O  O     . ALA B 1 22  ? 31.165  -36.972 26.921 1.00 33.58 ? 164 ALA B O     1 
ATOM   1506 C  CB    . ALA B 1 22  ? 33.644  -37.459 24.833 1.00 37.88 ? 164 ALA B CB    1 
ATOM   1507 N  N     . MET B 1 23  ? 31.399  -35.268 25.471 1.00 31.74 ? 165 MET B N     1 
ATOM   1508 C  CA    . MET B 1 23  ? 30.721  -34.295 26.337 1.00 29.21 ? 165 MET B CA    1 
ATOM   1509 C  C     . MET B 1 23  ? 29.243  -34.649 26.523 1.00 27.73 ? 165 MET B C     1 
ATOM   1510 O  O     . MET B 1 23  ? 28.700  -34.544 27.622 1.00 26.32 ? 165 MET B O     1 
ATOM   1511 C  CB    . MET B 1 23  ? 30.819  -32.888 25.749 1.00 27.72 ? 165 MET B CB    1 
ATOM   1512 C  CG    . MET B 1 23  ? 32.135  -32.186 25.978 1.00 29.94 ? 165 MET B CG    1 
ATOM   1513 S  SD    . MET B 1 23  ? 32.116  -30.696 27.039 1.00 29.78 ? 165 MET B SD    1 
ATOM   1514 C  CE    . MET B 1 23  ? 30.414  -30.154 26.932 1.00 29.45 ? 165 MET B CE    1 
ATOM   1515 N  N     . MET B 1 24  ? 28.596  -35.049 25.441 1.00 28.51 ? 166 MET B N     1 
ATOM   1516 C  CA    . MET B 1 24  ? 27.191  -35.403 25.497 1.00 28.66 ? 166 MET B CA    1 
ATOM   1517 C  C     . MET B 1 24  ? 26.964  -36.530 26.500 1.00 28.62 ? 166 MET B C     1 
ATOM   1518 O  O     . MET B 1 24  ? 26.124  -36.393 27.391 1.00 27.03 ? 166 MET B O     1 
ATOM   1519 C  CB    . MET B 1 24  ? 26.673  -35.796 24.110 1.00 30.82 ? 166 MET B CB    1 
ATOM   1520 C  CG    . MET B 1 24  ? 25.171  -35.630 23.937 1.00 31.20 ? 166 MET B CG    1 
ATOM   1521 S  SD    . MET B 1 24  ? 24.668  -35.849 22.210 1.00 34.86 ? 166 MET B SD    1 
ATOM   1522 C  CE    . MET B 1 24  ? 25.309  -37.497 21.893 1.00 39.06 ? 166 MET B CE    1 
ATOM   1523 N  N     . ASP B 1 25  ? 27.732  -37.620 26.371 1.00 30.36 ? 167 ASP B N     1 
ATOM   1524 C  CA    . ASP B 1 25  ? 27.616  -38.781 27.283 1.00 31.68 ? 167 ASP B CA    1 
ATOM   1525 C  C     . ASP B 1 25  ? 27.863  -38.436 28.762 1.00 29.80 ? 167 ASP B C     1 
ATOM   1526 O  O     . ASP B 1 25  ? 27.110  -38.876 29.640 1.00 29.71 ? 167 ASP B O     1 
ATOM   1527 C  CB    . ASP B 1 25  ? 28.560  -39.906 26.854 1.00 34.96 ? 167 ASP B CB    1 
ATOM   1528 C  CG    . ASP B 1 25  ? 28.177  -40.528 25.491 1.00 38.65 ? 167 ASP B CG    1 
ATOM   1529 O  OD1   . ASP B 1 25  ? 27.194  -40.072 24.855 1.00 38.32 ? 167 ASP B OD1   1 
ATOM   1530 O  OD2   . ASP B 1 25  ? 28.867  -41.480 25.056 1.00 42.84 ? 167 ASP B OD2   1 
ATOM   1531 N  N     . PHE B 1 26  ? 28.890  -37.622 29.019 1.00 28.14 ? 168 PHE B N     1 
ATOM   1532 C  CA    . PHE B 1 26  ? 29.234  -37.185 30.367 1.00 26.96 ? 168 PHE B CA    1 
ATOM   1533 C  C     . PHE B 1 26  ? 28.090  -36.453 31.077 1.00 25.27 ? 168 PHE B C     1 
ATOM   1534 O  O     . PHE B 1 26  ? 27.767  -36.770 32.230 1.00 25.54 ? 168 PHE B O     1 
ATOM   1535 C  CB    . PHE B 1 26  ? 30.472  -36.293 30.335 1.00 26.02 ? 168 PHE B CB    1 
ATOM   1536 C  CG    . PHE B 1 26  ? 30.814  -35.690 31.673 1.00 25.25 ? 168 PHE B CG    1 
ATOM   1537 C  CD1   . PHE B 1 26  ? 31.521  -36.421 32.618 1.00 26.23 ? 168 PHE B CD1   1 
ATOM   1538 C  CD2   . PHE B 1 26  ? 30.406  -34.398 31.994 1.00 23.39 ? 168 PHE B CD2   1 
ATOM   1539 C  CE1   . PHE B 1 26  ? 31.821  -35.879 33.855 1.00 26.38 ? 168 PHE B CE1   1 
ATOM   1540 C  CE2   . PHE B 1 26  ? 30.707  -33.841 33.222 1.00 22.90 ? 168 PHE B CE2   1 
ATOM   1541 C  CZ    . PHE B 1 26  ? 31.416  -34.585 34.160 1.00 24.83 ? 168 PHE B CZ    1 
ATOM   1542 N  N     . PHE B 1 27  ? 27.476  -35.487 30.392 1.00 23.90 ? 169 PHE B N     1 
ATOM   1543 C  CA    . PHE B 1 27  ? 26.398  -34.674 30.995 1.00 22.56 ? 169 PHE B CA    1 
ATOM   1544 C  C     . PHE B 1 27  ? 25.088  -35.426 31.151 1.00 23.21 ? 169 PHE B C     1 
ATOM   1545 O  O     . PHE B 1 27  ? 24.361  -35.218 32.126 1.00 23.13 ? 169 PHE B O     1 
ATOM   1546 C  CB    . PHE B 1 27  ? 26.158  -33.380 30.216 1.00 22.00 ? 169 PHE B CB    1 
ATOM   1547 C  CG    . PHE B 1 27  ? 27.097  -32.268 30.596 1.00 21.09 ? 169 PHE B CG    1 
ATOM   1548 C  CD1   . PHE B 1 27  ? 28.180  -31.947 29.795 1.00 21.84 ? 169 PHE B CD1   1 
ATOM   1549 C  CD2   . PHE B 1 27  ? 26.894  -31.550 31.759 1.00 22.33 ? 169 PHE B CD2   1 
ATOM   1550 C  CE1   . PHE B 1 27  ? 29.054  -30.931 30.143 1.00 20.76 ? 169 PHE B CE1   1 
ATOM   1551 C  CE2   . PHE B 1 27  ? 27.754  -30.531 32.118 1.00 22.35 ? 169 PHE B CE2   1 
ATOM   1552 C  CZ    . PHE B 1 27  ? 28.843  -30.220 31.300 1.00 21.44 ? 169 PHE B CZ    1 
ATOM   1553 N  N     . ASN B 1 28  ? 24.782  -36.291 30.197 1.00 24.00 ? 170 ASN B N     1 
ATOM   1554 C  CA    . ASN B 1 28  ? 23.630  -37.166 30.338 1.00 25.87 ? 170 ASN B CA    1 
ATOM   1555 C  C     . ASN B 1 28  ? 23.801  -38.094 31.533 1.00 27.21 ? 170 ASN B C     1 
ATOM   1556 O  O     . ASN B 1 28  ? 22.845  -38.347 32.275 1.00 27.45 ? 170 ASN B O     1 
ATOM   1557 C  CB    . ASN B 1 28  ? 23.407  -37.994 29.072 1.00 27.34 ? 170 ASN B CB    1 
ATOM   1558 C  CG    . ASN B 1 28  ? 22.833  -37.184 27.941 1.00 27.14 ? 170 ASN B CG    1 
ATOM   1559 O  OD1   . ASN B 1 28  ? 22.092  -36.221 28.155 1.00 26.81 ? 170 ASN B OD1   1 
ATOM   1560 N  ND2   . ASN B 1 28  ? 23.162  -37.576 26.719 1.00 28.22 ? 170 ASN B ND2   1 
ATOM   1561 N  N     . ALA B 1 29  ? 25.022  -38.606 31.703 1.00 28.17 ? 171 ALA B N     1 
ATOM   1562 C  CA    . ALA B 1 29  ? 25.311  -39.540 32.783 1.00 30.27 ? 171 ALA B CA    1 
ATOM   1563 C  C     . ALA B 1 29  ? 25.106  -38.824 34.127 1.00 29.71 ? 171 ALA B C     1 
ATOM   1564 O  O     . ALA B 1 29  ? 24.442  -39.341 35.016 1.00 31.38 ? 171 ALA B O     1 
ATOM   1565 C  CB    . ALA B 1 29  ? 26.728  -40.099 32.645 1.00 30.66 ? 171 ALA B CB    1 
ATOM   1566 N  N     . GLN B 1 30  ? 25.640  -37.614 34.247 1.00 28.33 ? 172 GLN B N     1 
ATOM   1567 C  CA    . GLN B 1 30  ? 25.562  -36.862 35.485 1.00 28.26 ? 172 GLN B CA    1 
ATOM   1568 C  C     . GLN B 1 30  ? 24.104  -36.529 35.845 1.00 28.76 ? 172 GLN B C     1 
ATOM   1569 O  O     . GLN B 1 30  ? 23.685  -36.717 36.993 1.00 30.43 ? 172 GLN B O     1 
ATOM   1570 C  CB    . GLN B 1 30  ? 26.401  -35.581 35.366 1.00 26.84 ? 172 GLN B CB    1 
ATOM   1571 C  CG    . GLN B 1 30  ? 27.930  -35.790 35.376 1.00 27.50 ? 172 GLN B CG    1 
ATOM   1572 C  CD    . GLN B 1 30  ? 28.518  -35.941 36.792 1.00 29.41 ? 172 GLN B CD    1 
ATOM   1573 O  OE1   . GLN B 1 30  ? 27.792  -35.884 37.787 1.00 29.24 ? 172 GLN B OE1   1 
ATOM   1574 N  NE2   . GLN B 1 30  ? 29.837  -36.141 36.874 1.00 28.55 ? 172 GLN B NE2   1 
ATOM   1575 N  N     . MET B 1 31  ? 23.335  -36.059 34.867 1.00 27.86 ? 173 MET B N     1 
ATOM   1576 C  CA    . MET B 1 31  ? 21.901  -35.784 35.068 1.00 28.90 ? 173 MET B CA    1 
ATOM   1577 C  C     . MET B 1 31  ? 21.118  -36.993 35.591 1.00 31.41 ? 173 MET B C     1 
ATOM   1578 O  O     . MET B 1 31  ? 20.217  -36.830 36.401 1.00 32.94 ? 173 MET B O     1 
ATOM   1579 C  CB    . MET B 1 31  ? 21.241  -35.312 33.759 1.00 28.38 ? 173 MET B CB    1 
ATOM   1580 C  CG    . MET B 1 31  ? 21.706  -33.945 33.260 1.00 27.67 ? 173 MET B CG    1 
ATOM   1581 S  SD    . MET B 1 31  ? 20.819  -32.555 33.998 1.00 30.48 ? 173 MET B SD    1 
ATOM   1582 C  CE    . MET B 1 31  ? 19.166  -32.680 33.299 1.00 29.86 ? 173 MET B CE    1 
ATOM   1583 N  N     . ARG B 1 32  ? 21.442  -38.191 35.113 1.00 32.77 ? 174 ARG B N     1 
ATOM   1584 C  CA    . ARG B 1 32  ? 20.780  -39.415 35.571 1.00 36.28 ? 174 ARG B CA    1 
ATOM   1585 C  C     . ARG B 1 32  ? 21.307  -39.853 36.939 1.00 37.49 ? 174 ARG B C     1 
ATOM   1586 O  O     . ARG B 1 32  ? 20.556  -40.350 37.760 1.00 39.52 ? 174 ARG B O     1 
ATOM   1587 C  CB    . ARG B 1 32  ? 20.941  -40.555 34.540 1.00 37.82 ? 174 ARG B CB    1 
ATOM   1588 C  CG    . ARG B 1 32  ? 20.181  -40.296 33.218 1.00 38.92 ? 174 ARG B CG    1 
ATOM   1589 C  CD    . ARG B 1 32  ? 20.134  -41.501 32.264 1.00 42.28 ? 174 ARG B CD    1 
ATOM   1590 N  NE    . ARG B 1 32  ? 21.016  -41.353 31.094 1.00 44.21 ? 174 ARG B NE    1 
ATOM   1591 C  CZ    . ARG B 1 32  ? 22.204  -41.958 30.931 1.00 45.91 ? 174 ARG B CZ    1 
ATOM   1592 N  NH1   . ARG B 1 32  ? 22.708  -42.782 31.861 1.00 47.24 ? 174 ARG B NH1   1 
ATOM   1593 N  NH2   . ARG B 1 32  ? 22.910  -41.732 29.818 1.00 45.31 ? 174 ARG B NH2   1 
ATOM   1594 N  N     . LEU B 1 33  ? 22.601  -39.676 37.178 1.00 36.68 ? 175 LEU B N     1 
ATOM   1595 C  CA    . LEU B 1 33  ? 23.180  -40.023 38.472 1.00 38.76 ? 175 LEU B CA    1 
ATOM   1596 C  C     . LEU B 1 33  ? 22.550  -39.206 39.605 1.00 39.10 ? 175 LEU B C     1 
ATOM   1597 O  O     . LEU B 1 33  ? 22.268  -39.750 40.665 1.00 42.13 ? 175 LEU B O     1 
ATOM   1598 C  CB    . LEU B 1 33  ? 24.709  -39.839 38.470 1.00 37.72 ? 175 LEU B CB    1 
ATOM   1599 C  CG    . LEU B 1 33  ? 25.427  -40.235 39.770 1.00 39.75 ? 175 LEU B CG    1 
ATOM   1600 C  CD1   . LEU B 1 33  ? 25.488  -41.746 39.925 1.00 40.57 ? 175 LEU B CD1   1 
ATOM   1601 C  CD2   . LEU B 1 33  ? 26.819  -39.617 39.816 1.00 38.92 ? 175 LEU B CD2   1 
ATOM   1602 N  N     . GLY B 1 34  ? 22.327  -37.913 39.377 1.00 37.00 ? 176 GLY B N     1 
ATOM   1603 C  CA    . GLY B 1 34  ? 21.772  -37.030 40.410 1.00 37.73 ? 176 GLY B CA    1 
ATOM   1604 C  C     . GLY B 1 34  ? 20.246  -36.982 40.471 1.00 39.18 ? 176 GLY B C     1 
ATOM   1605 O  O     . GLY B 1 34  ? 19.674  -36.197 41.240 1.00 39.86 ? 176 GLY B O     1 
ATOM   1606 N  N     . GLY B 1 35  ? 19.588  -37.821 39.666 1.00 39.78 ? 177 GLY B N     1 
ATOM   1607 C  CA    . GLY B 1 35  ? 18.131  -37.825 39.561 1.00 41.05 ? 177 GLY B CA    1 
ATOM   1608 C  C     . GLY B 1 35  ? 17.522  -36.494 39.131 1.00 39.33 ? 177 GLY B C     1 
ATOM   1609 O  O     . GLY B 1 35  ? 16.442  -36.138 39.595 1.00 41.08 ? 177 GLY B O     1 
ATOM   1610 N  N     . LEU B 1 36  ? 18.196  -35.768 38.240 1.00 36.57 ? 178 LEU B N     1 
ATOM   1611 C  CA    . LEU B 1 36  ? 17.766  -34.419 37.843 1.00 35.30 ? 178 LEU B CA    1 
ATOM   1612 C  C     . LEU B 1 36  ? 16.948  -34.356 36.551 1.00 35.37 ? 178 LEU B C     1 
ATOM   1613 O  O     . LEU B 1 36  ? 16.630  -33.253 36.087 1.00 35.20 ? 178 LEU B O     1 
ATOM   1614 C  CB    . LEU B 1 36  ? 18.979  -33.492 37.709 1.00 32.77 ? 178 LEU B CB    1 
ATOM   1615 C  CG    . LEU B 1 36  ? 19.753  -33.237 39.010 1.00 33.07 ? 178 LEU B CG    1 
ATOM   1616 C  CD1   . LEU B 1 36  ? 20.750  -32.109 38.786 1.00 29.62 ? 178 LEU B CD1   1 
ATOM   1617 C  CD2   . LEU B 1 36  ? 18.803  -32.925 40.189 1.00 32.96 ? 178 LEU B CD2   1 
ATOM   1618 N  N     . THR B 1 37  ? 16.600  -35.509 35.975 1.00 36.35 ? 179 THR B N     1 
ATOM   1619 C  CA    . THR B 1 37  ? 15.820  -35.536 34.741 1.00 36.42 ? 179 THR B CA    1 
ATOM   1620 C  C     . THR B 1 37  ? 14.349  -35.552 35.110 1.00 39.29 ? 179 THR B C     1 
ATOM   1621 O  O     . THR B 1 37  ? 13.998  -36.011 36.187 1.00 41.71 ? 179 THR B O     1 
ATOM   1622 C  CB    . THR B 1 37  ? 16.158  -36.767 33.830 1.00 36.83 ? 179 THR B CB    1 
ATOM   1623 O  OG1   . THR B 1 37  ? 15.786  -37.995 34.475 1.00 38.48 ? 179 THR B OG1   1 
ATOM   1624 C  CG2   . THR B 1 37  ? 17.642  -36.808 33.471 1.00 33.86 ? 179 THR B CG2   1 
ATOM   1625 N  N     . GLN B 1 38  ? 13.497  -35.052 34.217 1.00 39.90 ? 180 GLN B N     1 
ATOM   1626 C  CA    . GLN B 1 38  ? 12.044  -35.034 34.440 1.00 42.99 ? 180 GLN B CA    1 
ATOM   1627 C  C     . GLN B 1 38  ? 11.265  -36.057 33.586 1.00 44.19 ? 180 GLN B C     1 
ATOM   1628 O  O     . GLN B 1 38  ? 10.040  -36.145 33.673 1.00 46.87 ? 180 GLN B O     1 
ATOM   1629 C  CB    . GLN B 1 38  ? 11.478  -33.617 34.220 1.00 43.53 ? 180 GLN B CB    1 
ATOM   1630 C  CG    . GLN B 1 38  ? 11.710  -33.018 32.834 1.00 43.74 ? 180 GLN B CG    1 
ATOM   1631 C  CD    . GLN B 1 38  ? 10.994  -31.674 32.666 1.00 45.47 ? 180 GLN B CD    1 
ATOM   1632 O  OE1   . GLN B 1 38  ? 10.989  -30.840 33.588 1.00 49.91 ? 180 GLN B OE1   1 
ATOM   1633 N  NE2   . GLN B 1 38  ? 10.379  -31.458 31.489 1.00 48.64 ? 180 GLN B NE2   1 
ATOM   1634 N  N     . ALA B 1 39  ? 11.981  -36.822 32.771 1.00 42.24 ? 181 ALA B N     1 
ATOM   1635 C  CA    . ALA B 1 39  ? 11.383  -37.886 31.991 1.00 43.78 ? 181 ALA B CA    1 
ATOM   1636 C  C     . ALA B 1 39  ? 12.471  -38.880 31.657 1.00 42.35 ? 181 ALA B C     1 
ATOM   1637 O  O     . ALA B 1 39  ? 13.652  -38.588 31.826 1.00 39.94 ? 181 ALA B O     1 
ATOM   1638 C  CB    . ALA B 1 39  ? 10.770  -37.337 30.721 1.00 44.01 ? 181 ALA B CB    1 
ATOM   1639 N  N     . PRO B 1 40  ? 12.086  -40.063 31.172 1.00 44.17 ? 182 PRO B N     1 
ATOM   1640 C  CA    . PRO B 1 40  ? 13.110  -40.964 30.679 1.00 43.92 ? 182 PRO B CA    1 
ATOM   1641 C  C     . PRO B 1 40  ? 13.849  -40.389 29.461 1.00 41.91 ? 182 PRO B C     1 
ATOM   1642 O  O     . PRO B 1 40  ? 13.333  -39.491 28.768 1.00 41.22 ? 182 PRO B O     1 
ATOM   1643 C  CB    . PRO B 1 40  ? 12.320  -42.210 30.298 1.00 47.56 ? 182 PRO B CB    1 
ATOM   1644 C  CG    . PRO B 1 40  ? 10.994  -42.064 30.962 1.00 49.33 ? 182 PRO B CG    1 
ATOM   1645 C  CD    . PRO B 1 40  ? 10.736  -40.627 31.043 1.00 47.27 ? 182 PRO B CD    1 
ATOM   1646 N  N     . GLY B 1 41  ? 15.049  -40.903 29.214 1.00 41.08 ? 183 GLY B N     1 
ATOM   1647 C  CA    . GLY B 1 41  ? 15.847  -40.493 28.059 1.00 39.82 ? 183 GLY B CA    1 
ATOM   1648 C  C     . GLY B 1 41  ? 16.990  -39.560 28.409 1.00 36.56 ? 183 GLY B C     1 
ATOM   1649 O  O     . GLY B 1 41  ? 17.342  -39.406 29.582 1.00 35.00 ? 183 GLY B O     1 
ATOM   1650 N  N     . ASN B 1 42  ? 17.556  -38.942 27.368 1.00 35.74 ? 184 ASN B N     1 
ATOM   1651 C  CA    . ASN B 1 42  ? 18.688  -38.005 27.473 1.00 32.75 ? 184 ASN B CA    1 
ATOM   1652 C  C     . ASN B 1 42  ? 18.279  -36.543 27.292 1.00 31.02 ? 184 ASN B C     1 
ATOM   1653 O  O     . ASN B 1 42  ? 17.836  -36.167 26.215 1.00 31.89 ? 184 ASN B O     1 
ATOM   1654 C  CB    . ASN B 1 42  ? 19.715  -38.331 26.388 1.00 33.56 ? 184 ASN B CB    1 
ATOM   1655 C  CG    . ASN B 1 42  ? 20.399  -39.673 26.601 1.00 35.91 ? 184 ASN B CG    1 
ATOM   1656 O  OD1   . ASN B 1 42  ? 20.669  -40.096 27.738 1.00 37.04 ? 184 ASN B OD1   1 
ATOM   1657 N  ND2   . ASN B 1 42  ? 20.695  -40.344 25.499 1.00 38.46 ? 184 ASN B ND2   1 
ATOM   1658 N  N     . PRO B 1 43  ? 18.425  -35.716 28.341 1.00 29.01 ? 185 PRO B N     1 
ATOM   1659 C  CA    . PRO B 1 43  ? 18.191  -34.263 28.279 1.00 27.32 ? 185 PRO B CA    1 
ATOM   1660 C  C     . PRO B 1 43  ? 19.019  -33.450 27.266 1.00 25.78 ? 185 PRO B C     1 
ATOM   1661 O  O     . PRO B 1 43  ? 18.498  -32.488 26.701 1.00 25.62 ? 185 PRO B O     1 
ATOM   1662 C  CB    . PRO B 1 43  ? 18.529  -33.786 29.695 1.00 25.83 ? 185 PRO B CB    1 
ATOM   1663 C  CG    . PRO B 1 43  ? 18.436  -34.968 30.545 1.00 27.40 ? 185 PRO B CG    1 
ATOM   1664 C  CD    . PRO B 1 43  ? 18.763  -36.157 29.706 1.00 28.88 ? 185 PRO B CD    1 
ATOM   1665 N  N     . VAL B 1 44  ? 20.283  -33.804 27.059 1.00 24.61 ? 186 VAL B N     1 
ATOM   1666 C  CA    . VAL B 1 44  ? 21.158  -33.045 26.152 1.00 23.85 ? 186 VAL B CA    1 
ATOM   1667 C  C     . VAL B 1 44  ? 21.013  -33.557 24.717 1.00 25.79 ? 186 VAL B C     1 
ATOM   1668 O  O     . VAL B 1 44  ? 21.323  -34.710 24.422 1.00 26.77 ? 186 VAL B O     1 
ATOM   1669 C  CB    . VAL B 1 44  ? 22.642  -33.122 26.590 1.00 22.65 ? 186 VAL B CB    1 
ATOM   1670 C  CG1   . VAL B 1 44  ? 23.521  -32.342 25.645 1.00 21.36 ? 186 VAL B CG1   1 
ATOM   1671 C  CG2   . VAL B 1 44  ? 22.816  -32.607 28.021 1.00 21.03 ? 186 VAL B CG2   1 
ATOM   1672 N  N     . LEU B 1 45  ? 20.531  -32.687 23.834 1.00 26.65 ? 187 LEU B N     1 
ATOM   1673 C  CA    . LEU B 1 45  ? 20.276  -33.038 22.437 1.00 29.07 ? 187 LEU B CA    1 
ATOM   1674 C  C     . LEU B 1 45  ? 21.507  -32.865 21.572 1.00 29.43 ? 187 LEU B C     1 
ATOM   1675 O  O     . LEU B 1 45  ? 21.706  -33.616 20.630 1.00 31.32 ? 187 LEU B O     1 
ATOM   1676 C  CB    . LEU B 1 45  ? 19.164  -32.159 21.864 1.00 30.14 ? 187 LEU B CB    1 
ATOM   1677 C  CG    . LEU B 1 45  ? 17.803  -32.197 22.552 1.00 30.39 ? 187 LEU B CG    1 
ATOM   1678 C  CD1   . LEU B 1 45  ? 16.909  -31.096 22.016 1.00 30.26 ? 187 LEU B CD1   1 
ATOM   1679 C  CD2   . LEU B 1 45  ? 17.160  -33.553 22.357 1.00 31.69 ? 187 LEU B CD2   1 
ATOM   1680 N  N     . ALA B 1 46  ? 22.322  -31.853 21.862 1.00 28.08 ? 188 ALA B N     1 
ATOM   1681 C  CA    . ALA B 1 46  ? 23.495  -31.582 21.033 1.00 28.81 ? 188 ALA B CA    1 
ATOM   1682 C  C     . ALA B 1 46  ? 24.541  -30.775 21.767 1.00 26.72 ? 188 ALA B C     1 
ATOM   1683 O  O     . ALA B 1 46  ? 24.242  -30.142 22.779 1.00 25.32 ? 188 ALA B O     1 
ATOM   1684 C  CB    . ALA B 1 46  ? 23.074  -30.870 19.725 1.00 30.74 ? 188 ALA B CB    1 
ATOM   1685 N  N     . VAL B 1 47  ? 25.763  -30.820 21.235 1.00 27.71 ? 189 VAL B N     1 
ATOM   1686 C  CA    . VAL B 1 47  ? 26.929  -30.110 21.756 1.00 26.37 ? 189 VAL B CA    1 
ATOM   1687 C  C     . VAL B 1 47  ? 27.788  -29.549 20.612 1.00 28.19 ? 189 VAL B C     1 
ATOM   1688 O  O     . VAL B 1 47  ? 28.171  -30.288 19.710 1.00 30.13 ? 189 VAL B O     1 
ATOM   1689 C  CB    . VAL B 1 47  ? 27.820  -31.053 22.588 1.00 25.69 ? 189 VAL B CB    1 
ATOM   1690 C  CG1   . VAL B 1 47  ? 29.137  -30.357 22.992 1.00 25.29 ? 189 VAL B CG1   1 
ATOM   1691 C  CG2   . VAL B 1 47  ? 27.087  -31.532 23.815 1.00 24.57 ? 189 VAL B CG2   1 
ATOM   1692 N  N     . GLN B 1 48  ? 28.094  -28.251 20.677 1.00 27.95 ? 190 GLN B N     1 
ATOM   1693 C  CA    . GLN B 1 48  ? 29.001  -27.575 19.754 1.00 29.87 ? 190 GLN B CA    1 
ATOM   1694 C  C     . GLN B 1 48  ? 30.249  -27.107 20.497 1.00 28.86 ? 190 GLN B C     1 
ATOM   1695 O  O     . GLN B 1 48  ? 30.148  -26.544 21.606 1.00 26.96 ? 190 GLN B O     1 
ATOM   1696 C  CB    . GLN B 1 48  ? 28.314  -26.367 19.118 1.00 31.36 ? 190 GLN B CB    1 
ATOM   1697 C  CG    . GLN B 1 48  ? 27.513  -26.677 17.846 1.00 37.85 ? 190 GLN B CG    1 
ATOM   1698 C  CD    . GLN B 1 48  ? 26.001  -26.413 17.977 1.00 42.55 ? 190 GLN B CD    1 
ATOM   1699 O  OE1   . GLN B 1 48  ? 25.494  -25.393 17.468 1.00 47.93 ? 190 GLN B OE1   1 
ATOM   1700 N  NE2   . GLN B 1 48  ? 25.276  -27.332 18.636 1.00 42.16 ? 190 GLN B NE2   1 
ATOM   1701 N  N     . ILE B 1 49  ? 31.420  -27.310 19.879 1.00 30.23 ? 191 ILE B N     1 
ATOM   1702 C  CA    . ILE B 1 49  ? 32.713  -27.056 20.539 1.00 29.36 ? 191 ILE B CA    1 
ATOM   1703 C  C     . ILE B 1 49  ? 33.620  -26.128 19.732 1.00 30.89 ? 191 ILE B C     1 
ATOM   1704 O  O     . ILE B 1 49  ? 33.745  -26.292 18.522 1.00 33.64 ? 191 ILE B O     1 
ATOM   1705 C  CB    . ILE B 1 49  ? 33.491  -28.376 20.761 1.00 30.13 ? 191 ILE B CB    1 
ATOM   1706 C  CG1   . ILE B 1 49  ? 32.797  -29.234 21.816 1.00 28.77 ? 191 ILE B CG1   1 
ATOM   1707 C  CG2   . ILE B 1 49  ? 34.941  -28.097 21.180 1.00 30.16 ? 191 ILE B CG2   1 
ATOM   1708 C  CD1   . ILE B 1 49  ? 33.501  -30.562 22.080 1.00 29.58 ? 191 ILE B CD1   1 
ATOM   1709 N  N     . ASN B 1 50  ? 34.249  -25.172 20.418 1.00 29.39 ? 192 ASN B N     1 
ATOM   1710 C  CA    . ASN B 1 50  ? 35.327  -24.356 19.866 1.00 31.65 ? 192 ASN B CA    1 
ATOM   1711 C  C     . ASN B 1 50  ? 36.616  -24.785 20.545 1.00 31.70 ? 192 ASN B C     1 
ATOM   1712 O  O     . ASN B 1 50  ? 36.908  -24.383 21.670 1.00 30.23 ? 192 ASN B O     1 
ATOM   1713 C  CB    . ASN B 1 50  ? 35.055  -22.871 20.106 1.00 30.96 ? 192 ASN B CB    1 
ATOM   1714 C  CG    . ASN B 1 50  ? 36.052  -21.945 19.386 1.00 32.81 ? 192 ASN B CG    1 
ATOM   1715 O  OD1   . ASN B 1 50  ? 37.257  -22.186 19.358 1.00 30.51 ? 192 ASN B OD1   1 
ATOM   1716 N  ND2   . ASN B 1 50  ? 35.535  -20.860 18.830 1.00 31.54 ? 192 ASN B ND2   1 
ATOM   1717 N  N     . GLN B 1 51  ? 37.366  -25.622 19.844 1.00 34.51 ? 193 GLN B N     1 
ATOM   1718 C  CA    . GLN B 1 51  ? 38.586  -26.258 20.361 1.00 35.75 ? 193 GLN B CA    1 
ATOM   1719 C  C     . GLN B 1 51  ? 39.669  -25.205 20.679 1.00 36.46 ? 193 GLN B C     1 
ATOM   1720 O  O     . GLN B 1 51  ? 40.333  -25.287 21.726 1.00 35.53 ? 193 GLN B O     1 
ATOM   1721 C  CB    . GLN B 1 51  ? 39.158  -27.295 19.356 1.00 39.61 ? 193 GLN B CB    1 
ATOM   1722 C  CG    . GLN B 1 51  ? 38.254  -27.681 18.131 1.00 44.08 ? 193 GLN B CG    1 
ATOM   1723 C  CD    . GLN B 1 51  ? 38.007  -26.505 17.118 1.00 50.21 ? 193 GLN B CD    1 
ATOM   1724 O  OE1   . GLN B 1 51  ? 36.896  -26.343 16.595 1.00 52.36 ? 193 GLN B OE1   1 
ATOM   1725 N  NE2   . GLN B 1 51  ? 39.038  -25.683 16.875 1.00 53.20 ? 193 GLN B NE2   1 
ATOM   1726 N  N     . ASP B 1 52  ? 39.824  -24.233 19.772 1.00 37.73 ? 194 ASP B N     1 
ATOM   1727 C  CA    . ASP B 1 52  ? 40.808  -23.162 19.901 1.00 38.78 ? 194 ASP B CA    1 
ATOM   1728 C  C     . ASP B 1 52  ? 40.633  -22.293 21.150 1.00 35.80 ? 194 ASP B C     1 
ATOM   1729 O  O     . ASP B 1 52  ? 41.623  -21.874 21.747 1.00 35.91 ? 194 ASP B O     1 
ATOM   1730 C  CB    . ASP B 1 52  ? 40.781  -22.253 18.654 1.00 41.94 ? 194 ASP B CB    1 
ATOM   1731 C  CG    . ASP B 1 52  ? 41.425  -22.902 17.422 1.00 47.14 ? 194 ASP B CG    1 
ATOM   1732 O  OD1   . ASP B 1 52  ? 41.180  -22.409 16.296 1.00 51.65 ? 194 ASP B OD1   1 
ATOM   1733 O  OD2   . ASP B 1 52  ? 42.177  -23.896 17.565 1.00 50.18 ? 194 ASP B OD2   1 
ATOM   1734 N  N     . LYS B 1 53  ? 39.384  -22.014 21.528 1.00 33.09 ? 195 LYS B N     1 
ATOM   1735 C  CA    . LYS B 1 53  ? 39.082  -21.126 22.671 1.00 30.85 ? 195 LYS B CA    1 
ATOM   1736 C  C     . LYS B 1 53  ? 38.610  -21.927 23.870 1.00 28.26 ? 195 LYS B C     1 
ATOM   1737 O  O     . LYS B 1 53  ? 38.193  -21.369 24.876 1.00 26.58 ? 195 LYS B O     1 
ATOM   1738 C  CB    . LYS B 1 53  ? 38.049  -20.043 22.292 1.00 30.38 ? 195 LYS B CB    1 
ATOM   1739 C  CG    . LYS B 1 53  ? 38.571  -19.005 21.263 1.00 32.74 ? 195 LYS B CG    1 
ATOM   1740 C  CD    . LYS B 1 53  ? 37.558  -17.902 20.898 1.00 33.28 ? 195 LYS B CD    1 
ATOM   1741 C  CE    . LYS B 1 53  ? 37.099  -17.100 22.127 1.00 30.77 ? 195 LYS B CE    1 
ATOM   1742 N  NZ    . LYS B 1 53  ? 36.388  -15.829 21.796 1.00 30.86 ? 195 LYS B NZ    1 
ATOM   1743 N  N     . ASN B 1 54  ? 38.679  -23.247 23.759 1.00 28.37 ? 196 ASN B N     1 
ATOM   1744 C  CA    . ASN B 1 54  ? 38.367  -24.134 24.873 1.00 26.79 ? 196 ASN B CA    1 
ATOM   1745 C  C     . ASN B 1 54  ? 37.015  -23.893 25.551 1.00 24.44 ? 196 ASN B C     1 
ATOM   1746 O  O     . ASN B 1 54  ? 36.927  -23.779 26.770 1.00 22.98 ? 196 ASN B O     1 
ATOM   1747 C  CB    . ASN B 1 54  ? 39.517  -24.126 25.894 1.00 27.54 ? 196 ASN B CB    1 
ATOM   1748 C  CG    . ASN B 1 54  ? 40.733  -24.901 25.400 1.00 31.65 ? 196 ASN B CG    1 
ATOM   1749 O  OD1   . ASN B 1 54  ? 41.856  -24.382 25.401 1.00 35.95 ? 196 ASN B OD1   1 
ATOM   1750 N  ND2   . ASN B 1 54  ? 40.515  -26.145 24.958 1.00 33.02 ? 196 ASN B ND2   1 
ATOM   1751 N  N     . PHE B 1 55  ? 35.955  -23.853 24.749 1.00 24.34 ? 197 PHE B N     1 
ATOM   1752 C  CA    . PHE B 1 55  ? 34.620  -23.768 25.296 1.00 22.67 ? 197 PHE B CA    1 
ATOM   1753 C  C     . PHE B 1 55  ? 33.618  -24.566 24.458 1.00 22.96 ? 197 PHE B C     1 
ATOM   1754 O  O     . PHE B 1 55  ? 33.904  -24.935 23.317 1.00 24.11 ? 197 PHE B O     1 
ATOM   1755 C  CB    . PHE B 1 55  ? 34.217  -22.289 25.470 1.00 22.80 ? 197 PHE B CB    1 
ATOM   1756 C  CG    . PHE B 1 55  ? 33.805  -21.595 24.201 1.00 23.52 ? 197 PHE B CG    1 
ATOM   1757 C  CD1   . PHE B 1 55  ? 32.484  -21.615 23.785 1.00 23.03 ? 197 PHE B CD1   1 
ATOM   1758 C  CD2   . PHE B 1 55  ? 34.732  -20.888 23.444 1.00 26.58 ? 197 PHE B CD2   1 
ATOM   1759 C  CE1   . PHE B 1 55  ? 32.089  -20.964 22.596 1.00 26.17 ? 197 PHE B CE1   1 
ATOM   1760 C  CE2   . PHE B 1 55  ? 34.356  -20.225 22.253 1.00 28.00 ? 197 PHE B CE2   1 
ATOM   1761 C  CZ    . PHE B 1 55  ? 33.034  -20.266 21.829 1.00 27.98 ? 197 PHE B CZ    1 
ATOM   1762 N  N     . ALA B 1 56  ? 32.456  -24.857 25.041 1.00 21.89 ? 198 ALA B N     1 
ATOM   1763 C  CA    . ALA B 1 56  ? 31.358  -25.460 24.286 1.00 22.66 ? 198 ALA B CA    1 
ATOM   1764 C  C     . ALA B 1 56  ? 29.997  -24.907 24.692 1.00 22.27 ? 198 ALA B C     1 
ATOM   1765 O  O     . ALA B 1 56  ? 29.856  -24.298 25.760 1.00 21.52 ? 198 ALA B O     1 
ATOM   1766 C  CB    . ALA B 1 56  ? 31.359  -26.948 24.463 1.00 22.08 ? 198 ALA B CB    1 
ATOM   1767 N  N     . PHE B 1 57  ? 29.003  -25.131 23.829 1.00 23.27 ? 199 PHE B N     1 
ATOM   1768 C  CA    . PHE B 1 57  ? 27.593  -24.965 24.210 1.00 23.14 ? 199 PHE B CA    1 
ATOM   1769 C  C     . PHE B 1 57  ? 26.842  -26.291 24.216 1.00 23.46 ? 199 PHE B C     1 
ATOM   1770 O  O     . PHE B 1 57  ? 27.042  -27.145 23.333 1.00 24.42 ? 199 PHE B O     1 
ATOM   1771 C  CB    . PHE B 1 57  ? 26.891  -23.977 23.289 1.00 25.03 ? 199 PHE B CB    1 
ATOM   1772 C  CG    . PHE B 1 57  ? 27.101  -22.551 23.685 1.00 25.24 ? 199 PHE B CG    1 
ATOM   1773 C  CD1   . PHE B 1 57  ? 26.150  -21.885 24.442 1.00 25.66 ? 199 PHE B CD1   1 
ATOM   1774 C  CD2   . PHE B 1 57  ? 28.265  -21.887 23.333 1.00 25.61 ? 199 PHE B CD2   1 
ATOM   1775 C  CE1   . PHE B 1 57  ? 26.340  -20.566 24.816 1.00 26.54 ? 199 PHE B CE1   1 
ATOM   1776 C  CE2   . PHE B 1 57  ? 28.472  -20.580 23.704 1.00 26.66 ? 199 PHE B CE2   1 
ATOM   1777 C  CZ    . PHE B 1 57  ? 27.502  -19.908 24.449 1.00 27.23 ? 199 PHE B CZ    1 
ATOM   1778 N  N     . LEU B 1 58  ? 26.004  -26.461 25.241 1.00 22.46 ? 200 LEU B N     1 
ATOM   1779 C  CA    . LEU B 1 58  ? 25.144  -27.624 25.387 1.00 22.17 ? 200 LEU B CA    1 
ATOM   1780 C  C     . LEU B 1 58  ? 23.762  -27.160 24.972 1.00 22.99 ? 200 LEU B C     1 
ATOM   1781 O  O     . LEU B 1 58  ? 23.426  -26.026 25.251 1.00 22.62 ? 200 LEU B O     1 
ATOM   1782 C  CB    . LEU B 1 58  ? 25.077  -28.049 26.854 1.00 21.00 ? 200 LEU B CB    1 
ATOM   1783 C  CG    . LEU B 1 58  ? 26.285  -28.559 27.626 1.00 20.22 ? 200 LEU B CG    1 
ATOM   1784 C  CD1   . LEU B 1 58  ? 25.850  -28.751 29.080 1.00 18.59 ? 200 LEU B CD1   1 
ATOM   1785 C  CD2   . LEU B 1 58  ? 26.841  -29.866 27.064 1.00 21.02 ? 200 LEU B CD2   1 
ATOM   1786 N  N     . GLU B 1 59  ? 22.964  -28.021 24.334 1.00 24.31 ? 201 GLU B N     1 
ATOM   1787 C  CA    . GLU B 1 59  ? 21.553  -27.715 24.038 1.00 25.90 ? 201 GLU B CA    1 
ATOM   1788 C  C     . GLU B 1 59  ? 20.709  -28.795 24.677 1.00 25.36 ? 201 GLU B C     1 
ATOM   1789 O  O     . GLU B 1 59  ? 20.984  -29.979 24.499 1.00 25.52 ? 201 GLU B O     1 
ATOM   1790 C  CB    . GLU B 1 59  ? 21.255  -27.662 22.516 1.00 28.51 ? 201 GLU B CB    1 
ATOM   1791 C  CG    . GLU B 1 59  ? 19.998  -26.800 22.151 1.00 31.00 ? 201 GLU B CG    1 
ATOM   1792 C  CD    . GLU B 1 59  ? 19.270  -27.199 20.830 1.00 36.40 ? 201 GLU B CD    1 
ATOM   1793 O  OE1   . GLU B 1 59  ? 19.805  -28.016 20.030 1.00 42.81 ? 201 GLU B OE1   1 
ATOM   1794 O  OE2   . GLU B 1 59  ? 18.133  -26.695 20.582 1.00 40.17 ? 201 GLU B OE2   1 
ATOM   1795 N  N     . PHE B 1 60  ? 19.676  -28.400 25.406 1.00 25.07 ? 202 PHE B N     1 
ATOM   1796 C  CA    . PHE B 1 60  ? 18.878  -29.351 26.156 1.00 25.26 ? 202 PHE B CA    1 
ATOM   1797 C  C     . PHE B 1 60  ? 17.501  -29.527 25.533 1.00 27.40 ? 202 PHE B C     1 
ATOM   1798 O  O     . PHE B 1 60  ? 17.057  -28.687 24.768 1.00 28.82 ? 202 PHE B O     1 
ATOM   1799 C  CB    . PHE B 1 60  ? 18.695  -28.870 27.579 1.00 24.60 ? 202 PHE B CB    1 
ATOM   1800 C  CG    . PHE B 1 60  ? 19.919  -28.940 28.404 1.00 22.22 ? 202 PHE B CG    1 
ATOM   1801 C  CD1   . PHE B 1 60  ? 20.865  -27.927 28.350 1.00 22.77 ? 202 PHE B CD1   1 
ATOM   1802 C  CD2   . PHE B 1 60  ? 20.109  -29.989 29.289 1.00 22.58 ? 202 PHE B CD2   1 
ATOM   1803 C  CE1   . PHE B 1 60  ? 22.012  -27.968 29.159 1.00 22.15 ? 202 PHE B CE1   1 
ATOM   1804 C  CE2   . PHE B 1 60  ? 21.246  -30.059 30.092 1.00 22.47 ? 202 PHE B CE2   1 
ATOM   1805 C  CZ    . PHE B 1 60  ? 22.202  -29.043 30.046 1.00 20.92 ? 202 PHE B CZ    1 
ATOM   1806 N  N     . ARG B 1 61  ? 16.816  -30.614 25.881 1.00 27.88 ? 203 ARG B N     1 
ATOM   1807 C  CA    . ARG B 1 61  ? 15.448  -30.829 25.405 1.00 30.01 ? 203 ARG B CA    1 
ATOM   1808 C  C     . ARG B 1 61  ? 14.410  -29.996 26.159 1.00 30.51 ? 203 ARG B C     1 
ATOM   1809 O  O     . ARG B 1 61  ? 13.269  -29.912 25.712 1.00 33.02 ? 203 ARG B O     1 
ATOM   1810 C  CB    . ARG B 1 61  ? 15.061  -32.309 25.486 1.00 30.90 ? 203 ARG B CB    1 
ATOM   1811 C  CG    . ARG B 1 61  ? 14.749  -32.777 26.877 1.00 30.43 ? 203 ARG B CG    1 
ATOM   1812 C  CD    . ARG B 1 61  ? 14.595  -34.252 26.931 1.00 32.24 ? 203 ARG B CD    1 
ATOM   1813 N  NE    . ARG B 1 61  ? 14.580  -34.750 28.304 1.00 32.18 ? 203 ARG B NE    1 
ATOM   1814 C  CZ    . ARG B 1 61  ? 14.388  -36.027 28.625 1.00 34.37 ? 203 ARG B CZ    1 
ATOM   1815 N  NH1   . ARG B 1 61  ? 14.148  -36.937 27.689 1.00 36.26 ? 203 ARG B NH1   1 
ATOM   1816 N  NH2   . ARG B 1 61  ? 14.403  -36.394 29.895 1.00 35.72 ? 203 ARG B NH2   1 
ATOM   1817 N  N     . SER B 1 62  ? 14.772  -29.404 27.297 1.00 28.59 ? 204 SER B N     1 
ATOM   1818 C  CA    . SER B 1 62  ? 13.782  -28.669 28.086 1.00 30.08 ? 204 SER B CA    1 
ATOM   1819 C  C     . SER B 1 62  ? 14.318  -27.486 28.900 1.00 28.79 ? 204 SER B C     1 
ATOM   1820 O  O     . SER B 1 62  ? 15.505  -27.359 29.141 1.00 27.23 ? 204 SER B O     1 
ATOM   1821 C  CB    . SER B 1 62  ? 13.005  -29.630 28.994 1.00 30.89 ? 204 SER B CB    1 
ATOM   1822 O  OG    . SER B 1 62  ? 13.637  -29.819 30.236 1.00 29.63 ? 204 SER B OG    1 
ATOM   1823 N  N     . VAL B 1 63  ? 13.405  -26.617 29.305 1.00 30.73 ? 205 VAL B N     1 
ATOM   1824 C  CA    . VAL B 1 63  ? 13.737  -25.440 30.083 1.00 30.57 ? 205 VAL B CA    1 
ATOM   1825 C  C     . VAL B 1 63  ? 14.036  -25.801 31.534 1.00 29.98 ? 205 VAL B C     1 
ATOM   1826 O  O     . VAL B 1 63  ? 15.004  -25.310 32.096 1.00 28.16 ? 205 VAL B O     1 
ATOM   1827 C  CB    . VAL B 1 63  ? 12.599  -24.391 30.017 1.00 33.39 ? 205 VAL B CB    1 
ATOM   1828 C  CG1   . VAL B 1 63  ? 12.792  -23.313 31.073 1.00 33.19 ? 205 VAL B CG1   1 
ATOM   1829 C  CG2   . VAL B 1 63  ? 12.531  -23.792 28.636 1.00 32.27 ? 205 VAL B CG2   1 
ATOM   1830 N  N     . ASP B 1 64  ? 13.223  -26.667 32.129 1.00 31.62 ? 206 ASP B N     1 
ATOM   1831 C  CA    . ASP B 1 64  ? 13.422  -27.047 33.527 1.00 32.34 ? 206 ASP B CA    1 
ATOM   1832 C  C     . ASP B 1 64  ? 14.735  -27.810 33.724 1.00 29.91 ? 206 ASP B C     1 
ATOM   1833 O  O     . ASP B 1 64  ? 15.429  -27.613 34.716 1.00 29.14 ? 206 ASP B O     1 
ATOM   1834 C  CB    . ASP B 1 64  ? 12.236  -27.875 34.049 1.00 35.12 ? 206 ASP B CB    1 
ATOM   1835 C  CG    . ASP B 1 64  ? 10.930  -27.062 34.136 1.00 40.22 ? 206 ASP B CG    1 
ATOM   1836 O  OD1   . ASP B 1 64  ? 9.834   -27.680 34.073 1.00 45.02 ? 206 ASP B OD1   1 
ATOM   1837 O  OD2   . ASP B 1 64  ? 10.985  -25.810 34.253 1.00 42.49 ? 206 ASP B OD2   1 
ATOM   1838 N  N     . GLU B 1 65  ? 15.082  -28.669 32.771 1.00 29.04 ? 207 GLU B N     1 
ATOM   1839 C  CA    . GLU B 1 65  ? 16.310  -29.460 32.867 1.00 27.26 ? 207 GLU B CA    1 
ATOM   1840 C  C     . GLU B 1 65  ? 17.561  -28.596 32.644 1.00 25.05 ? 207 GLU B C     1 
ATOM   1841 O  O     . GLU B 1 65  ? 18.594  -28.844 33.257 1.00 23.40 ? 207 GLU B O     1 
ATOM   1842 C  CB    . GLU B 1 65  ? 16.276  -30.652 31.893 1.00 27.45 ? 207 GLU B CB    1 
ATOM   1843 C  CG    . GLU B 1 65  ? 15.487  -31.870 32.437 1.00 30.11 ? 207 GLU B CG    1 
ATOM   1844 C  CD    . GLU B 1 65  ? 15.193  -32.959 31.385 1.00 32.08 ? 207 GLU B CD    1 
ATOM   1845 O  OE1   . GLU B 1 65  ? 15.125  -32.656 30.165 1.00 35.89 ? 207 GLU B OE1   1 
ATOM   1846 O  OE2   . GLU B 1 65  ? 14.998  -34.128 31.788 1.00 35.44 ? 207 GLU B OE2   1 
ATOM   1847 N  N     . THR B 1 66  ? 17.451  -27.571 31.792 1.00 24.58 ? 208 THR B N     1 
ATOM   1848 C  CA    . THR B 1 66  ? 18.558  -26.632 31.568 1.00 23.15 ? 208 THR B CA    1 
ATOM   1849 C  C     . THR B 1 66  ? 18.906  -25.949 32.896 1.00 23.18 ? 208 THR B C     1 
ATOM   1850 O  O     . THR B 1 66  ? 20.058  -25.901 33.297 1.00 21.46 ? 208 THR B O     1 
ATOM   1851 C  CB    . THR B 1 66  ? 18.205  -25.595 30.443 1.00 24.01 ? 208 THR B CB    1 
ATOM   1852 O  OG1   . THR B 1 66  ? 17.853  -26.301 29.234 1.00 23.35 ? 208 THR B OG1   1 
ATOM   1853 C  CG2   . THR B 1 66  ? 19.365  -24.616 30.168 1.00 21.42 ? 208 THR B CG2   1 
ATOM   1854 N  N     . THR B 1 67  ? 17.879  -25.468 33.585 1.00 25.39 ? 209 THR B N     1 
ATOM   1855 C  CA    . THR B 1 67  ? 18.013  -24.883 34.916 1.00 26.48 ? 209 THR B CA    1 
ATOM   1856 C  C     . THR B 1 67  ? 18.661  -25.843 35.917 1.00 26.01 ? 209 THR B C     1 
ATOM   1857 O  O     . THR B 1 67  ? 19.569  -25.464 36.637 1.00 25.51 ? 209 THR B O     1 
ATOM   1858 C  CB    . THR B 1 67  ? 16.626  -24.410 35.443 1.00 29.53 ? 209 THR B CB    1 
ATOM   1859 O  OG1   . THR B 1 67  ? 16.203  -23.242 34.717 1.00 29.67 ? 209 THR B OG1   1 
ATOM   1860 C  CG2   . THR B 1 67  ? 16.681  -24.081 36.924 1.00 30.81 ? 209 THR B CG2   1 
ATOM   1861 N  N     . GLN B 1 68  ? 18.219  -27.095 35.936 1.00 26.89 ? 210 GLN B N     1 
ATOM   1862 C  CA    . GLN B 1 68  ? 18.775  -28.102 36.856 1.00 26.83 ? 210 GLN B CA    1 
ATOM   1863 C  C     . GLN B 1 68  ? 20.261  -28.290 36.673 1.00 24.63 ? 210 GLN B C     1 
ATOM   1864 O  O     . GLN B 1 68  ? 20.973  -28.411 37.651 1.00 24.64 ? 210 GLN B O     1 
ATOM   1865 C  CB    . GLN B 1 68  ? 18.091  -29.460 36.679 1.00 28.06 ? 210 GLN B CB    1 
ATOM   1866 C  CG    . GLN B 1 68  ? 16.641  -29.498 37.115 1.00 32.19 ? 210 GLN B CG    1 
ATOM   1867 C  CD    . GLN B 1 68  ? 16.500  -29.254 38.586 1.00 37.71 ? 210 GLN B CD    1 
ATOM   1868 O  OE1   . GLN B 1 68  ? 17.115  -29.950 39.401 1.00 41.21 ? 210 GLN B OE1   1 
ATOM   1869 N  NE2   . GLN B 1 68  ? 15.719  -28.240 38.949 1.00 41.31 ? 210 GLN B NE2   1 
ATOM   1870 N  N     . ALA B 1 69  ? 20.717  -28.291 35.417 1.00 23.43 ? 211 ALA B N     1 
ATOM   1871 C  CA    . ALA B 1 69  ? 22.127  -28.552 35.058 1.00 21.85 ? 211 ALA B CA    1 
ATOM   1872 C  C     . ALA B 1 69  ? 23.087  -27.473 35.567 1.00 21.49 ? 211 ALA B C     1 
ATOM   1873 O  O     . ALA B 1 69  ? 24.291  -27.664 35.630 1.00 20.47 ? 211 ALA B O     1 
ATOM   1874 C  CB    . ALA B 1 69  ? 22.258  -28.699 33.547 1.00 20.44 ? 211 ALA B CB    1 
ATOM   1875 N  N     . MET B 1 70  ? 22.541  -26.328 35.926 1.00 23.24 ? 212 MET B N     1 
ATOM   1876 C  CA    . MET B 1 70  ? 23.318  -25.225 36.493 1.00 23.91 ? 212 MET B CA    1 
ATOM   1877 C  C     . MET B 1 70  ? 24.034  -25.625 37.791 1.00 24.38 ? 212 MET B C     1 
ATOM   1878 O  O     . MET B 1 70  ? 25.047  -25.026 38.170 1.00 24.01 ? 212 MET B O     1 
ATOM   1879 C  CB    . MET B 1 70  ? 22.353  -24.083 36.791 1.00 26.66 ? 212 MET B CB    1 
ATOM   1880 C  CG    . MET B 1 70  ? 22.934  -22.738 36.675 1.00 29.30 ? 212 MET B CG    1 
ATOM   1881 S  SD    . MET B 1 70  ? 23.151  -22.247 34.957 1.00 32.57 ? 212 MET B SD    1 
ATOM   1882 C  CE    . MET B 1 70  ? 24.085  -20.738 35.327 1.00 29.86 ? 212 MET B CE    1 
ATOM   1883 N  N     . ALA B 1 71  ? 23.499  -26.635 38.473 1.00 24.96 ? 213 ALA B N     1 
ATOM   1884 C  CA    . ALA B 1 71  ? 24.076  -27.112 39.724 1.00 26.58 ? 213 ALA B CA    1 
ATOM   1885 C  C     . ALA B 1 71  ? 25.402  -27.859 39.516 1.00 25.74 ? 213 ALA B C     1 
ATOM   1886 O  O     . ALA B 1 71  ? 26.066  -28.214 40.492 1.00 27.34 ? 213 ALA B O     1 
ATOM   1887 C  CB    . ALA B 1 71  ? 23.072  -27.995 40.474 1.00 27.89 ? 213 ALA B CB    1 
ATOM   1888 N  N     . PHE B 1 72  ? 25.778  -28.094 38.259 1.00 24.02 ? 214 PHE B N     1 
ATOM   1889 C  CA    . PHE B 1 72  ? 27.023  -28.768 37.921 1.00 23.40 ? 214 PHE B CA    1 
ATOM   1890 C  C     . PHE B 1 72  ? 28.196  -27.819 37.773 1.00 22.76 ? 214 PHE B C     1 
ATOM   1891 O  O     . PHE B 1 72  ? 29.277  -28.234 37.420 1.00 22.76 ? 214 PHE B O     1 
ATOM   1892 C  CB    . PHE B 1 72  ? 26.880  -29.558 36.612 1.00 23.32 ? 214 PHE B CB    1 
ATOM   1893 C  CG    . PHE B 1 72  ? 25.955  -30.738 36.697 1.00 23.66 ? 214 PHE B CG    1 
ATOM   1894 C  CD1   . PHE B 1 72  ? 25.119  -31.036 35.644 1.00 24.70 ? 214 PHE B CD1   1 
ATOM   1895 C  CD2   . PHE B 1 72  ? 25.936  -31.560 37.821 1.00 27.05 ? 214 PHE B CD2   1 
ATOM   1896 C  CE1   . PHE B 1 72  ? 24.269  -32.126 35.701 1.00 26.39 ? 214 PHE B CE1   1 
ATOM   1897 C  CE2   . PHE B 1 72  ? 25.090  -32.654 37.902 1.00 28.25 ? 214 PHE B CE2   1 
ATOM   1898 C  CZ    . PHE B 1 72  ? 24.253  -32.945 36.844 1.00 28.50 ? 214 PHE B CZ    1 
ATOM   1899 N  N     . ASP B 1 73  ? 28.012  -26.543 38.046 1.00 23.28 ? 215 ASP B N     1 
ATOM   1900 C  CA    . ASP B 1 73  ? 29.154  -25.627 38.021 1.00 22.89 ? 215 ASP B CA    1 
ATOM   1901 C  C     . ASP B 1 73  ? 30.272  -26.119 38.968 1.00 23.81 ? 215 ASP B C     1 
ATOM   1902 O  O     . ASP B 1 73  ? 30.019  -26.441 40.141 1.00 24.85 ? 215 ASP B O     1 
ATOM   1903 C  CB    . ASP B 1 73  ? 28.720  -24.218 38.415 1.00 23.73 ? 215 ASP B CB    1 
ATOM   1904 C  CG    . ASP B 1 73  ? 29.843  -23.232 38.314 1.00 25.30 ? 215 ASP B CG    1 
ATOM   1905 O  OD1   . ASP B 1 73  ? 30.673  -23.394 37.385 1.00 27.63 ? 215 ASP B OD1   1 
ATOM   1906 O  OD2   . ASP B 1 73  ? 29.909  -22.304 39.161 1.00 28.51 ? 215 ASP B OD2   1 
ATOM   1907 N  N     . GLY B 1 74  ? 31.497  -26.175 38.446 1.00 22.96 ? 216 GLY B N     1 
ATOM   1908 C  CA    . GLY B 1 74  ? 32.644  -26.694 39.203 1.00 24.14 ? 216 GLY B CA    1 
ATOM   1909 C  C     . GLY B 1 74  ? 32.868  -28.206 39.138 1.00 24.17 ? 216 GLY B C     1 
ATOM   1910 O  O     . GLY B 1 74  ? 33.843  -28.687 39.701 1.00 25.50 ? 216 GLY B O     1 
ATOM   1911 N  N     . ILE B 1 75  ? 31.988  -28.946 38.442 1.00 22.85 ? 217 ILE B N     1 
ATOM   1912 C  CA    . ILE B 1 75  ? 32.087  -30.407 38.310 1.00 23.20 ? 217 ILE B CA    1 
ATOM   1913 C  C     . ILE B 1 75  ? 33.357  -30.837 37.556 1.00 23.37 ? 217 ILE B C     1 
ATOM   1914 O  O     . ILE B 1 75  ? 33.868  -30.134 36.682 1.00 22.10 ? 217 ILE B O     1 
ATOM   1915 C  CB    . ILE B 1 75  ? 30.853  -30.985 37.573 1.00 22.48 ? 217 ILE B CB    1 
ATOM   1916 C  CG1   . ILE B 1 75  ? 30.669  -32.484 37.839 1.00 24.32 ? 217 ILE B CG1   1 
ATOM   1917 C  CG2   . ILE B 1 75  ? 30.939  -30.740 36.039 1.00 20.91 ? 217 ILE B CG2   1 
ATOM   1918 C  CD1   . ILE B 1 75  ? 30.569  -32.876 39.309 1.00 26.19 ? 217 ILE B CD1   1 
ATOM   1919 N  N     . ILE B 1 76  ? 33.850  -32.012 37.902 1.00 25.04 ? 218 ILE B N     1 
ATOM   1920 C  CA    . ILE B 1 76  ? 35.109  -32.501 37.407 1.00 26.36 ? 218 ILE B CA    1 
ATOM   1921 C  C     . ILE B 1 76  ? 34.903  -33.355 36.162 1.00 26.32 ? 218 ILE B C     1 
ATOM   1922 O  O     . ILE B 1 76  ? 34.053  -34.229 36.131 1.00 27.01 ? 218 ILE B O     1 
ATOM   1923 C  CB    . ILE B 1 76  ? 35.856  -33.287 38.502 1.00 28.79 ? 218 ILE B CB    1 
ATOM   1924 C  CG1   . ILE B 1 76  ? 36.029  -32.419 39.765 1.00 29.55 ? 218 ILE B CG1   1 
ATOM   1925 C  CG2   . ILE B 1 76  ? 37.234  -33.747 37.999 1.00 30.55 ? 218 ILE B CG2   1 
ATOM   1926 C  CD1   . ILE B 1 76  ? 36.873  -31.149 39.567 1.00 26.40 ? 218 ILE B CD1   1 
ATOM   1927 N  N     . PHE B 1 77  ? 35.698  -33.095 35.135 1.00 26.82 ? 219 PHE B N     1 
ATOM   1928 C  CA    . PHE B 1 77  ? 35.639  -33.858 33.898 1.00 27.45 ? 219 PHE B CA    1 
ATOM   1929 C  C     . PHE B 1 77  ? 37.062  -34.032 33.341 1.00 29.24 ? 219 PHE B C     1 
ATOM   1930 O  O     . PHE B 1 77  ? 37.743  -33.062 33.057 1.00 28.40 ? 219 PHE B O     1 
ATOM   1931 C  CB    . PHE B 1 77  ? 34.689  -33.153 32.916 1.00 25.77 ? 219 PHE B CB    1 
ATOM   1932 C  CG    . PHE B 1 77  ? 34.519  -33.861 31.591 1.00 26.10 ? 219 PHE B CG    1 
ATOM   1933 C  CD1   . PHE B 1 77  ? 34.294  -35.213 31.523 1.00 29.89 ? 219 PHE B CD1   1 
ATOM   1934 C  CD2   . PHE B 1 77  ? 34.559  -33.154 30.411 1.00 26.88 ? 219 PHE B CD2   1 
ATOM   1935 C  CE1   . PHE B 1 77  ? 34.127  -35.866 30.280 1.00 31.11 ? 219 PHE B CE1   1 
ATOM   1936 C  CE2   . PHE B 1 77  ? 34.410  -33.802 29.177 1.00 28.35 ? 219 PHE B CE2   1 
ATOM   1937 C  CZ    . PHE B 1 77  ? 34.186  -35.148 29.117 1.00 29.26 ? 219 PHE B CZ    1 
ATOM   1938 N  N     . GLN B 1 78  ? 37.499  -35.282 33.218 1.00 32.08 ? 220 GLN B N     1 
ATOM   1939 C  CA    . GLN B 1 78  ? 38.878  -35.623 32.845 1.00 35.15 ? 220 GLN B CA    1 
ATOM   1940 C  C     . GLN B 1 78  ? 39.904  -34.772 33.580 1.00 35.34 ? 220 GLN B C     1 
ATOM   1941 O  O     . GLN B 1 78  ? 40.802  -34.204 32.965 1.00 35.43 ? 220 GLN B O     1 
ATOM   1942 C  CB    . GLN B 1 78  ? 39.110  -35.497 31.339 1.00 35.21 ? 220 GLN B CB    1 
ATOM   1943 C  CG    . GLN B 1 78  ? 38.253  -36.405 30.485 1.00 37.05 ? 220 GLN B CG    1 
ATOM   1944 C  CD    . GLN B 1 78  ? 38.763  -36.530 29.042 1.00 39.31 ? 220 GLN B CD    1 
ATOM   1945 O  OE1   . GLN B 1 78  ? 39.851  -36.042 28.699 1.00 43.26 ? 220 GLN B OE1   1 
ATOM   1946 N  NE2   . GLN B 1 78  ? 37.984  -37.207 28.200 1.00 41.52 ? 220 GLN B NE2   1 
ATOM   1947 N  N     . GLY B 1 79  ? 39.751  -34.688 34.899 1.00 35.63 ? 221 GLY B N     1 
ATOM   1948 C  CA    . GLY B 1 79  ? 40.716  -34.010 35.764 1.00 36.74 ? 221 GLY B CA    1 
ATOM   1949 C  C     . GLY B 1 79  ? 40.436  -32.539 35.991 1.00 34.35 ? 221 GLY B C     1 
ATOM   1950 O  O     . GLY B 1 79  ? 41.034  -31.935 36.869 1.00 35.17 ? 221 GLY B O     1 
ATOM   1951 N  N     . GLN B 1 80  ? 39.512  -31.955 35.231 1.00 31.90 ? 222 GLN B N     1 
ATOM   1952 C  CA    . GLN B 1 80  ? 39.355  -30.500 35.241 1.00 30.43 ? 222 GLN B CA    1 
ATOM   1953 C  C     . GLN B 1 80  ? 37.994  -29.987 35.697 1.00 27.90 ? 222 GLN B C     1 
ATOM   1954 O  O     . GLN B 1 80  ? 36.960  -30.585 35.459 1.00 26.23 ? 222 GLN B O     1 
ATOM   1955 C  CB    . GLN B 1 80  ? 39.701  -29.929 33.872 1.00 29.94 ? 222 GLN B CB    1 
ATOM   1956 C  CG    . GLN B 1 80  ? 41.226  -29.864 33.630 1.00 33.76 ? 222 GLN B CG    1 
ATOM   1957 C  CD    . GLN B 1 80  ? 41.563  -29.561 32.187 1.00 34.20 ? 222 GLN B CD    1 
ATOM   1958 O  OE1   . GLN B 1 80  ? 40.672  -29.219 31.391 1.00 36.88 ? 222 GLN B OE1   1 
ATOM   1959 N  NE2   . GLN B 1 80  ? 42.845  -29.684 31.832 1.00 37.47 ? 222 GLN B NE2   1 
ATOM   1960 N  N     . SER B 1 81  ? 38.042  -28.834 36.337 1.00 27.39 ? 223 SER B N     1 
ATOM   1961 C  CA    . SER B 1 81  ? 36.890  -28.222 36.967 1.00 26.27 ? 223 SER B CA    1 
ATOM   1962 C  C     . SER B 1 81  ? 36.146  -27.391 35.914 1.00 23.76 ? 223 SER B C     1 
ATOM   1963 O  O     . SER B 1 81  ? 36.693  -26.421 35.400 1.00 23.93 ? 223 SER B O     1 
ATOM   1964 C  CB    . SER B 1 81  ? 37.413  -27.365 38.132 1.00 27.60 ? 223 SER B CB    1 
ATOM   1965 O  OG    . SER B 1 81  ? 36.381  -26.930 38.971 1.00 29.37 ? 223 SER B OG    1 
ATOM   1966 N  N     . LEU B 1 82  ? 34.929  -27.786 35.549 1.00 22.08 ? 224 LEU B N     1 
ATOM   1967 C  CA    . LEU B 1 82  ? 34.211  -27.091 34.471 1.00 20.25 ? 224 LEU B CA    1 
ATOM   1968 C  C     . LEU B 1 82  ? 33.450  -25.880 35.003 1.00 19.77 ? 224 LEU B C     1 
ATOM   1969 O  O     . LEU B 1 82  ? 32.939  -25.895 36.128 1.00 20.05 ? 224 LEU B O     1 
ATOM   1970 C  CB    . LEU B 1 82  ? 33.220  -28.007 33.746 1.00 19.07 ? 224 LEU B CB    1 
ATOM   1971 C  CG    . LEU B 1 82  ? 33.709  -29.279 33.044 1.00 18.89 ? 224 LEU B CG    1 
ATOM   1972 C  CD1   . LEU B 1 82  ? 32.515  -30.042 32.457 1.00 15.54 ? 224 LEU B CD1   1 
ATOM   1973 C  CD2   . LEU B 1 82  ? 34.728  -28.980 31.973 1.00 18.32 ? 224 LEU B CD2   1 
ATOM   1974 N  N     . LYS B 1 83  ? 33.358  -24.849 34.164 1.00 19.11 ? 225 LYS B N     1 
ATOM   1975 C  CA    . LYS B 1 83  ? 32.645  -23.618 34.477 1.00 19.28 ? 225 LYS B CA    1 
ATOM   1976 C  C     . LYS B 1 83  ? 31.331  -23.585 33.702 1.00 18.27 ? 225 LYS B C     1 
ATOM   1977 O  O     . LYS B 1 83  ? 31.335  -23.548 32.468 1.00 18.14 ? 225 LYS B O     1 
ATOM   1978 C  CB    . LYS B 1 83  ? 33.516  -22.421 34.080 1.00 20.00 ? 225 LYS B CB    1 
ATOM   1979 C  CG    . LYS B 1 83  ? 33.013  -21.082 34.558 1.00 21.16 ? 225 LYS B CG    1 
ATOM   1980 C  CD    . LYS B 1 83  ? 33.697  -19.940 33.821 1.00 22.39 ? 225 LYS B CD    1 
ATOM   1981 C  CE    . LYS B 1 83  ? 33.236  -18.581 34.299 1.00 23.56 ? 225 LYS B CE    1 
ATOM   1982 N  NZ    . LYS B 1 83  ? 34.301  -17.577 34.022 1.00 25.13 ? 225 LYS B NZ    1 
ATOM   1983 N  N     . ILE B 1 84  ? 30.214  -23.592 34.415 1.00 17.97 ? 226 ILE B N     1 
ATOM   1984 C  CA    . ILE B 1 84  ? 28.902  -23.627 33.772 1.00 17.75 ? 226 ILE B CA    1 
ATOM   1985 C  C     . ILE B 1 84  ? 28.207  -22.296 34.018 1.00 18.83 ? 226 ILE B C     1 
ATOM   1986 O  O     . ILE B 1 84  ? 28.138  -21.835 35.170 1.00 20.17 ? 226 ILE B O     1 
ATOM   1987 C  CB    . ILE B 1 84  ? 28.041  -24.782 34.329 1.00 17.80 ? 226 ILE B CB    1 
ATOM   1988 C  CG1   . ILE B 1 84  ? 28.820  -26.110 34.267 1.00 17.92 ? 226 ILE B CG1   1 
ATOM   1989 C  CG2   . ILE B 1 84  ? 26.738  -24.890 33.581 1.00 16.59 ? 226 ILE B CG2   1 
ATOM   1990 C  CD1   . ILE B 1 84  ? 29.168  -26.552 32.853 1.00 18.44 ? 226 ILE B CD1   1 
ATOM   1991 N  N     . ARG B 1 85  ? 27.702  -21.675 32.948 1.00 18.69 ? 227 ARG B N     1 
ATOM   1992 C  CA    . ARG B 1 85  ? 27.019  -20.367 33.031 1.00 19.67 ? 227 ARG B CA    1 
ATOM   1993 C  C     . ARG B 1 85  ? 25.885  -20.290 32.024 1.00 19.60 ? 227 ARG B C     1 
ATOM   1994 O  O     . ARG B 1 85  ? 25.837  -21.100 31.110 1.00 18.57 ? 227 ARG B O     1 
ATOM   1995 C  CB    . ARG B 1 85  ? 27.991  -19.216 32.742 1.00 20.34 ? 227 ARG B CB    1 
ATOM   1996 C  CG    . ARG B 1 85  ? 29.125  -19.045 33.730 1.00 20.70 ? 227 ARG B CG    1 
ATOM   1997 C  CD    . ARG B 1 85  ? 28.658  -18.381 35.018 1.00 23.20 ? 227 ARG B CD    1 
ATOM   1998 N  NE    . ARG B 1 85  ? 29.770  -18.080 35.914 1.00 22.89 ? 227 ARG B NE    1 
ATOM   1999 C  CZ    . ARG B 1 85  ? 30.320  -18.946 36.761 1.00 24.16 ? 227 ARG B CZ    1 
ATOM   2000 N  NH1   . ARG B 1 85  ? 29.879  -20.190 36.852 1.00 22.54 ? 227 ARG B NH1   1 
ATOM   2001 N  NH2   . ARG B 1 85  ? 31.333  -18.566 37.532 1.00 25.52 ? 227 ARG B NH2   1 
ATOM   2002 N  N     . ARG B 1 86  ? 24.983  -19.318 32.216 1.00 21.48 ? 228 ARG B N     1 
ATOM   2003 C  CA    . ARG B 1 86  ? 23.946  -18.946 31.237 1.00 22.96 ? 228 ARG B CA    1 
ATOM   2004 C  C     . ARG B 1 86  ? 24.536  -18.235 30.022 1.00 23.70 ? 228 ARG B C     1 
ATOM   2005 O  O     . ARG B 1 86  ? 25.539  -17.568 30.138 1.00 24.03 ? 228 ARG B O     1 
ATOM   2006 C  CB    . ARG B 1 86  ? 22.942  -17.980 31.844 1.00 25.10 ? 228 ARG B CB    1 
ATOM   2007 C  CG    . ARG B 1 86  ? 22.104  -18.521 32.968 1.00 25.87 ? 228 ARG B CG    1 
ATOM   2008 C  CD    . ARG B 1 86  ? 21.149  -19.597 32.515 1.00 25.56 ? 228 ARG B CD    1 
ATOM   2009 N  NE    . ARG B 1 86  ? 20.156  -19.882 33.550 1.00 27.51 ? 228 ARG B NE    1 
ATOM   2010 C  CZ    . ARG B 1 86  ? 19.179  -20.783 33.428 1.00 28.00 ? 228 ARG B CZ    1 
ATOM   2011 N  NH1   . ARG B 1 86  ? 19.040  -21.472 32.299 1.00 26.31 ? 228 ARG B NH1   1 
ATOM   2012 N  NH2   . ARG B 1 86  ? 18.314  -20.968 34.430 1.00 28.45 ? 228 ARG B NH2   1 
ATOM   2013 N  N     . PRO B 1 87  ? 23.891  -18.350 28.855 1.00 24.92 ? 229 PRO B N     1 
ATOM   2014 C  CA    . PRO B 1 87  ? 24.362  -17.566 27.700 1.00 26.53 ? 229 PRO B CA    1 
ATOM   2015 C  C     . PRO B 1 87  ? 24.210  -16.086 27.961 1.00 29.43 ? 229 PRO B C     1 
ATOM   2016 O  O     . PRO B 1 87  ? 23.328  -15.708 28.733 1.00 30.98 ? 229 PRO B O     1 
ATOM   2017 C  CB    . PRO B 1 87  ? 23.417  -17.979 26.565 1.00 27.41 ? 229 PRO B CB    1 
ATOM   2018 C  CG    . PRO B 1 87  ? 22.748  -19.247 27.039 1.00 25.83 ? 229 PRO B CG    1 
ATOM   2019 C  CD    . PRO B 1 87  ? 22.714  -19.174 28.537 1.00 24.72 ? 229 PRO B CD    1 
ATOM   2020 N  N     . HIS B 1 88  ? 25.025  -15.251 27.312 1.00 31.03 ? 230 HIS B N     1 
ATOM   2021 C  CA    . HIS B 1 88  ? 24.957  -13.802 27.538 1.00 34.25 ? 230 HIS B CA    1 
ATOM   2022 C  C     . HIS B 1 88  ? 23.627  -13.196 27.055 1.00 37.62 ? 230 HIS B C     1 
ATOM   2023 O  O     . HIS B 1 88  ? 23.257  -12.101 27.485 1.00 40.76 ? 230 HIS B O     1 
ATOM   2024 C  CB    . HIS B 1 88  ? 26.136  -13.070 26.889 1.00 35.25 ? 230 HIS B CB    1 
ATOM   2025 C  CG    . HIS B 1 88  ? 27.449  -13.272 27.590 1.00 34.33 ? 230 HIS B CG    1 
ATOM   2026 N  ND1   . HIS B 1 88  ? 28.663  -13.151 26.942 1.00 34.22 ? 230 HIS B ND1   1 
ATOM   2027 C  CD2   . HIS B 1 88  ? 27.742  -13.588 28.877 1.00 33.47 ? 230 HIS B CD2   1 
ATOM   2028 C  CE1   . HIS B 1 88  ? 29.645  -13.385 27.800 1.00 34.19 ? 230 HIS B CE1   1 
ATOM   2029 N  NE2   . HIS B 1 88  ? 29.113  -13.657 28.980 1.00 33.04 ? 230 HIS B NE2   1 
ATOM   2030 N  N     . ASP B 1 89  ? 22.905  -13.899 26.180 1.00 37.31 ? 231 ASP B N     1 
ATOM   2031 C  CA    . ASP B 1 89  ? 21.602  -13.422 25.720 1.00 40.44 ? 231 ASP B CA    1 
ATOM   2032 C  C     . ASP B 1 89  ? 20.401  -14.117 26.401 1.00 39.87 ? 231 ASP B C     1 
ATOM   2033 O  O     . ASP B 1 89  ? 19.266  -14.021 25.903 1.00 42.48 ? 231 ASP B O     1 
ATOM   2034 C  CB    . ASP B 1 89  ? 21.506  -13.549 24.185 1.00 42.22 ? 231 ASP B CB    1 
ATOM   2035 C  CG    . ASP B 1 89  ? 21.546  -14.999 23.711 1.00 40.51 ? 231 ASP B CG    1 
ATOM   2036 O  OD1   . ASP B 1 89  ? 21.519  -15.895 24.572 1.00 38.05 ? 231 ASP B OD1   1 
ATOM   2037 O  OD2   . ASP B 1 89  ? 21.617  -15.244 22.484 1.00 43.62 ? 231 ASP B OD2   1 
ATOM   2038 N  N     . TYR B 1 90  ? 20.642  -14.800 27.522 1.00 36.68 ? 232 TYR B N     1 
ATOM   2039 C  CA    . TYR B 1 90  ? 19.576  -15.468 28.286 1.00 36.48 ? 232 TYR B CA    1 
ATOM   2040 C  C     . TYR B 1 90  ? 18.535  -14.466 28.771 1.00 40.16 ? 232 TYR B C     1 
ATOM   2041 O  O     . TYR B 1 90  ? 18.893  -13.439 29.319 1.00 41.62 ? 232 TYR B O     1 
ATOM   2042 C  CB    . TYR B 1 90  ? 20.176  -16.221 29.482 1.00 33.17 ? 232 TYR B CB    1 
ATOM   2043 C  CG    . TYR B 1 90  ? 19.185  -16.779 30.488 1.00 33.13 ? 232 TYR B CG    1 
ATOM   2044 C  CD1   . TYR B 1 90  ? 18.303  -17.792 30.137 1.00 31.33 ? 232 TYR B CD1   1 
ATOM   2045 C  CD2   . TYR B 1 90  ? 19.152  -16.308 31.802 1.00 33.33 ? 232 TYR B CD2   1 
ATOM   2046 C  CE1   . TYR B 1 90  ? 17.391  -18.297 31.048 1.00 32.24 ? 232 TYR B CE1   1 
ATOM   2047 C  CE2   . TYR B 1 90  ? 18.244  -16.814 32.728 1.00 34.47 ? 232 TYR B CE2   1 
ATOM   2048 C  CZ    . TYR B 1 90  ? 17.369  -17.813 32.339 1.00 34.06 ? 232 TYR B CZ    1 
ATOM   2049 O  OH    . TYR B 1 90  ? 16.471  -18.333 33.237 1.00 35.13 ? 232 TYR B OH    1 
ATOM   2050 N  N     . GLN B 1 91  ? 17.251  -14.761 28.548 1.00 42.21 ? 233 GLN B N     1 
ATOM   2051 C  CA    . GLN B 1 91  ? 16.168  -13.922 29.065 1.00 46.63 ? 233 GLN B CA    1 
ATOM   2052 C  C     . GLN B 1 91  ? 15.595  -14.491 30.375 1.00 46.75 ? 233 GLN B C     1 
ATOM   2053 O  O     . GLN B 1 91  ? 14.823  -15.456 30.351 1.00 45.58 ? 233 GLN B O     1 
ATOM   2054 C  CB    . GLN B 1 91  ? 15.062  -13.737 28.017 1.00 49.48 ? 233 GLN B CB    1 
ATOM   2055 C  CG    . GLN B 1 91  ? 15.536  -12.969 26.803 1.00 50.85 ? 233 GLN B CG    1 
ATOM   2056 C  CD    . GLN B 1 91  ? 14.446  -12.718 25.786 1.00 55.01 ? 233 GLN B CD    1 
ATOM   2057 O  OE1   . GLN B 1 91  ? 14.514  -13.223 24.666 1.00 55.39 ? 233 GLN B OE1   1 
ATOM   2058 N  NE2   . GLN B 1 91  ? 13.435  -11.929 26.161 1.00 58.16 ? 233 GLN B NE2   1 
ATOM   2059 N  N     . PRO B 1 92  ? 15.998  -13.909 31.529 1.00 48.37 ? 234 PRO B N     1 
ATOM   2060 C  CA    . PRO B 1 92  ? 15.406  -14.311 32.815 1.00 49.39 ? 234 PRO B CA    1 
ATOM   2061 C  C     . PRO B 1 92  ? 13.898  -14.189 32.801 1.00 53.60 ? 234 PRO B C     1 
ATOM   2062 O  O     . PRO B 1 92  ? 13.210  -15.144 33.159 1.00 53.82 ? 234 PRO B O     1 
ATOM   2063 C  CB    . PRO B 1 92  ? 16.012  -13.328 33.824 1.00 51.29 ? 234 PRO B CB    1 
ATOM   2064 C  CG    . PRO B 1 92  ? 16.675  -12.241 33.005 1.00 52.43 ? 234 PRO B CG    1 
ATOM   2065 C  CD    . PRO B 1 92  ? 17.040  -12.876 31.706 1.00 49.03 ? 234 PRO B CD    1 
ATOM   2066 N  N     . LEU B 1 93  ? 13.398  -13.026 32.376 1.00 57.88 ? 235 LEU B N     1 
ATOM   2067 C  CA    . LEU B 1 93  ? 11.961  -12.813 32.160 1.00 61.89 ? 235 LEU B CA    1 
ATOM   2068 C  C     . LEU B 1 93  ? 11.611  -12.971 30.666 1.00 62.07 ? 235 LEU B C     1 
ATOM   2069 O  O     . LEU B 1 93  ? 11.959  -12.114 29.853 1.00 63.69 ? 235 LEU B O     1 
ATOM   2070 C  CB    . LEU B 1 93  ? 11.539  -11.417 32.655 1.00 67.51 ? 235 LEU B CB    1 
ATOM   2071 C  CG    . LEU B 1 93  ? 11.451  -11.156 34.171 1.00 69.75 ? 235 LEU B CG    1 
ATOM   2072 C  CD1   . LEU B 1 93  ? 11.103  -9.694  34.445 1.00 75.58 ? 235 LEU B CD1   1 
ATOM   2073 C  CD2   . LEU B 1 93  ? 10.426  -12.067 34.851 1.00 70.90 ? 235 LEU B CD2   1 
ATOM   2074 N  N     . PRO B 1 94  ? 10.925  -14.068 30.295 1.00 60.87 ? 236 PRO B N     1 
ATOM   2075 C  CA    . PRO B 1 94  ? 10.612  -14.317 28.876 1.00 60.80 ? 236 PRO B CA    1 
ATOM   2076 C  C     . PRO B 1 94  ? 9.522   -13.424 28.294 1.00 65.88 ? 236 PRO B C     1 
ATOM   2077 O  O     . PRO B 1 94  ? 8.570   -13.084 28.990 1.00 69.62 ? 236 PRO B O     1 
ATOM   2078 C  CB    . PRO B 1 94  ? 10.119  -15.766 28.886 1.00 58.93 ? 236 PRO B CB    1 
ATOM   2079 C  CG    . PRO B 1 94  ? 9.522   -15.938 30.245 1.00 60.36 ? 236 PRO B CG    1 
ATOM   2080 C  CD    . PRO B 1 94  ? 10.414  -15.146 31.164 1.00 59.87 ? 236 PRO B CD    1 
ATOM   2081 N  N     . GLY B 1 95  ? 9.678   -13.038 27.029 1.00 66.61 ? 237 GLY B N     1 
ATOM   2082 C  CA    . GLY B 1 95  ? 8.743   -12.166 26.363 1.00 71.81 ? 237 GLY B CA    1 
ATOM   2083 C  C     . GLY B 1 95  ? 8.780   -10.704 26.735 1.00 75.56 ? 237 GLY B C     1 
ATOM   2084 O  O     . GLY B 1 95  ? 7.879   -9.990  26.403 1.00 80.50 ? 237 GLY B O     1 
ATOM   2085 N  N     . ALA B 1 96  ? 9.824   -10.273 27.415 1.00 34.46 ? 258 ALA B N     1 
ATOM   2086 C  CA    . ALA B 1 96  ? 9.968   -8.909  27.833 1.00 34.13 ? 258 ALA B CA    1 
ATOM   2087 C  C     . ALA B 1 96  ? 10.381  -7.952  26.756 1.00 32.24 ? 258 ALA B C     1 
ATOM   2088 O  O     . ALA B 1 96  ? 10.267  -6.803  26.935 1.00 32.66 ? 258 ALA B O     1 
ATOM   2089 C  CB    . ALA B 1 96  ? 10.928  -8.818  28.941 1.00 36.68 ? 258 ALA B CB    1 
ATOM   2090 N  N     . HIS B 1 97  ? 10.847  -8.457  25.617 1.00 31.07 ? 259 HIS B N     1 
ATOM   2091 C  CA    . HIS B 1 97  ? 11.234  -7.591  24.519 1.00 29.63 ? 259 HIS B CA    1 
ATOM   2092 C  C     . HIS B 1 97  ? 10.343  -7.798  23.311 1.00 27.50 ? 259 HIS B C     1 
ATOM   2093 O  O     . HIS B 1 97  ? 10.745  -7.551  22.177 1.00 26.93 ? 259 HIS B O     1 
ATOM   2094 C  CB    . HIS B 1 97  ? 12.721  -7.778  24.185 1.00 31.56 ? 259 HIS B CB    1 
ATOM   2095 C  CG    . HIS B 1 97  ? 13.625  -7.533  25.353 1.00 33.12 ? 259 HIS B CG    1 
ATOM   2096 N  ND1   . HIS B 1 97  ? 14.548  -8.457  25.789 1.00 37.53 ? 259 HIS B ND1   1 
ATOM   2097 C  CD2   . HIS B 1 97  ? 13.703  -6.495  26.214 1.00 34.14 ? 259 HIS B CD2   1 
ATOM   2098 C  CE1   . HIS B 1 97  ? 15.178  -7.985  26.852 1.00 39.12 ? 259 HIS B CE1   1 
ATOM   2099 N  NE2   . HIS B 1 97  ? 14.680  -6.795  27.134 1.00 37.14 ? 259 HIS B NE2   1 
ATOM   2100 N  N     . LYS B 1 98  ? 9.118   -8.237  23.578 1.00 26.80 ? 260 LYS B N     1 
ATOM   2101 C  CA    . LYS B 1 98  ? 8.081   -8.374  22.563 1.00 25.15 ? 260 LYS B CA    1 
ATOM   2102 C  C     . LYS B 1 98  ? 7.354   -7.055  22.361 1.00 23.29 ? 260 LYS B C     1 
ATOM   2103 O  O     . LYS B 1 98  ? 6.939   -6.437  23.324 1.00 23.16 ? 260 LYS B O     1 
ATOM   2104 C  CB    . LYS B 1 98  ? 7.071   -9.428  23.006 1.00 26.01 ? 260 LYS B CB    1 
ATOM   2105 C  CG    . LYS B 1 98  ? 5.919   -9.642  22.036 1.00 25.80 ? 260 LYS B CG    1 
ATOM   2106 C  CD    . LYS B 1 98  ? 4.886   -10.610 22.625 1.00 26.97 ? 260 LYS B CD    1 
ATOM   2107 C  CE    . LYS B 1 98  ? 3.917   -11.074 21.555 1.00 27.80 ? 260 LYS B CE    1 
ATOM   2108 N  NZ    . LYS B 1 98  ? 3.424   -12.444 21.832 1.00 31.70 ? 260 LYS B NZ    1 
ATOM   2109 N  N     . LEU B 1 99  ? 7.168   -6.666  21.102 1.00 22.23 ? 261 LEU B N     1 
ATOM   2110 C  CA    . LEU B 1 99  ? 6.571   -5.383  20.730 1.00 21.67 ? 261 LEU B CA    1 
ATOM   2111 C  C     . LEU B 1 99  ? 5.135   -5.514  20.227 1.00 21.31 ? 261 LEU B C     1 
ATOM   2112 O  O     . LEU B 1 99  ? 4.794   -6.478  19.531 1.00 21.29 ? 261 LEU B O     1 
ATOM   2113 C  CB    . LEU B 1 99  ? 7.398   -4.729  19.619 1.00 21.14 ? 261 LEU B CB    1 
ATOM   2114 C  CG    . LEU B 1 99  ? 8.813   -4.255  19.963 1.00 22.44 ? 261 LEU B CG    1 
ATOM   2115 C  CD1   . LEU B 1 99  ? 9.468   -3.570  18.750 1.00 21.79 ? 261 LEU B CD1   1 
ATOM   2116 C  CD2   . LEU B 1 99  ? 8.823   -3.322  21.186 1.00 21.68 ? 261 LEU B CD2   1 
ATOM   2117 N  N     . PHE B 1 100 ? 4.308   -4.525  20.558 1.00 21.72 ? 262 PHE B N     1 
ATOM   2118 C  CA    . PHE B 1 100 ? 2.979   -4.357  19.941 1.00 21.67 ? 262 PHE B CA    1 
ATOM   2119 C  C     . PHE B 1 100 ? 3.080   -3.269  18.873 1.00 21.74 ? 262 PHE B C     1 
ATOM   2120 O  O     . PHE B 1 100 ? 3.693   -2.243  19.134 1.00 21.99 ? 262 PHE B O     1 
ATOM   2121 C  CB    . PHE B 1 100 ? 1.979   -3.966  21.020 1.00 22.83 ? 262 PHE B CB    1 
ATOM   2122 C  CG    . PHE B 1 100 ? 0.643   -3.532  20.511 1.00 23.50 ? 262 PHE B CG    1 
ATOM   2123 C  CD1   . PHE B 1 100 ? -0.274  -4.464  20.023 1.00 24.96 ? 262 PHE B CD1   1 
ATOM   2124 C  CD2   . PHE B 1 100 ? 0.263   -2.203  20.582 1.00 25.31 ? 262 PHE B CD2   1 
ATOM   2125 C  CE1   . PHE B 1 100 ? -1.526  -4.070  19.583 1.00 24.71 ? 262 PHE B CE1   1 
ATOM   2126 C  CE2   . PHE B 1 100 ? -0.994  -1.792  20.146 1.00 26.35 ? 262 PHE B CE2   1 
ATOM   2127 C  CZ    . PHE B 1 100 ? -1.891  -2.725  19.660 1.00 26.67 ? 262 PHE B CZ    1 
ATOM   2128 N  N     . ILE B 1 101 ? 2.526   -3.513  17.678 1.00 21.50 ? 263 ILE B N     1 
ATOM   2129 C  CA    . ILE B 1 101 ? 2.460   -2.489  16.624 1.00 22.57 ? 263 ILE B CA    1 
ATOM   2130 C  C     . ILE B 1 101 ? 1.015   -2.189  16.275 1.00 23.39 ? 263 ILE B C     1 
ATOM   2131 O  O     . ILE B 1 101 ? 0.295   -3.072  15.812 1.00 22.45 ? 263 ILE B O     1 
ATOM   2132 C  CB    . ILE B 1 101 ? 3.206   -2.881  15.316 1.00 22.83 ? 263 ILE B CB    1 
ATOM   2133 C  CG1   . ILE B 1 101 ? 4.694   -3.096  15.584 1.00 23.56 ? 263 ILE B CG1   1 
ATOM   2134 C  CG2   . ILE B 1 101 ? 3.038   -1.792  14.253 1.00 23.60 ? 263 ILE B CG2   1 
ATOM   2135 C  CD1   . ILE B 1 101 ? 5.021   -4.524  16.016 1.00 25.57 ? 263 ILE B CD1   1 
ATOM   2136 N  N     . GLY B 1 102 ? 0.618   -0.931  16.498 1.00 24.85 ? 264 GLY B N     1 
ATOM   2137 C  CA    . GLY B 1 102 ? -0.772  -0.489  16.389 1.00 26.32 ? 264 GLY B CA    1 
ATOM   2138 C  C     . GLY B 1 102 ? -0.939  0.682   15.441 1.00 28.12 ? 264 GLY B C     1 
ATOM   2139 O  O     . GLY B 1 102 ? 0.006   1.398   15.177 1.00 28.52 ? 264 GLY B O     1 
ATOM   2140 N  N     . GLY B 1 103 ? -2.150  0.869   14.927 1.00 29.74 ? 265 GLY B N     1 
ATOM   2141 C  CA    . GLY B 1 103 ? -2.444  1.974   14.015 1.00 32.55 ? 265 GLY B CA    1 
ATOM   2142 C  C     . GLY B 1 103 ? -1.890  1.779   12.612 1.00 32.67 ? 265 GLY B C     1 
ATOM   2143 O  O     . GLY B 1 103 ? -1.550  2.744   11.931 1.00 34.81 ? 265 GLY B O     1 
ATOM   2144 N  N     . LEU B 1 104 ? -1.777  0.527   12.183 1.00 30.90 ? 266 LEU B N     1 
ATOM   2145 C  CA    . LEU B 1 104 ? -1.429  0.219   10.803 1.00 31.24 ? 266 LEU B CA    1 
ATOM   2146 C  C     . LEU B 1 104 ? -2.634  0.462   9.910  1.00 33.95 ? 266 LEU B C     1 
ATOM   2147 O  O     . LEU B 1 104 ? -3.772  0.235   10.340 1.00 34.81 ? 266 LEU B O     1 
ATOM   2148 C  CB    . LEU B 1 104 ? -1.039  -1.246  10.672 1.00 28.93 ? 266 LEU B CB    1 
ATOM   2149 C  CG    . LEU B 1 104 ? 0.192   -1.665  11.459 1.00 26.50 ? 266 LEU B CG    1 
ATOM   2150 C  CD1   . LEU B 1 104 ? 0.303   -3.171  11.461 1.00 22.78 ? 266 LEU B CD1   1 
ATOM   2151 C  CD2   . LEU B 1 104 ? 1.451   -0.980  10.886 1.00 25.60 ? 266 LEU B CD2   1 
ATOM   2152 N  N     . PRO B 1 105 ? -2.400  0.942   8.675  1.00 36.38 ? 267 PRO B N     1 
ATOM   2153 C  CA    . PRO B 1 105 ? -3.425  0.929   7.624  1.00 38.82 ? 267 PRO B CA    1 
ATOM   2154 C  C     . PRO B 1 105 ? -3.951  -0.487  7.335  1.00 37.86 ? 267 PRO B C     1 
ATOM   2155 O  O     . PRO B 1 105 ? -3.157  -1.430  7.205  1.00 35.78 ? 267 PRO B O     1 
ATOM   2156 C  CB    . PRO B 1 105 ? -2.682  1.476   6.405  1.00 41.05 ? 267 PRO B CB    1 
ATOM   2157 C  CG    . PRO B 1 105 ? -1.580  2.281   6.958  1.00 40.73 ? 267 PRO B CG    1 
ATOM   2158 C  CD    . PRO B 1 105 ? -1.154  1.580   8.209  1.00 37.16 ? 267 PRO B CD    1 
ATOM   2159 N  N     . ASN B 1 106 ? -5.277  -0.616  7.235  1.00 39.53 ? 268 ASN B N     1 
ATOM   2160 C  CA    . ASN B 1 106 ? -5.948  -1.922  7.141  1.00 38.96 ? 268 ASN B CA    1 
ATOM   2161 C  C     . ASN B 1 106 ? -5.676  -2.712  5.847  1.00 39.59 ? 268 ASN B C     1 
ATOM   2162 O  O     . ASN B 1 106 ? -5.865  -3.926  5.799  1.00 38.86 ? 268 ASN B O     1 
ATOM   2163 C  CB    . ASN B 1 106 ? -7.475  -1.769  7.362  1.00 41.59 ? 268 ASN B CB    1 
ATOM   2164 C  CG    . ASN B 1 106 ? -8.144  -0.793  6.378  1.00 47.20 ? 268 ASN B CG    1 
ATOM   2165 O  OD1   . ASN B 1 106 ? -7.796  -0.705  5.182  1.00 49.52 ? 268 ASN B OD1   1 
ATOM   2166 N  ND2   . ASN B 1 106 ? -9.129  -0.063  6.885  1.00 51.39 ? 268 ASN B ND2   1 
ATOM   2167 N  N     . TYR B 1 107 ? -5.245  -2.024  4.801  1.00 41.19 ? 269 TYR B N     1 
ATOM   2168 C  CA    . TYR B 1 107 ? -4.944  -2.684  3.537  1.00 42.67 ? 269 TYR B CA    1 
ATOM   2169 C  C     . TYR B 1 107 ? -3.576  -3.381  3.478  1.00 40.63 ? 269 TYR B C     1 
ATOM   2170 O  O     . TYR B 1 107 ? -3.313  -4.122  2.529  1.00 42.47 ? 269 TYR B O     1 
ATOM   2171 C  CB    . TYR B 1 107 ? -5.054  -1.687  2.387  1.00 46.51 ? 269 TYR B CB    1 
ATOM   2172 C  CG    . TYR B 1 107 ? -4.187  -0.462  2.525  1.00 46.63 ? 269 TYR B CG    1 
ATOM   2173 C  CD1   . TYR B 1 107 ? -2.830  -0.518  2.238  1.00 46.54 ? 269 TYR B CD1   1 
ATOM   2174 C  CD2   . TYR B 1 107 ? -4.725  0.757   2.917  1.00 48.03 ? 269 TYR B CD2   1 
ATOM   2175 C  CE1   . TYR B 1 107 ? -2.026  0.601   2.353  1.00 47.44 ? 269 TYR B CE1   1 
ATOM   2176 C  CE2   . TYR B 1 107 ? -3.931  1.883   3.033  1.00 49.53 ? 269 TYR B CE2   1 
ATOM   2177 C  CZ    . TYR B 1 107 ? -2.580  1.796   2.745  1.00 48.99 ? 269 TYR B CZ    1 
ATOM   2178 O  OH    . TYR B 1 107 ? -1.772  2.897   2.831  1.00 50.10 ? 269 TYR B OH    1 
ATOM   2179 N  N     . LEU B 1 108 ? -2.708  -3.138  4.457  1.00 37.31 ? 270 LEU B N     1 
ATOM   2180 C  CA    . LEU B 1 108 ? -1.354  -3.684  4.430  1.00 36.42 ? 270 LEU B CA    1 
ATOM   2181 C  C     . LEU B 1 108 ? -1.277  -5.161  4.837  1.00 34.87 ? 270 LEU B C     1 
ATOM   2182 O  O     . LEU B 1 108 ? -1.802  -5.539  5.889  1.00 32.86 ? 270 LEU B O     1 
ATOM   2183 C  CB    . LEU B 1 108 ? -0.430  -2.872  5.342  1.00 34.43 ? 270 LEU B CB    1 
ATOM   2184 C  CG    . LEU B 1 108 ? -0.091  -1.450  4.900  1.00 36.54 ? 270 LEU B CG    1 
ATOM   2185 C  CD1   . LEU B 1 108 ? 0.884   -0.856  5.882  1.00 34.21 ? 270 LEU B CD1   1 
ATOM   2186 C  CD2   . LEU B 1 108 ? 0.487   -1.409  3.487  1.00 38.31 ? 270 LEU B CD2   1 
ATOM   2187 N  N     . ASN B 1 109 ? -0.592  -5.974  4.018  1.00 36.31 ? 271 ASN B N     1 
ATOM   2188 C  CA    . ASN B 1 109 ? -0.422  -7.415  4.280  1.00 35.73 ? 271 ASN B CA    1 
ATOM   2189 C  C     . ASN B 1 109 ? 0.805   -7.731  5.155  1.00 33.84 ? 271 ASN B C     1 
ATOM   2190 O  O     . ASN B 1 109 ? 1.584   -6.834  5.483  1.00 32.64 ? 271 ASN B O     1 
ATOM   2191 C  CB    . ASN B 1 109 ? -0.370  -8.212  2.963  1.00 38.71 ? 271 ASN B CB    1 
ATOM   2192 C  CG    . ASN B 1 109 ? 0.984   -8.115  2.246  1.00 40.08 ? 271 ASN B CG    1 
ATOM   2193 O  OD1   . ASN B 1 109 ? 2.036   -8.000  2.863  1.00 37.60 ? 271 ASN B OD1   1 
ATOM   2194 N  ND2   . ASN B 1 109 ? 0.948   -8.179  0.931  1.00 44.65 ? 271 ASN B ND2   1 
ATOM   2195 N  N     . ASP B 1 110 ? 0.950   -9.018  5.500  1.00 34.13 ? 272 ASP B N     1 
ATOM   2196 C  CA    . ASP B 1 110 ? 2.031   -9.546  6.349  1.00 33.34 ? 272 ASP B CA    1 
ATOM   2197 C  C     . ASP B 1 110 ? 3.438   -9.105  5.925  1.00 34.16 ? 272 ASP B C     1 
ATOM   2198 O  O     . ASP B 1 110 ? 4.179   -8.531  6.725  1.00 32.36 ? 272 ASP B O     1 
ATOM   2199 C  CB    . ASP B 1 110 ? 1.994   -11.083 6.376  1.00 35.28 ? 272 ASP B CB    1 
ATOM   2200 C  CG    . ASP B 1 110 ? 1.049   -11.654 7.443  1.00 37.25 ? 272 ASP B CG    1 
ATOM   2201 O  OD1   . ASP B 1 110 ? -0.164  -11.775 7.174  1.00 41.24 ? 272 ASP B OD1   1 
ATOM   2202 O  OD2   . ASP B 1 110 ? 1.526   -12.033 8.545  1.00 41.01 ? 272 ASP B OD2   1 
ATOM   2203 N  N     . ASP B 1 111 ? 3.808   -9.398  4.681  1.00 37.14 ? 273 ASP B N     1 
ATOM   2204 C  CA    . ASP B 1 111 ? 5.145   -9.082  4.168  1.00 39.06 ? 273 ASP B CA    1 
ATOM   2205 C  C     . ASP B 1 111 ? 5.462   -7.585  4.139  1.00 38.50 ? 273 ASP B C     1 
ATOM   2206 O  O     . ASP B 1 111 ? 6.601   -7.182  4.354  1.00 38.85 ? 273 ASP B O     1 
ATOM   2207 C  CB    . ASP B 1 111 ? 5.299   -9.627  2.745  1.00 43.73 ? 273 ASP B CB    1 
ATOM   2208 C  CG    . ASP B 1 111 ? 5.575   -11.120 2.707  1.00 47.09 ? 273 ASP B CG    1 
ATOM   2209 O  OD1   . ASP B 1 111 ? 6.172   -11.663 3.665  1.00 48.07 ? 273 ASP B OD1   1 
ATOM   2210 O  OD2   . ASP B 1 111 ? 5.212   -11.750 1.689  1.00 53.16 ? 273 ASP B OD2   1 
ATOM   2211 N  N     . GLN B 1 112 ? 4.457   -6.772  3.828  1.00 38.26 ? 274 GLN B N     1 
ATOM   2212 C  CA    . GLN B 1 112 ? 4.608   -5.326  3.779  1.00 38.35 ? 274 GLN B CA    1 
ATOM   2213 C  C     . GLN B 1 112 ? 4.950   -4.784  5.157  1.00 35.80 ? 274 GLN B C     1 
ATOM   2214 O  O     . GLN B 1 112 ? 5.897   -4.003  5.308  1.00 36.26 ? 274 GLN B O     1 
ATOM   2215 C  CB    . GLN B 1 112 ? 3.336   -4.674  3.220  1.00 38.90 ? 274 GLN B CB    1 
ATOM   2216 C  CG    . GLN B 1 112 ? 3.232   -4.826  1.702  1.00 42.65 ? 274 GLN B CG    1 
ATOM   2217 C  CD    . GLN B 1 112 ? 1.868   -4.495  1.118  1.00 43.80 ? 274 GLN B CD    1 
ATOM   2218 O  OE1   . GLN B 1 112 ? 0.857   -4.435  1.824  1.00 41.50 ? 274 GLN B OE1   1 
ATOM   2219 N  NE2   . GLN B 1 112 ? 1.834   -4.298  -0.190 1.00 45.76 ? 274 GLN B NE2   1 
ATOM   2220 N  N     . VAL B 1 113 ? 4.186   -5.210  6.161  1.00 33.40 ? 275 VAL B N     1 
ATOM   2221 C  CA    . VAL B 1 113 ? 4.451   -4.828  7.546  1.00 31.40 ? 275 VAL B CA    1 
ATOM   2222 C  C     . VAL B 1 113 ? 5.840   -5.325  7.990  1.00 31.94 ? 275 VAL B C     1 
ATOM   2223 O  O     . VAL B 1 113 ? 6.636   -4.538  8.535  1.00 31.79 ? 275 VAL B O     1 
ATOM   2224 C  CB    . VAL B 1 113 ? 3.359   -5.367  8.514  1.00 29.48 ? 275 VAL B CB    1 
ATOM   2225 C  CG1   . VAL B 1 113 ? 3.639   -4.906  9.929  1.00 26.64 ? 275 VAL B CG1   1 
ATOM   2226 C  CG2   . VAL B 1 113 ? 1.954   -4.917  8.062  1.00 28.77 ? 275 VAL B CG2   1 
ATOM   2227 N  N     . LYS B 1 114 ? 6.140   -6.608  7.725  1.00 32.92 ? 276 LYS B N     1 
ATOM   2228 C  CA    . LYS B 1 114 ? 7.472   -7.181  8.016  1.00 34.05 ? 276 LYS B CA    1 
ATOM   2229 C  C     . LYS B 1 114 ? 8.589   -6.304  7.446  1.00 36.40 ? 276 LYS B C     1 
ATOM   2230 O  O     . LYS B 1 114 ? 9.630   -6.107  8.080  1.00 37.03 ? 276 LYS B O     1 
ATOM   2231 C  CB    . LYS B 1 114 ? 7.617   -8.594  7.444  1.00 35.81 ? 276 LYS B CB    1 
ATOM   2232 C  CG    . LYS B 1 114 ? 6.943   -9.709  8.262  1.00 36.13 ? 276 LYS B CG    1 
ATOM   2233 C  CD    . LYS B 1 114 ? 7.020   -11.089 7.545  1.00 38.45 ? 276 LYS B CD    1 
ATOM   2234 C  CE    . LYS B 1 114 ? 8.367   -11.756 7.820  1.00 42.60 ? 276 LYS B CE    1 
ATOM   2235 N  NZ    . LYS B 1 114 ? 8.747   -12.885 6.866  1.00 46.60 ? 276 LYS B NZ    1 
ATOM   2236 N  N     . GLU B 1 115 ? 8.351   -5.776  6.249  1.00 38.58 ? 277 GLU B N     1 
ATOM   2237 C  CA    . GLU B 1 115 ? 9.328   -4.967  5.529  1.00 41.59 ? 277 GLU B CA    1 
ATOM   2238 C  C     . GLU B 1 115 ? 9.579   -3.630  6.225  1.00 40.74 ? 277 GLU B C     1 
ATOM   2239 O  O     . GLU B 1 115 ? 10.686  -3.114  6.201  1.00 43.03 ? 277 GLU B O     1 
ATOM   2240 C  CB    . GLU B 1 115 ? 8.842   -4.754  4.099  1.00 44.24 ? 277 GLU B CB    1 
ATOM   2241 C  CG    . GLU B 1 115 ? 9.845   -4.124  3.187  1.00 48.77 ? 277 GLU B CG    1 
ATOM   2242 C  CD    . GLU B 1 115 ? 9.510   -4.347  1.719  1.00 53.11 ? 277 GLU B CD    1 
ATOM   2243 O  OE1   . GLU B 1 115 ? 8.406   -4.868  1.417  1.00 53.34 ? 277 GLU B OE1   1 
ATOM   2244 O  OE2   . GLU B 1 115 ? 10.358  -4.009  0.868  1.00 57.31 ? 277 GLU B OE2   1 
ATOM   2245 N  N     . LEU B 1 116 ? 8.545   -3.085  6.857  1.00 38.40 ? 278 LEU B N     1 
ATOM   2246 C  CA    . LEU B 1 116 ? 8.689   -1.904  7.706  1.00 37.59 ? 278 LEU B CA    1 
ATOM   2247 C  C     . LEU B 1 116 ? 9.536   -2.222  8.941  1.00 35.86 ? 278 LEU B C     1 
ATOM   2248 O  O     . LEU B 1 116 ? 10.423  -1.451  9.299  1.00 37.15 ? 278 LEU B O     1 
ATOM   2249 C  CB    . LEU B 1 116 ? 7.312   -1.389  8.153  1.00 35.85 ? 278 LEU B CB    1 
ATOM   2250 C  CG    . LEU B 1 116 ? 7.229   0.047   8.688  1.00 36.57 ? 278 LEU B CG    1 
ATOM   2251 C  CD1   . LEU B 1 116 ? 7.426   1.060   7.560  1.00 40.34 ? 278 LEU B CD1   1 
ATOM   2252 C  CD2   . LEU B 1 116 ? 5.895   0.275   9.370  1.00 34.74 ? 278 LEU B CD2   1 
ATOM   2253 N  N     . LEU B 1 117 ? 9.266   -3.353  9.589  1.00 33.41 ? 279 LEU B N     1 
ATOM   2254 C  CA    . LEU B 1 117 ? 9.991   -3.708  10.819 1.00 32.24 ? 279 LEU B CA    1 
ATOM   2255 C  C     . LEU B 1 117 ? 11.456  -4.084  10.569 1.00 34.42 ? 279 LEU B C     1 
ATOM   2256 O  O     . LEU B 1 117 ? 12.331  -3.656  11.327 1.00 34.73 ? 279 LEU B O     1 
ATOM   2257 C  CB    . LEU B 1 117 ? 9.285   -4.841  11.573 1.00 30.10 ? 279 LEU B CB    1 
ATOM   2258 C  CG    . LEU B 1 117 ? 7.899   -4.531  12.148 1.00 28.71 ? 279 LEU B CG    1 
ATOM   2259 C  CD1   . LEU B 1 117 ? 7.220   -5.804  12.621 1.00 28.76 ? 279 LEU B CD1   1 
ATOM   2260 C  CD2   . LEU B 1 117 ? 7.964   -3.531  13.290 1.00 27.98 ? 279 LEU B CD2   1 
ATOM   2261 N  N     . THR B 1 118 ? 11.722  -4.854  9.508  1.00 36.02 ? 280 THR B N     1 
ATOM   2262 C  CA    . THR B 1 118 ? 13.057  -5.432  9.286  1.00 39.01 ? 280 THR B CA    1 
ATOM   2263 C  C     . THR B 1 118 ? 14.150  -4.445  8.870  1.00 42.15 ? 280 THR B C     1 
ATOM   2264 O  O     . THR B 1 118 ? 15.322  -4.832  8.772  1.00 44.87 ? 280 THR B O     1 
ATOM   2265 C  CB    . THR B 1 118 ? 13.042  -6.584  8.241  1.00 41.05 ? 280 THR B CB    1 
ATOM   2266 O  OG1   . THR B 1 118 ? 12.574  -6.097  6.978  1.00 42.63 ? 280 THR B OG1   1 
ATOM   2267 C  CG2   . THR B 1 118 ? 12.151  -7.735  8.711  1.00 39.44 ? 280 THR B CG2   1 
ATOM   2268 N  N     . SER B 1 119 ? 13.798  -3.186  8.622  1.00 42.36 ? 281 SER B N     1 
ATOM   2269 C  CA    . SER B 1 119 ? 14.831  -2.166  8.374  1.00 46.19 ? 281 SER B CA    1 
ATOM   2270 C  C     . SER B 1 119 ? 15.800  -1.977  9.572  1.00 46.27 ? 281 SER B C     1 
ATOM   2271 O  O     . SER B 1 119 ? 16.943  -1.572  9.387  1.00 49.78 ? 281 SER B O     1 
ATOM   2272 C  CB    . SER B 1 119 ? 14.194  -0.825  7.966  1.00 46.96 ? 281 SER B CB    1 
ATOM   2273 O  OG    . SER B 1 119 ? 13.482  -0.223  9.036  1.00 44.52 ? 281 SER B OG    1 
ATOM   2274 N  N     . PHE B 1 120 ? 15.335  -2.281  10.783 1.00 42.99 ? 282 PHE B N     1 
ATOM   2275 C  CA    . PHE B 1 120 ? 16.165  -2.245  11.994 1.00 43.12 ? 282 PHE B CA    1 
ATOM   2276 C  C     . PHE B 1 120 ? 16.846  -3.576  12.296 1.00 43.75 ? 282 PHE B C     1 
ATOM   2277 O  O     . PHE B 1 120 ? 17.636  -3.665  13.235 1.00 44.88 ? 282 PHE B O     1 
ATOM   2278 C  CB    . PHE B 1 120 ? 15.304  -1.843  13.190 1.00 40.19 ? 282 PHE B CB    1 
ATOM   2279 C  CG    . PHE B 1 120 ? 14.711  -0.485  13.050 1.00 40.90 ? 282 PHE B CG    1 
ATOM   2280 C  CD1   . PHE B 1 120 ? 13.475  -0.316  12.434 1.00 39.24 ? 282 PHE B CD1   1 
ATOM   2281 C  CD2   . PHE B 1 120 ? 15.422  0.642   13.479 1.00 43.95 ? 282 PHE B CD2   1 
ATOM   2282 C  CE1   . PHE B 1 120 ? 12.926  0.947   12.275 1.00 40.23 ? 282 PHE B CE1   1 
ATOM   2283 C  CE2   . PHE B 1 120 ? 14.892  1.920   13.331 1.00 44.43 ? 282 PHE B CE2   1 
ATOM   2284 C  CZ    . PHE B 1 120 ? 13.637  2.079   12.726 1.00 43.53 ? 282 PHE B CZ    1 
ATOM   2285 N  N     . GLY B 1 121 ? 16.527  -4.614  11.522 1.00 43.62 ? 283 GLY B N     1 
ATOM   2286 C  CA    . GLY B 1 121 ? 17.189  -5.918  11.650 1.00 44.81 ? 283 GLY B CA    1 
ATOM   2287 C  C     . GLY B 1 121 ? 16.224  -7.089  11.539 1.00 42.49 ? 283 GLY B C     1 
ATOM   2288 O  O     . GLY B 1 121 ? 15.013  -6.892  11.469 1.00 39.24 ? 283 GLY B O     1 
ATOM   2289 N  N     . PRO B 1 122 ? 16.760  -8.322  11.541 1.00 44.26 ? 284 PRO B N     1 
ATOM   2290 C  CA    . PRO B 1 122 ? 15.963  -9.549  11.383 1.00 43.56 ? 284 PRO B CA    1 
ATOM   2291 C  C     . PRO B 1 122 ? 15.053  -9.903  12.566 1.00 39.97 ? 284 PRO B C     1 
ATOM   2292 O  O     . PRO B 1 122 ? 15.384  -9.611  13.708 1.00 39.26 ? 284 PRO B O     1 
ATOM   2293 C  CB    . PRO B 1 122 ? 17.022  -10.643 11.210 1.00 47.68 ? 284 PRO B CB    1 
ATOM   2294 C  CG    . PRO B 1 122 ? 18.328  -9.943  11.095 1.00 50.90 ? 284 PRO B CG    1 
ATOM   2295 C  CD    . PRO B 1 122 ? 18.190  -8.614  11.704 1.00 48.10 ? 284 PRO B CD    1 
ATOM   2296 N  N     . LEU B 1 123 ? 13.937  -10.566 12.281 1.00 38.60 ? 285 LEU B N     1 
ATOM   2297 C  CA    . LEU B 1 123 ? 12.963  -10.954 13.306 1.00 36.01 ? 285 LEU B CA    1 
ATOM   2298 C  C     . LEU B 1 123 ? 13.039  -12.437 13.624 1.00 37.62 ? 285 LEU B C     1 
ATOM   2299 O  O     . LEU B 1 123 ? 13.282  -13.239 12.731 1.00 40.46 ? 285 LEU B O     1 
ATOM   2300 C  CB    . LEU B 1 123 ? 11.545  -10.652 12.820 1.00 33.76 ? 285 LEU B CB    1 
ATOM   2301 C  CG    . LEU B 1 123 ? 11.264  -9.206  12.417 1.00 32.88 ? 285 LEU B CG    1 
ATOM   2302 C  CD1   . LEU B 1 123 ? 10.052  -9.144  11.497 1.00 31.10 ? 285 LEU B CD1   1 
ATOM   2303 C  CD2   . LEU B 1 123 ? 11.072  -8.370  13.663 1.00 30.37 ? 285 LEU B CD2   1 
ATOM   2304 N  N     . LYS B 1 124 ? 12.812  -12.804 14.885 1.00 36.72 ? 286 LYS B N     1 
ATOM   2305 C  CA    . LYS B 1 124 ? 12.642  -14.215 15.239 1.00 38.74 ? 286 LYS B CA    1 
ATOM   2306 C  C     . LYS B 1 124 ? 11.158  -14.602 15.230 1.00 36.55 ? 286 LYS B C     1 
ATOM   2307 O  O     . LYS B 1 124 ? 10.824  -15.745 14.910 1.00 38.80 ? 286 LYS B O     1 
ATOM   2308 C  CB    . LYS B 1 124 ? 13.337  -14.572 16.562 1.00 40.01 ? 286 LYS B CB    1 
ATOM   2309 C  CG    . LYS B 1 124 ? 12.710  -14.004 17.823 1.00 38.83 ? 286 LYS B CG    1 
ATOM   2310 C  CD    . LYS B 1 124 ? 13.431  -14.517 19.091 1.00 41.20 ? 286 LYS B CD    1 
ATOM   2311 C  CE    . LYS B 1 124 ? 14.521  -13.537 19.583 1.00 43.08 ? 286 LYS B CE    1 
ATOM   2312 N  NZ    . LYS B 1 124 ? 15.430  -14.063 20.653 1.00 45.89 ? 286 LYS B NZ    1 
ATOM   2313 N  N     . ALA B 1 125 ? 10.273  -13.647 15.523 1.00 32.65 ? 287 ALA B N     1 
ATOM   2314 C  CA    . ALA B 1 125 ? 8.816   -13.913 15.556 1.00 30.89 ? 287 ALA B CA    1 
ATOM   2315 C  C     . ALA B 1 125 ? 7.990   -12.749 14.996 1.00 27.51 ? 287 ALA B C     1 
ATOM   2316 O  O     . ALA B 1 125 ? 8.285   -11.584 15.254 1.00 25.26 ? 287 ALA B O     1 
ATOM   2317 C  CB    . ALA B 1 125 ? 8.358   -14.252 17.009 1.00 29.71 ? 287 ALA B CB    1 
ATOM   2318 N  N     . PHE B 1 126 ? 6.944   -13.076 14.244 1.00 27.60 ? 288 PHE B N     1 
ATOM   2319 C  CA    . PHE B 1 126 ? 6.017   -12.060 13.731 1.00 25.70 ? 288 PHE B CA    1 
ATOM   2320 C  C     . PHE B 1 126 ? 4.622   -12.630 13.424 1.00 25.65 ? 288 PHE B C     1 
ATOM   2321 O  O     . PHE B 1 126 ? 4.517   -13.697 12.835 1.00 27.48 ? 288 PHE B O     1 
ATOM   2322 C  CB    . PHE B 1 126 ? 6.576   -11.411 12.462 1.00 26.15 ? 288 PHE B CB    1 
ATOM   2323 C  CG    . PHE B 1 126 ? 5.597   -10.497 11.794 1.00 25.70 ? 288 PHE B CG    1 
ATOM   2324 C  CD1   . PHE B 1 126 ? 5.517   -9.156  12.162 1.00 24.00 ? 288 PHE B CD1   1 
ATOM   2325 C  CD2   . PHE B 1 126 ? 4.702   -10.987 10.846 1.00 26.31 ? 288 PHE B CD2   1 
ATOM   2326 C  CE1   . PHE B 1 126 ? 4.590   -8.306  11.567 1.00 22.98 ? 288 PHE B CE1   1 
ATOM   2327 C  CE2   . PHE B 1 126 ? 3.766   -10.141 10.254 1.00 25.96 ? 288 PHE B CE2   1 
ATOM   2328 C  CZ    . PHE B 1 126 ? 3.722   -8.796  10.609 1.00 24.34 ? 288 PHE B CZ    1 
ATOM   2329 N  N     . ASN B 1 127 ? 3.571   -11.908 13.828 1.00 23.85 ? 289 ASN B N     1 
ATOM   2330 C  CA    . ASN B 1 127 ? 2.193   -12.207 13.421 1.00 24.36 ? 289 ASN B CA    1 
ATOM   2331 C  C     . ASN B 1 127 ? 1.358   -10.935 13.232 1.00 23.12 ? 289 ASN B C     1 
ATOM   2332 O  O     . ASN B 1 127 ? 1.450   -10.004 14.028 1.00 22.34 ? 289 ASN B O     1 
ATOM   2333 C  CB    . ASN B 1 127 ? 1.510   -13.201 14.376 1.00 24.77 ? 289 ASN B CB    1 
ATOM   2334 C  CG    . ASN B 1 127 ? 1.154   -12.596 15.731 1.00 25.20 ? 289 ASN B CG    1 
ATOM   2335 O  OD1   . ASN B 1 127 ? 2.039   -12.207 16.508 1.00 23.89 ? 289 ASN B OD1   1 
ATOM   2336 N  ND2   . ASN B 1 127 ? -0.153  -12.547 16.040 1.00 24.92 ? 289 ASN B ND2   1 
ATOM   2337 N  N     . LEU B 1 128 ? 0.589   -10.873 12.145 1.00 24.10 ? 290 LEU B N     1 
ATOM   2338 C  CA    . LEU B 1 128 ? -0.385  -9.796  11.936 1.00 23.78 ? 290 LEU B CA    1 
ATOM   2339 C  C     . LEU B 1 128 ? -1.776  -10.326 12.240 1.00 24.96 ? 290 LEU B C     1 
ATOM   2340 O  O     . LEU B 1 128 ? -2.141  -11.410 11.792 1.00 26.79 ? 290 LEU B O     1 
ATOM   2341 C  CB    . LEU B 1 128 ? -0.319  -9.267  10.506 1.00 24.66 ? 290 LEU B CB    1 
ATOM   2342 C  CG    . LEU B 1 128 ? -1.385  -8.267  10.039 1.00 25.22 ? 290 LEU B CG    1 
ATOM   2343 C  CD1   . LEU B 1 128 ? -1.333  -6.961  10.816 1.00 24.14 ? 290 LEU B CD1   1 
ATOM   2344 C  CD2   . LEU B 1 128 ? -1.231  -8.011  8.523  1.00 27.77 ? 290 LEU B CD2   1 
ATOM   2345 N  N     . VAL B 1 129 ? -2.550  -9.571  13.015 1.00 24.92 ? 291 VAL B N     1 
ATOM   2346 C  CA    . VAL B 1 129 ? -3.879  -10.024 13.441 1.00 26.60 ? 291 VAL B CA    1 
ATOM   2347 C  C     . VAL B 1 129 ? -4.974  -9.696  12.413 1.00 28.62 ? 291 VAL B C     1 
ATOM   2348 O  O     . VAL B 1 129 ? -5.105  -8.557  11.963 1.00 28.01 ? 291 VAL B O     1 
ATOM   2349 C  CB    . VAL B 1 129 ? -4.247  -9.459  14.822 1.00 26.24 ? 291 VAL B CB    1 
ATOM   2350 C  CG1   . VAL B 1 129 ? -5.602  -9.999  15.272 1.00 28.06 ? 291 VAL B CG1   1 
ATOM   2351 C  CG2   . VAL B 1 129 ? -3.159  -9.806  15.840 1.00 23.73 ? 291 VAL B CG2   1 
ATOM   2352 N  N     . LYS B 1 130 ? -5.756  -10.719 12.066 1.00 31.45 ? 292 LYS B N     1 
ATOM   2353 C  CA    . LYS B 1 130 ? -6.755  -10.653 11.006 1.00 34.40 ? 292 LYS B CA    1 
ATOM   2354 C  C     . LYS B 1 130 ? -8.106  -11.181 11.478 1.00 37.13 ? 292 LYS B C     1 
ATOM   2355 O  O     . LYS B 1 130 ? -8.175  -11.887 12.483 1.00 37.32 ? 292 LYS B O     1 
ATOM   2356 C  CB    . LYS B 1 130 ? -6.302  -11.526 9.845  1.00 35.79 ? 292 LYS B CB    1 
ATOM   2357 C  CG    . LYS B 1 130 ? -4.937  -11.174 9.298  1.00 35.39 ? 292 LYS B CG    1 
ATOM   2358 C  CD    . LYS B 1 130 ? -4.279  -12.380 8.653  1.00 36.85 ? 292 LYS B CD    1 
ATOM   2359 C  CE    . LYS B 1 130 ? -2.800  -12.115 8.386  1.00 37.03 ? 292 LYS B CE    1 
ATOM   2360 N  NZ    . LYS B 1 130 ? -1.970  -13.348 8.513  1.00 38.77 ? 292 LYS B NZ    1 
ATOM   2361 N  N     . ASP B 1 131 ? -9.178  -10.848 10.751 1.00 40.14 ? 293 ASP B N     1 
ATOM   2362 C  CA    . ASP B 1 131 ? -10.462 -11.532 10.947 1.00 43.49 ? 293 ASP B CA    1 
ATOM   2363 C  C     . ASP B 1 131 ? -10.471 -12.811 10.133 1.00 45.39 ? 293 ASP B C     1 
ATOM   2364 O  O     . ASP B 1 131 ? -10.520 -12.764 8.911  1.00 46.29 ? 293 ASP B O     1 
ATOM   2365 C  CB    . ASP B 1 131 ? -11.673 -10.693 10.534 1.00 46.14 ? 293 ASP B CB    1 
ATOM   2366 C  CG    . ASP B 1 131 ? -12.979 -11.510 10.589 1.00 51.42 ? 293 ASP B CG    1 
ATOM   2367 O  OD1   . ASP B 1 131 ? -13.852 -11.377 9.690  1.00 55.56 ? 293 ASP B OD1   1 
ATOM   2368 O  OD2   . ASP B 1 131 ? -13.109 -12.337 11.524 1.00 54.62 ? 293 ASP B OD2   1 
ATOM   2369 N  N     . SER B 1 132 ? -10.472 -13.948 10.821 1.00 46.67 ? 294 SER B N     1 
ATOM   2370 C  CA    . SER B 1 132 ? -10.497 -15.257 10.160 1.00 49.53 ? 294 SER B CA    1 
ATOM   2371 C  C     . SER B 1 132 ? -11.741 -15.505 9.283  1.00 53.53 ? 294 SER B C     1 
ATOM   2372 O  O     . SER B 1 132 ? -11.682 -16.324 8.364  1.00 55.59 ? 294 SER B O     1 
ATOM   2373 C  CB    . SER B 1 132 ? -10.360 -16.383 11.196 1.00 50.82 ? 294 SER B CB    1 
ATOM   2374 O  OG    . SER B 1 132 ? -11.532 -16.499 11.978 1.00 53.57 ? 294 SER B OG    1 
ATOM   2375 N  N     . ALA B 1 133 ? -12.853 -14.820 9.565  1.00 54.86 ? 295 ALA B N     1 
ATOM   2376 C  CA    . ALA B 1 133 ? -14.053 -14.949 8.721  1.00 59.40 ? 295 ALA B CA    1 
ATOM   2377 C  C     . ALA B 1 133 ? -14.007 -14.089 7.453  1.00 59.27 ? 295 ALA B C     1 
ATOM   2378 O  O     . ALA B 1 133 ? -14.898 -14.209 6.615  1.00 62.98 ? 295 ALA B O     1 
ATOM   2379 C  CB    . ALA B 1 133 ? -15.335 -14.650 9.514  1.00 62.02 ? 295 ALA B CB    1 
ATOM   2380 N  N     . THR B 1 134 ? -13.002 -13.219 7.315  1.00 55.35 ? 296 THR B N     1 
ATOM   2381 C  CA    . THR B 1 134 ? -12.827 -12.437 6.073  1.00 55.63 ? 296 THR B CA    1 
ATOM   2382 C  C     . THR B 1 134 ? -11.389 -12.472 5.524  1.00 53.10 ? 296 THR B C     1 
ATOM   2383 O  O     . THR B 1 134 ? -11.187 -12.539 4.320  1.00 54.93 ? 296 THR B O     1 
ATOM   2384 C  CB    . THR B 1 134 ? -13.289 -10.954 6.238  1.00 55.14 ? 296 THR B CB    1 
ATOM   2385 O  OG1   . THR B 1 134 ? -12.387 -10.238 7.096  1.00 51.00 ? 296 THR B OG1   1 
ATOM   2386 C  CG2   . THR B 1 134 ? -14.712 -10.874 6.804  1.00 58.14 ? 296 THR B CG2   1 
ATOM   2387 N  N     . GLY B 1 135 ? -10.399 -12.432 6.406  1.00 49.59 ? 297 GLY B N     1 
ATOM   2388 C  CA    . GLY B 1 135 ? -8.995  -12.381 6.007  1.00 47.43 ? 297 GLY B CA    1 
ATOM   2389 C  C     . GLY B 1 135 ? -8.401  -10.986 6.128  1.00 44.92 ? 297 GLY B C     1 
ATOM   2390 O  O     . GLY B 1 135 ? -7.260  -10.754 5.710  1.00 43.66 ? 297 GLY B O     1 
ATOM   2391 N  N     . LEU B 1 136 ? -9.169  -10.066 6.717  1.00 44.71 ? 298 LEU B N     1 
ATOM   2392 C  CA    . LEU B 1 136 ? -8.847  -8.641  6.728  1.00 42.89 ? 298 LEU B CA    1 
ATOM   2393 C  C     . LEU B 1 136 ? -8.127  -8.282  8.014  1.00 39.44 ? 298 LEU B C     1 
ATOM   2394 O  O     . LEU B 1 136 ? -8.515  -8.713  9.097  1.00 38.90 ? 298 LEU B O     1 
ATOM   2395 C  CB    . LEU B 1 136 ? -10.129 -7.808  6.564  1.00 45.88 ? 298 LEU B CB    1 
ATOM   2396 C  CG    . LEU B 1 136 ? -10.163 -6.312  6.941  1.00 45.98 ? 298 LEU B CG    1 
ATOM   2397 C  CD1   . LEU B 1 136 ? -8.863  -5.574  6.601  1.00 44.50 ? 298 LEU B CD1   1 
ATOM   2398 C  CD2   . LEU B 1 136 ? -11.376 -5.620  6.257  1.00 50.02 ? 298 LEU B CD2   1 
ATOM   2399 N  N     . SER B 1 137 ? -7.057  -7.508  7.867  1.00 36.99 ? 299 SER B N     1 
ATOM   2400 C  CA    . SER B 1 137 ? -6.266  -7.026  8.975  1.00 33.68 ? 299 SER B CA    1 
ATOM   2401 C  C     . SER B 1 137 ? -7.107  -6.216  9.957  1.00 33.59 ? 299 SER B C     1 
ATOM   2402 O  O     . SER B 1 137 ? -7.894  -5.368  9.551  1.00 35.28 ? 299 SER B O     1 
ATOM   2403 C  CB    . SER B 1 137 ? -5.100  -6.169  8.432  1.00 32.59 ? 299 SER B CB    1 
ATOM   2404 O  OG    . SER B 1 137 ? -4.533  -5.334  9.427  1.00 30.49 ? 299 SER B OG    1 
ATOM   2405 N  N     . LYS B 1 138 ? -6.914  -6.479  11.250 1.00 31.95 ? 300 LYS B N     1 
ATOM   2406 C  CA    . LYS B 1 138 ? -7.504  -5.661  12.317 1.00 32.32 ? 300 LYS B CA    1 
ATOM   2407 C  C     . LYS B 1 138 ? -6.630  -4.438  12.636 1.00 30.84 ? 300 LYS B C     1 
ATOM   2408 O  O     . LYS B 1 138 ? -6.969  -3.628  13.501 1.00 31.29 ? 300 LYS B O     1 
ATOM   2409 C  CB    . LYS B 1 138 ? -7.720  -6.493  13.581 1.00 31.99 ? 300 LYS B CB    1 
ATOM   2410 C  CG    . LYS B 1 138 ? -8.645  -7.686  13.377 1.00 33.65 ? 300 LYS B CG    1 
ATOM   2411 C  CD    . LYS B 1 138 ? -9.070  -8.285  14.707 1.00 34.19 ? 300 LYS B CD    1 
ATOM   2412 C  CE    . LYS B 1 138 ? -9.915  -9.540  14.520 1.00 36.46 ? 300 LYS B CE    1 
ATOM   2413 N  NZ    . LYS B 1 138 ? -10.408 -10.110 15.810 1.00 36.69 ? 300 LYS B NZ    1 
ATOM   2414 N  N     . GLY B 1 139 ? -5.506  -4.307  11.943 1.00 29.09 ? 301 GLY B N     1 
ATOM   2415 C  CA    . GLY B 1 139 ? -4.692  -3.104  12.069 1.00 29.19 ? 301 GLY B CA    1 
ATOM   2416 C  C     . GLY B 1 139 ? -3.606  -3.091  13.136 1.00 26.97 ? 301 GLY B C     1 
ATOM   2417 O  O     . GLY B 1 139 ? -2.961  -2.063  13.335 1.00 26.36 ? 301 GLY B O     1 
ATOM   2418 N  N     . TYR B 1 140 ? -3.391  -4.220  13.811 1.00 26.06 ? 302 TYR B N     1 
ATOM   2419 C  CA    . TYR B 1 140 ? -2.233  -4.365  14.695 1.00 25.15 ? 302 TYR B CA    1 
ATOM   2420 C  C     . TYR B 1 140 ? -1.510  -5.707  14.527 1.00 24.59 ? 302 TYR B C     1 
ATOM   2421 O  O     . TYR B 1 140 ? -2.061  -6.676  13.969 1.00 25.08 ? 302 TYR B O     1 
ATOM   2422 C  CB    . TYR B 1 140 ? -2.615  -4.135  16.162 1.00 25.47 ? 302 TYR B CB    1 
ATOM   2423 C  CG    . TYR B 1 140 ? -3.774  -4.975  16.641 1.00 27.07 ? 302 TYR B CG    1 
ATOM   2424 C  CD1   . TYR B 1 140 ? -3.559  -6.224  17.240 1.00 26.27 ? 302 TYR B CD1   1 
ATOM   2425 C  CD2   . TYR B 1 140 ? -5.089  -4.526  16.504 1.00 29.39 ? 302 TYR B CD2   1 
ATOM   2426 C  CE1   . TYR B 1 140 ? -4.624  -7.008  17.672 1.00 28.19 ? 302 TYR B CE1   1 
ATOM   2427 C  CE2   . TYR B 1 140 ? -6.169  -5.308  16.940 1.00 31.11 ? 302 TYR B CE2   1 
ATOM   2428 C  CZ    . TYR B 1 140 ? -5.927  -6.546  17.519 1.00 30.25 ? 302 TYR B CZ    1 
ATOM   2429 O  OH    . TYR B 1 140 ? -6.978  -7.306  17.965 1.00 32.70 ? 302 TYR B OH    1 
ATOM   2430 N  N     . ALA B 1 141 ? -0.266  -5.733  15.004 1.00 23.64 ? 303 ALA B N     1 
ATOM   2431 C  CA    . ALA B 1 141 ? 0.601   -6.913  14.907 1.00 23.53 ? 303 ALA B CA    1 
ATOM   2432 C  C     . ALA B 1 141 ? 1.540   -7.032  16.112 1.00 22.82 ? 303 ALA B C     1 
ATOM   2433 O  O     . ALA B 1 141 ? 1.642   -6.116  16.916 1.00 22.85 ? 303 ALA B O     1 
ATOM   2434 C  CB    . ALA B 1 141 ? 1.412   -6.859  13.620 1.00 23.23 ? 303 ALA B CB    1 
ATOM   2435 N  N     . PHE B 1 142 ? 2.235   -8.161  16.212 1.00 23.28 ? 304 PHE B N     1 
ATOM   2436 C  CA    . PHE B 1 142 ? 3.264   -8.361  17.232 1.00 23.29 ? 304 PHE B CA    1 
ATOM   2437 C  C     . PHE B 1 142 ? 4.562   -8.900  16.618 1.00 23.91 ? 304 PHE B C     1 
ATOM   2438 O  O     . PHE B 1 142 ? 4.524   -9.626  15.626 1.00 25.09 ? 304 PHE B O     1 
ATOM   2439 C  CB    . PHE B 1 142 ? 2.776   -9.315  18.311 1.00 23.46 ? 304 PHE B CB    1 
ATOM   2440 C  CG    . PHE B 1 142 ? 1.514   -8.879  18.978 1.00 23.98 ? 304 PHE B CG    1 
ATOM   2441 C  CD1   . PHE B 1 142 ? 1.543   -8.269  20.221 1.00 23.55 ? 304 PHE B CD1   1 
ATOM   2442 C  CD2   . PHE B 1 142 ? 0.274   -9.104  18.377 1.00 25.95 ? 304 PHE B CD2   1 
ATOM   2443 C  CE1   . PHE B 1 142 ? 0.354   -7.875  20.866 1.00 24.78 ? 304 PHE B CE1   1 
ATOM   2444 C  CE2   . PHE B 1 142 ? -0.929  -8.703  19.022 1.00 25.98 ? 304 PHE B CE2   1 
ATOM   2445 C  CZ    . PHE B 1 142 ? -0.877  -8.088  20.264 1.00 25.05 ? 304 PHE B CZ    1 
ATOM   2446 N  N     . CYS B 1 143 ? 5.700   -8.549  17.212 1.00 23.89 ? 305 CYS B N     1 
ATOM   2447 C  CA    . CYS B 1 143 ? 6.980   -9.113  16.782 1.00 25.64 ? 305 CYS B CA    1 
ATOM   2448 C  C     . CYS B 1 143 ? 8.054   -9.146  17.879 1.00 26.08 ? 305 CYS B C     1 
ATOM   2449 O  O     . CYS B 1 143 ? 7.923   -8.467  18.904 1.00 25.47 ? 305 CYS B O     1 
ATOM   2450 C  CB    . CYS B 1 143 ? 7.527   -8.326  15.588 1.00 26.26 ? 305 CYS B CB    1 
ATOM   2451 S  SG    . CYS B 1 143 ? 8.265   -6.764  16.052 1.00 28.17 ? 305 CYS B SG    1 
ATOM   2452 N  N     . GLU B 1 144 ? 9.102   -9.941  17.643 1.00 27.39 ? 306 GLU B N     1 
ATOM   2453 C  CA    . GLU B 1 144 ? 10.328  -9.897  18.448 1.00 28.61 ? 306 GLU B CA    1 
ATOM   2454 C  C     . GLU B 1 144 ? 11.565  -10.020 17.544 1.00 29.57 ? 306 GLU B C     1 
ATOM   2455 O  O     . GLU B 1 144 ? 11.611  -10.863 16.663 1.00 30.53 ? 306 GLU B O     1 
ATOM   2456 C  CB    . GLU B 1 144 ? 10.333  -10.990 19.541 1.00 29.81 ? 306 GLU B CB    1 
ATOM   2457 C  CG    . GLU B 1 144 ? 11.506  -10.825 20.544 1.00 32.49 ? 306 GLU B CG    1 
ATOM   2458 C  CD    . GLU B 1 144 ? 11.489  -11.812 21.738 1.00 35.88 ? 306 GLU B CD    1 
ATOM   2459 O  OE1   . GLU B 1 144 ? 10.381  -12.212 22.193 1.00 38.87 ? 306 GLU B OE1   1 
ATOM   2460 O  OE2   . GLU B 1 144 ? 12.602  -12.178 22.233 1.00 41.46 ? 306 GLU B OE2   1 
ATOM   2461 N  N     . TYR B 1 145 ? 12.567  -9.182  17.778 1.00 30.00 ? 307 TYR B N     1 
ATOM   2462 C  CA    . TYR B 1 145 ? 13.788  -9.189  16.963 1.00 32.18 ? 307 TYR B CA    1 
ATOM   2463 C  C     . TYR B 1 145 ? 14.730  -10.294 17.416 1.00 35.11 ? 307 TYR B C     1 
ATOM   2464 O  O     . TYR B 1 145 ? 14.748  -10.657 18.596 1.00 35.36 ? 307 TYR B O     1 
ATOM   2465 C  CB    . TYR B 1 145 ? 14.509  -7.830  17.029 1.00 31.95 ? 307 TYR B CB    1 
ATOM   2466 C  CG    . TYR B 1 145 ? 13.823  -6.741  16.241 1.00 29.46 ? 307 TYR B CG    1 
ATOM   2467 C  CD1   . TYR B 1 145 ? 14.044  -6.591  14.870 1.00 30.79 ? 307 TYR B CD1   1 
ATOM   2468 C  CD2   . TYR B 1 145 ? 12.937  -5.880  16.853 1.00 26.85 ? 307 TYR B CD2   1 
ATOM   2469 C  CE1   . TYR B 1 145 ? 13.398  -5.598  14.131 1.00 29.57 ? 307 TYR B CE1   1 
ATOM   2470 C  CE2   . TYR B 1 145 ? 12.288  -4.879  16.122 1.00 27.13 ? 307 TYR B CE2   1 
ATOM   2471 C  CZ    . TYR B 1 145 ? 12.528  -4.748  14.769 1.00 27.48 ? 307 TYR B CZ    1 
ATOM   2472 O  OH    . TYR B 1 145 ? 11.879  -3.769  14.074 1.00 27.60 ? 307 TYR B OH    1 
ATOM   2473 N  N     . VAL B 1 146 ? 15.506  -10.828 16.469 1.00 38.05 ? 308 VAL B N     1 
ATOM   2474 C  CA    . VAL B 1 146 ? 16.539  -11.817 16.763 1.00 41.39 ? 308 VAL B CA    1 
ATOM   2475 C  C     . VAL B 1 146 ? 17.440  -11.297 17.860 1.00 42.64 ? 308 VAL B C     1 
ATOM   2476 O  O     . VAL B 1 146 ? 17.613  -11.956 18.875 1.00 44.04 ? 308 VAL B O     1 
ATOM   2477 C  CB    . VAL B 1 146 ? 17.407  -12.120 15.539 1.00 44.83 ? 308 VAL B CB    1 
ATOM   2478 C  CG1   . VAL B 1 146 ? 18.686  -12.876 15.958 1.00 49.13 ? 308 VAL B CG1   1 
ATOM   2479 C  CG2   . VAL B 1 146 ? 16.616  -12.912 14.506 1.00 44.33 ? 308 VAL B CG2   1 
ATOM   2480 N  N     . ASP B 1 147 ? 17.999  -10.110 17.651 1.00 43.04 ? 309 ASP B N     1 
ATOM   2481 C  CA    . ASP B 1 147 ? 18.906  -9.486  18.622 1.00 44.96 ? 309 ASP B CA    1 
ATOM   2482 C  C     . ASP B 1 147 ? 18.140  -8.517  19.524 1.00 42.03 ? 309 ASP B C     1 
ATOM   2483 O  O     . ASP B 1 147 ? 17.872  -7.381  19.148 1.00 40.88 ? 309 ASP B O     1 
ATOM   2484 C  CB    . ASP B 1 147 ? 20.034  -8.750  17.886 1.00 47.81 ? 309 ASP B CB    1 
ATOM   2485 C  CG    . ASP B 1 147 ? 21.045  -8.108  18.829 1.00 50.47 ? 309 ASP B CG    1 
ATOM   2486 O  OD1   . ASP B 1 147 ? 22.084  -7.619  18.328 1.00 55.59 ? 309 ASP B OD1   1 
ATOM   2487 O  OD2   . ASP B 1 147 ? 20.824  -8.094  20.063 1.00 50.32 ? 309 ASP B OD2   1 
ATOM   2488 N  N     . ILE B 1 148 ? 17.820  -8.943  20.735 1.00 41.87 ? 310 ILE B N     1 
ATOM   2489 C  CA    . ILE B 1 148 ? 16.952  -8.131  21.591 1.00 39.94 ? 310 ILE B CA    1 
ATOM   2490 C  C     . ILE B 1 148 ? 17.478  -6.732  21.906 1.00 40.62 ? 310 ILE B C     1 
ATOM   2491 O  O     . ILE B 1 148 ? 16.712  -5.871  22.329 1.00 39.12 ? 310 ILE B O     1 
ATOM   2492 C  CB    . ILE B 1 148 ? 16.569  -8.861  22.892 1.00 40.31 ? 310 ILE B CB    1 
ATOM   2493 C  CG1   . ILE B 1 148 ? 17.814  -9.174  23.736 1.00 44.57 ? 310 ILE B CG1   1 
ATOM   2494 C  CG2   . ILE B 1 148 ? 15.730  -10.111 22.545 1.00 40.17 ? 310 ILE B CG2   1 
ATOM   2495 C  CD1   . ILE B 1 148 ? 17.734  -10.487 24.518 1.00 46.19 ? 310 ILE B CD1   1 
ATOM   2496 N  N     . ASN B 1 149 ? 18.763  -6.494  21.671 1.00 44.00 ? 311 ASN B N     1 
ATOM   2497 C  CA    . ASN B 1 149 ? 19.356  -5.165  21.892 1.00 45.62 ? 311 ASN B CA    1 
ATOM   2498 C  C     . ASN B 1 149 ? 18.905  -4.105  20.881 1.00 44.44 ? 311 ASN B C     1 
ATOM   2499 O  O     . ASN B 1 149 ? 19.054  -2.908  21.145 1.00 45.96 ? 311 ASN B O     1 
ATOM   2500 C  CB    . ASN B 1 149 ? 20.887  -5.253  21.892 1.00 50.11 ? 311 ASN B CB    1 
ATOM   2501 C  CG    . ASN B 1 149 ? 21.416  -6.171  22.989 1.00 52.55 ? 311 ASN B CG    1 
ATOM   2502 O  OD1   . ASN B 1 149 ? 21.336  -5.857  24.177 1.00 51.64 ? 311 ASN B OD1   1 
ATOM   2503 N  ND2   . ASN B 1 149 ? 21.952  -7.315  22.590 1.00 55.70 ? 311 ASN B ND2   1 
ATOM   2504 N  N     . VAL B 1 150 ? 18.382  -4.546  19.735 1.00 42.46 ? 312 VAL B N     1 
ATOM   2505 C  CA    . VAL B 1 150 ? 17.852  -3.653  18.694 1.00 41.28 ? 312 VAL B CA    1 
ATOM   2506 C  C     . VAL B 1 150 ? 16.483  -3.057  19.090 1.00 38.19 ? 312 VAL B C     1 
ATOM   2507 O  O     . VAL B 1 150 ? 16.068  -2.023  18.543 1.00 37.97 ? 312 VAL B O     1 
ATOM   2508 C  CB    . VAL B 1 150 ? 17.705  -4.422  17.314 1.00 41.18 ? 312 VAL B CB    1 
ATOM   2509 C  CG1   . VAL B 1 150 ? 16.510  -3.934  16.522 1.00 38.94 ? 312 VAL B CG1   1 
ATOM   2510 C  CG2   . VAL B 1 150 ? 18.963  -4.325  16.484 1.00 44.14 ? 312 VAL B CG2   1 
ATOM   2511 N  N     . THR B 1 151 ? 15.797  -3.713  20.037 1.00 36.05 ? 313 THR B N     1 
ATOM   2512 C  CA    . THR B 1 151 ? 14.394  -3.410  20.389 1.00 33.26 ? 313 THR B CA    1 
ATOM   2513 C  C     . THR B 1 151 ? 14.086  -1.924  20.566 1.00 33.43 ? 313 THR B C     1 
ATOM   2514 O  O     . THR B 1 151 ? 13.145  -1.400  19.966 1.00 31.65 ? 313 THR B O     1 
ATOM   2515 C  CB    . THR B 1 151 ? 13.961  -4.176  21.677 1.00 32.47 ? 313 THR B CB    1 
ATOM   2516 O  OG1   . THR B 1 151 ? 14.011  -5.585  21.424 1.00 32.06 ? 313 THR B OG1   1 
ATOM   2517 C  CG2   . THR B 1 151 ? 12.544  -3.816  22.088 1.00 29.91 ? 313 THR B CG2   1 
ATOM   2518 N  N     . ASP B 1 152 ? 14.899  -1.255  21.374 1.00 35.52 ? 314 ASP B N     1 
ATOM   2519 C  CA    . ASP B 1 152 ? 14.681  0.157   21.711 1.00 36.90 ? 314 ASP B CA    1 
ATOM   2520 C  C     . ASP B 1 152 ? 14.992  1.155   20.593 1.00 38.21 ? 314 ASP B C     1 
ATOM   2521 O  O     . ASP B 1 152 ? 14.321  2.187   20.479 1.00 37.87 ? 314 ASP B O     1 
ATOM   2522 C  CB    . ASP B 1 152 ? 15.461  0.497   22.975 1.00 39.50 ? 314 ASP B CB    1 
ATOM   2523 C  CG    . ASP B 1 152 ? 14.751  0.009   24.208 1.00 38.98 ? 314 ASP B CG    1 
ATOM   2524 O  OD1   . ASP B 1 152 ? 13.760  0.688   24.574 1.00 39.25 ? 314 ASP B OD1   1 
ATOM   2525 O  OD2   . ASP B 1 152 ? 15.157  -1.040  24.777 1.00 37.45 ? 314 ASP B OD2   1 
ATOM   2526 N  N     . GLN B 1 153 ? 16.014  0.835   19.798 1.00 39.77 ? 315 GLN B N     1 
ATOM   2527 C  CA    . GLN B 1 153 ? 16.290  1.493   18.506 1.00 41.47 ? 315 GLN B CA    1 
ATOM   2528 C  C     . GLN B 1 153 ? 15.090  1.453   17.551 1.00 39.08 ? 315 GLN B C     1 
ATOM   2529 O  O     . GLN B 1 153 ? 14.898  2.368   16.763 1.00 40.44 ? 315 GLN B O     1 
ATOM   2530 C  CB    . GLN B 1 153 ? 17.502  0.839   17.800 1.00 43.51 ? 315 GLN B CB    1 
ATOM   2531 C  CG    . GLN B 1 153 ? 18.811  1.644   17.838 1.00 48.72 ? 315 GLN B CG    1 
ATOM   2532 C  CD    . GLN B 1 153 ? 19.867  1.104   18.796 1.00 51.03 ? 315 GLN B CD    1 
ATOM   2533 O  OE1   . GLN B 1 153 ? 20.635  1.864   19.361 1.00 53.66 ? 315 GLN B OE1   1 
ATOM   2534 N  NE2   . GLN B 1 153 ? 19.923  -0.207  18.957 1.00 51.29 ? 315 GLN B NE2   1 
ATOM   2535 N  N     . ALA B 1 154 ? 14.295  0.386   17.609 1.00 36.09 ? 316 ALA B N     1 
ATOM   2536 C  CA    . ALA B 1 154 ? 13.144  0.253   16.718 1.00 34.10 ? 316 ALA B CA    1 
ATOM   2537 C  C     . ALA B 1 154 ? 11.931  1.052   17.216 1.00 32.87 ? 316 ALA B C     1 
ATOM   2538 O  O     . ALA B 1 154 ? 11.201  1.627   16.419 1.00 33.31 ? 316 ALA B O     1 
ATOM   2539 C  CB    . ALA B 1 154 ? 12.790  -1.202  16.541 1.00 32.12 ? 316 ALA B CB    1 
ATOM   2540 N  N     . ILE B 1 155 ? 11.721  1.079   18.526 1.00 31.81 ? 317 ILE B N     1 
ATOM   2541 C  CA    . ILE B 1 155 ? 10.675  1.908   19.136 1.00 31.66 ? 317 ILE B CA    1 
ATOM   2542 C  C     . ILE B 1 155 ? 10.932  3.397   18.885 1.00 34.68 ? 317 ILE B C     1 
ATOM   2543 O  O     . ILE B 1 155 ? 10.022  4.141   18.519 1.00 35.85 ? 317 ILE B O     1 
ATOM   2544 C  CB    . ILE B 1 155 ? 10.611  1.680   20.668 1.00 31.16 ? 317 ILE B CB    1 
ATOM   2545 C  CG1   . ILE B 1 155 ? 10.148  0.257   20.965 1.00 28.56 ? 317 ILE B CG1   1 
ATOM   2546 C  CG2   . ILE B 1 155 ? 9.704   2.710   21.348 1.00 31.92 ? 317 ILE B CG2   1 
ATOM   2547 C  CD1   . ILE B 1 155 ? 10.279  -0.123  22.418 1.00 29.96 ? 317 ILE B CD1   1 
ATOM   2548 N  N     . ALA B 1 156 ? 12.170  3.828   19.113 1.00 36.67 ? 318 ALA B N     1 
ATOM   2549 C  CA    . ALA B 1 156 ? 12.576  5.206   18.872 1.00 39.98 ? 318 ALA B CA    1 
ATOM   2550 C  C     . ALA B 1 156 ? 12.296  5.606   17.424 1.00 40.67 ? 318 ALA B C     1 
ATOM   2551 O  O     . ALA B 1 156 ? 11.761  6.672   17.162 1.00 42.57 ? 318 ALA B O     1 
ATOM   2552 C  CB    . ALA B 1 156 ? 14.042  5.379   19.199 1.00 42.14 ? 318 ALA B CB    1 
ATOM   2553 N  N     . GLY B 1 157 ? 12.632  4.728   16.489 1.00 39.70 ? 319 GLY B N     1 
ATOM   2554 C  CA    . GLY B 1 157 ? 12.426  4.991   15.066 1.00 40.91 ? 319 GLY B CA    1 
ATOM   2555 C  C     . GLY B 1 157 ? 10.994  4.947   14.573 1.00 38.83 ? 319 GLY B C     1 
ATOM   2556 O  O     . GLY B 1 157 ? 10.621  5.740   13.733 1.00 40.49 ? 319 GLY B O     1 
ATOM   2557 N  N     . LEU B 1 158 ? 10.188  4.029   15.094 1.00 35.82 ? 320 LEU B N     1 
ATOM   2558 C  CA    . LEU B 1 158 ? 8.853   3.769   14.530 1.00 34.88 ? 320 LEU B CA    1 
ATOM   2559 C  C     . LEU B 1 158 ? 7.678   4.377   15.300 1.00 35.13 ? 320 LEU B C     1 
ATOM   2560 O  O     . LEU B 1 158 ? 6.663   4.721   14.688 1.00 36.14 ? 320 LEU B O     1 
ATOM   2561 C  CB    . LEU B 1 158 ? 8.620   2.260   14.359 1.00 32.01 ? 320 LEU B CB    1 
ATOM   2562 C  CG    . LEU B 1 158 ? 9.447   1.552   13.269 1.00 33.20 ? 320 LEU B CG    1 
ATOM   2563 C  CD1   . LEU B 1 158 ? 9.119   0.068   13.242 1.00 28.79 ? 320 LEU B CD1   1 
ATOM   2564 C  CD2   . LEU B 1 158 ? 9.270   2.190   11.856 1.00 34.31 ? 320 LEU B CD2   1 
ATOM   2565 N  N     . ASN B 1 159 ? 7.795   4.507   16.621 1.00 34.84 ? 321 ASN B N     1 
ATOM   2566 C  CA    . ASN B 1 159 ? 6.705   5.069   17.409 1.00 35.39 ? 321 ASN B CA    1 
ATOM   2567 C  C     . ASN B 1 159 ? 6.399   6.468   16.912 1.00 39.16 ? 321 ASN B C     1 
ATOM   2568 O  O     . ASN B 1 159 ? 7.264   7.333   16.900 1.00 42.02 ? 321 ASN B O     1 
ATOM   2569 C  CB    . ASN B 1 159 ? 7.038   5.095   18.909 1.00 35.43 ? 321 ASN B CB    1 
ATOM   2570 C  CG    . ASN B 1 159 ? 5.819   5.410   19.786 1.00 35.52 ? 321 ASN B CG    1 
ATOM   2571 O  OD1   . ASN B 1 159 ? 4.689   5.202   19.379 1.00 36.43 ? 321 ASN B OD1   1 
ATOM   2572 N  ND2   . ASN B 1 159 ? 6.055   5.892   20.992 1.00 35.49 ? 321 ASN B ND2   1 
ATOM   2573 N  N     . GLY B 1 160 ? 5.166   6.679   16.477 1.00 40.10 ? 322 GLY B N     1 
ATOM   2574 C  CA    . GLY B 1 160 ? 4.727   7.995   16.023 1.00 44.51 ? 322 GLY B CA    1 
ATOM   2575 C  C     . GLY B 1 160 ? 4.930   8.249   14.535 1.00 46.33 ? 322 GLY B C     1 
ATOM   2576 O  O     . GLY B 1 160 ? 4.617   9.334   14.044 1.00 49.84 ? 322 GLY B O     1 
ATOM   2577 N  N     . MET B 1 161 ? 5.427   7.251   13.807 1.00 44.39 ? 323 MET B N     1 
ATOM   2578 C  CA    . MET B 1 161 ? 5.682   7.429   12.386 1.00 46.67 ? 323 MET B CA    1 
ATOM   2579 C  C     . MET B 1 161 ? 4.365   7.672   11.641 1.00 47.97 ? 323 MET B C     1 
ATOM   2580 O  O     . MET B 1 161 ? 3.376   6.969   11.851 1.00 45.25 ? 323 MET B O     1 
ATOM   2581 C  CB    . MET B 1 161 ? 6.420   6.226   11.793 1.00 44.20 ? 323 MET B CB    1 
ATOM   2582 C  CG    . MET B 1 161 ? 7.005   6.510   10.405 1.00 47.57 ? 323 MET B CG    1 
ATOM   2583 S  SD    . MET B 1 161 ? 7.746   5.071   9.586  1.00 47.31 ? 323 MET B SD    1 
ATOM   2584 C  CE    . MET B 1 161 ? 8.256   5.784   8.013  1.00 50.50 ? 323 MET B CE    1 
ATOM   2585 N  N     . GLN B 1 162 ? 4.360   8.692   10.787 1.00 52.56 ? 324 GLN B N     1 
ATOM   2586 C  CA    . GLN B 1 162 ? 3.192   9.027   9.999  1.00 54.43 ? 324 GLN B CA    1 
ATOM   2587 C  C     . GLN B 1 162 ? 3.150   8.051   8.828  1.00 52.85 ? 324 GLN B C     1 
ATOM   2588 O  O     . GLN B 1 162 ? 4.002   8.092   7.938  1.00 54.46 ? 324 GLN B O     1 
ATOM   2589 C  CB    . GLN B 1 162 ? 3.269   10.489  9.529  1.00 60.65 ? 324 GLN B CB    1 
ATOM   2590 C  CG    . GLN B 1 162 ? 2.047   11.007  8.727  1.00 64.83 ? 324 GLN B CG    1 
ATOM   2591 C  CD    . GLN B 1 162 ? 0.762   11.076  9.556  1.00 66.05 ? 324 GLN B CD    1 
ATOM   2592 O  OE1   . GLN B 1 162 ? 0.356   12.154  9.994  1.00 70.29 ? 324 GLN B OE1   1 
ATOM   2593 N  NE2   . GLN B 1 162 ? 0.124   9.924   9.773  1.00 62.50 ? 324 GLN B NE2   1 
ATOM   2594 N  N     . LEU B 1 163 ? 2.168   7.155   8.848  1.00 50.00 ? 325 LEU B N     1 
ATOM   2595 C  CA    . LEU B 1 163 ? 2.003   6.170   7.786  1.00 48.86 ? 325 LEU B CA    1 
ATOM   2596 C  C     . LEU B 1 163 ? 0.768   6.536   6.975  1.00 51.83 ? 325 LEU B C     1 
ATOM   2597 O  O     . LEU B 1 163 ? -0.343  6.068   7.244  1.00 50.58 ? 325 LEU B O     1 
ATOM   2598 C  CB    . LEU B 1 163 ? 1.899   4.765   8.387  1.00 44.29 ? 325 LEU B CB    1 
ATOM   2599 C  CG    . LEU B 1 163 ? 2.745   3.674   7.739  1.00 42.31 ? 325 LEU B CG    1 
ATOM   2600 C  CD1   . LEU B 1 163 ? 4.106   4.219   7.305  1.00 44.15 ? 325 LEU B CD1   1 
ATOM   2601 C  CD2   . LEU B 1 163 ? 2.909   2.502   8.702  1.00 38.11 ? 325 LEU B CD2   1 
ATOM   2602 N  N     . GLY B 1 164 ? 0.985   7.401   5.987  1.00 56.32 ? 326 GLY B N     1 
ATOM   2603 C  CA    . GLY B 1 164 ? -0.086  7.989   5.211  1.00 60.26 ? 326 GLY B CA    1 
ATOM   2604 C  C     . GLY B 1 164 ? -1.078  8.706   6.103  1.00 61.46 ? 326 GLY B C     1 
ATOM   2605 O  O     . GLY B 1 164 ? -0.813  9.785   6.629  1.00 64.11 ? 326 GLY B O     1 
ATOM   2606 N  N     . ASP B 1 165 ? -2.203  8.046   6.313  1.00 59.92 ? 327 ASP B N     1 
ATOM   2607 C  CA    . ASP B 1 165 ? -3.369  8.623   6.950  1.00 62.00 ? 327 ASP B CA    1 
ATOM   2608 C  C     . ASP B 1 165 ? -3.348  8.494   8.501  1.00 59.11 ? 327 ASP B C     1 
ATOM   2609 O  O     . ASP B 1 165 ? -4.187  9.071   9.191  1.00 61.19 ? 327 ASP B O     1 
ATOM   2610 C  CB    . ASP B 1 165 ? -4.582  7.892   6.364  1.00 62.11 ? 327 ASP B CB    1 
ATOM   2611 C  CG    . ASP B 1 165 ? -5.860  8.644   6.532  1.00 66.59 ? 327 ASP B CG    1 
ATOM   2612 O  OD1   . ASP B 1 165 ? -6.876  8.205   5.957  1.00 69.48 ? 327 ASP B OD1   1 
ATOM   2613 O  OD2   . ASP B 1 165 ? -5.863  9.672   7.228  1.00 70.00 ? 327 ASP B OD2   1 
ATOM   2614 N  N     . LYS B 1 166 ? -2.391  7.753   9.048  1.00 54.85 ? 328 LYS B N     1 
ATOM   2615 C  CA    . LYS B 1 166 ? -2.431  7.382   10.465 1.00 52.22 ? 328 LYS B CA    1 
ATOM   2616 C  C     . LYS B 1 166 ? -1.074  7.468   11.160 1.00 50.46 ? 328 LYS B C     1 
ATOM   2617 O  O     . LYS B 1 166 ? -0.027  7.499   10.510 1.00 50.63 ? 328 LYS B O     1 
ATOM   2618 C  CB    . LYS B 1 166 ? -2.972  5.954   10.612 1.00 48.57 ? 328 LYS B CB    1 
ATOM   2619 C  CG    . LYS B 1 166 ? -4.305  5.704   9.886  1.00 50.78 ? 328 LYS B CG    1 
ATOM   2620 C  CD    . LYS B 1 166 ? -5.116  4.575   10.538 1.00 48.08 ? 328 LYS B CD    1 
ATOM   2621 C  CE    . LYS B 1 166 ? -6.293  4.127   9.649  1.00 50.53 ? 328 LYS B CE    1 
ATOM   2622 N  NZ    . LYS B 1 166 ? -7.269  5.218   9.259  1.00 55.19 ? 328 LYS B NZ    1 
ATOM   2623 N  N     . LYS B 1 167 ? -1.116  7.480   12.492 1.00 49.38 ? 329 LYS B N     1 
ATOM   2624 C  CA    . LYS B 1 167 ? 0.077   7.556   13.338 1.00 47.79 ? 329 LYS B CA    1 
ATOM   2625 C  C     . LYS B 1 167 ? 0.289   6.253   14.121 1.00 43.03 ? 329 LYS B C     1 
ATOM   2626 O  O     . LYS B 1 167 ? -0.590  5.821   14.870 1.00 42.20 ? 329 LYS B O     1 
ATOM   2627 C  CB    . LYS B 1 167 ? -0.082  8.729   14.301 1.00 51.54 ? 329 LYS B CB    1 
ATOM   2628 C  CG    . LYS B 1 167 ? 1.188   9.140   15.021 1.00 52.05 ? 329 LYS B CG    1 
ATOM   2629 C  CD    . LYS B 1 167 ? 1.051   10.529  15.647 1.00 57.29 ? 329 LYS B CD    1 
ATOM   2630 C  CE    . LYS B 1 167 ? 2.312   10.928  16.433 1.00 58.87 ? 329 LYS B CE    1 
ATOM   2631 N  NZ    . LYS B 1 167 ? 2.579   10.027  17.603 1.00 55.99 ? 329 LYS B NZ    1 
ATOM   2632 N  N     . LEU B 1 168 ? 1.455   5.630   13.939 1.00 40.45 ? 330 LEU B N     1 
ATOM   2633 C  CA    . LEU B 1 168 ? 1.782   4.356   14.592 1.00 36.45 ? 330 LEU B CA    1 
ATOM   2634 C  C     . LEU B 1 168 ? 2.009   4.431   16.103 1.00 35.67 ? 330 LEU B C     1 
ATOM   2635 O  O     . LEU B 1 168 ? 2.645   5.364   16.603 1.00 37.49 ? 330 LEU B O     1 
ATOM   2636 C  CB    . LEU B 1 168 ? 3.066   3.770   14.012 1.00 35.20 ? 330 LEU B CB    1 
ATOM   2637 C  CG    . LEU B 1 168 ? 3.082   3.106   12.648 1.00 34.96 ? 330 LEU B CG    1 
ATOM   2638 C  CD1   . LEU B 1 168 ? 4.063   1.939   12.717 1.00 32.78 ? 330 LEU B CD1   1 
ATOM   2639 C  CD2   . LEU B 1 168 ? 1.710   2.626   12.234 1.00 35.67 ? 330 LEU B CD2   1 
ATOM   2640 N  N     . LEU B 1 169 ? 1.517   3.414   16.809 1.00 33.11 ? 331 LEU B N     1 
ATOM   2641 C  CA    . LEU B 1 169 ? 1.903   3.145   18.187 1.00 32.02 ? 331 LEU B CA    1 
ATOM   2642 C  C     . LEU B 1 169 ? 2.830   1.933   18.176 1.00 29.18 ? 331 LEU B C     1 
ATOM   2643 O  O     . LEU B 1 169 ? 2.478   0.891   17.648 1.00 27.65 ? 331 LEU B O     1 
ATOM   2644 C  CB    . LEU B 1 169 ? 0.683   2.864   19.060 1.00 32.41 ? 331 LEU B CB    1 
ATOM   2645 C  CG    . LEU B 1 169 ? 0.948   2.696   20.574 1.00 33.14 ? 331 LEU B CG    1 
ATOM   2646 C  CD1   . LEU B 1 169 ? 1.454   4.007   21.183 1.00 34.83 ? 331 LEU B CD1   1 
ATOM   2647 C  CD2   . LEU B 1 169 ? -0.287  2.211   21.315 1.00 32.73 ? 331 LEU B CD2   1 
ATOM   2648 N  N     . VAL B 1 170 ? 4.035   2.087   18.719 1.00 29.13 ? 332 VAL B N     1 
ATOM   2649 C  CA    . VAL B 1 170 ? 4.987   0.979   18.817 1.00 26.76 ? 332 VAL B CA    1 
ATOM   2650 C  C     . VAL B 1 170 ? 5.559   0.994   20.221 1.00 27.15 ? 332 VAL B C     1 
ATOM   2651 O  O     . VAL B 1 170 ? 6.172   1.976   20.649 1.00 29.00 ? 332 VAL B O     1 
ATOM   2652 C  CB    . VAL B 1 170 ? 6.111   1.121   17.800 1.00 27.18 ? 332 VAL B CB    1 
ATOM   2653 C  CG1   . VAL B 1 170 ? 7.036   -0.067  17.836 1.00 24.64 ? 332 VAL B CG1   1 
ATOM   2654 C  CG2   . VAL B 1 170 ? 5.528   1.308   16.429 1.00 28.09 ? 332 VAL B CG2   1 
ATOM   2655 N  N     . GLN B 1 171 ? 5.329   -0.092  20.943 1.00 25.59 ? 333 GLN B N     1 
ATOM   2656 C  CA    . GLN B 1 171 ? 5.710   -0.179  22.347 1.00 26.15 ? 333 GLN B CA    1 
ATOM   2657 C  C     . GLN B 1 171 ? 5.869   -1.653  22.746 1.00 24.69 ? 333 GLN B C     1 
ATOM   2658 O  O     . GLN B 1 171 ? 5.374   -2.537  22.059 1.00 23.63 ? 333 GLN B O     1 
ATOM   2659 C  CB    . GLN B 1 171 ? 4.639   0.490   23.201 1.00 27.53 ? 333 GLN B CB    1 
ATOM   2660 C  CG    . GLN B 1 171 ? 3.288   -0.269  23.182 1.00 27.05 ? 333 GLN B CG    1 
ATOM   2661 C  CD    . GLN B 1 171 ? 2.186   0.429   23.938 1.00 28.91 ? 333 GLN B CD    1 
ATOM   2662 O  OE1   . GLN B 1 171 ? 2.309   1.589   24.341 1.00 31.04 ? 333 GLN B OE1   1 
ATOM   2663 N  NE2   . GLN B 1 171 ? 1.089   -0.275  24.128 1.00 28.76 ? 333 GLN B NE2   1 
ATOM   2664 N  N     . ARG B 1 172 ? 6.558   -1.915  23.851 1.00 25.56 ? 334 ARG B N     1 
ATOM   2665 C  CA    . ARG B 1 172 ? 6.656   -3.271  24.393 1.00 25.21 ? 334 ARG B CA    1 
ATOM   2666 C  C     . ARG B 1 172 ? 5.255   -3.780  24.697 1.00 24.66 ? 334 ARG B C     1 
ATOM   2667 O  O     . ARG B 1 172 ? 4.513   -3.136  25.404 1.00 25.67 ? 334 ARG B O     1 
ATOM   2668 C  CB    . ARG B 1 172 ? 7.519   -3.302  25.667 1.00 27.11 ? 334 ARG B CB    1 
ATOM   2669 C  CG    . ARG B 1 172 ? 9.014   -3.280  25.404 1.00 27.46 ? 334 ARG B CG    1 
ATOM   2670 C  CD    . ARG B 1 172 ? 9.898   -3.558  26.640 1.00 29.12 ? 334 ARG B CD    1 
ATOM   2671 N  NE    . ARG B 1 172 ? 11.237  -3.871  26.152 1.00 29.87 ? 334 ARG B NE    1 
ATOM   2672 C  CZ    . ARG B 1 172 ? 12.127  -2.970  25.738 1.00 31.31 ? 334 ARG B CZ    1 
ATOM   2673 N  NH1   . ARG B 1 172 ? 11.847  -1.676  25.794 1.00 33.26 ? 334 ARG B NH1   1 
ATOM   2674 N  NH2   . ARG B 1 172 ? 13.304  -3.357  25.259 1.00 30.87 ? 334 ARG B NH2   1 
ATOM   2675 N  N     . ALA B 1 173 ? 4.891   -4.924  24.142 1.00 24.12 ? 335 ALA B N     1 
ATOM   2676 C  CA    . ALA B 1 173 ? 3.547   -5.497  24.337 1.00 25.52 ? 335 ALA B CA    1 
ATOM   2677 C  C     . ALA B 1 173 ? 3.282   -5.734  25.816 1.00 28.08 ? 335 ALA B C     1 
ATOM   2678 O  O     . ALA B 1 173 ? 2.143   -5.709  26.269 1.00 28.84 ? 335 ALA B O     1 
ATOM   2679 C  CB    . ALA B 1 173 ? 3.391   -6.793  23.565 1.00 23.54 ? 335 ALA B CB    1 
ATOM   2680 N  N     . SER B 1 174 ? 4.372   -5.954  26.544 1.00 30.33 ? 336 SER B N     1 
ATOM   2681 C  CA    . SER B 1 174 ? 4.374   -6.201  27.977 1.00 33.74 ? 336 SER B CA    1 
ATOM   2682 C  C     . SER B 1 174 ? 3.889   -7.613  28.249 1.00 35.59 ? 336 SER B C     1 
ATOM   2683 O  O     . SER B 1 174 ? 3.743   -8.008  29.397 1.00 39.30 ? 336 SER B O     1 
ATOM   2684 C  CB    . SER B 1 174 ? 3.546   -5.153  28.737 1.00 36.18 ? 336 SER B CB    1 
ATOM   2685 O  OG    . SER B 1 174 ? 4.057   -4.972  30.052 1.00 39.48 ? 336 SER B OG    1 
ATOM   2686 O  OXT   . SER B 1 174 ? 3.653   -8.411  27.335 1.00 35.28 ? 336 SER B OXT   1 
ATOM   2687 P  P     B DU  C 2 1   ? 37.999  -14.114 34.176 0.60 42.13 ? 1   DU  E P     1 
ATOM   2688 O  OP1   B DU  C 2 1   ? 36.829  -13.680 33.369 0.60 42.20 ? 1   DU  E OP1   1 
ATOM   2689 O  OP2   B DU  C 2 1   ? 37.789  -14.732 35.508 0.60 41.78 ? 1   DU  E OP2   1 
ATOM   2690 O  "O5'" A DU  C 2 1   ? 36.765  -9.751  33.007 0.40 31.30 ? 1   DU  E "O5'" 1 
ATOM   2691 O  "O5'" B DU  C 2 1   ? 38.903  -15.125 33.315 0.60 36.93 ? 1   DU  E "O5'" 1 
ATOM   2692 C  "C5'" A DU  C 2 1   ? 38.144  -9.591  32.678 0.40 30.74 ? 1   DU  E "C5'" 1 
ATOM   2693 C  "C5'" B DU  C 2 1   ? 38.984  -15.009 31.905 0.60 33.82 ? 1   DU  E "C5'" 1 
ATOM   2694 C  "C4'" A DU  C 2 1   ? 38.948  -10.840 32.999 0.40 30.56 ? 1   DU  E "C4'" 1 
ATOM   2695 C  "C4'" B DU  C 2 1   ? 39.053  -16.383 31.284 0.60 31.95 ? 1   DU  E "C4'" 1 
ATOM   2696 O  "O4'" A DU  C 2 1   ? 40.366  -10.513 33.044 0.40 29.47 ? 1   DU  E "O4'" 1 
ATOM   2697 O  "O4'" B DU  C 2 1   ? 40.396  -16.887 31.508 0.60 30.68 ? 1   DU  E "O4'" 1 
ATOM   2698 C  "C3'" A DU  C 2 1   ? 38.674  -11.470 34.355 0.40 30.74 ? 1   DU  E "C3'" 1 
ATOM   2699 C  "C3'" B DU  C 2 1   ? 38.073  -17.408 31.864 0.60 30.67 ? 1   DU  E "C3'" 1 
ATOM   2700 O  "O3'" A DU  C 2 1   ? 39.057  -12.824 34.347 0.40 32.21 ? 1   DU  E "O3'" 1 
ATOM   2701 O  "O3'" B DU  C 2 1   ? 37.488  -18.204 30.836 0.60 28.33 ? 1   DU  E "O3'" 1 
ATOM   2702 C  "C2'" A DU  C 2 1   ? 39.584  -10.620 35.241 0.40 29.89 ? 1   DU  E "C2'" 1 
ATOM   2703 C  "C2'" B DU  C 2 1   ? 38.963  -18.275 32.739 0.60 30.44 ? 1   DU  E "C2'" 1 
ATOM   2704 C  "C1'" A DU  C 2 1   ? 40.838  -10.615 34.374 0.40 28.85 ? 1   DU  E "C1'" 1 
ATOM   2705 C  "C1'" B DU  C 2 1   ? 40.327  -18.184 32.058 0.60 30.91 ? 1   DU  E "C1'" 1 
ATOM   2706 N  N1    A DU  C 2 1   ? 41.763  -9.478  34.679 0.40 28.33 ? 1   DU  E N1    1 
ATOM   2707 N  N1    B DU  C 2 1   ? 41.495  -18.415 32.965 0.60 31.08 ? 1   DU  E N1    1 
ATOM   2708 C  C2    A DU  C 2 1   ? 43.028  -9.715  35.185 0.40 27.31 ? 1   DU  E C2    1 
ATOM   2709 C  C2    B DU  C 2 1   ? 42.185  -19.607 32.874 0.60 30.94 ? 1   DU  E C2    1 
ATOM   2710 O  O2    A DU  C 2 1   ? 43.476  -10.821 35.407 0.40 26.39 ? 1   DU  E O2    1 
ATOM   2711 O  O2    B DU  C 2 1   ? 41.904  -20.491 32.088 0.60 30.82 ? 1   DU  E O2    1 
ATOM   2712 N  N3    A DU  C 2 1   ? 43.774  -8.588  35.426 0.40 27.60 ? 1   DU  E N3    1 
ATOM   2713 N  N3    B DU  C 2 1   ? 43.241  -19.729 33.739 0.60 30.88 ? 1   DU  E N3    1 
ATOM   2714 C  C4    A DU  C 2 1   ? 43.389  -7.280  35.226 0.40 27.42 ? 1   DU  E C4    1 
ATOM   2715 C  C4    B DU  C 2 1   ? 43.670  -18.806 34.674 0.60 30.89 ? 1   DU  E C4    1 
ATOM   2716 O  O4    A DU  C 2 1   ? 44.167  -6.381  35.491 0.40 27.79 ? 1   DU  E O4    1 
ATOM   2717 O  O4    B DU  C 2 1   ? 44.633  -19.065 35.378 0.60 31.37 ? 1   DU  E O4    1 
ATOM   2718 C  C5    A DU  C 2 1   ? 42.066  -7.102  34.704 0.40 27.58 ? 1   DU  E C5    1 
ATOM   2719 C  C5    B DU  C 2 1   ? 42.909  -17.589 34.723 0.60 30.90 ? 1   DU  E C5    1 
ATOM   2720 C  C6    A DU  C 2 1   ? 41.321  -8.187  34.461 0.40 28.27 ? 1   DU  E C6    1 
ATOM   2721 C  C6    B DU  C 2 1   ? 41.872  -17.445 33.881 0.60 31.25 ? 1   DU  E C6    1 
ATOM   2722 P  P     A DU  C 2 2   ? 37.990  -14.005 34.156 0.40 34.48 ? 2   DU  E P     1 
ATOM   2723 P  P     B DU  C 2 2   ? 35.929  -18.214 30.514 0.60 26.18 ? 2   DU  E P     1 
ATOM   2724 O  OP1   A DU  C 2 2   ? 36.865  -13.489 33.338 0.40 34.60 ? 2   DU  E OP1   1 
ATOM   2725 O  OP1   B DU  C 2 2   ? 35.230  -17.231 31.355 0.60 25.36 ? 2   DU  E OP1   1 
ATOM   2726 O  OP2   A DU  C 2 2   ? 37.727  -14.596 35.489 0.40 34.37 ? 2   DU  E OP2   1 
ATOM   2727 O  OP2   B DU  C 2 2   ? 35.466  -19.615 30.555 0.60 26.81 ? 2   DU  E OP2   1 
ATOM   2728 O  "O5'" A DU  C 2 2   ? 38.812  -15.103 33.319 0.40 32.46 ? 2   DU  E "O5'" 1 
ATOM   2729 O  "O5'" B DU  C 2 2   ? 35.963  -17.760 28.982 0.60 24.43 ? 2   DU  E "O5'" 1 
ATOM   2730 C  "C5'" A DU  C 2 2   ? 38.958  -15.002 31.910 0.40 31.35 ? 2   DU  E "C5'" 1 
ATOM   2731 C  "C5'" B DU  C 2 2   ? 36.096  -16.402 28.616 0.60 23.17 ? 2   DU  E "C5'" 1 
ATOM   2732 C  "C4'" A DU  C 2 2   ? 39.040  -16.378 31.285 0.40 30.81 ? 2   DU  E "C4'" 1 
ATOM   2733 C  "C4'" B DU  C 2 2   ? 36.661  -16.304 27.210 0.60 22.61 ? 2   DU  E "C4'" 1 
ATOM   2734 O  "O4'" A DU  C 2 2   ? 40.386  -16.884 31.512 0.40 30.26 ? 2   DU  E "O4'" 1 
ATOM   2735 O  "O4'" B DU  C 2 2   ? 38.017  -16.821 27.208 0.60 21.97 ? 2   DU  E "O4'" 1 
ATOM   2736 C  "C3'" A DU  C 2 2   ? 38.055  -17.414 31.838 0.40 30.41 ? 2   DU  E "C3'" 1 
ATOM   2737 C  "C3'" B DU  C 2 2   ? 35.904  -17.092 26.143 0.60 22.07 ? 2   DU  E "C3'" 1 
ATOM   2738 O  "O3'" A DU  C 2 2   ? 37.496  -18.196 30.794 0.40 29.34 ? 2   DU  E "O3'" 1 
ATOM   2739 O  "O3'" B DU  C 2 2   ? 35.712  -16.322 24.960 0.60 21.38 ? 2   DU  E "O3'" 1 
ATOM   2740 C  "C2'" A DU  C 2 2   ? 38.955  -18.287 32.692 0.40 30.34 ? 2   DU  E "C2'" 1 
ATOM   2741 C  "C2'" B DU  C 2 2   ? 36.820  -18.276 25.849 0.60 22.10 ? 2   DU  E "C2'" 1 
ATOM   2742 C  "C1'" A DU  C 2 2   ? 40.333  -18.191 32.050 0.40 30.71 ? 2   DU  E "C1'" 1 
ATOM   2743 C  "C1'" B DU  C 2 2   ? 38.208  -17.714 26.131 0.60 21.66 ? 2   DU  E "C1'" 1 
ATOM   2744 N  N1    A DU  C 2 2   ? 41.495  -18.414 32.968 0.40 30.93 ? 2   DU  E N1    1 
ATOM   2745 N  N1    B DU  C 2 2   ? 39.214  -18.758 26.533 0.60 21.22 ? 2   DU  E N1    1 
ATOM   2746 C  C2    A DU  C 2 2   ? 42.188  -19.606 32.884 0.40 30.90 ? 2   DU  E C2    1 
ATOM   2747 C  C2    B DU  C 2 2   ? 40.225  -19.142 25.681 0.60 20.62 ? 2   DU  E C2    1 
ATOM   2748 O  O2    A DU  C 2 2   ? 41.913  -20.497 32.101 0.40 30.84 ? 2   DU  E O2    1 
ATOM   2749 O  O2    B DU  C 2 2   ? 40.374  -18.681 24.572 0.60 21.25 ? 2   DU  E O2    1 
ATOM   2750 N  N3    A DU  C 2 2   ? 43.240  -19.723 33.755 0.40 30.88 ? 2   DU  E N3    1 
ATOM   2751 N  N3    B DU  C 2 2   ? 41.080  -20.099 26.177 0.60 21.14 ? 2   DU  E N3    1 
ATOM   2752 C  C4    A DU  C 2 2   ? 43.663  -18.796 34.688 0.40 30.86 ? 2   DU  E C4    1 
ATOM   2753 C  C4    B DU  C 2 2   ? 41.024  -20.711 27.421 0.60 21.64 ? 2   DU  E C4    1 
ATOM   2754 O  O4    A DU  C 2 2   ? 44.625  -19.052 35.401 0.40 31.17 ? 2   DU  E O4    1 
ATOM   2755 O  O4    B DU  C 2 2   ? 41.846  -21.565 27.739 0.60 21.25 ? 2   DU  E O4    1 
ATOM   2756 C  C5    A DU  C 2 2   ? 42.899  -17.579 34.727 0.40 30.90 ? 2   DU  E C5    1 
ATOM   2757 C  C5    B DU  C 2 2   ? 39.945  -20.263 28.262 0.60 21.51 ? 2   DU  E C5    1 
ATOM   2758 C  C6    A DU  C 2 2   ? 41.866  -17.439 33.881 0.40 31.11 ? 2   DU  E C6    1 
ATOM   2759 C  C6    B DU  C 2 2   ? 39.103  -19.331 27.792 0.60 22.27 ? 2   DU  E C6    1 
HETATM 2760 N  N1    A BRU C 2 3   ? 39.159  -18.750 26.602 0.40 26.82 ? 3   BRU E N1    1 
HETATM 2761 N  N1    B BRU C 2 3   ? 29.731  -16.779 26.549 0.60 25.44 ? 3   BRU E N1    1 
HETATM 2762 C  C2    A BRU C 2 3   ? 40.223  -19.161 25.761 0.40 26.57 ? 3   BRU E C2    1 
HETATM 2763 C  C2    B BRU C 2 3   ? 28.458  -16.807 27.171 0.60 24.82 ? 3   BRU E C2    1 
HETATM 2764 N  N3    A BRU C 2 3   ? 41.101  -20.098 26.151 0.40 26.88 ? 3   BRU E N3    1 
HETATM 2765 N  N3    B BRU C 2 3   ? 28.311  -16.808 28.496 0.60 24.72 ? 3   BRU E N3    1 
HETATM 2766 C  C4    A BRU C 2 3   ? 41.006  -20.682 27.353 0.40 27.08 ? 3   BRU E C4    1 
HETATM 2767 C  C4    B BRU C 2 3   ? 29.376  -16.780 29.298 0.60 25.31 ? 3   BRU E C4    1 
HETATM 2768 C  C5    A BRU C 2 3   ? 39.909  -20.274 28.264 0.40 26.95 ? 3   BRU E C5    1 
HETATM 2769 C  C5    B BRU C 2 3   ? 30.731  -16.747 28.692 0.60 24.89 ? 3   BRU E C5    1 
HETATM 2770 C  C6    A BRU C 2 3   ? 39.020  -19.299 27.823 0.40 27.32 ? 3   BRU E C6    1 
HETATM 2771 C  C6    B BRU C 2 3   ? 30.841  -16.756 27.304 0.60 24.52 ? 3   BRU E C6    1 
HETATM 2772 O  O2    A BRU C 2 3   ? 40.361  -18.653 24.632 0.40 26.92 ? 3   BRU E O2    1 
HETATM 2773 O  O2    B BRU C 2 3   ? 27.436  -16.833 26.476 0.60 25.16 ? 3   BRU E O2    1 
HETATM 2774 O  O4    A BRU C 2 3   ? 41.823  -21.560 27.709 0.40 26.89 ? 3   BRU E O4    1 
HETATM 2775 O  O4    B BRU C 2 3   ? 29.236  -16.778 30.544 0.60 25.40 ? 3   BRU E O4    1 
HETATM 2776 BR BR    A BRU C 2 3   ? 39.716  -21.085 30.019 0.40 26.95 ? 3   BRU E BR    1 
HETATM 2777 BR BR    B BRU C 2 3   ? 32.297  -16.700 29.843 0.60 24.23 ? 3   BRU E BR    1 
HETATM 2778 C  "C1'" A BRU C 2 3   ? 38.210  -17.711 26.167 0.40 26.97 ? 3   BRU E "C1'" 1 
HETATM 2779 C  "C1'" B BRU C 2 3   ? 29.811  -16.798 25.072 0.60 25.94 ? 3   BRU E "C1'" 1 
HETATM 2780 C  "C2'" A BRU C 2 3   ? 36.823  -18.260 25.867 0.40 27.12 ? 3   BRU E "C2'" 1 
HETATM 2781 C  "C2'" B BRU C 2 3   ? 30.228  -15.471 24.441 0.60 26.85 ? 3   BRU E "C2'" 1 
HETATM 2782 C  "C3'" A BRU C 2 3   ? 35.907  -17.096 26.174 0.40 27.02 ? 3   BRU E "C3'" 1 
HETATM 2783 C  "C3'" B BRU C 2 3   ? 30.981  -15.897 23.199 0.60 28.25 ? 3   BRU E "C3'" 1 
HETATM 2784 C  "C4'" A BRU C 2 3   ? 36.662  -16.266 27.203 0.40 27.16 ? 3   BRU E "C4'" 1 
HETATM 2785 C  "C4'" B BRU C 2 3   ? 31.489  -17.301 23.501 0.60 26.60 ? 3   BRU E "C4'" 1 
HETATM 2786 O  "O3'" A BRU C 2 3   ? 35.691  -16.350 24.973 0.40 26.79 ? 3   BRU E "O3'" 1 
HETATM 2787 O  "O3'" B BRU C 2 3   ? 30.092  -16.020 22.097 0.60 32.67 ? 3   BRU E "O3'" 1 
HETATM 2788 O  "O4'" A BRU C 2 3   ? 38.014  -16.737 27.198 0.40 26.94 ? 3   BRU E "O4'" 1 
HETATM 2789 O  "O4'" B BRU C 2 3   ? 30.772  -17.772 24.645 0.60 25.90 ? 3   BRU E "O4'" 1 
HETATM 2790 C  "C5'" A BRU C 2 3   ? 36.071  -16.373 28.605 0.40 27.22 ? 3   BRU E "C5'" 1 
HETATM 2791 C  "C5'" B BRU C 2 3   ? 32.976  -17.325 23.792 0.60 25.18 ? 3   BRU E "C5'" 1 
HETATM 2792 O  "O5'" A BRU C 2 3   ? 35.921  -17.742 28.964 0.40 27.62 ? 3   BRU E "O5'" 1 
HETATM 2793 O  "O5'" B BRU C 2 3   ? 33.230  -16.391 24.839 0.60 23.82 ? 3   BRU E "O5'" 1 
HETATM 2794 P  P     A BRU C 2 3   ? 35.932  -18.208 30.503 0.40 28.35 ? 3   BRU E P     1 
HETATM 2795 P  P     B BRU C 2 3   ? 34.454  -15.358 24.780 0.60 20.91 ? 3   BRU E P     1 
HETATM 2796 O  OP1   A BRU C 2 3   ? 35.271  -17.170 31.365 0.40 27.92 ? 3   BRU E OP1   1 
HETATM 2797 O  OP1   B BRU C 2 3   ? 34.538  -14.791 23.391 0.60 19.48 ? 3   BRU E OP1   1 
HETATM 2798 O  OP2   A BRU C 2 3   ? 35.451  -19.635 30.572 0.40 28.74 ? 3   BRU E OP2   1 
HETATM 2799 O  OP2   B BRU C 2 3   ? 34.323  -14.477 25.991 0.60 18.91 ? 3   BRU E OP2   1 
ATOM   2800 P  P     A DC  C 2 4   ? 34.439  -15.375 24.808 0.40 26.64 ? 4   DC  E P     1 
ATOM   2801 P  P     B DC  C 2 4   ? 30.385  -15.520 20.600 0.60 35.92 ? 4   DC  E P     1 
ATOM   2802 O  OP1   A DC  C 2 4   ? 34.515  -14.786 23.456 0.40 25.79 ? 4   DC  E OP1   1 
ATOM   2803 O  OP1   B DC  C 2 4   ? 31.823  -15.494 20.288 0.60 35.16 ? 4   DC  E OP1   1 
ATOM   2804 O  OP2   A DC  C 2 4   ? 34.334  -14.518 26.006 0.40 25.47 ? 4   DC  E OP2   1 
ATOM   2805 O  OP2   B DC  C 2 4   ? 29.547  -14.303 20.496 0.60 36.73 ? 4   DC  E OP2   1 
ATOM   2806 O  "O5'" A DC  C 2 4   ? 33.217  -16.398 24.871 0.40 28.62 ? 4   DC  E "O5'" 1 
ATOM   2807 O  "O5'" B DC  C 2 4   ? 29.723  -16.650 19.679 0.60 37.89 ? 4   DC  E "O5'" 1 
ATOM   2808 C  "C5'" A DC  C 2 4   ? 32.958  -17.317 23.813 0.40 29.71 ? 4   DC  E "C5'" 1 
ATOM   2809 C  "C5'" B DC  C 2 4   ? 30.323  -17.930 19.473 0.60 40.59 ? 4   DC  E "C5'" 1 
ATOM   2810 C  "C4'" A DC  C 2 4   ? 31.482  -17.289 23.486 0.40 30.79 ? 4   DC  E "C4'" 1 
ATOM   2811 C  "C4'" B DC  C 2 4   ? 29.274  -19.041 19.372 0.60 42.04 ? 4   DC  E "C4'" 1 
ATOM   2812 O  "O4'" A DC  C 2 4   ? 30.743  -17.755 24.642 0.40 30.57 ? 4   DC  E "O4'" 1 
ATOM   2813 O  "O4'" B DC  C 2 4   ? 28.635  -19.222 20.662 0.60 42.30 ? 4   DC  E "O4'" 1 
ATOM   2814 C  "C3'" A DC  C 2 4   ? 30.929  -15.906 23.150 0.40 31.83 ? 4   DC  E "C3'" 1 
ATOM   2815 C  "C3'" B DC  C 2 4   ? 28.119  -18.800 18.405 0.60 43.83 ? 4   DC  E "C3'" 1 
ATOM   2816 O  "O3'" A DC  C 2 4   ? 30.010  -16.016 22.082 0.40 34.86 ? 4   DC  E "O3'" 1 
ATOM   2817 O  "O3'" B DC  C 2 4   ? 28.448  -19.242 17.075 0.60 46.11 ? 4   DC  E "O3'" 1 
ATOM   2818 C  "C2'" A DC  C 2 4   ? 30.245  -15.464 24.437 0.40 31.19 ? 4   DC  E "C2'" 1 
ATOM   2819 C  "C2'" B DC  C 2 4   ? 26.982  -19.616 19.017 0.60 43.79 ? 4   DC  E "C2'" 1 
ATOM   2820 C  "C1'" A DC  C 2 4   ? 29.785  -16.790 25.033 0.40 30.90 ? 4   DC  E "C1'" 1 
ATOM   2821 C  "C1'" B DC  C 2 4   ? 27.266  -19.569 20.515 0.60 43.07 ? 4   DC  E "C1'" 1 
ATOM   2822 N  N1    A DC  C 2 4   ? 29.669  -16.813 26.539 0.40 30.74 ? 4   DC  E N1    1 
ATOM   2823 N  N1    B DC  C 2 4   ? 26.462  -18.584 21.322 0.60 43.45 ? 4   DC  E N1    1 
ATOM   2824 C  C2    A DC  C 2 4   ? 28.404  -16.768 27.149 0.40 30.43 ? 4   DC  E C2    1 
ATOM   2825 C  C2    B DC  C 2 4   ? 25.185  -18.909 21.815 0.60 43.22 ? 4   DC  E C2    1 
ATOM   2826 O  O2    A DC  C 2 4   ? 27.395  -16.704 26.450 0.40 30.76 ? 4   DC  E O2    1 
ATOM   2827 O  O2    B DC  C 2 4   ? 24.700  -20.013 21.563 0.60 43.13 ? 4   DC  E O2    1 
ATOM   2828 N  N3    A DC  C 2 4   ? 28.310  -16.796 28.499 0.40 30.41 ? 4   DC  E N3    1 
ATOM   2829 N  N3    B DC  C 2 4   ? 24.501  -17.998 22.559 0.60 42.61 ? 4   DC  E N3    1 
ATOM   2830 C  C4    A DC  C 2 4   ? 29.417  -16.864 29.240 0.40 30.67 ? 4   DC  E C4    1 
ATOM   2831 C  C4    B DC  C 2 4   ? 25.047  -16.807 22.820 0.60 43.09 ? 4   DC  E C4    1 
ATOM   2832 N  N4    A DC  C 2 4   ? 29.275  -16.887 30.571 0.40 30.71 ? 4   DC  E N4    1 
ATOM   2833 N  N4    B DC  C 2 4   ? 24.349  -15.930 23.548 0.60 43.56 ? 4   DC  E N4    1 
ATOM   2834 C  C5    A DC  C 2 4   ? 30.717  -16.906 28.649 0.40 30.48 ? 4   DC  E C5    1 
ATOM   2835 C  C5    B DC  C 2 4   ? 26.339  -16.449 22.335 0.60 43.18 ? 4   DC  E C5    1 
ATOM   2836 C  C6    A DC  C 2 4   ? 30.796  -16.882 27.312 0.40 30.14 ? 4   DC  E C6    1 
ATOM   2837 C  C6    B DC  C 2 4   ? 27.002  -17.351 21.597 0.60 43.74 ? 4   DC  E C6    1 
ATOM   2838 P  P     A DU  C 2 5   ? 30.348  -15.531 20.591 0.40 36.74 ? 5   DU  E P     1 
ATOM   2839 P  P     B DU  C 2 5   ? 27.705  -18.669 15.767 0.60 46.86 ? 5   DU  E P     1 
ATOM   2840 O  OP1   A DU  C 2 5   ? 31.805  -15.537 20.358 0.40 36.28 ? 5   DU  E OP1   1 
ATOM   2841 O  OP1   B DU  C 2 5   ? 28.768  -18.236 14.826 0.60 46.44 ? 5   DU  E OP1   1 
ATOM   2842 O  OP2   A DU  C 2 5   ? 29.554  -14.294 20.415 0.40 37.36 ? 5   DU  E OP2   1 
ATOM   2843 O  OP2   B DU  C 2 5   ? 26.651  -17.721 16.203 0.60 45.37 ? 5   DU  E OP2   1 
ATOM   2844 O  "O5'" A DU  C 2 5   ? 29.695  -16.668 19.673 0.40 37.79 ? 5   DU  E "O5'" 1 
ATOM   2845 O  "O5'" B DU  C 2 5   ? 26.995  -19.981 15.163 0.60 47.07 ? 5   DU  E "O5'" 1 
ATOM   2846 C  "C5'" A DU  C 2 5   ? 30.320  -17.940 19.490 0.40 39.27 ? 5   DU  E "C5'" 1 
ATOM   2847 C  "C5'" B DU  C 2 5   ? 25.712  -20.394 15.633 0.60 46.94 ? 5   DU  E "C5'" 1 
ATOM   2848 C  "C4'" A DU  C 2 5   ? 29.302  -19.077 19.420 0.40 40.01 ? 5   DU  E "C4'" 1 
ATOM   2849 C  "C4'" B DU  C 2 5   ? 25.437  -21.866 15.354 0.60 46.83 ? 5   DU  E "C4'" 1 
ATOM   2850 O  "O4'" A DU  C 2 5   ? 28.620  -19.199 20.693 0.40 40.20 ? 5   DU  E "O4'" 1 
ATOM   2851 O  "O4'" B DU  C 2 5   ? 24.881  -22.474 16.554 0.60 47.09 ? 5   DU  E "O4'" 1 
ATOM   2852 C  "C3'" A DU  C 2 5   ? 28.208  -18.927 18.368 0.40 40.97 ? 5   DU  E "C3'" 1 
ATOM   2853 C  "C3'" B DU  C 2 5   ? 24.444  -22.154 14.223 0.60 46.88 ? 5   DU  E "C3'" 1 
ATOM   2854 O  "O3'" A DU  C 2 5   ? 28.524  -19.739 17.235 0.40 42.01 ? 5   DU  E "O3'" 1 
ATOM   2855 O  "O3'" B DU  C 2 5   ? 24.953  -23.192 13.390 0.60 46.68 ? 5   DU  E "O3'" 1 
ATOM   2856 C  "C2'" A DU  C 2 5   ? 26.919  -19.413 19.034 0.40 41.15 ? 5   DU  E "C2'" 1 
ATOM   2857 C  "C2'" B DU  C 2 5   ? 23.136  -22.569 14.911 0.60 46.82 ? 5   DU  E "C2'" 1 
ATOM   2858 C  "C1'" A DU  C 2 5   ? 27.248  -19.506 20.520 0.40 40.75 ? 5   DU  E "C1'" 1 
ATOM   2859 C  "C1'" B DU  C 2 5   ? 23.514  -22.814 16.379 0.60 46.72 ? 5   DU  E "C1'" 1 
ATOM   2860 N  N1    A DU  C 2 5   ? 26.450  -18.563 21.365 0.40 41.03 ? 5   DU  E N1    1 
ATOM   2861 N  N1    B DU  C 2 5   ? 22.652  -22.032 17.361 0.60 46.60 ? 5   DU  E N1    1 
ATOM   2862 C  C2    A DU  C 2 5   ? 25.178  -18.908 21.793 0.40 40.83 ? 5   DU  E C2    1 
ATOM   2863 C  C2    B DU  C 2 5   ? 21.606  -22.684 18.004 0.60 46.81 ? 5   DU  E C2    1 
ATOM   2864 O  O2    A DU  C 2 5   ? 24.636  -19.958 21.517 0.40 40.81 ? 5   DU  E O2    1 
ATOM   2865 O  O2    B DU  C 2 5   ? 21.341  -23.864 17.840 0.60 46.60 ? 5   DU  E O2    1 
ATOM   2866 N  N3    A DU  C 2 5   ? 24.544  -17.965 22.569 0.40 40.39 ? 5   DU  E N3    1 
ATOM   2867 N  N3    B DU  C 2 5   ? 20.868  -21.905 18.871 0.60 46.69 ? 5   DU  E N3    1 
ATOM   2868 C  C4    A DU  C 2 5   ? 25.046  -16.733 22.953 0.40 40.77 ? 5   DU  E C4    1 
ATOM   2869 C  C4    B DU  C 2 5   ? 21.055  -20.562 19.162 0.60 46.57 ? 5   DU  E C4    1 
ATOM   2870 O  O4    A DU  C 2 5   ? 24.371  -15.982 23.649 0.40 41.17 ? 5   DU  E O4    1 
ATOM   2871 O  O4    B DU  C 2 5   ? 20.303  -20.017 19.970 0.60 46.32 ? 5   DU  E O4    1 
ATOM   2872 C  C5    A DU  C 2 5   ? 26.370  -16.434 22.473 0.40 40.84 ? 5   DU  E C5    1 
ATOM   2873 C  C5    B DU  C 2 5   ? 22.158  -19.939 18.456 0.60 46.35 ? 5   DU  E C5    1 
ATOM   2874 C  C6    A DU  C 2 5   ? 27.003  -17.338 21.716 0.40 41.24 ? 5   DU  E C6    1 
ATOM   2875 C  C6    B DU  C 2 5   ? 22.893  -20.682 17.603 0.60 46.44 ? 5   DU  E C6    1 
ATOM   2876 O  "O5'" . DU  D 2 1   ? -5.049  -0.636  15.557 1.00 44.17 ? 2   DU  P "O5'" 1 
ATOM   2877 C  "C5'" . DU  D 2 1   ? -6.035  -0.680  16.623 1.00 44.97 ? 2   DU  P "C5'" 1 
ATOM   2878 C  "C4'" . DU  D 2 1   ? -5.383  -1.119  17.937 1.00 45.25 ? 2   DU  P "C4'" 1 
ATOM   2879 O  "O4'" . DU  D 2 1   ? -4.370  -0.099  18.058 1.00 45.99 ? 2   DU  P "O4'" 1 
ATOM   2880 C  "C3'" . DU  D 2 1   ? -6.098  -1.173  19.299 1.00 44.91 ? 2   DU  P "C3'" 1 
ATOM   2881 O  "O3'" . DU  D 2 1   ? -5.614  -2.291  20.051 1.00 43.36 ? 2   DU  P "O3'" 1 
ATOM   2882 C  "C2'" . DU  D 2 1   ? -5.662  0.126   19.962 1.00 45.35 ? 2   DU  P "C2'" 1 
ATOM   2883 C  "C1'" . DU  D 2 1   ? -4.322  0.471   19.337 1.00 47.44 ? 2   DU  P "C1'" 1 
ATOM   2884 N  N1    . DU  D 2 1   ? -3.951  1.914   19.150 1.00 49.11 ? 2   DU  P N1    1 
ATOM   2885 C  C2    . DU  D 2 1   ? -3.824  2.729   20.272 1.00 50.01 ? 2   DU  P C2    1 
ATOM   2886 O  O2    . DU  D 2 1   ? -4.021  2.335   21.420 1.00 50.23 ? 2   DU  P O2    1 
ATOM   2887 N  N3    . DU  D 2 1   ? -3.449  4.027   19.989 1.00 49.67 ? 2   DU  P N3    1 
ATOM   2888 C  C4    . DU  D 2 1   ? -3.205  4.562   18.722 1.00 49.82 ? 2   DU  P C4    1 
ATOM   2889 O  O4    . DU  D 2 1   ? -2.882  5.741   18.592 1.00 50.12 ? 2   DU  P O4    1 
ATOM   2890 C  C5    . DU  D 2 1   ? -3.359  3.649   17.616 1.00 49.28 ? 2   DU  P C5    1 
ATOM   2891 C  C6    . DU  D 2 1   ? -3.704  2.385   17.864 1.00 48.39 ? 2   DU  P C6    1 
ATOM   2892 P  P     . DU  D 2 2   ? -6.278  -2.732  21.443 1.00 40.94 ? 3   DU  P P     1 
ATOM   2893 O  OP1   . DU  D 2 2   ? -7.714  -3.017  21.175 1.00 41.07 ? 3   DU  P OP1   1 
ATOM   2894 O  OP2   . DU  D 2 2   ? -5.915  -1.714  22.464 1.00 39.88 ? 3   DU  P OP2   1 
ATOM   2895 O  "O5'" . DU  D 2 2   ? -5.554  -4.124  21.765 1.00 36.18 ? 3   DU  P "O5'" 1 
ATOM   2896 C  "C5'" . DU  D 2 2   ? -5.754  -5.246  20.939 1.00 32.55 ? 3   DU  P "C5'" 1 
ATOM   2897 C  "C4'" . DU  D 2 2   ? -5.123  -6.490  21.540 1.00 31.14 ? 3   DU  P "C4'" 1 
ATOM   2898 O  "O4'" . DU  D 2 2   ? -3.704  -6.288  21.732 1.00 29.45 ? 3   DU  P "O4'" 1 
ATOM   2899 C  "C3'" . DU  D 2 2   ? -5.666  -6.922  22.908 1.00 29.80 ? 3   DU  P "C3'" 1 
ATOM   2900 O  "O3'" . DU  D 2 2   ? -5.615  -8.344  23.012 1.00 28.60 ? 3   DU  P "O3'" 1 
ATOM   2901 C  "C2'" . DU  D 2 2   ? -4.710  -6.238  23.881 1.00 28.34 ? 3   DU  P "C2'" 1 
ATOM   2902 C  "C1'" . DU  D 2 2   ? -3.403  -6.440  23.120 1.00 29.62 ? 3   DU  P "C1'" 1 
ATOM   2903 N  N1    . DU  D 2 2   ? -2.297  -5.486  23.498 1.00 28.72 ? 3   DU  P N1    1 
ATOM   2904 C  C2    . DU  D 2 2   ? -1.127  -5.935  24.096 1.00 28.18 ? 3   DU  P C2    1 
ATOM   2905 O  O2    . DU  D 2 2   ? -0.870  -7.091  24.362 1.00 26.86 ? 3   DU  P O2    1 
ATOM   2906 N  N3    . DU  D 2 2   ? -0.209  -4.957  24.374 1.00 28.73 ? 3   DU  P N3    1 
ATOM   2907 C  C4    . DU  D 2 2   ? -0.349  -3.619  24.107 1.00 28.31 ? 3   DU  P C4    1 
ATOM   2908 O  O4    . DU  D 2 2   ? 0.552   -2.870  24.397 1.00 29.14 ? 3   DU  P O4    1 
ATOM   2909 C  C5    . DU  D 2 2   ? -1.574  -3.221  23.485 1.00 28.05 ? 3   DU  P C5    1 
ATOM   2910 C  C6    . DU  D 2 2   ? -2.482  -4.155  23.214 1.00 27.87 ? 3   DU  P C6    1 
HETATM 2911 N  N1    . BRU D 2 3   ? -3.156  -11.302 20.178 1.00 26.34 ? 4   BRU P N1    1 
HETATM 2912 C  C2    . BRU D 2 3   ? -1.937  -11.754 19.644 1.00 27.38 ? 4   BRU P C2    1 
HETATM 2913 N  N3    . BRU D 2 3   ? -0.830  -11.751 20.384 1.00 27.93 ? 4   BRU P N3    1 
HETATM 2914 C  C4    . BRU D 2 3   ? -0.817  -11.331 21.644 1.00 27.83 ? 4   BRU P C4    1 
HETATM 2915 C  C5    . BRU D 2 3   ? -2.078  -10.846 22.257 1.00 27.76 ? 4   BRU P C5    1 
HETATM 2916 C  C6    . BRU D 2 3   ? -3.218  -10.866 21.447 1.00 27.07 ? 4   BRU P C6    1 
HETATM 2917 O  O2    . BRU D 2 3   ? -1.850  -12.158 18.464 1.00 27.55 ? 4   BRU P O2    1 
HETATM 2918 O  O4    . BRU D 2 3   ? 0.260   -11.364 22.277 1.00 27.73 ? 4   BRU P O4    1 
HETATM 2919 BR BR    . BRU D 2 3   ? -2.113  -10.233 24.109 1.00 25.59 ? 4   BRU P BR    1 
HETATM 2920 C  "C1'" . BRU D 2 3   ? -4.350  -11.341 19.333 1.00 26.89 ? 4   BRU P "C1'" 1 
HETATM 2921 C  "C2'" . BRU D 2 3   ? -5.320  -12.395 19.864 1.00 27.31 ? 4   BRU P "C2'" 1 
HETATM 2922 C  "C3'" . BRU D 2 3   ? -6.671  -11.875 19.442 1.00 27.54 ? 4   BRU P "C3'" 1 
HETATM 2923 C  "C4'" . BRU D 2 3   ? -6.468  -10.373 19.277 1.00 27.85 ? 4   BRU P "C4'" 1 
HETATM 2924 O  "O3'" . BRU D 2 3   ? -7.035  -12.504 18.206 1.00 29.05 ? 4   BRU P "O3'" 1 
HETATM 2925 O  "O4'" . BRU D 2 3   ? -5.064  -10.107 19.325 1.00 26.52 ? 4   BRU P "O4'" 1 
HETATM 2926 C  "C5'" . BRU D 2 3   ? -7.160  -9.589  20.387 1.00 27.59 ? 4   BRU P "C5'" 1 
HETATM 2927 O  "O5'" . BRU D 2 3   ? -6.749  -10.138 21.632 1.00 26.92 ? 4   BRU P "O5'" 1 
HETATM 2928 P  P     . BRU D 2 3   ? -6.893  -9.307  22.987 1.00 28.27 ? 4   BRU P P     1 
HETATM 2929 O  OP1   . BRU D 2 3   ? -8.160  -8.498  22.997 1.00 26.91 ? 4   BRU P OP1   1 
HETATM 2930 O  OP2   . BRU D 2 3   ? -6.636  -10.310 24.080 1.00 30.50 ? 4   BRU P OP2   1 
ATOM   2931 P  P     . DC  D 2 4   ? -8.508  -12.461 17.582 1.00 28.51 ? 5   DC  P P     1 
ATOM   2932 O  OP1   . DC  D 2 4   ? -8.365  -12.872 16.176 1.00 27.39 ? 5   DC  P OP1   1 
ATOM   2933 O  OP2   . DC  D 2 4   ? -9.131  -11.165 17.912 1.00 26.97 ? 5   DC  P OP2   1 
ATOM   2934 O  "O5'" . DC  D 2 4   ? -9.256  -13.594 18.421 1.00 28.35 ? 5   DC  P "O5'" 1 
ATOM   2935 C  "C5'" . DC  D 2 4   ? -8.824  -14.948 18.348 1.00 30.56 ? 5   DC  P "C5'" 1 
ATOM   2936 C  "C4'" . DC  D 2 4   ? -10.016 -15.904 18.340 1.00 31.06 ? 5   DC  P "C4'" 1 
ATOM   2937 O  "O4'" . DC  D 2 4   ? -10.686 -15.822 19.635 1.00 30.54 ? 5   DC  P "O4'" 1 
ATOM   2938 C  "C3'" . DC  D 2 4   ? -11.086 -15.610 17.291 1.00 30.42 ? 5   DC  P "C3'" 1 
ATOM   2939 O  "O3'" . DC  D 2 4   ? -11.666 -16.815 16.755 1.00 31.55 ? 5   DC  P "O3'" 1 
ATOM   2940 C  "C2'" . DC  D 2 4   ? -12.068 -14.767 18.092 1.00 30.02 ? 5   DC  P "C2'" 1 
ATOM   2941 C  "C1'" . DC  D 2 4   ? -12.032 -15.461 19.446 1.00 29.76 ? 5   DC  P "C1'" 1 
ATOM   2942 N  N1    . DC  D 2 4   ? -12.459 -14.618 20.598 1.00 29.39 ? 5   DC  P N1    1 
ATOM   2943 C  C2    . DC  D 2 4   ? -13.669 -14.884 21.254 1.00 30.22 ? 5   DC  P C2    1 
ATOM   2944 O  O2    . DC  D 2 4   ? -14.367 -15.820 20.853 1.00 29.74 ? 5   DC  P O2    1 
ATOM   2945 N  N3    . DC  D 2 4   ? -14.047 -14.106 22.310 1.00 30.09 ? 5   DC  P N3    1 
ATOM   2946 C  C4    . DC  D 2 4   ? -13.276 -13.097 22.714 1.00 29.94 ? 5   DC  P C4    1 
ATOM   2947 N  N4    . DC  D 2 4   ? -13.683 -12.348 23.743 1.00 28.82 ? 5   DC  P N4    1 
ATOM   2948 C  C5    . DC  D 2 4   ? -12.043 -12.812 22.052 1.00 30.15 ? 5   DC  P C5    1 
ATOM   2949 C  C6    . DC  D 2 4   ? -11.681 -13.588 21.020 1.00 29.29 ? 5   DC  P C6    1 
ATOM   2950 P  P     . DU  D 2 5   ? -11.131 -17.469 15.387 1.00 35.79 ? 6   DU  P P     1 
ATOM   2951 O  OP1   . DU  D 2 5   ? -10.042 -16.644 14.805 1.00 36.40 ? 6   DU  P OP1   1 
ATOM   2952 O  OP2   . DU  D 2 5   ? -12.276 -17.839 14.553 1.00 37.14 ? 6   DU  P OP2   1 
ATOM   2953 O  "O5'" . DU  D 2 5   ? -10.447 -18.824 15.831 1.00 37.13 ? 6   DU  P "O5'" 1 
ATOM   2954 C  "C5'" . DU  D 2 5   ? -11.186 -19.975 16.020 1.00 40.25 ? 6   DU  P "C5'" 1 
ATOM   2955 C  "C4'" . DU  D 2 5   ? -10.826 -20.487 17.389 1.00 42.69 ? 6   DU  P "C4'" 1 
ATOM   2956 O  "O4'" . DU  D 2 5   ? -11.567 -19.778 18.427 1.00 42.22 ? 6   DU  P "O4'" 1 
ATOM   2957 C  "C3'" . DU  D 2 5   ? -11.158 -21.950 17.604 1.00 44.29 ? 6   DU  P "C3'" 1 
ATOM   2958 O  "O3'" . DU  D 2 5   ? -10.223 -22.397 18.583 1.00 49.39 ? 6   DU  P "O3'" 1 
ATOM   2959 C  "C2'" . DU  D 2 5   ? -12.620 -21.874 18.037 1.00 42.78 ? 6   DU  P "C2'" 1 
ATOM   2960 C  "C1'" . DU  D 2 5   ? -12.612 -20.614 18.897 1.00 41.72 ? 6   DU  P "C1'" 1 
ATOM   2961 N  N1    . DU  D 2 5   ? -13.873 -19.794 18.889 1.00 40.96 ? 6   DU  P N1    1 
ATOM   2962 C  C2    . DU  D 2 5   ? -14.878 -20.083 19.810 1.00 39.26 ? 6   DU  P C2    1 
ATOM   2963 O  O2    . DU  D 2 5   ? -14.808 -21.002 20.608 1.00 40.29 ? 6   DU  P O2    1 
ATOM   2964 N  N3    . DU  D 2 5   ? -15.972 -19.264 19.762 1.00 36.99 ? 6   DU  P N3    1 
ATOM   2965 C  C4    . DU  D 2 5   ? -16.148 -18.209 18.880 1.00 40.32 ? 6   DU  P C4    1 
ATOM   2966 O  O4    . DU  D 2 5   ? -17.176 -17.537 18.919 1.00 41.86 ? 6   DU  P O4    1 
ATOM   2967 C  C5    . DU  D 2 5   ? -15.065 -17.958 17.954 1.00 40.04 ? 6   DU  P C5    1 
ATOM   2968 C  C6    . DU  D 2 5   ? -13.988 -18.743 17.995 1.00 39.67 ? 6   DU  P C6    1 
ATOM   2969 P  P     . DU  D 2 6   ? -10.448 -23.656 19.549 1.00 52.17 ? 7   DU  P P     1 
ATOM   2970 O  OP1   . DU  D 2 6   ? -10.186 -24.940 18.842 1.00 52.75 ? 7   DU  P OP1   1 
ATOM   2971 O  OP2   . DU  D 2 6   ? -11.773 -23.426 20.163 1.00 53.19 ? 7   DU  P OP2   1 
ATOM   2972 O  "O5'" . DU  D 2 6   ? -9.285  -23.341 20.628 1.00 54.74 ? 7   DU  P "O5'" 1 
ATOM   2973 C  "C5'" . DU  D 2 6   ? -7.898  -23.021 20.269 1.00 54.07 ? 7   DU  P "C5'" 1 
ATOM   2974 C  "C4'" . DU  D 2 6   ? -7.245  -24.247 19.646 1.00 54.78 ? 7   DU  P "C4'" 1 
ATOM   2975 O  "O4'" . DU  D 2 6   ? -7.302  -24.083 18.215 1.00 56.19 ? 7   DU  P "O4'" 1 
ATOM   2976 C  "C3'" . DU  D 2 6   ? -5.786  -24.549 19.962 1.00 54.86 ? 7   DU  P "C3'" 1 
ATOM   2977 O  "O3'" . DU  D 2 6   ? -5.576  -25.966 20.006 1.00 54.20 ? 7   DU  P "O3'" 1 
ATOM   2978 C  "C2'" . DU  D 2 6   ? -5.005  -23.919 18.799 1.00 55.46 ? 7   DU  P "C2'" 1 
ATOM   2979 C  "C1'" . DU  D 2 6   ? -6.007  -23.923 17.648 1.00 56.45 ? 7   DU  P "C1'" 1 
ATOM   2980 N  N1    . DU  D 2 6   ? -6.124  -22.738 16.714 1.00 56.34 ? 7   DU  P N1    1 
ATOM   2981 C  C2    . DU  D 2 6   ? -5.507  -22.818 15.472 1.00 57.40 ? 7   DU  P C2    1 
ATOM   2982 O  O2    . DU  D 2 6   ? -4.820  -23.770 15.092 1.00 56.85 ? 7   DU  P O2    1 
ATOM   2983 N  N3    . DU  D 2 6   ? -5.709  -21.704 14.688 1.00 57.77 ? 7   DU  P N3    1 
ATOM   2984 C  C4    . DU  D 2 6   ? -6.448  -20.570 15.001 1.00 56.69 ? 7   DU  P C4    1 
ATOM   2985 O  O4    . DU  D 2 6   ? -6.528  -19.659 14.180 1.00 57.36 ? 7   DU  P O4    1 
ATOM   2986 C  C5    . DU  D 2 6   ? -7.066  -20.578 16.296 1.00 55.51 ? 7   DU  P C5    1 
ATOM   2987 C  C6    . DU  D 2 6   ? -6.887  -21.643 17.079 1.00 55.21 ? 7   DU  P C6    1 
HETATM 2988 C  C1    . DIO E 3 .   ? -27.953 -18.276 28.554 1.00 47.48 ? 401 DIO A C1    1 
HETATM 2989 C  C2    . DIO E 3 .   ? -26.725 -18.473 26.542 1.00 48.07 ? 401 DIO A C2    1 
HETATM 2990 C  "C1'" . DIO E 3 .   ? -27.040 -19.401 29.037 1.00 48.48 ? 401 DIO A "C1'" 1 
HETATM 2991 C  "C2'" . DIO E 3 .   ? -26.174 -19.861 26.848 1.00 48.20 ? 401 DIO A "C2'" 1 
HETATM 2992 O  O1    . DIO E 3 .   ? -28.019 -18.332 27.130 1.00 47.72 ? 401 DIO A O1    1 
HETATM 2993 O  "O1'" . DIO E 3 .   ? -26.830 -20.383 28.005 1.00 48.83 ? 401 DIO A "O1'" 1 
HETATM 2994 S  S     . SO4 F 4 .   ? -12.984 -6.164  25.231 1.00 49.94 ? 402 SO4 A S     1 
HETATM 2995 O  O1    . SO4 F 4 .   ? -12.901 -7.625  25.170 1.00 49.61 ? 402 SO4 A O1    1 
HETATM 2996 O  O2    . SO4 F 4 .   ? -12.662 -5.699  23.878 1.00 49.38 ? 402 SO4 A O2    1 
HETATM 2997 O  O3    . SO4 F 4 .   ? -14.337 -5.764  25.643 1.00 48.56 ? 402 SO4 A O3    1 
HETATM 2998 O  O4    . SO4 F 4 .   ? -12.011 -5.586  26.175 1.00 49.53 ? 402 SO4 A O4    1 
HETATM 2999 S  S     . SO4 G 4 .   ? -20.824 -24.898 21.827 1.00 62.51 ? 403 SO4 A S     1 
HETATM 3000 O  O1    . SO4 G 4 .   ? -19.890 -24.208 20.928 1.00 61.81 ? 403 SO4 A O1    1 
HETATM 3001 O  O2    . SO4 G 4 .   ? -21.854 -25.624 21.063 1.00 63.81 ? 403 SO4 A O2    1 
HETATM 3002 O  O3    . SO4 G 4 .   ? -20.048 -25.792 22.704 1.00 62.10 ? 403 SO4 A O3    1 
HETATM 3003 O  O4    . SO4 G 4 .   ? -21.573 -23.942 22.628 1.00 62.89 ? 403 SO4 A O4    1 
HETATM 3004 C  C1    . DIO H 3 .   ? 8.489   -14.362 10.322 1.00 54.65 ? 401 DIO B C1    1 
HETATM 3005 C  C2    . DIO H 3 .   ? 10.826  -14.636 10.052 1.00 54.70 ? 401 DIO B C2    1 
HETATM 3006 C  "C1'" . DIO H 3 .   ? 8.588   -14.736 11.804 1.00 54.47 ? 401 DIO B "C1'" 1 
HETATM 3007 C  "C2'" . DIO H 3 .   ? 10.954  -14.977 11.537 1.00 54.84 ? 401 DIO B "C2'" 1 
HETATM 3008 O  O1    . DIO H 3 .   ? 9.716   -13.745 9.889  1.00 54.34 ? 401 DIO B O1    1 
HETATM 3009 O  "O1'" . DIO H 3 .   ? 9.739   -15.562 12.023 1.00 54.74 ? 401 DIO B "O1'" 1 
HETATM 3010 C  C1    . DIO I 3 .   ? 15.241  -44.454 32.027 1.00 54.09 ? 402 DIO B C1    1 
HETATM 3011 C  C2    . DIO I 3 .   ? 17.477  -43.983 31.419 1.00 54.71 ? 402 DIO B C2    1 
HETATM 3012 C  "C1'" . DIO I 3 .   ? 15.032  -45.053 30.637 1.00 54.14 ? 402 DIO B "C1'" 1 
HETATM 3013 C  "C2'" . DIO I 3 .   ? 17.216  -44.417 29.988 1.00 54.18 ? 402 DIO B "C2'" 1 
HETATM 3014 O  O1    . DIO I 3 .   ? 16.254  -43.450 31.942 1.00 54.98 ? 402 DIO B O1    1 
HETATM 3015 O  "O1'" . DIO I 3 .   ? 16.275  -45.486 30.053 1.00 53.70 ? 402 DIO B "O1'" 1 
HETATM 3016 C  C1    . DIO J 3 .   ? -4.690  -8.439  5.280  1.00 48.45 ? 403 DIO B C1    1 
HETATM 3017 C  C2    . DIO J 3 .   ? -5.709  -6.566  4.215  1.00 48.30 ? 403 DIO B C2    1 
HETATM 3018 C  "C1'" . DIO J 3 .   ? -4.439  -9.104  3.924  1.00 48.37 ? 403 DIO B "C1'" 1 
HETATM 3019 C  "C2'" . DIO J 3 .   ? -5.484  -7.233  2.854  1.00 48.70 ? 403 DIO B "C2'" 1 
HETATM 3020 O  O1    . DIO J 3 .   ? -5.828  -7.557  5.236  1.00 47.38 ? 403 DIO B O1    1 
HETATM 3021 O  "O1'" . DIO J 3 .   ? -4.338  -8.098  2.906  1.00 48.88 ? 403 DIO B "O1'" 1 
HETATM 3022 C  C1    . CPQ K 5 .   ? 6.707   -0.403  0.889  1.00 37.82 ? 404 CPQ B C1    1 
HETATM 3023 C  C2    . CPQ K 5 .   ? 5.502   -0.225  1.818  1.00 36.59 ? 404 CPQ B C2    1 
HETATM 3024 C  C3    . CPQ K 5 .   ? 4.573   1.803   0.546  1.00 36.36 ? 404 CPQ B C3    1 
HETATM 3025 C  C4    . CPQ K 5 .   ? 4.045   3.238   0.649  1.00 36.29 ? 404 CPQ B C4    1 
HETATM 3026 C  C5    . CPQ K 5 .   ? 2.911   3.369   1.647  1.00 37.83 ? 404 CPQ B C5    1 
HETATM 3027 C  C6    . CPQ K 5 .   ? 3.387   2.799   2.974  1.00 37.61 ? 404 CPQ B C6    1 
HETATM 3028 C  C7    . CPQ K 5 .   ? 2.273   3.153   3.947  1.00 37.64 ? 404 CPQ B C7    1 
HETATM 3029 C  C8    . CPQ K 5 .   ? 1.773   4.507   3.441  1.00 38.43 ? 404 CPQ B C8    1 
HETATM 3030 C  C9    . CPQ K 5 .   ? 2.484   4.777   2.103  1.00 39.94 ? 404 CPQ B C9    1 
HETATM 3031 C  C10   . CPQ K 5 .   ? 1.692   2.607   1.117  1.00 36.93 ? 404 CPQ B C10   1 
HETATM 3032 C  C11   . CPQ K 5 .   ? 4.364   -1.106  1.322  1.00 35.84 ? 404 CPQ B C11   1 
HETATM 3033 C  C12   . CPQ K 5 .   ? 7.994   0.288   1.382  1.00 38.32 ? 404 CPQ B C12   1 
HETATM 3034 C  C13   . CPQ K 5 .   ? 8.374   -0.206  2.781  1.00 38.83 ? 404 CPQ B C13   1 
HETATM 3035 C  C14   . CPQ K 5 .   ? 7.191   0.029   3.718  1.00 37.95 ? 404 CPQ B C14   1 
HETATM 3036 C  C15   . CPQ K 5 .   ? 5.927   -0.685  3.212  1.00 37.15 ? 404 CPQ B C15   1 
HETATM 3037 C  C16   . CPQ K 5 .   ? 4.816   -0.543  4.264  1.00 37.34 ? 404 CPQ B C16   1 
HETATM 3038 C  C17   . CPQ K 5 .   ? 4.218   0.861   4.301  1.00 36.90 ? 404 CPQ B C17   1 
HETATM 3039 C  C18   . CPQ K 5 .   ? 3.829   1.346   2.902  1.00 37.19 ? 404 CPQ B C18   1 
HETATM 3040 C  C19   . CPQ K 5 .   ? 4.988   1.218   1.897  1.00 36.27 ? 404 CPQ B C19   1 
HETATM 3041 C  C20   . CPQ K 5 .   ? 1.622   5.601   1.135  1.00 42.90 ? 404 CPQ B C20   1 
HETATM 3042 C  C21   . CPQ K 5 .   ? 2.331   5.840   -0.202 1.00 43.56 ? 404 CPQ B C21   1 
HETATM 3043 C  C22   . CPQ K 5 .   ? 1.163   6.939   1.741  1.00 45.61 ? 404 CPQ B C22   1 
HETATM 3044 C  C23   . CPQ K 5 .   ? 2.170   8.073   1.555  1.00 48.03 ? 404 CPQ B C23   1 
HETATM 3045 O  O2    . CPQ K 5 .   ? 9.542   0.450   3.302  1.00 38.81 ? 404 CPQ B O2    1 
HETATM 3046 O  O4    . CPQ K 5 .   ? 5.111   4.076   1.058  1.00 35.63 ? 404 CPQ B O4    1 
HETATM 3047 C  C57   . CPQ K 5 .   ? 1.894   9.216   2.511  1.00 49.95 ? 404 CPQ B C57   1 
HETATM 3048 O  O58   . CPQ K 5 .   ? 2.827   9.675   3.164  1.00 52.11 ? 404 CPQ B O58   1 
HETATM 3049 S  S     . SO4 L 4 .   ? 10.064  -26.792 27.310 1.00 56.17 ? 405 SO4 B S     1 
HETATM 3050 O  O1    . SO4 L 4 .   ? 11.089  -26.311 26.386 1.00 55.77 ? 405 SO4 B O1    1 
HETATM 3051 O  O2    . SO4 L 4 .   ? 8.786   -26.143 26.970 1.00 55.67 ? 405 SO4 B O2    1 
HETATM 3052 O  O3    . SO4 L 4 .   ? 9.973   -28.259 27.139 1.00 56.12 ? 405 SO4 B O3    1 
HETATM 3053 O  O4    . SO4 L 4 .   ? 10.417  -26.462 28.705 1.00 54.32 ? 405 SO4 B O4    1 
HETATM 3054 S  S     . SO4 M 4 .   ? 31.285  -14.839 36.006 1.00 57.51 ? 406 SO4 B S     1 
HETATM 3055 O  O1    . SO4 M 4 .   ? 32.143  -15.511 35.005 1.00 56.54 ? 406 SO4 B O1    1 
HETATM 3056 O  O2    . SO4 M 4 .   ? 31.433  -15.434 37.345 1.00 55.12 ? 406 SO4 B O2    1 
HETATM 3057 O  O3    . SO4 M 4 .   ? 29.869  -14.900 35.593 1.00 56.49 ? 406 SO4 B O3    1 
HETATM 3058 O  O4    . SO4 M 4 .   ? 31.716  -13.426 36.035 1.00 58.14 ? 406 SO4 B O4    1 
HETATM 3059 S  S     . SO4 N 4 .   ? 20.046  -18.374 36.684 1.00 57.77 ? 407 SO4 B S     1 
HETATM 3060 O  O1    . SO4 N 4 .   ? 21.042  -19.143 35.927 1.00 58.70 ? 407 SO4 B O1    1 
HETATM 3061 O  O2    . SO4 N 4 .   ? 19.631  -17.237 35.840 1.00 58.03 ? 407 SO4 B O2    1 
HETATM 3062 O  O3    . SO4 N 4 .   ? 18.908  -19.230 37.068 1.00 54.76 ? 407 SO4 B O3    1 
HETATM 3063 O  O4    . SO4 N 4 .   ? 20.704  -17.866 37.894 1.00 58.32 ? 407 SO4 B O4    1 
HETATM 3064 C  C1    . GOL O 6 .   ? 8.422   0.560   28.213 1.00 47.28 ? 408 GOL B C1    1 
HETATM 3065 O  O1    . GOL O 6 .   ? 7.977   -0.486  29.072 1.00 47.73 ? 408 GOL B O1    1 
HETATM 3066 C  C2    . GOL O 6 .   ? 8.984   -0.020  26.910 1.00 45.78 ? 408 GOL B C2    1 
HETATM 3067 O  O2    . GOL O 6 .   ? 10.225  0.550   26.543 1.00 44.78 ? 408 GOL B O2    1 
HETATM 3068 C  C3    . GOL O 6 .   ? 7.999   0.123   25.752 1.00 45.35 ? 408 GOL B C3    1 
HETATM 3069 O  O3    . GOL O 6 .   ? 7.819   1.438   25.279 1.00 45.80 ? 408 GOL B O3    1 
HETATM 3070 O  O     . HOH P 7 .   ? -35.022 -1.589  17.652 1.00 36.39 ? 501 HOH A O     1 
HETATM 3071 O  O     . HOH P 7 .   ? -13.020 -9.565  23.856 1.00 31.77 ? 502 HOH A O     1 
HETATM 3072 O  O     . HOH P 7 .   ? -19.373 -19.042 27.980 1.00 21.71 ? 503 HOH A O     1 
HETATM 3073 O  O     . HOH P 7 .   ? -31.042 -1.641  37.716 1.00 26.77 ? 504 HOH A O     1 
HETATM 3074 O  O     . HOH P 7 .   ? -28.404 8.311   17.069 1.00 46.42 ? 505 HOH A O     1 
HETATM 3075 O  O     . HOH P 7 .   ? -28.417 -3.501  27.635 1.00 27.71 ? 506 HOH A O     1 
HETATM 3076 O  O     . HOH P 7 .   ? -22.317 -20.055 31.474 1.00 18.87 ? 507 HOH A O     1 
HETATM 3077 O  O     . HOH P 7 .   ? -12.393 -32.254 45.163 1.00 37.37 ? 508 HOH A O     1 
HETATM 3078 O  O     . HOH P 7 .   ? -25.185 -18.189 23.096 1.00 24.06 ? 509 HOH A O     1 
HETATM 3079 O  O     . HOH P 7 .   ? -23.672 -4.728  32.583 1.00 33.94 ? 510 HOH A O     1 
HETATM 3080 O  O     . HOH P 7 .   ? -19.882 -24.498 25.238 1.00 19.41 ? 511 HOH A O     1 
HETATM 3081 O  O     . HOH P 7 .   ? -25.010 -19.112 34.965 1.00 33.56 ? 512 HOH A O     1 
HETATM 3082 O  O     . HOH P 7 .   ? 0.208   -7.355  32.148 1.00 32.10 ? 513 HOH A O     1 
HETATM 3083 O  O     . HOH P 7 .   ? -40.503 9.736   31.794 1.00 37.29 ? 514 HOH A O     1 
HETATM 3084 O  O     . HOH P 7 .   ? -21.947 -25.911 39.175 1.00 30.35 ? 515 HOH A O     1 
HETATM 3085 O  O     . HOH P 7 .   ? -17.036 -21.694 17.716 1.00 37.82 ? 516 HOH A O     1 
HETATM 3086 O  O     . HOH P 7 .   ? -17.137 -11.913 23.578 1.00 31.72 ? 517 HOH A O     1 
HETATM 3087 O  O     . HOH P 7 .   ? -24.499 -18.712 30.711 1.00 20.89 ? 518 HOH A O     1 
HETATM 3088 O  O     . HOH P 7 .   ? 0.546   -15.969 39.604 1.00 46.73 ? 519 HOH A O     1 
HETATM 3089 O  O     . HOH P 7 .   ? -23.862 -24.238 24.933 1.00 41.18 ? 520 HOH A O     1 
HETATM 3090 O  O     . HOH P 7 .   ? -2.541  -14.195 41.062 1.00 32.33 ? 521 HOH A O     1 
HETATM 3091 O  O     . HOH P 7 .   ? -7.233  -17.224 15.534 1.00 23.51 ? 522 HOH A O     1 
HETATM 3092 O  O     . HOH P 7 .   ? -12.181 -19.179 49.500 1.00 35.58 ? 523 HOH A O     1 
HETATM 3093 O  O     . HOH P 7 .   ? -40.052 13.340  30.993 1.00 42.94 ? 524 HOH A O     1 
HETATM 3094 O  O     . HOH P 7 .   ? -33.333 8.724   39.633 1.00 31.81 ? 525 HOH A O     1 
HETATM 3095 O  O     . HOH P 7 .   ? -10.210 -34.254 32.108 1.00 35.72 ? 526 HOH A O     1 
HETATM 3096 O  O     . HOH P 7 .   ? -42.683 2.939   20.730 1.00 33.54 ? 527 HOH A O     1 
HETATM 3097 O  O     . HOH P 7 .   ? -38.729 4.853   18.267 1.00 33.98 ? 528 HOH A O     1 
HETATM 3098 O  O     . HOH P 7 .   ? -39.474 1.417   39.430 1.00 37.63 ? 529 HOH A O     1 
HETATM 3099 O  O     . HOH P 7 .   ? -18.264 -15.143 40.659 1.00 38.37 ? 530 HOH A O     1 
HETATM 3100 O  O     . HOH P 7 .   ? -10.263 -5.632  31.459 1.00 36.04 ? 531 HOH A O     1 
HETATM 3101 O  O     . HOH P 7 .   ? -8.395  -7.516  31.395 1.00 39.25 ? 532 HOH A O     1 
HETATM 3102 O  O     . HOH P 7 .   ? -35.724 10.166  14.336 1.00 37.80 ? 533 HOH A O     1 
HETATM 3103 O  O     . HOH P 7 .   ? -49.757 10.925  12.792 1.00 34.77 ? 534 HOH A O     1 
HETATM 3104 O  O     . HOH P 7 .   ? -26.077 1.496   17.610 1.00 35.55 ? 535 HOH A O     1 
HETATM 3105 O  O     . HOH P 7 .   ? -38.975 20.181  35.638 1.00 39.12 ? 536 HOH A O     1 
HETATM 3106 O  O     . HOH P 7 .   ? -47.466 6.817   29.819 1.00 24.40 ? 537 HOH A O     1 
HETATM 3107 O  O     . HOH P 7 .   ? -23.481 8.877   19.874 1.00 34.66 ? 538 HOH A O     1 
HETATM 3108 O  O     . HOH P 7 .   ? -21.215 -28.291 39.748 1.00 38.31 ? 539 HOH A O     1 
HETATM 3109 O  O     . HOH P 7 .   ? -33.818 18.454  38.585 1.00 46.51 ? 540 HOH A O     1 
HETATM 3110 O  O     . HOH P 7 .   ? -10.529 -3.885  28.011 1.00 36.04 ? 541 HOH A O     1 
HETATM 3111 O  O     . HOH P 7 .   ? -50.520 5.852   22.182 1.00 35.07 ? 542 HOH A O     1 
HETATM 3112 O  O     . HOH P 7 .   ? -3.676  -11.576 40.716 1.00 27.43 ? 543 HOH A O     1 
HETATM 3113 O  O     . HOH P 7 .   ? -22.036 -12.483 31.005 1.00 36.21 ? 544 HOH A O     1 
HETATM 3114 O  O     . HOH P 7 .   ? -17.218 -21.550 22.157 1.00 35.58 ? 545 HOH A O     1 
HETATM 3115 O  O     . HOH P 7 .   ? -0.925  -23.573 17.886 1.00 32.81 ? 546 HOH A O     1 
HETATM 3116 O  O     . HOH P 7 .   ? 0.616   -25.903 23.734 1.00 35.00 ? 547 HOH A O     1 
HETATM 3117 O  O     . HOH P 7 .   ? -52.504 7.745   20.811 1.00 37.98 ? 548 HOH A O     1 
HETATM 3118 O  O     . HOH Q 7 .   ? 34.043  -33.317 18.255 1.00 19.80 ? 501 HOH B O     1 
HETATM 3119 O  O     . HOH Q 7 .   ? 10.773  -21.682 21.260 1.00 34.18 ? 502 HOH B O     1 
HETATM 3120 O  O     . HOH Q 7 .   ? 19.843  -20.991 29.407 1.00 14.80 ? 503 HOH B O     1 
HETATM 3121 O  O     . HOH Q 7 .   ? 32.648  -20.212 17.877 1.00 30.89 ? 504 HOH B O     1 
HETATM 3122 O  O     . HOH Q 7 .   ? 12.360  -7.167  20.162 1.00 29.09 ? 505 HOH B O     1 
HETATM 3123 O  O     . HOH Q 7 .   ? 11.337  -11.227 24.597 1.00 21.73 ? 506 HOH B O     1 
HETATM 3124 O  O     . HOH Q 7 .   ? 10.420  -27.273 30.897 1.00 37.07 ? 507 HOH B O     1 
HETATM 3125 O  O     . HOH Q 7 .   ? -12.034 -12.405 14.781 1.00 29.38 ? 508 HOH B O     1 
HETATM 3126 O  O     . HOH Q 7 .   ? -2.584  -4.060  8.045  1.00 28.36 ? 509 HOH B O     1 
HETATM 3127 O  O     . HOH Q 7 .   ? -1.902  -13.709 13.720 1.00 25.35 ? 510 HOH B O     1 
HETATM 3128 O  O     . HOH Q 7 .   ? 19.772  -29.276 40.258 1.00 36.72 ? 511 HOH B O     1 
HETATM 3129 O  O     . HOH Q 7 .   ? 43.259  -20.938 23.868 1.00 23.60 ? 512 HOH B O     1 
HETATM 3130 O  O     . HOH Q 7 .   ? 11.802  2.119   24.935 1.00 39.63 ? 513 HOH B O     1 
HETATM 3131 O  O     . HOH Q 7 .   ? 13.368  -3.738  5.292  1.00 36.12 ? 514 HOH B O     1 
HETATM 3132 O  O     . HOH Q 7 .   ? 40.870  -27.344 37.129 1.00 28.84 ? 515 HOH B O     1 
HETATM 3133 O  O     . HOH Q 7 .   ? -9.474  -6.329  18.153 1.00 21.39 ? 516 HOH B O     1 
HETATM 3134 O  O     . HOH Q 7 .   ? 15.955  -38.110 37.125 1.00 38.71 ? 517 HOH B O     1 
HETATM 3135 O  O     . HOH Q 7 .   ? 30.374  -28.951 41.145 1.00 33.43 ? 518 HOH B O     1 
HETATM 3136 O  O     . HOH Q 7 .   ? 24.079  -14.597 20.830 1.00 48.14 ? 519 HOH B O     1 
HETATM 3137 O  O     . HOH Q 7 .   ? 8.014   -5.878  28.840 1.00 23.18 ? 520 HOH B O     1 
HETATM 3138 O  O     . HOH Q 7 .   ? -1.525  -15.980 9.027  1.00 42.97 ? 521 HOH B O     1 
HETATM 3139 O  O     . HOH Q 7 .   ? 12.869  -28.674 22.416 1.00 38.19 ? 522 HOH B O     1 
HETATM 3140 O  O     . HOH Q 7 .   ? 3.237   -8.030  -0.357 1.00 35.45 ? 523 HOH B O     1 
HETATM 3141 O  O     . HOH Q 7 .   ? 19.787  -24.130 38.937 1.00 40.90 ? 524 HOH B O     1 
HETATM 3142 O  O     . HOH Q 7 .   ? 17.192  -2.718  23.908 1.00 37.60 ? 525 HOH B O     1 
HETATM 3143 O  O     . HOH Q 7 .   ? 14.689  -20.681 32.281 1.00 29.34 ? 526 HOH B O     1 
HETATM 3144 O  O     . HOH Q 7 .   ? 23.281  -13.950 31.722 1.00 42.19 ? 527 HOH B O     1 
HETATM 3145 O  O     . HOH Q 7 .   ? 13.747  -17.168 28.992 1.00 33.76 ? 528 HOH B O     1 
HETATM 3146 O  O     . HOH Q 7 .   ? 9.976   -31.164 26.972 1.00 38.24 ? 529 HOH B O     1 
HETATM 3147 O  O     . HOH Q 7 .   ? 7.002   3.323   23.430 1.00 37.60 ? 530 HOH B O     1 
HETATM 3148 O  O     . HOH Q 7 .   ? 16.346  -22.805 31.565 1.00 19.44 ? 531 HOH B O     1 
HETATM 3149 O  O     . HOH Q 7 .   ? 1.692   -12.857 19.187 1.00 22.41 ? 532 HOH B O     1 
HETATM 3150 O  O     . HOH Q 7 .   ? 36.759  -17.542 35.694 1.00 33.58 ? 533 HOH B O     1 
HETATM 3151 O  O     . HOH Q 7 .   ? 37.065  -21.601 28.787 1.00 36.03 ? 534 HOH B O     1 
HETATM 3152 O  O     . HOH Q 7 .   ? 32.404  -10.349 28.493 1.00 34.88 ? 535 HOH B O     1 
HETATM 3153 O  O     . HOH Q 7 .   ? 28.451  -9.010  28.547 1.00 46.57 ? 536 HOH B O     1 
HETATM 3154 O  O     . HOH R 7 .   ? 30.683  -15.942 32.556 1.00 34.78 ? 101 HOH E O     1 
HETATM 3155 O  O     . HOH R 7 .   ? 36.715  -21.210 32.452 1.00 25.07 ? 102 HOH E O     1 
HETATM 3156 O  O     . HOH R 7 .   ? 45.111  -21.537 37.607 1.00 40.42 ? 103 HOH E O     1 
HETATM 3157 O  O     . HOH S 7 .   ? -5.090  -9.465  26.235 1.00 38.53 ? 101 HOH P O     1 
HETATM 3158 O  O     . HOH S 7 .   ? -11.159 -10.172 19.467 1.00 26.01 ? 102 HOH P O     1 
HETATM 3159 O  O     . HOH S 7 .   ? -4.419  -25.643 13.688 1.00 34.70 ? 103 HOH P O     1 
HETATM 3160 O  O     . HOH S 7 .   ? -5.070  -28.017 14.959 1.00 43.93 ? 104 HOH P O     1 
HETATM 3161 O  O     . HOH S 7 .   ? -2.802  -5.610  26.834 1.00 32.45 ? 105 HOH P O     1 
HETATM 3162 O  O     . HOH S 7 .   ? -10.539 -9.878  22.066 1.00 24.71 ? 106 HOH P O     1 
HETATM 3163 O  O     . HOH S 7 .   ? -6.416  -28.117 19.326 1.00 41.36 ? 107 HOH P O     1 
HETATM 3164 O  O     . HOH S 7 .   ? -5.325  -7.020  27.436 1.00 33.36 ? 108 HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.4155 0.6400 0.4656 -0.1420 -0.1163 -0.0129 143 GLY A N   
2    C CA  . GLY A 1   ? 0.4097 0.6502 0.4662 -0.1568 -0.1096 -0.0222 143 GLY A CA  
3    C C   . GLY A 1   ? 0.4243 0.7075 0.4833 -0.1820 -0.1270 -0.0122 143 GLY A C   
4    O O   . GLY A 1   ? 0.4568 0.7324 0.4801 -0.2111 -0.1318 -0.0169 143 GLY A O   
5    N N   . PRO A 2   ? 0.4121 0.7433 0.5127 -0.1727 -0.1359 0.0011  144 PRO A N   
6    C CA  . PRO A 2   ? 0.3819 0.7283 0.5255 -0.1399 -0.1284 0.0048  144 PRO A CA  
7    C C   . PRO A 2   ? 0.3660 0.6854 0.5066 -0.1353 -0.1054 -0.0133 144 PRO A C   
8    O O   . PRO A 2   ? 0.3490 0.6562 0.5068 -0.1080 -0.0947 -0.0156 144 PRO A O   
9    C CB  . PRO A 2   ? 0.3799 0.7931 0.5630 -0.1434 -0.1425 0.0206  144 PRO A CB  
10   C CG  . PRO A 2   ? 0.4114 0.8446 0.5739 -0.1735 -0.1642 0.0320  144 PRO A CG  
11   C CD  . PRO A 2   ? 0.4284 0.8089 0.5348 -0.1988 -0.1551 0.0138  144 PRO A CD  
12   N N   . LEU A 3   ? 0.3762 0.6826 0.4919 -0.1629 -0.0985 -0.0255 145 LEU A N   
13   C CA  . LEU A 3   ? 0.3631 0.6397 0.4721 -0.1616 -0.0790 -0.0402 145 LEU A CA  
14   C C   . LEU A 3   ? 0.3693 0.5859 0.4424 -0.1619 -0.0664 -0.0548 145 LEU A C   
15   O O   . LEU A 3   ? 0.3644 0.5540 0.4342 -0.1563 -0.0519 -0.0640 145 LEU A O   
16   C CB  . LEU A 3   ? 0.3726 0.6698 0.4805 -0.1898 -0.0786 -0.0431 145 LEU A CB  
17   C CG  . LEU A 3   ? 0.3543 0.7174 0.5057 -0.1866 -0.0857 -0.0296 145 LEU A CG  
18   C CD1 . LEU A 3   ? 0.3784 0.7601 0.5244 -0.2195 -0.0847 -0.0324 145 LEU A CD1 
19   C CD2 . LEU A 3   ? 0.3134 0.6861 0.4977 -0.1533 -0.0742 -0.0285 145 LEU A CD2 
20   N N   . GLY A 4   ? 0.3849 0.5845 0.4329 -0.1683 -0.0721 -0.0557 146 GLY A N   
21   C CA  . GLY A 4   ? 0.3894 0.5408 0.4083 -0.1663 -0.0595 -0.0687 146 GLY A CA  
22   C C   . GLY A 4   ? 0.3639 0.4950 0.3944 -0.1382 -0.0499 -0.0687 146 GLY A C   
23   O O   . GLY A 4   ? 0.3499 0.4991 0.4064 -0.1186 -0.0542 -0.0587 146 GLY A O   
24   N N   . SER A 5   ? 0.3623 0.4556 0.3731 -0.1370 -0.0363 -0.0806 147 SER A N   
25   C CA  . SER A 5   ? 0.3422 0.4146 0.3576 -0.1159 -0.0276 -0.0810 147 SER A CA  
26   C C   . SER A 5   ? 0.3168 0.3937 0.3567 -0.0989 -0.0232 -0.0771 147 SER A C   
27   O O   . SER A 5   ? 0.3013 0.3716 0.3485 -0.0818 -0.0218 -0.0729 147 SER A O   
28   C CB  . SER A 5   ? 0.3409 0.4164 0.3510 -0.1091 -0.0359 -0.0728 147 SER A CB  
29   O OG  . SER A 5   ? 0.3628 0.4323 0.3451 -0.1268 -0.0371 -0.0780 147 SER A OG  
30   N N   . ALA A 6   ? 0.3135 0.3999 0.3619 -0.1070 -0.0205 -0.0791 148 ALA A N   
31   C CA  . ALA A 6   ? 0.2967 0.3915 0.3651 -0.0953 -0.0152 -0.0763 148 ALA A CA  
32   C C   . ALA A 6   ? 0.2911 0.3544 0.3528 -0.0883 -0.0036 -0.0806 148 ALA A C   
33   O O   . ALA A 6   ? 0.2732 0.3407 0.3466 -0.0779 0.0004  -0.0777 148 ALA A O   
34   C CB  . ALA A 6   ? 0.2952 0.4163 0.3742 -0.1101 -0.0165 -0.0753 148 ALA A CB  
35   N N   . ARG A 7   ? 0.3059 0.3395 0.3494 -0.0938 0.0018  -0.0873 149 ARG A N   
36   C CA  . ARG A 7   ? 0.3122 0.3187 0.3529 -0.0873 0.0111  -0.0889 149 ARG A CA  
37   C C   . ARG A 7   ? 0.3162 0.3036 0.3489 -0.0776 0.0152  -0.0910 149 ARG A C   
38   O O   . ARG A 7   ? 0.3283 0.2922 0.3564 -0.0754 0.0229  -0.0945 149 ARG A O   
39   C CB  . ARG A 7   ? 0.3306 0.3184 0.3624 -0.1019 0.0156  -0.0937 149 ARG A CB  
40   C CG  . ARG A 7   ? 0.3372 0.3444 0.3793 -0.1107 0.0139  -0.0889 149 ARG A CG  
41   C CD  . ARG A 7   ? 0.3726 0.3659 0.4022 -0.1325 0.0148  -0.0928 149 ARG A CD  
42   N NE  . ARG A 7   ? 0.4099 0.3572 0.4224 -0.1333 0.0212  -0.0990 149 ARG A NE  
43   C CZ  . ARG A 7   ? 0.4366 0.3601 0.4295 -0.1443 0.0232  -0.1096 149 ARG A CZ  
44   N NH1 . ARG A 7   ? 0.4689 0.4109 0.4533 -0.1598 0.0172  -0.1140 149 ARG A NH1 
45   N NH2 . ARG A 7   ? 0.4953 0.3752 0.4763 -0.1401 0.0313  -0.1159 149 ARG A NH2 
46   N N   . ARG A 8   ? 0.3067 0.3058 0.3396 -0.0713 0.0100  -0.0876 150 ARG A N   
47   C CA  . ARG A 8   ? 0.3072 0.2962 0.3326 -0.0657 0.0134  -0.0886 150 ARG A CA  
48   C C   . ARG A 8   ? 0.2830 0.2814 0.3131 -0.0564 0.0068  -0.0798 150 ARG A C   
49   O O   . ARG A 8   ? 0.2744 0.2863 0.3092 -0.0554 -0.0015 -0.0752 150 ARG A O   
50   C CB  . ARG A 8   ? 0.3288 0.3170 0.3369 -0.0769 0.0139  -0.0961 150 ARG A CB  
51   C CG  . ARG A 8   ? 0.3698 0.3399 0.3663 -0.0878 0.0220  -0.1081 150 ARG A CG  
52   C CD  . ARG A 8   ? 0.4030 0.3743 0.3767 -0.1034 0.0215  -0.1169 150 ARG A CD  
53   N NE  . ARG A 8   ? 0.4277 0.3996 0.3926 -0.0993 0.0268  -0.1191 150 ARG A NE  
54   C CZ  . ARG A 8   ? 0.4631 0.4181 0.4226 -0.0943 0.0419  -0.1297 150 ARG A CZ  
55   N NH1 . ARG A 8   ? 0.4878 0.4174 0.4490 -0.0908 0.0522  -0.1386 150 ARG A NH1 
56   N NH2 . ARG A 8   ? 0.4491 0.4127 0.4024 -0.0922 0.0472  -0.1309 150 ARG A NH2 
57   N N   . LEU A 9   ? 0.2741 0.2649 0.3034 -0.0499 0.0104  -0.0770 151 LEU A N   
58   C CA  . LEU A 9   ? 0.2614 0.2543 0.2893 -0.0447 0.0043  -0.0691 151 LEU A CA  
59   C C   . LEU A 9   ? 0.2655 0.2581 0.2843 -0.0476 0.0067  -0.0685 151 LEU A C   
60   O O   . LEU A 9   ? 0.2714 0.2620 0.2921 -0.0474 0.0162  -0.0734 151 LEU A O   
61   C CB  . LEU A 9   ? 0.2509 0.2380 0.2856 -0.0379 0.0057  -0.0646 151 LEU A CB  
62   C CG  . LEU A 9   ? 0.2413 0.2317 0.2839 -0.0355 0.0056  -0.0655 151 LEU A CG  
63   C CD1 . LEU A 9   ? 0.2308 0.2142 0.2731 -0.0322 0.0075  -0.0616 151 LEU A CD1 
64   C CD2 . LEU A 9   ? 0.2294 0.2294 0.2748 -0.0324 -0.0013 -0.0647 151 LEU A CD2 
65   N N   . TYR A 10  ? 0.2654 0.2601 0.2751 -0.0501 -0.0014 -0.0620 152 TYR A N   
66   C CA  . TYR A 10  ? 0.2674 0.2656 0.2671 -0.0557 0.0001  -0.0589 152 TYR A CA  
67   C C   . TYR A 10  ? 0.2571 0.2522 0.2612 -0.0521 0.0002  -0.0519 152 TYR A C   
68   O O   . TYR A 10  ? 0.2495 0.2344 0.2535 -0.0484 -0.0062 -0.0473 152 TYR A O   
69   C CB  . TYR A 10  ? 0.2774 0.2764 0.2616 -0.0638 -0.0112 -0.0524 152 TYR A CB  
70   C CG  . TYR A 10  ? 0.2849 0.2866 0.2560 -0.0725 -0.0125 -0.0456 152 TYR A CG  
71   C CD1 . TYR A 10  ? 0.2926 0.2829 0.2585 -0.0726 -0.0208 -0.0354 152 TYR A CD1 
72   C CD2 . TYR A 10  ? 0.2836 0.2988 0.2451 -0.0826 -0.0046 -0.0502 152 TYR A CD2 
73   C CE1 . TYR A 10  ? 0.2984 0.2921 0.2507 -0.0845 -0.0229 -0.0279 152 TYR A CE1 
74   C CE2 . TYR A 10  ? 0.3003 0.3238 0.2501 -0.0932 -0.0050 -0.0433 152 TYR A CE2 
75   C CZ  . TYR A 10  ? 0.3069 0.3202 0.2525 -0.0950 -0.0151 -0.0311 152 TYR A CZ  
76   O OH  . TYR A 10  ? 0.3062 0.3283 0.2389 -0.1090 -0.0164 -0.0229 152 TYR A OH  
77   N N   . VAL A 11  ? 0.2556 0.2612 0.2638 -0.0536 0.0079  -0.0515 153 VAL A N   
78   C CA  . VAL A 11  ? 0.2523 0.2617 0.2648 -0.0540 0.0065  -0.0427 153 VAL A CA  
79   C C   . VAL A 11  ? 0.2669 0.2916 0.2712 -0.0645 0.0068  -0.0374 153 VAL A C   
80   O O   . VAL A 11  ? 0.2699 0.3128 0.2812 -0.0644 0.0175  -0.0419 153 VAL A O   
81   C CB  . VAL A 11  ? 0.2424 0.2583 0.2747 -0.0454 0.0145  -0.0429 153 VAL A CB  
82   C CG1 . VAL A 11  ? 0.2113 0.2330 0.2468 -0.0485 0.0091  -0.0311 153 VAL A CG1 
83   C CG2 . VAL A 11  ? 0.2326 0.2347 0.2704 -0.0387 0.0156  -0.0485 153 VAL A CG2 
84   N N   . GLY A 12  ? 0.2795 0.2952 0.2677 -0.0739 -0.0042 -0.0284 154 GLY A N   
85   C CA  . GLY A 12  ? 0.2917 0.3208 0.2686 -0.0883 -0.0060 -0.0208 154 GLY A CA  
86   C C   . GLY A 12  ? 0.2919 0.3343 0.2755 -0.0939 -0.0067 -0.0116 154 GLY A C   
87   O O   . GLY A 12  ? 0.2837 0.3164 0.2732 -0.0890 -0.0099 -0.0093 154 GLY A O   
88   N N   . ASN A 13  ? 0.3028 0.3708 0.2846 -0.1064 -0.0037 -0.0058 155 ASN A N   
89   C CA  . ASN A 13  ? 0.3099 0.3996 0.2979 -0.1169 -0.0060 0.0058  155 ASN A CA  
90   C C   . ASN A 13  ? 0.2984 0.4147 0.3194 -0.1035 0.0026  0.0064  155 ASN A C   
91   O O   . ASN A 13  ? 0.2978 0.4201 0.3242 -0.1081 -0.0042 0.0164  155 ASN A O   
92   C CB  . ASN A 13  ? 0.3256 0.3842 0.2904 -0.1289 -0.0216 0.0143  155 ASN A CB  
93   C CG  . ASN A 13  ? 0.3379 0.4157 0.2955 -0.1508 -0.0278 0.0282  155 ASN A CG  
94   O OD1 . ASN A 13  ? 0.3288 0.4412 0.2917 -0.1612 -0.0224 0.0329  155 ASN A OD1 
95   N ND2 . ASN A 13  ? 0.3437 0.4002 0.2873 -0.1600 -0.0384 0.0344  155 ASN A ND2 
96   N N   . ILE A 14  ? 0.2953 0.4257 0.3368 -0.0877 0.0169  -0.0038 156 ILE A N   
97   C CA  . ILE A 14  ? 0.2880 0.4407 0.3625 -0.0726 0.0245  -0.0015 156 ILE A CA  
98   C C   . ILE A 14  ? 0.2981 0.4994 0.3925 -0.0785 0.0298  0.0086  156 ILE A C   
99   O O   . ILE A 14  ? 0.3100 0.5310 0.3962 -0.0893 0.0360  0.0065  156 ILE A O   
100  C CB  . ILE A 14  ? 0.2872 0.4311 0.3762 -0.0524 0.0387  -0.0165 156 ILE A CB  
101  C CG1 . ILE A 14  ? 0.2901 0.4559 0.3824 -0.0511 0.0551  -0.0272 156 ILE A CG1 
102  C CG2 . ILE A 14  ? 0.2727 0.3759 0.3421 -0.0505 0.0333  -0.0258 156 ILE A CG2 
103  C CD1 . ILE A 14  ? 0.2939 0.4398 0.3877 -0.0370 0.0677  -0.0448 156 ILE A CD1 
104  N N   . PRO A 15  ? 0.2984 0.5233 0.4198 -0.0724 0.0269  0.0209  157 PRO A N   
105  C CA  . PRO A 15  ? 0.3022 0.5828 0.4515 -0.0753 0.0321  0.0324  157 PRO A CA  
106  C C   . PRO A 15  ? 0.3109 0.6180 0.4863 -0.0564 0.0543  0.0202  157 PRO A C   
107  O O   . PRO A 15  ? 0.3207 0.6051 0.5056 -0.0351 0.0638  0.0078  157 PRO A O   
108  C CB  . PRO A 15  ? 0.2936 0.5876 0.4680 -0.0687 0.0224  0.0483  157 PRO A CB  
109  C CG  . PRO A 15  ? 0.2894 0.5380 0.4572 -0.0545 0.0201  0.0405  157 PRO A CG  
110  C CD  . PRO A 15  ? 0.2955 0.5001 0.4240 -0.0635 0.0184  0.0261  157 PRO A CD  
111  N N   . PHE A 16  ? 0.3222 0.6756 0.5069 -0.0656 0.0635  0.0229  158 PHE A N   
112  C CA  . PHE A 16  ? 0.3318 0.7118 0.5381 -0.0486 0.0881  0.0084  158 PHE A CA  
113  C C   . PHE A 16  ? 0.3310 0.7359 0.5881 -0.0186 0.0973  0.0125  158 PHE A C   
114  O O   . PHE A 16  ? 0.3226 0.7517 0.6037 -0.0183 0.0845  0.0328  158 PHE A O   
115  C CB  . PHE A 16  ? 0.3465 0.7765 0.5504 -0.0685 0.0962  0.0118  158 PHE A CB  
116  C CG  . PHE A 16  ? 0.3650 0.8239 0.5853 -0.0540 0.1248  -0.0064 158 PHE A CG  
117  C CD1 . PHE A 16  ? 0.3915 0.8185 0.5777 -0.0579 0.1357  -0.0277 158 PHE A CD1 
118  C CD2 . PHE A 16  ? 0.3809 0.9009 0.6504 -0.0370 0.1412  -0.0024 158 PHE A CD2 
119  C CE1 . PHE A 16  ? 0.4076 0.8590 0.6029 -0.0472 0.1640  -0.0471 158 PHE A CE1 
120  C CE2 . PHE A 16  ? 0.3890 0.9354 0.6732 -0.0220 0.1711  -0.0222 158 PHE A CE2 
121  C CZ  . PHE A 16  ? 0.4061 0.9159 0.6504 -0.0282 0.1832  -0.0458 158 PHE A CZ  
122  N N   . GLY A 17  ? 0.3432 0.7385 0.6141 0.0059  0.1183  -0.0064 159 GLY A N   
123  C CA  . GLY A 17  ? 0.3467 0.7585 0.6662 0.0386  0.1290  -0.0042 159 GLY A CA  
124  C C   . GLY A 17  ? 0.3460 0.7050 0.6654 0.0544  0.1191  -0.0034 159 GLY A C   
125  O O   . GLY A 17  ? 0.3597 0.7128 0.7106 0.0832  0.1298  -0.0065 159 GLY A O   
126  N N   . ILE A 18  ? 0.3318 0.6512 0.6157 0.0357  0.0995  0.0007  160 ILE A N   
127  C CA  . ILE A 18  ? 0.3282 0.6050 0.6108 0.0453  0.0880  0.0051  160 ILE A CA  
128  C C   . ILE A 18  ? 0.3460 0.5796 0.6234 0.0637  0.1035  -0.0167 160 ILE A C   
129  O O   . ILE A 18  ? 0.3612 0.5839 0.6165 0.0588  0.1171  -0.0370 160 ILE A O   
130  C CB  . ILE A 18  ? 0.3170 0.5638 0.5608 0.0207  0.0675  0.0105  160 ILE A CB  
131  C CG1 . ILE A 18  ? 0.3217 0.5460 0.5713 0.0259  0.0529  0.0237  160 ILE A CG1 
132  C CG2 . ILE A 18  ? 0.3144 0.5224 0.5198 0.0115  0.0717  -0.0096 160 ILE A CG2 
133  C CD1 . ILE A 18  ? 0.3234 0.5907 0.6053 0.0270  0.0419  0.0492  160 ILE A CD1 
134  N N   . THR A 19  ? 0.3530 0.5614 0.6483 0.0824  0.1009  -0.0117 161 THR A N   
135  C CA  . THR A 19  ? 0.3792 0.5413 0.6682 0.0985  0.1147  -0.0313 161 THR A CA  
136  C C   . THR A 19  ? 0.3768 0.4880 0.6275 0.0834  0.1037  -0.0379 161 THR A C   
137  O O   . THR A 19  ? 0.3534 0.4633 0.5889 0.0663  0.0853  -0.0253 161 THR A O   
138  C CB  . THR A 19  ? 0.4028 0.5574 0.7309 0.1276  0.1178  -0.0218 161 THR A CB  
139  O OG1 . THR A 19  ? 0.3865 0.5272 0.7148 0.1218  0.0953  0.0000  161 THR A OG1 
140  C CG2 . THR A 19  ? 0.3980 0.6106 0.7741 0.1472  0.1285  -0.0123 161 THR A CG2 
141  N N   . GLU A 20  ? 0.4024 0.4727 0.6380 0.0895  0.1160  -0.0583 162 GLU A N   
142  C CA  . GLU A 20  ? 0.4075 0.4327 0.6113 0.0763  0.1071  -0.0647 162 GLU A CA  
143  C C   . GLU A 20  ? 0.4046 0.4105 0.6203 0.0818  0.0929  -0.0466 162 GLU A C   
144  O O   . GLU A 20  ? 0.3906 0.3805 0.5857 0.0659  0.0792  -0.0416 162 GLU A O   
145  C CB  . GLU A 20  ? 0.4382 0.4266 0.6206 0.0776  0.1236  -0.0909 162 GLU A CB  
146  C CG  . GLU A 20  ? 0.4535 0.4610 0.6118 0.0620  0.1320  -0.1063 162 GLU A CG  
147  C CD  . GLU A 20  ? 0.4920 0.4709 0.6256 0.0598  0.1503  -0.1337 162 GLU A CD  
148  O OE1 . GLU A 20  ? 0.5537 0.4977 0.6925 0.0751  0.1622  -0.1448 162 GLU A OE1 
149  O OE2 . GLU A 20  ? 0.4852 0.4754 0.5916 0.0410  0.1521  -0.1438 162 GLU A OE2 
150  N N   . GLU A 21  ? 0.4185 0.4303 0.6689 0.1040  0.0960  -0.0353 163 GLU A N   
151  C CA  . GLU A 21  ? 0.4284 0.4246 0.6915 0.1090  0.0813  -0.0144 163 GLU A CA  
152  C C   . GLU A 21  ? 0.3939 0.4223 0.6571 0.0929  0.0612  0.0081  163 GLU A C   
153  O O   . GLU A 21  ? 0.3831 0.3922 0.6283 0.0790  0.0474  0.0168  163 GLU A O   
154  C CB  . GLU A 21  ? 0.4572 0.4551 0.7615 0.1394  0.0886  -0.0056 163 GLU A CB  
155  C CG  . GLU A 21  ? 0.5034 0.4558 0.8100 0.1470  0.0797  0.0060  163 GLU A CG  
156  C CD  . GLU A 21  ? 0.5344 0.4958 0.8879 0.1774  0.0796  0.0251  163 GLU A CD  
157  O OE1 . GLU A 21  ? 0.5734 0.5351 0.9376 0.1757  0.0600  0.0522  163 GLU A OE1 
158  O OE2 . GLU A 21  ? 0.5839 0.5537 0.9638 0.2029  0.0989  0.0135  163 GLU A OE2 
159  N N   . ALA A 22  ? 0.3759 0.4534 0.6571 0.0926  0.0608  0.0165  164 ALA A N   
160  C CA  . ALA A 22  ? 0.3542 0.4622 0.6338 0.0756  0.0424  0.0374  164 ALA A CA  
161  C C   . ALA A 22  ? 0.3385 0.4296 0.5762 0.0500  0.0344  0.0295  164 ALA A C   
162  O O   . ALA A 22  ? 0.3302 0.4198 0.5548 0.0354  0.0193  0.0425  164 ALA A O   
163  C CB  . ALA A 22  ? 0.3379 0.5013 0.6415 0.0768  0.0449  0.0455  164 ALA A CB  
164  N N   . MET A 23  ? 0.3398 0.4190 0.5565 0.0450  0.0449  0.0083  165 MET A N   
165  C CA  . MET A 23  ? 0.3287 0.3919 0.5102 0.0251  0.0385  0.0003  165 MET A CA  
166  C C   . MET A 23  ? 0.3241 0.3502 0.4906 0.0224  0.0344  -0.0028 165 MET A C   
167  O O   . MET A 23  ? 0.3114 0.3305 0.4583 0.0082  0.0248  0.0001  165 MET A O   
168  C CB  . MET A 23  ? 0.3265 0.3902 0.4924 0.0208  0.0492  -0.0183 165 MET A CB  
169  C CG  . MET A 23  ? 0.3322 0.3803 0.4661 0.0038  0.0418  -0.0251 165 MET A CG  
170  S SD  . MET A 23  ? 0.3755 0.4450 0.4928 -0.0107 0.0403  -0.0271 165 MET A SD  
171  C CE  . MET A 23  ? 0.3720 0.4730 0.5034 -0.0165 0.0302  -0.0058 165 MET A CE  
172  N N   . MET A 24  ? 0.3379 0.3399 0.5132 0.0353  0.0427  -0.0091 166 MET A N   
173  C CA  . MET A 24  ? 0.3499 0.3175 0.5121 0.0306  0.0387  -0.0098 166 MET A CA  
174  C C   . MET A 24  ? 0.3407 0.3110 0.5072 0.0257  0.0245  0.0117  166 MET A C   
175  O O   . MET A 24  ? 0.3333 0.2930 0.4796 0.0110  0.0175  0.0129  166 MET A O   
176  C CB  . MET A 24  ? 0.3829 0.3192 0.5526 0.0447  0.0498  -0.0193 166 MET A CB  
177  C CG  . MET A 24  ? 0.3978 0.2967 0.5452 0.0339  0.0486  -0.0270 166 MET A CG  
178  S SD  . MET A 24  ? 0.4482 0.3050 0.5911 0.0437  0.0645  -0.0469 166 MET A SD  
179  C CE  . MET A 24  ? 0.4932 0.3325 0.6669 0.0677  0.0643  -0.0300 166 MET A CE  
180  N N   . ASP A 25  ? 0.3445 0.3323 0.5380 0.0375  0.0205  0.0291  167 ASP A N   
181  C CA  . ASP A 25  ? 0.3499 0.3435 0.5470 0.0310  0.0051  0.0526  167 ASP A CA  
182  C C   . ASP A 25  ? 0.3233 0.3350 0.4979 0.0094  -0.0046 0.0562  167 ASP A C   
183  O O   . ASP A 25  ? 0.3212 0.3238 0.4785 -0.0048 -0.0139 0.0646  167 ASP A O   
184  C CB  . ASP A 25  ? 0.3632 0.3831 0.5977 0.0476  0.0006  0.0731  167 ASP A CB  
185  C CG  . ASP A 25  ? 0.4136 0.4089 0.6724 0.0723  0.0089  0.0730  167 ASP A CG  
186  O OD1 . ASP A 25  ? 0.4582 0.4098 0.7003 0.0716  0.0135  0.0623  167 ASP A OD1 
187  O OD2 . ASP A 25  ? 0.4527 0.4728 0.7484 0.0926  0.0110  0.0840  167 ASP A OD2 
188  N N   . PHE A 26  ? 0.2990 0.3340 0.4717 0.0060  -0.0017 0.0494  168 PHE A N   
189  C CA  . PHE A 26  ? 0.2909 0.3369 0.4405 -0.0138 -0.0103 0.0520  168 PHE A CA  
190  C C   . PHE A 26  ? 0.2874 0.3074 0.4063 -0.0254 -0.0090 0.0383  168 PHE A C   
191  O O   . PHE A 26  ? 0.2934 0.3102 0.3933 -0.0400 -0.0166 0.0440  168 PHE A O   
192  C CB  . PHE A 26  ? 0.2763 0.3461 0.4268 -0.0166 -0.0076 0.0473  168 PHE A CB  
193  C CG  . PHE A 26  ? 0.2737 0.3479 0.3980 -0.0375 -0.0170 0.0501  168 PHE A CG  
194  C CD1 . PHE A 26  ? 0.2843 0.3758 0.4077 -0.0500 -0.0299 0.0689  168 PHE A CD1 
195  C CD2 . PHE A 26  ? 0.2723 0.3307 0.3712 -0.0451 -0.0137 0.0345  168 PHE A CD2 
196  C CE1 . PHE A 26  ? 0.2858 0.3749 0.3799 -0.0712 -0.0377 0.0694  168 PHE A CE1 
197  C CE2 . PHE A 26  ? 0.2781 0.3325 0.3511 -0.0627 -0.0214 0.0358  168 PHE A CE2 
198  C CZ  . PHE A 26  ? 0.2870 0.3547 0.3555 -0.0765 -0.0326 0.0519  168 PHE A CZ  
199  N N   . PHE A 27  ? 0.2829 0.2872 0.3973 -0.0196 0.0011  0.0203  169 PHE A N   
200  C CA  . PHE A 27  ? 0.2846 0.2719 0.3762 -0.0285 0.0029  0.0078  169 PHE A CA  
201  C C   . PHE A 27  ? 0.2920 0.2625 0.3782 -0.0330 0.0016  0.0111  169 PHE A C   
202  O O   . PHE A 27  ? 0.2865 0.2523 0.3546 -0.0437 0.0010  0.0064  169 PHE A O   
203  C CB  . PHE A 27  ? 0.2856 0.2662 0.3747 -0.0234 0.0117  -0.0097 169 PHE A CB  
204  C CG  . PHE A 27  ? 0.2729 0.2646 0.3534 -0.0268 0.0110  -0.0147 169 PHE A CG  
205  C CD1 . PHE A 27  ? 0.2768 0.2633 0.3388 -0.0349 0.0076  -0.0195 169 PHE A CD1 
206  C CD2 . PHE A 27  ? 0.2754 0.2827 0.3665 -0.0218 0.0142  -0.0141 169 PHE A CD2 
207  C CE1 . PHE A 27  ? 0.2875 0.2780 0.3396 -0.0383 0.0052  -0.0223 169 PHE A CE1 
208  C CE2 . PHE A 27  ? 0.2728 0.2887 0.3529 -0.0283 0.0122  -0.0166 169 PHE A CE2 
209  C CZ  . PHE A 27  ? 0.2702 0.2748 0.3299 -0.0367 0.0067  -0.0199 169 PHE A CZ  
210  N N   . ASN A 28  ? 0.3006 0.2613 0.4024 -0.0246 0.0020  0.0188  170 ASN A N   
211  C CA  . ASN A 28  ? 0.3165 0.2594 0.4113 -0.0318 -0.0014 0.0260  170 ASN A CA  
212  C C   . ASN A 28  ? 0.3195 0.2734 0.4056 -0.0445 -0.0124 0.0434  170 ASN A C   
213  O O   . ASN A 28  ? 0.3268 0.2748 0.3937 -0.0590 -0.0140 0.0439  170 ASN A O   
214  C CB  . ASN A 28  ? 0.3379 0.2591 0.4492 -0.0194 0.0012  0.0301  170 ASN A CB  
215  C CG  . ASN A 28  ? 0.3500 0.2494 0.4543 -0.0181 0.0117  0.0105  170 ASN A CG  
216  O OD1 . ASN A 28  ? 0.3362 0.2380 0.4242 -0.0296 0.0141  -0.0012 170 ASN A OD1 
217  N ND2 . ASN A 28  ? 0.3599 0.2392 0.4768 -0.0043 0.0179  0.0069  170 ASN A ND2 
218  N N   . ALA A 29  ? 0.3171 0.2906 0.4154 -0.0412 -0.0196 0.0571  171 ALA A N   
219  C CA  . ALA A 29  ? 0.3258 0.3120 0.4129 -0.0565 -0.0318 0.0746  171 ALA A CA  
220  C C   . ALA A 29  ? 0.3217 0.3097 0.3778 -0.0735 -0.0300 0.0624  171 ALA A C   
221  O O   . ALA A 29  ? 0.3333 0.3174 0.3672 -0.0901 -0.0337 0.0668  171 ALA A O   
222  C CB  . ALA A 29  ? 0.3197 0.3322 0.4287 -0.0507 -0.0403 0.0916  171 ALA A CB  
223  N N   . GLN A 30  ? 0.3036 0.2950 0.3568 -0.0692 -0.0236 0.0468  172 GLN A N   
224  C CA  . GLN A 30  ? 0.3087 0.2965 0.3342 -0.0815 -0.0214 0.0348  172 GLN A CA  
225  C C   . GLN A 30  ? 0.3136 0.2882 0.3242 -0.0853 -0.0130 0.0213  172 GLN A C   
226  O O   . GLN A 30  ? 0.3218 0.2938 0.3085 -0.0985 -0.0121 0.0176  172 GLN A O   
227  C CB  . GLN A 30  ? 0.2969 0.2875 0.3231 -0.0754 -0.0180 0.0236  172 GLN A CB  
228  C CG  . GLN A 30  ? 0.3063 0.3155 0.3405 -0.0784 -0.0261 0.0363  172 GLN A CG  
229  C CD  . GLN A 30  ? 0.3228 0.3354 0.3333 -0.0988 -0.0358 0.0457  172 GLN A CD  
230  O OE1 . GLN A 30  ? 0.3475 0.3466 0.3334 -0.1102 -0.0351 0.0412  172 GLN A OE1 
231  N NE2 . GLN A 30  ? 0.3241 0.3569 0.3408 -0.1053 -0.0444 0.0584  172 GLN A NE2 
232  N N   . MET A 31  ? 0.3082 0.2764 0.3322 -0.0752 -0.0063 0.0135  173 MET A N   
233  C CA  . MET A 31  ? 0.3162 0.2790 0.3312 -0.0804 0.0008  0.0039  173 MET A CA  
234  C C   . MET A 31  ? 0.3377 0.2996 0.3381 -0.0965 -0.0027 0.0153  173 MET A C   
235  O O   . MET A 31  ? 0.3405 0.3054 0.3238 -0.1067 0.0036  0.0070  173 MET A O   
236  C CB  . MET A 31  ? 0.3159 0.2717 0.3465 -0.0717 0.0056  -0.0021 173 MET A CB  
237  C CG  . MET A 31  ? 0.3098 0.2682 0.3487 -0.0602 0.0103  -0.0162 173 MET A CG  
238  S SD  . MET A 31  ? 0.3688 0.3359 0.3994 -0.0612 0.0167  -0.0326 173 MET A SD  
239  C CE  . MET A 31  ? 0.3036 0.2727 0.3374 -0.0693 0.0216  -0.0356 173 MET A CE  
240  N N   . ARG A 32  ? 0.3493 0.3088 0.3566 -0.0989 -0.0124 0.0348  174 ARG A N   
241  C CA  . ARG A 32  ? 0.3817 0.3395 0.3731 -0.1166 -0.0182 0.0492  174 ARG A CA  
242  C C   . ARG A 32  ? 0.3878 0.3552 0.3533 -0.1333 -0.0221 0.0523  174 ARG A C   
243  O O   . ARG A 32  ? 0.4021 0.3706 0.3428 -0.1502 -0.0177 0.0486  174 ARG A O   
244  C CB  . ARG A 32  ? 0.4048 0.3553 0.4126 -0.1129 -0.0298 0.0725  174 ARG A CB  
245  C CG  . ARG A 32  ? 0.4283 0.3595 0.4548 -0.1001 -0.0260 0.0706  174 ARG A CG  
246  C CD  . ARG A 32  ? 0.4636 0.3812 0.5016 -0.0982 -0.0380 0.0957  174 ARG A CD  
247  N NE  . ARG A 32  ? 0.5086 0.3996 0.5633 -0.0838 -0.0340 0.0929  174 ARG A NE  
248  C CZ  . ARG A 32  ? 0.5314 0.4159 0.6129 -0.0608 -0.0329 0.0937  174 ARG A CZ  
249  N NH1 . ARG A 32  ? 0.5256 0.4343 0.6249 -0.0492 -0.0363 0.0994  174 ARG A NH1 
250  N NH2 . ARG A 32  ? 0.5537 0.4075 0.6434 -0.0505 -0.0274 0.0882  174 ARG A NH2 
251  N N   . LEU A 33  ? 0.3762 0.3514 0.3459 -0.1308 -0.0300 0.0593  175 LEU A N   
252  C CA  . LEU A 33  ? 0.3965 0.3777 0.3382 -0.1493 -0.0350 0.0619  175 LEU A CA  
253  C C   . LEU A 33  ? 0.4018 0.3754 0.3182 -0.1537 -0.0215 0.0370  175 LEU A C   
254  O O   . LEU A 33  ? 0.4290 0.4005 0.3126 -0.1730 -0.0197 0.0336  175 LEU A O   
255  C CB  . LEU A 33  ? 0.3834 0.3769 0.3368 -0.1463 -0.0459 0.0730  175 LEU A CB  
256  C CG  . LEU A 33  ? 0.3868 0.3946 0.3623 -0.1456 -0.0615 0.1019  175 LEU A CG  
257  C CD1 . LEU A 33  ? 0.3651 0.3938 0.3613 -0.1390 -0.0697 0.1117  175 LEU A CD1 
258  C CD2 . LEU A 33  ? 0.4023 0.4135 0.3512 -0.1713 -0.0727 0.1194  175 LEU A CD2 
259  N N   . GLY A 34  ? 0.3791 0.3482 0.3102 -0.1357 -0.0119 0.0199  176 GLY A N   
260  C CA  . GLY A 34  ? 0.3857 0.3471 0.3002 -0.1337 0.0006  -0.0026 176 GLY A CA  
261  C C   . GLY A 34  ? 0.3935 0.3586 0.3038 -0.1357 0.0132  -0.0137 176 GLY A C   
262  O O   . GLY A 34  ? 0.4093 0.3719 0.3085 -0.1328 0.0251  -0.0319 176 GLY A O   
263  N N   . GLY A 35  ? 0.3920 0.3631 0.3124 -0.1402 0.0109  -0.0024 177 GLY A N   
264  C CA  . GLY A 35  ? 0.4008 0.3801 0.3169 -0.1470 0.0219  -0.0099 177 GLY A CA  
265  C C   . GLY A 35  ? 0.3819 0.3680 0.3197 -0.1304 0.0317  -0.0253 177 GLY A C   
266  O O   . GLY A 35  ? 0.3924 0.3917 0.3277 -0.1335 0.0436  -0.0366 177 GLY A O   
267  N N   . LEU A 36  ? 0.3643 0.3449 0.3237 -0.1140 0.0268  -0.0253 178 LEU A N   
268  C CA  . LEU A 36  ? 0.3509 0.3389 0.3295 -0.1002 0.0332  -0.0378 178 LEU A CA  
269  C C   . LEU A 36  ? 0.3520 0.3429 0.3456 -0.1028 0.0323  -0.0329 178 LEU A C   
270  O O   . LEU A 36  ? 0.3522 0.3549 0.3583 -0.0980 0.0377  -0.0422 178 LEU A O   
271  C CB  . LEU A 36  ? 0.3336 0.3137 0.3219 -0.0846 0.0287  -0.0413 178 LEU A CB  
272  C CG  . LEU A 36  ? 0.3451 0.3170 0.3167 -0.0826 0.0295  -0.0481 178 LEU A CG  
273  C CD1 . LEU A 36  ? 0.3123 0.2772 0.2936 -0.0698 0.0244  -0.0497 178 LEU A CD1 
274  C CD2 . LEU A 36  ? 0.3420 0.3194 0.3040 -0.0811 0.0422  -0.0637 178 LEU A CD2 
275  N N   . THR A 37  ? 0.3678 0.3465 0.3593 -0.1110 0.0246  -0.0175 179 THR A N   
276  C CA  . THR A 37  ? 0.3756 0.3464 0.3757 -0.1156 0.0229  -0.0120 179 THR A CA  
277  C C   . THR A 37  ? 0.3884 0.3743 0.3805 -0.1319 0.0302  -0.0152 179 THR A C   
278  O O   . THR A 37  ? 0.4001 0.3985 0.3764 -0.1428 0.0350  -0.0157 179 THR A O   
279  C CB  . THR A 37  ? 0.3960 0.3466 0.3942 -0.1200 0.0124  0.0077  179 THR A CB  
280  O OG1 . THR A 37  ? 0.4286 0.3728 0.4384 -0.1044 0.0068  0.0113  179 THR A OG1 
281  C CG2 . THR A 37  ? 0.4107 0.3430 0.4141 -0.1245 0.0106  0.0131  179 THR A CG2 
282  N N   . GLN A 38  ? 0.3885 0.3747 0.3896 -0.1359 0.0317  -0.0177 180 GLN A N   
283  C CA  . GLN A 38  ? 0.4007 0.4078 0.3972 -0.1536 0.0388  -0.0203 180 GLN A CA  
284  C C   . GLN A 38  ? 0.4221 0.4103 0.4096 -0.1729 0.0332  -0.0067 180 GLN A C   
285  O O   . GLN A 38  ? 0.4449 0.4503 0.4262 -0.1924 0.0381  -0.0061 180 GLN A O   
286  C CB  . GLN A 38  ? 0.3813 0.4138 0.3954 -0.1464 0.0453  -0.0348 180 GLN A CB  
287  C CG  . GLN A 38  ? 0.3714 0.4176 0.3937 -0.1262 0.0497  -0.0466 180 GLN A CG  
288  C CD  . GLN A 38  ? 0.3655 0.4438 0.4073 -0.1189 0.0557  -0.0582 180 GLN A CD  
289  O OE1 . GLN A 38  ? 0.4018 0.4939 0.4525 -0.1292 0.0551  -0.0576 180 GLN A OE1 
290  N NE2 . GLN A 38  ? 0.3707 0.4598 0.4191 -0.1016 0.0604  -0.0675 180 GLN A NE2 
291  N N   . ALA A 39  ? 0.4285 0.3813 0.4155 -0.1678 0.0233  0.0049  181 ALA A N   
292  C CA  . ALA A 39  ? 0.4637 0.3872 0.4417 -0.1831 0.0165  0.0189  181 ALA A CA  
293  C C   . ALA A 39  ? 0.4764 0.3653 0.4566 -0.1712 0.0058  0.0341  181 ALA A C   
294  O O   . ALA A 39  ? 0.4503 0.3387 0.4436 -0.1500 0.0048  0.0304  181 ALA A O   
295  C CB  . ALA A 39  ? 0.4640 0.3774 0.4476 -0.1868 0.0184  0.0099  181 ALA A CB  
296  N N   . PRO A 40  ? 0.5159 0.3770 0.4848 -0.1849 -0.0026 0.0528  182 PRO A N   
297  C CA  . PRO A 40  ? 0.5385 0.3663 0.5146 -0.1712 -0.0135 0.0695  182 PRO A CA  
298  C C   . PRO A 40  ? 0.5328 0.3411 0.5287 -0.1462 -0.0104 0.0578  182 PRO A C   
299  O O   . PRO A 40  ? 0.5331 0.3355 0.5287 -0.1480 -0.0033 0.0417  182 PRO A O   
300  C CB  . PRO A 40  ? 0.5892 0.3826 0.5494 -0.1914 -0.0214 0.0873  182 PRO A CB  
301  C CG  . PRO A 40  ? 0.5934 0.4014 0.5404 -0.2146 -0.0131 0.0756  182 PRO A CG  
302  C CD  . PRO A 40  ? 0.5485 0.4076 0.4981 -0.2141 -0.0031 0.0609  182 PRO A CD  
303  N N   . GLY A 41  ? 0.5271 0.3287 0.5393 -0.1249 -0.0155 0.0662  183 GLY A N   
304  C CA  . GLY A 41  ? 0.5263 0.3090 0.5567 -0.1012 -0.0110 0.0559  183 GLY A CA  
305  C C   . GLY A 41  ? 0.4847 0.2991 0.5263 -0.0874 -0.0035 0.0389  183 GLY A C   
306  O O   . GLY A 41  ? 0.4687 0.3154 0.5065 -0.0922 -0.0038 0.0381  183 GLY A O   
307  N N   . ASN A 42  ? 0.4778 0.2797 0.5304 -0.0714 0.0035  0.0252  184 ASN A N   
308  C CA  . ASN A 42  ? 0.4394 0.2670 0.5039 -0.0567 0.0087  0.0137  184 ASN A CA  
309  C C   . ASN A 42  ? 0.4177 0.2600 0.4735 -0.0636 0.0160  -0.0067 184 ASN A C   
310  O O   . ASN A 42  ? 0.4385 0.2614 0.4882 -0.0673 0.0209  -0.0182 184 ASN A O   
311  C CB  . ASN A 42  ? 0.4551 0.2666 0.5385 -0.0339 0.0126  0.0125  184 ASN A CB  
312  C CG  . ASN A 42  ? 0.4648 0.2824 0.5672 -0.0213 0.0040  0.0347  184 ASN A CG  
313  O OD1 . ASN A 42  ? 0.4394 0.2869 0.5429 -0.0260 -0.0031 0.0454  184 ASN A OD1 
314  N ND2 . ASN A 42  ? 0.5011 0.2901 0.6186 -0.0052 0.0045  0.0416  184 ASN A ND2 
315  N N   . PRO A 43  ? 0.3808 0.2557 0.4351 -0.0659 0.0160  -0.0105 185 PRO A N   
316  C CA  . PRO A 43  ? 0.3591 0.2515 0.4103 -0.0677 0.0211  -0.0271 185 PRO A CA  
317  C C   . PRO A 43  ? 0.3510 0.2406 0.4085 -0.0555 0.0257  -0.0386 185 PRO A C   
318  O O   . PRO A 43  ? 0.3484 0.2417 0.4004 -0.0607 0.0287  -0.0509 185 PRO A O   
319  C CB  . PRO A 43  ? 0.3347 0.2545 0.3841 -0.0682 0.0193  -0.0257 185 PRO A CB  
320  C CG  . PRO A 43  ? 0.3454 0.2634 0.3907 -0.0736 0.0140  -0.0101 185 PRO A CG  
321  C CD  . PRO A 43  ? 0.3696 0.2636 0.4227 -0.0678 0.0103  0.0013  185 PRO A CD  
322  N N   . VAL A 44  ? 0.3456 0.2331 0.4141 -0.0410 0.0262  -0.0341 186 VAL A N   
323  C CA  . VAL A 44  ? 0.3433 0.2323 0.4163 -0.0309 0.0325  -0.0455 186 VAL A CA  
324  C C   . VAL A 44  ? 0.3748 0.2326 0.4495 -0.0247 0.0394  -0.0511 186 VAL A C   
325  O O   . VAL A 44  ? 0.3987 0.2405 0.4842 -0.0156 0.0385  -0.0405 186 VAL A O   
326  C CB  . VAL A 44  ? 0.3280 0.2380 0.4128 -0.0199 0.0312  -0.0390 186 VAL A CB  
327  C CG1 . VAL A 44  ? 0.3095 0.2252 0.3964 -0.0126 0.0390  -0.0510 186 VAL A CG1 
328  C CG2 . VAL A 44  ? 0.3087 0.2406 0.3865 -0.0274 0.0245  -0.0346 186 VAL A CG2 
329  N N   . LEU A 45  ? 0.3863 0.2337 0.4490 -0.0302 0.0457  -0.0675 187 LEU A N   
330  C CA  . LEU A 45  ? 0.4252 0.2349 0.4821 -0.0272 0.0542  -0.0775 187 LEU A CA  
331  C C   . LEU A 45  ? 0.4312 0.2413 0.4964 -0.0106 0.0653  -0.0870 187 LEU A C   
332  O O   . LEU A 45  ? 0.4710 0.2506 0.5402 0.0009  0.0739  -0.0917 187 LEU A O   
333  C CB  . LEU A 45  ? 0.4403 0.2366 0.4743 -0.0467 0.0556  -0.0919 187 LEU A CB  
334  C CG  . LEU A 45  ? 0.4503 0.2441 0.4742 -0.0669 0.0476  -0.0860 187 LEU A CG  
335  C CD1 . LEU A 45  ? 0.4547 0.2568 0.4615 -0.0860 0.0471  -0.0988 187 LEU A CD1 
336  C CD2 . LEU A 45  ? 0.4781 0.2290 0.4965 -0.0702 0.0474  -0.0801 187 LEU A CD2 
337  N N   . ALA A 46  ? 0.4015 0.2446 0.4681 -0.0099 0.0661  -0.0906 188 ALA A N   
338  C CA  . ALA A 46  ? 0.4092 0.2584 0.4792 0.0009  0.0783  -0.1021 188 ALA A CA  
339  C C   . ALA A 46  ? 0.3742 0.2632 0.4465 -0.0011 0.0750  -0.0990 188 ALA A C   
340  O O   . ALA A 46  ? 0.3453 0.2505 0.4105 -0.0121 0.0643  -0.0933 188 ALA A O   
341  C CB  . ALA A 46  ? 0.4424 0.2650 0.4885 -0.0084 0.0887  -0.1237 188 ALA A CB  
342  N N   . VAL A 47  ? 0.3804 0.2842 0.4630 0.0101  0.0849  -0.1026 189 VAL A N   
343  C CA  . VAL A 47  ? 0.3614 0.3001 0.4439 0.0060  0.0822  -0.0989 189 VAL A CA  
344  C C   . VAL A 47  ? 0.3779 0.3221 0.4528 0.0072  0.0974  -0.1149 189 VAL A C   
345  O O   . VAL A 47  ? 0.4115 0.3423 0.4955 0.0206  0.1121  -0.1243 189 VAL A O   
346  C CB  . VAL A 47  ? 0.3460 0.3099 0.4530 0.0158  0.0763  -0.0803 189 VAL A CB  
347  C CG1 . VAL A 47  ? 0.3301 0.3277 0.4347 0.0093  0.0746  -0.0769 189 VAL A CG1 
348  C CG2 . VAL A 47  ? 0.3335 0.2916 0.4411 0.0106  0.0615  -0.0658 189 VAL A CG2 
349  N N   . GLN A 48  ? 0.3719 0.3336 0.4285 -0.0071 0.0945  -0.1185 190 GLN A N   
350  C CA  . GLN A 48  ? 0.3981 0.3695 0.4425 -0.0105 0.1090  -0.1332 190 GLN A CA  
351  C C   . GLN A 48  ? 0.3681 0.3773 0.4165 -0.0151 0.1053  -0.1226 190 GLN A C   
352  O O   . GLN A 48  ? 0.3492 0.3664 0.3877 -0.0270 0.0897  -0.1119 190 GLN A O   
353  C CB  . GLN A 48  ? 0.4205 0.3752 0.4315 -0.0295 0.1082  -0.1474 190 GLN A CB  
354  C CG  . GLN A 48  ? 0.4791 0.3966 0.4789 -0.0279 0.1207  -0.1657 190 GLN A CG  
355  C CD  . GLN A 48  ? 0.4967 0.3937 0.4733 -0.0469 0.1093  -0.1690 190 GLN A CD  
356  O OE1 . GLN A 48  ? 0.5354 0.4322 0.5216 -0.0480 0.0948  -0.1556 190 GLN A OE1 
357  N NE2 . GLN A 48  ? 0.5307 0.4132 0.4761 -0.0635 0.1163  -0.1871 190 GLN A NE2 
358  N N   . ILE A 49  ? 0.3643 0.3963 0.4284 -0.0052 0.1198  -0.1252 191 ILE A N   
359  C CA  . ILE A 49  ? 0.3452 0.4158 0.4147 -0.0117 0.1166  -0.1135 191 ILE A CA  
360  C C   . ILE A 49  ? 0.3545 0.4443 0.4048 -0.0235 0.1303  -0.1261 191 ILE A C   
361  O O   . ILE A 49  ? 0.3772 0.4647 0.4282 -0.0154 0.1511  -0.1439 191 ILE A O   
362  C CB  . ILE A 49  ? 0.3354 0.4315 0.4432 0.0061  0.1204  -0.1010 191 ILE A CB  
363  C CG1 . ILE A 49  ? 0.3166 0.4012 0.4366 0.0098  0.1022  -0.0834 191 ILE A CG1 
364  C CG2 . ILE A 49  ? 0.3228 0.4650 0.4365 -0.0026 0.1224  -0.0922 191 ILE A CG2 
365  C CD1 . ILE A 49  ? 0.3066 0.4207 0.4616 0.0222  0.1006  -0.0663 191 ILE A CD1 
366  N N   . ASN A 50  ? 0.3384 0.4440 0.3689 -0.0434 0.1184  -0.1168 192 ASN A N   
367  C CA  . ASN A 50  ? 0.3582 0.4940 0.3751 -0.0572 0.1285  -0.1206 192 ASN A CA  
368  C C   . ASN A 50  ? 0.3443 0.5197 0.3878 -0.0537 0.1286  -0.1047 192 ASN A C   
369  O O   . ASN A 50  ? 0.3190 0.4990 0.3594 -0.0643 0.1099  -0.0864 192 ASN A O   
370  C CB  . ASN A 50  ? 0.3551 0.4846 0.3351 -0.0827 0.1124  -0.1151 192 ASN A CB  
371  C CG  . ASN A 50  ? 0.3725 0.5275 0.3285 -0.1018 0.1236  -0.1215 192 ASN A CG  
372  O OD1 . ASN A 50  ? 0.3323 0.5230 0.3014 -0.1023 0.1345  -0.1180 192 ASN A OD1 
373  N ND2 . ASN A 50  ? 0.3310 0.4714 0.2513 -0.1198 0.1202  -0.1296 192 ASN A ND2 
374  N N   . GLN A 51  ? 0.3620 0.5660 0.4321 -0.0388 0.1497  -0.1117 193 GLN A N   
375  C CA  . GLN A 51  ? 0.3521 0.6019 0.4521 -0.0363 0.1494  -0.0949 193 GLN A CA  
376  C C   . GLN A 51  ? 0.3515 0.6306 0.4281 -0.0649 0.1436  -0.0855 193 GLN A C   
377  O O   . GLN A 51  ? 0.3360 0.6341 0.4197 -0.0748 0.1290  -0.0655 193 GLN A O   
378  C CB  . GLN A 51  ? 0.3746 0.6556 0.5143 -0.0113 0.1744  -0.1036 193 GLN A CB  
379  C CG  . GLN A 51  ? 0.3911 0.6446 0.5608 0.0190  0.1775  -0.1064 193 GLN A CG  
380  C CD  . GLN A 51  ? 0.3938 0.6513 0.5904 0.0259  0.1562  -0.0811 193 GLN A CD  
381  O OE1 . GLN A 51  ? 0.3933 0.6782 0.5908 0.0100  0.1409  -0.0619 193 GLN A OE1 
382  N NE2 . GLN A 51  ? 0.3853 0.6125 0.6000 0.0474  0.1550  -0.0812 193 GLN A NE2 
383  N N   . ASP A 52  ? 0.3723 0.6512 0.4168 -0.0808 0.1535  -0.0992 194 ASP A N   
384  C CA  . ASP A 52  ? 0.3838 0.6892 0.4022 -0.1104 0.1488  -0.0899 194 ASP A CA  
385  C C   . ASP A 52  ? 0.3718 0.6509 0.3618 -0.1316 0.1189  -0.0708 194 ASP A C   
386  O O   . ASP A 52  ? 0.3803 0.6807 0.3600 -0.1527 0.1100  -0.0550 194 ASP A O   
387  C CB  . ASP A 52  ? 0.4192 0.7312 0.4071 -0.1237 0.1678  -0.1099 194 ASP A CB  
388  C CG  . ASP A 52  ? 0.4582 0.8095 0.4728 -0.1074 0.2012  -0.1276 194 ASP A CG  
389  O OD1 . ASP A 52  ? 0.4587 0.8606 0.5035 -0.1051 0.2084  -0.1170 194 ASP A OD1 
390  O OD2 . ASP A 52  ? 0.5021 0.8340 0.5077 -0.0969 0.2207  -0.1525 194 ASP A OD2 
391  N N   . LYS A 53  ? 0.3589 0.5921 0.3365 -0.1264 0.1042  -0.0721 195 LYS A N   
392  C CA  . LYS A 53  ? 0.3507 0.5560 0.3048 -0.1411 0.0777  -0.0558 195 LYS A CA  
393  C C   . LYS A 53  ? 0.3216 0.5064 0.2963 -0.1265 0.0635  -0.0454 195 LYS A C   
394  O O   . LYS A 53  ? 0.3178 0.4730 0.2770 -0.1319 0.0442  -0.0358 195 LYS A O   
395  C CB  . LYS A 53  ? 0.3641 0.5390 0.2868 -0.1494 0.0703  -0.0631 195 LYS A CB  
396  C CG  . LYS A 53  ? 0.3991 0.5925 0.2906 -0.1722 0.0795  -0.0695 195 LYS A CG  
397  C CD  . LYS A 53  ? 0.4151 0.5843 0.2767 -0.1816 0.0733  -0.0775 195 LYS A CD  
398  C CE  . LYS A 53  ? 0.4246 0.5665 0.2698 -0.1904 0.0438  -0.0581 195 LYS A CE  
399  N NZ  . LYS A 53  ? 0.4230 0.5477 0.2436 -0.1997 0.0345  -0.0620 195 LYS A NZ  
400  N N   . ASN A 54  ? 0.3065 0.5077 0.3157 -0.1078 0.0735  -0.0470 196 ASN A N   
401  C CA  . ASN A 54  ? 0.2873 0.4750 0.3142 -0.0974 0.0611  -0.0361 196 ASN A CA  
402  C C   . ASN A 54  ? 0.2775 0.4213 0.2918 -0.0923 0.0475  -0.0377 196 ASN A C   
403  O O   . ASN A 54  ? 0.2772 0.4035 0.2828 -0.0982 0.0314  -0.0264 196 ASN A O   
404  C CB  . ASN A 54  ? 0.2903 0.4937 0.3134 -0.1146 0.0481  -0.0171 196 ASN A CB  
405  C CG  . ASN A 54  ? 0.3071 0.5641 0.3516 -0.1188 0.0609  -0.0124 196 ASN A CG  
406  O OD1 . ASN A 54  ? 0.3321 0.6125 0.3615 -0.1369 0.0662  -0.0116 196 ASN A OD1 
407  N ND2 . ASN A 54  ? 0.3139 0.5940 0.3952 -0.1022 0.0661  -0.0083 196 ASN A ND2 
408  N N   . PHE A 55  ? 0.2798 0.4063 0.2925 -0.0825 0.0549  -0.0524 197 PHE A N   
409  C CA  . PHE A 55  ? 0.2691 0.3618 0.2766 -0.0761 0.0444  -0.0543 197 PHE A CA  
410  C C   . PHE A 55  ? 0.2671 0.3491 0.2880 -0.0608 0.0564  -0.0684 197 PHE A C   
411  O O   . PHE A 55  ? 0.2682 0.3621 0.2969 -0.0550 0.0733  -0.0794 197 PHE A O   
412  C CB  . PHE A 55  ? 0.2779 0.3537 0.2569 -0.0894 0.0324  -0.0534 197 PHE A CB  
413  C CG  . PHE A 55  ? 0.2973 0.3742 0.2615 -0.0952 0.0412  -0.0670 197 PHE A CG  
414  C CD1 . PHE A 55  ? 0.2979 0.3568 0.2620 -0.0889 0.0424  -0.0776 197 PHE A CD1 
415  C CD2 . PHE A 55  ? 0.3091 0.4059 0.2565 -0.1101 0.0485  -0.0692 197 PHE A CD2 
416  C CE1 . PHE A 55  ? 0.3130 0.3710 0.2587 -0.0980 0.0499  -0.0908 197 PHE A CE1 
417  C CE2 . PHE A 55  ? 0.3324 0.4291 0.2606 -0.1186 0.0571  -0.0830 197 PHE A CE2 
418  C CZ  . PHE A 55  ? 0.3378 0.4137 0.2644 -0.1128 0.0575  -0.0942 197 PHE A CZ  
419  N N   . ALA A 56  ? 0.2619 0.3200 0.2847 -0.0546 0.0481  -0.0681 198 ALA A N   
420  C CA  . ALA A 56  ? 0.2667 0.3082 0.2988 -0.0433 0.0562  -0.0790 198 ALA A CA  
421  C C   . ALA A 56  ? 0.2724 0.2930 0.2931 -0.0473 0.0460  -0.0809 198 ALA A C   
422  O O   . ALA A 56  ? 0.2651 0.2835 0.2781 -0.0527 0.0326  -0.0722 198 ALA A O   
423  C CB  . ALA A 56  ? 0.2478 0.2905 0.3056 -0.0292 0.0584  -0.0723 198 ALA A CB  
424  N N   . PHE A 57  ? 0.2870 0.2922 0.3070 -0.0447 0.0528  -0.0925 199 PHE A N   
425  C CA  . PHE A 57  ? 0.2884 0.2787 0.3052 -0.0471 0.0446  -0.0930 199 PHE A CA  
426  C C   . PHE A 57  ? 0.2890 0.2643 0.3210 -0.0372 0.0491  -0.0934 199 PHE A C   
427  O O   . PHE A 57  ? 0.2998 0.2661 0.3381 -0.0300 0.0610  -0.1005 199 PHE A O   
428  C CB  . PHE A 57  ? 0.3090 0.2940 0.3065 -0.0594 0.0453  -0.1041 199 PHE A CB  
429  C CG  . PHE A 57  ? 0.3100 0.3077 0.2923 -0.0709 0.0339  -0.0983 199 PHE A CG  
430  C CD1 . PHE A 57  ? 0.3189 0.3184 0.3019 -0.0735 0.0195  -0.0906 199 PHE A CD1 
431  C CD2 . PHE A 57  ? 0.3238 0.3327 0.2920 -0.0788 0.0373  -0.0995 199 PHE A CD2 
432  C CE1 . PHE A 57  ? 0.3176 0.3265 0.2889 -0.0818 0.0070  -0.0827 199 PHE A CE1 
433  C CE2 . PHE A 57  ? 0.3425 0.3601 0.2948 -0.0908 0.0244  -0.0913 199 PHE A CE2 
434  C CZ  . PHE A 57  ? 0.3302 0.3459 0.2848 -0.0912 0.0083  -0.0821 199 PHE A CZ  
435  N N   . LEU A 58  ? 0.2793 0.2516 0.3170 -0.0365 0.0399  -0.0852 200 LEU A N   
436  C CA  . LEU A 58  ? 0.2907 0.2484 0.3379 -0.0320 0.0414  -0.0835 200 LEU A CA  
437  C C   . LEU A 58  ? 0.3050 0.2523 0.3423 -0.0418 0.0398  -0.0910 200 LEU A C   
438  O O   . LEU A 58  ? 0.3008 0.2598 0.3313 -0.0492 0.0324  -0.0908 200 LEU A O   
439  C CB  . LEU A 58  ? 0.2696 0.2328 0.3242 -0.0298 0.0333  -0.0711 200 LEU A CB  
440  C CG  . LEU A 58  ? 0.2737 0.2499 0.3340 -0.0258 0.0303  -0.0612 200 LEU A CG  
441  C CD1 . LEU A 58  ? 0.2791 0.2555 0.3383 -0.0280 0.0223  -0.0522 200 LEU A CD1 
442  C CD2 . LEU A 58  ? 0.2896 0.2684 0.3650 -0.0168 0.0374  -0.0579 200 LEU A CD2 
443  N N   . GLU A 59  ? 0.3342 0.2600 0.3714 -0.0424 0.0457  -0.0962 201 GLU A N   
444  C CA  . GLU A 59  ? 0.3481 0.2637 0.3764 -0.0553 0.0430  -0.1006 201 GLU A CA  
445  C C   . GLU A 59  ? 0.3368 0.2462 0.3745 -0.0542 0.0397  -0.0904 201 GLU A C   
446  O O   . GLU A 59  ? 0.3485 0.2420 0.3940 -0.0455 0.0431  -0.0851 201 GLU A O   
447  C CB  . GLU A 59  ? 0.3890 0.2779 0.4026 -0.0617 0.0520  -0.1149 201 GLU A CB  
448  C CG  . GLU A 59  ? 0.4212 0.2980 0.4205 -0.0810 0.0485  -0.1203 201 GLU A CG  
449  C CD  . GLU A 59  ? 0.4969 0.3335 0.4772 -0.0882 0.0585  -0.1354 201 GLU A CD  
450  O OE1 . GLU A 59  ? 0.5701 0.3872 0.5510 -0.0746 0.0703  -0.1429 201 GLU A OE1 
451  O OE2 . GLU A 59  ? 0.5576 0.3814 0.5220 -0.1081 0.0553  -0.1403 201 GLU A OE2 
452  N N   . PHE A 60  ? 0.3151 0.2398 0.3532 -0.0628 0.0331  -0.0865 202 PHE A N   
453  C CA  . PHE A 60  ? 0.3133 0.2352 0.3562 -0.0660 0.0311  -0.0778 202 PHE A CA  
454  C C   . PHE A 60  ? 0.3328 0.2415 0.3670 -0.0822 0.0315  -0.0813 202 PHE A C   
455  O O   . PHE A 60  ? 0.3442 0.2544 0.3696 -0.0929 0.0312  -0.0901 202 PHE A O   
456  C CB  . PHE A 60  ? 0.2887 0.2376 0.3376 -0.0651 0.0265  -0.0722 202 PHE A CB  
457  C CG  . PHE A 60  ? 0.2742 0.2297 0.3272 -0.0532 0.0250  -0.0670 202 PHE A CG  
458  C CD1 . PHE A 60  ? 0.2623 0.2185 0.3169 -0.0514 0.0238  -0.0582 202 PHE A CD1 
459  C CD2 . PHE A 60  ? 0.2638 0.2249 0.3155 -0.0474 0.0240  -0.0703 202 PHE A CD2 
460  C CE1 . PHE A 60  ? 0.2651 0.2263 0.3199 -0.0445 0.0214  -0.0536 202 PHE A CE1 
461  C CE2 . PHE A 60  ? 0.2546 0.2206 0.3074 -0.0403 0.0218  -0.0648 202 PHE A CE2 
462  C CZ  . PHE A 60  ? 0.2509 0.2164 0.3051 -0.0390 0.0203  -0.0567 202 PHE A CZ  
463  N N   . ARG A 61  ? 0.3410 0.2372 0.3754 -0.0870 0.0310  -0.0730 203 ARG A N   
464  C CA  . ARG A 61  ? 0.3630 0.2443 0.3869 -0.1057 0.0305  -0.0740 203 ARG A CA  
465  C C   . ARG A 61  ? 0.3487 0.2657 0.3748 -0.1205 0.0272  -0.0742 203 ARG A C   
466  O O   . ARG A 61  ? 0.3660 0.2799 0.3831 -0.1397 0.0260  -0.0772 203 ARG A O   
467  C CB  . ARG A 61  ? 0.3816 0.2376 0.4036 -0.1078 0.0296  -0.0621 203 ARG A CB  
468  C CG  . ARG A 61  ? 0.3605 0.2426 0.3880 -0.1107 0.0266  -0.0509 203 ARG A CG  
469  C CD  . ARG A 61  ? 0.3748 0.2327 0.3975 -0.1155 0.0237  -0.0366 203 ARG A CD  
470  N NE  . ARG A 61  ? 0.3385 0.2200 0.3641 -0.1148 0.0215  -0.0265 203 ARG A NE  
471  C CZ  . ARG A 61  ? 0.3462 0.2158 0.3659 -0.1215 0.0172  -0.0112 203 ARG A CZ  
472  N NH1 . ARG A 61  ? 0.3785 0.2109 0.3917 -0.1274 0.0136  -0.0027 203 ARG A NH1 
473  N NH2 . ARG A 61  ? 0.3370 0.2290 0.3549 -0.1231 0.0159  -0.0043 203 ARG A NH2 
474  N N   . SER A 62  ? 0.3171 0.2677 0.3554 -0.1119 0.0262  -0.0710 204 SER A N   
475  C CA  . SER A 62  ? 0.3046 0.2936 0.3511 -0.1213 0.0251  -0.0707 204 SER A CA  
476  C C   . SER A 62  ? 0.2751 0.2948 0.3347 -0.1073 0.0232  -0.0735 204 SER A C   
477  O O   . SER A 62  ? 0.2736 0.2844 0.3334 -0.0920 0.0228  -0.0739 204 SER A O   
478  C CB  . SER A 62  ? 0.3035 0.3004 0.3505 -0.1281 0.0279  -0.0628 204 SER A CB  
479  O OG  . SER A 62  ? 0.2893 0.2984 0.3421 -0.1137 0.0301  -0.0604 204 SER A OG  
480  N N   . VAL A 63  ? 0.2668 0.3226 0.3380 -0.1130 0.0213  -0.0744 205 VAL A N   
481  C CA  . VAL A 63  ? 0.2539 0.3377 0.3401 -0.0981 0.0184  -0.0750 205 VAL A CA  
482  C C   . VAL A 63  ? 0.2462 0.3344 0.3387 -0.0813 0.0234  -0.0737 205 VAL A C   
483  O O   . VAL A 63  ? 0.2380 0.3190 0.3308 -0.0660 0.0210  -0.0741 205 VAL A O   
484  C CB  . VAL A 63  ? 0.2540 0.3807 0.3564 -0.1075 0.0144  -0.0740 205 VAL A CB  
485  C CG1 . VAL A 63  ? 0.2368 0.3934 0.3599 -0.0884 0.0114  -0.0723 205 VAL A CG1 
486  C CG2 . VAL A 63  ? 0.2800 0.4001 0.3707 -0.1257 0.0071  -0.0761 205 VAL A CG2 
487  N N   . ASP A 64  ? 0.2529 0.3501 0.3461 -0.0868 0.0305  -0.0724 206 ASP A N   
488  C CA  . ASP A 64  ? 0.2522 0.3554 0.3474 -0.0747 0.0371  -0.0738 206 ASP A CA  
489  C C   . ASP A 64  ? 0.2556 0.3241 0.3346 -0.0680 0.0360  -0.0718 206 ASP A C   
490  O O   . ASP A 64  ? 0.2455 0.3099 0.3226 -0.0550 0.0373  -0.0741 206 ASP A O   
491  C CB  . ASP A 64  ? 0.2595 0.3835 0.3554 -0.0869 0.0462  -0.0735 206 ASP A CB  
492  C CG  . ASP A 64  ? 0.2823 0.4548 0.4014 -0.0890 0.0498  -0.0760 206 ASP A CG  
493  O OD1 . ASP A 64  ? 0.3007 0.4974 0.4221 -0.1000 0.0589  -0.0763 206 ASP A OD1 
494  O OD2 . ASP A 64  ? 0.2878 0.4784 0.4237 -0.0810 0.0432  -0.0763 206 ASP A OD2 
495  N N   . GLU A 65  ? 0.2671 0.3103 0.3348 -0.0768 0.0333  -0.0669 207 GLU A N   
496  C CA  . GLU A 65  ? 0.2715 0.2888 0.3287 -0.0710 0.0312  -0.0624 207 GLU A CA  
497  C C   . GLU A 65  ? 0.2620 0.2722 0.3210 -0.0583 0.0266  -0.0647 207 GLU A C   
498  O O   . GLU A 65  ? 0.2688 0.2706 0.3220 -0.0515 0.0255  -0.0628 207 GLU A O   
499  C CB  . GLU A 65  ? 0.2894 0.2835 0.3395 -0.0803 0.0294  -0.0551 207 GLU A CB  
500  C CG  . GLU A 65  ? 0.3075 0.3046 0.3503 -0.0946 0.0322  -0.0489 207 GLU A CG  
501  C CD  . GLU A 65  ? 0.3241 0.2957 0.3606 -0.1053 0.0289  -0.0402 207 GLU A CD  
502  O OE1 . GLU A 65  ? 0.3598 0.3212 0.3975 -0.1102 0.0282  -0.0438 207 GLU A OE1 
503  O OE2 . GLU A 65  ? 0.3231 0.2829 0.3514 -0.1100 0.0266  -0.0293 207 GLU A OE2 
504  N N   . THR A 66  ? 0.2555 0.2700 0.3196 -0.0583 0.0236  -0.0684 208 THR A N   
505  C CA  . THR A 66  ? 0.2473 0.2603 0.3114 -0.0488 0.0189  -0.0699 208 THR A CA  
506  C C   . THR A 66  ? 0.2439 0.2662 0.3114 -0.0380 0.0178  -0.0705 208 THR A C   
507  O O   . THR A 66  ? 0.2491 0.2592 0.3096 -0.0313 0.0149  -0.0688 208 THR A O   
508  C CB  . THR A 66  ? 0.2473 0.2688 0.3138 -0.0538 0.0149  -0.0735 208 THR A CB  
509  O OG1 . THR A 66  ? 0.2475 0.2545 0.3074 -0.0647 0.0175  -0.0758 208 THR A OG1 
510  C CG2 . THR A 66  ? 0.2393 0.2566 0.3010 -0.0473 0.0096  -0.0731 208 THR A CG2 
511  N N   . THR A 67  ? 0.2406 0.2841 0.3188 -0.0364 0.0208  -0.0730 209 THR A N   
512  C CA  . THR A 67  ? 0.2510 0.2996 0.3335 -0.0231 0.0222  -0.0754 209 THR A CA  
513  C C   . THR A 67  ? 0.2625 0.2906 0.3291 -0.0217 0.0270  -0.0765 209 THR A C   
514  O O   . THR A 67  ? 0.2662 0.2788 0.3249 -0.0129 0.0248  -0.0774 209 THR A O   
515  C CB  . THR A 67  ? 0.2534 0.3352 0.3551 -0.0207 0.0276  -0.0788 209 THR A CB  
516  O OG1 . THR A 67  ? 0.2410 0.3440 0.3565 -0.0243 0.0202  -0.0759 209 THR A OG1 
517  C CG2 . THR A 67  ? 0.2457 0.3307 0.3541 -0.0028 0.0322  -0.0835 209 THR A CG2 
518  N N   . GLN A 68  ? 0.2691 0.2954 0.3281 -0.0328 0.0321  -0.0752 210 GLN A N   
519  C CA  . GLN A 68  ? 0.2821 0.2934 0.3237 -0.0359 0.0356  -0.0751 210 GLN A CA  
520  C C   . GLN A 68  ? 0.2825 0.2714 0.3123 -0.0355 0.0280  -0.0694 210 GLN A C   
521  O O   . GLN A 68  ? 0.2933 0.2677 0.3084 -0.0341 0.0278  -0.0710 210 GLN A O   
522  C CB  . GLN A 68  ? 0.2899 0.3049 0.3253 -0.0508 0.0394  -0.0706 210 GLN A CB  
523  C CG  . GLN A 68  ? 0.3160 0.3560 0.3596 -0.0563 0.0480  -0.0751 210 GLN A CG  
524  C CD  . GLN A 68  ? 0.3636 0.4092 0.3957 -0.0576 0.0585  -0.0821 210 GLN A CD  
525  O OE1 . GLN A 68  ? 0.3954 0.4376 0.4266 -0.0443 0.0627  -0.0908 210 GLN A OE1 
526  N NE2 . GLN A 68  ? 0.3989 0.4504 0.4195 -0.0744 0.0633  -0.0785 210 GLN A NE2 
527  N N   . ALA A 69  ? 0.2704 0.2572 0.3059 -0.0377 0.0226  -0.0637 211 ALA A N   
528  C CA  . ALA A 69  ? 0.2711 0.2454 0.3003 -0.0382 0.0169  -0.0574 211 ALA A CA  
529  C C   . ALA A 69  ? 0.2766 0.2428 0.2998 -0.0321 0.0121  -0.0587 211 ALA A C   
530  O O   . ALA A 69  ? 0.2821 0.2407 0.2979 -0.0353 0.0077  -0.0531 211 ALA A O   
531  C CB  . ALA A 69  ? 0.2585 0.2340 0.2971 -0.0394 0.0157  -0.0540 211 ALA A CB  
532  N N   . MET A 70  ? 0.2860 0.2549 0.3133 -0.0240 0.0123  -0.0644 212 MET A N   
533  C CA  . MET A 70  ? 0.3066 0.2617 0.3259 -0.0181 0.0065  -0.0641 212 MET A CA  
534  C C   . MET A 70  ? 0.3207 0.2541 0.3198 -0.0208 0.0071  -0.0652 212 MET A C   
535  O O   . MET A 70  ? 0.3284 0.2432 0.3143 -0.0215 0.0008  -0.0625 212 MET A O   
536  C CB  . MET A 70  ? 0.3103 0.2735 0.3420 -0.0061 0.0058  -0.0681 212 MET A CB  
537  C CG  . MET A 70  ? 0.3184 0.3041 0.3667 -0.0068 0.0026  -0.0665 212 MET A CG  
538  S SD  . MET A 70  ? 0.3678 0.3500 0.4149 -0.0031 -0.0100 -0.0599 212 MET A SD  
539  C CE  . MET A 70  ? 0.3367 0.3068 0.3666 -0.0158 -0.0122 -0.0556 212 MET A CE  
540  N N   . ALA A 71  ? 0.3274 0.2617 0.3204 -0.0253 0.0142  -0.0690 213 ALA A N   
541  C CA  . ALA A 71  ? 0.3523 0.2645 0.3205 -0.0315 0.0156  -0.0720 213 ALA A CA  
542  C C   . ALA A 71  ? 0.3528 0.2577 0.3072 -0.0456 0.0074  -0.0616 213 ALA A C   
543  O O   . ALA A 71  ? 0.3834 0.2673 0.3139 -0.0540 0.0048  -0.0622 213 ALA A O   
544  C CB  . ALA A 71  ? 0.3593 0.2774 0.3210 -0.0360 0.0261  -0.0789 213 ALA A CB  
545  N N   . PHE A 72  ? 0.3276 0.2503 0.2972 -0.0483 0.0037  -0.0525 214 PHE A N   
546  C CA  . PHE A 72  ? 0.3293 0.2540 0.2941 -0.0585 -0.0036 -0.0416 214 PHE A CA  
547  C C   . PHE A 72  ? 0.3377 0.2532 0.2959 -0.0592 -0.0101 -0.0391 214 PHE A C   
548  O O   . PHE A 72  ? 0.3338 0.2562 0.2890 -0.0693 -0.0156 -0.0296 214 PHE A O   
549  C CB  . PHE A 72  ? 0.3155 0.2620 0.3018 -0.0576 -0.0034 -0.0336 214 PHE A CB  
550  C CG  . PHE A 72  ? 0.3063 0.2589 0.2965 -0.0605 -0.0001 -0.0313 214 PHE A CG  
551  C CD1 . PHE A 72  ? 0.3106 0.2718 0.3187 -0.0543 0.0041  -0.0321 214 PHE A CD1 
552  C CD2 . PHE A 72  ? 0.3283 0.2759 0.3005 -0.0724 -0.0017 -0.0279 214 PHE A CD2 
553  C CE1 . PHE A 72  ? 0.3246 0.2883 0.3339 -0.0595 0.0060  -0.0279 214 PHE A CE1 
554  C CE2 . PHE A 72  ? 0.3319 0.2853 0.3045 -0.0781 0.0002  -0.0237 214 PHE A CE2 
555  C CZ  . PHE A 72  ? 0.3438 0.3049 0.3356 -0.0714 0.0036  -0.0227 214 PHE A CZ  
556  N N   . ASP A 73  ? 0.3439 0.2471 0.3011 -0.0497 -0.0104 -0.0453 215 ASP A N   
557  C CA  . ASP A 73  ? 0.3510 0.2422 0.2980 -0.0531 -0.0183 -0.0405 215 ASP A CA  
558  C C   . ASP A 73  ? 0.3752 0.2470 0.2962 -0.0689 -0.0240 -0.0358 215 ASP A C   
559  O O   . ASP A 73  ? 0.4039 0.2514 0.3058 -0.0709 -0.0224 -0.0422 215 ASP A O   
560  C CB  . ASP A 73  ? 0.3660 0.2403 0.3122 -0.0404 -0.0200 -0.0459 215 ASP A CB  
561  C CG  . ASP A 73  ? 0.3918 0.2514 0.3255 -0.0456 -0.0302 -0.0381 215 ASP A CG  
562  O OD1 . ASP A 73  ? 0.4073 0.2376 0.3292 -0.0391 -0.0347 -0.0396 215 ASP A OD1 
563  O OD2 . ASP A 73  ? 0.3825 0.2594 0.3181 -0.0559 -0.0332 -0.0304 215 ASP A OD2 
564  N N   . GLY A 74  ? 0.3730 0.2578 0.2927 -0.0814 -0.0298 -0.0253 216 GLY A N   
565  C CA  . GLY A 74  ? 0.3928 0.2654 0.2883 -0.1013 -0.0371 -0.0182 216 GLY A CA  
566  C C   . GLY A 74  ? 0.3809 0.2797 0.2821 -0.1138 -0.0383 -0.0093 216 GLY A C   
567  O O   . GLY A 74  ? 0.4033 0.3019 0.2879 -0.1335 -0.0459 -0.0006 216 GLY A O   
568  N N   . ILE A 75  ? 0.3510 0.2725 0.2754 -0.1039 -0.0322 -0.0097 217 ILE A N   
569  C CA  . ILE A 75  ? 0.3434 0.2894 0.2765 -0.1129 -0.0348 0.0012  217 ILE A CA  
570  C C   . ILE A 75  ? 0.3372 0.3154 0.2852 -0.1212 -0.0399 0.0154  217 ILE A C   
571  O O   . ILE A 75  ? 0.3184 0.3109 0.2827 -0.1132 -0.0362 0.0150  217 ILE A O   
572  C CB  . ILE A 75  ? 0.3214 0.2813 0.2780 -0.0988 -0.0278 -0.0007 217 ILE A CB  
573  C CG1 . ILE A 75  ? 0.3341 0.3105 0.2938 -0.1087 -0.0325 0.0117  217 ILE A CG1 
574  C CG2 . ILE A 75  ? 0.2758 0.2548 0.2613 -0.0838 -0.0223 -0.0011 217 ILE A CG2 
575  C CD1 . ILE A 75  ? 0.3045 0.2881 0.2830 -0.0971 -0.0271 0.0118  217 ILE A CD1 
576  N N   . ILE A 76  ? 0.3538 0.3463 0.2955 -0.1389 -0.0482 0.0280  218 ILE A N   
577  C CA  . ILE A 76  ? 0.3537 0.3851 0.3132 -0.1479 -0.0532 0.0433  218 ILE A CA  
578  C C   . ILE A 76  ? 0.3344 0.4038 0.3356 -0.1315 -0.0486 0.0516  218 ILE A C   
579  O O   . ILE A 76  ? 0.3327 0.4023 0.3401 -0.1273 -0.0498 0.0553  218 ILE A O   
580  C CB  . ILE A 76  ? 0.3820 0.4194 0.3199 -0.1762 -0.0660 0.0562  218 ILE A CB  
581  C CG1 . ILE A 76  ? 0.4160 0.4077 0.3084 -0.1938 -0.0705 0.0475  218 ILE A CG1 
582  C CG2 . ILE A 76  ? 0.3632 0.4525 0.3278 -0.1841 -0.0705 0.0739  218 ILE A CG2 
583  C CD1 . ILE A 76  ? 0.4217 0.4094 0.3107 -0.1958 -0.0703 0.0466  218 ILE A CD1 
584  N N   . PHE A 77  ? 0.3207 0.4197 0.3482 -0.1227 -0.0429 0.0544  219 PHE A N   
585  C CA  . PHE A 77  ? 0.3027 0.4346 0.3709 -0.1043 -0.0366 0.0607  219 PHE A CA  
586  C C   . PHE A 77  ? 0.2999 0.4799 0.3924 -0.1085 -0.0363 0.0730  219 PHE A C   
587  O O   . PHE A 77  ? 0.2953 0.4825 0.3867 -0.1090 -0.0292 0.0663  219 PHE A O   
588  C CB  . PHE A 77  ? 0.3011 0.4159 0.3790 -0.0825 -0.0233 0.0445  219 PHE A CB  
589  C CG  . PHE A 77  ? 0.2951 0.4304 0.4102 -0.0619 -0.0154 0.0478  219 PHE A CG  
590  C CD1 . PHE A 77  ? 0.3148 0.4587 0.4461 -0.0580 -0.0217 0.0617  219 PHE A CD1 
591  C CD2 . PHE A 77  ? 0.2974 0.4396 0.4287 -0.0468 -0.0017 0.0370  219 PHE A CD2 
592  C CE1 . PHE A 77  ? 0.3128 0.4690 0.4788 -0.0367 -0.0151 0.0658  219 PHE A CE1 
593  C CE2 . PHE A 77  ? 0.2989 0.4525 0.4624 -0.0262 0.0072  0.0380  219 PHE A CE2 
594  C CZ  . PHE A 77  ? 0.3012 0.4601 0.4834 -0.0196 0.0003  0.0527  219 PHE A CZ  
595  N N   . GLN A 78  ? 0.2956 0.5117 0.4102 -0.1127 -0.0444 0.0922  220 GLN A N   
596  C CA  . GLN A 78  ? 0.2949 0.5669 0.4370 -0.1188 -0.0458 0.1075  220 GLN A CA  
597  C C   . GLN A 78  ? 0.3035 0.5768 0.4173 -0.1447 -0.0496 0.1066  220 GLN A C   
598  O O   . GLN A 78  ? 0.2918 0.5919 0.4183 -0.1435 -0.0406 0.1045  220 GLN A O   
599  C CB  . GLN A 78  ? 0.2779 0.5798 0.4637 -0.0907 -0.0295 0.1038  220 GLN A CB  
600  C CG  . GLN A 78  ? 0.2874 0.5874 0.5030 -0.0661 -0.0278 0.1087  220 GLN A CG  
601  C CD  . GLN A 78  ? 0.2935 0.6191 0.5524 -0.0369 -0.0106 0.1044  220 GLN A CD  
602  O OE1 . GLN A 78  ? 0.3300 0.6871 0.6013 -0.0360 0.0006  0.0996  220 GLN A OE1 
603  N NE2 . GLN A 78  ? 0.3150 0.6254 0.5954 -0.0135 -0.0076 0.1055  220 GLN A NE2 
604  N N   . GLY A 79  ? 0.3249 0.5647 0.3968 -0.1689 -0.0624 0.1074  221 GLY A N   
605  C CA  . GLY A 79  ? 0.3487 0.5770 0.3860 -0.1968 -0.0691 0.1078  221 GLY A CA  
606  C C   . GLY A 79  ? 0.3552 0.5382 0.3640 -0.1942 -0.0625 0.0899  221 GLY A C   
607  O O   . GLY A 79  ? 0.3796 0.5404 0.3536 -0.2178 -0.0702 0.0908  221 GLY A O   
608  N N   . GLN A 80  ? 0.3383 0.5063 0.3599 -0.1676 -0.0500 0.0754  222 GLN A N   
609  C CA  . GLN A 80  ? 0.3459 0.4776 0.3444 -0.1645 -0.0452 0.0610  222 GLN A CA  
610  C C   . GLN A 80  ? 0.3456 0.4244 0.3236 -0.1532 -0.0454 0.0470  222 GLN A C   
611  O O   . GLN A 80  ? 0.3280 0.4044 0.3214 -0.1366 -0.0411 0.0427  222 GLN A O   
612  C CB  . GLN A 80  ? 0.3311 0.4889 0.3559 -0.1469 -0.0305 0.0541  222 GLN A CB  
613  C CG  . GLN A 80  ? 0.3638 0.5804 0.4146 -0.1539 -0.0257 0.0653  222 GLN A CG  
614  C CD  . GLN A 80  ? 0.4217 0.6477 0.4620 -0.1623 -0.0187 0.0608  222 GLN A CD  
615  O OE1 . GLN A 80  ? 0.4720 0.6613 0.4760 -0.1767 -0.0260 0.0581  222 GLN A OE1 
616  N NE2 . GLN A 80  ? 0.4399 0.7156 0.5116 -0.1537 -0.0043 0.0606  222 GLN A NE2 
617  N N   . SER A 81  ? 0.3622 0.4000 0.3069 -0.1616 -0.0502 0.0409  223 SER A N   
618  C CA  . SER A 81  ? 0.3663 0.3584 0.2947 -0.1492 -0.0493 0.0276  223 SER A CA  
619  C C   . SER A 81  ? 0.3436 0.3365 0.2885 -0.1282 -0.0401 0.0174  223 SER A C   
620  O O   . SER A 81  ? 0.3443 0.3404 0.2853 -0.1310 -0.0396 0.0176  223 SER A O   
621  C CB  . SER A 81  ? 0.4009 0.3468 0.2898 -0.1636 -0.0583 0.0260  223 SER A CB  
622  O OG  . SER A 81  ? 0.4077 0.3149 0.2855 -0.1497 -0.0559 0.0133  223 SER A OG  
623  N N   . LEU A 82  ? 0.3261 0.3166 0.2863 -0.1106 -0.0335 0.0093  224 LEU A N   
624  C CA  . LEU A 82  ? 0.3089 0.3032 0.2848 -0.0936 -0.0251 -0.0002 224 LEU A CA  
625  C C   . LEU A 82  ? 0.3215 0.2835 0.2811 -0.0881 -0.0279 -0.0084 224 LEU A C   
626  O O   . LEU A 82  ? 0.3299 0.2667 0.2781 -0.0853 -0.0302 -0.0126 224 LEU A O   
627  C CB  . LEU A 82  ? 0.2821 0.2868 0.2809 -0.0793 -0.0176 -0.0041 224 LEU A CB  
628  C CG  . LEU A 82  ? 0.2784 0.3158 0.3025 -0.0769 -0.0136 0.0042  224 LEU A CG  
629  C CD1 . LEU A 82  ? 0.2496 0.2865 0.2932 -0.0611 -0.0064 -0.0009 224 LEU A CD1 
630  C CD2 . LEU A 82  ? 0.2609 0.3270 0.2963 -0.0790 -0.0086 0.0070  224 LEU A CD2 
631  N N   . LYS A 83  ? 0.3214 0.2871 0.2811 -0.0862 -0.0272 -0.0103 225 LYS A N   
632  C CA  . LYS A 83  ? 0.3334 0.2760 0.2838 -0.0792 -0.0314 -0.0151 225 LYS A CA  
633  C C   . LYS A 83  ? 0.3105 0.2627 0.2794 -0.0649 -0.0244 -0.0244 225 LYS A C   
634  O O   . LYS A 83  ? 0.3015 0.2715 0.2780 -0.0650 -0.0196 -0.0269 225 LYS A O   
635  C CB  . LYS A 83  ? 0.3514 0.2915 0.2863 -0.0902 -0.0382 -0.0085 225 LYS A CB  
636  C CG  . LYS A 83  ? 0.3715 0.2880 0.2972 -0.0836 -0.0464 -0.0087 225 LYS A CG  
637  C CD  . LYS A 83  ? 0.4029 0.3134 0.3083 -0.0982 -0.0559 0.0016  225 LYS A CD  
638  C CE  . LYS A 83  ? 0.4276 0.3190 0.3279 -0.0904 -0.0660 0.0047  225 LYS A CE  
639  N NZ  . LYS A 83  ? 0.4554 0.3387 0.3327 -0.1071 -0.0775 0.0177  225 LYS A NZ  
640  N N   . ILE A 84  ? 0.3078 0.2479 0.2810 -0.0549 -0.0233 -0.0300 226 ILE A N   
641  C CA  . ILE A 84  ? 0.2886 0.2388 0.2785 -0.0446 -0.0172 -0.0378 226 ILE A CA  
642  C C   . ILE A 84  ? 0.2952 0.2377 0.2850 -0.0372 -0.0226 -0.0399 226 ILE A C   
643  O O   . ILE A 84  ? 0.3143 0.2386 0.2985 -0.0311 -0.0260 -0.0402 226 ILE A O   
644  C CB  . ILE A 84  ? 0.2841 0.2328 0.2809 -0.0404 -0.0117 -0.0413 226 ILE A CB  
645  C CG1 . ILE A 84  ? 0.2820 0.2366 0.2781 -0.0479 -0.0104 -0.0352 226 ILE A CG1 
646  C CG2 . ILE A 84  ? 0.2670 0.2276 0.2797 -0.0344 -0.0055 -0.0477 226 ILE A CG2 
647  C CD1 . ILE A 84  ? 0.2696 0.2439 0.2822 -0.0468 -0.0046 -0.0338 226 ILE A CD1 
648  N N   . ARG A 85  ? 0.2880 0.2446 0.2843 -0.0374 -0.0232 -0.0415 227 ARG A N   
649  C CA  . ARG A 85  ? 0.2935 0.2508 0.2933 -0.0315 -0.0308 -0.0400 227 ARG A CA  
650  C C   . ARG A 85  ? 0.2802 0.2584 0.2935 -0.0314 -0.0276 -0.0455 227 ARG A C   
651  O O   . ARG A 85  ? 0.2684 0.2549 0.2835 -0.0374 -0.0196 -0.0511 227 ARG A O   
652  C CB  . ARG A 85  ? 0.3144 0.2664 0.2990 -0.0393 -0.0413 -0.0312 227 ARG A CB  
653  C CG  . ARG A 85  ? 0.3427 0.2690 0.3100 -0.0421 -0.0479 -0.0237 227 ARG A CG  
654  C CD  . ARG A 85  ? 0.3663 0.2699 0.3355 -0.0278 -0.0534 -0.0226 227 ARG A CD  
655  N NE  . ARG A 85  ? 0.4145 0.2848 0.3613 -0.0328 -0.0613 -0.0154 227 ARG A NE  
656  C CZ  . ARG A 85  ? 0.4121 0.2657 0.3449 -0.0399 -0.0575 -0.0174 227 ARG A CZ  
657  N NH1 . ARG A 85  ? 0.3913 0.2600 0.3322 -0.0413 -0.0467 -0.0249 227 ARG A NH1 
658  N NH2 . ARG A 85  ? 0.4474 0.2680 0.3563 -0.0478 -0.0659 -0.0105 227 ARG A NH2 
659  N N   . ARG A 86  ? 0.2793 0.2658 0.3025 -0.0250 -0.0342 -0.0434 228 ARG A N   
660  C CA  . ARG A 86  ? 0.2684 0.2771 0.3003 -0.0306 -0.0349 -0.0462 228 ARG A CA  
661  C C   . ARG A 86  ? 0.2704 0.2822 0.2857 -0.0445 -0.0403 -0.0433 228 ARG A C   
662  O O   . ARG A 86  ? 0.2731 0.2750 0.2756 -0.0468 -0.0478 -0.0354 228 ARG A O   
663  C CB  . ARG A 86  ? 0.2697 0.2945 0.3197 -0.0210 -0.0425 -0.0418 228 ARG A CB  
664  C CG  . ARG A 86  ? 0.2594 0.2876 0.3263 -0.0082 -0.0346 -0.0468 228 ARG A CG  
665  C CD  . ARG A 86  ? 0.2396 0.2809 0.3131 -0.0158 -0.0237 -0.0552 228 ARG A CD  
666  N NE  . ARG A 86  ? 0.2409 0.2942 0.3315 -0.0057 -0.0171 -0.0586 228 ARG A NE  
667  C CZ  . ARG A 86  ? 0.2165 0.2856 0.3155 -0.0121 -0.0090 -0.0637 228 ARG A CZ  
668  N NH1 . ARG A 86  ? 0.2023 0.2711 0.2937 -0.0276 -0.0071 -0.0661 228 ARG A NH1 
669  N NH2 . ARG A 86  ? 0.1964 0.2796 0.3096 -0.0036 -0.0018 -0.0668 228 ARG A NH2 
670  N N   . PRO A 87  ? 0.2732 0.2968 0.2856 -0.0558 -0.0358 -0.0503 229 PRO A N   
671  C CA  . PRO A 87  ? 0.2929 0.3224 0.2866 -0.0715 -0.0402 -0.0498 229 PRO A CA  
672  C C   . PRO A 87  ? 0.3133 0.3548 0.3064 -0.0742 -0.0579 -0.0370 229 PRO A C   
673  O O   . PRO A 87  ? 0.3093 0.3631 0.3224 -0.0647 -0.0648 -0.0320 229 PRO A O   
674  C CB  . PRO A 87  ? 0.2929 0.3285 0.2850 -0.0817 -0.0316 -0.0619 229 PRO A CB  
675  C CG  . PRO A 87  ? 0.2737 0.3014 0.2812 -0.0714 -0.0206 -0.0681 229 PRO A CG  
676  C CD  . PRO A 87  ? 0.2603 0.2882 0.2829 -0.0565 -0.0257 -0.0599 229 PRO A CD  
677  N N   . HIS A 88  ? 0.3393 0.3801 0.3108 -0.0873 -0.0652 -0.0309 230 HIS A N   
678  C CA  . HIS A 88  ? 0.3638 0.4146 0.3320 -0.0916 -0.0850 -0.0149 230 HIS A CA  
679  C C   . HIS A 88  ? 0.3697 0.4466 0.3494 -0.0974 -0.0925 -0.0139 230 HIS A C   
680  O O   . HIS A 88  ? 0.3785 0.4696 0.3735 -0.0906 -0.1088 0.0008  230 HIS A O   
681  C CB  . HIS A 88  ? 0.3901 0.4380 0.3265 -0.1116 -0.0902 -0.0094 230 HIS A CB  
682  C CG  . HIS A 88  ? 0.4020 0.4292 0.3274 -0.1090 -0.0889 -0.0039 230 HIS A CG  
683  N ND1 . HIS A 88  ? 0.4118 0.4203 0.3519 -0.0902 -0.0893 0.0000  230 HIS A ND1 
684  C CD2 . HIS A 88  ? 0.4260 0.4494 0.3250 -0.1254 -0.0869 -0.0018 230 HIS A CD2 
685  C CE1 . HIS A 88  ? 0.4143 0.4068 0.3369 -0.0966 -0.0891 0.0051  230 HIS A CE1 
686  N NE2 . HIS A 88  ? 0.4337 0.4374 0.3330 -0.1176 -0.0875 0.0047  230 HIS A NE2 
687  N N   . ASP A 89  ? 0.3787 0.4612 0.3510 -0.1104 -0.0810 -0.0288 231 ASP A N   
688  C CA  . ASP A 89  ? 0.3882 0.4942 0.3681 -0.1211 -0.0857 -0.0308 231 ASP A CA  
689  C C   . ASP A 89  ? 0.3668 0.4901 0.3822 -0.1048 -0.0872 -0.0275 231 ASP A C   
690  O O   . ASP A 89  ? 0.3754 0.5261 0.4010 -0.1142 -0.0949 -0.0243 231 ASP A O   
691  C CB  . ASP A 89  ? 0.4018 0.4965 0.3631 -0.1367 -0.0688 -0.0510 231 ASP A CB  
692  C CG  . ASP A 89  ? 0.4622 0.5547 0.3877 -0.1616 -0.0693 -0.0563 231 ASP A CG  
693  O OD1 . ASP A 89  ? 0.5185 0.6259 0.4340 -0.1716 -0.0864 -0.0420 231 ASP A OD1 
694  O OD2 . ASP A 89  ? 0.5211 0.5960 0.4272 -0.1711 -0.0525 -0.0747 231 ASP A OD2 
695  N N   . TYR A 90  ? 0.3492 0.4585 0.3810 -0.0834 -0.0783 -0.0296 232 TYR A N   
696  C CA  . TYR A 90  ? 0.3375 0.4626 0.4001 -0.0685 -0.0750 -0.0298 232 TYR A CA  
697  C C   . TYR A 90  ? 0.3465 0.4901 0.4329 -0.0520 -0.0895 -0.0141 232 TYR A C   
698  O O   . TYR A 90  ? 0.3549 0.4797 0.4356 -0.0415 -0.0963 -0.0057 232 TYR A O   
699  C CB  . TYR A 90  ? 0.3204 0.4215 0.3861 -0.0543 -0.0596 -0.0387 232 TYR A CB  
700  C CG  . TYR A 90  ? 0.2998 0.4156 0.3925 -0.0404 -0.0535 -0.0404 232 TYR A CG  
701  C CD1 . TYR A 90  ? 0.2929 0.4191 0.3908 -0.0495 -0.0441 -0.0487 232 TYR A CD1 
702  C CD2 . TYR A 90  ? 0.2960 0.4122 0.4062 -0.0188 -0.0559 -0.0346 232 TYR A CD2 
703  C CE1 . TYR A 90  ? 0.2956 0.4388 0.4160 -0.0395 -0.0371 -0.0504 232 TYR A CE1 
704  C CE2 . TYR A 90  ? 0.3008 0.4320 0.4338 -0.0062 -0.0471 -0.0387 232 TYR A CE2 
705  C CZ  . TYR A 90  ? 0.2912 0.4390 0.4294 -0.0176 -0.0375 -0.0463 232 TYR A CZ  
706  O OH  . TYR A 90  ? 0.2746 0.4420 0.4338 -0.0083 -0.0277 -0.0501 232 TYR A OH  
707  N N   . GLN A 91  ? 0.3500 0.5306 0.4638 -0.0496 -0.0943 -0.0096 233 GLN A N   
708  C CA  . GLN A 91  ? 0.3646 0.5680 0.5098 -0.0286 -0.1060 0.0050  233 GLN A CA  
709  C C   . GLN A 91  ? 0.3526 0.5873 0.5319 -0.0172 -0.0961 0.0000  233 GLN A C   
710  O O   . GLN A 91  ? 0.3458 0.6043 0.5273 -0.0353 -0.0917 -0.0059 233 GLN A O   
711  C CB  . GLN A 91  ? 0.3928 0.6256 0.5405 -0.0405 -0.1285 0.0226  233 GLN A CB  
712  C CG  . GLN A 91  ? 0.4488 0.6541 0.5665 -0.0477 -0.1416 0.0329  233 GLN A CG  
713  C CD  . GLN A 91  ? 0.5054 0.6926 0.6367 -0.0207 -0.1516 0.0476  233 GLN A CD  
714  O OE1 . GLN A 91  ? 0.5380 0.7514 0.7041 -0.0017 -0.1632 0.0618  233 GLN A OE1 
715  N NE2 . GLN A 91  ? 0.5259 0.6680 0.6297 -0.0195 -0.1475 0.0448  233 GLN A NE2 
716  N N   . PRO A 92  ? 0.3540 0.5881 0.5582 0.0114  -0.0919 0.0018  234 PRO A N   
717  C CA  . PRO A 92  ? 0.3394 0.6073 0.5768 0.0233  -0.0802 -0.0036 234 PRO A CA  
718  C C   . PRO A 92  ? 0.3399 0.6668 0.6126 0.0234  -0.0943 0.0110  234 PRO A C   
719  O O   . PRO A 92  ? 0.3587 0.6933 0.6307 0.0198  -0.1144 0.0269  234 PRO A O   
720  C CB  . PRO A 92  ? 0.3530 0.5953 0.6003 0.0544  -0.0718 -0.0069 234 PRO A CB  
721  C CG  . PRO A 92  ? 0.3801 0.5969 0.6178 0.0628  -0.0895 0.0072  234 PRO A CG  
722  C CD  . PRO A 92  ? 0.3753 0.5756 0.5760 0.0330  -0.0973 0.0085  234 PRO A CD  
723  N N   . LEU A 93  ? 0.3221 0.6939 0.6255 0.0254  -0.0851 0.0076  235 LEU A N   
724  C CA  . LEU A 93  ? 0.3259 0.7628 0.6650 0.0211  -0.0990 0.0226  235 LEU A CA  
725  C C   . LEU A 93  ? 0.3390 0.7959 0.7166 0.0547  -0.1109 0.0391  235 LEU A C   
726  O O   . LEU A 93  ? 0.3455 0.7728 0.7301 0.0850  -0.1006 0.0334  235 LEU A O   
727  C CB  . LEU A 93  ? 0.3134 0.7969 0.6758 0.0122  -0.0848 0.0150  235 LEU A CB  
728  C CG  . LEU A 93  ? 0.3098 0.7804 0.6370 -0.0261 -0.0795 0.0045  235 LEU A CG  
729  C CD1 . LEU A 93  ? 0.3090 0.8165 0.6552 -0.0340 -0.0636 -0.0031 235 LEU A CD1 
730  C CD2 . LEU A 93  ? 0.3220 0.8102 0.6351 -0.0566 -0.1000 0.0153  235 LEU A CD2 
731  N N   . PRO A 94  ? 0.3478 0.8538 0.7498 0.0492  -0.1333 0.0601  236 PRO A N   
732  C CA  . PRO A 94  ? 0.3677 0.8924 0.8081 0.0818  -0.1488 0.0802  236 PRO A CA  
733  C C   . PRO A 94  ? 0.3693 0.9076 0.8537 0.1234  -0.1308 0.0734  236 PRO A C   
734  O O   . PRO A 94  ? 0.3544 0.9396 0.8664 0.1234  -0.1147 0.0644  236 PRO A O   
735  C CB  . PRO A 94  ? 0.3707 0.9685 0.8396 0.0639  -0.1713 0.1018  236 PRO A CB  
736  C CG  . PRO A 94  ? 0.3655 0.9537 0.7881 0.0171  -0.1742 0.0945  236 PRO A CG  
737  C CD  . PRO A 94  ? 0.3446 0.8909 0.7388 0.0108  -0.1464 0.0671  236 PRO A CD  
738  N N   . GLY A 95  ? 0.3907 0.8859 0.8779 0.1562  -0.1320 0.0764  237 GLY A N   
739  C CA  . GLY A 95  ? 0.4050 0.9024 0.9280 0.1973  -0.1133 0.0673  237 GLY A CA  
740  C C   . GLY A 95  ? 0.3931 0.8594 0.8964 0.1999  -0.0820 0.0385  237 GLY A C   
741  O O   . GLY A 95  ? 0.4056 0.8827 0.9381 0.2297  -0.0633 0.0280  237 GLY A O   
742  N N   . ALA A 96  ? 0.5166 0.2136 1.0338 -0.0415 -0.0149 -0.0369 258 ALA A N   
743  C CA  . ALA A 96  ? 0.5254 0.2225 1.0677 -0.0316 -0.0251 0.0229  258 ALA A CA  
744  C C   . ALA A 96  ? 0.4784 0.2314 0.9569 -0.0298 -0.0232 0.0465  258 ALA A C   
745  O O   . ALA A 96  ? 0.4806 0.2519 0.9497 -0.0353 -0.0310 0.0986  258 ALA A O   
746  C CB  . ALA A 96  ? 0.5625 0.2323 1.1768 -0.0042 -0.0289 0.0145  258 ALA A CB  
747  N N   . HIS A 97  ? 0.4418 0.2248 0.8770 -0.0238 -0.0122 0.0064  259 HIS A N   
748  C CA  . HIS A 97  ? 0.4049 0.2366 0.7886 -0.0215 -0.0096 0.0212  259 HIS A CA  
749  C C   . HIS A 97  ? 0.3702 0.2258 0.6881 -0.0356 0.0004  -0.0025 259 HIS A C   
750  O O   . HIS A 97  ? 0.3443 0.2298 0.6275 -0.0320 0.0070  -0.0143 259 HIS A O   
751  C CB  . HIS A 97  ? 0.4071 0.2554 0.8144 0.0013  -0.0073 0.0053  259 HIS A CB  
752  C CG  . HIS A 97  ? 0.4501 0.2767 0.9331 0.0207  -0.0197 0.0306  259 HIS A CG  
753  N ND1 . HIS A 97  ? 0.4843 0.2832 1.0323 0.0406  -0.0162 -0.0047 259 HIS A ND1 
754  C CD2 . HIS A 97  ? 0.4769 0.3063 0.9850 0.0235  -0.0366 0.0896  259 HIS A CD2 
755  C CE1 . HIS A 97  ? 0.5301 0.3093 1.1479 0.0579  -0.0315 0.0330  259 HIS A CE1 
756  N NE2 . HIS A 97  ? 0.5174 0.3157 1.1096 0.0469  -0.0455 0.0946  259 HIS A NE2 
757  N N   . LYS A 98  ? 0.3767 0.2199 0.6835 -0.0522 0.0003  -0.0063 260 LYS A N   
758  C CA  . LYS A 98  ? 0.3483 0.2139 0.6025 -0.0634 0.0060  -0.0215 260 LYS A CA  
759  C C   . LYS A 98  ? 0.3164 0.2159 0.5330 -0.0656 0.0085  0.0032  260 LYS A C   
760  O O   . LYS A 98  ? 0.3199 0.2303 0.5437 -0.0687 0.0046  0.0376  260 LYS A O   
761  C CB  . LYS A 98  ? 0.3614 0.2149 0.6233 -0.0804 0.0022  -0.0228 260 LYS A CB  
762  C CG  . LYS A 98  ? 0.3462 0.2223 0.5664 -0.0885 0.0043  -0.0396 260 LYS A CG  
763  C CD  . LYS A 98  ? 0.3554 0.2288 0.5924 -0.1053 -0.0015 -0.0394 260 LYS A CD  
764  C CE  . LYS A 98  ? 0.3589 0.2443 0.5752 -0.1113 -0.0057 -0.0714 260 LYS A CE  
765  N NZ  . LYS A 98  ? 0.3899 0.2680 0.6392 -0.1291 -0.0139 -0.0803 260 LYS A NZ  
766  N N   . LEU A 99  ? 0.2923 0.2096 0.4696 -0.0658 0.0149  -0.0146 261 LEU A N   
767  C CA  . LEU A 99  ? 0.2711 0.2162 0.4175 -0.0686 0.0188  -0.0018 261 LEU A CA  
768  C C   . LEU A 99  ? 0.2558 0.2076 0.3800 -0.0764 0.0217  -0.0080 261 LEU A C   
769  O O   . LEU A 99  ? 0.2455 0.1876 0.3632 -0.0776 0.0202  -0.0256 261 LEU A O   
770  C CB  . LEU A 99  ? 0.2632 0.2216 0.3933 -0.0621 0.0238  -0.0141 261 LEU A CB  
771  C CG  . LEU A 99  ? 0.2702 0.2400 0.4235 -0.0525 0.0205  -0.0045 261 LEU A CG  
772  C CD1 . LEU A 99  ? 0.2454 0.2339 0.3826 -0.0506 0.0278  -0.0227 261 LEU A CD1 
773  C CD2 . LEU A 99  ? 0.2427 0.2348 0.3981 -0.0561 0.0137  0.0283  261 LEU A CD2 
774  N N   . PHE A 100 ? 0.2465 0.2207 0.3613 -0.0813 0.0254  0.0057  262 PHE A N   
775  C CA  . PHE A 100 ? 0.2405 0.2260 0.3428 -0.0838 0.0300  -0.0026 262 PHE A CA  
776  C C   . PHE A 100 ? 0.2296 0.2229 0.3105 -0.0803 0.0363  -0.0134 262 PHE A C   
777  O O   . PHE A 100 ? 0.2325 0.2420 0.3063 -0.0819 0.0391  -0.0096 262 PHE A O   
778  C CB  . PHE A 100 ? 0.2422 0.2526 0.3551 -0.0924 0.0341  0.0118  262 PHE A CB  
779  C CG  . PHE A 100 ? 0.2292 0.2594 0.3395 -0.0913 0.0417  -0.0002 262 PHE A CG  
780  C CD1 . PHE A 100 ? 0.2414 0.2672 0.3668 -0.0889 0.0375  -0.0076 262 PHE A CD1 
781  C CD2 . PHE A 100 ? 0.2362 0.2942 0.3346 -0.0926 0.0525  -0.0061 262 PHE A CD2 
782  C CE1 . PHE A 100 ? 0.2368 0.2819 0.3727 -0.0834 0.0436  -0.0181 262 PHE A CE1 
783  C CE2 . PHE A 100 ? 0.2460 0.3209 0.3532 -0.0886 0.0617  -0.0235 262 PHE A CE2 
784  C CZ  . PHE A 100 ? 0.2278 0.2945 0.3578 -0.0820 0.0570  -0.0278 262 PHE A CZ  
785  N N   . ILE A 101 ? 0.2329 0.2153 0.3068 -0.0772 0.0367  -0.0250 263 ILE A N   
786  C CA  . ILE A 101 ? 0.2384 0.2199 0.3012 -0.0763 0.0428  -0.0346 263 ILE A CA  
787  C C   . ILE A 101 ? 0.2400 0.2237 0.3152 -0.0723 0.0458  -0.0405 263 ILE A C   
788  O O   . ILE A 101 ? 0.2483 0.2201 0.3310 -0.0675 0.0388  -0.0373 263 ILE A O   
789  C CB  . ILE A 101 ? 0.2498 0.2119 0.2996 -0.0762 0.0405  -0.0377 263 ILE A CB  
790  C CG1 . ILE A 101 ? 0.2678 0.2330 0.3144 -0.0771 0.0400  -0.0383 263 ILE A CG1 
791  C CG2 . ILE A 101 ? 0.2533 0.2085 0.2985 -0.0792 0.0468  -0.0444 263 ILE A CG2 
792  C CD1 . ILE A 101 ? 0.2795 0.2368 0.3326 -0.0753 0.0337  -0.0399 263 ILE A CD1 
793  N N   . GLY A 102 ? 0.2437 0.2476 0.3234 -0.0739 0.0558  -0.0510 264 GLY A N   
794  C CA  . GLY A 102 ? 0.2561 0.2653 0.3578 -0.0672 0.0622  -0.0644 264 GLY A CA  
795  C C   . GLY A 102 ? 0.2744 0.2698 0.3808 -0.0660 0.0697  -0.0845 264 GLY A C   
796  O O   . GLY A 102 ? 0.2792 0.2726 0.3679 -0.0747 0.0719  -0.0903 264 GLY A O   
797  N N   . GLY A 103 ? 0.2918 0.2776 0.4298 -0.0548 0.0726  -0.0959 265 GLY A N   
798  C CA  . GLY A 103 ? 0.3206 0.2822 0.4772 -0.0522 0.0793  -0.1169 265 GLY A CA  
799  C C   . GLY A 103 ? 0.3393 0.2533 0.4961 -0.0522 0.0691  -0.0997 265 GLY A C   
800  O O   . GLY A 103 ? 0.3586 0.2505 0.5216 -0.0591 0.0746  -0.1135 265 GLY A O   
801  N N   . LEU A 104 ? 0.3380 0.2403 0.4875 -0.0480 0.0544  -0.0699 266 LEU A N   
802  C CA  . LEU A 104 ? 0.3602 0.2265 0.5050 -0.0506 0.0443  -0.0466 266 LEU A CA  
803  C C   . LEU A 104 ? 0.3924 0.2310 0.5820 -0.0352 0.0371  -0.0372 266 LEU A C   
804  O O   . LEU A 104 ? 0.3942 0.2487 0.6141 -0.0193 0.0332  -0.0395 266 LEU A O   
805  C CB  . LEU A 104 ? 0.3540 0.2306 0.4671 -0.0548 0.0316  -0.0218 266 LEU A CB  
806  C CG  . LEU A 104 ? 0.3285 0.2268 0.4078 -0.0658 0.0359  -0.0276 266 LEU A CG  
807  C CD1 . LEU A 104 ? 0.3073 0.2185 0.3713 -0.0655 0.0242  -0.0150 266 LEU A CD1 
808  C CD2 . LEU A 104 ? 0.3149 0.2045 0.3746 -0.0795 0.0426  -0.0285 266 LEU A CD2 
809  N N   . PRO A 105 ? 0.4314 0.2293 0.6324 -0.0397 0.0346  -0.0242 267 PRO A N   
810  C CA  . PRO A 105 ? 0.4715 0.2378 0.7234 -0.0224 0.0238  -0.0068 267 PRO A CA  
811  C C   . PRO A 105 ? 0.4743 0.2559 0.7191 -0.0135 0.0013  0.0324  267 PRO A C   
812  O O   . PRO A 105 ? 0.4762 0.2680 0.6733 -0.0280 -0.0071 0.0565  267 PRO A O   
813  C CB  . PRO A 105 ? 0.5151 0.2327 0.7726 -0.0363 0.0243  0.0087  267 PRO A CB  
814  C CG  . PRO A 105 ? 0.4897 0.2199 0.7100 -0.0590 0.0402  -0.0164 267 PRO A CG  
815  C CD  . PRO A 105 ? 0.4439 0.2236 0.6200 -0.0609 0.0408  -0.0219 267 PRO A CD  
816  N N   . ASN A 106 ? 0.4824 0.2722 0.7763 0.0094  -0.0084 0.0356  268 ASN A N   
817  C CA  . ASN A 106 ? 0.4794 0.2999 0.7657 0.0157  -0.0312 0.0664  268 ASN A CA  
818  C C   . ASN A 106 ? 0.5218 0.3246 0.8009 0.0139  -0.0563 0.1198  268 ASN A C   
819  O O   . ASN A 106 ? 0.5225 0.3596 0.7828 0.0135  -0.0772 0.1448  268 ASN A O   
820  C CB  . ASN A 106 ? 0.4735 0.3253 0.8159 0.0390  -0.0338 0.0511  268 ASN A CB  
821  C CG  . ASN A 106 ? 0.5210 0.3440 0.9402 0.0627  -0.0285 0.0387  268 ASN A CG  
822  O OD1 . ASN A 106 ? 0.5959 0.3683 1.0358 0.0652  -0.0335 0.0576  268 ASN A OD1 
823  N ND2 . ASN A 106 ? 0.5295 0.3854 0.9965 0.0795  -0.0167 0.0052  268 ASN A ND2 
824  N N   . TYR A 107 ? 0.5593 0.3128 0.8521 0.0097  -0.0550 0.1386  269 TYR A N   
825  C CA  . TYR A 107 ? 0.6109 0.3497 0.8889 0.0019  -0.0778 0.1980  269 TYR A CA  
826  C C   . TYR A 107 ? 0.6013 0.3609 0.7964 -0.0298 -0.0740 0.2107  269 TYR A C   
827  O O   . TYR A 107 ? 0.6371 0.4001 0.8042 -0.0425 -0.0905 0.2592  269 TYR A O   
828  C CB  . TYR A 107 ? 0.6730 0.3463 1.0077 0.0082  -0.0793 0.2207  269 TYR A CB  
829  C CG  . TYR A 107 ? 0.6736 0.3081 1.0124 -0.0065 -0.0513 0.1822  269 TYR A CG  
830  C CD1 . TYR A 107 ? 0.6804 0.3067 0.9667 -0.0384 -0.0417 0.1935  269 TYR A CD1 
831  C CD2 . TYR A 107 ? 0.6645 0.2795 1.0609 0.0099  -0.0337 0.1308  269 TYR A CD2 
832  C CE1 . TYR A 107 ? 0.6812 0.2797 0.9752 -0.0535 -0.0187 0.1574  269 TYR A CE1 
833  C CE2 . TYR A 107 ? 0.6642 0.2527 1.0620 -0.0063 -0.0104 0.0917  269 TYR A CE2 
834  C CZ  . TYR A 107 ? 0.6749 0.2546 1.0230 -0.0380 -0.0045 0.1064  269 TYR A CZ  
835  O OH  . TYR A 107 ? 0.6841 0.2440 1.0379 -0.0557 0.0163  0.0667  269 TYR A OH  
836  N N   . LEU A 108 ? 0.5500 0.3285 0.7087 -0.0422 -0.0525 0.1682  270 LEU A N   
837  C CA  . LEU A 108 ? 0.5454 0.3458 0.6379 -0.0686 -0.0445 0.1700  270 LEU A CA  
838  C C   . LEU A 108 ? 0.5293 0.3821 0.5784 -0.0729 -0.0561 0.1703  270 LEU A C   
839  O O   . LEU A 108 ? 0.4923 0.3671 0.5561 -0.0601 -0.0597 0.1472  270 LEU A O   
840  C CB  . LEU A 108 ? 0.5028 0.3003 0.5856 -0.0776 -0.0185 0.1261  270 LEU A CB  
841  C CG  . LEU A 108 ? 0.5325 0.2880 0.6390 -0.0870 -0.0045 0.1216  270 LEU A CG  
842  C CD1 . LEU A 108 ? 0.5040 0.2760 0.5907 -0.0988 0.0162  0.0820  270 LEU A CD1 
843  C CD2 . LEU A 108 ? 0.5726 0.3082 0.6652 -0.1065 -0.0103 0.1678  270 LEU A CD2 
844  N N   . ASN A 109 ? 0.5603 0.4362 0.5570 -0.0940 -0.0603 0.1933  271 ASN A N   
845  C CA  . ASN A 109 ? 0.5596 0.4883 0.5124 -0.1022 -0.0701 0.1863  271 ASN A CA  
846  C C   . ASN A 109 ? 0.5254 0.4746 0.4452 -0.1143 -0.0482 0.1422  271 ASN A C   
847  O O   . ASN A 109 ? 0.5022 0.4300 0.4312 -0.1161 -0.0275 0.1221  271 ASN A O   
848  C CB  . ASN A 109 ? 0.6182 0.5749 0.5317 -0.1179 -0.0900 0.2346  271 ASN A CB  
849  C CG  . ASN A 109 ? 0.6479 0.6146 0.5120 -0.1458 -0.0731 0.2449  271 ASN A CG  
850  O OD1 . ASN A 109 ? 0.6108 0.5817 0.4603 -0.1542 -0.0482 0.2063  271 ASN A OD1 
851  N ND2 . ASN A 109 ? 0.6751 0.6512 0.5159 -0.1608 -0.0875 0.3007  271 ASN A ND2 
852  N N   . ASP A 110 ? 0.5331 0.5256 0.4200 -0.1221 -0.0547 0.1264  272 ASP A N   
853  C CA  . ASP A 110 ? 0.5098 0.5201 0.3795 -0.1284 -0.0372 0.0810  272 ASP A CA  
854  C C   . ASP A 110 ? 0.5125 0.5246 0.3588 -0.1427 -0.0143 0.0732  272 ASP A C   
855  O O   . ASP A 110 ? 0.4726 0.4699 0.3380 -0.1374 0.0029  0.0468  272 ASP A O   
856  C CB  . ASP A 110 ? 0.5337 0.5907 0.3730 -0.1380 -0.0493 0.0638  272 ASP A CB  
857  C CG  . ASP A 110 ? 0.5544 0.6180 0.4236 -0.1262 -0.0716 0.0649  272 ASP A CG  
858  O OD1 . ASP A 110 ? 0.5675 0.6601 0.4298 -0.1325 -0.0784 0.0364  272 ASP A OD1 
859  O OD2 . ASP A 110 ? 0.6133 0.6544 0.5188 -0.1110 -0.0819 0.0922  272 ASP A OD2 
860  N N   . ASP A 111 ? 0.5598 0.5964 0.3658 -0.1621 -0.0146 0.0985  273 ASP A N   
861  C CA  . ASP A 111 ? 0.5745 0.6242 0.3599 -0.1792 0.0094  0.0911  273 ASP A CA  
862  C C   . ASP A 111 ? 0.5518 0.5583 0.3727 -0.1759 0.0215  0.0993  273 ASP A C   
863  O O   . ASP A 111 ? 0.5302 0.5428 0.3578 -0.1798 0.0418  0.0736  273 ASP A O   
864  C CB  . ASP A 111 ? 0.6416 0.7321 0.3751 -0.2051 0.0073  0.1242  273 ASP A CB  
865  C CG  . ASP A 111 ? 0.6962 0.8439 0.3866 -0.2138 -0.0016 0.1051  273 ASP A CG  
866  O OD1 . ASP A 111 ? 0.7099 0.8774 0.4013 -0.2101 0.0112  0.0510  273 ASP A OD1 
867  O OD2 . ASP A 111 ? 0.7859 0.9590 0.4453 -0.2243 -0.0232 0.1437  273 ASP A OD2 
868  N N   . GLN A 112 ? 0.5616 0.5271 0.4103 -0.1682 0.0083  0.1319  274 GLN A N   
869  C CA  . GLN A 112 ? 0.5534 0.4759 0.4397 -0.1667 0.0186  0.1336  274 GLN A CA  
870  C C   . GLN A 112 ? 0.4976 0.4129 0.4116 -0.1513 0.0292  0.0889  274 GLN A C   
871  O O   . GLN A 112 ? 0.4773 0.3909 0.4014 -0.1583 0.0451  0.0720  274 GLN A O   
872  C CB  . GLN A 112 ? 0.5802 0.4575 0.5007 -0.1579 0.0019  0.1708  274 GLN A CB  
873  C CG  . GLN A 112 ? 0.6463 0.5235 0.5455 -0.1774 -0.0081 0.2273  274 GLN A CG  
874  C CD  . GLN A 112 ? 0.6845 0.5221 0.6229 -0.1624 -0.0323 0.2703  274 GLN A CD  
875  O OE1 . GLN A 112 ? 0.6501 0.4714 0.6280 -0.1359 -0.0425 0.2547  274 GLN A OE1 
876  N NE2 . GLN A 112 ? 0.7372 0.5627 0.6685 -0.1795 -0.0414 0.3270  274 GLN A NE2 
877  N N   . VAL A 113 ? 0.4734 0.3911 0.3993 -0.1329 0.0193  0.0728  275 VAL A N   
878  C CA  . VAL A 113 ? 0.4329 0.3493 0.3808 -0.1207 0.0275  0.0386  275 VAL A CA  
879  C C   . VAL A 113 ? 0.4207 0.3675 0.3524 -0.1261 0.0401  0.0125  275 VAL A C   
880  O O   . VAL A 113 ? 0.3997 0.3477 0.3481 -0.1233 0.0504  -0.0061 275 VAL A O   
881  C CB  . VAL A 113 ? 0.4138 0.3295 0.3803 -0.1037 0.0147  0.0328  275 VAL A CB  
882  C CG1 . VAL A 113 ? 0.3644 0.2874 0.3453 -0.0960 0.0226  0.0043  275 VAL A CG1 
883  C CG2 . VAL A 113 ? 0.4281 0.3160 0.4274 -0.0928 0.0065  0.0493  275 VAL A CG2 
884  N N   . LYS A 114 ? 0.4436 0.4185 0.3459 -0.1335 0.0384  0.0100  276 LYS A N   
885  C CA  . LYS A 114 ? 0.4378 0.4424 0.3324 -0.1362 0.0514  -0.0202 276 LYS A CA  
886  C C   . LYS A 114 ? 0.4394 0.4571 0.3354 -0.1473 0.0697  -0.0230 276 LYS A C   
887  O O   . LYS A 114 ? 0.4220 0.4579 0.3341 -0.1423 0.0810  -0.0489 276 LYS A O   
888  C CB  . LYS A 114 ? 0.4693 0.5075 0.3287 -0.1460 0.0479  -0.0271 276 LYS A CB  
889  C CG  . LYS A 114 ? 0.4757 0.5267 0.3456 -0.1378 0.0489  -0.0658 276 LYS A CG  
890  C CD  . LYS A 114 ? 0.5120 0.5950 0.3476 -0.1489 0.0397  -0.0756 276 LYS A CD  
891  C CE  . LYS A 114 ? 0.5751 0.7060 0.3690 -0.1687 0.0549  -0.0836 276 LYS A CE  
892  N NZ  . LYS A 114 ? 0.6124 0.7866 0.3645 -0.1835 0.0455  -0.0962 276 LYS A NZ  
893  N N   . GLU A 115 ? 0.4633 0.4723 0.3490 -0.1625 0.0714  0.0055  277 GLU A N   
894  C CA  . GLU A 115 ? 0.4728 0.4967 0.3622 -0.1791 0.0886  0.0063  277 GLU A CA  
895  C C   . GLU A 115 ? 0.4337 0.4466 0.3612 -0.1705 0.0932  -0.0115 277 GLU A C   
896  O O   . GLU A 115 ? 0.4344 0.4776 0.3743 -0.1758 0.1066  -0.0281 277 GLU A O   
897  C CB  . GLU A 115 ? 0.5182 0.5238 0.3958 -0.1992 0.0864  0.0470  277 GLU A CB  
898  C CG  . GLU A 115 ? 0.5425 0.5677 0.4211 -0.2245 0.1049  0.0538  277 GLU A CG  
899  C CD  . GLU A 115 ? 0.6054 0.6018 0.4787 -0.2464 0.1007  0.1013  277 GLU A CD  
900  O OE1 . GLU A 115 ? 0.6654 0.6194 0.5453 -0.2359 0.0819  0.1260  277 GLU A OE1 
901  O OE2 . GLU A 115 ? 0.6271 0.6434 0.4956 -0.2740 0.1159  0.1156  277 GLU A OE2 
902  N N   . LEU A 116 ? 0.4027 0.3806 0.3497 -0.1581 0.0820  -0.0089 278 LEU A N   
903  C CA  . LEU A 116 ? 0.3716 0.3488 0.3470 -0.1517 0.0841  -0.0265 278 LEU A CA  
904  C C   . LEU A 116 ? 0.3417 0.3469 0.3279 -0.1372 0.0852  -0.0482 278 LEU A C   
905  O O   . LEU A 116 ? 0.3390 0.3666 0.3450 -0.1375 0.0900  -0.0598 278 LEU A O   
906  C CB  . LEU A 116 ? 0.3611 0.3047 0.3515 -0.1414 0.0741  -0.0243 278 LEU A CB  
907  C CG  . LEU A 116 ? 0.3404 0.2921 0.3523 -0.1395 0.0762  -0.0431 278 LEU A CG  
908  C CD1 . LEU A 116 ? 0.3540 0.3080 0.3772 -0.1605 0.0848  -0.0469 278 LEU A CD1 
909  C CD2 . LEU A 116 ? 0.3325 0.2648 0.3559 -0.1280 0.0697  -0.0482 278 LEU A CD2 
910  N N   . LEU A 117 ? 0.3305 0.3338 0.3097 -0.1248 0.0789  -0.0526 279 LEU A N   
911  C CA  . LEU A 117 ? 0.3032 0.3203 0.3026 -0.1097 0.0778  -0.0700 279 LEU A CA  
912  C C   . LEU A 117 ? 0.3058 0.3573 0.3130 -0.1104 0.0902  -0.0885 279 LEU A C   
913  O O   . LEU A 117 ? 0.2924 0.3603 0.3313 -0.0995 0.0915  -0.0991 279 LEU A O   
914  C CB  . LEU A 117 ? 0.3025 0.3030 0.2987 -0.0998 0.0674  -0.0713 279 LEU A CB  
915  C CG  . LEU A 117 ? 0.2944 0.2705 0.2935 -0.0957 0.0568  -0.0571 279 LEU A CG  
916  C CD1 . LEU A 117 ? 0.2796 0.2466 0.2762 -0.0909 0.0467  -0.0574 279 LEU A CD1 
917  C CD2 . LEU A 117 ? 0.2719 0.2516 0.2935 -0.0890 0.0557  -0.0570 279 LEU A CD2 
918  N N   . THR A 118 ? 0.3266 0.3946 0.3073 -0.1232 0.0994  -0.0917 280 THR A N   
919  C CA  . THR A 118 ? 0.3374 0.4485 0.3260 -0.1256 0.1163  -0.1156 280 THR A CA  
920  C C   . THR A 118 ? 0.3327 0.4747 0.3397 -0.1357 0.1289  -0.1147 280 THR A C   
921  O O   . THR A 118 ? 0.3394 0.5251 0.3616 -0.1366 0.1450  -0.1360 280 THR A O   
922  C CB  . THR A 118 ? 0.3696 0.5033 0.3178 -0.1400 0.1245  -0.1226 280 THR A CB  
923  O OG1 . THR A 118 ? 0.4059 0.5339 0.3183 -0.1616 0.1232  -0.0897 280 THR A OG1 
924  C CG2 . THR A 118 ? 0.3689 0.4844 0.3074 -0.1306 0.1119  -0.1339 280 THR A CG2 
925  N N   . SER A 119 ? 0.3225 0.4467 0.3333 -0.1440 0.1229  -0.0949 281 SER A N   
926  C CA  . SER A 119 ? 0.3186 0.4753 0.3547 -0.1546 0.1319  -0.0981 281 SER A CA  
927  C C   . SER A 119 ? 0.2927 0.4779 0.3747 -0.1329 0.1288  -0.1165 281 SER A C   
928  O O   . SER A 119 ? 0.2865 0.5186 0.3979 -0.1359 0.1391  -0.1282 281 SER A O   
929  C CB  . SER A 119 ? 0.3170 0.4465 0.3526 -0.1684 0.1242  -0.0809 281 SER A CB  
930  O OG  . SER A 119 ? 0.2956 0.4004 0.3405 -0.1515 0.1083  -0.0808 281 SER A OG  
931  N N   . PHE A 120 ? 0.2773 0.4361 0.3691 -0.1116 0.1137  -0.1152 282 PHE A N   
932  C CA  . PHE A 120 ? 0.2632 0.4407 0.4011 -0.0891 0.1059  -0.1223 282 PHE A CA  
933  C C   . PHE A 120 ? 0.2722 0.4647 0.4378 -0.0716 0.1147  -0.1466 282 PHE A C   
934  O O   . PHE A 120 ? 0.2693 0.4827 0.4859 -0.0517 0.1107  -0.1532 282 PHE A O   
935  C CB  . PHE A 120 ? 0.2583 0.4010 0.3955 -0.0771 0.0867  -0.1053 282 PHE A CB  
936  C CG  . PHE A 120 ? 0.2531 0.3918 0.3744 -0.0902 0.0784  -0.0903 282 PHE A CG  
937  C CD1 . PHE A 120 ? 0.2609 0.3651 0.3464 -0.1034 0.0791  -0.0836 282 PHE A CD1 
938  C CD2 . PHE A 120 ? 0.2496 0.4231 0.3953 -0.0892 0.0695  -0.0856 282 PHE A CD2 
939  C CE1 . PHE A 120 ? 0.2564 0.3560 0.3336 -0.1146 0.0743  -0.0790 282 PHE A CE1 
940  C CE2 . PHE A 120 ? 0.2630 0.4384 0.3918 -0.1044 0.0635  -0.0807 282 PHE A CE2 
941  C CZ  . PHE A 120 ? 0.2657 0.4012 0.3614 -0.1167 0.0676  -0.0807 282 PHE A CZ  
942  N N   . GLY A 121 ? 0.2918 0.4747 0.4275 -0.0781 0.1252  -0.1607 283 GLY A N   
943  C CA  . GLY A 121 ? 0.3137 0.5100 0.4744 -0.0632 0.1355  -0.1945 283 GLY A CA  
944  C C   . GLY A 121 ? 0.3311 0.4978 0.4551 -0.0678 0.1337  -0.2043 283 GLY A C   
945  O O   . GLY A 121 ? 0.3234 0.4563 0.4117 -0.0768 0.1209  -0.1804 283 GLY A O   
946  N N   . PRO A 122 ? 0.3615 0.5461 0.4981 -0.0618 0.1466  -0.2436 284 PRO A N   
947  C CA  . PRO A 122 ? 0.3869 0.5571 0.4838 -0.0718 0.1451  -0.2585 284 PRO A CA  
948  C C   . PRO A 122 ? 0.3824 0.4985 0.4950 -0.0602 0.1243  -0.2514 284 PRO A C   
949  O O   . PRO A 122 ? 0.3685 0.4607 0.5340 -0.0402 0.1153  -0.2456 284 PRO A O   
950  C CB  . PRO A 122 ? 0.4202 0.6339 0.5343 -0.0689 0.1676  -0.3126 284 PRO A CB  
951  C CG  . PRO A 122 ? 0.4114 0.6379 0.6010 -0.0437 0.1737  -0.3265 284 PRO A CG  
952  C CD  . PRO A 122 ? 0.3777 0.6029 0.5702 -0.0456 0.1636  -0.2809 284 PRO A CD  
953  N N   . LEU A 123 ? 0.3961 0.4990 0.4642 -0.0746 0.1162  -0.2490 285 LEU A N   
954  C CA  . LEU A 123 ? 0.3879 0.4464 0.4642 -0.0707 0.0968  -0.2383 285 LEU A CA  
955  C C   . LEU A 123 ? 0.4237 0.4811 0.5097 -0.0722 0.0983  -0.2832 285 LEU A C   
956  O O   . LEU A 123 ? 0.4512 0.5467 0.5016 -0.0863 0.1092  -0.3124 285 LEU A O   
957  C CB  . LEU A 123 ? 0.3758 0.4252 0.4017 -0.0861 0.0840  -0.2027 285 LEU A CB  
958  C CG  . LEU A 123 ? 0.3466 0.3878 0.3611 -0.0880 0.0801  -0.1619 285 LEU A CG  
959  C CD1 . LEU A 123 ? 0.3319 0.3673 0.3035 -0.1018 0.0697  -0.1365 285 LEU A CD1 
960  C CD2 . LEU A 123 ? 0.3166 0.3300 0.3692 -0.0737 0.0705  -0.1443 285 LEU A CD2 
961  N N   . LYS A 124 ? 0.4229 0.4398 0.5563 -0.0609 0.0875  -0.2888 286 LYS A N   
962  C CA  . LYS A 124 ? 0.4637 0.4714 0.6079 -0.0673 0.0851  -0.3308 286 LYS A CA  
963  C C   . LYS A 124 ? 0.4548 0.4437 0.5734 -0.0823 0.0653  -0.3096 286 LYS A C   
964  O O   . LYS A 124 ? 0.4873 0.4742 0.6098 -0.0928 0.0604  -0.3427 286 LYS A O   
965  C CB  . LYS A 124 ? 0.4870 0.4602 0.7127 -0.0477 0.0875  -0.3594 286 LYS A CB  
966  C CG  . LYS A 124 ? 0.4724 0.3965 0.7455 -0.0349 0.0715  -0.3142 286 LYS A CG  
967  C CD  . LYS A 124 ? 0.5064 0.3928 0.8667 -0.0158 0.0722  -0.3388 286 LYS A CD  
968  C CE  . LYS A 124 ? 0.4950 0.3389 0.9003 -0.0050 0.0551  -0.2831 286 LYS A CE  
969  N NZ  . LYS A 124 ? 0.5420 0.3376 1.0381 0.0110  0.0513  -0.2981 286 LYS A NZ  
970  N N   . ALA A 125 ? 0.4178 0.3973 0.5153 -0.0838 0.0544  -0.2590 287 ALA A N   
971  C CA  . ALA A 125 ? 0.4089 0.3810 0.4868 -0.0962 0.0370  -0.2393 287 ALA A CA  
972  C C   . ALA A 125 ? 0.3727 0.3497 0.4193 -0.0966 0.0319  -0.1929 287 ALA A C   
973  O O   . ALA A 125 ? 0.3444 0.3145 0.4000 -0.0866 0.0381  -0.1715 287 ALA A O   
974  C CB  . ALA A 125 ? 0.4053 0.3376 0.5358 -0.0933 0.0270  -0.2355 287 ALA A CB  
975  N N   . PHE A 126 ? 0.3737 0.3646 0.3886 -0.1080 0.0195  -0.1797 288 PHE A N   
976  C CA  . PHE A 126 ? 0.3486 0.3393 0.3447 -0.1065 0.0137  -0.1395 288 PHE A CA  
977  C C   . PHE A 126 ? 0.3533 0.3563 0.3370 -0.1146 -0.0046 -0.1269 288 PHE A C   
978  O O   . PHE A 126 ? 0.3819 0.4102 0.3449 -0.1267 -0.0128 -0.1449 288 PHE A O   
979  C CB  . PHE A 126 ? 0.3588 0.3673 0.3201 -0.1092 0.0240  -0.1292 288 PHE A CB  
980  C CG  . PHE A 126 ? 0.3470 0.3502 0.2935 -0.1092 0.0171  -0.0916 288 PHE A CG  
981  C CD1 . PHE A 126 ? 0.3162 0.2980 0.2835 -0.0998 0.0213  -0.0742 288 PHE A CD1 
982  C CD2 . PHE A 126 ? 0.3821 0.4030 0.2979 -0.1184 0.0049  -0.0744 288 PHE A CD2 
983  C CE1 . PHE A 126 ? 0.3211 0.2941 0.2841 -0.0987 0.0165  -0.0478 288 PHE A CE1 
984  C CE2 . PHE A 126 ? 0.3800 0.3889 0.2955 -0.1150 -0.0024 -0.0395 288 PHE A CE2 
985  C CZ  . PHE A 126 ? 0.3445 0.3267 0.2863 -0.1047 0.0049  -0.0299 288 PHE A CZ  
986  N N   . ASN A 127 ? 0.3290 0.3206 0.3283 -0.1081 -0.0112 -0.0985 289 ASN A N   
987  C CA  . ASN A 127 ? 0.3344 0.3428 0.3314 -0.1115 -0.0289 -0.0826 289 ASN A CA  
988  C C   . ASN A 127 ? 0.3097 0.3074 0.3206 -0.0998 -0.0288 -0.0524 289 ASN A C   
989  O O   . ASN A 127 ? 0.2795 0.2615 0.3161 -0.0930 -0.0195 -0.0500 289 ASN A O   
990  C CB  . ASN A 127 ? 0.3377 0.3535 0.3625 -0.1198 -0.0402 -0.1000 289 ASN A CB  
991  C CG  . ASN A 127 ? 0.3173 0.3162 0.3857 -0.1145 -0.0370 -0.0887 289 ASN A CG  
992  O OD1 . ASN A 127 ? 0.3368 0.3122 0.4230 -0.1109 -0.0248 -0.0912 289 ASN A OD1 
993  N ND2 . ASN A 127 ? 0.3047 0.3222 0.3925 -0.1153 -0.0487 -0.0753 289 ASN A ND2 
994  N N   . LEU A 128 ? 0.3204 0.3284 0.3150 -0.0982 -0.0388 -0.0299 290 LEU A N   
995  C CA  . LEU A 128 ? 0.3081 0.3049 0.3252 -0.0854 -0.0404 -0.0059 290 LEU A CA  
996  C C   . LEU A 128 ? 0.3093 0.3273 0.3573 -0.0806 -0.0576 0.0017  290 LEU A C   
997  O O   . LEU A 128 ? 0.3285 0.3730 0.3658 -0.0863 -0.0771 0.0092  290 LEU A O   
998  C CB  . LEU A 128 ? 0.3311 0.3201 0.3258 -0.0852 -0.0424 0.0182  290 LEU A CB  
999  C CG  . LEU A 128 ? 0.3343 0.3042 0.3598 -0.0711 -0.0450 0.0408  290 LEU A CG  
1000 C CD1 . LEU A 128 ? 0.2887 0.2342 0.3336 -0.0649 -0.0245 0.0265  290 LEU A CD1 
1001 C CD2 . LEU A 128 ? 0.3703 0.3329 0.3764 -0.0749 -0.0540 0.0729  290 LEU A CD2 
1002 N N   . VAL A 129 ? 0.2882 0.3031 0.3750 -0.0716 -0.0503 -0.0007 291 VAL A N   
1003 C CA  . VAL A 129 ? 0.2892 0.3323 0.4143 -0.0683 -0.0625 0.0017  291 VAL A CA  
1004 C C   . VAL A 129 ? 0.3140 0.3672 0.4600 -0.0532 -0.0778 0.0255  291 VAL A C   
1005 O O   . VAL A 129 ? 0.3093 0.3410 0.4708 -0.0393 -0.0688 0.0336  291 VAL A O   
1006 C CB  . VAL A 129 ? 0.2594 0.3053 0.4192 -0.0663 -0.0462 -0.0082 291 VAL A CB  
1007 C CG1 . VAL A 129 ? 0.2460 0.3305 0.4509 -0.0656 -0.0568 -0.0070 291 VAL A CG1 
1008 C CG2 . VAL A 129 ? 0.2340 0.2654 0.3794 -0.0797 -0.0346 -0.0221 291 VAL A CG2 
1009 N N   . LYS A 130 ? 0.3475 0.4346 0.4987 -0.0562 -0.1025 0.0358  292 LYS A N   
1010 C CA  . LYS A 130 ? 0.3819 0.4831 0.5557 -0.0411 -0.1239 0.0662  292 LYS A CA  
1011 C C   . LYS A 130 ? 0.3883 0.5358 0.6159 -0.0341 -0.1412 0.0678  292 LYS A C   
1012 O O   . LYS A 130 ? 0.3862 0.5642 0.6156 -0.0501 -0.1464 0.0496  292 LYS A O   
1013 C CB  . LYS A 130 ? 0.4200 0.5318 0.5429 -0.0529 -0.1437 0.0872  292 LYS A CB  
1014 C CG  . LYS A 130 ? 0.4360 0.5081 0.5177 -0.0567 -0.1288 0.0968  292 LYS A CG  
1015 C CD  . LYS A 130 ? 0.4881 0.5824 0.5161 -0.0722 -0.1463 0.1204  292 LYS A CD  
1016 C CE  . LYS A 130 ? 0.5033 0.6221 0.4835 -0.0956 -0.1407 0.0862  292 LYS A CE  
1017 N NZ  . LYS A 130 ? 0.4839 0.5668 0.4527 -0.0989 -0.1094 0.0566  292 LYS A NZ  
1018 N N   . ASP A 131 ? 0.4142 0.5672 0.6929 -0.0101 -0.1501 0.0883  293 ASP A N   
1019 C CA  . ASP A 131 ? 0.4230 0.6300 0.7596 -0.0003 -0.1719 0.0958  293 ASP A CA  
1020 C C   . ASP A 131 ? 0.4660 0.7131 0.7714 -0.0142 -0.2079 0.1165  293 ASP A C   
1021 O O   . ASP A 131 ? 0.5065 0.7425 0.7795 -0.0121 -0.2242 0.1486  293 ASP A O   
1022 C CB  . ASP A 131 ? 0.4386 0.6401 0.8435 0.0331  -0.1752 0.1143  293 ASP A CB  
1023 C CG  . ASP A 131 ? 0.4454 0.7094 0.9253 0.0469  -0.1922 0.1156  293 ASP A CG  
1024 O OD1 . ASP A 131 ? 0.5047 0.7982 1.0119 0.0601  -0.2268 0.1497  293 ASP A OD1 
1025 O OD2 . ASP A 131 ? 0.4367 0.7261 0.9488 0.0427  -0.1718 0.0852  293 ASP A OD2 
1026 N N   . SER A 132 ? 0.4627 0.7604 0.7775 -0.0313 -0.2204 0.0987  294 SER A N   
1027 C CA  . SER A 132 ? 0.4974 0.8375 0.7681 -0.0533 -0.2508 0.1046  294 SER A CA  
1028 C C   . SER A 132 ? 0.5399 0.9234 0.8314 -0.0383 -0.2903 0.1501  294 SER A C   
1029 O O   . SER A 132 ? 0.5836 0.9749 0.8196 -0.0474 -0.3097 0.1769  294 SER A O   
1030 C CB  . SER A 132 ? 0.4886 0.8697 0.7711 -0.0789 -0.2540 0.0682  294 SER A CB  
1031 O OG  . SER A 132 ? 0.4899 0.9198 0.8500 -0.0683 -0.2656 0.0714  294 SER A OG  
1032 N N   . ALA A 133 ? 0.5291 0.9456 0.9032 -0.0155 -0.3017 0.1607  295 ALA A N   
1033 C CA  . ALA A 133 ? 0.5672 1.0303 0.9813 0.0044  -0.3428 0.2075  295 ALA A CA  
1034 C C   . ALA A 133 ? 0.6008 1.0148 1.0056 0.0265  -0.3486 0.2556  295 ALA A C   
1035 O O   . ALA A 133 ? 0.6522 1.0951 1.0356 0.0257  -0.3851 0.3028  295 ALA A O   
1036 C CB  . ALA A 133 ? 0.5470 1.0546 1.0667 0.0286  -0.3477 0.2027  295 ALA A CB  
1037 N N   . THR A 134 ? 0.5745 0.9176 0.9953 0.0430  -0.3139 0.2452  296 THR A N   
1038 C CA  . THR A 134 ? 0.6105 0.8974 1.0283 0.0600  -0.3159 0.2868  296 THR A CA  
1039 C C   . THR A 134 ? 0.6209 0.8721 0.9387 0.0307  -0.3034 0.2893  296 THR A C   
1040 O O   . THR A 134 ? 0.6749 0.9394 0.9483 0.0203  -0.3287 0.3335  296 THR A O   
1041 C CB  . THR A 134 ? 0.5921 0.8240 1.0842 0.0919  -0.2871 0.2720  296 THR A CB  
1042 O OG1 . THR A 134 ? 0.5498 0.7381 1.0046 0.0774  -0.2442 0.2257  296 THR A OG1 
1043 C CG2 . THR A 134 ? 0.5704 0.8505 1.1630 0.1188  -0.2925 0.2578  296 THR A CG2 
1044 N N   . GLY A 135 ? 0.5759 0.7901 0.8598 0.0166  -0.2653 0.2437  297 GLY A N   
1045 C CA  . GLY A 135 ? 0.5791 0.7661 0.7766 -0.0101 -0.2494 0.2375  297 GLY A CA  
1046 C C   . GLY A 135 ? 0.5554 0.6721 0.7477 -0.0061 -0.2139 0.2239  297 GLY A C   
1047 O O   . GLY A 135 ? 0.5578 0.6547 0.6877 -0.0264 -0.1990 0.2184  297 GLY A O   
1048 N N   . LEU A 136 ? 0.5316 0.6176 0.7915 0.0190  -0.1996 0.2141  298 LEU A N   
1049 C CA  . LEU A 136 ? 0.5236 0.5462 0.7890 0.0247  -0.1721 0.2059  298 LEU A CA  
1050 C C   . LEU A 136 ? 0.4634 0.4782 0.7230 0.0182  -0.1386 0.1532  298 LEU A C   
1051 O O   . LEU A 136 ? 0.4353 0.4863 0.7136 0.0182  -0.1365 0.1288  298 LEU A O   
1052 C CB  . LEU A 136 ? 0.5507 0.5451 0.8974 0.0561  -0.1792 0.2272  298 LEU A CB  
1053 C CG  . LEU A 136 ? 0.6122 0.6240 0.9733 0.0647  -0.2198 0.2891  298 LEU A CG  
1054 C CD1 . LEU A 136 ? 0.6195 0.6459 1.0828 0.1019  -0.2385 0.3025  298 LEU A CD1 
1055 C CD2 . LEU A 136 ? 0.6576 0.6188 0.9872 0.0542  -0.2218 0.3310  298 LEU A CD2 
1056 N N   . SER A 137 ? 0.4495 0.4213 0.6837 0.0104  -0.1141 0.1392  299 SER A N   
1057 C CA  . SER A 137 ? 0.4005 0.3712 0.6119 -0.0014 -0.0872 0.0980  299 SER A CA  
1058 C C   . SER A 137 ? 0.3669 0.3460 0.6315 0.0134  -0.0705 0.0688  299 SER A C   
1059 O O   . SER A 137 ? 0.3857 0.3546 0.7056 0.0342  -0.0703 0.0706  299 SER A O   
1060 C CB  . SER A 137 ? 0.4015 0.3335 0.5744 -0.0142 -0.0684 0.0928  299 SER A CB  
1061 O OG  . SER A 137 ? 0.3663 0.2951 0.5376 -0.0179 -0.0440 0.0573  299 SER A OG  
1062 N N   . LYS A 138 ? 0.3271 0.3270 0.5765 0.0018  -0.0560 0.0423  300 LYS A N   
1063 C CA  . LYS A 138 ? 0.2992 0.3165 0.5857 0.0085  -0.0359 0.0151  300 LYS A CA  
1064 C C   . LYS A 138 ? 0.2825 0.2742 0.5483 0.0026  -0.0107 -0.0060 300 LYS A C   
1065 O O   . LYS A 138 ? 0.2626 0.2716 0.5511 0.0058  0.0082  -0.0298 300 LYS A O   
1066 C CB  . LYS A 138 ? 0.2743 0.3322 0.5590 -0.0047 -0.0357 0.0055  300 LYS A CB  
1067 C CG  . LYS A 138 ? 0.2813 0.3741 0.5891 -0.0029 -0.0615 0.0206  300 LYS A CG  
1068 C CD  . LYS A 138 ? 0.2652 0.4031 0.6005 -0.0127 -0.0578 0.0073  300 LYS A CD  
1069 C CE  . LYS A 138 ? 0.2786 0.4569 0.6404 -0.0119 -0.0872 0.0211  300 LYS A CE  
1070 N NZ  . LYS A 138 ? 0.2566 0.4837 0.6552 -0.0240 -0.0856 0.0091  300 LYS A NZ  
1071 N N   . GLY A 139 ? 0.2888 0.2480 0.5116 -0.0079 -0.0107 0.0020  301 GLY A N   
1072 C CA  . GLY A 139 ? 0.2881 0.2264 0.4941 -0.0146 0.0091  -0.0162 301 GLY A CA  
1073 C C   . GLY A 139 ? 0.2646 0.2162 0.4323 -0.0310 0.0197  -0.0272 301 GLY A C   
1074 O O   . GLY A 139 ? 0.2608 0.2085 0.4178 -0.0367 0.0345  -0.0431 301 GLY A O   
1075 N N   . TYR A 140 ? 0.2518 0.2197 0.4034 -0.0386 0.0106  -0.0194 302 TYR A N   
1076 C CA  . TYR A 140 ? 0.2306 0.2045 0.3562 -0.0514 0.0176  -0.0252 302 TYR A CA  
1077 C C   . TYR A 140 ? 0.2372 0.2080 0.3401 -0.0598 0.0057  -0.0188 302 TYR A C   
1078 O O   . TYR A 140 ? 0.2438 0.2216 0.3490 -0.0592 -0.0094 -0.0111 302 TYR A O   
1079 C CB  . TYR A 140 ? 0.2071 0.2100 0.3508 -0.0546 0.0275  -0.0325 302 TYR A CB  
1080 C CG  . TYR A 140 ? 0.1963 0.2250 0.3716 -0.0527 0.0207  -0.0293 302 TYR A CG  
1081 C CD1 . TYR A 140 ? 0.1945 0.2313 0.3697 -0.0640 0.0118  -0.0235 302 TYR A CD1 
1082 C CD2 . TYR A 140 ? 0.1888 0.2363 0.4016 -0.0401 0.0239  -0.0355 302 TYR A CD2 
1083 C CE1 . TYR A 140 ? 0.1903 0.2561 0.3986 -0.0662 0.0050  -0.0218 302 TYR A CE1 
1084 C CE2 . TYR A 140 ? 0.2002 0.2805 0.4488 -0.0385 0.0174  -0.0329 302 TYR A CE2 
1085 C CZ  . TYR A 140 ? 0.1934 0.2847 0.4380 -0.0534 0.0074  -0.0252 302 TYR A CZ  
1086 O OH  . TYR A 140 ? 0.1716 0.3003 0.4555 -0.0555 0.0003  -0.0238 302 TYR A OH  
1087 N N   . ALA A 141 ? 0.2343 0.1988 0.3175 -0.0673 0.0122  -0.0243 303 ALA A N   
1088 C CA  . ALA A 141 ? 0.2476 0.2083 0.3123 -0.0742 0.0061  -0.0281 303 ALA A CA  
1089 C C   . ALA A 141 ? 0.2456 0.2052 0.3184 -0.0784 0.0112  -0.0348 303 ALA A C   
1090 O O   . ALA A 141 ? 0.2420 0.2056 0.3246 -0.0775 0.0191  -0.0301 303 ALA A O   
1091 C CB  . ALA A 141 ? 0.2544 0.2051 0.2919 -0.0764 0.0092  -0.0271 303 ALA A CB  
1092 N N   . PHE A 142 ? 0.2626 0.2186 0.3335 -0.0836 0.0060  -0.0456 304 PHE A N   
1093 C CA  . PHE A 142 ? 0.2657 0.2115 0.3531 -0.0850 0.0095  -0.0520 304 PHE A CA  
1094 C C   . PHE A 142 ? 0.2820 0.2232 0.3565 -0.0840 0.0131  -0.0702 304 PHE A C   
1095 O O   . PHE A 142 ? 0.2970 0.2473 0.3490 -0.0887 0.0099  -0.0816 304 PHE A O   
1096 C CB  . PHE A 142 ? 0.2639 0.2074 0.3779 -0.0931 0.0017  -0.0559 304 PHE A CB  
1097 C CG  . PHE A 142 ? 0.2477 0.2051 0.3795 -0.0964 0.0012  -0.0392 304 PHE A CG  
1098 C CD1 . PHE A 142 ? 0.2397 0.1972 0.3908 -0.0995 0.0072  -0.0225 304 PHE A CD1 
1099 C CD2 . PHE A 142 ? 0.2342 0.2108 0.3656 -0.0963 -0.0052 -0.0379 304 PHE A CD2 
1100 C CE1 . PHE A 142 ? 0.2275 0.2084 0.3932 -0.1053 0.0106  -0.0091 304 PHE A CE1 
1101 C CE2 . PHE A 142 ? 0.2209 0.2186 0.3758 -0.0981 -0.0026 -0.0270 304 PHE A CE2 
1102 C CZ  . PHE A 142 ? 0.2177 0.2197 0.3874 -0.1038 0.0073  -0.0147 304 PHE A CZ  
1103 N N   . CYS A 143 ? 0.2829 0.2169 0.3729 -0.0781 0.0195  -0.0721 305 CYS A N   
1104 C CA  . CYS A 143 ? 0.3130 0.2485 0.4022 -0.0752 0.0255  -0.0952 305 CYS A CA  
1105 C C   . CYS A 143 ? 0.3250 0.2483 0.4549 -0.0654 0.0278  -0.0990 305 CYS A C   
1106 O O   . CYS A 143 ? 0.3279 0.2419 0.4818 -0.0623 0.0233  -0.0757 305 CYS A O   
1107 C CB  . CYS A 143 ? 0.3113 0.2635 0.3709 -0.0755 0.0338  -0.0934 305 CYS A CB  
1108 S SG  . CYS A 143 ? 0.3336 0.2918 0.4079 -0.0677 0.0396  -0.0785 305 CYS A SG  
1109 N N   . GLU A 144 ? 0.3439 0.2716 0.4833 -0.0605 0.0352  -0.1274 306 GLU A N   
1110 C CA  . GLU A 144 ? 0.3581 0.2739 0.5478 -0.0464 0.0371  -0.1349 306 GLU A CA  
1111 C C   . GLU A 144 ? 0.3625 0.3023 0.5549 -0.0389 0.0507  -0.1641 306 GLU A C   
1112 O O   . GLU A 144 ? 0.3777 0.3348 0.5435 -0.0473 0.0593  -0.1949 306 GLU A O   
1113 C CB  . GLU A 144 ? 0.3861 0.2708 0.6148 -0.0481 0.0310  -0.1510 306 GLU A CB  
1114 C CG  . GLU A 144 ? 0.4140 0.2731 0.7083 -0.0324 0.0279  -0.1439 306 GLU A CG  
1115 C CD  . GLU A 144 ? 0.4613 0.2796 0.7995 -0.0387 0.0195  -0.1479 306 GLU A CD  
1116 O OE1 . GLU A 144 ? 0.4895 0.3073 0.8026 -0.0571 0.0157  -0.1551 306 GLU A OE1 
1117 O OE2 . GLU A 144 ? 0.4908 0.2785 0.8936 -0.0257 0.0155  -0.1416 306 GLU A OE2 
1118 N N   . TYR A 145 ? 0.3537 0.3028 0.5782 -0.0244 0.0526  -0.1534 307 TYR A N   
1119 C CA  . TYR A 145 ? 0.3584 0.3413 0.5919 -0.0171 0.0670  -0.1780 307 TYR A CA  
1120 C C   . TYR A 145 ? 0.3931 0.3691 0.6858 -0.0006 0.0739  -0.2167 307 TYR A C   
1121 O O   . TYR A 145 ? 0.4076 0.3493 0.7546 0.0127  0.0633  -0.2077 307 TYR A O   
1122 C CB  . TYR A 145 ? 0.3287 0.3346 0.5742 -0.0098 0.0641  -0.1497 307 TYR A CB  
1123 C CG  . TYR A 145 ? 0.2970 0.3186 0.4891 -0.0267 0.0644  -0.1289 307 TYR A CG  
1124 C CD1 . TYR A 145 ? 0.3011 0.3509 0.4610 -0.0391 0.0783  -0.1427 307 TYR A CD1 
1125 C CD2 . TYR A 145 ? 0.2743 0.2835 0.4515 -0.0318 0.0522  -0.0963 307 TYR A CD2 
1126 C CE1 . TYR A 145 ? 0.2891 0.3441 0.4091 -0.0552 0.0781  -0.1230 307 TYR A CE1 
1127 C CE2 . TYR A 145 ? 0.2578 0.2774 0.3950 -0.0460 0.0539  -0.0846 307 TYR A CE2 
1128 C CZ  . TYR A 145 ? 0.2663 0.3036 0.3783 -0.0570 0.0658  -0.0972 307 TYR A CZ  
1129 O OH  . TYR A 145 ? 0.2663 0.3047 0.3482 -0.0713 0.0668  -0.0852 307 TYR A OH  
1130 N N   . VAL A 146 ? 0.4126 0.4227 0.6985 -0.0020 0.0928  -0.2592 308 VAL A N   
1131 C CA  . VAL A 146 ? 0.4532 0.4659 0.8009 0.0156  0.1045  -0.3075 308 VAL A CA  
1132 C C   . VAL A 146 ? 0.4566 0.4613 0.8832 0.0438  0.0970  -0.2890 308 VAL A C   
1133 O O   . VAL A 146 ? 0.4847 0.4482 0.9764 0.0606  0.0881  -0.2925 308 VAL A O   
1134 C CB  . VAL A 146 ? 0.4687 0.5396 0.7932 0.0085  0.1305  -0.3537 308 VAL A CB  
1135 C CG1 . VAL A 146 ? 0.4974 0.5807 0.8998 0.0322  0.1460  -0.4066 308 VAL A CG1 
1136 C CG2 . VAL A 146 ? 0.4868 0.5692 0.7400 -0.0185 0.1353  -0.3749 308 VAL A CG2 
1137 N N   . ASP A 147 ? 0.4400 0.4851 0.8644 0.0479  0.0990  -0.2671 309 ASP A N   
1138 C CA  . ASP A 147 ? 0.4377 0.4856 0.9304 0.0727  0.0858  -0.2385 309 ASP A CA  
1139 C C   . ASP A 147 ? 0.4192 0.4362 0.8907 0.0656  0.0615  -0.1797 309 ASP A C   
1140 O O   . ASP A 147 ? 0.3910 0.4197 0.7970 0.0448  0.0593  -0.1572 309 ASP A O   
1141 C CB  . ASP A 147 ? 0.4245 0.5377 0.9233 0.0758  0.0958  -0.2397 309 ASP A CB  
1142 C CG  . ASP A 147 ? 0.4403 0.5695 1.0245 0.1059  0.0814  -0.2180 309 ASP A CG  
1143 O OD1 . ASP A 147 ? 0.4404 0.6295 1.0479 0.1117  0.0891  -0.2247 309 ASP A OD1 
1144 O OD2 . ASP A 147 ? 0.4966 0.5816 1.1277 0.1225  0.0612  -0.1907 309 ASP A OD2 
1145 N N   . ILE A 148 ? 0.4436 0.4216 0.9731 0.0818  0.0445  -0.1557 310 ILE A N   
1146 C CA  . ILE A 148 ? 0.4340 0.3888 0.9432 0.0722  0.0234  -0.0989 310 ILE A CA  
1147 C C   . ILE A 148 ? 0.4116 0.4092 0.9188 0.0759  0.0094  -0.0545 310 ILE A C   
1148 O O   . ILE A 148 ? 0.4008 0.3986 0.8717 0.0620  -0.0036 -0.0128 310 ILE A O   
1149 C CB  . ILE A 148 ? 0.4766 0.3728 1.0457 0.0818  0.0098  -0.0816 310 ILE A CB  
1150 C CG1 . ILE A 148 ? 0.5100 0.3978 1.1798 0.1150  0.0046  -0.0869 310 ILE A CG1 
1151 C CG2 . ILE A 148 ? 0.5017 0.3584 1.0525 0.0662  0.0200  -0.1209 310 ILE A CG2 
1152 C CD1 . ILE A 148 ? 0.5698 0.3897 1.3095 0.1239  -0.0072 -0.0746 310 ILE A CD1 
1153 N N   . ASN A 149 ? 0.4063 0.4477 0.9528 0.0928  0.0129  -0.0669 311 ASN A N   
1154 C CA  . ASN A 149 ? 0.3853 0.4800 0.9278 0.0927  -0.0007 -0.0324 311 ASN A CA  
1155 C C   . ASN A 149 ? 0.3439 0.4701 0.8045 0.0638  0.0097  -0.0399 311 ASN A C   
1156 O O   . ASN A 149 ? 0.3324 0.4974 0.7731 0.0547  -0.0017 -0.0138 311 ASN A O   
1157 C CB  . ASN A 149 ? 0.3979 0.5361 1.0174 0.1198  -0.0005 -0.0460 311 ASN A CB  
1158 C CG  . ASN A 149 ? 0.4533 0.5539 1.1695 0.1531  -0.0088 -0.0459 311 ASN A CG  
1159 O OD1 . ASN A 149 ? 0.4950 0.5344 1.2189 0.1524  -0.0162 -0.0313 311 ASN A OD1 
1160 N ND2 . ASN A 149 ? 0.4579 0.5953 1.2555 0.1821  -0.0068 -0.0639 311 ASN A ND2 
1161 N N   . VAL A 150 ? 0.3275 0.4376 0.7442 0.0489  0.0303  -0.0757 312 VAL A N   
1162 C CA  . VAL A 150 ? 0.2980 0.4235 0.6442 0.0222  0.0397  -0.0801 312 VAL A CA  
1163 C C   . VAL A 150 ? 0.2840 0.3839 0.5842 0.0072  0.0282  -0.0502 312 VAL A C   
1164 O O   . VAL A 150 ? 0.2718 0.3919 0.5335 -0.0092 0.0268  -0.0402 312 VAL A O   
1165 C CB  . VAL A 150 ? 0.2984 0.4166 0.6134 0.0110  0.0622  -0.1195 312 VAL A CB  
1166 C CG1 . VAL A 150 ? 0.2829 0.4051 0.5311 -0.0156 0.0685  -0.1147 312 VAL A CG1 
1167 C CG2 . VAL A 150 ? 0.2974 0.4565 0.6528 0.0217  0.0787  -0.1529 312 VAL A CG2 
1168 N N   . THR A 151 ? 0.2969 0.3548 0.6070 0.0120  0.0213  -0.0393 313 THR A N   
1169 C CA  . THR A 151 ? 0.2922 0.3318 0.5674 -0.0016 0.0126  -0.0116 313 THR A CA  
1170 C C   . THR A 151 ? 0.2789 0.3579 0.5325 -0.0106 0.0025  0.0164  313 THR A C   
1171 O O   . THR A 151 ? 0.2593 0.3452 0.4659 -0.0279 0.0075  0.0133  313 THR A O   
1172 C CB  . THR A 151 ? 0.3150 0.3158 0.6287 0.0070  0.0018  0.0088  313 THR A CB  
1173 O OG1 . THR A 151 ? 0.3219 0.2895 0.6599 0.0139  0.0112  -0.0264 313 THR A OG1 
1174 C CG2 . THR A 151 ? 0.3080 0.2960 0.5861 -0.0105 -0.0027 0.0339  313 THR A CG2 
1175 N N   . ASP A 152 ? 0.2945 0.4024 0.5857 0.0013  -0.0126 0.0418  314 ASP A N   
1176 C CA  . ASP A 152 ? 0.2962 0.4529 0.5637 -0.0101 -0.0246 0.0667  314 ASP A CA  
1177 C C   . ASP A 152 ? 0.2743 0.4678 0.5120 -0.0245 -0.0154 0.0397  314 ASP A C   
1178 O O   . ASP A 152 ? 0.2740 0.4952 0.4741 -0.0423 -0.0184 0.0443  314 ASP A O   
1179 C CB  . ASP A 152 ? 0.3190 0.5065 0.6359 0.0061  -0.0474 0.1053  314 ASP A CB  
1180 C CG  . ASP A 152 ? 0.3576 0.5159 0.6916 0.0099  -0.0608 0.1485  314 ASP A CG  
1181 O OD1 . ASP A 152 ? 0.3889 0.5577 0.7750 0.0266  -0.0810 0.1867  314 ASP A OD1 
1182 O OD2 . ASP A 152 ? 0.3722 0.4980 0.6724 -0.0043 -0.0517 0.1471  314 ASP A OD2 
1183 N N   . GLN A 153 ? 0.2615 0.4567 0.5174 -0.0192 -0.0028 0.0100  315 GLN A N   
1184 C CA  . GLN A 153 ? 0.2486 0.4738 0.4826 -0.0365 0.0076  -0.0134 315 GLN A CA  
1185 C C   . GLN A 153 ? 0.2375 0.4293 0.4182 -0.0566 0.0215  -0.0292 315 GLN A C   
1186 O O   . GLN A 153 ? 0.2360 0.4445 0.3907 -0.0752 0.0231  -0.0361 315 GLN A O   
1187 C CB  . GLN A 153 ? 0.2475 0.4904 0.5185 -0.0274 0.0195  -0.0372 315 GLN A CB  
1188 C CG  . GLN A 153 ? 0.2627 0.5510 0.5981 -0.0060 0.0053  -0.0250 315 GLN A CG  
1189 C CD  . GLN A 153 ? 0.2610 0.5709 0.6427 0.0064  0.0215  -0.0548 315 GLN A CD  
1190 O OE1 . GLN A 153 ? 0.2428 0.5297 0.6057 0.0003  0.0433  -0.0827 315 GLN A OE1 
1191 N NE2 . GLN A 153 ? 0.2770 0.6391 0.7205 0.0237  0.0105  -0.0484 315 GLN A NE2 
1192 N N   . ALA A 154 ? 0.2325 0.3786 0.4024 -0.0526 0.0303  -0.0363 316 ALA A N   
1193 C CA  . ALA A 154 ? 0.2272 0.3419 0.3554 -0.0668 0.0387  -0.0437 316 ALA A CA  
1194 C C   . ALA A 154 ? 0.2217 0.3423 0.3279 -0.0757 0.0316  -0.0313 316 ALA A C   
1195 O O   . ALA A 154 ? 0.2228 0.3433 0.3057 -0.0903 0.0375  -0.0432 316 ALA A O   
1196 C CB  . ALA A 154 ? 0.2285 0.3024 0.3533 -0.0596 0.0428  -0.0479 316 ALA A CB  
1197 N N   . ILE A 155 ? 0.2205 0.3474 0.3376 -0.0678 0.0201  -0.0082 317 ILE A N   
1198 C CA  . ILE A 155 ? 0.2249 0.3697 0.3192 -0.0780 0.0154  0.0045  317 ILE A CA  
1199 C C   . ILE A 155 ? 0.2251 0.4168 0.3052 -0.0922 0.0131  -0.0055 317 ILE A C   
1200 O O   . ILE A 155 ? 0.2246 0.4207 0.2787 -0.1061 0.0204  -0.0222 317 ILE A O   
1201 C CB  . ILE A 155 ? 0.2380 0.3917 0.3492 -0.0704 0.0019  0.0399  317 ILE A CB  
1202 C CG1 . ILE A 155 ? 0.2466 0.3514 0.3724 -0.0622 0.0050  0.0449  317 ILE A CG1 
1203 C CG2 . ILE A 155 ? 0.2466 0.4383 0.3287 -0.0853 -0.0015 0.0540  317 ILE A CG2 
1204 C CD1 . ILE A 155 ? 0.2646 0.3648 0.4210 -0.0548 -0.0084 0.0822  317 ILE A CD1 
1205 N N   . ALA A 156 ? 0.2222 0.4506 0.3252 -0.0884 0.0030  0.0008  318 ALA A N   
1206 C CA  . ALA A 156 ? 0.2290 0.5121 0.3230 -0.1043 -0.0030 -0.0092 318 ALA A CA  
1207 C C   . ALA A 156 ? 0.2198 0.4897 0.3027 -0.1207 0.0120  -0.0455 318 ALA A C   
1208 O O   . ALA A 156 ? 0.2233 0.5213 0.2897 -0.1396 0.0122  -0.0644 318 ALA A O   
1209 C CB  . ALA A 156 ? 0.2261 0.5570 0.3575 -0.0941 -0.0201 0.0090  318 ALA A CB  
1210 N N   . GLY A 157 ? 0.2131 0.4409 0.3056 -0.1154 0.0244  -0.0549 319 GLY A N   
1211 C CA  . GLY A 157 ? 0.2195 0.4296 0.3060 -0.1321 0.0379  -0.0795 319 GLY A CA  
1212 C C   . GLY A 157 ? 0.2299 0.3920 0.2938 -0.1383 0.0483  -0.0905 319 GLY A C   
1213 O O   . GLY A 157 ? 0.2435 0.3897 0.3064 -0.1544 0.0568  -0.1085 319 GLY A O   
1214 N N   . LEU A 158 ? 0.2205 0.3597 0.2738 -0.1258 0.0470  -0.0786 320 LEU A N   
1215 C CA  . LEU A 158 ? 0.2300 0.3282 0.2716 -0.1265 0.0554  -0.0868 320 LEU A CA  
1216 C C   . LEU A 158 ? 0.2391 0.3506 0.2691 -0.1273 0.0557  -0.0921 320 LEU A C   
1217 O O   . LEU A 158 ? 0.2505 0.3417 0.2800 -0.1310 0.0641  -0.1104 320 LEU A O   
1218 C CB  . LEU A 158 ? 0.2168 0.2780 0.2592 -0.1132 0.0566  -0.0729 320 LEU A CB  
1219 C CG  . LEU A 158 ? 0.2188 0.2686 0.2654 -0.1149 0.0612  -0.0721 320 LEU A CG  
1220 C CD1 . LEU A 158 ? 0.2157 0.2406 0.2578 -0.1036 0.0608  -0.0631 320 LEU A CD1 
1221 C CD2 . LEU A 158 ? 0.2271 0.2582 0.2710 -0.1308 0.0691  -0.0812 320 LEU A CD2 
1222 N N   . ASN A 159 ? 0.2426 0.3904 0.2673 -0.1241 0.0472  -0.0752 321 ASN A N   
1223 C CA  . ASN A 159 ? 0.2564 0.4267 0.2668 -0.1276 0.0501  -0.0764 321 ASN A CA  
1224 C C   . ASN A 159 ? 0.2834 0.4896 0.2809 -0.1447 0.0560  -0.1084 321 ASN A C   
1225 O O   . ASN A 159 ? 0.3008 0.5447 0.2943 -0.1560 0.0487  -0.1145 321 ASN A O   
1226 C CB  . ASN A 159 ? 0.2547 0.4579 0.2622 -0.1239 0.0384  -0.0418 321 ASN A CB  
1227 C CG  . ASN A 159 ? 0.2685 0.5014 0.2588 -0.1312 0.0436  -0.0377 321 ASN A CG  
1228 O OD1 . ASN A 159 ? 0.2769 0.4872 0.2698 -0.1283 0.0552  -0.0488 321 ASN A OD1 
1229 N ND2 . ASN A 159 ? 0.2637 0.5548 0.2374 -0.1415 0.0348  -0.0197 321 ASN A ND2 
1230 N N   . GLY A 160 ? 0.3009 0.4992 0.2966 -0.1467 0.0691  -0.1329 322 GLY A N   
1231 C CA  . GLY A 160 ? 0.3351 0.5659 0.3231 -0.1631 0.0781  -0.1748 322 GLY A CA  
1232 C C   . GLY A 160 ? 0.3543 0.5507 0.3617 -0.1713 0.0829  -0.2069 322 GLY A C   
1233 O O   . GLY A 160 ? 0.3922 0.6145 0.3980 -0.1882 0.0888  -0.2471 322 GLY A O   
1234 N N   . MET A 161 ? 0.3440 0.4837 0.3698 -0.1622 0.0811  -0.1906 323 MET A N   
1235 C CA  . MET A 161 ? 0.3647 0.4691 0.4105 -0.1733 0.0845  -0.2085 323 MET A CA  
1236 C C   . MET A 161 ? 0.3907 0.4346 0.4625 -0.1659 0.0946  -0.2219 323 MET A C   
1237 O O   . MET A 161 ? 0.3826 0.4088 0.4582 -0.1480 0.0964  -0.2093 323 MET A O   
1238 C CB  . MET A 161 ? 0.3402 0.4316 0.3883 -0.1714 0.0768  -0.1779 323 MET A CB  
1239 C CG  . MET A 161 ? 0.3205 0.4664 0.3561 -0.1699 0.0647  -0.1576 323 MET A CG  
1240 S SD  . MET A 161 ? 0.3148 0.5283 0.3495 -0.1934 0.0569  -0.1794 323 MET A SD  
1241 C CE  . MET A 161 ? 0.3235 0.5110 0.3836 -0.2042 0.0607  -0.1798 323 MET A CE  
1242 N N   . GLN A 162 ? 0.4356 0.4486 0.5314 -0.1801 0.0998  -0.2458 324 GLN A N   
1243 C CA  . GLN A 162 ? 0.4705 0.4230 0.6025 -0.1729 0.1078  -0.2590 324 GLN A CA  
1244 C C   . GLN A 162 ? 0.4747 0.3724 0.6168 -0.1651 0.1020  -0.2167 324 GLN A C   
1245 O O   . GLN A 162 ? 0.4697 0.3665 0.6022 -0.1780 0.0980  -0.1961 324 GLN A O   
1246 C CB  . GLN A 162 ? 0.5188 0.4584 0.6790 -0.1939 0.1159  -0.3055 324 GLN A CB  
1247 C CG  . GLN A 162 ? 0.5815 0.4630 0.7912 -0.1833 0.1255  -0.3306 324 GLN A CG  
1248 C CD  . GLN A 162 ? 0.6379 0.5524 0.8537 -0.1700 0.1371  -0.3715 324 GLN A CD  
1249 O OE1 . GLN A 162 ? 0.6612 0.6447 0.8455 -0.1812 0.1413  -0.3995 324 GLN A OE1 
1250 N NE2 . GLN A 162 ? 0.6775 0.5485 0.9363 -0.1467 0.1423  -0.3737 324 GLN A NE2 
1251 N N   . LEU A 163 ? 0.4883 0.3498 0.6496 -0.1447 0.1014  -0.2036 325 LEU A N   
1252 C CA  . LEU A 163 ? 0.4984 0.3133 0.6679 -0.1375 0.0935  -0.1618 325 LEU A CA  
1253 C C   . LEU A 163 ? 0.5450 0.3119 0.7627 -0.1223 0.0948  -0.1683 325 LEU A C   
1254 O O   . LEU A 163 ? 0.5395 0.3142 0.7681 -0.1002 0.0932  -0.1679 325 LEU A O   
1255 C CB  . LEU A 163 ? 0.4630 0.3004 0.6013 -0.1235 0.0848  -0.1291 325 LEU A CB  
1256 C CG  . LEU A 163 ? 0.4729 0.2881 0.5982 -0.1237 0.0758  -0.0864 325 LEU A CG  
1257 C CD1 . LEU A 163 ? 0.4935 0.3180 0.6013 -0.1462 0.0791  -0.0787 325 LEU A CD1 
1258 C CD2 . LEU A 163 ? 0.4237 0.2645 0.5245 -0.1091 0.0679  -0.0685 325 LEU A CD2 
1259 N N   . GLY A 164 ? 0.5977 0.3161 0.8524 -0.1343 0.0978  -0.1760 326 GLY A N   
1260 C CA  . GLY A 164 ? 0.6465 0.3131 0.9620 -0.1188 0.0992  -0.1868 326 GLY A CA  
1261 C C   . GLY A 164 ? 0.6634 0.3527 1.0035 -0.1144 0.1142  -0.2519 326 GLY A C   
1262 O O   . GLY A 164 ? 0.6800 0.3908 1.0120 -0.1368 0.1237  -0.2931 326 GLY A O   
1263 N N   . ASP A 165 ? 0.6671 0.3591 1.0388 -0.0868 0.1168  -0.2633 327 ASP A N   
1264 C CA  . ASP A 165 ? 0.6748 0.4052 1.0642 -0.0814 0.1345  -0.3266 327 ASP A CA  
1265 C C   . ASP A 165 ? 0.6202 0.4223 0.9646 -0.0720 0.1357  -0.3189 327 ASP A C   
1266 O O   . ASP A 165 ? 0.6239 0.4647 0.9853 -0.0606 0.1494  -0.3561 327 ASP A O   
1267 C CB  . ASP A 165 ? 0.7345 0.4168 1.2096 -0.0582 0.1417  -0.3559 327 ASP A CB  
1268 C CG  . ASP A 165 ? 0.7629 0.3809 1.2796 -0.0371 0.1227  -0.2960 327 ASP A CG  
1269 O OD1 . ASP A 165 ? 0.7300 0.3635 1.2045 -0.0329 0.1066  -0.2391 327 ASP A OD1 
1270 O OD2 . ASP A 165 ? 0.8095 0.3635 1.4034 -0.0252 0.1232  -0.3069 327 ASP A OD2 
1271 N N   . LYS A 166 ? 0.5755 0.3958 0.8664 -0.0788 0.1226  -0.2719 328 LYS A N   
1272 C CA  . LYS A 166 ? 0.5284 0.4086 0.7772 -0.0750 0.1215  -0.2580 328 LYS A CA  
1273 C C   . LYS A 166 ? 0.5039 0.4240 0.6975 -0.0978 0.1193  -0.2538 328 LYS A C   
1274 O O   . LYS A 166 ? 0.5065 0.4040 0.6879 -0.1116 0.1123  -0.2381 328 LYS A O   
1275 C CB  . LYS A 166 ? 0.5025 0.3672 0.7469 -0.0595 0.1055  -0.2060 328 LYS A CB  
1276 C CG  . LYS A 166 ? 0.5264 0.3805 0.8225 -0.0332 0.1045  -0.2054 328 LYS A CG  
1277 C CD  . LYS A 166 ? 0.5034 0.4181 0.7925 -0.0257 0.1114  -0.2136 328 LYS A CD  
1278 C CE  . LYS A 166 ? 0.5104 0.4209 0.8492 0.0000  0.1043  -0.1995 328 LYS A CE  
1279 N NZ  . LYS A 166 ? 0.4835 0.4561 0.8195 0.0034  0.1115  -0.2042 328 LYS A NZ  
1280 N N   . LYS A 167 ? 0.4798 0.4629 0.6443 -0.1018 0.1250  -0.2646 329 LYS A N   
1281 C CA  . LYS A 167 ? 0.4501 0.4776 0.5671 -0.1182 0.1187  -0.2500 329 LYS A CA  
1282 C C   . LYS A 167 ? 0.4048 0.4371 0.5021 -0.1084 0.1074  -0.2033 329 LYS A C   
1283 O O   . LYS A 167 ? 0.3972 0.4414 0.5024 -0.0967 0.1099  -0.1958 329 LYS A O   
1284 C CB  . LYS A 167 ? 0.4630 0.5597 0.5596 -0.1307 0.1296  -0.2833 329 LYS A CB  
1285 C CG  . LYS A 167 ? 0.4753 0.6162 0.5351 -0.1521 0.1218  -0.2818 329 LYS A CG  
1286 C CD  . LYS A 167 ? 0.5056 0.7233 0.5410 -0.1681 0.1316  -0.3163 329 LYS A CD  
1287 C CE  . LYS A 167 ? 0.5025 0.7673 0.5156 -0.1626 0.1337  -0.2883 329 LYS A CE  
1288 N NZ  . LYS A 167 ? 0.5263 0.8789 0.5048 -0.1830 0.1421  -0.3131 329 LYS A NZ  
1289 N N   . LEU A 168 ? 0.3824 0.4081 0.4594 -0.1138 0.0960  -0.1756 330 LEU A N   
1290 C CA  . LEU A 168 ? 0.3527 0.3769 0.4176 -0.1048 0.0859  -0.1384 330 LEU A CA  
1291 C C   . LEU A 168 ? 0.3401 0.4140 0.3854 -0.1082 0.0843  -0.1268 330 LEU A C   
1292 O O   . LEU A 168 ? 0.3534 0.4693 0.3826 -0.1205 0.0857  -0.1372 330 LEU A O   
1293 C CB  . LEU A 168 ? 0.3442 0.3486 0.3999 -0.1084 0.0773  -0.1189 330 LEU A CB  
1294 C CG  . LEU A 168 ? 0.3627 0.3189 0.4304 -0.1065 0.0757  -0.1108 330 LEU A CG  
1295 C CD1 . LEU A 168 ? 0.3606 0.3176 0.4159 -0.1164 0.0728  -0.0994 330 LEU A CD1 
1296 C CD2 . LEU A 168 ? 0.3589 0.2958 0.4315 -0.0921 0.0691  -0.0900 330 LEU A CD2 
1297 N N   . LEU A 169 ? 0.3192 0.3902 0.3673 -0.0995 0.0798  -0.1029 331 LEU A N   
1298 C CA  . LEU A 169 ? 0.3110 0.4164 0.3463 -0.1038 0.0752  -0.0797 331 LEU A CA  
1299 C C   . LEU A 169 ? 0.2960 0.3731 0.3346 -0.0973 0.0629  -0.0542 331 LEU A C   
1300 O O   . LEU A 169 ? 0.2963 0.3404 0.3455 -0.0895 0.0604  -0.0518 331 LEU A O   
1301 C CB  . LEU A 169 ? 0.3166 0.4429 0.3610 -0.1028 0.0824  -0.0763 331 LEU A CB  
1302 C CG  . LEU A 169 ? 0.3199 0.4872 0.3525 -0.1129 0.0803  -0.0488 331 LEU A CG  
1303 C CD1 . LEU A 169 ? 0.3460 0.5740 0.3539 -0.1279 0.0884  -0.0604 331 LEU A CD1 
1304 C CD2 . LEU A 169 ? 0.3135 0.4857 0.3645 -0.1121 0.0847  -0.0372 331 LEU A CD2 
1305 N N   . VAL A 170 ? 0.2903 0.3839 0.3228 -0.1002 0.0549  -0.0379 332 VAL A N   
1306 C CA  . VAL A 170 ? 0.2720 0.3427 0.3164 -0.0922 0.0453  -0.0191 332 VAL A CA  
1307 C C   . VAL A 170 ? 0.2801 0.3761 0.3303 -0.0939 0.0367  0.0096  332 VAL A C   
1308 O O   . VAL A 170 ? 0.2935 0.4246 0.3363 -0.0986 0.0316  0.0171  332 VAL A O   
1309 C CB  . VAL A 170 ? 0.2681 0.3288 0.3137 -0.0900 0.0435  -0.0284 332 VAL A CB  
1310 C CG1 . VAL A 170 ? 0.2444 0.2841 0.3065 -0.0802 0.0379  -0.0196 332 VAL A CG1 
1311 C CG2 . VAL A 170 ? 0.2520 0.2915 0.2910 -0.0934 0.0514  -0.0492 332 VAL A CG2 
1312 N N   . GLN A 171 ? 0.2761 0.3559 0.3419 -0.0919 0.0334  0.0279  333 GLN A N   
1313 C CA  . GLN A 171 ? 0.2952 0.3885 0.3744 -0.0945 0.0241  0.0629  333 GLN A CA  
1314 C C   . GLN A 171 ? 0.3013 0.3518 0.4123 -0.0881 0.0187  0.0717  333 GLN A C   
1315 O O   . GLN A 171 ? 0.2884 0.3117 0.4019 -0.0856 0.0230  0.0500  333 GLN A O   
1316 C CB  . GLN A 171 ? 0.3043 0.4380 0.3679 -0.1095 0.0301  0.0780  333 GLN A CB  
1317 C CG  . GLN A 171 ? 0.2942 0.4160 0.3658 -0.1137 0.0399  0.0696  333 GLN A CG  
1318 C CD  . GLN A 171 ? 0.3104 0.4843 0.3662 -0.1289 0.0522  0.0731  333 GLN A CD  
1319 O OE1 . GLN A 171 ? 0.3362 0.5568 0.3661 -0.1375 0.0554  0.0733  333 GLN A OE1 
1320 N NE2 . GLN A 171 ? 0.2818 0.4556 0.3539 -0.1340 0.0598  0.0732  333 GLN A NE2 
1321 N N   . ARG A 172 ? 0.3291 0.3748 0.4666 -0.0867 0.0080  0.1039  334 ARG A N   
1322 C CA  . ARG A 172 ? 0.3513 0.3540 0.5269 -0.0845 0.0032  0.1113  334 ARG A CA  
1323 C C   . ARG A 172 ? 0.3503 0.3491 0.5249 -0.0989 0.0098  0.1104  334 ARG A C   
1324 O O   . ARG A 172 ? 0.3508 0.3851 0.5098 -0.1128 0.0151  0.1290  334 ARG A O   
1325 C CB  . ARG A 172 ? 0.3886 0.3849 0.6011 -0.0814 -0.0105 0.1533  334 ARG A CB  
1326 C CG  . ARG A 172 ? 0.3979 0.3865 0.6359 -0.0611 -0.0188 0.1478  334 ARG A CG  
1327 C CD  . ARG A 172 ? 0.4529 0.4234 0.7456 -0.0524 -0.0350 0.1897  334 ARG A CD  
1328 N NE  . ARG A 172 ? 0.4765 0.4371 0.8081 -0.0283 -0.0407 0.1743  334 ARG A NE  
1329 C CZ  . ARG A 172 ? 0.4866 0.4899 0.8070 -0.0194 -0.0446 0.1726  334 ARG A CZ  
1330 N NH1 . ARG A 172 ? 0.4734 0.5291 0.7425 -0.0336 -0.0446 0.1833  334 ARG A NH1 
1331 N NH2 . ARG A 172 ? 0.4839 0.4819 0.8484 0.0029  -0.0474 0.1555  334 ARG A NH2 
1332 N N   . ALA A 173 ? 0.3505 0.3143 0.5423 -0.0968 0.0098  0.0862  335 ALA A N   
1333 C CA  . ALA A 173 ? 0.3560 0.3194 0.5539 -0.1098 0.0134  0.0804  335 ALA A CA  
1334 C C   . ALA A 173 ? 0.3884 0.3546 0.6140 -0.1270 0.0114  0.1167  335 ALA A C   
1335 O O   . ALA A 173 ? 0.3847 0.3730 0.6114 -0.1416 0.0177  0.1199  335 ALA A O   
1336 C CB  . ALA A 173 ? 0.3499 0.2816 0.5604 -0.1061 0.0097  0.0475  335 ALA A CB  
1337 N N   . SER A 174 ? 0.4285 0.3739 0.6823 -0.1259 0.0025  0.1466  336 SER A N   
1338 C CA  . SER A 174 ? 0.4736 0.4272 0.7489 -0.1448 0.0002  0.1940  336 SER A CA  
1339 C C   . SER A 174 ? 0.5162 0.4506 0.8196 -0.1372 -0.0132 0.2339  336 SER A C   
1340 O O   . SER A 174 ? 0.5647 0.4657 0.9156 -0.1464 -0.0213 0.2666  336 SER A O   
1341 C CB  . SER A 174 ? 0.4990 0.4249 0.8126 -0.1617 0.0003  0.1885  336 SER A CB  
1342 O OG  . SER A 174 ? 0.5236 0.4106 0.8519 -0.1503 -0.0035 0.1420  336 SER A OG  
1343 O OXT . SER A 174 ? 0.5102 0.4635 0.7943 -0.1219 -0.0174 0.2361  336 SER A OXT 
1344 N N   . GLY B 1   ? 0.5420 0.7770 0.8308 -0.0691 -0.3418 0.2469  143 GLY B N   
1345 C CA  . GLY B 1   ? 0.5626 0.8108 0.9134 -0.0523 -0.3772 0.2870  143 GLY B CA  
1346 C C   . GLY B 1   ? 0.5447 0.7604 0.9463 -0.0143 -0.3580 0.2776  143 GLY B C   
1347 O O   . GLY B 1   ? 0.5405 0.7121 0.8990 -0.0144 -0.3355 0.2626  143 GLY B O   
1348 N N   . PRO B 2   ? 0.5338 0.7727 1.0291 0.0180  -0.3653 0.2833  144 PRO B N   
1349 C CA  . PRO B 2   ? 0.5129 0.7234 1.0583 0.0549  -0.3398 0.2610  144 PRO B CA  
1350 C C   . PRO B 2   ? 0.4721 0.6710 0.9800 0.0547  -0.2949 0.2146  144 PRO B C   
1351 O O   . PRO B 2   ? 0.4763 0.6298 0.9476 0.0574  -0.2747 0.1978  144 PRO B O   
1352 C CB  . PRO B 2   ? 0.5150 0.7697 1.1666 0.0853  -0.3509 0.2678  144 PRO B CB  
1353 C CG  . PRO B 2   ? 0.5462 0.8407 1.2094 0.0664  -0.3970 0.3117  144 PRO B CG  
1354 C CD  . PRO B 2   ? 0.5467 0.8421 1.1090 0.0216  -0.3975 0.3089  144 PRO B CD  
1355 N N   . LEU B 3   ? 0.4380 0.6785 0.9521 0.0475  -0.2821 0.1975  145 LEU B N   
1356 C CA  . LEU B 3   ? 0.4001 0.6334 0.8792 0.0444  -0.2433 0.1599  145 LEU B CA  
1357 C C   . LEU B 3   ? 0.3946 0.5916 0.7825 0.0177  -0.2331 0.1515  145 LEU B C   
1358 O O   . LEU B 3   ? 0.3831 0.5681 0.7422 0.0167  -0.2036 0.1242  145 LEU B O   
1359 C CB  . LEU B 3   ? 0.3835 0.6702 0.8918 0.0383  -0.2346 0.1497  145 LEU B CB  
1360 C CG  . LEU B 3   ? 0.3786 0.7010 0.9762 0.0710  -0.2218 0.1392  145 LEU B CG  
1361 C CD1 . LEU B 3   ? 0.3605 0.7496 1.0082 0.0624  -0.2302 0.1471  145 LEU B CD1 
1362 C CD2 . LEU B 3   ? 0.3512 0.6553 0.9352 0.0854  -0.1795 0.1018  145 LEU B CD2 
1363 N N   . GLY B 4   ? 0.4117 0.5933 0.7556 -0.0035 -0.2563 0.1749  146 GLY B N   
1364 C CA  . GLY B 4   ? 0.4047 0.5559 0.6677 -0.0272 -0.2436 0.1646  146 GLY B CA  
1365 C C   . GLY B 4   ? 0.3770 0.4922 0.6241 -0.0134 -0.2137 0.1404  146 GLY B C   
1366 O O   . GLY B 4   ? 0.3598 0.4639 0.5647 -0.0233 -0.1913 0.1188  146 GLY B O   
1367 N N   . SER B 5   ? 0.3717 0.4681 0.6566 0.0094  -0.2150 0.1443  147 SER B N   
1368 C CA  . SER B 5   ? 0.3518 0.4156 0.6246 0.0205  -0.1913 0.1223  147 SER B CA  
1369 C C   . SER B 5   ? 0.3124 0.3883 0.6064 0.0372  -0.1649 0.0913  147 SER B C   
1370 O O   . SER B 5   ? 0.2972 0.3512 0.5759 0.0437  -0.1458 0.0710  147 SER B O   
1371 C CB  . SER B 5   ? 0.3812 0.4147 0.6835 0.0346  -0.2036 0.1360  147 SER B CB  
1372 O OG  . SER B 5   ? 0.4321 0.4367 0.6843 0.0159  -0.2042 0.1452  147 SER B OG  
1373 N N   . ALA B 6   ? 0.2903 0.4047 0.6182 0.0414  -0.1645 0.0891  148 ALA B N   
1374 C CA  . ALA B 6   ? 0.2635 0.3965 0.6012 0.0497  -0.1377 0.0631  148 ALA B CA  
1375 C C   . ALA B 6   ? 0.2387 0.3761 0.5266 0.0265  -0.1265 0.0567  148 ALA B C   
1376 O O   . ALA B 6   ? 0.2173 0.3680 0.5047 0.0281  -0.1057 0.0405  148 ALA B O   
1377 C CB  . ALA B 6   ? 0.2546 0.4302 0.6602 0.0658  -0.1388 0.0632  148 ALA B CB  
1378 N N   . ARG B 7   ? 0.2465 0.3707 0.4921 0.0047  -0.1397 0.0691  149 ARG B N   
1379 C CA  . ARG B 7   ? 0.2466 0.3670 0.4473 -0.0170 -0.1303 0.0612  149 ARG B CA  
1380 C C   . ARG B 7   ? 0.2432 0.3269 0.3912 -0.0253 -0.1220 0.0551  149 ARG B C   
1381 O O   . ARG B 7   ? 0.2538 0.3297 0.3649 -0.0443 -0.1203 0.0517  149 ARG B O   
1382 C CB  . ARG B 7   ? 0.2590 0.4021 0.4565 -0.0392 -0.1505 0.0745  149 ARG B CB  
1383 C CG  . ARG B 7   ? 0.2682 0.4573 0.5224 -0.0355 -0.1582 0.0807  149 ARG B CG  
1384 C CD  . ARG B 7   ? 0.2979 0.5118 0.5469 -0.0623 -0.1819 0.0936  149 ARG B CD  
1385 N NE  . ARG B 7   ? 0.3469 0.5775 0.6168 -0.0623 -0.2143 0.1194  149 ARG B NE  
1386 C CZ  . ARG B 7   ? 0.3621 0.6360 0.6985 -0.0519 -0.2330 0.1361  149 ARG B CZ  
1387 N NH1 . ARG B 7   ? 0.3413 0.6511 0.7315 -0.0411 -0.2192 0.1270  149 ARG B NH1 
1388 N NH2 . ARG B 7   ? 0.3767 0.6617 0.7293 -0.0526 -0.2664 0.1645  149 ARG B NH2 
1389 N N   . ARG B 8   ? 0.2358 0.2987 0.3843 -0.0115 -0.1160 0.0515  150 ARG B N   
1390 C CA  . ARG B 8   ? 0.2466 0.2824 0.3557 -0.0189 -0.1094 0.0485  150 ARG B CA  
1391 C C   . ARG B 8   ? 0.2280 0.2493 0.3426 -0.0038 -0.0951 0.0352  150 ARG B C   
1392 O O   . ARG B 8   ? 0.2197 0.2443 0.3660 0.0123  -0.0949 0.0306  150 ARG B O   
1393 C CB  . ARG B 8   ? 0.2666 0.2930 0.3657 -0.0274 -0.1268 0.0679  150 ARG B CB  
1394 C CG  . ARG B 8   ? 0.3075 0.3445 0.3773 -0.0504 -0.1398 0.0793  150 ARG B CG  
1395 C CD  . ARG B 8   ? 0.3524 0.3882 0.4161 -0.0602 -0.1627 0.1065  150 ARG B CD  
1396 N NE  . ARG B 8   ? 0.4106 0.4270 0.4391 -0.0704 -0.1544 0.1088  150 ARG B NE  
1397 C CZ  . ARG B 8   ? 0.4363 0.4520 0.4158 -0.0905 -0.1429 0.1001  150 ARG B CZ  
1398 N NH1 . ARG B 8   ? 0.4445 0.4494 0.3992 -0.0991 -0.1326 0.1025  150 ARG B NH1 
1399 N NH2 . ARG B 8   ? 0.4678 0.4941 0.4252 -0.1028 -0.1398 0.0868  150 ARG B NH2 
1400 N N   . LEU B 9   ? 0.2212 0.2285 0.3072 -0.0092 -0.0834 0.0273  151 LEU B N   
1401 C CA  . LEU B 9   ? 0.2198 0.2161 0.3083 0.0010  -0.0744 0.0172  151 LEU B CA  
1402 C C   . LEU B 9   ? 0.2260 0.2086 0.2940 -0.0074 -0.0719 0.0195  151 LEU B C   
1403 O O   . LEU B 9   ? 0.2419 0.2243 0.2873 -0.0194 -0.0679 0.0214  151 LEU B O   
1404 C CB  . LEU B 9   ? 0.2098 0.2132 0.2944 0.0062  -0.0607 0.0049  151 LEU B CB  
1405 C CG  . LEU B 9   ? 0.2112 0.2347 0.3155 0.0129  -0.0571 0.0007  151 LEU B CG  
1406 C CD1 . LEU B 9   ? 0.1949 0.2237 0.2862 0.0130  -0.0439 -0.0060 151 LEU B CD1 
1407 C CD2 . LEU B 9   ? 0.2130 0.2402 0.3464 0.0273  -0.0601 -0.0054 151 LEU B CD2 
1408 N N   . TYR B 10  ? 0.2255 0.1983 0.3036 -0.0021 -0.0730 0.0171  152 TYR B N   
1409 C CA  . TYR B 10  ? 0.2273 0.1934 0.2944 -0.0100 -0.0690 0.0186  152 TYR B CA  
1410 C C   . TYR B 10  ? 0.2146 0.1867 0.2776 -0.0051 -0.0576 0.0063  152 TYR B C   
1411 O O   . TYR B 10  ? 0.2024 0.1776 0.2726 0.0045  -0.0567 -0.0028 152 TYR B O   
1412 C CB  . TYR B 10  ? 0.2402 0.1919 0.3246 -0.0097 -0.0785 0.0230  152 TYR B CB  
1413 C CG  . TYR B 10  ? 0.2385 0.1888 0.3195 -0.0187 -0.0739 0.0229  152 TYR B CG  
1414 C CD1 . TYR B 10  ? 0.2271 0.1804 0.3155 -0.0132 -0.0704 0.0091  152 TYR B CD1 
1415 C CD2 . TYR B 10  ? 0.2361 0.1874 0.3061 -0.0347 -0.0731 0.0375  152 TYR B CD2 
1416 C CE1 . TYR B 10  ? 0.2352 0.1940 0.3276 -0.0225 -0.0680 0.0103  152 TYR B CE1 
1417 C CE2 . TYR B 10  ? 0.2512 0.2086 0.3240 -0.0440 -0.0667 0.0379  152 TYR B CE2 
1418 C CZ  . TYR B 10  ? 0.2506 0.2124 0.3384 -0.0373 -0.0649 0.0244  152 TYR B CZ  
1419 O OH  . TYR B 10  ? 0.2562 0.2304 0.3539 -0.0476 -0.0603 0.0260  152 TYR B OH  
1420 N N   . VAL B 11  ? 0.2167 0.1925 0.2694 -0.0117 -0.0488 0.0067  153 VAL B N   
1421 C CA  . VAL B 11  ? 0.2056 0.1883 0.2622 -0.0057 -0.0407 -0.0003 153 VAL B CA  
1422 C C   . VAL B 11  ? 0.2152 0.2055 0.2808 -0.0110 -0.0368 0.0012  153 VAL B C   
1423 O O   . VAL B 11  ? 0.2239 0.2187 0.2828 -0.0196 -0.0274 0.0032  153 VAL B O   
1424 C CB  . VAL B 11  ? 0.1995 0.1815 0.2468 -0.0047 -0.0310 -0.0036 153 VAL B CB  
1425 C CG1 . VAL B 11  ? 0.1940 0.1806 0.2523 0.0046  -0.0268 -0.0059 153 VAL B CG1 
1426 C CG2 . VAL B 11  ? 0.2075 0.1860 0.2484 -0.0045 -0.0347 -0.0032 153 VAL B CG2 
1427 N N   . GLY B 12  ? 0.2073 0.2027 0.2873 -0.0079 -0.0430 -0.0011 154 GLY B N   
1428 C CA  . GLY B 12  ? 0.2137 0.2225 0.3098 -0.0144 -0.0411 0.0011  154 GLY B CA  
1429 C C   . GLY B 12  ? 0.2110 0.2386 0.3235 -0.0062 -0.0370 -0.0010 154 GLY B C   
1430 O O   . GLY B 12  ? 0.2066 0.2326 0.3154 0.0044  -0.0379 -0.0024 154 GLY B O   
1431 N N   . ASN B 13  ? 0.2151 0.2626 0.3497 -0.0119 -0.0330 0.0015  155 ASN B N   
1432 C CA  . ASN B 13  ? 0.2152 0.2870 0.3782 -0.0033 -0.0321 0.0024  155 ASN B CA  
1433 C C   . ASN B 13  ? 0.2217 0.2926 0.3890 0.0098  -0.0175 -0.0002 155 ASN B C   
1434 O O   . ASN B 13  ? 0.2254 0.3025 0.4099 0.0228  -0.0219 0.0033  155 ASN B O   
1435 C CB  . ASN B 13  ? 0.2105 0.2863 0.3753 0.0012  -0.0511 0.0035  155 ASN B CB  
1436 C CG  . ASN B 13  ? 0.2115 0.3191 0.4116 0.0062  -0.0575 0.0098  155 ASN B CG  
1437 O OD1 . ASN B 13  ? 0.2295 0.3604 0.4602 0.0020  -0.0502 0.0116  155 ASN B OD1 
1438 N ND2 . ASN B 13  ? 0.2063 0.3189 0.4039 0.0140  -0.0717 0.0152  155 ASN B ND2 
1439 N N   . ILE B 14  ? 0.2334 0.2942 0.3841 0.0050  -0.0016 -0.0059 156 ILE B N   
1440 C CA  . ILE B 14  ? 0.2463 0.2987 0.3980 0.0153  0.0132  -0.0139 156 ILE B CA  
1441 C C   . ILE B 14  ? 0.2536 0.3326 0.4461 0.0237  0.0276  -0.0180 156 ILE B C   
1442 O O   . ILE B 14  ? 0.2507 0.3560 0.4599 0.0147  0.0318  -0.0159 156 ILE B O   
1443 C CB  . ILE B 14  ? 0.2650 0.2998 0.3810 0.0043  0.0245  -0.0223 156 ILE B CB  
1444 C CG1 . ILE B 14  ? 0.2866 0.3389 0.3962 -0.0111 0.0385  -0.0245 156 ILE B CG1 
1445 C CG2 . ILE B 14  ? 0.2465 0.2624 0.3337 -0.0023 0.0087  -0.0160 156 ILE B CG2 
1446 C CD1 . ILE B 14  ? 0.3048 0.3454 0.3766 -0.0233 0.0503  -0.0336 156 ILE B CD1 
1447 N N   . PRO B 15  ? 0.2653 0.3374 0.4789 0.0409  0.0355  -0.0233 157 PRO B N   
1448 C CA  . PRO B 15  ? 0.2730 0.3703 0.5376 0.0552  0.0500  -0.0284 157 PRO B CA  
1449 C C   . PRO B 15  ? 0.2914 0.3986 0.5556 0.0503  0.0813  -0.0489 157 PRO B C   
1450 O O   . PRO B 15  ? 0.3058 0.3884 0.5280 0.0406  0.0920  -0.0618 157 PRO B O   
1451 C CB  . PRO B 15  ? 0.2868 0.3608 0.5699 0.0756  0.0449  -0.0255 157 PRO B CB  
1452 C CG  . PRO B 15  ? 0.2975 0.3321 0.5321 0.0672  0.0428  -0.0298 157 PRO B CG  
1453 C CD  . PRO B 15  ? 0.2744 0.3124 0.4694 0.0479  0.0308  -0.0239 157 PRO B CD  
1454 N N   . PHE B 16  ? 0.2923 0.4394 0.6032 0.0556  0.0961  -0.0523 158 PHE B N   
1455 C CA  . PHE B 16  ? 0.3182 0.4845 0.6285 0.0486  0.1304  -0.0733 158 PHE B CA  
1456 C C   . PHE B 16  ? 0.3520 0.4863 0.6482 0.0587  0.1514  -0.0991 158 PHE B C   
1457 O O   . PHE B 16  ? 0.3586 0.4695 0.6828 0.0808  0.1460  -0.1008 158 PHE B O   
1458 C CB  . PHE B 16  ? 0.3171 0.5375 0.6955 0.0578  0.1459  -0.0744 158 PHE B CB  
1459 C CG  . PHE B 16  ? 0.3465 0.5926 0.7264 0.0514  0.1872  -0.0994 158 PHE B CG  
1460 C CD1 . PHE B 16  ? 0.3488 0.6197 0.6953 0.0216  0.1991  -0.0965 158 PHE B CD1 
1461 C CD2 . PHE B 16  ? 0.3742 0.6168 0.7853 0.0737  0.2149  -0.1265 158 PHE B CD2 
1462 C CE1 . PHE B 16  ? 0.3863 0.6843 0.7250 0.0118  0.2390  -0.1192 158 PHE B CE1 
1463 C CE2 . PHE B 16  ? 0.4160 0.6834 0.8228 0.0667  0.2568  -0.1553 158 PHE B CE2 
1464 C CZ  . PHE B 16  ? 0.4287 0.7271 0.7960 0.0344  0.2695  -0.1512 158 PHE B CZ  
1465 N N   . GLY B 17  ? 0.3788 0.5108 0.6299 0.0402  0.1741  -0.1183 159 GLY B N   
1466 C CA  . GLY B 17  ? 0.4210 0.5281 0.6595 0.0464  0.1995  -0.1508 159 GLY B CA  
1467 C C   . GLY B 17  ? 0.4306 0.4849 0.6211 0.0405  0.1845  -0.1547 159 GLY B C   
1468 O O   . GLY B 17  ? 0.4766 0.5086 0.6398 0.0353  0.2034  -0.1832 159 GLY B O   
1469 N N   . ILE B 18  ? 0.3969 0.4338 0.5769 0.0393  0.1517  -0.1281 160 ILE B N   
1470 C CA  . ILE B 18  ? 0.4016 0.3942 0.5487 0.0354  0.1360  -0.1278 160 ILE B CA  
1471 C C   . ILE B 18  ? 0.4258 0.4084 0.5090 0.0085  0.1411  -0.1410 160 ILE B C   
1472 O O   . ILE B 18  ? 0.4212 0.4289 0.4764 -0.0100 0.1425  -0.1345 160 ILE B O   
1473 C CB  . ILE B 18  ? 0.3576 0.3451 0.5057 0.0372  0.1033  -0.0967 160 ILE B CB  
1474 C CG1 . ILE B 18  ? 0.3772 0.3246 0.5125 0.0392  0.0905  -0.0946 160 ILE B CG1 
1475 C CG2 . ILE B 18  ? 0.3410 0.3440 0.4532 0.0167  0.0904  -0.0826 160 ILE B CG2 
1476 C CD1 . ILE B 18  ? 0.4050 0.3314 0.5859 0.0622  0.0939  -0.0966 160 ILE B CD1 
1477 N N   . THR B 19  ? 0.4578 0.4036 0.5194 0.0048  0.1418  -0.1576 161 THR B N   
1478 C CA  . THR B 19  ? 0.4915 0.4278 0.4923 -0.0223 0.1433  -0.1717 161 THR B CA  
1479 C C   . THR B 19  ? 0.4721 0.3927 0.4478 -0.0341 0.1130  -0.1506 161 THR B C   
1480 O O   . THR B 19  ? 0.4389 0.3507 0.4420 -0.0207 0.0956  -0.1306 161 THR B O   
1481 C CB  . THR B 19  ? 0.5486 0.4547 0.5415 -0.0227 0.1651  -0.2102 161 THR B CB  
1482 O OG1 . THR B 19  ? 0.5407 0.4078 0.5668 -0.0060 0.1543  -0.2074 161 THR B OG1 
1483 C CG2 . THR B 19  ? 0.5589 0.4849 0.5776 -0.0108 0.2012  -0.2378 161 THR B CG2 
1484 N N   . GLU B 20  ? 0.5029 0.4245 0.4274 -0.0599 0.1071  -0.1549 162 GLU B N   
1485 C CA  . GLU B 20  ? 0.4959 0.4124 0.4012 -0.0722 0.0785  -0.1342 162 GLU B CA  
1486 C C   . GLU B 20  ? 0.5044 0.3878 0.4217 -0.0686 0.0710  -0.1404 162 GLU B C   
1487 O O   . GLU B 20  ? 0.4729 0.3548 0.4029 -0.0659 0.0509  -0.1188 162 GLU B O   
1488 C CB  . GLU B 20  ? 0.5246 0.4556 0.3753 -0.1017 0.0715  -0.1343 162 GLU B CB  
1489 C CG  . GLU B 20  ? 0.5435 0.5067 0.3829 -0.1083 0.0753  -0.1186 162 GLU B CG  
1490 C CD  . GLU B 20  ? 0.5852 0.5651 0.3681 -0.1392 0.0665  -0.1114 162 GLU B CD  
1491 O OE1 . GLU B 20  ? 0.6187 0.6204 0.3975 -0.1454 0.0605  -0.0867 162 GLU B OE1 
1492 O OE2 . GLU B 20  ? 0.6294 0.6006 0.3726 -0.1589 0.0640  -0.1285 162 GLU B OE2 
1493 N N   . GLU B 21  ? 0.5534 0.4099 0.4692 -0.0690 0.0891  -0.1709 163 GLU B N   
1494 C CA  . GLU B 21  ? 0.5775 0.3959 0.5068 -0.0684 0.0836  -0.1778 163 GLU B CA  
1495 C C   . GLU B 21  ? 0.5484 0.3544 0.5307 -0.0414 0.0795  -0.1577 163 GLU B C   
1496 O O   . GLU B 21  ? 0.5352 0.3248 0.5284 -0.0430 0.0641  -0.1417 163 GLU B O   
1497 C CB  . GLU B 21  ? 0.6496 0.4360 0.5619 -0.0780 0.1043  -0.2201 163 GLU B CB  
1498 C CG  . GLU B 21  ? 0.7053 0.4978 0.6271 -0.0646 0.1368  -0.2484 163 GLU B CG  
1499 C CD  . GLU B 21  ? 0.7626 0.5904 0.6316 -0.0865 0.1488  -0.2620 163 GLU B CD  
1500 O OE1 . GLU B 21  ? 0.8172 0.6430 0.6746 -0.0879 0.1792  -0.2996 163 GLU B OE1 
1501 O OE2 . GLU B 21  ? 0.7454 0.6031 0.5861 -0.1020 0.1288  -0.2347 163 GLU B OE2 
1502 N N   . ALA B 22  ? 0.5324 0.3513 0.5470 -0.0191 0.0922  -0.1562 164 ALA B N   
1503 C CA  . ALA B 22  ? 0.5092 0.3215 0.5714 0.0049  0.0853  -0.1348 164 ALA B CA  
1504 C C   . ALA B 22  ? 0.4623 0.2969 0.5212 0.0032  0.0620  -0.1013 164 ALA B C   
1505 O O   . ALA B 22  ? 0.4591 0.2812 0.5356 0.0097  0.0498  -0.0820 164 ALA B O   
1506 C CB  . ALA B 22  ? 0.5027 0.3323 0.6042 0.0277  0.1016  -0.1400 164 ALA B CB  
1507 N N   . MET B 23  ? 0.4346 0.3008 0.4706 -0.0064 0.0566  -0.0948 165 MET B N   
1508 C CA  . MET B 23  ? 0.3976 0.2824 0.4297 -0.0085 0.0367  -0.0697 165 MET B CA  
1509 C C   . MET B 23  ? 0.3881 0.2604 0.4050 -0.0224 0.0246  -0.0644 165 MET B C   
1510 O O   . MET B 23  ? 0.3654 0.2422 0.3925 -0.0187 0.0134  -0.0461 165 MET B O   
1511 C CB  . MET B 23  ? 0.3755 0.2886 0.3891 -0.0171 0.0332  -0.0655 165 MET B CB  
1512 C CG  . MET B 23  ? 0.3894 0.3240 0.4240 -0.0057 0.0387  -0.0608 165 MET B CG  
1513 S SD  . MET B 23  ? 0.3771 0.3336 0.4207 -0.0020 0.0198  -0.0379 165 MET B SD  
1514 C CE  . MET B 23  ? 0.3828 0.3352 0.4011 -0.0151 0.0042  -0.0305 165 MET B CE  
1515 N N   . MET B 24  ? 0.4101 0.2714 0.4017 -0.0405 0.0272  -0.0809 166 MET B N   
1516 C CA  . MET B 24  ? 0.4176 0.2724 0.3990 -0.0570 0.0149  -0.0766 166 MET B CA  
1517 C C   . MET B 24  ? 0.4179 0.2466 0.4228 -0.0517 0.0146  -0.0693 166 MET B C   
1518 O O   . MET B 24  ? 0.3916 0.2310 0.4043 -0.0544 0.0039  -0.0500 166 MET B O   
1519 C CB  . MET B 24  ? 0.4587 0.3046 0.4077 -0.0802 0.0166  -0.0985 166 MET B CB  
1520 C CG  . MET B 24  ? 0.4632 0.3218 0.4004 -0.1011 -0.0021 -0.0896 166 MET B CG  
1521 S SD  . MET B 24  ? 0.5253 0.3833 0.4158 -0.1323 -0.0056 -0.1131 166 MET B SD  
1522 C CE  . MET B 24  ? 0.5961 0.4033 0.4848 -0.1340 0.0161  -0.1488 166 MET B CE  
1523 N N   . ASP B 25  ? 0.4464 0.2419 0.4651 -0.0437 0.0273  -0.0836 167 ASP B N   
1524 C CA  . ASP B 25  ? 0.4655 0.2285 0.5097 -0.0388 0.0257  -0.0727 167 ASP B CA  
1525 C C   . ASP B 25  ? 0.4292 0.2092 0.4937 -0.0236 0.0166  -0.0410 167 ASP B C   
1526 O O   . ASP B 25  ? 0.4283 0.2024 0.4980 -0.0307 0.0083  -0.0212 167 ASP B O   
1527 C CB  . ASP B 25  ? 0.5138 0.2365 0.5779 -0.0273 0.0411  -0.0940 167 ASP B CB  
1528 C CG  . ASP B 25  ? 0.5775 0.2742 0.6169 -0.0469 0.0512  -0.1305 167 ASP B CG  
1529 O OD1 . ASP B 25  ? 0.5791 0.2927 0.5843 -0.0708 0.0429  -0.1355 167 ASP B OD1 
1530 O OD2 . ASP B 25  ? 0.6375 0.2974 0.6930 -0.0382 0.0670  -0.1551 167 ASP B OD2 
1531 N N   . PHE B 26  ? 0.3972 0.2018 0.4704 -0.0062 0.0182  -0.0365 168 PHE B N   
1532 C CA  . PHE B 26  ? 0.3712 0.1958 0.4573 0.0060  0.0083  -0.0103 168 PHE B CA  
1533 C C   . PHE B 26  ? 0.3474 0.1973 0.4156 -0.0057 -0.0019 0.0046  168 PHE B C   
1534 O O   . PHE B 26  ? 0.3490 0.2008 0.4208 -0.0064 -0.0083 0.0258  168 PHE B O   
1535 C CB  . PHE B 26  ? 0.3472 0.1977 0.4437 0.0212  0.0106  -0.0125 168 PHE B CB  
1536 C CG  . PHE B 26  ? 0.3272 0.2021 0.4302 0.0295  -0.0020 0.0106  168 PHE B CG  
1537 C CD1 . PHE B 26  ? 0.3338 0.2014 0.4615 0.0422  -0.0086 0.0294  168 PHE B CD1 
1538 C CD2 . PHE B 26  ? 0.3000 0.2042 0.3844 0.0239  -0.0086 0.0133  168 PHE B CD2 
1539 C CE1 . PHE B 26  ? 0.3278 0.2207 0.4539 0.0458  -0.0224 0.0501  168 PHE B CE1 
1540 C CE2 . PHE B 26  ? 0.2865 0.2120 0.3714 0.0288  -0.0192 0.0287  168 PHE B CE2 
1541 C CZ  . PHE B 26  ? 0.3066 0.2285 0.4086 0.0382  -0.0266 0.0471  168 PHE B CZ  
1542 N N   . PHE B 27  ? 0.3290 0.1997 0.3794 -0.0149 -0.0029 -0.0055 169 PHE B N   
1543 C CA  . PHE B 27  ? 0.3054 0.2038 0.3478 -0.0220 -0.0104 0.0049  169 PHE B CA  
1544 C C   . PHE B 27  ? 0.3156 0.2089 0.3573 -0.0388 -0.0121 0.0108  169 PHE B C   
1545 O O   . PHE B 27  ? 0.3071 0.2210 0.3508 -0.0420 -0.0143 0.0246  169 PHE B O   
1546 C CB  . PHE B 27  ? 0.2943 0.2148 0.3269 -0.0241 -0.0135 -0.0040 169 PHE B CB  
1547 C CG  . PHE B 27  ? 0.2764 0.2128 0.3123 -0.0109 -0.0151 -0.0022 169 PHE B CG  
1548 C CD1 . PHE B 27  ? 0.2869 0.2204 0.3224 -0.0066 -0.0107 -0.0109 169 PHE B CD1 
1549 C CD2 . PHE B 27  ? 0.2847 0.2402 0.3236 -0.0051 -0.0197 0.0065  169 PHE B CD2 
1550 C CE1 . PHE B 27  ? 0.2662 0.2147 0.3080 0.0019  -0.0132 -0.0084 169 PHE B CE1 
1551 C CE2 . PHE B 27  ? 0.2803 0.2472 0.3218 0.0039  -0.0227 0.0054  169 PHE B CE2 
1552 C CZ  . PHE B 27  ? 0.2690 0.2319 0.3139 0.0068  -0.0207 -0.0006 169 PHE B CZ  
1553 N N   . ASN B 28  ? 0.3349 0.2032 0.3736 -0.0515 -0.0100 -0.0014 170 ASN B N   
1554 C CA  . ASN B 28  ? 0.3605 0.2198 0.4027 -0.0709 -0.0125 0.0044  170 ASN B CA  
1555 C C   . ASN B 28  ? 0.3794 0.2205 0.4340 -0.0688 -0.0112 0.0252  170 ASN B C   
1556 O O   . ASN B 28  ? 0.3769 0.2311 0.4351 -0.0821 -0.0129 0.0417  170 ASN B O   
1557 C CB  . ASN B 28  ? 0.3917 0.2211 0.4260 -0.0871 -0.0115 -0.0166 170 ASN B CB  
1558 C CG  . ASN B 28  ? 0.3868 0.2405 0.4041 -0.0985 -0.0178 -0.0299 170 ASN B CG  
1559 O OD1 . ASN B 28  ? 0.3687 0.2605 0.3896 -0.0994 -0.0256 -0.0193 170 ASN B OD1 
1560 N ND2 . ASN B 28  ? 0.4137 0.2458 0.4128 -0.1073 -0.0145 -0.0533 170 ASN B ND2 
1561 N N   . ALA B 29  ? 0.3977 0.2113 0.4612 -0.0528 -0.0083 0.0264  171 ALA B N   
1562 C CA  . ALA B 29  ? 0.4268 0.2190 0.5041 -0.0498 -0.0109 0.0511  171 ALA B CA  
1563 C C   . ALA B 29  ? 0.4095 0.2413 0.4779 -0.0477 -0.0153 0.0749  171 ALA B C   
1564 O O   . ALA B 29  ? 0.4304 0.2647 0.4970 -0.0607 -0.0170 0.0976  171 ALA B O   
1565 C CB  . ALA B 29  ? 0.4354 0.1967 0.5326 -0.0288 -0.0088 0.0478  171 ALA B CB  
1566 N N   . GLN B 30  ? 0.3842 0.2472 0.4448 -0.0340 -0.0160 0.0680  172 GLN B N   
1567 C CA  . GLN B 30  ? 0.3755 0.2742 0.4240 -0.0316 -0.0190 0.0830  172 GLN B CA  
1568 C C   . GLN B 30  ? 0.3751 0.3032 0.4146 -0.0482 -0.0142 0.0854  172 GLN B C   
1569 O O   . GLN B 30  ? 0.3935 0.3390 0.4236 -0.0564 -0.0128 0.1047  172 GLN B O   
1570 C CB  . GLN B 30  ? 0.3516 0.2721 0.3962 -0.0161 -0.0209 0.0693  172 GLN B CB  
1571 C CG  . GLN B 30  ? 0.3598 0.2670 0.4182 0.0006  -0.0258 0.0723  172 GLN B CG  
1572 C CD  . GLN B 30  ? 0.3811 0.3005 0.4358 0.0048  -0.0361 0.0974  172 GLN B CD  
1573 O OE1 . GLN B 30  ? 0.3797 0.3168 0.4145 -0.0063 -0.0373 0.1114  172 GLN B OE1 
1574 N NE2 . GLN B 30  ? 0.3654 0.2795 0.4397 0.0197  -0.0436 0.1035  172 GLN B NE2 
1575 N N   . MET B 31  ? 0.3591 0.2966 0.4029 -0.0539 -0.0118 0.0672  173 MET B N   
1576 C CA  . MET B 31  ? 0.3602 0.3302 0.4078 -0.0683 -0.0075 0.0685  173 MET B CA  
1577 C C   . MET B 31  ? 0.3929 0.3555 0.4450 -0.0893 -0.0046 0.0881  173 MET B C   
1578 O O   . MET B 31  ? 0.4003 0.3982 0.4530 -0.0996 0.0024  0.0982  173 MET B O   
1579 C CB  . MET B 31  ? 0.3481 0.3250 0.4051 -0.0728 -0.0108 0.0503  173 MET B CB  
1580 C CG  . MET B 31  ? 0.3353 0.3260 0.3901 -0.0564 -0.0141 0.0358  173 MET B CG  
1581 S SD  . MET B 31  ? 0.3506 0.3905 0.4171 -0.0489 -0.0103 0.0333  173 MET B SD  
1582 C CE  . MET B 31  ? 0.3251 0.3921 0.4172 -0.0651 -0.0133 0.0335  173 MET B CE  
1583 N N   . ARG B 32  ? 0.4235 0.3406 0.4809 -0.0967 -0.0084 0.0922  174 ARG B N   
1584 C CA  . ARG B 32  ? 0.4714 0.3716 0.5355 -0.1190 -0.0075 0.1132  174 ARG B CA  
1585 C C   . ARG B 32  ? 0.4912 0.3878 0.5455 -0.1170 -0.0080 0.1438  174 ARG B C   
1586 O O   . ARG B 32  ? 0.5132 0.4232 0.5651 -0.1367 -0.0040 0.1673  174 ARG B O   
1587 C CB  . ARG B 32  ? 0.5056 0.3503 0.5810 -0.1281 -0.0120 0.1034  174 ARG B CB  
1588 C CG  . ARG B 32  ? 0.5161 0.3682 0.5946 -0.1401 -0.0140 0.0767  174 ARG B CG  
1589 C CD  . ARG B 32  ? 0.5745 0.3730 0.6588 -0.1564 -0.0173 0.0630  174 ARG B CD  
1590 N NE  . ARG B 32  ? 0.6107 0.3836 0.6854 -0.1429 -0.0169 0.0331  174 ARG B NE  
1591 C CZ  . ARG B 32  ? 0.6461 0.3734 0.7248 -0.1264 -0.0128 0.0255  174 ARG B CZ  
1592 N NH1 . ARG B 32  ? 0.6679 0.3645 0.7624 -0.1196 -0.0128 0.0487  174 ARG B NH1 
1593 N NH2 . ARG B 32  ? 0.6459 0.3607 0.7148 -0.1166 -0.0084 -0.0044 174 ARG B NH2 
1594 N N   . LEU B 33  ? 0.4876 0.3697 0.5364 -0.0954 -0.0137 0.1459  175 LEU B N   
1595 C CA  . LEU B 33  ? 0.5175 0.4005 0.5548 -0.0935 -0.0191 0.1776  175 LEU B CA  
1596 C C   . LEU B 33  ? 0.5114 0.4508 0.5234 -0.1018 -0.0118 0.1861  175 LEU B C   
1597 O O   . LEU B 33  ? 0.5516 0.4999 0.5491 -0.1174 -0.0114 0.2166  175 LEU B O   
1598 C CB  . LEU B 33  ? 0.5080 0.3752 0.5499 -0.0678 -0.0289 0.1762  175 LEU B CB  
1599 C CG  . LEU B 33  ? 0.5364 0.4053 0.5685 -0.0654 -0.0407 0.2127  175 LEU B CG  
1600 C CD1 . LEU B 33  ? 0.5568 0.3765 0.6083 -0.0736 -0.0484 0.2434  175 LEU B CD1 
1601 C CD2 . LEU B 33  ? 0.5218 0.3981 0.5588 -0.0408 -0.0505 0.2060  175 LEU B CD2 
1602 N N   . GLY B 34  ? 0.4745 0.4504 0.4811 -0.0921 -0.0052 0.1591  176 GLY B N   
1603 C CA  . GLY B 34  ? 0.4734 0.5017 0.4586 -0.0965 0.0051  0.1582  176 GLY B CA  
1604 C C   . GLY B 34  ? 0.4768 0.5405 0.4713 -0.1150 0.0205  0.1554  176 GLY B C   
1605 O O   . GLY B 34  ? 0.4735 0.5847 0.4562 -0.1169 0.0339  0.1482  176 GLY B O   
1606 N N   . GLY B 35  ? 0.4835 0.5262 0.5017 -0.1292 0.0193  0.1590  177 GLY B N   
1607 C CA  . GLY B 35  ? 0.4810 0.5604 0.5183 -0.1481 0.0312  0.1567  177 GLY B CA  
1608 C C   . GLY B 35  ? 0.4394 0.5617 0.4932 -0.1347 0.0382  0.1273  177 GLY B C   
1609 O O   . GLY B 35  ? 0.4405 0.6132 0.5072 -0.1435 0.0531  0.1256  177 GLY B O   
1610 N N   . LEU B 36  ? 0.4096 0.5130 0.4669 -0.1136 0.0281  0.1059  178 LEU B N   
1611 C CA  . LEU B 36  ? 0.3768 0.5134 0.4510 -0.0980 0.0312  0.0817  178 LEU B CA  
1612 C C   . LEU B 36  ? 0.3657 0.5068 0.4714 -0.1032 0.0232  0.0722  178 LEU B C   
1613 O O   . LEU B 36  ? 0.3498 0.5133 0.4741 -0.0890 0.0212  0.0565  178 LEU B O   
1614 C CB  . LEU B 36  ? 0.3562 0.4741 0.4147 -0.0743 0.0239  0.0670  178 LEU B CB  
1615 C CG  . LEU B 36  ? 0.3681 0.4923 0.3959 -0.0684 0.0288  0.0717  178 LEU B CG  
1616 C CD1 . LEU B 36  ? 0.3300 0.4439 0.3515 -0.0473 0.0214  0.0529  178 LEU B CD1 
1617 C CD2 . LEU B 36  ? 0.3518 0.5261 0.3745 -0.0766 0.0479  0.0716  178 LEU B CD2 
1618 N N   . THR B 37  ? 0.3832 0.5024 0.4956 -0.1243 0.0169  0.0823  179 THR B N   
1619 C CA  . THR B 37  ? 0.3739 0.4991 0.5109 -0.1343 0.0060  0.0737  179 THR B CA  
1620 C C   . THR B 37  ? 0.3804 0.5610 0.5515 -0.1505 0.0143  0.0808  179 THR B C   
1621 O O   . THR B 37  ? 0.4051 0.6050 0.5747 -0.1622 0.0291  0.0954  179 THR B O   
1622 C CB  . THR B 37  ? 0.4000 0.4723 0.5269 -0.1517 -0.0056 0.0745  179 THR B CB  
1623 O OG1 . THR B 37  ? 0.4244 0.4846 0.5533 -0.1751 -0.0001 0.0936  179 THR B OG1 
1624 C CG2 . THR B 37  ? 0.3880 0.4106 0.4881 -0.1342 -0.0100 0.0660  179 THR B CG2 
1625 N N   . GLN B 38  ? 0.3675 0.5777 0.5707 -0.1523 0.0044  0.0726  180 GLN B N   
1626 C CA  . GLN B 38  ? 0.3713 0.6426 0.6194 -0.1669 0.0106  0.0789  180 GLN B CA  
1627 C C   . GLN B 38  ? 0.3814 0.6501 0.6473 -0.1998 -0.0039 0.0858  180 GLN B C   
1628 O O   . GLN B 38  ? 0.3833 0.7057 0.6921 -0.2161 -0.0015 0.0927  180 GLN B O   
1629 C CB  . GLN B 38  ? 0.3494 0.6692 0.6354 -0.1432 0.0094  0.0671  180 GLN B CB  
1630 C CG  . GLN B 38  ? 0.3572 0.6590 0.6458 -0.1338 -0.0160 0.0591  180 GLN B CG  
1631 C CD  . GLN B 38  ? 0.3466 0.6974 0.6837 -0.1114 -0.0196 0.0539  180 GLN B CD  
1632 O OE1 . GLN B 38  ? 0.3909 0.7641 0.7415 -0.0891 -0.0012 0.0458  180 GLN B OE1 
1633 N NE2 . GLN B 38  ? 0.3722 0.7393 0.7367 -0.1177 -0.0443 0.0582  180 GLN B NE2 
1634 N N   . ALA B 39  ? 0.3872 0.5955 0.6225 -0.2100 -0.0182 0.0816  181 ALA B N   
1635 C CA  . ALA B 39  ? 0.4086 0.6025 0.6522 -0.2439 -0.0319 0.0833  181 ALA B CA  
1636 C C   . ALA B 39  ? 0.4302 0.5456 0.6331 -0.2497 -0.0355 0.0777  181 ALA B C   
1637 O O   . ALA B 39  ? 0.4208 0.5020 0.5948 -0.2251 -0.0306 0.0722  181 ALA B O   
1638 C CB  . ALA B 39  ? 0.3966 0.6166 0.6591 -0.2480 -0.0542 0.0728  181 ALA B CB  
1639 N N   . PRO B 40  ? 0.4624 0.5486 0.6674 -0.2822 -0.0439 0.0777  182 PRO B N   
1640 C CA  . PRO B 40  ? 0.4961 0.5044 0.6684 -0.2846 -0.0473 0.0659  182 PRO B CA  
1641 C C   . PRO B 40  ? 0.4862 0.4744 0.6318 -0.2688 -0.0579 0.0402  182 PRO B C   
1642 O O   . PRO B 40  ? 0.4607 0.4917 0.6137 -0.2666 -0.0697 0.0339  182 PRO B O   
1643 C CB  . PRO B 40  ? 0.5447 0.5320 0.7304 -0.3260 -0.0559 0.0666  182 PRO B CB  
1644 C CG  . PRO B 40  ? 0.5307 0.5867 0.7568 -0.3450 -0.0523 0.0876  182 PRO B CG  
1645 C CD  . PRO B 40  ? 0.4780 0.5997 0.7184 -0.3182 -0.0505 0.0863  182 PRO B CD  
1646 N N   . GLY B 41  ? 0.5058 0.4318 0.6233 -0.2578 -0.0536 0.0275  183 GLY B N   
1647 C CA  . GLY B 41  ? 0.5064 0.4115 0.5950 -0.2460 -0.0590 0.0022  183 GLY B CA  
1648 C C   . GLY B 41  ? 0.4689 0.3757 0.5446 -0.2096 -0.0498 0.0031  183 GLY B C   
1649 O O   . GLY B 41  ? 0.4444 0.3566 0.5288 -0.1928 -0.0394 0.0206  183 GLY B O   
1650 N N   . ASN B 42  ? 0.4671 0.3711 0.5198 -0.2009 -0.0544 -0.0153 184 ASN B N   
1651 C CA  . ASN B 42  ? 0.4329 0.3384 0.4732 -0.1705 -0.0474 -0.0169 184 ASN B CA  
1652 C C   . ASN B 42  ? 0.3923 0.3481 0.4383 -0.1603 -0.0562 -0.0098 184 ASN B C   
1653 O O   . ASN B 42  ? 0.4014 0.3726 0.4376 -0.1726 -0.0697 -0.0166 184 ASN B O   
1654 C CB  . ASN B 42  ? 0.4659 0.3323 0.4770 -0.1691 -0.0434 -0.0421 184 ASN B CB  
1655 C CG  . ASN B 42  ? 0.5140 0.3237 0.5266 -0.1693 -0.0319 -0.0519 184 ASN B CG  
1656 O OD1 . ASN B 42  ? 0.5262 0.3229 0.5581 -0.1584 -0.0257 -0.0340 184 ASN B OD1 
1657 N ND2 . ASN B 42  ? 0.5647 0.3400 0.5566 -0.1819 -0.0294 -0.0805 184 ASN B ND2 
1658 N N   . PRO B 43  ? 0.3537 0.3335 0.4152 -0.1387 -0.0497 0.0041  185 PRO B N   
1659 C CA  . PRO B 43  ? 0.3159 0.3342 0.3880 -0.1238 -0.0561 0.0091  185 PRO B CA  
1660 C C   . PRO B 43  ? 0.3069 0.3160 0.3565 -0.1152 -0.0622 0.0008  185 PRO B C   
1661 O O   . PRO B 43  ? 0.2931 0.3295 0.3507 -0.1146 -0.0755 0.0062  185 PRO B O   
1662 C CB  . PRO B 43  ? 0.2894 0.3188 0.3733 -0.1030 -0.0434 0.0181  185 PRO B CB  
1663 C CG  . PRO B 43  ? 0.3139 0.3280 0.3993 -0.1131 -0.0339 0.0256  185 PRO B CG  
1664 C CD  . PRO B 43  ? 0.3522 0.3230 0.4220 -0.1294 -0.0368 0.0162  185 PRO B CD  
1665 N N   . VAL B 44  ? 0.3117 0.2858 0.3377 -0.1086 -0.0526 -0.0099 186 VAL B N   
1666 C CA  . VAL B 44  ? 0.3109 0.2800 0.3152 -0.1026 -0.0544 -0.0166 186 VAL B CA  
1667 C C   . VAL B 44  ? 0.3487 0.3072 0.3238 -0.1255 -0.0609 -0.0305 186 VAL B C   
1668 O O   . VAL B 44  ? 0.3762 0.3040 0.3370 -0.1358 -0.0522 -0.0472 186 VAL B O   
1669 C CB  . VAL B 44  ? 0.3057 0.2512 0.3037 -0.0846 -0.0392 -0.0223 186 VAL B CB  
1670 C CG1 . VAL B 44  ? 0.2958 0.2417 0.2741 -0.0820 -0.0387 -0.0279 186 VAL B CG1 
1671 C CG2 . VAL B 44  ? 0.2741 0.2317 0.2934 -0.0657 -0.0353 -0.0098 186 VAL B CG2 
1672 N N   . LEU B 45  ? 0.3545 0.3375 0.3204 -0.1341 -0.0771 -0.0235 187 LEU B N   
1673 C CA  . LEU B 45  ? 0.3974 0.3787 0.3283 -0.1602 -0.0874 -0.0344 187 LEU B CA  
1674 C C   . LEU B 45  ? 0.4204 0.3852 0.3127 -0.1605 -0.0761 -0.0476 187 LEU B C   
1675 O O   . LEU B 45  ? 0.4615 0.4104 0.3182 -0.1801 -0.0715 -0.0690 187 LEU B O   
1676 C CB  . LEU B 45  ? 0.3952 0.4155 0.3345 -0.1709 -0.1141 -0.0149 187 LEU B CB  
1677 C CG  . LEU B 45  ? 0.3732 0.4235 0.3578 -0.1723 -0.1263 -0.0011 187 LEU B CG  
1678 C CD1 . LEU B 45  ? 0.3514 0.4428 0.3553 -0.1741 -0.1529 0.0214  187 LEU B CD1 
1679 C CD2 . LEU B 45  ? 0.3950 0.4356 0.3735 -0.1987 -0.1279 -0.0150 187 LEU B CD2 
1680 N N   . ALA B 46  ? 0.3991 0.3697 0.2982 -0.1411 -0.0707 -0.0366 188 ALA B N   
1681 C CA  . ALA B 46  ? 0.4216 0.3848 0.2882 -0.1433 -0.0587 -0.0459 188 ALA B CA  
1682 C C   . ALA B 46  ? 0.3883 0.3515 0.2755 -0.1193 -0.0480 -0.0369 188 ALA B C   
1683 O O   . ALA B 46  ? 0.3567 0.3283 0.2771 -0.1029 -0.0547 -0.0214 188 ALA B O   
1684 C CB  . ALA B 46  ? 0.4506 0.4352 0.2822 -0.1658 -0.0771 -0.0351 188 ALA B CB  
1685 N N   . VAL B 47  ? 0.4098 0.3659 0.2773 -0.1193 -0.0303 -0.0491 189 VAL B N   
1686 C CA  . VAL B 47  ? 0.3858 0.3448 0.2713 -0.1015 -0.0195 -0.0427 189 VAL B CA  
1687 C C   . VAL B 47  ? 0.4155 0.3855 0.2699 -0.1146 -0.0109 -0.0436 189 VAL B C   
1688 O O   . VAL B 47  ? 0.4516 0.4178 0.2753 -0.1279 0.0046  -0.0652 189 VAL B O   
1689 C CB  . VAL B 47  ? 0.3753 0.3168 0.2841 -0.0835 0.0001  -0.0584 189 VAL B CB  
1690 C CG1 . VAL B 47  ? 0.3609 0.3117 0.2884 -0.0688 0.0102  -0.0530 189 VAL B CG1 
1691 C CG2 . VAL B 47  ? 0.3548 0.2876 0.2913 -0.0725 -0.0075 -0.0520 189 VAL B CG2 
1692 N N   . GLN B 48  ? 0.4055 0.3883 0.2683 -0.1120 -0.0195 -0.0214 190 GLN B N   
1693 C CA  . GLN B 48  ? 0.4334 0.4291 0.2724 -0.1252 -0.0109 -0.0156 190 GLN B CA  
1694 C C   . GLN B 48  ? 0.4087 0.4074 0.2804 -0.1089 0.0023  -0.0138 190 GLN B C   
1695 O O   . GLN B 48  ? 0.3746 0.3685 0.2813 -0.0922 -0.0086 -0.0027 190 GLN B O   
1696 C CB  . GLN B 48  ? 0.4538 0.4601 0.2775 -0.1403 -0.0360 0.0148  190 GLN B CB  
1697 C CG  . GLN B 48  ? 0.5493 0.5646 0.3242 -0.1676 -0.0472 0.0160  190 GLN B CG  
1698 C CD  . GLN B 48  ? 0.6033 0.6220 0.3912 -0.1686 -0.0792 0.0347  190 GLN B CD  
1699 O OE1 . GLN B 48  ? 0.6693 0.6987 0.4531 -0.1780 -0.1035 0.0654  190 GLN B OE1 
1700 N NE2 . GLN B 48  ? 0.5943 0.6058 0.4017 -0.1595 -0.0797 0.0185  190 GLN B NE2 
1701 N N   . ILE B 49  ? 0.4260 0.4361 0.2865 -0.1153 0.0260  -0.0259 191 ILE B N   
1702 C CA  . ILE B 49  ? 0.3998 0.4192 0.2968 -0.1012 0.0402  -0.0270 191 ILE B CA  
1703 C C   . ILE B 49  ? 0.4157 0.4576 0.3006 -0.1188 0.0494  -0.0144 191 ILE B C   
1704 O O   . ILE B 49  ? 0.4598 0.5143 0.3041 -0.1398 0.0624  -0.0202 191 ILE B O   
1705 C CB  . ILE B 49  ? 0.4039 0.4216 0.3193 -0.0865 0.0655  -0.0558 191 ILE B CB  
1706 C CG1 . ILE B 49  ? 0.3874 0.3814 0.3243 -0.0681 0.0557  -0.0618 191 ILE B CG1 
1707 C CG2 . ILE B 49  ? 0.3844 0.4228 0.3386 -0.0757 0.0806  -0.0556 191 ILE B CG2 
1708 C CD1 . ILE B 49  ? 0.3927 0.3775 0.3537 -0.0519 0.0765  -0.0855 191 ILE B CD1 
1709 N N   . ASN B 50  ? 0.3836 0.4310 0.3019 -0.1129 0.0428  0.0020  192 ASN B N   
1710 C CA  . ASN B 50  ? 0.4041 0.4746 0.3239 -0.1289 0.0541  0.0140  192 ASN B CA  
1711 C C   . ASN B 50  ? 0.3835 0.4724 0.3486 -0.1132 0.0735  -0.0011 192 ASN B C   
1712 O O   . ASN B 50  ? 0.3531 0.4382 0.3572 -0.0993 0.0610  0.0053  192 ASN B O   
1713 C CB  . ASN B 50  ? 0.3960 0.4561 0.3244 -0.1373 0.0287  0.0454  192 ASN B CB  
1714 C CG  . ASN B 50  ? 0.4135 0.4946 0.3384 -0.1613 0.0378  0.0641  192 ASN B CG  
1715 O OD1 . ASN B 50  ? 0.3688 0.4770 0.3133 -0.1628 0.0614  0.0535  192 ASN B OD1 
1716 N ND2 . ASN B 50  ? 0.4078 0.4775 0.3129 -0.1803 0.0179  0.0948  192 ASN B ND2 
1717 N N   . GLN B 51  ? 0.4135 0.5240 0.3738 -0.1155 0.1038  -0.0224 193 GLN B N   
1718 C CA  . GLN B 51  ? 0.4051 0.5378 0.4155 -0.0971 0.1248  -0.0393 193 GLN B CA  
1719 C C   . GLN B 51  ? 0.3923 0.5536 0.4393 -0.1045 0.1238  -0.0208 193 GLN B C   
1720 O O   . GLN B 51  ? 0.3605 0.5309 0.4585 -0.0868 0.1185  -0.0213 193 GLN B O   
1721 C CB  . GLN B 51  ? 0.4512 0.6034 0.4503 -0.0991 0.1621  -0.0693 193 GLN B CB  
1722 C CG  . GLN B 51  ? 0.5352 0.6744 0.4652 -0.1195 0.1689  -0.0817 193 GLN B CG  
1723 C CD  . GLN B 51  ? 0.6253 0.7784 0.5041 -0.1548 0.1618  -0.0556 193 GLN B CD  
1724 O OE1 . GLN B 51  ? 0.6753 0.8098 0.5045 -0.1704 0.1432  -0.0461 193 GLN B OE1 
1725 N NE2 . GLN B 51  ? 0.6466 0.8334 0.5414 -0.1682 0.1742  -0.0405 193 GLN B NE2 
1726 N N   . ASP B 52  ? 0.4128 0.5881 0.4325 -0.1333 0.1268  -0.0027 194 ASP B N   
1727 C CA  . ASP B 52  ? 0.4075 0.6084 0.4578 -0.1479 0.1261  0.0172  194 ASP B CA  
1728 C C   . ASP B 52  ? 0.3669 0.5451 0.4482 -0.1402 0.0933  0.0338  194 ASP B C   
1729 O O   . ASP B 52  ? 0.3458 0.5462 0.4726 -0.1406 0.0925  0.0382  194 ASP B O   
1730 C CB  . ASP B 52  ? 0.4587 0.6700 0.4649 -0.1842 0.1312  0.0397  194 ASP B CB  
1731 C CG  . ASP B 52  ? 0.5195 0.7709 0.5007 -0.1990 0.1716  0.0224  194 ASP B CG  
1732 O OD1 . ASP B 52  ? 0.5922 0.8504 0.5200 -0.2298 0.1764  0.0384  194 ASP B OD1 
1733 O OD2 . ASP B 52  ? 0.5384 0.8152 0.5532 -0.1802 0.1989  -0.0071 194 ASP B OD2 
1734 N N   . LYS B 53  ? 0.3539 0.4912 0.4121 -0.1345 0.0671  0.0412  195 LYS B N   
1735 C CA  . LYS B 53  ? 0.3262 0.4384 0.4075 -0.1279 0.0380  0.0522  195 LYS B CA  
1736 C C   . LYS B 53  ? 0.2932 0.3908 0.3896 -0.0995 0.0285  0.0353  195 LYS B C   
1737 O O   . LYS B 53  ? 0.2751 0.3519 0.3829 -0.0920 0.0070  0.0382  195 LYS B O   
1738 C CB  . LYS B 53  ? 0.3406 0.4196 0.3941 -0.1417 0.0156  0.0748  195 LYS B CB  
1739 C CG  . LYS B 53  ? 0.3711 0.4598 0.4131 -0.1738 0.0185  0.1011  195 LYS B CG  
1740 C CD  . LYS B 53  ? 0.3968 0.4488 0.4188 -0.1856 -0.0078 0.1289  195 LYS B CD  
1741 C CE  . LYS B 53  ? 0.3661 0.3818 0.4211 -0.1703 -0.0339 0.1285  195 LYS B CE  
1742 N NZ  . LYS B 53  ? 0.3803 0.3595 0.4328 -0.1817 -0.0584 0.1572  195 LYS B NZ  
1743 N N   . ASN B 54  ? 0.2916 0.3990 0.3872 -0.0849 0.0456  0.0169  196 ASN B N   
1744 C CA  . ASN B 54  ? 0.2700 0.3661 0.3819 -0.0601 0.0383  0.0048  196 ASN B CA  
1745 C C   . ASN B 54  ? 0.2576 0.3203 0.3505 -0.0533 0.0160  0.0086  196 ASN B C   
1746 O O   . ASN B 54  ? 0.2357 0.2919 0.3455 -0.0417 0.0016  0.0080  196 ASN B O   
1747 C CB  . ASN B 54  ? 0.2555 0.3753 0.4156 -0.0504 0.0349  0.0043  196 ASN B CB  
1748 C CG  . ASN B 54  ? 0.2846 0.4415 0.4765 -0.0457 0.0604  -0.0053 196 ASN B CG  
1749 O OD1 . ASN B 54  ? 0.3164 0.5070 0.5425 -0.0543 0.0649  0.0005  196 ASN B OD1 
1750 N ND2 . ASN B 54  ? 0.3060 0.4577 0.4910 -0.0326 0.0782  -0.0215 196 ASN B ND2 
1751 N N   . PHE B 55  ? 0.2738 0.3196 0.3315 -0.0614 0.0138  0.0119  197 PHE B N   
1752 C CA  . PHE B 55  ? 0.2645 0.2859 0.3109 -0.0536 -0.0038 0.0139  197 PHE B CA  
1753 C C   . PHE B 55  ? 0.2815 0.2945 0.2964 -0.0572 0.0002  0.0091  197 PHE B C   
1754 O O   . PHE B 55  ? 0.3003 0.3227 0.2932 -0.0700 0.0146  0.0051  197 PHE B O   
1755 C CB  . PHE B 55  ? 0.2696 0.2773 0.3195 -0.0610 -0.0231 0.0295  197 PHE B CB  
1756 C CG  . PHE B 55  ? 0.2882 0.2911 0.3144 -0.0799 -0.0274 0.0468  197 PHE B CG  
1757 C CD1 . PHE B 55  ? 0.2926 0.2827 0.2996 -0.0801 -0.0392 0.0533  197 PHE B CD1 
1758 C CD2 . PHE B 55  ? 0.3235 0.3378 0.3484 -0.0994 -0.0216 0.0601  197 PHE B CD2 
1759 C CE1 . PHE B 55  ? 0.3408 0.3287 0.3247 -0.0990 -0.0480 0.0746  197 PHE B CE1 
1760 C CE2 . PHE B 55  ? 0.3518 0.3622 0.3499 -0.1201 -0.0278 0.0820  197 PHE B CE2 
1761 C CZ  . PHE B 55  ? 0.3634 0.3600 0.3399 -0.1195 -0.0426 0.0901  197 PHE B CZ  
1762 N N   . ALA B 56  ? 0.2738 0.2719 0.2860 -0.0480 -0.0115 0.0076  198 ALA B N   
1763 C CA  . ALA B 56  ? 0.2947 0.2861 0.2801 -0.0550 -0.0134 0.0053  198 ALA B CA  
1764 C C   . ALA B 56  ? 0.2913 0.2741 0.2807 -0.0516 -0.0334 0.0155  198 ALA B C   
1765 O O   . ALA B 56  ? 0.2754 0.2544 0.2879 -0.0396 -0.0416 0.0179  198 ALA B O   
1766 C CB  . ALA B 56  ? 0.2894 0.2760 0.2737 -0.0474 -0.0003 -0.0126 198 ALA B CB  
1767 N N   . PHE B 57  ? 0.3112 0.2941 0.2790 -0.0627 -0.0408 0.0197  199 PHE B N   
1768 C CA  . PHE B 57  ? 0.3062 0.2879 0.2852 -0.0576 -0.0573 0.0262  199 PHE B CA  
1769 C C   . PHE B 57  ? 0.3132 0.2949 0.2832 -0.0599 -0.0532 0.0139  199 PHE B C   
1770 O O   . PHE B 57  ? 0.3350 0.3149 0.2779 -0.0731 -0.0447 0.0037  199 PHE B O   
1771 C CB  . PHE B 57  ? 0.3310 0.3164 0.3034 -0.0691 -0.0766 0.0474  199 PHE B CB  
1772 C CG  . PHE B 57  ? 0.3279 0.3055 0.3257 -0.0615 -0.0872 0.0619  199 PHE B CG  
1773 C CD1 . PHE B 57  ? 0.3230 0.2975 0.3544 -0.0463 -0.1002 0.0661  199 PHE B CD1 
1774 C CD2 . PHE B 57  ? 0.3360 0.3093 0.3277 -0.0700 -0.0823 0.0690  199 PHE B CD2 
1775 C CE1 . PHE B 57  ? 0.3302 0.2906 0.3875 -0.0387 -0.1092 0.0751  199 PHE B CE1 
1776 C CE2 . PHE B 57  ? 0.3455 0.3056 0.3621 -0.0656 -0.0930 0.0813  199 PHE B CE2 
1777 C CZ  . PHE B 57  ? 0.3450 0.2952 0.3943 -0.0492 -0.1070 0.0832  199 PHE B CZ  
1778 N N   . LEU B 58  ? 0.2923 0.2758 0.2852 -0.0483 -0.0577 0.0131  200 LEU B N   
1779 C CA  . LEU B 58  ? 0.2891 0.2731 0.2801 -0.0525 -0.0562 0.0056  200 LEU B CA  
1780 C C   . LEU B 58  ? 0.2914 0.2912 0.2911 -0.0592 -0.0746 0.0176  200 LEU B C   
1781 O O   . LEU B 58  ? 0.2767 0.2842 0.2986 -0.0497 -0.0849 0.0292  200 LEU B O   
1782 C CB  . LEU B 58  ? 0.2676 0.2503 0.2799 -0.0378 -0.0489 0.0014  200 LEU B CB  
1783 C CG  . LEU B 58  ? 0.2607 0.2325 0.2750 -0.0277 -0.0358 -0.0055 200 LEU B CG  
1784 C CD1 . LEU B 58  ? 0.2329 0.2104 0.2631 -0.0176 -0.0348 -0.0031 200 LEU B CD1 
1785 C CD2 . LEU B 58  ? 0.2806 0.2366 0.2816 -0.0338 -0.0242 -0.0166 200 LEU B CD2 
1786 N N   . GLU B 59  ? 0.3108 0.3152 0.2976 -0.0752 -0.0798 0.0144  201 GLU B N   
1787 C CA  . GLU B 59  ? 0.3176 0.3448 0.3215 -0.0819 -0.0996 0.0271  201 GLU B CA  
1788 C C   . GLU B 59  ? 0.3040 0.3372 0.3224 -0.0857 -0.0952 0.0194  201 GLU B C   
1789 O O   . GLU B 59  ? 0.3188 0.3348 0.3162 -0.0972 -0.0854 0.0055  201 GLU B O   
1790 C CB  . GLU B 59  ? 0.3586 0.3932 0.3314 -0.1054 -0.1163 0.0346  201 GLU B CB  
1791 C CG  . GLU B 59  ? 0.3716 0.4345 0.3717 -0.1073 -0.1441 0.0581  201 GLU B CG  
1792 C CD  . GLU B 59  ? 0.4439 0.5234 0.4156 -0.1363 -0.1655 0.0650  201 GLU B CD  
1793 O OE1 . GLU B 59  ? 0.5462 0.6124 0.4679 -0.1574 -0.1578 0.0491  201 GLU B OE1 
1794 O OE2 . GLU B 59  ? 0.4723 0.5805 0.4735 -0.1385 -0.1910 0.0853  201 GLU B OE2 
1795 N N   . PHE B 60  ? 0.2793 0.3367 0.3365 -0.0766 -0.1011 0.0279  202 PHE B N   
1796 C CA  . PHE B 60  ? 0.2723 0.3403 0.3471 -0.0813 -0.0944 0.0237  202 PHE B CA  
1797 C C   . PHE B 60  ? 0.2830 0.3815 0.3765 -0.0981 -0.1127 0.0322  202 PHE B C   
1798 O O   . PHE B 60  ? 0.2918 0.4086 0.3948 -0.0992 -0.1323 0.0448  202 PHE B O   
1799 C CB  . PHE B 60  ? 0.2490 0.3304 0.3552 -0.0608 -0.0827 0.0246  202 PHE B CB  
1800 C CG  . PHE B 60  ? 0.2326 0.2896 0.3221 -0.0484 -0.0665 0.0168  202 PHE B CG  
1801 C CD1 . PHE B 60  ? 0.2456 0.2907 0.3289 -0.0354 -0.0671 0.0161  202 PHE B CD1 
1802 C CD2 . PHE B 60  ? 0.2423 0.2900 0.3255 -0.0509 -0.0528 0.0132  202 PHE B CD2 
1803 C CE1 . PHE B 60  ? 0.2472 0.2754 0.3190 -0.0254 -0.0549 0.0097  202 PHE B CE1 
1804 C CE2 . PHE B 60  ? 0.2512 0.2808 0.3217 -0.0396 -0.0419 0.0097  202 PHE B CE2 
1805 C CZ  . PHE B 60  ? 0.2357 0.2580 0.3012 -0.0267 -0.0432 0.0069  202 PHE B CZ  
1806 N N   . ARG B 61  ? 0.2841 0.3893 0.3861 -0.1124 -0.1083 0.0281  203 ARG B N   
1807 C CA  . ARG B 61  ? 0.2905 0.4316 0.4181 -0.1306 -0.1263 0.0364  203 ARG B CA  
1808 C C   . ARG B 61  ? 0.2617 0.4493 0.4483 -0.1141 -0.1285 0.0488  203 ARG B C   
1809 O O   . ARG B 61  ? 0.2695 0.4962 0.4890 -0.1248 -0.1466 0.0593  203 ARG B O   
1810 C CB  . ARG B 61  ? 0.3079 0.4388 0.4273 -0.1558 -0.1212 0.0277  203 ARG B CB  
1811 C CG  . ARG B 61  ? 0.2902 0.4293 0.4368 -0.1495 -0.1019 0.0300  203 ARG B CG  
1812 C CD  . ARG B 61  ? 0.3249 0.4406 0.4593 -0.1749 -0.0968 0.0238  203 ARG B CD  
1813 N NE  . ARG B 61  ? 0.3197 0.4341 0.4688 -0.1697 -0.0767 0.0299  203 ARG B NE  
1814 C CZ  . ARG B 61  ? 0.3554 0.4486 0.5020 -0.1908 -0.0706 0.0307  203 ARG B CZ  
1815 N NH1 . ARG B 61  ? 0.3914 0.4617 0.5247 -0.2183 -0.0821 0.0212  203 ARG B NH1 
1816 N NH2 . ARG B 61  ? 0.3687 0.4634 0.5250 -0.1869 -0.0535 0.0416  203 ARG B NH2 
1817 N N   . SER B 62  ? 0.2323 0.4192 0.4347 -0.0891 -0.1100 0.0458  204 SER B N   
1818 C CA  . SER B 62  ? 0.2172 0.4488 0.4768 -0.0723 -0.1060 0.0509  204 SER B CA  
1819 C C   . SER B 62  ? 0.1990 0.4241 0.4708 -0.0418 -0.0936 0.0448  204 SER B C   
1820 O O   . SER B 62  ? 0.2039 0.3916 0.4393 -0.0348 -0.0849 0.0372  204 SER B O   
1821 C CB  . SER B 62  ? 0.2122 0.4698 0.4915 -0.0844 -0.0897 0.0491  204 SER B CB  
1822 O OG  . SER B 62  ? 0.2071 0.4491 0.4696 -0.0742 -0.0644 0.0408  204 SER B OG  
1823 N N   . VAL B 63  ? 0.1921 0.4556 0.5199 -0.0242 -0.0934 0.0469  205 VAL B N   
1824 C CA  . VAL B 63  ? 0.1857 0.4437 0.5320 0.0044  -0.0816 0.0366  205 VAL B CA  
1825 C C   . VAL B 63  ? 0.1831 0.4419 0.5143 0.0089  -0.0514 0.0197  205 VAL B C   
1826 O O   . VAL B 63  ? 0.1781 0.4079 0.4839 0.0208  -0.0420 0.0082  205 VAL B O   
1827 C CB  . VAL B 63  ? 0.1836 0.4822 0.6031 0.0245  -0.0903 0.0417  205 VAL B CB  
1828 C CG1 . VAL B 63  ? 0.1745 0.4688 0.6176 0.0538  -0.0707 0.0225  205 VAL B CG1 
1829 C CG2 . VAL B 63  ? 0.1690 0.4593 0.5977 0.0229  -0.1240 0.0629  205 VAL B CG2 
1830 N N   . ASP B 64  ? 0.1877 0.4812 0.5324 -0.0037 -0.0377 0.0202  206 ASP B N   
1831 C CA  . ASP B 64  ? 0.2008 0.5007 0.5273 -0.0034 -0.0096 0.0088  206 ASP B CA  
1832 C C   . ASP B 64  ? 0.2071 0.4590 0.4702 -0.0143 -0.0073 0.0096  206 ASP B C   
1833 O O   . ASP B 64  ? 0.2096 0.4502 0.4475 -0.0063 0.0073  -0.0003 206 ASP B O   
1834 C CB  . ASP B 64  ? 0.2098 0.5598 0.5646 -0.0197 0.0043  0.0144  206 ASP B CB  
1835 C CG  . ASP B 64  ? 0.2301 0.6393 0.6587 -0.0043 0.0088  0.0104  206 ASP B CG  
1836 O OD1 . ASP B 64  ? 0.2630 0.7190 0.7286 -0.0203 0.0105  0.0202  206 ASP B OD1 
1837 O OD2 . ASP B 64  ? 0.2498 0.6592 0.7053 0.0237  0.0101  -0.0024 206 ASP B OD2 
1838 N N   . GLU B 65  ? 0.2132 0.4380 0.4523 -0.0322 -0.0224 0.0200  207 GLU B N   
1839 C CA  . GLU B 65  ? 0.2220 0.4022 0.4116 -0.0399 -0.0203 0.0207  207 GLU B CA  
1840 C C   . GLU B 65  ? 0.2121 0.3598 0.3799 -0.0236 -0.0256 0.0133  207 GLU B C   
1841 O O   . GLU B 65  ? 0.2086 0.3332 0.3471 -0.0209 -0.0185 0.0105  207 GLU B O   
1842 C CB  . GLU B 65  ? 0.2363 0.3958 0.4108 -0.0632 -0.0317 0.0283  207 GLU B CB  
1843 C CG  . GLU B 65  ? 0.2625 0.4369 0.4445 -0.0848 -0.0228 0.0369  207 GLU B CG  
1844 C CD  . GLU B 65  ? 0.2957 0.4517 0.4713 -0.1106 -0.0362 0.0402  207 GLU B CD  
1845 O OE1 . GLU B 65  ? 0.3458 0.4977 0.5202 -0.1141 -0.0537 0.0364  207 GLU B OE1 
1846 O OE2 . GLU B 65  ? 0.3436 0.4888 0.5140 -0.1297 -0.0297 0.0470  207 GLU B OE2 
1847 N N   . THR B 66  ? 0.1999 0.3483 0.3856 -0.0140 -0.0396 0.0129  208 THR B N   
1848 C CA  . THR B 66  ? 0.1963 0.3164 0.3669 -0.0012 -0.0447 0.0081  208 THR B CA  
1849 C C   . THR B 66  ? 0.1951 0.3184 0.3672 0.0145  -0.0300 -0.0053 208 THR B C   
1850 O O   . THR B 66  ? 0.1904 0.2904 0.3346 0.0168  -0.0270 -0.0103 208 THR B O   
1851 C CB  . THR B 66  ? 0.1988 0.3209 0.3927 0.0042  -0.0642 0.0158  208 THR B CB  
1852 O OG1 . THR B 66  ? 0.1932 0.3167 0.3773 -0.0149 -0.0789 0.0271  208 THR B OG1 
1853 C CG2 . THR B 66  ? 0.1813 0.2723 0.3604 0.0133  -0.0697 0.0141  208 THR B CG2 
1854 N N   . THR B 67  ? 0.2010 0.3572 0.4066 0.0240  -0.0204 -0.0127 209 THR B N   
1855 C CA  . THR B 67  ? 0.2122 0.3775 0.4163 0.0361  -0.0029 -0.0308 209 THR B CA  
1856 C C   . THR B 67  ? 0.2219 0.3834 0.3831 0.0244  0.0094  -0.0303 209 THR B C   
1857 O O   . THR B 67  ? 0.2287 0.3758 0.3646 0.0290  0.0130  -0.0404 209 THR B O   
1858 C CB  . THR B 67  ? 0.2201 0.4301 0.4718 0.0467  0.0105  -0.0406 209 THR B CB  
1859 O OG1 . THR B 67  ? 0.2073 0.4157 0.5044 0.0641  -0.0024 -0.0424 209 THR B OG1 
1860 C CG2 . THR B 67  ? 0.2352 0.4606 0.4747 0.0535  0.0346  -0.0629 209 THR B CG2 
1861 N N   . GLN B 68  ? 0.2316 0.4044 0.3855 0.0077  0.0131  -0.0162 210 GLN B N   
1862 C CA  . GLN B 68  ? 0.2452 0.4122 0.3619 -0.0045 0.0217  -0.0085 210 GLN B CA  
1863 C C   . GLN B 68  ? 0.2409 0.3686 0.3263 -0.0034 0.0109  -0.0049 210 GLN B C   
1864 O O   . GLN B 68  ? 0.2508 0.3758 0.3095 -0.0040 0.0150  -0.0049 210 GLN B O   
1865 C CB  . GLN B 68  ? 0.2573 0.4323 0.3766 -0.0247 0.0235  0.0095  210 GLN B CB  
1866 C CG  . GLN B 68  ? 0.2830 0.5067 0.4335 -0.0308 0.0377  0.0094  210 GLN B CG  
1867 C CD  . GLN B 68  ? 0.3480 0.6010 0.4840 -0.0294 0.0594  0.0016  210 GLN B CD  
1868 O OE1 . GLN B 68  ? 0.4087 0.6513 0.5057 -0.0403 0.0636  0.0123  210 GLN B OE1 
1869 N NE2 . GLN B 68  ? 0.3710 0.6610 0.5377 -0.0156 0.0731  -0.0177 210 GLN B NE2 
1870 N N   . ALA B 69  ? 0.2328 0.3349 0.3225 -0.0029 -0.0030 -0.0015 211 ALA B N   
1871 C CA  . ALA B 69  ? 0.2310 0.3004 0.2989 -0.0020 -0.0111 0.0016  211 ALA B CA  
1872 C C   . ALA B 69  ? 0.2310 0.2948 0.2909 0.0095  -0.0132 -0.0094 211 ALA B C   
1873 O O   . ALA B 69  ? 0.2285 0.2755 0.2736 0.0102  -0.0180 -0.0065 211 ALA B O   
1874 C CB  . ALA B 69  ? 0.2176 0.2683 0.2906 -0.0061 -0.0213 0.0041  211 ALA B CB  
1875 N N   . MET B 70  ? 0.2433 0.3219 0.3180 0.0185  -0.0098 -0.0231 212 MET B N   
1876 C CA  . MET B 70  ? 0.2562 0.3275 0.3248 0.0270  -0.0116 -0.0379 212 MET B CA  
1877 C C   . MET B 70  ? 0.2705 0.3480 0.3078 0.0222  -0.0075 -0.0391 212 MET B C   
1878 O O   . MET B 70  ? 0.2729 0.3410 0.2984 0.0239  -0.0140 -0.0472 212 MET B O   
1879 C CB  . MET B 70  ? 0.2775 0.3635 0.3719 0.0382  -0.0048 -0.0557 212 MET B CB  
1880 C CG  . MET B 70  ? 0.3145 0.3802 0.4187 0.0475  -0.0121 -0.0699 212 MET B CG  
1881 S SD  . MET B 70  ? 0.3569 0.3974 0.4832 0.0485  -0.0303 -0.0542 212 MET B SD  
1882 C CE  . MET B 70  ? 0.3301 0.3441 0.4604 0.0547  -0.0363 -0.0717 212 MET B CE  
1883 N N   . ALA B 71  ? 0.2764 0.3716 0.3004 0.0137  0.0014  -0.0288 213 ALA B N   
1884 C CA  . ALA B 71  ? 0.3048 0.4094 0.2956 0.0062  0.0029  -0.0233 213 ALA B CA  
1885 C C   . ALA B 71  ? 0.3048 0.3880 0.2852 0.0037  -0.0116 -0.0054 213 ALA B C   
1886 O O   . ALA B 71  ? 0.3309 0.4210 0.2868 -0.0017 -0.0165 0.0036  213 ALA B O   
1887 C CB  . ALA B 71  ? 0.3164 0.4466 0.2968 -0.0051 0.0167  -0.0121 213 ALA B CB  
1888 N N   . PHE B 72  ? 0.2840 0.3448 0.2840 0.0075  -0.0182 -0.0002 214 PHE B N   
1889 C CA  . PHE B 72  ? 0.2819 0.3249 0.2825 0.0085  -0.0281 0.0127  214 PHE B CA  
1890 C C   . PHE B 72  ? 0.2736 0.3127 0.2785 0.0140  -0.0373 0.0030  214 PHE B C   
1891 O O   . PHE B 72  ? 0.2736 0.3041 0.2870 0.0164  -0.0440 0.0114  214 PHE B O   
1892 C CB  . PHE B 72  ? 0.2821 0.3047 0.2991 0.0079  -0.0268 0.0187  214 PHE B CB  
1893 C CG  . PHE B 72  ? 0.2878 0.3078 0.3036 -0.0010 -0.0210 0.0311  214 PHE B CG  
1894 C CD1 . PHE B 72  ? 0.2995 0.3119 0.3270 -0.0063 -0.0177 0.0278  214 PHE B CD1 
1895 C CD2 . PHE B 72  ? 0.3334 0.3590 0.3356 -0.0072 -0.0207 0.0484  214 PHE B CD2 
1896 C CE1 . PHE B 72  ? 0.3215 0.3305 0.3507 -0.0181 -0.0136 0.0386  214 PHE B CE1 
1897 C CE2 . PHE B 72  ? 0.3498 0.3705 0.3529 -0.0187 -0.0156 0.0626  214 PHE B CE2 
1898 C CZ  . PHE B 72  ? 0.3509 0.3626 0.3693 -0.0245 -0.0116 0.0564  214 PHE B CZ  
1899 N N   . ASP B 73  ? 0.2786 0.3240 0.2820 0.0158  -0.0370 -0.0152 215 ASP B N   
1900 C CA  . ASP B 73  ? 0.2738 0.3146 0.2814 0.0167  -0.0471 -0.0237 215 ASP B CA  
1901 C C   . ASP B 73  ? 0.2860 0.3385 0.2803 0.0127  -0.0579 -0.0134 215 ASP B C   
1902 O O   . ASP B 73  ? 0.3022 0.3704 0.2715 0.0075  -0.0583 -0.0102 215 ASP B O   
1903 C CB  . ASP B 73  ? 0.2845 0.3257 0.2914 0.0180  -0.0454 -0.0471 215 ASP B CB  
1904 C CG  . ASP B 73  ? 0.3050 0.3370 0.3192 0.0154  -0.0568 -0.0559 215 ASP B CG  
1905 O OD1 . ASP B 73  ? 0.3319 0.3560 0.3619 0.0144  -0.0622 -0.0443 215 ASP B OD1 
1906 O OD2 . ASP B 73  ? 0.3487 0.3820 0.3527 0.0125  -0.0592 -0.0760 215 ASP B OD2 
1907 N N   . GLY B 74  ? 0.2705 0.3194 0.2826 0.0141  -0.0669 -0.0066 216 GLY B N   
1908 C CA  . GLY B 74  ? 0.2807 0.3446 0.2921 0.0123  -0.0807 0.0074  216 GLY B CA  
1909 C C   . GLY B 74  ? 0.2785 0.3400 0.2999 0.0178  -0.0814 0.0319  216 GLY B C   
1910 O O   . GLY B 74  ? 0.2883 0.3626 0.3177 0.0189  -0.0952 0.0477  216 GLY B O   
1911 N N   . ILE B 75  ? 0.2665 0.3106 0.2912 0.0208  -0.0686 0.0353  217 ILE B N   
1912 C CA  . ILE B 75  ? 0.2709 0.3028 0.3077 0.0254  -0.0679 0.0555  217 ILE B CA  
1913 C C   . ILE B 75  ? 0.2625 0.2899 0.3354 0.0359  -0.0704 0.0597  217 ILE B C   
1914 O O   . ILE B 75  ? 0.2409 0.2704 0.3285 0.0376  -0.0659 0.0455  217 ILE B O   
1915 C CB  . ILE B 75  ? 0.2693 0.2816 0.3034 0.0228  -0.0536 0.0525  217 ILE B CB  
1916 C CG1 . ILE B 75  ? 0.2964 0.2927 0.3350 0.0225  -0.0540 0.0740  217 ILE B CG1 
1917 C CG2 . ILE B 75  ? 0.2483 0.2463 0.2997 0.0262  -0.0447 0.0373  217 ILE B CG2 
1918 C CD1 . ILE B 75  ? 0.3224 0.3328 0.3398 0.0157  -0.0637 0.0964  217 ILE B CD1 
1919 N N   . ILE B 76  ? 0.2800 0.3018 0.3697 0.0428  -0.0768 0.0804  218 ILE B N   
1920 C CA  . ILE B 76  ? 0.2821 0.3053 0.4142 0.0561  -0.0791 0.0853  218 ILE B CA  
1921 C C   . ILE B 76  ? 0.2848 0.2789 0.4365 0.0635  -0.0612 0.0757  218 ILE B C   
1922 O O   . ILE B 76  ? 0.3051 0.2735 0.4475 0.0609  -0.0562 0.0810  218 ILE B O   
1923 C CB  . ILE B 76  ? 0.3039 0.3380 0.4520 0.0624  -0.0991 0.1149  218 ILE B CB  
1924 C CG1 . ILE B 76  ? 0.3129 0.3787 0.4313 0.0504  -0.1181 0.1216  218 ILE B CG1 
1925 C CG2 . ILE B 76  ? 0.3045 0.3467 0.5098 0.0800  -0.1014 0.1194  218 ILE B CG2 
1926 C CD1 . ILE B 76  ? 0.2611 0.3527 0.3893 0.0471  -0.1228 0.1036  218 ILE B CD1 
1927 N N   . PHE B 77  ? 0.2806 0.2801 0.4582 0.0700  -0.0507 0.0602  219 PHE B N   
1928 C CA  . PHE B 77  ? 0.2918 0.2669 0.4844 0.0756  -0.0315 0.0453  219 PHE B CA  
1929 C C   . PHE B 77  ? 0.2932 0.2846 0.5333 0.0902  -0.0240 0.0395  219 PHE B C   
1930 O O   . PHE B 77  ? 0.2706 0.2907 0.5179 0.0868  -0.0226 0.0325  219 PHE B O   
1931 C CB  . PHE B 77  ? 0.2842 0.2517 0.4432 0.0613  -0.0193 0.0252  219 PHE B CB  
1932 C CG  . PHE B 77  ? 0.2952 0.2397 0.4568 0.0613  -0.0003 0.0063  219 PHE B CG  
1933 C CD1 . PHE B 77  ? 0.3495 0.2627 0.5233 0.0672  0.0047  0.0064  219 PHE B CD1 
1934 C CD2 . PHE B 77  ? 0.3068 0.2593 0.4551 0.0526  0.0120  -0.0118 219 PHE B CD2 
1935 C CE1 . PHE B 77  ? 0.3737 0.2630 0.5455 0.0646  0.0231  -0.0172 219 PHE B CE1 
1936 C CE2 . PHE B 77  ? 0.3335 0.2676 0.4758 0.0491  0.0299  -0.0320 219 PHE B CE2 
1937 C CZ  . PHE B 77  ? 0.3521 0.2545 0.5052 0.0550  0.0359  -0.0375 219 PHE B CZ  
1938 N N   . GLN B 78  ? 0.3230 0.2959 0.5998 0.1065  -0.0188 0.0429  220 GLN B N   
1939 C CA  . GLN B 78  ? 0.3362 0.3281 0.6713 0.1254  -0.0110 0.0389  220 GLN B CA  
1940 C C   . GLN B 78  ? 0.3149 0.3546 0.6733 0.1268  -0.0286 0.0541  220 GLN B C   
1941 O O   . GLN B 78  ? 0.2966 0.3678 0.6817 0.1283  -0.0179 0.0420  220 GLN B O   
1942 C CB  . GLN B 78  ? 0.3358 0.3281 0.6739 0.1241  0.0187  0.0063  220 GLN B CB  
1943 C CG  . GLN B 78  ? 0.3808 0.3279 0.6988 0.1214  0.0365  -0.0141 220 GLN B CG  
1944 C CD  . GLN B 78  ? 0.4050 0.3559 0.7328 0.1232  0.0678  -0.0479 220 GLN B CD  
1945 O OE1 . GLN B 78  ? 0.4316 0.4215 0.7904 0.1293  0.0785  -0.0538 220 GLN B OE1 
1946 N NE2 . GLN B 78  ? 0.4545 0.3677 0.7554 0.1157  0.0830  -0.0708 220 GLN B NE2 
1947 N N   . GLY B 79  ? 0.3204 0.3675 0.6661 0.1232  -0.0555 0.0804  221 GLY B N   
1948 C CA  . GLY B 79  ? 0.3128 0.4046 0.6787 0.1222  -0.0780 0.0967  221 GLY B CA  
1949 C C   . GLY B 79  ? 0.2903 0.4013 0.6134 0.1001  -0.0844 0.0874  221 GLY B C   
1950 O O   . GLY B 79  ? 0.2889 0.4316 0.6159 0.0937  -0.1064 0.0992  221 GLY B O   
1951 N N   . GLN B 80  ? 0.2795 0.3700 0.5626 0.0878  -0.0675 0.0665  222 GLN B N   
1952 C CA  . GLN B 80  ? 0.2657 0.3702 0.5203 0.0698  -0.0711 0.0554  222 GLN B CA  
1953 C C   . GLN B 80  ? 0.2590 0.3424 0.4585 0.0570  -0.0745 0.0509  222 GLN B C   
1954 O O   . GLN B 80  ? 0.2539 0.3103 0.4322 0.0579  -0.0652 0.0491  222 GLN B O   
1955 C CB  . GLN B 80  ? 0.2540 0.3636 0.5202 0.0654  -0.0500 0.0369  222 GLN B CB  
1956 C CG  . GLN B 80  ? 0.2703 0.4193 0.5929 0.0715  -0.0485 0.0394  222 GLN B CG  
1957 C CD  . GLN B 80  ? 0.2702 0.4258 0.6033 0.0669  -0.0217 0.0222  222 GLN B CD  
1958 O OE1 . GLN B 80  ? 0.3258 0.4568 0.6186 0.0562  -0.0090 0.0104  222 GLN B OE1 
1959 N NE2 . GLN B 80  ? 0.2809 0.4741 0.6687 0.0738  -0.0130 0.0220  222 GLN B NE2 
1960 N N   . SER B 81  ? 0.2537 0.3520 0.4349 0.0445  -0.0872 0.0470  223 SER B N   
1961 C CA  . SER B 81  ? 0.2587 0.3445 0.3948 0.0343  -0.0906 0.0401  223 SER B CA  
1962 C C   . SER B 81  ? 0.2372 0.3048 0.3606 0.0283  -0.0759 0.0224  223 SER B C   
1963 O O   . SER B 81  ? 0.2335 0.3078 0.3681 0.0214  -0.0757 0.0144  223 SER B O   
1964 C CB  . SER B 81  ? 0.2714 0.3804 0.3968 0.0238  -0.1111 0.0398  223 SER B CB  
1965 O OG  . SER B 81  ? 0.3107 0.4121 0.3931 0.0157  -0.1132 0.0316  223 SER B OG  
1966 N N   . LEU B 82  ? 0.2297 0.2760 0.3333 0.0295  -0.0652 0.0193  224 LEU B N   
1967 C CA  . LEU B 82  ? 0.2142 0.2459 0.3092 0.0242  -0.0548 0.0075  224 LEU B CA  
1968 C C   . LEU B 82  ? 0.2153 0.2441 0.2918 0.0179  -0.0605 -0.0025 224 LEU B C   
1969 O O   . LEU B 82  ? 0.2230 0.2565 0.2824 0.0178  -0.0654 -0.0038 224 LEU B O   
1970 C CB  . LEU B 82  ? 0.2084 0.2218 0.2944 0.0264  -0.0431 0.0077  224 LEU B CB  
1971 C CG  . LEU B 82  ? 0.2032 0.2089 0.3055 0.0329  -0.0332 0.0106  224 LEU B CG  
1972 C CD1 . LEU B 82  ? 0.1730 0.1575 0.2598 0.0296  -0.0248 0.0074  224 LEU B CD1 
1973 C CD2 . LEU B 82  ? 0.1871 0.2014 0.3078 0.0322  -0.0242 0.0039  224 LEU B CD2 
1974 N N   . LYS B 83  ? 0.2084 0.2288 0.2890 0.0125  -0.0588 -0.0093 225 LYS B N   
1975 C CA  . LYS B 83  ? 0.2162 0.2272 0.2892 0.0093  -0.0634 -0.0202 225 LYS B CA  
1976 C C   . LYS B 83  ? 0.2092 0.2072 0.2777 0.0116  -0.0569 -0.0201 225 LYS B C   
1977 O O   . LYS B 83  ? 0.2084 0.1997 0.2811 0.0077  -0.0538 -0.0139 225 LYS B O   
1978 C CB  . LYS B 83  ? 0.2216 0.2291 0.3091 0.0003  -0.0699 -0.0230 225 LYS B CB  
1979 C CG  . LYS B 83  ? 0.2420 0.2339 0.3282 -0.0024 -0.0768 -0.0367 225 LYS B CG  
1980 C CD  . LYS B 83  ? 0.2559 0.2353 0.3595 -0.0136 -0.0827 -0.0342 225 LYS B CD  
1981 C CE  . LYS B 83  ? 0.2772 0.2326 0.3855 -0.0154 -0.0904 -0.0495 225 LYS B CE  
1982 N NZ  . LYS B 83  ? 0.2944 0.2405 0.4199 -0.0313 -0.0997 -0.0476 225 LYS B NZ  
1983 N N   . ILE B 84  ? 0.2079 0.2070 0.2679 0.0163  -0.0549 -0.0265 226 ILE B N   
1984 C CA  . ILE B 84  ? 0.2057 0.2002 0.2685 0.0187  -0.0507 -0.0250 226 ILE B CA  
1985 C C   . ILE B 84  ? 0.2176 0.2055 0.2925 0.0232  -0.0541 -0.0364 226 ILE B C   
1986 O O   . ILE B 84  ? 0.2344 0.2266 0.3054 0.0265  -0.0528 -0.0513 226 ILE B O   
1987 C CB  . ILE B 84  ? 0.2058 0.2113 0.2590 0.0205  -0.0433 -0.0220 226 ILE B CB  
1988 C CG1 . ILE B 84  ? 0.2098 0.2149 0.2562 0.0182  -0.0411 -0.0114 226 ILE B CG1 
1989 C CG2 . ILE B 84  ? 0.1875 0.1939 0.2489 0.0203  -0.0409 -0.0191 226 ILE B CG2 
1990 C CD1 . ILE B 84  ? 0.2184 0.2128 0.2695 0.0147  -0.0387 -0.0066 226 ILE B CD1 
1991 N N   . ARG B 85  ? 0.2146 0.1916 0.3041 0.0232  -0.0588 -0.0297 227 ARG B N   
1992 C CA  . ARG B 85  ? 0.2235 0.1888 0.3351 0.0305  -0.0640 -0.0376 227 ARG B CA  
1993 C C   . ARG B 85  ? 0.2165 0.1832 0.3451 0.0334  -0.0687 -0.0246 227 ARG B C   
1994 O O   . ARG B 85  ? 0.2054 0.1783 0.3220 0.0252  -0.0698 -0.0103 227 ARG B O   
1995 C CB  . ARG B 85  ? 0.2366 0.1796 0.3568 0.0246  -0.0735 -0.0372 227 ARG B CB  
1996 C CG  . ARG B 85  ? 0.2446 0.1878 0.3542 0.0194  -0.0736 -0.0509 227 ARG B CG  
1997 C CD  . ARG B 85  ? 0.2766 0.2167 0.3884 0.0272  -0.0708 -0.0770 227 ARG B CD  
1998 N NE  . ARG B 85  ? 0.2771 0.2169 0.3759 0.0179  -0.0754 -0.0907 227 ARG B NE  
1999 C CZ  . ARG B 85  ? 0.2935 0.2564 0.3681 0.0134  -0.0736 -0.0923 227 ARG B CZ  
2000 N NH1 . ARG B 85  ? 0.2707 0.2539 0.3318 0.0174  -0.0658 -0.0812 227 ARG B NH1 
2001 N NH2 . ARG B 85  ? 0.3130 0.2782 0.3783 0.0030  -0.0823 -0.1033 227 ARG B NH2 
2002 N N   . ARG B 86  ? 0.2321 0.1939 0.3902 0.0453  -0.0722 -0.0310 228 ARG B N   
2003 C CA  . ARG B 86  ? 0.2415 0.2046 0.4264 0.0496  -0.0830 -0.0149 228 ARG B CA  
2004 C C   . ARG B 86  ? 0.2583 0.1986 0.4437 0.0397  -0.0990 0.0069  228 ARG B C   
2005 O O   . ARG B 86  ? 0.2709 0.1898 0.4521 0.0346  -0.1012 0.0043  228 ARG B O   
2006 C CB  . ARG B 86  ? 0.2546 0.2172 0.4817 0.0689  -0.0821 -0.0286 228 ARG B CB  
2007 C CG  . ARG B 86  ? 0.2529 0.2449 0.4853 0.0785  -0.0641 -0.0491 228 ARG B CG  
2008 C CD  . ARG B 86  ? 0.2374 0.2614 0.4723 0.0741  -0.0629 -0.0349 228 ARG B CD  
2009 N NE  . ARG B 86  ? 0.2458 0.3017 0.4977 0.0836  -0.0451 -0.0521 228 ARG B NE  
2010 C CZ  . ARG B 86  ? 0.2376 0.3272 0.4990 0.0792  -0.0407 -0.0436 228 ARG B CZ  
2011 N NH1 . ARG B 86  ? 0.2178 0.3099 0.4719 0.0658  -0.0548 -0.0207 228 ARG B NH1 
2012 N NH2 . ARG B 86  ? 0.2266 0.3493 0.5050 0.0862  -0.0215 -0.0594 228 ARG B NH2 
2013 N N   . PRO B 87  ? 0.2700 0.2172 0.4597 0.0343  -0.1115 0.0299  229 PRO B N   
2014 C CA  . PRO B 87  ? 0.2977 0.2250 0.4855 0.0226  -0.1279 0.0549  229 PRO B CA  
2015 C C   . PRO B 87  ? 0.3305 0.2293 0.5586 0.0348  -0.1389 0.0564  229 PRO B C   
2016 O O   . PRO B 87  ? 0.3372 0.2382 0.6017 0.0552  -0.1363 0.0408  229 PRO B O   
2017 C CB  . PRO B 87  ? 0.3032 0.2493 0.4890 0.0156  -0.1417 0.0781  229 PRO B CB  
2018 C CG  . PRO B 87  ? 0.2763 0.2510 0.4543 0.0182  -0.1292 0.0629  229 PRO B CG  
2019 C CD  . PRO B 87  ? 0.2563 0.2316 0.4515 0.0352  -0.1129 0.0359  229 PRO B CD  
2020 N N   . HIS B 88  ? 0.3608 0.2328 0.5856 0.0222  -0.1499 0.0745  230 HIS B N   
2021 C CA  . HIS B 88  ? 0.4001 0.2352 0.6662 0.0321  -0.1619 0.0768  230 HIS B CA  
2022 C C   . HIS B 88  ? 0.4282 0.2609 0.7401 0.0482  -0.1806 0.0963  230 HIS B C   
2023 O O   . HIS B 88  ? 0.4617 0.2654 0.8215 0.0658  -0.1874 0.0902  230 HIS B O   
2024 C CB  . HIS B 88  ? 0.4264 0.2334 0.6797 0.0104  -0.1707 0.0971  230 HIS B CB  
2025 C CG  . HIS B 88  ? 0.4229 0.2282 0.6531 -0.0007 -0.1555 0.0751  230 HIS B CG  
2026 N ND1 . HIS B 88  ? 0.4302 0.2319 0.6382 -0.0256 -0.1558 0.0919  230 HIS B ND1 
2027 C CD2 . HIS B 88  ? 0.4111 0.2227 0.6381 0.0081  -0.1407 0.0396  230 HIS B CD2 
2028 C CE1 . HIS B 88  ? 0.4310 0.2382 0.6297 -0.0299 -0.1434 0.0677  230 HIS B CE1 
2029 N NE2 . HIS B 88  ? 0.4121 0.2242 0.6190 -0.0103 -0.1356 0.0369  230 HIS B NE2 
2030 N N   . ASP B 89  ? 0.4178 0.2809 0.7190 0.0425  -0.1898 0.1185  231 ASP B N   
2031 C CA  . ASP B 89  ? 0.4388 0.3094 0.7883 0.0576  -0.2105 0.1398  231 ASP B CA  
2032 C C   . ASP B 89  ? 0.4094 0.3191 0.7863 0.0771  -0.1998 0.1186  231 ASP B C   
2033 O O   . ASP B 89  ? 0.4225 0.3539 0.8375 0.0862  -0.2172 0.1383  231 ASP B O   
2034 C CB  . ASP B 89  ? 0.4665 0.3473 0.7904 0.0349  -0.2349 0.1846  231 ASP B CB  
2035 C CG  . ASP B 89  ? 0.4505 0.3695 0.7191 0.0151  -0.2255 0.1810  231 ASP B CG  
2036 O OD1 . ASP B 89  ? 0.4167 0.3533 0.6758 0.0217  -0.2028 0.1486  231 ASP B OD1 
2037 O OD2 . ASP B 89  ? 0.4984 0.4280 0.7311 -0.0084 -0.2407 0.2101  231 ASP B OD2 
2038 N N   . TYR B 90  ? 0.3708 0.2927 0.7302 0.0816  -0.1728 0.0819  232 TYR B N   
2039 C CA  . TYR B 90  ? 0.3477 0.3082 0.7301 0.0965  -0.1583 0.0613  232 TYR B CA  
2040 C C   . TYR B 90  ? 0.3695 0.3299 0.8263 0.1264  -0.1610 0.0530  232 TYR B C   
2041 O O   . TYR B 90  ? 0.3924 0.3170 0.8722 0.1397  -0.1576 0.0371  232 TYR B O   
2042 C CB  . TYR B 90  ? 0.3155 0.2827 0.6622 0.0940  -0.1299 0.0269  232 TYR B CB  
2043 C CG  . TYR B 90  ? 0.2954 0.2999 0.6633 0.1076  -0.1104 0.0035  232 TYR B CG  
2044 C CD1 . TYR B 90  ? 0.2587 0.3034 0.6283 0.1010  -0.1111 0.0145  232 TYR B CD1 
2045 C CD2 . TYR B 90  ? 0.2940 0.2952 0.6770 0.1237  -0.0901 -0.0309 232 TYR B CD2 
2046 C CE1 . TYR B 90  ? 0.2505 0.3330 0.6416 0.1102  -0.0919 -0.0040 232 TYR B CE1 
2047 C CE2 . TYR B 90  ? 0.2901 0.3307 0.6890 0.1335  -0.0689 -0.0516 232 TYR B CE2 
2048 C CZ  . TYR B 90  ? 0.2690 0.3512 0.6737 0.1264  -0.0697 -0.0361 232 TYR B CZ  
2049 O OH  . TYR B 90  ? 0.2627 0.3876 0.6846 0.1324  -0.0476 -0.0534 232 TYR B OH  
2050 N N   . GLN B 91  ? 0.3681 0.3691 0.8664 0.1367  -0.1673 0.0626  233 GLN B N   
2051 C CA  . GLN B 91  ? 0.3938 0.4049 0.9731 0.1689  -0.1657 0.0515  233 GLN B CA  
2052 C C   . GLN B 91  ? 0.3791 0.4279 0.9692 0.1810  -0.1316 0.0116  233 GLN B C   
2053 O O   . GLN B 91  ? 0.3469 0.4455 0.9394 0.1747  -0.1264 0.0156  233 GLN B O   
2054 C CB  . GLN B 91  ? 0.4029 0.4414 1.0356 0.1749  -0.1960 0.0897  233 GLN B CB  
2055 C CG  . GLN B 91  ? 0.4347 0.4351 1.0622 0.1647  -0.2307 0.1318  233 GLN B CG  
2056 C CD  . GLN B 91  ? 0.4604 0.4889 1.1410 0.1702  -0.2657 0.1739  233 GLN B CD  
2057 O OE1 . GLN B 91  ? 0.4742 0.5166 1.1137 0.1433  -0.2893 0.2083  233 GLN B OE1 
2058 N NE2 . GLN B 91  ? 0.4657 0.5050 1.2393 0.2049  -0.2698 0.1707  233 GLN B NE2 
2059 N N   . PRO B 92  ? 0.4067 0.4324 0.9988 0.1947  -0.1082 -0.0272 234 PRO B N   
2060 C CA  . PRO B 92  ? 0.4038 0.4675 1.0055 0.2059  -0.0743 -0.0656 234 PRO B CA  
2061 C C   . PRO B 92  ? 0.4139 0.5266 1.0961 0.2288  -0.0716 -0.0640 234 PRO B C   
2062 O O   . PRO B 92  ? 0.3991 0.5658 1.0799 0.2225  -0.0555 -0.0683 234 PRO B O   
2063 C CB  . PRO B 92  ? 0.4413 0.4643 1.0431 0.2192  -0.0573 -0.1054 234 PRO B CB  
2064 C CG  . PRO B 92  ? 0.4711 0.4339 1.0871 0.2207  -0.0852 -0.0852 234 PRO B CG  
2065 C CD  . PRO B 92  ? 0.4391 0.4039 1.0201 0.1963  -0.1119 -0.0380 234 PRO B CD  
2066 N N   . LEU B 93  ? 0.4495 0.5438 1.2057 0.2547  -0.0885 -0.0553 235 LEU B N   
2067 C CA  . LEU B 93  ? 0.4536 0.5965 1.3014 0.2793  -0.0932 -0.0460 235 LEU B CA  
2068 C C   . LEU B 93  ? 0.4471 0.6003 1.3112 0.2682  -0.1364 0.0100  235 LEU B C   
2069 O O   . LEU B 93  ? 0.4776 0.5860 1.3565 0.2720  -0.1665 0.0377  235 LEU B O   
2070 C CB  . LEU B 93  ? 0.5051 0.6233 1.4366 0.3190  -0.0855 -0.0718 235 LEU B CB  
2071 C CG  . LEU B 93  ? 0.5293 0.6539 1.4669 0.3364  -0.0395 -0.1337 235 LEU B CG  
2072 C CD1 . LEU B 93  ? 0.5867 0.6744 1.6105 0.3761  -0.0366 -0.1583 235 LEU B CD1 
2073 C CD2 . LEU B 93  ? 0.5104 0.7177 1.4656 0.3378  -0.0085 -0.1508 235 LEU B CD2 
2074 N N   . PRO B 94  ? 0.4141 0.6259 1.2726 0.2512  -0.1408 0.0277  236 PRO B N   
2075 C CA  . PRO B 94  ? 0.4077 0.6332 1.2693 0.2346  -0.1828 0.0782  236 PRO B CA  
2076 C C   . PRO B 94  ? 0.4300 0.6774 1.3957 0.2624  -0.2112 0.1053  236 PRO B C   
2077 O O   . PRO B 94  ? 0.4372 0.7221 1.4859 0.2928  -0.1935 0.0844  236 PRO B O   
2078 C CB  . PRO B 94  ? 0.3748 0.6580 1.2062 0.2090  -0.1738 0.0789  236 PRO B CB  
2079 C CG  . PRO B 94  ? 0.3683 0.6898 1.2351 0.2267  -0.1323 0.0382  236 PRO B CG  
2080 C CD  . PRO B 94  ? 0.3872 0.6549 1.2327 0.2427  -0.1081 0.0028  236 PRO B CD  
2081 N N   . GLY B 95  ? 0.4476 0.6734 1.4096 0.2520  -0.2548 0.1526  237 GLY B N   
2082 C CA  . GLY B 95  ? 0.4763 0.7180 1.5343 0.2764  -0.2898 0.1879  237 GLY B CA  
2083 C C   . GLY B 95  ? 0.5157 0.7081 1.6470 0.3159  -0.2900 0.1798  237 GLY B C   
2084 O O   . GLY B 95  ? 0.5399 0.7501 1.7687 0.3440  -0.3134 0.2030  237 GLY B O   
2085 N N   . ALA B 96  ? 0.4980 0.4583 0.3530 -0.1104 -0.1528 0.0840  258 ALA B N   
2086 C CA  . ALA B 96  ? 0.4924 0.4745 0.3300 -0.1151 -0.1489 0.0659  258 ALA B CA  
2087 C C   . ALA B 96  ? 0.4525 0.4451 0.3274 -0.1096 -0.1327 0.0416  258 ALA B C   
2088 O O   . ALA B 96  ? 0.4615 0.4594 0.3200 -0.1148 -0.1270 0.0262  258 ALA B O   
2089 C CB  . ALA B 96  ? 0.5245 0.5156 0.3534 -0.1169 -0.1802 0.0730  258 ALA B CB  
2090 N N   . HIS B 97  ? 0.4215 0.4150 0.3441 -0.0995 -0.1255 0.0382  259 HIS B N   
2091 C CA  . HIS B 97  ? 0.3882 0.3961 0.3416 -0.0988 -0.1078 0.0201  259 HIS B CA  
2092 C C   . HIS B 97  ? 0.3640 0.3641 0.3169 -0.0958 -0.0820 0.0153  259 HIS B C   
2093 O O   . HIS B 97  ? 0.3428 0.3558 0.3246 -0.0930 -0.0677 0.0052  259 HIS B O   
2094 C CB  . HIS B 97  ? 0.3844 0.4190 0.3956 -0.0916 -0.1193 0.0160  259 HIS B CB  
2095 C CG  . HIS B 97  ? 0.3980 0.4470 0.4136 -0.0959 -0.1492 0.0205  259 HIS B CG  
2096 N ND1 . HIS B 97  ? 0.4381 0.5005 0.4873 -0.0827 -0.1754 0.0303  259 HIS B ND1 
2097 C CD2 . HIS B 97  ? 0.4200 0.4699 0.4073 -0.1108 -0.1605 0.0153  259 HIS B CD2 
2098 C CE1 . HIS B 97  ? 0.4556 0.5328 0.4978 -0.0912 -0.2023 0.0332  259 HIS B CE1 
2099 N NE2 . HIS B 97  ? 0.4466 0.5153 0.4492 -0.1097 -0.1933 0.0224  259 HIS B NE2 
2100 N N   . LYS B 98  ? 0.3716 0.3568 0.2898 -0.0991 -0.0765 0.0232  260 LYS B N   
2101 C CA  . LYS B 98  ? 0.3537 0.3356 0.2662 -0.0992 -0.0558 0.0187  260 LYS B CA  
2102 C C   . LYS B 98  ? 0.3351 0.3235 0.2264 -0.1016 -0.0414 0.0093  260 LYS B C   
2103 O O   . LYS B 98  ? 0.3426 0.3319 0.2055 -0.1042 -0.0449 0.0084  260 LYS B O   
2104 C CB  . LYS B 98  ? 0.3764 0.3456 0.2663 -0.1062 -0.0586 0.0330  260 LYS B CB  
2105 C CG  . LYS B 98  ? 0.3744 0.3459 0.2601 -0.1099 -0.0413 0.0282  260 LYS B CG  
2106 C CD  . LYS B 98  ? 0.3985 0.3633 0.2631 -0.1250 -0.0449 0.0452  260 LYS B CD  
2107 C CE  . LYS B 98  ? 0.4064 0.3731 0.2768 -0.1312 -0.0338 0.0393  260 LYS B CE  
2108 N NZ  . LYS B 98  ? 0.4650 0.4083 0.3312 -0.1486 -0.0446 0.0558  260 LYS B NZ  
2109 N N   . LEU B 99  ? 0.3168 0.3086 0.2193 -0.0990 -0.0265 0.0019  261 LEU B N   
2110 C CA  . LEU B 99  ? 0.3154 0.3055 0.2023 -0.0978 -0.0170 -0.0043 261 LEU B CA  
2111 C C   . LEU B 99  ? 0.3138 0.3109 0.1851 -0.0942 -0.0061 -0.0040 261 LEU B C   
2112 O O   . LEU B 99  ? 0.3089 0.3120 0.1880 -0.0963 -0.0017 -0.0018 261 LEU B O   
2113 C CB  . LEU B 99  ? 0.3018 0.2927 0.2088 -0.1005 -0.0104 -0.0069 261 LEU B CB  
2114 C CG  . LEU B 99  ? 0.3096 0.3039 0.2392 -0.1084 -0.0196 -0.0080 261 LEU B CG  
2115 C CD1 . LEU B 99  ? 0.2928 0.2956 0.2396 -0.1175 -0.0082 -0.0064 261 LEU B CD1 
2116 C CD2 . LEU B 99  ? 0.3123 0.2893 0.2221 -0.1120 -0.0339 -0.0123 261 LEU B CD2 
2117 N N   . PHE B 100 ? 0.3251 0.3227 0.1774 -0.0874 -0.0036 -0.0090 262 PHE B N   
2118 C CA  . PHE B 100 ? 0.3216 0.3344 0.1675 -0.0799 0.0050  -0.0101 262 PHE B CA  
2119 C C   . PHE B 100 ? 0.3271 0.3245 0.1745 -0.0729 0.0063  -0.0108 262 PHE B C   
2120 O O   . PHE B 100 ? 0.3398 0.3122 0.1834 -0.0713 0.0006  -0.0138 262 PHE B O   
2121 C CB  . PHE B 100 ? 0.3363 0.3667 0.1646 -0.0718 0.0068  -0.0169 262 PHE B CB  
2122 C CG  . PHE B 100 ? 0.3363 0.3908 0.1658 -0.0583 0.0135  -0.0212 262 PHE B CG  
2123 C CD1 . PHE B 100 ? 0.3405 0.4283 0.1797 -0.0660 0.0188  -0.0146 262 PHE B CD1 
2124 C CD2 . PHE B 100 ? 0.3646 0.4088 0.1881 -0.0372 0.0115  -0.0331 262 PHE B CD2 
2125 C CE1 . PHE B 100 ? 0.3237 0.4449 0.1703 -0.0531 0.0222  -0.0187 262 PHE B CE1 
2126 C CE2 . PHE B 100 ? 0.3664 0.4378 0.1970 -0.0188 0.0145  -0.0376 262 PHE B CE2 
2127 C CZ  . PHE B 100 ? 0.3511 0.4672 0.1950 -0.0268 0.0201  -0.0300 262 PHE B CZ  
2128 N N   . ILE B 101 ? 0.3193 0.3283 0.1692 -0.0721 0.0111  -0.0063 263 ILE B N   
2129 C CA  . ILE B 101 ? 0.3397 0.3346 0.1832 -0.0664 0.0100  -0.0007 263 ILE B CA  
2130 C C   . ILE B 101 ? 0.3458 0.3591 0.1839 -0.0510 0.0077  -0.0006 263 ILE B C   
2131 O O   . ILE B 101 ? 0.3221 0.3662 0.1645 -0.0547 0.0104  -0.0006 263 ILE B O   
2132 C CB  . ILE B 101 ? 0.3411 0.3393 0.1872 -0.0788 0.0162  0.0062  263 ILE B CB  
2133 C CG1 . ILE B 101 ? 0.3472 0.3392 0.2087 -0.0910 0.0191  0.0048  263 ILE B CG1 
2134 C CG2 . ILE B 101 ? 0.3608 0.3446 0.1911 -0.0765 0.0136  0.0189  263 ILE B CG2 
2135 C CD1 . ILE B 101 ? 0.3622 0.3693 0.2399 -0.0935 0.0205  -0.0033 263 ILE B CD1 
2136 N N   . GLY B 102 ? 0.3732 0.3661 0.2048 -0.0331 0.0003  -0.0022 264 GLY B N   
2137 C CA  . GLY B 102 ? 0.3836 0.3984 0.2178 -0.0099 -0.0045 -0.0057 264 GLY B CA  
2138 C C   . GLY B 102 ? 0.4202 0.4026 0.2454 0.0044  -0.0173 0.0063  264 GLY B C   
2139 O O   . GLY B 102 ? 0.4450 0.3798 0.2589 -0.0043 -0.0221 0.0159  264 GLY B O   
2140 N N   . GLY B 103 ? 0.4294 0.4395 0.2609 0.0245  -0.0250 0.0084  265 GLY B N   
2141 C CA  . GLY B 103 ? 0.4793 0.4568 0.3006 0.0420  -0.0427 0.0243  265 GLY B CA  
2142 C C   . GLY B 103 ? 0.4911 0.4591 0.2913 0.0195  -0.0450 0.0486  265 GLY B C   
2143 O O   . GLY B 103 ? 0.5400 0.4615 0.3210 0.0202  -0.0574 0.0694  265 GLY B O   
2144 N N   . LEU B 104 ? 0.4545 0.4643 0.2552 -0.0018 -0.0331 0.0459  266 LEU B N   
2145 C CA  . LEU B 104 ? 0.4648 0.4802 0.2421 -0.0201 -0.0332 0.0619  266 LEU B CA  
2146 C C   . LEU B 104 ? 0.4930 0.5338 0.2632 -0.0039 -0.0516 0.0727  266 LEU B C   
2147 O O   . LEU B 104 ? 0.4825 0.5629 0.2774 0.0142  -0.0579 0.0607  266 LEU B O   
2148 C CB  . LEU B 104 ? 0.4227 0.4720 0.2043 -0.0424 -0.0174 0.0476  266 LEU B CB  
2149 C CG  . LEU B 104 ? 0.3942 0.4263 0.1864 -0.0569 -0.0022 0.0379  266 LEU B CG  
2150 C CD1 . LEU B 104 ? 0.3343 0.3949 0.1365 -0.0703 0.0074  0.0216  266 LEU B CD1 
2151 C CD2 . LEU B 104 ? 0.3980 0.4001 0.1744 -0.0713 0.0030  0.0528  266 LEU B CD2 
2152 N N   . PRO B 105 ? 0.5403 0.5647 0.2772 -0.0113 -0.0612 0.0971  267 PRO B N   
2153 C CA  . PRO B 105 ? 0.5649 0.6221 0.2878 -0.0021 -0.0807 0.1089  267 PRO B CA  
2154 C C   . PRO B 105 ? 0.5291 0.6489 0.2604 -0.0158 -0.0746 0.0879  267 PRO B C   
2155 O O   . PRO B 105 ? 0.5039 0.6288 0.2268 -0.0405 -0.0558 0.0746  267 PRO B O   
2156 C CB  . PRO B 105 ? 0.6193 0.6466 0.2937 -0.0201 -0.0846 0.1393  267 PRO B CB  
2157 C CG  . PRO B 105 ? 0.6355 0.6036 0.3086 -0.0285 -0.0755 0.1493  267 PRO B CG  
2158 C CD  . PRO B 105 ? 0.5750 0.5529 0.2840 -0.0315 -0.0554 0.1180  267 PRO B CD  
2159 N N   . ASN B 106 ? 0.5283 0.6945 0.2793 0.0008  -0.0925 0.0839  268 ASN B N   
2160 C CA  . ASN B 106 ? 0.4959 0.7208 0.2635 -0.0146 -0.0907 0.0627  268 ASN B CA  
2161 C C   . ASN B 106 ? 0.5123 0.7514 0.2407 -0.0405 -0.0925 0.0604  268 ASN B C   
2162 O O   . ASN B 106 ? 0.4909 0.7583 0.2273 -0.0603 -0.0875 0.0379  268 ASN B O   
2163 C CB  . ASN B 106 ? 0.4970 0.7800 0.3030 0.0080  -0.1105 0.0598  268 ASN B CB  
2164 C CG  . ASN B 106 ? 0.5712 0.8605 0.3618 0.0319  -0.1415 0.0838  268 ASN B CG  
2165 O OD1 . ASN B 106 ? 0.6212 0.8960 0.3646 0.0195  -0.1523 0.1009  268 ASN B OD1 
2166 N ND2 . ASN B 106 ? 0.6027 0.9173 0.4327 0.0681  -0.1569 0.0850  268 ASN B ND2 
2167 N N   . TYR B 107 ? 0.5548 0.7722 0.2378 -0.0415 -0.1005 0.0831  269 TYR B N   
2168 C CA  . TYR B 107 ? 0.5833 0.8181 0.2199 -0.0648 -0.1002 0.0787  269 TYR B CA  
2169 C C   . TYR B 107 ? 0.5700 0.7844 0.1894 -0.0875 -0.0697 0.0616  269 TYR B C   
2170 O O   . TYR B 107 ? 0.5984 0.8322 0.1832 -0.1050 -0.0651 0.0467  269 TYR B O   
2171 C CB  . TYR B 107 ? 0.6508 0.8782 0.2381 -0.0597 -0.1208 0.1135  269 TYR B CB  
2172 C CG  . TYR B 107 ? 0.6774 0.8464 0.2480 -0.0549 -0.1149 0.1450  269 TYR B CG  
2173 C CD1 . TYR B 107 ? 0.6935 0.8401 0.2345 -0.0793 -0.0883 0.1479  269 TYR B CD1 
2174 C CD2 . TYR B 107 ? 0.7002 0.8376 0.2870 -0.0265 -0.1372 0.1705  269 TYR B CD2 
2175 C CE1 . TYR B 107 ? 0.7264 0.8215 0.2545 -0.0825 -0.0841 0.1787  269 TYR B CE1 
2176 C CE2 . TYR B 107 ? 0.7463 0.8193 0.3164 -0.0264 -0.1355 0.1993  269 TYR B CE2 
2177 C CZ  . TYR B 107 ? 0.7560 0.8088 0.2964 -0.0581 -0.1091 0.2050  269 TYR B CZ  
2178 O OH  . TYR B 107 ? 0.7953 0.7872 0.3209 -0.0659 -0.1082 0.2356  269 TYR B OH  
2179 N N   . LEU B 108 ? 0.5316 0.7111 0.1751 -0.0853 -0.0504 0.0612  270 LEU B N   
2180 C CA  . LEU B 108 ? 0.5272 0.6937 0.1631 -0.1021 -0.0234 0.0470  270 LEU B CA  
2181 C C   . LEU B 108 ? 0.4952 0.6744 0.1554 -0.1102 -0.0134 0.0102  270 LEU B C   
2182 O O   . LEU B 108 ? 0.4574 0.6347 0.1563 -0.1047 -0.0173 0.0017  270 LEU B O   
2183 C CB  . LEU B 108 ? 0.5083 0.6356 0.1641 -0.0984 -0.0110 0.0606  270 LEU B CB  
2184 C CG  . LEU B 108 ? 0.5540 0.6517 0.1825 -0.0987 -0.0174 0.0975  270 LEU B CG  
2185 C CD1 . LEU B 108 ? 0.5289 0.5888 0.1822 -0.1009 -0.0057 0.1025  270 LEU B CD1 
2186 C CD2 . LEU B 108 ? 0.5882 0.7033 0.1640 -0.1192 -0.0093 0.1108  270 LEU B CD2 
2187 N N   . ASN B 109 ? 0.5180 0.7080 0.1536 -0.1232 -0.0002 -0.0112 271 ASN B N   
2188 C CA  . ASN B 109 ? 0.5044 0.6936 0.1595 -0.1292 0.0062  -0.0481 271 ASN B CA  
2189 C C   . ASN B 109 ? 0.4780 0.6429 0.1648 -0.1258 0.0265  -0.0576 271 ASN B C   
2190 O O   . ASN B 109 ? 0.4642 0.6196 0.1565 -0.1226 0.0373  -0.0378 271 ASN B O   
2191 C CB  . ASN B 109 ? 0.5487 0.7597 0.1625 -0.1397 0.0072  -0.0753 271 ASN B CB  
2192 C CG  . ASN B 109 ? 0.5722 0.7916 0.1590 -0.1419 0.0336  -0.0831 271 ASN B CG  
2193 O OD1 . ASN B 109 ? 0.5358 0.7429 0.1500 -0.1373 0.0526  -0.0820 271 ASN B OD1 
2194 N ND2 . ASN B 109 ? 0.6384 0.8870 0.1712 -0.1503 0.0348  -0.0920 271 ASN B ND2 
2195 N N   . ASP B 110 ? 0.4787 0.6317 0.1863 -0.1277 0.0277  -0.0871 272 ASP B N   
2196 C CA  . ASP B 110 ? 0.4649 0.5951 0.2066 -0.1214 0.0404  -0.0984 272 ASP B CA  
2197 C C   . ASP B 110 ? 0.4722 0.6158 0.2099 -0.1173 0.0632  -0.0993 272 ASP B C   
2198 O O   . ASP B 110 ? 0.4435 0.5793 0.2068 -0.1137 0.0701  -0.0837 272 ASP B O   
2199 C CB  . ASP B 110 ? 0.4921 0.6024 0.2459 -0.1232 0.0346  -0.1327 272 ASP B CB  
2200 C CG  . ASP B 110 ? 0.5160 0.6036 0.2957 -0.1311 0.0164  -0.1257 272 ASP B CG  
2201 O OD1 . ASP B 110 ? 0.5652 0.6666 0.3352 -0.1434 0.0013  -0.1239 272 ASP B OD1 
2202 O OD2 . ASP B 110 ? 0.5626 0.6230 0.3725 -0.1270 0.0166  -0.1214 272 ASP B OD2 
2203 N N   . ASP B 111 ? 0.5118 0.6815 0.2177 -0.1200 0.0750  -0.1195 273 ASP B N   
2204 C CA  . ASP B 111 ? 0.5273 0.7260 0.2306 -0.1191 0.1012  -0.1234 273 ASP B CA  
2205 C C   . ASP B 111 ? 0.5205 0.7300 0.2123 -0.1299 0.1078  -0.0817 273 ASP B C   
2206 O O   . ASP B 111 ? 0.5127 0.7371 0.2264 -0.1326 0.1253  -0.0751 273 ASP B O   
2207 C CB  . ASP B 111 ? 0.5894 0.8227 0.2495 -0.1215 0.1138  -0.1539 273 ASP B CB  
2208 C CG  . ASP B 111 ? 0.6299 0.8511 0.3083 -0.1070 0.1149  -0.2048 273 ASP B CG  
2209 O OD1 . ASP B 111 ? 0.6332 0.8306 0.3626 -0.0932 0.1146  -0.2143 273 ASP B OD1 
2210 O OD2 . ASP B 111 ? 0.7158 0.9487 0.3551 -0.1088 0.1137  -0.2363 273 ASP B OD2 
2211 N N   . GLN B 112 ? 0.5308 0.7327 0.1900 -0.1367 0.0915  -0.0538 274 GLN B N   
2212 C CA  . GLN B 112 ? 0.5391 0.7346 0.1835 -0.1463 0.0908  -0.0118 274 GLN B CA  
2213 C C   . GLN B 112 ? 0.5024 0.6655 0.1923 -0.1414 0.0866  0.0021  274 GLN B C   
2214 O O   . GLN B 112 ? 0.5053 0.6681 0.2043 -0.1520 0.0976  0.0201  274 GLN B O   
2215 C CB  . GLN B 112 ? 0.5616 0.7497 0.1666 -0.1470 0.0674  0.0126  274 GLN B CB  
2216 C CG  . GLN B 112 ? 0.6170 0.8413 0.1623 -0.1584 0.0718  0.0098  274 GLN B CG  
2217 C CD  . GLN B 112 ? 0.6434 0.8680 0.1529 -0.1558 0.0425  0.0267  274 GLN B CD  
2218 O OE1 . GLN B 112 ? 0.6111 0.8178 0.1480 -0.1426 0.0199  0.0304  274 GLN B OE1 
2219 N NE2 . GLN B 112 ? 0.6792 0.9322 0.1272 -0.1683 0.0428  0.0365  274 GLN B NE2 
2220 N N   . VAL B 113 ? 0.4710 0.6104 0.1877 -0.1285 0.0706  -0.0066 275 VAL B N   
2221 C CA  . VAL B 113 ? 0.4424 0.5542 0.1965 -0.1228 0.0658  0.0011  275 VAL B CA  
2222 C C   . VAL B 113 ? 0.4346 0.5564 0.2225 -0.1246 0.0817  -0.0138 275 VAL B C   
2223 O O   . VAL B 113 ? 0.4293 0.5437 0.2348 -0.1309 0.0848  0.0006  275 VAL B O   
2224 C CB  . VAL B 113 ? 0.4170 0.5138 0.1893 -0.1114 0.0495  -0.0073 275 VAL B CB  
2225 C CG1 . VAL B 113 ? 0.3797 0.4524 0.1802 -0.1061 0.0454  -0.0001 275 VAL B CG1 
2226 C CG2 . VAL B 113 ? 0.4140 0.5156 0.1635 -0.1068 0.0329  0.0047  275 VAL B CG2 
2227 N N   . LYS B 114 ? 0.4379 0.5763 0.2368 -0.1183 0.0893  -0.0439 276 LYS B N   
2228 C CA  . LYS B 114 ? 0.4340 0.5895 0.2702 -0.1134 0.1029  -0.0617 276 LYS B CA  
2229 C C   . LYS B 114 ? 0.4518 0.6427 0.2885 -0.1273 0.1228  -0.0487 276 LYS B C   
2230 O O   . LYS B 114 ? 0.4430 0.6457 0.3185 -0.1289 0.1278  -0.0467 276 LYS B O   
2231 C CB  . LYS B 114 ? 0.4511 0.6186 0.2911 -0.1014 0.1089  -0.0992 276 LYS B CB  
2232 C CG  . LYS B 114 ? 0.4626 0.5906 0.3194 -0.0910 0.0891  -0.1132 276 LYS B CG  
2233 C CD  . LYS B 114 ? 0.4932 0.6198 0.3481 -0.0802 0.0911  -0.1533 276 LYS B CD  
2234 C CE  . LYS B 114 ? 0.5277 0.6640 0.4270 -0.0608 0.1000  -0.1757 276 LYS B CE  
2235 N NZ  . LYS B 114 ? 0.5758 0.7213 0.4733 -0.0442 0.1090  -0.2222 276 LYS B NZ  
2236 N N   . GLU B 115 ? 0.4875 0.6984 0.2800 -0.1404 0.1323  -0.0374 277 GLU B N   
2237 C CA  . GLU B 115 ? 0.5156 0.7653 0.2993 -0.1610 0.1535  -0.0204 277 GLU B CA  
2238 C C   . GLU B 115 ? 0.5108 0.7319 0.3051 -0.1778 0.1440  0.0163  277 GLU B C   
2239 O O   . GLU B 115 ? 0.5234 0.7729 0.3388 -0.1962 0.1584  0.0270  277 GLU B O   
2240 C CB  . GLU B 115 ? 0.5623 0.8342 0.2842 -0.1727 0.1616  -0.0126 277 GLU B CB  
2241 C CG  . GLU B 115 ? 0.6084 0.9318 0.3129 -0.1978 0.1884  0.0037  277 GLU B CG  
2242 C CD  . GLU B 115 ? 0.6723 1.0330 0.3128 -0.2053 0.2011  -0.0018 277 GLU B CD  
2243 O OE1 . GLU B 115 ? 0.6928 1.0322 0.3018 -0.1920 0.1835  -0.0153 277 GLU B OE1 
2244 O OE2 . GLU B 115 ? 0.7133 1.1301 0.3340 -0.2269 0.2286  0.0072  277 GLU B OE2 
2245 N N   . LEU B 116 ? 0.5032 0.6702 0.2856 -0.1715 0.1193  0.0326  278 LEU B N   
2246 C CA  . LEU B 116 ? 0.5024 0.6290 0.2966 -0.1811 0.1055  0.0580  278 LEU B CA  
2247 C C   . LEU B 116 ? 0.4623 0.5909 0.3093 -0.1767 0.1040  0.0427  278 LEU B C   
2248 O O   . LEU B 116 ? 0.4721 0.6003 0.3392 -0.1953 0.1048  0.0562  278 LEU B O   
2249 C CB  . LEU B 116 ? 0.5047 0.5794 0.2782 -0.1662 0.0802  0.0692  278 LEU B CB  
2250 C CG  . LEU B 116 ? 0.5329 0.5550 0.3017 -0.1734 0.0633  0.0959  278 LEU B CG  
2251 C CD1 . LEU B 116 ? 0.5960 0.6094 0.3274 -0.1968 0.0651  0.1311  278 LEU B CD1 
2252 C CD2 . LEU B 116 ? 0.5241 0.5085 0.2873 -0.1479 0.0412  0.0928  278 LEU B CD2 
2253 N N   . LEU B 117 ? 0.4240 0.5533 0.2920 -0.1549 0.0989  0.0167  279 LEU B N   
2254 C CA  . LEU B 117 ? 0.3945 0.5229 0.3074 -0.1486 0.0919  0.0055  279 LEU B CA  
2255 C C   . LEU B 117 ? 0.3905 0.5733 0.3441 -0.1546 0.1091  -0.0058 279 LEU B C   
2256 O O   . LEU B 117 ? 0.3806 0.5707 0.3684 -0.1638 0.1035  -0.0007 279 LEU B O   
2257 C CB  . LEU B 117 ? 0.3710 0.4814 0.2911 -0.1266 0.0795  -0.0128 279 LEU B CB  
2258 C CG  . LEU B 117 ? 0.3753 0.4462 0.2694 -0.1200 0.0630  -0.0044 279 LEU B CG  
2259 C CD1 . LEU B 117 ? 0.3765 0.4409 0.2755 -0.1067 0.0556  -0.0198 279 LEU B CD1 
2260 C CD2 . LEU B 117 ? 0.3742 0.4162 0.2729 -0.1232 0.0495  0.0072  279 LEU B CD2 
2261 N N   . THR B 118 ? 0.3973 0.6231 0.3484 -0.1490 0.1293  -0.0236 280 THR B N   
2262 C CA  . THR B 118 ? 0.3986 0.6869 0.3965 -0.1450 0.1474  -0.0433 280 THR B CA  
2263 C C   . THR B 118 ? 0.4160 0.7546 0.4309 -0.1749 0.1652  -0.0251 280 THR B C   
2264 O O   . THR B 118 ? 0.4123 0.8163 0.4764 -0.1725 0.1809  -0.0410 280 THR B O   
2265 C CB  . THR B 118 ? 0.4158 0.7384 0.4054 -0.1264 0.1658  -0.0760 280 THR B CB  
2266 O OG1 . THR B 118 ? 0.4493 0.7863 0.3843 -0.1433 0.1818  -0.0659 280 THR B OG1 
2267 C CG2 . THR B 118 ? 0.4134 0.6872 0.3979 -0.1004 0.1463  -0.0966 280 THR B CG2 
2268 N N   . SER B 119 ? 0.4401 0.7507 0.4187 -0.2033 0.1620  0.0085  281 SER B N   
2269 C CA  . SER B 119 ? 0.4706 0.8180 0.4666 -0.2401 0.1743  0.0322  281 SER B CA  
2270 C C   . SER B 119 ? 0.4471 0.8056 0.5053 -0.2458 0.1607  0.0295  281 SER B C   
2271 O O   . SER B 119 ? 0.4589 0.8772 0.5552 -0.2720 0.1746  0.0368  281 SER B O   
2272 C CB  . SER B 119 ? 0.5159 0.8101 0.4581 -0.2690 0.1658  0.0723  281 SER B CB  
2273 O OG  . SER B 119 ? 0.5141 0.7286 0.4489 -0.2625 0.1343  0.0816  281 SER B OG  
2274 N N   . PHE B 120 ? 0.4195 0.7270 0.4869 -0.2236 0.1333  0.0197  282 PHE B N   
2275 C CA  . PHE B 120 ? 0.4006 0.7173 0.5204 -0.2246 0.1151  0.0143  282 PHE B CA  
2276 C C   . PHE B 120 ? 0.3737 0.7421 0.5465 -0.1936 0.1172  -0.0152 282 PHE B C   
2277 O O   . PHE B 120 ? 0.3653 0.7535 0.5864 -0.1916 0.1006  -0.0198 282 PHE B O   
2278 C CB  . PHE B 120 ? 0.3989 0.6352 0.4930 -0.2174 0.0838  0.0197  282 PHE B CB  
2279 C CG  . PHE B 120 ? 0.4415 0.6202 0.4925 -0.2416 0.0761  0.0446  282 PHE B CG  
2280 C CD1 . PHE B 120 ? 0.4526 0.5883 0.4500 -0.2320 0.0781  0.0532  282 PHE B CD1 
2281 C CD2 . PHE B 120 ? 0.4789 0.6458 0.5453 -0.2747 0.0645  0.0595  282 PHE B CD2 
2282 C CE1 . PHE B 120 ? 0.4967 0.5747 0.4571 -0.2488 0.0674  0.0769  282 PHE B CE1 
2283 C CE2 . PHE B 120 ? 0.5203 0.6209 0.5469 -0.2955 0.0537  0.0822  282 PHE B CE2 
2284 C CZ  . PHE B 120 ? 0.5419 0.5963 0.5156 -0.2798 0.0549  0.0915  282 PHE B CZ  
2285 N N   . GLY B 121 ? 0.3695 0.7552 0.5327 -0.1679 0.1335  -0.0360 283 GLY B N   
2286 C CA  . GLY B 121 ? 0.3532 0.7819 0.5673 -0.1339 0.1354  -0.0669 283 GLY B CA  
2287 C C   . GLY B 121 ? 0.3489 0.7312 0.5344 -0.1013 0.1292  -0.0869 283 GLY B C   
2288 O O   . GLY B 121 ? 0.3457 0.6693 0.4758 -0.1062 0.1225  -0.0760 283 GLY B O   
2289 N N   . PRO B 122 ? 0.3489 0.7565 0.5762 -0.0675 0.1290  -0.1167 284 PRO B N   
2290 C CA  . PRO B 122 ? 0.3632 0.7232 0.5688 -0.0385 0.1213  -0.1387 284 PRO B CA  
2291 C C   . PRO B 122 ? 0.3515 0.6307 0.5364 -0.0329 0.0878  -0.1242 284 PRO B C   
2292 O O   . PRO B 122 ? 0.3389 0.6080 0.5447 -0.0363 0.0665  -0.1076 284 PRO B O   
2293 C CB  . PRO B 122 ? 0.3786 0.7867 0.6463 -0.0025 0.1260  -0.1736 284 PRO B CB  
2294 C CG  . PRO B 122 ? 0.3713 0.8700 0.6927 -0.0145 0.1429  -0.1706 284 PRO B CG  
2295 C CD  . PRO B 122 ? 0.3470 0.8305 0.6502 -0.0543 0.1335  -0.1319 284 PRO B CD  
2296 N N   . LEU B 123 ? 0.3648 0.5931 0.5087 -0.0264 0.0833  -0.1316 285 LEU B N   
2297 C CA  . LEU B 123 ? 0.3624 0.5224 0.4833 -0.0262 0.0560  -0.1164 285 LEU B CA  
2298 C C   . LEU B 123 ? 0.3872 0.5125 0.5299 0.0011  0.0379  -0.1343 285 LEU B C   
2299 O O   . LEU B 123 ? 0.4162 0.5512 0.5700 0.0201  0.0484  -0.1653 285 LEU B O   
2300 C CB  . LEU B 123 ? 0.3639 0.4920 0.4268 -0.0430 0.0604  -0.1083 285 LEU B CB  
2301 C CG  . LEU B 123 ? 0.3564 0.5027 0.3903 -0.0670 0.0736  -0.0884 285 LEU B CG  
2302 C CD1 . LEU B 123 ? 0.3548 0.4869 0.3400 -0.0749 0.0802  -0.0892 285 LEU B CD1 
2303 C CD2 . LEU B 123 ? 0.3335 0.4560 0.3644 -0.0781 0.0568  -0.0634 285 LEU B CD2 
2304 N N   . LYS B 124 ? 0.3897 0.4711 0.5343 0.0028  0.0096  -0.1151 286 LYS B N   
2305 C CA  . LYS B 124 ? 0.4301 0.4583 0.5837 0.0226  -0.0130 -0.1231 286 LYS B CA  
2306 C C   . LYS B 124 ? 0.4375 0.4103 0.5411 0.0041  -0.0192 -0.1142 286 LYS B C   
2307 O O   . LYS B 124 ? 0.4811 0.4104 0.5829 0.0138  -0.0290 -0.1302 286 LYS B O   
2308 C CB  . LYS B 124 ? 0.4406 0.4540 0.6255 0.0351  -0.0434 -0.1046 286 LYS B CB  
2309 C CG  . LYS B 124 ? 0.4451 0.4346 0.5956 0.0109  -0.0599 -0.0684 286 LYS B CG  
2310 C CD  . LYS B 124 ? 0.4722 0.4459 0.6474 0.0243  -0.0940 -0.0501 286 LYS B CD  
2311 C CE  . LYS B 124 ? 0.4658 0.4984 0.6725 0.0233  -0.0964 -0.0452 286 LYS B CE  
2312 N NZ  . LYS B 124 ? 0.4907 0.5221 0.7310 0.0416  -0.1322 -0.0318 286 LYS B NZ  
2313 N N   . ALA B 125 ? 0.3992 0.3758 0.4656 -0.0221 -0.0135 -0.0917 287 ALA B N   
2314 C CA  . ALA B 125 ? 0.4022 0.3434 0.4280 -0.0415 -0.0180 -0.0819 287 ALA B CA  
2315 C C   . ALA B 125 ? 0.3604 0.3307 0.3542 -0.0594 0.0004  -0.0763 287 ALA B C   
2316 O O   . ALA B 125 ? 0.3234 0.3205 0.3157 -0.0642 0.0079  -0.0644 287 ALA B O   
2317 C CB  . ALA B 125 ? 0.4030 0.3080 0.4181 -0.0524 -0.0414 -0.0521 287 ALA B CB  
2318 N N   . PHE B 126 ? 0.3729 0.3339 0.3418 -0.0692 0.0039  -0.0847 288 PHE B N   
2319 C CA  . PHE B 126 ? 0.3505 0.3362 0.2897 -0.0831 0.0152  -0.0769 288 PHE B CA  
2320 C C   . PHE B 126 ? 0.3616 0.3340 0.2790 -0.0978 0.0081  -0.0783 288 PHE B C   
2321 O O   . PHE B 126 ? 0.3916 0.3428 0.3096 -0.0977 0.0025  -0.0984 288 PHE B O   
2322 C CB  . PHE B 126 ? 0.3460 0.3674 0.2801 -0.0783 0.0348  -0.0909 288 PHE B CB  
2323 C CG  . PHE B 126 ? 0.3456 0.3845 0.2465 -0.0900 0.0410  -0.0812 288 PHE B CG  
2324 C CD1 . PHE B 126 ? 0.3231 0.3724 0.2164 -0.0943 0.0437  -0.0593 288 PHE B CD1 
2325 C CD2 . PHE B 126 ? 0.3604 0.4013 0.2380 -0.0960 0.0395  -0.0943 288 PHE B CD2 
2326 C CE1 . PHE B 126 ? 0.3159 0.3757 0.1814 -0.1000 0.0447  -0.0487 288 PHE B CE1 
2327 C CE2 . PHE B 126 ? 0.3590 0.4191 0.2083 -0.1041 0.0402  -0.0826 288 PHE B CE2 
2328 C CZ  . PHE B 126 ? 0.3372 0.4058 0.1818 -0.1040 0.0426  -0.0587 288 PHE B CZ  
2329 N N   . ASN B 127 ? 0.3392 0.3264 0.2404 -0.1098 0.0075  -0.0597 289 ASN B N   
2330 C CA  . ASN B 127 ? 0.3481 0.3432 0.2343 -0.1253 0.0023  -0.0603 289 ASN B CA  
2331 C C   . ASN B 127 ? 0.3248 0.3568 0.1968 -0.1255 0.0082  -0.0484 289 ASN B C   
2332 O O   . ASN B 127 ? 0.3120 0.3513 0.1854 -0.1192 0.0114  -0.0339 289 ASN B O   
2333 C CB  . ASN B 127 ? 0.3590 0.3308 0.2511 -0.1427 -0.0118 -0.0490 289 ASN B CB  
2334 C CG  . ASN B 127 ? 0.3601 0.3461 0.2512 -0.1473 -0.0112 -0.0239 289 ASN B CG  
2335 O OD1 . ASN B 127 ? 0.3449 0.3225 0.2403 -0.1363 -0.0104 -0.0162 289 ASN B OD1 
2336 N ND2 . ASN B 127 ? 0.3490 0.3627 0.2351 -0.1642 -0.0118 -0.0133 289 ASN B ND2 
2337 N N   . LEU B 128 ? 0.3352 0.3878 0.1927 -0.1302 0.0070  -0.0564 290 LEU B N   
2338 C CA  . LEU B 128 ? 0.3231 0.4096 0.1710 -0.1275 0.0063  -0.0442 290 LEU B CA  
2339 C C   . LEU B 128 ? 0.3274 0.4371 0.1838 -0.1427 -0.0039 -0.0412 290 LEU B C   
2340 O O   . LEU B 128 ? 0.3524 0.4561 0.2094 -0.1596 -0.0123 -0.0534 290 LEU B O   
2341 C CB  . LEU B 128 ? 0.3369 0.4386 0.1614 -0.1227 0.0085  -0.0499 290 LEU B CB  
2342 C CG  . LEU B 128 ? 0.3374 0.4705 0.1504 -0.1172 0.0008  -0.0367 290 LEU B CG  
2343 C CD1 . LEU B 128 ? 0.3230 0.4523 0.1422 -0.1015 0.0034  -0.0183 290 LEU B CD1 
2344 C CD2 . LEU B 128 ? 0.3769 0.5210 0.1574 -0.1175 0.0000  -0.0407 290 LEU B CD2 
2345 N N   . VAL B 129 ? 0.3143 0.4528 0.1797 -0.1377 -0.0030 -0.0272 291 VAL B N   
2346 C CA  . VAL B 129 ? 0.3176 0.4946 0.1986 -0.1539 -0.0089 -0.0228 291 VAL B CA  
2347 C C   . VAL B 129 ? 0.3273 0.5504 0.2098 -0.1530 -0.0187 -0.0264 291 VAL B C   
2348 O O   . VAL B 129 ? 0.3166 0.5552 0.1924 -0.1306 -0.0197 -0.0220 291 VAL B O   
2349 C CB  . VAL B 129 ? 0.3017 0.5015 0.1938 -0.1477 -0.0008 -0.0104 291 VAL B CB  
2350 C CG1 . VAL B 129 ? 0.3003 0.5537 0.2123 -0.1688 -0.0027 -0.0051 291 VAL B CG1 
2351 C CG2 . VAL B 129 ? 0.2864 0.4428 0.1724 -0.1502 0.0041  -0.0051 291 VAL B CG2 
2352 N N   . LYS B 130 ? 0.3540 0.5955 0.2456 -0.1791 -0.0294 -0.0329 292 LYS B N   
2353 C CA  . LYS B 130 ? 0.3758 0.6624 0.2690 -0.1840 -0.0442 -0.0390 292 LYS B CA  
2354 C C   . LYS B 130 ? 0.3799 0.7248 0.3060 -0.2088 -0.0514 -0.0345 292 LYS B C   
2355 O O   . LYS B 130 ? 0.3800 0.7180 0.3200 -0.2306 -0.0450 -0.0273 292 LYS B O   
2356 C CB  . LYS B 130 ? 0.4127 0.6657 0.2815 -0.1982 -0.0538 -0.0591 292 LYS B CB  
2357 C CG  . LYS B 130 ? 0.4327 0.6404 0.2716 -0.1787 -0.0433 -0.0662 292 LYS B CG  
2358 C CD  . LYS B 130 ? 0.4706 0.6360 0.2936 -0.1924 -0.0463 -0.0921 292 LYS B CD  
2359 C CE  . LYS B 130 ? 0.4904 0.6211 0.2956 -0.1725 -0.0301 -0.0994 292 LYS B CE  
2360 N NZ  . LYS B 130 ? 0.5274 0.6081 0.3374 -0.1775 -0.0290 -0.1215 292 LYS B NZ  
2361 N N   . ASP B 131 ? 0.3931 0.7996 0.3323 -0.2076 -0.0658 -0.0363 293 ASP B N   
2362 C CA  . ASP B 131 ? 0.4021 0.8730 0.3771 -0.2393 -0.0757 -0.0354 293 ASP B CA  
2363 C C   . ASP B 131 ? 0.4405 0.8810 0.4029 -0.2767 -0.0934 -0.0516 293 ASP B C   
2364 O O   . ASP B 131 ? 0.4587 0.9003 0.4000 -0.2732 -0.1097 -0.0657 293 ASP B O   
2365 C CB  . ASP B 131 ? 0.3962 0.9570 0.4001 -0.2221 -0.0878 -0.0322 293 ASP B CB  
2366 C CG  . ASP B 131 ? 0.4232 1.0609 0.4695 -0.2617 -0.1002 -0.0332 293 ASP B CG  
2367 O OD1 . ASP B 131 ? 0.4505 1.1481 0.5125 -0.2630 -0.1229 -0.0387 293 ASP B OD1 
2368 O OD2 . ASP B 131 ? 0.4583 1.0960 0.5211 -0.2958 -0.0892 -0.0265 293 ASP B OD2 
2369 N N   . SER B 132 ? 0.4627 0.8752 0.4354 -0.3137 -0.0922 -0.0492 294 SER B N   
2370 C CA  . SER B 132 ? 0.5166 0.8863 0.4792 -0.3516 -0.1118 -0.0673 294 SER B CA  
2371 C C   . SER B 132 ? 0.5388 0.9756 0.5196 -0.3778 -0.1365 -0.0779 294 SER B C   
2372 O O   . SER B 132 ? 0.5838 0.9841 0.5444 -0.3993 -0.1567 -0.1019 294 SER B O   
2373 C CB  . SER B 132 ? 0.5451 0.8675 0.5182 -0.3885 -0.1094 -0.0552 294 SER B CB  
2374 O OG  . SER B 132 ? 0.5418 0.9393 0.5542 -0.4204 -0.1074 -0.0341 294 SER B OG  
2375 N N   . ALA B 133 ? 0.5091 1.0459 0.5295 -0.3748 -0.1363 -0.0633 295 ALA B N   
2376 C CA  . ALA B 133 ? 0.5325 1.1474 0.5770 -0.3961 -0.1627 -0.0722 295 ALA B CA  
2377 C C   . ALA B 133 ? 0.5342 1.1666 0.5510 -0.3599 -0.1784 -0.0837 295 ALA B C   
2378 O O   . ALA B 133 ? 0.5577 1.2491 0.5861 -0.3754 -0.2056 -0.0929 295 ALA B O   
2379 C CB  . ALA B 133 ? 0.5064 1.2360 0.6140 -0.4085 -0.1578 -0.0534 295 ALA B CB  
2380 N N   . THR B 134 ? 0.5127 1.0977 0.4926 -0.3153 -0.1635 -0.0804 296 THR B N   
2381 C CA  . THR B 134 ? 0.5273 1.1169 0.4694 -0.2857 -0.1780 -0.0858 296 THR B CA  
2382 C C   . THR B 134 ? 0.5453 1.0451 0.4270 -0.2710 -0.1661 -0.0979 296 THR B C   
2383 O O   . THR B 134 ? 0.5862 1.0762 0.4247 -0.2710 -0.1806 -0.1135 296 THR B O   
2384 C CB  . THR B 134 ? 0.4947 1.1429 0.4576 -0.2405 -0.1769 -0.0633 296 THR B CB  
2385 O OG1 . THR B 134 ? 0.4608 1.0609 0.4160 -0.2102 -0.1489 -0.0506 296 THR B OG1 
2386 C CG2 . THR B 134 ? 0.4752 1.2279 0.5061 -0.2485 -0.1855 -0.0551 296 THR B CG2 
2387 N N   . GLY B 135 ? 0.5208 0.9633 0.4000 -0.2594 -0.1397 -0.0915 297 GLY B N   
2388 C CA  . GLY B 135 ? 0.5324 0.9037 0.3661 -0.2428 -0.1251 -0.1014 297 GLY B CA  
2389 C C   . GLY B 135 ? 0.5058 0.8739 0.3271 -0.2039 -0.1102 -0.0800 297 GLY B C   
2390 O O   . GLY B 135 ? 0.5165 0.8402 0.3023 -0.1908 -0.0974 -0.0842 297 GLY B O   
2391 N N   . LEU B 136 ? 0.4765 0.8924 0.3297 -0.1861 -0.1119 -0.0587 298 LEU B N   
2392 C CA  . LEU B 136 ? 0.4583 0.8703 0.3011 -0.1491 -0.1063 -0.0385 298 LEU B CA  
2393 C C   . LEU B 136 ? 0.4215 0.7976 0.2793 -0.1361 -0.0824 -0.0303 298 LEU B C   
2394 O O   . LEU B 136 ? 0.3981 0.7905 0.2895 -0.1463 -0.0745 -0.0305 298 LEU B O   
2395 C CB  . LEU B 136 ? 0.4638 0.9457 0.3337 -0.1302 -0.1266 -0.0248 298 LEU B CB  
2396 C CG  . LEU B 136 ? 0.4623 0.9440 0.3407 -0.0879 -0.1252 -0.0040 298 LEU B CG  
2397 C CD1 . LEU B 136 ? 0.4832 0.8927 0.3151 -0.0739 -0.1146 0.0071  298 LEU B CD1 
2398 C CD2 . LEU B 136 ? 0.4862 1.0330 0.3814 -0.0669 -0.1554 0.0068  298 LEU B CD2 
2399 N N   . SER B 137 ? 0.4153 0.7450 0.2451 -0.1174 -0.0716 -0.0222 299 SER B N   
2400 C CA  . SER B 137 ? 0.3825 0.6760 0.2212 -0.1046 -0.0528 -0.0153 299 SER B CA  
2401 C C   . SER B 137 ? 0.3590 0.6862 0.2311 -0.0836 -0.0533 -0.0061 299 SER B C   
2402 O O   . SER B 137 ? 0.3675 0.7266 0.2465 -0.0622 -0.0678 0.0023  299 SER B O   
2403 C CB  . SER B 137 ? 0.3951 0.6435 0.1997 -0.0914 -0.0459 -0.0058 299 SER B CB  
2404 O OG  . SER B 137 ? 0.3749 0.5942 0.1894 -0.0753 -0.0350 0.0035  299 SER B OG  
2405 N N   . LYS B 138 ? 0.3342 0.6547 0.2249 -0.0877 -0.0382 -0.0087 300 LYS B N   
2406 C CA  . LYS B 138 ? 0.3210 0.6701 0.2369 -0.0649 -0.0327 -0.0058 300 LYS B CA  
2407 C C   . LYS B 138 ? 0.3254 0.6224 0.2241 -0.0380 -0.0279 -0.0007 300 LYS B C   
2408 O O   . LYS B 138 ? 0.3229 0.6302 0.2359 -0.0143 -0.0242 -0.0034 300 LYS B O   
2409 C CB  . LYS B 138 ? 0.3034 0.6735 0.2387 -0.0852 -0.0186 -0.0096 300 LYS B CB  
2410 C CG  . LYS B 138 ? 0.3010 0.7203 0.2571 -0.1183 -0.0247 -0.0118 300 LYS B CG  
2411 C CD  . LYS B 138 ? 0.2903 0.7423 0.2664 -0.1385 -0.0105 -0.0083 300 LYS B CD  
2412 C CE  . LYS B 138 ? 0.2989 0.7910 0.2955 -0.1809 -0.0178 -0.0066 300 LYS B CE  
2413 N NZ  . LYS B 138 ? 0.2830 0.8140 0.2969 -0.2069 -0.0032 0.0033  300 LYS B NZ  
2414 N N   . GLY B 139 ? 0.3311 0.5746 0.1997 -0.0432 -0.0276 0.0046  301 GLY B N   
2415 C CA  . GLY B 139 ? 0.3542 0.5479 0.2070 -0.0246 -0.0267 0.0128  301 GLY B CA  
2416 C C   . GLY B 139 ? 0.3398 0.4944 0.1906 -0.0300 -0.0127 0.0081  301 GLY B C   
2417 O O   . GLY B 139 ? 0.3491 0.4625 0.1899 -0.0181 -0.0139 0.0131  301 GLY B O   
2418 N N   . TYR B 140 ? 0.3223 0.4862 0.1816 -0.0496 -0.0030 0.0001  302 TYR B N   
2419 C CA  . TYR B 140 ? 0.3240 0.4522 0.1794 -0.0569 0.0060  -0.0021 302 TYR B CA  
2420 C C   . TYR B 140 ? 0.3204 0.4381 0.1760 -0.0798 0.0102  -0.0054 302 TYR B C   
2421 O O   . TYR B 140 ? 0.3190 0.4558 0.1780 -0.0933 0.0072  -0.0092 302 TYR B O   
2422 C CB  . TYR B 140 ? 0.3207 0.4623 0.1846 -0.0490 0.0108  -0.0077 302 TYR B CB  
2423 C CG  . TYR B 140 ? 0.3179 0.5134 0.1974 -0.0589 0.0144  -0.0098 302 TYR B CG  
2424 C CD1 . TYR B 140 ? 0.3072 0.5036 0.1875 -0.0848 0.0187  -0.0064 302 TYR B CD1 
2425 C CD2 . TYR B 140 ? 0.3243 0.5717 0.2206 -0.0435 0.0119  -0.0131 302 TYR B CD2 
2426 C CE1 . TYR B 140 ? 0.3106 0.5559 0.2045 -0.1020 0.0219  -0.0035 302 TYR B CE1 
2427 C CE2 . TYR B 140 ? 0.3187 0.6282 0.2350 -0.0581 0.0170  -0.0138 302 TYR B CE2 
2428 C CZ  . TYR B 140 ? 0.3098 0.6166 0.2230 -0.0908 0.0227  -0.0076 302 TYR B CZ  
2429 O OH  . TYR B 140 ? 0.3146 0.6813 0.2464 -0.1124 0.0277  -0.0036 302 TYR B OH  
2430 N N   . ALA B 141 ? 0.3195 0.4051 0.1735 -0.0828 0.0146  -0.0056 303 ALA B N   
2431 C CA  . ALA B 141 ? 0.3215 0.3917 0.1808 -0.0964 0.0165  -0.0106 303 ALA B CA  
2432 C C   . ALA B 141 ? 0.3170 0.3669 0.1832 -0.0973 0.0164  -0.0086 303 ALA B C   
2433 O O   . ALA B 141 ? 0.3202 0.3659 0.1823 -0.0896 0.0158  -0.0057 303 ALA B O   
2434 C CB  . ALA B 141 ? 0.3226 0.3851 0.1749 -0.0969 0.0208  -0.0150 303 ALA B CB  
2435 N N   . PHE B 142 ? 0.3244 0.3595 0.2005 -0.1048 0.0140  -0.0118 304 PHE B N   
2436 C CA  . PHE B 142 ? 0.3275 0.3448 0.2123 -0.1040 0.0091  -0.0082 304 PHE B CA  
2437 C C   . PHE B 142 ? 0.3330 0.3391 0.2363 -0.1000 0.0096  -0.0170 304 PHE B C   
2438 O O   . PHE B 142 ? 0.3469 0.3526 0.2536 -0.1002 0.0127  -0.0283 304 PHE B O   
2439 C CB  . PHE B 142 ? 0.3326 0.3443 0.2145 -0.1145 0.0008  0.0012  304 PHE B CB  
2440 C CG  . PHE B 142 ? 0.3352 0.3732 0.2027 -0.1193 0.0046  0.0077  304 PHE B CG  
2441 C CD1 . PHE B 142 ? 0.3318 0.3767 0.1863 -0.1165 0.0043  0.0124  304 PHE B CD1 
2442 C CD2 . PHE B 142 ? 0.3514 0.4149 0.2197 -0.1263 0.0082  0.0063  304 PHE B CD2 
2443 C CE1 . PHE B 142 ? 0.3397 0.4196 0.1824 -0.1176 0.0114  0.0136  304 PHE B CE1 
2444 C CE2 . PHE B 142 ? 0.3402 0.4433 0.2035 -0.1285 0.0137  0.0104  304 PHE B CE2 
2445 C CZ  . PHE B 142 ? 0.3295 0.4421 0.1803 -0.1225 0.0172  0.0128  304 PHE B CZ  
2446 N N   . CYS B 143 ? 0.3294 0.3319 0.2464 -0.0955 0.0061  -0.0150 305 CYS B N   
2447 C CA  . CYS B 143 ? 0.3416 0.3461 0.2864 -0.0885 0.0065  -0.0248 305 CYS B CA  
2448 C C   . CYS B 143 ? 0.3412 0.3432 0.3067 -0.0845 -0.0067 -0.0190 305 CYS B C   
2449 O O   . CYS B 143 ? 0.3390 0.3376 0.2910 -0.0897 -0.0144 -0.0088 305 CYS B O   
2450 C CB  . CYS B 143 ? 0.3405 0.3682 0.2891 -0.0884 0.0225  -0.0321 305 CYS B CB  
2451 S SG  . CYS B 143 ? 0.3610 0.3963 0.3131 -0.0957 0.0229  -0.0211 305 CYS B SG  
2452 N N   . GLU B 144 ? 0.3451 0.3517 0.3437 -0.0731 -0.0106 -0.0285 306 GLU B N   
2453 C CA  . GLU B 144 ? 0.3469 0.3645 0.3757 -0.0666 -0.0243 -0.0250 306 GLU B CA  
2454 C C   . GLU B 144 ? 0.3322 0.3863 0.4049 -0.0549 -0.0137 -0.0423 306 GLU B C   
2455 O O   . GLU B 144 ? 0.3401 0.3954 0.4243 -0.0423 -0.0054 -0.0594 306 GLU B O   
2456 C CB  . GLU B 144 ? 0.3715 0.3593 0.4019 -0.0602 -0.0492 -0.0134 306 GLU B CB  
2457 C CG  . GLU B 144 ? 0.3922 0.3944 0.4480 -0.0545 -0.0697 -0.0058 306 GLU B CG  
2458 C CD  . GLU B 144 ? 0.4487 0.4185 0.4963 -0.0502 -0.0991 0.0136  306 GLU B CD  
2459 O OE1 . GLU B 144 ? 0.5102 0.4489 0.5179 -0.0627 -0.1020 0.0283  306 GLU B OE1 
2460 O OE2 . GLU B 144 ? 0.5045 0.4841 0.5868 -0.0357 -0.1207 0.0165  306 GLU B OE2 
2461 N N   . TYR B 145 ? 0.3182 0.4058 0.4160 -0.0601 -0.0139 -0.0401 307 TYR B N   
2462 C CA  . TYR B 145 ? 0.3125 0.4524 0.4578 -0.0529 -0.0003 -0.0552 307 TYR B CA  
2463 C C   . TYR B 145 ? 0.3292 0.4809 0.5238 -0.0270 -0.0181 -0.0644 307 TYR B C   
2464 O O   . TYR B 145 ? 0.3415 0.4667 0.5355 -0.0221 -0.0459 -0.0508 307 TYR B O   
2465 C CB  . TYR B 145 ? 0.2935 0.4687 0.4517 -0.0749 0.0051  -0.0468 307 TYR B CB  
2466 C CG  . TYR B 145 ? 0.2780 0.4447 0.3968 -0.0965 0.0243  -0.0392 307 TYR B CG  
2467 C CD1 . TYR B 145 ? 0.2825 0.4840 0.4035 -0.1018 0.0510  -0.0461 307 TYR B CD1 
2468 C CD2 . TYR B 145 ? 0.2728 0.3974 0.3500 -0.1092 0.0149  -0.0254 307 TYR B CD2 
2469 C CE1 . TYR B 145 ? 0.2848 0.4736 0.3652 -0.1215 0.0641  -0.0333 307 TYR B CE1 
2470 C CE2 . TYR B 145 ? 0.2923 0.4027 0.3357 -0.1239 0.0278  -0.0169 307 TYR B CE2 
2471 C CZ  . TYR B 145 ? 0.2866 0.4265 0.3311 -0.1309 0.0504  -0.0180 307 TYR B CZ  
2472 O OH  . TYR B 145 ? 0.3068 0.4278 0.3142 -0.1451 0.0581  -0.0041 307 TYR B OH  
2473 N N   . VAL B 146 ? 0.3388 0.5324 0.5746 -0.0085 -0.0026 -0.0878 308 VAL B N   
2474 C CA  . VAL B 146 ? 0.3545 0.5688 0.6494 0.0234  -0.0189 -0.1013 308 VAL B CA  
2475 C C   . VAL B 146 ? 0.3489 0.5931 0.6783 0.0181  -0.0419 -0.0853 308 VAL B C   
2476 O O   . VAL B 146 ? 0.3721 0.5888 0.7123 0.0338  -0.0746 -0.0747 308 VAL B O   
2477 C CB  . VAL B 146 ? 0.3608 0.6408 0.7018 0.0425  0.0082  -0.1335 308 VAL B CB  
2478 C CG1 . VAL B 146 ? 0.3760 0.6968 0.7941 0.0782  -0.0101 -0.1475 308 VAL B CG1 
2479 C CG2 . VAL B 146 ? 0.3764 0.6230 0.6851 0.0546  0.0242  -0.1569 308 VAL B CG2 
2480 N N   . ASP B 147 ? 0.3315 0.6291 0.6749 -0.0069 -0.0273 -0.0815 309 ASP B N   
2481 C CA  . ASP B 147 ? 0.3327 0.6653 0.7105 -0.0185 -0.0498 -0.0693 309 ASP B CA  
2482 C C   . ASP B 147 ? 0.3316 0.6148 0.6508 -0.0487 -0.0637 -0.0474 309 ASP B C   
2483 O O   . ASP B 147 ? 0.3251 0.6089 0.6193 -0.0777 -0.0469 -0.0425 309 ASP B O   
2484 C CB  . ASP B 147 ? 0.3203 0.7431 0.7531 -0.0335 -0.0274 -0.0788 309 ASP B CB  
2485 C CG  . ASP B 147 ? 0.3246 0.7919 0.8012 -0.0495 -0.0527 -0.0687 309 ASP B CG  
2486 O OD1 . ASP B 147 ? 0.3423 0.8938 0.8762 -0.0633 -0.0378 -0.0753 309 ASP B OD1 
2487 O OD2 . ASP B 147 ? 0.3446 0.7691 0.7983 -0.0510 -0.0875 -0.0545 309 ASP B OD2 
2488 N N   . ILE B 148 ? 0.3513 0.5920 0.6477 -0.0414 -0.0953 -0.0344 310 ILE B N   
2489 C CA  . ILE B 148 ? 0.3631 0.5576 0.5969 -0.0650 -0.1050 -0.0196 310 ILE B CA  
2490 C C   . ILE B 148 ? 0.3626 0.5808 0.6001 -0.0948 -0.1085 -0.0184 310 ILE B C   
2491 O O   . ILE B 148 ? 0.3740 0.5530 0.5594 -0.1132 -0.1091 -0.0137 310 ILE B O   
2492 C CB  . ILE B 148 ? 0.3915 0.5452 0.5951 -0.0550 -0.1374 -0.0043 310 ILE B CB  
2493 C CG1 . ILE B 148 ? 0.4174 0.6075 0.6685 -0.0442 -0.1719 0.0002  310 ILE B CG1 
2494 C CG2 . ILE B 148 ? 0.4104 0.5205 0.5953 -0.0358 -0.1326 -0.0017 310 ILE B CG2 
2495 C CD1 . ILE B 148 ? 0.4512 0.6076 0.6963 -0.0199 -0.2028 0.0161  310 ILE B CD1 
2496 N N   . ASN B 149 ? 0.3624 0.6454 0.6639 -0.0998 -0.1106 -0.0245 311 ASN B N   
2497 C CA  . ASN B 149 ? 0.3720 0.6779 0.6836 -0.1348 -0.1156 -0.0230 311 ASN B CA  
2498 C C   . ASN B 149 ? 0.3700 0.6617 0.6568 -0.1615 -0.0848 -0.0217 311 ASN B C   
2499 O O   . ASN B 149 ? 0.3973 0.6766 0.6724 -0.1931 -0.0918 -0.0180 311 ASN B O   
2500 C CB  . ASN B 149 ? 0.3721 0.7639 0.7680 -0.1365 -0.1265 -0.0283 311 ASN B CB  
2501 C CG  . ASN B 149 ? 0.3898 0.7950 0.8117 -0.1102 -0.1657 -0.0259 311 ASN B CG  
2502 O OD1 . ASN B 149 ? 0.3976 0.7763 0.7882 -0.1205 -0.1980 -0.0185 311 ASN B OD1 
2503 N ND2 . ASN B 149 ? 0.3985 0.8428 0.8750 -0.0743 -0.1646 -0.0330 311 ASN B ND2 
2504 N N   . VAL B 150 ? 0.3486 0.6387 0.6260 -0.1494 -0.0544 -0.0245 312 VAL B N   
2505 C CA  . VAL B 150 ? 0.3495 0.6230 0.5959 -0.1713 -0.0271 -0.0186 312 VAL B CA  
2506 C C   . VAL B 150 ? 0.3610 0.5546 0.5356 -0.1745 -0.0329 -0.0121 312 VAL B C   
2507 O O   . VAL B 150 ? 0.3766 0.5432 0.5229 -0.1949 -0.0221 -0.0039 312 VAL B O   
2508 C CB  . VAL B 150 ? 0.3359 0.6389 0.5899 -0.1548 0.0055  -0.0265 312 VAL B CB  
2509 C CG1 . VAL B 150 ? 0.3436 0.5990 0.5367 -0.1626 0.0234  -0.0185 312 VAL B CG1 
2510 C CG2 . VAL B 150 ? 0.3245 0.7141 0.6386 -0.1665 0.0259  -0.0315 312 VAL B CG2 
2511 N N   . THR B 151 ? 0.3545 0.5135 0.5017 -0.1540 -0.0502 -0.0144 313 THR B N   
2512 C CA  . THR B 151 ? 0.3598 0.4591 0.4448 -0.1499 -0.0510 -0.0120 313 THR B CA  
2513 C C   . THR B 151 ? 0.3843 0.4466 0.4392 -0.1710 -0.0549 -0.0103 313 THR B C   
2514 O O   . THR B 151 ? 0.3837 0.4136 0.4053 -0.1704 -0.0420 -0.0069 313 THR B O   
2515 C CB  . THR B 151 ? 0.3636 0.4436 0.4266 -0.1342 -0.0726 -0.0120 313 THR B CB  
2516 O OG1 . THR B 151 ? 0.3470 0.4410 0.4302 -0.1134 -0.0706 -0.0110 313 THR B OG1 
2517 C CG2 . THR B 151 ? 0.3655 0.4008 0.3701 -0.1313 -0.0699 -0.0118 313 THR B CG2 
2518 N N   . ASP B 152 ? 0.4051 0.4706 0.4737 -0.1886 -0.0759 -0.0137 314 ASP B N   
2519 C CA  . ASP B 152 ? 0.4479 0.4664 0.4877 -0.2083 -0.0863 -0.0170 314 ASP B CA  
2520 C C   . ASP B 152 ? 0.4635 0.4741 0.5143 -0.2344 -0.0729 -0.0057 314 ASP B C   
2521 O O   . ASP B 152 ? 0.4905 0.4430 0.5055 -0.2406 -0.0753 -0.0043 314 ASP B O   
2522 C CB  . ASP B 152 ? 0.4770 0.4993 0.5246 -0.2215 -0.1169 -0.0272 314 ASP B CB  
2523 C CG  . ASP B 152 ? 0.4908 0.4944 0.4961 -0.2007 -0.1319 -0.0368 314 ASP B CG  
2524 O OD1 . ASP B 152 ? 0.5269 0.4818 0.4827 -0.1950 -0.1317 -0.0471 314 ASP B OD1 
2525 O OD2 . ASP B 152 ? 0.4546 0.4928 0.4756 -0.1892 -0.1434 -0.0332 314 ASP B OD2 
2526 N N   . GLN B 153 ? 0.4469 0.5172 0.5470 -0.2486 -0.0596 0.0028  315 GLN B N   
2527 C CA  . GLN B 153 ? 0.4625 0.5422 0.5709 -0.2741 -0.0387 0.0197  315 GLN B CA  
2528 C C   . GLN B 153 ? 0.4580 0.5046 0.5222 -0.2579 -0.0190 0.0283  315 GLN B C   
2529 O O   . GLN B 153 ? 0.4915 0.5093 0.5356 -0.2779 -0.0122 0.0454  315 GLN B O   
2530 C CB  . GLN B 153 ? 0.4374 0.6085 0.6075 -0.2835 -0.0207 0.0224  315 GLN B CB  
2531 C CG  . GLN B 153 ? 0.4739 0.6855 0.6916 -0.3269 -0.0276 0.0300  315 GLN B CG  
2532 C CD  . GLN B 153 ? 0.4643 0.7352 0.7395 -0.3238 -0.0487 0.0161  315 GLN B CD  
2533 O OE1 . GLN B 153 ? 0.4867 0.7654 0.7868 -0.3565 -0.0697 0.0170  315 GLN B OE1 
2534 N NE2 . GLN B 153 ? 0.4468 0.7577 0.7442 -0.2852 -0.0461 0.0039  315 GLN B NE2 
2535 N N   . ALA B 154 ? 0.4238 0.4744 0.4731 -0.2242 -0.0126 0.0188  316 ALA B N   
2536 C CA  . ALA B 154 ? 0.4184 0.4471 0.4301 -0.2093 0.0029  0.0249  316 ALA B CA  
2537 C C   . ALA B 154 ? 0.4409 0.4013 0.4067 -0.1989 -0.0108 0.0245  316 ALA B C   
2538 O O   . ALA B 154 ? 0.4654 0.3971 0.4032 -0.1983 -0.0051 0.0365  316 ALA B O   
2539 C CB  . ALA B 154 ? 0.3810 0.4406 0.3987 -0.1823 0.0133  0.0138  316 ALA B CB  
2540 N N   . ILE B 155 ? 0.4372 0.3763 0.3952 -0.1887 -0.0293 0.0099  317 ILE B N   
2541 C CA  . ILE B 155 ? 0.4672 0.3493 0.3863 -0.1760 -0.0417 0.0021  317 ILE B CA  
2542 C C   . ILE B 155 ? 0.5261 0.3556 0.4361 -0.1970 -0.0528 0.0098  317 ILE B C   
2543 O O   . ILE B 155 ? 0.5660 0.3482 0.4478 -0.1858 -0.0553 0.0141  317 ILE B O   
2544 C CB  . ILE B 155 ? 0.4652 0.3437 0.3750 -0.1657 -0.0585 -0.0177 317 ILE B CB  
2545 C CG1 . ILE B 155 ? 0.4197 0.3355 0.3298 -0.1463 -0.0505 -0.0197 317 ILE B CG1 
2546 C CG2 . ILE B 155 ? 0.5057 0.3295 0.3777 -0.1529 -0.0703 -0.0330 317 ILE B CG2 
2547 C CD1 . ILE B 155 ? 0.4391 0.3609 0.3384 -0.1419 -0.0669 -0.0314 317 ILE B CD1 
2548 N N   . ALA B 156 ? 0.5401 0.3765 0.4767 -0.2278 -0.0625 0.0120  318 ALA B N   
2549 C CA  . ALA B 156 ? 0.6013 0.3844 0.5333 -0.2573 -0.0756 0.0225  318 ALA B CA  
2550 C C   . ALA B 156 ? 0.6182 0.3884 0.5387 -0.2673 -0.0605 0.0519  318 ALA B C   
2551 O O   . ALA B 156 ? 0.6750 0.3746 0.5677 -0.2692 -0.0725 0.0617  318 ALA B O   
2552 C CB  . ALA B 156 ? 0.6044 0.4193 0.5773 -0.2951 -0.0851 0.0235  318 ALA B CB  
2553 N N   . GLY B 157 ? 0.5775 0.4144 0.5165 -0.2712 -0.0359 0.0648  319 GLY B N   
2554 C CA  . GLY B 157 ? 0.5982 0.4360 0.5201 -0.2829 -0.0198 0.0932  319 GLY B CA  
2555 C C   . GLY B 157 ? 0.5960 0.4020 0.4774 -0.2504 -0.0187 0.0969  319 GLY B C   
2556 O O   . GLY B 157 ? 0.6393 0.4058 0.4935 -0.2591 -0.0219 0.1219  319 GLY B O   
2557 N N   . LEU B 158 ? 0.5526 0.3774 0.4309 -0.2149 -0.0163 0.0746  320 LEU B N   
2558 C CA  . LEU B 158 ? 0.5526 0.3705 0.4023 -0.1862 -0.0128 0.0771  320 LEU B CA  
2559 C C   . LEU B 158 ? 0.5802 0.3454 0.4094 -0.1562 -0.0313 0.0639  320 LEU B C   
2560 O O   . LEU B 158 ? 0.6072 0.3516 0.4145 -0.1379 -0.0355 0.0739  320 LEU B O   
2561 C CB  . LEU B 158 ? 0.4917 0.3723 0.3524 -0.1702 0.0045  0.0637  320 LEU B CB  
2562 C CG  . LEU B 158 ? 0.4832 0.4207 0.3574 -0.1877 0.0266  0.0717  320 LEU B CG  
2563 C CD1 . LEU B 158 ? 0.4096 0.3907 0.2934 -0.1674 0.0375  0.0523  320 LEU B CD1 
2564 C CD2 . LEU B 158 ? 0.5096 0.4406 0.3533 -0.2030 0.0338  0.0995  320 LEU B CD2 
2565 N N   . ASN B 159 ? 0.5794 0.3289 0.4155 -0.1490 -0.0426 0.0402  321 ASN B N   
2566 C CA  . ASN B 159 ? 0.6058 0.3156 0.4231 -0.1177 -0.0564 0.0210  321 ASN B CA  
2567 C C   . ASN B 159 ? 0.6844 0.3198 0.4836 -0.1160 -0.0738 0.0346  321 ASN B C   
2568 O O   . ASN B 159 ? 0.7359 0.3247 0.5360 -0.1437 -0.0861 0.0440  321 ASN B O   
2569 C CB  . ASN B 159 ? 0.6075 0.3116 0.4271 -0.1154 -0.0662 -0.0078 321 ASN B CB  
2570 C CG  . ASN B 159 ? 0.6212 0.3078 0.4206 -0.0784 -0.0726 -0.0345 321 ASN B CG  
2571 O OD1 . ASN B 159 ? 0.6289 0.3320 0.4233 -0.0525 -0.0655 -0.0328 321 ASN B OD1 
2572 N ND2 . ASN B 159 ? 0.6326 0.2941 0.4217 -0.0761 -0.0856 -0.0612 321 ASN B ND2 
2573 N N   . GLY B 160 ? 0.7049 0.3289 0.4898 -0.0844 -0.0773 0.0375  322 GLY B N   
2574 C CA  . GLY B 160 ? 0.7925 0.3387 0.5601 -0.0738 -0.0991 0.0512  322 GLY B CA  
2575 C C   . GLY B 160 ? 0.8233 0.3591 0.5780 -0.0957 -0.0990 0.0950  322 GLY B C   
2576 O O   . GLY B 160 ? 0.8972 0.3622 0.6342 -0.0904 -0.1202 0.1154  322 GLY B O   
2577 N N   . MET B 161 ? 0.7740 0.3782 0.5343 -0.1185 -0.0763 0.1094  323 MET B N   
2578 C CA  . MET B 161 ? 0.8087 0.4149 0.5498 -0.1426 -0.0722 0.1493  323 MET B CA  
2579 C C   . MET B 161 ? 0.8371 0.4301 0.5553 -0.1103 -0.0853 0.1635  323 MET B C   
2580 O O   . MET B 161 ? 0.7859 0.4218 0.5118 -0.0776 -0.0815 0.1428  323 MET B O   
2581 C CB  . MET B 161 ? 0.7459 0.4361 0.4974 -0.1666 -0.0431 0.1518  323 MET B CB  
2582 C CG  . MET B 161 ? 0.7933 0.4919 0.5221 -0.2015 -0.0344 0.1915  323 MET B CG  
2583 S SD  . MET B 161 ? 0.7518 0.5556 0.4902 -0.2202 0.0022  0.1857  323 MET B SD  
2584 C CE  . MET B 161 ? 0.8058 0.6094 0.5038 -0.2609 0.0094  0.2358  323 MET B CE  
2585 N N   . GLN B 162 ? 0.9241 0.4577 0.6152 -0.1217 -0.1032 0.2014  324 GLN B N   
2586 C CA  . GLN B 162 ? 0.9608 0.4783 0.6291 -0.0919 -0.1218 0.2213  324 GLN B CA  
2587 C C   . GLN B 162 ? 0.9206 0.5162 0.5711 -0.1067 -0.1022 0.2379  324 GLN B C   
2588 O O   . GLN B 162 ? 0.9454 0.5508 0.5732 -0.1471 -0.0909 0.2685  324 GLN B O   
2589 C CB  . GLN B 162 ? 1.0826 0.4976 0.7244 -0.1004 -0.1527 0.2604  324 GLN B CB  
2590 C CG  . GLN B 162 ? 1.1531 0.5388 0.7715 -0.0643 -0.1811 0.2860  324 GLN B CG  
2591 C CD  . GLN B 162 ? 1.1596 0.5444 0.8057 -0.0010 -0.1967 0.2474  324 GLN B CD  
2592 O OE1 . GLN B 162 ? 1.2403 0.5406 0.8899 0.0288  -0.2261 0.2436  324 GLN B OE1 
2593 N NE2 . GLN B 162 ? 1.0758 0.5556 0.7431 0.0188  -0.1768 0.2175  324 GLN B NE2 
2594 N N   . LEU B 163 ? 0.8613 0.5164 0.5220 -0.0761 -0.0974 0.2153  325 LEU B N   
2595 C CA  . LEU B 163 ? 0.8292 0.5555 0.4717 -0.0867 -0.0825 0.2227  325 LEU B CA  
2596 C C   . LEU B 163 ? 0.8763 0.5974 0.4958 -0.0596 -0.1085 0.2434  325 LEU B C   
2597 O O   . LEU B 163 ? 0.8416 0.5996 0.4808 -0.0260 -0.1156 0.2213  325 LEU B O   
2598 C CB  . LEU B 163 ? 0.7377 0.5350 0.4102 -0.0799 -0.0600 0.1819  325 LEU B CB  
2599 C CG  . LEU B 163 ? 0.6949 0.5516 0.3610 -0.1097 -0.0321 0.1771  325 LEU B CG  
2600 C CD1 . LEU B 163 ? 0.7282 0.5680 0.3813 -0.1484 -0.0203 0.2013  325 LEU B CD1 
2601 C CD2 . LEU B 163 ? 0.6161 0.5129 0.3191 -0.1038 -0.0153 0.1382  325 LEU B CD2 
2602 N N   . GLY B 164 ? 0.9612 0.6387 0.5398 -0.0767 -0.1242 0.2890  326 GLY B N   
2603 C CA  . GLY B 164 ? 1.0266 0.6834 0.5798 -0.0508 -0.1572 0.3177  326 GLY B CA  
2604 C C   . GLY B 164 ? 1.0459 0.6568 0.6326 0.0005  -0.1853 0.3010  326 GLY B C   
2605 O O   . GLY B 164 ? 1.1067 0.6318 0.6975 0.0069  -0.2023 0.3089  326 GLY B O   
2606 N N   . ASP B 165 ? 0.9964 0.6702 0.6102 0.0360  -0.1882 0.2732  327 ASP B N   
2607 C CA  . ASP B 165 ? 1.0167 0.6744 0.6645 0.0910  -0.2140 0.2565  327 ASP B CA  
2608 C C   . ASP B 165 ? 0.9644 0.6244 0.6573 0.1095  -0.1973 0.2074  327 ASP B C   
2609 O O   . ASP B 165 ? 0.9861 0.6305 0.7084 0.1562  -0.2140 0.1868  327 ASP B O   
2610 C CB  . ASP B 165 ? 0.9859 0.7299 0.6440 0.1135  -0.2230 0.2514  327 ASP B CB  
2611 C CG  . ASP B 165 ? 1.0359 0.7712 0.7230 0.1715  -0.2580 0.2494  327 ASP B CG  
2612 O OD1 . ASP B 165 ? 1.0459 0.8509 0.7432 0.1898  -0.2724 0.2510  327 ASP B OD1 
2613 O OD2 . ASP B 165 ? 1.0988 0.7599 0.8008 0.2001  -0.2730 0.2438  327 ASP B OD2 
2614 N N   . LYS B 166 ? 0.9015 0.5838 0.5987 0.0751  -0.1653 0.1883  328 LYS B N   
2615 C CA  . LYS B 166 ? 0.8493 0.5527 0.5823 0.0885  -0.1482 0.1435  328 LYS B CA  
2616 C C   . LYS B 166 ? 0.8414 0.5053 0.5704 0.0549  -0.1320 0.1357  328 LYS B C   
2617 O O   . LYS B 166 ? 0.8578 0.5022 0.5639 0.0147  -0.1252 0.1616  328 LYS B O   
2618 C CB  . LYS B 166 ? 0.7628 0.5660 0.5167 0.0864  -0.1265 0.1201  328 LYS B CB  
2619 C CG  . LYS B 166 ? 0.7689 0.6285 0.5318 0.1122  -0.1424 0.1261  328 LYS B CG  
2620 C CD  . LYS B 166 ? 0.6930 0.6420 0.4919 0.1198  -0.1257 0.0936  328 LYS B CD  
2621 C CE  . LYS B 166 ? 0.6981 0.7154 0.5064 0.1318  -0.1408 0.1013  328 LYS B CE  
2622 N NZ  . LYS B 166 ? 0.7582 0.7618 0.5768 0.1770  -0.1749 0.1151  328 LYS B NZ  
2623 N N   . LYS B 167 ? 0.8207 0.4829 0.5728 0.0710  -0.1254 0.0988  329 LYS B N   
2624 C CA  . LYS B 167 ? 0.8107 0.4420 0.5632 0.0434  -0.1145 0.0856  329 LYS B CA  
2625 C C   . LYS B 167 ? 0.7200 0.4246 0.4902 0.0321  -0.0878 0.0588  329 LYS B C   
2626 O O   . LYS B 167 ? 0.6894 0.4379 0.4762 0.0585  -0.0822 0.0323  329 LYS B O   
2627 C CB  . LYS B 167 ? 0.8814 0.4397 0.6374 0.0708  -0.1338 0.0635  329 LYS B CB  
2628 C CG  . LYS B 167 ? 0.9068 0.4133 0.6576 0.0391  -0.1333 0.0551  329 LYS B CG  
2629 C CD  . LYS B 167 ? 1.0073 0.4170 0.7525 0.0631  -0.1608 0.0386  329 LYS B CD  
2630 C CE  . LYS B 167 ? 1.0452 0.4057 0.7860 0.0275  -0.1636 0.0261  329 LYS B CE  
2631 N NZ  . LYS B 167 ? 0.9831 0.4091 0.7351 0.0239  -0.1427 -0.0104 329 LYS B NZ  
2632 N N   . LEU B 168 ? 0.6832 0.4028 0.4509 -0.0072 -0.0721 0.0674  330 LEU B N   
2633 C CA  . LEU B 168 ? 0.6075 0.3865 0.3910 -0.0190 -0.0512 0.0476  330 LEU B CA  
2634 C C   . LEU B 168 ? 0.5975 0.3678 0.3902 -0.0125 -0.0507 0.0185  330 LEU B C   
2635 O O   . LEU B 168 ? 0.6410 0.3553 0.4283 -0.0185 -0.0624 0.0138  330 LEU B O   
2636 C CB  . LEU B 168 ? 0.5862 0.3813 0.3699 -0.0571 -0.0372 0.0621  330 LEU B CB  
2637 C CG  . LEU B 168 ? 0.5742 0.4069 0.3474 -0.0708 -0.0268 0.0810  330 LEU B CG  
2638 C CD1 . LEU B 168 ? 0.5266 0.4032 0.3156 -0.0924 -0.0069 0.0711  330 LEU B CD1 
2639 C CD2 . LEU B 168 ? 0.5728 0.4399 0.3425 -0.0469 -0.0305 0.0776  330 LEU B CD2 
2640 N N   . LEU B 169 ? 0.5432 0.3687 0.3462 -0.0047 -0.0383 0.0002  331 LEU B N   
2641 C CA  . LEU B 169 ? 0.5265 0.3590 0.3314 -0.0076 -0.0345 -0.0223 331 LEU B CA  
2642 C C   . LEU B 169 ? 0.4761 0.3420 0.2906 -0.0357 -0.0228 -0.0152 331 LEU B C   
2643 O O   . LEU B 169 ? 0.4407 0.3479 0.2622 -0.0393 -0.0127 -0.0084 331 LEU B O   
2644 C CB  . LEU B 169 ? 0.5172 0.3904 0.3238 0.0192  -0.0289 -0.0442 331 LEU B CB  
2645 C CG  . LEU B 169 ? 0.5265 0.4090 0.3238 0.0180  -0.0256 -0.0677 331 LEU B CG  
2646 C CD1 . LEU B 169 ? 0.5738 0.3924 0.3570 0.0257  -0.0414 -0.0860 331 LEU B CD1 
2647 C CD2 . LEU B 169 ? 0.5011 0.4432 0.2993 0.0375  -0.0135 -0.0840 331 LEU B CD2 
2648 N N   . VAL B 170 ? 0.4810 0.3273 0.2983 -0.0548 -0.0271 -0.0179 332 VAL B N   
2649 C CA  . VAL B 170 ? 0.4351 0.3135 0.2680 -0.0753 -0.0196 -0.0135 332 VAL B CA  
2650 C C   . VAL B 170 ? 0.4425 0.3164 0.2728 -0.0795 -0.0285 -0.0288 332 VAL B C   
2651 O O   . VAL B 170 ? 0.4794 0.3169 0.3055 -0.0867 -0.0412 -0.0359 332 VAL B O   
2652 C CB  . VAL B 170 ? 0.4375 0.3113 0.2838 -0.0983 -0.0166 0.0033  332 VAL B CB  
2653 C CG1 . VAL B 170 ? 0.3845 0.2977 0.2541 -0.1110 -0.0088 0.0034  332 VAL B CG1 
2654 C CG2 . VAL B 170 ? 0.4524 0.3259 0.2891 -0.0953 -0.0106 0.0195  332 VAL B CG2 
2655 N N   . GLN B 171 ? 0.4115 0.3197 0.2411 -0.0771 -0.0242 -0.0328 333 GLN B N   
2656 C CA  . GLN B 171 ? 0.4219 0.3321 0.2396 -0.0800 -0.0340 -0.0450 333 GLN B CA  
2657 C C   . GLN B 171 ? 0.3896 0.3348 0.2137 -0.0865 -0.0313 -0.0354 333 GLN B C   
2658 O O   . GLN B 171 ? 0.3668 0.3307 0.2005 -0.0853 -0.0209 -0.0252 333 GLN B O   
2659 C CB  . GLN B 171 ? 0.4506 0.3555 0.2400 -0.0603 -0.0341 -0.0650 333 GLN B CB  
2660 C CG  . GLN B 171 ? 0.4319 0.3790 0.2169 -0.0473 -0.0188 -0.0627 333 GLN B CG  
2661 C CD  . GLN B 171 ? 0.4590 0.4162 0.2233 -0.0240 -0.0147 -0.0855 333 GLN B CD  
2662 O OE1 . GLN B 171 ? 0.5023 0.4237 0.2535 -0.0115 -0.0241 -0.1065 333 GLN B OE1 
2663 N NE2 . GLN B 171 ? 0.4405 0.4484 0.2040 -0.0182 -0.0005 -0.0836 333 GLN B NE2 
2664 N N   . ARG B 172 ? 0.4018 0.3508 0.2186 -0.0941 -0.0442 -0.0380 334 ARG B N   
2665 C CA  . ARG B 172 ? 0.3897 0.3617 0.2066 -0.0990 -0.0473 -0.0252 334 ARG B CA  
2666 C C   . ARG B 172 ? 0.3840 0.3756 0.1776 -0.0933 -0.0347 -0.0226 334 ARG B C   
2667 O O   . ARG B 172 ? 0.4036 0.4022 0.1697 -0.0858 -0.0307 -0.0361 334 ARG B O   
2668 C CB  . ARG B 172 ? 0.4177 0.3906 0.2216 -0.1068 -0.0678 -0.0270 334 ARG B CB  
2669 C CG  . ARG B 172 ? 0.4103 0.3821 0.2509 -0.1158 -0.0827 -0.0237 334 ARG B CG  
2670 C CD  . ARG B 172 ? 0.4307 0.4120 0.2637 -0.1230 -0.1085 -0.0214 334 ARG B CD  
2671 N NE  . ARG B 172 ? 0.4181 0.4141 0.3026 -0.1277 -0.1196 -0.0149 334 ARG B NE  
2672 C CZ  . ARG B 172 ? 0.4259 0.4241 0.3395 -0.1388 -0.1239 -0.0238 334 ARG B CZ  
2673 N NH1 . ARG B 172 ? 0.4665 0.4384 0.3586 -0.1466 -0.1224 -0.0388 334 ARG B NH1 
2674 N NH2 . ARG B 172 ? 0.3928 0.4202 0.3598 -0.1424 -0.1299 -0.0179 334 ARG B NH2 
2675 N N   . ALA B 173 ? 0.3689 0.3719 0.1759 -0.0976 -0.0282 -0.0078 335 ALA B N   
2676 C CA  . ALA B 173 ? 0.3831 0.4113 0.1751 -0.0994 -0.0163 -0.0021 335 ALA B CA  
2677 C C   . ALA B 173 ? 0.4214 0.4670 0.1785 -0.1069 -0.0200 0.0022  335 ALA B C   
2678 O O   . ALA B 173 ? 0.4266 0.5047 0.1646 -0.1074 -0.0068 0.0000  335 ALA B O   
2679 C CB  . ALA B 173 ? 0.3516 0.3792 0.1635 -0.1088 -0.0148 0.0131  335 ALA B CB  
2680 N N   . SER B 174 ? 0.4574 0.4878 0.2070 -0.1132 -0.0382 0.0086  336 SER B N   
2681 C CA  . SER B 174 ? 0.5097 0.5535 0.2187 -0.1227 -0.0471 0.0161  336 SER B CA  
2682 C C   . SER B 174 ? 0.5333 0.5854 0.2336 -0.1401 -0.0477 0.0462  336 SER B C   
2683 O O   . SER B 174 ? 0.5886 0.6547 0.2499 -0.1534 -0.0537 0.0613  336 SER B O   
2684 C CB  . SER B 174 ? 0.5443 0.6134 0.2169 -0.1143 -0.0343 -0.0077 336 SER B CB  
2685 O OG  . SER B 174 ? 0.5985 0.6720 0.2297 -0.1204 -0.0487 -0.0110 336 SER B OG  
2686 O OXT . SER B 174 ? 0.5234 0.5648 0.2523 -0.1440 -0.0440 0.0573  336 SER B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   143 143 GLY GLY A . n 
A 1 2   PRO 2   144 144 PRO PRO A . n 
A 1 3   LEU 3   145 145 LEU LEU A . n 
A 1 4   GLY 4   146 146 GLY GLY A . n 
A 1 5   SER 5   147 147 SER SER A . n 
A 1 6   ALA 6   148 148 ALA ALA A . n 
A 1 7   ARG 7   149 149 ARG ARG A . n 
A 1 8   ARG 8   150 150 ARG ARG A . n 
A 1 9   LEU 9   151 151 LEU LEU A . n 
A 1 10  TYR 10  152 152 TYR TYR A . n 
A 1 11  VAL 11  153 153 VAL VAL A . n 
A 1 12  GLY 12  154 154 GLY GLY A . n 
A 1 13  ASN 13  155 155 ASN ASN A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  PRO 15  157 157 PRO PRO A . n 
A 1 16  PHE 16  158 158 PHE PHE A . n 
A 1 17  GLY 17  159 159 GLY GLY A . n 
A 1 18  ILE 18  160 160 ILE ILE A . n 
A 1 19  THR 19  161 161 THR THR A . n 
A 1 20  GLU 20  162 162 GLU GLU A . n 
A 1 21  GLU 21  163 163 GLU GLU A . n 
A 1 22  ALA 22  164 164 ALA ALA A . n 
A 1 23  MET 23  165 165 MET MET A . n 
A 1 24  MET 24  166 166 MET MET A . n 
A 1 25  ASP 25  167 167 ASP ASP A . n 
A 1 26  PHE 26  168 168 PHE PHE A . n 
A 1 27  PHE 27  169 169 PHE PHE A . n 
A 1 28  ASN 28  170 170 ASN ASN A . n 
A 1 29  ALA 29  171 171 ALA ALA A . n 
A 1 30  GLN 30  172 172 GLN GLN A . n 
A 1 31  MET 31  173 173 MET MET A . n 
A 1 32  ARG 32  174 174 ARG ARG A . n 
A 1 33  LEU 33  175 175 LEU LEU A . n 
A 1 34  GLY 34  176 176 GLY GLY A . n 
A 1 35  GLY 35  177 177 GLY GLY A . n 
A 1 36  LEU 36  178 178 LEU LEU A . n 
A 1 37  THR 37  179 179 THR THR A . n 
A 1 38  GLN 38  180 180 GLN GLN A . n 
A 1 39  ALA 39  181 181 ALA ALA A . n 
A 1 40  PRO 40  182 182 PRO PRO A . n 
A 1 41  GLY 41  183 183 GLY GLY A . n 
A 1 42  ASN 42  184 184 ASN ASN A . n 
A 1 43  PRO 43  185 185 PRO PRO A . n 
A 1 44  VAL 44  186 186 VAL VAL A . n 
A 1 45  LEU 45  187 187 LEU LEU A . n 
A 1 46  ALA 46  188 188 ALA ALA A . n 
A 1 47  VAL 47  189 189 VAL VAL A . n 
A 1 48  GLN 48  190 190 GLN GLN A . n 
A 1 49  ILE 49  191 191 ILE ILE A . n 
A 1 50  ASN 50  192 192 ASN ASN A . n 
A 1 51  GLN 51  193 193 GLN GLN A . n 
A 1 52  ASP 52  194 194 ASP ASP A . n 
A 1 53  LYS 53  195 195 LYS LYS A . n 
A 1 54  ASN 54  196 196 ASN ASN A . n 
A 1 55  PHE 55  197 197 PHE PHE A . n 
A 1 56  ALA 56  198 198 ALA ALA A . n 
A 1 57  PHE 57  199 199 PHE PHE A . n 
A 1 58  LEU 58  200 200 LEU LEU A . n 
A 1 59  GLU 59  201 201 GLU GLU A . n 
A 1 60  PHE 60  202 202 PHE PHE A . n 
A 1 61  ARG 61  203 203 ARG ARG A . n 
A 1 62  SER 62  204 204 SER SER A . n 
A 1 63  VAL 63  205 205 VAL VAL A . n 
A 1 64  ASP 64  206 206 ASP ASP A . n 
A 1 65  GLU 65  207 207 GLU GLU A . n 
A 1 66  THR 66  208 208 THR THR A . n 
A 1 67  THR 67  209 209 THR THR A . n 
A 1 68  GLN 68  210 210 GLN GLN A . n 
A 1 69  ALA 69  211 211 ALA ALA A . n 
A 1 70  MET 70  212 212 MET MET A . n 
A 1 71  ALA 71  213 213 ALA ALA A . n 
A 1 72  PHE 72  214 214 PHE PHE A . n 
A 1 73  ASP 73  215 215 ASP ASP A . n 
A 1 74  GLY 74  216 216 GLY GLY A . n 
A 1 75  ILE 75  217 217 ILE ILE A . n 
A 1 76  ILE 76  218 218 ILE ILE A . n 
A 1 77  PHE 77  219 219 PHE PHE A . n 
A 1 78  GLN 78  220 220 GLN GLN A . n 
A 1 79  GLY 79  221 221 GLY GLY A . n 
A 1 80  GLN 80  222 222 GLN GLN A . n 
A 1 81  SER 81  223 223 SER SER A . n 
A 1 82  LEU 82  224 224 LEU LEU A . n 
A 1 83  LYS 83  225 225 LYS LYS A . n 
A 1 84  ILE 84  226 226 ILE ILE A . n 
A 1 85  ARG 85  227 227 ARG ARG A . n 
A 1 86  ARG 86  228 228 ARG ARG A . n 
A 1 87  PRO 87  229 229 PRO PRO A . n 
A 1 88  HIS 88  230 230 HIS HIS A . n 
A 1 89  ASP 89  231 231 ASP ASP A . n 
A 1 90  TYR 90  232 232 TYR TYR A . n 
A 1 91  GLN 91  233 233 GLN GLN A . n 
A 1 92  PRO 92  234 234 PRO PRO A . n 
A 1 93  LEU 93  235 235 LEU LEU A . n 
A 1 94  PRO 94  236 236 PRO PRO A . n 
A 1 95  GLY 95  237 237 GLY GLY A . n 
A 1 96  ALA 96  258 258 ALA ALA A . n 
A 1 97  HIS 97  259 259 HIS HIS A . n 
A 1 98  LYS 98  260 260 LYS LYS A . n 
A 1 99  LEU 99  261 261 LEU LEU A . n 
A 1 100 PHE 100 262 262 PHE PHE A . n 
A 1 101 ILE 101 263 263 ILE ILE A . n 
A 1 102 GLY 102 264 264 GLY GLY A . n 
A 1 103 GLY 103 265 265 GLY GLY A . n 
A 1 104 LEU 104 266 266 LEU LEU A . n 
A 1 105 PRO 105 267 267 PRO PRO A . n 
A 1 106 ASN 106 268 268 ASN ASN A . n 
A 1 107 TYR 107 269 269 TYR TYR A . n 
A 1 108 LEU 108 270 270 LEU LEU A . n 
A 1 109 ASN 109 271 271 ASN ASN A . n 
A 1 110 ASP 110 272 272 ASP ASP A . n 
A 1 111 ASP 111 273 273 ASP ASP A . n 
A 1 112 GLN 112 274 274 GLN GLN A . n 
A 1 113 VAL 113 275 275 VAL VAL A . n 
A 1 114 LYS 114 276 276 LYS LYS A . n 
A 1 115 GLU 115 277 277 GLU GLU A . n 
A 1 116 LEU 116 278 278 LEU LEU A . n 
A 1 117 LEU 117 279 279 LEU LEU A . n 
A 1 118 THR 118 280 280 THR THR A . n 
A 1 119 SER 119 281 281 SER SER A . n 
A 1 120 PHE 120 282 282 PHE PHE A . n 
A 1 121 GLY 121 283 283 GLY GLY A . n 
A 1 122 PRO 122 284 284 PRO PRO A . n 
A 1 123 LEU 123 285 285 LEU LEU A . n 
A 1 124 LYS 124 286 286 LYS LYS A . n 
A 1 125 ALA 125 287 287 ALA ALA A . n 
A 1 126 PHE 126 288 288 PHE PHE A . n 
A 1 127 ASN 127 289 289 ASN ASN A . n 
A 1 128 LEU 128 290 290 LEU LEU A . n 
A 1 129 VAL 129 291 291 VAL VAL A . n 
A 1 130 LYS 130 292 292 LYS LYS A . n 
A 1 131 ASP 131 293 293 ASP ASP A . n 
A 1 132 SER 132 294 294 SER SER A . n 
A 1 133 ALA 133 295 295 ALA ALA A . n 
A 1 134 THR 134 296 296 THR THR A . n 
A 1 135 GLY 135 297 297 GLY GLY A . n 
A 1 136 LEU 136 298 298 LEU LEU A . n 
A 1 137 SER 137 299 299 SER SER A . n 
A 1 138 LYS 138 300 300 LYS LYS A . n 
A 1 139 GLY 139 301 301 GLY GLY A . n 
A 1 140 TYR 140 302 302 TYR TYR A . n 
A 1 141 ALA 141 303 303 ALA ALA A . n 
A 1 142 PHE 142 304 304 PHE PHE A . n 
A 1 143 CYS 143 305 305 CYS CYS A . n 
A 1 144 GLU 144 306 306 GLU GLU A . n 
A 1 145 TYR 145 307 307 TYR TYR A . n 
A 1 146 VAL 146 308 308 VAL VAL A . n 
A 1 147 ASP 147 309 309 ASP ASP A . n 
A 1 148 ILE 148 310 310 ILE ILE A . n 
A 1 149 ASN 149 311 311 ASN ASN A . n 
A 1 150 VAL 150 312 312 VAL VAL A . n 
A 1 151 THR 151 313 313 THR THR A . n 
A 1 152 ASP 152 314 314 ASP ASP A . n 
A 1 153 GLN 153 315 315 GLN GLN A . n 
A 1 154 ALA 154 316 316 ALA ALA A . n 
A 1 155 ILE 155 317 317 ILE ILE A . n 
A 1 156 ALA 156 318 318 ALA ALA A . n 
A 1 157 GLY 157 319 319 GLY GLY A . n 
A 1 158 LEU 158 320 320 LEU LEU A . n 
A 1 159 ASN 159 321 321 ASN ASN A . n 
A 1 160 GLY 160 322 322 GLY GLY A . n 
A 1 161 MET 161 323 323 MET MET A . n 
A 1 162 GLN 162 324 324 GLN GLN A . n 
A 1 163 LEU 163 325 325 LEU LEU A . n 
A 1 164 GLY 164 326 326 GLY GLY A . n 
A 1 165 ASP 165 327 327 ASP ASP A . n 
A 1 166 LYS 166 328 328 LYS LYS A . n 
A 1 167 LYS 167 329 329 LYS LYS A . n 
A 1 168 LEU 168 330 330 LEU LEU A . n 
A 1 169 LEU 169 331 331 LEU LEU A . n 
A 1 170 VAL 170 332 332 VAL VAL A . n 
A 1 171 GLN 171 333 333 GLN GLN A . n 
A 1 172 ARG 172 334 334 ARG ARG A . n 
A 1 173 ALA 173 335 335 ALA ALA A . n 
A 1 174 SER 174 336 336 SER SER A . n 
B 1 1   GLY 1   143 143 GLY GLY B . n 
B 1 2   PRO 2   144 144 PRO PRO B . n 
B 1 3   LEU 3   145 145 LEU LEU B . n 
B 1 4   GLY 4   146 146 GLY GLY B . n 
B 1 5   SER 5   147 147 SER SER B . n 
B 1 6   ALA 6   148 148 ALA ALA B . n 
B 1 7   ARG 7   149 149 ARG ARG B . n 
B 1 8   ARG 8   150 150 ARG ARG B . n 
B 1 9   LEU 9   151 151 LEU LEU B . n 
B 1 10  TYR 10  152 152 TYR TYR B . n 
B 1 11  VAL 11  153 153 VAL VAL B . n 
B 1 12  GLY 12  154 154 GLY GLY B . n 
B 1 13  ASN 13  155 155 ASN ASN B . n 
B 1 14  ILE 14  156 156 ILE ILE B . n 
B 1 15  PRO 15  157 157 PRO PRO B . n 
B 1 16  PHE 16  158 158 PHE PHE B . n 
B 1 17  GLY 17  159 159 GLY GLY B . n 
B 1 18  ILE 18  160 160 ILE ILE B . n 
B 1 19  THR 19  161 161 THR THR B . n 
B 1 20  GLU 20  162 162 GLU GLU B . n 
B 1 21  GLU 21  163 163 GLU GLU B . n 
B 1 22  ALA 22  164 164 ALA ALA B . n 
B 1 23  MET 23  165 165 MET MET B . n 
B 1 24  MET 24  166 166 MET MET B . n 
B 1 25  ASP 25  167 167 ASP ASP B . n 
B 1 26  PHE 26  168 168 PHE PHE B . n 
B 1 27  PHE 27  169 169 PHE PHE B . n 
B 1 28  ASN 28  170 170 ASN ASN B . n 
B 1 29  ALA 29  171 171 ALA ALA B . n 
B 1 30  GLN 30  172 172 GLN GLN B . n 
B 1 31  MET 31  173 173 MET MET B . n 
B 1 32  ARG 32  174 174 ARG ARG B . n 
B 1 33  LEU 33  175 175 LEU LEU B . n 
B 1 34  GLY 34  176 176 GLY GLY B . n 
B 1 35  GLY 35  177 177 GLY GLY B . n 
B 1 36  LEU 36  178 178 LEU LEU B . n 
B 1 37  THR 37  179 179 THR THR B . n 
B 1 38  GLN 38  180 180 GLN GLN B . n 
B 1 39  ALA 39  181 181 ALA ALA B . n 
B 1 40  PRO 40  182 182 PRO PRO B . n 
B 1 41  GLY 41  183 183 GLY GLY B . n 
B 1 42  ASN 42  184 184 ASN ASN B . n 
B 1 43  PRO 43  185 185 PRO PRO B . n 
B 1 44  VAL 44  186 186 VAL VAL B . n 
B 1 45  LEU 45  187 187 LEU LEU B . n 
B 1 46  ALA 46  188 188 ALA ALA B . n 
B 1 47  VAL 47  189 189 VAL VAL B . n 
B 1 48  GLN 48  190 190 GLN GLN B . n 
B 1 49  ILE 49  191 191 ILE ILE B . n 
B 1 50  ASN 50  192 192 ASN ASN B . n 
B 1 51  GLN 51  193 193 GLN GLN B . n 
B 1 52  ASP 52  194 194 ASP ASP B . n 
B 1 53  LYS 53  195 195 LYS LYS B . n 
B 1 54  ASN 54  196 196 ASN ASN B . n 
B 1 55  PHE 55  197 197 PHE PHE B . n 
B 1 56  ALA 56  198 198 ALA ALA B . n 
B 1 57  PHE 57  199 199 PHE PHE B . n 
B 1 58  LEU 58  200 200 LEU LEU B . n 
B 1 59  GLU 59  201 201 GLU GLU B . n 
B 1 60  PHE 60  202 202 PHE PHE B . n 
B 1 61  ARG 61  203 203 ARG ARG B . n 
B 1 62  SER 62  204 204 SER SER B . n 
B 1 63  VAL 63  205 205 VAL VAL B . n 
B 1 64  ASP 64  206 206 ASP ASP B . n 
B 1 65  GLU 65  207 207 GLU GLU B . n 
B 1 66  THR 66  208 208 THR THR B . n 
B 1 67  THR 67  209 209 THR THR B . n 
B 1 68  GLN 68  210 210 GLN GLN B . n 
B 1 69  ALA 69  211 211 ALA ALA B . n 
B 1 70  MET 70  212 212 MET MET B . n 
B 1 71  ALA 71  213 213 ALA ALA B . n 
B 1 72  PHE 72  214 214 PHE PHE B . n 
B 1 73  ASP 73  215 215 ASP ASP B . n 
B 1 74  GLY 74  216 216 GLY GLY B . n 
B 1 75  ILE 75  217 217 ILE ILE B . n 
B 1 76  ILE 76  218 218 ILE ILE B . n 
B 1 77  PHE 77  219 219 PHE PHE B . n 
B 1 78  GLN 78  220 220 GLN GLN B . n 
B 1 79  GLY 79  221 221 GLY GLY B . n 
B 1 80  GLN 80  222 222 GLN GLN B . n 
B 1 81  SER 81  223 223 SER SER B . n 
B 1 82  LEU 82  224 224 LEU LEU B . n 
B 1 83  LYS 83  225 225 LYS LYS B . n 
B 1 84  ILE 84  226 226 ILE ILE B . n 
B 1 85  ARG 85  227 227 ARG ARG B . n 
B 1 86  ARG 86  228 228 ARG ARG B . n 
B 1 87  PRO 87  229 229 PRO PRO B . n 
B 1 88  HIS 88  230 230 HIS HIS B . n 
B 1 89  ASP 89  231 231 ASP ASP B . n 
B 1 90  TYR 90  232 232 TYR TYR B . n 
B 1 91  GLN 91  233 233 GLN GLN B . n 
B 1 92  PRO 92  234 234 PRO PRO B . n 
B 1 93  LEU 93  235 235 LEU LEU B . n 
B 1 94  PRO 94  236 236 PRO PRO B . n 
B 1 95  GLY 95  237 237 GLY GLY B . n 
B 1 96  ALA 96  258 258 ALA ALA B . n 
B 1 97  HIS 97  259 259 HIS HIS B . n 
B 1 98  LYS 98  260 260 LYS LYS B . n 
B 1 99  LEU 99  261 261 LEU LEU B . n 
B 1 100 PHE 100 262 262 PHE PHE B . n 
B 1 101 ILE 101 263 263 ILE ILE B . n 
B 1 102 GLY 102 264 264 GLY GLY B . n 
B 1 103 GLY 103 265 265 GLY GLY B . n 
B 1 104 LEU 104 266 266 LEU LEU B . n 
B 1 105 PRO 105 267 267 PRO PRO B . n 
B 1 106 ASN 106 268 268 ASN ASN B . n 
B 1 107 TYR 107 269 269 TYR TYR B . n 
B 1 108 LEU 108 270 270 LEU LEU B . n 
B 1 109 ASN 109 271 271 ASN ASN B . n 
B 1 110 ASP 110 272 272 ASP ASP B . n 
B 1 111 ASP 111 273 273 ASP ASP B . n 
B 1 112 GLN 112 274 274 GLN GLN B . n 
B 1 113 VAL 113 275 275 VAL VAL B . n 
B 1 114 LYS 114 276 276 LYS LYS B . n 
B 1 115 GLU 115 277 277 GLU GLU B . n 
B 1 116 LEU 116 278 278 LEU LEU B . n 
B 1 117 LEU 117 279 279 LEU LEU B . n 
B 1 118 THR 118 280 280 THR THR B . n 
B 1 119 SER 119 281 281 SER SER B . n 
B 1 120 PHE 120 282 282 PHE PHE B . n 
B 1 121 GLY 121 283 283 GLY GLY B . n 
B 1 122 PRO 122 284 284 PRO PRO B . n 
B 1 123 LEU 123 285 285 LEU LEU B . n 
B 1 124 LYS 124 286 286 LYS LYS B . n 
B 1 125 ALA 125 287 287 ALA ALA B . n 
B 1 126 PHE 126 288 288 PHE PHE B . n 
B 1 127 ASN 127 289 289 ASN ASN B . n 
B 1 128 LEU 128 290 290 LEU LEU B . n 
B 1 129 VAL 129 291 291 VAL VAL B . n 
B 1 130 LYS 130 292 292 LYS LYS B . n 
B 1 131 ASP 131 293 293 ASP ASP B . n 
B 1 132 SER 132 294 294 SER SER B . n 
B 1 133 ALA 133 295 295 ALA ALA B . n 
B 1 134 THR 134 296 296 THR THR B . n 
B 1 135 GLY 135 297 297 GLY GLY B . n 
B 1 136 LEU 136 298 298 LEU LEU B . n 
B 1 137 SER 137 299 299 SER SER B . n 
B 1 138 LYS 138 300 300 LYS LYS B . n 
B 1 139 GLY 139 301 301 GLY GLY B . n 
B 1 140 TYR 140 302 302 TYR TYR B . n 
B 1 141 ALA 141 303 303 ALA ALA B . n 
B 1 142 PHE 142 304 304 PHE PHE B . n 
B 1 143 CYS 143 305 305 CYS CYS B . n 
B 1 144 GLU 144 306 306 GLU GLU B . n 
B 1 145 TYR 145 307 307 TYR TYR B . n 
B 1 146 VAL 146 308 308 VAL VAL B . n 
B 1 147 ASP 147 309 309 ASP ASP B . n 
B 1 148 ILE 148 310 310 ILE ILE B . n 
B 1 149 ASN 149 311 311 ASN ASN B . n 
B 1 150 VAL 150 312 312 VAL VAL B . n 
B 1 151 THR 151 313 313 THR THR B . n 
B 1 152 ASP 152 314 314 ASP ASP B . n 
B 1 153 GLN 153 315 315 GLN GLN B . n 
B 1 154 ALA 154 316 316 ALA ALA B . n 
B 1 155 ILE 155 317 317 ILE ILE B . n 
B 1 156 ALA 156 318 318 ALA ALA B . n 
B 1 157 GLY 157 319 319 GLY GLY B . n 
B 1 158 LEU 158 320 320 LEU LEU B . n 
B 1 159 ASN 159 321 321 ASN ASN B . n 
B 1 160 GLY 160 322 322 GLY GLY B . n 
B 1 161 MET 161 323 323 MET MET B . n 
B 1 162 GLN 162 324 324 GLN GLN B . n 
B 1 163 LEU 163 325 325 LEU LEU B . n 
B 1 164 GLY 164 326 326 GLY GLY B . n 
B 1 165 ASP 165 327 327 ASP ASP B . n 
B 1 166 LYS 166 328 328 LYS LYS B . n 
B 1 167 LYS 167 329 329 LYS LYS B . n 
B 1 168 LEU 168 330 330 LEU LEU B . n 
B 1 169 LEU 169 331 331 LEU LEU B . n 
B 1 170 VAL 170 332 332 VAL VAL B . n 
B 1 171 GLN 171 333 333 GLN GLN B . n 
B 1 172 ARG 172 334 334 ARG ARG B . n 
B 1 173 ALA 173 335 335 ALA ALA B . n 
B 1 174 SER 174 336 336 SER SER B . n 
C 2 1   DU  1   1   1   DU  DU  E . n 
C 2 2   DU  2   2   2   DU  DU  E . n 
C 2 3   BRU 3   3   3   BRU BRU E . n 
C 2 4   DC  4   4   4   DC  DC  E . n 
C 2 5   DU  5   5   5   DU  DU  E . n 
C 2 6   DU  6   6   ?   ?   ?   E . n 
C 2 7   DU  7   7   ?   ?   ?   E . n 
D 2 1   DU  1   2   2   DU  DU  P . n 
D 2 2   DU  2   3   3   DU  DU  P . n 
D 2 3   BRU 3   4   4   BRU BRU P . n 
D 2 4   DC  4   5   5   DC  DC  P . n 
D 2 5   DU  5   6   6   DU  DU  P . n 
D 2 6   DU  6   7   7   DU  DU  P . n 
D 2 7   DU  7   8   ?   ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 DIO 1  401 8   DIO DIO A . 
F 4 SO4 1  402 5   SO4 SO4 A . 
G 4 SO4 1  403 10  SO4 SO4 A . 
H 3 DIO 1  401 1   DIO DIO B . 
I 3 DIO 1  402 4   DIO DIO B . 
J 3 DIO 1  403 7   DIO DIO B . 
K 5 CPQ 1  404 101 CPQ CPQ B . 
L 4 SO4 1  405 1   SO4 SO4 B . 
M 4 SO4 1  406 6   SO4 SO4 B . 
N 4 SO4 1  407 9   SO4 SO4 B . 
O 6 GOL 1  408 2   GOL GOL B . 
P 7 HOH 1  501 1   HOH HOH A . 
P 7 HOH 2  502 3   HOH HOH A . 
P 7 HOH 3  503 6   HOH HOH A . 
P 7 HOH 4  504 10  HOH HOH A . 
P 7 HOH 5  505 11  HOH HOH A . 
P 7 HOH 6  506 12  HOH HOH A . 
P 7 HOH 7  507 13  HOH HOH A . 
P 7 HOH 8  508 15  HOH HOH A . 
P 7 HOH 9  509 17  HOH HOH A . 
P 7 HOH 10 510 18  HOH HOH A . 
P 7 HOH 11 511 20  HOH HOH A . 
P 7 HOH 12 512 22  HOH HOH A . 
P 7 HOH 13 513 24  HOH HOH A . 
P 7 HOH 14 514 28  HOH HOH A . 
P 7 HOH 15 515 33  HOH HOH A . 
P 7 HOH 16 516 35  HOH HOH A . 
P 7 HOH 17 517 36  HOH HOH A . 
P 7 HOH 18 518 39  HOH HOH A . 
P 7 HOH 19 519 40  HOH HOH A . 
P 7 HOH 20 520 41  HOH HOH A . 
P 7 HOH 21 521 43  HOH HOH A . 
P 7 HOH 22 522 44  HOH HOH A . 
P 7 HOH 23 523 46  HOH HOH A . 
P 7 HOH 24 524 48  HOH HOH A . 
P 7 HOH 25 525 52  HOH HOH A . 
P 7 HOH 26 526 53  HOH HOH A . 
P 7 HOH 27 527 54  HOH HOH A . 
P 7 HOH 28 528 55  HOH HOH A . 
P 7 HOH 29 529 60  HOH HOH A . 
P 7 HOH 30 530 61  HOH HOH A . 
P 7 HOH 31 531 64  HOH HOH A . 
P 7 HOH 32 532 65  HOH HOH A . 
P 7 HOH 33 533 68  HOH HOH A . 
P 7 HOH 34 534 69  HOH HOH A . 
P 7 HOH 35 535 71  HOH HOH A . 
P 7 HOH 36 536 72  HOH HOH A . 
P 7 HOH 37 537 74  HOH HOH A . 
P 7 HOH 38 538 75  HOH HOH A . 
P 7 HOH 39 539 76  HOH HOH A . 
P 7 HOH 40 540 78  HOH HOH A . 
P 7 HOH 41 541 79  HOH HOH A . 
P 7 HOH 42 542 80  HOH HOH A . 
P 7 HOH 43 543 81  HOH HOH A . 
P 7 HOH 44 544 82  HOH HOH A . 
P 7 HOH 45 545 85  HOH HOH A . 
P 7 HOH 46 546 93  HOH HOH A . 
P 7 HOH 47 547 94  HOH HOH A . 
P 7 HOH 48 548 95  HOH HOH A . 
Q 7 HOH 1  501 2   HOH HOH B . 
Q 7 HOH 2  502 4   HOH HOH B . 
Q 7 HOH 3  503 5   HOH HOH B . 
Q 7 HOH 4  504 7   HOH HOH B . 
Q 7 HOH 5  505 8   HOH HOH B . 
Q 7 HOH 6  506 9   HOH HOH B . 
Q 7 HOH 7  507 14  HOH HOH B . 
Q 7 HOH 8  508 16  HOH HOH B . 
Q 7 HOH 9  509 19  HOH HOH B . 
Q 7 HOH 10 510 21  HOH HOH B . 
Q 7 HOH 11 511 23  HOH HOH B . 
Q 7 HOH 12 512 27  HOH HOH B . 
Q 7 HOH 13 513 29  HOH HOH B . 
Q 7 HOH 14 514 30  HOH HOH B . 
Q 7 HOH 15 515 32  HOH HOH B . 
Q 7 HOH 16 516 38  HOH HOH B . 
Q 7 HOH 17 517 42  HOH HOH B . 
Q 7 HOH 18 518 45  HOH HOH B . 
Q 7 HOH 19 519 47  HOH HOH B . 
Q 7 HOH 20 520 49  HOH HOH B . 
Q 7 HOH 21 521 51  HOH HOH B . 
Q 7 HOH 22 522 56  HOH HOH B . 
Q 7 HOH 23 523 57  HOH HOH B . 
Q 7 HOH 24 524 58  HOH HOH B . 
Q 7 HOH 25 525 59  HOH HOH B . 
Q 7 HOH 26 526 62  HOH HOH B . 
Q 7 HOH 27 527 63  HOH HOH B . 
Q 7 HOH 28 528 66  HOH HOH B . 
Q 7 HOH 29 529 67  HOH HOH B . 
Q 7 HOH 30 530 70  HOH HOH B . 
Q 7 HOH 31 531 83  HOH HOH B . 
Q 7 HOH 32 532 86  HOH HOH B . 
Q 7 HOH 33 533 89  HOH HOH B . 
Q 7 HOH 34 534 90  HOH HOH B . 
Q 7 HOH 35 535 91  HOH HOH B . 
Q 7 HOH 36 536 92  HOH HOH B . 
R 7 HOH 1  101 25  HOH HOH E . 
R 7 HOH 2  102 31  HOH HOH E . 
R 7 HOH 3  103 77  HOH HOH E . 
S 7 HOH 1  101 26  HOH HOH P . 
S 7 HOH 2  102 34  HOH HOH P . 
S 7 HOH 3  103 37  HOH HOH P . 
S 7 HOH 4  104 50  HOH HOH P . 
S 7 HOH 5  105 73  HOH HOH P . 
S 7 HOH 6  106 84  HOH HOH P . 
S 7 HOH 7  107 87  HOH HOH P . 
S 7 HOH 8  108 88  HOH HOH P . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C BRU 3 E BRU 3 ? DU ? 
2 D BRU 3 P BRU 4 ? DU ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-02-13 
2 'Structure model' 1 1 2013-05-22 
3 'Structure model' 1 2 2017-08-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -11.3371 -20.0452 31.1604 -0.1703 -0.1917 -0.1220 -0.0323 0.0181  -0.0570 2.8131 2.4576 4.2445 
1.7676 0.1808 -0.7513 -0.1089 -0.0552 0.1641  0.1504 -0.2686 -0.0878 -0.0836 0.1061  0.0820  
'X-RAY DIFFRACTION' 2 ? refined -33.0880 5.6690   27.0658 -0.1692 -0.2193 -0.1413 -0.0801 0.0376  -0.0405 9.7477 3.8363 4.4640 
1.8382 0.2213 0.4564  -0.0010 0.1102  -0.1092 0.1771 -0.0213 0.1411  -0.2886 -0.1376 0.1124  
'X-RAY DIFFRACTION' 3 ? refined 25.4787  -27.7808 29.1000 -0.1984 -0.2117 -0.1607 -0.0150 -0.0415 0.0002  6.1631 4.4105 3.9011 
1.8886 0.4303 -0.4111 -0.2528 0.1963  0.0565  0.1385 0.0365  0.1607  -0.2431 0.1542  -0.2313 
'X-RAY DIFFRACTION' 4 ? refined 4.6689   -4.0739  13.9100 -0.1001 -0.0812 -0.2415 -0.0966 0.0309  0.0033  6.8024 4.5330 7.0756 
0.8356 2.1383 0.4194  -0.1078 0.0726  0.0352  0.4979 0.1232  -0.3151 -0.2403 -0.3540 -0.0120 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 143 A 237 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 258 A 336 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 B 143 B 237 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 B 258 B 336 ? . . . . ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.2.0019 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .        ?               ?       ?                    ?                        'data collection' ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    147 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O4 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SO4 
_pdbx_validate_close_contact.auth_seq_id_2    403 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "C5'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             P 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             P 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             "C3'" 
_pdbx_validate_rmsd_angle.auth_asym_id_3             P 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.86 
_pdbx_validate_rmsd_angle.angle_target_value         115.70 
_pdbx_validate_rmsd_angle.angle_deviation            9.16 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    THR 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     296 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -131.32 
_pdbx_validate_torsion.psi             -38.55 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 B CPQ 404 ? N59 ? K CPQ 1 N59 
2  1 N 1 B CPQ 404 ? C74 ? K CPQ 1 C74 
3  1 N 1 B CPQ 404 ? C75 ? K CPQ 1 C75 
4  1 N 1 B CPQ 404 ? C76 ? K CPQ 1 C76 
5  1 N 1 B CPQ 404 ? N77 ? K CPQ 1 N77 
6  1 N 1 B CPQ 404 ? C78 ? K CPQ 1 C78 
7  1 N 1 B CPQ 404 ? C80 ? K CPQ 1 C80 
8  1 N 1 B CPQ 404 ? O86 ? K CPQ 1 O86 
9  1 N 1 B CPQ 404 ? C81 ? K CPQ 1 C81 
10 1 N 1 B CPQ 404 ? O87 ? K CPQ 1 O87 
11 1 N 1 B CPQ 404 ? C82 ? K CPQ 1 C82 
12 1 N 1 B CPQ 404 ? O88 ? K CPQ 1 O88 
13 1 N 1 B CPQ 404 ? C83 ? K CPQ 1 C83 
14 1 N 1 B CPQ 404 ? O89 ? K CPQ 1 O89 
15 1 N 1 B CPQ 404 ? C84 ? K CPQ 1 C84 
16 1 N 1 B CPQ 404 ? O85 ? K CPQ 1 O85 
17 1 N 1 B CPQ 404 ? O79 ? K CPQ 1 O79 
18 1 N 1 B CPQ 404 ? C68 ? K CPQ 1 C68 
19 1 N 1 B CPQ 404 ? C69 ? K CPQ 1 C69 
20 1 N 1 B CPQ 404 ? C70 ? K CPQ 1 C70 
21 1 N 1 B CPQ 404 ? N71 ? K CPQ 1 N71 
22 1 N 1 B CPQ 404 ? C72 ? K CPQ 1 C72 
23 1 N 1 B CPQ 404 ? C90 ? K CPQ 1 C90 
24 1 N 1 B CPQ 404 ? O96 ? K CPQ 1 O96 
25 1 N 1 B CPQ 404 ? C91 ? K CPQ 1 C91 
26 1 N 1 B CPQ 404 ? O97 ? K CPQ 1 O97 
27 1 N 1 B CPQ 404 ? C92 ? K CPQ 1 C92 
28 1 N 1 B CPQ 404 ? O98 ? K CPQ 1 O98 
29 1 N 1 B CPQ 404 ? C93 ? K CPQ 1 C93 
30 1 N 1 B CPQ 404 ? O99 ? K CPQ 1 O99 
31 1 N 1 B CPQ 404 ? C94 ? K CPQ 1 C94 
32 1 N 1 B CPQ 404 ? O95 ? K CPQ 1 O95 
33 1 N 1 B CPQ 404 ? O73 ? K CPQ 1 O73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 E DU 6 ? C DU 6 
2 1 Y 1 E DU 7 ? C DU 7 
3 1 Y 1 P DU 8 ? D DU 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '1,4-DIETHYLENE DIOXIDE'                       DIO 
4 'SULFATE ION'                                  SO4 
5 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' CPQ 
6 GLYCEROL                                       GOL 
7 water                                          HOH 
#