data_3VAS
# 
_entry.id   3VAS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VAS         
RCSB  RCSB069810   
WWPDB D_1000069810 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3UQ6 'Schistosoma adenosine kinase in complex with adenosine and AMP' unspecified 
PDB 3UQ9 'Schistosoma adenosine kinase in complex with tubercidin'        unspecified 
PDB 3VAQ 'Schistosoma adenosine kinase in complex with adenosine'         unspecified 
# 
_pdbx_database_status.entry_id                        3VAS 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Romanello, L.'    1 
'Bachega, F.R.'    2 
'Garatt, R.C.'     3 
'DeMarco, R.'      4 
'Brandao-neto, J.' 5 
'Pereira, H.M.'    6 
# 
_citation.id                        primary 
_citation.title                     
'Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            69 
_citation.page_first                126 
_citation.page_last                 136 
_citation.year                      2013 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23275171 
_citation.pdbx_database_id_DOI      10.1107/S0907444912044800 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Romanello, L.'    1 
primary 'Bachega, J.F.'    2 
primary 'Cassago, A.'      3 
primary 'Brandao-Neto, J.' 4 
primary 'Demarco, R.'      5 
primary 'Garratt, R.C.'    6 
primary 'Pereira, H.D.'    7 
# 
_cell.entry_id           3VAS 
_cell.length_a           58.970 
_cell.length_b           180.120 
_cell.length_c           79.270 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3VAS 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Putative adenosine kinase' 41340.277 2   2.7.1.20 ? 'Adenosine kinase' ? 
2 non-polymer syn ADENOSINE                   267.241   2   ?        ? ?                  ? 
3 non-polymer syn 'CHLORIDE ION'              35.453    2   ?        ? ?                  ? 
4 water       nat water                       18.015    278 ?        ? ?                  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHDLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIA
GGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAAC
DLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGN
ESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGD
AFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYSLKINK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHDLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIA
GGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAAC
DLSLAHIEQPHVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGN
ESEAEAYGEVHGLLEDTVHATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGD
AFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYSLKINK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  ASP n 
1 22  LEU n 
1 23  SER n 
1 24  GLU n 
1 25  GLY n 
1 26  TYR n 
1 27  VAL n 
1 28  PHE n 
1 29  GLY n 
1 30  MET n 
1 31  GLY n 
1 32  ASN n 
1 33  PRO n 
1 34  LEU n 
1 35  LEU n 
1 36  ASP n 
1 37  ILE n 
1 38  ILE n 
1 39  VAL n 
1 40  ASP n 
1 41  ALA n 
1 42  ASP n 
1 43  ASP n 
1 44  PHE n 
1 45  MET n 
1 46  TYR n 
1 47  ARG n 
1 48  LYS n 
1 49  TYR n 
1 50  ASN n 
1 51  LEU n 
1 52  LYS n 
1 53  LYS n 
1 54  ASP n 
1 55  ASN n 
1 56  ILE n 
1 57  VAL n 
1 58  LEU n 
1 59  ALA n 
1 60  GLU n 
1 61  GLU n 
1 62  LYS n 
1 63  HIS n 
1 64  MET n 
1 65  THR n 
1 66  ILE n 
1 67  TYR n 
1 68  ASP n 
1 69  GLU n 
1 70  ILE n 
1 71  GLN n 
1 72  LYS n 
1 73  LYS n 
1 74  LYS n 
1 75  LYS n 
1 76  LEU n 
1 77  ASN n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  GLY n 
1 82  GLY n 
1 83  ALA n 
1 84  THR n 
1 85  LEU n 
1 86  ASN n 
1 87  THR n 
1 88  VAL n 
1 89  LYS n 
1 90  MET n 
1 91  ILE n 
1 92  GLN n 
1 93  TRP n 
1 94  ILE n 
1 95  ILE n 
1 96  GLN n 
1 97  LYS n 
1 98  PRO n 
1 99  PHE n 
1 100 VAL n 
1 101 CYS n 
1 102 SER n 
1 103 TYR n 
1 104 VAL n 
1 105 GLY n 
1 106 CYS n 
1 107 ILE n 
1 108 GLY n 
1 109 ALA n 
1 110 ASP n 
1 111 ILE n 
1 112 GLN n 
1 113 GLY n 
1 114 LYS n 
1 115 TYR n 
1 116 ILE n 
1 117 LYS n 
1 118 ASN n 
1 119 ASP n 
1 120 CYS n 
1 121 SER n 
1 122 ALA n 
1 123 LEU n 
1 124 ASP n 
1 125 LEU n 
1 126 VAL n 
1 127 THR n 
1 128 GLU n 
1 129 PHE n 
1 130 GLN n 
1 131 ILE n 
1 132 ALA n 
1 133 GLU n 
1 134 GLU n 
1 135 PRO n 
1 136 LEU n 
1 137 MET n 
1 138 THR n 
1 139 GLY n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 VAL n 
1 144 LEU n 
1 145 VAL n 
1 146 SER n 
1 147 GLU n 
1 148 LYS n 
1 149 LEU n 
1 150 ARG n 
1 151 SER n 
1 152 MET n 
1 153 VAL n 
1 154 THR n 
1 155 TYR n 
1 156 LEU n 
1 157 GLY n 
1 158 ALA n 
1 159 ALA n 
1 160 CYS n 
1 161 ASP n 
1 162 LEU n 
1 163 SER n 
1 164 LEU n 
1 165 ALA n 
1 166 HIS n 
1 167 ILE n 
1 168 GLU n 
1 169 GLN n 
1 170 PRO n 
1 171 HIS n 
1 172 VAL n 
1 173 TRP n 
1 174 SER n 
1 175 LEU n 
1 176 VAL n 
1 177 GLU n 
1 178 LYS n 
1 179 ALA n 
1 180 GLN n 
1 181 VAL n 
1 182 TYR n 
1 183 TYR n 
1 184 ILE n 
1 185 ALA n 
1 186 GLY n 
1 187 PHE n 
1 188 VAL n 
1 189 ILE n 
1 190 ASN n 
1 191 THR n 
1 192 CYS n 
1 193 TYR n 
1 194 GLU n 
1 195 GLY n 
1 196 MET n 
1 197 LEU n 
1 198 LYS n 
1 199 ILE n 
1 200 ALA n 
1 201 LYS n 
1 202 HIS n 
1 203 SER n 
1 204 LEU n 
1 205 GLU n 
1 206 ASN n 
1 207 GLU n 
1 208 LYS n 
1 209 LEU n 
1 210 PHE n 
1 211 CYS n 
1 212 PHE n 
1 213 ASN n 
1 214 LEU n 
1 215 SER n 
1 216 ALA n 
1 217 PRO n 
1 218 PHE n 
1 219 LEU n 
1 220 SER n 
1 221 GLN n 
1 222 PHE n 
1 223 ASN n 
1 224 THR n 
1 225 LYS n 
1 226 GLU n 
1 227 VAL n 
1 228 ASP n 
1 229 GLU n 
1 230 MET n 
1 231 ILE n 
1 232 SER n 
1 233 TYR n 
1 234 SER n 
1 235 ASN n 
1 236 ILE n 
1 237 VAL n 
1 238 PHE n 
1 239 GLY n 
1 240 ASN n 
1 241 GLU n 
1 242 SER n 
1 243 GLU n 
1 244 ALA n 
1 245 GLU n 
1 246 ALA n 
1 247 TYR n 
1 248 GLY n 
1 249 GLU n 
1 250 VAL n 
1 251 HIS n 
1 252 GLY n 
1 253 LEU n 
1 254 LEU n 
1 255 GLU n 
1 256 ASP n 
1 257 THR n 
1 258 VAL n 
1 259 HIS n 
1 260 ALA n 
1 261 THR n 
1 262 ALA n 
1 263 ARG n 
1 264 TYR n 
1 265 ILE n 
1 266 ALA n 
1 267 ASP n 
1 268 LEU n 
1 269 PRO n 
1 270 PHE n 
1 271 ALA n 
1 272 ASP n 
1 273 GLY n 
1 274 LYS n 
1 275 LYS n 
1 276 ARG n 
1 277 LYS n 
1 278 ARG n 
1 279 LEU n 
1 280 VAL n 
1 281 ILE n 
1 282 ILE n 
1 283 THR n 
1 284 ARG n 
1 285 GLY n 
1 286 LYS n 
1 287 ASN n 
1 288 PRO n 
1 289 LEU n 
1 290 LEU n 
1 291 TYR n 
1 292 THR n 
1 293 ASP n 
1 294 SER n 
1 295 SER n 
1 296 ASP n 
1 297 SER n 
1 298 GLU n 
1 299 ILE n 
1 300 HIS n 
1 301 GLN n 
1 302 PHE n 
1 303 MET n 
1 304 VAL n 
1 305 GLU n 
1 306 GLN n 
1 307 PHE n 
1 308 LYS n 
1 309 ASP n 
1 310 ASP n 
1 311 GLN n 
1 312 ILE n 
1 313 ILE n 
1 314 ASP n 
1 315 THR n 
1 316 ASN n 
1 317 GLY n 
1 318 ALA n 
1 319 GLY n 
1 320 ASP n 
1 321 ALA n 
1 322 PHE n 
1 323 ALA n 
1 324 ALA n 
1 325 GLY n 
1 326 PHE n 
1 327 ILE n 
1 328 ALA n 
1 329 ASP n 
1 330 TYR n 
1 331 ILE n 
1 332 ARG n 
1 333 GLY n 
1 334 LYS n 
1 335 PRO n 
1 336 MET n 
1 337 ILE n 
1 338 THR n 
1 339 SER n 
1 340 LEU n 
1 341 HIS n 
1 342 ALA n 
1 343 ALA n 
1 344 VAL n 
1 345 LYS n 
1 346 ALA n 
1 347 ALA n 
1 348 ALA n 
1 349 TYR n 
1 350 ILE n 
1 351 ILE n 
1 352 CYS n 
1 353 ARG n 
1 354 SER n 
1 355 GLY n 
1 356 PHE n 
1 357 SER n 
1 358 LEU n 
1 359 GLY n 
1 360 SER n 
1 361 ARG n 
1 362 ASP n 
1 363 SER n 
1 364 TYR n 
1 365 SER n 
1 366 LEU n 
1 367 LYS n 
1 368 ILE n 
1 369 ASN n 
1 370 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Blood fluke' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Smp_008360 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Schistosoma mansoni' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6183 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G4V7G8_SCHMA 
_struct_ref.pdbx_db_accession          G4V7G8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;HDLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKPF
VCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAACDLSLAHIEQPHVWSLVEKA
QVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLSQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVH
ATARYIADLPFADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGDAFAAGFIADYIRGKPMITS
LHAAVKAAAYIICRSGFSLGSRDSYSLKINK
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VAS A 20 ? 370 ? G4V7G8 2 ? 352 ? 2 352 
2 1 3VAS B 20 ? 370 ? G4V7G8 2 ? 352 ? 2 352 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VAS MET A 1  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -17 1  
1 3VAS GLY A 2  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -16 2  
1 3VAS SER A 3  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -15 3  
1 3VAS SER A 4  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -14 4  
1 3VAS HIS A 5  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -13 5  
1 3VAS HIS A 6  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -12 6  
1 3VAS HIS A 7  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -11 7  
1 3VAS HIS A 8  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -10 8  
1 3VAS HIS A 9  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -9  9  
1 3VAS HIS A 10 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -8  10 
1 3VAS SER A 11 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -7  11 
1 3VAS SER A 12 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -6  12 
1 3VAS GLY A 13 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -5  13 
1 3VAS LEU A 14 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -4  14 
1 3VAS VAL A 15 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -3  15 
1 3VAS PRO A 16 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -2  16 
1 3VAS ARG A 17 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -1  17 
1 3VAS GLY A 18 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' 0   18 
1 3VAS SER A 19 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' 1   19 
2 3VAS MET B 1  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -17 20 
2 3VAS GLY B 2  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -16 21 
2 3VAS SER B 3  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -15 22 
2 3VAS SER B 4  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -14 23 
2 3VAS HIS B 5  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -13 24 
2 3VAS HIS B 6  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -12 25 
2 3VAS HIS B 7  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -11 26 
2 3VAS HIS B 8  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -10 27 
2 3VAS HIS B 9  ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -9  28 
2 3VAS HIS B 10 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -8  29 
2 3VAS SER B 11 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -7  30 
2 3VAS SER B 12 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -6  31 
2 3VAS GLY B 13 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -5  32 
2 3VAS LEU B 14 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -4  33 
2 3VAS VAL B 15 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -3  34 
2 3VAS PRO B 16 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -2  35 
2 3VAS ARG B 17 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' -1  36 
2 3VAS GLY B 18 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' 0   37 
2 3VAS SER B 19 ? UNP G4V7G8 ? ? 'EXPRESSION TAG' 1   38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADN non-polymer         . ADENOSINE       ? 'C10 H13 N5 O4'  267.241 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3VAS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.69 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   6.1-6.7 
_exptl_crystal_grow.pdbx_details    
'100mM Bis-tris pH 6.1-6.7, 200mM LiSO4, 16-20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-09-25 
_diffrn_detector.details                'Compound Refractive Lenses' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    DCM 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96110 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96110 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3VAS 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   -3.00 
_reflns.d_resolution_low             90.06 
_reflns.d_resolution_high            2.260 
_reflns.number_obs                   40098 
_reflns.number_all                   40098 
_reflns.percent_possible_obs         97.400 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.430 
_reflns.B_iso_Wilson_estimate        36.926 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  2.260  2.320  97.400 0.570 ? 1.630  ? ? ? ? ? ? ? 
1 2  2.320  2.380  96.800 0.487 ? 1.850  ? ? ? ? ? ? ? 
1 3  2.380  2.450  97.600 0.407 ? 2.160  ? ? ? ? ? ? ? 
1 4  2.450  2.530  97.700 0.335 ? 2.580  ? ? ? ? ? ? ? 
1 5  2.530  2.610  97.500 0.286 ? 3.060  ? ? ? ? ? ? ? 
1 6  2.610  2.700  97.600 0.231 ? 3.690  ? ? ? ? ? ? ? 
1 7  2.700  2.800  97.800 0.195 ? 4.330  ? ? ? ? ? ? ? 
1 8  2.800  2.920  98.100 0.169 ? 4.860  ? ? ? ? ? ? ? 
1 9  2.920  3.050  98.200 0.144 ? 5.660  ? ? ? ? ? ? ? 
1 10 3.050  3.200  98.300 0.119 ? 6.720  ? ? ? ? ? ? ? 
1 11 3.200  3.370  98.100 0.097 ? 7.980  ? ? ? ? ? ? ? 
1 12 3.370  3.570  97.400 0.075 ? 9.940  ? ? ? ? ? ? ? 
1 13 3.570  3.820  96.600 0.067 ? 11.060 ? ? ? ? ? ? ? 
1 14 3.820  4.130  95.300 0.060 ? 12.010 ? ? ? ? ? ? ? 
1 15 4.130  4.520  95.100 0.054 ? 13.000 ? ? ? ? ? ? ? 
1 16 4.520  5.050  96.300 0.055 ? 13.960 ? ? ? ? ? ? ? 
1 17 5.050  5.840  96.700 0.053 ? 13.180 ? ? ? ? ? ? ? 
1 18 5.840  7.150  97.900 0.055 ? 13.050 ? ? ? ? ? ? ? 
1 19 7.150  10.110 98.100 0.046 ? 15.400 ? ? ? ? ? ? ? 
1 20 10.110 ?      96.900 0.045 ? 15.950 ? ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3VAS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40098 
_refine.ls_number_reflns_all                     40098 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             90.060 
_refine.ls_d_res_high                            2.260 
_refine.ls_percent_reflns_obs                    99.17 
_refine.ls_R_factor_obs                          0.1792 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1771 
_refine.ls_R_factor_R_free                       0.2216 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  2011 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.000 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.0587 
_refine.aniso_B[1][1]                            -7.6289 
_refine.aniso_B[2][2]                            9.2205 
_refine.aniso_B[3][3]                            -0.1900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3UQ6' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 20.86 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5354 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             278 
_refine_hist.number_atoms_total               5672 
_refine_hist.d_res_high                       2.260 
_refine_hist.d_res_low                        90.060 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 5501 'X-RAY DIFFRACTION' ? 
f_angle_d          0.819  ? ? 7438 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.814 ? ? 2010 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.058  ? ? 830  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 940  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.2600 2.3165  2650 0.2376 99.00  0.2791 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.3165 2.3792  2662 0.2219 99.00  0.2890 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.3792 2.4492  2704 0.2123 99.00  0.2788 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.4492 2.5283  2683 0.2021 99.00  0.2406 . . 136 . . . . 
'X-RAY DIFFRACTION' . 2.5283 2.6186  2624 0.1886 99.00  0.2404 . . 172 . . . . 
'X-RAY DIFFRACTION' . 2.6186 2.7235  2710 0.1833 99.00  0.2256 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.7235 2.8474  2691 0.1895 99.00  0.2446 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.8474 2.9976  2706 0.1956 99.00  0.2675 . . 144 . . . . 
'X-RAY DIFFRACTION' . 2.9976 3.1854  2728 0.1949 99.00  0.2717 . . 127 . . . . 
'X-RAY DIFFRACTION' . 3.1854 3.4313  2736 0.1778 100.00 0.2405 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.4313 3.7766  2722 0.1594 99.00  0.1921 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.7766 4.3231  2751 0.1518 99.00  0.1695 . . 141 . . . . 
'X-RAY DIFFRACTION' . 4.3231 5.4466  2787 0.1410 99.00  0.1844 . . 151 . . . . 
'X-RAY DIFFRACTION' . 5.4466 90.1315 2933 0.1834 99.00  0.2207 . . 139 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3VAS 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3VAS 
_struct.title                     
'Adenosine kinase from Schistosoma mansoni in complex with adenosine in occluded loop conformation' 
_struct.pdbx_descriptor           'Putative adenosine kinase (E.C.2.7.1.20)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VAS 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'ribokinase, enzyme, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 43  ? TYR A 49  ? ASP A 25  TYR A 31  1 ? 7  
HELX_P HELX_P2  2  GLU A 60  ? HIS A 63  ? GLU A 42  HIS A 45  5 ? 4  
HELX_P HELX_P3  3  MET A 64  ? GLN A 71  ? MET A 46  GLN A 53  1 ? 8  
HELX_P HELX_P4  4  GLY A 82  ? GLN A 96  ? GLY A 64  GLN A 78  1 ? 15 
HELX_P HELX_P5  5  ASP A 110 ? LEU A 123 ? ASP A 92  LEU A 105 1 ? 14 
HELX_P HELX_P6  6  ALA A 159 ? LEU A 162 ? ALA A 141 LEU A 144 5 ? 4  
HELX_P HELX_P7  7  SER A 163 ? GLU A 168 ? SER A 145 GLU A 150 1 ? 6  
HELX_P HELX_P8  8  GLN A 169 ? ALA A 179 ? GLN A 151 ALA A 161 1 ? 11 
HELX_P HELX_P9  9  VAL A 188 ? ASN A 206 ? VAL A 170 ASN A 188 1 ? 19 
HELX_P HELX_P10 10 ALA A 216 ? ASN A 223 ? ALA A 198 ASN A 205 1 ? 8  
HELX_P HELX_P11 11 ASN A 223 ? SER A 232 ? ASN A 205 SER A 214 1 ? 10 
HELX_P HELX_P12 12 GLU A 241 ? HIS A 251 ? GLU A 223 HIS A 233 1 ? 11 
HELX_P HELX_P13 13 ASP A 256 ? LEU A 268 ? ASP A 238 LEU A 250 1 ? 13 
HELX_P HELX_P14 14 GLY A 317 ? ILE A 331 ? GLY A 299 ILE A 313 1 ? 15 
HELX_P HELX_P15 15 PRO A 335 ? CYS A 352 ? PRO A 317 CYS A 334 1 ? 18 
HELX_P HELX_P16 16 SER A 360 ? SER A 365 ? SER A 342 SER A 347 5 ? 6  
HELX_P HELX_P17 17 ASP B 43  ? TYR B 49  ? ASP B 25  TYR B 31  1 ? 7  
HELX_P HELX_P18 18 GLU B 60  ? MET B 64  ? GLU B 42  MET B 46  5 ? 5  
HELX_P HELX_P19 19 THR B 65  ? LYS B 72  ? THR B 47  LYS B 54  1 ? 8  
HELX_P HELX_P20 20 GLY B 82  ? GLN B 96  ? GLY B 64  GLN B 78  1 ? 15 
HELX_P HELX_P21 21 ASP B 110 ? LEU B 123 ? ASP B 92  LEU B 105 1 ? 14 
HELX_P HELX_P22 22 ALA B 159 ? LEU B 162 ? ALA B 141 LEU B 144 5 ? 4  
HELX_P HELX_P23 23 SER B 163 ? GLU B 168 ? SER B 145 GLU B 150 1 ? 6  
HELX_P HELX_P24 24 GLN B 169 ? ALA B 179 ? GLN B 151 ALA B 161 1 ? 11 
HELX_P HELX_P25 25 VAL B 188 ? ASN B 206 ? VAL B 170 ASN B 188 1 ? 19 
HELX_P HELX_P26 26 ALA B 216 ? ASN B 223 ? ALA B 198 ASN B 205 1 ? 8  
HELX_P HELX_P27 27 ASN B 223 ? SER B 232 ? ASN B 205 SER B 214 1 ? 10 
HELX_P HELX_P28 28 GLU B 241 ? HIS B 251 ? GLU B 223 HIS B 233 1 ? 11 
HELX_P HELX_P29 29 ASP B 256 ? LEU B 268 ? ASP B 238 LEU B 250 1 ? 13 
HELX_P HELX_P30 30 ASN B 316 ? ILE B 331 ? ASN B 298 ILE B 313 1 ? 16 
HELX_P HELX_P31 31 PRO B 335 ? ARG B 353 ? PRO B 317 ARG B 335 1 ? 19 
HELX_P HELX_P32 32 SER B 360 ? TYR B 364 ? SER B 342 TYR B 346 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 134 A . ? GLU 116 A PRO 135 A ? PRO 117 A 1 5.38  
2 GLU 134 B . ? GLU 116 B PRO 135 B ? PRO 117 B 1 -0.04 
3 THR 315 B . ? THR 297 B ASN 316 B ? ASN 298 B 1 8.78  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 9 ? 
C ? 5 ? 
D ? 9 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? anti-parallel 
D 8 9 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 126 ? THR A 127 ? VAL A 108 THR A 109 
A 2 CYS A 101 ? ILE A 107 ? CYS A 83  ILE A 89  
A 3 GLN A 130 ? ILE A 131 ? GLN A 112 ILE A 113 
B 1 VAL A 126 ? THR A 127 ? VAL A 108 THR A 109 
B 2 CYS A 101 ? ILE A 107 ? CYS A 83  ILE A 89  
B 3 VAL A 27  ? GLY A 31  ? VAL A 9   GLY A 13  
B 4 VAL A 181 ? ALA A 185 ? VAL A 163 ALA A 167 
B 5 LEU A 209 ? ASN A 213 ? LEU A 191 ASN A 195 
B 6 ILE A 236 ? ASN A 240 ? ILE A 218 ASN A 222 
B 7 LEU A 279 ? ARG A 284 ? LEU A 261 ARG A 266 
B 8 ASN A 287 ? ASP A 293 ? ASN A 269 ASP A 275 
B 9 HIS A 300 ? PHE A 302 ? HIS A 282 PHE A 284 
C 1 ASN A 55  ? LEU A 58  ? ASN A 37  LEU A 40  
C 2 ARG A 150 ? GLY A 157 ? ARG A 132 GLY A 139 
C 3 THR A 138 ? VAL A 145 ? THR A 120 VAL A 127 
C 4 LEU A 34  ? ASP A 40  ? LEU A 16  ASP A 22  
C 5 ASN A 77  ? GLY A 81  ? ASN A 59  GLY A 63  
D 1 VAL B 126 ? ILE B 131 ? VAL B 108 ILE B 113 
D 2 CYS B 101 ? ILE B 107 ? CYS B 83  ILE B 89  
D 3 VAL B 27  ? GLY B 31  ? VAL B 9   GLY B 13  
D 4 VAL B 181 ? ALA B 185 ? VAL B 163 ALA B 167 
D 5 LEU B 209 ? ASN B 213 ? LEU B 191 ASN B 195 
D 6 ILE B 236 ? ASN B 240 ? ILE B 218 ASN B 222 
D 7 LEU B 279 ? ARG B 284 ? LEU B 261 ARG B 266 
D 8 ASN B 287 ? ASP B 293 ? ASN B 269 ASP B 275 
D 9 HIS B 300 ? PHE B 302 ? HIS B 282 PHE B 284 
E 1 ILE B 56  ? LEU B 58  ? ILE B 38  LEU B 40  
E 2 MET B 152 ? GLY B 157 ? MET B 134 GLY B 139 
E 3 THR B 138 ? VAL B 145 ? THR B 120 VAL B 127 
E 4 LEU B 34  ? ASP B 40  ? LEU B 16  ASP B 22  
E 5 ASN B 77  ? GLY B 81  ? ASN B 59  GLY B 63  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 126 ? O VAL A 108 N TYR A 103 ? N TYR A 85  
A 2 3 N GLY A 105 ? N GLY A 87  O GLN A 130 ? O GLN A 112 
B 1 2 O VAL A 126 ? O VAL A 108 N TYR A 103 ? N TYR A 85  
B 2 3 O SER A 102 ? O SER A 84  N VAL A 27  ? N VAL A 9   
B 3 4 N PHE A 28  ? N PHE A 10  O VAL A 181 ? O VAL A 163 
B 4 5 N TYR A 182 ? N TYR A 164 O LEU A 209 ? O LEU A 191 
B 5 6 N PHE A 212 ? N PHE A 194 O PHE A 238 ? O PHE A 220 
B 6 7 N VAL A 237 ? N VAL A 219 O LEU A 279 ? O LEU A 261 
B 7 8 N ILE A 282 ? N ILE A 264 O LEU A 290 ? O LEU A 272 
B 8 9 N TYR A 291 ? N TYR A 273 O HIS A 300 ? O HIS A 282 
C 1 2 N VAL A 57  ? N VAL A 39  O THR A 154 ? O THR A 136 
C 2 3 O TYR A 155 ? O TYR A 137 N LYS A 140 ? N LYS A 122 
C 3 4 O VAL A 145 ? O VAL A 127 N VAL A 39  ? N VAL A 21  
C 4 5 N LEU A 34  ? N LEU A 16  O GLY A 81  ? O GLY A 63  
D 1 2 O GLN B 130 ? O GLN B 112 N GLY B 105 ? N GLY B 87  
D 2 3 O SER B 102 ? O SER B 84  N GLY B 29  ? N GLY B 11  
D 3 4 N PHE B 28  ? N PHE B 10  O VAL B 181 ? O VAL B 163 
D 4 5 N TYR B 182 ? N TYR B 164 O LEU B 209 ? O LEU B 191 
D 5 6 N PHE B 212 ? N PHE B 194 O ILE B 236 ? O ILE B 218 
D 6 7 N VAL B 237 ? N VAL B 219 O LEU B 279 ? O LEU B 261 
D 7 8 N VAL B 280 ? N VAL B 262 O THR B 292 ? O THR B 274 
D 8 9 N TYR B 291 ? N TYR B 273 O HIS B 300 ? O HIS B 282 
E 1 2 N VAL B 57  ? N VAL B 39  O THR B 154 ? O THR B 136 
E 2 3 O TYR B 155 ? O TYR B 137 N LYS B 140 ? N LYS B 122 
E 3 4 O VAL B 141 ? O VAL B 123 N ILE B 37  ? N ILE B 19  
E 4 5 N ASP B 36  ? N ASP B 18  O ILE B 79  ? O ILE B 61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ADN A 401' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 402'  
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ADN B 401' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL B 402'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 ASN A 32  ? ASN A 14  . ? 1_555 ? 
2  AC1 16 LEU A 34  ? LEU A 16  . ? 1_555 ? 
3  AC1 16 ASP A 36  ? ASP A 18  . ? 1_555 ? 
4  AC1 16 ILE A 56  ? ILE A 38  . ? 1_555 ? 
5  AC1 16 LEU A 58  ? LEU A 40  . ? 1_555 ? 
6  AC1 16 GLY A 82  ? GLY A 64  . ? 1_555 ? 
7  AC1 16 ALA A 83  ? ALA A 65  . ? 1_555 ? 
8  AC1 16 ASN A 86  ? ASN A 68  . ? 1_555 ? 
9  AC1 16 VAL A 141 ? VAL A 123 . ? 1_555 ? 
10 AC1 16 THR A 154 ? THR A 136 . ? 1_555 ? 
11 AC1 16 LEU A 156 ? LEU A 138 . ? 1_555 ? 
12 AC1 16 PHE A 187 ? PHE A 169 . ? 1_555 ? 
13 AC1 16 ASN A 316 ? ASN A 298 . ? 1_555 ? 
14 AC1 16 ASP A 320 ? ASP A 302 . ? 1_555 ? 
15 AC1 16 CL  D .   ? CL  A 402 . ? 1_555 ? 
16 AC1 16 HOH G .   ? HOH A 512 . ? 1_555 ? 
17 AC2 3  ASN A 32  ? ASN A 14  . ? 1_555 ? 
18 AC2 3  THR A 84  ? THR A 66  . ? 1_555 ? 
19 AC2 3  ADN C .   ? ADN A 401 . ? 1_555 ? 
20 AC3 17 ASN B 32  ? ASN B 14  . ? 1_555 ? 
21 AC3 17 LEU B 34  ? LEU B 16  . ? 1_555 ? 
22 AC3 17 ASP B 36  ? ASP B 18  . ? 1_555 ? 
23 AC3 17 ILE B 56  ? ILE B 38  . ? 1_555 ? 
24 AC3 17 LEU B 58  ? LEU B 40  . ? 1_555 ? 
25 AC3 17 GLY B 82  ? GLY B 64  . ? 1_555 ? 
26 AC3 17 ALA B 83  ? ALA B 65  . ? 1_555 ? 
27 AC3 17 ASN B 86  ? ASN B 68  . ? 1_555 ? 
28 AC3 17 VAL B 141 ? VAL B 123 . ? 1_555 ? 
29 AC3 17 THR B 154 ? THR B 136 . ? 1_555 ? 
30 AC3 17 LEU B 156 ? LEU B 138 . ? 1_555 ? 
31 AC3 17 PHE B 187 ? PHE B 169 . ? 1_555 ? 
32 AC3 17 ASN B 316 ? ASN B 298 . ? 1_555 ? 
33 AC3 17 GLY B 317 ? GLY B 299 . ? 1_555 ? 
34 AC3 17 ASP B 320 ? ASP B 302 . ? 1_555 ? 
35 AC3 17 CL  F .   ? CL  B 402 . ? 1_555 ? 
36 AC3 17 HOH H .   ? HOH B 518 . ? 1_555 ? 
37 AC4 4  ASN B 32  ? ASN B 14  . ? 1_555 ? 
38 AC4 4  THR B 84  ? THR B 66  . ? 1_555 ? 
39 AC4 4  ADN E .   ? ADN B 401 . ? 1_555 ? 
40 AC4 4  HOH H .   ? HOH B 502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3VAS 
_atom_sites.fract_transf_matrix[1][1]   0.016958 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005552 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012615 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 21  ? -6.317  -37.760 3.594   1.00 69.01  ? 3   ASP A N     1 
ATOM   2    C  CA    . ASP A 1 21  ? -6.099  -37.231 2.253   1.00 67.78  ? 3   ASP A CA    1 
ATOM   3    C  C     . ASP A 1 21  ? -6.663  -35.820 2.133   1.00 63.60  ? 3   ASP A C     1 
ATOM   4    O  O     . ASP A 1 21  ? -7.879  -35.629 2.069   1.00 65.38  ? 3   ASP A O     1 
ATOM   5    C  CB    . ASP A 1 21  ? -6.726  -38.149 1.200   1.00 73.77  ? 3   ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 21  ? -6.105  -39.537 1.186   1.00 78.68  ? 3   ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 21  ? -6.841  -40.519 0.946   1.00 80.20  ? 3   ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 21  ? -4.880  -39.645 1.415   1.00 79.71  ? 3   ASP A OD2   1 
ATOM   9    N  N     . LEU A 1 22  ? -5.767  -34.835 2.100   1.00 56.17  ? 4   LEU A N     1 
ATOM   10   C  CA    . LEU A 1 22  ? -6.155  -33.428 2.111   1.00 47.62  ? 4   LEU A CA    1 
ATOM   11   C  C     . LEU A 1 22  ? -6.424  -32.867 0.717   1.00 44.23  ? 4   LEU A C     1 
ATOM   12   O  O     . LEU A 1 22  ? -5.691  -33.139 -0.235  1.00 38.14  ? 4   LEU A O     1 
ATOM   13   C  CB    . LEU A 1 22  ? -5.081  -32.584 2.801   1.00 43.81  ? 4   LEU A CB    1 
ATOM   14   C  CG    . LEU A 1 22  ? -4.786  -32.851 4.278   1.00 43.85  ? 4   LEU A CG    1 
ATOM   15   C  CD1   . LEU A 1 22  ? -3.557  -32.062 4.716   1.00 40.55  ? 4   LEU A CD1   1 
ATOM   16   C  CD2   . LEU A 1 22  ? -5.987  -32.500 5.142   1.00 37.49  ? 4   LEU A CD2   1 
ATOM   17   N  N     . SER A 1 23  ? -7.483  -32.072 0.623   1.00 42.00  ? 5   SER A N     1 
ATOM   18   C  CA    . SER A 1 23  ? -7.847  -31.359 -0.594  1.00 42.61  ? 5   SER A CA    1 
ATOM   19   C  C     . SER A 1 23  ? -6.726  -30.426 -1.062  1.00 40.88  ? 5   SER A C     1 
ATOM   20   O  O     . SER A 1 23  ? -5.904  -29.984 -0.260  1.00 39.10  ? 5   SER A O     1 
ATOM   21   C  CB    . SER A 1 23  ? -9.117  -30.550 -0.326  1.00 45.13  ? 5   SER A CB    1 
ATOM   22   O  OG    . SER A 1 23  ? -9.482  -29.771 -1.444  1.00 49.43  ? 5   SER A OG    1 
ATOM   23   N  N     . GLU A 1 24  ? -6.685  -30.133 -2.359  1.00 42.48  ? 6   GLU A N     1 
ATOM   24   C  CA    . GLU A 1 24  ? -5.705  -29.181 -2.883  1.00 43.77  ? 6   GLU A CA    1 
ATOM   25   C  C     . GLU A 1 24  ? -5.971  -27.780 -2.339  1.00 39.02  ? 6   GLU A C     1 
ATOM   26   O  O     . GLU A 1 24  ? -7.123  -27.386 -2.148  1.00 36.50  ? 6   GLU A O     1 
ATOM   27   C  CB    . GLU A 1 24  ? -5.707  -29.165 -4.414  1.00 48.97  ? 6   GLU A CB    1 
ATOM   28   C  CG    . GLU A 1 24  ? -5.163  -30.436 -5.053  1.00 54.92  ? 6   GLU A CG    1 
ATOM   29   C  CD    . GLU A 1 24  ? -4.987  -30.306 -6.558  1.00 59.50  ? 6   GLU A CD    1 
ATOM   30   O  OE1   . GLU A 1 24  ? -5.280  -29.218 -7.106  1.00 60.07  ? 6   GLU A OE1   1 
ATOM   31   O  OE2   . GLU A 1 24  ? -4.553  -31.292 -7.191  1.00 61.89  ? 6   GLU A OE2   1 
ATOM   32   N  N     . GLY A 1 25  ? -4.901  -27.037 -2.077  1.00 31.35  ? 7   GLY A N     1 
ATOM   33   C  CA    . GLY A 1 25  ? -5.026  -25.714 -1.496  1.00 30.10  ? 7   GLY A CA    1 
ATOM   34   C  C     . GLY A 1 25  ? -5.674  -25.720 -0.122  1.00 30.21  ? 7   GLY A C     1 
ATOM   35   O  O     . GLY A 1 25  ? -6.298  -24.744 0.283   1.00 30.01  ? 7   GLY A O     1 
ATOM   36   N  N     . TYR A 1 26  ? -5.528  -26.829 0.594   1.00 30.80  ? 8   TYR A N     1 
ATOM   37   C  CA    . TYR A 1 26  ? -6.056  -26.959 1.948   1.00 31.20  ? 8   TYR A CA    1 
ATOM   38   C  C     . TYR A 1 26  ? -5.378  -25.969 2.901   1.00 30.95  ? 8   TYR A C     1 
ATOM   39   O  O     . TYR A 1 26  ? -6.007  -25.456 3.827   1.00 31.35  ? 8   TYR A O     1 
ATOM   40   C  CB    . TYR A 1 26  ? -5.837  -28.387 2.444   1.00 32.29  ? 8   TYR A CB    1 
ATOM   41   C  CG    . TYR A 1 26  ? -6.645  -28.761 3.659   1.00 38.02  ? 8   TYR A CG    1 
ATOM   42   C  CD1   . TYR A 1 26  ? -7.948  -29.225 3.531   1.00 38.75  ? 8   TYR A CD1   1 
ATOM   43   C  CD2   . TYR A 1 26  ? -6.102  -28.667 4.936   1.00 33.04  ? 8   TYR A CD2   1 
ATOM   44   C  CE1   . TYR A 1 26  ? -8.691  -29.576 4.641   1.00 40.55  ? 8   TYR A CE1   1 
ATOM   45   C  CE2   . TYR A 1 26  ? -6.838  -29.018 6.050   1.00 34.43  ? 8   TYR A CE2   1 
ATOM   46   C  CZ    . TYR A 1 26  ? -8.131  -29.469 5.897   1.00 36.21  ? 8   TYR A CZ    1 
ATOM   47   O  OH    . TYR A 1 26  ? -8.867  -29.819 7.004   1.00 42.11  ? 8   TYR A OH    1 
ATOM   48   N  N     . VAL A 1 27  ? -4.093  -25.713 2.655   1.00 28.31  ? 9   VAL A N     1 
ATOM   49   C  CA    . VAL A 1 27  ? -3.277  -24.835 3.488   1.00 26.93  ? 9   VAL A CA    1 
ATOM   50   C  C     . VAL A 1 27  ? -2.846  -23.600 2.704   1.00 27.72  ? 9   VAL A C     1 
ATOM   51   O  O     . VAL A 1 27  ? -2.297  -23.713 1.609   1.00 25.45  ? 9   VAL A O     1 
ATOM   52   C  CB    . VAL A 1 27  ? -2.002  -25.556 3.986   1.00 26.98  ? 9   VAL A CB    1 
ATOM   53   C  CG1   . VAL A 1 27  ? -1.112  -24.597 4.764   1.00 25.26  ? 9   VAL A CG1   1 
ATOM   54   C  CG2   . VAL A 1 27  ? -2.365  -26.769 4.834   1.00 28.02  ? 9   VAL A CG2   1 
ATOM   55   N  N     . PHE A 1 28  ? -3.095  -22.424 3.271   1.00 27.06  ? 10  PHE A N     1 
ATOM   56   C  CA    . PHE A 1 28  ? -2.738  -21.164 2.624   1.00 26.49  ? 10  PHE A CA    1 
ATOM   57   C  C     . PHE A 1 28  ? -1.801  -20.348 3.503   1.00 24.14  ? 10  PHE A C     1 
ATOM   58   O  O     . PHE A 1 28  ? -2.042  -20.189 4.698   1.00 24.45  ? 10  PHE A O     1 
ATOM   59   C  CB    . PHE A 1 28  ? -3.996  -20.340 2.316   1.00 24.99  ? 10  PHE A CB    1 
ATOM   60   C  CG    . PHE A 1 28  ? -3.709  -18.989 1.702   1.00 27.03  ? 10  PHE A CG    1 
ATOM   61   C  CD1   . PHE A 1 28  ? -3.719  -18.824 0.326   1.00 27.21  ? 10  PHE A CD1   1 
ATOM   62   C  CD2   . PHE A 1 28  ? -3.439  -17.885 2.503   1.00 23.70  ? 10  PHE A CD2   1 
ATOM   63   C  CE1   . PHE A 1 28  ? -3.454  -17.589 -0.242  1.00 27.65  ? 10  PHE A CE1   1 
ATOM   64   C  CE2   . PHE A 1 28  ? -3.172  -16.652 1.943   1.00 24.53  ? 10  PHE A CE2   1 
ATOM   65   C  CZ    . PHE A 1 28  ? -3.182  -16.501 0.569   1.00 27.55  ? 10  PHE A CZ    1 
ATOM   66   N  N     . GLY A 1 29  ? -0.741  -19.820 2.903   1.00 22.02  ? 11  GLY A N     1 
ATOM   67   C  CA    . GLY A 1 29  ? 0.116   -18.869 3.585   1.00 21.74  ? 11  GLY A CA    1 
ATOM   68   C  C     . GLY A 1 29  ? 0.276   -17.591 2.781   1.00 21.15  ? 11  GLY A C     1 
ATOM   69   O  O     . GLY A 1 29  ? 0.220   -17.613 1.550   1.00 20.83  ? 11  GLY A O     1 
ATOM   70   N  N     . MET A 1 30  ? 0.444   -16.469 3.471   1.00 23.86  ? 12  MET A N     1 
ATOM   71   C  CA    . MET A 1 30  ? 0.900   -15.238 2.825   1.00 24.02  ? 12  MET A CA    1 
ATOM   72   C  C     . MET A 1 30  ? 2.041   -14.668 3.651   1.00 22.21  ? 12  MET A C     1 
ATOM   73   O  O     . MET A 1 30  ? 2.017   -14.756 4.874   1.00 22.38  ? 12  MET A O     1 
ATOM   74   C  CB    . MET A 1 30  ? -0.230  -14.211 2.659   1.00 26.96  ? 12  MET A CB    1 
ATOM   75   C  CG    . MET A 1 30  ? -0.824  -13.671 3.960   1.00 31.40  ? 12  MET A CG    1 
ATOM   76   S  SD    . MET A 1 30  ? -1.840  -12.182 3.729   1.00 46.96  ? 12  MET A SD    1 
ATOM   77   C  CE    . MET A 1 30  ? -0.613  -10.896 3.745   1.00 31.29  ? 12  MET A CE    1 
ATOM   78   N  N     . GLY A 1 31  ? 3.052   -14.106 2.995   1.00 23.35  ? 13  GLY A N     1 
ATOM   79   C  CA    . GLY A 1 31  ? 4.188   -13.579 3.733   1.00 24.21  ? 13  GLY A CA    1 
ATOM   80   C  C     . GLY A 1 31  ? 5.208   -12.782 2.944   1.00 25.50  ? 13  GLY A C     1 
ATOM   81   O  O     . GLY A 1 31  ? 4.925   -12.262 1.859   1.00 24.17  ? 13  GLY A O     1 
ATOM   82   N  N     . ASN A 1 32  ? 6.407   -12.681 3.511   1.00 20.31  ? 14  ASN A N     1 
ATOM   83   C  CA    . ASN A 1 32  ? 7.501   -11.963 2.877   1.00 18.80  ? 14  ASN A CA    1 
ATOM   84   C  C     . ASN A 1 32  ? 8.510   -12.943 2.277   1.00 18.56  ? 14  ASN A C     1 
ATOM   85   O  O     . ASN A 1 32  ? 9.273   -13.581 3.001   1.00 18.63  ? 14  ASN A O     1 
ATOM   86   C  CB    . ASN A 1 32  ? 8.188   -11.048 3.898   1.00 17.45  ? 14  ASN A CB    1 
ATOM   87   C  CG    . ASN A 1 32  ? 7.192   -10.248 4.729   1.00 19.22  ? 14  ASN A CG    1 
ATOM   88   O  OD1   . ASN A 1 32  ? 6.134   -9.852  4.237   1.00 20.48  ? 14  ASN A OD1   1 
ATOM   89   N  ND2   . ASN A 1 32  ? 7.525   -10.012 5.994   1.00 16.73  ? 14  ASN A ND2   1 
ATOM   90   N  N     . PRO A 1 33  ? 8.506   -13.087 0.946   1.00 19.99  ? 15  PRO A N     1 
ATOM   91   C  CA    . PRO A 1 33  ? 9.484   -14.010 0.360   1.00 19.11  ? 15  PRO A CA    1 
ATOM   92   C  C     . PRO A 1 33  ? 10.829  -13.316 0.245   1.00 20.06  ? 15  PRO A C     1 
ATOM   93   O  O     . PRO A 1 33  ? 10.934  -12.267 -0.397  1.00 20.08  ? 15  PRO A O     1 
ATOM   94   C  CB    . PRO A 1 33  ? 8.890   -14.331 -1.015  1.00 17.47  ? 15  PRO A CB    1 
ATOM   95   C  CG    . PRO A 1 33  ? 8.034   -13.162 -1.347  1.00 18.84  ? 15  PRO A CG    1 
ATOM   96   C  CD    . PRO A 1 33  ? 7.587   -12.521 -0.057  1.00 19.57  ? 15  PRO A CD    1 
ATOM   97   N  N     . LEU A 1 34  ? 11.843  -13.882 0.888   1.00 19.46  ? 16  LEU A N     1 
ATOM   98   C  CA    . LEU A 1 34  ? 13.132  -13.211 1.004   1.00 20.80  ? 16  LEU A CA    1 
ATOM   99   C  C     . LEU A 1 34  ? 14.281  -14.129 0.618   1.00 22.88  ? 16  LEU A C     1 
ATOM   100  O  O     . LEU A 1 34  ? 14.194  -15.351 0.751   1.00 21.56  ? 16  LEU A O     1 
ATOM   101  C  CB    . LEU A 1 34  ? 13.341  -12.715 2.439   1.00 21.73  ? 16  LEU A CB    1 
ATOM   102  C  CG    . LEU A 1 34  ? 12.261  -11.824 3.059   1.00 21.36  ? 16  LEU A CG    1 
ATOM   103  C  CD1   . LEU A 1 34  ? 12.475  -11.695 4.566   1.00 20.40  ? 16  LEU A CD1   1 
ATOM   104  C  CD2   . LEU A 1 34  ? 12.247  -10.447 2.395   1.00 18.19  ? 16  LEU A CD2   1 
ATOM   105  N  N     . LEU A 1 35  ? 15.367  -13.535 0.141   1.00 23.39  ? 17  LEU A N     1 
ATOM   106  C  CA    . LEU A 1 35  ? 16.576  -14.300 -0.111  1.00 21.34  ? 17  LEU A CA    1 
ATOM   107  C  C     . LEU A 1 35  ? 17.479  -14.223 1.115   1.00 21.84  ? 17  LEU A C     1 
ATOM   108  O  O     . LEU A 1 35  ? 17.829  -13.131 1.568   1.00 23.24  ? 17  LEU A O     1 
ATOM   109  C  CB    . LEU A 1 35  ? 17.305  -13.763 -1.341  1.00 19.66  ? 17  LEU A CB    1 
ATOM   110  C  CG    . LEU A 1 35  ? 18.562  -14.537 -1.739  1.00 23.33  ? 17  LEU A CG    1 
ATOM   111  C  CD1   . LEU A 1 35  ? 18.189  -15.862 -2.386  1.00 25.28  ? 17  LEU A CD1   1 
ATOM   112  C  CD2   . LEU A 1 35  ? 19.441  -13.711 -2.658  1.00 22.77  ? 17  LEU A CD2   1 
ATOM   113  N  N     . ASP A 1 36  ? 17.840  -15.378 1.664   1.00 22.16  ? 18  ASP A N     1 
ATOM   114  C  CA    . ASP A 1 36  ? 18.817  -15.429 2.749   1.00 22.23  ? 18  ASP A CA    1 
ATOM   115  C  C     . ASP A 1 36  ? 20.239  -15.378 2.200   1.00 23.76  ? 18  ASP A C     1 
ATOM   116  O  O     . ASP A 1 36  ? 20.590  -16.108 1.272   1.00 21.18  ? 18  ASP A O     1 
ATOM   117  C  CB    . ASP A 1 36  ? 18.634  -16.685 3.606   1.00 21.84  ? 18  ASP A CB    1 
ATOM   118  C  CG    . ASP A 1 36  ? 17.389  -16.623 4.482   1.00 26.65  ? 18  ASP A CG    1 
ATOM   119  O  OD1   . ASP A 1 36  ? 16.750  -15.547 4.540   1.00 26.85  ? 18  ASP A OD1   1 
ATOM   120  O  OD2   . ASP A 1 36  ? 17.059  -17.649 5.124   1.00 27.63  ? 18  ASP A OD2   1 
ATOM   121  N  N     . ILE A 1 37  ? 21.054  -14.502 2.773   1.00 23.58  ? 19  ILE A N     1 
ATOM   122  C  CA    . ILE A 1 37  ? 22.459  -14.434 2.411   1.00 24.12  ? 19  ILE A CA    1 
ATOM   123  C  C     . ILE A 1 37  ? 23.295  -14.804 3.633   1.00 26.34  ? 19  ILE A C     1 
ATOM   124  O  O     . ILE A 1 37  ? 23.520  -13.983 4.518   1.00 28.29  ? 19  ILE A O     1 
ATOM   125  C  CB    . ILE A 1 37  ? 22.836  -13.044 1.886   1.00 24.49  ? 19  ILE A CB    1 
ATOM   126  C  CG1   . ILE A 1 37  ? 21.850  -12.613 0.796   1.00 23.78  ? 19  ILE A CG1   1 
ATOM   127  C  CG2   . ILE A 1 37  ? 24.275  -13.033 1.374   1.00 22.38  ? 19  ILE A CG2   1 
ATOM   128  C  CD1   . ILE A 1 37  ? 22.186  -11.275 0.163   1.00 28.45  ? 19  ILE A CD1   1 
ATOM   129  N  N     . ILE A 1 38  ? 23.744  -16.055 3.669   1.00 25.41  ? 20  ILE A N     1 
ATOM   130  C  CA    . ILE A 1 38  ? 24.390  -16.614 4.846   1.00 26.98  ? 20  ILE A CA    1 
ATOM   131  C  C     . ILE A 1 38  ? 25.905  -16.506 4.761   1.00 29.36  ? 20  ILE A C     1 
ATOM   132  O  O     . ILE A 1 38  ? 26.528  -17.021 3.830   1.00 30.39  ? 20  ILE A O     1 
ATOM   133  C  CB    . ILE A 1 38  ? 23.986  -18.085 5.042   1.00 27.61  ? 20  ILE A CB    1 
ATOM   134  C  CG1   . ILE A 1 38  ? 22.460  -18.216 4.981   1.00 25.47  ? 20  ILE A CG1   1 
ATOM   135  C  CG2   . ILE A 1 38  ? 24.539  -18.626 6.356   1.00 25.38  ? 20  ILE A CG2   1 
ATOM   136  C  CD1   . ILE A 1 38  ? 21.969  -19.644 4.988   1.00 28.00  ? 20  ILE A CD1   1 
ATOM   137  N  N     . VAL A 1 39  ? 26.492  -15.838 5.747   1.00 29.16  ? 21  VAL A N     1 
ATOM   138  C  CA    . VAL A 1 39  ? 27.917  -15.538 5.729   1.00 30.66  ? 21  VAL A CA    1 
ATOM   139  C  C     . VAL A 1 39  ? 28.556  -15.843 7.078   1.00 31.89  ? 21  VAL A C     1 
ATOM   140  O  O     . VAL A 1 39  ? 27.945  -15.622 8.123   1.00 29.05  ? 21  VAL A O     1 
ATOM   141  C  CB    . VAL A 1 39  ? 28.164  -14.050 5.350   1.00 38.45  ? 21  VAL A CB    1 
ATOM   142  C  CG1   . VAL A 1 39  ? 27.217  -13.127 6.109   1.00 35.86  ? 21  VAL A CG1   1 
ATOM   143  C  CG2   . VAL A 1 39  ? 29.615  -13.647 5.584   1.00 41.67  ? 21  VAL A CG2   1 
ATOM   144  N  N     . ASP A 1 40  ? 29.771  -16.383 7.047   1.00 38.40  ? 22  ASP A N     1 
ATOM   145  C  CA    . ASP A 1 40  ? 30.594  -16.475 8.244   1.00 46.21  ? 22  ASP A CA    1 
ATOM   146  C  C     . ASP A 1 40  ? 31.103  -15.079 8.590   1.00 45.25  ? 22  ASP A C     1 
ATOM   147  O  O     . ASP A 1 40  ? 32.004  -14.551 7.932   1.00 44.88  ? 22  ASP A O     1 
ATOM   148  C  CB    . ASP A 1 40  ? 31.764  -17.435 8.030   1.00 55.01  ? 22  ASP A CB    1 
ATOM   149  C  CG    . ASP A 1 40  ? 31.322  -18.886 7.959   1.00 62.12  ? 22  ASP A CG    1 
ATOM   150  O  OD1   . ASP A 1 40  ? 30.277  -19.221 8.560   1.00 61.90  ? 22  ASP A OD1   1 
ATOM   151  O  OD2   . ASP A 1 40  ? 32.021  -19.691 7.306   1.00 66.43  ? 22  ASP A OD2   1 
ATOM   152  N  N     . ALA A 1 41  ? 30.513  -14.483 9.620   1.00 43.07  ? 23  ALA A N     1 
ATOM   153  C  CA    . ALA A 1 41  ? 30.796  -13.096 9.966   1.00 41.70  ? 23  ALA A CA    1 
ATOM   154  C  C     . ALA A 1 41  ? 31.956  -12.956 10.944  1.00 45.47  ? 23  ALA A C     1 
ATOM   155  O  O     . ALA A 1 41  ? 32.149  -13.796 11.826  1.00 47.73  ? 23  ALA A O     1 
ATOM   156  C  CB    . ALA A 1 41  ? 29.550  -12.433 10.532  1.00 36.90  ? 23  ALA A CB    1 
ATOM   157  N  N     . ASP A 1 42  ? 32.726  -11.886 10.777  1.00 46.82  ? 24  ASP A N     1 
ATOM   158  C  CA    . ASP A 1 42  ? 33.785  -11.545 11.715  1.00 47.88  ? 24  ASP A CA    1 
ATOM   159  C  C     . ASP A 1 42  ? 33.164  -10.939 12.966  1.00 43.63  ? 24  ASP A C     1 
ATOM   160  O  O     . ASP A 1 42  ? 32.050  -10.418 12.925  1.00 40.92  ? 24  ASP A O     1 
ATOM   161  C  CB    . ASP A 1 42  ? 34.765  -10.554 11.084  1.00 54.57  ? 24  ASP A CB    1 
ATOM   162  C  CG    . ASP A 1 42  ? 35.209  -10.975 9.691   1.00 59.11  ? 24  ASP A CG    1 
ATOM   163  O  OD1   . ASP A 1 42  ? 36.191  -11.742 9.579   1.00 60.29  ? 24  ASP A OD1   1 
ATOM   164  O  OD2   . ASP A 1 42  ? 34.574  -10.532 8.707   1.00 59.73  ? 24  ASP A OD2   1 
ATOM   165  N  N     . ASP A 1 43  ? 33.890  -10.998 14.074  1.00 46.09  ? 25  ASP A N     1 
ATOM   166  C  CA    . ASP A 1 43  ? 33.360  -10.557 15.359  1.00 47.73  ? 25  ASP A CA    1 
ATOM   167  C  C     . ASP A 1 43  ? 33.053  -9.062  15.413  1.00 45.01  ? 25  ASP A C     1 
ATOM   168  O  O     . ASP A 1 43  ? 32.160  -8.641  16.151  1.00 44.03  ? 25  ASP A O     1 
ATOM   169  C  CB    . ASP A 1 43  ? 34.315  -10.946 16.490  1.00 55.16  ? 25  ASP A CB    1 
ATOM   170  C  CG    . ASP A 1 43  ? 34.663  -12.424 16.473  1.00 62.36  ? 25  ASP A CG    1 
ATOM   171  O  OD1   . ASP A 1 43  ? 33.808  -13.241 16.877  1.00 63.13  ? 25  ASP A OD1   1 
ATOM   172  O  OD2   . ASP A 1 43  ? 35.791  -12.768 16.056  1.00 66.57  ? 25  ASP A OD2   1 
ATOM   173  N  N     . PHE A 1 44  ? 33.781  -8.262  14.637  1.00 43.63  ? 26  PHE A N     1 
ATOM   174  C  CA    . PHE A 1 44  ? 33.563  -6.814  14.656  1.00 40.85  ? 26  PHE A CA    1 
ATOM   175  C  C     . PHE A 1 44  ? 32.181  -6.436  14.136  1.00 36.21  ? 26  PHE A C     1 
ATOM   176  O  O     . PHE A 1 44  ? 31.612  -5.429  14.554  1.00 35.95  ? 26  PHE A O     1 
ATOM   177  C  CB    . PHE A 1 44  ? 34.670  -6.049  13.905  1.00 42.72  ? 26  PHE A CB    1 
ATOM   178  C  CG    . PHE A 1 44  ? 34.617  -6.181  12.396  1.00 42.42  ? 26  PHE A CG    1 
ATOM   179  C  CD1   . PHE A 1 44  ? 33.740  -5.412  11.641  1.00 33.91  ? 26  PHE A CD1   1 
ATOM   180  C  CD2   . PHE A 1 44  ? 35.481  -7.042  11.732  1.00 42.25  ? 26  PHE A CD2   1 
ATOM   181  C  CE1   . PHE A 1 44  ? 33.702  -5.525  10.258  1.00 34.08  ? 26  PHE A CE1   1 
ATOM   182  C  CE2   . PHE A 1 44  ? 35.451  -7.155  10.348  1.00 41.35  ? 26  PHE A CE2   1 
ATOM   183  C  CZ    . PHE A 1 44  ? 34.559  -6.397  9.611   1.00 34.09  ? 26  PHE A CZ    1 
ATOM   184  N  N     . MET A 1 45  ? 31.653  -7.258  13.231  1.00 35.10  ? 27  MET A N     1 
ATOM   185  C  CA    . MET A 1 45  ? 30.376  -6.989  12.571  1.00 35.21  ? 27  MET A CA    1 
ATOM   186  C  C     . MET A 1 45  ? 29.231  -6.800  13.559  1.00 35.74  ? 27  MET A C     1 
ATOM   187  O  O     . MET A 1 45  ? 28.358  -5.956  13.351  1.00 33.81  ? 27  MET A O     1 
ATOM   188  C  CB    . MET A 1 45  ? 30.029  -8.117  11.595  1.00 35.02  ? 27  MET A CB    1 
ATOM   189  C  CG    . MET A 1 45  ? 30.982  -8.246  10.421  1.00 35.97  ? 27  MET A CG    1 
ATOM   190  S  SD    . MET A 1 45  ? 30.697  -6.987  9.168   1.00 50.97  ? 27  MET A SD    1 
ATOM   191  C  CE    . MET A 1 45  ? 29.031  -7.389  8.671   1.00 30.61  ? 27  MET A CE    1 
ATOM   192  N  N     . TYR A 1 46  ? 29.241  -7.584  14.632  1.00 37.81  ? 28  TYR A N     1 
ATOM   193  C  CA    . TYR A 1 46  ? 28.166  -7.536  15.622  1.00 37.42  ? 28  TYR A CA    1 
ATOM   194  C  C     . TYR A 1 46  ? 28.223  -6.258  16.450  1.00 38.18  ? 28  TYR A C     1 
ATOM   195  O  O     . TYR A 1 46  ? 27.186  -5.710  16.821  1.00 37.30  ? 28  TYR A O     1 
ATOM   196  C  CB    . TYR A 1 46  ? 28.189  -8.789  16.509  1.00 37.00  ? 28  TYR A CB    1 
ATOM   197  C  CG    . TYR A 1 46  ? 28.082  -10.056 15.697  1.00 36.47  ? 28  TYR A CG    1 
ATOM   198  C  CD1   . TYR A 1 46  ? 26.841  -10.598 15.377  1.00 34.92  ? 28  TYR A CD1   1 
ATOM   199  C  CD2   . TYR A 1 46  ? 29.221  -10.691 15.211  1.00 37.49  ? 28  TYR A CD2   1 
ATOM   200  C  CE1   . TYR A 1 46  ? 26.739  -11.750 14.611  1.00 32.25  ? 28  TYR A CE1   1 
ATOM   201  C  CE2   . TYR A 1 46  ? 29.127  -11.843 14.446  1.00 35.21  ? 28  TYR A CE2   1 
ATOM   202  C  CZ    . TYR A 1 46  ? 27.885  -12.365 14.151  1.00 32.90  ? 28  TYR A CZ    1 
ATOM   203  O  OH    . TYR A 1 46  ? 27.791  -13.505 13.388  1.00 34.38  ? 28  TYR A OH    1 
ATOM   204  N  N     . ARG A 1 47  ? 29.434  -5.779  16.726  1.00 40.09  ? 29  ARG A N     1 
ATOM   205  C  CA    . ARG A 1 47  ? 29.609  -4.509  17.429  1.00 43.45  ? 29  ARG A CA    1 
ATOM   206  C  C     . ARG A 1 47  ? 29.310  -3.342  16.490  1.00 38.85  ? 29  ARG A C     1 
ATOM   207  O  O     . ARG A 1 47  ? 28.575  -2.416  16.839  1.00 35.42  ? 29  ARG A O     1 
ATOM   208  C  CB    . ARG A 1 47  ? 31.031  -4.383  17.992  1.00 49.47  ? 29  ARG A CB    1 
ATOM   209  C  CG    . ARG A 1 47  ? 31.528  -5.618  18.742  1.00 55.17  ? 29  ARG A CG    1 
ATOM   210  C  CD    . ARG A 1 47  ? 32.811  -5.334  19.525  1.00 61.30  ? 29  ARG A CD    1 
ATOM   211  N  NE    . ARG A 1 47  ? 33.854  -4.723  18.700  1.00 64.33  ? 29  ARG A NE    1 
ATOM   212  C  CZ    . ARG A 1 47  ? 34.825  -5.396  18.086  1.00 64.18  ? 29  ARG A CZ    1 
ATOM   213  N  NH1   . ARG A 1 47  ? 34.900  -6.718  18.197  1.00 62.24  ? 29  ARG A NH1   1 
ATOM   214  N  NH2   . ARG A 1 47  ? 35.725  -4.743  17.359  1.00 64.32  ? 29  ARG A NH2   1 
ATOM   215  N  N     . LYS A 1 48  ? 29.884  -3.407  15.292  1.00 36.81  ? 30  LYS A N     1 
ATOM   216  C  CA    . LYS A 1 48  ? 29.707  -2.382  14.270  1.00 32.84  ? 30  LYS A CA    1 
ATOM   217  C  C     . LYS A 1 48  ? 28.235  -2.074  13.985  1.00 31.20  ? 30  LYS A C     1 
ATOM   218  O  O     . LYS A 1 48  ? 27.849  -0.910  13.870  1.00 29.76  ? 30  LYS A O     1 
ATOM   219  C  CB    . LYS A 1 48  ? 30.422  -2.808  12.986  1.00 30.99  ? 30  LYS A CB    1 
ATOM   220  C  CG    . LYS A 1 48  ? 30.298  -1.835  11.822  1.00 33.80  ? 30  LYS A CG    1 
ATOM   221  C  CD    . LYS A 1 48  ? 31.227  -2.253  10.689  1.00 33.35  ? 30  LYS A CD    1 
ATOM   222  C  CE    . LYS A 1 48  ? 31.105  -1.338  9.489   1.00 30.41  ? 30  LYS A CE    1 
ATOM   223  N  NZ    . LYS A 1 48  ? 32.092  -1.704  8.440   1.00 31.13  ? 30  LYS A NZ    1 
ATOM   224  N  N     . TYR A 1 49  ? 27.414  -3.115  13.887  1.00 28.46  ? 31  TYR A N     1 
ATOM   225  C  CA    . TYR A 1 49  ? 26.000  -2.930  13.564  1.00 27.01  ? 31  TYR A CA    1 
ATOM   226  C  C     . TYR A 1 49  ? 25.074  -3.100  14.765  1.00 32.31  ? 31  TYR A C     1 
ATOM   227  O  O     . TYR A 1 49  ? 23.852  -3.148  14.604  1.00 31.38  ? 31  TYR A O     1 
ATOM   228  C  CB    . TYR A 1 49  ? 25.576  -3.868  12.430  1.00 25.50  ? 31  TYR A CB    1 
ATOM   229  C  CG    . TYR A 1 49  ? 26.260  -3.555  11.124  1.00 29.77  ? 31  TYR A CG    1 
ATOM   230  C  CD1   . TYR A 1 49  ? 27.366  -4.282  10.698  1.00 25.93  ? 31  TYR A CD1   1 
ATOM   231  C  CD2   . TYR A 1 49  ? 25.815  -2.513  10.327  1.00 26.92  ? 31  TYR A CD2   1 
ATOM   232  C  CE1   . TYR A 1 49  ? 27.994  -3.985  9.509   1.00 31.31  ? 31  TYR A CE1   1 
ATOM   233  C  CE2   . TYR A 1 49  ? 26.435  -2.210  9.141   1.00 26.66  ? 31  TYR A CE2   1 
ATOM   234  C  CZ    . TYR A 1 49  ? 27.520  -2.944  8.735   1.00 25.68  ? 31  TYR A CZ    1 
ATOM   235  O  OH    . TYR A 1 49  ? 28.129  -2.628  7.550   1.00 26.08  ? 31  TYR A OH    1 
ATOM   236  N  N     . ASN A 1 50  ? 25.663  -3.182  15.958  1.00 34.09  ? 32  ASN A N     1 
ATOM   237  C  CA    . ASN A 1 50  ? 24.909  -3.364  17.198  1.00 36.46  ? 32  ASN A CA    1 
ATOM   238  C  C     . ASN A 1 50  ? 23.916  -4.527  17.127  1.00 36.85  ? 32  ASN A C     1 
ATOM   239  O  O     . ASN A 1 50  ? 22.739  -4.367  17.444  1.00 38.20  ? 32  ASN A O     1 
ATOM   240  C  CB    . ASN A 1 50  ? 24.186  -2.071  17.583  1.00 37.99  ? 32  ASN A CB    1 
ATOM   241  C  CG    . ASN A 1 50  ? 23.821  -2.025  19.056  1.00 42.31  ? 32  ASN A CG    1 
ATOM   242  O  OD1   . ASN A 1 50  ? 24.419  -2.721  19.878  1.00 44.59  ? 32  ASN A OD1   1 
ATOM   243  N  ND2   . ASN A 1 50  ? 22.834  -1.203  19.396  1.00 44.04  ? 32  ASN A ND2   1 
ATOM   244  N  N     . LEU A 1 51  ? 24.399  -5.691  16.704  1.00 34.60  ? 33  LEU A N     1 
ATOM   245  C  CA    . LEU A 1 51  ? 23.543  -6.861  16.524  1.00 34.53  ? 33  LEU A CA    1 
ATOM   246  C  C     . LEU A 1 51  ? 23.594  -7.786  17.736  1.00 39.78  ? 33  LEU A C     1 
ATOM   247  O  O     . LEU A 1 51  ? 24.606  -7.853  18.435  1.00 42.11  ? 33  LEU A O     1 
ATOM   248  C  CB    . LEU A 1 51  ? 23.946  -7.627  15.264  1.00 30.59  ? 33  LEU A CB    1 
ATOM   249  C  CG    . LEU A 1 51  ? 23.960  -6.792  13.981  1.00 27.45  ? 33  LEU A CG    1 
ATOM   250  C  CD1   . LEU A 1 51  ? 24.367  -7.640  12.792  1.00 28.43  ? 33  LEU A CD1   1 
ATOM   251  C  CD2   . LEU A 1 51  ? 22.602  -6.145  13.745  1.00 25.77  ? 33  LEU A CD2   1 
ATOM   252  N  N     . LYS A 1 52  ? 22.502  -8.505  17.967  1.00 41.13  ? 34  LYS A N     1 
ATOM   253  C  CA    . LYS A 1 52  ? 22.363  -9.338  19.155  1.00 47.61  ? 34  LYS A CA    1 
ATOM   254  C  C     . LYS A 1 52  ? 22.168  -10.811 18.804  1.00 49.95  ? 34  LYS A C     1 
ATOM   255  O  O     . LYS A 1 52  ? 21.725  -11.144 17.702  1.00 48.14  ? 34  LYS A O     1 
ATOM   256  C  CB    . LYS A 1 52  ? 21.190  -8.839  20.004  1.00 51.18  ? 34  LYS A CB    1 
ATOM   257  C  CG    . LYS A 1 52  ? 21.336  -7.395  20.462  1.00 56.88  ? 34  LYS A CG    1 
ATOM   258  C  CD    . LYS A 1 52  ? 19.984  -6.703  20.589  1.00 61.63  ? 34  LYS A CD    1 
ATOM   259  C  CE    . LYS A 1 52  ? 19.100  -7.369  21.635  1.00 66.13  ? 34  LYS A CE    1 
ATOM   260  N  NZ    . LYS A 1 52  ? 17.782  -6.682  21.778  1.00 66.15  ? 34  LYS A NZ    1 
ATOM   261  N  N     . LYS A 1 53  ? 22.502  -11.680 19.754  1.00 53.60  ? 35  LYS A N     1 
ATOM   262  C  CA    . LYS A 1 53  ? 22.370  -13.128 19.599  1.00 55.65  ? 35  LYS A CA    1 
ATOM   263  C  C     . LYS A 1 53  ? 20.948  -13.559 19.244  1.00 49.79  ? 35  LYS A C     1 
ATOM   264  O  O     . LYS A 1 53  ? 19.980  -13.081 19.838  1.00 49.90  ? 35  LYS A O     1 
ATOM   265  C  CB    . LYS A 1 53  ? 22.797  -13.830 20.896  1.00 64.00  ? 35  LYS A CB    1 
ATOM   266  C  CG    . LYS A 1 53  ? 22.823  -15.352 20.810  1.00 70.27  ? 35  LYS A CG    1 
ATOM   267  C  CD    . LYS A 1 53  ? 24.137  -15.853 20.223  1.00 74.83  ? 35  LYS A CD    1 
ATOM   268  C  CE    . LYS A 1 53  ? 24.059  -17.320 19.808  1.00 75.99  ? 35  LYS A CE    1 
ATOM   269  N  NZ    . LYS A 1 53  ? 23.292  -17.504 18.539  1.00 73.26  ? 35  LYS A NZ    1 
ATOM   270  N  N     . ASP A 1 54  ? 20.837  -14.463 18.274  1.00 46.43  ? 36  ASP A N     1 
ATOM   271  C  CA    . ASP A 1 54  ? 19.560  -15.072 17.895  1.00 48.22  ? 36  ASP A CA    1 
ATOM   272  C  C     . ASP A 1 54  ? 18.459  -14.059 17.607  1.00 46.80  ? 36  ASP A C     1 
ATOM   273  O  O     . ASP A 1 54  ? 17.279  -14.350 17.788  1.00 48.35  ? 36  ASP A O     1 
ATOM   274  C  CB    . ASP A 1 54  ? 19.083  -16.047 18.977  1.00 53.77  ? 36  ASP A CB    1 
ATOM   275  C  CG    . ASP A 1 54  ? 19.958  -17.280 19.080  1.00 59.44  ? 36  ASP A CG    1 
ATOM   276  O  OD1   . ASP A 1 54  ? 20.160  -17.778 20.210  1.00 63.45  ? 36  ASP A OD1   1 
ATOM   277  O  OD2   . ASP A 1 54  ? 20.443  -17.751 18.030  1.00 59.79  ? 36  ASP A OD2   1 
ATOM   278  N  N     . ASN A 1 55  ? 18.845  -12.872 17.160  1.00 43.41  ? 37  ASN A N     1 
ATOM   279  C  CA    . ASN A 1 55  ? 17.878  -11.807 16.953  1.00 40.84  ? 37  ASN A CA    1 
ATOM   280  C  C     . ASN A 1 55  ? 17.726  -11.442 15.480  1.00 33.16  ? 37  ASN A C     1 
ATOM   281  O  O     . ASN A 1 55  ? 18.523  -11.849 14.636  1.00 28.05  ? 37  ASN A O     1 
ATOM   282  C  CB    . ASN A 1 55  ? 18.272  -10.570 17.768  1.00 44.73  ? 37  ASN A CB    1 
ATOM   283  C  CG    . ASN A 1 55  ? 17.101  -9.640  18.017  1.00 47.82  ? 37  ASN A CG    1 
ATOM   284  O  OD1   . ASN A 1 55  ? 15.947  -10.074 18.050  1.00 47.41  ? 37  ASN A OD1   1 
ATOM   285  N  ND2   . ASN A 1 55  ? 17.390  -8.352  18.188  1.00 49.93  ? 37  ASN A ND2   1 
ATOM   286  N  N     . ILE A 1 56  ? 16.684  -10.681 15.180  1.00 32.95  ? 38  ILE A N     1 
ATOM   287  C  CA    . ILE A 1 56  ? 16.501  -10.132 13.849  1.00 31.83  ? 38  ILE A CA    1 
ATOM   288  C  C     . ILE A 1 56  ? 16.082  -8.667  13.969  1.00 29.46  ? 38  ILE A C     1 
ATOM   289  O  O     . ILE A 1 56  ? 15.253  -8.316  14.806  1.00 30.77  ? 38  ILE A O     1 
ATOM   290  C  CB    . ILE A 1 56  ? 15.484  -10.969 13.015  1.00 30.04  ? 38  ILE A CB    1 
ATOM   291  C  CG1   . ILE A 1 56  ? 15.375  -10.439 11.578  1.00 32.52  ? 38  ILE A CG1   1 
ATOM   292  C  CG2   . ILE A 1 56  ? 14.129  -11.037 13.706  1.00 29.82  ? 38  ILE A CG2   1 
ATOM   293  C  CD1   . ILE A 1 56  ? 14.269  -9.411  11.346  1.00 33.55  ? 38  ILE A CD1   1 
ATOM   294  N  N     . VAL A 1 57  ? 16.687  -7.812  13.153  1.00 26.25  ? 39  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 57  ? 16.267  -6.422  13.064  1.00 25.09  ? 39  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 57  ? 15.971  -6.054  11.614  1.00 26.70  ? 39  VAL A C     1 
ATOM   297  O  O     . VAL A 1 57  ? 16.557  -6.621  10.685  1.00 30.22  ? 39  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 57  ? 17.323  -5.451  13.650  1.00 28.12  ? 39  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 57  ? 17.575  -5.769  15.110  1.00 34.94  ? 39  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 57  ? 18.624  -5.510  12.863  1.00 24.51  ? 39  VAL A CG2   1 
ATOM   301  N  N     . LEU A 1 58  ? 15.043  -5.122  11.426  1.00 23.42  ? 40  LEU A N     1 
ATOM   302  C  CA    . LEU A 1 58  ? 14.760  -4.584  10.107  1.00 21.99  ? 40  LEU A CA    1 
ATOM   303  C  C     . LEU A 1 58  ? 15.779  -3.492  9.823   1.00 26.20  ? 40  LEU A C     1 
ATOM   304  O  O     . LEU A 1 58  ? 15.946  -2.575  10.629  1.00 30.09  ? 40  LEU A O     1 
ATOM   305  C  CB    . LEU A 1 58  ? 13.344  -4.009  10.061  1.00 21.03  ? 40  LEU A CB    1 
ATOM   306  C  CG    . LEU A 1 58  ? 12.191  -4.983  10.338  1.00 23.89  ? 40  LEU A CG    1 
ATOM   307  C  CD1   . LEU A 1 58  ? 10.851  -4.269  10.284  1.00 23.61  ? 40  LEU A CD1   1 
ATOM   308  C  CD2   . LEU A 1 58  ? 12.201  -6.153  9.360   1.00 17.94  ? 40  LEU A CD2   1 
ATOM   309  N  N     . ALA A 1 59  ? 16.459  -3.595  8.684   1.00 26.89  ? 41  ALA A N     1 
ATOM   310  C  CA    . ALA A 1 59  ? 17.490  -2.631  8.297   1.00 29.11  ? 41  ALA A CA    1 
ATOM   311  C  C     . ALA A 1 59  ? 17.026  -1.181  8.402   1.00 33.62  ? 41  ALA A C     1 
ATOM   312  O  O     . ALA A 1 59  ? 15.974  -0.811  7.880   1.00 35.51  ? 41  ALA A O     1 
ATOM   313  C  CB    . ALA A 1 59  ? 17.994  -2.917  6.887   1.00 24.33  ? 41  ALA A CB    1 
ATOM   314  N  N     . GLU A 1 60  ? 17.813  -0.381  9.111   1.00 34.78  ? 42  GLU A N     1 
ATOM   315  C  CA    . GLU A 1 60  ? 17.671  1.066   9.113   1.00 35.50  ? 42  GLU A CA    1 
ATOM   316  C  C     . GLU A 1 60  ? 18.839  1.600   8.295   1.00 37.40  ? 42  GLU A C     1 
ATOM   317  O  O     . GLU A 1 60  ? 19.652  0.818   7.796   1.00 32.93  ? 42  GLU A O     1 
ATOM   318  C  CB    . GLU A 1 60  ? 17.728  1.608   10.537  1.00 38.31  ? 42  GLU A CB    1 
ATOM   319  C  CG    . GLU A 1 60  ? 16.680  1.016   11.470  1.00 43.45  ? 42  GLU A CG    1 
ATOM   320  C  CD    . GLU A 1 60  ? 16.895  1.417   12.920  1.00 51.67  ? 42  GLU A CD    1 
ATOM   321  O  OE1   . GLU A 1 60  ? 17.258  2.589   13.169  1.00 57.81  ? 42  GLU A OE1   1 
ATOM   322  O  OE2   . GLU A 1 60  ? 16.711  0.557   13.810  1.00 50.81  ? 42  GLU A OE2   1 
ATOM   323  N  N     . GLU A 1 61  ? 18.936  2.919   8.158   1.00 41.28  ? 43  GLU A N     1 
ATOM   324  C  CA    . GLU A 1 61  ? 19.968  3.499   7.300   1.00 40.80  ? 43  GLU A CA    1 
ATOM   325  C  C     . GLU A 1 61  ? 21.379  3.138   7.770   1.00 34.66  ? 43  GLU A C     1 
ATOM   326  O  O     . GLU A 1 61  ? 22.266  2.890   6.951   1.00 33.00  ? 43  GLU A O     1 
ATOM   327  C  CB    . GLU A 1 61  ? 19.800  5.017   7.169   1.00 46.08  ? 43  GLU A CB    1 
ATOM   328  C  CG    . GLU A 1 61  ? 20.517  5.608   5.958   1.00 52.93  ? 43  GLU A CG    1 
ATOM   329  C  CD    . GLU A 1 61  ? 20.137  4.915   4.649   1.00 58.65  ? 43  GLU A CD    1 
ATOM   330  O  OE1   . GLU A 1 61  ? 18.939  4.608   4.455   1.00 61.92  ? 43  GLU A OE1   1 
ATOM   331  O  OE2   . GLU A 1 61  ? 21.039  4.670   3.814   1.00 57.52  ? 43  GLU A OE2   1 
ATOM   332  N  N     . LYS A 1 62  ? 21.572  3.077   9.086   1.00 29.13  ? 44  LYS A N     1 
ATOM   333  C  CA    . LYS A 1 62  ? 22.868  2.708   9.652   1.00 30.88  ? 44  LYS A CA    1 
ATOM   334  C  C     . LYS A 1 62  ? 23.275  1.266   9.334   1.00 30.20  ? 44  LYS A C     1 
ATOM   335  O  O     . LYS A 1 62  ? 24.449  0.914   9.440   1.00 33.42  ? 44  LYS A O     1 
ATOM   336  C  CB    . LYS A 1 62  ? 22.882  2.931   11.166  1.00 35.17  ? 44  LYS A CB    1 
ATOM   337  C  CG    . LYS A 1 62  ? 21.940  2.036   11.954  1.00 38.14  ? 44  LYS A CG    1 
ATOM   338  C  CD    . LYS A 1 62  ? 21.944  2.405   13.433  1.00 42.99  ? 44  LYS A CD    1 
ATOM   339  C  CE    . LYS A 1 62  ? 21.057  1.472   14.249  1.00 45.89  ? 44  LYS A CE    1 
ATOM   340  N  NZ    . LYS A 1 62  ? 20.819  1.997   15.627  1.00 48.21  ? 44  LYS A NZ    1 
ATOM   341  N  N     . HIS A 1 63  ? 22.307  0.441   8.944   1.00 24.85  ? 45  HIS A N     1 
ATOM   342  C  CA    . HIS A 1 63  ? 22.566  -0.972  8.652   1.00 25.08  ? 45  HIS A CA    1 
ATOM   343  C  C     . HIS A 1 63  ? 22.931  -1.223  7.194   1.00 25.70  ? 45  HIS A C     1 
ATOM   344  O  O     . HIS A 1 63  ? 23.473  -2.271  6.871   1.00 24.34  ? 45  HIS A O     1 
ATOM   345  C  CB    . HIS A 1 63  ? 21.345  -1.830  8.990   1.00 21.79  ? 45  HIS A CB    1 
ATOM   346  C  CG    . HIS A 1 63  ? 20.998  -1.847  10.446  1.00 25.86  ? 45  HIS A CG    1 
ATOM   347  N  ND1   . HIS A 1 63  ? 19.861  -1.251  10.947  1.00 26.76  ? 45  HIS A ND1   1 
ATOM   348  C  CD2   . HIS A 1 63  ? 21.636  -2.392  11.508  1.00 26.25  ? 45  HIS A CD2   1 
ATOM   349  C  CE1   . HIS A 1 63  ? 19.816  -1.426  12.256  1.00 27.74  ? 45  HIS A CE1   1 
ATOM   350  N  NE2   . HIS A 1 63  ? 20.881  -2.115  12.620  1.00 27.50  ? 45  HIS A NE2   1 
ATOM   351  N  N     . MET A 1 64  ? 22.634  -0.261  6.322   1.00 26.71  ? 46  MET A N     1 
ATOM   352  C  CA    . MET A 1 64  ? 22.631  -0.508  4.879   1.00 24.89  ? 46  MET A CA    1 
ATOM   353  C  C     . MET A 1 64  ? 23.953  -0.972  4.281   1.00 26.21  ? 46  MET A C     1 
ATOM   354  O  O     . MET A 1 64  ? 23.958  -1.703  3.293   1.00 27.98  ? 46  MET A O     1 
ATOM   355  C  CB    . MET A 1 64  ? 22.092  0.701   4.110   1.00 25.23  ? 46  MET A CB    1 
ATOM   356  C  CG    . MET A 1 64  ? 20.606  0.939   4.314   1.00 27.71  ? 46  MET A CG    1 
ATOM   357  S  SD    . MET A 1 64  ? 19.597  -0.530  4.001   1.00 35.53  ? 46  MET A SD    1 
ATOM   358  C  CE    . MET A 1 64  ? 17.988  0.078   4.511   1.00 51.51  ? 46  MET A CE    1 
ATOM   359  N  N     . THR A 1 65  ? 25.069  -0.570  4.878   1.00 26.65  ? 47  THR A N     1 
ATOM   360  C  CA    . THR A 1 65  ? 26.377  -0.952  4.340   1.00 27.72  ? 47  THR A CA    1 
ATOM   361  C  C     . THR A 1 65  ? 26.667  -2.442  4.488   1.00 26.93  ? 47  THR A C     1 
ATOM   362  O  O     . THR A 1 65  ? 27.558  -2.966  3.819   1.00 27.47  ? 47  THR A O     1 
ATOM   363  C  CB    . THR A 1 65  ? 27.526  -0.156  4.988   1.00 28.34  ? 47  THR A CB    1 
ATOM   364  O  OG1   . THR A 1 65  ? 27.436  -0.264  6.414   1.00 27.25  ? 47  THR A OG1   1 
ATOM   365  C  CG2   . THR A 1 65  ? 27.462  1.318   4.578   1.00 27.52  ? 47  THR A CG2   1 
ATOM   366  N  N     . ILE A 1 66  ? 25.911  -3.120  5.352   1.00 26.10  ? 48  ILE A N     1 
ATOM   367  C  CA    . ILE A 1 66  ? 26.156  -4.533  5.644   1.00 23.34  ? 48  ILE A CA    1 
ATOM   368  C  C     . ILE A 1 66  ? 26.048  -5.411  4.394   1.00 24.08  ? 48  ILE A C     1 
ATOM   369  O  O     . ILE A 1 66  ? 26.797  -6.378  4.241   1.00 25.88  ? 48  ILE A O     1 
ATOM   370  C  CB    . ILE A 1 66  ? 25.239  -5.073  6.784   1.00 25.20  ? 48  ILE A CB    1 
ATOM   371  C  CG1   . ILE A 1 66  ? 25.843  -6.326  7.407   1.00 28.89  ? 48  ILE A CG1   1 
ATOM   372  C  CG2   . ILE A 1 66  ? 23.817  -5.353  6.289   1.00 21.24  ? 48  ILE A CG2   1 
ATOM   373  C  CD1   . ILE A 1 66  ? 25.004  -6.915  8.523   1.00 31.57  ? 48  ILE A CD1   1 
ATOM   374  N  N     . TYR A 1 67  ? 25.146  -5.055  3.487   1.00 23.89  ? 49  TYR A N     1 
ATOM   375  C  CA    . TYR A 1 67  ? 24.917  -5.868  2.295   1.00 28.84  ? 49  TYR A CA    1 
ATOM   376  C  C     . TYR A 1 67  ? 26.084  -5.803  1.312   1.00 33.58  ? 49  TYR A C     1 
ATOM   377  O  O     . TYR A 1 67  ? 26.485  -6.821  0.752   1.00 36.05  ? 49  TYR A O     1 
ATOM   378  C  CB    . TYR A 1 67  ? 23.584  -5.499  1.635   1.00 24.78  ? 49  TYR A CB    1 
ATOM   379  C  CG    . TYR A 1 67  ? 22.431  -5.635  2.601   1.00 23.18  ? 49  TYR A CG    1 
ATOM   380  C  CD1   . TYR A 1 67  ? 21.958  -6.890  2.976   1.00 25.63  ? 49  TYR A CD1   1 
ATOM   381  C  CD2   . TYR A 1 67  ? 21.836  -4.518  3.162   1.00 21.88  ? 49  TYR A CD2   1 
ATOM   382  C  CE1   . TYR A 1 67  ? 20.914  -7.023  3.874   1.00 25.28  ? 49  TYR A CE1   1 
ATOM   383  C  CE2   . TYR A 1 67  ? 20.793  -4.640  4.063   1.00 23.43  ? 49  TYR A CE2   1 
ATOM   384  C  CZ    . TYR A 1 67  ? 20.338  -5.890  4.416   1.00 24.35  ? 49  TYR A CZ    1 
ATOM   385  O  OH    . TYR A 1 67  ? 19.301  -6.003  5.311   1.00 23.72  ? 49  TYR A OH    1 
ATOM   386  N  N     . ASP A 1 68  ? 26.637  -4.612  1.114   1.00 38.34  ? 50  ASP A N     1 
ATOM   387  C  CA    . ASP A 1 68  ? 27.842  -4.471  0.305   1.00 41.13  ? 50  ASP A CA    1 
ATOM   388  C  C     . ASP A 1 68  ? 29.020  -5.113  1.022   1.00 38.76  ? 50  ASP A C     1 
ATOM   389  O  O     . ASP A 1 68  ? 29.896  -5.707  0.392   1.00 41.20  ? 50  ASP A O     1 
ATOM   390  C  CB    . ASP A 1 68  ? 28.148  -2.998  0.030   1.00 47.34  ? 50  ASP A CB    1 
ATOM   391  C  CG    . ASP A 1 68  ? 27.198  -2.379  -0.979  1.00 52.26  ? 50  ASP A CG    1 
ATOM   392  O  OD1   . ASP A 1 68  ? 26.751  -3.099  -1.897  1.00 53.25  ? 50  ASP A OD1   1 
ATOM   393  O  OD2   . ASP A 1 68  ? 26.902  -1.170  -0.853  1.00 55.01  ? 50  ASP A OD2   1 
ATOM   394  N  N     . GLU A 1 69  ? 29.026  -5.000  2.347   1.00 33.32  ? 51  GLU A N     1 
ATOM   395  C  CA    . GLU A 1 69  ? 30.137  -5.491  3.151   1.00 30.90  ? 51  GLU A CA    1 
ATOM   396  C  C     . GLU A 1 69  ? 30.271  -7.016  3.126   1.00 29.40  ? 51  GLU A C     1 
ATOM   397  O  O     . GLU A 1 69  ? 31.359  -7.539  2.884   1.00 29.03  ? 51  GLU A O     1 
ATOM   398  C  CB    . GLU A 1 69  ? 30.035  -4.985  4.592   1.00 30.27  ? 51  GLU A CB    1 
ATOM   399  C  CG    . GLU A 1 69  ? 31.274  -5.276  5.423   1.00 33.59  ? 51  GLU A CG    1 
ATOM   400  C  CD    . GLU A 1 69  ? 31.354  -4.435  6.686   1.00 36.79  ? 51  GLU A CD    1 
ATOM   401  O  OE1   . GLU A 1 69  ? 30.314  -3.888  7.113   1.00 35.94  ? 51  GLU A OE1   1 
ATOM   402  O  OE2   . GLU A 1 69  ? 32.462  -4.320  7.251   1.00 38.26  ? 51  GLU A OE2   1 
ATOM   403  N  N     . ILE A 1 70  ? 29.176  -7.729  3.371   1.00 28.77  ? 52  ILE A N     1 
ATOM   404  C  CA    . ILE A 1 70  ? 29.232  -9.192  3.376   1.00 32.49  ? 52  ILE A CA    1 
ATOM   405  C  C     . ILE A 1 70  ? 29.427  -9.753  1.970   1.00 35.47  ? 52  ILE A C     1 
ATOM   406  O  O     . ILE A 1 70  ? 29.812  -10.907 1.802   1.00 36.05  ? 52  ILE A O     1 
ATOM   407  C  CB    . ILE A 1 70  ? 27.977  -9.827  4.001   1.00 31.31  ? 52  ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 70  ? 26.752  -9.559  3.126   1.00 31.11  ? 52  ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 70  ? 27.769  -9.324  5.419   1.00 29.19  ? 52  ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 70  ? 25.485  -10.173 3.665   1.00 31.86  ? 52  ILE A CD1   1 
ATOM   411  N  N     . GLN A 1 71  ? 29.169  -8.928  0.961   1.00 40.21  ? 53  GLN A N     1 
ATOM   412  C  CA    . GLN A 1 71  ? 29.328  -9.345  -0.427  1.00 46.00  ? 53  GLN A CA    1 
ATOM   413  C  C     . GLN A 1 71  ? 30.807  -9.425  -0.804  1.00 49.51  ? 53  GLN A C     1 
ATOM   414  O  O     . GLN A 1 71  ? 31.164  -9.910  -1.879  1.00 52.73  ? 53  GLN A O     1 
ATOM   415  C  CB    . GLN A 1 71  ? 28.581  -8.389  -1.361  1.00 48.16  ? 53  GLN A CB    1 
ATOM   416  C  CG    . GLN A 1 71  ? 28.105  -9.029  -2.653  1.00 50.63  ? 53  GLN A CG    1 
ATOM   417  C  CD    . GLN A 1 71  ? 27.180  -10.212 -2.413  1.00 51.17  ? 53  GLN A CD    1 
ATOM   418  O  OE1   . GLN A 1 71  ? 27.348  -11.275 -3.013  1.00 53.96  ? 53  GLN A OE1   1 
ATOM   419  N  NE2   . GLN A 1 71  ? 26.193  -10.031 -1.538  1.00 45.77  ? 53  GLN A NE2   1 
ATOM   420  N  N     . LYS A 1 72  ? 31.664  -8.950  0.093   1.00 48.91  ? 54  LYS A N     1 
ATOM   421  C  CA    . LYS A 1 72  ? 33.104  -9.016  -0.110  1.00 50.70  ? 54  LYS A CA    1 
ATOM   422  C  C     . LYS A 1 72  ? 33.658  -10.292 0.513   1.00 50.98  ? 54  LYS A C     1 
ATOM   423  O  O     . LYS A 1 72  ? 34.826  -10.635 0.333   1.00 52.60  ? 54  LYS A O     1 
ATOM   424  C  CB    . LYS A 1 72  ? 33.779  -7.784  0.494   1.00 49.57  ? 54  LYS A CB    1 
ATOM   425  C  CG    . LYS A 1 72  ? 33.355  -6.488  -0.168  1.00 50.12  ? 54  LYS A CG    1 
ATOM   426  C  CD    . LYS A 1 72  ? 33.859  -5.275  0.584   1.00 51.59  ? 54  LYS A CD    1 
ATOM   427  C  CE    . LYS A 1 72  ? 33.562  -4.007  -0.196  1.00 53.40  ? 54  LYS A CE    1 
ATOM   428  N  NZ    . LYS A 1 72  ? 34.257  -4.007  -1.516  1.00 55.48  ? 54  LYS A NZ    1 
ATOM   429  N  N     . LYS A 1 73  ? 32.802  -10.990 1.246   1.00 51.21  ? 55  LYS A N     1 
ATOM   430  C  CA    . LYS A 1 73  ? 33.181  -12.236 1.890   1.00 52.58  ? 55  LYS A CA    1 
ATOM   431  C  C     . LYS A 1 73  ? 33.040  -13.392 0.909   1.00 51.21  ? 55  LYS A C     1 
ATOM   432  O  O     . LYS A 1 73  ? 32.130  -13.405 0.080   1.00 50.45  ? 55  LYS A O     1 
ATOM   433  C  CB    . LYS A 1 73  ? 32.294  -12.482 3.111   1.00 53.50  ? 55  LYS A CB    1 
ATOM   434  C  CG    . LYS A 1 73  ? 33.034  -13.020 4.316   1.00 58.49  ? 55  LYS A CG    1 
ATOM   435  C  CD    . LYS A 1 73  ? 34.016  -11.993 4.851   1.00 61.88  ? 55  LYS A CD    1 
ATOM   436  C  CE    . LYS A 1 73  ? 34.803  -12.543 6.031   1.00 65.40  ? 55  LYS A CE    1 
ATOM   437  N  NZ    . LYS A 1 73  ? 35.796  -11.557 6.544   1.00 68.40  ? 55  LYS A NZ    1 
ATOM   438  N  N     . LYS A 1 74  ? 33.949  -14.357 0.997   1.00 51.93  ? 56  LYS A N     1 
ATOM   439  C  CA    . LYS A 1 74  ? 33.828  -15.586 0.224   1.00 53.53  ? 56  LYS A CA    1 
ATOM   440  C  C     . LYS A 1 74  ? 32.866  -16.532 0.933   1.00 53.05  ? 56  LYS A C     1 
ATOM   441  O  O     . LYS A 1 74  ? 32.359  -16.208 2.008   1.00 53.40  ? 56  LYS A O     1 
ATOM   442  C  CB    . LYS A 1 74  ? 35.195  -16.251 0.057   1.00 55.92  ? 56  LYS A CB    1 
ATOM   443  C  CG    . LYS A 1 74  ? 36.194  -15.425 -0.734  1.00 58.34  ? 56  LYS A CG    1 
ATOM   444  C  CD    . LYS A 1 74  ? 37.542  -16.123 -0.829  1.00 62.40  ? 56  LYS A CD    1 
ATOM   445  C  CE    . LYS A 1 74  ? 38.504  -15.348 -1.725  1.00 64.58  ? 56  LYS A CE    1 
ATOM   446  N  NZ    . LYS A 1 74  ? 38.665  -13.929 -1.291  1.00 62.37  ? 56  LYS A NZ    1 
ATOM   447  N  N     . LYS A 1 75  ? 32.608  -17.687 0.325   1.00 52.27  ? 57  LYS A N     1 
ATOM   448  C  CA    . LYS A 1 75  ? 31.798  -18.736 0.944   1.00 54.32  ? 57  LYS A CA    1 
ATOM   449  C  C     . LYS A 1 75  ? 30.358  -18.312 1.248   1.00 51.93  ? 57  LYS A C     1 
ATOM   450  O  O     . LYS A 1 75  ? 29.729  -18.849 2.164   1.00 52.37  ? 57  LYS A O     1 
ATOM   451  C  CB    . LYS A 1 75  ? 32.464  -19.243 2.230   1.00 58.73  ? 57  LYS A CB    1 
ATOM   452  C  CG    . LYS A 1 75  ? 33.677  -20.133 2.022   1.00 63.49  ? 57  LYS A CG    1 
ATOM   453  C  CD    . LYS A 1 75  ? 33.264  -21.573 1.772   1.00 65.85  ? 57  LYS A CD    1 
ATOM   454  C  CE    . LYS A 1 75  ? 34.446  -22.518 1.926   1.00 69.63  ? 57  LYS A CE    1 
ATOM   455  N  NZ    . LYS A 1 75  ? 35.548  -22.199 0.974   1.00 71.99  ? 57  LYS A NZ    1 
ATOM   456  N  N     . LEU A 1 76  ? 29.836  -17.354 0.490   1.00 46.13  ? 58  LEU A N     1 
ATOM   457  C  CA    . LEU A 1 76  ? 28.457  -16.924 0.680   1.00 40.00  ? 58  LEU A CA    1 
ATOM   458  C  C     . LEU A 1 76  ? 27.480  -18.019 0.264   1.00 39.36  ? 58  LEU A C     1 
ATOM   459  O  O     . LEU A 1 76  ? 27.641  -18.641 -0.783  1.00 39.93  ? 58  LEU A O     1 
ATOM   460  C  CB    . LEU A 1 76  ? 28.171  -15.642 -0.106  1.00 36.96  ? 58  LEU A CB    1 
ATOM   461  C  CG    . LEU A 1 76  ? 28.755  -14.336 0.432   1.00 36.41  ? 58  LEU A CG    1 
ATOM   462  C  CD1   . LEU A 1 76  ? 28.475  -13.192 -0.530  1.00 37.45  ? 58  LEU A CD1   1 
ATOM   463  C  CD2   . LEU A 1 76  ? 28.190  -14.024 1.803   1.00 33.60  ? 58  LEU A CD2   1 
ATOM   464  N  N     . ASN A 1 77  ? 26.467  -18.252 1.091   1.00 38.44  ? 59  ASN A N     1 
ATOM   465  C  CA    . ASN A 1 77  ? 25.410  -19.196 0.757   1.00 37.78  ? 59  ASN A CA    1 
ATOM   466  C  C     . ASN A 1 77  ? 24.100  -18.461 0.493   1.00 32.59  ? 59  ASN A C     1 
ATOM   467  O  O     . ASN A 1 77  ? 23.551  -17.815 1.379   1.00 31.51  ? 59  ASN A O     1 
ATOM   468  C  CB    . ASN A 1 77  ? 25.235  -20.233 1.873   1.00 40.55  ? 59  ASN A CB    1 
ATOM   469  C  CG    . ASN A 1 77  ? 24.179  -21.283 1.545   1.00 40.92  ? 59  ASN A CG    1 
ATOM   470  O  OD1   . ASN A 1 77  ? 23.769  -21.439 0.393   1.00 41.54  ? 59  ASN A OD1   1 
ATOM   471  N  ND2   . ASN A 1 77  ? 23.742  -22.015 2.564   1.00 39.08  ? 59  ASN A ND2   1 
ATOM   472  N  N     . TYR A 1 78  ? 23.614  -18.557 -0.739  1.00 29.66  ? 60  TYR A N     1 
ATOM   473  C  CA    . TYR A 1 78  ? 22.356  -17.936 -1.122  1.00 27.49  ? 60  TYR A CA    1 
ATOM   474  C  C     . TYR A 1 78  ? 21.271  -18.994 -1.098  1.00 27.73  ? 60  TYR A C     1 
ATOM   475  O  O     . TYR A 1 78  ? 21.415  -20.046 -1.720  1.00 28.57  ? 60  TYR A O     1 
ATOM   476  C  CB    . TYR A 1 78  ? 22.455  -17.350 -2.532  1.00 28.36  ? 60  TYR A CB    1 
ATOM   477  C  CG    . TYR A 1 78  ? 23.527  -16.297 -2.705  1.00 26.47  ? 60  TYR A CG    1 
ATOM   478  C  CD1   . TYR A 1 78  ? 23.296  -14.980 -2.339  1.00 29.95  ? 60  TYR A CD1   1 
ATOM   479  C  CD2   . TYR A 1 78  ? 24.762  -16.619 -3.251  1.00 27.48  ? 60  TYR A CD2   1 
ATOM   480  C  CE1   . TYR A 1 78  ? 24.272  -14.007 -2.505  1.00 32.52  ? 60  TYR A CE1   1 
ATOM   481  C  CE2   . TYR A 1 78  ? 25.746  -15.658 -3.417  1.00 31.57  ? 60  TYR A CE2   1 
ATOM   482  C  CZ    . TYR A 1 78  ? 25.493  -14.352 -3.044  1.00 34.20  ? 60  TYR A CZ    1 
ATOM   483  O  OH    . TYR A 1 78  ? 26.463  -13.390 -3.206  1.00 38.22  ? 60  TYR A OH    1 
ATOM   484  N  N     . ILE A 1 79  ? 20.186  -18.727 -0.381  1.00 23.96  ? 61  ILE A N     1 
ATOM   485  C  CA    . ILE A 1 79  ? 19.114  -19.708 -0.272  1.00 25.42  ? 61  ILE A CA    1 
ATOM   486  C  C     . ILE A 1 79  ? 17.786  -19.019 0.024   1.00 23.96  ? 61  ILE A C     1 
ATOM   487  O  O     . ILE A 1 79  ? 17.743  -18.046 0.774   1.00 23.10  ? 61  ILE A O     1 
ATOM   488  C  CB    . ILE A 1 79  ? 19.448  -20.797 0.789   1.00 29.55  ? 61  ILE A CB    1 
ATOM   489  C  CG1   . ILE A 1 79  ? 18.385  -21.896 0.811   1.00 33.14  ? 61  ILE A CG1   1 
ATOM   490  C  CG2   . ILE A 1 79  ? 19.624  -20.187 2.170   1.00 29.06  ? 61  ILE A CG2   1 
ATOM   491  C  CD1   . ILE A 1 79  ? 18.785  -23.110 1.654   1.00 37.64  ? 61  ILE A CD1   1 
ATOM   492  N  N     . ALA A 1 80  ? 16.714  -19.506 -0.595  1.00 21.37  ? 62  ALA A N     1 
ATOM   493  C  CA    . ALA A 1 80  ? 15.386  -18.937 -0.393  1.00 21.44  ? 62  ALA A CA    1 
ATOM   494  C  C     . ALA A 1 80  ? 14.998  -18.929 1.081   1.00 20.20  ? 62  ALA A C     1 
ATOM   495  O  O     . ALA A 1 80  ? 15.198  -19.914 1.794   1.00 23.05  ? 62  ALA A O     1 
ATOM   496  C  CB    . ALA A 1 80  ? 14.352  -19.698 -1.210  1.00 20.31  ? 62  ALA A CB    1 
ATOM   497  N  N     . GLY A 1 81  ? 14.447  -17.806 1.531   1.00 18.49  ? 63  GLY A N     1 
ATOM   498  C  CA    . GLY A 1 81  ? 14.042  -17.648 2.918   1.00 17.74  ? 63  GLY A CA    1 
ATOM   499  C  C     . GLY A 1 81  ? 12.643  -17.075 3.054   1.00 23.60  ? 63  GLY A C     1 
ATOM   500  O  O     . GLY A 1 81  ? 11.806  -17.233 2.163   1.00 23.10  ? 63  GLY A O     1 
ATOM   501  N  N     . GLY A 1 82  ? 12.388  -16.400 4.171   1.00 25.68  ? 64  GLY A N     1 
ATOM   502  C  CA    . GLY A 1 82  ? 11.052  -15.920 4.484   1.00 13.73  ? 64  GLY A CA    1 
ATOM   503  C  C     . GLY A 1 82  ? 10.350  -16.881 5.432   1.00 14.97  ? 64  GLY A C     1 
ATOM   504  O  O     . GLY A 1 82  ? 10.122  -18.048 5.092   1.00 20.33  ? 64  GLY A O     1 
ATOM   505  N  N     . ALA A 1 83  ? 10.004  -16.387 6.618   1.00 19.66  ? 65  ALA A N     1 
ATOM   506  C  CA    . ALA A 1 83  ? 9.494   -17.233 7.691   1.00 19.77  ? 65  ALA A CA    1 
ATOM   507  C  C     . ALA A 1 83  ? 8.234   -18.012 7.308   1.00 16.79  ? 65  ALA A C     1 
ATOM   508  O  O     . ALA A 1 83  ? 8.175   -19.226 7.492   1.00 18.70  ? 65  ALA A O     1 
ATOM   509  C  CB    . ALA A 1 83  ? 9.253   -16.409 8.954   1.00 12.91  ? 65  ALA A CB    1 
ATOM   510  N  N     . THR A 1 84  ? 7.237   -17.313 6.777   1.00 15.67  ? 66  THR A N     1 
ATOM   511  C  CA    . THR A 1 84  ? 5.982   -17.950 6.402   1.00 17.25  ? 66  THR A CA    1 
ATOM   512  C  C     . THR A 1 84  ? 6.206   -18.942 5.267   1.00 19.59  ? 66  THR A C     1 
ATOM   513  O  O     . THR A 1 84  ? 5.669   -20.049 5.284   1.00 20.09  ? 66  THR A O     1 
ATOM   514  C  CB    . THR A 1 84  ? 4.917   -16.920 5.970   1.00 18.83  ? 66  THR A CB    1 
ATOM   515  O  OG1   . THR A 1 84  ? 4.673   -15.992 7.035   1.00 17.82  ? 66  THR A OG1   1 
ATOM   516  C  CG2   . THR A 1 84  ? 3.607   -17.621 5.596   1.00 15.83  ? 66  THR A CG2   1 
ATOM   517  N  N     . LEU A 1 85  ? 7.012   -18.538 4.290   1.00 18.66  ? 67  LEU A N     1 
ATOM   518  C  CA    . LEU A 1 85  ? 7.295   -19.382 3.142   1.00 17.75  ? 67  LEU A CA    1 
ATOM   519  C  C     . LEU A 1 85  ? 8.034   -20.660 3.555   1.00 17.48  ? 67  LEU A C     1 
ATOM   520  O  O     . LEU A 1 85  ? 7.709   -21.742 3.069   1.00 17.16  ? 67  LEU A O     1 
ATOM   521  C  CB    . LEU A 1 85  ? 8.064   -18.608 2.058   1.00 15.82  ? 67  LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 85  ? 8.476   -19.420 0.825   1.00 17.50  ? 67  LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 85  ? 7.268   -20.114 0.183   1.00 16.25  ? 67  LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 85  ? 9.212   -18.553 -0.203  1.00 15.26  ? 67  LEU A CD2   1 
ATOM   525  N  N     . ASN A 1 86  ? 9.011   -20.529 4.455   1.00 16.30  ? 68  ASN A N     1 
ATOM   526  C  CA    . ASN A 1 86  ? 9.721   -21.688 4.996   1.00 17.64  ? 68  ASN A CA    1 
ATOM   527  C  C     . ASN A 1 86  ? 8.745   -22.724 5.567   1.00 21.39  ? 68  ASN A C     1 
ATOM   528  O  O     . ASN A 1 86  ? 8.809   -23.910 5.235   1.00 20.49  ? 68  ASN A O     1 
ATOM   529  C  CB    . ASN A 1 86  ? 10.706  -21.276 6.100   1.00 16.58  ? 68  ASN A CB    1 
ATOM   530  C  CG    . ASN A 1 86  ? 11.953  -20.577 5.570   1.00 19.86  ? 68  ASN A CG    1 
ATOM   531  O  OD1   . ASN A 1 86  ? 12.239  -20.587 4.371   1.00 22.23  ? 68  ASN A OD1   1 
ATOM   532  N  ND2   . ASN A 1 86  ? 12.719  -19.985 6.484   1.00 15.83  ? 68  ASN A ND2   1 
ATOM   533  N  N     . THR A 1 87  ? 7.835   -22.254 6.414   1.00 19.89  ? 69  THR A N     1 
ATOM   534  C  CA    . THR A 1 87  ? 6.867   -23.116 7.081   1.00 19.74  ? 69  THR A CA    1 
ATOM   535  C  C     . THR A 1 87  ? 5.904   -23.778 6.100   1.00 21.06  ? 69  THR A C     1 
ATOM   536  O  O     . THR A 1 87  ? 5.703   -24.993 6.133   1.00 22.93  ? 69  THR A O     1 
ATOM   537  C  CB    . THR A 1 87  ? 6.071   -22.321 8.140   1.00 14.75  ? 69  THR A CB    1 
ATOM   538  O  OG1   . THR A 1 87  ? 6.953   -21.934 9.200   1.00 17.05  ? 69  THR A OG1   1 
ATOM   539  C  CG2   . THR A 1 87  ? 4.939   -23.156 8.719   1.00 15.40  ? 69  THR A CG2   1 
ATOM   540  N  N     . VAL A 1 88  ? 5.318   -22.978 5.217   1.00 20.56  ? 70  VAL A N     1 
ATOM   541  C  CA    . VAL A 1 88  ? 4.320   -23.486 4.284   1.00 20.31  ? 70  VAL A CA    1 
ATOM   542  C  C     . VAL A 1 88  ? 4.901   -24.473 3.272   1.00 20.44  ? 70  VAL A C     1 
ATOM   543  O  O     . VAL A 1 88  ? 4.287   -25.494 2.969   1.00 22.86  ? 70  VAL A O     1 
ATOM   544  C  CB    . VAL A 1 88  ? 3.596   -22.330 3.574   1.00 23.08  ? 70  VAL A CB    1 
ATOM   545  C  CG1   . VAL A 1 88  ? 2.755   -22.844 2.406   1.00 23.06  ? 70  VAL A CG1   1 
ATOM   546  C  CG2   . VAL A 1 88  ? 2.742   -21.575 4.574   1.00 22.29  ? 70  VAL A CG2   1 
ATOM   547  N  N     . LYS A 1 89  ? 6.093   -24.192 2.761   1.00 22.50  ? 71  LYS A N     1 
ATOM   548  C  CA    . LYS A 1 89  ? 6.678   -25.101 1.786   1.00 22.42  ? 71  LYS A CA    1 
ATOM   549  C  C     . LYS A 1 89  ? 7.150   -26.401 2.437   1.00 21.90  ? 71  LYS A C     1 
ATOM   550  O  O     . LYS A 1 89  ? 7.170   -27.448 1.794   1.00 23.84  ? 71  LYS A O     1 
ATOM   551  C  CB    . LYS A 1 89  ? 7.786   -24.428 0.967   1.00 23.71  ? 71  LYS A CB    1 
ATOM   552  C  CG    . LYS A 1 89  ? 9.093   -24.174 1.693   1.00 23.90  ? 71  LYS A CG    1 
ATOM   553  C  CD    . LYS A 1 89  ? 10.035  -23.366 0.793   1.00 25.27  ? 71  LYS A CD    1 
ATOM   554  C  CE    . LYS A 1 89  ? 11.452  -23.332 1.346   1.00 26.23  ? 71  LYS A CE    1 
ATOM   555  N  NZ    . LYS A 1 89  ? 12.373  -22.562 0.462   1.00 26.54  ? 71  LYS A NZ    1 
ATOM   556  N  N     . MET A 1 90  ? 7.509   -26.350 3.716   1.00 22.06  ? 72  MET A N     1 
ATOM   557  C  CA    . MET A 1 90  ? 7.869   -27.585 4.407   1.00 20.39  ? 72  MET A CA    1 
ATOM   558  C  C     . MET A 1 90  ? 6.625   -28.409 4.744   1.00 21.49  ? 72  MET A C     1 
ATOM   559  O  O     . MET A 1 90  ? 6.670   -29.638 4.700   1.00 23.92  ? 72  MET A O     1 
ATOM   560  C  CB    . MET A 1 90  ? 8.716   -27.338 5.657   1.00 20.02  ? 72  MET A CB    1 
ATOM   561  C  CG    . MET A 1 90  ? 9.223   -28.635 6.291   1.00 21.89  ? 72  MET A CG    1 
ATOM   562  S  SD    . MET A 1 90  ? 10.413  -28.377 7.623   1.00 22.67  ? 72  MET A SD    1 
ATOM   563  C  CE    . MET A 1 90  ? 10.992  -30.051 7.914   1.00 19.54  ? 72  MET A CE    1 
ATOM   564  N  N     . ILE A 1 91  ? 5.519   -27.743 5.072   1.00 22.20  ? 73  ILE A N     1 
ATOM   565  C  CA    . ILE A 1 91  ? 4.249   -28.452 5.240   1.00 23.41  ? 73  ILE A CA    1 
ATOM   566  C  C     . ILE A 1 91  ? 3.947   -29.223 3.956   1.00 26.68  ? 73  ILE A C     1 
ATOM   567  O  O     . ILE A 1 91  ? 3.566   -30.392 3.988   1.00 24.94  ? 73  ILE A O     1 
ATOM   568  C  CB    . ILE A 1 91  ? 3.080   -27.494 5.523   1.00 19.82  ? 73  ILE A CB    1 
ATOM   569  C  CG1   . ILE A 1 91  ? 3.258   -26.802 6.874   1.00 19.10  ? 73  ILE A CG1   1 
ATOM   570  C  CG2   . ILE A 1 91  ? 1.747   -28.244 5.492   1.00 20.46  ? 73  ILE A CG2   1 
ATOM   571  C  CD1   . ILE A 1 91  ? 2.160   -25.807 7.194   1.00 17.83  ? 73  ILE A CD1   1 
ATOM   572  N  N     . GLN A 1 92  ? 4.145   -28.553 2.825   1.00 26.98  ? 74  GLN A N     1 
ATOM   573  C  CA    . GLN A 1 92  ? 3.949   -29.152 1.512   1.00 23.76  ? 74  GLN A CA    1 
ATOM   574  C  C     . GLN A 1 92  ? 4.902   -30.329 1.278   1.00 25.10  ? 74  GLN A C     1 
ATOM   575  O  O     . GLN A 1 92  ? 4.500   -31.376 0.771   1.00 27.83  ? 74  GLN A O     1 
ATOM   576  C  CB    . GLN A 1 92  ? 4.129   -28.081 0.426   1.00 20.86  ? 74  GLN A CB    1 
ATOM   577  C  CG    . GLN A 1 92  ? 4.120   -28.620 -1.003  1.00 25.02  ? 74  GLN A CG    1 
ATOM   578  C  CD    . GLN A 1 92  ? 2.767   -29.169 -1.414  1.00 29.51  ? 74  GLN A CD    1 
ATOM   579  O  OE1   . GLN A 1 92  ? 1.748   -28.482 -1.307  1.00 31.18  ? 74  GLN A OE1   1 
ATOM   580  N  NE2   . GLN A 1 92  ? 2.749   -30.415 -1.884  1.00 30.44  ? 74  GLN A NE2   1 
ATOM   581  N  N     . TRP A 1 93  ? 6.161   -30.147 1.656   1.00 21.00  ? 75  TRP A N     1 
ATOM   582  C  CA    . TRP A 1 93  ? 7.192   -31.171 1.502   1.00 21.83  ? 75  TRP A CA    1 
ATOM   583  C  C     . TRP A 1 93  ? 6.895   -32.398 2.374   1.00 25.89  ? 75  TRP A C     1 
ATOM   584  O  O     . TRP A 1 93  ? 7.010   -33.544 1.926   1.00 24.12  ? 75  TRP A O     1 
ATOM   585  C  CB    . TRP A 1 93  ? 8.535   -30.547 1.876   1.00 27.21  ? 75  TRP A CB    1 
ATOM   586  C  CG    . TRP A 1 93  ? 9.759   -31.402 1.726   1.00 26.67  ? 75  TRP A CG    1 
ATOM   587  C  CD1   . TRP A 1 93  ? 10.455  -31.655 0.575   1.00 25.28  ? 75  TRP A CD1   1 
ATOM   588  C  CD2   . TRP A 1 93  ? 10.476  -32.056 2.780   1.00 24.06  ? 75  TRP A CD2   1 
ATOM   589  N  NE1   . TRP A 1 93  ? 11.547  -32.448 0.849   1.00 24.72  ? 75  TRP A NE1   1 
ATOM   590  C  CE2   . TRP A 1 93  ? 11.581  -32.705 2.196   1.00 24.09  ? 75  TRP A CE2   1 
ATOM   591  C  CE3   . TRP A 1 93  ? 10.283  -32.164 4.161   1.00 24.25  ? 75  TRP A CE3   1 
ATOM   592  C  CZ2   . TRP A 1 93  ? 12.489  -33.451 2.945   1.00 28.08  ? 75  TRP A CZ2   1 
ATOM   593  C  CZ3   . TRP A 1 93  ? 11.186  -32.904 4.904   1.00 23.96  ? 75  TRP A CZ3   1 
ATOM   594  C  CH2   . TRP A 1 93  ? 12.274  -33.539 4.295   1.00 27.93  ? 75  TRP A CH2   1 
ATOM   595  N  N     . ILE A 1 94  ? 6.504   -32.151 3.620   1.00 23.93  ? 76  ILE A N     1 
ATOM   596  C  CA    . ILE A 1 94  ? 6.145   -33.227 4.533   1.00 26.27  ? 76  ILE A CA    1 
ATOM   597  C  C     . ILE A 1 94  ? 4.962   -34.041 4.015   1.00 28.67  ? 76  ILE A C     1 
ATOM   598  O  O     . ILE A 1 94  ? 5.038   -35.264 3.915   1.00 32.92  ? 76  ILE A O     1 
ATOM   599  C  CB    . ILE A 1 94  ? 5.822   -32.686 5.938   1.00 25.86  ? 76  ILE A CB    1 
ATOM   600  C  CG1   . ILE A 1 94  ? 7.096   -32.143 6.591   1.00 23.49  ? 76  ILE A CG1   1 
ATOM   601  C  CG2   . ILE A 1 94  ? 5.186   -33.781 6.803   1.00 26.66  ? 76  ILE A CG2   1 
ATOM   602  C  CD1   . ILE A 1 94  ? 6.874   -31.477 7.925   1.00 23.85  ? 76  ILE A CD1   1 
ATOM   603  N  N     . ILE A 1 95  ? 3.879   -33.355 3.671   1.00 28.09  ? 77  ILE A N     1 
ATOM   604  C  CA    . ILE A 1 95  ? 2.643   -34.023 3.271   1.00 28.46  ? 77  ILE A CA    1 
ATOM   605  C  C     . ILE A 1 95  ? 2.789   -34.724 1.919   1.00 29.63  ? 77  ILE A C     1 
ATOM   606  O  O     . ILE A 1 95  ? 2.146   -35.744 1.670   1.00 28.04  ? 77  ILE A O     1 
ATOM   607  C  CB    . ILE A 1 95  ? 1.448   -33.044 3.308   1.00 29.62  ? 77  ILE A CB    1 
ATOM   608  C  CG1   . ILE A 1 95  ? 1.260   -32.535 4.744   1.00 29.44  ? 77  ILE A CG1   1 
ATOM   609  C  CG2   . ILE A 1 95  ? 0.179   -33.707 2.800   1.00 26.25  ? 77  ILE A CG2   1 
ATOM   610  C  CD1   . ILE A 1 95  ? 0.091   -31.613 4.941   1.00 30.52  ? 77  ILE A CD1   1 
ATOM   611  N  N     . GLN A 1 96  ? 3.640   -34.170 1.059   1.00 32.33  ? 78  GLN A N     1 
ATOM   612  C  CA    . GLN A 1 96  ? 4.103   -34.867 -0.142  1.00 38.90  ? 78  GLN A CA    1 
ATOM   613  C  C     . GLN A 1 96  ? 3.001   -35.114 -1.177  1.00 41.62  ? 78  GLN A C     1 
ATOM   614  O  O     . GLN A 1 96  ? 3.169   -35.915 -2.093  1.00 45.90  ? 78  GLN A O     1 
ATOM   615  C  CB    . GLN A 1 96  ? 4.772   -36.191 0.252   1.00 42.37  ? 78  GLN A CB    1 
ATOM   616  C  CG    . GLN A 1 96  ? 5.925   -36.627 -0.624  1.00 46.40  ? 78  GLN A CG    1 
ATOM   617  C  CD    . GLN A 1 96  ? 6.453   -37.991 -0.221  1.00 54.07  ? 78  GLN A CD    1 
ATOM   618  O  OE1   . GLN A 1 96  ? 6.078   -38.529 0.826   1.00 54.02  ? 78  GLN A OE1   1 
ATOM   619  N  NE2   . GLN A 1 96  ? 7.323   -38.563 -1.052  1.00 57.35  ? 78  GLN A NE2   1 
ATOM   620  N  N     . LYS A 1 97  ? 1.868   -34.441 -1.018  1.00 38.44  ? 79  LYS A N     1 
ATOM   621  C  CA    . LYS A 1 97  ? 0.834   -34.454 -2.041  1.00 34.77  ? 79  LYS A CA    1 
ATOM   622  C  C     . LYS A 1 97  ? 0.862   -33.116 -2.768  1.00 32.90  ? 79  LYS A C     1 
ATOM   623  O  O     . LYS A 1 97  ? 0.769   -32.063 -2.134  1.00 29.24  ? 79  LYS A O     1 
ATOM   624  C  CB    . LYS A 1 97  ? -0.551  -34.683 -1.439  1.00 33.50  ? 79  LYS A CB    1 
ATOM   625  C  CG    . LYS A 1 97  ? -1.650  -34.635 -2.488  1.00 37.54  ? 79  LYS A CG    1 
ATOM   626  C  CD    . LYS A 1 97  ? -3.037  -34.638 -1.890  1.00 42.01  ? 79  LYS A CD    1 
ATOM   627  C  CE    . LYS A 1 97  ? -4.088  -34.636 -2.989  1.00 46.70  ? 79  LYS A CE    1 
ATOM   628  N  NZ    . LYS A 1 97  ? -5.472  -34.649 -2.439  1.00 51.15  ? 79  LYS A NZ    1 
ATOM   629  N  N     . PRO A 1 98  ? 0.990   -33.155 -4.103  1.00 33.63  ? 80  PRO A N     1 
ATOM   630  C  CA    . PRO A 1 98  ? 1.154   -31.928 -4.894  1.00 27.64  ? 80  PRO A CA    1 
ATOM   631  C  C     . PRO A 1 98  ? 0.001   -30.942 -4.711  1.00 32.94  ? 80  PRO A C     1 
ATOM   632  O  O     . PRO A 1 98  ? -1.159  -31.341 -4.760  1.00 35.17  ? 80  PRO A O     1 
ATOM   633  C  CB    . PRO A 1 98  ? 1.190   -32.438 -6.341  1.00 29.20  ? 80  PRO A CB    1 
ATOM   634  C  CG    . PRO A 1 98  ? 1.557   -33.899 -6.240  1.00 30.49  ? 80  PRO A CG    1 
ATOM   635  C  CD    . PRO A 1 98  ? 0.981   -34.371 -4.939  1.00 32.54  ? 80  PRO A CD    1 
ATOM   636  N  N     . PHE A 1 99  ? 0.341   -29.677 -4.470  1.00 32.50  ? 81  PHE A N     1 
ATOM   637  C  CA    . PHE A 1 99  ? -0.604  -28.555 -4.498  1.00 31.65  ? 81  PHE A CA    1 
ATOM   638  C  C     . PHE A 1 99  ? -1.518  -28.446 -3.281  1.00 29.47  ? 81  PHE A C     1 
ATOM   639  O  O     . PHE A 1 99  ? -2.483  -27.684 -3.293  1.00 29.96  ? 81  PHE A O     1 
ATOM   640  C  CB    . PHE A 1 99  ? -1.436  -28.562 -5.788  1.00 33.22  ? 81  PHE A CB    1 
ATOM   641  C  CG    . PHE A 1 99  ? -0.641  -28.895 -7.020  1.00 34.05  ? 81  PHE A CG    1 
ATOM   642  C  CD1   . PHE A 1 99  ? -1.070  -29.888 -7.889  1.00 36.30  ? 81  PHE A CD1   1 
ATOM   643  C  CD2   . PHE A 1 99  ? 0.537   -28.224 -7.305  1.00 33.77  ? 81  PHE A CD2   1 
ATOM   644  C  CE1   . PHE A 1 99  ? -0.339  -30.204 -9.022  1.00 37.92  ? 81  PHE A CE1   1 
ATOM   645  C  CE2   . PHE A 1 99  ? 1.273   -28.533 -8.438  1.00 35.45  ? 81  PHE A CE2   1 
ATOM   646  C  CZ    . PHE A 1 99  ? 0.833   -29.523 -9.298  1.00 37.73  ? 81  PHE A CZ    1 
ATOM   647  N  N     . VAL A 1 100 ? -1.215  -29.189 -2.224  1.00 26.96  ? 82  VAL A N     1 
ATOM   648  C  CA    . VAL A 1 100 ? -1.996  -29.061 -0.997  1.00 25.94  ? 82  VAL A CA    1 
ATOM   649  C  C     . VAL A 1 100 ? -1.807  -27.670 -0.370  1.00 26.16  ? 82  VAL A C     1 
ATOM   650  O  O     . VAL A 1 100 ? -2.705  -27.154 0.300   1.00 25.82  ? 82  VAL A O     1 
ATOM   651  C  CB    . VAL A 1 100 ? -1.683  -30.197 0.019   1.00 51.47  ? 82  VAL A CB    1 
ATOM   652  C  CG1   . VAL A 1 100 ? -0.221  -30.184 0.421   1.00 51.72  ? 82  VAL A CG1   1 
ATOM   653  C  CG2   . VAL A 1 100 ? -2.570  -30.089 1.245   1.00 51.01  ? 82  VAL A CG2   1 
ATOM   654  N  N     . CYS A 1 101 ? -0.655  -27.049 -0.618  1.00 25.01  ? 83  CYS A N     1 
ATOM   655  C  CA    . CYS A 1 101 ? -0.366  -25.740 -0.029  1.00 25.96  ? 83  CYS A CA    1 
ATOM   656  C  C     . CYS A 1 101 ? -0.343  -24.599 -1.046  1.00 30.71  ? 83  CYS A C     1 
ATOM   657  O  O     . CYS A 1 101 ? 0.047   -24.784 -2.201  1.00 30.19  ? 83  CYS A O     1 
ATOM   658  C  CB    . CYS A 1 101 ? 0.948   -25.767 0.759   1.00 21.60  ? 83  CYS A CB    1 
ATOM   659  S  SG    . CYS A 1 101 ? 0.957   -26.847 2.203   1.00 32.74  ? 83  CYS A SG    1 
ATOM   660  N  N     . SER A 1 102 ? -0.762  -23.419 -0.589  1.00 30.30  ? 84  SER A N     1 
ATOM   661  C  CA    . SER A 1 102 ? -0.785  -22.208 -1.400  1.00 26.40  ? 84  SER A CA    1 
ATOM   662  C  C     . SER A 1 102 ? -0.002  -21.111 -0.692  1.00 26.35  ? 84  SER A C     1 
ATOM   663  O  O     . SER A 1 102 ? -0.047  -21.008 0.536   1.00 22.68  ? 84  SER A O     1 
ATOM   664  C  CB    . SER A 1 102 ? -2.220  -21.724 -1.604  1.00 23.82  ? 84  SER A CB    1 
ATOM   665  O  OG    . SER A 1 102 ? -2.969  -22.611 -2.408  1.00 23.83  ? 84  SER A OG    1 
ATOM   666  N  N     . TYR A 1 103 ? 0.702   -20.291 -1.470  1.00 25.17  ? 85  TYR A N     1 
ATOM   667  C  CA    . TYR A 1 103 ? 1.461   -19.175 -0.917  1.00 23.41  ? 85  TYR A CA    1 
ATOM   668  C  C     . TYR A 1 103 ? 1.339   -17.905 -1.760  1.00 25.11  ? 85  TYR A C     1 
ATOM   669  O  O     . TYR A 1 103 ? 1.399   -17.952 -2.992  1.00 21.69  ? 85  TYR A O     1 
ATOM   670  C  CB    . TYR A 1 103 ? 2.935   -19.547 -0.757  1.00 22.41  ? 85  TYR A CB    1 
ATOM   671  C  CG    . TYR A 1 103 ? 3.796   -18.433 -0.190  1.00 20.59  ? 85  TYR A CG    1 
ATOM   672  C  CD1   . TYR A 1 103 ? 3.900   -18.240 1.185   1.00 18.31  ? 85  TYR A CD1   1 
ATOM   673  C  CD2   . TYR A 1 103 ? 4.516   -17.584 -1.027  1.00 20.86  ? 85  TYR A CD2   1 
ATOM   674  C  CE1   . TYR A 1 103 ? 4.695   -17.233 1.710   1.00 18.74  ? 85  TYR A CE1   1 
ATOM   675  C  CE2   . TYR A 1 103 ? 5.317   -16.571 -0.516  1.00 17.23  ? 85  TYR A CE2   1 
ATOM   676  C  CZ    . TYR A 1 103 ? 5.402   -16.398 0.855   1.00 19.01  ? 85  TYR A CZ    1 
ATOM   677  O  OH    . TYR A 1 103 ? 6.190   -15.389 1.376   1.00 17.30  ? 85  TYR A OH    1 
ATOM   678  N  N     . VAL A 1 104 ? 1.179   -16.778 -1.072  1.00 24.64  ? 86  VAL A N     1 
ATOM   679  C  CA    . VAL A 1 104 ? 1.136   -15.458 -1.691  1.00 21.68  ? 86  VAL A CA    1 
ATOM   680  C  C     . VAL A 1 104 ? 2.176   -14.538 -1.049  1.00 22.63  ? 86  VAL A C     1 
ATOM   681  O  O     . VAL A 1 104 ? 2.257   -14.440 0.177   1.00 19.23  ? 86  VAL A O     1 
ATOM   682  C  CB    . VAL A 1 104 ? -0.257  -14.817 -1.527  1.00 22.96  ? 86  VAL A CB    1 
ATOM   683  C  CG1   . VAL A 1 104 ? -0.227  -13.340 -1.918  1.00 22.20  ? 86  VAL A CG1   1 
ATOM   684  C  CG2   . VAL A 1 104 ? -1.299  -15.583 -2.336  1.00 21.91  ? 86  VAL A CG2   1 
ATOM   685  N  N     . GLY A 1 105 ? 2.974   -13.871 -1.880  1.00 25.07  ? 87  GLY A N     1 
ATOM   686  C  CA    . GLY A 1 105 ? 3.948   -12.904 -1.405  1.00 22.86  ? 87  GLY A CA    1 
ATOM   687  C  C     . GLY A 1 105 ? 4.364   -11.973 -2.529  1.00 26.03  ? 87  GLY A C     1 
ATOM   688  O  O     . GLY A 1 105 ? 3.996   -12.193 -3.686  1.00 29.16  ? 87  GLY A O     1 
ATOM   689  N  N     . CYS A 1 106 ? 5.136   -10.939 -2.205  1.00 24.21  ? 88  CYS A N     1 
ATOM   690  C  CA    . CYS A 1 106 ? 5.595   -9.997  -3.229  1.00 23.18  ? 88  CYS A CA    1 
ATOM   691  C  C     . CYS A 1 106 ? 7.108   -10.024 -3.452  1.00 23.94  ? 88  CYS A C     1 
ATOM   692  O  O     . CYS A 1 106 ? 7.893   -9.739  -2.543  1.00 25.25  ? 88  CYS A O     1 
ATOM   693  C  CB    . CYS A 1 106 ? 5.132   -8.568  -2.914  1.00 23.08  ? 88  CYS A CB    1 
ATOM   694  S  SG    . CYS A 1 106 ? 5.479   -7.375  -4.238  1.00 26.30  ? 88  CYS A SG    1 
ATOM   695  N  N     . ILE A 1 107 ? 7.506   -10.365 -4.674  1.00 23.27  ? 89  ILE A N     1 
ATOM   696  C  CA    . ILE A 1 107 ? 8.906   -10.336 -5.077  1.00 20.77  ? 89  ILE A CA    1 
ATOM   697  C  C     . ILE A 1 107 ? 9.130   -9.233  -6.114  1.00 24.93  ? 89  ILE A C     1 
ATOM   698  O  O     . ILE A 1 107 ? 8.170   -8.669  -6.651  1.00 25.57  ? 89  ILE A O     1 
ATOM   699  C  CB    . ILE A 1 107 ? 9.347   -11.678 -5.700  1.00 21.06  ? 89  ILE A CB    1 
ATOM   700  C  CG1   . ILE A 1 107 ? 8.463   -12.022 -6.905  1.00 20.19  ? 89  ILE A CG1   1 
ATOM   701  C  CG2   . ILE A 1 107 ? 9.324   -12.807 -4.660  1.00 17.86  ? 89  ILE A CG2   1 
ATOM   702  C  CD1   . ILE A 1 107 ? 8.963   -13.217 -7.722  1.00 20.31  ? 89  ILE A CD1   1 
ATOM   703  N  N     . GLY A 1 108 ? 10.397  -8.932  -6.395  1.00 22.27  ? 90  GLY A N     1 
ATOM   704  C  CA    . GLY A 1 108 ? 10.741  -8.005  -7.456  1.00 23.61  ? 90  GLY A CA    1 
ATOM   705  C  C     . GLY A 1 108 ? 10.901  -8.715  -8.792  1.00 28.72  ? 90  GLY A C     1 
ATOM   706  O  O     . GLY A 1 108 ? 10.855  -9.945  -8.857  1.00 28.25  ? 90  GLY A O     1 
ATOM   707  N  N     . ALA A 1 109 ? 11.082  -7.943  -9.861  1.00 30.11  ? 91  ALA A N     1 
ATOM   708  C  CA    . ALA A 1 109 ? 11.295  -8.514  -11.188 1.00 31.74  ? 91  ALA A CA    1 
ATOM   709  C  C     . ALA A 1 109 ? 12.784  -8.698  -11.445 1.00 31.89  ? 91  ALA A C     1 
ATOM   710  O  O     . ALA A 1 109 ? 13.348  -8.111  -12.366 1.00 37.44  ? 91  ALA A O     1 
ATOM   711  C  CB    . ALA A 1 109 ? 10.674  -7.627  -12.264 1.00 33.01  ? 91  ALA A CB    1 
ATOM   712  N  N     . ASP A 1 110 ? 13.416  -9.509  -10.610 1.00 28.26  ? 92  ASP A N     1 
ATOM   713  C  CA    . ASP A 1 110 ? 14.842  -9.762  -10.714 1.00 27.65  ? 92  ASP A CA    1 
ATOM   714  C  C     . ASP A 1 110 ? 15.108  -11.261 -10.637 1.00 26.87  ? 92  ASP A C     1 
ATOM   715  O  O     . ASP A 1 110 ? 14.182  -12.055 -10.461 1.00 26.02  ? 92  ASP A O     1 
ATOM   716  C  CB    . ASP A 1 110 ? 15.608  -9.008  -9.617  1.00 28.17  ? 92  ASP A CB    1 
ATOM   717  C  CG    . ASP A 1 110 ? 14.974  -9.160  -8.233  1.00 29.57  ? 92  ASP A CG    1 
ATOM   718  O  OD1   . ASP A 1 110 ? 15.262  -8.318  -7.353  1.00 30.00  ? 92  ASP A OD1   1 
ATOM   719  O  OD2   . ASP A 1 110 ? 14.192  -10.113 -8.021  1.00 27.80  ? 92  ASP A OD2   1 
ATOM   720  N  N     . ILE A 1 111 ? 16.372  -11.647 -10.770 1.00 26.95  ? 93  ILE A N     1 
ATOM   721  C  CA    . ILE A 1 111 ? 16.725  -13.059 -10.755 1.00 26.26  ? 93  ILE A CA    1 
ATOM   722  C  C     . ILE A 1 111 ? 16.461  -13.706 -9.393  1.00 25.50  ? 93  ILE A C     1 
ATOM   723  O  O     . ILE A 1 111 ? 16.098  -14.883 -9.328  1.00 25.18  ? 93  ILE A O     1 
ATOM   724  C  CB    . ILE A 1 111 ? 18.186  -13.295 -11.191 1.00 28.87  ? 93  ILE A CB    1 
ATOM   725  C  CG1   . ILE A 1 111 ? 18.420  -14.786 -11.455 1.00 26.48  ? 93  ILE A CG1   1 
ATOM   726  C  CG2   . ILE A 1 111 ? 19.165  -12.741 -10.153 1.00 27.05  ? 93  ILE A CG2   1 
ATOM   727  C  CD1   . ILE A 1 111 ? 19.826  -15.121 -11.848 1.00 27.73  ? 93  ILE A CD1   1 
ATOM   728  N  N     . GLN A 1 112 ? 16.622  -12.934 -8.317  1.00 22.54  ? 94  GLN A N     1 
ATOM   729  C  CA    . GLN A 1 112 ? 16.381  -13.436 -6.966  1.00 26.84  ? 94  GLN A CA    1 
ATOM   730  C  C     . GLN A 1 112 ? 14.928  -13.861 -6.812  1.00 26.34  ? 94  GLN A C     1 
ATOM   731  O  O     . GLN A 1 112 ? 14.634  -14.933 -6.271  1.00 23.95  ? 94  GLN A O     1 
ATOM   732  C  CB    . GLN A 1 112 ? 16.733  -12.386 -5.905  1.00 25.93  ? 94  GLN A CB    1 
ATOM   733  C  CG    . GLN A 1 112 ? 18.224  -12.067 -5.785  1.00 21.22  ? 94  GLN A CG    1 
ATOM   734  C  CD    . GLN A 1 112 ? 18.692  -11.020 -6.784  1.00 25.60  ? 94  GLN A CD    1 
ATOM   735  O  OE1   . GLN A 1 112 ? 17.934  -10.586 -7.659  1.00 23.07  ? 94  GLN A OE1   1 
ATOM   736  N  NE2   . GLN A 1 112 ? 19.945  -10.602 -6.652  1.00 24.94  ? 94  GLN A NE2   1 
ATOM   737  N  N     . GLY A 1 113 ? 14.024  -13.018 -7.302  1.00 24.05  ? 95  GLY A N     1 
ATOM   738  C  CA    . GLY A 1 113 ? 12.604  -13.304 -7.226  1.00 24.06  ? 95  GLY A CA    1 
ATOM   739  C  C     . GLY A 1 113 ? 12.247  -14.528 -8.046  1.00 28.13  ? 95  GLY A C     1 
ATOM   740  O  O     . GLY A 1 113 ? 11.469  -15.378 -7.609  1.00 26.14  ? 95  GLY A O     1 
ATOM   741  N  N     . LYS A 1 114 ? 12.825  -14.621 -9.241  1.00 29.05  ? 96  LYS A N     1 
ATOM   742  C  CA    . LYS A 1 114 ? 12.556  -15.756 -10.109 1.00 29.31  ? 96  LYS A CA    1 
ATOM   743  C  C     . LYS A 1 114 ? 13.091  -17.057 -9.505  1.00 28.79  ? 96  LYS A C     1 
ATOM   744  O  O     . LYS A 1 114 ? 12.447  -18.098 -9.596  1.00 30.31  ? 96  LYS A O     1 
ATOM   745  C  CB    . LYS A 1 114 ? 13.107  -15.529 -11.523 1.00 28.88  ? 96  LYS A CB    1 
ATOM   746  C  CG    . LYS A 1 114 ? 12.676  -16.616 -12.502 1.00 29.37  ? 96  LYS A CG    1 
ATOM   747  C  CD    . LYS A 1 114 ? 12.939  -16.247 -13.950 1.00 30.62  ? 96  LYS A CD    1 
ATOM   748  C  CE    . LYS A 1 114 ? 12.316  -17.285 -14.870 1.00 31.10  ? 96  LYS A CE    1 
ATOM   749  N  NZ    . LYS A 1 114 ? 12.484  -16.960 -16.309 1.00 35.70  ? 96  LYS A NZ    1 
ATOM   750  N  N     . TYR A 1 115 ? 14.262  -16.993 -8.880  1.00 28.91  ? 97  TYR A N     1 
ATOM   751  C  CA    . TYR A 1 115 ? 14.808  -18.159 -8.191  1.00 29.68  ? 97  TYR A CA    1 
ATOM   752  C  C     . TYR A 1 115 ? 13.871  -18.631 -7.072  1.00 29.30  ? 97  TYR A C     1 
ATOM   753  O  O     . TYR A 1 115 ? 13.594  -19.827 -6.945  1.00 20.61  ? 97  TYR A O     1 
ATOM   754  C  CB    . TYR A 1 115 ? 16.209  -17.870 -7.639  1.00 30.49  ? 97  TYR A CB    1 
ATOM   755  C  CG    . TYR A 1 115 ? 16.564  -18.718 -6.438  1.00 29.44  ? 97  TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1 115 ? 16.797  -20.082 -6.565  1.00 33.57  ? 97  TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1 115 ? 16.649  -18.156 -5.175  1.00 28.32  ? 97  TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1 115 ? 17.109  -20.860 -5.459  1.00 34.10  ? 97  TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1 115 ? 16.958  -18.920 -4.070  1.00 29.82  ? 97  TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1 115 ? 17.187  -20.269 -4.212  1.00 32.05  ? 97  TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1 115 ? 17.496  -21.021 -3.099  1.00 33.81  ? 97  TYR A OH    1 
ATOM   762  N  N     . ILE A 1 116 ? 13.382  -17.689 -6.269  1.00 25.03  ? 98  ILE A N     1 
ATOM   763  C  CA    . ILE A 1 116 ? 12.439  -18.026 -5.208  1.00 24.27  ? 98  ILE A CA    1 
ATOM   764  C  C     . ILE A 1 116 ? 11.165  -18.668 -5.778  1.00 27.10  ? 98  ILE A C     1 
ATOM   765  O  O     . ILE A 1 116 ? 10.684  -19.681 -5.258  1.00 24.98  ? 98  ILE A O     1 
ATOM   766  C  CB    . ILE A 1 116 ? 12.106  -16.801 -4.312  1.00 19.41  ? 98  ILE A CB    1 
ATOM   767  C  CG1   . ILE A 1 116 ? 13.344  -16.375 -3.518  1.00 18.54  ? 98  ILE A CG1   1 
ATOM   768  C  CG2   . ILE A 1 116 ? 10.972  -17.130 -3.356  1.00 19.98  ? 98  ILE A CG2   1 
ATOM   769  C  CD1   . ILE A 1 116 ? 13.213  -15.029 -2.827  1.00 19.00  ? 98  ILE A CD1   1 
ATOM   770  N  N     . LYS A 1 117 ? 10.638  -18.101 -6.862  1.00 30.64  ? 99  LYS A N     1 
ATOM   771  C  CA    . LYS A 1 117 ? 9.452   -18.672 -7.504  1.00 30.75  ? 99  LYS A CA    1 
ATOM   772  C  C     . LYS A 1 117 ? 9.696   -20.088 -8.031  1.00 28.54  ? 99  LYS A C     1 
ATOM   773  O  O     . LYS A 1 117 ? 8.856   -20.971 -7.856  1.00 28.23  ? 99  LYS A O     1 
ATOM   774  C  CB    . LYS A 1 117 ? 8.932   -17.775 -8.631  1.00 33.00  ? 99  LYS A CB    1 
ATOM   775  C  CG    . LYS A 1 117 ? 7.616   -18.265 -9.238  1.00 37.57  ? 99  LYS A CG    1 
ATOM   776  C  CD    . LYS A 1 117 ? 7.287   -17.566 -10.558 1.00 43.44  ? 99  LYS A CD    1 
ATOM   777  C  CE    . LYS A 1 117 ? 7.074   -16.073 -10.364 1.00 48.13  ? 99  LYS A CE    1 
ATOM   778  N  NZ    . LYS A 1 117 ? 6.785   -15.364 -11.650 1.00 52.91  ? 99  LYS A NZ    1 
ATOM   779  N  N     . ASN A 1 118 ? 10.838  -20.303 -8.680  1.00 26.95  ? 100 ASN A N     1 
ATOM   780  C  CA    . ASN A 1 118 ? 11.173  -21.629 -9.204  1.00 29.28  ? 100 ASN A CA    1 
ATOM   781  C  C     . ASN A 1 118 ? 11.357  -22.662 -8.096  1.00 30.36  ? 100 ASN A C     1 
ATOM   782  O  O     . ASN A 1 118 ? 11.072  -23.842 -8.283  1.00 32.45  ? 100 ASN A O     1 
ATOM   783  C  CB    . ASN A 1 118 ? 12.429  -21.582 -10.078 1.00 28.58  ? 100 ASN A CB    1 
ATOM   784  C  CG    . ASN A 1 118 ? 12.218  -20.811 -11.369 1.00 35.78  ? 100 ASN A CG    1 
ATOM   785  O  OD1   . ASN A 1 118 ? 11.085  -20.589 -11.803 1.00 37.19  ? 100 ASN A OD1   1 
ATOM   786  N  ND2   . ASN A 1 118 ? 13.314  -20.406 -11.994 1.00 39.38  ? 100 ASN A ND2   1 
ATOM   787  N  N     . ASP A 1 119 ? 11.845  -22.206 -6.947  1.00 29.86  ? 101 ASP A N     1 
ATOM   788  C  CA    . ASP A 1 119 ? 12.052  -23.069 -5.793  1.00 32.56  ? 101 ASP A CA    1 
ATOM   789  C  C     . ASP A 1 119 ? 10.706  -23.592 -5.294  1.00 32.88  ? 101 ASP A C     1 
ATOM   790  O  O     . ASP A 1 119 ? 10.576  -24.764 -4.945  1.00 32.47  ? 101 ASP A O     1 
ATOM   791  C  CB    . ASP A 1 119 ? 12.777  -22.293 -4.690  1.00 37.21  ? 101 ASP A CB    1 
ATOM   792  C  CG    . ASP A 1 119 ? 13.275  -23.184 -3.574  1.00 42.52  ? 101 ASP A CG    1 
ATOM   793  O  OD1   . ASP A 1 119 ? 14.166  -24.021 -3.837  1.00 49.45  ? 101 ASP A OD1   1 
ATOM   794  O  OD2   . ASP A 1 119 ? 12.792  -23.035 -2.430  1.00 38.94  ? 101 ASP A OD2   1 
ATOM   795  N  N     . CYS A 1 120 ? 9.704   -22.717 -5.280  1.00 30.66  ? 102 CYS A N     1 
ATOM   796  C  CA    . CYS A 1 120 ? 8.351   -23.095 -4.879  1.00 28.33  ? 102 CYS A CA    1 
ATOM   797  C  C     . CYS A 1 120 ? 7.724   -24.114 -5.828  1.00 29.96  ? 102 CYS A C     1 
ATOM   798  O  O     . CYS A 1 120 ? 7.117   -25.102 -5.390  1.00 26.01  ? 102 CYS A O     1 
ATOM   799  C  CB    . CYS A 1 120 ? 7.458   -21.859 -4.802  1.00 24.46  ? 102 CYS A CB    1 
ATOM   800  S  SG    . CYS A 1 120 ? 7.907   -20.730 -3.480  1.00 24.72  ? 102 CYS A SG    1 
ATOM   801  N  N     . SER A 1 121 ? 7.860   -23.863 -7.125  1.00 30.16  ? 103 SER A N     1 
ATOM   802  C  CA    . SER A 1 121 ? 7.315   -24.763 -8.134  1.00 34.12  ? 103 SER A CA    1 
ATOM   803  C  C     . SER A 1 121 ? 7.959   -26.144 -8.065  1.00 33.56  ? 103 SER A C     1 
ATOM   804  O  O     . SER A 1 121 ? 7.299   -27.156 -8.292  1.00 33.75  ? 103 SER A O     1 
ATOM   805  C  CB    . SER A 1 121 ? 7.484   -24.167 -9.531  1.00 36.71  ? 103 SER A CB    1 
ATOM   806  O  OG    . SER A 1 121 ? 6.720   -22.983 -9.651  1.00 41.81  ? 103 SER A OG    1 
ATOM   807  N  N     . ALA A 1 122 ? 9.249   -26.178 -7.749  1.00 31.89  ? 104 ALA A N     1 
ATOM   808  C  CA    . ALA A 1 122 ? 9.967   -27.437 -7.609  1.00 34.16  ? 104 ALA A CA    1 
ATOM   809  C  C     . ALA A 1 122 ? 9.389   -28.272 -6.468  1.00 34.73  ? 104 ALA A C     1 
ATOM   810  O  O     . ALA A 1 122 ? 9.491   -29.496 -6.475  1.00 33.05  ? 104 ALA A O     1 
ATOM   811  C  CB    . ALA A 1 122 ? 11.444  -27.178 -7.376  1.00 33.71  ? 104 ALA A CB    1 
ATOM   812  N  N     . LEU A 1 123 ? 8.777   -27.599 -5.497  1.00 33.98  ? 105 LEU A N     1 
ATOM   813  C  CA    . LEU A 1 123 ? 8.216   -28.267 -4.326  1.00 35.84  ? 105 LEU A CA    1 
ATOM   814  C  C     . LEU A 1 123 ? 6.720   -28.585 -4.460  1.00 36.44  ? 105 LEU A C     1 
ATOM   815  O  O     . LEU A 1 123 ? 6.107   -29.096 -3.519  1.00 36.12  ? 105 LEU A O     1 
ATOM   816  C  CB    . LEU A 1 123 ? 8.465   -27.416 -3.074  1.00 34.90  ? 105 LEU A CB    1 
ATOM   817  C  CG    . LEU A 1 123 ? 9.906   -27.392 -2.558  1.00 34.33  ? 105 LEU A CG    1 
ATOM   818  C  CD1   . LEU A 1 123 ? 10.087  -26.327 -1.498  1.00 35.18  ? 105 LEU A CD1   1 
ATOM   819  C  CD2   . LEU A 1 123 ? 10.282  -28.762 -2.005  1.00 35.06  ? 105 LEU A CD2   1 
ATOM   820  N  N     . ASP A 1 124 ? 6.150   -28.289 -5.628  1.00 33.93  ? 106 ASP A N     1 
ATOM   821  C  CA    . ASP A 1 124 ? 4.706   -28.425 -5.872  1.00 34.04  ? 106 ASP A CA    1 
ATOM   822  C  C     . ASP A 1 124 ? 3.860   -27.508 -4.988  1.00 31.74  ? 106 ASP A C     1 
ATOM   823  O  O     . ASP A 1 124 ? 2.712   -27.817 -4.672  1.00 31.88  ? 106 ASP A O     1 
ATOM   824  C  CB    . ASP A 1 124 ? 4.237   -29.875 -5.727  1.00 37.91  ? 106 ASP A CB    1 
ATOM   825  C  CG    . ASP A 1 124 ? 4.864   -30.791 -6.752  1.00 41.26  ? 106 ASP A CG    1 
ATOM   826  O  OD1   . ASP A 1 124 ? 5.195   -30.309 -7.855  1.00 40.33  ? 106 ASP A OD1   1 
ATOM   827  O  OD2   . ASP A 1 124 ? 5.025   -31.991 -6.450  1.00 44.30  ? 106 ASP A OD2   1 
ATOM   828  N  N     . LEU A 1 125 ? 4.439   -26.382 -4.593  1.00 27.84  ? 107 LEU A N     1 
ATOM   829  C  CA    . LEU A 1 125 ? 3.713   -25.360 -3.855  1.00 30.94  ? 107 LEU A CA    1 
ATOM   830  C  C     . LEU A 1 125 ? 3.052   -24.384 -4.832  1.00 32.45  ? 107 LEU A C     1 
ATOM   831  O  O     . LEU A 1 125 ? 3.736   -23.712 -5.603  1.00 37.66  ? 107 LEU A O     1 
ATOM   832  C  CB    . LEU A 1 125 ? 4.678   -24.626 -2.918  1.00 30.29  ? 107 LEU A CB    1 
ATOM   833  C  CG    . LEU A 1 125 ? 4.180   -23.428 -2.115  1.00 30.97  ? 107 LEU A CG    1 
ATOM   834  C  CD1   . LEU A 1 125 ? 3.066   -23.842 -1.189  1.00 30.34  ? 107 LEU A CD1   1 
ATOM   835  C  CD2   . LEU A 1 125 ? 5.326   -22.809 -1.328  1.00 31.12  ? 107 LEU A CD2   1 
ATOM   836  N  N     . VAL A 1 126 ? 1.725   -24.320 -4.820  1.00 30.29  ? 108 VAL A N     1 
ATOM   837  C  CA    . VAL A 1 126 ? 1.011   -23.362 -5.662  1.00 33.34  ? 108 VAL A CA    1 
ATOM   838  C  C     . VAL A 1 126 ? 1.248   -21.938 -5.155  1.00 33.89  ? 108 VAL A C     1 
ATOM   839  O  O     . VAL A 1 126 ? 1.054   -21.652 -3.976  1.00 35.08  ? 108 VAL A O     1 
ATOM   840  C  CB    . VAL A 1 126 ? -0.511  -23.646 -5.707  1.00 36.53  ? 108 VAL A CB    1 
ATOM   841  C  CG1   . VAL A 1 126 ? -1.258  -22.474 -6.337  1.00 37.87  ? 108 VAL A CG1   1 
ATOM   842  C  CG2   . VAL A 1 126 ? -0.795  -24.926 -6.473  1.00 35.63  ? 108 VAL A CG2   1 
ATOM   843  N  N     . THR A 1 127 ? 1.683   -21.052 -6.045  1.00 31.11  ? 109 THR A N     1 
ATOM   844  C  CA    . THR A 1 127 ? 1.937   -19.669 -5.665  1.00 30.19  ? 109 THR A CA    1 
ATOM   845  C  C     . THR A 1 127 ? 1.208   -18.672 -6.557  1.00 31.71  ? 109 THR A C     1 
ATOM   846  O  O     . THR A 1 127 ? 0.902   -18.955 -7.714  1.00 31.75  ? 109 THR A O     1 
ATOM   847  C  CB    . THR A 1 127 ? 3.442   -19.332 -5.689  1.00 28.55  ? 109 THR A CB    1 
ATOM   848  O  OG1   . THR A 1 127 ? 3.960   -19.512 -7.014  1.00 31.23  ? 109 THR A OG1   1 
ATOM   849  C  CG2   . THR A 1 127 ? 4.207   -20.218 -4.722  1.00 26.50  ? 109 THR A CG2   1 
ATOM   850  N  N     . GLU A 1 128 ? 0.920   -17.505 -5.992  1.00 30.31  ? 110 GLU A N     1 
ATOM   851  C  CA    . GLU A 1 128 ? 0.467   -16.359 -6.766  1.00 30.43  ? 110 GLU A CA    1 
ATOM   852  C  C     . GLU A 1 128 ? 1.239   -15.136 -6.291  1.00 31.19  ? 110 GLU A C     1 
ATOM   853  O  O     . GLU A 1 128 ? 0.775   -14.386 -5.430  1.00 30.67  ? 110 GLU A O     1 
ATOM   854  C  CB    . GLU A 1 128 ? -1.040  -16.143 -6.613  1.00 32.06  ? 110 GLU A CB    1 
ATOM   855  C  CG    . GLU A 1 128 ? -1.899  -17.147 -7.367  1.00 34.46  ? 110 GLU A CG    1 
ATOM   856  C  CD    . GLU A 1 128 ? -1.822  -16.984 -8.881  1.00 39.71  ? 110 GLU A CD    1 
ATOM   857  O  OE1   . GLU A 1 128 ? -1.391  -15.911 -9.359  1.00 39.26  ? 110 GLU A OE1   1 
ATOM   858  O  OE2   . GLU A 1 128 ? -2.200  -17.935 -9.597  1.00 42.91  ? 110 GLU A OE2   1 
ATOM   859  N  N     . PHE A 1 129 ? 2.433   -14.953 -6.843  1.00 31.16  ? 111 PHE A N     1 
ATOM   860  C  CA    . PHE A 1 129 ? 3.288   -13.848 -6.436  1.00 28.46  ? 111 PHE A CA    1 
ATOM   861  C  C     . PHE A 1 129 ? 2.804   -12.533 -7.012  1.00 31.35  ? 111 PHE A C     1 
ATOM   862  O  O     . PHE A 1 129 ? 2.355   -12.468 -8.155  1.00 31.33  ? 111 PHE A O     1 
ATOM   863  C  CB    . PHE A 1 129 ? 4.734   -14.085 -6.877  1.00 25.84  ? 111 PHE A CB    1 
ATOM   864  C  CG    . PHE A 1 129 ? 5.458   -15.110 -6.057  1.00 27.20  ? 111 PHE A CG    1 
ATOM   865  C  CD1   . PHE A 1 129 ? 5.920   -14.798 -4.786  1.00 25.92  ? 111 PHE A CD1   1 
ATOM   866  C  CD2   . PHE A 1 129 ? 5.682   -16.383 -6.556  1.00 26.08  ? 111 PHE A CD2   1 
ATOM   867  C  CE1   . PHE A 1 129 ? 6.589   -15.737 -4.026  1.00 23.08  ? 111 PHE A CE1   1 
ATOM   868  C  CE2   . PHE A 1 129 ? 6.351   -17.327 -5.800  1.00 26.97  ? 111 PHE A CE2   1 
ATOM   869  C  CZ    . PHE A 1 129 ? 6.804   -17.005 -4.535  1.00 26.02  ? 111 PHE A CZ    1 
ATOM   870  N  N     . GLN A 1 130 ? 2.889   -11.486 -6.203  1.00 31.33  ? 112 GLN A N     1 
ATOM   871  C  CA    . GLN A 1 130 ? 2.745   -10.133 -6.705  1.00 30.30  ? 112 GLN A CA    1 
ATOM   872  C  C     . GLN A 1 130 ? 4.142   -9.678  -7.096  1.00 29.12  ? 112 GLN A C     1 
ATOM   873  O  O     . GLN A 1 130 ? 5.112   -9.941  -6.384  1.00 27.57  ? 112 GLN A O     1 
ATOM   874  C  CB    . GLN A 1 130 ? 2.169   -9.218  -5.626  1.00 30.32  ? 112 GLN A CB    1 
ATOM   875  C  CG    . GLN A 1 130 ? 2.012   -7.765  -6.050  1.00 32.37  ? 112 GLN A CG    1 
ATOM   876  C  CD    . GLN A 1 130 ? 1.481   -6.901  -4.927  1.00 33.13  ? 112 GLN A CD    1 
ATOM   877  O  OE1   . GLN A 1 130 ? 1.032   -7.414  -3.903  1.00 35.10  ? 112 GLN A OE1   1 
ATOM   878  N  NE2   . GLN A 1 130 ? 1.534   -5.585  -5.108  1.00 31.38  ? 112 GLN A NE2   1 
ATOM   879  N  N     . ILE A 1 131 ? 4.263   -9.030  -8.243  1.00 29.25  ? 113 ILE A N     1 
ATOM   880  C  CA    . ILE A 1 131 ? 5.570   -8.560  -8.669  1.00 29.20  ? 113 ILE A CA    1 
ATOM   881  C  C     . ILE A 1 131 ? 5.637   -7.056  -8.428  1.00 29.53  ? 113 ILE A C     1 
ATOM   882  O  O     . ILE A 1 131 ? 4.749   -6.310  -8.850  1.00 30.16  ? 113 ILE A O     1 
ATOM   883  C  CB    . ILE A 1 131 ? 5.879   -8.925  -10.145 1.00 34.61  ? 113 ILE A CB    1 
ATOM   884  C  CG1   . ILE A 1 131 ? 6.365   -10.375 -10.267 1.00 36.33  ? 113 ILE A CG1   1 
ATOM   885  C  CG2   . ILE A 1 131 ? 6.977   -8.037  -10.693 1.00 32.07  ? 113 ILE A CG2   1 
ATOM   886  C  CD1   . ILE A 1 131 ? 5.363   -11.444 -9.880  1.00 37.00  ? 113 ILE A CD1   1 
ATOM   887  N  N     . ALA A 1 132 ? 6.670   -6.620  -7.714  1.00 26.90  ? 114 ALA A N     1 
ATOM   888  C  CA    . ALA A 1 132 ? 6.838   -5.207  -7.410  1.00 27.09  ? 114 ALA A CA    1 
ATOM   889  C  C     . ALA A 1 132 ? 7.257   -4.421  -8.651  1.00 29.87  ? 114 ALA A C     1 
ATOM   890  O  O     . ALA A 1 132 ? 7.982   -4.932  -9.506  1.00 29.89  ? 114 ALA A O     1 
ATOM   891  C  CB    . ALA A 1 132 ? 7.854   -5.023  -6.295  1.00 26.98  ? 114 ALA A CB    1 
ATOM   892  N  N     . GLU A 1 133 ? 6.781   -3.183  -8.749  1.00 34.09  ? 115 GLU A N     1 
ATOM   893  C  CA    . GLU A 1 133 ? 7.198   -2.270  -9.807  1.00 39.09  ? 115 GLU A CA    1 
ATOM   894  C  C     . GLU A 1 133 ? 8.704   -2.046  -9.753  1.00 37.67  ? 115 GLU A C     1 
ATOM   895  O  O     . GLU A 1 133 ? 9.262   -1.788  -8.686  1.00 34.98  ? 115 GLU A O     1 
ATOM   896  C  CB    . GLU A 1 133 ? 6.472   -0.935  -9.663  1.00 48.14  ? 115 GLU A CB    1 
ATOM   897  C  CG    . GLU A 1 133 ? 5.040   -0.950  -10.163 1.00 57.16  ? 115 GLU A CG    1 
ATOM   898  C  CD    . GLU A 1 133 ? 4.957   -0.829  -11.671 1.00 66.50  ? 115 GLU A CD    1 
ATOM   899  O  OE1   . GLU A 1 133 ? 3.888   -1.142  -12.240 1.00 70.44  ? 115 GLU A OE1   1 
ATOM   900  O  OE2   . GLU A 1 133 ? 5.962   -0.413  -12.289 1.00 69.73  ? 115 GLU A OE2   1 
ATOM   901  N  N     . GLU A 1 134 ? 9.361   -2.159  -10.903 1.00 40.55  ? 116 GLU A N     1 
ATOM   902  C  CA    . GLU A 1 134 ? 10.801  -1.944  -10.981 1.00 44.59  ? 116 GLU A CA    1 
ATOM   903  C  C     . GLU A 1 134 ? 11.105  -0.484  -10.644 1.00 45.01  ? 116 GLU A C     1 
ATOM   904  O  O     . GLU A 1 134 ? 10.302  0.397   -10.937 1.00 45.93  ? 116 GLU A O     1 
ATOM   905  C  CB    . GLU A 1 134 ? 11.326  -2.318  -12.375 1.00 49.32  ? 116 GLU A CB    1 
ATOM   906  C  CG    . GLU A 1 134 ? 10.902  -3.713  -12.840 1.00 53.36  ? 116 GLU A CG    1 
ATOM   907  C  CD    . GLU A 1 134 ? 11.644  -4.186  -14.090 1.00 59.83  ? 116 GLU A CD    1 
ATOM   908  O  OE1   . GLU A 1 134 ? 10.990  -4.739  -15.003 1.00 60.32  ? 116 GLU A OE1   1 
ATOM   909  O  OE2   . GLU A 1 134 ? 12.881  -4.018  -14.155 1.00 61.95  ? 116 GLU A OE2   1 
ATOM   910  N  N     . PRO A 1 135 ? 12.271  -0.217  -10.036 1.00 44.13  ? 117 PRO A N     1 
ATOM   911  C  CA    . PRO A 1 135 ? 13.352  -1.160  -9.748  1.00 41.79  ? 117 PRO A CA    1 
ATOM   912  C  C     . PRO A 1 135 ? 13.393  -1.642  -8.295  1.00 37.54  ? 117 PRO A C     1 
ATOM   913  O  O     . PRO A 1 135 ? 14.486  -1.857  -7.771  1.00 37.15  ? 117 PRO A O     1 
ATOM   914  C  CB    . PRO A 1 135 ? 14.589  -0.312  -10.025 1.00 44.47  ? 117 PRO A CB    1 
ATOM   915  C  CG    . PRO A 1 135 ? 14.186  1.050   -9.527  1.00 44.77  ? 117 PRO A CG    1 
ATOM   916  C  CD    . PRO A 1 135 ? 12.684  1.168   -9.746  1.00 44.45  ? 117 PRO A CD    1 
ATOM   917  N  N     . LEU A 1 136 ? 12.243  -1.809  -7.650  1.00 32.95  ? 118 LEU A N     1 
ATOM   918  C  CA    . LEU A 1 136 ? 12.235  -2.333  -6.286  1.00 29.08  ? 118 LEU A CA    1 
ATOM   919  C  C     . LEU A 1 136 ? 12.611  -3.820  -6.301  1.00 28.32  ? 118 LEU A C     1 
ATOM   920  O  O     . LEU A 1 136 ? 11.942  -4.633  -6.939  1.00 29.10  ? 118 LEU A O     1 
ATOM   921  C  CB    . LEU A 1 136 ? 10.878  -2.108  -5.617  1.00 28.62  ? 118 LEU A CB    1 
ATOM   922  C  CG    . LEU A 1 136 ? 10.770  -2.476  -4.131  1.00 30.85  ? 118 LEU A CG    1 
ATOM   923  C  CD1   . LEU A 1 136 ? 11.870  -1.804  -3.319  1.00 29.95  ? 118 LEU A CD1   1 
ATOM   924  C  CD2   . LEU A 1 136 ? 9.399   -2.106  -3.576  1.00 30.14  ? 118 LEU A CD2   1 
ATOM   925  N  N     . MET A 1 137 ? 13.694  -4.164  -5.608  1.00 23.23  ? 119 MET A N     1 
ATOM   926  C  CA    . MET A 1 137 ? 14.253  -5.513  -5.662  1.00 22.12  ? 119 MET A CA    1 
ATOM   927  C  C     . MET A 1 137 ? 13.705  -6.442  -4.586  1.00 24.41  ? 119 MET A C     1 
ATOM   928  O  O     . MET A 1 137 ? 13.269  -5.995  -3.523  1.00 24.11  ? 119 MET A O     1 
ATOM   929  C  CB    . MET A 1 137 ? 15.784  -5.465  -5.585  1.00 22.60  ? 119 MET A CB    1 
ATOM   930  C  CG    . MET A 1 137 ? 16.455  -4.687  -6.737  1.00 24.32  ? 119 MET A CG    1 
ATOM   931  S  SD    . MET A 1 137 ? 16.320  -5.464  -8.364  1.00 64.03  ? 119 MET A SD    1 
ATOM   932  C  CE    . MET A 1 137 ? 14.809  -4.761  -9.029  1.00 80.00  ? 119 MET A CE    1 
ATOM   933  N  N     . THR A 1 138 ? 13.724  -7.738  -4.884  1.00 24.37  ? 120 THR A N     1 
ATOM   934  C  CA    . THR A 1 138 ? 13.307  -8.758  -3.935  1.00 23.87  ? 120 THR A CA    1 
ATOM   935  C  C     . THR A 1 138 ? 14.045  -8.564  -2.611  1.00 21.88  ? 120 THR A C     1 
ATOM   936  O  O     . THR A 1 138 ? 15.248  -8.303  -2.599  1.00 18.80  ? 120 THR A O     1 
ATOM   937  C  CB    . THR A 1 138 ? 13.592  -10.171 -4.486  1.00 21.67  ? 120 THR A CB    1 
ATOM   938  O  OG1   . THR A 1 138 ? 12.803  -10.393 -5.663  1.00 23.39  ? 120 THR A OG1   1 
ATOM   939  C  CG2   . THR A 1 138 ? 13.261  -11.236 -3.448  1.00 17.80  ? 120 THR A CG2   1 
ATOM   940  N  N     . GLY A 1 139 ? 13.317  -8.667  -1.504  1.00 18.94  ? 121 GLY A N     1 
ATOM   941  C  CA    . GLY A 1 139 ? 13.909  -8.500  -0.190  1.00 21.04  ? 121 GLY A CA    1 
ATOM   942  C  C     . GLY A 1 139 ? 15.001  -9.516  0.103   1.00 24.03  ? 121 GLY A C     1 
ATOM   943  O  O     . GLY A 1 139 ? 15.083  -10.564 -0.540  1.00 24.86  ? 121 GLY A O     1 
ATOM   944  N  N     . LYS A 1 140 ? 15.840  -9.204  1.082   1.00 22.73  ? 122 LYS A N     1 
ATOM   945  C  CA    . LYS A 1 140 ? 16.969  -10.054 1.422   1.00 23.69  ? 122 LYS A CA    1 
ATOM   946  C  C     . LYS A 1 140 ? 17.254  -10.005 2.920   1.00 25.95  ? 122 LYS A C     1 
ATOM   947  O  O     . LYS A 1 140 ? 16.959  -9.007  3.589   1.00 24.46  ? 122 LYS A O     1 
ATOM   948  C  CB    . LYS A 1 140 ? 18.208  -9.610  0.645   1.00 22.16  ? 122 LYS A CB    1 
ATOM   949  C  CG    . LYS A 1 140 ? 18.486  -8.119  0.766   1.00 25.17  ? 122 LYS A CG    1 
ATOM   950  C  CD    . LYS A 1 140 ? 19.665  -7.687  -0.094  1.00 28.47  ? 122 LYS A CD    1 
ATOM   951  C  CE    . LYS A 1 140 ? 19.791  -6.172  -0.126  1.00 31.25  ? 122 LYS A CE    1 
ATOM   952  N  NZ    . LYS A 1 140 ? 20.911  -5.725  -1.006  1.00 34.00  ? 122 LYS A NZ    1 
ATOM   953  N  N     . VAL A 1 141 ? 17.832  -11.085 3.437   1.00 22.28  ? 123 VAL A N     1 
ATOM   954  C  CA    . VAL A 1 141 ? 18.225  -11.154 4.838   1.00 19.82  ? 123 VAL A CA    1 
ATOM   955  C  C     . VAL A 1 141 ? 19.719  -11.428 4.936   1.00 19.93  ? 123 VAL A C     1 
ATOM   956  O  O     . VAL A 1 141 ? 20.218  -12.404 4.382   1.00 18.80  ? 123 VAL A O     1 
ATOM   957  C  CB    . VAL A 1 141 ? 17.470  -12.270 5.594   1.00 19.99  ? 123 VAL A CB    1 
ATOM   958  C  CG1   . VAL A 1 141 ? 17.837  -12.248 7.077   1.00 19.13  ? 123 VAL A CG1   1 
ATOM   959  C  CG2   . VAL A 1 141 ? 15.963  -12.123 5.413   1.00 17.27  ? 123 VAL A CG2   1 
ATOM   960  N  N     . ALA A 1 142 ? 20.446  -10.556 5.621   1.00 20.81  ? 124 ALA A N     1 
ATOM   961  C  CA    . ALA A 1 142 ? 21.835  -10.852 5.910   1.00 22.39  ? 124 ALA A CA    1 
ATOM   962  C  C     . ALA A 1 142 ? 21.836  -11.747 7.134   1.00 22.06  ? 124 ALA A C     1 
ATOM   963  O  O     . ALA A 1 142 ? 21.423  -11.323 8.214   1.00 20.89  ? 124 ALA A O     1 
ATOM   964  C  CB    . ALA A 1 142 ? 22.621  -9.580  6.170   1.00 20.68  ? 124 ALA A CB    1 
ATOM   965  N  N     . VAL A 1 143 ? 22.265  -12.995 6.959   1.00 21.41  ? 125 VAL A N     1 
ATOM   966  C  CA    . VAL A 1 143 ? 22.329  -13.932 8.076   1.00 21.38  ? 125 VAL A CA    1 
ATOM   967  C  C     . VAL A 1 143 ? 23.782  -14.104 8.499   1.00 23.81  ? 125 VAL A C     1 
ATOM   968  O  O     . VAL A 1 143 ? 24.566  -14.768 7.821   1.00 25.00  ? 125 VAL A O     1 
ATOM   969  C  CB    . VAL A 1 143 ? 21.702  -15.292 7.723   1.00 24.12  ? 125 VAL A CB    1 
ATOM   970  C  CG1   . VAL A 1 143 ? 21.650  -16.197 8.952   1.00 18.59  ? 125 VAL A CG1   1 
ATOM   971  C  CG2   . VAL A 1 143 ? 20.306  -15.092 7.148   1.00 28.30  ? 125 VAL A CG2   1 
ATOM   972  N  N     . LEU A 1 144 ? 24.137  -13.486 9.618   1.00 25.79  ? 126 LEU A N     1 
ATOM   973  C  CA    . LEU A 1 144 ? 25.523  -13.448 10.068  1.00 28.10  ? 126 LEU A CA    1 
ATOM   974  C  C     . LEU A 1 144 ? 25.829  -14.596 11.024  1.00 33.99  ? 126 LEU A C     1 
ATOM   975  O  O     . LEU A 1 144 ? 25.324  -14.636 12.144  1.00 32.18  ? 126 LEU A O     1 
ATOM   976  C  CB    . LEU A 1 144 ? 25.825  -12.105 10.730  1.00 27.05  ? 126 LEU A CB    1 
ATOM   977  C  CG    . LEU A 1 144 ? 26.326  -10.984 9.814   1.00 29.14  ? 126 LEU A CG    1 
ATOM   978  C  CD1   . LEU A 1 144 ? 25.385  -10.728 8.644   1.00 26.29  ? 126 LEU A CD1   1 
ATOM   979  C  CD2   . LEU A 1 144 ? 26.547  -9.712  10.615  1.00 32.86  ? 126 LEU A CD2   1 
ATOM   980  N  N     . VAL A 1 145 ? 26.654  -15.535 10.576  1.00 39.38  ? 127 VAL A N     1 
ATOM   981  C  CA    . VAL A 1 145 ? 26.947  -16.714 11.380  1.00 27.23  ? 127 VAL A CA    1 
ATOM   982  C  C     . VAL A 1 145 ? 28.355  -16.678 11.972  1.00 27.64  ? 127 VAL A C     1 
ATOM   983  O  O     . VAL A 1 145 ? 29.329  -16.382 11.275  1.00 35.39  ? 127 VAL A O     1 
ATOM   984  C  CB    . VAL A 1 145 ? 26.752  -18.016 10.566  1.00 30.50  ? 127 VAL A CB    1 
ATOM   985  C  CG1   . VAL A 1 145 ? 27.175  -19.231 11.384  1.00 30.25  ? 127 VAL A CG1   1 
ATOM   986  C  CG2   . VAL A 1 145 ? 25.300  -18.149 10.115  1.00 28.92  ? 127 VAL A CG2   1 
ATOM   987  N  N     . SER A 1 146 ? 28.452  -16.964 13.265  1.00 53.97  ? 128 SER A N     1 
ATOM   988  C  CA    . SER A 1 146 ? 29.745  -17.163 13.902  1.00 53.39  ? 128 SER A CA    1 
ATOM   989  C  C     . SER A 1 146 ? 29.600  -18.136 15.064  1.00 53.74  ? 128 SER A C     1 
ATOM   990  O  O     . SER A 1 146 ? 28.488  -18.486 15.460  1.00 49.67  ? 128 SER A O     1 
ATOM   991  C  CB    . SER A 1 146 ? 30.337  -15.833 14.377  1.00 50.61  ? 128 SER A CB    1 
ATOM   992  O  OG    . SER A 1 146 ? 29.510  -15.220 15.348  1.00 46.19  ? 128 SER A OG    1 
ATOM   993  N  N     . GLU A 1 147 ? 30.728  -18.579 15.604  1.00 60.40  ? 129 GLU A N     1 
ATOM   994  C  CA    . GLU A 1 147 ? 30.713  -19.490 16.738  1.00 65.06  ? 129 GLU A CA    1 
ATOM   995  C  C     . GLU A 1 147 ? 30.133  -18.792 17.965  1.00 66.42  ? 129 GLU A C     1 
ATOM   996  O  O     . GLU A 1 147 ? 29.497  -19.423 18.808  1.00 65.48  ? 129 GLU A O     1 
ATOM   997  C  CB    . GLU A 1 147 ? 32.123  -20.007 17.023  1.00 68.07  ? 129 GLU A CB    1 
ATOM   998  C  CG    . GLU A 1 147 ? 32.188  -21.063 18.110  1.00 71.44  ? 129 GLU A CG    1 
ATOM   999  C  CD    . GLU A 1 147 ? 33.585  -21.618 18.288  1.00 77.94  ? 129 GLU A CD    1 
ATOM   1000 O  OE1   . GLU A 1 147 ? 34.126  -22.185 17.314  1.00 79.94  ? 129 GLU A OE1   1 
ATOM   1001 O  OE2   . GLU A 1 147 ? 34.146  -21.481 19.396  1.00 80.74  ? 129 GLU A OE2   1 
ATOM   1002 N  N     . LYS A 1 148 ? 30.343  -17.481 18.044  1.00 69.13  ? 130 LYS A N     1 
ATOM   1003 C  CA    . LYS A 1 148 ? 29.860  -16.679 19.165  1.00 69.89  ? 130 LYS A CA    1 
ATOM   1004 C  C     . LYS A 1 148 ? 28.376  -16.335 19.034  1.00 67.55  ? 130 LYS A C     1 
ATOM   1005 O  O     . LYS A 1 148 ? 27.609  -16.496 19.984  1.00 66.28  ? 130 LYS A O     1 
ATOM   1006 C  CB    . LYS A 1 148 ? 30.672  -15.385 19.274  1.00 70.81  ? 130 LYS A CB    1 
ATOM   1007 C  CG    . LYS A 1 148 ? 31.027  -14.968 20.695  1.00 71.26  ? 130 LYS A CG    1 
ATOM   1008 C  CD    . LYS A 1 148 ? 32.476  -15.304 21.011  1.00 72.47  ? 130 LYS A CD    1 
ATOM   1009 C  CE    . LYS A 1 148 ? 33.420  -14.646 20.015  1.00 71.73  ? 130 LYS A CE    1 
ATOM   1010 N  NZ    . LYS A 1 148 ? 34.828  -15.112 20.165  1.00 73.72  ? 130 LYS A NZ    1 
ATOM   1011 N  N     . LEU A 1 149 ? 27.980  -15.854 17.857  1.00 66.53  ? 131 LEU A N     1 
ATOM   1012 C  CA    . LEU A 1 149 ? 26.631  -15.325 17.651  1.00 64.44  ? 131 LEU A CA    1 
ATOM   1013 C  C     . LEU A 1 149 ? 26.042  -15.685 16.290  1.00 62.66  ? 131 LEU A C     1 
ATOM   1014 O  O     . LEU A 1 149 ? 26.769  -15.953 15.332  1.00 64.19  ? 131 LEU A O     1 
ATOM   1015 C  CB    . LEU A 1 149 ? 26.639  -13.795 17.771  1.00 64.40  ? 131 LEU A CB    1 
ATOM   1016 C  CG    . LEU A 1 149 ? 27.135  -13.119 19.049  1.00 66.47  ? 131 LEU A CG    1 
ATOM   1017 C  CD1   . LEU A 1 149 ? 28.096  -11.996 18.705  1.00 67.59  ? 131 LEU A CD1   1 
ATOM   1018 C  CD2   . LEU A 1 149 ? 25.967  -12.583 19.849  1.00 65.73  ? 131 LEU A CD2   1 
ATOM   1019 N  N     . ARG A 1 150 ? 24.714  -15.683 16.216  1.00 58.76  ? 132 ARG A N     1 
ATOM   1020 C  CA    . ARG A 1 150 ? 24.018  -15.660 14.936  1.00 55.38  ? 132 ARG A CA    1 
ATOM   1021 C  C     . ARG A 1 150 ? 22.990  -14.527 14.974  1.00 47.77  ? 132 ARG A C     1 
ATOM   1022 O  O     . ARG A 1 150 ? 22.338  -14.296 15.997  1.00 46.25  ? 132 ARG A O     1 
ATOM   1023 C  CB    . ARG A 1 150 ? 23.377  -17.014 14.600  1.00 59.38  ? 132 ARG A CB    1 
ATOM   1024 C  CG    . ARG A 1 150 ? 22.024  -17.271 15.242  1.00 65.00  ? 132 ARG A CG    1 
ATOM   1025 C  CD    . ARG A 1 150 ? 21.015  -17.774 14.215  1.00 69.23  ? 132 ARG A CD    1 
ATOM   1026 N  NE    . ARG A 1 150 ? 19.684  -17.969 14.792  1.00 72.74  ? 132 ARG A NE    1 
ATOM   1027 C  CZ    . ARG A 1 150 ? 18.771  -17.008 14.916  1.00 73.60  ? 132 ARG A CZ    1 
ATOM   1028 N  NH1   . ARG A 1 150 ? 19.040  -15.772 14.509  1.00 74.14  ? 132 ARG A NH1   1 
ATOM   1029 N  NH2   . ARG A 1 150 ? 17.589  -17.281 15.452  1.00 72.49  ? 132 ARG A NH2   1 
ATOM   1030 N  N     . SER A 1 151 ? 22.868  -13.802 13.867  1.00 38.56  ? 133 SER A N     1 
ATOM   1031 C  CA    . SER A 1 151 ? 22.062  -12.593 13.854  1.00 31.48  ? 133 SER A CA    1 
ATOM   1032 C  C     . SER A 1 151 ? 21.608  -12.257 12.438  1.00 27.37  ? 133 SER A C     1 
ATOM   1033 O  O     . SER A 1 151 ? 22.340  -12.478 11.469  1.00 24.55  ? 133 SER A O     1 
ATOM   1034 C  CB    . SER A 1 151 ? 22.865  -11.431 14.452  1.00 34.50  ? 133 SER A CB    1 
ATOM   1035 O  OG    . SER A 1 151 ? 22.017  -10.395 14.918  1.00 36.64  ? 133 SER A OG    1 
ATOM   1036 N  N     . MET A 1 152 ? 20.401  -11.714 12.325  1.00 23.64  ? 134 MET A N     1 
ATOM   1037 C  CA    . MET A 1 152 ? 19.829  -11.383 11.024  1.00 24.12  ? 134 MET A CA    1 
ATOM   1038 C  C     . MET A 1 152 ? 19.518  -9.899  10.864  1.00 25.49  ? 134 MET A C     1 
ATOM   1039 O  O     . MET A 1 152 ? 18.985  -9.263  11.774  1.00 26.48  ? 134 MET A O     1 
ATOM   1040 C  CB    . MET A 1 152 ? 18.556  -12.196 10.778  1.00 20.38  ? 134 MET A CB    1 
ATOM   1041 C  CG    . MET A 1 152 ? 18.816  -13.667 10.510  1.00 27.95  ? 134 MET A CG    1 
ATOM   1042 S  SD    . MET A 1 152 ? 17.291  -14.590 10.272  1.00 29.89  ? 134 MET A SD    1 
ATOM   1043 C  CE    . MET A 1 152 ? 16.531  -14.426 11.885  1.00 78.29  ? 134 MET A CE    1 
ATOM   1044 N  N     . VAL A 1 153 ? 19.850  -9.358  9.694   1.00 26.44  ? 135 VAL A N     1 
ATOM   1045 C  CA    . VAL A 1 153 ? 19.436  -8.011  9.319   1.00 21.49  ? 135 VAL A CA    1 
ATOM   1046 C  C     . VAL A 1 153 ? 18.624  -8.083  8.030   1.00 20.61  ? 135 VAL A C     1 
ATOM   1047 O  O     . VAL A 1 153 ? 19.139  -8.465  6.978   1.00 21.06  ? 135 VAL A O     1 
ATOM   1048 C  CB    . VAL A 1 153 ? 20.635  -7.064  9.136   1.00 24.08  ? 135 VAL A CB    1 
ATOM   1049 C  CG1   . VAL A 1 153 ? 20.150  -5.632  8.880   1.00 23.94  ? 135 VAL A CG1   1 
ATOM   1050 C  CG2   . VAL A 1 153 ? 21.538  -7.115  10.361  1.00 25.77  ? 135 VAL A CG2   1 
ATOM   1051 N  N     . THR A 1 154 ? 17.351  -7.716  8.121   1.00 19.69  ? 136 THR A N     1 
ATOM   1052 C  CA    . THR A 1 154 ? 16.421  -7.902  7.019   1.00 18.97  ? 136 THR A CA    1 
ATOM   1053 C  C     . THR A 1 154 ? 16.106  -6.617  6.261   1.00 21.04  ? 136 THR A C     1 
ATOM   1054 O  O     . THR A 1 154 ? 15.714  -5.616  6.857   1.00 19.33  ? 136 THR A O     1 
ATOM   1055 C  CB    . THR A 1 154 ? 15.096  -8.494  7.522   1.00 17.96  ? 136 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 154 ? 15.352  -9.767  8.124   1.00 17.84  ? 136 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 154 ? 14.114  -8.666  6.374   1.00 17.46  ? 136 THR A CG2   1 
ATOM   1058 N  N     . TYR A 1 155 ? 16.293  -6.657  4.946   1.00 19.51  ? 137 TYR A N     1 
ATOM   1059 C  CA    . TYR A 1 155 ? 15.829  -5.593  4.061   1.00 20.71  ? 137 TYR A CA    1 
ATOM   1060 C  C     . TYR A 1 155 ? 14.612  -6.112  3.302   1.00 20.57  ? 137 TYR A C     1 
ATOM   1061 O  O     . TYR A 1 155 ? 14.741  -6.923  2.387   1.00 19.26  ? 137 TYR A O     1 
ATOM   1062 C  CB    . TYR A 1 155 ? 16.924  -5.171  3.076   1.00 26.06  ? 137 TYR A CB    1 
ATOM   1063 C  CG    . TYR A 1 155 ? 16.517  -3.998  2.203   1.00 32.18  ? 137 TYR A CG    1 
ATOM   1064 C  CD1   . TYR A 1 155 ? 16.456  -2.712  2.725   1.00 34.38  ? 137 TYR A CD1   1 
ATOM   1065 C  CD2   . TYR A 1 155 ? 16.180  -4.179  0.866   1.00 33.42  ? 137 TYR A CD2   1 
ATOM   1066 C  CE1   . TYR A 1 155 ? 16.074  -1.637  1.945   1.00 38.22  ? 137 TYR A CE1   1 
ATOM   1067 C  CE2   . TYR A 1 155 ? 15.796  -3.104  0.073   1.00 36.79  ? 137 TYR A CE2   1 
ATOM   1068 C  CZ    . TYR A 1 155 ? 15.748  -1.837  0.621   1.00 40.49  ? 137 TYR A CZ    1 
ATOM   1069 O  OH    . TYR A 1 155 ? 15.371  -0.759  -0.150  1.00 46.86  ? 137 TYR A OH    1 
ATOM   1070 N  N     . LEU A 1 156 ? 13.433  -5.659  3.704   1.00 18.74  ? 138 LEU A N     1 
ATOM   1071 C  CA    . LEU A 1 156 ? 12.184  -6.213  3.194   1.00 20.30  ? 138 LEU A CA    1 
ATOM   1072 C  C     . LEU A 1 156 ? 11.989  -6.008  1.694   1.00 23.23  ? 138 LEU A C     1 
ATOM   1073 O  O     . LEU A 1 156 ? 11.440  -6.881  1.019   1.00 24.11  ? 138 LEU A O     1 
ATOM   1074 C  CB    . LEU A 1 156 ? 10.993  -5.659  3.975   1.00 20.11  ? 138 LEU A CB    1 
ATOM   1075 C  CG    . LEU A 1 156 ? 10.844  -6.251  5.382   1.00 22.88  ? 138 LEU A CG    1 
ATOM   1076 C  CD1   . LEU A 1 156 ? 9.730   -5.557  6.158   1.00 17.17  ? 138 LEU A CD1   1 
ATOM   1077 C  CD2   . LEU A 1 156 ? 10.588  -7.744  5.295   1.00 16.65  ? 138 LEU A CD2   1 
ATOM   1078 N  N     . GLY A 1 157 ? 12.438  -4.862  1.184   1.00 23.12  ? 139 GLY A N     1 
ATOM   1079 C  CA    . GLY A 1 157 ? 12.387  -4.573  -0.242  1.00 23.12  ? 139 GLY A CA    1 
ATOM   1080 C  C     . GLY A 1 157 ? 11.018  -4.777  -0.866  1.00 25.19  ? 139 GLY A C     1 
ATOM   1081 O  O     . GLY A 1 157 ? 10.019  -4.230  -0.392  1.00 20.50  ? 139 GLY A O     1 
ATOM   1082 N  N     . ALA A 1 158 ? 10.970  -5.597  -1.912  1.00 20.94  ? 140 ALA A N     1 
ATOM   1083 C  CA    . ALA A 1 158 ? 9.737   -5.830  -2.663  1.00 27.03  ? 140 ALA A CA    1 
ATOM   1084 C  C     . ALA A 1 158 ? 8.577   -6.356  -1.812  1.00 28.91  ? 140 ALA A C     1 
ATOM   1085 O  O     . ALA A 1 158 ? 7.414   -6.080  -2.115  1.00 20.86  ? 140 ALA A O     1 
ATOM   1086 C  CB    . ALA A 1 158 ? 10.003  -6.767  -3.828  1.00 25.58  ? 140 ALA A CB    1 
ATOM   1087 N  N     . ALA A 1 159 ? 8.897   -7.101  -0.753  1.00 19.38  ? 141 ALA A N     1 
ATOM   1088 C  CA    . ALA A 1 159 ? 7.888   -7.688  0.129   1.00 20.58  ? 141 ALA A CA    1 
ATOM   1089 C  C     . ALA A 1 159 ? 6.923   -6.670  0.746   1.00 22.43  ? 141 ALA A C     1 
ATOM   1090 O  O     . ALA A 1 159 ? 5.793   -7.018  1.090   1.00 22.42  ? 141 ALA A O     1 
ATOM   1091 C  CB    . ALA A 1 159 ? 8.556   -8.520  1.224   1.00 22.63  ? 141 ALA A CB    1 
ATOM   1092 N  N     . CYS A 1 160 ? 7.367   -5.421  0.884   1.00 22.08  ? 142 CYS A N     1 
ATOM   1093 C  CA    . CYS A 1 160 ? 6.524   -4.350  1.419   1.00 22.69  ? 142 CYS A CA    1 
ATOM   1094 C  C     . CYS A 1 160 ? 5.348   -4.014  0.514   1.00 25.85  ? 142 CYS A C     1 
ATOM   1095 O  O     . CYS A 1 160 ? 4.298   -3.575  0.990   1.00 23.94  ? 142 CYS A O     1 
ATOM   1096 C  CB    . CYS A 1 160 ? 7.340   -3.076  1.647   1.00 22.33  ? 142 CYS A CB    1 
ATOM   1097 S  SG    . CYS A 1 160 ? 8.543   -3.200  2.975   1.00 35.05  ? 142 CYS A SG    1 
ATOM   1098 N  N     . ASP A 1 161 ? 5.530   -4.212  -0.788  1.00 26.31  ? 143 ASP A N     1 
ATOM   1099 C  CA    . ASP A 1 161 ? 4.523   -3.824  -1.772  1.00 28.57  ? 143 ASP A CA    1 
ATOM   1100 C  C     . ASP A 1 161 ? 3.332   -4.776  -1.842  1.00 27.02  ? 143 ASP A C     1 
ATOM   1101 O  O     . ASP A 1 161 ? 2.403   -4.548  -2.618  1.00 27.54  ? 143 ASP A O     1 
ATOM   1102 C  CB    . ASP A 1 161 ? 5.154   -3.661  -3.158  1.00 32.00  ? 143 ASP A CB    1 
ATOM   1103 C  CG    . ASP A 1 161 ? 5.738   -2.274  -3.374  1.00 38.81  ? 143 ASP A CG    1 
ATOM   1104 O  OD1   . ASP A 1 161 ? 6.033   -1.582  -2.376  1.00 41.69  ? 143 ASP A OD1   1 
ATOM   1105 O  OD2   . ASP A 1 161 ? 5.903   -1.875  -4.546  1.00 42.29  ? 143 ASP A OD2   1 
ATOM   1106 N  N     . LEU A 1 162 ? 3.356   -5.838  -1.040  1.00 23.65  ? 144 LEU A N     1 
ATOM   1107 C  CA    . LEU A 1 162 ? 2.229   -6.765  -0.988  1.00 24.17  ? 144 LEU A CA    1 
ATOM   1108 C  C     . LEU A 1 162 ? 0.976   -6.013  -0.554  1.00 28.05  ? 144 LEU A C     1 
ATOM   1109 O  O     . LEU A 1 162 ? 0.957   -5.380  0.504   1.00 25.68  ? 144 LEU A O     1 
ATOM   1110 C  CB    . LEU A 1 162 ? 2.518   -7.916  -0.029  1.00 21.19  ? 144 LEU A CB    1 
ATOM   1111 C  CG    . LEU A 1 162 ? 1.378   -8.906  0.211   1.00 22.71  ? 144 LEU A CG    1 
ATOM   1112 C  CD1   . LEU A 1 162 ? 1.061   -9.705  -1.055  1.00 22.09  ? 144 LEU A CD1   1 
ATOM   1113 C  CD2   . LEU A 1 162 ? 1.736   -9.821  1.365   1.00 19.12  ? 144 LEU A CD2   1 
ATOM   1114 N  N     . SER A 1 163 ? -0.063  -6.067  -1.381  1.00 30.46  ? 145 SER A N     1 
ATOM   1115 C  CA    . SER A 1 163 ? -1.236  -5.232  -1.155  1.00 32.82  ? 145 SER A CA    1 
ATOM   1116 C  C     . SER A 1 163 ? -2.526  -6.026  -1.048  1.00 34.09  ? 145 SER A C     1 
ATOM   1117 O  O     . SER A 1 163 ? -2.621  -7.154  -1.523  1.00 36.18  ? 145 SER A O     1 
ATOM   1118 C  CB    . SER A 1 163 ? -1.378  -4.197  -2.271  1.00 33.22  ? 145 SER A CB    1 
ATOM   1119 O  OG    . SER A 1 163 ? -1.648  -4.829  -3.507  1.00 35.94  ? 145 SER A OG    1 
ATOM   1120 N  N     . LEU A 1 164 ? -3.521  -5.408  -0.426  1.00 34.50  ? 146 LEU A N     1 
ATOM   1121 C  CA    . LEU A 1 164 ? -4.850  -5.985  -0.334  1.00 35.01  ? 146 LEU A CA    1 
ATOM   1122 C  C     . LEU A 1 164 ? -5.451  -6.127  -1.732  1.00 34.88  ? 146 LEU A C     1 
ATOM   1123 O  O     . LEU A 1 164 ? -6.218  -7.055  -1.994  1.00 35.88  ? 146 LEU A O     1 
ATOM   1124 C  CB    . LEU A 1 164 ? -5.738  -5.104  0.548   1.00 36.59  ? 146 LEU A CB    1 
ATOM   1125 C  CG    . LEU A 1 164 ? -7.090  -5.656  0.994   1.00 40.74  ? 146 LEU A CG    1 
ATOM   1126 C  CD1   . LEU A 1 164 ? -6.933  -7.021  1.657   1.00 40.12  ? 146 LEU A CD1   1 
ATOM   1127 C  CD2   . LEU A 1 164 ? -7.768  -4.672  1.936   1.00 42.24  ? 146 LEU A CD2   1 
ATOM   1128 N  N     . ALA A 1 165 ? -5.089  -5.207  -2.627  1.00 30.09  ? 147 ALA A N     1 
ATOM   1129 C  CA    . ALA A 1 165 ? -5.553  -5.251  -4.009  1.00 35.50  ? 147 ALA A CA    1 
ATOM   1130 C  C     . ALA A 1 165 ? -5.145  -6.537  -4.722  1.00 36.71  ? 147 ALA A C     1 
ATOM   1131 O  O     . ALA A 1 165 ? -5.917  -7.091  -5.505  1.00 37.86  ? 147 ALA A O     1 
ATOM   1132 C  CB    . ALA A 1 165 ? -5.053  -4.034  -4.787  1.00 36.28  ? 147 ALA A CB    1 
ATOM   1133 N  N     . HIS A 1 166 ? -3.929  -7.004  -4.459  1.00 34.62  ? 148 HIS A N     1 
ATOM   1134 C  CA    . HIS A 1 166 ? -3.431  -8.209  -5.112  1.00 33.40  ? 148 HIS A CA    1 
ATOM   1135 C  C     . HIS A 1 166 ? -4.093  -9.439  -4.514  1.00 34.91  ? 148 HIS A C     1 
ATOM   1136 O  O     . HIS A 1 166 ? -4.440  -10.382 -5.222  1.00 35.91  ? 148 HIS A O     1 
ATOM   1137 C  CB    . HIS A 1 166 ? -1.917  -8.311  -4.969  1.00 29.75  ? 148 HIS A CB    1 
ATOM   1138 C  CG    . HIS A 1 166 ? -1.369  -9.649  -5.352  1.00 30.05  ? 148 HIS A CG    1 
ATOM   1139 N  ND1   . HIS A 1 166 ? -1.187  -10.031 -6.664  1.00 28.93  ? 148 HIS A ND1   1 
ATOM   1140 C  CD2   . HIS A 1 166 ? -0.979  -10.701 -4.594  1.00 27.21  ? 148 HIS A CD2   1 
ATOM   1141 C  CE1   . HIS A 1 166 ? -0.700  -11.259 -6.698  1.00 27.93  ? 148 HIS A CE1   1 
ATOM   1142 N  NE2   . HIS A 1 166 ? -0.566  -11.689 -5.456  1.00 27.67  ? 148 HIS A NE2   1 
ATOM   1143 N  N     . ILE A 1 167 ? -4.267  -9.411  -3.199  1.00 36.49  ? 149 ILE A N     1 
ATOM   1144 C  CA    . ILE A 1 167 ? -4.896  -10.500 -2.465  1.00 35.84  ? 149 ILE A CA    1 
ATOM   1145 C  C     . ILE A 1 167 ? -6.372  -10.653 -2.839  1.00 38.85  ? 149 ILE A C     1 
ATOM   1146 O  O     . ILE A 1 167 ? -6.903  -11.764 -2.860  1.00 42.48  ? 149 ILE A O     1 
ATOM   1147 C  CB    . ILE A 1 167 ? -4.738  -10.280 -0.946  1.00 33.67  ? 149 ILE A CB    1 
ATOM   1148 C  CG1   . ILE A 1 167 ? -3.255  -10.338 -0.566  1.00 34.57  ? 149 ILE A CG1   1 
ATOM   1149 C  CG2   . ILE A 1 167 ? -5.525  -11.306 -0.152  1.00 32.47  ? 149 ILE A CG2   1 
ATOM   1150 C  CD1   . ILE A 1 167 ? -2.966  -9.889  0.851   1.00 33.45  ? 149 ILE A CD1   1 
ATOM   1151 N  N     . GLU A 1 168 ? -7.024  -9.542  -3.164  1.00 38.11  ? 150 GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 168 ? -8.459  -9.559  -3.437  1.00 38.54  ? 150 GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 168 ? -8.818  -9.854  -4.892  1.00 38.23  ? 150 GLU A C     1 
ATOM   1154 O  O     . GLU A 1 168 ? -9.998  -9.896  -5.244  1.00 38.22  ? 150 GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 168 ? -9.116  -8.254  -2.979  1.00 41.63  ? 150 GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 168 ? -9.200  -8.108  -1.468  1.00 43.80  ? 150 GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 168 ? -9.913  -6.841  -1.038  1.00 49.88  ? 150 GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 168 ? -9.795  -5.813  -1.743  1.00 52.67  ? 150 GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 168 ? -10.598 -6.876  0.006   1.00 51.65  ? 150 GLU A OE2   1 
ATOM   1160 N  N     . GLN A 1 169 ? -7.810  -10.054 -5.736  1.00 39.46  ? 151 GLN A N     1 
ATOM   1161 C  CA    . GLN A 1 169 ? -8.060  -10.501 -7.104  1.00 39.79  ? 151 GLN A CA    1 
ATOM   1162 C  C     . GLN A 1 169 ? -8.796  -11.830 -7.041  1.00 38.38  ? 151 GLN A C     1 
ATOM   1163 O  O     . GLN A 1 169 ? -8.447  -12.685 -6.232  1.00 36.84  ? 151 GLN A O     1 
ATOM   1164 C  CB    . GLN A 1 169 ? -6.750  -10.691 -7.859  1.00 39.65  ? 151 GLN A CB    1 
ATOM   1165 C  CG    . GLN A 1 169 ? -6.077  -9.416  -8.299  1.00 40.18  ? 151 GLN A CG    1 
ATOM   1166 C  CD    . GLN A 1 169 ? -4.807  -9.694  -9.069  1.00 38.91  ? 151 GLN A CD    1 
ATOM   1167 O  OE1   . GLN A 1 169 ? -4.762  -9.540  -10.288 1.00 40.44  ? 151 GLN A OE1   1 
ATOM   1168 N  NE2   . GLN A 1 169 ? -3.768  -10.122 -8.362  1.00 35.79  ? 151 GLN A NE2   1 
ATOM   1169 N  N     . PRO A 1 170 ? -9.829  -12.001 -7.880  1.00 41.43  ? 152 PRO A N     1 
ATOM   1170 C  CA    . PRO A 1 170 ? -10.619 -13.239 -7.891  1.00 42.50  ? 152 PRO A CA    1 
ATOM   1171 C  C     . PRO A 1 170 ? -9.768  -14.513 -7.933  1.00 41.44  ? 152 PRO A C     1 
ATOM   1172 O  O     . PRO A 1 170 ? -10.096 -15.477 -7.239  1.00 40.23  ? 152 PRO A O     1 
ATOM   1173 C  CB    . PRO A 1 170 ? -11.451 -13.099 -9.164  1.00 43.49  ? 152 PRO A CB    1 
ATOM   1174 C  CG    . PRO A 1 170 ? -11.665 -11.624 -9.284  1.00 44.71  ? 152 PRO A CG    1 
ATOM   1175 C  CD    . PRO A 1 170 ? -10.384 -10.987 -8.796  1.00 43.20  ? 152 PRO A CD    1 
ATOM   1176 N  N     . HIS A 1 171 ? -8.684  -14.510 -8.704  1.00 40.22  ? 153 HIS A N     1 
ATOM   1177 C  CA    . HIS A 1 171 ? -7.879  -15.721 -8.870  1.00 41.18  ? 153 HIS A CA    1 
ATOM   1178 C  C     . HIS A 1 171 ? -6.934  -15.974 -7.699  1.00 42.03  ? 153 HIS A C     1 
ATOM   1179 O  O     . HIS A 1 171 ? -6.363  -17.058 -7.585  1.00 44.01  ? 153 HIS A O     1 
ATOM   1180 C  CB    . HIS A 1 171 ? -7.107  -15.707 -10.196 1.00 38.05  ? 153 HIS A CB    1 
ATOM   1181 C  CG    . HIS A 1 171 ? -5.963  -14.740 -10.229 1.00 41.79  ? 153 HIS A CG    1 
ATOM   1182 N  ND1   . HIS A 1 171 ? -6.113  -13.419 -10.593 1.00 42.97  ? 153 HIS A ND1   1 
ATOM   1183 C  CD2   . HIS A 1 171 ? -4.646  -14.907 -9.958  1.00 40.79  ? 153 HIS A CD2   1 
ATOM   1184 C  CE1   . HIS A 1 171 ? -4.942  -12.812 -10.539 1.00 42.07  ? 153 HIS A CE1   1 
ATOM   1185 N  NE2   . HIS A 1 171 ? -4.034  -13.692 -10.155 1.00 41.85  ? 153 HIS A NE2   1 
ATOM   1186 N  N     . VAL A 1 172 ? -6.769  -14.975 -6.836  1.00 40.35  ? 154 VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 172 ? -5.956  -15.135 -5.638  1.00 37.95  ? 154 VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 172 ? -6.834  -15.367 -4.409  1.00 38.90  ? 154 VAL A C     1 
ATOM   1189 O  O     . VAL A 1 172 ? -6.546  -16.238 -3.582  1.00 38.39  ? 154 VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 172 ? -5.036  -13.921 -5.394  1.00 35.61  ? 154 VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 172 ? -4.282  -14.086 -4.080  1.00 32.63  ? 154 VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 172 ? -4.062  -13.750 -6.549  1.00 34.31  ? 154 VAL A CG2   1 
ATOM   1193 N  N     . TRP A 1 173 ? -7.913  -14.598 -4.295  1.00 36.77  ? 155 TRP A N     1 
ATOM   1194 C  CA    . TRP A 1 173 ? -8.821  -14.758 -3.168  1.00 36.36  ? 155 TRP A CA    1 
ATOM   1195 C  C     . TRP A 1 173 ? -9.442  -16.152 -3.143  1.00 37.26  ? 155 TRP A C     1 
ATOM   1196 O  O     . TRP A 1 173 ? -9.823  -16.648 -2.082  1.00 36.19  ? 155 TRP A O     1 
ATOM   1197 C  CB    . TRP A 1 173 ? -9.919  -13.690 -3.171  1.00 32.74  ? 155 TRP A CB    1 
ATOM   1198 C  CG    . TRP A 1 173 ? -10.772 -13.766 -1.947  1.00 34.54  ? 155 TRP A CG    1 
ATOM   1199 C  CD1   . TRP A 1 173 ? -12.066 -14.198 -1.871  1.00 36.26  ? 155 TRP A CD1   1 
ATOM   1200 C  CD2   . TRP A 1 173 ? -10.382 -13.432 -0.608  1.00 30.85  ? 155 TRP A CD2   1 
ATOM   1201 N  NE1   . TRP A 1 173 ? -12.507 -14.142 -0.570  1.00 35.40  ? 155 TRP A NE1   1 
ATOM   1202 C  CE2   . TRP A 1 173 ? -11.492 -13.675 0.225   1.00 33.47  ? 155 TRP A CE2   1 
ATOM   1203 C  CE3   . TRP A 1 173 ? -9.202  -12.942 -0.035  1.00 36.10  ? 155 TRP A CE3   1 
ATOM   1204 C  CZ2   . TRP A 1 173 ? -11.459 -13.448 1.600   1.00 33.22  ? 155 TRP A CZ2   1 
ATOM   1205 C  CZ3   . TRP A 1 173 ? -9.169  -12.719 1.333   1.00 34.31  ? 155 TRP A CZ3   1 
ATOM   1206 C  CH2   . TRP A 1 173 ? -10.291 -12.971 2.134   1.00 35.06  ? 155 TRP A CH2   1 
ATOM   1207 N  N     . SER A 1 174 ? -9.534  -16.785 -4.310  1.00 39.49  ? 156 SER A N     1 
ATOM   1208 C  CA    . SER A 1 174 ? -10.077 -18.139 -4.394  1.00 41.97  ? 156 SER A CA    1 
ATOM   1209 C  C     . SER A 1 174 ? -9.182  -19.168 -3.691  1.00 37.59  ? 156 SER A C     1 
ATOM   1210 O  O     . SER A 1 174 ? -9.660  -20.209 -3.250  1.00 39.87  ? 156 SER A O     1 
ATOM   1211 C  CB    . SER A 1 174 ? -10.337 -18.546 -5.849  1.00 44.02  ? 156 SER A CB    1 
ATOM   1212 O  OG    . SER A 1 174 ? -9.126  -18.795 -6.535  1.00 45.13  ? 156 SER A OG    1 
ATOM   1213 N  N     . LEU A 1 175 ? -7.888  -18.876 -3.589  1.00 35.00  ? 157 LEU A N     1 
ATOM   1214 C  CA    . LEU A 1 175 ? -6.980  -19.723 -2.812  1.00 34.48  ? 157 LEU A CA    1 
ATOM   1215 C  C     . LEU A 1 175 ? -7.274  -19.604 -1.317  1.00 33.33  ? 157 LEU A C     1 
ATOM   1216 O  O     . LEU A 1 175 ? -7.108  -20.564 -0.561  1.00 31.82  ? 157 LEU A O     1 
ATOM   1217 C  CB    . LEU A 1 175 ? -5.517  -19.361 -3.085  1.00 31.60  ? 157 LEU A CB    1 
ATOM   1218 C  CG    . LEU A 1 175 ? -5.001  -19.552 -4.514  1.00 32.99  ? 157 LEU A CG    1 
ATOM   1219 C  CD1   . LEU A 1 175 ? -3.556  -19.096 -4.616  1.00 31.59  ? 157 LEU A CD1   1 
ATOM   1220 C  CD2   . LEU A 1 175 ? -5.145  -21.000 -4.952  1.00 29.94  ? 157 LEU A CD2   1 
ATOM   1221 N  N     . VAL A 1 176 ? -7.709  -18.420 -0.893  1.00 32.05  ? 158 VAL A N     1 
ATOM   1222 C  CA    . VAL A 1 176 ? -8.059  -18.198 0.505   1.00 30.48  ? 158 VAL A CA    1 
ATOM   1223 C  C     . VAL A 1 176 ? -9.369  -18.901 0.837   1.00 32.35  ? 158 VAL A C     1 
ATOM   1224 O  O     . VAL A 1 176 ? -9.495  -19.536 1.886   1.00 33.22  ? 158 VAL A O     1 
ATOM   1225 C  CB    . VAL A 1 176 ? -8.185  -16.694 0.837   1.00 31.15  ? 158 VAL A CB    1 
ATOM   1226 C  CG1   . VAL A 1 176 ? -8.643  -16.496 2.284   1.00 26.89  ? 158 VAL A CG1   1 
ATOM   1227 C  CG2   . VAL A 1 176 ? -6.866  -15.978 0.584   1.00 30.60  ? 158 VAL A CG2   1 
ATOM   1228 N  N     . GLU A 1 177 ? -10.337 -18.791 -0.068  1.00 33.43  ? 159 GLU A N     1 
ATOM   1229 C  CA    . GLU A 1 177 ? -11.655 -19.381 0.140   1.00 35.80  ? 159 GLU A CA    1 
ATOM   1230 C  C     . GLU A 1 177 ? -11.619 -20.909 0.235   1.00 34.54  ? 159 GLU A C     1 
ATOM   1231 O  O     . GLU A 1 177 ? -12.354 -21.498 1.023   1.00 35.57  ? 159 GLU A O     1 
ATOM   1232 C  CB    . GLU A 1 177 ? -12.638 -18.914 -0.945  1.00 42.29  ? 159 GLU A CB    1 
ATOM   1233 C  CG    . GLU A 1 177 ? -13.231 -17.525 -0.683  1.00 49.17  ? 159 GLU A CG    1 
ATOM   1234 C  CD    . GLU A 1 177 ? -14.023 -16.969 -1.861  1.00 58.07  ? 159 GLU A CD    1 
ATOM   1235 O  OE1   . GLU A 1 177 ? -14.892 -16.098 -1.634  1.00 61.60  ? 159 GLU A OE1   1 
ATOM   1236 O  OE2   . GLU A 1 177 ? -13.773 -17.387 -3.014  1.00 60.13  ? 159 GLU A OE2   1 
ATOM   1237 N  N     . LYS A 1 178 ? -10.752 -21.546 -0.549  1.00 33.35  ? 160 LYS A N     1 
ATOM   1238 C  CA    . LYS A 1 178 ? -10.674 -23.006 -0.570  1.00 34.53  ? 160 LYS A CA    1 
ATOM   1239 C  C     . LYS A 1 178 ? -9.825  -23.584 0.569   1.00 30.90  ? 160 LYS A C     1 
ATOM   1240 O  O     . LYS A 1 178 ? -9.884  -24.785 0.848   1.00 31.36  ? 160 LYS A O     1 
ATOM   1241 C  CB    . LYS A 1 178 ? -10.140 -23.507 -1.916  1.00 37.97  ? 160 LYS A CB    1 
ATOM   1242 C  CG    . LYS A 1 178 ? -8.695  -23.123 -2.182  1.00 42.18  ? 160 LYS A CG    1 
ATOM   1243 C  CD    . LYS A 1 178 ? -8.076  -23.990 -3.267  1.00 45.62  ? 160 LYS A CD    1 
ATOM   1244 C  CE    . LYS A 1 178 ? -8.761  -23.793 -4.598  1.00 50.50  ? 160 LYS A CE    1 
ATOM   1245 N  NZ    . LYS A 1 178 ? -8.307  -24.802 -5.593  1.00 55.57  ? 160 LYS A NZ    1 
ATOM   1246 N  N     . ALA A 1 179 ? -9.033  -22.738 1.221   1.00 29.03  ? 161 ALA A N     1 
ATOM   1247 C  CA    . ALA A 1 179 ? -8.188  -23.195 2.325   1.00 31.70  ? 161 ALA A CA    1 
ATOM   1248 C  C     . ALA A 1 179 ? -8.999  -23.437 3.591   1.00 33.50  ? 161 ALA A C     1 
ATOM   1249 O  O     . ALA A 1 179 ? -9.991  -22.757 3.842   1.00 35.04  ? 161 ALA A O     1 
ATOM   1250 C  CB    . ALA A 1 179 ? -7.070  -22.204 2.596   1.00 25.65  ? 161 ALA A CB    1 
ATOM   1251 N  N     . GLN A 1 180 ? -8.575  -24.415 4.383   1.00 34.71  ? 162 GLN A N     1 
ATOM   1252 C  CA    . GLN A 1 180 ? -9.215  -24.690 5.667   1.00 30.96  ? 162 GLN A CA    1 
ATOM   1253 C  C     . GLN A 1 180 ? -8.252  -24.339 6.785   1.00 26.86  ? 162 GLN A C     1 
ATOM   1254 O  O     . GLN A 1 180 ? -8.640  -24.239 7.952   1.00 26.96  ? 162 GLN A O     1 
ATOM   1255 C  CB    . GLN A 1 180 ? -9.630  -26.159 5.764   1.00 30.42  ? 162 GLN A CB    1 
ATOM   1256 C  CG    . GLN A 1 180 ? -10.663 -26.571 4.726   1.00 33.12  ? 162 GLN A CG    1 
ATOM   1257 C  CD    . GLN A 1 180 ? -11.940 -25.760 4.831   1.00 38.94  ? 162 GLN A CD    1 
ATOM   1258 O  OE1   . GLN A 1 180 ? -12.472 -25.282 3.827   1.00 42.94  ? 162 GLN A OE1   1 
ATOM   1259 N  NE2   . GLN A 1 180 ? -12.441 -25.600 6.052   1.00 39.88  ? 162 GLN A NE2   1 
ATOM   1260 N  N     . VAL A 1 181 ? -6.990  -24.150 6.406   1.00 24.47  ? 163 VAL A N     1 
ATOM   1261 C  CA    . VAL A 1 181 ? -5.913  -23.869 7.351   1.00 27.19  ? 163 VAL A CA    1 
ATOM   1262 C  C     . VAL A 1 181 ? -5.050  -22.714 6.854   1.00 25.42  ? 163 VAL A C     1 
ATOM   1263 O  O     . VAL A 1 181 ? -4.653  -22.687 5.689   1.00 27.37  ? 163 VAL A O     1 
ATOM   1264 C  CB    . VAL A 1 181 ? -5.010  -25.106 7.548   1.00 27.03  ? 163 VAL A CB    1 
ATOM   1265 C  CG1   . VAL A 1 181 ? -3.837  -24.778 8.467   1.00 21.56  ? 163 VAL A CG1   1 
ATOM   1266 C  CG2   . VAL A 1 181 ? -5.820  -26.280 8.094   1.00 24.11  ? 163 VAL A CG2   1 
ATOM   1267 N  N     . TYR A 1 182 ? -4.764  -21.760 7.735   1.00 24.68  ? 164 TYR A N     1 
ATOM   1268 C  CA    . TYR A 1 182 ? -3.880  -20.650 7.392   1.00 23.77  ? 164 TYR A CA    1 
ATOM   1269 C  C     . TYR A 1 182 ? -2.665  -20.593 8.308   1.00 22.96  ? 164 TYR A C     1 
ATOM   1270 O  O     . TYR A 1 182 ? -2.756  -20.880 9.504   1.00 23.28  ? 164 TYR A O     1 
ATOM   1271 C  CB    . TYR A 1 182 ? -4.628  -19.317 7.444   1.00 22.79  ? 164 TYR A CB    1 
ATOM   1272 C  CG    . TYR A 1 182 ? -5.914  -19.315 6.655   1.00 22.14  ? 164 TYR A CG    1 
ATOM   1273 C  CD1   . TYR A 1 182 ? -5.908  -19.111 5.282   1.00 22.64  ? 164 TYR A CD1   1 
ATOM   1274 C  CD2   . TYR A 1 182 ? -7.132  -19.526 7.280   1.00 22.50  ? 164 TYR A CD2   1 
ATOM   1275 C  CE1   . TYR A 1 182 ? -7.082  -19.113 4.555   1.00 24.46  ? 164 TYR A CE1   1 
ATOM   1276 C  CE2   . TYR A 1 182 ? -8.311  -19.534 6.561   1.00 25.11  ? 164 TYR A CE2   1 
ATOM   1277 C  CZ    . TYR A 1 182 ? -8.281  -19.326 5.200   1.00 25.93  ? 164 TYR A CZ    1 
ATOM   1278 O  OH    . TYR A 1 182 ? -9.455  -19.331 4.481   1.00 29.94  ? 164 TYR A OH    1 
ATOM   1279 N  N     . TYR A 1 183 ? -1.522  -20.243 7.731   1.00 20.37  ? 165 TYR A N     1 
ATOM   1280 C  CA    . TYR A 1 183 ? -0.341  -19.930 8.514   1.00 21.01  ? 165 TYR A CA    1 
ATOM   1281 C  C     . TYR A 1 183 ? 0.211   -18.580 8.078   1.00 20.61  ? 165 TYR A C     1 
ATOM   1282 O  O     . TYR A 1 183 ? 0.621   -18.419 6.928   1.00 19.59  ? 165 TYR A O     1 
ATOM   1283 C  CB    . TYR A 1 183 ? 0.743   -21.002 8.360   1.00 17.27  ? 165 TYR A CB    1 
ATOM   1284 C  CG    . TYR A 1 183 ? 1.961   -20.720 9.216   1.00 19.17  ? 165 TYR A CG    1 
ATOM   1285 C  CD1   . TYR A 1 183 ? 1.992   -21.084 10.562  1.00 20.18  ? 165 TYR A CD1   1 
ATOM   1286 C  CD2   . TYR A 1 183 ? 3.071   -20.066 8.691   1.00 19.39  ? 165 TYR A CD2   1 
ATOM   1287 C  CE1   . TYR A 1 183 ? 3.099   -20.816 11.357  1.00 19.73  ? 165 TYR A CE1   1 
ATOM   1288 C  CE2   . TYR A 1 183 ? 4.180   -19.788 9.477   1.00 18.63  ? 165 TYR A CE2   1 
ATOM   1289 C  CZ    . TYR A 1 183 ? 4.191   -20.168 10.806  1.00 18.75  ? 165 TYR A CZ    1 
ATOM   1290 O  OH    . TYR A 1 183 ? 5.299   -19.901 11.580  1.00 19.95  ? 165 TYR A OH    1 
ATOM   1291 N  N     . ILE A 1 184 ? 0.205   -17.610 8.987   1.00 18.07  ? 166 ILE A N     1 
ATOM   1292 C  CA    . ILE A 1 184 ? 0.852   -16.328 8.733   1.00 18.47  ? 166 ILE A CA    1 
ATOM   1293 C  C     . ILE A 1 184 ? 1.735   -15.927 9.915   1.00 18.84  ? 166 ILE A C     1 
ATOM   1294 O  O     . ILE A 1 184 ? 1.276   -15.869 11.059  1.00 18.39  ? 166 ILE A O     1 
ATOM   1295 C  CB    . ILE A 1 184 ? -0.163  -15.197 8.468   1.00 22.08  ? 166 ILE A CB    1 
ATOM   1296 C  CG1   . ILE A 1 184 ? -1.216  -15.621 7.441   1.00 20.96  ? 166 ILE A CG1   1 
ATOM   1297 C  CG2   . ILE A 1 184 ? 0.558   -13.939 7.992   1.00 22.91  ? 166 ILE A CG2   1 
ATOM   1298 C  CD1   . ILE A 1 184 ? -2.280  -14.564 7.202   1.00 20.43  ? 166 ILE A CD1   1 
ATOM   1299 N  N     . ALA A 1 185 ? 3.007   -15.664 9.633   1.00 19.09  ? 167 ALA A N     1 
ATOM   1300 C  CA    . ALA A 1 185 ? 3.945   -15.216 10.659  1.00 20.91  ? 167 ALA A CA    1 
ATOM   1301 C  C     . ALA A 1 185 ? 3.696   -13.758 11.037  1.00 20.16  ? 167 ALA A C     1 
ATOM   1302 O  O     . ALA A 1 185 ? 3.175   -12.976 10.235  1.00 18.23  ? 167 ALA A O     1 
ATOM   1303 C  CB    . ALA A 1 185 ? 5.385   -15.399 10.187  1.00 20.60  ? 167 ALA A CB    1 
ATOM   1304 N  N     . GLY A 1 186 ? 4.078   -13.402 12.261  1.00 19.70  ? 168 GLY A N     1 
ATOM   1305 C  CA    . GLY A 1 186 ? 3.943   -12.040 12.740  1.00 19.66  ? 168 GLY A CA    1 
ATOM   1306 C  C     . GLY A 1 186 ? 4.684   -11.039 11.874  1.00 18.83  ? 168 GLY A C     1 
ATOM   1307 O  O     . GLY A 1 186 ? 4.307   -9.871  11.814  1.00 18.25  ? 168 GLY A O     1 
ATOM   1308 N  N     . PHE A 1 187 ? 5.736   -11.505 11.203  1.00 17.68  ? 169 PHE A N     1 
ATOM   1309 C  CA    . PHE A 1 187 ? 6.551   -10.672 10.322  1.00 19.08  ? 169 PHE A CA    1 
ATOM   1310 C  C     . PHE A 1 187 ? 5.741   -9.907  9.277   1.00 19.42  ? 169 PHE A C     1 
ATOM   1311 O  O     . PHE A 1 187 ? 6.176   -8.863  8.791   1.00 21.68  ? 169 PHE A O     1 
ATOM   1312 C  CB    . PHE A 1 187 ? 7.586   -11.531 9.597   1.00 19.13  ? 169 PHE A CB    1 
ATOM   1313 C  CG    . PHE A 1 187 ? 8.747   -11.957 10.456  1.00 22.06  ? 169 PHE A CG    1 
ATOM   1314 C  CD1   . PHE A 1 187 ? 9.161   -13.280 10.473  1.00 19.32  ? 169 PHE A CD1   1 
ATOM   1315 C  CD2   . PHE A 1 187 ? 9.443   -11.033 11.220  1.00 23.80  ? 169 PHE A CD2   1 
ATOM   1316 C  CE1   . PHE A 1 187 ? 10.233  -13.678 11.252  1.00 19.09  ? 169 PHE A CE1   1 
ATOM   1317 C  CE2   . PHE A 1 187 ? 10.516  -11.427 11.999  1.00 22.86  ? 169 PHE A CE2   1 
ATOM   1318 C  CZ    . PHE A 1 187 ? 10.910  -12.750 12.013  1.00 22.20  ? 169 PHE A CZ    1 
ATOM   1319 N  N     . VAL A 1 188 ? 4.573   -10.433 8.927   1.00 17.37  ? 170 VAL A N     1 
ATOM   1320 C  CA    . VAL A 1 188 ? 3.748   -9.841  7.874   1.00 17.34  ? 170 VAL A CA    1 
ATOM   1321 C  C     . VAL A 1 188 ? 3.020   -8.579  8.354   1.00 19.10  ? 170 VAL A C     1 
ATOM   1322 O  O     . VAL A 1 188 ? 2.507   -7.798  7.552   1.00 18.83  ? 170 VAL A O     1 
ATOM   1323 C  CB    . VAL A 1 188 ? 2.767   -10.884 7.300   1.00 18.82  ? 170 VAL A CB    1 
ATOM   1324 C  CG1   . VAL A 1 188 ? 2.054   -10.350 6.063   1.00 18.02  ? 170 VAL A CG1   1 
ATOM   1325 C  CG2   . VAL A 1 188 ? 3.530   -12.151 6.950   1.00 17.35  ? 170 VAL A CG2   1 
ATOM   1326 N  N     . ILE A 1 189 ? 3.001   -8.373  9.668   1.00 20.77  ? 171 ILE A N     1 
ATOM   1327 C  CA    . ILE A 1 189 ? 2.471   -7.142  10.242  1.00 18.60  ? 171 ILE A CA    1 
ATOM   1328 C  C     . ILE A 1 189 ? 3.145   -5.919  9.616   1.00 22.25  ? 171 ILE A C     1 
ATOM   1329 O  O     . ILE A 1 189 ? 2.484   -4.912  9.352   1.00 25.57  ? 171 ILE A O     1 
ATOM   1330 C  CB    . ILE A 1 189 ? 2.633   -7.124  11.782  1.00 20.83  ? 171 ILE A CB    1 
ATOM   1331 C  CG1   . ILE A 1 189 ? 1.650   -8.109  12.425  1.00 21.43  ? 171 ILE A CG1   1 
ATOM   1332 C  CG2   . ILE A 1 189 ? 2.412   -5.725  12.340  1.00 24.67  ? 171 ILE A CG2   1 
ATOM   1333 C  CD1   . ILE A 1 189 ? 1.935   -8.416  13.883  1.00 16.72  ? 171 ILE A CD1   1 
ATOM   1334 N  N     . ASN A 1 190 ? 4.448   -6.026  9.345   1.00 18.73  ? 172 ASN A N     1 
ATOM   1335 C  CA    . ASN A 1 190 ? 5.219   -4.915  8.783   1.00 19.15  ? 172 ASN A CA    1 
ATOM   1336 C  C     . ASN A 1 190 ? 4.965   -4.654  7.295   1.00 24.98  ? 172 ASN A C     1 
ATOM   1337 O  O     . ASN A 1 190 ? 5.236   -3.559  6.794   1.00 29.58  ? 172 ASN A O     1 
ATOM   1338 C  CB    . ASN A 1 190 ? 6.723   -5.134  8.983   1.00 16.86  ? 172 ASN A CB    1 
ATOM   1339 C  CG    . ASN A 1 190 ? 7.124   -5.203  10.449  1.00 20.89  ? 172 ASN A CG    1 
ATOM   1340 O  OD1   . ASN A 1 190 ? 7.907   -6.067  10.843  1.00 21.39  ? 172 ASN A OD1   1 
ATOM   1341 N  ND2   . ASN A 1 190 ? 6.593   -4.291  11.261  1.00 20.25  ? 172 ASN A ND2   1 
ATOM   1342 N  N     . THR A 1 191 ? 4.462   -5.654  6.582   1.00 21.47  ? 173 THR A N     1 
ATOM   1343 C  CA    . THR A 1 191 ? 4.372   -5.545  5.131   1.00 21.81  ? 173 THR A CA    1 
ATOM   1344 C  C     . THR A 1 191 ? 2.943   -5.415  4.613   1.00 23.23  ? 173 THR A C     1 
ATOM   1345 O  O     . THR A 1 191 ? 2.685   -4.647  3.686   1.00 26.30  ? 173 THR A O     1 
ATOM   1346 C  CB    . THR A 1 191 ? 5.075   -6.728  4.425   1.00 21.18  ? 173 THR A CB    1 
ATOM   1347 O  OG1   . THR A 1 191 ? 4.556   -7.965  4.931   1.00 22.99  ? 173 THR A OG1   1 
ATOM   1348 C  CG2   . THR A 1 191 ? 6.584   -6.680  4.664   1.00 17.37  ? 173 THR A CG2   1 
ATOM   1349 N  N     . CYS A 1 192 ? 2.015   -6.165  5.201   1.00 20.28  ? 174 CYS A N     1 
ATOM   1350 C  CA    . CYS A 1 192 ? 0.636   -6.139  4.732   1.00 23.06  ? 174 CYS A CA    1 
ATOM   1351 C  C     . CYS A 1 192 ? -0.357  -6.531  5.819   1.00 22.36  ? 174 CYS A C     1 
ATOM   1352 O  O     . CYS A 1 192 ? -1.046  -7.546  5.710   1.00 22.59  ? 174 CYS A O     1 
ATOM   1353 C  CB    . CYS A 1 192 ? 0.471   -7.065  3.527   1.00 25.09  ? 174 CYS A CB    1 
ATOM   1354 S  SG    . CYS A 1 192 ? -1.098  -6.870  2.674   1.00 34.53  ? 174 CYS A SG    1 
ATOM   1355 N  N     . TYR A 1 193 ? -0.436  -5.716  6.863   1.00 22.22  ? 175 TYR A N     1 
ATOM   1356 C  CA    . TYR A 1 193 ? -1.335  -6.007  7.967   1.00 23.09  ? 175 TYR A CA    1 
ATOM   1357 C  C     . TYR A 1 193 ? -2.792  -6.097  7.518   1.00 21.98  ? 175 TYR A C     1 
ATOM   1358 O  O     . TYR A 1 193 ? -3.547  -6.935  8.007   1.00 21.83  ? 175 TYR A O     1 
ATOM   1359 C  CB    . TYR A 1 193 ? -1.187  -4.977  9.087   1.00 19.47  ? 175 TYR A CB    1 
ATOM   1360 C  CG    . TYR A 1 193 ? -2.005  -5.359  10.292  1.00 20.86  ? 175 TYR A CG    1 
ATOM   1361 C  CD1   . TYR A 1 193 ? -1.741  -6.536  10.981  1.00 21.20  ? 175 TYR A CD1   1 
ATOM   1362 C  CD2   . TYR A 1 193 ? -3.059  -4.563  10.725  1.00 23.41  ? 175 TYR A CD2   1 
ATOM   1363 C  CE1   . TYR A 1 193 ? -2.492  -6.901  12.081  1.00 23.81  ? 175 TYR A CE1   1 
ATOM   1364 C  CE2   . TYR A 1 193 ? -3.813  -4.914  11.822  1.00 23.01  ? 175 TYR A CE2   1 
ATOM   1365 C  CZ    . TYR A 1 193 ? -3.527  -6.085  12.495  1.00 26.18  ? 175 TYR A CZ    1 
ATOM   1366 O  OH    . TYR A 1 193 ? -4.279  -6.445  13.583  1.00 29.43  ? 175 TYR A OH    1 
ATOM   1367 N  N     . GLU A 1 194 ? -3.170  -5.237  6.578   1.00 21.31  ? 176 GLU A N     1 
ATOM   1368 C  CA    . GLU A 1 194 ? -4.533  -5.199  6.060   1.00 29.84  ? 176 GLU A CA    1 
ATOM   1369 C  C     . GLU A 1 194 ? -4.958  -6.541  5.449   1.00 26.45  ? 176 GLU A C     1 
ATOM   1370 O  O     . GLU A 1 194 ? -6.071  -7.013  5.674   1.00 28.56  ? 176 GLU A O     1 
ATOM   1371 C  CB    . GLU A 1 194 ? -4.688  -4.053  5.042   1.00 35.00  ? 176 GLU A CB    1 
ATOM   1372 C  CG    . GLU A 1 194 ? -3.582  -3.993  3.977   1.00 44.02  ? 176 GLU A CG    1 
ATOM   1373 C  CD    . GLU A 1 194 ? -3.865  -2.984  2.860   1.00 55.56  ? 176 GLU A CD    1 
ATOM   1374 O  OE1   . GLU A 1 194 ? -4.718  -2.087  3.059   1.00 60.45  ? 176 GLU A OE1   1 
ATOM   1375 O  OE2   . GLU A 1 194 ? -3.233  -3.090  1.780   1.00 56.14  ? 176 GLU A OE2   1 
ATOM   1376 N  N     . GLY A 1 195 ? -4.066  -7.151  4.678   1.00 24.88  ? 177 GLY A N     1 
ATOM   1377 C  CA    . GLY A 1 195 ? -4.343  -8.439  4.073   1.00 24.10  ? 177 GLY A CA    1 
ATOM   1378 C  C     . GLY A 1 195 ? -4.433  -9.557  5.098   1.00 25.48  ? 177 GLY A C     1 
ATOM   1379 O  O     . GLY A 1 195 ? -5.352  -10.377 5.061   1.00 21.72  ? 177 GLY A O     1 
ATOM   1380 N  N     . MET A 1 196 ? -3.483  -9.600  6.025   1.00 24.34  ? 178 MET A N     1 
ATOM   1381 C  CA    . MET A 1 196 ? -3.491  -10.677 7.006   1.00 24.28  ? 178 MET A CA    1 
ATOM   1382 C  C     . MET A 1 196 ? -4.681  -10.544 7.955   1.00 25.93  ? 178 MET A C     1 
ATOM   1383 O  O     . MET A 1 196 ? -5.230  -11.543 8.408   1.00 25.32  ? 178 MET A O     1 
ATOM   1384 C  CB    . MET A 1 196 ? -2.155  -10.777 7.752   1.00 20.94  ? 178 MET A CB    1 
ATOM   1385 C  CG    . MET A 1 196 ? -1.839  -9.626  8.668   1.00 21.54  ? 178 MET A CG    1 
ATOM   1386 S  SD    . MET A 1 196 ? -0.135  -9.710  9.262   1.00 25.02  ? 178 MET A SD    1 
ATOM   1387 C  CE    . MET A 1 196 ? -0.189  -11.157 10.308  1.00 19.20  ? 178 MET A CE    1 
ATOM   1388 N  N     . LEU A 1 197 ? -5.097  -9.310  8.224   1.00 29.52  ? 179 LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 197 ? -6.281  -9.072  9.048   1.00 30.25  ? 179 LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 197 ? -7.542  -9.543  8.328   1.00 31.16  ? 179 LEU A C     1 
ATOM   1391 O  O     . LEU A 1 197 ? -8.420  -10.161 8.932   1.00 31.15  ? 179 LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 197 ? -6.408  -7.587  9.410   1.00 28.02  ? 179 LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 197 ? -7.546  -7.245  10.376  1.00 26.87  ? 179 LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 197 ? -7.449  -8.086  11.643  1.00 24.02  ? 179 LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 197 ? -7.548  -5.764  10.723  1.00 27.69  ? 179 LEU A CD2   1 
ATOM   1396 N  N     . LYS A 1 198 ? -7.625  -9.245  7.035   1.00 30.46  ? 180 LYS A N     1 
ATOM   1397 C  CA    . LYS A 1 198 ? -8.764  -9.668  6.234   1.00 31.59  ? 180 LYS A CA    1 
ATOM   1398 C  C     . LYS A 1 198 ? -8.875  -11.192 6.208   1.00 30.65  ? 180 LYS A C     1 
ATOM   1399 O  O     . LYS A 1 198 ? -9.960  -11.740 6.388   1.00 30.15  ? 180 LYS A O     1 
ATOM   1400 C  CB    . LYS A 1 198 ? -8.666  -9.130  4.805   1.00 33.99  ? 180 LYS A CB    1 
ATOM   1401 C  CG    . LYS A 1 198 ? -10.013 -9.088  4.098   1.00 39.16  ? 180 LYS A CG    1 
ATOM   1402 C  CD    . LYS A 1 198 ? -9.891  -9.257  2.590   1.00 44.01  ? 180 LYS A CD    1 
ATOM   1403 C  CE    . LYS A 1 198 ? -11.278 -9.411  1.960   1.00 49.31  ? 180 LYS A CE    1 
ATOM   1404 N  NZ    . LYS A 1 198 ? -11.231 -9.911  0.558   1.00 50.71  ? 180 LYS A NZ    1 
ATOM   1405 N  N     . ILE A 1 199 ? -7.753  -11.872 5.989   1.00 23.40  ? 181 ILE A N     1 
ATOM   1406 C  CA    . ILE A 1 199 ? -7.750  -13.332 5.959   1.00 25.18  ? 181 ILE A CA    1 
ATOM   1407 C  C     . ILE A 1 199 ? -8.109  -13.912 7.328   1.00 24.62  ? 181 ILE A C     1 
ATOM   1408 O  O     . ILE A 1 199 ? -8.852  -14.884 7.418   1.00 25.54  ? 181 ILE A O     1 
ATOM   1409 C  CB    . ILE A 1 199 ? -6.397  -13.894 5.476   1.00 25.06  ? 181 ILE A CB    1 
ATOM   1410 C  CG1   . ILE A 1 199 ? -6.193  -13.563 3.997   1.00 28.65  ? 181 ILE A CG1   1 
ATOM   1411 C  CG2   . ILE A 1 199 ? -6.332  -15.404 5.684   1.00 23.24  ? 181 ILE A CG2   1 
ATOM   1412 C  CD1   . ILE A 1 199 ? -4.845  -13.984 3.452   1.00 28.43  ? 181 ILE A CD1   1 
ATOM   1413 N  N     . ALA A 1 200 ? -7.594  -13.297 8.390   1.00 23.88  ? 182 ALA A N     1 
ATOM   1414 C  CA    . ALA A 1 200 ? -7.891  -13.737 9.750   1.00 26.43  ? 182 ALA A CA    1 
ATOM   1415 C  C     . ALA A 1 200 ? -9.388  -13.662 10.067  1.00 29.69  ? 182 ALA A C     1 
ATOM   1416 O  O     . ALA A 1 200 ? -9.949  -14.575 10.672  1.00 29.72  ? 182 ALA A O     1 
ATOM   1417 C  CB    . ALA A 1 200 ? -7.087  -12.929 10.762  1.00 23.50  ? 182 ALA A CB    1 
ATOM   1418 N  N     . LYS A 1 201 ? -10.029 -12.572 9.657   1.00 31.81  ? 183 LYS A N     1 
ATOM   1419 C  CA    . LYS A 1 201 ? -11.469 -12.422 9.846   1.00 34.19  ? 183 LYS A CA    1 
ATOM   1420 C  C     . LYS A 1 201 ? -12.252 -13.458 9.041   1.00 31.96  ? 183 LYS A C     1 
ATOM   1421 O  O     . LYS A 1 201 ? -13.250 -13.996 9.522   1.00 31.72  ? 183 LYS A O     1 
ATOM   1422 C  CB    . LYS A 1 201 ? -11.928 -11.010 9.478   1.00 34.70  ? 183 LYS A CB    1 
ATOM   1423 C  CG    . LYS A 1 201 ? -11.399 -9.940  10.408  1.00 36.20  ? 183 LYS A CG    1 
ATOM   1424 C  CD    . LYS A 1 201 ? -11.796 -8.555  9.950   1.00 37.97  ? 183 LYS A CD    1 
ATOM   1425 C  CE    . LYS A 1 201 ? -11.244 -7.503  10.893  1.00 39.31  ? 183 LYS A CE    1 
ATOM   1426 N  NZ    . LYS A 1 201 ? -11.442 -6.133  10.351  1.00 44.21  ? 183 LYS A NZ    1 
ATOM   1427 N  N     . HIS A 1 202 ? -11.800 -13.727 7.819   1.00 28.82  ? 184 HIS A N     1 
ATOM   1428 C  CA    . HIS A 1 202 ? -12.425 -14.751 6.987   1.00 29.52  ? 184 HIS A CA    1 
ATOM   1429 C  C     . HIS A 1 202 ? -12.357 -16.117 7.668   1.00 28.71  ? 184 HIS A C     1 
ATOM   1430 O  O     . HIS A 1 202 ? -13.337 -16.862 7.678   1.00 31.28  ? 184 HIS A O     1 
ATOM   1431 C  CB    . HIS A 1 202 ? -11.763 -14.814 5.609   1.00 28.84  ? 184 HIS A CB    1 
ATOM   1432 C  CG    . HIS A 1 202 ? -12.168 -16.008 4.801   1.00 29.93  ? 184 HIS A CG    1 
ATOM   1433 N  ND1   . HIS A 1 202 ? -13.277 -16.014 3.982   1.00 32.98  ? 184 HIS A ND1   1 
ATOM   1434 C  CD2   . HIS A 1 202 ? -11.615 -17.240 4.694   1.00 30.27  ? 184 HIS A CD2   1 
ATOM   1435 C  CE1   . HIS A 1 202 ? -13.388 -17.197 3.403   1.00 34.84  ? 184 HIS A CE1   1 
ATOM   1436 N  NE2   . HIS A 1 202 ? -12.392 -17.959 3.818   1.00 34.18  ? 184 HIS A NE2   1 
ATOM   1437 N  N     . SER A 1 203 ? -11.200 -16.434 8.240   1.00 26.35  ? 185 SER A N     1 
ATOM   1438 C  CA    . SER A 1 203 ? -11.011 -17.700 8.944   1.00 32.34  ? 185 SER A CA    1 
ATOM   1439 C  C     . SER A 1 203 ? -11.982 -17.857 10.114  1.00 32.42  ? 185 SER A C     1 
ATOM   1440 O  O     . SER A 1 203 ? -12.691 -18.858 10.208  1.00 36.78  ? 185 SER A O     1 
ATOM   1441 C  CB    . SER A 1 203 ? -9.565  -17.840 9.433   1.00 29.66  ? 185 SER A CB    1 
ATOM   1442 O  OG    . SER A 1 203 ? -9.384  -19.036 10.181  1.00 28.34  ? 185 SER A OG    1 
ATOM   1443 N  N     . LEU A 1 204 ? -12.019 -16.864 10.997  1.00 29.62  ? 186 LEU A N     1 
ATOM   1444 C  CA    . LEU A 1 204 ? -12.866 -16.933 12.185  1.00 32.02  ? 186 LEU A CA    1 
ATOM   1445 C  C     . LEU A 1 204 ? -14.352 -17.031 11.840  1.00 38.01  ? 186 LEU A C     1 
ATOM   1446 O  O     . LEU A 1 204 ? -15.087 -17.821 12.439  1.00 37.87  ? 186 LEU A O     1 
ATOM   1447 C  CB    . LEU A 1 204 ? -12.622 -15.736 13.105  1.00 28.66  ? 186 LEU A CB    1 
ATOM   1448 C  CG    . LEU A 1 204 ? -13.136 -15.943 14.530  1.00 30.29  ? 186 LEU A CG    1 
ATOM   1449 C  CD1   . LEU A 1 204 ? -12.319 -17.026 15.216  1.00 30.03  ? 186 LEU A CD1   1 
ATOM   1450 C  CD2   . LEU A 1 204 ? -13.101 -14.650 15.335  1.00 30.54  ? 186 LEU A CD2   1 
ATOM   1451 N  N     . GLU A 1 205 ? -14.793 -16.233 10.872  1.00 40.23  ? 187 GLU A N     1 
ATOM   1452 C  CA    . GLU A 1 205 ? -16.198 -16.237 10.481  1.00 43.59  ? 187 GLU A CA    1 
ATOM   1453 C  C     . GLU A 1 205 ? -16.599 -17.567 9.843   1.00 39.73  ? 187 GLU A C     1 
ATOM   1454 O  O     . GLU A 1 205 ? -17.760 -17.960 9.901   1.00 42.03  ? 187 GLU A O     1 
ATOM   1455 C  CB    . GLU A 1 205 ? -16.529 -15.055 9.559   1.00 51.47  ? 187 GLU A CB    1 
ATOM   1456 C  CG    . GLU A 1 205 ? -16.044 -15.200 8.125   1.00 61.15  ? 187 GLU A CG    1 
ATOM   1457 C  CD    . GLU A 1 205 ? -16.398 -13.996 7.260   1.00 70.12  ? 187 GLU A CD    1 
ATOM   1458 O  OE1   . GLU A 1 205 ? -16.617 -14.178 6.040   1.00 72.89  ? 187 GLU A OE1   1 
ATOM   1459 O  OE2   . GLU A 1 205 ? -16.451 -12.868 7.797   1.00 72.62  ? 187 GLU A OE2   1 
ATOM   1460 N  N     . ASN A 1 206 ? -15.633 -18.267 9.255   1.00 38.17  ? 188 ASN A N     1 
ATOM   1461 C  CA    . ASN A 1 206 ? -15.904 -19.561 8.629   1.00 40.00  ? 188 ASN A CA    1 
ATOM   1462 C  C     . ASN A 1 206 ? -15.441 -20.760 9.456   1.00 39.39  ? 188 ASN A C     1 
ATOM   1463 O  O     . ASN A 1 206 ? -15.470 -21.894 8.977   1.00 38.97  ? 188 ASN A O     1 
ATOM   1464 C  CB    . ASN A 1 206 ? -15.304 -19.620 7.222   1.00 39.02  ? 188 ASN A CB    1 
ATOM   1465 C  CG    . ASN A 1 206 ? -16.022 -18.707 6.249   1.00 38.90  ? 188 ASN A CG    1 
ATOM   1466 O  OD1   . ASN A 1 206 ? -15.431 -17.785 5.690   1.00 38.31  ? 188 ASN A OD1   1 
ATOM   1467 N  ND2   . ASN A 1 206 ? -17.310 -18.955 6.050   1.00 39.68  ? 188 ASN A ND2   1 
ATOM   1468 N  N     . GLU A 1 207 ? -15.030 -20.497 10.696  1.00 40.15  ? 189 GLU A N     1 
ATOM   1469 C  CA    . GLU A 1 207 ? -14.586 -21.540 11.623  1.00 41.84  ? 189 GLU A CA    1 
ATOM   1470 C  C     . GLU A 1 207 ? -13.452 -22.390 11.060  1.00 40.32  ? 189 GLU A C     1 
ATOM   1471 O  O     . GLU A 1 207 ? -13.458 -23.615 11.178  1.00 44.40  ? 189 GLU A O     1 
ATOM   1472 C  CB    . GLU A 1 207 ? -15.755 -22.425 12.067  1.00 47.19  ? 189 GLU A CB    1 
ATOM   1473 C  CG    . GLU A 1 207 ? -16.593 -21.821 13.187  1.00 54.56  ? 189 GLU A CG    1 
ATOM   1474 C  CD    . GLU A 1 207 ? -15.777 -21.562 14.446  1.00 58.43  ? 189 GLU A CD    1 
ATOM   1475 O  OE1   . GLU A 1 207 ? -15.268 -22.539 15.039  1.00 60.10  ? 189 GLU A OE1   1 
ATOM   1476 O  OE2   . GLU A 1 207 ? -15.635 -20.382 14.837  1.00 57.51  ? 189 GLU A OE2   1 
ATOM   1477 N  N     . LYS A 1 208 ? -12.482 -21.727 10.445  1.00 34.61  ? 190 LYS A N     1 
ATOM   1478 C  CA    . LYS A 1 208 ? -11.309 -22.400 9.915   1.00 27.37  ? 190 LYS A CA    1 
ATOM   1479 C  C     . LYS A 1 208 ? -10.175 -22.353 10.930  1.00 25.81  ? 190 LYS A C     1 
ATOM   1480 O  O     . LYS A 1 208 ? -10.348 -21.852 12.042  1.00 30.65  ? 190 LYS A O     1 
ATOM   1481 C  CB    . LYS A 1 208 ? -10.881 -21.761 8.593   1.00 30.33  ? 190 LYS A CB    1 
ATOM   1482 C  CG    . LYS A 1 208 ? -11.934 -21.859 7.497   1.00 28.70  ? 190 LYS A CG    1 
ATOM   1483 C  CD    . LYS A 1 208 ? -11.464 -21.201 6.210   1.00 36.28  ? 190 LYS A CD    1 
ATOM   1484 C  CE    . LYS A 1 208 ? -12.511 -21.312 5.110   1.00 36.08  ? 190 LYS A CE    1 
ATOM   1485 N  NZ    . LYS A 1 208 ? -11.981 -20.874 3.791   1.00 33.75  ? 190 LYS A NZ    1 
ATOM   1486 N  N     . LEU A 1 209 ? -9.015  -22.874 10.548  1.00 24.80  ? 191 LEU A N     1 
ATOM   1487 C  CA    . LEU A 1 209 ? -7.876  -22.927 11.457  1.00 26.44  ? 191 LEU A CA    1 
ATOM   1488 C  C     . LEU A 1 209 ? -6.821  -21.888 11.099  1.00 25.15  ? 191 LEU A C     1 
ATOM   1489 O  O     . LEU A 1 209 ? -6.138  -22.011 10.083  1.00 23.62  ? 191 LEU A O     1 
ATOM   1490 C  CB    . LEU A 1 209 ? -7.249  -24.323 11.448  1.00 25.37  ? 191 LEU A CB    1 
ATOM   1491 C  CG    . LEU A 1 209 ? -6.203  -24.554 12.538  1.00 27.64  ? 191 LEU A CG    1 
ATOM   1492 C  CD1   . LEU A 1 209 ? -6.884  -24.774 13.896  1.00 29.75  ? 191 LEU A CD1   1 
ATOM   1493 C  CD2   . LEU A 1 209 ? -5.287  -25.719 12.184  1.00 27.15  ? 191 LEU A CD2   1 
ATOM   1494 N  N     . PHE A 1 210 ? -6.678  -20.873 11.944  1.00 25.94  ? 192 PHE A N     1 
ATOM   1495 C  CA    . PHE A 1 210 ? -5.699  -19.823 11.701  1.00 23.30  ? 192 PHE A CA    1 
ATOM   1496 C  C     . PHE A 1 210 ? -4.521  -19.949 12.659  1.00 22.94  ? 192 PHE A C     1 
ATOM   1497 O  O     . PHE A 1 210 ? -4.691  -19.871 13.873  1.00 26.87  ? 192 PHE A O     1 
ATOM   1498 C  CB    . PHE A 1 210 ? -6.342  -18.438 11.834  1.00 25.60  ? 192 PHE A CB    1 
ATOM   1499 C  CG    . PHE A 1 210 ? -5.453  -17.311 11.369  1.00 24.41  ? 192 PHE A CG    1 
ATOM   1500 C  CD1   . PHE A 1 210 ? -5.517  -16.860 10.060  1.00 24.70  ? 192 PHE A CD1   1 
ATOM   1501 C  CD2   . PHE A 1 210 ? -4.551  -16.714 12.237  1.00 20.83  ? 192 PHE A CD2   1 
ATOM   1502 C  CE1   . PHE A 1 210 ? -4.702  -15.829 9.624   1.00 27.33  ? 192 PHE A CE1   1 
ATOM   1503 C  CE2   . PHE A 1 210 ? -3.733  -15.682 11.810  1.00 23.49  ? 192 PHE A CE2   1 
ATOM   1504 C  CZ    . PHE A 1 210 ? -3.806  -15.241 10.498  1.00 24.26  ? 192 PHE A CZ    1 
ATOM   1505 N  N     . CYS A 1 211 ? -3.325  -20.124 12.104  1.00 20.17  ? 193 CYS A N     1 
ATOM   1506 C  CA    . CYS A 1 211 ? -2.117  -20.305 12.903  1.00 21.76  ? 193 CYS A CA    1 
ATOM   1507 C  C     . CYS A 1 211 ? -1.199  -19.094 12.793  1.00 23.42  ? 193 CYS A C     1 
ATOM   1508 O  O     . CYS A 1 211 ? -0.920  -18.612 11.695  1.00 20.97  ? 193 CYS A O     1 
ATOM   1509 C  CB    . CYS A 1 211 ? -1.378  -21.575 12.470  1.00 23.76  ? 193 CYS A CB    1 
ATOM   1510 S  SG    . CYS A 1 211 ? -2.437  -23.051 12.406  1.00 27.45  ? 193 CYS A SG    1 
ATOM   1511 N  N     . PHE A 1 212 ? -0.726  -18.612 13.939  1.00 24.58  ? 194 PHE A N     1 
ATOM   1512 C  CA    . PHE A 1 212 ? -0.001  -17.351 14.009  1.00 21.18  ? 194 PHE A CA    1 
ATOM   1513 C  C     . PHE A 1 212 ? 1.309   -17.526 14.766  1.00 21.87  ? 194 PHE A C     1 
ATOM   1514 O  O     . PHE A 1 212 ? 1.354   -18.205 15.792  1.00 24.02  ? 194 PHE A O     1 
ATOM   1515 C  CB    . PHE A 1 212 ? -0.884  -16.300 14.690  1.00 21.59  ? 194 PHE A CB    1 
ATOM   1516 C  CG    . PHE A 1 212 ? -0.248  -14.938 14.804  1.00 18.69  ? 194 PHE A CG    1 
ATOM   1517 C  CD1   . PHE A 1 212 ? 0.055   -14.199 13.669  1.00 19.22  ? 194 PHE A CD1   1 
ATOM   1518 C  CD2   . PHE A 1 212 ? 0.020   -14.388 16.047  1.00 16.98  ? 194 PHE A CD2   1 
ATOM   1519 C  CE1   . PHE A 1 212 ? 0.635   -12.943 13.772  1.00 23.38  ? 194 PHE A CE1   1 
ATOM   1520 C  CE2   . PHE A 1 212 ? 0.602   -13.131 16.162  1.00 22.50  ? 194 PHE A CE2   1 
ATOM   1521 C  CZ    . PHE A 1 212 ? 0.909   -12.407 15.022  1.00 23.56  ? 194 PHE A CZ    1 
ATOM   1522 N  N     . ASN A 1 213 ? 2.377   -16.924 14.253  1.00 18.84  ? 195 ASN A N     1 
ATOM   1523 C  CA    . ASN A 1 213 ? 3.679   -16.990 14.912  1.00 19.64  ? 195 ASN A CA    1 
ATOM   1524 C  C     . ASN A 1 213 ? 4.099   -15.613 15.440  1.00 22.46  ? 195 ASN A C     1 
ATOM   1525 O  O     . ASN A 1 213 ? 4.030   -14.621 14.712  1.00 22.40  ? 195 ASN A O     1 
ATOM   1526 C  CB    . ASN A 1 213 ? 4.735   -17.540 13.944  1.00 17.43  ? 195 ASN A CB    1 
ATOM   1527 C  CG    . ASN A 1 213 ? 5.930   -18.165 14.664  1.00 19.65  ? 195 ASN A CG    1 
ATOM   1528 O  OD1   . ASN A 1 213 ? 6.600   -17.516 15.471  1.00 19.35  ? 195 ASN A OD1   1 
ATOM   1529 N  ND2   . ASN A 1 213 ? 6.193   -19.438 14.375  1.00 18.90  ? 195 ASN A ND2   1 
ATOM   1530 N  N     . LEU A 1 214 ? 4.523   -15.550 16.700  1.00 20.86  ? 196 LEU A N     1 
ATOM   1531 C  CA    . LEU A 1 214 ? 5.000   -14.288 17.278  1.00 20.44  ? 196 LEU A CA    1 
ATOM   1532 C  C     . LEU A 1 214 ? 6.246   -13.771 16.540  1.00 20.77  ? 196 LEU A C     1 
ATOM   1533 O  O     . LEU A 1 214 ? 6.502   -12.565 16.498  1.00 22.24  ? 196 LEU A O     1 
ATOM   1534 C  CB    . LEU A 1 214 ? 5.277   -14.431 18.784  1.00 19.44  ? 196 LEU A CB    1 
ATOM   1535 C  CG    . LEU A 1 214 ? 4.110   -14.808 19.710  1.00 20.84  ? 196 LEU A CG    1 
ATOM   1536 C  CD1   . LEU A 1 214 ? 4.563   -14.924 21.167  1.00 23.45  ? 196 LEU A CD1   1 
ATOM   1537 C  CD2   . LEU A 1 214 ? 2.962   -13.810 19.584  1.00 19.80  ? 196 LEU A CD2   1 
ATOM   1538 N  N     . SER A 1 215 ? 7.018   -14.700 15.981  1.00 18.01  ? 197 SER A N     1 
ATOM   1539 C  CA    . SER A 1 215 ? 8.089   -14.398 15.022  1.00 18.08  ? 197 SER A CA    1 
ATOM   1540 C  C     . SER A 1 215 ? 9.360   -13.717 15.557  1.00 18.06  ? 197 SER A C     1 
ATOM   1541 O  O     . SER A 1 215 ? 10.465  -14.174 15.266  1.00 18.75  ? 197 SER A O     1 
ATOM   1542 C  CB    . SER A 1 215 ? 7.543   -13.642 13.806  1.00 19.27  ? 197 SER A CB    1 
ATOM   1543 O  OG    . SER A 1 215 ? 6.586   -14.432 13.124  1.00 25.25  ? 197 SER A OG    1 
ATOM   1544 N  N     . ALA A 1 216 ? 9.205   -12.633 16.316  1.00 18.80  ? 198 ALA A N     1 
ATOM   1545 C  CA    . ALA A 1 216 ? 10.348  -11.867 16.820  1.00 20.55  ? 198 ALA A CA    1 
ATOM   1546 C  C     . ALA A 1 216 ? 9.937   -10.915 17.949  1.00 21.22  ? 198 ALA A C     1 
ATOM   1547 O  O     . ALA A 1 216 ? 8.827   -10.381 17.940  1.00 21.04  ? 198 ALA A O     1 
ATOM   1548 C  CB    . ALA A 1 216 ? 11.000  -11.081 15.686  1.00 22.15  ? 198 ALA A CB    1 
ATOM   1549 N  N     . PRO A 1 217 ? 10.840  -10.689 18.916  1.00 20.24  ? 199 PRO A N     1 
ATOM   1550 C  CA    . PRO A 1 217 ? 10.536  -9.807  20.051  1.00 25.12  ? 199 PRO A CA    1 
ATOM   1551 C  C     . PRO A 1 217 ? 10.103  -8.389  19.653  1.00 25.99  ? 199 PRO A C     1 
ATOM   1552 O  O     . PRO A 1 217 ? 9.208   -7.848  20.297  1.00 26.47  ? 199 PRO A O     1 
ATOM   1553 C  CB    . PRO A 1 217 ? 11.859  -9.769  20.829  1.00 21.18  ? 199 PRO A CB    1 
ATOM   1554 C  CG    . PRO A 1 217 ? 12.519  -11.061 20.486  1.00 24.43  ? 199 PRO A CG    1 
ATOM   1555 C  CD    . PRO A 1 217 ? 12.180  -11.290 19.035  1.00 19.74  ? 199 PRO A CD    1 
ATOM   1556 N  N     . PHE A 1 218 ? 10.704  -7.805  18.619  1.00 19.51  ? 200 PHE A N     1 
ATOM   1557 C  CA    . PHE A 1 218 ? 10.366  -6.429  18.251  1.00 24.67  ? 200 PHE A CA    1 
ATOM   1558 C  C     . PHE A 1 218 ? 8.891   -6.247  17.876  1.00 27.12  ? 200 PHE A C     1 
ATOM   1559 O  O     . PHE A 1 218 ? 8.331   -5.163  18.053  1.00 30.37  ? 200 PHE A O     1 
ATOM   1560 C  CB    . PHE A 1 218 ? 11.310  -5.856  17.172  1.00 20.84  ? 200 PHE A CB    1 
ATOM   1561 C  CG    . PHE A 1 218 ? 11.068  -6.386  15.776  1.00 21.70  ? 200 PHE A CG    1 
ATOM   1562 C  CD1   . PHE A 1 218 ? 10.108  -5.810  14.951  1.00 24.19  ? 200 PHE A CD1   1 
ATOM   1563 C  CD2   . PHE A 1 218 ? 11.838  -7.424  15.270  1.00 21.55  ? 200 PHE A CD2   1 
ATOM   1564 C  CE1   . PHE A 1 218 ? 9.894   -6.285  13.654  1.00 24.07  ? 200 PHE A CE1   1 
ATOM   1565 C  CE2   . PHE A 1 218 ? 11.635  -7.903  13.973  1.00 23.11  ? 200 PHE A CE2   1 
ATOM   1566 C  CZ    . PHE A 1 218 ? 10.660  -7.333  13.166  1.00 22.02  ? 200 PHE A CZ    1 
ATOM   1567 N  N     . LEU A 1 219 ? 8.265   -7.310  17.382  1.00 23.20  ? 201 LEU A N     1 
ATOM   1568 C  CA    . LEU A 1 219 ? 6.851   -7.258  17.017  1.00 22.99  ? 201 LEU A CA    1 
ATOM   1569 C  C     . LEU A 1 219 ? 5.952   -7.063  18.235  1.00 24.27  ? 201 LEU A C     1 
ATOM   1570 O  O     . LEU A 1 219 ? 5.041   -6.237  18.212  1.00 24.56  ? 201 LEU A O     1 
ATOM   1571 C  CB    . LEU A 1 219 ? 6.436   -8.510  16.239  1.00 20.60  ? 201 LEU A CB    1 
ATOM   1572 C  CG    . LEU A 1 219 ? 7.033   -8.626  14.833  1.00 21.95  ? 201 LEU A CG    1 
ATOM   1573 C  CD1   . LEU A 1 219 ? 6.831   -10.029 14.288  1.00 20.70  ? 201 LEU A CD1   1 
ATOM   1574 C  CD2   . LEU A 1 219 ? 6.439   -7.578  13.887  1.00 18.21  ? 201 LEU A CD2   1 
ATOM   1575 N  N     . SER A 1 220 ? 6.203   -7.820  19.299  1.00 21.31  ? 202 SER A N     1 
ATOM   1576 C  CA    . SER A 1 220 ? 5.425   -7.655  20.523  1.00 23.35  ? 202 SER A CA    1 
ATOM   1577 C  C     . SER A 1 220 ? 5.689   -6.313  21.200  1.00 26.69  ? 202 SER A C     1 
ATOM   1578 O  O     . SER A 1 220 ? 4.823   -5.784  21.890  1.00 27.47  ? 202 SER A O     1 
ATOM   1579 C  CB    . SER A 1 220 ? 5.699   -8.794  21.501  1.00 22.98  ? 202 SER A CB    1 
ATOM   1580 O  OG    . SER A 1 220 ? 5.157   -10.003 21.003  1.00 25.89  ? 202 SER A OG    1 
ATOM   1581 N  N     . GLN A 1 221 ? 6.884   -5.767  20.998  1.00 29.22  ? 203 GLN A N     1 
ATOM   1582 C  CA    . GLN A 1 221 ? 7.266   -4.505  21.634  1.00 32.00  ? 203 GLN A CA    1 
ATOM   1583 C  C     . GLN A 1 221 ? 6.726   -3.286  20.888  1.00 30.56  ? 203 GLN A C     1 
ATOM   1584 O  O     . GLN A 1 221 ? 6.171   -2.379  21.504  1.00 32.60  ? 203 GLN A O     1 
ATOM   1585 C  CB    . GLN A 1 221 ? 8.789   -4.404  21.766  1.00 35.57  ? 203 GLN A CB    1 
ATOM   1586 C  CG    . GLN A 1 221 ? 9.411   -5.503  22.619  1.00 42.83  ? 203 GLN A CG    1 
ATOM   1587 C  CD    . GLN A 1 221 ? 10.928  -5.548  22.519  1.00 45.76  ? 203 GLN A CD    1 
ATOM   1588 O  OE1   . GLN A 1 221 ? 11.506  -5.210  21.484  1.00 45.35  ? 203 GLN A OE1   1 
ATOM   1589 N  NE2   . GLN A 1 221 ? 11.579  -5.966  23.600  1.00 46.43  ? 203 GLN A NE2   1 
ATOM   1590 N  N     . PHE A 1 222 ? 6.883   -3.269  19.566  1.00 24.85  ? 204 PHE A N     1 
ATOM   1591 C  CA    . PHE A 1 222 ? 6.543   -2.083  18.781  1.00 26.04  ? 204 PHE A CA    1 
ATOM   1592 C  C     . PHE A 1 222 ? 5.266   -2.227  17.966  1.00 27.21  ? 204 PHE A C     1 
ATOM   1593 O  O     . PHE A 1 222 ? 4.749   -1.244  17.435  1.00 27.33  ? 204 PHE A O     1 
ATOM   1594 C  CB    . PHE A 1 222 ? 7.714   -1.689  17.880  1.00 27.43  ? 204 PHE A CB    1 
ATOM   1595 C  CG    . PHE A 1 222 ? 8.989   -1.459  18.634  1.00 34.34  ? 204 PHE A CG    1 
ATOM   1596 C  CD1   . PHE A 1 222 ? 9.150   -0.324  19.414  1.00 38.51  ? 204 PHE A CD1   1 
ATOM   1597 C  CD2   . PHE A 1 222 ? 10.018  -2.388  18.585  1.00 34.98  ? 204 PHE A CD2   1 
ATOM   1598 C  CE1   . PHE A 1 222 ? 10.319  -0.112  20.124  1.00 41.43  ? 204 PHE A CE1   1 
ATOM   1599 C  CE2   . PHE A 1 222 ? 11.190  -2.183  19.290  1.00 37.91  ? 204 PHE A CE2   1 
ATOM   1600 C  CZ    . PHE A 1 222 ? 11.341  -1.043  20.062  1.00 40.70  ? 204 PHE A CZ    1 
ATOM   1601 N  N     . ASN A 1 223 ? 4.762   -3.451  17.865  1.00 27.21  ? 205 ASN A N     1 
ATOM   1602 C  CA    . ASN A 1 223 ? 3.522   -3.699  17.146  1.00 12.93  ? 205 ASN A CA    1 
ATOM   1603 C  C     . ASN A 1 223 ? 2.565   -4.495  18.005  1.00 12.98  ? 205 ASN A C     1 
ATOM   1604 O  O     . ASN A 1 223 ? 1.913   -5.430  17.534  1.00 16.82  ? 205 ASN A O     1 
ATOM   1605 C  CB    . ASN A 1 223 ? 3.801   -4.430  15.836  1.00 15.33  ? 205 ASN A CB    1 
ATOM   1606 C  CG    . ASN A 1 223 ? 4.683   -3.625  14.908  1.00 21.89  ? 205 ASN A CG    1 
ATOM   1607 O  OD1   . ASN A 1 223 ? 5.901   -3.801  14.886  1.00 28.57  ? 205 ASN A OD1   1 
ATOM   1608 N  ND2   . ASN A 1 223 ? 4.075   -2.720  14.148  1.00 18.76  ? 205 ASN A ND2   1 
ATOM   1609 N  N     . THR A 1 224 ? 2.503   -4.112  19.275  1.00 26.10  ? 206 THR A N     1 
ATOM   1610 C  CA    . THR A 1 224 ? 1.716   -4.815  20.275  1.00 24.18  ? 206 THR A CA    1 
ATOM   1611 C  C     . THR A 1 224 ? 0.250   -4.892  19.867  1.00 23.99  ? 206 THR A C     1 
ATOM   1612 O  O     . THR A 1 224 ? -0.355  -5.955  19.951  1.00 24.27  ? 206 THR A O     1 
ATOM   1613 C  CB    . THR A 1 224 ? 1.824   -4.122  21.649  1.00 23.81  ? 206 THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 224 ? 3.180   -3.722  21.881  1.00 25.58  ? 206 THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 224 ? 1.374   -5.054  22.752  1.00 21.23  ? 206 THR A CG2   1 
ATOM   1616 N  N     . LYS A 1 225 ? -0.308  -3.766  19.425  1.00 25.26  ? 207 LYS A N     1 
ATOM   1617 C  CA    . LYS A 1 225 ? -1.705  -3.703  18.988  1.00 24.88  ? 207 LYS A CA    1 
ATOM   1618 C  C     . LYS A 1 225 ? -1.995  -4.761  17.929  1.00 22.88  ? 207 LYS A C     1 
ATOM   1619 O  O     . LYS A 1 225 ? -2.970  -5.500  18.038  1.00 25.40  ? 207 LYS A O     1 
ATOM   1620 C  CB    . LYS A 1 225 ? -2.049  -2.290  18.472  1.00 25.66  ? 207 LYS A CB    1 
ATOM   1621 C  CG    . LYS A 1 225 ? -3.474  -2.086  17.922  1.00 25.60  ? 207 LYS A CG    1 
ATOM   1622 C  CD    . LYS A 1 225 ? -3.580  -2.440  16.424  1.00 29.84  ? 207 LYS A CD    1 
ATOM   1623 C  CE    . LYS A 1 225 ? -4.354  -1.401  15.619  1.00 33.00  ? 207 LYS A CE    1 
ATOM   1624 N  NZ    . LYS A 1 225 ? -3.487  -0.299  15.131  1.00 29.80  ? 207 LYS A NZ    1 
ATOM   1625 N  N     . GLU A 1 226 ? -1.144  -4.830  16.907  1.00 21.65  ? 208 GLU A N     1 
ATOM   1626 C  CA    . GLU A 1 226 ? -1.336  -5.779  15.808  1.00 23.13  ? 208 GLU A CA    1 
ATOM   1627 C  C     . GLU A 1 226 ? -1.180  -7.239  16.252  1.00 23.79  ? 208 GLU A C     1 
ATOM   1628 O  O     . GLU A 1 226 ? -1.921  -8.115  15.794  1.00 19.58  ? 208 GLU A O     1 
ATOM   1629 C  CB    . GLU A 1 226 ? -0.379  -5.485  14.646  1.00 23.18  ? 208 GLU A CB    1 
ATOM   1630 C  CG    . GLU A 1 226 ? -0.638  -4.168  13.897  1.00 28.48  ? 208 GLU A CG    1 
ATOM   1631 C  CD    . GLU A 1 226 ? 0.214   -3.014  14.413  1.00 30.90  ? 208 GLU A CD    1 
ATOM   1632 O  OE1   . GLU A 1 226 ? 0.613   -3.045  15.596  1.00 31.96  ? 208 GLU A OE1   1 
ATOM   1633 O  OE2   . GLU A 1 226 ? 0.495   -2.081  13.633  1.00 33.19  ? 208 GLU A OE2   1 
ATOM   1634 N  N     . VAL A 1 227 ? -0.210  -7.505  17.126  1.00 22.74  ? 209 VAL A N     1 
ATOM   1635 C  CA    . VAL A 1 227 ? -0.002  -8.866  17.619  1.00 21.74  ? 209 VAL A CA    1 
ATOM   1636 C  C     . VAL A 1 227 ? -1.229  -9.343  18.395  1.00 21.82  ? 209 VAL A C     1 
ATOM   1637 O  O     . VAL A 1 227 ? -1.725  -10.449 18.174  1.00 24.14  ? 209 VAL A O     1 
ATOM   1638 C  CB    . VAL A 1 227 ? 1.262   -8.989  18.509  1.00 21.32  ? 209 VAL A CB    1 
ATOM   1639 C  CG1   . VAL A 1 227 ? 1.326   -10.375 19.166  1.00 17.87  ? 209 VAL A CG1   1 
ATOM   1640 C  CG2   . VAL A 1 227 ? 2.530   -8.714  17.695  1.00 16.45  ? 209 VAL A CG2   1 
ATOM   1641 N  N     . ASP A 1 228 ? -1.730  -8.499  19.289  1.00 22.45  ? 210 ASP A N     1 
ATOM   1642 C  CA    . ASP A 1 228 ? -2.877  -8.876  20.105  1.00 27.47  ? 210 ASP A CA    1 
ATOM   1643 C  C     . ASP A 1 228 ? -4.140  -9.005  19.270  1.00 28.81  ? 210 ASP A C     1 
ATOM   1644 O  O     . ASP A 1 228 ? -4.996  -9.842  19.554  1.00 29.20  ? 210 ASP A O     1 
ATOM   1645 C  CB    . ASP A 1 228 ? -3.090  -7.888  21.253  1.00 31.75  ? 210 ASP A CB    1 
ATOM   1646 C  CG    . ASP A 1 228 ? -2.126  -8.116  22.400  1.00 33.73  ? 210 ASP A CG    1 
ATOM   1647 O  OD1   . ASP A 1 228 ? -1.475  -9.186  22.431  1.00 31.31  ? 210 ASP A OD1   1 
ATOM   1648 O  OD2   . ASP A 1 228 ? -2.027  -7.229  23.273  1.00 33.87  ? 210 ASP A OD2   1 
ATOM   1649 N  N     . GLU A 1 229 ? -4.264  -8.178  18.239  1.00 26.97  ? 211 GLU A N     1 
ATOM   1650 C  CA    . GLU A 1 229 ? -5.421  -8.291  17.367  1.00 27.82  ? 211 GLU A CA    1 
ATOM   1651 C  C     . GLU A 1 229 ? -5.383  -9.615  16.604  1.00 26.66  ? 211 GLU A C     1 
ATOM   1652 O  O     . GLU A 1 229 ? -6.399  -10.302 16.494  1.00 20.43  ? 211 GLU A O     1 
ATOM   1653 C  CB    . GLU A 1 229 ? -5.528  -7.110  16.404  1.00 26.86  ? 211 GLU A CB    1 
ATOM   1654 C  CG    . GLU A 1 229 ? -6.779  -7.175  15.542  1.00 33.14  ? 211 GLU A CG    1 
ATOM   1655 C  CD    . GLU A 1 229 ? -7.110  -5.858  14.858  1.00 40.39  ? 211 GLU A CD    1 
ATOM   1656 O  OE1   . GLU A 1 229 ? -6.182  -5.160  14.396  1.00 41.28  ? 211 GLU A OE1   1 
ATOM   1657 O  OE2   . GLU A 1 229 ? -8.310  -5.523  14.782  1.00 44.89  ? 211 GLU A OE2   1 
ATOM   1658 N  N     . MET A 1 230 ? -4.208  -9.971  16.089  1.00 21.68  ? 212 MET A N     1 
ATOM   1659 C  CA    . MET A 1 230 ? -4.032  -11.240 15.388  1.00 20.42  ? 212 MET A CA    1 
ATOM   1660 C  C     . MET A 1 230 ? -4.323  -12.445 16.292  1.00 21.81  ? 212 MET A C     1 
ATOM   1661 O  O     . MET A 1 230 ? -5.006  -13.382 15.882  1.00 22.78  ? 212 MET A O     1 
ATOM   1662 C  CB    . MET A 1 230 ? -2.628  -11.343 14.787  1.00 17.36  ? 212 MET A CB    1 
ATOM   1663 C  CG    . MET A 1 230 ? -2.376  -10.373 13.636  1.00 23.87  ? 212 MET A CG    1 
ATOM   1664 S  SD    . MET A 1 230 ? -3.615  -10.501 12.330  1.00 31.26  ? 212 MET A SD    1 
ATOM   1665 C  CE    . MET A 1 230 ? -3.317  -12.155 11.753  1.00 20.78  ? 212 MET A CE    1 
ATOM   1666 N  N     . ILE A 1 231 ? -3.807  -12.411 17.518  1.00 19.94  ? 213 ILE A N     1 
ATOM   1667 C  CA    . ILE A 1 231 ? -4.074  -13.473 18.480  1.00 22.38  ? 213 ILE A CA    1 
ATOM   1668 C  C     . ILE A 1 231 ? -5.580  -13.693 18.636  1.00 28.39  ? 213 ILE A C     1 
ATOM   1669 O  O     . ILE A 1 231 ? -6.039  -14.834 18.748  1.00 29.39  ? 213 ILE A O     1 
ATOM   1670 C  CB    . ILE A 1 231 ? -3.413  -13.187 19.849  1.00 18.34  ? 213 ILE A CB    1 
ATOM   1671 C  CG1   . ILE A 1 231 ? -1.887  -13.256 19.723  1.00 17.34  ? 213 ILE A CG1   1 
ATOM   1672 C  CG2   . ILE A 1 231 ? -3.886  -14.175 20.898  1.00 19.28  ? 213 ILE A CG2   1 
ATOM   1673 C  CD1   . ILE A 1 231 ? -1.148  -12.941 21.007  1.00 17.42  ? 213 ILE A CD1   1 
ATOM   1674 N  N     . SER A 1 232 ? -6.354  -12.608 18.587  1.00 25.98  ? 214 SER A N     1 
ATOM   1675 C  CA    . SER A 1 232 ? -7.800  -12.711 18.803  1.00 25.46  ? 214 SER A CA    1 
ATOM   1676 C  C     . SER A 1 232 ? -8.545  -13.437 17.670  1.00 23.74  ? 214 SER A C     1 
ATOM   1677 O  O     . SER A 1 232 ? -9.725  -13.759 17.811  1.00 23.88  ? 214 SER A O     1 
ATOM   1678 C  CB    . SER A 1 232 ? -8.431  -11.339 19.120  1.00 25.07  ? 214 SER A CB    1 
ATOM   1679 O  OG    . SER A 1 232 ? -8.580  -10.528 17.964  1.00 25.72  ? 214 SER A OG    1 
ATOM   1680 N  N     . TYR A 1 233 ? -7.853  -13.707 16.563  1.00 22.39  ? 215 TYR A N     1 
ATOM   1681 C  CA    . TYR A 1 233 ? -8.422  -14.514 15.479  1.00 23.46  ? 215 TYR A CA    1 
ATOM   1682 C  C     . TYR A 1 233 ? -7.686  -15.847 15.324  1.00 26.72  ? 215 TYR A C     1 
ATOM   1683 O  O     . TYR A 1 233 ? -8.049  -16.672 14.483  1.00 30.08  ? 215 TYR A O     1 
ATOM   1684 C  CB    . TYR A 1 233 ? -8.373  -13.762 14.142  1.00 23.61  ? 215 TYR A CB    1 
ATOM   1685 C  CG    . TYR A 1 233 ? -9.178  -12.478 14.102  1.00 25.15  ? 215 TYR A CG    1 
ATOM   1686 C  CD1   . TYR A 1 233 ? -8.608  -11.267 14.477  1.00 23.54  ? 215 TYR A CD1   1 
ATOM   1687 C  CD2   . TYR A 1 233 ? -10.501 -12.478 13.680  1.00 26.55  ? 215 TYR A CD2   1 
ATOM   1688 C  CE1   . TYR A 1 233 ? -9.335  -10.091 14.440  1.00 26.53  ? 215 TYR A CE1   1 
ATOM   1689 C  CE2   . TYR A 1 233 ? -11.238 -11.307 13.639  1.00 29.64  ? 215 TYR A CE2   1 
ATOM   1690 C  CZ    . TYR A 1 233 ? -10.649 -10.114 14.021  1.00 30.09  ? 215 TYR A CZ    1 
ATOM   1691 O  OH    . TYR A 1 233 ? -11.372 -8.943  13.987  1.00 31.94  ? 215 TYR A OH    1 
ATOM   1692 N  N     . SER A 1 234 ? -6.648  -16.053 16.130  1.00 24.42  ? 216 SER A N     1 
ATOM   1693 C  CA    . SER A 1 234 ? -5.789  -17.222 15.972  1.00 22.41  ? 216 SER A CA    1 
ATOM   1694 C  C     . SER A 1 234 ? -6.269  -18.405 16.800  1.00 25.04  ? 216 SER A C     1 
ATOM   1695 O  O     . SER A 1 234 ? -6.568  -18.260 17.983  1.00 25.22  ? 216 SER A O     1 
ATOM   1696 C  CB    . SER A 1 234 ? -4.350  -16.881 16.354  1.00 22.53  ? 216 SER A CB    1 
ATOM   1697 O  OG    . SER A 1 234 ? -3.853  -15.821 15.560  1.00 23.18  ? 216 SER A OG    1 
ATOM   1698 N  N     . ASN A 1 235 ? -6.343  -19.573 16.172  1.00 23.37  ? 217 ASN A N     1 
ATOM   1699 C  CA    . ASN A 1 235 ? -6.671  -20.800 16.885  1.00 25.33  ? 217 ASN A CA    1 
ATOM   1700 C  C     . ASN A 1 235 ? -5.430  -21.424 17.503  1.00 24.96  ? 217 ASN A C     1 
ATOM   1701 O  O     . ASN A 1 235 ? -5.512  -22.123 18.513  1.00 23.68  ? 217 ASN A O     1 
ATOM   1702 C  CB    . ASN A 1 235 ? -7.343  -21.797 15.947  1.00 26.19  ? 217 ASN A CB    1 
ATOM   1703 C  CG    . ASN A 1 235 ? -8.517  -21.196 15.215  1.00 28.01  ? 217 ASN A CG    1 
ATOM   1704 O  OD1   . ASN A 1 235 ? -8.365  -20.642 14.122  1.00 24.02  ? 217 ASN A OD1   1 
ATOM   1705 N  ND2   . ASN A 1 235 ? -9.697  -21.288 15.817  1.00 28.56  ? 217 ASN A ND2   1 
ATOM   1706 N  N     . ILE A 1 236 ? -4.280  -21.171 16.883  1.00 19.89  ? 218 ILE A N     1 
ATOM   1707 C  CA    . ILE A 1 236 ? -3.003  -21.682 17.375  1.00 20.80  ? 218 ILE A CA    1 
ATOM   1708 C  C     . ILE A 1 236 ? -1.943  -20.583 17.315  1.00 21.03  ? 218 ILE A C     1 
ATOM   1709 O  O     . ILE A 1 236 ? -1.803  -19.906 16.295  1.00 18.57  ? 218 ILE A O     1 
ATOM   1710 C  CB    . ILE A 1 236 ? -2.515  -22.894 16.544  1.00 20.64  ? 218 ILE A CB    1 
ATOM   1711 C  CG1   . ILE A 1 236 ? -3.583  -23.992 16.502  1.00 22.33  ? 218 ILE A CG1   1 
ATOM   1712 C  CG2   . ILE A 1 236 ? -1.208  -23.449 17.104  1.00 19.66  ? 218 ILE A CG2   1 
ATOM   1713 C  CD1   . ILE A 1 236 ? -3.151  -25.233 15.742  1.00 24.25  ? 218 ILE A CD1   1 
ATOM   1714 N  N     . VAL A 1 237 ? -1.208  -20.403 18.411  1.00 17.50  ? 219 VAL A N     1 
ATOM   1715 C  CA    . VAL A 1 237 ? -0.142  -19.406 18.460  1.00 16.64  ? 219 VAL A CA    1 
ATOM   1716 C  C     . VAL A 1 237 ? 1.191   -20.057 18.809  1.00 20.05  ? 219 VAL A C     1 
ATOM   1717 O  O     . VAL A 1 237 ? 1.296   -20.777 19.805  1.00 22.42  ? 219 VAL A O     1 
ATOM   1718 C  CB    . VAL A 1 237 ? -0.443  -18.288 19.489  1.00 20.69  ? 219 VAL A CB    1 
ATOM   1719 C  CG1   . VAL A 1 237 ? 0.690   -17.270 19.523  1.00 16.07  ? 219 VAL A CG1   1 
ATOM   1720 C  CG2   . VAL A 1 237 ? -1.766  -17.604 19.173  1.00 21.08  ? 219 VAL A CG2   1 
ATOM   1721 N  N     . PHE A 1 238 ? 2.198   -19.808 17.976  1.00 17.41  ? 220 PHE A N     1 
ATOM   1722 C  CA    . PHE A 1 238 ? 3.548   -20.302 18.205  1.00 16.59  ? 220 PHE A CA    1 
ATOM   1723 C  C     . PHE A 1 238 ? 4.435   -19.162 18.688  1.00 22.54  ? 220 PHE A C     1 
ATOM   1724 O  O     . PHE A 1 238 ? 4.296   -18.021 18.237  1.00 25.76  ? 220 PHE A O     1 
ATOM   1725 C  CB    . PHE A 1 238 ? 4.153   -20.850 16.907  1.00 15.77  ? 220 PHE A CB    1 
ATOM   1726 C  CG    . PHE A 1 238 ? 3.458   -22.067 16.360  1.00 17.50  ? 220 PHE A CG    1 
ATOM   1727 C  CD1   . PHE A 1 238 ? 3.879   -23.339 16.716  1.00 18.16  ? 220 PHE A CD1   1 
ATOM   1728 C  CD2   . PHE A 1 238 ? 2.406   -21.941 15.466  1.00 17.36  ? 220 PHE A CD2   1 
ATOM   1729 C  CE1   . PHE A 1 238 ? 3.258   -24.461 16.203  1.00 20.43  ? 220 PHE A CE1   1 
ATOM   1730 C  CE2   . PHE A 1 238 ? 1.775   -23.067 14.941  1.00 17.40  ? 220 PHE A CE2   1 
ATOM   1731 C  CZ    . PHE A 1 238 ? 2.203   -24.327 15.312  1.00 20.09  ? 220 PHE A CZ    1 
ATOM   1732 N  N     . GLY A 1 239 ? 5.367   -19.475 19.580  1.00 21.49  ? 221 GLY A N     1 
ATOM   1733 C  CA    . GLY A 1 239 ? 6.330   -18.492 20.040  1.00 19.19  ? 221 GLY A CA    1 
ATOM   1734 C  C     . GLY A 1 239 ? 7.570   -19.171 20.573  1.00 20.00  ? 221 GLY A C     1 
ATOM   1735 O  O     . GLY A 1 239 ? 7.576   -20.384 20.776  1.00 23.45  ? 221 GLY A O     1 
ATOM   1736 N  N     . ASN A 1 240 ? 8.630   -18.401 20.784  1.00 21.46  ? 222 ASN A N     1 
ATOM   1737 C  CA    . ASN A 1 240 ? 9.792   -18.911 21.510  1.00 22.17  ? 222 ASN A CA    1 
ATOM   1738 C  C     . ASN A 1 240 ? 9.993   -18.143 22.818  1.00 21.60  ? 222 ASN A C     1 
ATOM   1739 O  O     . ASN A 1 240 ? 9.230   -17.228 23.121  1.00 24.73  ? 222 ASN A O     1 
ATOM   1740 C  CB    . ASN A 1 240 ? 11.060  -18.922 20.639  1.00 23.07  ? 222 ASN A CB    1 
ATOM   1741 C  CG    . ASN A 1 240 ? 11.533  -17.525 20.247  1.00 25.77  ? 222 ASN A CG    1 
ATOM   1742 O  OD1   . ASN A 1 240 ? 11.211  -16.533 20.898  1.00 25.06  ? 222 ASN A OD1   1 
ATOM   1743 N  ND2   . ASN A 1 240 ? 12.313  -17.449 19.174  1.00 28.11  ? 222 ASN A ND2   1 
ATOM   1744 N  N     . GLU A 1 241 ? 11.020  -18.506 23.578  1.00 21.40  ? 223 GLU A N     1 
ATOM   1745 C  CA    . GLU A 1 241 ? 11.240  -17.917 24.897  1.00 24.90  ? 223 GLU A CA    1 
ATOM   1746 C  C     . GLU A 1 241 ? 11.454  -16.394 24.878  1.00 25.50  ? 223 GLU A C     1 
ATOM   1747 O  O     . GLU A 1 241 ? 10.853  -15.676 25.675  1.00 24.24  ? 223 GLU A O     1 
ATOM   1748 C  CB    . GLU A 1 241 ? 12.394  -18.622 25.619  1.00 27.74  ? 223 GLU A CB    1 
ATOM   1749 C  CG    . GLU A 1 241 ? 12.521  -18.242 27.090  1.00 32.08  ? 223 GLU A CG    1 
ATOM   1750 C  CD    . GLU A 1 241 ? 13.124  -19.352 27.925  1.00 41.67  ? 223 GLU A CD    1 
ATOM   1751 O  OE1   . GLU A 1 241 ? 12.635  -19.580 29.052  1.00 47.08  ? 223 GLU A OE1   1 
ATOM   1752 O  OE2   . GLU A 1 241 ? 14.084  -20.000 27.454  1.00 44.24  ? 223 GLU A OE2   1 
ATOM   1753 N  N     . SER A 1 242 ? 12.290  -15.901 23.970  1.00 25.06  ? 224 SER A N     1 
ATOM   1754 C  CA    . SER A 1 242 ? 12.558  -14.465 23.903  1.00 27.89  ? 224 SER A CA    1 
ATOM   1755 C  C     . SER A 1 242 ? 11.325  -13.657 23.483  1.00 29.32  ? 224 SER A C     1 
ATOM   1756 O  O     . SER A 1 242 ? 11.132  -12.530 23.936  1.00 29.25  ? 224 SER A O     1 
ATOM   1757 C  CB    . SER A 1 242 ? 13.731  -14.172 22.969  1.00 31.91  ? 224 SER A CB    1 
ATOM   1758 O  OG    . SER A 1 242 ? 13.459  -14.623 21.655  1.00 36.98  ? 224 SER A OG    1 
ATOM   1759 N  N     . GLU A 1 243 ? 10.491  -14.236 22.623  1.00 27.17  ? 225 GLU A N     1 
ATOM   1760 C  CA    . GLU A 1 243 ? 9.258   -13.569 22.201  1.00 24.58  ? 225 GLU A CA    1 
ATOM   1761 C  C     . GLU A 1 243 ? 8.237   -13.524 23.336  1.00 21.94  ? 225 GLU A C     1 
ATOM   1762 O  O     . GLU A 1 243 ? 7.536   -12.530 23.518  1.00 25.27  ? 225 GLU A O     1 
ATOM   1763 C  CB    . GLU A 1 243 ? 8.655   -14.266 20.975  1.00 24.25  ? 225 GLU A CB    1 
ATOM   1764 C  CG    . GLU A 1 243 ? 9.510   -14.150 19.721  1.00 28.71  ? 225 GLU A CG    1 
ATOM   1765 C  CD    . GLU A 1 243 ? 9.349   -15.334 18.784  1.00 32.34  ? 225 GLU A CD    1 
ATOM   1766 O  OE1   . GLU A 1 243 ? 8.400   -16.123 18.977  1.00 31.89  ? 225 GLU A OE1   1 
ATOM   1767 O  OE2   . GLU A 1 243 ? 10.180  -15.481 17.860  1.00 33.67  ? 225 GLU A OE2   1 
ATOM   1768 N  N     . ALA A 1 244 ? 8.151   -14.614 24.087  1.00 19.74  ? 226 ALA A N     1 
ATOM   1769 C  CA    . ALA A 1 244 ? 7.255   -14.682 25.228  1.00 23.79  ? 226 ALA A CA    1 
ATOM   1770 C  C     . ALA A 1 244 ? 7.694   -13.669 26.284  1.00 25.17  ? 226 ALA A C     1 
ATOM   1771 O  O     . ALA A 1 244 ? 6.865   -12.987 26.887  1.00 25.26  ? 226 ALA A O     1 
ATOM   1772 C  CB    . ALA A 1 244 ? 7.241   -16.095 25.808  1.00 18.20  ? 226 ALA A CB    1 
ATOM   1773 N  N     . GLU A 1 245 ? 9.005   -13.569 26.484  1.00 26.00  ? 227 GLU A N     1 
ATOM   1774 C  CA    . GLU A 1 245 ? 9.576   -12.635 27.451  1.00 32.48  ? 227 GLU A CA    1 
ATOM   1775 C  C     . GLU A 1 245 ? 9.262   -11.187 27.069  1.00 30.23  ? 227 GLU A C     1 
ATOM   1776 O  O     . GLU A 1 245 ? 8.833   -10.396 27.905  1.00 32.33  ? 227 GLU A O     1 
ATOM   1777 C  CB    . GLU A 1 245 ? 11.089  -12.831 27.553  1.00 40.99  ? 227 GLU A CB    1 
ATOM   1778 C  CG    . GLU A 1 245 ? 11.678  -12.439 28.896  1.00 52.65  ? 227 GLU A CG    1 
ATOM   1779 C  CD    . GLU A 1 245 ? 11.754  -13.608 29.861  1.00 60.42  ? 227 GLU A CD    1 
ATOM   1780 O  OE1   . GLU A 1 245 ? 12.212  -14.692 29.442  1.00 62.13  ? 227 GLU A OE1   1 
ATOM   1781 O  OE2   . GLU A 1 245 ? 11.357  -13.444 31.035  1.00 64.19  ? 227 GLU A OE2   1 
ATOM   1782 N  N     . ALA A 1 246 ? 9.463   -10.847 25.801  1.00 27.18  ? 228 ALA A N     1 
ATOM   1783 C  CA    . ALA A 1 246 ? 9.193   -9.492  25.339  1.00 25.88  ? 228 ALA A CA    1 
ATOM   1784 C  C     . ALA A 1 246 ? 7.698   -9.192  25.385  1.00 27.05  ? 228 ALA A C     1 
ATOM   1785 O  O     . ALA A 1 246 ? 7.293   -8.096  25.763  1.00 25.38  ? 228 ALA A O     1 
ATOM   1786 C  CB    . ALA A 1 246 ? 9.744   -9.283  23.944  1.00 22.67  ? 228 ALA A CB    1 
ATOM   1787 N  N     . TYR A 1 247 ? 6.882   -10.174 25.007  1.00 25.04  ? 229 TYR A N     1 
ATOM   1788 C  CA    . TYR A 1 247 ? 5.431   -10.026 25.062  1.00 19.53  ? 229 TYR A CA    1 
ATOM   1789 C  C     . TYR A 1 247 ? 4.981   -9.794  26.499  1.00 22.52  ? 229 TYR A C     1 
ATOM   1790 O  O     . TYR A 1 247 ? 4.165   -8.905  26.779  1.00 22.93  ? 229 TYR A O     1 
ATOM   1791 C  CB    . TYR A 1 247 ? 4.748   -11.277 24.507  1.00 18.61  ? 229 TYR A CB    1 
ATOM   1792 C  CG    . TYR A 1 247 ? 3.236   -11.197 24.455  1.00 21.42  ? 229 TYR A CG    1 
ATOM   1793 C  CD1   . TYR A 1 247 ? 2.580   -10.885 23.269  1.00 21.28  ? 229 TYR A CD1   1 
ATOM   1794 C  CD2   . TYR A 1 247 ? 2.463   -11.445 25.584  1.00 22.73  ? 229 TYR A CD2   1 
ATOM   1795 C  CE1   . TYR A 1 247 ? 1.202   -10.816 23.213  1.00 23.23  ? 229 TYR A CE1   1 
ATOM   1796 C  CE2   . TYR A 1 247 ? 1.080   -11.370 25.536  1.00 25.51  ? 229 TYR A CE2   1 
ATOM   1797 C  CZ    . TYR A 1 247 ? 0.457   -11.057 24.348  1.00 26.38  ? 229 TYR A CZ    1 
ATOM   1798 O  OH    . TYR A 1 247 ? -0.916  -10.985 24.293  1.00 31.54  ? 229 TYR A OH    1 
ATOM   1799 N  N     . GLY A 1 248 ? 5.514   -10.609 27.405  1.00 22.11  ? 230 GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 248 ? 5.158   -10.535 28.807  1.00 25.49  ? 230 GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 248 ? 5.479   -9.187  29.418  1.00 30.36  ? 230 GLY A C     1 
ATOM   1802 O  O     . GLY A 1 248 ? 4.640   -8.598  30.103  1.00 32.86  ? 230 GLY A O     1 
ATOM   1803 N  N     . GLU A 1 249 ? 6.691   -8.698  29.170  1.00 31.32  ? 231 GLU A N     1 
ATOM   1804 C  CA    . GLU A 1 249 ? 7.113   -7.410  29.711  1.00 37.23  ? 231 GLU A CA    1 
ATOM   1805 C  C     . GLU A 1 249 ? 6.188   -6.280  29.265  1.00 35.90  ? 231 GLU A C     1 
ATOM   1806 O  O     . GLU A 1 249 ? 5.752   -5.461  30.080  1.00 36.97  ? 231 GLU A O     1 
ATOM   1807 C  CB    . GLU A 1 249 ? 8.552   -7.087  29.309  1.00 43.27  ? 231 GLU A CB    1 
ATOM   1808 C  CG    . GLU A 1 249 ? 8.983   -5.691  29.745  1.00 52.07  ? 231 GLU A CG    1 
ATOM   1809 C  CD    . GLU A 1 249 ? 10.413  -5.361  29.372  1.00 58.55  ? 231 GLU A CD    1 
ATOM   1810 O  OE1   . GLU A 1 249 ? 10.921  -4.321  29.847  1.00 64.01  ? 231 GLU A OE1   1 
ATOM   1811 O  OE2   . GLU A 1 249 ? 11.026  -6.133  28.605  1.00 58.70  ? 231 GLU A OE2   1 
ATOM   1812 N  N     . VAL A 1 250 ? 5.890   -6.248  27.971  1.00 31.05  ? 232 VAL A N     1 
ATOM   1813 C  CA    . VAL A 1 250 ? 5.017   -5.223  27.408  1.00 36.03  ? 232 VAL A CA    1 
ATOM   1814 C  C     . VAL A 1 250 ? 3.622   -5.259  28.043  1.00 34.89  ? 232 VAL A C     1 
ATOM   1815 O  O     . VAL A 1 250 ? 2.941   -4.239  28.119  1.00 33.92  ? 232 VAL A O     1 
ATOM   1816 C  CB    . VAL A 1 250 ? 4.928   -5.348  25.867  1.00 37.63  ? 232 VAL A CB    1 
ATOM   1817 C  CG1   . VAL A 1 250 ? 3.943   -4.351  25.293  1.00 38.91  ? 232 VAL A CG1   1 
ATOM   1818 C  CG2   . VAL A 1 250 ? 6.297   -5.139  25.252  1.00 39.91  ? 232 VAL A CG2   1 
ATOM   1819 N  N     . HIS A 1 251 ? 3.214   -6.428  28.531  1.00 33.00  ? 233 HIS A N     1 
ATOM   1820 C  CA    . HIS A 1 251 ? 1.891   -6.569  29.137  1.00 31.84  ? 233 HIS A CA    1 
ATOM   1821 C  C     . HIS A 1 251 ? 1.886   -6.499  30.664  1.00 30.42  ? 233 HIS A C     1 
ATOM   1822 O  O     . HIS A 1 251 ? 0.860   -6.744  31.296  1.00 34.59  ? 233 HIS A O     1 
ATOM   1823 C  CB    . HIS A 1 251 ? 1.205   -7.852  28.655  1.00 29.28  ? 233 HIS A CB    1 
ATOM   1824 C  CG    . HIS A 1 251 ? 0.823   -7.817  27.209  1.00 29.65  ? 233 HIS A CG    1 
ATOM   1825 N  ND1   . HIS A 1 251 ? 1.732   -8.024  26.194  1.00 28.44  ? 233 HIS A ND1   1 
ATOM   1826 C  CD2   . HIS A 1 251 ? -0.365  -7.576  26.607  1.00 30.27  ? 233 HIS A CD2   1 
ATOM   1827 C  CE1   . HIS A 1 251 ? 1.120   -7.922  25.029  1.00 26.21  ? 233 HIS A CE1   1 
ATOM   1828 N  NE2   . HIS A 1 251 ? -0.154  -7.652  25.251  1.00 28.84  ? 233 HIS A NE2   1 
ATOM   1829 N  N     . GLY A 1 252 ? 3.023   -6.157  31.257  1.00 27.30  ? 234 GLY A N     1 
ATOM   1830 C  CA    . GLY A 1 252 ? 3.100   -6.042  32.704  1.00 28.85  ? 234 GLY A CA    1 
ATOM   1831 C  C     . GLY A 1 252 ? 3.129   -7.368  33.451  1.00 41.07  ? 234 GLY A C     1 
ATOM   1832 O  O     . GLY A 1 252 ? 2.933   -7.402  34.666  1.00 42.11  ? 234 GLY A O     1 
ATOM   1833 N  N     . LEU A 1 253 ? 3.373   -8.462  32.733  1.00 38.87  ? 235 LEU A N     1 
ATOM   1834 C  CA    . LEU A 1 253 ? 3.516   -9.770  33.363  1.00 38.34  ? 235 LEU A CA    1 
ATOM   1835 C  C     . LEU A 1 253 ? 4.915   -9.902  33.964  1.00 39.73  ? 235 LEU A C     1 
ATOM   1836 O  O     . LEU A 1 253 ? 5.800   -10.543 33.386  1.00 40.35  ? 235 LEU A O     1 
ATOM   1837 C  CB    . LEU A 1 253 ? 3.255   -10.883 32.348  1.00 34.05  ? 235 LEU A CB    1 
ATOM   1838 C  CG    . LEU A 1 253 ? 1.937   -10.738 31.582  1.00 32.02  ? 235 LEU A CG    1 
ATOM   1839 C  CD1   . LEU A 1 253 ? 1.730   -11.883 30.593  1.00 23.53  ? 235 LEU A CD1   1 
ATOM   1840 C  CD2   . LEU A 1 253 ? 0.770   -10.636 32.549  1.00 30.65  ? 235 LEU A CD2   1 
ATOM   1841 N  N     . LEU A 1 254 ? 5.100   -9.290  35.130  1.00 41.53  ? 236 LEU A N     1 
ATOM   1842 C  CA    . LEU A 1 254 ? 6.415   -9.170  35.759  1.00 46.07  ? 236 LEU A CA    1 
ATOM   1843 C  C     . LEU A 1 254 ? 7.022   -10.500 36.217  1.00 49.59  ? 236 LEU A C     1 
ATOM   1844 O  O     . LEU A 1 254 ? 8.162   -10.815 35.878  1.00 53.12  ? 236 LEU A O     1 
ATOM   1845 C  CB    . LEU A 1 254 ? 6.351   -8.190  36.933  1.00 47.94  ? 236 LEU A CB    1 
ATOM   1846 N  N     . GLU A 1 255 ? 6.265   -11.271 36.991  1.00 48.40  ? 237 GLU A N     1 
ATOM   1847 C  CA    . GLU A 1 255 ? 6.760   -12.536 37.526  1.00 46.82  ? 237 GLU A CA    1 
ATOM   1848 C  C     . GLU A 1 255 ? 6.302   -13.708 36.674  1.00 46.54  ? 237 GLU A C     1 
ATOM   1849 O  O     . GLU A 1 255 ? 5.252   -13.633 36.034  1.00 46.92  ? 237 GLU A O     1 
ATOM   1850 C  CB    . GLU A 1 255 ? 6.283   -12.731 38.966  1.00 47.07  ? 237 GLU A CB    1 
ATOM   1851 N  N     . ASP A 1 256 ? 7.097   -14.779 36.674  1.00 46.15  ? 238 ASP A N     1 
ATOM   1852 C  CA    . ASP A 1 256 ? 6.762   -16.022 35.976  1.00 47.45  ? 238 ASP A CA    1 
ATOM   1853 C  C     . ASP A 1 256 ? 6.446   -15.751 34.503  1.00 41.35  ? 238 ASP A C     1 
ATOM   1854 O  O     . ASP A 1 256 ? 5.528   -16.340 33.928  1.00 35.29  ? 238 ASP A O     1 
ATOM   1855 C  CB    . ASP A 1 256 ? 5.580   -16.710 36.671  1.00 56.29  ? 238 ASP A CB    1 
ATOM   1856 C  CG    . ASP A 1 256 ? 5.547   -18.207 36.429  1.00 63.73  ? 238 ASP A CG    1 
ATOM   1857 O  OD1   . ASP A 1 256 ? 6.628   -18.809 36.250  1.00 66.34  ? 238 ASP A OD1   1 
ATOM   1858 O  OD2   . ASP A 1 256 ? 4.437   -18.783 36.424  1.00 66.28  ? 238 ASP A OD2   1 
ATOM   1859 N  N     . THR A 1 257 ? 7.234   -14.860 33.907  1.00 39.45  ? 239 THR A N     1 
ATOM   1860 C  CA    . THR A 1 257 ? 6.889   -14.222 32.640  1.00 35.42  ? 239 THR A CA    1 
ATOM   1861 C  C     . THR A 1 257 ? 6.492   -15.177 31.512  1.00 33.27  ? 239 THR A C     1 
ATOM   1862 O  O     . THR A 1 257 ? 5.464   -14.972 30.864  1.00 33.45  ? 239 THR A O     1 
ATOM   1863 C  CB    . THR A 1 257 ? 8.012   -13.271 32.165  1.00 32.93  ? 239 THR A CB    1 
ATOM   1864 O  OG1   . THR A 1 257 ? 8.390   -12.403 33.243  1.00 36.94  ? 239 THR A OG1   1 
ATOM   1865 C  CG2   . THR A 1 257 ? 7.536   -12.428 30.994  1.00 31.87  ? 239 THR A CG2   1 
ATOM   1866 N  N     . VAL A 1 258 ? 7.287   -16.221 31.290  1.00 28.61  ? 240 VAL A N     1 
ATOM   1867 C  CA    . VAL A 1 258 ? 7.044   -17.113 30.159  1.00 29.60  ? 240 VAL A CA    1 
ATOM   1868 C  C     . VAL A 1 258 ? 5.771   -17.952 30.327  1.00 26.94  ? 240 VAL A C     1 
ATOM   1869 O  O     . VAL A 1 258 ? 4.963   -18.041 29.403  1.00 24.66  ? 240 VAL A O     1 
ATOM   1870 C  CB    . VAL A 1 258 ? 8.261   -18.010 29.849  1.00 29.46  ? 240 VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1 258 ? 7.959   -18.908 28.669  1.00 25.88  ? 240 VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1 258 ? 9.488   -17.148 29.559  1.00 29.47  ? 240 VAL A CG2   1 
ATOM   1873 N  N     . HIS A 1 259 ? 5.591   -18.546 31.504  1.00 24.61  ? 241 HIS A N     1 
ATOM   1874 C  CA    . HIS A 1 259 ? 4.351   -19.248 31.829  1.00 28.11  ? 241 HIS A CA    1 
ATOM   1875 C  C     . HIS A 1 259 ? 3.151   -18.299 31.814  1.00 30.91  ? 241 HIS A C     1 
ATOM   1876 O  O     . HIS A 1 259 ? 2.100   -18.625 31.262  1.00 31.52  ? 241 HIS A O     1 
ATOM   1877 C  CB    . HIS A 1 259 ? 4.452   -19.936 33.195  1.00 30.55  ? 241 HIS A CB    1 
ATOM   1878 C  CG    . HIS A 1 259 ? 5.314   -21.161 33.195  1.00 36.59  ? 241 HIS A CG    1 
ATOM   1879 N  ND1   . HIS A 1 259 ? 4.801   -22.432 33.348  1.00 39.75  ? 241 HIS A ND1   1 
ATOM   1880 C  CD2   . HIS A 1 259 ? 6.653   -21.309 33.057  1.00 38.24  ? 241 HIS A CD2   1 
ATOM   1881 C  CE1   . HIS A 1 259 ? 5.788   -23.311 33.309  1.00 39.00  ? 241 HIS A CE1   1 
ATOM   1882 N  NE2   . HIS A 1 259 ? 6.922   -22.656 33.135  1.00 40.64  ? 241 HIS A NE2   1 
ATOM   1883 N  N     . ALA A 1 260 ? 3.314   -17.127 32.422  1.00 31.16  ? 242 ALA A N     1 
ATOM   1884 C  CA    . ALA A 1 260 ? 2.250   -16.126 32.456  1.00 29.87  ? 242 ALA A CA    1 
ATOM   1885 C  C     . ALA A 1 260 ? 1.834   -15.685 31.050  1.00 27.07  ? 242 ALA A C     1 
ATOM   1886 O  O     . ALA A 1 260 ? 0.652   -15.487 30.780  1.00 26.94  ? 242 ALA A O     1 
ATOM   1887 C  CB    . ALA A 1 260 ? 2.670   -14.921 33.294  1.00 26.79  ? 242 ALA A CB    1 
ATOM   1888 N  N     . THR A 1 261 ? 2.809   -15.540 30.159  1.00 25.84  ? 243 THR A N     1 
ATOM   1889 C  CA    . THR A 1 261 ? 2.528   -15.155 28.779  1.00 25.87  ? 243 THR A CA    1 
ATOM   1890 C  C     . THR A 1 261 ? 1.713   -16.230 28.065  1.00 27.32  ? 243 THR A C     1 
ATOM   1891 O  O     . THR A 1 261 ? 0.761   -15.924 27.344  1.00 25.62  ? 243 THR A O     1 
ATOM   1892 C  CB    . THR A 1 261 ? 3.828   -14.885 27.990  1.00 25.88  ? 243 THR A CB    1 
ATOM   1893 O  OG1   . THR A 1 261 ? 4.465   -13.707 28.500  1.00 28.89  ? 243 THR A OG1   1 
ATOM   1894 C  CG2   . THR A 1 261 ? 3.534   -14.691 26.509  1.00 25.68  ? 243 THR A CG2   1 
ATOM   1895 N  N     . ALA A 1 262 ? 2.088   -17.490 28.278  1.00 27.48  ? 244 ALA A N     1 
ATOM   1896 C  CA    . ALA A 1 262 ? 1.387   -18.611 27.658  1.00 25.87  ? 244 ALA A CA    1 
ATOM   1897 C  C     . ALA A 1 262 ? -0.074  -18.631 28.094  1.00 26.01  ? 244 ALA A C     1 
ATOM   1898 O  O     . ALA A 1 262 ? -0.975  -18.797 27.273  1.00 25.77  ? 244 ALA A O     1 
ATOM   1899 C  CB    . ALA A 1 262 ? 2.073   -19.927 28.006  1.00 22.13  ? 244 ALA A CB    1 
ATOM   1900 N  N     . ARG A 1 263 ? -0.293  -18.444 29.392  1.00 27.50  ? 245 ARG A N     1 
ATOM   1901 C  CA    . ARG A 1 263 ? -1.632  -18.381 29.969  1.00 28.46  ? 245 ARG A CA    1 
ATOM   1902 C  C     . ARG A 1 263 ? -2.411  -17.182 29.425  1.00 28.01  ? 245 ARG A C     1 
ATOM   1903 O  O     . ARG A 1 263 ? -3.571  -17.306 29.026  1.00 27.30  ? 245 ARG A O     1 
ATOM   1904 C  CB    . ARG A 1 263 ? -1.526  -18.317 31.498  1.00 33.02  ? 245 ARG A CB    1 
ATOM   1905 C  CG    . ARG A 1 263 ? -2.822  -18.031 32.255  1.00 36.36  ? 245 ARG A CG    1 
ATOM   1906 C  CD    . ARG A 1 263 ? -3.911  -19.044 31.941  1.00 39.01  ? 245 ARG A CD    1 
ATOM   1907 N  NE    . ARG A 1 263 ? -3.430  -20.418 31.966  1.00 42.50  ? 245 ARG A NE    1 
ATOM   1908 C  CZ    . ARG A 1 263 ? -3.834  -21.363 31.122  1.00 41.03  ? 245 ARG A CZ    1 
ATOM   1909 N  NH1   . ARG A 1 263 ? -4.727  -21.083 30.182  1.00 37.60  ? 245 ARG A NH1   1 
ATOM   1910 N  NH2   . ARG A 1 263 ? -3.340  -22.589 31.218  1.00 42.18  ? 245 ARG A NH2   1 
ATOM   1911 N  N     . TYR A 1 264 ? -1.759  -16.026 29.402  1.00 27.34  ? 246 TYR A N     1 
ATOM   1912 C  CA    . TYR A 1 264 ? -2.392  -14.795 28.943  1.00 28.84  ? 246 TYR A CA    1 
ATOM   1913 C  C     . TYR A 1 264 ? -2.840  -14.885 27.484  1.00 27.38  ? 246 TYR A C     1 
ATOM   1914 O  O     . TYR A 1 264 ? -3.969  -14.526 27.153  1.00 29.27  ? 246 TYR A O     1 
ATOM   1915 C  CB    . TYR A 1 264 ? -1.443  -13.611 29.135  1.00 29.03  ? 246 TYR A CB    1 
ATOM   1916 C  CG    . TYR A 1 264 ? -2.047  -12.266 28.803  1.00 28.92  ? 246 TYR A CG    1 
ATOM   1917 C  CD1   . TYR A 1 264 ? -2.646  -11.490 29.791  1.00 31.45  ? 246 TYR A CD1   1 
ATOM   1918 C  CD2   . TYR A 1 264 ? -2.004  -11.765 27.506  1.00 25.68  ? 246 TYR A CD2   1 
ATOM   1919 C  CE1   . TYR A 1 264 ? -3.191  -10.249 29.492  1.00 33.70  ? 246 TYR A CE1   1 
ATOM   1920 C  CE2   . TYR A 1 264 ? -2.548  -10.532 27.198  1.00 29.35  ? 246 TYR A CE2   1 
ATOM   1921 C  CZ    . TYR A 1 264 ? -3.137  -9.776  28.194  1.00 33.46  ? 246 TYR A CZ    1 
ATOM   1922 O  OH    . TYR A 1 264 ? -3.678  -8.549  27.887  1.00 35.34  ? 246 TYR A OH    1 
ATOM   1923 N  N     . ILE A 1 265 ? -1.951  -15.359 26.617  1.00 24.02  ? 247 ILE A N     1 
ATOM   1924 C  CA    . ILE A 1 265 ? -2.257  -15.478 25.194  1.00 24.25  ? 247 ILE A CA    1 
ATOM   1925 C  C     . ILE A 1 265 ? -3.381  -16.484 24.946  1.00 25.80  ? 247 ILE A C     1 
ATOM   1926 O  O     . ILE A 1 265 ? -4.271  -16.250 24.128  1.00 26.88  ? 247 ILE A O     1 
ATOM   1927 C  CB    . ILE A 1 265 ? -1.006  -15.869 24.378  1.00 24.05  ? 247 ILE A CB    1 
ATOM   1928 C  CG1   . ILE A 1 265 ? 0.015   -14.728 24.400  1.00 22.24  ? 247 ILE A CG1   1 
ATOM   1929 C  CG2   . ILE A 1 265 ? -1.382  -16.221 22.939  1.00 18.23  ? 247 ILE A CG2   1 
ATOM   1930 C  CD1   . ILE A 1 265 ? 1.230   -14.983 23.520  1.00 19.05  ? 247 ILE A CD1   1 
ATOM   1931 N  N     . ALA A 1 266 ? -3.338  -17.599 25.664  1.00 25.68  ? 248 ALA A N     1 
ATOM   1932 C  CA    . ALA A 1 266 ? -4.363  -18.631 25.549  1.00 27.36  ? 248 ALA A CA    1 
ATOM   1933 C  C     . ALA A 1 266 ? -5.744  -18.121 25.954  1.00 30.06  ? 248 ALA A C     1 
ATOM   1934 O  O     . ALA A 1 266 ? -6.756  -18.541 25.393  1.00 32.58  ? 248 ALA A O     1 
ATOM   1935 C  CB    . ALA A 1 266 ? -3.984  -19.846 26.394  1.00 22.61  ? 248 ALA A CB    1 
ATOM   1936 N  N     . ASP A 1 267 ? -5.779  -17.215 26.927  1.00 28.74  ? 249 ASP A N     1 
ATOM   1937 C  CA    . ASP A 1 267 ? -7.046  -16.768 27.501  1.00 32.73  ? 249 ASP A CA    1 
ATOM   1938 C  C     . ASP A 1 267 ? -7.625  -15.500 26.877  1.00 32.84  ? 249 ASP A C     1 
ATOM   1939 O  O     . ASP A 1 267 ? -8.740  -15.107 27.215  1.00 37.54  ? 249 ASP A O     1 
ATOM   1940 C  CB    . ASP A 1 267 ? -6.921  -16.578 29.017  1.00 35.56  ? 249 ASP A CB    1 
ATOM   1941 C  CG    . ASP A 1 267 ? -6.712  -17.883 29.753  1.00 40.74  ? 249 ASP A CG    1 
ATOM   1942 O  OD1   . ASP A 1 267 ? -6.790  -18.957 29.117  1.00 42.54  ? 249 ASP A OD1   1 
ATOM   1943 O  OD2   . ASP A 1 267 ? -6.486  -17.833 30.978  1.00 43.17  ? 249 ASP A OD2   1 
ATOM   1944 N  N     . LEU A 1 268 ? -6.879  -14.854 25.985  1.00 31.35  ? 250 LEU A N     1 
ATOM   1945 C  CA    . LEU A 1 268 ? -7.384  -13.650 25.327  1.00 31.91  ? 250 LEU A CA    1 
ATOM   1946 C  C     . LEU A 1 268 ? -8.673  -13.980 24.596  1.00 30.37  ? 250 LEU A C     1 
ATOM   1947 O  O     . LEU A 1 268 ? -8.755  -15.008 23.923  1.00 28.40  ? 250 LEU A O     1 
ATOM   1948 C  CB    . LEU A 1 268 ? -6.362  -13.079 24.339  1.00 28.40  ? 250 LEU A CB    1 
ATOM   1949 C  CG    . LEU A 1 268 ? -5.308  -12.107 24.868  1.00 30.41  ? 250 LEU A CG    1 
ATOM   1950 C  CD1   . LEU A 1 268 ? -4.307  -11.769 23.771  1.00 29.66  ? 250 LEU A CD1   1 
ATOM   1951 C  CD2   . LEU A 1 268 ? -5.967  -10.839 25.400  1.00 31.65  ? 250 LEU A CD2   1 
ATOM   1952 N  N     . PRO A 1 269 ? -9.693  -13.123 24.744  1.00 28.78  ? 251 PRO A N     1 
ATOM   1953 C  CA    . PRO A 1 269 ? -10.960 -13.364 24.045  1.00 29.51  ? 251 PRO A CA    1 
ATOM   1954 C  C     . PRO A 1 269 ? -10.755 -13.423 22.535  1.00 30.00  ? 251 PRO A C     1 
ATOM   1955 O  O     . PRO A 1 269 ? -9.859  -12.758 22.009  1.00 30.31  ? 251 PRO A O     1 
ATOM   1956 C  CB    . PRO A 1 269 ? -11.805 -12.137 24.417  1.00 29.69  ? 251 PRO A CB    1 
ATOM   1957 C  CG    . PRO A 1 269 ? -11.233 -11.665 25.720  1.00 31.61  ? 251 PRO A CG    1 
ATOM   1958 C  CD    . PRO A 1 269 ? -9.750  -11.926 25.602  1.00 31.39  ? 251 PRO A CD    1 
ATOM   1959 N  N     . PHE A 1 270 ? -11.553 -14.234 21.850  1.00 29.87  ? 252 PHE A N     1 
ATOM   1960 C  CA    . PHE A 1 270 ? -11.593 -14.179 20.397  1.00 31.25  ? 252 PHE A CA    1 
ATOM   1961 C  C     . PHE A 1 270 ? -12.382 -12.941 19.980  1.00 35.22  ? 252 PHE A C     1 
ATOM   1962 O  O     . PHE A 1 270 ? -13.195 -12.428 20.751  1.00 34.38  ? 252 PHE A O     1 
ATOM   1963 C  CB    . PHE A 1 270 ? -12.211 -15.448 19.814  1.00 30.84  ? 252 PHE A CB    1 
ATOM   1964 C  CG    . PHE A 1 270 ? -11.285 -16.628 19.827  1.00 33.08  ? 252 PHE A CG    1 
ATOM   1965 C  CD1   . PHE A 1 270 ? -10.496 -16.916 18.727  1.00 31.69  ? 252 PHE A CD1   1 
ATOM   1966 C  CD2   . PHE A 1 270 ? -11.188 -17.440 20.947  1.00 35.24  ? 252 PHE A CD2   1 
ATOM   1967 C  CE1   . PHE A 1 270 ? -9.638  -17.995 18.737  1.00 31.73  ? 252 PHE A CE1   1 
ATOM   1968 C  CE2   . PHE A 1 270 ? -10.328 -18.523 20.961  1.00 32.87  ? 252 PHE A CE2   1 
ATOM   1969 C  CZ    . PHE A 1 270 ? -9.553  -18.800 19.855  1.00 29.99  ? 252 PHE A CZ    1 
ATOM   1970 N  N     . ALA A 1 271 ? -12.136 -12.467 18.763  1.00 36.99  ? 253 ALA A N     1 
ATOM   1971 C  CA    . ALA A 1 271 ? -12.705 -11.206 18.291  1.00 37.15  ? 253 ALA A CA    1 
ATOM   1972 C  C     . ALA A 1 271 ? -14.234 -11.151 18.307  1.00 38.54  ? 253 ALA A C     1 
ATOM   1973 O  O     . ALA A 1 271 ? -14.810 -10.091 18.536  1.00 41.70  ? 253 ALA A O     1 
ATOM   1974 C  CB    . ALA A 1 271 ? -12.183 -10.880 16.910  1.00 38.02  ? 253 ALA A CB    1 
ATOM   1975 N  N     . ASP A 1 272 ? -14.891 -12.281 18.060  1.00 38.40  ? 254 ASP A N     1 
ATOM   1976 C  CA    . ASP A 1 272 ? -16.351 -12.314 18.093  1.00 41.10  ? 254 ASP A CA    1 
ATOM   1977 C  C     . ASP A 1 272 ? -16.890 -12.598 19.497  1.00 43.59  ? 254 ASP A C     1 
ATOM   1978 O  O     . ASP A 1 272 ? -18.100 -12.642 19.713  1.00 45.18  ? 254 ASP A O     1 
ATOM   1979 C  CB    . ASP A 1 272 ? -16.915 -13.314 17.075  1.00 43.74  ? 254 ASP A CB    1 
ATOM   1980 C  CG    . ASP A 1 272 ? -16.379 -14.723 17.265  1.00 45.13  ? 254 ASP A CG    1 
ATOM   1981 O  OD1   . ASP A 1 272 ? -16.714 -15.592 16.433  1.00 45.40  ? 254 ASP A OD1   1 
ATOM   1982 O  OD2   . ASP A 1 272 ? -15.627 -14.965 18.233  1.00 46.24  ? 254 ASP A OD2   1 
ATOM   1983 N  N     . GLY A 1 273 ? -15.983 -12.789 20.449  1.00 43.31  ? 255 GLY A N     1 
ATOM   1984 C  CA    . GLY A 1 273 ? -16.366 -13.036 21.826  1.00 44.96  ? 255 GLY A CA    1 
ATOM   1985 C  C     . GLY A 1 273 ? -16.913 -14.433 22.045  1.00 48.05  ? 255 GLY A C     1 
ATOM   1986 O  O     . GLY A 1 273 ? -17.367 -14.765 23.139  1.00 49.48  ? 255 GLY A O     1 
ATOM   1987 N  N     . LYS A 1 274 ? -16.866 -15.255 21.002  1.00 49.23  ? 256 LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 274 ? -17.355 -16.625 21.077  1.00 50.50  ? 256 LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 274 ? -16.399 -17.482 21.900  1.00 49.17  ? 256 LYS A C     1 
ATOM   1990 O  O     . LYS A 1 274 ? -15.177 -17.359 21.773  1.00 45.92  ? 256 LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 274 ? -17.490 -17.212 19.673  1.00 53.80  ? 256 LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 274 ? -18.573 -18.263 19.537  1.00 60.34  ? 256 LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 274 ? -19.942 -17.619 19.392  1.00 65.24  ? 256 LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 274 ? -20.106 -16.974 18.024  1.00 66.10  ? 256 LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 274 ? -20.125 -17.995 16.938  1.00 66.62  ? 256 LYS A NZ    1 
ATOM   1996 N  N     . LYS A 1 275 ? -16.957 -18.341 22.747  1.00 50.75  ? 257 LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 275 ? -16.156 -19.280 23.523  1.00 50.31  ? 257 LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 275 ? -15.544 -20.312 22.584  1.00 49.71  ? 257 LYS A C     1 
ATOM   1999 O  O     . LYS A 1 275 ? -16.255 -21.015 21.866  1.00 51.12  ? 257 LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 275 ? -17.003 -19.964 24.598  1.00 52.15  ? 257 LYS A CB    1 
ATOM   2001 N  N     . ARG A 1 276 ? -14.220 -20.398 22.598  1.00 47.85  ? 258 ARG A N     1 
ATOM   2002 C  CA    . ARG A 1 276 ? -13.492 -21.193 21.624  1.00 46.78  ? 258 ARG A CA    1 
ATOM   2003 C  C     . ARG A 1 276 ? -12.128 -21.560 22.195  1.00 43.66  ? 258 ARG A C     1 
ATOM   2004 O  O     . ARG A 1 276 ? -11.577 -20.837 23.023  1.00 42.31  ? 258 ARG A O     1 
ATOM   2005 C  CB    . ARG A 1 276 ? -13.333 -20.387 20.330  1.00 48.58  ? 258 ARG A CB    1 
ATOM   2006 C  CG    . ARG A 1 276 ? -12.935 -21.189 19.107  1.00 48.74  ? 258 ARG A CG    1 
ATOM   2007 C  CD    . ARG A 1 276 ? -12.759 -20.287 17.882  1.00 48.52  ? 258 ARG A CD    1 
ATOM   2008 N  NE    . ARG A 1 276 ? -14.025 -19.841 17.293  1.00 47.70  ? 258 ARG A NE    1 
ATOM   2009 C  CZ    . ARG A 1 276 ? -14.570 -18.642 17.488  1.00 45.22  ? 258 ARG A CZ    1 
ATOM   2010 N  NH1   . ARG A 1 276 ? -13.972 -17.757 18.271  1.00 43.88  ? 258 ARG A NH1   1 
ATOM   2011 N  NH2   . ARG A 1 276 ? -15.716 -18.325 16.902  1.00 44.97  ? 258 ARG A NH2   1 
ATOM   2012 N  N     . LYS A 1 277 ? -11.588 -22.690 21.754  1.00 43.55  ? 259 LYS A N     1 
ATOM   2013 C  CA    . LYS A 1 277 ? -10.287 -23.155 22.220  1.00 43.17  ? 259 LYS A CA    1 
ATOM   2014 C  C     . LYS A 1 277 ? -9.129  -22.580 21.398  1.00 40.55  ? 259 LYS A C     1 
ATOM   2015 O  O     . LYS A 1 277 ? -9.108  -22.698 20.170  1.00 43.14  ? 259 LYS A O     1 
ATOM   2016 C  CB    . LYS A 1 277 ? -10.248 -24.685 22.188  1.00 46.54  ? 259 LYS A CB    1 
ATOM   2017 C  CG    . LYS A 1 277 ? -8.861  -25.291 22.262  1.00 50.31  ? 259 LYS A CG    1 
ATOM   2018 C  CD    . LYS A 1 277 ? -8.940  -26.815 22.331  1.00 57.95  ? 259 LYS A CD    1 
ATOM   2019 C  CE    . LYS A 1 277 ? -7.560  -27.447 22.256  1.00 60.90  ? 259 LYS A CE    1 
ATOM   2020 N  NZ    . LYS A 1 277 ? -7.597  -28.908 22.544  1.00 64.60  ? 259 LYS A NZ    1 
ATOM   2021 N  N     . ARG A 1 278 ? -8.172  -21.950 22.073  1.00 31.70  ? 260 ARG A N     1 
ATOM   2022 C  CA    . ARG A 1 278 ? -6.936  -21.538 21.415  1.00 28.69  ? 260 ARG A CA    1 
ATOM   2023 C  C     . ARG A 1 278 ? -5.745  -22.270 22.008  1.00 27.54  ? 260 ARG A C     1 
ATOM   2024 O  O     . ARG A 1 278 ? -5.604  -22.346 23.223  1.00 27.88  ? 260 ARG A O     1 
ATOM   2025 C  CB    . ARG A 1 278 ? -6.702  -20.028 21.510  1.00 26.92  ? 260 ARG A CB    1 
ATOM   2026 C  CG    . ARG A 1 278 ? -5.348  -19.613 20.925  1.00 25.96  ? 260 ARG A CG    1 
ATOM   2027 C  CD    . ARG A 1 278 ? -5.256  -18.120 20.655  1.00 28.95  ? 260 ARG A CD    1 
ATOM   2028 N  NE    . ARG A 1 278 ? -5.625  -17.351 21.825  1.00 36.07  ? 260 ARG A NE    1 
ATOM   2029 C  CZ    . ARG A 1 278 ? -6.708  -16.592 21.916  1.00 34.70  ? 260 ARG A CZ    1 
ATOM   2030 N  NH1   . ARG A 1 278 ? -7.539  -16.473 20.891  1.00 33.06  ? 260 ARG A NH1   1 
ATOM   2031 N  NH2   . ARG A 1 278 ? -6.948  -15.949 23.043  1.00 34.23  ? 260 ARG A NH2   1 
ATOM   2032 N  N     . LEU A 1 279 ? -4.889  -22.796 21.139  1.00 21.89  ? 261 LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 279 ? -3.707  -23.534 21.560  1.00 22.13  ? 261 LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 279 ? -2.464  -22.650 21.486  1.00 19.92  ? 261 LEU A C     1 
ATOM   2035 O  O     . LEU A 1 279 ? -2.240  -21.966 20.489  1.00 19.17  ? 261 LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 279 ? -3.532  -24.775 20.679  1.00 24.30  ? 261 LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 279 ? -2.338  -25.675 20.990  1.00 26.90  ? 261 LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 279 ? -2.475  -26.258 22.386  1.00 27.70  ? 261 LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 279 ? -2.201  -26.778 19.946  1.00 26.92  ? 261 LEU A CD2   1 
ATOM   2040 N  N     . VAL A 1 280 ? -1.659  -22.659 22.544  1.00 19.75  ? 262 VAL A N     1 
ATOM   2041 C  CA    . VAL A 1 280 ? -0.432  -21.868 22.573  1.00 18.70  ? 262 VAL A CA    1 
ATOM   2042 C  C     . VAL A 1 280 ? 0.773   -22.774 22.815  1.00 23.30  ? 262 VAL A C     1 
ATOM   2043 O  O     . VAL A 1 280 ? 0.761   -23.611 23.717  1.00 19.32  ? 262 VAL A O     1 
ATOM   2044 C  CB    . VAL A 1 280 ? -0.500  -20.764 23.654  1.00 27.15  ? 262 VAL A CB    1 
ATOM   2045 C  CG1   . VAL A 1 280 ? 0.757   -19.907 23.632  1.00 18.02  ? 262 VAL A CG1   1 
ATOM   2046 C  CG2   . VAL A 1 280 ? -1.742  -19.899 23.448  1.00 19.24  ? 262 VAL A CG2   1 
ATOM   2047 N  N     . ILE A 1 281 ? 1.805   -22.616 21.992  1.00 20.72  ? 263 ILE A N     1 
ATOM   2048 C  CA    . ILE A 1 281 ? 3.002   -23.444 22.092  1.00 20.33  ? 263 ILE A CA    1 
ATOM   2049 C  C     . ILE A 1 281 ? 4.231   -22.549 22.127  1.00 23.75  ? 263 ILE A C     1 
ATOM   2050 O  O     . ILE A 1 281 ? 4.491   -21.804 21.186  1.00 26.87  ? 263 ILE A O     1 
ATOM   2051 C  CB    . ILE A 1 281 ? 3.124   -24.413 20.895  1.00 18.40  ? 263 ILE A CB    1 
ATOM   2052 C  CG1   . ILE A 1 281 ? 1.871   -25.285 20.782  1.00 18.65  ? 263 ILE A CG1   1 
ATOM   2053 C  CG2   . ILE A 1 281 ? 4.394   -25.259 21.002  1.00 17.98  ? 263 ILE A CG2   1 
ATOM   2054 C  CD1   . ILE A 1 281 ? 1.855   -26.204 19.569  1.00 18.97  ? 263 ILE A CD1   1 
ATOM   2055 N  N     . ILE A 1 282 ? 4.983   -22.622 23.216  1.00 21.90  ? 264 ILE A N     1 
ATOM   2056 C  CA    . ILE A 1 282 ? 6.173   -21.801 23.371  1.00 21.03  ? 264 ILE A CA    1 
ATOM   2057 C  C     . ILE A 1 282 ? 7.412   -22.681 23.427  1.00 21.41  ? 264 ILE A C     1 
ATOM   2058 O  O     . ILE A 1 282 ? 7.605   -23.429 24.386  1.00 23.47  ? 264 ILE A O     1 
ATOM   2059 C  CB    . ILE A 1 282 ? 6.103   -20.948 24.660  1.00 23.30  ? 264 ILE A CB    1 
ATOM   2060 C  CG1   . ILE A 1 282 ? 4.834   -20.092 24.669  1.00 25.11  ? 264 ILE A CG1   1 
ATOM   2061 C  CG2   . ILE A 1 282 ? 7.353   -20.080 24.809  1.00 20.39  ? 264 ILE A CG2   1 
ATOM   2062 C  CD1   . ILE A 1 282 ? 4.717   -19.162 23.480  1.00 24.97  ? 264 ILE A CD1   1 
ATOM   2063 N  N     . THR A 1 283 ? 8.251   -22.597 22.401  1.00 19.27  ? 265 THR A N     1 
ATOM   2064 C  CA    . THR A 1 283 ? 9.481   -23.381 22.387  1.00 21.34  ? 265 THR A CA    1 
ATOM   2065 C  C     . THR A 1 283 ? 10.564  -22.697 23.228  1.00 21.64  ? 265 THR A C     1 
ATOM   2066 O  O     . THR A 1 283 ? 10.532  -21.482 23.422  1.00 20.77  ? 265 THR A O     1 
ATOM   2067 C  CB    . THR A 1 283 ? 9.980   -23.644 20.950  1.00 21.02  ? 265 THR A CB    1 
ATOM   2068 O  OG1   . THR A 1 283 ? 10.175  -22.399 20.266  1.00 18.97  ? 265 THR A OG1   1 
ATOM   2069 C  CG2   . THR A 1 283 ? 8.965   -24.488 20.181  1.00 18.43  ? 265 THR A CG2   1 
ATOM   2070 N  N     . ARG A 1 284 ? 11.509  -23.483 23.739  1.00 23.04  ? 266 ARG A N     1 
ATOM   2071 C  CA    . ARG A 1 284 ? 12.521  -22.968 24.665  1.00 23.23  ? 266 ARG A CA    1 
ATOM   2072 C  C     . ARG A 1 284 ? 13.911  -23.555 24.390  1.00 25.59  ? 266 ARG A C     1 
ATOM   2073 O  O     . ARG A 1 284 ? 14.647  -23.908 25.317  1.00 24.79  ? 266 ARG A O     1 
ATOM   2074 C  CB    . ARG A 1 284 ? 12.108  -23.258 26.118  1.00 23.97  ? 266 ARG A CB    1 
ATOM   2075 C  CG    . ARG A 1 284 ? 10.852  -22.523 26.578  1.00 22.76  ? 266 ARG A CG    1 
ATOM   2076 C  CD    . ARG A 1 284 ? 10.478  -22.845 28.024  1.00 25.71  ? 266 ARG A CD    1 
ATOM   2077 N  NE    . ARG A 1 284 ? 11.571  -22.599 28.960  1.00 25.60  ? 266 ARG A NE    1 
ATOM   2078 C  CZ    . ARG A 1 284 ? 12.145  -23.535 29.715  1.00 29.64  ? 266 ARG A CZ    1 
ATOM   2079 N  NH1   . ARG A 1 284 ? 11.733  -24.799 29.653  1.00 23.54  ? 266 ARG A NH1   1 
ATOM   2080 N  NH2   . ARG A 1 284 ? 13.133  -23.206 30.541  1.00 28.06  ? 266 ARG A NH2   1 
ATOM   2081 N  N     . GLY A 1 285 ? 14.269  -23.659 23.115  1.00 25.96  ? 267 GLY A N     1 
ATOM   2082 C  CA    . GLY A 1 285 ? 15.565  -24.200 22.739  1.00 28.09  ? 267 GLY A CA    1 
ATOM   2083 C  C     . GLY A 1 285 ? 15.722  -25.664 23.109  1.00 28.38  ? 267 GLY A C     1 
ATOM   2084 O  O     . GLY A 1 285 ? 14.879  -26.494 22.763  1.00 27.15  ? 267 GLY A O     1 
ATOM   2085 N  N     . LYS A 1 286 ? 16.801  -25.979 23.820  1.00 29.09  ? 268 LYS A N     1 
ATOM   2086 C  CA    . LYS A 1 286 ? 17.073  -27.349 24.247  1.00 29.67  ? 268 LYS A CA    1 
ATOM   2087 C  C     . LYS A 1 286 ? 16.184  -27.738 25.428  1.00 32.81  ? 268 LYS A C     1 
ATOM   2088 O  O     . LYS A 1 286 ? 15.971  -28.917 25.703  1.00 37.92  ? 268 LYS A O     1 
ATOM   2089 C  CB    . LYS A 1 286 ? 18.548  -27.504 24.627  1.00 33.24  ? 268 LYS A CB    1 
ATOM   2090 C  CG    . LYS A 1 286 ? 18.964  -26.678 25.842  1.00 37.87  ? 268 LYS A CG    1 
ATOM   2091 C  CD    . LYS A 1 286 ? 20.414  -26.933 26.234  1.00 41.52  ? 268 LYS A CD    1 
ATOM   2092 C  CE    . LYS A 1 286 ? 20.759  -26.253 27.555  1.00 43.64  ? 268 LYS A CE    1 
ATOM   2093 N  NZ    . LYS A 1 286 ? 22.103  -26.658 28.066  1.00 47.68  ? 268 LYS A NZ    1 
ATOM   2094 N  N     . ASN A 1 287 ? 15.665  -26.733 26.120  1.00 29.24  ? 269 ASN A N     1 
ATOM   2095 C  CA    . ASN A 1 287 ? 14.809  -26.942 27.277  1.00 27.12  ? 269 ASN A CA    1 
ATOM   2096 C  C     . ASN A 1 287 ? 13.389  -27.330 26.868  1.00 26.13  ? 269 ASN A C     1 
ATOM   2097 O  O     . ASN A 1 287 ? 12.988  -27.089 25.731  1.00 26.18  ? 269 ASN A O     1 
ATOM   2098 C  CB    . ASN A 1 287 ? 14.805  -25.676 28.135  1.00 24.35  ? 269 ASN A CB    1 
ATOM   2099 C  CG    . ASN A 1 287 ? 16.146  -25.425 28.788  1.00 30.32  ? 269 ASN A CG    1 
ATOM   2100 O  OD1   . ASN A 1 287 ? 16.789  -26.351 29.275  1.00 28.80  ? 269 ASN A OD1   1 
ATOM   2101 N  ND2   . ASN A 1 287 ? 16.578  -24.171 28.801  1.00 31.37  ? 269 ASN A ND2   1 
ATOM   2102 N  N     . PRO A 1 288 ? 12.628  -27.946 27.790  1.00 26.81  ? 270 PRO A N     1 
ATOM   2103 C  CA    . PRO A 1 288 ? 11.258  -28.360 27.469  1.00 23.31  ? 270 PRO A CA    1 
ATOM   2104 C  C     . PRO A 1 288 ? 10.380  -27.217 26.977  1.00 23.43  ? 270 PRO A C     1 
ATOM   2105 O  O     . PRO A 1 288 ? 10.374  -26.120 27.548  1.00 23.01  ? 270 PRO A O     1 
ATOM   2106 C  CB    . PRO A 1 288 ? 10.734  -28.884 28.804  1.00 24.41  ? 270 PRO A CB    1 
ATOM   2107 C  CG    . PRO A 1 288 ? 11.957  -29.379 29.505  1.00 26.96  ? 270 PRO A CG    1 
ATOM   2108 C  CD    . PRO A 1 288 ? 13.041  -28.412 29.127  1.00 25.31  ? 270 PRO A CD    1 
ATOM   2109 N  N     . LEU A 1 289 ? 9.654   -27.476 25.897  1.00 22.07  ? 271 LEU A N     1 
ATOM   2110 C  CA    . LEU A 1 289 ? 8.715   -26.503 25.374  1.00 20.36  ? 271 LEU A CA    1 
ATOM   2111 C  C     . LEU A 1 289 ? 7.478   -26.517 26.255  1.00 20.74  ? 271 LEU A C     1 
ATOM   2112 O  O     . LEU A 1 289 ? 7.205   -27.505 26.941  1.00 21.71  ? 271 LEU A O     1 
ATOM   2113 C  CB    . LEU A 1 289 ? 8.360   -26.812 23.912  1.00 24.14  ? 271 LEU A CB    1 
ATOM   2114 C  CG    . LEU A 1 289 ? 7.659   -28.130 23.556  1.00 23.73  ? 271 LEU A CG    1 
ATOM   2115 C  CD1   . LEU A 1 289 ? 6.147   -28.032 23.726  1.00 23.17  ? 271 LEU A CD1   1 
ATOM   2116 C  CD2   . LEU A 1 289 ? 8.001   -28.542 22.135  1.00 21.22  ? 271 LEU A CD2   1 
ATOM   2117 N  N     . LEU A 1 290 ? 6.737   -25.417 26.230  1.00 20.16  ? 272 LEU A N     1 
ATOM   2118 C  CA    . LEU A 1 290 ? 5.513   -25.292 27.002  1.00 20.65  ? 272 LEU A CA    1 
ATOM   2119 C  C     . LEU A 1 290 ? 4.323   -25.272 26.057  1.00 25.71  ? 272 LEU A C     1 
ATOM   2120 O  O     . LEU A 1 290 ? 4.404   -24.728 24.956  1.00 25.35  ? 272 LEU A O     1 
ATOM   2121 C  CB    . LEU A 1 290 ? 5.536   -24.008 27.843  1.00 20.70  ? 272 LEU A CB    1 
ATOM   2122 C  CG    . LEU A 1 290 ? 6.741   -23.825 28.767  1.00 25.77  ? 272 LEU A CG    1 
ATOM   2123 C  CD1   . LEU A 1 290 ? 6.731   -22.451 29.410  1.00 26.83  ? 272 LEU A CD1   1 
ATOM   2124 C  CD2   . LEU A 1 290 ? 6.785   -24.925 29.827  1.00 25.75  ? 272 LEU A CD2   1 
ATOM   2125 N  N     . TYR A 1 291 ? 3.220   -25.873 26.485  1.00 21.03  ? 273 TYR A N     1 
ATOM   2126 C  CA    . TYR A 1 291 ? 1.966   -25.741 25.759  1.00 20.95  ? 273 TYR A CA    1 
ATOM   2127 C  C     . TYR A 1 291 ? 0.778   -25.724 26.712  1.00 22.06  ? 273 TYR A C     1 
ATOM   2128 O  O     . TYR A 1 291 ? 0.834   -26.283 27.804  1.00 23.10  ? 273 TYR A O     1 
ATOM   2129 C  CB    . TYR A 1 291 ? 1.804   -26.843 24.704  1.00 22.98  ? 273 TYR A CB    1 
ATOM   2130 C  CG    . TYR A 1 291 ? 1.602   -28.243 25.251  1.00 22.39  ? 273 TYR A CG    1 
ATOM   2131 C  CD1   . TYR A 1 291 ? 0.329   -28.729 25.524  1.00 25.70  ? 273 TYR A CD1   1 
ATOM   2132 C  CD2   . TYR A 1 291 ? 2.684   -29.085 25.471  1.00 25.61  ? 273 TYR A CD2   1 
ATOM   2133 C  CE1   . TYR A 1 291 ? 0.141   -30.017 26.016  1.00 24.93  ? 273 TYR A CE1   1 
ATOM   2134 C  CE2   . TYR A 1 291 ? 2.508   -30.367 25.964  1.00 27.07  ? 273 TYR A CE2   1 
ATOM   2135 C  CZ    . TYR A 1 291 ? 1.238   -30.828 26.232  1.00 28.65  ? 273 TYR A CZ    1 
ATOM   2136 O  OH    . TYR A 1 291 ? 1.071   -32.104 26.722  1.00 32.65  ? 273 TYR A OH    1 
ATOM   2137 N  N     . THR A 1 292 ? -0.287  -25.054 26.291  1.00 26.44  ? 274 THR A N     1 
ATOM   2138 C  CA    . THR A 1 292 ? -1.544  -25.034 27.024  1.00 27.47  ? 274 THR A CA    1 
ATOM   2139 C  C     . THR A 1 292 ? -2.615  -24.627 26.032  1.00 28.12  ? 274 THR A C     1 
ATOM   2140 O  O     . THR A 1 292 ? -2.311  -24.301 24.883  1.00 27.27  ? 274 THR A O     1 
ATOM   2141 C  CB    . THR A 1 292 ? -1.518  -24.012 28.189  1.00 26.72  ? 274 THR A CB    1 
ATOM   2142 O  OG1   . THR A 1 292 ? -2.700  -24.153 29.000  1.00 27.93  ? 274 THR A OG1   1 
ATOM   2143 C  CG2   . THR A 1 292 ? -1.432  -22.587 27.647  1.00 24.58  ? 274 THR A CG2   1 
ATOM   2144 N  N     . ASP A 1 293 ? -3.868  -24.658 26.467  1.00 30.38  ? 275 ASP A N     1 
ATOM   2145 C  CA    . ASP A 1 293 ? -4.952  -24.081 25.688  1.00 32.36  ? 275 ASP A CA    1 
ATOM   2146 C  C     . ASP A 1 293 ? -5.960  -23.419 26.622  1.00 34.11  ? 275 ASP A C     1 
ATOM   2147 O  O     . ASP A 1 293 ? -5.892  -23.598 27.838  1.00 36.64  ? 275 ASP A O     1 
ATOM   2148 C  CB    . ASP A 1 293 ? -5.617  -25.128 24.792  1.00 33.46  ? 275 ASP A CB    1 
ATOM   2149 C  CG    . ASP A 1 293 ? -6.153  -26.300 25.571  1.00 38.12  ? 275 ASP A CG    1 
ATOM   2150 O  OD1   . ASP A 1 293 ? -7.302  -26.213 26.053  1.00 39.19  ? 275 ASP A OD1   1 
ATOM   2151 O  OD2   . ASP A 1 293 ? -5.421  -27.306 25.704  1.00 41.94  ? 275 ASP A OD2   1 
ATOM   2152 N  N     . SER A 1 294 ? -6.886  -22.653 26.055  1.00 33.65  ? 276 SER A N     1 
ATOM   2153 C  CA    . SER A 1 294 ? -7.817  -21.855 26.852  1.00 38.07  ? 276 SER A CA    1 
ATOM   2154 C  C     . SER A 1 294 ? -8.719  -22.671 27.782  1.00 40.51  ? 276 SER A C     1 
ATOM   2155 O  O     . SER A 1 294 ? -9.242  -22.139 28.759  1.00 41.60  ? 276 SER A O     1 
ATOM   2156 C  CB    . SER A 1 294 ? -8.656  -20.936 25.955  1.00 41.54  ? 276 SER A CB    1 
ATOM   2157 O  OG    . SER A 1 294 ? -9.046  -21.585 24.759  1.00 43.20  ? 276 SER A OG    1 
ATOM   2158 N  N     . SER A 1 295 ? -8.887  -23.958 27.479  1.00 41.43  ? 277 SER A N     1 
ATOM   2159 C  CA    . SER A 1 295 ? -9.705  -24.853 28.297  1.00 45.67  ? 277 SER A CA    1 
ATOM   2160 C  C     . SER A 1 295 ? -8.882  -25.556 29.370  1.00 47.35  ? 277 SER A C     1 
ATOM   2161 O  O     . SER A 1 295 ? -9.420  -26.290 30.197  1.00 47.19  ? 277 SER A O     1 
ATOM   2162 C  CB    . SER A 1 295 ? -10.373 -25.912 27.419  1.00 49.56  ? 277 SER A CB    1 
ATOM   2163 O  OG    . SER A 1 295 ? -11.234 -25.316 26.467  1.00 55.54  ? 277 SER A OG    1 
ATOM   2164 N  N     . ASP A 1 296 ? -7.573  -25.335 29.344  1.00 46.91  ? 278 ASP A N     1 
ATOM   2165 C  CA    . ASP A 1 296 ? -6.664  -26.043 30.230  1.00 44.33  ? 278 ASP A CA    1 
ATOM   2166 C  C     . ASP A 1 296 ? -6.172  -25.114 31.329  1.00 40.71  ? 278 ASP A C     1 
ATOM   2167 O  O     . ASP A 1 296 ? -5.682  -24.022 31.052  1.00 38.92  ? 278 ASP A O     1 
ATOM   2168 C  CB    . ASP A 1 296 ? -5.479  -26.583 29.426  1.00 45.94  ? 278 ASP A CB    1 
ATOM   2169 C  CG    . ASP A 1 296 ? -4.786  -27.744 30.112  1.00 50.56  ? 278 ASP A CG    1 
ATOM   2170 O  OD1   . ASP A 1 296 ? -4.248  -28.616 29.397  1.00 51.97  ? 278 ASP A OD1   1 
ATOM   2171 O  OD2   . ASP A 1 296 ? -4.781  -27.790 31.360  1.00 52.72  ? 278 ASP A OD2   1 
ATOM   2172 N  N     . SER A 1 297 ? -6.308  -25.547 32.578  1.00 43.89  ? 279 SER A N     1 
ATOM   2173 C  CA    . SER A 1 297 ? -5.853  -24.751 33.715  1.00 43.39  ? 279 SER A CA    1 
ATOM   2174 C  C     . SER A 1 297 ? -4.337  -24.835 33.867  1.00 41.65  ? 279 SER A C     1 
ATOM   2175 O  O     . SER A 1 297 ? -3.713  -23.957 34.462  1.00 41.69  ? 279 SER A O     1 
ATOM   2176 C  CB    . SER A 1 297 ? -6.533  -25.212 35.008  1.00 45.92  ? 279 SER A CB    1 
ATOM   2177 O  OG    . SER A 1 297 ? -6.007  -26.455 35.455  1.00 46.35  ? 279 SER A OG    1 
ATOM   2178 N  N     . GLU A 1 298 ? -3.748  -25.890 33.314  1.00 40.43  ? 280 GLU A N     1 
ATOM   2179 C  CA    . GLU A 1 298 ? -2.330  -26.162 33.515  1.00 41.20  ? 280 GLU A CA    1 
ATOM   2180 C  C     . GLU A 1 298 ? -1.456  -25.889 32.291  1.00 42.31  ? 280 GLU A C     1 
ATOM   2181 O  O     . GLU A 1 298 ? -1.918  -25.901 31.145  1.00 39.20  ? 280 GLU A O     1 
ATOM   2182 C  CB    . GLU A 1 298 ? -2.129  -27.604 33.973  1.00 44.20  ? 280 GLU A CB    1 
ATOM   2183 C  CG    . GLU A 1 298 ? -2.694  -27.900 35.350  1.00 53.24  ? 280 GLU A CG    1 
ATOM   2184 C  CD    . GLU A 1 298 ? -2.588  -29.370 35.713  1.00 59.47  ? 280 GLU A CD    1 
ATOM   2185 O  OE1   . GLU A 1 298 ? -2.789  -30.223 34.820  1.00 58.68  ? 280 GLU A OE1   1 
ATOM   2186 O  OE2   . GLU A 1 298 ? -2.299  -29.671 36.890  1.00 65.26  ? 280 GLU A OE2   1 
ATOM   2187 N  N     . ILE A 1 299 ? -0.179  -25.651 32.556  1.00 44.68  ? 281 ILE A N     1 
ATOM   2188 C  CA    . ILE A 1 299 ? 0.810   -25.461 31.509  1.00 20.68  ? 281 ILE A CA    1 
ATOM   2189 C  C     . ILE A 1 299 ? 1.769   -26.653 31.498  1.00 22.16  ? 281 ILE A C     1 
ATOM   2190 O  O     . ILE A 1 299 ? 2.437   -26.932 32.497  1.00 27.22  ? 281 ILE A O     1 
ATOM   2191 C  CB    . ILE A 1 299 ? 1.560   -24.125 31.697  1.00 22.58  ? 281 ILE A CB    1 
ATOM   2192 C  CG1   . ILE A 1 299 ? 0.618   -22.958 31.373  1.00 25.96  ? 281 ILE A CG1   1 
ATOM   2193 C  CG2   . ILE A 1 299 ? 2.797   -24.071 30.818  1.00 23.56  ? 281 ILE A CG2   1 
ATOM   2194 C  CD1   . ILE A 1 299 ? 1.200   -21.598 31.642  1.00 28.39  ? 281 ILE A CD1   1 
ATOM   2195 N  N     . HIS A 1 300 ? 1.818   -27.364 30.377  1.00 37.92  ? 282 HIS A N     1 
ATOM   2196 C  CA    . HIS A 1 300 ? 2.583   -28.602 30.294  1.00 32.76  ? 282 HIS A CA    1 
ATOM   2197 C  C     . HIS A 1 300 ? 3.975   -28.398 29.706  1.00 31.89  ? 282 HIS A C     1 
ATOM   2198 O  O     . HIS A 1 300 ? 4.158   -27.611 28.781  1.00 32.25  ? 282 HIS A O     1 
ATOM   2199 C  CB    . HIS A 1 300 ? 1.837   -29.636 29.446  1.00 33.11  ? 282 HIS A CB    1 
ATOM   2200 C  CG    . HIS A 1 300 ? 0.409   -29.832 29.845  1.00 34.80  ? 282 HIS A CG    1 
ATOM   2201 N  ND1   . HIS A 1 300 ? 0.043   -30.464 31.015  1.00 35.56  ? 282 HIS A ND1   1 
ATOM   2202 C  CD2   . HIS A 1 300 ? -0.744  -29.480 29.230  1.00 33.62  ? 282 HIS A CD2   1 
ATOM   2203 C  CE1   . HIS A 1 300 ? -1.275  -30.490 31.103  1.00 34.25  ? 282 HIS A CE1   1 
ATOM   2204 N  NE2   . HIS A 1 300 ? -1.777  -29.903 30.031  1.00 33.24  ? 282 HIS A NE2   1 
ATOM   2205 N  N     . GLN A 1 301 ? 4.949   -29.120 30.249  1.00 27.07  ? 283 GLN A N     1 
ATOM   2206 C  CA    . GLN A 1 301 ? 6.272   -29.207 29.654  1.00 28.00  ? 283 GLN A CA    1 
ATOM   2207 C  C     . GLN A 1 301 ? 6.331   -30.413 28.726  1.00 30.89  ? 283 GLN A C     1 
ATOM   2208 O  O     . GLN A 1 301 ? 5.709   -31.441 28.987  1.00 26.90  ? 283 GLN A O     1 
ATOM   2209 C  CB    . GLN A 1 301 ? 7.343   -29.393 30.724  1.00 28.65  ? 283 GLN A CB    1 
ATOM   2210 C  CG    . GLN A 1 301 ? 7.418   -28.330 31.786  1.00 32.01  ? 283 GLN A CG    1 
ATOM   2211 C  CD    . GLN A 1 301 ? 8.437   -28.692 32.855  1.00 33.76  ? 283 GLN A CD    1 
ATOM   2212 O  OE1   . GLN A 1 301 ? 9.643   -28.518 32.668  1.00 35.11  ? 283 GLN A OE1   1 
ATOM   2213 N  NE2   . GLN A 1 301 ? 7.955   -29.219 33.972  1.00 29.44  ? 283 GLN A NE2   1 
ATOM   2214 N  N     . PHE A 1 302 ? 7.096   -30.287 27.650  1.00 31.90  ? 284 PHE A N     1 
ATOM   2215 C  CA    . PHE A 1 302 ? 7.318   -31.394 26.732  1.00 28.58  ? 284 PHE A CA    1 
ATOM   2216 C  C     . PHE A 1 302 ? 8.818   -31.503 26.523  1.00 29.76  ? 284 PHE A C     1 
ATOM   2217 O  O     . PHE A 1 302 ? 9.446   -30.582 25.995  1.00 30.55  ? 284 PHE A O     1 
ATOM   2218 C  CB    . PHE A 1 302 ? 6.593   -31.135 25.412  1.00 28.55  ? 284 PHE A CB    1 
ATOM   2219 C  CG    . PHE A 1 302 ? 6.794   -32.208 24.372  1.00 40.06  ? 284 PHE A CG    1 
ATOM   2220 C  CD1   . PHE A 1 302 ? 5.966   -33.319 24.332  1.00 28.34  ? 284 PHE A CD1   1 
ATOM   2221 C  CD2   . PHE A 1 302 ? 7.794   -32.091 23.416  1.00 29.95  ? 284 PHE A CD2   1 
ATOM   2222 C  CE1   . PHE A 1 302 ? 6.136   -34.297 23.368  1.00 28.93  ? 284 PHE A CE1   1 
ATOM   2223 C  CE2   . PHE A 1 302 ? 7.972   -33.066 22.448  1.00 35.63  ? 284 PHE A CE2   1 
ATOM   2224 C  CZ    . PHE A 1 302 ? 7.140   -34.171 22.425  1.00 35.89  ? 284 PHE A CZ    1 
ATOM   2225 N  N     . MET A 1 303 ? 9.396   -32.617 26.958  1.00 33.46  ? 285 MET A N     1 
ATOM   2226 C  CA    . MET A 1 303 ? 10.841  -32.798 26.876  1.00 39.17  ? 285 MET A CA    1 
ATOM   2227 C  C     . MET A 1 303 ? 11.307  -32.877 25.429  1.00 43.88  ? 285 MET A C     1 
ATOM   2228 O  O     . MET A 1 303 ? 10.624  -33.442 24.578  1.00 45.25  ? 285 MET A O     1 
ATOM   2229 C  CB    . MET A 1 303 ? 11.275  -34.047 27.637  1.00 41.20  ? 285 MET A CB    1 
ATOM   2230 C  CG    . MET A 1 303 ? 12.755  -34.070 27.965  1.00 44.39  ? 285 MET A CG    1 
ATOM   2231 S  SD    . MET A 1 303 ? 13.058  -33.915 29.732  1.00 96.46  ? 285 MET A SD    1 
ATOM   2232 C  CE    . MET A 1 303 ? 12.293  -35.416 30.329  1.00 32.52  ? 285 MET A CE    1 
ATOM   2233 N  N     . VAL A 1 304 ? 12.474  -32.303 25.160  1.00 48.66  ? 286 VAL A N     1 
ATOM   2234 C  CA    . VAL A 1 304 ? 13.004  -32.214 23.804  1.00 52.10  ? 286 VAL A CA    1 
ATOM   2235 C  C     . VAL A 1 304 ? 14.343  -32.951 23.698  1.00 55.99  ? 286 VAL A C     1 
ATOM   2236 O  O     . VAL A 1 304 ? 15.170  -32.883 24.609  1.00 53.36  ? 286 VAL A O     1 
ATOM   2237 C  CB    . VAL A 1 304 ? 13.144  -30.727 23.368  1.00 42.42  ? 286 VAL A CB    1 
ATOM   2238 C  CG1   . VAL A 1 304 ? 14.122  -30.570 22.219  1.00 45.83  ? 286 VAL A CG1   1 
ATOM   2239 C  CG2   . VAL A 1 304 ? 11.779  -30.150 23.009  1.00 37.71  ? 286 VAL A CG2   1 
ATOM   2240 N  N     . GLU A 1 305 ? 14.532  -33.669 22.591  1.00 61.54  ? 287 GLU A N     1 
ATOM   2241 C  CA    . GLU A 1 305 ? 15.759  -34.424 22.339  1.00 66.01  ? 287 GLU A CA    1 
ATOM   2242 C  C     . GLU A 1 305 ? 17.015  -33.564 22.475  1.00 68.28  ? 287 GLU A C     1 
ATOM   2243 O  O     . GLU A 1 305 ? 17.159  -32.541 21.801  1.00 68.29  ? 287 GLU A O     1 
ATOM   2244 C  CB    . GLU A 1 305 ? 15.714  -35.067 20.949  1.00 66.91  ? 287 GLU A CB    1 
ATOM   2245 N  N     . GLN A 1 306 ? 17.918  -33.990 23.354  1.00 69.34  ? 288 GLN A N     1 
ATOM   2246 C  CA    . GLN A 1 306 ? 19.146  -33.251 23.619  1.00 70.96  ? 288 GLN A CA    1 
ATOM   2247 C  C     . GLN A 1 306 ? 20.140  -33.369 22.467  1.00 73.99  ? 288 GLN A C     1 
ATOM   2248 O  O     . GLN A 1 306 ? 20.434  -34.470 21.999  1.00 76.33  ? 288 GLN A O     1 
ATOM   2249 C  CB    . GLN A 1 306 ? 19.788  -33.741 24.919  1.00 71.96  ? 288 GLN A CB    1 
ATOM   2250 N  N     . PHE A 1 307 ? 20.651  -32.227 22.017  1.00 73.29  ? 289 PHE A N     1 
ATOM   2251 C  CA    . PHE A 1 307 ? 21.642  -32.181 20.945  1.00 73.76  ? 289 PHE A CA    1 
ATOM   2252 C  C     . PHE A 1 307 ? 23.054  -32.013 21.493  1.00 73.09  ? 289 PHE A C     1 
ATOM   2253 O  O     . PHE A 1 307 ? 23.284  -31.216 22.400  1.00 72.46  ? 289 PHE A O     1 
ATOM   2254 C  CB    . PHE A 1 307 ? 21.344  -31.018 19.994  1.00 76.25  ? 289 PHE A CB    1 
ATOM   2255 C  CG    . PHE A 1 307 ? 20.371  -31.352 18.898  1.00 77.30  ? 289 PHE A CG    1 
ATOM   2256 C  CD1   . PHE A 1 307 ? 20.825  -31.775 17.657  1.00 79.18  ? 289 PHE A CD1   1 
ATOM   2257 C  CD2   . PHE A 1 307 ? 19.006  -31.230 19.101  1.00 75.78  ? 289 PHE A CD2   1 
ATOM   2258 C  CE1   . PHE A 1 307 ? 19.936  -32.078 16.641  1.00 78.35  ? 289 PHE A CE1   1 
ATOM   2259 C  CE2   . PHE A 1 307 ? 18.111  -31.532 18.089  1.00 75.65  ? 289 PHE A CE2   1 
ATOM   2260 C  CZ    . PHE A 1 307 ? 18.578  -31.957 16.858  1.00 76.61  ? 289 PHE A CZ    1 
ATOM   2261 N  N     . LYS A 1 308 ? 24.001  -32.761 20.934  1.00 74.12  ? 290 LYS A N     1 
ATOM   2262 C  CA    . LYS A 1 308 ? 25.411  -32.545 21.232  1.00 74.95  ? 290 LYS A CA    1 
ATOM   2263 C  C     . LYS A 1 308 ? 25.863  -31.269 20.532  1.00 75.66  ? 290 LYS A C     1 
ATOM   2264 O  O     . LYS A 1 308 ? 25.183  -30.778 19.632  1.00 74.49  ? 290 LYS A O     1 
ATOM   2265 C  CB    . LYS A 1 308 ? 26.253  -33.730 20.756  1.00 76.31  ? 290 LYS A CB    1 
ATOM   2266 C  CG    . LYS A 1 308 ? 26.926  -34.519 21.869  1.00 77.34  ? 290 LYS A CG    1 
ATOM   2267 C  CD    . LYS A 1 308 ? 25.917  -35.279 22.710  1.00 75.61  ? 290 LYS A CD    1 
ATOM   2268 C  CE    . LYS A 1 308 ? 26.612  -36.106 23.780  1.00 78.00  ? 290 LYS A CE    1 
ATOM   2269 N  NZ    . LYS A 1 308 ? 25.644  -36.910 24.575  1.00 77.53  ? 290 LYS A NZ    1 
ATOM   2270 N  N     . ASP A 1 309 ? 27.009  -30.734 20.943  1.00 77.98  ? 291 ASP A N     1 
ATOM   2271 C  CA    . ASP A 1 309 ? 27.521  -29.498 20.357  1.00 79.45  ? 291 ASP A CA    1 
ATOM   2272 C  C     . ASP A 1 309 ? 27.918  -29.676 18.891  1.00 83.01  ? 291 ASP A C     1 
ATOM   2273 O  O     . ASP A 1 309 ? 27.651  -28.809 18.057  1.00 81.47  ? 291 ASP A O     1 
ATOM   2274 C  CB    . ASP A 1 309 ? 28.707  -28.961 21.165  1.00 79.50  ? 291 ASP A CB    1 
ATOM   2275 C  CG    . ASP A 1 309 ? 28.289  -28.391 22.509  1.00 77.65  ? 291 ASP A CG    1 
ATOM   2276 O  OD1   . ASP A 1 309 ? 27.091  -28.078 22.678  1.00 75.74  ? 291 ASP A OD1   1 
ATOM   2277 O  OD2   . ASP A 1 309 ? 29.159  -28.247 23.394  1.00 78.45  ? 291 ASP A OD2   1 
ATOM   2278 N  N     . ASP A 1 310 ? 28.547  -30.808 18.585  1.00 86.72  ? 292 ASP A N     1 
ATOM   2279 C  CA    . ASP A 1 310 ? 29.013  -31.088 17.229  1.00 88.92  ? 292 ASP A CA    1 
ATOM   2280 C  C     . ASP A 1 310 ? 27.891  -31.504 16.270  1.00 86.72  ? 292 ASP A C     1 
ATOM   2281 O  O     . ASP A 1 310 ? 28.091  -31.554 15.057  1.00 87.33  ? 292 ASP A O     1 
ATOM   2282 C  CB    . ASP A 1 310 ? 30.130  -32.141 17.246  1.00 93.16  ? 292 ASP A CB    1 
ATOM   2283 C  CG    . ASP A 1 310 ? 29.785  -33.351 18.099  1.00 95.59  ? 292 ASP A CG    1 
ATOM   2284 O  OD1   . ASP A 1 310 ? 30.706  -33.909 18.734  1.00 98.35  ? 292 ASP A OD1   1 
ATOM   2285 O  OD2   . ASP A 1 310 ? 28.601  -33.750 18.134  1.00 94.65  ? 292 ASP A OD2   1 
ATOM   2286 N  N     . GLN A 1 311 ? 26.716  -31.800 16.816  1.00 84.64  ? 293 GLN A N     1 
ATOM   2287 C  CA    . GLN A 1 311 ? 25.568  -32.176 15.995  1.00 82.67  ? 293 GLN A CA    1 
ATOM   2288 C  C     . GLN A 1 311 ? 24.951  -30.962 15.305  1.00 79.31  ? 293 GLN A C     1 
ATOM   2289 O  O     . GLN A 1 311 ? 24.453  -31.058 14.182  1.00 80.24  ? 293 GLN A O     1 
ATOM   2290 C  CB    . GLN A 1 311 ? 24.503  -32.880 16.840  1.00 82.75  ? 293 GLN A CB    1 
ATOM   2291 C  CG    . GLN A 1 311 ? 24.916  -34.246 17.365  1.00 85.60  ? 293 GLN A CG    1 
ATOM   2292 C  CD    . GLN A 1 311 ? 23.772  -34.975 18.048  1.00 84.35  ? 293 GLN A CD    1 
ATOM   2293 O  OE1   . GLN A 1 311 ? 23.569  -34.844 19.255  1.00 84.40  ? 293 GLN A OE1   1 
ATOM   2294 N  NE2   . GLN A 1 311 ? 23.017  -35.748 17.275  1.00 83.32  ? 293 GLN A NE2   1 
ATOM   2295 N  N     . ILE A 1 312 ? 24.988  -29.824 15.988  1.00 73.75  ? 294 ILE A N     1 
ATOM   2296 C  CA    . ILE A 1 312 ? 24.351  -28.607 15.499  1.00 66.99  ? 294 ILE A CA    1 
ATOM   2297 C  C     . ILE A 1 312 ? 25.089  -27.994 14.309  1.00 63.48  ? 294 ILE A C     1 
ATOM   2298 O  O     . ILE A 1 312 ? 26.247  -27.589 14.424  1.00 63.33  ? 294 ILE A O     1 
ATOM   2299 C  CB    . ILE A 1 312 ? 24.223  -27.560 16.621  1.00 64.28  ? 294 ILE A CB    1 
ATOM   2300 C  CG1   . ILE A 1 312 ? 23.301  -28.080 17.727  1.00 60.08  ? 294 ILE A CG1   1 
ATOM   2301 C  CG2   . ILE A 1 312 ? 23.704  -26.246 16.066  1.00 64.38  ? 294 ILE A CG2   1 
ATOM   2302 C  CD1   . ILE A 1 312 ? 23.229  -27.174 18.938  1.00 58.24  ? 294 ILE A CD1   1 
ATOM   2303 N  N     . ILE A 1 313 ? 24.409  -27.935 13.167  1.00 59.47  ? 295 ILE A N     1 
ATOM   2304 C  CA    . ILE A 1 313 ? 24.964  -27.315 11.968  1.00 58.38  ? 295 ILE A CA    1 
ATOM   2305 C  C     . ILE A 1 313 ? 24.510  -25.863 11.838  1.00 55.43  ? 295 ILE A C     1 
ATOM   2306 O  O     . ILE A 1 313 ? 25.335  -24.955 11.759  1.00 50.03  ? 295 ILE A O     1 
ATOM   2307 C  CB    . ILE A 1 313 ? 24.569  -28.086 10.693  1.00 57.79  ? 295 ILE A CB    1 
ATOM   2308 C  CG1   . ILE A 1 313 ? 25.185  -29.488 10.705  1.00 58.48  ? 295 ILE A CG1   1 
ATOM   2309 C  CG2   . ILE A 1 313 ? 24.997  -27.318 9.446   1.00 57.70  ? 295 ILE A CG2   1 
ATOM   2310 C  CD1   . ILE A 1 313 ? 26.701  -29.496 10.701  1.00 59.35  ? 295 ILE A CD1   1 
ATOM   2311 N  N     . ASP A 1 314 ? 23.196  -25.654 11.818  1.00 53.12  ? 296 ASP A N     1 
ATOM   2312 C  CA    . ASP A 1 314 ? 22.621  -24.314 11.704  1.00 54.29  ? 296 ASP A CA    1 
ATOM   2313 C  C     . ASP A 1 314 ? 21.170  -24.304 12.188  1.00 53.48  ? 296 ASP A C     1 
ATOM   2314 O  O     . ASP A 1 314 ? 20.288  -24.881 11.549  1.00 44.72  ? 296 ASP A O     1 
ATOM   2315 C  CB    . ASP A 1 314 ? 22.708  -23.809 10.259  1.00 55.21  ? 296 ASP A CB    1 
ATOM   2316 C  CG    . ASP A 1 314 ? 22.285  -22.352 10.118  1.00 57.81  ? 296 ASP A CG    1 
ATOM   2317 O  OD1   . ASP A 1 314 ? 22.255  -21.636 11.141  1.00 60.06  ? 296 ASP A OD1   1 
ATOM   2318 O  OD2   . ASP A 1 314 ? 21.990  -21.920 8.981   1.00 57.46  ? 296 ASP A OD2   1 
ATOM   2319 N  N     . THR A 1 315 ? 20.933  -23.639 13.317  1.00 52.42  ? 297 THR A N     1 
ATOM   2320 C  CA    . THR A 1 315 ? 19.611  -23.616 13.944  1.00 50.74  ? 297 THR A CA    1 
ATOM   2321 C  C     . THR A 1 315 ? 18.673  -22.578 13.331  1.00 50.09  ? 297 THR A C     1 
ATOM   2322 O  O     . THR A 1 315 ? 17.502  -22.497 13.705  1.00 42.02  ? 297 THR A O     1 
ATOM   2323 C  CB    . THR A 1 315 ? 19.704  -23.354 15.463  1.00 48.60  ? 297 THR A CB    1 
ATOM   2324 O  OG1   . THR A 1 315 ? 20.295  -22.068 15.695  1.00 44.19  ? 297 THR A OG1   1 
ATOM   2325 C  CG2   . THR A 1 315 ? 20.538  -24.431 16.142  1.00 47.79  ? 297 THR A CG2   1 
ATOM   2326 N  N     . ASN A 1 316 ? 19.193  -21.782 12.402  1.00 50.93  ? 298 ASN A N     1 
ATOM   2327 C  CA    . ASN A 1 316 ? 18.384  -20.788 11.709  1.00 53.85  ? 298 ASN A CA    1 
ATOM   2328 C  C     . ASN A 1 316 ? 17.226  -21.447 10.965  1.00 52.24  ? 298 ASN A C     1 
ATOM   2329 O  O     . ASN A 1 316 ? 17.434  -22.314 10.116  1.00 43.39  ? 298 ASN A O     1 
ATOM   2330 C  CB    . ASN A 1 316 ? 19.255  -19.973 10.747  1.00 59.43  ? 298 ASN A CB    1 
ATOM   2331 C  CG    . ASN A 1 316 ? 18.484  -18.862 10.048  1.00 62.85  ? 298 ASN A CG    1 
ATOM   2332 O  OD1   . ASN A 1 316 ? 18.081  -17.879 10.676  1.00 63.64  ? 298 ASN A OD1   1 
ATOM   2333 N  ND2   . ASN A 1 316 ? 18.297  -19.002 8.736   1.00 63.04  ? 298 ASN A ND2   1 
ATOM   2334 N  N     . GLY A 1 317 ? 16.006  -21.051 11.308  1.00 51.97  ? 299 GLY A N     1 
ATOM   2335 C  CA    . GLY A 1 317 ? 14.825  -21.583 10.655  1.00 16.37  ? 299 GLY A CA    1 
ATOM   2336 C  C     . GLY A 1 317 ? 14.153  -22.726 11.406  1.00 20.97  ? 299 GLY A C     1 
ATOM   2337 O  O     . GLY A 1 317 ? 13.088  -23.193 10.993  1.00 23.74  ? 299 GLY A O     1 
ATOM   2338 N  N     . ALA A 1 318 ? 14.768  -23.166 12.504  1.00 30.54  ? 300 ALA A N     1 
ATOM   2339 C  CA    . ALA A 1 318 ? 14.249  -24.275 13.305  1.00 27.72  ? 300 ALA A CA    1 
ATOM   2340 C  C     . ALA A 1 318 ? 12.818  -24.038 13.781  1.00 23.69  ? 300 ALA A C     1 
ATOM   2341 O  O     . ALA A 1 318 ? 11.996  -24.955 13.779  1.00 24.16  ? 300 ALA A O     1 
ATOM   2342 C  CB    . ALA A 1 318 ? 15.165  -24.547 14.495  1.00 27.46  ? 300 ALA A CB    1 
ATOM   2343 N  N     . GLY A 1 319 ? 12.531  -22.807 14.193  1.00 19.74  ? 301 GLY A N     1 
ATOM   2344 C  CA    . GLY A 1 319 ? 11.191  -22.425 14.603  1.00 18.60  ? 301 GLY A CA    1 
ATOM   2345 C  C     . GLY A 1 319 ? 10.179  -22.534 13.475  1.00 20.11  ? 301 GLY A C     1 
ATOM   2346 O  O     . GLY A 1 319 ? 9.038   -22.945 13.698  1.00 20.74  ? 301 GLY A O     1 
ATOM   2347 N  N     . ASP A 1 320 ? 10.596  -22.156 12.266  1.00 17.07  ? 302 ASP A N     1 
ATOM   2348 C  CA    . ASP A 1 320 ? 9.738   -22.256 11.092  1.00 19.04  ? 302 ASP A CA    1 
ATOM   2349 C  C     . ASP A 1 320 ? 9.431   -23.718 10.797  1.00 18.40  ? 302 ASP A C     1 
ATOM   2350 O  O     . ASP A 1 320 ? 8.301   -24.068 10.449  1.00 17.60  ? 302 ASP A O     1 
ATOM   2351 C  CB    . ASP A 1 320 ? 10.404  -21.625 9.866   1.00 23.20  ? 302 ASP A CB    1 
ATOM   2352 C  CG    . ASP A 1 320 ? 10.771  -20.164 10.075  1.00 28.69  ? 302 ASP A CG    1 
ATOM   2353 O  OD1   . ASP A 1 320 ? 10.112  -19.477 10.889  1.00 32.12  ? 302 ASP A OD1   1 
ATOM   2354 O  OD2   . ASP A 1 320 ? 11.727  -19.700 9.415   1.00 28.97  ? 302 ASP A OD2   1 
ATOM   2355 N  N     . ALA A 1 321 ? 10.451  -24.562 10.923  1.00 15.64  ? 303 ALA A N     1 
ATOM   2356 C  CA    . ALA A 1 321 ? 10.305  -25.995 10.694  1.00 19.88  ? 303 ALA A CA    1 
ATOM   2357 C  C     . ALA A 1 321 ? 9.409   -26.607 11.761  1.00 20.51  ? 303 ALA A C     1 
ATOM   2358 O  O     . ALA A 1 321 ? 8.548   -27.437 11.464  1.00 15.74  ? 303 ALA A O     1 
ATOM   2359 C  CB    . ALA A 1 321 ? 11.663  -26.671 10.710  1.00 19.14  ? 303 ALA A CB    1 
ATOM   2360 N  N     . PHE A 1 322 ? 9.626   -26.189 13.005  1.00 15.40  ? 304 PHE A N     1 
ATOM   2361 C  CA    . PHE A 1 322 ? 8.829   -26.669 14.122  1.00 18.88  ? 304 PHE A CA    1 
ATOM   2362 C  C     . PHE A 1 322 ? 7.347   -26.473 13.832  1.00 20.64  ? 304 PHE A C     1 
ATOM   2363 O  O     . PHE A 1 322 ? 6.552   -27.392 13.999  1.00 25.08  ? 304 PHE A O     1 
ATOM   2364 C  CB    . PHE A 1 322 ? 9.214   -25.950 15.418  1.00 18.13  ? 304 PHE A CB    1 
ATOM   2365 C  CG    . PHE A 1 322 ? 8.457   -26.435 16.624  1.00 18.36  ? 304 PHE A CG    1 
ATOM   2366 C  CD1   . PHE A 1 322 ? 8.973   -27.452 17.421  1.00 16.07  ? 304 PHE A CD1   1 
ATOM   2367 C  CD2   . PHE A 1 322 ? 7.226   -25.884 16.958  1.00 16.00  ? 304 PHE A CD2   1 
ATOM   2368 C  CE1   . PHE A 1 322 ? 8.275   -27.908 18.535  1.00 16.47  ? 304 PHE A CE1   1 
ATOM   2369 C  CE2   . PHE A 1 322 ? 6.524   -26.335 18.070  1.00 20.41  ? 304 PHE A CE2   1 
ATOM   2370 C  CZ    . PHE A 1 322 ? 7.047   -27.349 18.857  1.00 16.47  ? 304 PHE A CZ    1 
ATOM   2371 N  N     . ALA A 1 323 ? 6.986   -25.270 13.397  1.00 18.55  ? 305 ALA A N     1 
ATOM   2372 C  CA    . ALA A 1 323 ? 5.600   -24.965 13.072  1.00 17.84  ? 305 ALA A CA    1 
ATOM   2373 C  C     . ALA A 1 323 ? 5.075   -25.861 11.950  1.00 17.50  ? 305 ALA A C     1 
ATOM   2374 O  O     . ALA A 1 323 ? 3.970   -26.395 12.046  1.00 18.40  ? 305 ALA A O     1 
ATOM   2375 C  CB    . ALA A 1 323 ? 5.443   -23.480 12.703  1.00 15.60  ? 305 ALA A CB    1 
ATOM   2376 N  N     . ALA A 1 324 ? 5.869   -26.020 10.892  1.00 15.87  ? 306 ALA A N     1 
ATOM   2377 C  CA    . ALA A 1 324 ? 5.507   -26.898 9.778   1.00 23.12  ? 306 ALA A CA    1 
ATOM   2378 C  C     . ALA A 1 324 ? 5.257   -28.331 10.244  1.00 22.82  ? 306 ALA A C     1 
ATOM   2379 O  O     . ALA A 1 324 ? 4.228   -28.932 9.919   1.00 17.48  ? 306 ALA A O     1 
ATOM   2380 C  CB    . ALA A 1 324 ? 6.593   -26.881 8.711   1.00 16.54  ? 306 ALA A CB    1 
ATOM   2381 N  N     . GLY A 1 325 ? 6.209   -28.868 11.003  1.00 19.39  ? 307 GLY A N     1 
ATOM   2382 C  CA    . GLY A 1 325 ? 6.120   -30.229 11.500  1.00 17.68  ? 307 GLY A CA    1 
ATOM   2383 C  C     . GLY A 1 325 ? 4.885   -30.436 12.357  1.00 18.56  ? 307 GLY A C     1 
ATOM   2384 O  O     . GLY A 1 325 ? 4.206   -31.457 12.237  1.00 18.98  ? 307 GLY A O     1 
ATOM   2385 N  N     . PHE A 1 326 ? 4.577   -29.464 13.211  1.00 17.65  ? 308 PHE A N     1 
ATOM   2386 C  CA    . PHE A 1 326 ? 3.388   -29.567 14.051  1.00 18.76  ? 308 PHE A CA    1 
ATOM   2387 C  C     . PHE A 1 326 ? 2.111   -29.556 13.223  1.00 19.06  ? 308 PHE A C     1 
ATOM   2388 O  O     . PHE A 1 326 ? 1.273   -30.441 13.356  1.00 20.63  ? 308 PHE A O     1 
ATOM   2389 C  CB    . PHE A 1 326 ? 3.313   -28.443 15.093  1.00 16.97  ? 308 PHE A CB    1 
ATOM   2390 C  CG    . PHE A 1 326 ? 2.125   -28.568 16.015  1.00 18.41  ? 308 PHE A CG    1 
ATOM   2391 C  CD1   . PHE A 1 326 ? 2.208   -29.335 17.170  1.00 18.08  ? 308 PHE A CD1   1 
ATOM   2392 C  CD2   . PHE A 1 326 ? 0.919   -27.954 15.707  1.00 18.16  ? 308 PHE A CD2   1 
ATOM   2393 C  CE1   . PHE A 1 326 ? 1.110   -29.477 18.010  1.00 25.69  ? 308 PHE A CE1   1 
ATOM   2394 C  CE2   . PHE A 1 326 ? -0.180  -28.086 16.540  1.00 23.16  ? 308 PHE A CE2   1 
ATOM   2395 C  CZ    . PHE A 1 326 ? -0.084  -28.851 17.697  1.00 25.81  ? 308 PHE A CZ    1 
ATOM   2396 N  N     . ILE A 1 327 ? 1.964   -28.534 12.386  1.00 19.53  ? 309 ILE A N     1 
ATOM   2397 C  CA    . ILE A 1 327 ? 0.735   -28.328 11.628  1.00 19.71  ? 309 ILE A CA    1 
ATOM   2398 C  C     . ILE A 1 327 ? 0.432   -29.471 10.661  1.00 21.51  ? 309 ILE A C     1 
ATOM   2399 O  O     . ILE A 1 327 ? -0.704  -29.941 10.595  1.00 22.02  ? 309 ILE A O     1 
ATOM   2400 C  CB    . ILE A 1 327 ? 0.770   -26.985 10.878  1.00 18.47  ? 309 ILE A CB    1 
ATOM   2401 C  CG1   . ILE A 1 327 ? 0.801   -25.828 11.885  1.00 18.07  ? 309 ILE A CG1   1 
ATOM   2402 C  CG2   . ILE A 1 327 ? -0.429  -26.850 9.944   1.00 19.80  ? 309 ILE A CG2   1 
ATOM   2403 C  CD1   . ILE A 1 327 ? 1.121   -24.490 11.258  1.00 17.83  ? 309 ILE A CD1   1 
ATOM   2404 N  N     . ALA A 1 328 ? 1.452   -29.922 9.932   1.00 21.50  ? 310 ALA A N     1 
ATOM   2405 C  CA    . ALA A 1 328 ? 1.292   -30.990 8.947   1.00 23.30  ? 310 ALA A CA    1 
ATOM   2406 C  C     . ALA A 1 328 ? 0.672   -32.233 9.566   1.00 26.85  ? 310 ALA A C     1 
ATOM   2407 O  O     . ALA A 1 328 ? -0.141  -32.909 8.934   1.00 27.63  ? 310 ALA A O     1 
ATOM   2408 C  CB    . ALA A 1 328 ? 2.632   -31.337 8.297   1.00 20.16  ? 310 ALA A CB    1 
ATOM   2409 N  N     . ASP A 1 329 ? 1.060   -32.528 10.803  1.00 29.47  ? 311 ASP A N     1 
ATOM   2410 C  CA    . ASP A 1 329 ? 0.534   -33.696 11.506  1.00 31.50  ? 311 ASP A CA    1 
ATOM   2411 C  C     . ASP A 1 329 ? -0.809  -33.395 12.156  1.00 29.05  ? 311 ASP A C     1 
ATOM   2412 O  O     . ASP A 1 329 ? -1.741  -34.191 12.062  1.00 28.62  ? 311 ASP A O     1 
ATOM   2413 C  CB    . ASP A 1 329 ? 1.534   -34.212 12.545  1.00 31.05  ? 311 ASP A CB    1 
ATOM   2414 C  CG    . ASP A 1 329 ? 2.358   -35.382 12.028  1.00 36.88  ? 311 ASP A CG    1 
ATOM   2415 O  OD1   . ASP A 1 329 ? 2.651   -35.418 10.814  1.00 38.59  ? 311 ASP A OD1   1 
ATOM   2416 O  OD2   . ASP A 1 329 ? 2.705   -36.276 12.830  1.00 40.99  ? 311 ASP A OD2   1 
ATOM   2417 N  N     . TYR A 1 330 ? -0.907  -32.229 12.788  1.00 26.00  ? 312 TYR A N     1 
ATOM   2418 C  CA    . TYR A 1 330 ? -2.105  -31.843 13.526  1.00 25.04  ? 312 TYR A CA    1 
ATOM   2419 C  C     . TYR A 1 330 ? -3.344  -31.735 12.633  1.00 27.62  ? 312 TYR A C     1 
ATOM   2420 O  O     . TYR A 1 330 ? -4.441  -32.116 13.042  1.00 31.00  ? 312 TYR A O     1 
ATOM   2421 C  CB    . TYR A 1 330 ? -1.870  -30.525 14.276  1.00 23.97  ? 312 TYR A CB    1 
ATOM   2422 C  CG    . TYR A 1 330 ? -2.928  -30.210 15.302  1.00 30.01  ? 312 TYR A CG    1 
ATOM   2423 C  CD1   . TYR A 1 330 ? -2.935  -30.847 16.537  1.00 33.79  ? 312 TYR A CD1   1 
ATOM   2424 C  CD2   . TYR A 1 330 ? -3.917  -29.270 15.044  1.00 34.95  ? 312 TYR A CD2   1 
ATOM   2425 C  CE1   . TYR A 1 330 ? -3.901  -30.564 17.487  1.00 35.42  ? 312 TYR A CE1   1 
ATOM   2426 C  CE2   . TYR A 1 330 ? -4.890  -28.978 15.989  1.00 37.88  ? 312 TYR A CE2   1 
ATOM   2427 C  CZ    . TYR A 1 330 ? -4.876  -29.630 17.209  1.00 38.65  ? 312 TYR A CZ    1 
ATOM   2428 O  OH    . TYR A 1 330 ? -5.841  -29.349 18.153  1.00 43.59  ? 312 TYR A OH    1 
ATOM   2429 N  N     . ILE A 1 331 ? -3.173  -31.217 11.418  1.00 27.00  ? 313 ILE A N     1 
ATOM   2430 C  CA    . ILE A 1 331 ? -4.305  -31.064 10.504  1.00 27.71  ? 313 ILE A CA    1 
ATOM   2431 C  C     . ILE A 1 331 ? -4.702  -32.379 9.838   1.00 30.74  ? 313 ILE A C     1 
ATOM   2432 O  O     . ILE A 1 331 ? -5.738  -32.455 9.178   1.00 31.25  ? 313 ILE A O     1 
ATOM   2433 C  CB    . ILE A 1 331 ? -4.039  -30.010 9.412   1.00 29.67  ? 313 ILE A CB    1 
ATOM   2434 C  CG1   . ILE A 1 331 ? -2.949  -30.487 8.447   1.00 26.81  ? 313 ILE A CG1   1 
ATOM   2435 C  CG2   . ILE A 1 331 ? -3.697  -28.657 10.038  1.00 30.44  ? 313 ILE A CG2   1 
ATOM   2436 C  CD1   . ILE A 1 331 ? -2.695  -29.523 7.307   1.00 23.99  ? 313 ILE A CD1   1 
ATOM   2437 N  N     . ARG A 1 332 ? -3.878  -33.410 10.008  1.00 31.05  ? 314 ARG A N     1 
ATOM   2438 C  CA    . ARG A 1 332 ? -4.227  -34.743 9.517   1.00 32.64  ? 314 ARG A CA    1 
ATOM   2439 C  C     . ARG A 1 332 ? -4.772  -35.632 10.635  1.00 32.27  ? 314 ARG A C     1 
ATOM   2440 O  O     . ARG A 1 332 ? -4.924  -36.842 10.466  1.00 34.95  ? 314 ARG A O     1 
ATOM   2441 C  CB    . ARG A 1 332 ? -3.042  -35.398 8.799   1.00 31.47  ? 314 ARG A CB    1 
ATOM   2442 C  CG    . ARG A 1 332 ? -2.695  -34.720 7.475   1.00 33.42  ? 314 ARG A CG    1 
ATOM   2443 C  CD    . ARG A 1 332 ? -1.540  -35.404 6.774   1.00 36.89  ? 314 ARG A CD    1 
ATOM   2444 N  NE    . ARG A 1 332 ? -0.296  -35.279 7.528   1.00 38.83  ? 314 ARG A NE    1 
ATOM   2445 C  CZ    . ARG A 1 332 ? 0.849   -35.853 7.174   1.00 38.23  ? 314 ARG A CZ    1 
ATOM   2446 N  NH1   . ARG A 1 332 ? 0.904   -36.596 6.076   1.00 36.79  ? 314 ARG A NH1   1 
ATOM   2447 N  NH2   . ARG A 1 332 ? 1.937   -35.687 7.918   1.00 36.33  ? 314 ARG A NH2   1 
ATOM   2448 N  N     . GLY A 1 333 ? -5.066  -35.020 11.776  1.00 28.81  ? 315 GLY A N     1 
ATOM   2449 C  CA    . GLY A 1 333 ? -5.776  -35.700 12.847  1.00 32.47  ? 315 GLY A CA    1 
ATOM   2450 C  C     . GLY A 1 333 ? -4.924  -36.358 13.917  1.00 31.79  ? 315 GLY A C     1 
ATOM   2451 O  O     . GLY A 1 333 ? -5.455  -37.015 14.806  1.00 35.93  ? 315 GLY A O     1 
ATOM   2452 N  N     . LYS A 1 334 ? -3.607  -36.200 13.837  1.00 31.23  ? 316 LYS A N     1 
ATOM   2453 C  CA    . LYS A 1 334 ? -2.723  -36.767 14.852  1.00 31.89  ? 316 LYS A CA    1 
ATOM   2454 C  C     . LYS A 1 334 ? -2.900  -36.001 16.162  1.00 31.36  ? 316 LYS A C     1 
ATOM   2455 O  O     . LYS A 1 334 ? -3.017  -34.782 16.151  1.00 35.17  ? 316 LYS A O     1 
ATOM   2456 C  CB    . LYS A 1 334 ? -1.265  -36.700 14.393  1.00 33.58  ? 316 LYS A CB    1 
ATOM   2457 C  CG    . LYS A 1 334 ? -1.012  -37.274 13.007  1.00 39.37  ? 316 LYS A CG    1 
ATOM   2458 C  CD    . LYS A 1 334 ? -1.354  -38.749 12.931  1.00 48.29  ? 316 LYS A CD    1 
ATOM   2459 C  CE    . LYS A 1 334 ? -1.205  -39.260 11.506  1.00 55.01  ? 316 LYS A CE    1 
ATOM   2460 N  NZ    . LYS A 1 334 ? 0.087   -38.808 10.917  1.00 56.62  ? 316 LYS A NZ    1 
ATOM   2461 N  N     . PRO A 1 335 ? -2.939  -36.716 17.296  1.00 32.40  ? 317 PRO A N     1 
ATOM   2462 C  CA    . PRO A 1 335 ? -3.102  -36.058 18.601  1.00 28.84  ? 317 PRO A CA    1 
ATOM   2463 C  C     . PRO A 1 335 ? -1.957  -35.110 18.954  1.00 28.75  ? 317 PRO A C     1 
ATOM   2464 O  O     . PRO A 1 335 ? -0.908  -35.127 18.306  1.00 26.73  ? 317 PRO A O     1 
ATOM   2465 C  CB    . PRO A 1 335 ? -3.154  -37.228 19.594  1.00 28.76  ? 317 PRO A CB    1 
ATOM   2466 C  CG    . PRO A 1 335 ? -2.664  -38.422 18.837  1.00 37.24  ? 317 PRO A CG    1 
ATOM   2467 C  CD    . PRO A 1 335 ? -2.999  -38.182 17.401  1.00 34.87  ? 317 PRO A CD    1 
ATOM   2468 N  N     . MET A 1 336 ? -2.181  -34.300 19.986  1.00 31.13  ? 318 MET A N     1 
ATOM   2469 C  CA    . MET A 1 336 ? -1.256  -33.249 20.410  1.00 30.10  ? 318 MET A CA    1 
ATOM   2470 C  C     . MET A 1 336 ? 0.191   -33.708 20.588  1.00 28.30  ? 318 MET A C     1 
ATOM   2471 O  O     . MET A 1 336 ? 1.111   -33.092 20.049  1.00 29.09  ? 318 MET A O     1 
ATOM   2472 C  CB    . MET A 1 336 ? -1.751  -32.623 21.719  1.00 28.72  ? 318 MET A CB    1 
ATOM   2473 C  CG    . MET A 1 336 ? -0.838  -31.547 22.277  1.00 25.06  ? 318 MET A CG    1 
ATOM   2474 S  SD    . MET A 1 336 ? -0.909  -30.045 21.292  1.00 34.00  ? 318 MET A SD    1 
ATOM   2475 C  CE    . MET A 1 336 ? 0.441   -29.101 21.993  1.00 32.97  ? 318 MET A CE    1 
ATOM   2476 N  N     . ILE A 1 337 ? 0.388   -34.779 21.351  1.00 26.67  ? 319 ILE A N     1 
ATOM   2477 C  CA    . ILE A 1 337 ? 1.735   -35.248 21.673  1.00 28.02  ? 319 ILE A CA    1 
ATOM   2478 C  C     . ILE A 1 337 ? 2.466   -35.767 20.434  1.00 28.48  ? 319 ILE A C     1 
ATOM   2479 O  O     . ILE A 1 337 ? 3.639   -35.454 20.212  1.00 24.74  ? 319 ILE A O     1 
ATOM   2480 C  CB    . ILE A 1 337 ? 1.711   -36.338 22.765  1.00 29.64  ? 319 ILE A CB    1 
ATOM   2481 C  CG1   . ILE A 1 337 ? 1.091   -35.787 24.053  1.00 30.92  ? 319 ILE A CG1   1 
ATOM   2482 C  CG2   . ILE A 1 337 ? 3.119   -36.856 23.040  1.00 29.54  ? 319 ILE A CG2   1 
ATOM   2483 C  CD1   . ILE A 1 337 ? 1.917   -34.704 24.716  1.00 27.73  ? 319 ILE A CD1   1 
ATOM   2484 N  N     . THR A 1 338 ? 1.760   -36.560 19.632  1.00 27.58  ? 320 THR A N     1 
ATOM   2485 C  CA    . THR A 1 338 ? 2.296   -37.062 18.374  1.00 26.87  ? 320 THR A CA    1 
ATOM   2486 C  C     . THR A 1 338 ? 2.736   -35.899 17.485  1.00 25.17  ? 320 THR A C     1 
ATOM   2487 O  O     . THR A 1 338 ? 3.805   -35.940 16.875  1.00 23.99  ? 320 THR A O     1 
ATOM   2488 C  CB    . THR A 1 338 ? 1.250   -37.927 17.635  1.00 27.89  ? 320 THR A CB    1 
ATOM   2489 O  OG1   . THR A 1 338 ? 0.930   -39.075 18.433  1.00 27.16  ? 320 THR A OG1   1 
ATOM   2490 C  CG2   . THR A 1 338 ? 1.772   -38.384 16.272  1.00 25.48  ? 320 THR A CG2   1 
ATOM   2491 N  N     . SER A 1 339 ? 1.915   -34.854 17.436  1.00 25.02  ? 321 SER A N     1 
ATOM   2492 C  CA    . SER A 1 339 ? 2.211   -33.678 16.620  1.00 23.43  ? 321 SER A CA    1 
ATOM   2493 C  C     . SER A 1 339 ? 3.439   -32.919 17.124  1.00 22.55  ? 321 SER A C     1 
ATOM   2494 O  O     . SER A 1 339 ? 4.237   -32.418 16.326  1.00 21.39  ? 321 SER A O     1 
ATOM   2495 C  CB    . SER A 1 339 ? 0.999   -32.746 16.558  1.00 24.12  ? 321 SER A CB    1 
ATOM   2496 O  OG    . SER A 1 339 ? -0.092  -33.363 15.894  1.00 27.58  ? 321 SER A OG    1 
ATOM   2497 N  N     . LEU A 1 340 ? 3.588   -32.839 18.446  1.00 22.34  ? 322 LEU A N     1 
ATOM   2498 C  CA    . LEU A 1 340 ? 4.763   -32.206 19.045  1.00 23.40  ? 322 LEU A CA    1 
ATOM   2499 C  C     . LEU A 1 340 ? 6.050   -32.938 18.665  1.00 23.86  ? 322 LEU A C     1 
ATOM   2500 O  O     . LEU A 1 340 ? 7.058   -32.305 18.359  1.00 26.43  ? 322 LEU A O     1 
ATOM   2501 C  CB    . LEU A 1 340 ? 4.633   -32.116 20.569  1.00 21.22  ? 322 LEU A CB    1 
ATOM   2502 C  CG    . LEU A 1 340 ? 3.584   -31.140 21.107  1.00 22.24  ? 322 LEU A CG    1 
ATOM   2503 C  CD1   . LEU A 1 340 ? 3.578   -31.153 22.628  1.00 20.40  ? 322 LEU A CD1   1 
ATOM   2504 C  CD2   . LEU A 1 340 ? 3.839   -29.727 20.576  1.00 21.68  ? 322 LEU A CD2   1 
ATOM   2505 N  N     . HIS A 1 341 ? 6.015   -34.267 18.692  1.00 22.52  ? 323 HIS A N     1 
ATOM   2506 C  CA    . HIS A 1 341 ? 7.152   -35.061 18.229  1.00 25.68  ? 323 HIS A CA    1 
ATOM   2507 C  C     . HIS A 1 341 ? 7.453   -34.822 16.751  1.00 26.12  ? 323 HIS A C     1 
ATOM   2508 O  O     . HIS A 1 341 ? 8.611   -34.788 16.344  1.00 24.01  ? 323 HIS A O     1 
ATOM   2509 C  CB    . HIS A 1 341 ? 6.921   -36.551 18.480  1.00 27.88  ? 323 HIS A CB    1 
ATOM   2510 C  CG    . HIS A 1 341 ? 7.251   -36.979 19.874  1.00 31.12  ? 323 HIS A CG    1 
ATOM   2511 N  ND1   . HIS A 1 341 ? 6.286   -37.305 20.801  1.00 33.25  ? 323 HIS A ND1   1 
ATOM   2512 C  CD2   . HIS A 1 341 ? 8.441   -37.118 20.504  1.00 33.03  ? 323 HIS A CD2   1 
ATOM   2513 C  CE1   . HIS A 1 341 ? 6.867   -37.638 21.940  1.00 34.58  ? 323 HIS A CE1   1 
ATOM   2514 N  NE2   . HIS A 1 341 ? 8.174   -37.532 21.787  1.00 35.11  ? 323 HIS A NE2   1 
ATOM   2515 N  N     . ALA A 1 342 ? 6.405   -34.654 15.953  1.00 19.79  ? 324 ALA A N     1 
ATOM   2516 C  CA    . ALA A 1 342 ? 6.570   -34.374 14.535  1.00 23.36  ? 324 ALA A CA    1 
ATOM   2517 C  C     . ALA A 1 342 ? 7.184   -32.992 14.340  1.00 23.42  ? 324 ALA A C     1 
ATOM   2518 O  O     . ALA A 1 342 ? 7.945   -32.766 13.401  1.00 22.67  ? 324 ALA A O     1 
ATOM   2519 C  CB    . ALA A 1 342 ? 5.237   -34.475 13.811  1.00 21.68  ? 324 ALA A CB    1 
ATOM   2520 N  N     . ALA A 1 343 ? 6.856   -32.074 15.244  1.00 23.32  ? 325 ALA A N     1 
ATOM   2521 C  CA    . ALA A 1 343 ? 7.374   -30.712 15.172  1.00 20.79  ? 325 ALA A CA    1 
ATOM   2522 C  C     . ALA A 1 343 ? 8.861   -30.685 15.512  1.00 19.57  ? 325 ALA A C     1 
ATOM   2523 O  O     . ALA A 1 343 ? 9.652   -30.028 14.830  1.00 18.74  ? 325 ALA A O     1 
ATOM   2524 C  CB    . ALA A 1 343 ? 6.588   -29.795 16.105  1.00 16.63  ? 325 ALA A CB    1 
ATOM   2525 N  N     . VAL A 1 344 ? 9.232   -31.412 16.566  1.00 19.77  ? 326 VAL A N     1 
ATOM   2526 C  CA    . VAL A 1 344 ? 10.628  -31.539 16.984  1.00 18.90  ? 326 VAL A CA    1 
ATOM   2527 C  C     . VAL A 1 344 ? 11.451  -32.210 15.891  1.00 20.31  ? 326 VAL A C     1 
ATOM   2528 O  O     . VAL A 1 344 ? 12.568  -31.792 15.599  1.00 24.57  ? 326 VAL A O     1 
ATOM   2529 C  CB    . VAL A 1 344 ? 10.754  -32.336 18.307  1.00 21.40  ? 326 VAL A CB    1 
ATOM   2530 C  CG1   . VAL A 1 344 ? 12.213  -32.611 18.644  1.00 20.82  ? 326 VAL A CG1   1 
ATOM   2531 C  CG2   . VAL A 1 344 ? 10.072  -31.582 19.448  1.00 18.52  ? 326 VAL A CG2   1 
ATOM   2532 N  N     . LYS A 1 345 ? 10.883  -33.242 15.278  1.00 21.02  ? 327 LYS A N     1 
ATOM   2533 C  CA    . LYS A 1 345 ? 11.535  -33.926 14.164  1.00 23.62  ? 327 LYS A CA    1 
ATOM   2534 C  C     . LYS A 1 345 ? 11.826  -32.959 13.012  1.00 24.17  ? 327 LYS A C     1 
ATOM   2535 O  O     . LYS A 1 345 ? 12.939  -32.922 12.486  1.00 23.29  ? 327 LYS A O     1 
ATOM   2536 C  CB    . LYS A 1 345 ? 10.683  -35.106 13.678  1.00 24.59  ? 327 LYS A CB    1 
ATOM   2537 C  CG    . LYS A 1 345 ? 11.248  -35.831 12.459  1.00 26.56  ? 327 LYS A CG    1 
ATOM   2538 C  CD    . LYS A 1 345 ? 10.345  -36.981 12.017  1.00 26.73  ? 327 LYS A CD    1 
ATOM   2539 C  CE    . LYS A 1 345 ? 10.898  -37.677 10.782  1.00 31.22  ? 327 LYS A CE    1 
ATOM   2540 N  NZ    . LYS A 1 345 ? 10.010  -38.775 10.298  1.00 33.61  ? 327 LYS A NZ    1 
ATOM   2541 N  N     . ALA A 1 346 ? 10.825  -32.169 12.635  1.00 24.97  ? 328 ALA A N     1 
ATOM   2542 C  CA    . ALA A 1 346 ? 10.992  -31.176 11.576  1.00 24.29  ? 328 ALA A CA    1 
ATOM   2543 C  C     . ALA A 1 346 ? 12.135  -30.223 11.890  1.00 24.86  ? 328 ALA A C     1 
ATOM   2544 O  O     . ALA A 1 346 ? 12.997  -29.969 11.044  1.00 24.59  ? 328 ALA A O     1 
ATOM   2545 C  CB    . ALA A 1 346 ? 9.710   -30.405 11.368  1.00 16.96  ? 328 ALA A CB    1 
ATOM   2546 N  N     . ALA A 1 347 ? 12.139  -29.708 13.116  1.00 26.87  ? 329 ALA A N     1 
ATOM   2547 C  CA    . ALA A 1 347 ? 13.143  -28.740 13.551  1.00 22.32  ? 329 ALA A CA    1 
ATOM   2548 C  C     . ALA A 1 347 ? 14.531  -29.362 13.577  1.00 23.23  ? 329 ALA A C     1 
ATOM   2549 O  O     . ALA A 1 347 ? 15.509  -28.740 13.153  1.00 20.63  ? 329 ALA A O     1 
ATOM   2550 C  CB    . ALA A 1 347 ? 12.784  -28.193 14.918  1.00 19.27  ? 329 ALA A CB    1 
ATOM   2551 N  N     . ALA A 1 348 ? 14.609  -30.594 14.078  1.00 25.38  ? 330 ALA A N     1 
ATOM   2552 C  CA    . ALA A 1 348 ? 15.871  -31.335 14.141  1.00 27.05  ? 330 ALA A CA    1 
ATOM   2553 C  C     . ALA A 1 348 ? 16.470  -31.577 12.753  1.00 26.92  ? 330 ALA A C     1 
ATOM   2554 O  O     . ALA A 1 348 ? 17.686  -31.520 12.573  1.00 27.52  ? 330 ALA A O     1 
ATOM   2555 C  CB    . ALA A 1 348 ? 15.676  -32.656 14.875  1.00 27.63  ? 330 ALA A CB    1 
ATOM   2556 N  N     . TYR A 1 349 ? 15.613  -31.852 11.776  1.00 25.73  ? 331 TYR A N     1 
ATOM   2557 C  CA    . TYR A 1 349 ? 16.059  -32.032 10.397  1.00 26.10  ? 331 TYR A CA    1 
ATOM   2558 C  C     . TYR A 1 349 ? 16.715  -30.751 9.875   1.00 28.21  ? 331 TYR A C     1 
ATOM   2559 O  O     . TYR A 1 349 ? 17.778  -30.790 9.258   1.00 29.66  ? 331 TYR A O     1 
ATOM   2560 C  CB    . TYR A 1 349 ? 14.876  -32.428 9.512   1.00 22.91  ? 331 TYR A CB    1 
ATOM   2561 C  CG    . TYR A 1 349 ? 15.191  -32.516 8.037   1.00 25.88  ? 331 TYR A CG    1 
ATOM   2562 C  CD1   . TYR A 1 349 ? 15.757  -33.666 7.488   1.00 26.90  ? 331 TYR A CD1   1 
ATOM   2563 C  CD2   . TYR A 1 349 ? 14.903  -31.456 7.184   1.00 28.07  ? 331 TYR A CD2   1 
ATOM   2564 C  CE1   . TYR A 1 349 ? 16.039  -33.750 6.126   1.00 26.81  ? 331 TYR A CE1   1 
ATOM   2565 C  CE2   . TYR A 1 349 ? 15.181  -31.530 5.822   1.00 27.32  ? 331 TYR A CE2   1 
ATOM   2566 C  CZ    . TYR A 1 349 ? 15.751  -32.676 5.300   1.00 26.08  ? 331 TYR A CZ    1 
ATOM   2567 O  OH    . TYR A 1 349 ? 16.024  -32.739 3.950   1.00 26.08  ? 331 TYR A OH    1 
ATOM   2568 N  N     . ILE A 1 350 ? 16.077  -29.617 10.142  1.00 25.80  ? 332 ILE A N     1 
ATOM   2569 C  CA    . ILE A 1 350 ? 16.589  -28.323 9.708   1.00 27.34  ? 332 ILE A CA    1 
ATOM   2570 C  C     . ILE A 1 350 ? 17.869  -27.911 10.451  1.00 29.88  ? 332 ILE A C     1 
ATOM   2571 O  O     . ILE A 1 350 ? 18.797  -27.370 9.847   1.00 31.16  ? 332 ILE A O     1 
ATOM   2572 C  CB    . ILE A 1 350 ? 15.498  -27.237 9.827   1.00 25.71  ? 332 ILE A CB    1 
ATOM   2573 C  CG1   . ILE A 1 350 ? 14.470  -27.411 8.703   1.00 26.17  ? 332 ILE A CG1   1 
ATOM   2574 C  CG2   . ILE A 1 350 ? 16.102  -25.843 9.793   1.00 25.84  ? 332 ILE A CG2   1 
ATOM   2575 C  CD1   . ILE A 1 350 ? 15.077  -27.522 7.303   1.00 25.40  ? 332 ILE A CD1   1 
ATOM   2576 N  N     . ILE A 1 351 ? 17.917  -28.187 11.753  1.00 28.75  ? 333 ILE A N     1 
ATOM   2577 C  CA    . ILE A 1 351 ? 19.079  -27.875 12.586  1.00 28.41  ? 333 ILE A CA    1 
ATOM   2578 C  C     . ILE A 1 351 ? 20.350  -28.546 12.057  1.00 32.96  ? 333 ILE A C     1 
ATOM   2579 O  O     . ILE A 1 351 ? 21.448  -27.992 12.141  1.00 32.66  ? 333 ILE A O     1 
ATOM   2580 C  CB    . ILE A 1 351 ? 18.819  -28.283 14.062  1.00 45.99  ? 333 ILE A CB    1 
ATOM   2581 C  CG1   . ILE A 1 351 ? 17.881  -27.275 14.730  1.00 45.30  ? 333 ILE A CG1   1 
ATOM   2582 C  CG2   . ILE A 1 351 ? 20.116  -28.398 14.859  1.00 44.99  ? 333 ILE A CG2   1 
ATOM   2583 C  CD1   . ILE A 1 351 ? 17.461  -27.662 16.132  1.00 45.18  ? 333 ILE A CD1   1 
ATOM   2584 N  N     . CYS A 1 352 ? 20.193  -29.733 11.484  1.00 34.03  ? 334 CYS A N     1 
ATOM   2585 C  CA    . CYS A 1 352 ? 21.337  -30.471 10.964  1.00 34.07  ? 334 CYS A CA    1 
ATOM   2586 C  C     . CYS A 1 352 ? 21.655  -30.117 9.508   1.00 35.62  ? 334 CYS A C     1 
ATOM   2587 O  O     . CYS A 1 352 ? 22.449  -30.797 8.856   1.00 37.55  ? 334 CYS A O     1 
ATOM   2588 C  CB    . CYS A 1 352 ? 21.113  -31.974 11.129  1.00 31.89  ? 334 CYS A CB    1 
ATOM   2589 S  SG    . CYS A 1 352 ? 21.130  -32.528 12.856  1.00 58.33  ? 334 CYS A SG    1 
ATOM   2590 N  N     . ARG A 1 353 ? 21.043  -29.047 9.009   1.00 34.27  ? 335 ARG A N     1 
ATOM   2591 C  CA    . ARG A 1 353 ? 21.268  -28.596 7.635   1.00 35.79  ? 335 ARG A CA    1 
ATOM   2592 C  C     . ARG A 1 353 ? 21.511  -27.081 7.556   1.00 38.64  ? 335 ARG A C     1 
ATOM   2593 O  O     . ARG A 1 353 ? 21.050  -26.319 8.409   1.00 38.31  ? 335 ARG A O     1 
ATOM   2594 C  CB    . ARG A 1 353 ? 20.089  -28.999 6.743   1.00 32.75  ? 335 ARG A CB    1 
ATOM   2595 C  CG    . ARG A 1 353 ? 19.845  -30.499 6.689   1.00 31.49  ? 335 ARG A CG    1 
ATOM   2596 C  CD    . ARG A 1 353 ? 18.583  -30.843 5.914   1.00 28.75  ? 335 ARG A CD    1 
ATOM   2597 N  NE    . ARG A 1 353 ? 18.665  -30.470 4.502   1.00 28.66  ? 335 ARG A NE    1 
ATOM   2598 C  CZ    . ARG A 1 353 ? 19.142  -31.263 3.547   1.00 33.46  ? 335 ARG A CZ    1 
ATOM   2599 N  NH1   . ARG A 1 353 ? 19.585  -32.479 3.853   1.00 31.41  ? 335 ARG A NH1   1 
ATOM   2600 N  NH2   . ARG A 1 353 ? 19.176  -30.843 2.285   1.00 33.32  ? 335 ARG A NH2   1 
ATOM   2601 N  N     . SER A 1 354 ? 22.233  -26.652 6.523   1.00 40.19  ? 336 SER A N     1 
ATOM   2602 C  CA    . SER A 1 354 ? 22.603  -25.247 6.365   1.00 40.72  ? 336 SER A CA    1 
ATOM   2603 C  C     . SER A 1 354 ? 21.484  -24.431 5.718   1.00 38.97  ? 336 SER A C     1 
ATOM   2604 O  O     . SER A 1 354 ? 21.083  -24.697 4.582   1.00 40.39  ? 336 SER A O     1 
ATOM   2605 C  CB    . SER A 1 354 ? 23.886  -25.123 5.538   1.00 45.10  ? 336 SER A CB    1 
ATOM   2606 O  OG    . SER A 1 354 ? 24.915  -25.952 6.056   1.00 48.97  ? 336 SER A OG    1 
ATOM   2607 N  N     . GLY A 1 355 ? 20.992  -23.429 6.441   1.00 35.89  ? 337 GLY A N     1 
ATOM   2608 C  CA    . GLY A 1 355 ? 19.862  -22.637 5.978   1.00 35.51  ? 337 GLY A CA    1 
ATOM   2609 C  C     . GLY A 1 355 ? 18.591  -23.466 5.954   1.00 33.08  ? 337 GLY A C     1 
ATOM   2610 O  O     . GLY A 1 355 ? 18.583  -24.613 6.402   1.00 32.41  ? 337 GLY A O     1 
ATOM   2611 N  N     . PHE A 1 356 ? 17.506  -22.904 5.433   1.00 31.89  ? 338 PHE A N     1 
ATOM   2612 C  CA    . PHE A 1 356 ? 16.282  -23.686 5.322   1.00 29.72  ? 338 PHE A CA    1 
ATOM   2613 C  C     . PHE A 1 356 ? 16.328  -24.549 4.064   1.00 30.41  ? 338 PHE A C     1 
ATOM   2614 O  O     . PHE A 1 356 ? 15.677  -24.256 3.059   1.00 33.06  ? 338 PHE A O     1 
ATOM   2615 C  CB    . PHE A 1 356 ? 15.038  -22.801 5.343   1.00 27.35  ? 338 PHE A CB    1 
ATOM   2616 C  CG    . PHE A 1 356 ? 13.808  -23.518 5.821   1.00 26.85  ? 338 PHE A CG    1 
ATOM   2617 C  CD1   . PHE A 1 356 ? 13.502  -23.565 7.174   1.00 23.06  ? 338 PHE A CD1   1 
ATOM   2618 C  CD2   . PHE A 1 356 ? 12.966  -24.162 4.921   1.00 22.35  ? 338 PHE A CD2   1 
ATOM   2619 C  CE1   . PHE A 1 356 ? 12.374  -24.235 7.625   1.00 22.34  ? 338 PHE A CE1   1 
ATOM   2620 C  CE2   . PHE A 1 356 ? 11.838  -24.831 5.362   1.00 21.37  ? 338 PHE A CE2   1 
ATOM   2621 C  CZ    . PHE A 1 356 ? 11.541  -24.870 6.718   1.00 23.63  ? 338 PHE A CZ    1 
ATOM   2622 N  N     . SER A 1 357 ? 17.115  -25.615 4.134   1.00 27.18  ? 339 SER A N     1 
ATOM   2623 C  CA    . SER A 1 357 ? 17.334  -26.492 2.992   1.00 27.78  ? 339 SER A CA    1 
ATOM   2624 C  C     . SER A 1 357 ? 16.522  -27.775 3.137   1.00 27.16  ? 339 SER A C     1 
ATOM   2625 O  O     . SER A 1 357 ? 16.704  -28.519 4.097   1.00 32.41  ? 339 SER A O     1 
ATOM   2626 C  CB    . SER A 1 357 ? 18.823  -26.827 2.878   1.00 29.25  ? 339 SER A CB    1 
ATOM   2627 O  OG    . SER A 1 357 ? 19.067  -27.749 1.830   1.00 36.07  ? 339 SER A OG    1 
ATOM   2628 N  N     . LEU A 1 358 ? 15.624  -28.028 2.189   1.00 26.02  ? 340 LEU A N     1 
ATOM   2629 C  CA    . LEU A 1 358 ? 14.850  -29.272 2.170   1.00 27.11  ? 340 LEU A CA    1 
ATOM   2630 C  C     . LEU A 1 358 ? 15.407  -30.221 1.112   1.00 26.94  ? 340 LEU A C     1 
ATOM   2631 O  O     . LEU A 1 358 ? 15.294  -29.955 -0.082  1.00 30.39  ? 340 LEU A O     1 
ATOM   2632 C  CB    . LEU A 1 358 ? 13.375  -28.984 1.872   1.00 25.82  ? 340 LEU A CB    1 
ATOM   2633 C  CG    . LEU A 1 358 ? 12.579  -28.184 2.906   1.00 24.88  ? 340 LEU A CG    1 
ATOM   2634 C  CD1   . LEU A 1 358 ? 11.203  -27.821 2.361   1.00 20.52  ? 340 LEU A CD1   1 
ATOM   2635 C  CD2   . LEU A 1 358 ? 12.459  -28.977 4.198   1.00 22.13  ? 340 LEU A CD2   1 
ATOM   2636 N  N     . GLY A 1 359 ? 16.010  -31.321 1.550   1.00 27.71  ? 341 GLY A N     1 
ATOM   2637 C  CA    . GLY A 1 359 ? 16.602  -32.288 0.636   1.00 31.05  ? 341 GLY A CA    1 
ATOM   2638 C  C     . GLY A 1 359 ? 15.595  -33.280 0.080   1.00 30.74  ? 341 GLY A C     1 
ATOM   2639 O  O     . GLY A 1 359 ? 14.400  -32.990 0.017   1.00 29.20  ? 341 GLY A O     1 
ATOM   2640 N  N     . SER A 1 360 ? 16.065  -34.456 -0.329  1.00 31.79  ? 342 SER A N     1 
ATOM   2641 C  CA    . SER A 1 360 ? 15.149  -35.447 -0.880  1.00 35.39  ? 342 SER A CA    1 
ATOM   2642 C  C     . SER A 1 360 ? 14.248  -35.985 0.223   1.00 33.46  ? 342 SER A C     1 
ATOM   2643 O  O     . SER A 1 360 ? 14.702  -36.299 1.326   1.00 32.98  ? 342 SER A O     1 
ATOM   2644 C  CB    . SER A 1 360 ? 15.879  -36.578 -1.621  1.00 39.63  ? 342 SER A CB    1 
ATOM   2645 O  OG    . SER A 1 360 ? 16.693  -37.337 -0.751  1.00 41.78  ? 342 SER A OG    1 
ATOM   2646 N  N     . ARG A 1 361 ? 12.962  -36.067 -0.091  1.00 33.25  ? 343 ARG A N     1 
ATOM   2647 C  CA    . ARG A 1 361 ? 11.934  -36.396 0.883   1.00 32.64  ? 343 ARG A CA    1 
ATOM   2648 C  C     . ARG A 1 361 ? 12.125  -37.794 1.483   1.00 34.93  ? 343 ARG A C     1 
ATOM   2649 O  O     . ARG A 1 361 ? 11.755  -38.040 2.635   1.00 31.49  ? 343 ARG A O     1 
ATOM   2650 C  CB    . ARG A 1 361 ? 10.558  -36.253 0.232   1.00 29.32  ? 343 ARG A CB    1 
ATOM   2651 C  CG    . ARG A 1 361 ? 9.392   -36.529 1.147   1.00 28.57  ? 343 ARG A CG    1 
ATOM   2652 C  CD    . ARG A 1 361 ? 9.475   -35.725 2.427   1.00 28.36  ? 343 ARG A CD    1 
ATOM   2653 N  NE    . ARG A 1 361 ? 8.280   -35.940 3.237   1.00 30.66  ? 343 ARG A NE    1 
ATOM   2654 C  CZ    . ARG A 1 361 ? 8.084   -37.005 4.007   1.00 30.16  ? 343 ARG A CZ    1 
ATOM   2655 N  NH1   . ARG A 1 361 ? 9.013   -37.952 4.085   1.00 26.78  ? 343 ARG A NH1   1 
ATOM   2656 N  NH2   . ARG A 1 361 ? 6.959   -37.120 4.698   1.00 27.51  ? 343 ARG A NH2   1 
ATOM   2657 N  N     . ASP A 1 362 ? 12.723  -38.691 0.702   1.00 38.13  ? 344 ASP A N     1 
ATOM   2658 C  CA    . ASP A 1 362 ? 13.007  -40.057 1.142   1.00 44.23  ? 344 ASP A CA    1 
ATOM   2659 C  C     . ASP A 1 362 ? 13.969  -40.126 2.322   1.00 44.33  ? 344 ASP A C     1 
ATOM   2660 O  O     . ASP A 1 362 ? 13.945  -41.086 3.089   1.00 47.33  ? 344 ASP A O     1 
ATOM   2661 C  CB    . ASP A 1 362 ? 13.588  -40.881 -0.008  1.00 53.40  ? 344 ASP A CB    1 
ATOM   2662 C  CG    . ASP A 1 362 ? 12.533  -41.350 -0.979  1.00 60.25  ? 344 ASP A CG    1 
ATOM   2663 O  OD1   . ASP A 1 362 ? 12.886  -41.649 -2.140  1.00 65.13  ? 344 ASP A OD1   1 
ATOM   2664 O  OD2   . ASP A 1 362 ? 11.352  -41.421 -0.578  1.00 61.08  ? 344 ASP A OD2   1 
ATOM   2665 N  N     . SER A 1 363 ? 14.822  -39.117 2.457   1.00 42.94  ? 345 SER A N     1 
ATOM   2666 C  CA    . SER A 1 363 ? 15.845  -39.123 3.497   1.00 45.46  ? 345 SER A CA    1 
ATOM   2667 C  C     . SER A 1 363 ? 15.398  -38.415 4.769   1.00 46.62  ? 345 SER A C     1 
ATOM   2668 O  O     . SER A 1 363 ? 16.209  -38.148 5.651   1.00 47.82  ? 345 SER A O     1 
ATOM   2669 C  CB    . SER A 1 363 ? 17.138  -38.494 2.978   1.00 47.13  ? 345 SER A CB    1 
ATOM   2670 O  OG    . SER A 1 363 ? 17.723  -39.311 1.980   1.00 53.47  ? 345 SER A OG    1 
ATOM   2671 N  N     . TYR A 1 364 ? 14.107  -38.112 4.858   1.00 47.24  ? 346 TYR A N     1 
ATOM   2672 C  CA    . TYR A 1 364 ? 13.553  -37.451 6.034   1.00 46.17  ? 346 TYR A CA    1 
ATOM   2673 C  C     . TYR A 1 364 ? 13.506  -38.426 7.211   1.00 54.84  ? 346 TYR A C     1 
ATOM   2674 O  O     . TYR A 1 364 ? 13.495  -38.010 8.368   1.00 54.41  ? 346 TYR A O     1 
ATOM   2675 C  CB    . TYR A 1 364 ? 12.151  -36.919 5.718   1.00 37.66  ? 346 TYR A CB    1 
ATOM   2676 C  CG    . TYR A 1 364 ? 11.533  -36.043 6.793   1.00 33.43  ? 346 TYR A CG    1 
ATOM   2677 C  CD1   . TYR A 1 364 ? 12.280  -35.060 7.434   1.00 29.51  ? 346 TYR A CD1   1 
ATOM   2678 C  CD2   . TYR A 1 364 ? 10.191  -36.179 7.144   1.00 30.44  ? 346 TYR A CD2   1 
ATOM   2679 C  CE1   . TYR A 1 364 ? 11.717  -34.253 8.402   1.00 25.51  ? 346 TYR A CE1   1 
ATOM   2680 C  CE2   . TYR A 1 364 ? 9.618   -35.372 8.115   1.00 27.17  ? 346 TYR A CE2   1 
ATOM   2681 C  CZ    . TYR A 1 364 ? 10.387  -34.409 8.740   1.00 25.42  ? 346 TYR A CZ    1 
ATOM   2682 O  OH    . TYR A 1 364 ? 9.829   -33.597 9.703   1.00 23.44  ? 346 TYR A OH    1 
ATOM   2683 N  N     . SER A 1 365 ? 13.498  -39.720 6.894   1.00 64.47  ? 347 SER A N     1 
ATOM   2684 C  CA    . SER A 1 365 ? 13.358  -40.794 7.883   1.00 44.93  ? 347 SER A CA    1 
ATOM   2685 C  C     . SER A 1 365 ? 12.061  -40.674 8.686   1.00 46.03  ? 347 SER A C     1 
ATOM   2686 O  O     . SER A 1 365 ? 10.995  -40.397 8.126   1.00 46.67  ? 347 SER A O     1 
ATOM   2687 C  CB    . SER A 1 365 ? 14.578  -40.868 8.813   1.00 46.59  ? 347 SER A CB    1 
ATOM   2688 O  OG    . SER A 1 365 ? 15.740  -41.271 8.105   1.00 48.01  ? 347 SER A OG    1 
ATOM   2689 N  N     . ASP B 1 21  ? 12.887  -49.725 -19.570 1.00 68.62  ? 3   ASP B N     1 
ATOM   2690 C  CA    . ASP B 1 21  ? 13.290  -48.612 -18.715 1.00 66.75  ? 3   ASP B CA    1 
ATOM   2691 C  C     . ASP B 1 21  ? 14.797  -48.380 -18.745 1.00 60.16  ? 3   ASP B C     1 
ATOM   2692 O  O     . ASP B 1 21  ? 15.571  -49.277 -19.084 1.00 63.86  ? 3   ASP B O     1 
ATOM   2693 C  CB    . ASP B 1 21  ? 12.830  -48.839 -17.272 1.00 70.38  ? 3   ASP B CB    1 
ATOM   2694 C  CG    . ASP B 1 21  ? 11.363  -48.512 -17.067 1.00 73.99  ? 3   ASP B CG    1 
ATOM   2695 O  OD1   . ASP B 1 21  ? 10.522  -49.420 -17.230 1.00 76.90  ? 3   ASP B OD1   1 
ATOM   2696 O  OD2   . ASP B 1 21  ? 11.052  -47.346 -16.741 1.00 73.76  ? 3   ASP B OD2   1 
ATOM   2697 N  N     . LEU B 1 22  ? 15.205  -47.167 -18.388 1.00 48.20  ? 4   LEU B N     1 
ATOM   2698 C  CA    . LEU B 1 22  ? 16.617  -46.830 -18.298 1.00 38.10  ? 4   LEU B CA    1 
ATOM   2699 C  C     . LEU B 1 22  ? 17.010  -46.680 -16.835 1.00 35.05  ? 4   LEU B C     1 
ATOM   2700 O  O     . LEU B 1 22  ? 16.250  -46.142 -16.034 1.00 37.04  ? 4   LEU B O     1 
ATOM   2701 C  CB    . LEU B 1 22  ? 16.907  -45.527 -19.042 1.00 31.19  ? 4   LEU B CB    1 
ATOM   2702 C  CG    . LEU B 1 22  ? 16.463  -45.404 -20.500 1.00 28.86  ? 4   LEU B CG    1 
ATOM   2703 C  CD1   . LEU B 1 22  ? 16.688  -43.979 -20.993 1.00 23.29  ? 4   LEU B CD1   1 
ATOM   2704 C  CD2   . LEU B 1 22  ? 17.196  -46.407 -21.384 1.00 26.30  ? 4   LEU B CD2   1 
ATOM   2705 N  N     . SER B 1 23  ? 18.199  -47.154 -16.488 1.00 31.64  ? 5   SER B N     1 
ATOM   2706 C  CA    . SER B 1 23  ? 18.695  -47.019 -15.127 1.00 30.71  ? 5   SER B CA    1 
ATOM   2707 C  C     . SER B 1 23  ? 19.045  -45.565 -14.832 1.00 31.16  ? 5   SER B C     1 
ATOM   2708 O  O     . SER B 1 23  ? 19.208  -44.753 -15.746 1.00 28.79  ? 5   SER B O     1 
ATOM   2709 C  CB    . SER B 1 23  ? 19.926  -47.898 -14.919 1.00 32.20  ? 5   SER B CB    1 
ATOM   2710 O  OG    . SER B 1 23  ? 20.996  -47.466 -15.743 1.00 33.00  ? 5   SER B OG    1 
ATOM   2711 N  N     . GLU B 1 24  ? 19.158  -45.240 -13.550 1.00 31.59  ? 6   GLU B N     1 
ATOM   2712 C  CA    . GLU B 1 24  ? 19.537  -43.898 -13.138 1.00 29.44  ? 6   GLU B CA    1 
ATOM   2713 C  C     . GLU B 1 24  ? 20.942  -43.552 -13.621 1.00 27.33  ? 6   GLU B C     1 
ATOM   2714 O  O     . GLU B 1 24  ? 21.845  -44.387 -13.597 1.00 25.71  ? 6   GLU B O     1 
ATOM   2715 C  CB    . GLU B 1 24  ? 19.430  -43.755 -11.619 1.00 34.80  ? 6   GLU B CB    1 
ATOM   2716 C  CG    . GLU B 1 24  ? 18.012  -43.984 -11.099 1.00 43.13  ? 6   GLU B CG    1 
ATOM   2717 C  CD    . GLU B 1 24  ? 17.805  -43.485 -9.678  1.00 48.00  ? 6   GLU B CD    1 
ATOM   2718 O  OE1   . GLU B 1 24  ? 18.804  -43.331 -8.939  1.00 48.28  ? 6   GLU B OE1   1 
ATOM   2719 O  OE2   . GLU B 1 24  ? 16.636  -43.243 -9.305  1.00 49.31  ? 6   GLU B OE2   1 
ATOM   2720 N  N     . GLY B 1 25  ? 21.116  -42.317 -14.079 1.00 26.09  ? 7   GLY B N     1 
ATOM   2721 C  CA    . GLY B 1 25  ? 22.405  -41.864 -14.560 1.00 25.32  ? 7   GLY B CA    1 
ATOM   2722 C  C     . GLY B 1 25  ? 22.810  -42.475 -15.889 1.00 24.86  ? 7   GLY B C     1 
ATOM   2723 O  O     . GLY B 1 25  ? 23.981  -42.436 -16.250 1.00 26.04  ? 7   GLY B O     1 
ATOM   2724 N  N     . TYR B 1 26  ? 21.842  -43.029 -16.615 1.00 22.07  ? 8   TYR B N     1 
ATOM   2725 C  CA    . TYR B 1 26  ? 22.080  -43.649 -17.919 1.00 21.93  ? 8   TYR B CA    1 
ATOM   2726 C  C     . TYR B 1 26  ? 22.685  -42.667 -18.929 1.00 22.21  ? 8   TYR B C     1 
ATOM   2727 O  O     . TYR B 1 26  ? 23.480  -43.055 -19.790 1.00 22.40  ? 8   TYR B O     1 
ATOM   2728 C  CB    . TYR B 1 26  ? 20.762  -44.193 -18.463 1.00 21.83  ? 8   TYR B CB    1 
ATOM   2729 C  CG    . TYR B 1 26  ? 20.877  -45.222 -19.564 1.00 27.06  ? 8   TYR B CG    1 
ATOM   2730 C  CD1   . TYR B 1 26  ? 21.092  -46.561 -19.268 1.00 26.49  ? 8   TYR B CD1   1 
ATOM   2731 C  CD2   . TYR B 1 26  ? 20.727  -44.861 -20.902 1.00 28.84  ? 8   TYR B CD2   1 
ATOM   2732 C  CE1   . TYR B 1 26  ? 21.177  -47.513 -20.267 1.00 25.14  ? 8   TYR B CE1   1 
ATOM   2733 C  CE2   . TYR B 1 26  ? 20.812  -45.810 -21.913 1.00 26.75  ? 8   TYR B CE2   1 
ATOM   2734 C  CZ    . TYR B 1 26  ? 21.039  -47.132 -21.585 1.00 25.63  ? 8   TYR B CZ    1 
ATOM   2735 O  OH    . TYR B 1 26  ? 21.122  -48.077 -22.579 1.00 26.84  ? 8   TYR B OH    1 
ATOM   2736 N  N     . VAL B 1 27  ? 22.298  -41.399 -18.814 1.00 19.62  ? 9   VAL B N     1 
ATOM   2737 C  CA    . VAL B 1 27  ? 22.769  -40.352 -19.713 1.00 18.85  ? 9   VAL B CA    1 
ATOM   2738 C  C     . VAL B 1 27  ? 23.621  -39.358 -18.941 1.00 22.00  ? 9   VAL B C     1 
ATOM   2739 O  O     . VAL B 1 27  ? 23.247  -38.932 -17.854 1.00 23.32  ? 9   VAL B O     1 
ATOM   2740 C  CB    . VAL B 1 27  ? 21.593  -39.596 -20.344 1.00 21.77  ? 9   VAL B CB    1 
ATOM   2741 C  CG1   . VAL B 1 27  ? 22.094  -38.567 -21.357 1.00 19.28  ? 9   VAL B CG1   1 
ATOM   2742 C  CG2   . VAL B 1 27  ? 20.628  -40.576 -20.989 1.00 19.38  ? 9   VAL B CG2   1 
ATOM   2743 N  N     . PHE B 1 28  ? 24.768  -39.000 -19.503 1.00 18.12  ? 10  PHE B N     1 
ATOM   2744 C  CA    . PHE B 1 28  ? 25.679  -38.070 -18.854 1.00 17.83  ? 10  PHE B CA    1 
ATOM   2745 C  C     . PHE B 1 28  ? 26.044  -36.924 -19.800 1.00 21.91  ? 10  PHE B C     1 
ATOM   2746 O  O     . PHE B 1 28  ? 26.395  -37.141 -20.962 1.00 20.83  ? 10  PHE B O     1 
ATOM   2747 C  CB    . PHE B 1 28  ? 26.946  -38.793 -18.380 1.00 18.57  ? 10  PHE B CB    1 
ATOM   2748 C  CG    . PHE B 1 28  ? 27.968  -37.885 -17.735 1.00 26.11  ? 10  PHE B CG    1 
ATOM   2749 C  CD1   . PHE B 1 28  ? 28.016  -37.745 -16.355 1.00 27.26  ? 10  PHE B CD1   1 
ATOM   2750 C  CD2   . PHE B 1 28  ? 28.885  -37.178 -18.507 1.00 22.65  ? 10  PHE B CD2   1 
ATOM   2751 C  CE1   . PHE B 1 28  ? 28.951  -36.916 -15.758 1.00 25.72  ? 10  PHE B CE1   1 
ATOM   2752 C  CE2   . PHE B 1 28  ? 29.822  -36.349 -17.919 1.00 21.81  ? 10  PHE B CE2   1 
ATOM   2753 C  CZ    . PHE B 1 28  ? 29.858  -36.220 -16.540 1.00 24.36  ? 10  PHE B CZ    1 
ATOM   2754 N  N     . GLY B 1 29  ? 25.959  -35.704 -19.288 1.00 21.76  ? 11  GLY B N     1 
ATOM   2755 C  CA    . GLY B 1 29  ? 26.390  -34.538 -20.037 1.00 21.81  ? 11  GLY B CA    1 
ATOM   2756 C  C     . GLY B 1 29  ? 27.434  -33.749 -19.272 1.00 22.24  ? 11  GLY B C     1 
ATOM   2757 O  O     . GLY B 1 29  ? 27.407  -33.687 -18.045 1.00 19.79  ? 11  GLY B O     1 
ATOM   2758 N  N     . MET B 1 30  ? 28.366  -33.154 -20.003 1.00 23.63  ? 12  MET B N     1 
ATOM   2759 C  CA    . MET B 1 30  ? 29.355  -32.266 -19.410 1.00 24.89  ? 12  MET B CA    1 
ATOM   2760 C  C     . MET B 1 30  ? 29.472  -31.019 -20.279 1.00 23.03  ? 12  MET B C     1 
ATOM   2761 O  O     . MET B 1 30  ? 29.542  -31.121 -21.506 1.00 20.99  ? 12  MET B O     1 
ATOM   2762 C  CB    . MET B 1 30  ? 30.697  -32.981 -19.296 1.00 28.58  ? 12  MET B CB    1 
ATOM   2763 C  CG    . MET B 1 30  ? 31.912  -32.089 -19.439 1.00 34.87  ? 12  MET B CG    1 
ATOM   2764 S  SD    . MET B 1 30  ? 33.437  -33.049 -19.357 1.00 51.54  ? 12  MET B SD    1 
ATOM   2765 C  CE    . MET B 1 30  ? 34.620  -31.894 -20.027 1.00 29.86  ? 12  MET B CE    1 
ATOM   2766 N  N     . GLY B 1 31  ? 29.478  -29.840 -19.660 1.00 18.23  ? 13  GLY B N     1 
ATOM   2767 C  CA    . GLY B 1 31  ? 29.536  -28.623 -20.449 1.00 20.17  ? 13  GLY B CA    1 
ATOM   2768 C  C     . GLY B 1 31  ? 29.643  -27.298 -19.726 1.00 20.66  ? 13  GLY B C     1 
ATOM   2769 O  O     . GLY B 1 31  ? 30.070  -27.229 -18.572 1.00 22.40  ? 13  GLY B O     1 
ATOM   2770 N  N     . ASN B 1 32  ? 29.247  -26.242 -20.432 1.00 19.91  ? 14  ASN B N     1 
ATOM   2771 C  CA    . ASN B 1 32  ? 29.299  -24.876 -19.923 1.00 19.33  ? 14  ASN B CA    1 
ATOM   2772 C  C     . ASN B 1 32  ? 27.932  -24.416 -19.410 1.00 17.78  ? 14  ASN B C     1 
ATOM   2773 O  O     . ASN B 1 32  ? 27.056  -24.057 -20.195 1.00 18.09  ? 14  ASN B O     1 
ATOM   2774 C  CB    . ASN B 1 32  ? 29.795  -23.922 -21.017 1.00 18.17  ? 14  ASN B CB    1 
ATOM   2775 C  CG    . ASN B 1 32  ? 31.095  -24.388 -21.662 1.00 21.41  ? 14  ASN B CG    1 
ATOM   2776 O  OD1   . ASN B 1 32  ? 31.941  -25.007 -21.011 1.00 23.31  ? 14  ASN B OD1   1 
ATOM   2777 N  ND2   . ASN B 1 32  ? 31.259  -24.091 -22.950 1.00 18.20  ? 14  ASN B ND2   1 
ATOM   2778 N  N     . PRO B 1 33  ? 27.740  -24.436 -18.085 1.00 18.53  ? 15  PRO B N     1 
ATOM   2779 C  CA    . PRO B 1 33  ? 26.485  -23.938 -17.517 1.00 18.13  ? 15  PRO B CA    1 
ATOM   2780 C  C     . PRO B 1 33  ? 26.461  -22.404 -17.530 1.00 20.34  ? 15  PRO B C     1 
ATOM   2781 O  O     . PRO B 1 33  ? 27.249  -21.759 -16.841 1.00 19.84  ? 15  PRO B O     1 
ATOM   2782 C  CB    . PRO B 1 33  ? 26.525  -24.473 -16.084 1.00 16.43  ? 15  PRO B CB    1 
ATOM   2783 C  CG    . PRO B 1 33  ? 27.982  -24.552 -15.764 1.00 17.82  ? 15  PRO B CG    1 
ATOM   2784 C  CD    . PRO B 1 33  ? 28.670  -24.922 -17.049 1.00 17.62  ? 15  PRO B CD    1 
ATOM   2785 N  N     . LEU B 1 34  ? 25.563  -21.829 -18.320 1.00 19.89  ? 16  LEU B N     1 
ATOM   2786 C  CA    . LEU B 1 34  ? 25.547  -20.387 -18.521 1.00 21.73  ? 16  LEU B CA    1 
ATOM   2787 C  C     . LEU B 1 34  ? 24.168  -19.832 -18.240 1.00 21.04  ? 16  LEU B C     1 
ATOM   2788 O  O     . LEU B 1 34  ? 23.162  -20.497 -18.484 1.00 21.24  ? 16  LEU B O     1 
ATOM   2789 C  CB    . LEU B 1 34  ? 25.933  -20.047 -19.963 1.00 20.02  ? 16  LEU B CB    1 
ATOM   2790 C  CG    . LEU B 1 34  ? 27.263  -20.599 -20.476 1.00 19.36  ? 16  LEU B CG    1 
ATOM   2791 C  CD1   . LEU B 1 34  ? 27.353  -20.457 -21.993 1.00 17.69  ? 16  LEU B CD1   1 
ATOM   2792 C  CD2   . LEU B 1 34  ? 28.414  -19.887 -19.798 1.00 22.85  ? 16  LEU B CD2   1 
ATOM   2793 N  N     . LEU B 1 35  ? 24.119  -18.609 -17.733 1.00 21.94  ? 17  LEU B N     1 
ATOM   2794 C  CA    . LEU B 1 35  ? 22.847  -17.922 -17.567 1.00 24.70  ? 17  LEU B CA    1 
ATOM   2795 C  C     . LEU B 1 35  ? 22.540  -17.080 -18.804 1.00 24.60  ? 17  LEU B C     1 
ATOM   2796 O  O     . LEU B 1 35  ? 23.306  -16.184 -19.157 1.00 26.03  ? 17  LEU B O     1 
ATOM   2797 C  CB    . LEU B 1 35  ? 22.866  -17.027 -16.327 1.00 26.08  ? 17  LEU B CB    1 
ATOM   2798 C  CG    . LEU B 1 35  ? 21.486  -16.440 -16.018 1.00 31.13  ? 17  LEU B CG    1 
ATOM   2799 C  CD1   . LEU B 1 35  ? 20.613  -17.485 -15.334 1.00 28.97  ? 17  LEU B CD1   1 
ATOM   2800 C  CD2   . LEU B 1 35  ? 21.591  -15.177 -15.186 1.00 34.08  ? 17  LEU B CD2   1 
ATOM   2801 N  N     . ASP B 1 36  ? 21.425  -17.366 -19.465 1.00 21.76  ? 18  ASP B N     1 
ATOM   2802 C  CA    . ASP B 1 36  ? 20.992  -16.539 -20.588 1.00 20.90  ? 18  ASP B CA    1 
ATOM   2803 C  C     . ASP B 1 36  ? 20.241  -15.305 -20.084 1.00 26.43  ? 18  ASP B C     1 
ATOM   2804 O  O     . ASP B 1 36  ? 19.282  -15.411 -19.314 1.00 25.27  ? 18  ASP B O     1 
ATOM   2805 C  CB    . ASP B 1 36  ? 20.115  -17.331 -21.564 1.00 22.40  ? 18  ASP B CB    1 
ATOM   2806 C  CG    . ASP B 1 36  ? 20.866  -18.474 -22.239 1.00 30.40  ? 18  ASP B CG    1 
ATOM   2807 O  OD1   . ASP B 1 36  ? 22.115  -18.479 -22.207 1.00 32.03  ? 18  ASP B OD1   1 
ATOM   2808 O  OD2   . ASP B 1 36  ? 20.205  -19.370 -22.806 1.00 32.46  ? 18  ASP B OD2   1 
ATOM   2809 N  N     . ILE B 1 37  ? 20.685  -14.134 -20.523 1.00 27.92  ? 19  ILE B N     1 
ATOM   2810 C  CA    . ILE B 1 37  ? 20.035  -12.886 -20.158 1.00 29.70  ? 19  ILE B CA    1 
ATOM   2811 C  C     . ILE B 1 37  ? 19.287  -12.347 -21.373 1.00 28.99  ? 19  ILE B C     1 
ATOM   2812 O  O     . ILE B 1 37  ? 19.893  -11.801 -22.295 1.00 25.02  ? 19  ILE B O     1 
ATOM   2813 C  CB    . ILE B 1 37  ? 21.063  -11.869 -19.649 1.00 31.00  ? 19  ILE B CB    1 
ATOM   2814 C  CG1   . ILE B 1 37  ? 21.873  -12.490 -18.506 1.00 30.02  ? 19  ILE B CG1   1 
ATOM   2815 C  CG2   . ILE B 1 37  ? 20.380  -10.578 -19.209 1.00 29.43  ? 19  ILE B CG2   1 
ATOM   2816 C  CD1   . ILE B 1 37  ? 23.094  -11.692 -18.115 1.00 31.96  ? 19  ILE B CD1   1 
ATOM   2817 N  N     . ILE B 1 38  ? 17.967  -12.525 -21.371 1.00 30.71  ? 20  ILE B N     1 
ATOM   2818 C  CA    . ILE B 1 38  ? 17.143  -12.228 -22.539 1.00 32.33  ? 20  ILE B CA    1 
ATOM   2819 C  C     . ILE B 1 38  ? 16.631  -10.797 -22.507 1.00 32.56  ? 20  ILE B C     1 
ATOM   2820 O  O     . ILE B 1 38  ? 16.016  -10.372 -21.530 1.00 35.68  ? 20  ILE B O     1 
ATOM   2821 C  CB    . ILE B 1 38  ? 15.915  -13.161 -22.630 1.00 33.42  ? 20  ILE B CB    1 
ATOM   2822 C  CG1   . ILE B 1 38  ? 16.277  -14.599 -22.239 1.00 31.61  ? 20  ILE B CG1   1 
ATOM   2823 C  CG2   . ILE B 1 38  ? 15.293  -13.087 -24.025 1.00 31.82  ? 20  ILE B CG2   1 
ATOM   2824 C  CD1   . ILE B 1 38  ? 17.187  -15.308 -23.216 1.00 28.98  ? 20  ILE B CD1   1 
ATOM   2825 N  N     . VAL B 1 39  ? 16.868  -10.057 -23.582 1.00 32.02  ? 21  VAL B N     1 
ATOM   2826 C  CA    . VAL B 1 39  ? 16.427  -8.668  -23.632 1.00 36.88  ? 21  VAL B CA    1 
ATOM   2827 C  C     . VAL B 1 39  ? 15.975  -8.270  -25.035 1.00 36.90  ? 21  VAL B C     1 
ATOM   2828 O  O     . VAL B 1 39  ? 16.514  -8.747  -26.035 1.00 35.34  ? 21  VAL B O     1 
ATOM   2829 C  CB    . VAL B 1 39  ? 17.530  -7.702  -23.118 1.00 43.05  ? 21  VAL B CB    1 
ATOM   2830 C  CG1   . VAL B 1 39  ? 18.686  -7.623  -24.101 1.00 27.33  ? 21  VAL B CG1   1 
ATOM   2831 C  CG2   . VAL B 1 39  ? 16.957  -6.316  -22.854 1.00 47.71  ? 21  VAL B CG2   1 
ATOM   2832 N  N     . ASP B 1 40  ? 14.958  -7.418  -25.101 1.00 41.96  ? 22  ASP B N     1 
ATOM   2833 C  CA    . ASP B 1 40  ? 14.565  -6.813  -26.364 1.00 47.03  ? 22  ASP B CA    1 
ATOM   2834 C  C     . ASP B 1 40  ? 15.551  -5.703  -26.685 1.00 43.86  ? 22  ASP B C     1 
ATOM   2835 O  O     . ASP B 1 40  ? 15.655  -4.728  -25.944 1.00 45.07  ? 22  ASP B O     1 
ATOM   2836 C  CB    . ASP B 1 40  ? 13.143  -6.264  -26.283 1.00 55.75  ? 22  ASP B CB    1 
ATOM   2837 C  CG    . ASP B 1 40  ? 12.101  -7.303  -26.639 1.00 61.49  ? 22  ASP B CG    1 
ATOM   2838 O  OD1   . ASP B 1 40  ? 11.544  -7.222  -27.756 1.00 66.32  ? 22  ASP B OD1   1 
ATOM   2839 O  OD2   . ASP B 1 40  ? 11.849  -8.206  -25.811 1.00 59.91  ? 22  ASP B OD2   1 
ATOM   2840 N  N     . ALA B 1 41  ? 16.282  -5.862  -27.783 1.00 42.07  ? 23  ALA B N     1 
ATOM   2841 C  CA    . ALA B 1 41  ? 17.361  -4.941  -28.116 1.00 44.25  ? 23  ALA B CA    1 
ATOM   2842 C  C     . ALA B 1 41  ? 16.954  -3.937  -29.179 1.00 49.57  ? 23  ALA B C     1 
ATOM   2843 O  O     . ALA B 1 41  ? 16.284  -4.288  -30.149 1.00 52.02  ? 23  ALA B O     1 
ATOM   2844 C  CB    . ALA B 1 41  ? 18.587  -5.710  -28.575 1.00 40.93  ? 23  ALA B CB    1 
ATOM   2845 N  N     . ASP B 1 42  ? 17.373  -2.687  -28.997 1.00 52.92  ? 24  ASP B N     1 
ATOM   2846 C  CA    . ASP B 1 42  ? 17.179  -1.664  -30.019 1.00 57.36  ? 24  ASP B CA    1 
ATOM   2847 C  C     . ASP B 1 42  ? 18.112  -1.927  -31.195 1.00 52.87  ? 24  ASP B C     1 
ATOM   2848 O  O     . ASP B 1 42  ? 19.127  -2.610  -31.059 1.00 50.56  ? 24  ASP B O     1 
ATOM   2849 C  CB    . ASP B 1 42  ? 17.427  -0.267  -29.450 1.00 63.37  ? 24  ASP B CB    1 
ATOM   2850 C  CG    . ASP B 1 42  ? 16.519  0.055   -28.280 1.00 68.33  ? 24  ASP B CG    1 
ATOM   2851 O  OD1   . ASP B 1 42  ? 15.437  0.639   -28.507 1.00 70.27  ? 24  ASP B OD1   1 
ATOM   2852 O  OD2   . ASP B 1 42  ? 16.889  -0.280  -27.134 1.00 69.11  ? 24  ASP B OD2   1 
ATOM   2853 N  N     . ASP B 1 43  ? 17.763  -1.376  -32.348 1.00 52.10  ? 25  ASP B N     1 
ATOM   2854 C  CA    . ASP B 1 43  ? 18.513  -1.623  -33.572 1.00 53.91  ? 25  ASP B CA    1 
ATOM   2855 C  C     . ASP B 1 43  ? 19.980  -1.192  -33.494 1.00 51.91  ? 25  ASP B C     1 
ATOM   2856 O  O     . ASP B 1 43  ? 20.838  -1.804  -34.134 1.00 50.41  ? 25  ASP B O     1 
ATOM   2857 C  CB    . ASP B 1 43  ? 17.818  -0.942  -34.751 1.00 60.53  ? 25  ASP B CB    1 
ATOM   2858 C  CG    . ASP B 1 43  ? 16.361  -1.345  -34.874 1.00 65.96  ? 25  ASP B CG    1 
ATOM   2859 O  OD1   . ASP B 1 43  ? 15.749  -1.060  -35.925 1.00 70.51  ? 25  ASP B OD1   1 
ATOM   2860 O  OD2   . ASP B 1 43  ? 15.827  -1.951  -33.919 1.00 66.09  ? 25  ASP B OD2   1 
ATOM   2861 N  N     . PHE B 1 44  ? 20.270  -0.154  -32.708 1.00 47.90  ? 26  PHE B N     1 
ATOM   2862 C  CA    . PHE B 1 44  ? 21.636  0.366   -32.627 1.00 44.67  ? 26  PHE B CA    1 
ATOM   2863 C  C     . PHE B 1 44  ? 22.619  -0.652  -32.048 1.00 40.62  ? 26  PHE B C     1 
ATOM   2864 O  O     . PHE B 1 44  ? 23.801  -0.641  -32.388 1.00 36.93  ? 26  PHE B O     1 
ATOM   2865 C  CB    . PHE B 1 44  ? 21.704  1.707   -31.867 1.00 46.25  ? 26  PHE B CB    1 
ATOM   2866 C  CG    . PHE B 1 44  ? 21.588  1.583   -30.365 1.00 45.21  ? 26  PHE B CG    1 
ATOM   2867 C  CD1   . PHE B 1 44  ? 22.685  1.227   -29.589 1.00 40.04  ? 26  PHE B CD1   1 
ATOM   2868 C  CD2   . PHE B 1 44  ? 20.390  1.857   -29.727 1.00 49.15  ? 26  PHE B CD2   1 
ATOM   2869 C  CE1   . PHE B 1 44  ? 22.580  1.119   -28.216 1.00 39.89  ? 26  PHE B CE1   1 
ATOM   2870 C  CE2   . PHE B 1 44  ? 20.280  1.754   -28.349 1.00 48.03  ? 26  PHE B CE2   1 
ATOM   2871 C  CZ    . PHE B 1 44  ? 21.376  1.386   -27.595 1.00 43.84  ? 26  PHE B CZ    1 
ATOM   2872 N  N     . MET B 1 45  ? 22.118  -1.525  -31.177 1.00 40.05  ? 27  MET B N     1 
ATOM   2873 C  CA    . MET B 1 45  ? 22.946  -2.523  -30.505 1.00 40.84  ? 27  MET B CA    1 
ATOM   2874 C  C     . MET B 1 45  ? 23.684  -3.439  -31.480 1.00 40.95  ? 27  MET B C     1 
ATOM   2875 O  O     . MET B 1 45  ? 24.822  -3.838  -31.231 1.00 37.27  ? 27  MET B O     1 
ATOM   2876 C  CB    . MET B 1 45  ? 22.089  -3.367  -29.558 1.00 41.05  ? 27  MET B CB    1 
ATOM   2877 C  CG    . MET B 1 45  ? 21.528  -2.597  -28.378 1.00 41.64  ? 27  MET B CG    1 
ATOM   2878 S  SD    . MET B 1 45  ? 22.770  -2.311  -27.105 1.00 45.73  ? 27  MET B SD    1 
ATOM   2879 C  CE    . MET B 1 45  ? 22.856  -3.938  -26.356 1.00 29.37  ? 27  MET B CE    1 
ATOM   2880 N  N     . TYR B 1 46  ? 23.035  -3.773  -32.589 1.00 43.16  ? 28  TYR B N     1 
ATOM   2881 C  CA    . TYR B 1 46  ? 23.622  -4.695  -33.557 1.00 42.89  ? 28  TYR B CA    1 
ATOM   2882 C  C     . TYR B 1 46  ? 24.774  -4.042  -34.316 1.00 44.71  ? 28  TYR B C     1 
ATOM   2883 O  O     . TYR B 1 46  ? 25.788  -4.683  -34.595 1.00 44.78  ? 28  TYR B O     1 
ATOM   2884 C  CB    . TYR B 1 46  ? 22.545  -5.244  -34.498 1.00 39.98  ? 28  TYR B CB    1 
ATOM   2885 C  CG    . TYR B 1 46  ? 21.485  -6.008  -33.742 1.00 39.65  ? 28  TYR B CG    1 
ATOM   2886 C  CD1   . TYR B 1 46  ? 21.617  -7.372  -33.508 1.00 38.11  ? 28  TYR B CD1   1 
ATOM   2887 C  CD2   . TYR B 1 46  ? 20.369  -5.360  -33.230 1.00 41.73  ? 28  TYR B CD2   1 
ATOM   2888 C  CE1   . TYR B 1 46  ? 20.659  -8.072  -32.800 1.00 39.16  ? 28  TYR B CE1   1 
ATOM   2889 C  CE2   . TYR B 1 46  ? 19.406  -6.050  -32.519 1.00 41.73  ? 28  TYR B CE2   1 
ATOM   2890 C  CZ    . TYR B 1 46  ? 19.556  -7.404  -32.309 1.00 42.43  ? 28  TYR B CZ    1 
ATOM   2891 O  OH    . TYR B 1 46  ? 18.597  -8.089  -31.601 1.00 45.11  ? 28  TYR B OH    1 
ATOM   2892 N  N     . ARG B 1 47  ? 24.618  -2.759  -34.621 1.00 45.14  ? 29  ARG B N     1 
ATOM   2893 C  CA    . ARG B 1 47  ? 25.667  -1.984  -35.273 1.00 46.10  ? 29  ARG B CA    1 
ATOM   2894 C  C     . ARG B 1 47  ? 26.823  -1.734  -34.304 1.00 42.88  ? 29  ARG B C     1 
ATOM   2895 O  O     . ARG B 1 47  ? 27.994  -1.911  -34.647 1.00 39.16  ? 29  ARG B O     1 
ATOM   2896 C  CB    . ARG B 1 47  ? 25.101  -0.650  -35.772 1.00 50.13  ? 29  ARG B CB    1 
ATOM   2897 C  CG    . ARG B 1 47  ? 23.641  -0.725  -36.218 1.00 54.84  ? 29  ARG B CG    1 
ATOM   2898 C  CD    . ARG B 1 47  ? 23.232  0.476   -37.075 1.00 59.10  ? 29  ARG B CD    1 
ATOM   2899 N  NE    . ARG B 1 47  ? 23.168  1.727   -36.322 1.00 61.63  ? 29  ARG B NE    1 
ATOM   2900 C  CZ    . ARG B 1 47  ? 22.046  2.263   -35.846 1.00 63.91  ? 29  ARG B CZ    1 
ATOM   2901 N  NH1   . ARG B 1 47  ? 20.882  1.657   -36.040 1.00 63.81  ? 29  ARG B NH1   1 
ATOM   2902 N  NH2   . ARG B 1 47  ? 22.089  3.409   -35.178 1.00 65.80  ? 29  ARG B NH2   1 
ATOM   2903 N  N     . LYS B 1 48  ? 26.475  -1.326  -33.088 1.00 36.02  ? 30  LYS B N     1 
ATOM   2904 C  CA    . LYS B 1 48  ? 27.455  -0.974  -32.070 1.00 37.98  ? 30  LYS B CA    1 
ATOM   2905 C  C     . LYS B 1 48  ? 28.385  -2.143  -31.734 1.00 35.21  ? 30  LYS B C     1 
ATOM   2906 O  O     . LYS B 1 48  ? 29.598  -1.971  -31.615 1.00 35.37  ? 30  LYS B O     1 
ATOM   2907 C  CB    . LYS B 1 48  ? 26.726  -0.481  -30.818 1.00 34.93  ? 30  LYS B CB    1 
ATOM   2908 C  CG    . LYS B 1 48  ? 27.615  -0.100  -29.652 1.00 38.54  ? 30  LYS B CG    1 
ATOM   2909 C  CD    . LYS B 1 48  ? 26.769  0.455   -28.510 1.00 34.48  ? 30  LYS B CD    1 
ATOM   2910 C  CE    . LYS B 1 48  ? 27.615  0.882   -27.323 1.00 37.22  ? 30  LYS B CE    1 
ATOM   2911 N  NZ    . LYS B 1 48  ? 26.761  1.381   -26.203 1.00 37.34  ? 30  LYS B NZ    1 
ATOM   2912 N  N     . TYR B 1 49  ? 27.819  -3.335  -31.592 1.00 34.08  ? 31  TYR B N     1 
ATOM   2913 C  CA    . TYR B 1 49  ? 28.617  -4.500  -31.222 1.00 30.75  ? 31  TYR B CA    1 
ATOM   2914 C  C     . TYR B 1 49  ? 28.925  -5.406  -32.404 1.00 33.32  ? 31  TYR B C     1 
ATOM   2915 O  O     . TYR B 1 49  ? 29.435  -6.514  -32.219 1.00 32.76  ? 31  TYR B O     1 
ATOM   2916 C  CB    . TYR B 1 49  ? 27.938  -5.282  -30.097 1.00 31.24  ? 31  TYR B CB    1 
ATOM   2917 C  CG    . TYR B 1 49  ? 27.890  -4.507  -28.803 1.00 35.70  ? 31  TYR B CG    1 
ATOM   2918 C  CD1   . TYR B 1 49  ? 26.737  -3.843  -28.409 1.00 29.47  ? 31  TYR B CD1   1 
ATOM   2919 C  CD2   . TYR B 1 49  ? 29.010  -4.419  -27.987 1.00 28.64  ? 31  TYR B CD2   1 
ATOM   2920 C  CE1   . TYR B 1 49  ? 26.696  -3.126  -27.229 1.00 30.30  ? 31  TYR B CE1   1 
ATOM   2921 C  CE2   . TYR B 1 49  ? 28.981  -3.706  -26.809 1.00 32.11  ? 31  TYR B CE2   1 
ATOM   2922 C  CZ    . TYR B 1 49  ? 27.822  -3.058  -26.435 1.00 31.05  ? 31  TYR B CZ    1 
ATOM   2923 O  OH    . TYR B 1 49  ? 27.792  -2.344  -25.260 1.00 30.30  ? 31  TYR B OH    1 
ATOM   2924 N  N     . ASN B 1 50  ? 28.618  -4.925  -33.609 1.00 35.28  ? 32  ASN B N     1 
ATOM   2925 C  CA    . ASN B 1 50  ? 28.911  -5.650  -34.842 1.00 42.13  ? 32  ASN B CA    1 
ATOM   2926 C  C     . ASN B 1 50  ? 28.393  -7.094  -34.791 1.00 43.88  ? 32  ASN B C     1 
ATOM   2927 O  O     . ASN B 1 50  ? 29.145  -8.048  -35.001 1.00 47.16  ? 32  ASN B O     1 
ATOM   2928 C  CB    . ASN B 1 50  ? 30.418  -5.620  -35.114 1.00 46.19  ? 32  ASN B CB    1 
ATOM   2929 C  CG    . ASN B 1 50  ? 30.768  -6.018  -36.535 1.00 50.69  ? 32  ASN B CG    1 
ATOM   2930 O  OD1   . ASN B 1 50  ? 29.963  -5.862  -37.456 1.00 51.16  ? 32  ASN B OD1   1 
ATOM   2931 N  ND2   . ASN B 1 50  ? 31.978  -6.535  -36.721 1.00 52.16  ? 32  ASN B ND2   1 
ATOM   2932 N  N     . LEU B 1 51  ? 27.107  -7.244  -34.488 1.00 41.35  ? 33  LEU B N     1 
ATOM   2933 C  CA    . LEU B 1 51  ? 26.510  -8.561  -34.303 1.00 40.67  ? 33  LEU B CA    1 
ATOM   2934 C  C     . LEU B 1 51  ? 25.658  -8.961  -35.498 1.00 47.05  ? 33  LEU B C     1 
ATOM   2935 O  O     . LEU B 1 51  ? 24.808  -8.193  -35.946 1.00 49.16  ? 33  LEU B O     1 
ATOM   2936 C  CB    . LEU B 1 51  ? 25.649  -8.578  -33.040 1.00 35.78  ? 33  LEU B CB    1 
ATOM   2937 C  CG    . LEU B 1 51  ? 26.377  -8.266  -31.734 1.00 34.16  ? 33  LEU B CG    1 
ATOM   2938 C  CD1   . LEU B 1 51  ? 25.396  -8.197  -30.575 1.00 33.64  ? 33  LEU B CD1   1 
ATOM   2939 C  CD2   . LEU B 1 51  ? 27.464  -9.299  -31.475 1.00 29.77  ? 33  LEU B CD2   1 
ATOM   2940 N  N     . LYS B 1 52  ? 25.883  -10.169 -36.004 1.00 51.81  ? 34  LYS B N     1 
ATOM   2941 C  CA    . LYS B 1 52  ? 25.114  -10.678 -37.134 1.00 57.94  ? 34  LYS B CA    1 
ATOM   2942 C  C     . LYS B 1 52  ? 23.745  -11.170 -36.691 1.00 60.58  ? 34  LYS B C     1 
ATOM   2943 O  O     . LYS B 1 52  ? 23.385  -11.066 -35.519 1.00 60.66  ? 34  LYS B O     1 
ATOM   2944 C  CB    . LYS B 1 52  ? 25.870  -11.804 -37.848 1.00 60.12  ? 34  LYS B CB    1 
ATOM   2945 C  CG    . LYS B 1 52  ? 26.936  -11.331 -38.827 1.00 64.31  ? 34  LYS B CG    1 
ATOM   2946 C  CD    . LYS B 1 52  ? 27.609  -12.513 -39.511 1.00 67.04  ? 34  LYS B CD    1 
ATOM   2947 C  CE    . LYS B 1 52  ? 26.583  -13.424 -40.173 1.00 70.09  ? 34  LYS B CE    1 
ATOM   2948 N  NZ    . LYS B 1 52  ? 27.188  -14.699 -40.658 1.00 71.41  ? 34  LYS B NZ    1 
ATOM   2949 N  N     . LYS B 1 53  ? 22.987  -11.711 -37.637 1.00 64.46  ? 35  LYS B N     1 
ATOM   2950 C  CA    . LYS B 1 53  ? 21.664  -12.244 -37.348 1.00 67.59  ? 35  LYS B CA    1 
ATOM   2951 C  C     . LYS B 1 53  ? 21.745  -13.698 -36.889 1.00 68.27  ? 35  LYS B C     1 
ATOM   2952 O  O     . LYS B 1 53  ? 22.438  -14.511 -37.503 1.00 70.17  ? 35  LYS B O     1 
ATOM   2953 C  CB    . LYS B 1 53  ? 20.770  -12.138 -38.585 1.00 70.82  ? 35  LYS B CB    1 
ATOM   2954 N  N     . ASP B 1 54  ? 21.043  -14.008 -35.802 1.00 66.54  ? 36  ASP B N     1 
ATOM   2955 C  CA    . ASP B 1 54  ? 20.892  -15.383 -35.328 1.00 66.95  ? 36  ASP B CA    1 
ATOM   2956 C  C     . ASP B 1 54  ? 22.232  -16.080 -35.086 1.00 63.76  ? 36  ASP B C     1 
ATOM   2957 O  O     . ASP B 1 54  ? 22.379  -17.272 -35.360 1.00 67.04  ? 36  ASP B O     1 
ATOM   2958 C  CB    . ASP B 1 54  ? 20.055  -16.189 -36.326 1.00 72.01  ? 36  ASP B CB    1 
ATOM   2959 C  CG    . ASP B 1 54  ? 19.129  -17.173 -35.648 1.00 75.84  ? 36  ASP B CG    1 
ATOM   2960 O  OD1   . ASP B 1 54  ? 18.980  -18.300 -36.165 1.00 78.66  ? 36  ASP B OD1   1 
ATOM   2961 O  OD2   . ASP B 1 54  ? 18.545  -16.817 -34.600 1.00 76.77  ? 36  ASP B OD2   1 
ATOM   2962 N  N     . ASN B 1 55  ? 23.199  -15.337 -34.560 1.00 56.20  ? 37  ASN B N     1 
ATOM   2963 C  CA    . ASN B 1 55  ? 24.573  -15.818 -34.462 1.00 45.66  ? 37  ASN B CA    1 
ATOM   2964 C  C     . ASN B 1 55  ? 25.045  -15.969 -33.016 1.00 38.54  ? 37  ASN B C     1 
ATOM   2965 O  O     . ASN B 1 55  ? 24.387  -15.506 -32.086 1.00 34.76  ? 37  ASN B O     1 
ATOM   2966 C  CB    . ASN B 1 55  ? 25.500  -14.863 -35.225 1.00 44.97  ? 37  ASN B CB    1 
ATOM   2967 C  CG    . ASN B 1 55  ? 26.859  -15.464 -35.509 1.00 42.94  ? 37  ASN B CG    1 
ATOM   2968 O  OD1   . ASN B 1 55  ? 27.002  -16.683 -35.608 1.00 43.73  ? 37  ASN B OD1   1 
ATOM   2969 N  ND2   . ASN B 1 55  ? 27.868  -14.609 -35.644 1.00 39.22  ? 37  ASN B ND2   1 
ATOM   2970 N  N     . ILE B 1 56  ? 26.182  -16.634 -32.833 1.00 38.08  ? 38  ILE B N     1 
ATOM   2971 C  CA    . ILE B 1 56  ? 26.809  -16.733 -31.520 1.00 34.83  ? 38  ILE B CA    1 
ATOM   2972 C  C     . ILE B 1 56  ? 28.285  -16.345 -31.607 1.00 33.92  ? 38  ILE B C     1 
ATOM   2973 O  O     . ILE B 1 56  ? 29.000  -16.755 -32.521 1.00 37.98  ? 38  ILE B O     1 
ATOM   2974 C  CB    . ILE B 1 56  ? 26.619  -18.138 -30.880 1.00 46.26  ? 38  ILE B CB    1 
ATOM   2975 C  CG1   . ILE B 1 56  ? 27.013  -18.123 -29.400 1.00 42.92  ? 38  ILE B CG1   1 
ATOM   2976 C  CG2   . ILE B 1 56  ? 27.382  -19.208 -31.655 1.00 50.52  ? 38  ILE B CG2   1 
ATOM   2977 C  CD1   . ILE B 1 56  ? 28.453  -18.505 -29.119 1.00 43.36  ? 38  ILE B CD1   1 
ATOM   2978 N  N     . VAL B 1 57  ? 28.727  -15.529 -30.656 1.00 28.57  ? 39  VAL B N     1 
ATOM   2979 C  CA    . VAL B 1 57  ? 30.090  -15.025 -30.637 1.00 28.29  ? 39  VAL B CA    1 
ATOM   2980 C  C     . VAL B 1 57  ? 30.625  -15.048 -29.208 1.00 27.71  ? 39  VAL B C     1 
ATOM   2981 O  O     . VAL B 1 57  ? 29.886  -14.780 -28.259 1.00 28.57  ? 39  VAL B O     1 
ATOM   2982 C  CB    . VAL B 1 57  ? 30.144  -13.573 -31.193 1.00 39.19  ? 39  VAL B CB    1 
ATOM   2983 C  CG1   . VAL B 1 57  ? 31.513  -12.952 -30.994 1.00 36.35  ? 39  VAL B CG1   1 
ATOM   2984 C  CG2   . VAL B 1 57  ? 29.760  -13.554 -32.665 1.00 42.26  ? 39  VAL B CG2   1 
ATOM   2985 N  N     . LEU B 1 58  ? 31.901  -15.389 -29.055 1.00 25.05  ? 40  LEU B N     1 
ATOM   2986 C  CA    . LEU B 1 58  ? 32.563  -15.285 -27.763 1.00 25.70  ? 40  LEU B CA    1 
ATOM   2987 C  C     . LEU B 1 58  ? 32.967  -13.833 -27.534 1.00 29.36  ? 40  LEU B C     1 
ATOM   2988 O  O     . LEU B 1 58  ? 33.571  -13.201 -28.406 1.00 29.07  ? 40  LEU B O     1 
ATOM   2989 C  CB    . LEU B 1 58  ? 33.788  -16.196 -27.703 1.00 26.59  ? 40  LEU B CB    1 
ATOM   2990 C  CG    . LEU B 1 58  ? 33.508  -17.703 -27.802 1.00 28.03  ? 40  LEU B CG    1 
ATOM   2991 C  CD1   . LEU B 1 58  ? 34.808  -18.490 -27.784 1.00 27.89  ? 40  LEU B CD1   1 
ATOM   2992 C  CD2   . LEU B 1 58  ? 32.590  -18.160 -26.675 1.00 24.99  ? 40  LEU B CD2   1 
ATOM   2993 N  N     . ALA B 1 59  ? 32.621  -13.311 -26.364 1.00 27.84  ? 41  ALA B N     1 
ATOM   2994 C  CA    . ALA B 1 59  ? 32.872  -11.915 -26.038 1.00 31.96  ? 41  ALA B CA    1 
ATOM   2995 C  C     . ALA B 1 59  ? 34.353  -11.551 -26.117 1.00 36.51  ? 41  ALA B C     1 
ATOM   2996 O  O     . ALA B 1 59  ? 35.191  -12.150 -25.444 1.00 38.69  ? 41  ALA B O     1 
ATOM   2997 C  CB    . ALA B 1 59  ? 32.308  -11.582 -24.656 1.00 29.53  ? 41  ALA B CB    1 
ATOM   2998 N  N     . GLU B 1 60  ? 34.668  -10.580 -26.966 1.00 37.43  ? 42  GLU B N     1 
ATOM   2999 C  CA    . GLU B 1 60  ? 35.999  -9.995  -26.994 1.00 40.56  ? 42  GLU B CA    1 
ATOM   3000 C  C     . GLU B 1 60  ? 35.938  -8.741  -26.131 1.00 37.82  ? 42  GLU B C     1 
ATOM   3001 O  O     . GLU B 1 60  ? 34.881  -8.411  -25.600 1.00 31.95  ? 42  GLU B O     1 
ATOM   3002 C  CB    . GLU B 1 60  ? 36.409  -9.641  -28.424 1.00 46.37  ? 42  GLU B CB    1 
ATOM   3003 C  CG    . GLU B 1 60  ? 36.288  -10.790 -29.420 1.00 52.61  ? 42  GLU B CG    1 
ATOM   3004 C  CD    . GLU B 1 60  ? 36.705  -10.392 -30.829 1.00 62.01  ? 42  GLU B CD    1 
ATOM   3005 O  OE1   . GLU B 1 60  ? 37.893  -10.060 -31.034 1.00 66.34  ? 42  GLU B OE1   1 
ATOM   3006 O  OE2   . GLU B 1 60  ? 35.842  -10.403 -31.734 1.00 64.21  ? 42  GLU B OE2   1 
ATOM   3007 N  N     . GLU B 1 61  ? 37.060  -8.043  -25.993 1.00 40.68  ? 43  GLU B N     1 
ATOM   3008 C  CA    . GLU B 1 61  ? 37.104  -6.848  -25.155 1.00 42.40  ? 43  GLU B CA    1 
ATOM   3009 C  C     . GLU B 1 61  ? 36.126  -5.767  -25.629 1.00 39.38  ? 43  GLU B C     1 
ATOM   3010 O  O     . GLU B 1 61  ? 35.487  -5.100  -24.820 1.00 36.66  ? 43  GLU B O     1 
ATOM   3011 C  CB    . GLU B 1 61  ? 38.526  -6.291  -25.077 1.00 47.39  ? 43  GLU B CB    1 
ATOM   3012 C  CG    . GLU B 1 61  ? 38.674  -5.132  -24.105 1.00 53.83  ? 43  GLU B CG    1 
ATOM   3013 C  CD    . GLU B 1 61  ? 38.221  -5.486  -22.698 1.00 59.18  ? 43  GLU B CD    1 
ATOM   3014 O  OE1   . GLU B 1 61  ? 38.408  -6.653  -22.282 1.00 61.29  ? 43  GLU B OE1   1 
ATOM   3015 O  OE2   . GLU B 1 61  ? 37.673  -4.597  -22.009 1.00 60.57  ? 43  GLU B OE2   1 
ATOM   3016 N  N     . LYS B 1 62  ? 35.993  -5.622  -26.942 1.00 38.04  ? 44  LYS B N     1 
ATOM   3017 C  CA    . LYS B 1 62  ? 35.090  -4.634  -27.517 1.00 38.55  ? 44  LYS B CA    1 
ATOM   3018 C  C     . LYS B 1 62  ? 33.622  -4.914  -27.172 1.00 35.27  ? 44  LYS B C     1 
ATOM   3019 O  O     . LYS B 1 62  ? 32.778  -4.026  -27.273 1.00 37.97  ? 44  LYS B O     1 
ATOM   3020 C  CB    . LYS B 1 62  ? 35.269  -4.582  -29.036 1.00 43.81  ? 44  LYS B CB    1 
ATOM   3021 C  CG    . LYS B 1 62  ? 34.554  -5.701  -29.778 1.00 48.99  ? 44  LYS B CG    1 
ATOM   3022 C  CD    . LYS B 1 62  ? 34.963  -5.776  -31.241 1.00 57.67  ? 44  LYS B CD    1 
ATOM   3023 C  CE    . LYS B 1 62  ? 36.298  -6.488  -31.409 1.00 63.14  ? 44  LYS B CE    1 
ATOM   3024 N  NZ    . LYS B 1 62  ? 36.631  -6.715  -32.845 1.00 66.74  ? 44  LYS B NZ    1 
ATOM   3025 N  N     . HIS B 1 63  ? 33.321  -6.143  -26.764 1.00 31.81  ? 45  HIS B N     1 
ATOM   3026 C  CA    . HIS B 1 63  ? 31.946  -6.538  -26.460 1.00 30.62  ? 45  HIS B CA    1 
ATOM   3027 C  C     . HIS B 1 63  ? 31.562  -6.348  -24.997 1.00 28.19  ? 45  HIS B C     1 
ATOM   3028 O  O     . HIS B 1 63  ? 30.378  -6.334  -24.670 1.00 25.77  ? 45  HIS B O     1 
ATOM   3029 C  CB    . HIS B 1 63  ? 31.706  -8.009  -26.825 1.00 30.77  ? 45  HIS B CB    1 
ATOM   3030 C  CG    . HIS B 1 63  ? 31.819  -8.300  -28.287 1.00 31.55  ? 45  HIS B CG    1 
ATOM   3031 N  ND1   . HIS B 1 63  ? 32.815  -9.096  -28.811 1.00 30.36  ? 45  HIS B ND1   1 
ATOM   3032 C  CD2   . HIS B 1 63  ? 31.059  -7.906  -29.337 1.00 32.84  ? 45  HIS B CD2   1 
ATOM   3033 C  CE1   . HIS B 1 63  ? 32.664  -9.179  -30.121 1.00 34.13  ? 45  HIS B CE1   1 
ATOM   3034 N  NE2   . HIS B 1 63  ? 31.605  -8.467  -30.465 1.00 34.64  ? 45  HIS B NE2   1 
ATOM   3035 N  N     . MET B 1 64  ? 32.560  -6.211  -24.127 1.00 28.64  ? 46  MET B N     1 
ATOM   3036 C  CA    . MET B 1 64  ? 32.347  -6.311  -22.679 1.00 28.76  ? 46  MET B CA    1 
ATOM   3037 C  C     . MET B 1 64  ? 31.326  -5.344  -22.088 1.00 30.74  ? 46  MET B C     1 
ATOM   3038 O  O     . MET B 1 64  ? 30.674  -5.669  -21.098 1.00 32.93  ? 46  MET B O     1 
ATOM   3039 C  CB    . MET B 1 64  ? 33.673  -6.210  -21.923 1.00 30.25  ? 46  MET B CB    1 
ATOM   3040 C  CG    . MET B 1 64  ? 34.600  -7.387  -22.178 1.00 32.12  ? 46  MET B CG    1 
ATOM   3041 S  SD    . MET B 1 64  ? 33.798  -8.969  -21.842 1.00 35.83  ? 46  MET B SD    1 
ATOM   3042 C  CE    . MET B 1 64  ? 35.065  -10.115 -22.385 1.00 79.66  ? 46  MET B CE    1 
ATOM   3043 N  N     . THR B 1 65  ? 31.183  -4.166  -22.690 1.00 31.59  ? 47  THR B N     1 
ATOM   3044 C  CA    . THR B 1 65  ? 30.241  -3.171  -22.182 1.00 30.98  ? 47  THR B CA    1 
ATOM   3045 C  C     . THR B 1 65  ? 28.787  -3.603  -22.352 1.00 29.73  ? 47  THR B C     1 
ATOM   3046 O  O     . THR B 1 65  ? 27.899  -3.031  -21.726 1.00 31.33  ? 47  THR B O     1 
ATOM   3047 C  CB    . THR B 1 65  ? 30.424  -1.786  -22.853 1.00 33.07  ? 47  THR B CB    1 
ATOM   3048 O  OG1   . THR B 1 65  ? 30.305  -1.917  -24.274 1.00 30.18  ? 47  THR B OG1   1 
ATOM   3049 C  CG2   . THR B 1 65  ? 31.781  -1.185  -22.512 1.00 31.26  ? 47  THR B CG2   1 
ATOM   3050 N  N     . ILE B 1 66  ? 28.545  -4.608  -23.195 1.00 27.64  ? 48  ILE B N     1 
ATOM   3051 C  CA    . ILE B 1 66  ? 27.181  -5.064  -23.474 1.00 27.55  ? 48  ILE B CA    1 
ATOM   3052 C  C     . ILE B 1 66  ? 26.446  -5.537  -22.219 1.00 29.27  ? 48  ILE B C     1 
ATOM   3053 O  O     . ILE B 1 66  ? 25.236  -5.346  -22.094 1.00 31.63  ? 48  ILE B O     1 
ATOM   3054 C  CB    . ILE B 1 66  ? 27.132  -6.182  -24.567 1.00 29.55  ? 48  ILE B CB    1 
ATOM   3055 C  CG1   . ILE B 1 66  ? 25.743  -6.252  -25.202 1.00 28.97  ? 48  ILE B CG1   1 
ATOM   3056 C  CG2   . ILE B 1 66  ? 27.527  -7.549  -24.002 1.00 24.12  ? 48  ILE B CG2   1 
ATOM   3057 C  CD1   . ILE B 1 66  ? 25.629  -7.282  -26.293 1.00 27.90  ? 48  ILE B CD1   1 
ATOM   3058 N  N     . TYR B 1 67  ? 27.182  -6.131  -21.284 1.00 28.02  ? 49  TYR B N     1 
ATOM   3059 C  CA    . TYR B 1 67  ? 26.564  -6.747  -20.119 1.00 28.83  ? 49  TYR B CA    1 
ATOM   3060 C  C     . TYR B 1 67  ? 25.983  -5.707  -19.168 1.00 32.26  ? 49  TYR B C     1 
ATOM   3061 O  O     . TYR B 1 67  ? 24.815  -5.801  -18.788 1.00 35.50  ? 49  TYR B O     1 
ATOM   3062 C  CB    . TYR B 1 67  ? 27.536  -7.727  -19.439 1.00 27.55  ? 49  TYR B CB    1 
ATOM   3063 C  CG    . TYR B 1 67  ? 27.920  -8.852  -20.384 1.00 26.35  ? 49  TYR B CG    1 
ATOM   3064 C  CD1   . TYR B 1 67  ? 27.022  -9.871  -20.678 1.00 24.12  ? 49  TYR B CD1   1 
ATOM   3065 C  CD2   . TYR B 1 67  ? 29.155  -8.868  -21.018 1.00 25.92  ? 49  TYR B CD2   1 
ATOM   3066 C  CE1   . TYR B 1 67  ? 27.349  -10.888 -21.555 1.00 21.39  ? 49  TYR B CE1   1 
ATOM   3067 C  CE2   . TYR B 1 67  ? 29.494  -9.878  -21.897 1.00 23.98  ? 49  TYR B CE2   1 
ATOM   3068 C  CZ    . TYR B 1 67  ? 28.588  -10.888 -22.165 1.00 24.88  ? 49  TYR B CZ    1 
ATOM   3069 O  OH    . TYR B 1 67  ? 28.920  -11.895 -23.053 1.00 22.69  ? 49  TYR B OH    1 
ATOM   3070 N  N     . ASP B 1 68  ? 26.773  -4.699  -18.815 1.00 33.43  ? 50  ASP B N     1 
ATOM   3071 C  CA    . ASP B 1 68  ? 26.257  -3.594  -18.010 1.00 37.90  ? 50  ASP B CA    1 
ATOM   3072 C  C     . ASP B 1 68  ? 25.141  -2.849  -18.732 1.00 36.81  ? 50  ASP B C     1 
ATOM   3073 O  O     . ASP B 1 68  ? 24.199  -2.364  -18.103 1.00 38.52  ? 50  ASP B O     1 
ATOM   3074 C  CB    . ASP B 1 68  ? 27.369  -2.610  -17.641 1.00 43.51  ? 50  ASP B CB    1 
ATOM   3075 C  CG    . ASP B 1 68  ? 28.255  -3.123  -16.527 1.00 49.64  ? 50  ASP B CG    1 
ATOM   3076 O  OD1   . ASP B 1 68  ? 27.823  -4.034  -15.788 1.00 49.80  ? 50  ASP B OD1   1 
ATOM   3077 O  OD2   . ASP B 1 68  ? 29.383  -2.608  -16.387 1.00 54.62  ? 50  ASP B OD2   1 
ATOM   3078 N  N     . GLU B 1 69  ? 25.248  -2.763  -20.054 1.00 35.46  ? 51  GLU B N     1 
ATOM   3079 C  CA    . GLU B 1 69  ? 24.292  -1.994  -20.845 1.00 36.52  ? 51  GLU B CA    1 
ATOM   3080 C  C     . GLU B 1 69  ? 22.893  -2.602  -20.784 1.00 36.98  ? 51  GLU B C     1 
ATOM   3081 O  O     . GLU B 1 69  ? 21.911  -1.886  -20.600 1.00 39.29  ? 51  GLU B O     1 
ATOM   3082 C  CB    . GLU B 1 69  ? 24.761  -1.870  -22.300 1.00 37.29  ? 51  GLU B CB    1 
ATOM   3083 C  CG    . GLU B 1 69  ? 24.121  -0.714  -23.067 1.00 41.88  ? 51  GLU B CG    1 
ATOM   3084 C  CD    . GLU B 1 69  ? 24.729  -0.507  -24.447 1.00 42.72  ? 51  GLU B CD    1 
ATOM   3085 O  OE1   . GLU B 1 69  ? 25.505  -1.372  -24.904 1.00 45.08  ? 51  GLU B OE1   1 
ATOM   3086 O  OE2   . GLU B 1 69  ? 24.431  0.522   -25.079 1.00 43.37  ? 51  GLU B OE2   1 
ATOM   3087 N  N     . ILE B 1 70  ? 22.800  -3.921  -20.926 1.00 33.38  ? 52  ILE B N     1 
ATOM   3088 C  CA    . ILE B 1 70  ? 21.490  -4.564  -20.944 1.00 35.24  ? 52  ILE B CA    1 
ATOM   3089 C  C     . ILE B 1 70  ? 20.878  -4.699  -19.550 1.00 38.60  ? 52  ILE B C     1 
ATOM   3090 O  O     . ILE B 1 70  ? 19.657  -4.724  -19.412 1.00 38.10  ? 52  ILE B O     1 
ATOM   3091 C  CB    . ILE B 1 70  ? 21.515  -5.940  -21.658 1.00 35.46  ? 52  ILE B CB    1 
ATOM   3092 C  CG1   . ILE B 1 70  ? 22.280  -6.977  -20.826 1.00 33.08  ? 52  ILE B CG1   1 
ATOM   3093 C  CG2   . ILE B 1 70  ? 22.095  -5.801  -23.065 1.00 35.00  ? 52  ILE B CG2   1 
ATOM   3094 C  CD1   . ILE B 1 70  ? 22.413  -8.316  -21.502 1.00 30.69  ? 52  ILE B CD1   1 
ATOM   3095 N  N     . GLN B 1 71  ? 21.721  -4.769  -18.521 1.00 43.93  ? 53  GLN B N     1 
ATOM   3096 C  CA    . GLN B 1 71  ? 21.236  -4.963  -17.153 1.00 50.91  ? 53  GLN B CA    1 
ATOM   3097 C  C     . GLN B 1 71  ? 20.455  -3.771  -16.612 1.00 56.21  ? 53  GLN B C     1 
ATOM   3098 O  O     . GLN B 1 71  ? 19.663  -3.914  -15.682 1.00 58.33  ? 53  GLN B O     1 
ATOM   3099 C  CB    . GLN B 1 71  ? 22.383  -5.304  -16.197 1.00 53.45  ? 53  GLN B CB    1 
ATOM   3100 C  CG    . GLN B 1 71  ? 22.856  -6.750  -16.267 1.00 56.96  ? 53  GLN B CG    1 
ATOM   3101 C  CD    . GLN B 1 71  ? 21.849  -7.750  -15.705 1.00 60.04  ? 53  GLN B CD    1 
ATOM   3102 O  OE1   . GLN B 1 71  ? 20.796  -7.374  -15.184 1.00 62.41  ? 53  GLN B OE1   1 
ATOM   3103 N  NE2   . GLN B 1 71  ? 22.178  -9.033  -15.805 1.00 59.56  ? 53  GLN B NE2   1 
ATOM   3104 N  N     . LYS B 1 72  ? 20.677  -2.598  -17.192 1.00 58.76  ? 54  LYS B N     1 
ATOM   3105 C  CA    . LYS B 1 72  ? 19.979  -1.400  -16.745 1.00 63.89  ? 54  LYS B CA    1 
ATOM   3106 C  C     . LYS B 1 72  ? 18.630  -1.291  -17.444 1.00 66.60  ? 54  LYS B C     1 
ATOM   3107 O  O     . LYS B 1 72  ? 17.924  -0.291  -17.305 1.00 70.99  ? 54  LYS B O     1 
ATOM   3108 C  CB    . LYS B 1 72  ? 20.821  -0.145  -17.003 1.00 62.77  ? 54  LYS B CB    1 
ATOM   3109 C  CG    . LYS B 1 72  ? 20.979  0.208   -18.474 1.00 62.65  ? 54  LYS B CG    1 
ATOM   3110 C  CD    . LYS B 1 72  ? 21.983  1.333   -18.689 1.00 63.94  ? 54  LYS B CD    1 
ATOM   3111 C  CE    . LYS B 1 72  ? 22.142  1.647   -20.173 1.00 64.57  ? 54  LYS B CE    1 
ATOM   3112 N  NZ    . LYS B 1 72  ? 23.155  2.710   -20.438 1.00 65.02  ? 54  LYS B NZ    1 
ATOM   3113 N  N     . LYS B 1 73  ? 18.273  -2.329  -18.193 1.00 61.97  ? 55  LYS B N     1 
ATOM   3114 C  CA    . LYS B 1 73  ? 17.044  -2.307  -18.972 1.00 61.62  ? 55  LYS B CA    1 
ATOM   3115 C  C     . LYS B 1 73  ? 15.890  -2.978  -18.227 1.00 61.40  ? 55  LYS B C     1 
ATOM   3116 O  O     . LYS B 1 73  ? 16.101  -3.783  -17.321 1.00 60.64  ? 55  LYS B O     1 
ATOM   3117 C  CB    . LYS B 1 73  ? 17.268  -2.954  -20.341 1.00 59.40  ? 55  LYS B CB    1 
ATOM   3118 C  CG    . LYS B 1 73  ? 16.229  -2.584  -21.374 1.00 62.37  ? 55  LYS B CG    1 
ATOM   3119 C  CD    . LYS B 1 73  ? 16.769  -2.737  -22.777 1.00 64.12  ? 55  LYS B CD    1 
ATOM   3120 C  CE    . LYS B 1 73  ? 15.729  -2.319  -23.799 1.00 68.79  ? 55  LYS B CE    1 
ATOM   3121 N  NZ    . LYS B 1 73  ? 16.229  -2.474  -25.191 1.00 69.81  ? 55  LYS B NZ    1 
ATOM   3122 N  N     . LYS B 1 74  ? 14.670  -2.625  -18.614 1.00 62.83  ? 56  LYS B N     1 
ATOM   3123 C  CA    . LYS B 1 74  ? 13.466  -3.126  -17.972 1.00 64.42  ? 56  LYS B CA    1 
ATOM   3124 C  C     . LYS B 1 74  ? 13.037  -4.461  -18.563 1.00 61.25  ? 56  LYS B C     1 
ATOM   3125 O  O     . LYS B 1 74  ? 13.414  -4.804  -19.683 1.00 59.46  ? 56  LYS B O     1 
ATOM   3126 C  CB    . LYS B 1 74  ? 12.338  -2.110  -18.140 1.00 70.77  ? 56  LYS B CB    1 
ATOM   3127 C  CG    . LYS B 1 74  ? 12.149  -1.659  -19.583 1.00 75.36  ? 56  LYS B CG    1 
ATOM   3128 C  CD    . LYS B 1 74  ? 11.089  -0.571  -19.707 1.00 80.30  ? 56  LYS B CD    1 
ATOM   3129 C  CE    . LYS B 1 74  ? 11.012  -0.041  -21.132 1.00 82.30  ? 56  LYS B CE    1 
ATOM   3130 N  NZ    . LYS B 1 74  ? 12.315  0.528   -21.588 1.00 82.06  ? 56  LYS B NZ    1 
ATOM   3131 N  N     . LYS B 1 75  ? 12.245  -5.204  -17.796 1.00 61.46  ? 57  LYS B N     1 
ATOM   3132 C  CA    . LYS B 1 75  ? 11.671  -6.473  -18.238 1.00 60.62  ? 57  LYS B CA    1 
ATOM   3133 C  C     . LYS B 1 75  ? 12.689  -7.460  -18.814 1.00 56.20  ? 57  LYS B C     1 
ATOM   3134 O  O     . LYS B 1 75  ? 12.439  -8.099  -19.837 1.00 57.99  ? 57  LYS B O     1 
ATOM   3135 C  CB    . LYS B 1 75  ? 10.522  -6.239  -19.229 1.00 65.48  ? 57  LYS B CB    1 
ATOM   3136 C  CG    . LYS B 1 75  ? 9.338   -5.480  -18.635 1.00 70.04  ? 57  LYS B CG    1 
ATOM   3137 C  CD    . LYS B 1 75  ? 8.035   -5.787  -19.370 1.00 71.98  ? 57  LYS B CD    1 
ATOM   3138 C  CE    . LYS B 1 75  ? 8.046   -5.253  -20.794 1.00 72.20  ? 57  LYS B CE    1 
ATOM   3139 N  NZ    . LYS B 1 75  ? 8.178   -3.772  -20.832 1.00 73.26  ? 57  LYS B NZ    1 
ATOM   3140 N  N     . LEU B 1 76  ? 13.837  -7.574  -18.155 1.00 49.03  ? 58  LEU B N     1 
ATOM   3141 C  CA    . LEU B 1 76  ? 14.794  -8.622  -18.476 1.00 44.51  ? 58  LEU B CA    1 
ATOM   3142 C  C     . LEU B 1 76  ? 14.198  -9.982  -18.127 1.00 43.92  ? 58  LEU B C     1 
ATOM   3143 O  O     . LEU B 1 76  ? 13.327  -10.083 -17.261 1.00 44.27  ? 58  LEU B O     1 
ATOM   3144 C  CB    . LEU B 1 76  ? 16.092  -8.429  -17.688 1.00 38.97  ? 58  LEU B CB    1 
ATOM   3145 C  CG    . LEU B 1 76  ? 17.040  -7.323  -18.140 1.00 38.86  ? 58  LEU B CG    1 
ATOM   3146 C  CD1   . LEU B 1 76  ? 18.132  -7.106  -17.107 1.00 37.16  ? 58  LEU B CD1   1 
ATOM   3147 C  CD2   . LEU B 1 76  ? 17.647  -7.672  -19.483 1.00 37.99  ? 58  LEU B CD2   1 
ATOM   3148 N  N     . ASN B 1 77  ? 14.665  -11.027 -18.805 1.00 39.89  ? 59  ASN B N     1 
ATOM   3149 C  CA    . ASN B 1 77  ? 14.346  -12.389 -18.402 1.00 37.57  ? 59  ASN B CA    1 
ATOM   3150 C  C     . ASN B 1 77  ? 15.631  -13.186 -18.219 1.00 34.39  ? 59  ASN B C     1 
ATOM   3151 O  O     . ASN B 1 77  ? 16.618  -12.954 -18.917 1.00 34.49  ? 59  ASN B O     1 
ATOM   3152 C  CB    . ASN B 1 77  ? 13.424  -13.070 -19.412 1.00 40.49  ? 59  ASN B CB    1 
ATOM   3153 C  CG    . ASN B 1 77  ? 12.817  -14.356 -18.872 1.00 45.54  ? 59  ASN B CG    1 
ATOM   3154 O  OD1   . ASN B 1 77  ? 12.737  -14.558 -17.659 1.00 48.03  ? 59  ASN B OD1   1 
ATOM   3155 N  ND2   . ASN B 1 77  ? 12.387  -15.231 -19.772 1.00 46.09  ? 59  ASN B ND2   1 
ATOM   3156 N  N     . TYR B 1 78  ? 15.622  -14.116 -17.273 1.00 33.96  ? 60  TYR B N     1 
ATOM   3157 C  CA    . TYR B 1 78  ? 16.809  -14.904 -16.974 1.00 32.01  ? 60  TYR B CA    1 
ATOM   3158 C  C     . TYR B 1 78  ? 16.510  -16.390 -17.116 1.00 32.70  ? 60  TYR B C     1 
ATOM   3159 O  O     . TYR B 1 78  ? 15.647  -16.921 -16.422 1.00 35.85  ? 60  TYR B O     1 
ATOM   3160 C  CB    . TYR B 1 78  ? 17.292  -14.615 -15.551 1.00 30.08  ? 60  TYR B CB    1 
ATOM   3161 C  CG    . TYR B 1 78  ? 17.538  -13.149 -15.253 1.00 30.80  ? 60  TYR B CG    1 
ATOM   3162 C  CD1   . TYR B 1 78  ? 18.764  -12.558 -15.539 1.00 31.48  ? 60  TYR B CD1   1 
ATOM   3163 C  CD2   . TYR B 1 78  ? 16.551  -12.363 -14.672 1.00 29.29  ? 60  TYR B CD2   1 
ATOM   3164 C  CE1   . TYR B 1 78  ? 18.995  -11.221 -15.264 1.00 35.12  ? 60  TYR B CE1   1 
ATOM   3165 C  CE2   . TYR B 1 78  ? 16.773  -11.028 -14.392 1.00 35.07  ? 60  TYR B CE2   1 
ATOM   3166 C  CZ    . TYR B 1 78  ? 17.998  -10.461 -14.690 1.00 38.67  ? 60  TYR B CZ    1 
ATOM   3167 O  OH    . TYR B 1 78  ? 18.227  -9.130  -14.417 1.00 43.99  ? 60  TYR B OH    1 
ATOM   3168 N  N     . ILE B 1 79  ? 17.222  -17.061 -18.014 1.00 30.87  ? 61  ILE B N     1 
ATOM   3169 C  CA    . ILE B 1 79  ? 17.020  -18.492 -18.217 1.00 29.67  ? 61  ILE B CA    1 
ATOM   3170 C  C     . ILE B 1 79  ? 18.332  -19.249 -18.039 1.00 26.70  ? 61  ILE B C     1 
ATOM   3171 O  O     . ILE B 1 79  ? 19.378  -18.809 -18.519 1.00 26.66  ? 61  ILE B O     1 
ATOM   3172 C  CB    . ILE B 1 79  ? 16.459  -18.798 -19.622 1.00 31.42  ? 61  ILE B CB    1 
ATOM   3173 C  CG1   . ILE B 1 79  ? 15.259  -17.905 -19.942 1.00 36.66  ? 61  ILE B CG1   1 
ATOM   3174 C  CG2   . ILE B 1 79  ? 16.050  -20.257 -19.723 1.00 29.10  ? 61  ILE B CG2   1 
ATOM   3175 C  CD1   . ILE B 1 79  ? 13.995  -18.303 -19.214 1.00 39.31  ? 61  ILE B CD1   1 
ATOM   3176 N  N     . ALA B 1 80  ? 18.280  -20.374 -17.332 1.00 24.62  ? 62  ALA B N     1 
ATOM   3177 C  CA    . ALA B 1 80  ? 19.423  -21.278 -17.262 1.00 25.64  ? 62  ALA B CA    1 
ATOM   3178 C  C     . ALA B 1 80  ? 19.677  -21.840 -18.657 1.00 29.03  ? 62  ALA B C     1 
ATOM   3179 O  O     . ALA B 1 80  ? 18.758  -22.328 -19.309 1.00 32.32  ? 62  ALA B O     1 
ATOM   3180 C  CB    . ALA B 1 80  ? 19.155  -22.401 -16.279 1.00 24.13  ? 62  ALA B CB    1 
ATOM   3181 N  N     . GLY B 1 81  ? 20.922  -21.760 -19.115 1.00 28.67  ? 63  GLY B N     1 
ATOM   3182 C  CA    . GLY B 1 81  ? 21.254  -22.141 -20.476 1.00 27.43  ? 63  GLY B CA    1 
ATOM   3183 C  C     . GLY B 1 81  ? 22.532  -22.951 -20.579 1.00 26.73  ? 63  GLY B C     1 
ATOM   3184 O  O     . GLY B 1 81  ? 22.907  -23.664 -19.651 1.00 27.11  ? 63  GLY B O     1 
ATOM   3185 N  N     . GLY B 1 82  ? 23.214  -22.826 -21.711 1.00 26.35  ? 64  GLY B N     1 
ATOM   3186 C  CA    . GLY B 1 82  ? 24.336  -23.694 -22.013 1.00 15.78  ? 64  GLY B CA    1 
ATOM   3187 C  C     . GLY B 1 82  ? 23.863  -24.815 -22.925 1.00 12.32  ? 64  GLY B C     1 
ATOM   3188 O  O     . GLY B 1 82  ? 22.861  -25.470 -22.637 1.00 16.68  ? 64  GLY B O     1 
ATOM   3189 N  N     . ALA B 1 83  ? 24.572  -25.025 -24.027 1.00 18.75  ? 65  ALA B N     1 
ATOM   3190 C  CA    . ALA B 1 83  ? 24.106  -25.944 -25.061 1.00 19.14  ? 65  ALA B CA    1 
ATOM   3191 C  C     . ALA B 1 83  ? 23.925  -27.371 -24.541 1.00 16.65  ? 65  ALA B C     1 
ATOM   3192 O  O     . ALA B 1 83  ? 22.852  -27.955 -24.687 1.00 17.35  ? 65  ALA B O     1 
ATOM   3193 C  CB    . ALA B 1 83  ? 25.040  -25.916 -26.271 1.00 17.32  ? 65  ALA B CB    1 
ATOM   3194 N  N     . THR B 1 84  ? 24.964  -27.915 -23.916 1.00 16.08  ? 66  THR B N     1 
ATOM   3195 C  CA    . THR B 1 84  ? 24.915  -29.284 -23.404 1.00 15.19  ? 66  THR B CA    1 
ATOM   3196 C  C     . THR B 1 84  ? 23.857  -29.437 -22.321 1.00 16.35  ? 66  THR B C     1 
ATOM   3197 O  O     . THR B 1 84  ? 23.120  -30.424 -22.295 1.00 17.15  ? 66  THR B O     1 
ATOM   3198 C  CB    . THR B 1 84  ? 26.271  -29.720 -22.837 1.00 16.50  ? 66  THR B CB    1 
ATOM   3199 O  OG1   . THR B 1 84  ? 27.265  -29.628 -23.864 1.00 15.41  ? 66  THR B OG1   1 
ATOM   3200 C  CG2   . THR B 1 84  ? 26.204  -31.162 -22.326 1.00 16.45  ? 66  THR B CG2   1 
ATOM   3201 N  N     . LEU B 1 85  ? 23.781  -28.454 -21.431 1.00 16.61  ? 67  LEU B N     1 
ATOM   3202 C  CA    . LEU B 1 85  ? 22.803  -28.498 -20.352 1.00 17.04  ? 67  LEU B CA    1 
ATOM   3203 C  C     . LEU B 1 85  ? 21.385  -28.493 -20.907 1.00 19.49  ? 67  LEU B C     1 
ATOM   3204 O  O     . LEU B 1 85  ? 20.529  -29.230 -20.416 1.00 17.83  ? 67  LEU B O     1 
ATOM   3205 C  CB    . LEU B 1 85  ? 23.006  -27.335 -19.380 1.00 17.02  ? 67  LEU B CB    1 
ATOM   3206 C  CG    . LEU B 1 85  ? 22.068  -27.284 -18.172 1.00 19.49  ? 67  LEU B CG    1 
ATOM   3207 C  CD1   . LEU B 1 85  ? 22.079  -28.603 -17.407 1.00 16.10  ? 67  LEU B CD1   1 
ATOM   3208 C  CD2   . LEU B 1 85  ? 22.444  -26.124 -17.246 1.00 20.36  ? 67  LEU B CD2   1 
ATOM   3209 N  N     . ASN B 1 86  ? 21.144  -27.666 -21.929 1.00 14.24  ? 68  ASN B N     1 
ATOM   3210 C  CA    . ASN B 1 86  ? 19.833  -27.600 -22.572 1.00 17.16  ? 68  ASN B CA    1 
ATOM   3211 C  C     . ASN B 1 86  ? 19.397  -28.969 -23.082 1.00 17.69  ? 68  ASN B C     1 
ATOM   3212 O  O     . ASN B 1 86  ? 18.278  -29.418 -22.822 1.00 16.87  ? 68  ASN B O     1 
ATOM   3213 C  CB    . ASN B 1 86  ? 19.839  -26.618 -23.748 1.00 16.92  ? 68  ASN B CB    1 
ATOM   3214 C  CG    . ASN B 1 86  ? 19.867  -25.159 -23.310 1.00 21.53  ? 68  ASN B CG    1 
ATOM   3215 O  OD1   . ASN B 1 86  ? 19.600  -24.829 -22.151 1.00 25.44  ? 68  ASN B OD1   1 
ATOM   3216 N  ND2   . ASN B 1 86  ? 20.178  -24.275 -24.250 1.00 17.93  ? 68  ASN B ND2   1 
ATOM   3217 N  N     . THR B 1 87  ? 20.299  -29.623 -23.811 1.00 15.74  ? 69  THR B N     1 
ATOM   3218 C  CA    . THR B 1 87  ? 20.026  -30.930 -24.390 1.00 16.32  ? 69  THR B CA    1 
ATOM   3219 C  C     . THR B 1 87  ? 19.791  -31.983 -23.308 1.00 17.71  ? 69  THR B C     1 
ATOM   3220 O  O     . THR B 1 87  ? 18.776  -32.688 -23.316 1.00 18.86  ? 69  THR B O     1 
ATOM   3221 C  CB    . THR B 1 87  ? 21.185  -31.385 -25.290 1.00 15.99  ? 69  THR B CB    1 
ATOM   3222 O  OG1   . THR B 1 87  ? 21.288  -30.511 -26.423 1.00 18.85  ? 69  THR B OG1   1 
ATOM   3223 C  CG2   . THR B 1 87  ? 20.963  -32.814 -25.767 1.00 13.34  ? 69  THR B CG2   1 
ATOM   3224 N  N     . VAL B 1 88  ? 20.728  -32.078 -22.374 1.00 13.85  ? 70  VAL B N     1 
ATOM   3225 C  CA    . VAL B 1 88  ? 20.639  -33.079 -21.318 1.00 19.48  ? 70  VAL B CA    1 
ATOM   3226 C  C     . VAL B 1 88  ? 19.400  -32.876 -20.445 1.00 18.90  ? 70  VAL B C     1 
ATOM   3227 O  O     . VAL B 1 88  ? 18.697  -33.832 -20.132 1.00 16.70  ? 70  VAL B O     1 
ATOM   3228 C  CB    . VAL B 1 88  ? 21.915  -33.097 -20.461 1.00 19.28  ? 70  VAL B CB    1 
ATOM   3229 C  CG1   . VAL B 1 88  ? 21.733  -33.988 -19.250 1.00 22.27  ? 70  VAL B CG1   1 
ATOM   3230 C  CG2   . VAL B 1 88  ? 23.093  -33.564 -21.305 1.00 18.47  ? 70  VAL B CG2   1 
ATOM   3231 N  N     . LYS B 1 89  ? 19.101  -31.631 -20.084 1.00 18.16  ? 71  LYS B N     1 
ATOM   3232 C  CA    . LYS B 1 89  ? 17.931  -31.397 -19.245 1.00 21.01  ? 71  LYS B CA    1 
ATOM   3233 C  C     . LYS B 1 89  ? 16.627  -31.700 -19.989 1.00 19.29  ? 71  LYS B C     1 
ATOM   3234 O  O     . LYS B 1 89  ? 15.655  -32.150 -19.383 1.00 18.50  ? 71  LYS B O     1 
ATOM   3235 C  CB    . LYS B 1 89  ? 17.938  -29.997 -18.608 1.00 22.54  ? 71  LYS B CB    1 
ATOM   3236 C  CG    . LYS B 1 89  ? 17.534  -28.831 -19.501 1.00 24.60  ? 71  LYS B CG    1 
ATOM   3237 C  CD    . LYS B 1 89  ? 17.654  -27.518 -18.719 1.00 25.98  ? 71  LYS B CD    1 
ATOM   3238 C  CE    . LYS B 1 89  ? 17.191  -26.310 -19.527 1.00 31.16  ? 71  LYS B CE    1 
ATOM   3239 N  NZ    . LYS B 1 89  ? 17.374  -25.025 -18.768 1.00 33.98  ? 71  LYS B NZ    1 
ATOM   3240 N  N     . MET B 1 90  ? 16.613  -31.504 -21.304 1.00 17.06  ? 72  MET B N     1 
ATOM   3241 C  CA    . MET B 1 90  ? 15.412  -31.833 -22.069 1.00 18.54  ? 72  MET B CA    1 
ATOM   3242 C  C     . MET B 1 90  ? 15.255  -33.347 -22.280 1.00 19.08  ? 72  MET B C     1 
ATOM   3243 O  O     . MET B 1 90  ? 14.135  -33.868 -22.281 1.00 18.05  ? 72  MET B O     1 
ATOM   3244 C  CB    . MET B 1 90  ? 15.349  -31.089 -23.406 1.00 16.63  ? 72  MET B CB    1 
ATOM   3245 C  CG    . MET B 1 90  ? 14.019  -31.318 -24.115 1.00 19.63  ? 72  MET B CG    1 
ATOM   3246 S  SD    . MET B 1 90  ? 13.732  -30.298 -25.561 1.00 23.05  ? 72  MET B SD    1 
ATOM   3247 C  CE    . MET B 1 90  ? 11.975  -30.580 -25.802 1.00 19.42  ? 72  MET B CE    1 
ATOM   3248 N  N     . ILE B 1 91  ? 16.374  -34.046 -22.452 1.00 17.76  ? 73  ILE B N     1 
ATOM   3249 C  CA    . ILE B 1 91  ? 16.355  -35.507 -22.465 1.00 17.88  ? 73  ILE B CA    1 
ATOM   3250 C  C     . ILE B 1 91  ? 15.704  -36.004 -21.176 1.00 22.47  ? 73  ILE B C     1 
ATOM   3251 O  O     . ILE B 1 91  ? 14.783  -36.823 -21.204 1.00 24.04  ? 73  ILE B O     1 
ATOM   3252 C  CB    . ILE B 1 91  ? 17.772  -36.102 -22.569 1.00 16.95  ? 73  ILE B CB    1 
ATOM   3253 C  CG1   . ILE B 1 91  ? 18.385  -35.805 -23.939 1.00 15.16  ? 73  ILE B CG1   1 
ATOM   3254 C  CG2   . ILE B 1 91  ? 17.740  -37.614 -22.324 1.00 21.21  ? 73  ILE B CG2   1 
ATOM   3255 C  CD1   . ILE B 1 91  ? 19.828  -36.254 -24.079 1.00 14.60  ? 73  ILE B CD1   1 
ATOM   3256 N  N     . GLN B 1 92  ? 16.186  -35.484 -20.052 1.00 20.83  ? 74  GLN B N     1 
ATOM   3257 C  CA    . GLN B 1 92  ? 15.645  -35.809 -18.738 1.00 22.01  ? 74  GLN B CA    1 
ATOM   3258 C  C     . GLN B 1 92  ? 14.143  -35.524 -18.672 1.00 23.84  ? 74  GLN B C     1 
ATOM   3259 O  O     . GLN B 1 92  ? 13.356  -36.355 -18.219 1.00 23.99  ? 74  GLN B O     1 
ATOM   3260 C  CB    . GLN B 1 92  ? 16.390  -35.006 -17.666 1.00 21.87  ? 74  GLN B CB    1 
ATOM   3261 C  CG    . GLN B 1 92  ? 15.784  -35.085 -16.272 1.00 25.26  ? 74  GLN B CG    1 
ATOM   3262 C  CD    . GLN B 1 92  ? 15.809  -36.492 -15.710 1.00 27.78  ? 74  GLN B CD    1 
ATOM   3263 O  OE1   . GLN B 1 92  ? 16.853  -37.151 -15.701 1.00 28.20  ? 74  GLN B OE1   1 
ATOM   3264 N  NE2   . GLN B 1 92  ? 14.655  -36.966 -15.245 1.00 27.30  ? 74  GLN B NE2   1 
ATOM   3265 N  N     . TRP B 1 93  ? 13.756  -34.350 -19.152 1.00 22.18  ? 75  TRP B N     1 
ATOM   3266 C  CA    . TRP B 1 93  ? 12.365  -33.915 -19.135 1.00 23.14  ? 75  TRP B CA    1 
ATOM   3267 C  C     . TRP B 1 93  ? 11.450  -34.787 -20.009 1.00 24.99  ? 75  TRP B C     1 
ATOM   3268 O  O     . TRP B 1 93  ? 10.311  -35.072 -19.638 1.00 25.30  ? 75  TRP B O     1 
ATOM   3269 C  CB    . TRP B 1 93  ? 12.311  -32.454 -19.581 1.00 23.55  ? 75  TRP B CB    1 
ATOM   3270 C  CG    . TRP B 1 93  ? 10.957  -31.833 -19.611 1.00 24.95  ? 75  TRP B CG    1 
ATOM   3271 C  CD1   . TRP B 1 93  ? 10.290  -31.265 -18.563 1.00 25.26  ? 75  TRP B CD1   1 
ATOM   3272 C  CD2   . TRP B 1 93  ? 10.118  -31.665 -20.760 1.00 27.93  ? 75  TRP B CD2   1 
ATOM   3273 N  NE1   . TRP B 1 93  ? 9.080   -30.767 -18.987 1.00 29.58  ? 75  TRP B NE1   1 
ATOM   3274 C  CE2   . TRP B 1 93  ? 8.950   -31.000 -20.332 1.00 29.73  ? 75  TRP B CE2   1 
ATOM   3275 C  CE3   . TRP B 1 93  ? 10.240  -32.021 -22.111 1.00 28.46  ? 75  TRP B CE3   1 
ATOM   3276 C  CZ2   . TRP B 1 93  ? 7.907   -30.682 -21.205 1.00 30.32  ? 75  TRP B CZ2   1 
ATOM   3277 C  CZ3   . TRP B 1 93  ? 9.203   -31.706 -22.977 1.00 27.93  ? 75  TRP B CZ3   1 
ATOM   3278 C  CH2   . TRP B 1 93  ? 8.052   -31.041 -22.520 1.00 30.14  ? 75  TRP B CH2   1 
ATOM   3279 N  N     . ILE B 1 94  ? 11.953  -35.208 -21.167 1.00 25.84  ? 76  ILE B N     1 
ATOM   3280 C  CA    . ILE B 1 94  ? 11.198  -36.073 -22.076 1.00 25.85  ? 76  ILE B CA    1 
ATOM   3281 C  C     . ILE B 1 94  ? 10.964  -37.464 -21.486 1.00 25.97  ? 76  ILE B C     1 
ATOM   3282 O  O     . ILE B 1 94  ? 9.854   -38.002 -21.535 1.00 23.82  ? 76  ILE B O     1 
ATOM   3283 C  CB    . ILE B 1 94  ? 11.939  -36.241 -23.424 1.00 25.39  ? 76  ILE B CB    1 
ATOM   3284 C  CG1   . ILE B 1 94  ? 11.891  -34.943 -24.231 1.00 24.60  ? 76  ILE B CG1   1 
ATOM   3285 C  CG2   . ILE B 1 94  ? 11.344  -37.392 -24.234 1.00 21.21  ? 76  ILE B CG2   1 
ATOM   3286 C  CD1   . ILE B 1 94  ? 12.809  -34.950 -25.441 1.00 24.78  ? 76  ILE B CD1   1 
ATOM   3287 N  N     . ILE B 1 95  ? 12.024  -38.041 -20.935 1.00 21.69  ? 77  ILE B N     1 
ATOM   3288 C  CA    . ILE B 1 95  ? 11.986  -39.405 -20.436 1.00 24.62  ? 77  ILE B CA    1 
ATOM   3289 C  C     . ILE B 1 95  ? 11.153  -39.540 -19.152 1.00 29.82  ? 77  ILE B C     1 
ATOM   3290 O  O     . ILE B 1 95  ? 10.551  -40.587 -18.911 1.00 33.45  ? 77  ILE B O     1 
ATOM   3291 C  CB    . ILE B 1 95  ? 13.419  -39.964 -20.269 1.00 23.47  ? 77  ILE B CB    1 
ATOM   3292 C  CG1   . ILE B 1 95  ? 14.128  -39.973 -21.627 1.00 22.05  ? 77  ILE B CG1   1 
ATOM   3293 C  CG2   . ILE B 1 95  ? 13.404  -41.372 -19.676 1.00 22.71  ? 77  ILE B CG2   1 
ATOM   3294 C  CD1   . ILE B 1 95  ? 15.513  -40.583 -21.603 1.00 21.05  ? 77  ILE B CD1   1 
ATOM   3295 N  N     . GLN B 1 96  ? 11.123  -38.475 -18.350 1.00 32.87  ? 78  GLN B N     1 
ATOM   3296 C  CA    . GLN B 1 96  ? 10.278  -38.367 -17.147 1.00 39.43  ? 78  GLN B CA    1 
ATOM   3297 C  C     . GLN B 1 96  ? 10.784  -39.103 -15.901 1.00 41.59  ? 78  GLN B C     1 
ATOM   3298 O  O     . GLN B 1 96  ? 10.555  -38.651 -14.779 1.00 46.36  ? 78  GLN B O     1 
ATOM   3299 C  CB    . GLN B 1 96  ? 8.815   -38.742 -17.427 1.00 43.27  ? 78  GLN B CB    1 
ATOM   3300 C  CG    . GLN B 1 96  ? 8.069   -37.747 -18.294 1.00 47.08  ? 78  GLN B CG    1 
ATOM   3301 C  CD    . GLN B 1 96  ? 6.604   -38.108 -18.471 1.00 51.26  ? 78  GLN B CD    1 
ATOM   3302 O  OE1   . GLN B 1 96  ? 6.239   -38.836 -19.397 1.00 51.60  ? 78  GLN B OE1   1 
ATOM   3303 N  NE2   . GLN B 1 96  ? 5.756   -37.597 -17.583 1.00 53.05  ? 78  GLN B NE2   1 
ATOM   3304 N  N     . LYS B 1 97  ? 11.461  -40.230 -16.091 1.00 37.41  ? 79  LYS B N     1 
ATOM   3305 C  CA    . LYS B 1 97  ? 12.016  -40.976 -14.965 1.00 33.61  ? 79  LYS B CA    1 
ATOM   3306 C  C     . LYS B 1 97  ? 13.078  -40.151 -14.237 1.00 29.50  ? 79  LYS B C     1 
ATOM   3307 O  O     . LYS B 1 97  ? 14.079  -39.756 -14.825 1.00 24.41  ? 79  LYS B O     1 
ATOM   3308 C  CB    . LYS B 1 97  ? 12.598  -42.312 -15.433 1.00 34.31  ? 79  LYS B CB    1 
ATOM   3309 C  CG    . LYS B 1 97  ? 13.091  -43.223 -14.303 1.00 38.09  ? 79  LYS B CG    1 
ATOM   3310 C  CD    . LYS B 1 97  ? 13.412  -44.620 -14.826 1.00 40.82  ? 79  LYS B CD    1 
ATOM   3311 C  CE    . LYS B 1 97  ? 13.834  -45.569 -13.711 1.00 44.23  ? 79  LYS B CE    1 
ATOM   3312 N  NZ    . LYS B 1 97  ? 15.143  -45.177 -13.124 1.00 46.04  ? 79  LYS B NZ    1 
ATOM   3313 N  N     . PRO B 1 98  ? 12.860  -39.894 -12.941 1.00 31.70  ? 80  PRO B N     1 
ATOM   3314 C  CA    . PRO B 1 98  ? 13.782  -39.035 -12.185 1.00 28.78  ? 80  PRO B CA    1 
ATOM   3315 C  C     . PRO B 1 98  ? 15.213  -39.581 -12.158 1.00 27.83  ? 80  PRO B C     1 
ATOM   3316 O  O     . PRO B 1 98  ? 15.403  -40.791 -12.012 1.00 30.12  ? 80  PRO B O     1 
ATOM   3317 C  CB    . PRO B 1 98  ? 13.184  -39.034 -10.772 1.00 28.86  ? 80  PRO B CB    1 
ATOM   3318 C  CG    . PRO B 1 98  ? 11.750  -39.474 -10.951 1.00 30.32  ? 80  PRO B CG    1 
ATOM   3319 C  CD    . PRO B 1 98  ? 11.764  -40.419 -12.106 1.00 29.58  ? 80  PRO B CD    1 
ATOM   3320 N  N     . PHE B 1 99  ? 16.189  -38.688 -12.328 1.00 26.23  ? 81  PHE B N     1 
ATOM   3321 C  CA    . PHE B 1 99  ? 17.618  -38.991 -12.163 1.00 24.56  ? 81  PHE B CA    1 
ATOM   3322 C  C     . PHE B 1 99  ? 18.255  -39.834 -13.283 1.00 24.98  ? 81  PHE B C     1 
ATOM   3323 O  O     . PHE B 1 99  ? 19.362  -40.347 -13.120 1.00 24.04  ? 81  PHE B O     1 
ATOM   3324 C  CB    . PHE B 1 99  ? 17.888  -39.627 -10.790 1.00 26.45  ? 81  PHE B CB    1 
ATOM   3325 C  CG    . PHE B 1 99  ? 17.179  -38.938 -9.647  1.00 27.83  ? 81  PHE B CG    1 
ATOM   3326 C  CD1   . PHE B 1 99  ? 16.456  -39.675 -8.718  1.00 30.87  ? 81  PHE B CD1   1 
ATOM   3327 C  CD2   . PHE B 1 99  ? 17.240  -37.561 -9.499  1.00 27.10  ? 81  PHE B CD2   1 
ATOM   3328 C  CE1   . PHE B 1 99  ? 15.801  -39.050 -7.665  1.00 32.30  ? 81  PHE B CE1   1 
ATOM   3329 C  CE2   . PHE B 1 99  ? 16.588  -36.927 -8.449  1.00 31.95  ? 81  PHE B CE2   1 
ATOM   3330 C  CZ    . PHE B 1 99  ? 15.869  -37.675 -7.530  1.00 33.07  ? 81  PHE B CZ    1 
ATOM   3331 N  N     . VAL B 1 100 ? 17.568  -39.967 -14.416 1.00 22.34  ? 82  VAL B N     1 
ATOM   3332 C  CA    . VAL B 1 100 ? 18.130  -40.684 -15.561 1.00 22.67  ? 82  VAL B CA    1 
ATOM   3333 C  C     . VAL B 1 100 ? 19.348  -39.953 -16.127 1.00 22.50  ? 82  VAL B C     1 
ATOM   3334 O  O     . VAL B 1 100 ? 20.284  -40.577 -16.633 1.00 23.80  ? 82  VAL B O     1 
ATOM   3335 C  CB    . VAL B 1 100 ? 17.074  -40.907 -16.675 1.00 29.20  ? 82  VAL B CB    1 
ATOM   3336 C  CG1   . VAL B 1 100 ? 17.710  -41.463 -17.931 1.00 28.40  ? 82  VAL B CG1   1 
ATOM   3337 C  CG2   . VAL B 1 100 ? 16.005  -41.854 -16.189 1.00 31.23  ? 82  VAL B CG2   1 
ATOM   3338 N  N     . CYS B 1 101 ? 19.345  -38.628 -16.015 1.00 22.07  ? 83  CYS B N     1 
ATOM   3339 C  CA    . CYS B 1 101 ? 20.434  -37.821 -16.554 1.00 21.64  ? 83  CYS B CA    1 
ATOM   3340 C  C     . CYS B 1 101 ? 21.341  -37.221 -15.486 1.00 22.93  ? 83  CYS B C     1 
ATOM   3341 O  O     . CYS B 1 101 ? 20.900  -36.891 -14.379 1.00 20.89  ? 83  CYS B O     1 
ATOM   3342 C  CB    . CYS B 1 101 ? 19.889  -36.704 -17.441 1.00 20.92  ? 83  CYS B CB    1 
ATOM   3343 S  SG    . CYS B 1 101 ? 19.039  -37.255 -18.924 1.00 27.42  ? 83  CYS B SG    1 
ATOM   3344 N  N     . SER B 1 102 ? 22.612  -37.069 -15.848 1.00 22.34  ? 84  SER B N     1 
ATOM   3345 C  CA    . SER B 1 102 ? 23.606  -36.440 -14.997 1.00 23.56  ? 84  SER B CA    1 
ATOM   3346 C  C     . SER B 1 102 ? 24.286  -35.323 -15.785 1.00 22.13  ? 84  SER B C     1 
ATOM   3347 O  O     . SER B 1 102 ? 24.394  -35.398 -17.010 1.00 20.51  ? 84  SER B O     1 
ATOM   3348 C  CB    . SER B 1 102 ? 24.651  -37.461 -14.546 1.00 26.24  ? 84  SER B CB    1 
ATOM   3349 O  OG    . SER B 1 102 ? 24.045  -38.582 -13.932 1.00 29.96  ? 84  SER B OG    1 
ATOM   3350 N  N     . TYR B 1 103 ? 24.737  -34.289 -15.082 1.00 21.46  ? 85  TYR B N     1 
ATOM   3351 C  CA    . TYR B 1 103 ? 25.415  -33.165 -15.723 1.00 21.66  ? 85  TYR B CA    1 
ATOM   3352 C  C     . TYR B 1 103 ? 26.547  -32.625 -14.858 1.00 21.33  ? 85  TYR B C     1 
ATOM   3353 O  O     . TYR B 1 103 ? 26.397  -32.460 -13.647 1.00 25.28  ? 85  TYR B O     1 
ATOM   3354 C  CB    . TYR B 1 103 ? 24.425  -32.044 -16.079 1.00 20.18  ? 85  TYR B CB    1 
ATOM   3355 C  CG    . TYR B 1 103 ? 25.074  -30.821 -16.706 1.00 21.89  ? 85  TYR B CG    1 
ATOM   3356 C  CD1   . TYR B 1 103 ? 25.268  -30.739 -18.081 1.00 22.34  ? 85  TYR B CD1   1 
ATOM   3357 C  CD2   . TYR B 1 103 ? 25.489  -29.745 -15.920 1.00 22.72  ? 85  TYR B CD2   1 
ATOM   3358 C  CE1   . TYR B 1 103 ? 25.863  -29.623 -18.659 1.00 21.99  ? 85  TYR B CE1   1 
ATOM   3359 C  CE2   . TYR B 1 103 ? 26.087  -28.629 -16.485 1.00 22.54  ? 85  TYR B CE2   1 
ATOM   3360 C  CZ    . TYR B 1 103 ? 26.272  -28.571 -17.853 1.00 23.65  ? 85  TYR B CZ    1 
ATOM   3361 O  OH    . TYR B 1 103 ? 26.860  -27.458 -18.417 1.00 22.58  ? 85  TYR B OH    1 
ATOM   3362 N  N     . VAL B 1 104 ? 27.681  -32.353 -15.494 1.00 20.59  ? 86  VAL B N     1 
ATOM   3363 C  CA    . VAL B 1 104 ? 28.833  -31.770 -14.815 1.00 24.07  ? 86  VAL B CA    1 
ATOM   3364 C  C     . VAL B 1 104 ? 29.239  -30.480 -15.527 1.00 23.15  ? 86  VAL B C     1 
ATOM   3365 O  O     . VAL B 1 104 ? 29.256  -30.426 -16.752 1.00 22.16  ? 86  VAL B O     1 
ATOM   3366 C  CB    . VAL B 1 104 ? 30.020  -32.760 -14.780 1.00 24.81  ? 86  VAL B CB    1 
ATOM   3367 C  CG1   . VAL B 1 104 ? 31.304  -32.065 -14.364 1.00 24.63  ? 86  VAL B CG1   1 
ATOM   3368 C  CG2   . VAL B 1 104 ? 29.711  -33.922 -13.850 1.00 26.96  ? 86  VAL B CG2   1 
ATOM   3369 N  N     . GLY B 1 105 ? 29.543  -29.441 -14.755 1.00 24.90  ? 87  GLY B N     1 
ATOM   3370 C  CA    . GLY B 1 105 ? 29.932  -28.154 -15.306 1.00 23.50  ? 87  GLY B CA    1 
ATOM   3371 C  C     . GLY B 1 105 ? 30.413  -27.236 -14.194 1.00 27.71  ? 87  GLY B C     1 
ATOM   3372 O  O     . GLY B 1 105 ? 30.275  -27.564 -13.015 1.00 27.80  ? 87  GLY B O     1 
ATOM   3373 N  N     . CYS B 1 106 ? 30.978  -26.088 -14.559 1.00 27.20  ? 88  CYS B N     1 
ATOM   3374 C  CA    . CYS B 1 106 ? 31.498  -25.161 -13.557 1.00 26.44  ? 88  CYS B CA    1 
ATOM   3375 C  C     . CYS B 1 106 ? 30.737  -23.834 -13.523 1.00 27.57  ? 88  CYS B C     1 
ATOM   3376 O  O     . CYS B 1 106 ? 30.706  -23.079 -14.505 1.00 20.00  ? 88  CYS B O     1 
ATOM   3377 C  CB    . CYS B 1 106 ? 33.000  -24.922 -13.750 1.00 25.23  ? 88  CYS B CB    1 
ATOM   3378 S  SG    . CYS B 1 106 ? 33.787  -23.956 -12.408 1.00 35.20  ? 88  CYS B SG    1 
ATOM   3379 N  N     . ILE B 1 107 ? 30.119  -23.567 -12.376 1.00 26.60  ? 89  ILE B N     1 
ATOM   3380 C  CA    . ILE B 1 107 ? 29.421  -22.314 -12.130 1.00 24.46  ? 89  ILE B CA    1 
ATOM   3381 C  C     . ILE B 1 107 ? 30.245  -21.472 -11.161 1.00 27.80  ? 89  ILE B C     1 
ATOM   3382 O  O     . ILE B 1 107 ? 31.277  -21.923 -10.663 1.00 29.96  ? 89  ILE B O     1 
ATOM   3383 C  CB    . ILE B 1 107 ? 28.025  -22.564 -11.526 1.00 23.34  ? 89  ILE B CB    1 
ATOM   3384 C  CG1   . ILE B 1 107 ? 28.129  -23.528 -10.336 1.00 24.10  ? 89  ILE B CG1   1 
ATOM   3385 C  CG2   . ILE B 1 107 ? 27.067  -23.100 -12.592 1.00 20.80  ? 89  ILE B CG2   1 
ATOM   3386 C  CD1   . ILE B 1 107 ? 26.828  -23.727 -9.565  1.00 24.06  ? 89  ILE B CD1   1 
ATOM   3387 N  N     . GLY B 1 108 ? 29.793  -20.249 -10.901 1.00 29.05  ? 90  GLY B N     1 
ATOM   3388 C  CA    . GLY B 1 108 ? 30.453  -19.380 -9.943  1.00 28.87  ? 90  GLY B CA    1 
ATOM   3389 C  C     . GLY B 1 108 ? 29.760  -19.438 -8.593  1.00 30.69  ? 90  GLY B C     1 
ATOM   3390 O  O     . GLY B 1 108 ? 28.666  -19.994 -8.475  1.00 28.63  ? 90  GLY B O     1 
ATOM   3391 N  N     . ALA B 1 109 ? 30.396  -18.879 -7.568  1.00 31.04  ? 91  ALA B N     1 
ATOM   3392 C  CA    . ALA B 1 109 ? 29.768  -18.801 -6.254  1.00 34.18  ? 91  ALA B CA    1 
ATOM   3393 C  C     . ALA B 1 109 ? 28.909  -17.545 -6.178  1.00 35.64  ? 91  ALA B C     1 
ATOM   3394 O  O     . ALA B 1 109 ? 29.225  -16.598 -5.453  1.00 37.15  ? 91  ALA B O     1 
ATOM   3395 C  CB    . ALA B 1 109 ? 30.815  -18.811 -5.148  1.00 33.11  ? 91  ALA B CB    1 
ATOM   3396 N  N     . ASP B 1 110 ? 27.824  -17.542 -6.944  1.00 33.22  ? 92  ASP B N     1 
ATOM   3397 C  CA    . ASP B 1 110 ? 26.937  -16.389 -7.012  1.00 35.09  ? 92  ASP B CA    1 
ATOM   3398 C  C     . ASP B 1 110 ? 25.472  -16.807 -7.113  1.00 33.65  ? 92  ASP B C     1 
ATOM   3399 O  O     . ASP B 1 110 ? 25.154  -18.001 -7.150  1.00 32.05  ? 92  ASP B O     1 
ATOM   3400 C  CB    . ASP B 1 110 ? 27.321  -15.483 -8.189  1.00 36.02  ? 92  ASP B CB    1 
ATOM   3401 C  CG    . ASP B 1 110 ? 27.529  -16.256 -9.491  1.00 35.24  ? 92  ASP B CG    1 
ATOM   3402 O  OD1   . ASP B 1 110 ? 28.398  -15.848 -10.290 1.00 37.83  ? 92  ASP B OD1   1 
ATOM   3403 O  OD2   . ASP B 1 110 ? 26.822  -17.258 -9.725  1.00 31.44  ? 92  ASP B OD2   1 
ATOM   3404 N  N     . ILE B 1 111 ? 24.588  -15.815 -7.155  1.00 34.95  ? 93  ILE B N     1 
ATOM   3405 C  CA    . ILE B 1 111 ? 23.155  -16.058 -7.269  1.00 34.78  ? 93  ILE B CA    1 
ATOM   3406 C  C     . ILE B 1 111 ? 22.801  -16.685 -8.627  1.00 33.45  ? 93  ILE B C     1 
ATOM   3407 O  O     . ILE B 1 111 ? 21.876  -17.496 -8.721  1.00 32.33  ? 93  ILE B O     1 
ATOM   3408 C  CB    . ILE B 1 111 ? 22.332  -14.761 -7.002  1.00 33.91  ? 93  ILE B CB    1 
ATOM   3409 C  CG1   . ILE B 1 111 ? 20.831  -15.060 -6.957  1.00 36.18  ? 93  ILE B CG1   1 
ATOM   3410 C  CG2   . ILE B 1 111 ? 22.656  -13.680 -8.026  1.00 33.66  ? 93  ILE B CG2   1 
ATOM   3411 C  CD1   . ILE B 1 111 ? 20.437  -16.000 -5.842  1.00 34.99  ? 93  ILE B CD1   1 
ATOM   3412 N  N     . GLN B 1 112 ? 23.553  -16.326 -9.668  1.00 32.45  ? 94  GLN B N     1 
ATOM   3413 C  CA    . GLN B 1 112 ? 23.352  -16.900 -11.001 1.00 30.17  ? 94  GLN B CA    1 
ATOM   3414 C  C     . GLN B 1 112 ? 23.624  -18.406 -11.010 1.00 28.35  ? 94  GLN B C     1 
ATOM   3415 O  O     . GLN B 1 112 ? 22.879  -19.177 -11.611 1.00 24.50  ? 94  GLN B O     1 
ATOM   3416 C  CB    . GLN B 1 112 ? 24.240  -16.207 -12.044 1.00 26.33  ? 94  GLN B CB    1 
ATOM   3417 C  CG    . GLN B 1 112 ? 23.829  -14.779 -12.399 1.00 27.48  ? 94  GLN B CG    1 
ATOM   3418 C  CD    . GLN B 1 112 ? 24.178  -13.776 -11.320 1.00 31.59  ? 94  GLN B CD    1 
ATOM   3419 O  OE1   . GLN B 1 112 ? 25.129  -13.966 -10.556 1.00 32.12  ? 94  GLN B OE1   1 
ATOM   3420 N  NE2   . GLN B 1 112 ? 23.405  -12.701 -11.245 1.00 34.41  ? 94  GLN B NE2   1 
ATOM   3421 N  N     . GLY B 1 113 ? 24.701  -18.816 -10.347 1.00 25.77  ? 95  GLY B N     1 
ATOM   3422 C  CA    . GLY B 1 113 ? 25.044  -20.223 -10.249 1.00 24.84  ? 95  GLY B CA    1 
ATOM   3423 C  C     . GLY B 1 113 ? 24.003  -20.986 -9.451  1.00 28.44  ? 95  GLY B C     1 
ATOM   3424 O  O     . GLY B 1 113 ? 23.626  -22.101 -9.814  1.00 28.87  ? 95  GLY B O     1 
ATOM   3425 N  N     . LYS B 1 114 ? 23.535  -20.381 -8.363  1.00 28.56  ? 96  LYS B N     1 
ATOM   3426 C  CA    . LYS B 1 114 ? 22.503  -20.989 -7.528  1.00 31.21  ? 96  LYS B CA    1 
ATOM   3427 C  C     . LYS B 1 114 ? 21.209  -21.139 -8.314  1.00 32.61  ? 96  LYS B C     1 
ATOM   3428 O  O     . LYS B 1 114 ? 20.466  -22.106 -8.132  1.00 31.61  ? 96  LYS B O     1 
ATOM   3429 C  CB    . LYS B 1 114 ? 22.253  -20.142 -6.278  1.00 34.59  ? 96  LYS B CB    1 
ATOM   3430 C  CG    . LYS B 1 114 ? 21.408  -20.828 -5.221  1.00 38.69  ? 96  LYS B CG    1 
ATOM   3431 C  CD    . LYS B 1 114 ? 22.080  -22.104 -4.746  1.00 43.83  ? 96  LYS B CD    1 
ATOM   3432 C  CE    . LYS B 1 114 ? 21.435  -22.644 -3.476  1.00 51.14  ? 96  LYS B CE    1 
ATOM   3433 N  NZ    . LYS B 1 114 ? 19.979  -22.898 -3.645  1.00 53.91  ? 96  LYS B NZ    1 
ATOM   3434 N  N     . TYR B 1 115 ? 20.943  -20.174 -9.190  1.00 32.09  ? 97  TYR B N     1 
ATOM   3435 C  CA    . TYR B 1 115 ? 19.749  -20.217 -10.020 1.00 31.70  ? 97  TYR B CA    1 
ATOM   3436 C  C     . TYR B 1 115 ? 19.790  -21.398 -10.982 1.00 29.90  ? 97  TYR B C     1 
ATOM   3437 O  O     . TYR B 1 115 ? 18.778  -22.065 -11.201 1.00 24.64  ? 97  TYR B O     1 
ATOM   3438 C  CB    . TYR B 1 115 ? 19.571  -18.909 -10.801 1.00 33.20  ? 97  TYR B CB    1 
ATOM   3439 C  CG    . TYR B 1 115 ? 18.353  -18.929 -11.693 1.00 33.94  ? 97  TYR B CG    1 
ATOM   3440 C  CD1   . TYR B 1 115 ? 17.114  -18.547 -11.206 1.00 35.32  ? 97  TYR B CD1   1 
ATOM   3441 C  CD2   . TYR B 1 115 ? 18.437  -19.357 -13.013 1.00 33.97  ? 97  TYR B CD2   1 
ATOM   3442 C  CE1   . TYR B 1 115 ? 15.993  -18.576 -12.010 1.00 37.15  ? 97  TYR B CE1   1 
ATOM   3443 C  CE2   . TYR B 1 115 ? 17.320  -19.394 -13.822 1.00 36.09  ? 97  TYR B CE2   1 
ATOM   3444 C  CZ    . TYR B 1 115 ? 16.100  -19.002 -13.316 1.00 38.49  ? 97  TYR B CZ    1 
ATOM   3445 O  OH    . TYR B 1 115 ? 14.982  -19.033 -14.115 1.00 41.62  ? 97  TYR B OH    1 
ATOM   3446 N  N     . ILE B 1 116 ? 20.958  -21.641 -11.570 1.00 23.49  ? 98  ILE B N     1 
ATOM   3447 C  CA    . ILE B 1 116 ? 21.116  -22.740 -12.517 1.00 24.17  ? 98  ILE B CA    1 
ATOM   3448 C  C     . ILE B 1 116 ? 21.039  -24.087 -11.799 1.00 24.70  ? 98  ILE B C     1 
ATOM   3449 O  O     . ILE B 1 116 ? 20.379  -25.008 -12.265 1.00 23.64  ? 98  ILE B O     1 
ATOM   3450 C  CB    . ILE B 1 116 ? 22.446  -22.642 -13.288 1.00 20.81  ? 98  ILE B CB    1 
ATOM   3451 C  CG1   . ILE B 1 116 ? 22.442  -21.427 -14.215 1.00 22.42  ? 98  ILE B CG1   1 
ATOM   3452 C  CG2   . ILE B 1 116 ? 22.695  -23.910 -14.095 1.00 19.43  ? 98  ILE B CG2   1 
ATOM   3453 C  CD1   . ILE B 1 116 ? 23.779  -21.175 -14.884 1.00 20.06  ? 98  ILE B CD1   1 
ATOM   3454 N  N     . LYS B 1 117 ? 21.709  -24.181 -10.656 1.00 29.82  ? 99  LYS B N     1 
ATOM   3455 C  CA    . LYS B 1 117 ? 21.722  -25.397 -9.851  1.00 32.65  ? 99  LYS B CA    1 
ATOM   3456 C  C     . LYS B 1 117 ? 20.304  -25.768 -9.422  1.00 33.18  ? 99  LYS B C     1 
ATOM   3457 O  O     . LYS B 1 117 ? 19.915  -26.933 -9.461  1.00 34.95  ? 99  LYS B O     1 
ATOM   3458 C  CB    . LYS B 1 117 ? 22.616  -25.198 -8.625  1.00 35.08  ? 99  LYS B CB    1 
ATOM   3459 C  CG    . LYS B 1 117 ? 22.836  -26.438 -7.783  1.00 41.58  ? 99  LYS B CG    1 
ATOM   3460 C  CD    . LYS B 1 117 ? 23.528  -26.083 -6.467  1.00 49.11  ? 99  LYS B CD    1 
ATOM   3461 C  CE    . LYS B 1 117 ? 24.827  -25.322 -6.716  1.00 52.44  ? 99  LYS B CE    1 
ATOM   3462 N  NZ    . LYS B 1 117 ? 25.370  -24.676 -5.483  1.00 55.65  ? 99  LYS B NZ    1 
ATOM   3463 N  N     . ASN B 1 118 ? 19.528  -24.764 -9.030  1.00 32.75  ? 100 ASN B N     1 
ATOM   3464 C  CA    . ASN B 1 118 ? 18.143  -24.982 -8.635  1.00 34.80  ? 100 ASN B CA    1 
ATOM   3465 C  C     . ASN B 1 118 ? 17.284  -25.448 -9.811  1.00 31.96  ? 100 ASN B C     1 
ATOM   3466 O  O     . ASN B 1 118 ? 16.374  -26.264 -9.644  1.00 27.96  ? 100 ASN B O     1 
ATOM   3467 C  CB    . ASN B 1 118 ? 17.565  -23.705 -8.021  1.00 39.35  ? 100 ASN B CB    1 
ATOM   3468 C  CG    . ASN B 1 118 ? 16.153  -23.892 -7.496  1.00 48.30  ? 100 ASN B CG    1 
ATOM   3469 O  OD1   . ASN B 1 118 ? 15.175  -23.573 -8.177  1.00 50.16  ? 100 ASN B OD1   1 
ATOM   3470 N  ND2   . ASN B 1 118 ? 16.040  -24.403 -6.273  1.00 51.64  ? 100 ASN B ND2   1 
ATOM   3471 N  N     . ASP B 1 119 ? 17.582  -24.922 -10.997 1.00 30.36  ? 101 ASP B N     1 
ATOM   3472 C  CA    . ASP B 1 119 ? 16.835  -25.253 -12.206 1.00 33.07  ? 101 ASP B CA    1 
ATOM   3473 C  C     . ASP B 1 119 ? 16.984  -26.738 -12.545 1.00 30.52  ? 101 ASP B C     1 
ATOM   3474 O  O     . ASP B 1 119 ? 16.039  -27.381 -13.008 1.00 32.82  ? 101 ASP B O     1 
ATOM   3475 C  CB    . ASP B 1 119 ? 17.328  -24.394 -13.376 1.00 37.63  ? 101 ASP B CB    1 
ATOM   3476 C  CG    . ASP B 1 119 ? 16.296  -24.254 -14.482 1.00 43.31  ? 101 ASP B CG    1 
ATOM   3477 O  OD1   . ASP B 1 119 ? 15.365  -23.438 -14.314 1.00 46.20  ? 101 ASP B OD1   1 
ATOM   3478 O  OD2   . ASP B 1 119 ? 16.424  -24.940 -15.522 1.00 44.94  ? 101 ASP B OD2   1 
ATOM   3479 N  N     . CYS B 1 120 ? 18.176  -27.275 -12.310 1.00 24.57  ? 102 CYS B N     1 
ATOM   3480 C  CA    . CYS B 1 120 ? 18.444  -28.679 -12.597 1.00 25.51  ? 102 CYS B CA    1 
ATOM   3481 C  C     . CYS B 1 120 ? 17.710  -29.587 -11.616 1.00 28.60  ? 102 CYS B C     1 
ATOM   3482 O  O     . CYS B 1 120 ? 17.083  -30.563 -12.026 1.00 30.95  ? 102 CYS B O     1 
ATOM   3483 C  CB    . CYS B 1 120 ? 19.949  -28.956 -12.588 1.00 23.85  ? 102 CYS B CB    1 
ATOM   3484 S  SG    . CYS B 1 120 ? 20.865  -27.991 -13.832 1.00 30.69  ? 102 CYS B SG    1 
ATOM   3485 N  N     . SER B 1 121 ? 17.772  -29.248 -10.329 1.00 25.63  ? 103 SER B N     1 
ATOM   3486 C  CA    . SER B 1 121 ? 17.077  -30.011 -9.286  1.00 29.06  ? 103 SER B CA    1 
ATOM   3487 C  C     . SER B 1 121 ? 15.585  -30.137 -9.548  1.00 28.94  ? 103 SER B C     1 
ATOM   3488 O  O     . SER B 1 121 ? 15.002  -31.199 -9.337  1.00 32.26  ? 103 SER B O     1 
ATOM   3489 C  CB    . SER B 1 121 ? 17.286  -29.376 -7.910  1.00 33.05  ? 103 SER B CB    1 
ATOM   3490 O  OG    . SER B 1 121 ? 18.654  -29.370 -7.555  1.00 38.00  ? 103 SER B OG    1 
ATOM   3491 N  N     . ALA B 1 122 ? 14.971  -29.049 -10.003 1.00 28.08  ? 104 ALA B N     1 
ATOM   3492 C  CA    . ALA B 1 122 ? 13.542  -29.035 -10.295 1.00 28.36  ? 104 ALA B CA    1 
ATOM   3493 C  C     . ALA B 1 122 ? 13.182  -30.025 -11.400 1.00 30.01  ? 104 ALA B C     1 
ATOM   3494 O  O     . ALA B 1 122 ? 12.071  -30.553 -11.436 1.00 32.28  ? 104 ALA B O     1 
ATOM   3495 C  CB    . ALA B 1 122 ? 13.096  -27.636 -10.669 1.00 29.47  ? 104 ALA B CB    1 
ATOM   3496 N  N     . LEU B 1 123 ? 14.128  -30.286 -12.296 1.00 28.03  ? 105 LEU B N     1 
ATOM   3497 C  CA    . LEU B 1 123 ? 13.888  -31.222 -13.391 1.00 29.70  ? 105 LEU B CA    1 
ATOM   3498 C  C     . LEU B 1 123 ? 14.313  -32.651 -13.039 1.00 31.24  ? 105 LEU B C     1 
ATOM   3499 O  O     . LEU B 1 123 ? 14.276  -33.540 -13.893 1.00 34.70  ? 105 LEU B O     1 
ATOM   3500 C  CB    . LEU B 1 123 ? 14.608  -30.756 -14.662 1.00 26.20  ? 105 LEU B CB    1 
ATOM   3501 C  CG    . LEU B 1 123 ? 14.134  -29.424 -15.247 1.00 25.34  ? 105 LEU B CG    1 
ATOM   3502 C  CD1   . LEU B 1 123 ? 15.121  -28.904 -16.285 1.00 24.75  ? 105 LEU B CD1   1 
ATOM   3503 C  CD2   . LEU B 1 123 ? 12.748  -29.576 -15.850 1.00 23.52  ? 105 LEU B CD2   1 
ATOM   3504 N  N     . ASP B 1 124 ? 14.707  -32.862 -11.786 1.00 26.52  ? 106 ASP B N     1 
ATOM   3505 C  CA    . ASP B 1 124 ? 15.232  -34.154 -11.337 1.00 29.42  ? 106 ASP B CA    1 
ATOM   3506 C  C     . ASP B 1 124 ? 16.467  -34.573 -12.125 1.00 29.63  ? 106 ASP B C     1 
ATOM   3507 O  O     . ASP B 1 124 ? 16.649  -35.744 -12.457 1.00 27.82  ? 106 ASP B O     1 
ATOM   3508 C  CB    . ASP B 1 124 ? 14.166  -35.248 -11.401 1.00 32.67  ? 106 ASP B CB    1 
ATOM   3509 C  CG    . ASP B 1 124 ? 12.998  -34.971 -10.488 1.00 38.83  ? 106 ASP B CG    1 
ATOM   3510 O  OD1   . ASP B 1 124 ? 13.224  -34.437 -9.381  1.00 42.64  ? 106 ASP B OD1   1 
ATOM   3511 O  OD2   . ASP B 1 124 ? 11.854  -35.282 -10.881 1.00 42.60  ? 106 ASP B OD2   1 
ATOM   3512 N  N     . LEU B 1 125 ? 17.308  -33.597 -12.427 1.00 32.96  ? 107 LEU B N     1 
ATOM   3513 C  CA    . LEU B 1 125 ? 18.587  -33.856 -13.063 1.00 32.52  ? 107 LEU B CA    1 
ATOM   3514 C  C     . LEU B 1 125 ? 19.634  -33.956 -11.963 1.00 32.69  ? 107 LEU B C     1 
ATOM   3515 O  O     . LEU B 1 125 ? 19.704  -33.099 -11.087 1.00 37.75  ? 107 LEU B O     1 
ATOM   3516 C  CB    . LEU B 1 125 ? 18.912  -32.720 -14.036 1.00 33.14  ? 107 LEU B CB    1 
ATOM   3517 C  CG    . LEU B 1 125 ? 20.292  -32.634 -14.682 1.00 35.22  ? 107 LEU B CG    1 
ATOM   3518 C  CD1   . LEU B 1 125 ? 20.583  -33.864 -15.510 1.00 35.76  ? 107 LEU B CD1   1 
ATOM   3519 C  CD2   . LEU B 1 125 ? 20.389  -31.387 -15.540 1.00 34.02  ? 107 LEU B CD2   1 
ATOM   3520 N  N     . VAL B 1 126 ? 20.425  -35.018 -11.984 1.00 30.89  ? 108 VAL B N     1 
ATOM   3521 C  CA    . VAL B 1 126 ? 21.523  -35.158 -11.036 1.00 29.95  ? 108 VAL B CA    1 
ATOM   3522 C  C     . VAL B 1 126 ? 22.691  -34.293 -11.506 1.00 31.22  ? 108 VAL B C     1 
ATOM   3523 O  O     . VAL B 1 126 ? 23.031  -34.297 -12.688 1.00 32.36  ? 108 VAL B O     1 
ATOM   3524 C  CB    . VAL B 1 126 ? 21.963  -36.627 -10.912 1.00 29.37  ? 108 VAL B CB    1 
ATOM   3525 C  CG1   . VAL B 1 126 ? 23.289  -36.739 -10.170 1.00 32.18  ? 108 VAL B CG1   1 
ATOM   3526 C  CG2   . VAL B 1 126 ? 20.881  -37.449 -10.222 1.00 25.73  ? 108 VAL B CG2   1 
ATOM   3527 N  N     . THR B 1 127 ? 23.286  -33.526 -10.596 1.00 28.95  ? 109 THR B N     1 
ATOM   3528 C  CA    . THR B 1 127 ? 24.403  -32.663 -10.968 1.00 27.37  ? 109 THR B CA    1 
ATOM   3529 C  C     . THR B 1 127 ? 25.565  -32.726 -9.987  1.00 28.71  ? 109 THR B C     1 
ATOM   3530 O  O     . THR B 1 127 ? 25.379  -32.940 -8.791  1.00 31.74  ? 109 THR B O     1 
ATOM   3531 C  CB    . THR B 1 127 ? 23.978  -31.181 -11.113 1.00 25.60  ? 109 THR B CB    1 
ATOM   3532 O  OG1   . THR B 1 127 ? 23.431  -30.706 -9.875  1.00 26.53  ? 109 THR B OG1   1 
ATOM   3533 C  CG2   . THR B 1 127 ? 22.951  -31.014 -12.221 1.00 21.57  ? 109 THR B CG2   1 
ATOM   3534 N  N     . GLU B 1 128 ? 26.768  -32.552 -10.517 1.00 27.87  ? 110 GLU B N     1 
ATOM   3535 C  CA    . GLU B 1 128 ? 27.946  -32.325 -9.697  1.00 29.25  ? 110 GLU B CA    1 
ATOM   3536 C  C     . GLU B 1 128 ? 28.683  -31.112 -10.242 1.00 29.56  ? 110 GLU B C     1 
ATOM   3537 O  O     . GLU B 1 128 ? 29.626  -31.241 -11.027 1.00 29.78  ? 110 GLU B O     1 
ATOM   3538 C  CB    . GLU B 1 128 ? 28.861  -33.551 -9.673  1.00 29.91  ? 110 GLU B CB    1 
ATOM   3539 C  CG    . GLU B 1 128 ? 28.336  -34.716 -8.835  1.00 33.21  ? 110 GLU B CG    1 
ATOM   3540 C  CD    . GLU B 1 128 ? 28.239  -34.398 -7.342  1.00 39.56  ? 110 GLU B CD    1 
ATOM   3541 O  OE1   . GLU B 1 128 ? 28.836  -33.395 -6.887  1.00 39.22  ? 110 GLU B OE1   1 
ATOM   3542 O  OE2   . GLU B 1 128 ? 27.560  -35.162 -6.621  1.00 41.07  ? 110 GLU B OE2   1 
ATOM   3543 N  N     . PHE B 1 129 ? 28.236  -29.931 -9.830  1.00 27.50  ? 111 PHE B N     1 
ATOM   3544 C  CA    . PHE B 1 129 ? 28.858  -28.690 -10.267 1.00 24.42  ? 111 PHE B CA    1 
ATOM   3545 C  C     . PHE B 1 129 ? 30.212  -28.453 -9.613  1.00 24.91  ? 111 PHE B C     1 
ATOM   3546 O  O     . PHE B 1 129 ? 30.431  -28.799 -8.454  1.00 27.60  ? 111 PHE B O     1 
ATOM   3547 C  CB    . PHE B 1 129 ? 27.927  -27.498 -10.021 1.00 23.18  ? 111 PHE B CB    1 
ATOM   3548 C  CG    . PHE B 1 129 ? 26.759  -27.443 -10.967 1.00 24.69  ? 111 PHE B CG    1 
ATOM   3549 C  CD1   . PHE B 1 129 ? 26.947  -27.100 -12.297 1.00 20.82  ? 111 PHE B CD1   1 
ATOM   3550 C  CD2   . PHE B 1 129 ? 25.476  -27.745 -10.531 1.00 28.69  ? 111 PHE B CD2   1 
ATOM   3551 C  CE1   . PHE B 1 129 ? 25.875  -27.055 -13.177 1.00 22.38  ? 111 PHE B CE1   1 
ATOM   3552 C  CE2   . PHE B 1 129 ? 24.397  -27.701 -11.406 1.00 27.56  ? 111 PHE B CE2   1 
ATOM   3553 C  CZ    . PHE B 1 129 ? 24.597  -27.357 -12.728 1.00 24.64  ? 111 PHE B CZ    1 
ATOM   3554 N  N     . GLN B 1 130 ? 31.130  -27.884 -10.382 1.00 24.93  ? 112 GLN B N     1 
ATOM   3555 C  CA    . GLN B 1 130 ? 32.360  -27.358 -9.819  1.00 27.53  ? 112 GLN B CA    1 
ATOM   3556 C  C     . GLN B 1 130 ? 32.116  -25.881 -9.533  1.00 28.50  ? 112 GLN B C     1 
ATOM   3557 O  O     . GLN B 1 130 ? 31.441  -25.202 -10.306 1.00 26.15  ? 112 GLN B O     1 
ATOM   3558 C  CB    . GLN B 1 130 ? 33.506  -27.520 -10.811 1.00 24.91  ? 112 GLN B CB    1 
ATOM   3559 C  CG    . GLN B 1 130 ? 34.863  -27.104 -10.270 1.00 25.54  ? 112 GLN B CG    1 
ATOM   3560 C  CD    . GLN B 1 130 ? 35.957  -27.258 -11.306 1.00 29.36  ? 112 GLN B CD    1 
ATOM   3561 O  OE1   . GLN B 1 130 ? 35.784  -27.963 -12.303 1.00 30.29  ? 112 GLN B OE1   1 
ATOM   3562 N  NE2   . GLN B 1 130 ? 37.084  -26.595 -11.085 1.00 29.11  ? 112 GLN B NE2   1 
ATOM   3563 N  N     . ILE B 1 131 ? 32.638  -25.391 -8.415  1.00 29.86  ? 113 ILE B N     1 
ATOM   3564 C  CA    . ILE B 1 131 ? 32.509  -23.977 -8.079  1.00 30.10  ? 113 ILE B CA    1 
ATOM   3565 C  C     . ILE B 1 131 ? 33.842  -23.277 -8.297  1.00 31.67  ? 113 ILE B C     1 
ATOM   3566 O  O     . ILE B 1 131 ? 34.840  -23.601 -7.650  1.00 30.52  ? 113 ILE B O     1 
ATOM   3567 C  CB    . ILE B 1 131 ? 32.087  -23.764 -6.612  1.00 30.51  ? 113 ILE B CB    1 
ATOM   3568 C  CG1   . ILE B 1 131 ? 30.930  -24.689 -6.236  1.00 29.12  ? 113 ILE B CG1   1 
ATOM   3569 C  CG2   . ILE B 1 131 ? 31.702  -22.317 -6.387  1.00 31.85  ? 113 ILE B CG2   1 
ATOM   3570 C  CD1   . ILE B 1 131 ? 29.642  -24.377 -6.963  1.00 29.58  ? 113 ILE B CD1   1 
ATOM   3571 N  N     . ALA B 1 132 ? 33.861  -22.324 -9.218  1.00 31.90  ? 114 ALA B N     1 
ATOM   3572 C  CA    . ALA B 1 132 ? 35.078  -21.581 -9.499  1.00 33.37  ? 114 ALA B CA    1 
ATOM   3573 C  C     . ALA B 1 132 ? 35.486  -20.744 -8.289  1.00 34.83  ? 114 ALA B C     1 
ATOM   3574 O  O     . ALA B 1 132 ? 34.639  -20.308 -7.506  1.00 34.98  ? 114 ALA B O     1 
ATOM   3575 C  CB    . ALA B 1 132 ? 34.888  -20.703 -10.720 1.00 31.76  ? 114 ALA B CB    1 
ATOM   3576 N  N     . GLU B 1 133 ? 36.787  -20.536 -8.130  1.00 37.46  ? 115 GLU B N     1 
ATOM   3577 C  CA    . GLU B 1 133 ? 37.287  -19.700 -7.047  1.00 43.15  ? 115 GLU B CA    1 
ATOM   3578 C  C     . GLU B 1 133 ? 36.864  -18.251 -7.279  1.00 42.61  ? 115 GLU B C     1 
ATOM   3579 O  O     . GLU B 1 133 ? 36.929  -17.753 -8.404  1.00 38.63  ? 115 GLU B O     1 
ATOM   3580 C  CB    . GLU B 1 133 ? 38.810  -19.801 -6.957  1.00 49.33  ? 115 GLU B CB    1 
ATOM   3581 C  CG    . GLU B 1 133 ? 39.410  -19.145 -5.722  1.00 59.64  ? 115 GLU B CG    1 
ATOM   3582 C  CD    . GLU B 1 133 ? 40.926  -19.060 -5.782  1.00 65.92  ? 115 GLU B CD    1 
ATOM   3583 O  OE1   . GLU B 1 133 ? 41.482  -19.123 -6.900  1.00 65.78  ? 115 GLU B OE1   1 
ATOM   3584 O  OE2   . GLU B 1 133 ? 41.563  -18.931 -4.712  1.00 70.26  ? 115 GLU B OE2   1 
ATOM   3585 N  N     . GLU B 1 134 ? 36.414  -17.590 -6.216  1.00 47.45  ? 116 GLU B N     1 
ATOM   3586 C  CA    . GLU B 1 134 ? 36.050  -16.177 -6.273  1.00 51.62  ? 116 GLU B CA    1 
ATOM   3587 C  C     . GLU B 1 134 ? 37.235  -15.348 -6.757  1.00 51.80  ? 116 GLU B C     1 
ATOM   3588 O  O     . GLU B 1 134 ? 38.384  -15.731 -6.542  1.00 51.15  ? 116 GLU B O     1 
ATOM   3589 C  CB    . GLU B 1 134 ? 35.603  -15.677 -4.891  1.00 56.23  ? 116 GLU B CB    1 
ATOM   3590 C  CG    . GLU B 1 134 ? 34.226  -16.147 -4.449  1.00 57.48  ? 116 GLU B CG    1 
ATOM   3591 C  CD    . GLU B 1 134 ? 34.273  -17.465 -3.705  1.00 60.81  ? 116 GLU B CD    1 
ATOM   3592 O  OE1   . GLU B 1 134 ? 35.007  -18.376 -4.148  1.00 61.99  ? 116 GLU B OE1   1 
ATOM   3593 O  OE2   . GLU B 1 134 ? 33.582  -17.587 -2.671  1.00 60.35  ? 116 GLU B OE2   1 
ATOM   3594 N  N     . PRO B 1 135 ? 36.963  -14.204 -7.408  1.00 51.78  ? 117 PRO B N     1 
ATOM   3595 C  CA    . PRO B 1 135 ? 35.627  -13.677 -7.698  1.00 50.40  ? 117 PRO B CA    1 
ATOM   3596 C  C     . PRO B 1 135 ? 35.143  -14.025 -9.107  1.00 47.99  ? 117 PRO B C     1 
ATOM   3597 O  O     . PRO B 1 135 ? 34.357  -13.272 -9.680  1.00 50.01  ? 117 PRO B O     1 
ATOM   3598 C  CB    . PRO B 1 135 ? 35.838  -12.171 -7.578  1.00 50.73  ? 117 PRO B CB    1 
ATOM   3599 C  CG    . PRO B 1 135 ? 37.227  -11.973 -8.098  1.00 50.26  ? 117 PRO B CG    1 
ATOM   3600 C  CD    . PRO B 1 135 ? 38.010  -13.221 -7.741  1.00 51.91  ? 117 PRO B CD    1 
ATOM   3601 N  N     . LEU B 1 136 ? 35.607  -15.146 -9.654  1.00 42.52  ? 118 LEU B N     1 
ATOM   3602 C  CA    . LEU B 1 136 ? 35.189  -15.575 -10.983 1.00 37.01  ? 118 LEU B CA    1 
ATOM   3603 C  C     . LEU B 1 136 ? 33.707  -15.933 -10.977 1.00 36.97  ? 118 LEU B C     1 
ATOM   3604 O  O     . LEU B 1 136 ? 33.276  -16.810 -10.230 1.00 37.28  ? 118 LEU B O     1 
ATOM   3605 C  CB    . LEU B 1 136 ? 36.025  -16.764 -11.446 1.00 33.08  ? 118 LEU B CB    1 
ATOM   3606 C  CG    . LEU B 1 136 ? 35.792  -17.190 -12.892 1.00 31.80  ? 118 LEU B CG    1 
ATOM   3607 C  CD1   . LEU B 1 136 ? 35.908  -15.996 -13.827 1.00 29.93  ? 118 LEU B CD1   1 
ATOM   3608 C  CD2   . LEU B 1 136 ? 36.781  -18.272 -13.279 1.00 30.84  ? 118 LEU B CD2   1 
ATOM   3609 N  N     . MET B 1 137 ? 32.930  -15.248 -11.806 1.00 29.10  ? 119 MET B N     1 
ATOM   3610 C  CA    . MET B 1 137 ? 31.480  -15.383 -11.763 1.00 28.34  ? 119 MET B CA    1 
ATOM   3611 C  C     . MET B 1 137 ? 30.910  -16.360 -12.792 1.00 26.25  ? 119 MET B C     1 
ATOM   3612 O  O     . MET B 1 137 ? 31.552  -16.672 -13.795 1.00 25.36  ? 119 MET B O     1 
ATOM   3613 C  CB    . MET B 1 137 ? 30.822  -14.013 -11.907 1.00 33.38  ? 119 MET B CB    1 
ATOM   3614 C  CG    . MET B 1 137 ? 31.115  -13.059 -10.745 1.00 38.79  ? 119 MET B CG    1 
ATOM   3615 S  SD    . MET B 1 137 ? 30.345  -13.546 -9.180  1.00 77.81  ? 119 MET B SD    1 
ATOM   3616 C  CE    . MET B 1 137 ? 31.638  -14.506 -8.382  1.00 38.94  ? 119 MET B CE    1 
ATOM   3617 N  N     . THR B 1 138 ? 29.702  -16.843 -12.514 1.00 25.67  ? 120 THR B N     1 
ATOM   3618 C  CA    . THR B 1 138 ? 28.981  -17.718 -13.426 1.00 28.82  ? 120 THR B CA    1 
ATOM   3619 C  C     . THR B 1 138 ? 28.900  -17.075 -14.802 1.00 29.94  ? 120 THR B C     1 
ATOM   3620 O  O     . THR B 1 138 ? 28.557  -15.897 -14.928 1.00 28.69  ? 120 THR B O     1 
ATOM   3621 C  CB    . THR B 1 138 ? 27.562  -18.021 -12.912 1.00 26.09  ? 120 THR B CB    1 
ATOM   3622 O  OG1   . THR B 1 138 ? 27.648  -18.775 -11.696 1.00 26.67  ? 120 THR B OG1   1 
ATOM   3623 C  CG2   . THR B 1 138 ? 26.768  -18.814 -13.944 1.00 22.31  ? 120 THR B CG2   1 
ATOM   3624 N  N     . GLY B 1 139 ? 29.250  -17.851 -15.825 1.00 29.22  ? 121 GLY B N     1 
ATOM   3625 C  CA    . GLY B 1 139 ? 29.209  -17.375 -17.192 1.00 29.87  ? 121 GLY B CA    1 
ATOM   3626 C  C     . GLY B 1 139 ? 27.811  -16.963 -17.600 1.00 29.46  ? 121 GLY B C     1 
ATOM   3627 O  O     . GLY B 1 139 ? 26.823  -17.406 -17.016 1.00 31.60  ? 121 GLY B O     1 
ATOM   3628 N  N     . LYS B 1 140 ? 27.727  -16.113 -18.612 1.00 27.18  ? 122 LYS B N     1 
ATOM   3629 C  CA    . LYS B 1 140 ? 26.451  -15.561 -19.026 1.00 25.75  ? 122 LYS B CA    1 
ATOM   3630 C  C     . LYS B 1 140 ? 26.418  -15.330 -20.530 1.00 26.08  ? 122 LYS B C     1 
ATOM   3631 O  O     . LYS B 1 140 ? 27.455  -15.244 -21.184 1.00 26.53  ? 122 LYS B O     1 
ATOM   3632 C  CB    . LYS B 1 140 ? 26.171  -14.252 -18.271 1.00 23.69  ? 122 LYS B CB    1 
ATOM   3633 C  CG    . LYS B 1 140 ? 27.350  -13.283 -18.233 1.00 24.86  ? 122 LYS B CG    1 
ATOM   3634 C  CD    . LYS B 1 140 ? 27.051  -12.060 -17.346 1.00 29.16  ? 122 LYS B CD    1 
ATOM   3635 C  CE    . LYS B 1 140 ? 28.203  -11.061 -17.365 1.00 31.52  ? 122 LYS B CE    1 
ATOM   3636 N  NZ    . LYS B 1 140 ? 27.930  -9.829  -16.550 1.00 33.12  ? 122 LYS B NZ    1 
ATOM   3637 N  N     . VAL B 1 141 ? 25.213  -15.247 -21.076 1.00 26.40  ? 123 VAL B N     1 
ATOM   3638 C  CA    . VAL B 1 141 ? 25.041  -14.982 -22.490 1.00 21.50  ? 123 VAL B CA    1 
ATOM   3639 C  C     . VAL B 1 141 ? 24.070  -13.829 -22.656 1.00 23.63  ? 123 VAL B C     1 
ATOM   3640 O  O     . VAL B 1 141 ? 22.934  -13.887 -22.179 1.00 23.45  ? 123 VAL B O     1 
ATOM   3641 C  CB    . VAL B 1 141 ? 24.488  -16.221 -23.243 1.00 28.69  ? 123 VAL B CB    1 
ATOM   3642 C  CG1   . VAL B 1 141 ? 24.368  -15.931 -24.744 1.00 20.34  ? 123 VAL B CG1   1 
ATOM   3643 C  CG2   . VAL B 1 141 ? 25.367  -17.439 -22.993 1.00 19.00  ? 123 VAL B CG2   1 
ATOM   3644 N  N     . ALA B 1 142 ? 24.529  -12.768 -23.309 1.00 24.39  ? 124 ALA B N     1 
ATOM   3645 C  CA    . ALA B 1 142 ? 23.642  -11.685 -23.696 1.00 25.97  ? 124 ALA B CA    1 
ATOM   3646 C  C     . ALA B 1 142 ? 22.843  -12.152 -24.902 1.00 25.86  ? 124 ALA B C     1 
ATOM   3647 O  O     . ALA B 1 142 ? 23.397  -12.358 -25.984 1.00 26.20  ? 124 ALA B O     1 
ATOM   3648 C  CB    . ALA B 1 142 ? 24.437  -10.436 -24.029 1.00 26.84  ? 124 ALA B CB    1 
ATOM   3649 N  N     . VAL B 1 143 ? 21.546  -12.350 -24.711 1.00 27.58  ? 125 VAL B N     1 
ATOM   3650 C  CA    . VAL B 1 143 ? 20.688  -12.757 -25.816 1.00 29.49  ? 125 VAL B CA    1 
ATOM   3651 C  C     . VAL B 1 143 ? 19.863  -11.568 -26.306 1.00 33.13  ? 125 VAL B C     1 
ATOM   3652 O  O     . VAL B 1 143 ? 18.878  -11.176 -25.675 1.00 35.17  ? 125 VAL B O     1 
ATOM   3653 C  CB    . VAL B 1 143 ? 19.767  -13.921 -25.426 1.00 27.94  ? 125 VAL B CB    1 
ATOM   3654 C  CG1   . VAL B 1 143 ? 19.145  -14.543 -26.672 1.00 26.20  ? 125 VAL B CG1   1 
ATOM   3655 C  CG2   . VAL B 1 143 ? 20.548  -14.968 -24.647 1.00 27.71  ? 125 VAL B CG2   1 
ATOM   3656 N  N     . LEU B 1 144 ? 20.287  -10.992 -27.426 1.00 33.86  ? 126 LEU B N     1 
ATOM   3657 C  CA    . LEU B 1 144 ? 19.591  -9.853  -28.021 1.00 37.75  ? 126 LEU B CA    1 
ATOM   3658 C  C     . LEU B 1 144 ? 18.461  -10.326 -28.932 1.00 38.23  ? 126 LEU B C     1 
ATOM   3659 O  O     . LEU B 1 144 ? 18.695  -11.033 -29.918 1.00 35.91  ? 126 LEU B O     1 
ATOM   3660 C  CB    . LEU B 1 144 ? 20.569  -8.959  -28.793 1.00 36.76  ? 126 LEU B CB    1 
ATOM   3661 C  CG    . LEU B 1 144 ? 21.339  -7.885  -28.010 1.00 38.11  ? 126 LEU B CG    1 
ATOM   3662 C  CD1   . LEU B 1 144 ? 22.190  -8.462  -26.893 1.00 34.55  ? 126 LEU B CD1   1 
ATOM   3663 C  CD2   . LEU B 1 144 ? 22.191  -7.046  -28.956 1.00 40.80  ? 126 LEU B CD2   1 
ATOM   3664 N  N     . VAL B 1 145 ? 17.235  -9.943  -28.587 1.00 39.83  ? 127 VAL B N     1 
ATOM   3665 C  CA    . VAL B 1 145 ? 16.065  -10.370 -29.343 1.00 42.88  ? 127 VAL B CA    1 
ATOM   3666 C  C     . VAL B 1 145 ? 15.439  -9.211  -30.110 1.00 47.55  ? 127 VAL B C     1 
ATOM   3667 O  O     . VAL B 1 145 ? 15.087  -8.188  -29.527 1.00 50.20  ? 127 VAL B O     1 
ATOM   3668 C  CB    . VAL B 1 145 ? 15.008  -11.011 -28.431 1.00 42.76  ? 127 VAL B CB    1 
ATOM   3669 C  CG1   . VAL B 1 145 ? 13.815  -11.477 -29.252 1.00 44.82  ? 127 VAL B CG1   1 
ATOM   3670 C  CG2   . VAL B 1 145 ? 15.613  -12.168 -27.663 1.00 38.25  ? 127 VAL B CG2   1 
ATOM   3671 N  N     . SER B 1 146 ? 15.309  -9.386  -31.422 1.00 51.22  ? 128 SER B N     1 
ATOM   3672 C  CA    . SER B 1 146 ? 14.741  -8.364  -32.294 1.00 55.30  ? 128 SER B CA    1 
ATOM   3673 C  C     . SER B 1 146 ? 13.732  -8.976  -33.257 1.00 55.50  ? 128 SER B C     1 
ATOM   3674 O  O     . SER B 1 146 ? 14.009  -9.996  -33.887 1.00 54.10  ? 128 SER B O     1 
ATOM   3675 C  CB    . SER B 1 146 ? 15.851  -7.666  -33.081 1.00 56.34  ? 128 SER B CB    1 
ATOM   3676 O  OG    . SER B 1 146 ? 15.317  -6.784  -34.049 1.00 61.08  ? 128 SER B OG    1 
ATOM   3677 N  N     . LEU B 1 149 ? 13.804  -13.133 -34.176 0.00 57.84  ? 131 LEU B N     1 
ATOM   3678 C  CA    . LEU B 1 149 ? 15.177  -13.596 -34.343 0.00 56.27  ? 131 LEU B CA    1 
ATOM   3679 C  C     . LEU B 1 149 ? 15.971  -13.463 -33.047 0.00 55.35  ? 131 LEU B C     1 
ATOM   3680 O  O     . LEU B 1 149 ? 15.396  -13.323 -31.968 0.00 55.32  ? 131 LEU B O     1 
ATOM   3681 C  CB    . LEU B 1 149 ? 15.878  -12.835 -35.473 0.00 57.24  ? 131 LEU B CB    1 
ATOM   3682 C  CG    . LEU B 1 149 ? 15.646  -13.306 -36.913 0.00 57.81  ? 131 LEU B CG    1 
ATOM   3683 C  CD1   . LEU B 1 149 ? 14.213  -13.061 -37.368 0.00 59.62  ? 131 LEU B CD1   1 
ATOM   3684 C  CD2   . LEU B 1 149 ? 16.632  -12.636 -37.859 0.00 58.71  ? 131 LEU B CD2   1 
ATOM   3685 N  N     . ARG B 1 150 ? 17.294  -13.501 -33.166 1.00 54.96  ? 132 ARG B N     1 
ATOM   3686 C  CA    . ARG B 1 150 ? 18.179  -13.459 -32.005 1.00 56.78  ? 132 ARG B CA    1 
ATOM   3687 C  C     . ARG B 1 150 ? 19.599  -13.027 -32.373 1.00 57.58  ? 132 ARG B C     1 
ATOM   3688 O  O     . ARG B 1 150 ? 19.899  -12.762 -33.542 1.00 61.42  ? 132 ARG B O     1 
ATOM   3689 C  CB    . ARG B 1 150 ? 18.233  -14.825 -31.313 1.00 54.41  ? 132 ARG B CB    1 
ATOM   3690 C  CG    . ARG B 1 150 ? 17.497  -14.885 -29.983 1.00 56.24  ? 132 ARG B CG    1 
ATOM   3691 C  CD    . ARG B 1 150 ? 16.246  -15.744 -30.073 1.00 57.82  ? 132 ARG B CD    1 
ATOM   3692 N  NE    . ARG B 1 150 ? 15.250  -15.381 -29.067 1.00 59.42  ? 132 ARG B NE    1 
ATOM   3693 C  CZ    . ARG B 1 150 ? 15.130  -15.968 -27.880 1.00 57.92  ? 132 ARG B CZ    1 
ATOM   3694 N  NH1   . ARG B 1 150 ? 15.946  -16.957 -27.538 1.00 55.77  ? 132 ARG B NH1   1 
ATOM   3695 N  NH2   . ARG B 1 150 ? 14.189  -15.566 -27.036 1.00 57.91  ? 132 ARG B NH2   1 
ATOM   3696 N  N     . SER B 1 151 ? 20.450  -12.949 -31.350 1.00 48.75  ? 133 SER B N     1 
ATOM   3697 C  CA    . SER B 1 151 ? 21.892  -12.747 -31.489 1.00 39.54  ? 133 SER B CA    1 
ATOM   3698 C  C     . SER B 1 151 ? 22.533  -12.875 -30.106 1.00 34.05  ? 133 SER B C     1 
ATOM   3699 O  O     . SER B 1 151 ? 22.100  -12.219 -29.154 1.00 32.89  ? 133 SER B O     1 
ATOM   3700 C  CB    . SER B 1 151 ? 22.216  -11.382 -32.092 1.00 37.77  ? 133 SER B CB    1 
ATOM   3701 O  OG    . SER B 1 151 ? 23.583  -11.322 -32.457 1.00 34.88  ? 133 SER B OG    1 
ATOM   3702 N  N     . MET B 1 152 ? 23.558  -13.717 -29.996 1.00 28.23  ? 134 MET B N     1 
ATOM   3703 C  CA    . MET B 1 152 ? 24.130  -14.052 -28.692 1.00 26.28  ? 134 MET B CA    1 
ATOM   3704 C  C     . MET B 1 152 ? 25.596  -13.652 -28.536 1.00 27.65  ? 134 MET B C     1 
ATOM   3705 O  O     . MET B 1 152 ? 26.425  -13.919 -29.408 1.00 29.30  ? 134 MET B O     1 
ATOM   3706 C  CB    . MET B 1 152 ? 23.983  -15.551 -28.408 1.00 23.74  ? 134 MET B CB    1 
ATOM   3707 C  CG    . MET B 1 152 ? 22.548  -16.033 -28.308 1.00 26.82  ? 134 MET B CG    1 
ATOM   3708 S  SD    . MET B 1 152 ? 22.412  -17.763 -27.795 1.00 36.48  ? 134 MET B SD    1 
ATOM   3709 C  CE    . MET B 1 152 ? 23.395  -18.582 -29.048 1.00 75.96  ? 134 MET B CE    1 
ATOM   3710 N  N     . VAL B 1 153 ? 25.904  -13.025 -27.405 1.00 26.02  ? 135 VAL B N     1 
ATOM   3711 C  CA    . VAL B 1 153 ? 27.280  -12.710 -27.037 1.00 24.04  ? 135 VAL B CA    1 
ATOM   3712 C  C     . VAL B 1 153 ? 27.595  -13.431 -25.732 1.00 26.52  ? 135 VAL B C     1 
ATOM   3713 O  O     . VAL B 1 153 ? 26.942  -13.197 -24.716 1.00 28.86  ? 135 VAL B O     1 
ATOM   3714 C  CB    . VAL B 1 153 ? 27.478  -11.192 -26.856 1.00 25.95  ? 135 VAL B CB    1 
ATOM   3715 C  CG1   . VAL B 1 153 ? 28.931  -10.875 -26.521 1.00 26.58  ? 135 VAL B CG1   1 
ATOM   3716 C  CG2   . VAL B 1 153 ? 27.045  -10.452 -28.108 1.00 27.13  ? 135 VAL B CG2   1 
ATOM   3717 N  N     . THR B 1 154 ? 28.591  -14.310 -25.759 1.00 24.85  ? 136 THR B N     1 
ATOM   3718 C  CA    . THR B 1 154 ? 28.833  -15.221 -24.642 1.00 21.33  ? 136 THR B CA    1 
ATOM   3719 C  C     . THR B 1 154 ? 30.078  -14.880 -23.837 1.00 25.54  ? 136 THR B C     1 
ATOM   3720 O  O     . THR B 1 154 ? 31.165  -14.729 -24.389 1.00 28.74  ? 136 THR B O     1 
ATOM   3721 C  CB    . THR B 1 154 ? 28.951  -16.690 -25.127 1.00 24.30  ? 136 THR B CB    1 
ATOM   3722 O  OG1   . THR B 1 154 ? 27.711  -17.106 -25.708 1.00 23.05  ? 136 THR B OG1   1 
ATOM   3723 C  CG2   . THR B 1 154 ? 29.298  -17.623 -23.966 1.00 19.18  ? 136 THR B CG2   1 
ATOM   3724 N  N     . TYR B 1 155 ? 29.905  -14.761 -22.526 1.00 24.11  ? 137 TYR B N     1 
ATOM   3725 C  CA    . TYR B 1 155 ? 31.025  -14.615 -21.609 1.00 23.05  ? 137 TYR B CA    1 
ATOM   3726 C  C     . TYR B 1 155 ? 31.103  -15.879 -20.755 1.00 25.68  ? 137 TYR B C     1 
ATOM   3727 O  O     . TYR B 1 155 ? 30.261  -16.103 -19.883 1.00 23.51  ? 137 TYR B O     1 
ATOM   3728 C  CB    . TYR B 1 155 ? 30.830  -13.392 -20.720 1.00 28.54  ? 137 TYR B CB    1 
ATOM   3729 C  CG    . TYR B 1 155 ? 31.966  -13.179 -19.757 1.00 32.89  ? 137 TYR B CG    1 
ATOM   3730 C  CD1   . TYR B 1 155 ? 33.180  -12.664 -20.194 1.00 38.82  ? 137 TYR B CD1   1 
ATOM   3731 C  CD2   . TYR B 1 155 ? 31.831  -13.492 -18.411 1.00 33.20  ? 137 TYR B CD2   1 
ATOM   3732 C  CE1   . TYR B 1 155 ? 34.232  -12.464 -19.317 1.00 43.53  ? 137 TYR B CE1   1 
ATOM   3733 C  CE2   . TYR B 1 155 ? 32.879  -13.299 -17.523 1.00 37.37  ? 137 TYR B CE2   1 
ATOM   3734 C  CZ    . TYR B 1 155 ? 34.077  -12.784 -17.983 1.00 43.39  ? 137 TYR B CZ    1 
ATOM   3735 O  OH    . TYR B 1 155 ? 35.127  -12.584 -17.112 1.00 48.69  ? 137 TYR B OH    1 
ATOM   3736 N  N     . LEU B 1 156 ? 32.108  -16.707 -21.018 1.00 24.03  ? 138 LEU B N     1 
ATOM   3737 C  CA    . LEU B 1 156 ? 32.184  -18.034 -20.419 1.00 22.30  ? 138 LEU B CA    1 
ATOM   3738 C  C     . LEU B 1 156 ? 32.403  -17.996 -18.907 1.00 26.05  ? 138 LEU B C     1 
ATOM   3739 O  O     . LEU B 1 156 ? 31.847  -18.820 -18.181 1.00 25.25  ? 138 LEU B O     1 
ATOM   3740 C  CB    . LEU B 1 156 ? 33.267  -18.873 -21.106 1.00 21.90  ? 138 LEU B CB    1 
ATOM   3741 C  CG    . LEU B 1 156 ? 32.900  -19.340 -22.518 1.00 22.13  ? 138 LEU B CG    1 
ATOM   3742 C  CD1   . LEU B 1 156 ? 34.106  -19.908 -23.251 1.00 22.16  ? 138 LEU B CD1   1 
ATOM   3743 C  CD2   . LEU B 1 156 ? 31.773  -20.364 -22.470 1.00 20.04  ? 138 LEU B CD2   1 
ATOM   3744 N  N     . GLY B 1 157 ? 33.200  -17.035 -18.442 1.00 22.84  ? 139 GLY B N     1 
ATOM   3745 C  CA    . GLY B 1 157 ? 33.500  -16.899 -17.025 1.00 23.88  ? 139 GLY B CA    1 
ATOM   3746 C  C     . GLY B 1 157 ? 33.891  -18.196 -16.329 1.00 33.93  ? 139 GLY B C     1 
ATOM   3747 O  O     . GLY B 1 157 ? 34.814  -18.891 -16.749 1.00 23.21  ? 139 GLY B O     1 
ATOM   3748 N  N     . ALA B 1 158 ? 33.161  -18.526 -15.268 1.00 23.45  ? 140 ALA B N     1 
ATOM   3749 C  CA    . ALA B 1 158 ? 33.445  -19.706 -14.451 1.00 28.01  ? 140 ALA B CA    1 
ATOM   3750 C  C     . ALA B 1 158 ? 33.488  -21.018 -15.240 1.00 26.81  ? 140 ALA B C     1 
ATOM   3751 O  O     . ALA B 1 158 ? 34.163  -21.967 -14.836 1.00 24.75  ? 140 ALA B O     1 
ATOM   3752 C  CB    . ALA B 1 158 ? 32.431  -19.816 -13.326 1.00 23.64  ? 140 ALA B CB    1 
ATOM   3753 N  N     . ALA B 1 159 ? 32.771  -21.074 -16.360 1.00 27.23  ? 141 ALA B N     1 
ATOM   3754 C  CA    . ALA B 1 159 ? 32.696  -22.306 -17.142 1.00 24.63  ? 141 ALA B CA    1 
ATOM   3755 C  C     . ALA B 1 159 ? 34.086  -22.760 -17.590 1.00 26.81  ? 141 ALA B C     1 
ATOM   3756 O  O     . ALA B 1 159 ? 34.331  -23.957 -17.777 1.00 28.16  ? 141 ALA B O     1 
ATOM   3757 C  CB    . ALA B 1 159 ? 31.769  -22.133 -18.331 1.00 20.63  ? 141 ALA B CB    1 
ATOM   3758 N  N     . CYS B 1 160 ? 34.995  -21.796 -17.729 1.00 25.02  ? 142 CYS B N     1 
ATOM   3759 C  CA    . CYS B 1 160 ? 36.377  -22.069 -18.111 1.00 28.53  ? 142 CYS B CA    1 
ATOM   3760 C  C     . CYS B 1 160 ? 37.157  -22.848 -17.058 1.00 31.50  ? 142 CYS B C     1 
ATOM   3761 O  O     . CYS B 1 160 ? 38.092  -23.569 -17.390 1.00 36.99  ? 142 CYS B O     1 
ATOM   3762 C  CB    . CYS B 1 160 ? 37.116  -20.764 -18.410 1.00 31.57  ? 142 CYS B CB    1 
ATOM   3763 S  SG    . CYS B 1 160 ? 36.647  -19.975 -19.955 1.00 39.25  ? 142 CYS B SG    1 
ATOM   3764 N  N     . ASP B 1 161 ? 36.787  -22.698 -15.791 1.00 30.41  ? 143 ASP B N     1 
ATOM   3765 C  CA    . ASP B 1 161 ? 37.545  -23.332 -14.714 1.00 31.28  ? 143 ASP B CA    1 
ATOM   3766 C  C     . ASP B 1 161 ? 37.242  -24.822 -14.556 1.00 30.40  ? 143 ASP B C     1 
ATOM   3767 O  O     . ASP B 1 161 ? 37.840  -25.494 -13.714 1.00 32.67  ? 143 ASP B O     1 
ATOM   3768 C  CB    . ASP B 1 161 ? 37.345  -22.593 -13.385 1.00 33.04  ? 143 ASP B CB    1 
ATOM   3769 C  CG    . ASP B 1 161 ? 38.228  -21.355 -13.260 1.00 37.85  ? 143 ASP B CG    1 
ATOM   3770 O  OD1   . ASP B 1 161 ? 38.712  -20.837 -14.294 1.00 39.45  ? 143 ASP B OD1   1 
ATOM   3771 O  OD2   . ASP B 1 161 ? 38.433  -20.891 -12.118 1.00 40.30  ? 143 ASP B OD2   1 
ATOM   3772 N  N     . LEU B 1 162 ? 36.319  -25.337 -15.364 1.00 30.35  ? 144 LEU B N     1 
ATOM   3773 C  CA    . LEU B 1 162 ? 36.046  -26.774 -15.383 1.00 29.95  ? 144 LEU B CA    1 
ATOM   3774 C  C     . LEU B 1 162 ? 37.338  -27.538 -15.661 1.00 31.65  ? 144 LEU B C     1 
ATOM   3775 O  O     . LEU B 1 162 ? 38.028  -27.264 -16.646 1.00 34.47  ? 144 LEU B O     1 
ATOM   3776 C  CB    . LEU B 1 162 ? 35.000  -27.110 -16.441 1.00 26.84  ? 144 LEU B CB    1 
ATOM   3777 C  CG    . LEU B 1 162 ? 34.553  -28.571 -16.480 1.00 26.13  ? 144 LEU B CG    1 
ATOM   3778 C  CD1   . LEU B 1 162 ? 34.025  -29.001 -15.110 1.00 24.88  ? 144 LEU B CD1   1 
ATOM   3779 C  CD2   . LEU B 1 162 ? 33.504  -28.780 -17.570 1.00 21.88  ? 144 LEU B CD2   1 
ATOM   3780 N  N     . SER B 1 163 ? 37.673  -28.483 -14.786 1.00 30.11  ? 145 SER B N     1 
ATOM   3781 C  CA    . SER B 1 163 ? 38.972  -29.147 -14.867 1.00 32.95  ? 145 SER B CA    1 
ATOM   3782 C  C     . SER B 1 163 ? 38.905  -30.674 -14.813 1.00 34.11  ? 145 SER B C     1 
ATOM   3783 O  O     . SER B 1 163 ? 37.908  -31.258 -14.382 1.00 33.56  ? 145 SER B O     1 
ATOM   3784 C  CB    . SER B 1 163 ? 39.899  -28.643 -13.759 1.00 32.46  ? 145 SER B CB    1 
ATOM   3785 O  OG    . SER B 1 163 ? 39.433  -29.052 -12.487 1.00 33.28  ? 145 SER B OG    1 
ATOM   3786 N  N     . LEU B 1 164 ? 39.991  -31.305 -15.247 1.00 32.93  ? 146 LEU B N     1 
ATOM   3787 C  CA    . LEU B 1 164 ? 40.116  -32.756 -15.211 1.00 33.85  ? 146 LEU B CA    1 
ATOM   3788 C  C     . LEU B 1 164 ? 40.086  -33.258 -13.770 1.00 32.90  ? 146 LEU B C     1 
ATOM   3789 O  O     . LEU B 1 164 ? 39.551  -34.327 -13.490 1.00 35.58  ? 146 LEU B O     1 
ATOM   3790 C  CB    . LEU B 1 164 ? 41.411  -33.192 -15.909 1.00 35.55  ? 146 LEU B CB    1 
ATOM   3791 C  CG    . LEU B 1 164 ? 41.653  -34.679 -16.188 1.00 36.24  ? 146 LEU B CG    1 
ATOM   3792 C  CD1   . LEU B 1 164 ? 40.565  -35.264 -17.075 1.00 31.60  ? 146 LEU B CD1   1 
ATOM   3793 C  CD2   . LEU B 1 164 ? 43.024  -34.879 -16.821 1.00 36.80  ? 146 LEU B CD2   1 
ATOM   3794 N  N     . ALA B 1 165 ? 40.648  -32.471 -12.857 1.00 30.41  ? 147 ALA B N     1 
ATOM   3795 C  CA    . ALA B 1 165 ? 40.685  -32.840 -11.447 1.00 32.24  ? 147 ALA B CA    1 
ATOM   3796 C  C     . ALA B 1 165 ? 39.289  -33.000 -10.839 1.00 33.95  ? 147 ALA B C     1 
ATOM   3797 O  O     . ALA B 1 165 ? 39.067  -33.889 -10.017 1.00 35.62  ? 147 ALA B O     1 
ATOM   3798 C  CB    . ALA B 1 165 ? 41.496  -31.829 -10.656 1.00 30.42  ? 147 ALA B CB    1 
ATOM   3799 N  N     . HIS B 1 166 ? 38.353  -32.138 -11.235 1.00 31.19  ? 148 HIS B N     1 
ATOM   3800 C  CA    . HIS B 1 166 ? 36.983  -32.231 -10.731 1.00 31.31  ? 148 HIS B CA    1 
ATOM   3801 C  C     . HIS B 1 166 ? 36.298  -33.480 -11.278 1.00 34.08  ? 148 HIS B C     1 
ATOM   3802 O  O     . HIS B 1 166 ? 35.530  -34.150 -10.583 1.00 33.87  ? 148 HIS B O     1 
ATOM   3803 C  CB    . HIS B 1 166 ? 36.175  -30.986 -11.107 1.00 28.80  ? 148 HIS B CB    1 
ATOM   3804 C  CG    . HIS B 1 166 ? 34.732  -31.063 -10.711 1.00 28.84  ? 148 HIS B CG    1 
ATOM   3805 N  ND1   . HIS B 1 166 ? 34.310  -30.930 -9.405  1.00 31.65  ? 148 HIS B ND1   1 
ATOM   3806 C  CD2   . HIS B 1 166 ? 33.615  -31.273 -11.448 1.00 26.17  ? 148 HIS B CD2   1 
ATOM   3807 C  CE1   . HIS B 1 166 ? 32.995  -31.049 -9.356  1.00 31.42  ? 148 HIS B CE1   1 
ATOM   3808 N  NE2   . HIS B 1 166 ? 32.549  -31.259 -10.582 1.00 29.12  ? 148 HIS B NE2   1 
ATOM   3809 N  N     . ILE B 1 167 ? 36.586  -33.781 -12.537 1.00 34.71  ? 149 ILE B N     1 
ATOM   3810 C  CA    . ILE B 1 167 ? 36.010  -34.938 -13.208 1.00 36.30  ? 149 ILE B CA    1 
ATOM   3811 C  C     . ILE B 1 167 ? 36.550  -36.247 -12.621 1.00 35.34  ? 149 ILE B C     1 
ATOM   3812 O  O     . ILE B 1 167 ? 35.821  -37.227 -12.492 1.00 33.78  ? 149 ILE B O     1 
ATOM   3813 C  CB    . ILE B 1 167 ? 36.273  -34.863 -14.727 1.00 33.85  ? 149 ILE B CB    1 
ATOM   3814 C  CG1   . ILE B 1 167 ? 35.510  -33.677 -15.320 1.00 33.59  ? 149 ILE B CG1   1 
ATOM   3815 C  CG2   . ILE B 1 167 ? 35.875  -36.154 -15.419 1.00 34.01  ? 149 ILE B CG2   1 
ATOM   3816 C  CD1   . ILE B 1 167 ? 35.872  -33.362 -16.753 1.00 35.45  ? 149 ILE B CD1   1 
ATOM   3817 N  N     . GLU B 1 168 ? 37.822  -36.235 -12.232 1.00 36.50  ? 150 GLU B N     1 
ATOM   3818 C  CA    . GLU B 1 168 ? 38.499  -37.440 -11.767 1.00 38.14  ? 150 GLU B CA    1 
ATOM   3819 C  C     . GLU B 1 168 ? 38.191  -37.791 -10.313 1.00 41.94  ? 150 GLU B C     1 
ATOM   3820 O  O     . GLU B 1 168 ? 38.583  -38.856 -9.836  1.00 45.73  ? 150 GLU B O     1 
ATOM   3821 C  CB    . GLU B 1 168 ? 40.009  -37.317 -11.976 1.00 40.13  ? 150 GLU B CB    1 
ATOM   3822 C  CG    . GLU B 1 168 ? 40.442  -37.472 -13.425 1.00 43.65  ? 150 GLU B CG    1 
ATOM   3823 C  CD    . GLU B 1 168 ? 41.936  -37.285 -13.611 1.00 50.38  ? 150 GLU B CD    1 
ATOM   3824 O  OE1   . GLU B 1 168 ? 42.570  -36.647 -12.739 1.00 54.67  ? 150 GLU B OE1   1 
ATOM   3825 O  OE2   . GLU B 1 168 ? 42.476  -37.776 -14.628 1.00 50.23  ? 150 GLU B OE2   1 
ATOM   3826 N  N     . GLN B 1 169 ? 37.502  -36.897 -9.611  1.00 40.60  ? 151 GLN B N     1 
ATOM   3827 C  CA    . GLN B 1 169 ? 37.020  -37.203 -8.269  1.00 39.74  ? 151 GLN B CA    1 
ATOM   3828 C  C     . GLN B 1 169 ? 36.129  -38.438 -8.328  1.00 38.28  ? 151 GLN B C     1 
ATOM   3829 O  O     . GLN B 1 169 ? 35.289  -38.555 -9.218  1.00 40.50  ? 151 GLN B O     1 
ATOM   3830 C  CB    . GLN B 1 169 ? 36.225  -36.032 -7.694  1.00 41.40  ? 151 GLN B CB    1 
ATOM   3831 C  CG    . GLN B 1 169 ? 37.060  -34.850 -7.233  1.00 45.28  ? 151 GLN B CG    1 
ATOM   3832 C  CD    . GLN B 1 169 ? 36.199  -33.719 -6.697  1.00 47.82  ? 151 GLN B CD    1 
ATOM   3833 O  OE1   . GLN B 1 169 ? 35.330  -33.198 -7.398  1.00 47.64  ? 151 GLN B OE1   1 
ATOM   3834 N  NE2   . GLN B 1 169 ? 36.428  -33.343 -5.445  1.00 48.39  ? 151 GLN B NE2   1 
ATOM   3835 N  N     . PRO B 1 170 ? 36.320  -39.369 -7.386  1.00 37.26  ? 152 PRO B N     1 
ATOM   3836 C  CA    . PRO B 1 170 ? 35.558  -40.619 -7.340  1.00 36.96  ? 152 PRO B CA    1 
ATOM   3837 C  C     . PRO B 1 170 ? 34.045  -40.418 -7.434  1.00 38.29  ? 152 PRO B C     1 
ATOM   3838 O  O     . PRO B 1 170 ? 33.393  -41.152 -8.173  1.00 29.90  ? 152 PRO B O     1 
ATOM   3839 C  CB    . PRO B 1 170 ? 35.932  -41.196 -5.975  1.00 39.51  ? 152 PRO B CB    1 
ATOM   3840 C  CG    . PRO B 1 170 ? 37.312  -40.698 -5.744  1.00 41.22  ? 152 PRO B CG    1 
ATOM   3841 C  CD    . PRO B 1 170 ? 37.334  -39.306 -6.319  1.00 39.24  ? 152 PRO B CD    1 
ATOM   3842 N  N     . HIS B 1 171 ? 33.503  -39.435 -6.717  1.00 38.22  ? 153 HIS B N     1 
ATOM   3843 C  CA    . HIS B 1 171 ? 32.054  -39.232 -6.681  1.00 37.89  ? 153 HIS B CA    1 
ATOM   3844 C  C     . HIS B 1 171 ? 31.533  -38.567 -7.951  1.00 38.34  ? 153 HIS B C     1 
ATOM   3845 O  O     . HIS B 1 171 ? 30.330  -38.556 -8.204  1.00 41.71  ? 153 HIS B O     1 
ATOM   3846 C  CB    . HIS B 1 171 ? 31.640  -38.423 -5.447  1.00 38.85  ? 153 HIS B CB    1 
ATOM   3847 C  CG    . HIS B 1 171 ? 32.121  -37.005 -5.461  1.00 38.13  ? 153 HIS B CG    1 
ATOM   3848 N  ND1   . HIS B 1 171 ? 33.359  -36.633 -4.981  1.00 39.78  ? 153 HIS B ND1   1 
ATOM   3849 C  CD2   . HIS B 1 171 ? 31.528  -35.866 -5.893  1.00 35.50  ? 153 HIS B CD2   1 
ATOM   3850 C  CE1   . HIS B 1 171 ? 33.509  -35.327 -5.119  1.00 37.48  ? 153 HIS B CE1   1 
ATOM   3851 N  NE2   . HIS B 1 171 ? 32.412  -34.838 -5.669  1.00 35.86  ? 153 HIS B NE2   1 
ATOM   3852 N  N     . VAL B 1 172 ? 32.442  -38.011 -8.744  1.00 35.76  ? 154 VAL B N     1 
ATOM   3853 C  CA    . VAL B 1 172 ? 32.075  -37.422 -10.025 1.00 30.38  ? 154 VAL B CA    1 
ATOM   3854 C  C     . VAL B 1 172 ? 32.307  -38.424 -11.157 1.00 29.68  ? 154 VAL B C     1 
ATOM   3855 O  O     . VAL B 1 172 ? 31.442  -38.622 -12.006 1.00 27.70  ? 154 VAL B O     1 
ATOM   3856 C  CB    . VAL B 1 172 ? 32.857  -36.119 -10.297 1.00 30.66  ? 154 VAL B CB    1 
ATOM   3857 C  CG1   . VAL B 1 172 ? 32.489  -35.543 -11.657 1.00 25.50  ? 154 VAL B CG1   1 
ATOM   3858 C  CG2   . VAL B 1 172 ? 32.587  -35.103 -9.200  1.00 31.45  ? 154 VAL B CG2   1 
ATOM   3859 N  N     . TRP B 1 173 ? 33.470  -39.070 -11.155 1.00 32.22  ? 155 TRP B N     1 
ATOM   3860 C  CA    . TRP B 1 173 ? 33.784  -40.062 -12.180 1.00 31.04  ? 155 TRP B CA    1 
ATOM   3861 C  C     . TRP B 1 173 ? 32.800  -41.238 -12.152 1.00 32.54  ? 155 TRP B C     1 
ATOM   3862 O  O     . TRP B 1 173 ? 32.508  -41.841 -13.188 1.00 33.25  ? 155 TRP B O     1 
ATOM   3863 C  CB    . TRP B 1 173 ? 35.225  -40.555 -12.046 1.00 29.55  ? 155 TRP B CB    1 
ATOM   3864 C  CG    . TRP B 1 173 ? 35.628  -41.455 -13.173 1.00 29.77  ? 155 TRP B CG    1 
ATOM   3865 C  CD1   . TRP B 1 173 ? 35.845  -42.802 -13.112 1.00 30.43  ? 155 TRP B CD1   1 
ATOM   3866 C  CD2   . TRP B 1 173 ? 35.837  -41.075 -14.542 1.00 27.17  ? 155 TRP B CD2   1 
ATOM   3867 N  NE1   . TRP B 1 173 ? 36.187  -43.282 -14.356 1.00 29.97  ? 155 TRP B NE1   1 
ATOM   3868 C  CE2   . TRP B 1 173 ? 36.187  -42.243 -15.251 1.00 28.08  ? 155 TRP B CE2   1 
ATOM   3869 C  CE3   . TRP B 1 173 ? 35.763  -39.860 -15.236 1.00 27.14  ? 155 TRP B CE3   1 
ATOM   3870 C  CZ2   . TRP B 1 173 ? 36.466  -42.234 -16.621 1.00 27.73  ? 155 TRP B CZ2   1 
ATOM   3871 C  CZ3   . TRP B 1 173 ? 36.040  -39.852 -16.598 1.00 26.71  ? 155 TRP B CZ3   1 
ATOM   3872 C  CH2   . TRP B 1 173 ? 36.387  -41.033 -17.274 1.00 26.32  ? 155 TRP B CH2   1 
ATOM   3873 N  N     . SER B 1 174 ? 32.286  -41.544 -10.964 1.00 28.77  ? 156 SER B N     1 
ATOM   3874 C  CA    . SER B 1 174 ? 31.238  -42.548 -10.799 1.00 31.80  ? 156 SER B CA    1 
ATOM   3875 C  C     . SER B 1 174 ? 30.006  -42.277 -11.682 1.00 32.66  ? 156 SER B C     1 
ATOM   3876 O  O     . SER B 1 174 ? 29.356  -43.213 -12.160 1.00 35.36  ? 156 SER B O     1 
ATOM   3877 C  CB    . SER B 1 174 ? 30.835  -42.648 -9.323  1.00 37.05  ? 156 SER B CB    1 
ATOM   3878 O  OG    . SER B 1 174 ? 29.445  -42.870 -9.177  1.00 42.74  ? 156 SER B OG    1 
ATOM   3879 N  N     . LEU B 1 175 ? 29.693  -41.001 -11.900 1.00 28.05  ? 157 LEU B N     1 
ATOM   3880 C  CA    . LEU B 1 175 ? 28.586  -40.628 -12.779 1.00 26.48  ? 157 LEU B CA    1 
ATOM   3881 C  C     . LEU B 1 175 ? 28.906  -40.949 -14.241 1.00 24.58  ? 157 LEU B C     1 
ATOM   3882 O  O     . LEU B 1 175 ? 28.013  -41.261 -15.025 1.00 22.00  ? 157 LEU B O     1 
ATOM   3883 C  CB    . LEU B 1 175 ? 28.236  -39.143 -12.632 1.00 24.96  ? 157 LEU B CB    1 
ATOM   3884 C  CG    . LEU B 1 175 ? 27.811  -38.650 -11.242 1.00 27.14  ? 157 LEU B CG    1 
ATOM   3885 C  CD1   . LEU B 1 175 ? 27.375  -37.199 -11.312 1.00 25.25  ? 157 LEU B CD1   1 
ATOM   3886 C  CD2   . LEU B 1 175 ? 26.707  -39.518 -10.661 1.00 26.92  ? 157 LEU B CD2   1 
ATOM   3887 N  N     . VAL B 1 176 ? 30.185  -40.865 -14.597 1.00 23.13  ? 158 VAL B N     1 
ATOM   3888 C  CA    . VAL B 1 176 ? 30.632  -41.214 -15.941 1.00 23.79  ? 158 VAL B CA    1 
ATOM   3889 C  C     . VAL B 1 176 ? 30.549  -42.724 -16.170 1.00 26.99  ? 158 VAL B C     1 
ATOM   3890 O  O     . VAL B 1 176 ? 30.079  -43.177 -17.218 1.00 25.66  ? 158 VAL B O     1 
ATOM   3891 C  CB    . VAL B 1 176 ? 32.075  -40.713 -16.216 1.00 20.78  ? 158 VAL B CB    1 
ATOM   3892 C  CG1   . VAL B 1 176 ? 32.559  -41.190 -17.583 1.00 20.45  ? 158 VAL B CG1   1 
ATOM   3893 C  CG2   . VAL B 1 176 ? 32.130  -39.193 -16.135 1.00 20.78  ? 158 VAL B CG2   1 
ATOM   3894 N  N     . GLU B 1 177 ? 30.981  -43.492 -15.173 1.00 23.12  ? 159 GLU B N     1 
ATOM   3895 C  CA    . GLU B 1 177 ? 31.016  -44.948 -15.277 1.00 24.34  ? 159 GLU B CA    1 
ATOM   3896 C  C     . GLU B 1 177 ? 29.641  -45.613 -15.348 1.00 25.13  ? 159 GLU B C     1 
ATOM   3897 O  O     . GLU B 1 177 ? 29.476  -46.626 -16.034 1.00 25.71  ? 159 GLU B O     1 
ATOM   3898 C  CB    . GLU B 1 177 ? 31.855  -45.555 -14.148 1.00 28.76  ? 159 GLU B CB    1 
ATOM   3899 C  CG    . GLU B 1 177 ? 33.311  -45.113 -14.185 1.00 36.80  ? 159 GLU B CG    1 
ATOM   3900 C  CD    . GLU B 1 177 ? 34.267  -46.161 -13.646 1.00 49.34  ? 159 GLU B CD    1 
ATOM   3901 O  OE1   . GLU B 1 177 ? 34.817  -46.939 -14.461 1.00 55.35  ? 159 GLU B OE1   1 
ATOM   3902 O  OE2   . GLU B 1 177 ? 34.474  -46.201 -12.413 1.00 51.59  ? 159 GLU B OE2   1 
ATOM   3903 N  N     . LYS B 1 178 ? 28.655  -45.051 -14.657 1.00 24.12  ? 160 LYS B N     1 
ATOM   3904 C  CA    . LYS B 1 178 ? 27.311  -45.632 -14.677 1.00 30.07  ? 160 LYS B CA    1 
ATOM   3905 C  C     . LYS B 1 178 ? 26.537  -45.269 -15.947 1.00 25.76  ? 160 LYS B C     1 
ATOM   3906 O  O     . LYS B 1 178 ? 25.576  -45.945 -16.303 1.00 25.74  ? 160 LYS B O     1 
ATOM   3907 C  CB    . LYS B 1 178 ? 26.506  -45.209 -13.443 1.00 32.20  ? 160 LYS B CB    1 
ATOM   3908 C  CG    . LYS B 1 178 ? 26.144  -43.735 -13.427 1.00 33.66  ? 160 LYS B CG    1 
ATOM   3909 C  CD    . LYS B 1 178 ? 25.119  -43.404 -12.347 1.00 38.14  ? 160 LYS B CD    1 
ATOM   3910 C  CE    . LYS B 1 178 ? 25.680  -43.598 -10.950 1.00 41.42  ? 160 LYS B CE    1 
ATOM   3911 N  NZ    . LYS B 1 178 ? 24.700  -43.176 -9.902  1.00 43.80  ? 160 LYS B NZ    1 
ATOM   3912 N  N     . ALA B 1 179 ? 26.946  -44.201 -16.624 1.00 21.49  ? 161 ALA B N     1 
ATOM   3913 C  CA    . ALA B 1 179 ? 26.256  -43.774 -17.840 1.00 20.95  ? 161 ALA B CA    1 
ATOM   3914 C  C     . ALA B 1 179 ? 26.584  -44.659 -19.039 1.00 22.00  ? 161 ALA B C     1 
ATOM   3915 O  O     . ALA B 1 179 ? 27.692  -45.179 -19.151 1.00 23.37  ? 161 ALA B O     1 
ATOM   3916 C  CB    . ALA B 1 179 ? 26.574  -42.314 -18.156 1.00 19.17  ? 161 ALA B CB    1 
ATOM   3917 N  N     . GLN B 1 180 ? 25.616  -44.834 -19.931 1.00 19.99  ? 162 GLN B N     1 
ATOM   3918 C  CA    . GLN B 1 180 ? 25.842  -45.609 -21.148 1.00 22.39  ? 162 GLN B CA    1 
ATOM   3919 C  C     . GLN B 1 180 ? 25.740  -44.714 -22.383 1.00 21.43  ? 162 GLN B C     1 
ATOM   3920 O  O     . GLN B 1 180 ? 26.067  -45.132 -23.494 1.00 20.29  ? 162 GLN B O     1 
ATOM   3921 C  CB    . GLN B 1 180 ? 24.842  -46.760 -21.245 1.00 23.36  ? 162 GLN B CB    1 
ATOM   3922 C  CG    . GLN B 1 180 ? 24.737  -47.593 -19.974 1.00 29.82  ? 162 GLN B CG    1 
ATOM   3923 C  CD    . GLN B 1 180 ? 26.047  -48.266 -19.595 1.00 31.59  ? 162 GLN B CD    1 
ATOM   3924 O  OE1   . GLN B 1 180 ? 26.776  -48.765 -20.455 1.00 28.85  ? 162 GLN B OE1   1 
ATOM   3925 N  NE2   . GLN B 1 180 ? 26.349  -48.286 -18.297 1.00 32.04  ? 162 GLN B NE2   1 
ATOM   3926 N  N     . VAL B 1 181 ? 25.281  -43.482 -22.165 1.00 19.01  ? 163 VAL B N     1 
ATOM   3927 C  CA    . VAL B 1 181 ? 25.096  -42.498 -23.227 1.00 18.08  ? 163 VAL B CA    1 
ATOM   3928 C  C     . VAL B 1 181 ? 25.698  -41.165 -22.797 1.00 19.45  ? 163 VAL B C     1 
ATOM   3929 O  O     . VAL B 1 181 ? 25.445  -40.690 -21.686 1.00 20.91  ? 163 VAL B O     1 
ATOM   3930 C  CB    . VAL B 1 181 ? 23.599  -42.285 -23.537 1.00 18.72  ? 163 VAL B CB    1 
ATOM   3931 C  CG1   . VAL B 1 181 ? 23.413  -41.200 -24.590 1.00 19.32  ? 163 VAL B CG1   1 
ATOM   3932 C  CG2   . VAL B 1 181 ? 22.955  -43.587 -23.992 1.00 19.67  ? 163 VAL B CG2   1 
ATOM   3933 N  N     . TYR B 1 182 ? 26.502  -40.569 -23.671 1.00 18.58  ? 164 TYR B N     1 
ATOM   3934 C  CA    . TYR B 1 182 ? 27.105  -39.271 -23.393 1.00 17.60  ? 164 TYR B CA    1 
ATOM   3935 C  C     . TYR B 1 182 ? 26.689  -38.231 -24.432 1.00 19.13  ? 164 TYR B C     1 
ATOM   3936 O  O     . TYR B 1 182 ? 26.524  -38.543 -25.618 1.00 17.55  ? 164 TYR B O     1 
ATOM   3937 C  CB    . TYR B 1 182 ? 28.635  -39.379 -23.339 1.00 18.39  ? 164 TYR B CB    1 
ATOM   3938 C  CG    . TYR B 1 182 ? 29.134  -40.412 -22.353 1.00 21.42  ? 164 TYR B CG    1 
ATOM   3939 C  CD1   . TYR B 1 182 ? 29.152  -40.147 -20.988 1.00 21.51  ? 164 TYR B CD1   1 
ATOM   3940 C  CD2   . TYR B 1 182 ? 29.579  -41.659 -22.786 1.00 22.98  ? 164 TYR B CD2   1 
ATOM   3941 C  CE1   . TYR B 1 182 ? 29.602  -41.093 -20.078 1.00 23.58  ? 164 TYR B CE1   1 
ATOM   3942 C  CE2   . TYR B 1 182 ? 30.034  -42.614 -21.883 1.00 26.75  ? 164 TYR B CE2   1 
ATOM   3943 C  CZ    . TYR B 1 182 ? 30.041  -42.322 -20.529 1.00 25.94  ? 164 TYR B CZ    1 
ATOM   3944 O  OH    . TYR B 1 182 ? 30.484  -43.259 -19.624 1.00 26.29  ? 164 TYR B OH    1 
ATOM   3945 N  N     . TYR B 1 183 ? 26.498  -36.998 -23.971 1.00 18.09  ? 165 TYR B N     1 
ATOM   3946 C  CA    . TYR B 1 183 ? 26.317  -35.866 -24.867 1.00 17.01  ? 165 TYR B CA    1 
ATOM   3947 C  C     . TYR B 1 183 ? 27.227  -34.734 -24.417 1.00 19.73  ? 165 TYR B C     1 
ATOM   3948 O  O     . TYR B 1 183 ? 27.173  -34.316 -23.259 1.00 19.55  ? 165 TYR B O     1 
ATOM   3949 C  CB    . TYR B 1 183 ? 24.863  -35.388 -24.884 1.00 14.45  ? 165 TYR B CB    1 
ATOM   3950 C  CG    . TYR B 1 183 ? 24.614  -34.288 -25.898 1.00 14.98  ? 165 TYR B CG    1 
ATOM   3951 C  CD1   . TYR B 1 183 ? 24.361  -34.591 -27.233 1.00 14.88  ? 165 TYR B CD1   1 
ATOM   3952 C  CD2   . TYR B 1 183 ? 24.654  -32.947 -25.527 1.00 17.33  ? 165 TYR B CD2   1 
ATOM   3953 C  CE1   . TYR B 1 183 ? 24.141  -33.592 -28.169 1.00 16.40  ? 165 TYR B CE1   1 
ATOM   3954 C  CE2   . TYR B 1 183 ? 24.431  -31.939 -26.456 1.00 18.60  ? 165 TYR B CE2   1 
ATOM   3955 C  CZ    . TYR B 1 183 ? 24.168  -32.267 -27.772 1.00 18.05  ? 165 TYR B CZ    1 
ATOM   3956 O  OH    . TYR B 1 183 ? 23.949  -31.268 -28.692 1.00 18.96  ? 165 TYR B OH    1 
ATOM   3957 N  N     . ILE B 1 184 ? 28.081  -34.261 -25.321 1.00 18.47  ? 166 ILE B N     1 
ATOM   3958 C  CA    . ILE B 1 184 ? 28.945  -33.115 -25.035 1.00 19.11  ? 166 ILE B CA    1 
ATOM   3959 C  C     . ILE B 1 184 ? 29.008  -32.224 -26.269 1.00 18.24  ? 166 ILE B C     1 
ATOM   3960 O  O     . ILE B 1 184 ? 29.344  -32.688 -27.356 1.00 19.51  ? 166 ILE B O     1 
ATOM   3961 C  CB    . ILE B 1 184 ? 30.386  -33.538 -24.642 1.00 21.31  ? 166 ILE B CB    1 
ATOM   3962 C  CG1   . ILE B 1 184 ? 30.378  -34.519 -23.467 1.00 17.15  ? 166 ILE B CG1   1 
ATOM   3963 C  CG2   . ILE B 1 184 ? 31.222  -32.320 -24.276 1.00 19.01  ? 166 ILE B CG2   1 
ATOM   3964 C  CD1   . ILE B 1 184 ? 31.757  -34.990 -23.058 1.00 16.84  ? 166 ILE B CD1   1 
ATOM   3965 N  N     . ALA B 1 185 ? 28.669  -30.949 -26.103 1.00 19.54  ? 167 ALA B N     1 
ATOM   3966 C  CA    . ALA B 1 185 ? 28.731  -29.992 -27.210 1.00 17.61  ? 167 ALA B CA    1 
ATOM   3967 C  C     . ALA B 1 185 ? 30.171  -29.628 -27.539 1.00 20.16  ? 167 ALA B C     1 
ATOM   3968 O  O     . ALA B 1 185 ? 31.043  -29.635 -26.660 1.00 21.64  ? 167 ALA B O     1 
ATOM   3969 C  CB    . ALA B 1 185 ? 27.927  -28.739 -26.882 1.00 15.63  ? 167 ALA B CB    1 
ATOM   3970 N  N     . GLY B 1 186 ? 30.416  -29.308 -28.806 1.00 18.17  ? 168 GLY B N     1 
ATOM   3971 C  CA    . GLY B 1 186 ? 31.731  -28.879 -29.245 1.00 18.66  ? 168 GLY B CA    1 
ATOM   3972 C  C     . GLY B 1 186 ? 32.239  -27.651 -28.506 1.00 21.21  ? 168 GLY B C     1 
ATOM   3973 O  O     . GLY B 1 186 ? 33.447  -27.430 -28.439 1.00 22.00  ? 168 GLY B O     1 
ATOM   3974 N  N     . PHE B 1 187 ? 31.322  -26.857 -27.950 1.00 16.68  ? 169 PHE B N     1 
ATOM   3975 C  CA    . PHE B 1 187 ? 31.685  -25.674 -27.162 1.00 18.67  ? 169 PHE B CA    1 
ATOM   3976 C  C     . PHE B 1 187 ? 32.619  -26.010 -26.001 1.00 21.75  ? 169 PHE B C     1 
ATOM   3977 O  O     . PHE B 1 187 ? 33.358  -25.151 -25.521 1.00 24.77  ? 169 PHE B O     1 
ATOM   3978 C  CB    . PHE B 1 187 ? 30.437  -24.981 -26.591 1.00 16.48  ? 169 PHE B CB    1 
ATOM   3979 C  CG    . PHE B 1 187 ? 29.613  -24.237 -27.611 1.00 17.16  ? 169 PHE B CG    1 
ATOM   3980 C  CD1   . PHE B 1 187 ? 28.279  -24.563 -27.813 1.00 17.82  ? 169 PHE B CD1   1 
ATOM   3981 C  CD2   . PHE B 1 187 ? 30.169  -23.209 -28.363 1.00 16.99  ? 169 PHE B CD2   1 
ATOM   3982 C  CE1   . PHE B 1 187 ? 27.509  -23.877 -28.748 1.00 14.90  ? 169 PHE B CE1   1 
ATOM   3983 C  CE2   . PHE B 1 187 ? 29.406  -22.515 -29.296 1.00 18.72  ? 169 PHE B CE2   1 
ATOM   3984 C  CZ    . PHE B 1 187 ? 28.074  -22.852 -29.487 1.00 21.90  ? 169 PHE B CZ    1 
ATOM   3985 N  N     . VAL B 1 188 ? 32.576  -27.259 -25.542 1.00 21.41  ? 170 VAL B N     1 
ATOM   3986 C  CA    . VAL B 1 188 ? 33.341  -27.666 -24.367 1.00 20.67  ? 170 VAL B CA    1 
ATOM   3987 C  C     . VAL B 1 188 ? 34.831  -27.796 -24.700 1.00 20.15  ? 170 VAL B C     1 
ATOM   3988 O  O     . VAL B 1 188 ? 35.681  -27.872 -23.810 1.00 23.49  ? 170 VAL B O     1 
ATOM   3989 C  CB    . VAL B 1 188 ? 32.752  -28.953 -23.744 1.00 21.26  ? 170 VAL B CB    1 
ATOM   3990 C  CG1   . VAL B 1 188 ? 33.471  -29.334 -22.449 1.00 24.75  ? 170 VAL B CG1   1 
ATOM   3991 C  CG2   . VAL B 1 188 ? 31.279  -28.751 -23.466 1.00 16.80  ? 170 VAL B CG2   1 
ATOM   3992 N  N     . ILE B 1 189 ? 35.148  -27.780 -25.990 1.00 19.30  ? 171 ILE B N     1 
ATOM   3993 C  CA    . ILE B 1 189 ? 36.543  -27.750 -26.431 1.00 23.02  ? 171 ILE B CA    1 
ATOM   3994 C  C     . ILE B 1 189 ? 37.321  -26.549 -25.863 1.00 24.70  ? 171 ILE B C     1 
ATOM   3995 O  O     . ILE B 1 189 ? 38.493  -26.679 -25.504 1.00 26.11  ? 171 ILE B O     1 
ATOM   3996 C  CB    . ILE B 1 189 ? 36.641  -27.787 -27.973 1.00 22.79  ? 171 ILE B CB    1 
ATOM   3997 C  CG1   . ILE B 1 189 ? 36.071  -29.107 -28.502 1.00 17.39  ? 171 ILE B CG1   1 
ATOM   3998 C  CG2   . ILE B 1 189 ? 38.083  -27.603 -28.433 1.00 23.04  ? 171 ILE B CG2   1 
ATOM   3999 C  CD1   . ILE B 1 189 ? 35.986  -29.174 -30.009 1.00 17.73  ? 171 ILE B CD1   1 
ATOM   4000 N  N     . ASN B 1 190 ? 36.660  -25.395 -25.757 1.00 24.57  ? 172 ASN B N     1 
ATOM   4001 C  CA    . ASN B 1 190 ? 37.303  -24.180 -25.244 1.00 27.59  ? 172 ASN B CA    1 
ATOM   4002 C  C     . ASN B 1 190 ? 37.488  -24.128 -23.729 1.00 27.44  ? 172 ASN B C     1 
ATOM   4003 O  O     . ASN B 1 190 ? 38.285  -23.332 -23.232 1.00 27.80  ? 172 ASN B O     1 
ATOM   4004 C  CB    . ASN B 1 190 ? 36.532  -22.923 -25.663 1.00 31.42  ? 172 ASN B CB    1 
ATOM   4005 C  CG    . ASN B 1 190 ? 36.464  -22.744 -27.164 1.00 32.88  ? 172 ASN B CG    1 
ATOM   4006 O  OD1   . ASN B 1 190 ? 35.458  -22.267 -27.692 1.00 32.86  ? 172 ASN B OD1   1 
ATOM   4007 N  ND2   . ASN B 1 190 ? 37.530  -23.129 -27.861 1.00 32.77  ? 172 ASN B ND2   1 
ATOM   4008 N  N     . THR B 1 191 ? 36.749  -24.953 -22.991 1.00 26.46  ? 173 THR B N     1 
ATOM   4009 C  CA    . THR B 1 191 ? 36.756  -24.850 -21.532 1.00 28.54  ? 173 THR B CA    1 
ATOM   4010 C  C     . THR B 1 191 ? 37.438  -26.020 -20.819 1.00 30.39  ? 173 THR B C     1 
ATOM   4011 O  O     . THR B 1 191 ? 38.093  -25.824 -19.790 1.00 30.79  ? 173 THR B O     1 
ATOM   4012 C  CB    . THR B 1 191 ? 35.334  -24.669 -20.971 1.00 28.30  ? 173 THR B CB    1 
ATOM   4013 O  OG1   . THR B 1 191 ? 34.484  -25.699 -21.488 1.00 27.74  ? 173 THR B OG1   1 
ATOM   4014 C  CG2   . THR B 1 191 ? 34.772  -23.301 -21.354 1.00 26.38  ? 173 THR B CG2   1 
ATOM   4015 N  N     . CYS B 1 192 ? 37.278  -27.228 -21.357 1.00 29.43  ? 174 CYS B N     1 
ATOM   4016 C  CA    . CYS B 1 192 ? 37.893  -28.419 -20.767 1.00 27.00  ? 174 CYS B CA    1 
ATOM   4017 C  C     . CYS B 1 192 ? 38.018  -29.554 -21.776 1.00 25.32  ? 174 CYS B C     1 
ATOM   4018 O  O     . CYS B 1 192 ? 37.295  -30.553 -21.697 1.00 23.89  ? 174 CYS B O     1 
ATOM   4019 C  CB    . CYS B 1 192 ? 37.101  -28.899 -19.549 1.00 25.56  ? 174 CYS B CB    1 
ATOM   4020 S  SG    . CYS B 1 192 ? 37.893  -30.244 -18.624 1.00 33.05  ? 174 CYS B SG    1 
ATOM   4021 N  N     . TYR B 1 193 ? 38.938  -29.401 -22.721 1.00 25.19  ? 175 TYR B N     1 
ATOM   4022 C  CA    . TYR B 1 193 ? 39.133  -30.419 -23.743 1.00 27.20  ? 175 TYR B CA    1 
ATOM   4023 C  C     . TYR B 1 193 ? 39.688  -31.712 -23.153 1.00 27.47  ? 175 TYR B C     1 
ATOM   4024 O  O     . TYR B 1 193 ? 39.264  -32.803 -23.529 1.00 24.43  ? 175 TYR B O     1 
ATOM   4025 C  CB    . TYR B 1 193 ? 40.055  -29.926 -24.856 1.00 20.83  ? 175 TYR B CB    1 
ATOM   4026 C  CG    . TYR B 1 193 ? 40.225  -30.959 -25.943 1.00 21.00  ? 175 TYR B CG    1 
ATOM   4027 C  CD1   . TYR B 1 193 ? 39.156  -31.307 -26.762 1.00 23.48  ? 175 TYR B CD1   1 
ATOM   4028 C  CD2   . TYR B 1 193 ? 41.439  -31.604 -26.138 1.00 23.31  ? 175 TYR B CD2   1 
ATOM   4029 C  CE1   . TYR B 1 193 ? 39.292  -32.257 -27.753 1.00 24.41  ? 175 TYR B CE1   1 
ATOM   4030 C  CE2   . TYR B 1 193 ? 41.586  -32.558 -27.131 1.00 27.23  ? 175 TYR B CE2   1 
ATOM   4031 C  CZ    . TYR B 1 193 ? 40.508  -32.877 -27.939 1.00 27.97  ? 175 TYR B CZ    1 
ATOM   4032 O  OH    . TYR B 1 193 ? 40.638  -33.822 -28.930 1.00 29.89  ? 175 TYR B OH    1 
ATOM   4033 N  N     . GLU B 1 194 ? 40.643  -31.575 -22.238 1.00 28.32  ? 176 GLU B N     1 
ATOM   4034 C  CA    . GLU B 1 194 ? 41.229  -32.721 -21.556 1.00 33.89  ? 176 GLU B CA    1 
ATOM   4035 C  C     . GLU B 1 194 ? 40.144  -33.592 -20.920 1.00 32.07  ? 176 GLU B C     1 
ATOM   4036 O  O     . GLU B 1 194 ? 40.197  -34.818 -20.994 1.00 33.68  ? 176 GLU B O     1 
ATOM   4037 C  CB    . GLU B 1 194 ? 42.251  -32.256 -20.509 1.00 42.77  ? 176 GLU B CB    1 
ATOM   4038 C  CG    . GLU B 1 194 ? 41.836  -30.989 -19.753 1.00 54.75  ? 176 GLU B CG    1 
ATOM   4039 C  CD    . GLU B 1 194 ? 42.843  -30.564 -18.687 1.00 65.56  ? 176 GLU B CD    1 
ATOM   4040 O  OE1   . GLU B 1 194 ? 44.015  -30.998 -18.760 1.00 69.52  ? 176 GLU B OE1   1 
ATOM   4041 O  OE2   . GLU B 1 194 ? 42.457  -29.797 -17.772 1.00 67.34  ? 176 GLU B OE2   1 
ATOM   4042 N  N     . GLY B 1 195 ? 39.143  -32.946 -20.331 1.00 28.66  ? 177 GLY B N     1 
ATOM   4043 C  CA    . GLY B 1 195 ? 38.051  -33.645 -19.679 1.00 25.08  ? 177 GLY B CA    1 
ATOM   4044 C  C     . GLY B 1 195 ? 37.128  -34.394 -20.621 1.00 23.96  ? 177 GLY B C     1 
ATOM   4045 O  O     . GLY B 1 195 ? 36.804  -35.551 -20.380 1.00 23.48  ? 177 GLY B O     1 
ATOM   4046 N  N     . MET B 1 196 ? 36.696  -33.739 -21.694 1.00 24.93  ? 178 MET B N     1 
ATOM   4047 C  CA    . MET B 1 196 ? 35.789  -34.373 -22.646 1.00 24.82  ? 178 MET B CA    1 
ATOM   4048 C  C     . MET B 1 196 ? 36.499  -35.474 -23.433 1.00 26.05  ? 178 MET B C     1 
ATOM   4049 O  O     . MET B 1 196 ? 35.876  -36.452 -23.843 1.00 25.03  ? 178 MET B O     1 
ATOM   4050 C  CB    . MET B 1 196 ? 35.155  -33.341 -23.594 1.00 22.47  ? 178 MET B CB    1 
ATOM   4051 C  CG    . MET B 1 196 ? 36.140  -32.600 -24.492 1.00 23.79  ? 178 MET B CG    1 
ATOM   4052 S  SD    . MET B 1 196 ? 35.415  -31.150 -25.316 1.00 22.91  ? 178 MET B SD    1 
ATOM   4053 C  CE    . MET B 1 196 ? 34.306  -31.915 -26.494 1.00 15.67  ? 178 MET B CE    1 
ATOM   4054 N  N     . LEU B 1 197 ? 37.805  -35.319 -23.630 1.00 23.98  ? 179 LEU B N     1 
ATOM   4055 C  CA    . LEU B 1 197 ? 38.581  -36.340 -24.314 1.00 24.43  ? 179 LEU B CA    1 
ATOM   4056 C  C     . LEU B 1 197 ? 38.650  -37.615 -23.470 1.00 26.20  ? 179 LEU B C     1 
ATOM   4057 O  O     . LEU B 1 197 ? 38.535  -38.720 -23.999 1.00 26.85  ? 179 LEU B O     1 
ATOM   4058 C  CB    . LEU B 1 197 ? 39.987  -35.830 -24.645 1.00 26.27  ? 179 LEU B CB    1 
ATOM   4059 C  CG    . LEU B 1 197 ? 40.890  -36.795 -25.422 1.00 29.17  ? 179 LEU B CG    1 
ATOM   4060 C  CD1   . LEU B 1 197 ? 40.249  -37.167 -26.755 1.00 30.06  ? 179 LEU B CD1   1 
ATOM   4061 C  CD2   . LEU B 1 197 ? 42.278  -36.205 -25.640 1.00 27.56  ? 179 LEU B CD2   1 
ATOM   4062 N  N     . LYS B 1 198 ? 38.828  -37.453 -22.160 1.00 26.37  ? 180 LYS B N     1 
ATOM   4063 C  CA    . LYS B 1 198 ? 38.939  -38.596 -21.253 1.00 28.19  ? 180 LYS B CA    1 
ATOM   4064 C  C     . LYS B 1 198 ? 37.630  -39.369 -21.203 1.00 24.61  ? 180 LYS B C     1 
ATOM   4065 O  O     . LYS B 1 198 ? 37.622  -40.596 -21.128 1.00 26.44  ? 180 LYS B O     1 
ATOM   4066 C  CB    . LYS B 1 198 ? 39.342  -38.154 -19.842 1.00 28.62  ? 180 LYS B CB    1 
ATOM   4067 C  CG    . LYS B 1 198 ? 39.727  -39.311 -18.918 1.00 32.60  ? 180 LYS B CG    1 
ATOM   4068 C  CD    . LYS B 1 198 ? 39.972  -38.827 -17.493 1.00 39.72  ? 180 LYS B CD    1 
ATOM   4069 C  CE    . LYS B 1 198 ? 40.477  -39.946 -16.591 1.00 45.34  ? 180 LYS B CE    1 
ATOM   4070 N  NZ    . LYS B 1 198 ? 41.784  -40.493 -17.062 1.00 49.31  ? 180 LYS B NZ    1 
ATOM   4071 N  N     . ILE B 1 199 ? 36.520  -38.645 -21.250 1.00 23.46  ? 181 ILE B N     1 
ATOM   4072 C  CA    . ILE B 1 199 ? 35.211  -39.282 -21.281 1.00 23.32  ? 181 ILE B CA    1 
ATOM   4073 C  C     . ILE B 1 199 ? 34.984  -40.022 -22.606 1.00 21.56  ? 181 ILE B C     1 
ATOM   4074 O  O     . ILE B 1 199 ? 34.467  -41.137 -22.623 1.00 21.35  ? 181 ILE B O     1 
ATOM   4075 C  CB    . ILE B 1 199 ? 34.092  -38.260 -21.012 1.00 21.59  ? 181 ILE B CB    1 
ATOM   4076 C  CG1   . ILE B 1 199 ? 34.156  -37.804 -19.550 1.00 24.27  ? 181 ILE B CG1   1 
ATOM   4077 C  CG2   . ILE B 1 199 ? 32.724  -38.855 -21.316 1.00 21.99  ? 181 ILE B CG2   1 
ATOM   4078 C  CD1   . ILE B 1 199 ? 33.169  -36.710 -19.192 1.00 23.33  ? 181 ILE B CD1   1 
ATOM   4079 N  N     . ALA B 1 200 ? 35.392  -39.401 -23.707 1.00 19.48  ? 182 ALA B N     1 
ATOM   4080 C  CA    . ALA B 1 200 ? 35.228  -39.995 -25.024 1.00 18.93  ? 182 ALA B CA    1 
ATOM   4081 C  C     . ALA B 1 200 ? 36.014  -41.296 -25.139 1.00 20.67  ? 182 ALA B C     1 
ATOM   4082 O  O     . ALA B 1 200 ? 35.500  -42.295 -25.648 1.00 21.81  ? 182 ALA B O     1 
ATOM   4083 C  CB    . ALA B 1 200 ? 35.647  -39.013 -26.107 1.00 19.52  ? 182 ALA B CB    1 
ATOM   4084 N  N     . LYS B 1 201 ? 37.253  -41.287 -24.655 1.00 21.50  ? 183 LYS B N     1 
ATOM   4085 C  CA    . LYS B 1 201 ? 38.079  -42.493 -24.655 1.00 26.95  ? 183 LYS B CA    1 
ATOM   4086 C  C     . LYS B 1 201 ? 37.443  -43.597 -23.822 1.00 27.71  ? 183 LYS B C     1 
ATOM   4087 O  O     . LYS B 1 201 ? 37.480  -44.768 -24.198 1.00 27.13  ? 183 LYS B O     1 
ATOM   4088 C  CB    . LYS B 1 201 ? 39.489  -42.190 -24.141 1.00 31.07  ? 183 LYS B CB    1 
ATOM   4089 C  CG    . LYS B 1 201 ? 40.345  -41.413 -25.131 1.00 32.41  ? 183 LYS B CG    1 
ATOM   4090 C  CD    . LYS B 1 201 ? 41.727  -41.104 -24.571 1.00 33.17  ? 183 LYS B CD    1 
ATOM   4091 C  CE    . LYS B 1 201 ? 42.554  -40.320 -25.580 1.00 34.66  ? 183 LYS B CE    1 
ATOM   4092 N  NZ    . LYS B 1 201 ? 43.846  -39.859 -25.014 1.00 37.82  ? 183 LYS B NZ    1 
ATOM   4093 N  N     . HIS B 1 202 ? 36.851  -43.212 -22.694 1.00 27.33  ? 184 HIS B N     1 
ATOM   4094 C  CA    . HIS B 1 202 ? 36.180  -44.160 -21.816 1.00 27.72  ? 184 HIS B CA    1 
ATOM   4095 C  C     . HIS B 1 202 ? 34.940  -44.750 -22.478 1.00 27.11  ? 184 HIS B C     1 
ATOM   4096 O  O     . HIS B 1 202 ? 34.653  -45.937 -22.331 1.00 23.62  ? 184 HIS B O     1 
ATOM   4097 C  CB    . HIS B 1 202 ? 35.780  -43.489 -20.502 1.00 29.95  ? 184 HIS B CB    1 
ATOM   4098 C  CG    . HIS B 1 202 ? 34.749  -44.253 -19.733 1.00 23.10  ? 184 HIS B CG    1 
ATOM   4099 N  ND1   . HIS B 1 202 ? 35.073  -45.257 -18.847 1.00 24.70  ? 184 HIS B ND1   1 
ATOM   4100 C  CD2   . HIS B 1 202 ? 33.398  -44.180 -19.741 1.00 22.11  ? 184 HIS B CD2   1 
ATOM   4101 C  CE1   . HIS B 1 202 ? 33.966  -45.762 -18.332 1.00 26.80  ? 184 HIS B CE1   1 
ATOM   4102 N  NE2   . HIS B 1 202 ? 32.935  -45.126 -18.858 1.00 23.12  ? 184 HIS B NE2   1 
ATOM   4103 N  N     . SER B 1 203 ? 34.204  -43.904 -23.194 1.00 21.23  ? 185 SER B N     1 
ATOM   4104 C  CA    . SER B 1 203 ? 32.996  -44.325 -23.892 1.00 25.80  ? 185 SER B CA    1 
ATOM   4105 C  C     . SER B 1 203 ? 33.289  -45.393 -24.943 1.00 25.81  ? 185 SER B C     1 
ATOM   4106 O  O     . SER B 1 203 ? 32.623  -46.426 -24.988 1.00 24.35  ? 185 SER B O     1 
ATOM   4107 C  CB    . SER B 1 203 ? 32.314  -43.128 -24.562 1.00 22.84  ? 185 SER B CB    1 
ATOM   4108 O  OG    . SER B 1 203 ? 31.192  -43.543 -25.325 1.00 22.25  ? 185 SER B OG    1 
ATOM   4109 N  N     . LEU B 1 204 ? 34.282  -45.130 -25.786 1.00 22.05  ? 186 LEU B N     1 
ATOM   4110 C  CA    . LEU B 1 204 ? 34.618  -46.027 -26.886 1.00 23.16  ? 186 LEU B CA    1 
ATOM   4111 C  C     . LEU B 1 204 ? 35.111  -47.374 -26.362 1.00 27.23  ? 186 LEU B C     1 
ATOM   4112 O  O     . LEU B 1 204 ? 34.714  -48.425 -26.861 1.00 30.27  ? 186 LEU B O     1 
ATOM   4113 C  CB    . LEU B 1 204 ? 35.674  -45.393 -27.795 1.00 23.46  ? 186 LEU B CB    1 
ATOM   4114 C  CG    . LEU B 1 204 ? 35.820  -46.030 -29.177 1.00 29.05  ? 186 LEU B CG    1 
ATOM   4115 C  CD1   . LEU B 1 204 ? 34.513  -45.907 -29.946 1.00 26.26  ? 186 LEU B CD1   1 
ATOM   4116 C  CD2   . LEU B 1 204 ? 36.970  -45.393 -29.952 1.00 28.73  ? 186 LEU B CD2   1 
ATOM   4117 N  N     . GLU B 1 205 ? 35.969  -47.328 -25.347 1.00 27.67  ? 187 GLU B N     1 
ATOM   4118 C  CA    . GLU B 1 205 ? 36.507  -48.532 -24.722 1.00 31.91  ? 187 GLU B CA    1 
ATOM   4119 C  C     . GLU B 1 205 ? 35.405  -49.422 -24.148 1.00 30.46  ? 187 GLU B C     1 
ATOM   4120 O  O     . GLU B 1 205 ? 35.510  -50.646 -24.181 1.00 34.48  ? 187 GLU B O     1 
ATOM   4121 C  CB    . GLU B 1 205 ? 37.506  -48.167 -23.621 1.00 37.68  ? 187 GLU B CB    1 
ATOM   4122 C  CG    . GLU B 1 205 ? 38.885  -48.765 -23.823 1.00 49.72  ? 187 GLU B CG    1 
ATOM   4123 C  CD    . GLU B 1 205 ? 39.486  -49.296 -22.534 1.00 59.07  ? 187 GLU B CD    1 
ATOM   4124 O  OE1   . GLU B 1 205 ? 39.129  -48.778 -21.454 1.00 63.28  ? 187 GLU B OE1   1 
ATOM   4125 O  OE2   . GLU B 1 205 ? 40.308  -50.238 -22.602 1.00 61.65  ? 187 GLU B OE2   1 
ATOM   4126 N  N     . ASN B 1 206 ? 34.347  -48.811 -23.625 1.00 27.58  ? 188 ASN B N     1 
ATOM   4127 C  CA    . ASN B 1 206 ? 33.252  -49.586 -23.049 1.00 30.01  ? 188 ASN B CA    1 
ATOM   4128 C  C     . ASN B 1 206 ? 32.050  -49.743 -23.978 1.00 29.43  ? 188 ASN B C     1 
ATOM   4129 O  O     . ASN B 1 206 ? 30.977  -50.163 -23.548 1.00 25.81  ? 188 ASN B O     1 
ATOM   4130 C  CB    . ASN B 1 206 ? 32.822  -48.999 -21.703 1.00 29.23  ? 188 ASN B CB    1 
ATOM   4131 C  CG    . ASN B 1 206 ? 33.901  -49.125 -20.651 1.00 27.14  ? 188 ASN B CG    1 
ATOM   4132 O  OD1   . ASN B 1 206 ? 34.816  -48.305 -20.584 1.00 28.60  ? 188 ASN B OD1   1 
ATOM   4133 N  ND2   . ASN B 1 206 ? 33.809  -50.165 -19.830 1.00 28.72  ? 188 ASN B ND2   1 
ATOM   4134 N  N     . GLU B 1 207 ? 32.247  -49.411 -25.251 1.00 29.02  ? 189 GLU B N     1 
ATOM   4135 C  CA    . GLU B 1 207 ? 31.205  -49.539 -26.266 1.00 28.03  ? 189 GLU B CA    1 
ATOM   4136 C  C     . GLU B 1 207 ? 29.928  -48.798 -25.882 1.00 25.62  ? 189 GLU B C     1 
ATOM   4137 O  O     . GLU B 1 207 ? 28.816  -49.292 -26.073 1.00 24.83  ? 189 GLU B O     1 
ATOM   4138 C  CB    . GLU B 1 207 ? 30.916  -51.012 -26.582 1.00 28.32  ? 189 GLU B CB    1 
ATOM   4139 C  CG    . GLU B 1 207 ? 32.110  -51.775 -27.154 1.00 35.74  ? 189 GLU B CG    1 
ATOM   4140 C  CD    . GLU B 1 207 ? 32.504  -51.349 -28.575 1.00 43.69  ? 189 GLU B CD    1 
ATOM   4141 O  OE1   . GLU B 1 207 ? 31.977  -50.340 -29.099 1.00 44.44  ? 189 GLU B OE1   1 
ATOM   4142 O  OE2   . GLU B 1 207 ? 33.353  -52.040 -29.175 1.00 48.56  ? 189 GLU B OE2   1 
ATOM   4143 N  N     . LYS B 1 208 ? 30.100  -47.603 -25.338 1.00 24.38  ? 190 LYS B N     1 
ATOM   4144 C  CA    . LYS B 1 208 ? 28.968  -46.763 -24.990 1.00 23.44  ? 190 LYS B CA    1 
ATOM   4145 C  C     . LYS B 1 208 ? 28.622  -45.859 -26.174 1.00 23.71  ? 190 LYS B C     1 
ATOM   4146 O  O     . LYS B 1 208 ? 29.297  -45.899 -27.206 1.00 25.26  ? 190 LYS B O     1 
ATOM   4147 C  CB    . LYS B 1 208 ? 29.283  -45.969 -23.726 1.00 20.47  ? 190 LYS B CB    1 
ATOM   4148 C  CG    . LYS B 1 208 ? 29.471  -46.863 -22.510 1.00 21.71  ? 190 LYS B CG    1 
ATOM   4149 C  CD    . LYS B 1 208 ? 29.881  -46.083 -21.269 1.00 21.48  ? 190 LYS B CD    1 
ATOM   4150 C  CE    . LYS B 1 208 ? 30.062  -47.014 -20.076 1.00 22.98  ? 190 LYS B CE    1 
ATOM   4151 N  NZ    . LYS B 1 208 ? 30.259  -46.271 -18.798 1.00 22.94  ? 190 LYS B NZ    1 
ATOM   4152 N  N     . LEU B 1 209 ? 27.565  -45.065 -26.034 1.00 21.04  ? 191 LEU B N     1 
ATOM   4153 C  CA    . LEU B 1 209 ? 27.107  -44.197 -27.112 1.00 22.03  ? 191 LEU B CA    1 
ATOM   4154 C  C     . LEU B 1 209 ? 27.530  -42.756 -26.858 1.00 24.46  ? 191 LEU B C     1 
ATOM   4155 O  O     . LEU B 1 209 ? 26.980  -42.091 -25.975 1.00 23.66  ? 191 LEU B O     1 
ATOM   4156 C  CB    . LEU B 1 209 ? 25.585  -44.268 -27.243 1.00 22.90  ? 191 LEU B CB    1 
ATOM   4157 C  CG    . LEU B 1 209 ? 24.998  -43.599 -28.493 1.00 20.22  ? 191 LEU B CG    1 
ATOM   4158 C  CD1   . LEU B 1 209 ? 25.095  -44.533 -29.694 1.00 19.28  ? 191 LEU B CD1   1 
ATOM   4159 C  CD2   . LEU B 1 209 ? 23.554  -43.150 -28.268 1.00 19.59  ? 191 LEU B CD2   1 
ATOM   4160 N  N     . PHE B 1 210 ? 28.508  -42.274 -27.622 1.00 23.07  ? 192 PHE B N     1 
ATOM   4161 C  CA    . PHE B 1 210 ? 28.977  -40.900 -27.464 1.00 21.36  ? 192 PHE B CA    1 
ATOM   4162 C  C     . PHE B 1 210 ? 28.401  -39.978 -28.539 1.00 21.42  ? 192 PHE B C     1 
ATOM   4163 O  O     . PHE B 1 210 ? 28.634  -40.178 -29.731 1.00 16.04  ? 192 PHE B O     1 
ATOM   4164 C  CB    . PHE B 1 210 ? 30.505  -40.832 -27.480 1.00 16.67  ? 192 PHE B CB    1 
ATOM   4165 C  CG    . PHE B 1 210 ? 31.052  -39.506 -27.040 1.00 24.07  ? 192 PHE B CG    1 
ATOM   4166 C  CD1   . PHE B 1 210 ? 31.356  -39.279 -25.706 1.00 23.68  ? 192 PHE B CD1   1 
ATOM   4167 C  CD2   . PHE B 1 210 ? 31.258  -38.481 -27.955 1.00 24.01  ? 192 PHE B CD2   1 
ATOM   4168 C  CE1   . PHE B 1 210 ? 31.858  -38.061 -25.293 1.00 22.96  ? 192 PHE B CE1   1 
ATOM   4169 C  CE2   . PHE B 1 210 ? 31.757  -37.260 -27.545 1.00 21.97  ? 192 PHE B CE2   1 
ATOM   4170 C  CZ    . PHE B 1 210 ? 32.054  -37.050 -26.217 1.00 23.63  ? 192 PHE B CZ    1 
ATOM   4171 N  N     . CYS B 1 211 ? 27.667  -38.959 -28.103 1.00 14.83  ? 193 CYS B N     1 
ATOM   4172 C  CA    . CYS B 1 211 ? 27.033  -38.019 -29.021 1.00 16.69  ? 193 CYS B CA    1 
ATOM   4173 C  C     . CYS B 1 211 ? 27.726  -36.655 -28.977 1.00 19.45  ? 193 CYS B C     1 
ATOM   4174 O  O     . CYS B 1 211 ? 27.902  -36.069 -27.905 1.00 18.44  ? 193 CYS B O     1 
ATOM   4175 C  CB    . CYS B 1 211 ? 25.545  -37.879 -28.689 1.00 15.49  ? 193 CYS B CB    1 
ATOM   4176 S  SG    . CYS B 1 211 ? 24.664  -39.458 -28.581 1.00 21.25  ? 193 CYS B SG    1 
ATOM   4177 N  N     . PHE B 1 212 ? 28.113  -36.162 -30.152 1.00 19.34  ? 194 PHE B N     1 
ATOM   4178 C  CA    . PHE B 1 212 ? 28.900  -34.936 -30.279 1.00 20.66  ? 194 PHE B CA    1 
ATOM   4179 C  C     . PHE B 1 212 ? 28.189  -33.912 -31.173 1.00 21.59  ? 194 PHE B C     1 
ATOM   4180 O  O     . PHE B 1 212 ? 27.556  -34.276 -32.164 1.00 24.31  ? 194 PHE B O     1 
ATOM   4181 C  CB    . PHE B 1 212 ? 30.265  -35.290 -30.868 1.00 17.84  ? 194 PHE B CB    1 
ATOM   4182 C  CG    . PHE B 1 212 ? 31.236  -34.148 -30.919 1.00 16.18  ? 194 PHE B CG    1 
ATOM   4183 C  CD1   . PHE B 1 212 ? 31.583  -33.458 -29.770 1.00 15.92  ? 194 PHE B CD1   1 
ATOM   4184 C  CD2   . PHE B 1 212 ? 31.846  -33.797 -32.112 1.00 19.19  ? 194 PHE B CD2   1 
ATOM   4185 C  CE1   . PHE B 1 212 ? 32.505  -32.417 -29.815 1.00 16.08  ? 194 PHE B CE1   1 
ATOM   4186 C  CE2   . PHE B 1 212 ? 32.767  -32.750 -32.164 1.00 20.21  ? 194 PHE B CE2   1 
ATOM   4187 C  CZ    . PHE B 1 212 ? 33.092  -32.061 -31.013 1.00 16.48  ? 194 PHE B CZ    1 
ATOM   4188 N  N     . ASN B 1 213 ? 28.299  -32.634 -30.825 1.00 19.14  ? 195 ASN B N     1 
ATOM   4189 C  CA    . ASN B 1 213 ? 27.710  -31.562 -31.633 1.00 18.33  ? 195 ASN B CA    1 
ATOM   4190 C  C     . ASN B 1 213 ? 28.795  -30.613 -32.138 1.00 19.91  ? 195 ASN B C     1 
ATOM   4191 O  O     . ASN B 1 213 ? 29.643  -30.170 -31.363 1.00 22.94  ? 195 ASN B O     1 
ATOM   4192 C  CB    . ASN B 1 213 ? 26.652  -30.794 -30.819 1.00 15.79  ? 195 ASN B CB    1 
ATOM   4193 C  CG    . ASN B 1 213 ? 25.674  -30.014 -31.694 1.00 18.54  ? 195 ASN B CG    1 
ATOM   4194 O  OD1   . ASN B 1 213 ? 26.071  -29.287 -32.608 1.00 17.17  ? 195 ASN B OD1   1 
ATOM   4195 N  ND2   . ASN B 1 213 ? 24.381  -30.168 -31.415 1.00 20.30  ? 195 ASN B ND2   1 
ATOM   4196 N  N     . LEU B 1 214 ? 28.773  -30.300 -33.432 1.00 19.60  ? 196 LEU B N     1 
ATOM   4197 C  CA    . LEU B 1 214 ? 29.743  -29.360 -33.999 1.00 20.26  ? 196 LEU B CA    1 
ATOM   4198 C  C     . LEU B 1 214 ? 29.623  -27.951 -33.387 1.00 20.91  ? 196 LEU B C     1 
ATOM   4199 O  O     . LEU B 1 214 ? 30.600  -27.201 -33.357 1.00 20.55  ? 196 LEU B O     1 
ATOM   4200 C  CB    . LEU B 1 214 ? 29.636  -29.319 -35.525 1.00 21.73  ? 196 LEU B CB    1 
ATOM   4201 C  CG    . LEU B 1 214 ? 29.937  -30.650 -36.230 1.00 23.78  ? 196 LEU B CG    1 
ATOM   4202 C  CD1   . LEU B 1 214 ? 29.862  -30.510 -37.747 1.00 22.15  ? 196 LEU B CD1   1 
ATOM   4203 C  CD2   . LEU B 1 214 ? 31.296  -31.180 -35.808 1.00 24.46  ? 196 LEU B CD2   1 
ATOM   4204 N  N     . SER B 1 215 ? 28.423  -27.612 -32.910 1.00 19.21  ? 197 SER B N     1 
ATOM   4205 C  CA    . SER B 1 215 ? 28.173  -26.423 -32.074 1.00 21.81  ? 197 SER B CA    1 
ATOM   4206 C  C     . SER B 1 215 ? 28.285  -25.061 -32.756 1.00 22.56  ? 197 SER B C     1 
ATOM   4207 O  O     . SER B 1 215 ? 27.336  -24.280 -32.733 1.00 22.46  ? 197 SER B O     1 
ATOM   4208 C  CB    . SER B 1 215 ? 29.025  -26.442 -30.800 1.00 25.11  ? 197 SER B CB    1 
ATOM   4209 O  OG    . SER B 1 215 ? 28.611  -27.491 -29.940 1.00 27.39  ? 197 SER B OG    1 
ATOM   4210 N  N     . ALA B 1 216 ? 29.436  -24.767 -33.349 1.00 21.28  ? 198 ALA B N     1 
ATOM   4211 C  CA    . ALA B 1 216 ? 29.622  -23.487 -34.014 1.00 22.45  ? 198 ALA B CA    1 
ATOM   4212 C  C     . ALA B 1 216 ? 30.716  -23.574 -35.063 1.00 25.23  ? 198 ALA B C     1 
ATOM   4213 O  O     . ALA B 1 216 ? 31.695  -24.303 -34.876 1.00 23.31  ? 198 ALA B O     1 
ATOM   4214 C  CB    . ALA B 1 216 ? 29.945  -22.387 -32.989 1.00 21.68  ? 198 ALA B CB    1 
ATOM   4215 N  N     . PRO B 1 217 ? 30.556  -22.819 -36.168 1.00 24.77  ? 199 PRO B N     1 
ATOM   4216 C  CA    . PRO B 1 217 ? 31.531  -22.799 -37.263 1.00 25.90  ? 199 PRO B CA    1 
ATOM   4217 C  C     . PRO B 1 217 ? 32.960  -22.524 -36.799 1.00 26.25  ? 199 PRO B C     1 
ATOM   4218 O  O     . PRO B 1 217 ? 33.877  -23.150 -37.329 1.00 27.67  ? 199 PRO B O     1 
ATOM   4219 C  CB    . PRO B 1 217 ? 31.029  -21.658 -38.159 1.00 24.20  ? 199 PRO B CB    1 
ATOM   4220 C  CG    . PRO B 1 217 ? 29.553  -21.629 -37.918 1.00 22.00  ? 199 PRO B CG    1 
ATOM   4221 C  CD    . PRO B 1 217 ? 29.397  -21.949 -36.449 1.00 20.48  ? 199 PRO B CD    1 
ATOM   4222 N  N     . PHE B 1 218 ? 33.149  -21.634 -35.826 1.00 21.88  ? 200 PHE B N     1 
ATOM   4223 C  CA    . PHE B 1 218 ? 34.505  -21.246 -35.420 1.00 30.24  ? 200 PHE B CA    1 
ATOM   4224 C  C     . PHE B 1 218 ? 35.319  -22.393 -34.806 1.00 29.73  ? 200 PHE B C     1 
ATOM   4225 O  O     . PHE B 1 218 ? 36.548  -22.391 -34.876 1.00 31.26  ? 200 PHE B O     1 
ATOM   4226 C  CB    . PHE B 1 218 ? 34.506  -19.999 -34.508 1.00 29.88  ? 200 PHE B CB    1 
ATOM   4227 C  CG    . PHE B 1 218 ? 33.947  -20.236 -33.120 1.00 30.53  ? 200 PHE B CG    1 
ATOM   4228 C  CD1   . PHE B 1 218 ? 34.735  -20.796 -32.118 1.00 29.25  ? 200 PHE B CD1   1 
ATOM   4229 C  CD2   . PHE B 1 218 ? 32.644  -19.867 -32.808 1.00 29.05  ? 200 PHE B CD2   1 
ATOM   4230 C  CE1   . PHE B 1 218 ? 34.225  -21.006 -30.841 1.00 28.42  ? 200 PHE B CE1   1 
ATOM   4231 C  CE2   . PHE B 1 218 ? 32.129  -20.078 -31.526 1.00 27.95  ? 200 PHE B CE2   1 
ATOM   4232 C  CZ    . PHE B 1 218 ? 32.921  -20.651 -30.547 1.00 25.82  ? 200 PHE B CZ    1 
ATOM   4233 N  N     . LEU B 1 219 ? 34.635  -23.369 -34.211 1.00 27.82  ? 201 LEU B N     1 
ATOM   4234 C  CA    . LEU B 1 219 ? 35.316  -24.516 -33.614 1.00 25.31  ? 201 LEU B CA    1 
ATOM   4235 C  C     . LEU B 1 219 ? 35.976  -25.394 -34.676 1.00 27.55  ? 201 LEU B C     1 
ATOM   4236 O  O     . LEU B 1 219 ? 37.077  -25.900 -34.471 1.00 27.57  ? 201 LEU B O     1 
ATOM   4237 C  CB    . LEU B 1 219 ? 34.354  -25.335 -32.752 1.00 22.81  ? 201 LEU B CB    1 
ATOM   4238 C  CG    . LEU B 1 219 ? 33.867  -24.605 -31.497 1.00 21.68  ? 201 LEU B CG    1 
ATOM   4239 C  CD1   . LEU B 1 219 ? 32.638  -25.273 -30.924 1.00 19.75  ? 201 LEU B CD1   1 
ATOM   4240 C  CD2   . LEU B 1 219 ? 34.973  -24.534 -30.451 1.00 22.06  ? 201 LEU B CD2   1 
ATOM   4241 N  N     . SER B 1 220 ? 35.303  -25.569 -35.809 1.00 27.24  ? 202 SER B N     1 
ATOM   4242 C  CA    . SER B 1 220 ? 35.870  -26.328 -36.916 1.00 30.72  ? 202 SER B CA    1 
ATOM   4243 C  C     . SER B 1 220 ? 37.030  -25.578 -37.564 1.00 33.34  ? 202 SER B C     1 
ATOM   4244 O  O     . SER B 1 220 ? 37.965  -26.191 -38.075 1.00 35.39  ? 202 SER B O     1 
ATOM   4245 C  CB    . SER B 1 220 ? 34.801  -26.639 -37.970 1.00 33.88  ? 202 SER B CB    1 
ATOM   4246 O  OG    . SER B 1 220 ? 33.956  -27.695 -37.547 1.00 36.31  ? 202 SER B OG    1 
ATOM   4247 N  N     . GLN B 1 221 ? 36.964  -24.251 -37.540 1.00 34.95  ? 203 GLN B N     1 
ATOM   4248 C  CA    . GLN B 1 221 ? 37.969  -23.425 -38.206 1.00 38.77  ? 203 GLN B CA    1 
ATOM   4249 C  C     . GLN B 1 221 ? 39.231  -23.242 -37.370 1.00 37.04  ? 203 GLN B C     1 
ATOM   4250 O  O     . GLN B 1 221 ? 40.338  -23.245 -37.903 1.00 38.16  ? 203 GLN B O     1 
ATOM   4251 C  CB    . GLN B 1 221 ? 37.384  -22.058 -38.573 1.00 41.43  ? 203 GLN B CB    1 
ATOM   4252 C  CG    . GLN B 1 221 ? 36.207  -22.120 -39.532 1.00 45.74  ? 203 GLN B CG    1 
ATOM   4253 C  CD    . GLN B 1 221 ? 35.530  -20.771 -39.723 1.00 47.56  ? 203 GLN B CD    1 
ATOM   4254 O  OE1   . GLN B 1 221 ? 35.607  -19.897 -38.860 1.00 47.33  ? 203 GLN B OE1   1 
ATOM   4255 N  NE2   . GLN B 1 221 ? 34.861  -20.598 -40.859 1.00 48.81  ? 203 GLN B NE2   1 
ATOM   4256 N  N     . PHE B 1 222 ? 39.064  -23.088 -36.060 1.00 35.57  ? 204 PHE B N     1 
ATOM   4257 C  CA    . PHE B 1 222 ? 40.185  -22.735 -35.192 1.00 40.33  ? 204 PHE B CA    1 
ATOM   4258 C  C     . PHE B 1 222 ? 40.559  -23.826 -34.183 1.00 41.69  ? 204 PHE B C     1 
ATOM   4259 O  O     . PHE B 1 222 ? 41.557  -23.709 -33.472 1.00 42.18  ? 204 PHE B O     1 
ATOM   4260 C  CB    . PHE B 1 222 ? 39.889  -21.410 -34.487 1.00 42.64  ? 204 PHE B CB    1 
ATOM   4261 C  CG    . PHE B 1 222 ? 39.556  -20.291 -35.434 1.00 47.00  ? 204 PHE B CG    1 
ATOM   4262 C  CD1   . PHE B 1 222 ? 40.343  -20.058 -36.553 1.00 50.17  ? 204 PHE B CD1   1 
ATOM   4263 C  CD2   . PHE B 1 222 ? 38.443  -19.492 -35.225 1.00 47.07  ? 204 PHE B CD2   1 
ATOM   4264 C  CE1   . PHE B 1 222 ? 40.038  -19.036 -37.437 1.00 51.68  ? 204 PHE B CE1   1 
ATOM   4265 C  CE2   . PHE B 1 222 ? 38.131  -18.469 -36.105 1.00 49.39  ? 204 PHE B CE2   1 
ATOM   4266 C  CZ    . PHE B 1 222 ? 38.929  -18.241 -37.212 1.00 51.32  ? 204 PHE B CZ    1 
ATOM   4267 N  N     . ASN B 1 223 ? 39.760  -24.886 -34.130 1.00 43.16  ? 205 ASN B N     1 
ATOM   4268 C  CA    . ASN B 1 223 ? 40.064  -26.036 -33.284 1.00 24.45  ? 205 ASN B CA    1 
ATOM   4269 C  C     . ASN B 1 223 ? 39.856  -27.340 -34.047 1.00 24.83  ? 205 ASN B C     1 
ATOM   4270 O  O     . ASN B 1 223 ? 39.321  -28.311 -33.500 1.00 27.72  ? 205 ASN B O     1 
ATOM   4271 C  CB    . ASN B 1 223 ? 39.198  -26.028 -32.024 1.00 26.59  ? 205 ASN B CB    1 
ATOM   4272 C  CG    . ASN B 1 223 ? 39.636  -24.979 -31.025 1.00 32.09  ? 205 ASN B CG    1 
ATOM   4273 O  OD1   . ASN B 1 223 ? 38.932  -24.002 -30.790 1.00 35.83  ? 205 ASN B OD1   1 
ATOM   4274 N  ND2   . ASN B 1 223 ? 40.803  -25.183 -30.424 1.00 34.55  ? 205 ASN B ND2   1 
ATOM   4275 N  N     . THR B 1 224 ? 40.282  -27.340 -35.309 1.00 42.43  ? 206 THR B N     1 
ATOM   4276 C  CA    . THR B 1 224 ? 40.045  -28.443 -36.235 1.00 35.52  ? 206 THR B CA    1 
ATOM   4277 C  C     . THR B 1 224 ? 40.552  -29.781 -35.711 1.00 35.03  ? 206 THR B C     1 
ATOM   4278 O  O     . THR B 1 224 ? 39.866  -30.797 -35.816 1.00 34.25  ? 206 THR B O     1 
ATOM   4279 C  CB    . THR B 1 224 ? 40.714  -28.183 -37.595 1.00 34.55  ? 206 THR B CB    1 
ATOM   4280 O  OG1   . THR B 1 224 ? 40.433  -26.844 -38.026 1.00 33.66  ? 206 THR B OG1   1 
ATOM   4281 C  CG2   . THR B 1 224 ? 40.205  -29.176 -38.629 1.00 33.45  ? 206 THR B CG2   1 
ATOM   4282 N  N     . LYS B 1 225 ? 41.760  -29.775 -35.159 1.00 35.90  ? 207 LYS B N     1 
ATOM   4283 C  CA    . LYS B 1 225 ? 42.355  -30.986 -34.606 1.00 38.64  ? 207 LYS B CA    1 
ATOM   4284 C  C     . LYS B 1 225 ? 41.476  -31.594 -33.510 1.00 34.59  ? 207 LYS B C     1 
ATOM   4285 O  O     . LYS B 1 225 ? 41.229  -32.801 -33.498 1.00 34.69  ? 207 LYS B O     1 
ATOM   4286 C  CB    . LYS B 1 225 ? 43.759  -30.689 -34.072 1.00 44.86  ? 207 LYS B CB    1 
ATOM   4287 C  CG    . LYS B 1 225 ? 44.339  -31.775 -33.181 1.00 51.23  ? 207 LYS B CG    1 
ATOM   4288 C  CD    . LYS B 1 225 ? 44.518  -31.274 -31.751 1.00 57.48  ? 207 LYS B CD    1 
ATOM   4289 C  CE    . LYS B 1 225 ? 45.416  -30.040 -31.709 1.00 62.42  ? 207 LYS B CE    1 
ATOM   4290 N  NZ    . LYS B 1 225 ? 45.514  -29.460 -30.341 1.00 64.89  ? 207 LYS B NZ    1 
ATOM   4291 N  N     . GLU B 1 226 ? 40.993  -30.750 -32.606 1.00 30.43  ? 208 GLU B N     1 
ATOM   4292 C  CA    . GLU B 1 226 ? 40.175  -31.211 -31.489 1.00 30.99  ? 208 GLU B CA    1 
ATOM   4293 C  C     . GLU B 1 226 ? 38.834  -31.764 -31.963 1.00 28.09  ? 208 GLU B C     1 
ATOM   4294 O  O     . GLU B 1 226 ? 38.376  -32.797 -31.479 1.00 27.58  ? 208 GLU B O     1 
ATOM   4295 C  CB    . GLU B 1 226 ? 39.959  -30.087 -30.471 1.00 33.95  ? 208 GLU B CB    1 
ATOM   4296 C  CG    . GLU B 1 226 ? 41.197  -29.714 -29.656 1.00 38.02  ? 208 GLU B CG    1 
ATOM   4297 C  CD    . GLU B 1 226 ? 42.103  -28.716 -30.357 1.00 45.80  ? 208 GLU B CD    1 
ATOM   4298 O  OE1   . GLU B 1 226 ? 41.933  -28.483 -31.573 1.00 45.80  ? 208 GLU B OE1   1 
ATOM   4299 O  OE2   . GLU B 1 226 ? 42.992  -28.154 -29.684 1.00 52.98  ? 208 GLU B OE2   1 
ATOM   4300 N  N     . VAL B 1 227 ? 38.213  -31.074 -32.913 1.00 25.92  ? 209 VAL B N     1 
ATOM   4301 C  CA    . VAL B 1 227 ? 36.949  -31.519 -33.489 1.00 21.67  ? 209 VAL B CA    1 
ATOM   4302 C  C     . VAL B 1 227 ? 37.089  -32.898 -34.138 1.00 22.83  ? 209 VAL B C     1 
ATOM   4303 O  O     . VAL B 1 227 ? 36.285  -33.796 -33.882 1.00 23.84  ? 209 VAL B O     1 
ATOM   4304 C  CB    . VAL B 1 227 ? 36.398  -30.484 -34.506 1.00 27.37  ? 209 VAL B CB    1 
ATOM   4305 C  CG1   . VAL B 1 227 ? 35.225  -31.059 -35.306 1.00 19.38  ? 209 VAL B CG1   1 
ATOM   4306 C  CG2   . VAL B 1 227 ? 35.988  -29.201 -33.779 1.00 20.74  ? 209 VAL B CG2   1 
ATOM   4307 N  N     . ASP B 1 228 ? 38.117  -33.073 -34.963 1.00 23.83  ? 210 ASP B N     1 
ATOM   4308 C  CA    . ASP B 1 228 ? 38.321  -34.354 -35.636 1.00 25.90  ? 210 ASP B CA    1 
ATOM   4309 C  C     . ASP B 1 228 ? 38.681  -35.467 -34.654 1.00 25.36  ? 210 ASP B C     1 
ATOM   4310 O  O     . ASP B 1 228 ? 38.223  -36.600 -34.805 1.00 24.12  ? 210 ASP B O     1 
ATOM   4311 C  CB    . ASP B 1 228 ? 39.363  -34.247 -36.757 1.00 26.28  ? 210 ASP B CB    1 
ATOM   4312 C  CG    . ASP B 1 228 ? 38.799  -33.612 -38.015 1.00 31.49  ? 210 ASP B CG    1 
ATOM   4313 O  OD1   . ASP B 1 228 ? 37.558  -33.533 -38.134 1.00 28.62  ? 210 ASP B OD1   1 
ATOM   4314 O  OD2   . ASP B 1 228 ? 39.592  -33.199 -38.894 1.00 38.22  ? 210 ASP B OD2   1 
ATOM   4315 N  N     . GLU B 1 229 ? 39.485  -35.147 -33.642 1.00 24.72  ? 211 GLU B N     1 
ATOM   4316 C  CA    . GLU B 1 229 ? 39.778  -36.127 -32.601 1.00 22.37  ? 211 GLU B CA    1 
ATOM   4317 C  C     . GLU B 1 229 ? 38.498  -36.592 -31.909 1.00 24.18  ? 211 GLU B C     1 
ATOM   4318 O  O     . GLU B 1 229 ? 38.271  -37.795 -31.762 1.00 24.21  ? 211 GLU B O     1 
ATOM   4319 C  CB    . GLU B 1 229 ? 40.782  -35.601 -31.573 1.00 24.93  ? 211 GLU B CB    1 
ATOM   4320 C  CG    . GLU B 1 229 ? 41.176  -36.672 -30.557 1.00 31.45  ? 211 GLU B CG    1 
ATOM   4321 C  CD    . GLU B 1 229 ? 42.394  -36.313 -29.732 1.00 37.07  ? 211 GLU B CD    1 
ATOM   4322 O  OE1   . GLU B 1 229 ? 42.523  -35.143 -29.314 1.00 38.47  ? 211 GLU B OE1   1 
ATOM   4323 O  OE2   . GLU B 1 229 ? 43.224  -37.216 -29.494 1.00 41.32  ? 211 GLU B OE2   1 
ATOM   4324 N  N     . MET B 1 230 ? 37.653  -35.643 -31.508 1.00 23.51  ? 212 MET B N     1 
ATOM   4325 C  CA    . MET B 1 230 ? 36.379  -35.982 -30.873 1.00 22.60  ? 212 MET B CA    1 
ATOM   4326 C  C     . MET B 1 230 ? 35.486  -36.815 -31.788 1.00 22.37  ? 212 MET B C     1 
ATOM   4327 O  O     . MET B 1 230 ? 34.779  -37.707 -31.328 1.00 20.99  ? 212 MET B O     1 
ATOM   4328 C  CB    . MET B 1 230 ? 35.632  -34.725 -30.400 1.00 18.79  ? 212 MET B CB    1 
ATOM   4329 C  CG    . MET B 1 230 ? 36.305  -33.997 -29.233 1.00 21.94  ? 212 MET B CG    1 
ATOM   4330 S  SD    . MET B 1 230 ? 36.580  -35.034 -27.775 1.00 28.28  ? 212 MET B SD    1 
ATOM   4331 C  CE    . MET B 1 230 ? 34.905  -35.495 -27.369 1.00 22.14  ? 212 MET B CE    1 
ATOM   4332 N  N     . ILE B 1 231 ? 35.511  -36.513 -33.082 1.00 25.26  ? 213 ILE B N     1 
ATOM   4333 C  CA    . ILE B 1 231 ? 34.699  -37.256 -34.044 1.00 23.68  ? 213 ILE B CA    1 
ATOM   4334 C  C     . ILE B 1 231 ? 35.138  -38.717 -34.063 1.00 22.27  ? 213 ILE B C     1 
ATOM   4335 O  O     . ILE B 1 231 ? 34.305  -39.618 -34.085 1.00 20.20  ? 213 ILE B O     1 
ATOM   4336 C  CB    . ILE B 1 231 ? 34.775  -36.646 -35.463 1.00 21.45  ? 213 ILE B CB    1 
ATOM   4337 C  CG1   . ILE B 1 231 ? 33.947  -35.361 -35.536 1.00 18.24  ? 213 ILE B CG1   1 
ATOM   4338 C  CG2   . ILE B 1 231 ? 34.283  -37.636 -36.506 1.00 21.02  ? 213 ILE B CG2   1 
ATOM   4339 C  CD1   . ILE B 1 231 ? 34.198  -34.543 -36.791 1.00 18.10  ? 213 ILE B CD1   1 
ATOM   4340 N  N     . SER B 1 232 ? 36.450  -38.941 -34.007 1.00 24.06  ? 214 SER B N     1 
ATOM   4341 C  CA    . SER B 1 232 ? 37.010  -40.294 -33.984 1.00 24.94  ? 214 SER B CA    1 
ATOM   4342 C  C     . SER B 1 232 ? 36.507  -41.158 -32.811 1.00 23.28  ? 214 SER B C     1 
ATOM   4343 O  O     . SER B 1 232 ? 36.657  -42.377 -32.830 1.00 23.64  ? 214 SER B O     1 
ATOM   4344 C  CB    . SER B 1 232 ? 38.543  -40.245 -33.981 1.00 26.33  ? 214 SER B CB    1 
ATOM   4345 O  OG    . SER B 1 232 ? 39.050  -39.974 -32.687 1.00 26.91  ? 214 SER B OG    1 
ATOM   4346 N  N     . TYR B 1 233 ? 35.906  -40.525 -31.805 1.00 20.57  ? 215 TYR B N     1 
ATOM   4347 C  CA    . TYR B 1 233 ? 35.356  -41.247 -30.660 1.00 21.34  ? 215 TYR B CA    1 
ATOM   4348 C  C     . TYR B 1 233 ? 33.830  -41.213 -30.611 1.00 19.44  ? 215 TYR B C     1 
ATOM   4349 O  O     . TYR B 1 233 ? 33.225  -41.790 -29.711 1.00 21.13  ? 215 TYR B O     1 
ATOM   4350 C  CB    . TYR B 1 233 ? 35.906  -40.680 -29.350 1.00 22.60  ? 215 TYR B CB    1 
ATOM   4351 C  CG    . TYR B 1 233 ? 37.379  -40.930 -29.138 1.00 22.79  ? 215 TYR B CG    1 
ATOM   4352 C  CD1   . TYR B 1 233 ? 38.319  -39.956 -29.447 1.00 22.70  ? 215 TYR B CD1   1 
ATOM   4353 C  CD2   . TYR B 1 233 ? 37.830  -42.138 -28.621 1.00 22.56  ? 215 TYR B CD2   1 
ATOM   4354 C  CE1   . TYR B 1 233 ? 39.668  -40.178 -29.252 1.00 23.73  ? 215 TYR B CE1   1 
ATOM   4355 C  CE2   . TYR B 1 233 ? 39.175  -42.369 -28.420 1.00 24.45  ? 215 TYR B CE2   1 
ATOM   4356 C  CZ    . TYR B 1 233 ? 40.091  -41.387 -28.742 1.00 25.71  ? 215 TYR B CZ    1 
ATOM   4357 O  OH    . TYR B 1 233 ? 41.436  -41.612 -28.551 1.00 29.20  ? 215 TYR B OH    1 
ATOM   4358 N  N     . SER B 1 234 ? 33.211  -40.539 -31.574 1.00 18.10  ? 216 SER B N     1 
ATOM   4359 C  CA    . SER B 1 234 ? 31.774  -40.293 -31.522 1.00 20.04  ? 216 SER B CA    1 
ATOM   4360 C  C     . SER B 1 234 ? 30.961  -41.305 -32.321 1.00 19.75  ? 216 SER B C     1 
ATOM   4361 O  O     . SER B 1 234 ? 31.297  -41.625 -33.453 1.00 19.55  ? 216 SER B O     1 
ATOM   4362 C  CB    . SER B 1 234 ? 31.454  -38.880 -32.028 1.00 21.30  ? 216 SER B CB    1 
ATOM   4363 O  OG    . SER B 1 234 ? 32.071  -37.891 -31.224 1.00 19.83  ? 216 SER B OG    1 
ATOM   4364 N  N     . ASN B 1 235 ? 29.884  -41.795 -31.720 1.00 17.79  ? 217 ASN B N     1 
ATOM   4365 C  CA    . ASN B 1 235 ? 28.958  -42.682 -32.405 1.00 21.40  ? 217 ASN B CA    1 
ATOM   4366 C  C     . ASN B 1 235 ? 27.914  -41.884 -33.185 1.00 22.08  ? 217 ASN B C     1 
ATOM   4367 O  O     . ASN B 1 235 ? 27.415  -42.337 -34.216 1.00 21.59  ? 217 ASN B O     1 
ATOM   4368 C  CB    . ASN B 1 235 ? 28.284  -43.616 -31.398 1.00 17.79  ? 217 ASN B CB    1 
ATOM   4369 C  CG    . ASN B 1 235 ? 29.287  -44.350 -30.537 1.00 22.78  ? 217 ASN B CG    1 
ATOM   4370 O  OD1   . ASN B 1 235 ? 29.746  -43.827 -29.520 1.00 21.65  ? 217 ASN B OD1   1 
ATOM   4371 N  ND2   . ASN B 1 235 ? 29.653  -45.563 -30.953 1.00 23.38  ? 217 ASN B ND2   1 
ATOM   4372 N  N     . ILE B 1 236 ? 27.595  -40.692 -32.683 1.00 18.46  ? 218 ILE B N     1 
ATOM   4373 C  CA    . ILE B 1 236 ? 26.643  -39.803 -33.339 1.00 21.02  ? 218 ILE B CA    1 
ATOM   4374 C  C     . ILE B 1 236 ? 27.189  -38.375 -33.398 1.00 22.26  ? 218 ILE B C     1 
ATOM   4375 O  O     . ILE B 1 236 ? 27.612  -37.816 -32.385 1.00 23.11  ? 218 ILE B O     1 
ATOM   4376 C  CB    . ILE B 1 236 ? 25.267  -39.806 -32.621 1.00 17.93  ? 218 ILE B CB    1 
ATOM   4377 C  CG1   . ILE B 1 236 ? 24.678  -41.220 -32.584 1.00 19.37  ? 218 ILE B CG1   1 
ATOM   4378 C  CG2   . ILE B 1 236 ? 24.293  -38.869 -33.322 1.00 16.37  ? 218 ILE B CG2   1 
ATOM   4379 C  CD1   . ILE B 1 236 ? 23.311  -41.293 -31.933 1.00 17.59  ? 218 ILE B CD1   1 
ATOM   4380 N  N     . VAL B 1 237 ? 27.194  -37.788 -34.590 1.00 22.46  ? 219 VAL B N     1 
ATOM   4381 C  CA    . VAL B 1 237 ? 27.591  -36.392 -34.733 1.00 19.88  ? 219 VAL B CA    1 
ATOM   4382 C  C     . VAL B 1 237 ? 26.435  -35.562 -35.276 1.00 18.69  ? 219 VAL B C     1 
ATOM   4383 O  O     . VAL B 1 237 ? 25.840  -35.902 -36.304 1.00 18.92  ? 219 VAL B O     1 
ATOM   4384 C  CB    . VAL B 1 237 ? 28.829  -36.223 -35.638 1.00 20.43  ? 219 VAL B CB    1 
ATOM   4385 C  CG1   . VAL B 1 237 ? 29.182  -34.742 -35.783 1.00 17.51  ? 219 VAL B CG1   1 
ATOM   4386 C  CG2   . VAL B 1 237 ? 30.013  -37.000 -35.076 1.00 15.31  ? 219 VAL B CG2   1 
ATOM   4387 N  N     . PHE B 1 238 ? 26.106  -34.494 -34.552 1.00 17.73  ? 220 PHE B N     1 
ATOM   4388 C  CA    . PHE B 1 238 ? 25.109  -33.525 -34.976 1.00 17.89  ? 220 PHE B CA    1 
ATOM   4389 C  C     . PHE B 1 238 ? 25.809  -32.282 -35.522 1.00 21.52  ? 220 PHE B C     1 
ATOM   4390 O  O     . PHE B 1 238 ? 26.831  -31.840 -34.985 1.00 21.24  ? 220 PHE B O     1 
ATOM   4391 C  CB    . PHE B 1 238 ? 24.233  -33.086 -33.799 1.00 19.46  ? 220 PHE B CB    1 
ATOM   4392 C  CG    . PHE B 1 238 ? 23.352  -34.167 -33.242 1.00 19.31  ? 220 PHE B CG    1 
ATOM   4393 C  CD1   . PHE B 1 238 ? 22.107  -34.414 -33.790 1.00 16.39  ? 220 PHE B CD1   1 
ATOM   4394 C  CD2   . PHE B 1 238 ? 23.757  -34.913 -32.143 1.00 19.68  ? 220 PHE B CD2   1 
ATOM   4395 C  CE1   . PHE B 1 238 ? 21.288  -35.400 -33.265 1.00 17.37  ? 220 PHE B CE1   1 
ATOM   4396 C  CE2   . PHE B 1 238 ? 22.944  -35.898 -31.614 1.00 20.32  ? 220 PHE B CE2   1 
ATOM   4397 C  CZ    . PHE B 1 238 ? 21.707  -36.142 -32.176 1.00 19.11  ? 220 PHE B CZ    1 
ATOM   4398 N  N     . GLY B 1 239 ? 25.243  -31.708 -36.576 1.00 21.52  ? 221 GLY B N     1 
ATOM   4399 C  CA    . GLY B 1 239 ? 25.743  -30.463 -37.124 1.00 21.22  ? 221 GLY B CA    1 
ATOM   4400 C  C     . GLY B 1 239 ? 24.629  -29.688 -37.793 1.00 22.54  ? 221 GLY B C     1 
ATOM   4401 O  O     . GLY B 1 239 ? 23.530  -30.214 -38.002 1.00 21.80  ? 221 GLY B O     1 
ATOM   4402 N  N     . ASN B 1 240 ? 24.896  -28.426 -38.105 1.00 24.59  ? 222 ASN B N     1 
ATOM   4403 C  CA    . ASN B 1 240 ? 24.001  -27.674 -38.967 1.00 24.14  ? 222 ASN B CA    1 
ATOM   4404 C  C     . ASN B 1 240 ? 24.717  -27.299 -40.255 1.00 27.16  ? 222 ASN B C     1 
ATOM   4405 O  O     . ASN B 1 240 ? 25.900  -27.610 -40.418 1.00 27.43  ? 222 ASN B O     1 
ATOM   4406 C  CB    . ASN B 1 240 ? 23.385  -26.464 -38.255 1.00 24.72  ? 222 ASN B CB    1 
ATOM   4407 C  CG    . ASN B 1 240 ? 24.406  -25.400 -37.861 1.00 29.09  ? 222 ASN B CG    1 
ATOM   4408 O  OD1   . ASN B 1 240 ? 25.434  -25.213 -38.511 1.00 29.61  ? 222 ASN B OD1   1 
ATOM   4409 N  ND2   . ASN B 1 240 ? 24.103  -24.680 -36.785 1.00 20.79  ? 222 ASN B ND2   1 
ATOM   4410 N  N     . GLU B 1 241 ? 24.004  -26.642 -41.163 1.00 25.82  ? 223 GLU B N     1 
ATOM   4411 C  CA    . GLU B 1 241 ? 24.554  -26.308 -42.468 1.00 27.80  ? 223 GLU B CA    1 
ATOM   4412 C  C     . GLU B 1 241 ? 25.783  -25.405 -42.367 1.00 26.80  ? 223 GLU B C     1 
ATOM   4413 O  O     . GLU B 1 241 ? 26.811  -25.682 -42.980 1.00 27.93  ? 223 GLU B O     1 
ATOM   4414 C  CB    . GLU B 1 241 ? 23.484  -25.655 -43.351 1.00 33.05  ? 223 GLU B CB    1 
ATOM   4415 C  CG    . GLU B 1 241 ? 23.952  -25.357 -44.769 1.00 40.45  ? 223 GLU B CG    1 
ATOM   4416 C  CD    . GLU B 1 241 ? 22.831  -24.857 -45.666 1.00 46.67  ? 223 GLU B CD    1 
ATOM   4417 O  OE1   . GLU B 1 241 ? 23.088  -23.965 -46.503 1.00 53.73  ? 223 GLU B OE1   1 
ATOM   4418 O  OE2   . GLU B 1 241 ? 21.695  -25.356 -45.538 1.00 44.99  ? 223 GLU B OE2   1 
ATOM   4419 N  N     . SER B 1 242 ? 25.679  -24.330 -41.591 1.00 23.60  ? 224 SER B N     1 
ATOM   4420 C  CA    . SER B 1 242 ? 26.776  -23.369 -41.496 1.00 25.73  ? 224 SER B CA    1 
ATOM   4421 C  C     . SER B 1 242 ? 28.027  -23.976 -40.849 1.00 27.03  ? 224 SER B C     1 
ATOM   4422 O  O     . SER B 1 242 ? 29.152  -23.611 -41.202 1.00 26.93  ? 224 SER B O     1 
ATOM   4423 C  CB    . SER B 1 242 ? 26.336  -22.097 -40.769 1.00 31.19  ? 224 SER B CB    1 
ATOM   4424 O  OG    . SER B 1 242 ? 26.008  -22.366 -39.418 1.00 38.28  ? 224 SER B OG    1 
ATOM   4425 N  N     . GLU B 1 243 ? 27.830  -24.907 -39.917 1.00 24.99  ? 225 GLU B N     1 
ATOM   4426 C  CA    . GLU B 1 243 ? 28.943  -25.664 -39.343 1.00 25.37  ? 225 GLU B CA    1 
ATOM   4427 C  C     . GLU B 1 243 ? 29.526  -26.616 -40.376 1.00 25.84  ? 225 GLU B C     1 
ATOM   4428 O  O     . GLU B 1 243 ? 30.743  -26.768 -40.475 1.00 26.12  ? 225 GLU B O     1 
ATOM   4429 C  CB    . GLU B 1 243 ? 28.492  -26.466 -38.118 1.00 25.47  ? 225 GLU B CB    1 
ATOM   4430 C  CG    . GLU B 1 243 ? 28.219  -25.621 -36.885 1.00 29.15  ? 225 GLU B CG    1 
ATOM   4431 C  CD    . GLU B 1 243 ? 27.116  -26.196 -36.007 1.00 32.98  ? 225 GLU B CD    1 
ATOM   4432 O  OE1   . GLU B 1 243 ? 26.769  -27.388 -36.166 1.00 31.30  ? 225 GLU B OE1   1 
ATOM   4433 O  OE2   . GLU B 1 243 ? 26.584  -25.444 -35.165 1.00 36.91  ? 225 GLU B OE2   1 
ATOM   4434 N  N     . ALA B 1 244 ? 28.647  -27.259 -41.139 1.00 21.27  ? 226 ALA B N     1 
ATOM   4435 C  CA    . ALA B 1 244 ? 29.071  -28.226 -42.142 1.00 21.49  ? 226 ALA B CA    1 
ATOM   4436 C  C     . ALA B 1 244 ? 29.854  -27.551 -43.262 1.00 25.87  ? 226 ALA B C     1 
ATOM   4437 O  O     . ALA B 1 244 ? 30.850  -28.091 -43.735 1.00 28.77  ? 226 ALA B O     1 
ATOM   4438 C  CB    . ALA B 1 244 ? 27.874  -28.982 -42.699 1.00 20.96  ? 226 ALA B CB    1 
ATOM   4439 N  N     . GLU B 1 245 ? 29.406  -26.367 -43.676 1.00 27.11  ? 227 GLU B N     1 
ATOM   4440 C  CA    . GLU B 1 245 ? 30.124  -25.585 -44.680 1.00 30.70  ? 227 GLU B CA    1 
ATOM   4441 C  C     . GLU B 1 245 ? 31.510  -25.172 -44.182 1.00 30.02  ? 227 GLU B C     1 
ATOM   4442 O  O     . GLU B 1 245 ? 32.492  -25.232 -44.925 1.00 30.71  ? 227 GLU B O     1 
ATOM   4443 C  CB    . GLU B 1 245 ? 29.315  -24.347 -45.087 1.00 37.20  ? 227 GLU B CB    1 
ATOM   4444 C  CG    . GLU B 1 245 ? 28.273  -24.610 -46.169 1.00 45.74  ? 227 GLU B CG    1 
ATOM   4445 C  CD    . GLU B 1 245 ? 27.187  -23.549 -46.215 1.00 53.19  ? 227 GLU B CD    1 
ATOM   4446 O  OE1   . GLU B 1 245 ? 27.143  -22.699 -45.298 1.00 54.04  ? 227 GLU B OE1   1 
ATOM   4447 O  OE2   . GLU B 1 245 ? 26.372  -23.571 -47.166 1.00 55.96  ? 227 GLU B OE2   1 
ATOM   4448 N  N     . ALA B 1 246 ? 31.589  -24.761 -42.920 1.00 27.32  ? 228 ALA B N     1 
ATOM   4449 C  CA    . ALA B 1 246 ? 32.863  -24.344 -42.344 1.00 29.33  ? 228 ALA B CA    1 
ATOM   4450 C  C     . ALA B 1 246 ? 33.820  -25.527 -42.230 1.00 28.91  ? 228 ALA B C     1 
ATOM   4451 O  O     . ALA B 1 246 ? 35.005  -25.415 -42.543 1.00 30.61  ? 228 ALA B O     1 
ATOM   4452 C  CB    . ALA B 1 246 ? 32.648  -23.693 -40.988 1.00 28.06  ? 228 ALA B CB    1 
ATOM   4453 N  N     . TYR B 1 247 ? 33.293  -26.663 -41.791 1.00 26.88  ? 229 TYR B N     1 
ATOM   4454 C  CA    . TYR B 1 247 ? 34.089  -27.875 -41.656 1.00 25.16  ? 229 TYR B CA    1 
ATOM   4455 C  C     . TYR B 1 247 ? 34.653  -28.306 -43.008 1.00 27.43  ? 229 TYR B C     1 
ATOM   4456 O  O     . TYR B 1 247 ? 35.838  -28.614 -43.126 1.00 28.09  ? 229 TYR B O     1 
ATOM   4457 C  CB    . TYR B 1 247 ? 33.241  -28.992 -41.045 1.00 22.48  ? 229 TYR B CB    1 
ATOM   4458 C  CG    . TYR B 1 247 ? 33.979  -30.289 -40.771 1.00 26.38  ? 229 TYR B CG    1 
ATOM   4459 C  CD1   . TYR B 1 247 ? 34.415  -30.606 -39.490 1.00 26.03  ? 229 TYR B CD1   1 
ATOM   4460 C  CD2   . TYR B 1 247 ? 34.214  -31.210 -41.790 1.00 28.42  ? 229 TYR B CD2   1 
ATOM   4461 C  CE1   . TYR B 1 247 ? 35.076  -31.800 -39.234 1.00 28.06  ? 229 TYR B CE1   1 
ATOM   4462 C  CE2   . TYR B 1 247 ? 34.876  -32.399 -41.547 1.00 29.73  ? 229 TYR B CE2   1 
ATOM   4463 C  CZ    . TYR B 1 247 ? 35.303  -32.691 -40.269 1.00 30.13  ? 229 TYR B CZ    1 
ATOM   4464 O  OH    . TYR B 1 247 ? 35.963  -33.874 -40.031 1.00 33.33  ? 229 TYR B OH    1 
ATOM   4465 N  N     . GLY B 1 248 ? 33.796  -28.323 -44.025 1.00 28.69  ? 230 GLY B N     1 
ATOM   4466 C  CA    . GLY B 1 248 ? 34.189  -28.743 -45.360 1.00 29.38  ? 230 GLY B CA    1 
ATOM   4467 C  C     . GLY B 1 248 ? 35.260  -27.877 -46.002 1.00 31.51  ? 230 GLY B C     1 
ATOM   4468 O  O     . GLY B 1 248 ? 36.181  -28.393 -46.631 1.00 33.52  ? 230 GLY B O     1 
ATOM   4469 N  N     . GLU B 1 249 ? 35.141  -26.562 -45.845 1.00 32.59  ? 231 GLU B N     1 
ATOM   4470 C  CA    . GLU B 1 249 ? 36.114  -25.631 -46.413 1.00 40.79  ? 231 GLU B CA    1 
ATOM   4471 C  C     . GLU B 1 249 ? 37.494  -25.838 -45.801 1.00 40.25  ? 231 GLU B C     1 
ATOM   4472 O  O     . GLU B 1 249 ? 38.508  -25.787 -46.494 1.00 42.02  ? 231 GLU B O     1 
ATOM   4473 C  CB    . GLU B 1 249 ? 35.660  -24.185 -46.203 1.00 47.87  ? 231 GLU B CB    1 
ATOM   4474 C  CG    . GLU B 1 249 ? 36.678  -23.143 -46.635 1.00 58.20  ? 231 GLU B CG    1 
ATOM   4475 C  CD    . GLU B 1 249 ? 36.235  -21.729 -46.309 1.00 66.17  ? 231 GLU B CD    1 
ATOM   4476 O  OE1   . GLU B 1 249 ? 35.212  -21.577 -45.603 1.00 67.09  ? 231 GLU B OE1   1 
ATOM   4477 O  OE2   . GLU B 1 249 ? 36.906  -20.771 -46.759 1.00 69.67  ? 231 GLU B OE2   1 
ATOM   4478 N  N     . VAL B 1 250 ? 37.517  -26.077 -44.496 1.00 37.88  ? 232 VAL B N     1 
ATOM   4479 C  CA    . VAL B 1 250 ? 38.755  -26.321 -43.766 1.00 39.70  ? 232 VAL B CA    1 
ATOM   4480 C  C     . VAL B 1 250 ? 39.395  -27.659 -44.171 1.00 39.61  ? 232 VAL B C     1 
ATOM   4481 O  O     . VAL B 1 250 ? 40.615  -27.824 -44.118 1.00 39.03  ? 232 VAL B O     1 
ATOM   4482 C  CB    . VAL B 1 250 ? 38.500  -26.248 -42.235 1.00 55.75  ? 232 VAL B CB    1 
ATOM   4483 C  CG1   . VAL B 1 250 ? 39.359  -27.233 -41.470 1.00 53.62  ? 232 VAL B CG1   1 
ATOM   4484 C  CG2   . VAL B 1 250 ? 38.713  -24.829 -41.727 1.00 56.50  ? 232 VAL B CG2   1 
ATOM   4485 N  N     . HIS B 1 251 ? 38.569  -28.606 -44.603 1.00 36.73  ? 233 HIS B N     1 
ATOM   4486 C  CA    . HIS B 1 251 ? 39.076  -29.900 -45.045 1.00 34.75  ? 233 HIS B CA    1 
ATOM   4487 C  C     . HIS B 1 251 ? 39.217  -29.999 -46.562 1.00 38.53  ? 233 HIS B C     1 
ATOM   4488 O  O     . HIS B 1 251 ? 39.493  -31.073 -47.093 1.00 40.45  ? 233 HIS B O     1 
ATOM   4489 C  CB    . HIS B 1 251 ? 38.197  -31.032 -44.513 1.00 30.56  ? 233 HIS B CB    1 
ATOM   4490 C  CG    . HIS B 1 251 ? 38.287  -31.208 -43.032 1.00 29.91  ? 233 HIS B CG    1 
ATOM   4491 N  ND1   . HIS B 1 251 ? 37.676  -30.350 -42.144 1.00 31.05  ? 233 HIS B ND1   1 
ATOM   4492 C  CD2   . HIS B 1 251 ? 38.937  -32.128 -42.281 1.00 30.64  ? 233 HIS B CD2   1 
ATOM   4493 C  CE1   . HIS B 1 251 ? 37.936  -30.740 -40.908 1.00 30.60  ? 233 HIS B CE1   1 
ATOM   4494 N  NE2   . HIS B 1 251 ? 38.699  -31.816 -40.964 1.00 32.56  ? 233 HIS B NE2   1 
ATOM   4495 N  N     . GLY B 1 252 ? 39.027  -28.879 -47.253 1.00 35.68  ? 234 GLY B N     1 
ATOM   4496 C  CA    . GLY B 1 252 ? 39.220  -28.831 -48.693 1.00 38.26  ? 234 GLY B CA    1 
ATOM   4497 C  C     . GLY B 1 252 ? 38.149  -29.547 -49.496 1.00 44.63  ? 234 GLY B C     1 
ATOM   4498 O  O     . GLY B 1 252 ? 38.393  -29.984 -50.621 1.00 45.71  ? 234 GLY B O     1 
ATOM   4499 N  N     . LEU B 1 253 ? 36.959  -29.671 -48.918 1.00 42.63  ? 235 LEU B N     1 
ATOM   4500 C  CA    . LEU B 1 253 ? 35.828  -30.275 -49.611 1.00 40.08  ? 235 LEU B CA    1 
ATOM   4501 C  C     . LEU B 1 253 ? 35.048  -29.188 -50.338 1.00 43.98  ? 235 LEU B C     1 
ATOM   4502 O  O     . LEU B 1 253 ? 33.957  -28.812 -49.916 1.00 44.83  ? 235 LEU B O     1 
ATOM   4503 C  CB    . LEU B 1 253 ? 34.918  -30.994 -48.613 1.00 33.38  ? 235 LEU B CB    1 
ATOM   4504 C  CG    . LEU B 1 253 ? 35.600  -31.947 -47.627 1.00 32.18  ? 235 LEU B CG    1 
ATOM   4505 C  CD1   . LEU B 1 253 ? 34.589  -32.554 -46.659 1.00 29.00  ? 235 LEU B CD1   1 
ATOM   4506 C  CD2   . LEU B 1 253 ? 36.362  -33.040 -48.363 1.00 32.43  ? 235 LEU B CD2   1 
ATOM   4507 N  N     . LEU B 1 254 ? 35.607  -28.684 -51.433 1.00 46.42  ? 236 LEU B N     1 
ATOM   4508 C  CA    . LEU B 1 254 ? 35.038  -27.512 -52.094 1.00 48.38  ? 236 LEU B CA    1 
ATOM   4509 C  C     . LEU B 1 254 ? 33.828  -27.822 -52.980 1.00 50.80  ? 236 LEU B C     1 
ATOM   4510 O  O     . LEU B 1 254 ? 33.021  -26.936 -53.264 1.00 51.50  ? 236 LEU B O     1 
ATOM   4511 C  CB    . LEU B 1 254 ? 36.111  -26.761 -52.888 1.00 49.29  ? 236 LEU B CB    1 
ATOM   4512 C  CG    . LEU B 1 254 ? 37.342  -26.281 -52.112 1.00 48.03  ? 236 LEU B CG    1 
ATOM   4513 C  CD1   . LEU B 1 254 ? 38.093  -25.223 -52.906 1.00 51.24  ? 236 LEU B CD1   1 
ATOM   4514 C  CD2   . LEU B 1 254 ? 36.970  -25.753 -50.730 1.00 45.19  ? 236 LEU B CD2   1 
ATOM   4515 N  N     . GLU B 1 255 ? 33.703  -29.075 -53.409 1.00 50.91  ? 237 GLU B N     1 
ATOM   4516 C  CA    . GLU B 1 255 ? 32.585  -29.484 -54.256 1.00 51.04  ? 237 GLU B CA    1 
ATOM   4517 C  C     . GLU B 1 255 ? 31.506  -30.196 -53.438 1.00 48.50  ? 237 GLU B C     1 
ATOM   4518 O  O     . GLU B 1 255 ? 31.805  -31.140 -52.705 1.00 44.65  ? 237 GLU B O     1 
ATOM   4519 C  CB    . GLU B 1 255 ? 33.073  -30.381 -55.397 1.00 52.32  ? 237 GLU B CB    1 
ATOM   4520 N  N     . ASP B 1 256 ? 30.260  -29.741 -53.585 1.00 49.37  ? 238 ASP B N     1 
ATOM   4521 C  CA    . ASP B 1 256 ? 29.131  -30.229 -52.786 1.00 46.32  ? 238 ASP B CA    1 
ATOM   4522 C  C     . ASP B 1 256 ? 29.505  -30.327 -51.318 1.00 39.05  ? 238 ASP B C     1 
ATOM   4523 O  O     . ASP B 1 256 ? 29.375  -31.383 -50.703 1.00 38.53  ? 238 ASP B O     1 
ATOM   4524 C  CB    . ASP B 1 256 ? 28.627  -31.579 -53.300 1.00 51.87  ? 238 ASP B CB    1 
ATOM   4525 C  CG    . ASP B 1 256 ? 27.600  -31.431 -54.404 1.00 61.06  ? 238 ASP B CG    1 
ATOM   4526 O  OD1   . ASP B 1 256 ? 26.405  -31.241 -54.079 1.00 64.69  ? 238 ASP B OD1   1 
ATOM   4527 O  OD2   . ASP B 1 256 ? 27.987  -31.498 -55.592 1.00 61.07  ? 238 ASP B OD2   1 
ATOM   4528 N  N     . THR B 1 257 ? 29.970  -29.209 -50.775 1.00 36.51  ? 239 THR B N     1 
ATOM   4529 C  CA    . THR B 1 257 ? 30.610  -29.175 -49.467 1.00 33.86  ? 239 THR B CA    1 
ATOM   4530 C  C     . THR B 1 257 ? 29.827  -29.856 -48.341 1.00 30.62  ? 239 THR B C     1 
ATOM   4531 O  O     . THR B 1 257 ? 30.386  -30.664 -47.601 1.00 31.52  ? 239 THR B O     1 
ATOM   4532 C  CB    . THR B 1 257 ? 30.956  -27.732 -49.071 1.00 34.89  ? 239 THR B CB    1 
ATOM   4533 O  OG1   . THR B 1 257 ? 31.761  -27.148 -50.101 1.00 40.48  ? 239 THR B OG1   1 
ATOM   4534 C  CG2   . THR B 1 257 ? 31.729  -27.709 -47.758 1.00 33.19  ? 239 THR B CG2   1 
ATOM   4535 N  N     . VAL B 1 258 ? 28.539  -29.549 -48.233 1.00 28.57  ? 240 VAL B N     1 
ATOM   4536 C  CA    . VAL B 1 258 ? 27.723  -30.060 -47.137 1.00 26.87  ? 240 VAL B CA    1 
ATOM   4537 C  C     . VAL B 1 258 ? 27.560  -31.578 -47.210 1.00 30.37  ? 240 VAL B C     1 
ATOM   4538 O  O     . VAL B 1 258 ? 27.782  -32.279 -46.221 1.00 28.42  ? 240 VAL B O     1 
ATOM   4539 C  CB    . VAL B 1 258 ? 26.344  -29.373 -47.086 1.00 27.50  ? 240 VAL B CB    1 
ATOM   4540 C  CG1   . VAL B 1 258 ? 25.537  -29.878 -45.902 1.00 27.30  ? 240 VAL B CG1   1 
ATOM   4541 C  CG2   . VAL B 1 258 ? 26.515  -27.858 -47.001 1.00 27.53  ? 240 VAL B CG2   1 
ATOM   4542 N  N     . HIS B 1 259 ? 27.180  -32.082 -48.381 1.00 30.30  ? 241 HIS B N     1 
ATOM   4543 C  CA    . HIS B 1 259 ? 27.091  -33.524 -48.597 1.00 28.54  ? 241 HIS B CA    1 
ATOM   4544 C  C     . HIS B 1 259 ? 28.450  -34.188 -48.401 1.00 29.38  ? 241 HIS B C     1 
ATOM   4545 O  O     . HIS B 1 259 ? 28.558  -35.204 -47.714 1.00 30.12  ? 241 HIS B O     1 
ATOM   4546 C  CB    . HIS B 1 259 ? 26.537  -33.838 -49.988 1.00 27.79  ? 241 HIS B CB    1 
ATOM   4547 C  CG    . HIS B 1 259 ? 25.074  -33.552 -50.131 1.00 35.71  ? 241 HIS B CG    1 
ATOM   4548 N  ND1   . HIS B 1 259 ? 24.133  -34.547 -50.283 1.00 36.53  ? 241 HIS B ND1   1 
ATOM   4549 C  CD2   . HIS B 1 259 ? 24.389  -32.385 -50.133 1.00 37.35  ? 241 HIS B CD2   1 
ATOM   4550 C  CE1   . HIS B 1 259 ? 22.932  -34.005 -50.379 1.00 36.46  ? 241 HIS B CE1   1 
ATOM   4551 N  NE2   . HIS B 1 259 ? 23.059  -32.694 -50.288 1.00 37.64  ? 241 HIS B NE2   1 
ATOM   4552 N  N     . ALA B 1 260 ? 29.482  -33.598 -48.995 1.00 29.21  ? 242 ALA B N     1 
ATOM   4553 C  CA    . ALA B 1 260 ? 30.845  -34.096 -48.851 1.00 30.41  ? 242 ALA B CA    1 
ATOM   4554 C  C     . ALA B 1 260 ? 31.291  -34.131 -47.390 1.00 30.67  ? 242 ALA B C     1 
ATOM   4555 O  O     . ALA B 1 260 ? 32.034  -35.023 -46.985 1.00 31.51  ? 242 ALA B O     1 
ATOM   4556 C  CB    . ALA B 1 260 ? 31.808  -33.253 -49.677 1.00 30.36  ? 242 ALA B CB    1 
ATOM   4557 N  N     . THR B 1 261 ? 30.840  -33.157 -46.606 1.00 29.09  ? 243 THR B N     1 
ATOM   4558 C  CA    . THR B 1 261 ? 31.202  -33.092 -45.194 1.00 27.31  ? 243 THR B CA    1 
ATOM   4559 C  C     . THR B 1 261 ? 30.535  -34.206 -44.400 1.00 25.70  ? 243 THR B C     1 
ATOM   4560 O  O     . THR B 1 261 ? 31.177  -34.865 -43.583 1.00 27.54  ? 243 THR B O     1 
ATOM   4561 C  CB    . THR B 1 261 ? 30.839  -31.729 -44.574 1.00 25.49  ? 243 THR B CB    1 
ATOM   4562 O  OG1   . THR B 1 261 ? 31.725  -30.728 -45.084 1.00 28.36  ? 243 THR B OG1   1 
ATOM   4563 C  CG2   . THR B 1 261 ? 30.962  -31.774 -43.055 1.00 22.59  ? 243 THR B CG2   1 
ATOM   4564 N  N     . ALA B 1 262 ? 29.247  -34.419 -44.648 1.00 22.69  ? 244 ALA B N     1 
ATOM   4565 C  CA    . ALA B 1 262 ? 28.519  -35.484 -43.972 1.00 23.04  ? 244 ALA B CA    1 
ATOM   4566 C  C     . ALA B 1 262 ? 29.162  -36.844 -44.272 1.00 25.70  ? 244 ALA B C     1 
ATOM   4567 O  O     . ALA B 1 262 ? 29.281  -37.690 -43.390 1.00 22.60  ? 244 ALA B O     1 
ATOM   4568 C  CB    . ALA B 1 262 ? 27.055  -35.470 -44.386 1.00 21.91  ? 244 ALA B CB    1 
ATOM   4569 N  N     . ARG B 1 263 ? 29.588  -37.030 -45.518 1.00 29.11  ? 245 ARG B N     1 
ATOM   4570 C  CA    . ARG B 1 263 ? 30.266  -38.253 -45.939 1.00 31.98  ? 245 ARG B CA    1 
ATOM   4571 C  C     . ARG B 1 263 ? 31.599  -38.415 -45.212 1.00 34.48  ? 245 ARG B C     1 
ATOM   4572 O  O     . ARG B 1 263 ? 31.883  -39.475 -44.650 1.00 33.62  ? 245 ARG B O     1 
ATOM   4573 C  CB    . ARG B 1 263 ? 30.467  -38.248 -47.463 1.00 31.44  ? 245 ARG B CB    1 
ATOM   4574 C  CG    . ARG B 1 263 ? 31.333  -39.381 -48.018 1.00 35.31  ? 245 ARG B CG    1 
ATOM   4575 C  CD    . ARG B 1 263 ? 30.930  -40.748 -47.459 1.00 39.51  ? 245 ARG B CD    1 
ATOM   4576 N  NE    . ARG B 1 263 ? 29.512  -41.027 -47.627 1.00 40.25  ? 245 ARG B NE    1 
ATOM   4577 C  CZ    . ARG B 1 263 ? 28.782  -41.741 -46.780 1.00 36.83  ? 245 ARG B CZ    1 
ATOM   4578 N  NH1   . ARG B 1 263 ? 29.331  -42.257 -45.688 1.00 32.43  ? 245 ARG B NH1   1 
ATOM   4579 N  NH2   . ARG B 1 263 ? 27.494  -41.932 -47.023 1.00 39.82  ? 245 ARG B NH2   1 
ATOM   4580 N  N     . TYR B 1 264 ? 32.398  -37.349 -45.217 1.00 34.42  ? 246 TYR B N     1 
ATOM   4581 C  CA    . TYR B 1 264 ? 33.723  -37.344 -44.605 1.00 30.47  ? 246 TYR B CA    1 
ATOM   4582 C  C     . TYR B 1 264 ? 33.673  -37.675 -43.118 1.00 27.91  ? 246 TYR B C     1 
ATOM   4583 O  O     . TYR B 1 264 ? 34.469  -38.470 -42.623 1.00 28.50  ? 246 TYR B O     1 
ATOM   4584 C  CB    . TYR B 1 264 ? 34.381  -35.978 -44.803 1.00 30.98  ? 246 TYR B CB    1 
ATOM   4585 C  CG    . TYR B 1 264 ? 35.812  -35.898 -44.319 1.00 31.88  ? 246 TYR B CG    1 
ATOM   4586 C  CD1   . TYR B 1 264 ? 36.874  -36.134 -45.186 1.00 36.25  ? 246 TYR B CD1   1 
ATOM   4587 C  CD2   . TYR B 1 264 ? 36.102  -35.572 -43.000 1.00 32.15  ? 246 TYR B CD2   1 
ATOM   4588 C  CE1   . TYR B 1 264 ? 38.183  -36.057 -44.751 1.00 38.74  ? 246 TYR B CE1   1 
ATOM   4589 C  CE2   . TYR B 1 264 ? 37.409  -35.495 -42.554 1.00 36.14  ? 246 TYR B CE2   1 
ATOM   4590 C  CZ    . TYR B 1 264 ? 38.444  -35.738 -43.433 1.00 39.63  ? 246 TYR B CZ    1 
ATOM   4591 O  OH    . TYR B 1 264 ? 39.743  -35.661 -42.988 1.00 43.86  ? 246 TYR B OH    1 
ATOM   4592 N  N     . ILE B 1 265 ? 32.746  -37.046 -42.407 1.00 26.60  ? 247 ILE B N     1 
ATOM   4593 C  CA    . ILE B 1 265 ? 32.627  -37.238 -40.972 1.00 22.72  ? 247 ILE B CA    1 
ATOM   4594 C  C     . ILE B 1 265 ? 32.178  -38.666 -40.659 1.00 25.40  ? 247 ILE B C     1 
ATOM   4595 O  O     . ILE B 1 265 ? 32.685  -39.298 -39.732 1.00 26.63  ? 247 ILE B O     1 
ATOM   4596 C  CB    . ILE B 1 265 ? 31.671  -36.192 -40.350 1.00 22.55  ? 247 ILE B CB    1 
ATOM   4597 C  CG1   . ILE B 1 265 ? 32.258  -34.787 -40.522 1.00 25.49  ? 247 ILE B CG1   1 
ATOM   4598 C  CG2   . ILE B 1 265 ? 31.440  -36.466 -38.879 1.00 19.53  ? 247 ILE B CG2   1 
ATOM   4599 C  CD1   . ILE B 1 265 ? 31.372  -33.667 -40.006 1.00 22.26  ? 247 ILE B CD1   1 
ATOM   4600 N  N     . ALA B 1 266 ? 31.243  -39.176 -41.451 1.00 25.10  ? 248 ALA B N     1 
ATOM   4601 C  CA    . ALA B 1 266 ? 30.755  -40.540 -41.273 1.00 28.11  ? 248 ALA B CA    1 
ATOM   4602 C  C     . ALA B 1 266 ? 31.872  -41.573 -41.429 1.00 31.92  ? 248 ALA B C     1 
ATOM   4603 O  O     . ALA B 1 266 ? 31.912  -42.570 -40.710 1.00 33.43  ? 248 ALA B O     1 
ATOM   4604 C  CB    . ALA B 1 266 ? 29.628  -40.832 -42.260 1.00 25.92  ? 248 ALA B CB    1 
ATOM   4605 N  N     . ASP B 1 267 ? 32.786  -41.322 -42.361 1.00 26.64  ? 249 ASP B N     1 
ATOM   4606 C  CA    . ASP B 1 267 ? 33.778  -42.321 -42.729 1.00 28.75  ? 249 ASP B CA    1 
ATOM   4607 C  C     . ASP B 1 267 ? 35.137  -42.180 -42.044 1.00 28.82  ? 249 ASP B C     1 
ATOM   4608 O  O     . ASP B 1 267 ? 36.038  -42.971 -42.310 1.00 32.40  ? 249 ASP B O     1 
ATOM   4609 C  CB    . ASP B 1 267 ? 33.971  -42.343 -44.247 1.00 30.83  ? 249 ASP B CB    1 
ATOM   4610 C  CG    . ASP B 1 267 ? 32.734  -42.815 -44.987 1.00 34.03  ? 249 ASP B CG    1 
ATOM   4611 O  OD1   . ASP B 1 267 ? 31.738  -43.186 -44.329 1.00 37.64  ? 249 ASP B OD1   1 
ATOM   4612 O  OD2   . ASP B 1 267 ? 32.765  -42.831 -46.230 1.00 37.47  ? 249 ASP B OD2   1 
ATOM   4613 N  N     . LEU B 1 268 ? 35.298  -41.182 -41.180 1.00 25.43  ? 250 LEU B N     1 
ATOM   4614 C  CA    . LEU B 1 268 ? 36.546  -41.047 -40.431 1.00 27.98  ? 250 LEU B CA    1 
ATOM   4615 C  C     . LEU B 1 268 ? 36.752  -42.296 -39.597 1.00 28.52  ? 250 LEU B C     1 
ATOM   4616 O  O     . LEU B 1 268 ? 35.803  -42.816 -39.016 1.00 23.35  ? 250 LEU B O     1 
ATOM   4617 C  CB    . LEU B 1 268 ? 36.526  -39.817 -39.520 1.00 28.85  ? 250 LEU B CB    1 
ATOM   4618 C  CG    . LEU B 1 268 ? 36.997  -38.503 -40.138 1.00 30.74  ? 250 LEU B CG    1 
ATOM   4619 C  CD1   . LEU B 1 268 ? 36.704  -37.337 -39.204 1.00 28.07  ? 250 LEU B CD1   1 
ATOM   4620 C  CD2   . LEU B 1 268 ? 38.483  -38.577 -40.458 1.00 31.36  ? 250 LEU B CD2   1 
ATOM   4621 N  N     . PRO B 1 269 ? 37.986  -42.807 -39.560 1.00 29.69  ? 251 PRO B N     1 
ATOM   4622 C  CA    . PRO B 1 269 ? 38.233  -43.994 -38.735 1.00 30.45  ? 251 PRO B CA    1 
ATOM   4623 C  C     . PRO B 1 269 ? 37.960  -43.742 -37.249 1.00 29.54  ? 251 PRO B C     1 
ATOM   4624 O  O     . PRO B 1 269 ? 38.200  -42.641 -36.750 1.00 28.67  ? 251 PRO B O     1 
ATOM   4625 C  CB    . PRO B 1 269 ? 39.719  -44.298 -38.981 1.00 33.25  ? 251 PRO B CB    1 
ATOM   4626 C  CG    . PRO B 1 269 ? 40.276  -43.101 -39.701 1.00 33.27  ? 251 PRO B CG    1 
ATOM   4627 C  CD    . PRO B 1 269 ? 39.139  -42.452 -40.403 1.00 30.87  ? 251 PRO B CD    1 
ATOM   4628 N  N     . PHE B 1 270 ? 37.429  -44.746 -36.556 1.00 30.07  ? 252 PHE B N     1 
ATOM   4629 C  CA    . PHE B 1 270 ? 37.319  -44.676 -35.103 1.00 27.38  ? 252 PHE B CA    1 
ATOM   4630 C  C     . PHE B 1 270 ? 38.713  -44.819 -34.513 1.00 30.80  ? 252 PHE B C     1 
ATOM   4631 O  O     . PHE B 1 270 ? 39.580  -45.463 -35.106 1.00 30.30  ? 252 PHE B O     1 
ATOM   4632 C  CB    . PHE B 1 270 ? 36.381  -45.755 -34.556 1.00 25.98  ? 252 PHE B CB    1 
ATOM   4633 C  CG    . PHE B 1 270 ? 34.928  -45.394 -34.653 1.00 24.42  ? 252 PHE B CG    1 
ATOM   4634 C  CD1   . PHE B 1 270 ? 34.314  -44.669 -33.645 1.00 21.07  ? 252 PHE B CD1   1 
ATOM   4635 C  CD2   . PHE B 1 270 ? 34.178  -45.769 -35.754 1.00 23.83  ? 252 PHE B CD2   1 
ATOM   4636 C  CE1   . PHE B 1 270 ? 32.973  -44.326 -33.732 1.00 24.15  ? 252 PHE B CE1   1 
ATOM   4637 C  CE2   . PHE B 1 270 ? 32.839  -45.427 -35.848 1.00 23.57  ? 252 PHE B CE2   1 
ATOM   4638 C  CZ    . PHE B 1 270 ? 32.236  -44.704 -34.837 1.00 20.36  ? 252 PHE B CZ    1 
ATOM   4639 N  N     . ALA B 1 271 ? 38.925  -44.215 -33.348 1.00 30.63  ? 253 ALA B N     1 
ATOM   4640 C  CA    . ALA B 1 271 ? 40.259  -44.131 -32.763 1.00 30.79  ? 253 ALA B CA    1 
ATOM   4641 C  C     . ALA B 1 271 ? 40.893  -45.492 -32.481 1.00 31.84  ? 253 ALA B C     1 
ATOM   4642 O  O     . ALA B 1 271 ? 42.107  -45.642 -32.584 1.00 36.27  ? 253 ALA B O     1 
ATOM   4643 C  CB    . ALA B 1 271 ? 40.227  -43.292 -31.510 1.00 30.21  ? 253 ALA B CB    1 
ATOM   4644 N  N     . ASP B 1 272 ? 40.075  -46.483 -32.135 1.00 27.64  ? 254 ASP B N     1 
ATOM   4645 C  CA    . ASP B 1 272 ? 40.593  -47.815 -31.824 1.00 30.44  ? 254 ASP B CA    1 
ATOM   4646 C  C     . ASP B 1 272 ? 40.630  -48.736 -33.051 1.00 32.57  ? 254 ASP B C     1 
ATOM   4647 O  O     . ASP B 1 272 ? 40.908  -49.930 -32.937 1.00 32.48  ? 254 ASP B O     1 
ATOM   4648 C  CB    . ASP B 1 272 ? 39.784  -48.454 -30.690 1.00 28.84  ? 254 ASP B CB    1 
ATOM   4649 C  CG    . ASP B 1 272 ? 38.327  -48.663 -31.057 1.00 33.16  ? 254 ASP B CG    1 
ATOM   4650 O  OD1   . ASP B 1 272 ? 37.602  -49.304 -30.265 1.00 34.76  ? 254 ASP B OD1   1 
ATOM   4651 O  OD2   . ASP B 1 272 ? 37.908  -48.199 -32.141 1.00 29.15  ? 254 ASP B OD2   1 
ATOM   4652 N  N     . GLY B 1 273 ? 40.331  -48.178 -34.220 1.00 34.29  ? 255 GLY B N     1 
ATOM   4653 C  CA    . GLY B 1 273 ? 40.415  -48.922 -35.466 1.00 37.25  ? 255 GLY B CA    1 
ATOM   4654 C  C     . GLY B 1 273 ? 39.319  -49.950 -35.680 1.00 40.09  ? 255 GLY B C     1 
ATOM   4655 O  O     . GLY B 1 273 ? 39.303  -50.637 -36.697 1.00 40.37  ? 255 GLY B O     1 
ATOM   4656 N  N     . LYS B 1 274 ? 38.400  -50.063 -34.727 1.00 40.52  ? 256 LYS B N     1 
ATOM   4657 C  CA    . LYS B 1 274 ? 37.314  -51.030 -34.837 1.00 40.36  ? 256 LYS B CA    1 
ATOM   4658 C  C     . LYS B 1 274 ? 36.205  -50.498 -35.740 1.00 38.43  ? 256 LYS B C     1 
ATOM   4659 O  O     . LYS B 1 274 ? 35.957  -49.292 -35.793 1.00 34.28  ? 256 LYS B O     1 
ATOM   4660 C  CB    . LYS B 1 274 ? 36.777  -51.401 -33.451 1.00 42.12  ? 256 LYS B CB    1 
ATOM   4661 C  CG    . LYS B 1 274 ? 37.804  -52.130 -32.592 1.00 49.46  ? 256 LYS B CG    1 
ATOM   4662 C  CD    . LYS B 1 274 ? 37.337  -52.338 -31.158 1.00 52.05  ? 256 LYS B CD    1 
ATOM   4663 C  CE    . LYS B 1 274 ? 38.470  -52.877 -30.286 1.00 54.02  ? 256 LYS B CE    1 
ATOM   4664 N  NZ    . LYS B 1 274 ? 38.142  -52.811 -28.832 1.00 53.53  ? 256 LYS B NZ    1 
ATOM   4665 N  N     . LYS B 1 275 ? 35.550  -51.403 -36.459 1.00 40.89  ? 257 LYS B N     1 
ATOM   4666 C  CA    . LYS B 1 275 ? 34.520  -51.016 -37.415 1.00 40.28  ? 257 LYS B CA    1 
ATOM   4667 C  C     . LYS B 1 275 ? 33.181  -50.804 -36.720 1.00 36.38  ? 257 LYS B C     1 
ATOM   4668 O  O     . LYS B 1 275 ? 32.625  -51.730 -36.142 1.00 37.57  ? 257 LYS B O     1 
ATOM   4669 C  CB    . LYS B 1 275 ? 34.387  -52.083 -38.500 1.00 45.63  ? 257 LYS B CB    1 
ATOM   4670 C  CG    . LYS B 1 275 ? 33.889  -51.561 -39.832 1.00 49.01  ? 257 LYS B CG    1 
ATOM   4671 C  CD    . LYS B 1 275 ? 34.137  -52.583 -40.928 1.00 55.31  ? 257 LYS B CD    1 
ATOM   4672 C  CE    . LYS B 1 275 ? 33.935  -51.986 -42.311 1.00 59.44  ? 257 LYS B CE    1 
ATOM   4673 N  NZ    . LYS B 1 275 ? 34.319  -52.957 -43.380 1.00 64.71  ? 257 LYS B NZ    1 
ATOM   4674 N  N     . ARG B 1 276 ? 32.673  -49.577 -36.774 1.00 35.48  ? 258 ARG B N     1 
ATOM   4675 C  CA    . ARG B 1 276 ? 31.394  -49.241 -36.159 1.00 35.44  ? 258 ARG B CA    1 
ATOM   4676 C  C     . ARG B 1 276 ? 30.576  -48.366 -37.087 1.00 32.13  ? 258 ARG B C     1 
ATOM   4677 O  O     . ARG B 1 276 ? 31.108  -47.792 -38.036 1.00 32.98  ? 258 ARG B O     1 
ATOM   4678 C  CB    . ARG B 1 276 ? 31.601  -48.470 -34.859 1.00 35.31  ? 258 ARG B CB    1 
ATOM   4679 C  CG    . ARG B 1 276 ? 32.255  -49.244 -33.760 1.00 36.61  ? 258 ARG B CG    1 
ATOM   4680 C  CD    . ARG B 1 276 ? 32.279  -48.410 -32.495 1.00 32.80  ? 258 ARG B CD    1 
ATOM   4681 N  NE    . ARG B 1 276 ? 33.065  -49.059 -31.459 1.00 31.57  ? 258 ARG B NE    1 
ATOM   4682 C  CZ    . ARG B 1 276 ? 34.388  -48.986 -31.381 1.00 30.20  ? 258 ARG B CZ    1 
ATOM   4683 N  NH1   . ARG B 1 276 ? 35.065  -48.287 -32.283 1.00 25.27  ? 258 ARG B NH1   1 
ATOM   4684 N  NH2   . ARG B 1 276 ? 35.033  -49.608 -30.402 1.00 27.69  ? 258 ARG B NH2   1 
ATOM   4685 N  N     . LYS B 1 277 ? 29.284  -48.256 -36.801 1.00 29.16  ? 259 LYS B N     1 
ATOM   4686 C  CA    . LYS B 1 277 ? 28.443  -47.305 -37.512 1.00 32.72  ? 259 LYS B CA    1 
ATOM   4687 C  C     . LYS B 1 277 ? 28.487  -45.968 -36.798 1.00 31.05  ? 259 LYS B C     1 
ATOM   4688 O  O     . LYS B 1 277 ? 28.039  -45.859 -35.656 1.00 31.33  ? 259 LYS B O     1 
ATOM   4689 C  CB    . LYS B 1 277 ? 26.992  -47.787 -37.591 1.00 38.22  ? 259 LYS B CB    1 
ATOM   4690 C  CG    . LYS B 1 277 ? 26.708  -48.791 -38.699 1.00 45.56  ? 259 LYS B CG    1 
ATOM   4691 C  CD    . LYS B 1 277 ? 25.212  -49.052 -38.825 1.00 46.65  ? 259 LYS B CD    1 
ATOM   4692 C  CE    . LYS B 1 277 ? 24.921  -50.132 -39.853 1.00 49.78  ? 259 LYS B CE    1 
ATOM   4693 N  NZ    . LYS B 1 277 ? 25.553  -51.433 -39.492 1.00 51.79  ? 259 LYS B NZ    1 
ATOM   4694 N  N     . ARG B 1 278 ? 29.041  -44.955 -37.456 1.00 27.39  ? 260 ARG B N     1 
ATOM   4695 C  CA    . ARG B 1 278 ? 28.881  -43.595 -36.965 1.00 27.08  ? 260 ARG B CA    1 
ATOM   4696 C  C     . ARG B 1 278 ? 27.753  -42.907 -37.713 1.00 25.35  ? 260 ARG B C     1 
ATOM   4697 O  O     . ARG B 1 278 ? 27.747  -42.857 -38.938 1.00 28.53  ? 260 ARG B O     1 
ATOM   4698 C  CB    . ARG B 1 278 ? 30.163  -42.774 -37.096 1.00 28.12  ? 260 ARG B CB    1 
ATOM   4699 C  CG    . ARG B 1 278 ? 29.957  -41.314 -36.710 1.00 28.23  ? 260 ARG B CG    1 
ATOM   4700 C  CD    . ARG B 1 278 ? 31.262  -40.657 -36.322 1.00 29.73  ? 260 ARG B CD    1 
ATOM   4701 N  NE    . ARG B 1 278 ? 32.254  -40.901 -37.348 1.00 37.66  ? 260 ARG B NE    1 
ATOM   4702 C  CZ    . ARG B 1 278 ? 33.431  -41.471 -37.144 1.00 32.91  ? 260 ARG B CZ    1 
ATOM   4703 N  NH1   . ARG B 1 278 ? 33.807  -41.850 -35.932 1.00 27.75  ? 260 ARG B NH1   1 
ATOM   4704 N  NH2   . ARG B 1 278 ? 34.236  -41.641 -38.170 1.00 35.07  ? 260 ARG B NH2   1 
ATOM   4705 N  N     . LEU B 1 279 ? 26.801  -42.380 -36.960 1.00 21.77  ? 261 LEU B N     1 
ATOM   4706 C  CA    . LEU B 1 279 ? 25.682  -41.659 -37.531 1.00 21.75  ? 261 LEU B CA    1 
ATOM   4707 C  C     . LEU B 1 279 ? 25.991  -40.157 -37.604 1.00 21.90  ? 261 LEU B C     1 
ATOM   4708 O  O     . LEU B 1 279 ? 26.490  -39.555 -36.644 1.00 16.73  ? 261 LEU B O     1 
ATOM   4709 C  CB    . LEU B 1 279 ? 24.441  -41.917 -36.683 1.00 22.26  ? 261 LEU B CB    1 
ATOM   4710 C  CG    . LEU B 1 279 ? 23.134  -41.237 -37.062 1.00 29.01  ? 261 LEU B CG    1 
ATOM   4711 C  CD1   . LEU B 1 279 ? 22.735  -41.605 -38.479 1.00 30.93  ? 261 LEU B CD1   1 
ATOM   4712 C  CD2   . LEU B 1 279 ? 22.053  -41.652 -36.071 1.00 31.86  ? 261 LEU B CD2   1 
ATOM   4713 N  N     . VAL B 1 280 ? 25.714  -39.560 -38.755 1.00 23.11  ? 262 VAL B N     1 
ATOM   4714 C  CA    . VAL B 1 280 ? 25.911  -38.129 -38.926 1.00 21.56  ? 262 VAL B CA    1 
ATOM   4715 C  C     . VAL B 1 280 ? 24.620  -37.486 -39.401 1.00 19.79  ? 262 VAL B C     1 
ATOM   4716 O  O     . VAL B 1 280 ? 24.031  -37.918 -40.389 1.00 16.95  ? 262 VAL B O     1 
ATOM   4717 C  CB    . VAL B 1 280 ? 27.043  -37.817 -39.922 1.00 22.39  ? 262 VAL B CB    1 
ATOM   4718 C  CG1   . VAL B 1 280 ? 27.204  -36.307 -40.082 1.00 20.48  ? 262 VAL B CG1   1 
ATOM   4719 C  CG2   . VAL B 1 280 ? 28.346  -38.450 -39.459 1.00 21.01  ? 262 VAL B CG2   1 
ATOM   4720 N  N     . ILE B 1 281 ? 24.184  -36.457 -38.681 1.00 18.60  ? 263 ILE B N     1 
ATOM   4721 C  CA    . ILE B 1 281 ? 22.949  -35.746 -38.992 1.00 19.17  ? 263 ILE B CA    1 
ATOM   4722 C  C     . ILE B 1 281 ? 23.230  -34.249 -39.144 1.00 23.32  ? 263 ILE B C     1 
ATOM   4723 O  O     . ILE B 1 281 ? 23.750  -33.614 -38.221 1.00 24.11  ? 263 ILE B O     1 
ATOM   4724 C  CB    . ILE B 1 281 ? 21.902  -35.945 -37.875 1.00 17.11  ? 263 ILE B CB    1 
ATOM   4725 C  CG1   . ILE B 1 281 ? 21.604  -37.434 -37.667 1.00 18.00  ? 263 ILE B CG1   1 
ATOM   4726 C  CG2   . ILE B 1 281 ? 20.632  -35.169 -38.183 1.00 15.82  ? 263 ILE B CG2   1 
ATOM   4727 C  CD1   . ILE B 1 281 ? 20.912  -37.735 -36.348 1.00 20.20  ? 263 ILE B CD1   1 
ATOM   4728 N  N     . ILE B 1 282 ? 22.889  -33.693 -40.305 1.00 20.55  ? 264 ILE B N     1 
ATOM   4729 C  CA    . ILE B 1 282 ? 23.107  -32.276 -40.581 1.00 17.01  ? 264 ILE B CA    1 
ATOM   4730 C  C     . ILE B 1 282 ? 21.787  -31.573 -40.874 1.00 19.12  ? 264 ILE B C     1 
ATOM   4731 O  O     . ILE B 1 282 ? 21.168  -31.801 -41.912 1.00 18.84  ? 264 ILE B O     1 
ATOM   4732 C  CB    . ILE B 1 282 ? 24.045  -32.057 -41.796 1.00 26.87  ? 264 ILE B CB    1 
ATOM   4733 C  CG1   . ILE B 1 282 ? 25.380  -32.779 -41.594 1.00 25.19  ? 264 ILE B CG1   1 
ATOM   4734 C  CG2   . ILE B 1 282 ? 24.261  -30.558 -42.051 1.00 18.71  ? 264 ILE B CG2   1 
ATOM   4735 C  CD1   . ILE B 1 282 ? 26.106  -32.361 -40.334 1.00 24.66  ? 264 ILE B CD1   1 
ATOM   4736 N  N     . THR B 1 283 ? 21.363  -30.705 -39.963 1.00 17.41  ? 265 THR B N     1 
ATOM   4737 C  CA    . THR B 1 283 ? 20.140  -29.943 -40.162 1.00 22.93  ? 265 THR B CA    1 
ATOM   4738 C  C     . THR B 1 283 ? 20.391  -28.759 -41.104 1.00 24.94  ? 265 THR B C     1 
ATOM   4739 O  O     . THR B 1 283 ? 21.496  -28.211 -41.148 1.00 24.44  ? 265 THR B O     1 
ATOM   4740 C  CB    . THR B 1 283 ? 19.562  -29.471 -38.810 1.00 24.38  ? 265 THR B CB    1 
ATOM   4741 O  OG1   . THR B 1 283 ? 20.571  -28.764 -38.079 1.00 25.51  ? 265 THR B OG1   1 
ATOM   4742 C  CG2   . THR B 1 283 ? 19.121  -30.670 -37.984 1.00 22.76  ? 265 THR B CG2   1 
ATOM   4743 N  N     . ARG B 1 284 ? 19.374  -28.382 -41.875 1.00 25.50  ? 266 ARG B N     1 
ATOM   4744 C  CA    . ARG B 1 284 ? 19.512  -27.280 -42.828 1.00 27.01  ? 266 ARG B CA    1 
ATOM   4745 C  C     . ARG B 1 284 ? 18.332  -26.312 -42.738 1.00 27.39  ? 266 ARG B C     1 
ATOM   4746 O  O     . ARG B 1 284 ? 17.719  -25.957 -43.749 1.00 29.22  ? 266 ARG B O     1 
ATOM   4747 C  CB    . ARG B 1 284 ? 19.659  -27.808 -44.262 1.00 30.24  ? 266 ARG B CB    1 
ATOM   4748 C  CG    . ARG B 1 284 ? 20.719  -28.898 -44.446 1.00 33.13  ? 266 ARG B CG    1 
ATOM   4749 C  CD    . ARG B 1 284 ? 21.022  -29.167 -45.927 1.00 39.00  ? 266 ARG B CD    1 
ATOM   4750 N  NE    . ARG B 1 284 ? 21.840  -28.104 -46.513 1.00 47.28  ? 266 ARG B NE    1 
ATOM   4751 C  CZ    . ARG B 1 284 ? 22.414  -28.155 -47.716 1.00 51.69  ? 266 ARG B CZ    1 
ATOM   4752 N  NH1   . ARG B 1 284 ? 22.269  -29.225 -48.489 1.00 49.78  ? 266 ARG B NH1   1 
ATOM   4753 N  NH2   . ARG B 1 284 ? 23.142  -27.131 -48.146 1.00 55.60  ? 266 ARG B NH2   1 
ATOM   4754 N  N     . GLY B 1 285 ? 18.015  -25.890 -41.521 1.00 25.74  ? 267 GLY B N     1 
ATOM   4755 C  CA    . GLY B 1 285 ? 16.960  -24.921 -41.295 1.00 23.72  ? 267 GLY B CA    1 
ATOM   4756 C  C     . GLY B 1 285 ? 15.600  -25.476 -41.649 1.00 29.99  ? 267 GLY B C     1 
ATOM   4757 O  O     . GLY B 1 285 ? 15.229  -26.566 -41.211 1.00 27.58  ? 267 GLY B O     1 
ATOM   4758 N  N     . LYS B 1 286 ? 14.857  -24.724 -42.453 1.00 30.97  ? 268 LYS B N     1 
ATOM   4759 C  CA    . LYS B 1 286 ? 13.530  -25.137 -42.884 1.00 32.04  ? 268 LYS B CA    1 
ATOM   4760 C  C     . LYS B 1 286 ? 13.618  -26.165 -44.010 1.00 30.87  ? 268 LYS B C     1 
ATOM   4761 O  O     . LYS B 1 286 ? 12.632  -26.815 -44.349 1.00 29.43  ? 268 LYS B O     1 
ATOM   4762 C  CB    . LYS B 1 286 ? 12.721  -23.924 -43.346 1.00 36.34  ? 268 LYS B CB    1 
ATOM   4763 C  CG    . LYS B 1 286 ? 13.162  -23.354 -44.685 1.00 41.19  ? 268 LYS B CG    1 
ATOM   4764 C  CD    . LYS B 1 286 ? 12.240  -22.226 -45.132 1.00 47.18  ? 268 LYS B CD    1 
ATOM   4765 C  CE    . LYS B 1 286 ? 12.880  -20.876 -44.890 1.00 52.81  ? 268 LYS B CE    1 
ATOM   4766 N  NZ    . LYS B 1 286 ? 14.148  -20.746 -45.662 1.00 55.86  ? 268 LYS B NZ    1 
ATOM   4767 N  N     . ASN B 1 287 ? 14.803  -26.294 -44.593 1.00 25.66  ? 269 ASN B N     1 
ATOM   4768 C  CA    . ASN B 1 287 ? 15.025  -27.235 -45.681 1.00 25.73  ? 269 ASN B CA    1 
ATOM   4769 C  C     . ASN B 1 287 ? 15.311  -28.635 -45.122 1.00 26.92  ? 269 ASN B C     1 
ATOM   4770 O  O     . ASN B 1 287 ? 15.651  -28.770 -43.947 1.00 23.73  ? 269 ASN B O     1 
ATOM   4771 C  CB    . ASN B 1 287 ? 16.161  -26.723 -46.576 1.00 26.49  ? 269 ASN B CB    1 
ATOM   4772 C  CG    . ASN B 1 287 ? 15.826  -25.388 -47.232 1.00 30.88  ? 269 ASN B CG    1 
ATOM   4773 O  OD1   . ASN B 1 287 ? 14.705  -25.176 -47.698 1.00 32.54  ? 269 ASN B OD1   1 
ATOM   4774 N  ND2   . ASN B 1 287 ? 16.795  -24.480 -47.260 1.00 30.30  ? 269 ASN B ND2   1 
ATOM   4775 N  N     . PRO B 1 288 ? 15.147  -29.685 -45.949 1.00 28.55  ? 270 PRO B N     1 
ATOM   4776 C  CA    . PRO B 1 288 ? 15.349  -31.053 -45.452 1.00 25.83  ? 270 PRO B CA    1 
ATOM   4777 C  C     . PRO B 1 288 ? 16.730  -31.269 -44.846 1.00 24.35  ? 270 PRO B C     1 
ATOM   4778 O  O     . PRO B 1 288 ? 17.733  -30.798 -45.384 1.00 24.02  ? 270 PRO B O     1 
ATOM   4779 C  CB    . PRO B 1 288 ? 15.200  -31.908 -46.714 1.00 27.15  ? 270 PRO B CB    1 
ATOM   4780 C  CG    . PRO B 1 288 ? 14.311  -31.105 -47.605 1.00 26.04  ? 270 PRO B CG    1 
ATOM   4781 C  CD    . PRO B 1 288 ? 14.683  -29.672 -47.349 1.00 26.12  ? 270 PRO B CD    1 
ATOM   4782 N  N     . LEU B 1 289 ? 16.775  -31.971 -43.721 1.00 20.84  ? 271 LEU B N     1 
ATOM   4783 C  CA    . LEU B 1 289 ? 18.046  -32.326 -43.115 1.00 20.13  ? 271 LEU B CA    1 
ATOM   4784 C  C     . LEU B 1 289 ? 18.679  -33.494 -43.864 1.00 24.08  ? 271 LEU B C     1 
ATOM   4785 O  O     . LEU B 1 289 ? 18.015  -34.207 -44.626 1.00 24.41  ? 271 LEU B O     1 
ATOM   4786 C  CB    . LEU B 1 289 ? 17.877  -32.655 -41.627 1.00 22.53  ? 271 LEU B CB    1 
ATOM   4787 C  CG    . LEU B 1 289 ? 16.937  -33.789 -41.193 1.00 24.57  ? 271 LEU B CG    1 
ATOM   4788 C  CD1   . LEU B 1 289 ? 17.639  -35.141 -41.187 1.00 27.06  ? 271 LEU B CD1   1 
ATOM   4789 C  CD2   . LEU B 1 289 ? 16.345  -33.494 -39.817 1.00 23.06  ? 271 LEU B CD2   1 
ATOM   4790 N  N     . LEU B 1 290 ? 19.973  -33.674 -43.650 1.00 21.45  ? 272 LEU B N     1 
ATOM   4791 C  CA    . LEU B 1 290 ? 20.692  -34.773 -44.248 1.00 23.46  ? 272 LEU B CA    1 
ATOM   4792 C  C     . LEU B 1 290 ? 21.071  -35.724 -43.134 1.00 26.20  ? 272 LEU B C     1 
ATOM   4793 O  O     . LEU B 1 290 ? 21.271  -35.302 -41.990 1.00 24.33  ? 272 LEU B O     1 
ATOM   4794 C  CB    . LEU B 1 290 ? 21.946  -34.267 -44.955 1.00 23.44  ? 272 LEU B CB    1 
ATOM   4795 C  CG    . LEU B 1 290 ? 21.722  -33.163 -45.991 1.00 26.93  ? 272 LEU B CG    1 
ATOM   4796 C  CD1   . LEU B 1 290 ? 23.049  -32.717 -46.590 1.00 26.16  ? 272 LEU B CD1   1 
ATOM   4797 C  CD2   . LEU B 1 290 ? 20.755  -33.635 -47.075 1.00 30.03  ? 272 LEU B CD2   1 
ATOM   4798 N  N     . TYR B 1 291 ? 21.145  -37.009 -43.456 1.00 24.71  ? 273 TYR B N     1 
ATOM   4799 C  CA    . TYR B 1 291 ? 21.663  -37.981 -42.505 1.00 26.74  ? 273 TYR B CA    1 
ATOM   4800 C  C     . TYR B 1 291 ? 22.252  -39.177 -43.236 1.00 27.49  ? 273 TYR B C     1 
ATOM   4801 O  O     . TYR B 1 291 ? 21.741  -39.605 -44.274 1.00 28.73  ? 273 TYR B O     1 
ATOM   4802 C  CB    . TYR B 1 291 ? 20.594  -38.418 -41.496 1.00 25.33  ? 273 TYR B CB    1 
ATOM   4803 C  CG    . TYR B 1 291 ? 19.495  -39.286 -42.064 1.00 27.22  ? 273 TYR B CG    1 
ATOM   4804 C  CD1   . TYR B 1 291 ? 19.618  -40.674 -42.089 1.00 29.82  ? 273 TYR B CD1   1 
ATOM   4805 C  CD2   . TYR B 1 291 ? 18.329  -38.724 -42.562 1.00 28.13  ? 273 TYR B CD2   1 
ATOM   4806 C  CE1   . TYR B 1 291 ? 18.613  -41.474 -42.604 1.00 28.03  ? 273 TYR B CE1   1 
ATOM   4807 C  CE2   . TYR B 1 291 ? 17.314  -39.517 -43.074 1.00 28.42  ? 273 TYR B CE2   1 
ATOM   4808 C  CZ    . TYR B 1 291 ? 17.464  -40.890 -43.092 1.00 30.64  ? 273 TYR B CZ    1 
ATOM   4809 O  OH    . TYR B 1 291 ? 16.462  -41.680 -43.605 1.00 32.92  ? 273 TYR B OH    1 
ATOM   4810 N  N     . THR B 1 292 ? 23.341  -39.699 -42.688 1.00 23.28  ? 274 THR B N     1 
ATOM   4811 C  CA    . THR B 1 292 ? 23.984  -40.871 -43.243 1.00 25.08  ? 274 THR B CA    1 
ATOM   4812 C  C     . THR B 1 292 ? 24.755  -41.580 -42.143 1.00 26.82  ? 274 THR B C     1 
ATOM   4813 O  O     . THR B 1 292 ? 24.810  -41.106 -41.001 1.00 24.23  ? 274 THR B O     1 
ATOM   4814 C  CB    . THR B 1 292 ? 24.936  -40.498 -44.397 1.00 28.99  ? 274 THR B CB    1 
ATOM   4815 O  OG1   . THR B 1 292 ? 25.345  -41.685 -45.087 1.00 35.16  ? 274 THR B OG1   1 
ATOM   4816 C  CG2   . THR B 1 292 ? 26.159  -39.753 -43.876 1.00 25.34  ? 274 THR B CG2   1 
ATOM   4817 N  N     . ASP B 1 293 ? 25.329  -42.730 -42.477 1.00 27.11  ? 275 ASP B N     1 
ATOM   4818 C  CA    . ASP B 1 293 ? 26.222  -43.409 -41.556 1.00 28.24  ? 275 ASP B CA    1 
ATOM   4819 C  C     . ASP B 1 293 ? 27.353  -44.089 -42.321 1.00 29.28  ? 275 ASP B C     1 
ATOM   4820 O  O     . ASP B 1 293 ? 27.275  -44.252 -43.538 1.00 32.87  ? 275 ASP B O     1 
ATOM   4821 C  CB    . ASP B 1 293 ? 25.465  -44.387 -40.645 1.00 30.45  ? 275 ASP B CB    1 
ATOM   4822 C  CG    . ASP B 1 293 ? 24.930  -45.600 -41.388 1.00 37.78  ? 275 ASP B CG    1 
ATOM   4823 O  OD1   . ASP B 1 293 ? 25.721  -46.523 -41.670 1.00 40.97  ? 275 ASP B OD1   1 
ATOM   4824 O  OD2   . ASP B 1 293 ? 23.714  -45.642 -41.672 1.00 40.79  ? 275 ASP B OD2   1 
ATOM   4825 N  N     . SER B 1 294 ? 28.402  -44.470 -41.601 1.00 29.83  ? 276 SER B N     1 
ATOM   4826 C  CA    . SER B 1 294 ? 29.598  -45.053 -42.207 1.00 35.55  ? 276 SER B CA    1 
ATOM   4827 C  C     . SER B 1 294 ? 29.345  -46.312 -43.044 1.00 36.92  ? 276 SER B C     1 
ATOM   4828 O  O     . SER B 1 294 ? 30.142  -46.639 -43.923 1.00 36.91  ? 276 SER B O     1 
ATOM   4829 C  CB    . SER B 1 294 ? 30.646  -45.343 -41.130 1.00 36.61  ? 276 SER B CB    1 
ATOM   4830 O  OG    . SER B 1 294 ? 30.056  -45.977 -40.017 1.00 38.03  ? 276 SER B OG    1 
ATOM   4831 N  N     . SER B 1 295 ? 28.243  -47.009 -42.773 1.00 37.87  ? 277 SER B N     1 
ATOM   4832 C  CA    . SER B 1 295 ? 27.870  -48.198 -43.547 1.00 41.86  ? 277 SER B CA    1 
ATOM   4833 C  C     . SER B 1 295 ? 27.041  -47.858 -44.779 1.00 42.50  ? 277 SER B C     1 
ATOM   4834 O  O     . SER B 1 295 ? 26.838  -48.705 -45.644 1.00 42.82  ? 277 SER B O     1 
ATOM   4835 C  CB    . SER B 1 295 ? 27.089  -49.189 -42.683 1.00 43.43  ? 277 SER B CB    1 
ATOM   4836 O  OG    . SER B 1 295 ? 27.938  -49.819 -41.745 1.00 48.74  ? 277 SER B OG    1 
ATOM   4837 N  N     . ASP B 1 296 ? 26.557  -46.622 -44.849 1.00 42.95  ? 278 ASP B N     1 
ATOM   4838 C  CA    . ASP B 1 296 ? 25.665  -46.206 -45.925 1.00 45.07  ? 278 ASP B CA    1 
ATOM   4839 C  C     . ASP B 1 296 ? 26.410  -45.416 -46.999 1.00 45.92  ? 278 ASP B C     1 
ATOM   4840 O  O     . ASP B 1 296 ? 27.072  -44.418 -46.706 1.00 45.98  ? 278 ASP B O     1 
ATOM   4841 C  CB    . ASP B 1 296 ? 24.515  -45.368 -45.363 1.00 45.52  ? 278 ASP B CB    1 
ATOM   4842 C  CG    . ASP B 1 296 ? 23.289  -45.381 -46.255 1.00 51.66  ? 278 ASP B CG    1 
ATOM   4843 O  OD1   . ASP B 1 296 ? 22.182  -45.115 -45.739 1.00 54.93  ? 278 ASP B OD1   1 
ATOM   4844 O  OD2   . ASP B 1 296 ? 23.424  -45.661 -47.467 1.00 53.33  ? 278 ASP B OD2   1 
ATOM   4845 N  N     . SER B 1 297 ? 26.292  -45.868 -48.243 1.00 46.42  ? 279 SER B N     1 
ATOM   4846 C  CA    . SER B 1 297 ? 26.908  -45.180 -49.373 1.00 47.17  ? 279 SER B CA    1 
ATOM   4847 C  C     . SER B 1 297 ? 26.068  -43.985 -49.831 1.00 47.26  ? 279 SER B C     1 
ATOM   4848 O  O     . SER B 1 297 ? 26.502  -43.199 -50.673 1.00 46.71  ? 279 SER B O     1 
ATOM   4849 C  CB    . SER B 1 297 ? 27.119  -46.151 -50.536 1.00 48.29  ? 279 SER B CB    1 
ATOM   4850 O  OG    . SER B 1 297 ? 25.888  -46.710 -50.954 1.00 47.69  ? 279 SER B OG    1 
ATOM   4851 N  N     . GLU B 1 298 ? 24.871  -43.847 -49.267 1.00 46.01  ? 280 GLU B N     1 
ATOM   4852 C  CA    . GLU B 1 298 ? 23.978  -42.757 -49.641 1.00 46.20  ? 280 GLU B CA    1 
ATOM   4853 C  C     . GLU B 1 298 ? 23.765  -41.748 -48.515 1.00 42.30  ? 280 GLU B C     1 
ATOM   4854 O  O     . GLU B 1 298 ? 23.863  -42.073 -47.328 1.00 38.46  ? 280 GLU B O     1 
ATOM   4855 C  CB    . GLU B 1 298 ? 22.622  -43.302 -50.086 1.00 50.79  ? 280 GLU B CB    1 
ATOM   4856 C  CG    . GLU B 1 298 ? 22.696  -44.307 -51.219 1.00 60.33  ? 280 GLU B CG    1 
ATOM   4857 C  CD    . GLU B 1 298 ? 21.328  -44.822 -51.616 1.00 67.69  ? 280 GLU B CD    1 
ATOM   4858 O  OE1   . GLU B 1 298 ? 20.321  -44.301 -51.089 1.00 68.21  ? 280 GLU B OE1   1 
ATOM   4859 O  OE2   . GLU B 1 298 ? 21.260  -45.747 -52.453 1.00 72.47  ? 280 GLU B OE2   1 
ATOM   4860 N  N     . ILE B 1 299 ? 23.466  -40.517 -48.907 1.00 38.61  ? 281 ILE B N     1 
ATOM   4861 C  CA    . ILE B 1 299 ? 23.077  -39.487 -47.966 1.00 34.26  ? 281 ILE B CA    1 
ATOM   4862 C  C     . ILE B 1 299 ? 21.596  -39.202 -48.164 1.00 36.35  ? 281 ILE B C     1 
ATOM   4863 O  O     . ILE B 1 299 ? 21.153  -38.939 -49.280 1.00 38.72  ? 281 ILE B O     1 
ATOM   4864 C  CB    . ILE B 1 299 ? 23.899  -38.215 -48.174 1.00 30.89  ? 281 ILE B CB    1 
ATOM   4865 C  CG1   . ILE B 1 299 ? 25.379  -38.519 -47.920 1.00 29.70  ? 281 ILE B CG1   1 
ATOM   4866 C  CG2   . ILE B 1 299 ? 23.392  -37.106 -47.260 1.00 27.28  ? 281 ILE B CG2   1 
ATOM   4867 C  CD1   . ILE B 1 299 ? 26.315  -37.431 -48.355 1.00 32.22  ? 281 ILE B CD1   1 
ATOM   4868 N  N     . HIS B 1 300 ? 20.829  -39.269 -47.083 1.00 34.05  ? 282 HIS B N     1 
ATOM   4869 C  CA    . HIS B 1 300 ? 19.380  -39.182 -47.189 1.00 33.53  ? 282 HIS B CA    1 
ATOM   4870 C  C     . HIS B 1 300 ? 18.844  -37.811 -46.797 1.00 29.41  ? 282 HIS B C     1 
ATOM   4871 O  O     . HIS B 1 300 ? 19.378  -37.157 -45.904 1.00 25.75  ? 282 HIS B O     1 
ATOM   4872 C  CB    . HIS B 1 300 ? 18.722  -40.264 -46.334 1.00 34.40  ? 282 HIS B CB    1 
ATOM   4873 C  CG    . HIS B 1 300 ? 19.281  -41.632 -46.563 1.00 37.46  ? 282 HIS B CG    1 
ATOM   4874 N  ND1   . HIS B 1 300 ? 19.024  -42.359 -47.706 1.00 40.72  ? 282 HIS B ND1   1 
ATOM   4875 C  CD2   . HIS B 1 300 ? 20.087  -42.406 -45.798 1.00 38.19  ? 282 HIS B CD2   1 
ATOM   4876 C  CE1   . HIS B 1 300 ? 19.646  -43.522 -47.633 1.00 42.42  ? 282 HIS B CE1   1 
ATOM   4877 N  NE2   . HIS B 1 300 ? 20.298  -43.576 -46.486 1.00 40.23  ? 282 HIS B NE2   1 
ATOM   4878 N  N     . GLN B 1 301 ? 17.790  -37.382 -47.484 1.00 30.32  ? 283 GLN B N     1 
ATOM   4879 C  CA    . GLN B 1 301 ? 17.076  -36.169 -47.120 1.00 32.10  ? 283 GLN B CA    1 
ATOM   4880 C  C     . GLN B 1 301 ? 15.871  -36.512 -46.255 1.00 32.21  ? 283 GLN B C     1 
ATOM   4881 O  O     . GLN B 1 301 ? 15.243  -37.553 -46.424 1.00 32.99  ? 283 GLN B O     1 
ATOM   4882 C  CB    . GLN B 1 301 ? 16.603  -35.424 -48.364 1.00 37.06  ? 283 GLN B CB    1 
ATOM   4883 C  CG    . GLN B 1 301 ? 17.709  -34.871 -49.229 1.00 40.20  ? 283 GLN B CG    1 
ATOM   4884 C  CD    . GLN B 1 301 ? 17.162  -34.054 -50.375 1.00 44.42  ? 283 GLN B CD    1 
ATOM   4885 O  OE1   . GLN B 1 301 ? 16.977  -32.840 -50.257 1.00 46.06  ? 283 GLN B OE1   1 
ATOM   4886 N  NE2   . GLN B 1 301 ? 16.881  -34.717 -51.490 1.00 47.18  ? 283 GLN B NE2   1 
ATOM   4887 N  N     . PHE B 1 302 ? 15.542  -35.622 -45.331 1.00 29.74  ? 284 PHE B N     1 
ATOM   4888 C  CA    . PHE B 1 302 ? 14.422  -35.848 -44.439 1.00 26.08  ? 284 PHE B CA    1 
ATOM   4889 C  C     . PHE B 1 302 ? 13.669  -34.536 -44.308 1.00 24.12  ? 284 PHE B C     1 
ATOM   4890 O  O     . PHE B 1 302 ? 14.156  -33.588 -43.687 1.00 24.51  ? 284 PHE B O     1 
ATOM   4891 C  CB    . PHE B 1 302 ? 14.934  -36.351 -43.084 1.00 24.69  ? 284 PHE B CB    1 
ATOM   4892 C  CG    . PHE B 1 302 ? 13.864  -36.547 -42.049 1.00 25.31  ? 284 PHE B CG    1 
ATOM   4893 C  CD1   . PHE B 1 302 ? 13.241  -37.777 -41.902 1.00 27.10  ? 284 PHE B CD1   1 
ATOM   4894 C  CD2   . PHE B 1 302 ? 13.506  -35.512 -41.196 1.00 23.35  ? 284 PHE B CD2   1 
ATOM   4895 C  CE1   . PHE B 1 302 ? 12.263  -37.969 -40.940 1.00 27.56  ? 284 PHE B CE1   1 
ATOM   4896 C  CE2   . PHE B 1 302 ? 12.526  -35.696 -40.233 1.00 27.29  ? 284 PHE B CE2   1 
ATOM   4897 C  CZ    . PHE B 1 302 ? 11.906  -36.927 -40.103 1.00 28.52  ? 284 PHE B CZ    1 
ATOM   4898 N  N     . MET B 1 303 ? 12.487  -34.487 -44.914 1.00 24.08  ? 285 MET B N     1 
ATOM   4899 C  CA    . MET B 1 303 ? 11.655  -33.294 -44.894 1.00 29.52  ? 285 MET B CA    1 
ATOM   4900 C  C     . MET B 1 303 ? 11.335  -32.867 -43.465 1.00 29.24  ? 285 MET B C     1 
ATOM   4901 O  O     . MET B 1 303 ? 11.095  -33.709 -42.593 1.00 25.41  ? 285 MET B O     1 
ATOM   4902 C  CB    . MET B 1 303 ? 10.364  -33.529 -45.671 1.00 31.00  ? 285 MET B CB    1 
ATOM   4903 C  CG    . MET B 1 303 ? 9.958   -32.351 -46.533 1.00 38.49  ? 285 MET B CG    1 
ATOM   4904 S  SD    . MET B 1 303 ? 8.536   -32.721 -47.574 1.00 79.43  ? 285 MET B SD    1 
ATOM   4905 C  CE    . MET B 1 303 ? 7.256   -32.867 -46.324 1.00 32.04  ? 285 MET B CE    1 
ATOM   4906 N  N     . VAL B 1 304 ? 11.336  -31.555 -43.242 1.00 27.26  ? 286 VAL B N     1 
ATOM   4907 C  CA    . VAL B 1 304 ? 11.144  -30.988 -41.914 1.00 28.97  ? 286 VAL B CA    1 
ATOM   4908 C  C     . VAL B 1 304 ? 9.868   -30.152 -41.852 1.00 31.77  ? 286 VAL B C     1 
ATOM   4909 O  O     . VAL B 1 304 ? 9.495   -29.510 -42.832 1.00 26.28  ? 286 VAL B O     1 
ATOM   4910 C  CB    . VAL B 1 304 ? 12.373  -30.137 -41.512 1.00 32.61  ? 286 VAL B CB    1 
ATOM   4911 C  CG1   . VAL B 1 304 ? 12.150  -29.440 -40.181 1.00 35.78  ? 286 VAL B CG1   1 
ATOM   4912 C  CG2   . VAL B 1 304 ? 13.614  -31.014 -41.448 1.00 30.56  ? 286 VAL B CG2   1 
ATOM   4913 N  N     . GLU B 1 305 ? 9.190   -30.183 -40.706 1.00 37.04  ? 287 GLU B N     1 
ATOM   4914 C  CA    . GLU B 1 305 ? 8.003   -29.358 -40.476 1.00 41.94  ? 287 GLU B CA    1 
ATOM   4915 C  C     . GLU B 1 305 ? 8.321   -27.862 -40.549 1.00 43.47  ? 287 GLU B C     1 
ATOM   4916 O  O     . GLU B 1 305 ? 9.398   -27.422 -40.137 1.00 42.28  ? 287 GLU B O     1 
ATOM   4917 C  CB    . GLU B 1 305 ? 7.383   -29.688 -39.116 1.00 42.25  ? 287 GLU B CB    1 
ATOM   4918 N  N     . GLN B 1 306 ? 7.377   -27.084 -41.073 1.00 44.66  ? 288 GLN B N     1 
ATOM   4919 C  CA    . GLN B 1 306 ? 7.552   -25.639 -41.194 1.00 47.38  ? 288 GLN B CA    1 
ATOM   4920 C  C     . GLN B 1 306 ? 6.828   -24.904 -40.064 1.00 51.82  ? 288 GLN B C     1 
ATOM   4921 O  O     . GLN B 1 306 ? 5.802   -25.373 -39.565 1.00 52.52  ? 288 GLN B O     1 
ATOM   4922 C  CB    . GLN B 1 306 ? 7.043   -25.149 -42.554 1.00 46.55  ? 288 GLN B CB    1 
ATOM   4923 C  CG    . GLN B 1 306 ? 7.607   -25.913 -43.751 1.00 43.23  ? 288 GLN B CG    1 
ATOM   4924 C  CD    . GLN B 1 306 ? 9.067   -25.596 -44.024 1.00 39.71  ? 288 GLN B CD    1 
ATOM   4925 O  OE1   . GLN B 1 306 ? 9.408   -24.482 -44.423 1.00 44.09  ? 288 GLN B OE1   1 
ATOM   4926 N  NE2   . GLN B 1 306 ? 9.936   -26.579 -43.815 1.00 33.84  ? 288 GLN B NE2   1 
ATOM   4927 N  N     . PHE B 1 307 ? 7.367   -23.752 -39.667 1.00 54.87  ? 289 PHE B N     1 
ATOM   4928 C  CA    . PHE B 1 307 ? 6.805   -22.965 -38.567 1.00 58.57  ? 289 PHE B CA    1 
ATOM   4929 C  C     . PHE B 1 307 ? 6.594   -21.504 -38.959 1.00 64.23  ? 289 PHE B C     1 
ATOM   4930 O  O     . PHE B 1 307 ? 6.946   -21.090 -40.062 1.00 63.52  ? 289 PHE B O     1 
ATOM   4931 C  CB    . PHE B 1 307 ? 7.713   -23.042 -37.337 1.00 55.29  ? 289 PHE B CB    1 
ATOM   4932 C  CG    . PHE B 1 307 ? 8.097   -24.442 -36.956 1.00 53.40  ? 289 PHE B CG    1 
ATOM   4933 C  CD1   . PHE B 1 307 ? 7.264   -25.209 -36.161 1.00 53.25  ? 289 PHE B CD1   1 
ATOM   4934 C  CD2   . PHE B 1 307 ? 9.290   -24.993 -37.393 1.00 51.56  ? 289 PHE B CD2   1 
ATOM   4935 C  CE1   . PHE B 1 307 ? 7.612   -26.496 -35.810 1.00 50.01  ? 289 PHE B CE1   1 
ATOM   4936 C  CE2   . PHE B 1 307 ? 9.642   -26.283 -37.045 1.00 48.58  ? 289 PHE B CE2   1 
ATOM   4937 C  CZ    . PHE B 1 307 ? 8.803   -27.034 -36.253 1.00 47.27  ? 289 PHE B CZ    1 
ATOM   4938 N  N     . LYS B 1 308 ? 6.028   -20.724 -38.042 1.00 71.67  ? 290 LYS B N     1 
ATOM   4939 C  CA    . LYS B 1 308 ? 5.745   -19.314 -38.296 1.00 78.04  ? 290 LYS B CA    1 
ATOM   4940 C  C     . LYS B 1 308 ? 6.982   -18.433 -38.108 1.00 80.90  ? 290 LYS B C     1 
ATOM   4941 O  O     . LYS B 1 308 ? 7.130   -17.775 -37.077 1.00 83.67  ? 290 LYS B O     1 
ATOM   4942 C  CB    . LYS B 1 308 ? 4.604   -18.831 -37.398 1.00 81.27  ? 290 LYS B CB    1 
ATOM   4943 C  CG    . LYS B 1 308 ? 3.322   -19.636 -37.552 1.00 83.89  ? 290 LYS B CG    1 
ATOM   4944 C  CD    . LYS B 1 308 ? 2.776   -19.537 -38.971 1.00 87.27  ? 290 LYS B CD    1 
ATOM   4945 C  CE    . LYS B 1 308 ? 2.526   -20.912 -39.579 1.00 86.90  ? 290 LYS B CE    1 
ATOM   4946 N  NZ    . LYS B 1 308 ? 1.467   -21.678 -38.864 1.00 87.88  ? 290 LYS B NZ    1 
ATOM   4947 N  N     . ASP B 1 309 ? 7.854   -18.443 -39.117 1.00 80.68  ? 291 ASP B N     1 
ATOM   4948 C  CA    . ASP B 1 309 ? 9.097   -17.654 -39.162 1.00 77.07  ? 291 ASP B CA    1 
ATOM   4949 C  C     . ASP B 1 309 ? 10.243  -18.180 -38.283 1.00 75.74  ? 291 ASP B C     1 
ATOM   4950 O  O     . ASP B 1 309 ? 11.147  -17.424 -37.924 1.00 78.71  ? 291 ASP B O     1 
ATOM   4951 C  CB    . ASP B 1 309 ? 8.837   -16.168 -38.882 1.00 75.01  ? 291 ASP B CB    1 
ATOM   4952 N  N     . ASP B 1 310 ? 10.217  -19.472 -37.959 1.00 69.55  ? 292 ASP B N     1 
ATOM   4953 C  CA    . ASP B 1 310 ? 11.260  -20.075 -37.125 1.00 65.29  ? 292 ASP B CA    1 
ATOM   4954 C  C     . ASP B 1 310 ? 11.811  -21.370 -37.725 1.00 58.93  ? 292 ASP B C     1 
ATOM   4955 O  O     . ASP B 1 310 ? 11.175  -21.985 -38.579 1.00 58.14  ? 292 ASP B O     1 
ATOM   4956 C  CB    . ASP B 1 310 ? 10.736  -20.351 -35.712 1.00 66.86  ? 292 ASP B CB    1 
ATOM   4957 C  CG    . ASP B 1 310 ? 10.316  -19.088 -34.981 1.00 70.96  ? 292 ASP B CG    1 
ATOM   4958 O  OD1   . ASP B 1 310 ? 9.118   -18.739 -35.041 1.00 73.58  ? 292 ASP B OD1   1 
ATOM   4959 O  OD2   . ASP B 1 310 ? 11.180  -18.451 -34.339 1.00 71.06  ? 292 ASP B OD2   1 
ATOM   4960 N  N     . GLN B 1 311 ? 12.989  -21.782 -37.260 1.00 56.84  ? 293 GLN B N     1 
ATOM   4961 C  CA    . GLN B 1 311 ? 13.636  -23.005 -37.742 1.00 57.58  ? 293 GLN B CA    1 
ATOM   4962 C  C     . GLN B 1 311 ? 14.012  -23.956 -36.603 1.00 54.36  ? 293 GLN B C     1 
ATOM   4963 O  O     . GLN B 1 311 ? 14.151  -23.534 -35.455 1.00 52.97  ? 293 GLN B O     1 
ATOM   4964 C  CB    . GLN B 1 311 ? 14.895  -22.659 -38.539 1.00 62.72  ? 293 GLN B CB    1 
ATOM   4965 C  CG    . GLN B 1 311 ? 14.636  -22.017 -39.887 1.00 71.21  ? 293 GLN B CG    1 
ATOM   4966 C  CD    . GLN B 1 311 ? 15.923  -21.677 -40.616 1.00 78.00  ? 293 GLN B CD    1 
ATOM   4967 O  OE1   . GLN B 1 311 ? 16.946  -21.389 -39.990 1.00 79.31  ? 293 GLN B OE1   1 
ATOM   4968 N  NE2   . GLN B 1 311 ? 15.882  -21.718 -41.948 1.00 80.46  ? 293 GLN B NE2   1 
ATOM   4969 N  N     . ILE B 1 312 ? 14.186  -25.237 -36.930 1.00 52.88  ? 294 ILE B N     1 
ATOM   4970 C  CA    . ILE B 1 312 ? 14.624  -26.238 -35.956 1.00 52.21  ? 294 ILE B CA    1 
ATOM   4971 C  C     . ILE B 1 312 ? 16.140  -26.227 -35.811 1.00 53.35  ? 294 ILE B C     1 
ATOM   4972 O  O     . ILE B 1 312 ? 16.701  -26.924 -34.964 1.00 52.23  ? 294 ILE B O     1 
ATOM   4973 C  CB    . ILE B 1 312 ? 14.240  -27.668 -36.389 1.00 51.06  ? 294 ILE B CB    1 
ATOM   4974 C  CG1   . ILE B 1 312 ? 15.157  -28.145 -37.523 1.00 48.71  ? 294 ILE B CG1   1 
ATOM   4975 C  CG2   . ILE B 1 312 ? 12.773  -27.741 -36.777 1.00 51.59  ? 294 ILE B CG2   1 
ATOM   4976 C  CD1   . ILE B 1 312 ? 15.013  -29.610 -37.861 1.00 47.88  ? 294 ILE B CD1   1 
ATOM   4977 N  N     . ILE B 1 313 ? 16.797  -25.439 -36.654 1.00 55.43  ? 295 ILE B N     1 
ATOM   4978 C  CA    . ILE B 1 313 ? 18.246  -25.482 -36.793 1.00 56.41  ? 295 ILE B CA    1 
ATOM   4979 C  C     . ILE B 1 313 ? 18.925  -24.590 -35.751 1.00 58.50  ? 295 ILE B C     1 
ATOM   4980 O  O     . ILE B 1 313 ? 20.062  -24.840 -35.350 1.00 57.88  ? 295 ILE B O     1 
ATOM   4981 C  CB    . ILE B 1 313 ? 18.663  -25.059 -38.232 1.00 33.41  ? 295 ILE B CB    1 
ATOM   4982 C  CG1   . ILE B 1 313 ? 19.870  -25.858 -38.727 1.00 32.10  ? 295 ILE B CG1   1 
ATOM   4983 C  CG2   . ILE B 1 313 ? 18.879  -23.537 -38.339 1.00 37.94  ? 295 ILE B CG2   1 
ATOM   4984 C  CD1   . ILE B 1 313 ? 20.615  -25.186 -39.893 1.00 37.57  ? 295 ILE B CD1   1 
ATOM   4985 N  N     . ASP B 1 314 ? 18.210  -23.564 -35.302 1.00 60.68  ? 296 ASP B N     1 
ATOM   4986 C  CA    . ASP B 1 314 ? 18.770  -22.578 -34.391 1.00 63.45  ? 296 ASP B CA    1 
ATOM   4987 C  C     . ASP B 1 314 ? 17.696  -21.619 -33.914 1.00 62.72  ? 296 ASP B C     1 
ATOM   4988 O  O     . ASP B 1 314 ? 17.342  -20.672 -34.616 1.00 62.42  ? 296 ASP B O     1 
ATOM   4989 C  CB    . ASP B 1 314 ? 19.886  -21.781 -35.074 1.00 66.39  ? 296 ASP B CB    1 
ATOM   4990 N  N     . THR B 1 315 ? 17.173  -21.876 -32.721 1.00 63.31  ? 297 THR B N     1 
ATOM   4991 C  CA    . THR B 1 315 ? 16.332  -20.898 -32.029 1.00 70.15  ? 297 THR B CA    1 
ATOM   4992 C  C     . THR B 1 315 ? 16.996  -19.746 -31.231 1.00 73.76  ? 297 THR B C     1 
ATOM   4993 O  O     . THR B 1 315 ? 16.330  -18.733 -31.037 1.00 76.44  ? 297 THR B O     1 
ATOM   4994 C  CB    . THR B 1 315 ? 15.293  -21.574 -31.106 1.00 71.30  ? 297 THR B CB    1 
ATOM   4995 N  N     . ASN B 1 316 ? 18.255  -19.831 -30.770 1.00 73.39  ? 298 ASN B N     1 
ATOM   4996 C  CA    . ASN B 1 316 ? 19.254  -20.868 -31.061 1.00 45.07  ? 298 ASN B CA    1 
ATOM   4997 C  C     . ASN B 1 316 ? 19.051  -22.215 -30.354 1.00 39.70  ? 298 ASN B C     1 
ATOM   4998 O  O     . ASN B 1 316 ? 19.714  -23.205 -30.686 1.00 44.87  ? 298 ASN B O     1 
ATOM   4999 C  CB    . ASN B 1 316 ? 20.665  -20.336 -30.794 1.00 48.08  ? 298 ASN B CB    1 
ATOM   5000 N  N     . GLY B 1 317 ? 18.118  -22.256 -29.407 1.00 54.12  ? 299 GLY B N     1 
ATOM   5001 C  CA    . GLY B 1 317 ? 17.905  -23.440 -28.596 1.00 40.67  ? 299 GLY B CA    1 
ATOM   5002 C  C     . GLY B 1 317 ? 17.153  -24.589 -29.246 1.00 30.60  ? 299 GLY B C     1 
ATOM   5003 O  O     . GLY B 1 317 ? 16.996  -25.644 -28.636 1.00 26.96  ? 299 GLY B O     1 
ATOM   5004 N  N     . ALA B 1 318 ? 16.688  -24.401 -30.478 1.00 28.74  ? 300 ALA B N     1 
ATOM   5005 C  CA    . ALA B 1 318 ? 15.935  -25.447 -31.170 1.00 29.12  ? 300 ALA B CA    1 
ATOM   5006 C  C     . ALA B 1 318 ? 16.839  -26.600 -31.580 1.00 27.34  ? 300 ALA B C     1 
ATOM   5007 O  O     . ALA B 1 318 ? 16.418  -27.759 -31.589 1.00 28.57  ? 300 ALA B O     1 
ATOM   5008 C  CB    . ALA B 1 318 ? 15.212  -24.885 -32.386 1.00 29.78  ? 300 ALA B CB    1 
ATOM   5009 N  N     . GLY B 1 319 ? 18.079  -26.270 -31.931 1.00 26.65  ? 301 GLY B N     1 
ATOM   5010 C  CA    . GLY B 1 319 ? 19.067  -27.268 -32.299 1.00 20.90  ? 301 GLY B CA    1 
ATOM   5011 C  C     . GLY B 1 319 ? 19.444  -28.141 -31.115 1.00 20.60  ? 301 GLY B C     1 
ATOM   5012 O  O     . GLY B 1 319 ? 19.669  -29.343 -31.267 1.00 21.62  ? 301 GLY B O     1 
ATOM   5013 N  N     . ASP B 1 320 ? 19.507  -27.543 -29.928 1.00 21.95  ? 302 ASP B N     1 
ATOM   5014 C  CA    . ASP B 1 320 ? 19.784  -28.304 -28.709 1.00 23.66  ? 302 ASP B CA    1 
ATOM   5015 C  C     . ASP B 1 320 ? 18.625  -29.242 -28.388 1.00 22.30  ? 302 ASP B C     1 
ATOM   5016 O  O     . ASP B 1 320 ? 18.828  -30.353 -27.889 1.00 22.16  ? 302 ASP B O     1 
ATOM   5017 C  CB    . ASP B 1 320 ? 20.031  -27.371 -27.522 1.00 26.33  ? 302 ASP B CB    1 
ATOM   5018 C  CG    . ASP B 1 320 ? 21.188  -26.416 -27.755 1.00 30.44  ? 302 ASP B CG    1 
ATOM   5019 O  OD1   . ASP B 1 320 ? 22.126  -26.782 -28.499 1.00 30.65  ? 302 ASP B OD1   1 
ATOM   5020 O  OD2   . ASP B 1 320 ? 21.156  -25.300 -27.190 1.00 30.59  ? 302 ASP B OD2   1 
ATOM   5021 N  N     . ALA B 1 321 ? 17.410  -28.782 -28.673 1.00 22.00  ? 303 ALA B N     1 
ATOM   5022 C  CA    . ALA B 1 321 ? 16.208  -29.578 -28.444 1.00 22.15  ? 303 ALA B CA    1 
ATOM   5023 C  C     . ALA B 1 321 ? 16.108  -30.718 -29.453 1.00 20.30  ? 303 ALA B C     1 
ATOM   5024 O  O     . ALA B 1 321 ? 15.643  -31.811 -29.129 1.00 20.97  ? 303 ALA B O     1 
ATOM   5025 C  CB    . ALA B 1 321 ? 14.979  -28.701 -28.525 1.00 22.29  ? 303 ALA B CB    1 
ATOM   5026 N  N     . PHE B 1 322 ? 16.543  -30.445 -30.678 1.00 19.62  ? 304 PHE B N     1 
ATOM   5027 C  CA    . PHE B 1 322 ? 16.559  -31.449 -31.735 1.00 19.28  ? 304 PHE B CA    1 
ATOM   5028 C  C     . PHE B 1 322 ? 17.437  -32.622 -31.314 1.00 18.57  ? 304 PHE B C     1 
ATOM   5029 O  O     . PHE B 1 322 ? 17.055  -33.776 -31.471 1.00 17.60  ? 304 PHE B O     1 
ATOM   5030 C  CB    . PHE B 1 322 ? 17.076  -30.844 -33.052 1.00 18.27  ? 304 PHE B CB    1 
ATOM   5031 C  CG    . PHE B 1 322 ? 17.139  -31.830 -34.194 1.00 22.99  ? 304 PHE B CG    1 
ATOM   5032 C  CD1   . PHE B 1 322 ? 16.112  -31.899 -35.123 1.00 18.23  ? 304 PHE B CD1   1 
ATOM   5033 C  CD2   . PHE B 1 322 ? 18.228  -32.687 -34.341 1.00 20.13  ? 304 PHE B CD2   1 
ATOM   5034 C  CE1   . PHE B 1 322 ? 16.166  -32.803 -36.177 1.00 22.51  ? 304 PHE B CE1   1 
ATOM   5035 C  CE2   . PHE B 1 322 ? 18.282  -33.598 -35.390 1.00 20.50  ? 304 PHE B CE2   1 
ATOM   5036 C  CZ    . PHE B 1 322 ? 17.255  -33.654 -36.310 1.00 18.16  ? 304 PHE B CZ    1 
ATOM   5037 N  N     . ALA B 1 323 ? 18.619  -32.319 -30.788 1.00 17.10  ? 305 ALA B N     1 
ATOM   5038 C  CA    . ALA B 1 323 ? 19.522  -33.366 -30.330 1.00 16.58  ? 305 ALA B CA    1 
ATOM   5039 C  C     . ALA B 1 323 ? 18.895  -34.167 -29.187 1.00 20.19  ? 305 ALA B C     1 
ATOM   5040 O  O     . ALA B 1 323 ? 18.995  -35.394 -29.150 1.00 22.25  ? 305 ALA B O     1 
ATOM   5041 C  CB    . ALA B 1 323 ? 20.867  -32.772 -29.912 1.00 16.81  ? 305 ALA B CB    1 
ATOM   5042 N  N     . ALA B 1 324 ? 18.228  -33.473 -28.268 1.00 20.63  ? 306 ALA B N     1 
ATOM   5043 C  CA    . ALA B 1 324 ? 17.593  -34.133 -27.123 1.00 21.34  ? 306 ALA B CA    1 
ATOM   5044 C  C     . ALA B 1 324 ? 16.489  -35.099 -27.546 1.00 17.53  ? 306 ALA B C     1 
ATOM   5045 O  O     . ALA B 1 324 ? 16.428  -36.221 -27.066 1.00 21.77  ? 306 ALA B O     1 
ATOM   5046 C  CB    . ALA B 1 324 ? 17.053  -33.104 -26.129 1.00 18.53  ? 306 ALA B CB    1 
ATOM   5047 N  N     . GLY B 1 325 ? 15.621  -34.655 -28.446 1.00 18.06  ? 307 GLY B N     1 
ATOM   5048 C  CA    . GLY B 1 325 ? 14.520  -35.480 -28.899 1.00 18.36  ? 307 GLY B CA    1 
ATOM   5049 C  C     . GLY B 1 325 ? 14.988  -36.713 -29.650 1.00 20.61  ? 307 GLY B C     1 
ATOM   5050 O  O     . GLY B 1 325 ? 14.436  -37.798 -29.466 1.00 20.63  ? 307 GLY B O     1 
ATOM   5051 N  N     . PHE B 1 326 ? 16.005  -36.549 -30.498 1.00 20.16  ? 308 PHE B N     1 
ATOM   5052 C  CA    . PHE B 1 326 ? 16.574  -37.689 -31.202 1.00 16.64  ? 308 PHE B CA    1 
ATOM   5053 C  C     . PHE B 1 326 ? 17.119  -38.721 -30.217 1.00 19.94  ? 308 PHE B C     1 
ATOM   5054 O  O     . PHE B 1 326 ? 16.802  -39.903 -30.300 1.00 22.45  ? 308 PHE B O     1 
ATOM   5055 C  CB    . PHE B 1 326 ? 17.694  -37.277 -32.157 1.00 17.42  ? 308 PHE B CB    1 
ATOM   5056 C  CG    . PHE B 1 326 ? 18.220  -38.426 -32.979 1.00 19.10  ? 308 PHE B CG    1 
ATOM   5057 C  CD1   . PHE B 1 326 ? 17.650  -38.732 -34.203 1.00 18.83  ? 308 PHE B CD1   1 
ATOM   5058 C  CD2   . PHE B 1 326 ? 19.252  -39.226 -32.504 1.00 20.05  ? 308 PHE B CD2   1 
ATOM   5059 C  CE1   . PHE B 1 326 ? 18.111  -39.795 -34.949 1.00 21.61  ? 308 PHE B CE1   1 
ATOM   5060 C  CE2   . PHE B 1 326 ? 19.715  -40.296 -33.242 1.00 20.56  ? 308 PHE B CE2   1 
ATOM   5061 C  CZ    . PHE B 1 326 ? 19.144  -40.582 -34.466 1.00 22.56  ? 308 PHE B CZ    1 
ATOM   5062 N  N     . ILE B 1 327 ? 17.945  -38.260 -29.289 1.00 20.41  ? 309 ILE B N     1 
ATOM   5063 C  CA    . ILE B 1 327 ? 18.630  -39.150 -28.366 1.00 20.22  ? 309 ILE B CA    1 
ATOM   5064 C  C     . ILE B 1 327 ? 17.662  -39.864 -27.422 1.00 22.57  ? 309 ILE B C     1 
ATOM   5065 O  O     . ILE B 1 327 ? 17.765  -41.076 -27.220 1.00 23.39  ? 309 ILE B O     1 
ATOM   5066 C  CB    . ILE B 1 327 ? 19.699  -38.389 -27.571 1.00 20.48  ? 309 ILE B CB    1 
ATOM   5067 C  CG1   . ILE B 1 327 ? 20.813  -37.929 -28.515 1.00 16.55  ? 309 ILE B CG1   1 
ATOM   5068 C  CG2   . ILE B 1 327 ? 20.259  -39.258 -26.457 1.00 17.61  ? 309 ILE B CG2   1 
ATOM   5069 C  CD1   . ILE B 1 327 ? 21.759  -36.910 -27.902 1.00 16.65  ? 309 ILE B CD1   1 
ATOM   5070 N  N     . ALA B 1 328 ? 16.712  -39.117 -26.867 1.00 17.95  ? 310 ALA B N     1 
ATOM   5071 C  CA    . ALA B 1 328 ? 15.748  -39.683 -25.924 1.00 27.50  ? 310 ALA B CA    1 
ATOM   5072 C  C     . ALA B 1 328 ? 14.969  -40.855 -26.524 1.00 29.24  ? 310 ALA B C     1 
ATOM   5073 O  O     . ALA B 1 328 ? 14.603  -41.790 -25.815 1.00 28.40  ? 310 ALA B O     1 
ATOM   5074 C  CB    . ALA B 1 328 ? 14.794  -38.606 -25.417 1.00 19.25  ? 310 ALA B CB    1 
ATOM   5075 N  N     . ASP B 1 329 ? 14.721  -40.809 -27.830 1.00 29.12  ? 311 ASP B N     1 
ATOM   5076 C  CA    . ASP B 1 329 ? 14.013  -41.903 -28.491 1.00 29.31  ? 311 ASP B CA    1 
ATOM   5077 C  C     . ASP B 1 329 ? 14.964  -42.984 -28.987 1.00 24.71  ? 311 ASP B C     1 
ATOM   5078 O  O     . ASP B 1 329 ? 14.674  -44.169 -28.879 1.00 25.42  ? 311 ASP B O     1 
ATOM   5079 C  CB    . ASP B 1 329 ? 13.161  -41.389 -29.652 1.00 32.12  ? 311 ASP B CB    1 
ATOM   5080 C  CG    . ASP B 1 329 ? 11.699  -41.245 -29.281 1.00 37.43  ? 311 ASP B CG    1 
ATOM   5081 O  OD1   . ASP B 1 329 ? 11.405  -40.778 -28.157 1.00 36.22  ? 311 ASP B OD1   1 
ATOM   5082 O  OD2   . ASP B 1 329 ? 10.845  -41.611 -30.118 1.00 42.40  ? 311 ASP B OD2   1 
ATOM   5083 N  N     . TYR B 1 330 ? 16.102  -42.570 -29.530 1.00 21.48  ? 312 TYR B N     1 
ATOM   5084 C  CA    . TYR B 1 330 ? 17.048  -43.517 -30.103 1.00 23.48  ? 312 TYR B CA    1 
ATOM   5085 C  C     . TYR B 1 330 ? 17.607  -44.474 -29.049 1.00 25.06  ? 312 TYR B C     1 
ATOM   5086 O  O     . TYR B 1 330 ? 17.789  -45.660 -29.318 1.00 24.85  ? 312 TYR B O     1 
ATOM   5087 C  CB    . TYR B 1 330 ? 18.178  -42.771 -30.816 1.00 25.33  ? 312 TYR B CB    1 
ATOM   5088 C  CG    . TYR B 1 330 ? 19.059  -43.647 -31.681 1.00 28.70  ? 312 TYR B CG    1 
ATOM   5089 C  CD1   . TYR B 1 330 ? 18.623  -44.098 -32.923 1.00 30.70  ? 312 TYR B CD1   1 
ATOM   5090 C  CD2   . TYR B 1 330 ? 20.329  -44.009 -31.261 1.00 30.14  ? 312 TYR B CD2   1 
ATOM   5091 C  CE1   . TYR B 1 330 ? 19.430  -44.893 -33.718 1.00 32.66  ? 312 TYR B CE1   1 
ATOM   5092 C  CE2   . TYR B 1 330 ? 21.140  -44.802 -32.046 1.00 35.68  ? 312 TYR B CE2   1 
ATOM   5093 C  CZ    . TYR B 1 330 ? 20.688  -45.242 -33.272 1.00 37.38  ? 312 TYR B CZ    1 
ATOM   5094 O  OH    . TYR B 1 330 ? 21.506  -46.034 -34.046 1.00 43.10  ? 312 TYR B OH    1 
ATOM   5095 N  N     . ILE B 1 331 ? 17.859  -43.962 -27.845 1.00 25.48  ? 313 ILE B N     1 
ATOM   5096 C  CA    . ILE B 1 331 ? 18.428  -44.782 -26.777 1.00 25.83  ? 313 ILE B CA    1 
ATOM   5097 C  C     . ILE B 1 331 ? 17.381  -45.672 -26.116 1.00 26.27  ? 313 ILE B C     1 
ATOM   5098 O  O     . ILE B 1 331 ? 17.712  -46.558 -25.324 1.00 25.72  ? 313 ILE B O     1 
ATOM   5099 C  CB    . ILE B 1 331 ? 19.157  -43.934 -25.704 1.00 25.12  ? 313 ILE B CB    1 
ATOM   5100 C  CG1   . ILE B 1 331 ? 18.159  -43.153 -24.844 1.00 20.79  ? 313 ILE B CG1   1 
ATOM   5101 C  CG2   . ILE B 1 331 ? 20.187  -43.017 -26.360 1.00 21.78  ? 313 ILE B CG2   1 
ATOM   5102 C  CD1   . ILE B 1 331 ? 18.823  -42.373 -23.707 1.00 20.78  ? 313 ILE B CD1   1 
ATOM   5103 N  N     . ARG B 1 332 ? 16.116  -45.437 -26.449 1.00 26.10  ? 314 ARG B N     1 
ATOM   5104 C  CA    . ARG B 1 332 ? 15.039  -46.291 -25.967 1.00 28.33  ? 314 ARG B CA    1 
ATOM   5105 C  C     . ARG B 1 332 ? 14.573  -47.288 -27.040 1.00 30.44  ? 314 ARG B C     1 
ATOM   5106 O  O     . ARG B 1 332 ? 13.488  -47.862 -26.946 1.00 31.50  ? 314 ARG B O     1 
ATOM   5107 C  CB    . ARG B 1 332 ? 13.882  -45.452 -25.418 1.00 26.25  ? 314 ARG B CB    1 
ATOM   5108 C  CG    . ARG B 1 332 ? 14.201  -44.817 -24.061 1.00 26.50  ? 314 ARG B CG    1 
ATOM   5109 C  CD    . ARG B 1 332 ? 13.010  -44.073 -23.476 1.00 24.33  ? 314 ARG B CD    1 
ATOM   5110 N  NE    . ARG B 1 332 ? 12.684  -42.880 -24.253 1.00 23.96  ? 314 ARG B NE    1 
ATOM   5111 C  CZ    . ARG B 1 332 ? 11.604  -42.132 -24.054 1.00 26.59  ? 314 ARG B CZ    1 
ATOM   5112 N  NH1   . ARG B 1 332 ? 10.738  -42.459 -23.102 1.00 26.56  ? 314 ARG B NH1   1 
ATOM   5113 N  NH2   . ARG B 1 332 ? 11.384  -41.063 -24.811 1.00 27.88  ? 314 ARG B NH2   1 
ATOM   5114 N  N     . GLY B 1 333 ? 15.407  -47.489 -28.057 1.00 29.87  ? 315 GLY B N     1 
ATOM   5115 C  CA    . GLY B 1 333 ? 15.161  -48.516 -29.054 1.00 29.90  ? 315 GLY B CA    1 
ATOM   5116 C  C     . GLY B 1 333 ? 14.411  -48.089 -30.306 1.00 32.18  ? 315 GLY B C     1 
ATOM   5117 O  O     . GLY B 1 333 ? 14.122  -48.924 -31.162 1.00 35.56  ? 315 GLY B O     1 
ATOM   5118 N  N     . LYS B 1 334 ? 14.090  -46.802 -30.428 1.00 28.16  ? 316 LYS B N     1 
ATOM   5119 C  CA    . LYS B 1 334 ? 13.365  -46.334 -31.604 1.00 27.11  ? 316 LYS B CA    1 
ATOM   5120 C  C     . LYS B 1 334 ? 14.284  -46.290 -32.825 1.00 27.98  ? 316 LYS B C     1 
ATOM   5121 O  O     . LYS B 1 334 ? 15.459  -45.939 -32.708 1.00 30.12  ? 316 LYS B O     1 
ATOM   5122 C  CB    . LYS B 1 334 ? 12.736  -44.962 -31.352 1.00 25.78  ? 316 LYS B CB    1 
ATOM   5123 C  CG    . LYS B 1 334 ? 11.715  -44.929 -30.222 1.00 26.44  ? 316 LYS B CG    1 
ATOM   5124 C  CD    . LYS B 1 334 ? 10.520  -45.813 -30.520 1.00 34.20  ? 316 LYS B CD    1 
ATOM   5125 C  CE    . LYS B 1 334 ? 9.564   -45.863 -29.332 1.00 41.34  ? 316 LYS B CE    1 
ATOM   5126 N  NZ    . LYS B 1 334 ? 8.569   -46.969 -29.458 1.00 46.47  ? 316 LYS B NZ    1 
ATOM   5127 N  N     . PRO B 1 335 ? 13.752  -46.658 -34.002 1.00 26.33  ? 317 PRO B N     1 
ATOM   5128 C  CA    . PRO B 1 335 ? 14.537  -46.622 -35.243 1.00 27.00  ? 317 PRO B CA    1 
ATOM   5129 C  C     . PRO B 1 335 ? 14.979  -45.200 -35.601 1.00 26.23  ? 317 PRO B C     1 
ATOM   5130 O  O     . PRO B 1 335 ? 14.488  -44.232 -35.023 1.00 25.55  ? 317 PRO B O     1 
ATOM   5131 C  CB    . PRO B 1 335 ? 13.554  -47.135 -36.306 1.00 25.18  ? 317 PRO B CB    1 
ATOM   5132 C  CG    . PRO B 1 335 ? 12.476  -47.837 -35.551 1.00 27.15  ? 317 PRO B CG    1 
ATOM   5133 C  CD    . PRO B 1 335 ? 12.380  -47.144 -34.224 1.00 26.10  ? 317 PRO B CD    1 
ATOM   5134 N  N     . MET B 1 336 ? 15.895  -45.105 -36.558 1.00 27.30  ? 318 MET B N     1 
ATOM   5135 C  CA    . MET B 1 336 ? 16.401  -43.845 -37.089 1.00 30.00  ? 318 MET B CA    1 
ATOM   5136 C  C     . MET B 1 336 ? 15.312  -42.832 -37.433 1.00 27.54  ? 318 MET B C     1 
ATOM   5137 O  O     . MET B 1 336 ? 15.265  -41.742 -36.864 1.00 30.33  ? 318 MET B O     1 
ATOM   5138 C  CB    . MET B 1 336 ? 17.222  -44.123 -38.351 1.00 32.94  ? 318 MET B CB    1 
ATOM   5139 C  CG    . MET B 1 336 ? 17.796  -42.872 -38.979 1.00 34.70  ? 318 MET B CG    1 
ATOM   5140 S  SD    . MET B 1 336 ? 18.953  -42.112 -37.838 1.00 42.52  ? 318 MET B SD    1 
ATOM   5141 C  CE    . MET B 1 336 ? 19.268  -40.559 -38.656 1.00 29.19  ? 318 MET B CE    1 
ATOM   5142 N  N     . ILE B 1 337 ? 14.453  -43.203 -38.376 1.00 23.98  ? 319 ILE B N     1 
ATOM   5143 C  CA    . ILE B 1 337 ? 13.394  -42.332 -38.870 1.00 25.38  ? 319 ILE B CA    1 
ATOM   5144 C  C     . ILE B 1 337 ? 12.468  -41.855 -37.756 1.00 26.27  ? 319 ILE B C     1 
ATOM   5145 O  O     . ILE B 1 337 ? 12.145  -40.666 -37.670 1.00 23.78  ? 319 ILE B O     1 
ATOM   5146 C  CB    . ILE B 1 337 ? 12.547  -43.044 -39.942 1.00 28.88  ? 319 ILE B CB    1 
ATOM   5147 C  CG1   . ILE B 1 337 ? 13.387  -43.323 -41.189 1.00 32.48  ? 319 ILE B CG1   1 
ATOM   5148 C  CG2   . ILE B 1 337 ? 11.324  -42.218 -40.306 1.00 29.75  ? 319 ILE B CG2   1 
ATOM   5149 C  CD1   . ILE B 1 337 ? 13.946  -42.089 -41.809 1.00 34.91  ? 319 ILE B CD1   1 
ATOM   5150 N  N     . THR B 1 338 ? 12.038  -42.793 -36.918 1.00 24.13  ? 320 THR B N     1 
ATOM   5151 C  CA    . THR B 1 338 ? 11.144  -42.492 -35.806 1.00 23.59  ? 320 THR B CA    1 
ATOM   5152 C  C     . THR B 1 338 ? 11.798  -41.476 -34.879 1.00 22.14  ? 320 THR B C     1 
ATOM   5153 O  O     . THR B 1 338 ? 11.158  -40.528 -34.429 1.00 22.21  ? 320 THR B O     1 
ATOM   5154 C  CB    . THR B 1 338 ? 10.790  -43.778 -35.021 1.00 22.96  ? 320 THR B CB    1 
ATOM   5155 O  OG1   . THR B 1 338 ? 10.150  -44.710 -35.904 1.00 24.50  ? 320 THR B OG1   1 
ATOM   5156 C  CG2   . THR B 1 338 ? 9.868   -43.474 -33.853 1.00 23.23  ? 320 THR B CG2   1 
ATOM   5157 N  N     . SER B 1 339 ? 13.087  -41.675 -34.618 1.00 19.85  ? 321 SER B N     1 
ATOM   5158 C  CA    . SER B 1 339 ? 13.856  -40.783 -33.762 1.00 18.82  ? 321 SER B CA    1 
ATOM   5159 C  C     . SER B 1 339 ? 13.989  -39.379 -34.355 1.00 21.71  ? 321 SER B C     1 
ATOM   5160 O  O     . SER B 1 339 ? 13.908  -38.390 -33.635 1.00 22.05  ? 321 SER B O     1 
ATOM   5161 C  CB    . SER B 1 339 ? 15.234  -41.388 -33.476 1.00 18.52  ? 321 SER B CB    1 
ATOM   5162 O  OG    . SER B 1 339 ? 15.111  -42.535 -32.644 1.00 19.23  ? 321 SER B OG    1 
ATOM   5163 N  N     . LEU B 1 340 ? 14.178  -39.294 -35.669 1.00 20.98  ? 322 LEU B N     1 
ATOM   5164 C  CA    . LEU B 1 340 ? 14.232  -38.000 -36.342 1.00 21.76  ? 322 LEU B CA    1 
ATOM   5165 C  C     . LEU B 1 340 ? 12.911  -37.242 -36.189 1.00 25.06  ? 322 LEU B C     1 
ATOM   5166 O  O     . LEU B 1 340 ? 12.902  -36.022 -36.029 1.00 26.35  ? 322 LEU B O     1 
ATOM   5167 C  CB    . LEU B 1 340 ? 14.590  -38.168 -37.818 1.00 20.89  ? 322 LEU B CB    1 
ATOM   5168 C  CG    . LEU B 1 340 ? 16.029  -38.592 -38.129 1.00 18.92  ? 322 LEU B CG    1 
ATOM   5169 C  CD1   . LEU B 1 340 ? 16.183  -38.892 -39.609 1.00 20.96  ? 322 LEU B CD1   1 
ATOM   5170 C  CD2   . LEU B 1 340 ? 17.022  -37.520 -37.695 1.00 17.62  ? 322 LEU B CD2   1 
ATOM   5171 N  N     . HIS B 1 341 ? 11.797  -37.966 -36.223 1.00 23.55  ? 323 HIS B N     1 
ATOM   5172 C  CA    . HIS B 1 341 ? 10.502  -37.340 -35.980 1.00 24.45  ? 323 HIS B CA    1 
ATOM   5173 C  C     . HIS B 1 341 ? 10.388  -36.848 -34.544 1.00 23.63  ? 323 HIS B C     1 
ATOM   5174 O  O     . HIS B 1 341 ? 9.796   -35.801 -34.285 1.00 22.62  ? 323 HIS B O     1 
ATOM   5175 C  CB    . HIS B 1 341 ? 9.360   -38.303 -36.292 1.00 28.42  ? 323 HIS B CB    1 
ATOM   5176 C  CG    . HIS B 1 341 ? 9.118   -38.489 -37.756 1.00 32.32  ? 323 HIS B CG    1 
ATOM   5177 N  ND1   . HIS B 1 341 ? 9.444   -39.651 -38.422 1.00 38.34  ? 323 HIS B ND1   1 
ATOM   5178 C  CD2   . HIS B 1 341 ? 8.589   -37.657 -38.683 1.00 31.08  ? 323 HIS B CD2   1 
ATOM   5179 C  CE1   . HIS B 1 341 ? 9.121   -39.529 -39.697 1.00 38.49  ? 323 HIS B CE1   1 
ATOM   5180 N  NE2   . HIS B 1 341 ? 8.601   -38.329 -39.882 1.00 36.41  ? 323 HIS B NE2   1 
ATOM   5181 N  N     . ALA B 1 342 ? 10.956  -37.607 -33.613 1.00 23.78  ? 324 ALA B N     1 
ATOM   5182 C  CA    . ALA B 1 342 ? 10.955  -37.207 -32.213 1.00 24.71  ? 324 ALA B CA    1 
ATOM   5183 C  C     . ALA B 1 342 ? 11.861  -36.000 -32.030 1.00 21.60  ? 324 ALA B C     1 
ATOM   5184 O  O     . ALA B 1 342 ? 11.610  -35.150 -31.180 1.00 21.18  ? 324 ALA B O     1 
ATOM   5185 C  CB    . ALA B 1 342 ? 11.409  -38.357 -31.319 1.00 19.48  ? 324 ALA B CB    1 
ATOM   5186 N  N     . ALA B 1 343 ? 12.914  -35.936 -32.840 1.00 18.29  ? 325 ALA B N     1 
ATOM   5187 C  CA    . ALA B 1 343 ? 13.852  -34.818 -32.799 1.00 21.33  ? 325 ALA B CA    1 
ATOM   5188 C  C     . ALA B 1 343 ? 13.182  -33.515 -33.253 1.00 22.46  ? 325 ALA B C     1 
ATOM   5189 O  O     . ALA B 1 343 ? 13.309  -32.473 -32.601 1.00 22.16  ? 325 ALA B O     1 
ATOM   5190 C  CB    . ALA B 1 343 ? 15.075  -35.127 -33.657 1.00 19.27  ? 325 ALA B CB    1 
ATOM   5191 N  N     . VAL B 1 344 ? 12.464  -33.585 -34.370 1.00 19.27  ? 326 VAL B N     1 
ATOM   5192 C  CA    . VAL B 1 344 ? 11.723  -32.435 -34.885 1.00 20.48  ? 326 VAL B CA    1 
ATOM   5193 C  C     . VAL B 1 344 ? 10.629  -31.995 -33.909 1.00 21.39  ? 326 VAL B C     1 
ATOM   5194 O  O     . VAL B 1 344 ? 10.384  -30.802 -33.731 1.00 24.65  ? 326 VAL B O     1 
ATOM   5195 C  CB    . VAL B 1 344 ? 11.117  -32.750 -36.268 1.00 21.02  ? 326 VAL B CB    1 
ATOM   5196 C  CG1   . VAL B 1 344 ? 9.979   -31.799 -36.609 1.00 22.60  ? 326 VAL B CG1   1 
ATOM   5197 C  CG2   . VAL B 1 344 ? 12.196  -32.703 -37.329 1.00 20.58  ? 326 VAL B CG2   1 
ATOM   5198 N  N     . LYS B 1 345 ? 9.986   -32.970 -33.273 1.00 22.75  ? 327 LYS B N     1 
ATOM   5199 C  CA    . LYS B 1 345 ? 8.928   -32.695 -32.306 1.00 25.65  ? 327 LYS B CA    1 
ATOM   5200 C  C     . LYS B 1 345 ? 9.441   -31.878 -31.117 1.00 27.57  ? 327 LYS B C     1 
ATOM   5201 O  O     . LYS B 1 345 ? 8.746   -30.988 -30.623 1.00 29.56  ? 327 LYS B O     1 
ATOM   5202 C  CB    . LYS B 1 345 ? 8.297   -34.000 -31.818 1.00 27.20  ? 327 LYS B CB    1 
ATOM   5203 C  CG    . LYS B 1 345 ? 7.298   -33.833 -30.680 1.00 30.27  ? 327 LYS B CG    1 
ATOM   5204 C  CD    . LYS B 1 345 ? 6.694   -35.171 -30.279 1.00 30.87  ? 327 LYS B CD    1 
ATOM   5205 C  CE    . LYS B 1 345 ? 5.783   -35.028 -29.072 1.00 35.98  ? 327 LYS B CE    1 
ATOM   5206 N  NZ    . LYS B 1 345 ? 5.062   -36.296 -28.780 1.00 38.93  ? 327 LYS B NZ    1 
ATOM   5207 N  N     . ALA B 1 346 ? 10.654  -32.186 -30.667 1.00 25.16  ? 328 ALA B N     1 
ATOM   5208 C  CA    . ALA B 1 346 ? 11.280  -31.459 -29.564 1.00 27.78  ? 328 ALA B CA    1 
ATOM   5209 C  C     . ALA B 1 346 ? 11.648  -30.033 -29.974 1.00 26.83  ? 328 ALA B C     1 
ATOM   5210 O  O     . ALA B 1 346 ? 11.426  -29.087 -29.223 1.00 23.36  ? 328 ALA B O     1 
ATOM   5211 C  CB    . ALA B 1 346 ? 12.511  -32.200 -29.065 1.00 20.23  ? 328 ALA B CB    1 
ATOM   5212 N  N     . ALA B 1 347 ? 12.219  -29.895 -31.166 1.00 26.04  ? 329 ALA B N     1 
ATOM   5213 C  CA    . ALA B 1 347 ? 12.578  -28.588 -31.701 1.00 25.43  ? 329 ALA B CA    1 
ATOM   5214 C  C     . ALA B 1 347 ? 11.330  -27.740 -31.887 1.00 26.41  ? 329 ALA B C     1 
ATOM   5215 O  O     . ALA B 1 347 ? 11.348  -26.532 -31.644 1.00 26.00  ? 329 ALA B O     1 
ATOM   5216 C  CB    . ALA B 1 347 ? 13.317  -28.737 -33.021 1.00 22.30  ? 329 ALA B CB    1 
ATOM   5217 N  N     . ALA B 1 348 ? 10.249  -28.388 -32.315 1.00 25.45  ? 330 ALA B N     1 
ATOM   5218 C  CA    . ALA B 1 348 ? 8.968   -27.717 -32.524 1.00 28.59  ? 330 ALA B CA    1 
ATOM   5219 C  C     . ALA B 1 348 ? 8.405   -27.161 -31.219 1.00 29.78  ? 330 ALA B C     1 
ATOM   5220 O  O     . ALA B 1 348 ? 7.825   -26.076 -31.195 1.00 31.70  ? 330 ALA B O     1 
ATOM   5221 C  CB    . ALA B 1 348 ? 7.967   -28.681 -33.156 1.00 27.76  ? 330 ALA B CB    1 
ATOM   5222 N  N     . TYR B 1 349 ? 8.575   -27.917 -30.140 1.00 27.41  ? 331 TYR B N     1 
ATOM   5223 C  CA    . TYR B 1 349 ? 8.062   -27.524 -28.835 1.00 31.35  ? 331 TYR B CA    1 
ATOM   5224 C  C     . TYR B 1 349 ? 8.792   -26.293 -28.317 1.00 29.29  ? 331 TYR B C     1 
ATOM   5225 O  O     . TYR B 1 349 ? 8.177   -25.365 -27.799 1.00 31.43  ? 331 TYR B O     1 
ATOM   5226 C  CB    . TYR B 1 349 ? 8.201   -28.679 -27.839 1.00 30.64  ? 331 TYR B CB    1 
ATOM   5227 C  CG    . TYR B 1 349 ? 7.820   -28.323 -26.418 1.00 30.10  ? 331 TYR B CG    1 
ATOM   5228 C  CD1   . TYR B 1 349 ? 6.489   -28.338 -26.008 1.00 30.59  ? 331 TYR B CD1   1 
ATOM   5229 C  CD2   . TYR B 1 349 ? 8.790   -27.985 -25.484 1.00 28.58  ? 331 TYR B CD2   1 
ATOM   5230 C  CE1   . TYR B 1 349 ? 6.136   -28.016 -24.705 1.00 32.16  ? 331 TYR B CE1   1 
ATOM   5231 C  CE2   . TYR B 1 349 ? 8.448   -27.660 -24.185 1.00 33.82  ? 331 TYR B CE2   1 
ATOM   5232 C  CZ    . TYR B 1 349 ? 7.122   -27.679 -23.798 1.00 33.87  ? 331 TYR B CZ    1 
ATOM   5233 O  OH    . TYR B 1 349 ? 6.790   -27.355 -22.500 1.00 36.63  ? 331 TYR B OH    1 
ATOM   5234 N  N     . ILE B 1 350 ? 10.110  -26.296 -28.463 1.00 30.39  ? 332 ILE B N     1 
ATOM   5235 C  CA    . ILE B 1 350 ? 10.930  -25.182 -28.022 1.00 33.99  ? 332 ILE B CA    1 
ATOM   5236 C  C     . ILE B 1 350 ? 10.623  -23.925 -28.833 1.00 38.62  ? 332 ILE B C     1 
ATOM   5237 O  O     . ILE B 1 350 ? 10.577  -22.819 -28.292 1.00 43.64  ? 332 ILE B O     1 
ATOM   5238 C  CB    . ILE B 1 350 ? 12.425  -25.543 -28.086 1.00 31.26  ? 332 ILE B CB    1 
ATOM   5239 C  CG1   . ILE B 1 350 ? 12.762  -26.495 -26.940 1.00 33.40  ? 332 ILE B CG1   1 
ATOM   5240 C  CG2   . ILE B 1 350 ? 13.294  -24.300 -28.007 1.00 30.42  ? 332 ILE B CG2   1 
ATOM   5241 C  CD1   . ILE B 1 350 ? 12.374  -25.965 -25.574 1.00 35.90  ? 332 ILE B CD1   1 
ATOM   5242 N  N     . ILE B 1 351 ? 10.387  -24.107 -30.128 1.00 37.05  ? 333 ILE B N     1 
ATOM   5243 C  CA    . ILE B 1 351 ? 9.993   -23.005 -30.998 1.00 40.81  ? 333 ILE B CA    1 
ATOM   5244 C  C     . ILE B 1 351 ? 8.674   -22.364 -30.545 1.00 42.83  ? 333 ILE B C     1 
ATOM   5245 O  O     . ILE B 1 351 ? 8.567   -21.142 -30.467 1.00 42.92  ? 333 ILE B O     1 
ATOM   5246 C  CB    . ILE B 1 351 ? 9.886   -23.473 -32.467 1.00 38.03  ? 333 ILE B CB    1 
ATOM   5247 C  CG1   . ILE B 1 351 ? 11.283  -23.684 -33.051 1.00 38.02  ? 333 ILE B CG1   1 
ATOM   5248 C  CG2   . ILE B 1 351 ? 9.116   -22.466 -33.299 1.00 37.05  ? 333 ILE B CG2   1 
ATOM   5249 C  CD1   . ILE B 1 351 ? 11.301  -24.536 -34.301 1.00 40.46  ? 333 ILE B CD1   1 
ATOM   5250 N  N     . CYS B 1 352 ? 7.683   -23.191 -30.225 1.00 44.20  ? 334 CYS B N     1 
ATOM   5251 C  CA    . CYS B 1 352 ? 6.370   -22.688 -29.823 1.00 47.81  ? 334 CYS B CA    1 
ATOM   5252 C  C     . CYS B 1 352 ? 6.382   -21.991 -28.463 1.00 52.01  ? 334 CYS B C     1 
ATOM   5253 O  O     . CYS B 1 352 ? 5.445   -21.270 -28.123 1.00 55.73  ? 334 CYS B O     1 
ATOM   5254 C  CB    . CYS B 1 352 ? 5.325   -23.807 -29.842 1.00 45.75  ? 334 CYS B CB    1 
ATOM   5255 S  SG    . CYS B 1 352 ? 4.893   -24.368 -31.509 1.00 125.12 ? 334 CYS B SG    1 
ATOM   5256 N  N     . ARG B 1 353 ? 7.441   -22.208 -27.690 1.00 52.06  ? 335 ARG B N     1 
ATOM   5257 C  CA    . ARG B 1 353 ? 7.597   -21.525 -26.409 1.00 53.22  ? 335 ARG B CA    1 
ATOM   5258 C  C     . ARG B 1 353 ? 8.639   -20.413 -26.487 1.00 53.67  ? 335 ARG B C     1 
ATOM   5259 O  O     . ARG B 1 353 ? 9.486   -20.402 -27.377 1.00 51.34  ? 335 ARG B O     1 
ATOM   5260 C  CB    . ARG B 1 353 ? 7.960   -22.524 -25.307 1.00 51.73  ? 335 ARG B CB    1 
ATOM   5261 C  CG    . ARG B 1 353 ? 6.820   -23.456 -24.947 1.00 50.17  ? 335 ARG B CG    1 
ATOM   5262 C  CD    . ARG B 1 353 ? 7.183   -24.381 -23.812 1.00 47.43  ? 335 ARG B CD    1 
ATOM   5263 N  NE    . ARG B 1 353 ? 7.479   -23.687 -22.561 1.00 49.26  ? 335 ARG B NE    1 
ATOM   5264 C  CZ    . ARG B 1 353 ? 6.577   -23.414 -21.620 1.00 53.65  ? 335 ARG B CZ    1 
ATOM   5265 N  NH1   . ARG B 1 353 ? 5.309   -23.763 -21.787 1.00 54.46  ? 335 ARG B NH1   1 
ATOM   5266 N  NH2   . ARG B 1 353 ? 6.944   -22.787 -20.510 1.00 54.86  ? 335 ARG B NH2   1 
ATOM   5267 N  N     . SER B 1 354 ? 8.568   -19.476 -25.549 1.00 59.24  ? 336 SER B N     1 
ATOM   5268 C  CA    . SER B 1 354 ? 9.505   -18.359 -25.518 1.00 63.17  ? 336 SER B CA    1 
ATOM   5269 C  C     . SER B 1 354 ? 10.900  -18.818 -25.106 1.00 58.81  ? 336 SER B C     1 
ATOM   5270 O  O     . SER B 1 354 ? 11.152  -19.093 -23.930 1.00 57.04  ? 336 SER B O     1 
ATOM   5271 C  CB    . SER B 1 354 ? 9.003   -17.261 -24.572 1.00 69.67  ? 336 SER B CB    1 
ATOM   5272 O  OG    . SER B 1 354 ? 8.743   -17.778 -23.278 1.00 71.25  ? 336 SER B OG    1 
ATOM   5273 N  N     . GLY B 1 355 ? 11.802  -18.895 -26.080 1.00 57.09  ? 337 GLY B N     1 
ATOM   5274 C  CA    . GLY B 1 355 ? 13.163  -19.336 -25.826 1.00 56.23  ? 337 GLY B CA    1 
ATOM   5275 C  C     . GLY B 1 355 ? 13.231  -20.802 -25.430 1.00 51.02  ? 337 GLY B C     1 
ATOM   5276 O  O     . GLY B 1 355 ? 12.385  -21.592 -25.846 1.00 51.27  ? 337 GLY B O     1 
ATOM   5277 N  N     . PHE B 1 356 ? 14.231  -21.168 -24.629 1.00 46.80  ? 338 PHE B N     1 
ATOM   5278 C  CA    . PHE B 1 356 ? 14.369  -22.552 -24.172 1.00 47.37  ? 338 PHE B CA    1 
ATOM   5279 C  C     . PHE B 1 356 ? 13.739  -22.755 -22.796 1.00 52.12  ? 338 PHE B C     1 
ATOM   5280 O  O     . PHE B 1 356 ? 14.433  -22.801 -21.778 1.00 55.16  ? 338 PHE B O     1 
ATOM   5281 C  CB    . PHE B 1 356 ? 15.837  -22.999 -24.149 1.00 42.50  ? 338 PHE B CB    1 
ATOM   5282 C  CG    . PHE B 1 356 ? 16.015  -24.496 -24.165 1.00 37.27  ? 338 PHE B CG    1 
ATOM   5283 C  CD1   . PHE B 1 356 ? 16.358  -25.153 -25.338 1.00 33.10  ? 338 PHE B CD1   1 
ATOM   5284 C  CD2   . PHE B 1 356 ? 15.825  -25.249 -23.012 1.00 28.06  ? 338 PHE B CD2   1 
ATOM   5285 C  CE1   . PHE B 1 356 ? 16.515  -26.531 -25.358 1.00 29.61  ? 338 PHE B CE1   1 
ATOM   5286 C  CE2   . PHE B 1 356 ? 15.979  -26.623 -23.027 1.00 26.18  ? 338 PHE B CE2   1 
ATOM   5287 C  CZ    . PHE B 1 356 ? 16.324  -27.266 -24.198 1.00 25.88  ? 338 PHE B CZ    1 
ATOM   5288 N  N     . SER B 1 357 ? 12.419  -22.888 -22.777 1.00 51.02  ? 339 SER B N     1 
ATOM   5289 C  CA    . SER B 1 357 ? 11.685  -23.058 -21.533 1.00 47.60  ? 339 SER B CA    1 
ATOM   5290 C  C     . SER B 1 357 ? 10.919  -24.373 -21.564 1.00 45.24  ? 339 SER B C     1 
ATOM   5291 O  O     . SER B 1 357 ? 10.213  -24.666 -22.528 1.00 44.46  ? 339 SER B O     1 
ATOM   5292 C  CB    . SER B 1 357 ? 10.726  -21.884 -21.320 1.00 44.63  ? 339 SER B CB    1 
ATOM   5293 O  OG    . SER B 1 357 ? 9.790   -22.164 -20.297 1.00 44.11  ? 339 SER B OG    1 
ATOM   5294 N  N     . LEU B 1 358 ? 11.073  -25.167 -20.511 1.00 42.64  ? 340 LEU B N     1 
ATOM   5295 C  CA    . LEU B 1 358 ? 10.372  -26.440 -20.410 1.00 38.75  ? 340 LEU B CA    1 
ATOM   5296 C  C     . LEU B 1 358 ? 9.186   -26.304 -19.460 1.00 40.88  ? 340 LEU B C     1 
ATOM   5297 O  O     . LEU B 1 358 ? 9.364   -26.167 -18.250 1.00 44.94  ? 340 LEU B O     1 
ATOM   5298 C  CB    . LEU B 1 358 ? 11.321  -27.544 -19.929 1.00 33.39  ? 340 LEU B CB    1 
ATOM   5299 C  CG    . LEU B 1 358 ? 12.541  -27.833 -20.809 1.00 31.88  ? 340 LEU B CG    1 
ATOM   5300 C  CD1   . LEU B 1 358 ? 13.425  -28.907 -20.180 1.00 27.60  ? 340 LEU B CD1   1 
ATOM   5301 C  CD2   . LEU B 1 358 ? 12.115  -28.243 -22.212 1.00 31.18  ? 340 LEU B CD2   1 
ATOM   5302 N  N     . GLY B 1 359 ? 7.978   -26.330 -20.014 1.00 38.94  ? 341 GLY B N     1 
ATOM   5303 C  CA    . GLY B 1 359 ? 6.773   -26.229 -19.212 1.00 40.67  ? 341 GLY B CA    1 
ATOM   5304 C  C     . GLY B 1 359 ? 6.334   -27.582 -18.690 1.00 40.85  ? 341 GLY B C     1 
ATOM   5305 O  O     . GLY B 1 359 ? 7.143   -28.505 -18.579 1.00 39.65  ? 341 GLY B O     1 
ATOM   5306 N  N     . SER B 1 360 ? 5.049   -27.705 -18.374 1.00 43.26  ? 342 SER B N     1 
ATOM   5307 C  CA    . SER B 1 360 ? 4.512   -28.955 -17.848 1.00 45.57  ? 342 SER B CA    1 
ATOM   5308 C  C     . SER B 1 360 ? 4.632   -30.076 -18.874 1.00 43.06  ? 342 SER B C     1 
ATOM   5309 O  O     . SER B 1 360 ? 4.316   -29.899 -20.052 1.00 42.78  ? 342 SER B O     1 
ATOM   5310 C  CB    . SER B 1 360 ? 3.056   -28.785 -17.408 1.00 51.12  ? 342 SER B CB    1 
ATOM   5311 O  OG    . SER B 1 360 ? 2.231   -28.445 -18.508 1.00 54.65  ? 342 SER B OG    1 
ATOM   5312 N  N     . ARG B 1 361 ? 5.086   -31.231 -18.403 1.00 42.46  ? 343 ARG B N     1 
ATOM   5313 C  CA    . ARG B 1 361 ? 5.388   -32.370 -19.259 1.00 41.17  ? 343 ARG B CA    1 
ATOM   5314 C  C     . ARG B 1 361 ? 4.169   -32.892 -20.022 1.00 44.31  ? 343 ARG B C     1 
ATOM   5315 O  O     . ARG B 1 361 ? 4.297   -33.426 -21.129 1.00 40.99  ? 343 ARG B O     1 
ATOM   5316 C  CB    . ARG B 1 361 ? 6.023   -33.483 -18.419 1.00 37.94  ? 343 ARG B CB    1 
ATOM   5317 C  CG    . ARG B 1 361 ? 6.472   -34.695 -19.207 1.00 33.27  ? 343 ARG B CG    1 
ATOM   5318 C  CD    . ARG B 1 361 ? 7.319   -34.314 -20.407 1.00 30.51  ? 343 ARG B CD    1 
ATOM   5319 N  NE    . ARG B 1 361 ? 7.779   -35.493 -21.133 1.00 27.87  ? 343 ARG B NE    1 
ATOM   5320 C  CZ    . ARG B 1 361 ? 7.023   -36.198 -21.968 1.00 34.43  ? 343 ARG B CZ    1 
ATOM   5321 N  NH1   . ARG B 1 361 ? 7.521   -37.262 -22.585 1.00 34.26  ? 343 ARG B NH1   1 
ATOM   5322 N  NH2   . ARG B 1 361 ? 5.764   -35.844 -22.185 1.00 34.68  ? 343 ARG B NH2   1 
ATOM   5323 N  N     . ASP B 1 362 ? 2.987   -32.719 -19.438 1.00 49.74  ? 344 ASP B N     1 
ATOM   5324 C  CA    . ASP B 1 362 ? 1.755   -33.217 -20.043 1.00 56.07  ? 344 ASP B CA    1 
ATOM   5325 C  C     . ASP B 1 362 ? 1.320   -32.404 -21.261 1.00 57.21  ? 344 ASP B C     1 
ATOM   5326 O  O     . ASP B 1 362 ? 0.503   -32.860 -22.061 1.00 57.94  ? 344 ASP B O     1 
ATOM   5327 C  CB    . ASP B 1 362 ? 0.635   -33.265 -19.006 1.00 64.29  ? 344 ASP B CB    1 
ATOM   5328 C  CG    . ASP B 1 362 ? 0.924   -34.245 -17.888 1.00 68.99  ? 344 ASP B CG    1 
ATOM   5329 O  OD1   . ASP B 1 362 ? 2.118   -34.497 -17.612 1.00 67.91  ? 344 ASP B OD1   1 
ATOM   5330 O  OD2   . ASP B 1 362 ? -0.040  -34.767 -17.289 1.00 73.47  ? 344 ASP B OD2   1 
ATOM   5331 N  N     . SER B 1 363 ? 1.875   -31.205 -21.401 1.00 57.94  ? 345 SER B N     1 
ATOM   5332 C  CA    . SER B 1 363 ? 1.556   -30.344 -22.534 1.00 58.16  ? 345 SER B CA    1 
ATOM   5333 C  C     . SER B 1 363 ? 2.495   -30.584 -23.711 1.00 54.74  ? 345 SER B C     1 
ATOM   5334 O  O     . SER B 1 363 ? 2.592   -29.758 -24.616 1.00 56.05  ? 345 SER B O     1 
ATOM   5335 C  CB    . SER B 1 363 ? 1.612   -28.873 -22.119 1.00 61.23  ? 345 SER B CB    1 
ATOM   5336 O  OG    . SER B 1 363 ? 0.644   -28.589 -21.125 1.00 65.75  ? 345 SER B OG    1 
ATOM   5337 N  N     . TYR B 1 364 ? 3.186   -31.717 -23.696 1.00 51.99  ? 346 TYR B N     1 
ATOM   5338 C  CA    . TYR B 1 364 ? 4.133   -32.045 -24.752 1.00 51.07  ? 346 TYR B CA    1 
ATOM   5339 C  C     . TYR B 1 364 ? 3.432   -32.780 -25.890 1.00 59.08  ? 346 TYR B C     1 
ATOM   5340 O  O     . TYR B 1 364 ? 3.769   -32.586 -27.059 1.00 56.53  ? 346 TYR B O     1 
ATOM   5341 C  CB    . TYR B 1 364 ? 5.266   -32.900 -24.181 1.00 44.22  ? 346 TYR B CB    1 
ATOM   5342 C  CG    . TYR B 1 364 ? 6.444   -33.108 -25.106 1.00 37.58  ? 346 TYR B CG    1 
ATOM   5343 C  CD1   . TYR B 1 364 ? 7.096   -32.028 -25.691 1.00 35.00  ? 346 TYR B CD1   1 
ATOM   5344 C  CD2   . TYR B 1 364 ? 6.924   -34.386 -25.368 1.00 35.29  ? 346 TYR B CD2   1 
ATOM   5345 C  CE1   . TYR B 1 364 ? 8.183   -32.217 -26.523 1.00 31.97  ? 346 TYR B CE1   1 
ATOM   5346 C  CE2   . TYR B 1 364 ? 8.008   -34.588 -26.201 1.00 30.98  ? 346 TYR B CE2   1 
ATOM   5347 C  CZ    . TYR B 1 364 ? 8.635   -33.501 -26.775 1.00 29.07  ? 346 TYR B CZ    1 
ATOM   5348 O  OH    . TYR B 1 364 ? 9.711   -33.697 -27.604 1.00 23.46  ? 346 TYR B OH    1 
ATOM   5349 N  N     . SER B 1 365 ? 2.451   -33.607 -25.527 1.00 69.88  ? 347 SER B N     1 
ATOM   5350 C  CA    . SER B 1 365 ? 1.722   -34.476 -26.459 1.00 46.64  ? 347 SER B CA    1 
ATOM   5351 C  C     . SER B 1 365 ? 2.621   -35.555 -27.062 1.00 51.14  ? 347 SER B C     1 
ATOM   5352 O  O     . SER B 1 365 ? 3.160   -36.404 -26.345 1.00 53.77  ? 347 SER B O     1 
ATOM   5353 C  CB    . SER B 1 365 ? 1.021   -33.671 -27.565 1.00 50.66  ? 347 SER B CB    1 
ATOM   5354 O  OG    . SER B 1 365 ? 0.137   -32.704 -27.021 1.00 52.78  ? 347 SER B OG    1 
HETATM 5355 O  "O5'" . ADN C 2 .   ? 13.365  -18.076 10.858  1.00 27.17  ? 401 ADN A "O5'" 1 
HETATM 5356 C  "C5'" . ADN C 2 .   ? 14.470  -17.771 10.009  1.00 25.47  ? 401 ADN A "C5'" 1 
HETATM 5357 C  "C4'" . ADN C 2 .   ? 14.013  -17.119 8.727   1.00 23.30  ? 401 ADN A "C4'" 1 
HETATM 5358 O  "O4'" . ADN C 2 .   ? 13.393  -15.857 9.019   1.00 17.99  ? 401 ADN A "O4'" 1 
HETATM 5359 C  "C3'" . ADN C 2 .   ? 15.103  -16.813 7.693   1.00 22.74  ? 401 ADN A "C3'" 1 
HETATM 5360 O  "O3'" . ADN C 2 .   ? 14.989  -17.720 6.595   1.00 20.24  ? 401 ADN A "O3'" 1 
HETATM 5361 C  "C2'" . ADN C 2 .   ? 14.777  -15.382 7.208   1.00 23.49  ? 401 ADN A "C2'" 1 
HETATM 5362 O  "O2'" . ADN C 2 .   ? 14.719  -15.235 5.806   1.00 25.17  ? 401 ADN A "O2'" 1 
HETATM 5363 C  "C1'" . ADN C 2 .   ? 13.417  -15.098 7.848   1.00 21.13  ? 401 ADN A "C1'" 1 
HETATM 5364 N  N9    . ADN C 2 .   ? 13.179  -13.691 8.171   1.00 17.71  ? 401 ADN A N9    1 
HETATM 5365 C  C8    . ADN C 2 .   ? 14.019  -12.857 8.754   1.00 18.02  ? 401 ADN A C8    1 
HETATM 5366 N  N7    . ADN C 2 .   ? 13.352  -11.547 8.839   1.00 19.53  ? 401 ADN A N7    1 
HETATM 5367 C  C5    . ADN C 2 .   ? 12.056  -11.672 8.255   1.00 15.85  ? 401 ADN A C5    1 
HETATM 5368 C  C6    . ADN C 2 .   ? 11.023  -10.758 8.070   1.00 14.75  ? 401 ADN A C6    1 
HETATM 5369 N  N6    . ADN C 2 .   ? 11.181  -9.398  8.511   1.00 15.22  ? 401 ADN A N6    1 
HETATM 5370 N  N1    . ADN C 2 .   ? 9.847   -11.163 7.452   1.00 15.86  ? 401 ADN A N1    1 
HETATM 5371 C  C2    . ADN C 2 .   ? 9.692   -12.459 7.029   1.00 16.76  ? 401 ADN A C2    1 
HETATM 5372 N  N3    . ADN C 2 .   ? 10.707  -13.361 7.214   1.00 17.32  ? 401 ADN A N3    1 
HETATM 5373 C  C4    . ADN C 2 .   ? 11.907  -12.937 7.839   1.00 16.30  ? 401 ADN A C4    1 
HETATM 5374 CL CL    . CL  D 3 .   ? 6.796   -14.021 6.438   1.00 19.21  ? 402 CL  A CL    1 
HETATM 5375 O  "O5'" . ADN E 2 .   ? 21.523  -23.114 -28.316 1.00 32.49  ? 401 ADN B "O5'" 1 
HETATM 5376 C  "C5'" . ADN E 2 .   ? 21.359  -21.924 -27.551 1.00 29.88  ? 401 ADN B "C5'" 1 
HETATM 5377 C  "C4'" . ADN E 2 .   ? 22.138  -22.003 -26.266 1.00 27.05  ? 401 ADN B "C4'" 1 
HETATM 5378 O  "O4'" . ADN E 2 .   ? 23.544  -21.924 -26.544 1.00 24.18  ? 401 ADN B "O4'" 1 
HETATM 5379 C  "C3'" . ADN E 2 .   ? 21.862  -20.908 -25.235 1.00 23.83  ? 401 ADN B "C3'" 1 
HETATM 5380 O  "O3'" . ADN E 2 .   ? 21.095  -21.454 -24.164 1.00 22.52  ? 401 ADN B "O3'" 1 
HETATM 5381 C  "C2'" . ADN E 2 .   ? 23.264  -20.515 -24.715 1.00 24.73  ? 401 ADN B "C2'" 1 
HETATM 5382 O  "O2'" . ADN E 2 .   ? 23.390  -20.514 -23.308 1.00 26.32  ? 401 ADN B "O2'" 1 
HETATM 5383 C  "C1'" . ADN E 2 .   ? 24.178  -21.559 -25.359 1.00 23.16  ? 401 ADN B "C1'" 1 
HETATM 5384 N  N9    . ADN E 2 .   ? 25.528  -21.096 -25.656 1.00 21.79  ? 401 ADN B N9    1 
HETATM 5385 C  C8    . ADN E 2 .   ? 25.886  -19.983 -26.272 1.00 22.15  ? 401 ADN B C8    1 
HETATM 5386 N  N7    . ADN E 2 .   ? 27.360  -19.936 -26.294 1.00 21.44  ? 401 ADN B N7    1 
HETATM 5387 C  C5    . ADN E 2 .   ? 27.845  -21.111 -25.635 1.00 22.80  ? 401 ADN B C5    1 
HETATM 5388 C  C6    . ADN E 2 .   ? 29.131  -21.581 -25.366 1.00 21.29  ? 401 ADN B C6    1 
HETATM 5389 N  N6    . ADN E 2 .   ? 30.289  -20.835 -25.784 1.00 19.00  ? 401 ADN B N6    1 
HETATM 5390 N  N1    . ADN E 2 .   ? 29.295  -22.779 -24.685 1.00 19.63  ? 401 ADN B N1    1 
HETATM 5391 C  C2    . ADN E 2 .   ? 28.214  -23.510 -24.283 1.00 20.09  ? 401 ADN B C2    1 
HETATM 5392 N  N3    . ADN E 2 .   ? 26.952  -23.053 -24.541 1.00 21.76  ? 401 ADN B N3    1 
HETATM 5393 C  C4    . ADN E 2 .   ? 26.785  -21.831 -25.235 1.00 22.14  ? 401 ADN B C4    1 
HETATM 5394 CL CL    . CL  F 3 .   ? 28.045  -26.686 -23.391 1.00 21.07  ? 402 CL  B CL    1 
HETATM 5395 O  O     . HOH G 4 .   ? 8.473   -40.478 6.329   1.00 22.24  ? 501 HOH A O     1 
HETATM 5396 O  O     . HOH G 4 .   ? 5.335   -9.978  0.539   1.00 17.94  ? 502 HOH A O     1 
HETATM 5397 O  O     . HOH G 4 .   ? 7.618   -15.798 3.793   1.00 19.18  ? 503 HOH A O     1 
HETATM 5398 O  O     . HOH G 4 .   ? 11.540  -20.065 1.779   1.00 21.42  ? 504 HOH A O     1 
HETATM 5399 O  O     . HOH G 4 .   ? 7.569   -19.308 10.391  1.00 22.13  ? 505 HOH A O     1 
HETATM 5400 O  O     . HOH G 4 .   ? 7.317   -2.635  4.874   1.00 28.44  ? 506 HOH A O     1 
HETATM 5401 O  O     . HOH G 4 .   ? 12.030  -26.351 23.371  1.00 22.24  ? 507 HOH A O     1 
HETATM 5402 O  O     . HOH G 4 .   ? 10.771  -5.002  -9.434  1.00 28.32  ? 508 HOH A O     1 
HETATM 5403 O  O     . HOH G 4 .   ? 10.632  -9.819  -1.701  1.00 24.36  ? 509 HOH A O     1 
HETATM 5404 O  O     . HOH G 4 .   ? 1.257   -0.747  16.665  1.00 22.21  ? 510 HOH A O     1 
HETATM 5405 O  O     . HOH G 4 .   ? 4.677   -33.382 10.481  1.00 21.82  ? 511 HOH A O     1 
HETATM 5406 O  O     . HOH G 4 .   ? 8.642   -7.993  9.027   1.00 16.44  ? 512 HOH A O     1 
HETATM 5407 O  O     . HOH G 4 .   ? 7.393   -33.913 10.969  1.00 19.65  ? 513 HOH A O     1 
HETATM 5408 O  O     . HOH G 4 .   ? 34.260  -2.357  6.123   1.00 34.26  ? 514 HOH A O     1 
HETATM 5409 O  O     . HOH G 4 .   ? 13.339  -3.895  5.924   1.00 21.05  ? 515 HOH A O     1 
HETATM 5410 O  O     . HOH G 4 .   ? 14.370  -17.575 22.243  1.00 27.10  ? 516 HOH A O     1 
HETATM 5411 O  O     . HOH G 4 .   ? -9.721  -18.579 12.847  1.00 28.54  ? 517 HOH A O     1 
HETATM 5412 O  O     . HOH G 4 .   ? 13.021  -22.123 20.771  1.00 22.83  ? 518 HOH A O     1 
HETATM 5413 O  O     . HOH G 4 .   ? 16.698  -35.208 3.152   1.00 29.86  ? 519 HOH A O     1 
HETATM 5414 O  O     . HOH G 4 .   ? 19.303  -24.251 9.117   1.00 31.37  ? 520 HOH A O     1 
HETATM 5415 O  O     . HOH G 4 .   ? -11.884 -20.713 14.094  1.00 38.05  ? 521 HOH A O     1 
HETATM 5416 O  O     . HOH G 4 .   ? 1.194   -1.207  19.331  1.00 26.02  ? 522 HOH A O     1 
HETATM 5417 O  O     . HOH G 4 .   ? 2.090   -3.537  1.756   1.00 32.31  ? 523 HOH A O     1 
HETATM 5418 O  O     . HOH G 4 .   ? -5.259  -22.535 -1.138  1.00 27.34  ? 524 HOH A O     1 
HETATM 5419 O  O     . HOH G 4 .   ? 25.165  -2.159  1.192   1.00 37.64  ? 525 HOH A O     1 
HETATM 5420 O  O     . HOH G 4 .   ? 7.733   -21.646 15.772  1.00 30.53  ? 526 HOH A O     1 
HETATM 5421 O  O     . HOH G 4 .   ? 6.656   -10.921 19.330  1.00 25.27  ? 527 HOH A O     1 
HETATM 5422 O  O     . HOH G 4 .   ? -9.943  -23.164 18.004  1.00 27.26  ? 528 HOH A O     1 
HETATM 5423 O  O     . HOH G 4 .   ? -2.000  -0.270  13.225  1.00 42.18  ? 529 HOH A O     1 
HETATM 5424 O  O     . HOH G 4 .   ? 5.260   -38.022 15.558  1.00 20.73  ? 530 HOH A O     1 
HETATM 5425 O  O     . HOH G 4 .   ? -3.018  -25.016 -3.949  1.00 28.85  ? 531 HOH A O     1 
HETATM 5426 O  O     . HOH G 4 .   ? 1.682   -21.462 -8.991  1.00 25.49  ? 532 HOH A O     1 
HETATM 5427 O  O     . HOH G 4 .   ? 17.042  -20.156 4.137   1.00 22.21  ? 533 HOH A O     1 
HETATM 5428 O  O     . HOH G 4 .   ? 20.009  -8.699  14.399  1.00 32.04  ? 534 HOH A O     1 
HETATM 5429 O  O     . HOH G 4 .   ? 12.676  -38.358 -2.058  1.00 41.87  ? 535 HOH A O     1 
HETATM 5430 O  O     . HOH G 4 .   ? 22.145  -24.851 2.182   1.00 29.40  ? 536 HOH A O     1 
HETATM 5431 O  O     . HOH G 4 .   ? 13.454  -8.494  17.989  1.00 32.18  ? 537 HOH A O     1 
HETATM 5432 O  O     . HOH G 4 .   ? 24.602  -8.711  0.030   1.00 36.40  ? 538 HOH A O     1 
HETATM 5433 O  O     . HOH G 4 .   ? 1.326   -3.277  6.859   1.00 28.99  ? 539 HOH A O     1 
HETATM 5434 O  O     . HOH G 4 .   ? 20.044  -7.408  16.765  1.00 24.59  ? 540 HOH A O     1 
HETATM 5435 O  O     . HOH G 4 .   ? 4.823   -2.592  -6.834  1.00 37.09  ? 541 HOH A O     1 
HETATM 5436 O  O     . HOH G 4 .   ? 3.214   -1.798  5.370   1.00 28.38  ? 542 HOH A O     1 
HETATM 5437 O  O     . HOH G 4 .   ? 13.013  -14.822 17.651  1.00 41.05  ? 543 HOH A O     1 
HETATM 5438 O  O     . HOH G 4 .   ? 7.916   -34.748 27.937  1.00 30.94  ? 544 HOH A O     1 
HETATM 5439 O  O     . HOH G 4 .   ? -1.977  -22.196 33.660  1.00 39.90  ? 545 HOH A O     1 
HETATM 5440 O  O     . HOH G 4 .   ? 1.730   -8.449  -9.723  1.00 28.41  ? 546 HOH A O     1 
HETATM 5441 O  O     . HOH G 4 .   ? 8.604   -18.429 17.405  1.00 39.42  ? 547 HOH A O     1 
HETATM 5442 O  O     . HOH G 4 .   ? 3.578   -0.853  20.687  1.00 38.42  ? 548 HOH A O     1 
HETATM 5443 O  O     . HOH G 4 .   ? -5.125  -4.978  19.709  1.00 30.67  ? 549 HOH A O     1 
HETATM 5444 O  O     . HOH G 4 .   ? -9.027  -26.891 -0.470  1.00 35.42  ? 550 HOH A O     1 
HETATM 5445 O  O     . HOH G 4 .   ? 20.950  -3.132  -0.465  1.00 35.30  ? 551 HOH A O     1 
HETATM 5446 O  O     . HOH G 4 .   ? 14.147  -30.448 26.765  1.00 32.45  ? 552 HOH A O     1 
HETATM 5447 O  O     . HOH G 4 .   ? -5.467  -33.174 15.388  1.00 34.44  ? 553 HOH A O     1 
HETATM 5448 O  O     . HOH G 4 .   ? -0.315  -39.288 20.853  1.00 43.39  ? 554 HOH A O     1 
HETATM 5449 O  O     . HOH G 4 .   ? 11.650  -40.394 5.109   1.00 44.75  ? 555 HOH A O     1 
HETATM 5450 O  O     . HOH G 4 .   ? 12.551  -2.098  2.824   1.00 31.84  ? 556 HOH A O     1 
HETATM 5451 O  O     . HOH G 4 .   ? 9.617   -20.835 17.859  1.00 38.72  ? 557 HOH A O     1 
HETATM 5452 O  O     . HOH G 4 .   ? 22.688  -28.608 4.630   1.00 36.74  ? 558 HOH A O     1 
HETATM 5453 O  O     . HOH G 4 .   ? 7.636   -2.040  13.755  1.00 32.00  ? 559 HOH A O     1 
HETATM 5454 O  O     . HOH G 4 .   ? -1.671  -36.243 22.486  1.00 35.03  ? 560 HOH A O     1 
HETATM 5455 O  O     . HOH G 4 .   ? 16.943  -21.187 16.301  1.00 46.35  ? 561 HOH A O     1 
HETATM 5456 O  O     . HOH G 4 .   ? 15.715  -22.143 27.391  1.00 27.52  ? 562 HOH A O     1 
HETATM 5457 O  O     . HOH G 4 .   ? -0.659  -7.843  -8.894  1.00 40.81  ? 563 HOH A O     1 
HETATM 5458 O  O     . HOH G 4 .   ? -2.191  -33.320 -5.800  1.00 33.82  ? 564 HOH A O     1 
HETATM 5459 O  O     . HOH G 4 .   ? 3.717   -37.449 6.195   1.00 44.36  ? 565 HOH A O     1 
HETATM 5460 O  O     . HOH G 4 .   ? -12.801 -11.078 5.786   1.00 38.98  ? 566 HOH A O     1 
HETATM 5461 O  O     . HOH G 4 .   ? 23.045  -7.529  -1.568  1.00 32.45  ? 567 HOH A O     1 
HETATM 5462 O  O     . HOH G 4 .   ? 3.206   -1.784  3.145   1.00 28.58  ? 568 HOH A O     1 
HETATM 5463 O  O     . HOH G 4 .   ? 5.511   -28.888 34.455  1.00 32.73  ? 569 HOH A O     1 
HETATM 5464 O  O     . HOH G 4 .   ? 10.966  -1.462  0.484   1.00 34.40  ? 570 HOH A O     1 
HETATM 5465 O  O     . HOH G 4 .   ? 16.732  -39.851 -0.191  1.00 48.70  ? 571 HOH A O     1 
HETATM 5466 O  O     . HOH G 4 .   ? -3.700  -19.902 -8.445  1.00 39.28  ? 572 HOH A O     1 
HETATM 5467 O  O     . HOH G 4 .   ? 5.305   -21.686 -7.637  1.00 40.76  ? 573 HOH A O     1 
HETATM 5468 O  O     . HOH G 4 .   ? 16.968  -8.706  -4.532  1.00 29.64  ? 574 HOH A O     1 
HETATM 5469 O  O     . HOH G 4 .   ? -4.543  -30.509 32.118  1.00 42.18  ? 575 HOH A O     1 
HETATM 5470 O  O     . HOH G 4 .   ? -13.333 -10.424 -1.052  1.00 52.54  ? 576 HOH A O     1 
HETATM 5471 O  O     . HOH G 4 .   ? 3.801   -38.554 13.279  1.00 31.66  ? 577 HOH A O     1 
HETATM 5472 O  O     . HOH G 4 .   ? -11.400 -18.387 24.633  1.00 55.18  ? 578 HOH A O     1 
HETATM 5473 O  O     . HOH G 4 .   ? 7.964   -16.704 12.380  1.00 30.50  ? 579 HOH A O     1 
HETATM 5474 O  O     . HOH G 4 .   ? -6.138  -15.935 32.546  1.00 39.19  ? 580 HOH A O     1 
HETATM 5475 O  O     . HOH G 4 .   ? 10.328  -17.393 15.647  1.00 36.83  ? 581 HOH A O     1 
HETATM 5476 O  O     . HOH G 4 .   ? 11.387  -26.458 32.029  1.00 30.17  ? 582 HOH A O     1 
HETATM 5477 O  O     . HOH G 4 .   ? -3.770  -7.541  25.202  1.00 38.33  ? 583 HOH A O     1 
HETATM 5478 O  O     . HOH G 4 .   ? 4.502   -1.975  10.948  1.00 32.53  ? 584 HOH A O     1 
HETATM 5479 O  O     . HOH G 4 .   ? 3.232   -16.711 -8.582  1.00 40.46  ? 585 HOH A O     1 
HETATM 5480 O  O     . HOH G 4 .   ? -13.300 -16.023 23.598  1.00 55.83  ? 586 HOH A O     1 
HETATM 5481 O  O     . HOH G 4 .   ? 30.716  -16.838 4.253   1.00 44.43  ? 587 HOH A O     1 
HETATM 5482 O  O     . HOH G 4 .   ? 31.206  -13.266 16.781  1.00 48.28  ? 588 HOH A O     1 
HETATM 5483 O  O     . HOH G 4 .   ? -0.926  -14.985 32.757  1.00 37.40  ? 589 HOH A O     1 
HETATM 5484 O  O     . HOH G 4 .   ? -2.757  -4.647  22.812  1.00 35.44  ? 590 HOH A O     1 
HETATM 5485 O  O     . HOH G 4 .   ? 15.767  -1.944  12.989  1.00 46.14  ? 591 HOH A O     1 
HETATM 5486 O  O     . HOH G 4 .   ? 10.011  -14.315 35.032  1.00 38.10  ? 592 HOH A O     1 
HETATM 5487 O  O     . HOH G 4 .   ? 6.396   -21.368 36.646  1.00 43.87  ? 593 HOH A O     1 
HETATM 5488 O  O     . HOH G 4 .   ? 10.511  -36.131 17.873  1.00 37.31  ? 594 HOH A O     1 
HETATM 5489 O  O     . HOH G 4 .   ? 20.994  -2.739  15.329  1.00 31.74  ? 595 HOH A O     1 
HETATM 5490 O  O     . HOH G 4 .   ? -9.735  -8.072  18.358  1.00 37.32  ? 596 HOH A O     1 
HETATM 5491 O  O     . HOH G 4 .   ? 23.368  -22.669 14.620  1.00 39.55  ? 597 HOH A O     1 
HETATM 5492 O  O     . HOH G 4 .   ? -0.334  -2.554  2.789   1.00 40.70  ? 598 HOH A O     1 
HETATM 5493 O  O     . HOH G 4 .   ? 15.212  -13.012 19.607  1.00 46.96  ? 599 HOH A O     1 
HETATM 5494 O  O     . HOH G 4 .   ? -8.178  -6.599  -6.486  1.00 38.11  ? 600 HOH A O     1 
HETATM 5495 O  O     . HOH G 4 .   ? -6.536  -8.878  21.802  1.00 38.54  ? 601 HOH A O     1 
HETATM 5496 O  O     . HOH G 4 .   ? 13.721  0.433   3.361   1.00 40.51  ? 602 HOH A O     1 
HETATM 5497 O  O     . HOH G 4 .   ? 9.673   -6.227  25.697  1.00 42.08  ? 603 HOH A O     1 
HETATM 5498 O  O     . HOH G 4 .   ? 6.801   -38.101 8.711   1.00 37.95  ? 604 HOH A O     1 
HETATM 5499 O  O     . HOH G 4 .   ? -4.991  -34.230 21.279  1.00 31.87  ? 605 HOH A O     1 
HETATM 5500 O  O     . HOH G 4 .   ? 14.966  -22.612 1.216   1.00 25.86  ? 606 HOH A O     1 
HETATM 5501 O  O     . HOH G 4 .   ? 4.573   -26.441 33.898  1.00 40.49  ? 607 HOH A O     1 
HETATM 5502 O  O     . HOH G 4 .   ? 20.680  -19.642 7.968   1.00 54.95  ? 608 HOH A O     1 
HETATM 5503 O  O     . HOH G 4 .   ? -7.208  -6.981  20.241  1.00 49.36  ? 609 HOH A O     1 
HETATM 5504 O  O     . HOH G 4 .   ? 14.731  -1.503  5.251   1.00 35.09  ? 610 HOH A O     1 
HETATM 5505 O  O     . HOH G 4 .   ? 7.324   -37.518 14.201  1.00 37.47  ? 611 HOH A O     1 
HETATM 5506 O  O     . HOH G 4 .   ? -1.281  -2.714  22.554  1.00 43.27  ? 612 HOH A O     1 
HETATM 5507 O  O     . HOH G 4 .   ? 23.797  -10.625 22.326  1.00 38.68  ? 613 HOH A O     1 
HETATM 5508 O  O     . HOH G 4 .   ? 13.673  -20.042 22.555  1.00 34.10  ? 614 HOH A O     1 
HETATM 5509 O  O     . HOH G 4 .   ? 19.504  -8.168  -4.386  1.00 35.27  ? 615 HOH A O     1 
HETATM 5510 O  O     . HOH G 4 .   ? 32.472  -16.559 11.151  1.00 37.97  ? 616 HOH A O     1 
HETATM 5511 O  O     . HOH G 4 .   ? 10.828  -17.003 12.588  1.00 49.23  ? 617 HOH A O     1 
HETATM 5512 O  O     . HOH G 4 .   ? 4.239   -33.496 27.615  1.00 44.66  ? 618 HOH A O     1 
HETATM 5513 O  O     . HOH G 4 .   ? 2.600   -4.524  -7.704  1.00 44.17  ? 619 HOH A O     1 
HETATM 5514 O  O     . HOH G 4 .   ? 12.232  -35.284 -2.649  1.00 40.65  ? 620 HOH A O     1 
HETATM 5515 O  O     . HOH G 4 .   ? 2.243   -41.008 13.886  1.00 38.11  ? 621 HOH A O     1 
HETATM 5516 O  O     . HOH G 4 .   ? -9.194  -9.984  22.454  1.00 38.89  ? 622 HOH A O     1 
HETATM 5517 O  O     . HOH G 4 .   ? -8.000  -30.754 9.727   1.00 37.54  ? 623 HOH A O     1 
HETATM 5518 O  O     . HOH G 4 .   ? -6.921  -2.633  19.240  1.00 36.86  ? 624 HOH A O     1 
HETATM 5519 O  O     . HOH G 4 .   ? -14.846 -14.220 25.191  1.00 48.52  ? 625 HOH A O     1 
HETATM 5520 O  O     . HOH G 4 .   ? 31.810  -8.894  7.109   1.00 43.41  ? 626 HOH A O     1 
HETATM 5521 O  O     . HOH G 4 .   ? -12.559 -15.807 -5.238  1.00 43.42  ? 627 HOH A O     1 
HETATM 5522 O  O     . HOH G 4 .   ? 15.626  -20.690 24.696  1.00 46.55  ? 628 HOH A O     1 
HETATM 5523 O  O     . HOH G 4 .   ? 4.756   -37.138 9.158   1.00 42.24  ? 629 HOH A O     1 
HETATM 5524 O  O     . HOH G 4 .   ? 2.217   -41.518 17.225  1.00 47.34  ? 630 HOH A O     1 
HETATM 5525 O  O     . HOH G 4 .   ? 23.588  -32.992 12.999  1.00 59.09  ? 631 HOH A O     1 
HETATM 5526 O  O     . HOH G 4 .   ? 6.051   -31.550 -2.270  1.00 40.31  ? 632 HOH A O     1 
HETATM 5527 O  O     . HOH G 4 .   ? 10.998  -24.868 -10.758 1.00 41.17  ? 633 HOH A O     1 
HETATM 5528 O  O     . HOH G 4 .   ? 6.385   -37.249 11.072  1.00 37.62  ? 634 HOH A O     1 
HETATM 5529 O  O     . HOH G 4 .   ? -6.862  -33.094 17.754  1.00 51.35  ? 635 HOH A O     1 
HETATM 5530 O  O     . HOH G 4 .   ? -7.350  -9.539  -11.411 1.00 43.81  ? 636 HOH A O     1 
HETATM 5531 O  O     . HOH G 4 .   ? -0.948  -3.045  -5.461  1.00 37.12  ? 637 HOH A O     1 
HETATM 5532 O  O     . HOH G 4 .   ? -5.110  -24.487 -6.006  1.00 41.98  ? 638 HOH A O     1 
HETATM 5533 O  O     . HOH G 4 .   ? -9.735  -32.342 2.351   1.00 40.07  ? 639 HOH A O     1 
HETATM 5534 O  O     . HOH G 4 .   ? -10.053 -6.029  7.824   1.00 35.53  ? 640 HOH A O     1 
HETATM 5535 O  O     . HOH G 4 .   ? 15.562  -16.841 20.435  1.00 46.51  ? 641 HOH A O     1 
HETATM 5536 O  O     . HOH G 4 .   ? 26.225  0.855   15.700  1.00 40.22  ? 642 HOH A O     1 
HETATM 5537 O  O     . HOH G 4 .   ? 13.782  -0.340  8.816   1.00 49.32  ? 643 HOH A O     1 
HETATM 5538 O  O     . HOH G 4 .   ? -3.161  -6.515  30.223  1.00 47.74  ? 644 HOH A O     1 
HETATM 5539 O  O     . HOH H 4 .   ? 25.866  -13.087 -6.314  1.00 31.39  ? 501 HOH B O     1 
HETATM 5540 O  O     . HOH H 4 .   ? 26.127  -26.682 -21.037 1.00 19.27  ? 502 HOH B O     1 
HETATM 5541 O  O     . HOH H 4 .   ? 25.325  -40.774 -14.858 1.00 15.53  ? 503 HOH B O     1 
HETATM 5542 O  O     . HOH H 4 .   ? 23.491  -28.928 -27.680 1.00 20.07  ? 504 HOH B O     1 
HETATM 5543 O  O     . HOH H 4 .   ? 32.051  -44.090 -27.864 1.00 16.05  ? 505 HOH B O     1 
HETATM 5544 O  O     . HOH H 4 .   ? 4.185   -37.832 -24.533 1.00 33.62  ? 506 HOH B O     1 
HETATM 5545 O  O     . HOH H 4 .   ? 12.405  -38.024 -27.852 1.00 16.28  ? 507 HOH B O     1 
HETATM 5546 O  O     . HOH H 4 .   ? 29.472  -20.792 -15.670 1.00 19.28  ? 508 HOH B O     1 
HETATM 5547 O  O     . HOH H 4 .   ? 32.175  -25.566 -17.365 1.00 18.72  ? 509 HOH B O     1 
HETATM 5548 O  O     . HOH H 4 .   ? 20.122  -25.022 -19.491 1.00 27.76  ? 510 HOH B O     1 
HETATM 5549 O  O     . HOH H 4 .   ? 30.927  -46.968 -29.014 1.00 25.96  ? 511 HOH B O     1 
HETATM 5550 O  O     . HOH H 4 .   ? 28.033  -46.781 -32.968 1.00 28.50  ? 512 HOH B O     1 
HETATM 5551 O  O     . HOH H 4 .   ? 22.174  -39.594 -12.326 1.00 28.17  ? 513 HOH B O     1 
HETATM 5552 O  O     . HOH H 4 .   ? 16.758  -29.030 -41.470 1.00 24.18  ? 514 HOH B O     1 
HETATM 5553 O  O     . HOH H 4 .   ? 38.574  -20.735 -21.524 1.00 38.54  ? 515 HOH B O     1 
HETATM 5554 O  O     . HOH H 4 .   ? 10.568  -35.764 -28.795 1.00 20.06  ? 516 HOH B O     1 
HETATM 5555 O  O     . HOH H 4 .   ? 9.358   -35.004 -16.862 1.00 30.94  ? 517 HOH B O     1 
HETATM 5556 O  O     . HOH H 4 .   ? 32.750  -22.291 -26.027 1.00 27.25  ? 518 HOH B O     1 
HETATM 5557 O  O     . HOH H 4 .   ? 38.970  -45.475 -26.192 1.00 32.30  ? 519 HOH B O     1 
HETATM 5558 O  O     . HOH H 4 .   ? 32.263  -26.757 -35.602 1.00 25.69  ? 520 HOH B O     1 
HETATM 5559 O  O     . HOH H 4 .   ? 18.415  -9.446  -11.409 1.00 27.04  ? 521 HOH B O     1 
HETATM 5560 O  O     . HOH H 4 .   ? 23.037  -46.132 -15.388 1.00 36.68  ? 522 HOH B O     1 
HETATM 5561 O  O     . HOH H 4 .   ? 30.664  -31.299 -7.107  1.00 44.54  ? 523 HOH B O     1 
HETATM 5562 O  O     . HOH H 4 .   ? 26.203  -29.966 -7.883  1.00 25.25  ? 524 HOH B O     1 
HETATM 5563 O  O     . HOH H 4 .   ? 38.459  -22.206 -9.980  1.00 31.96  ? 525 HOH B O     1 
HETATM 5564 O  O     . HOH H 4 .   ? 17.489  -47.269 -31.733 1.00 28.84  ? 526 HOH B O     1 
HETATM 5565 O  O     . HOH H 4 .   ? 23.465  -23.370 -40.093 1.00 30.42  ? 527 HOH B O     1 
HETATM 5566 O  O     . HOH H 4 .   ? 33.053  -17.873 -7.726  1.00 39.77  ? 528 HOH B O     1 
HETATM 5567 O  O     . HOH H 4 .   ? 27.330  -11.880 -34.378 1.00 25.81  ? 529 HOH B O     1 
HETATM 5568 O  O     . HOH H 4 .   ? 39.686  -42.341 -20.519 1.00 26.62  ? 530 HOH B O     1 
HETATM 5569 O  O     . HOH H 4 .   ? 26.082  -22.891 -35.755 1.00 36.82  ? 531 HOH B O     1 
HETATM 5570 O  O     . HOH H 4 .   ? 11.993  -29.438 -45.266 1.00 22.81  ? 532 HOH B O     1 
HETATM 5571 O  O     . HOH H 4 .   ? 24.738  -28.267 -34.597 1.00 32.84  ? 533 HOH B O     1 
HETATM 5572 O  O     . HOH H 4 .   ? 25.461  -8.918  -16.336 1.00 40.62  ? 534 HOH B O     1 
HETATM 5573 O  O     . HOH H 4 .   ? 16.395  -21.545 -47.696 1.00 31.50  ? 535 HOH B O     1 
HETATM 5574 O  O     . HOH H 4 .   ? 21.646  -29.880 -33.213 1.00 31.95  ? 536 HOH B O     1 
HETATM 5575 O  O     . HOH H 4 .   ? 15.968  -21.835 -10.824 1.00 31.43  ? 537 HOH B O     1 
HETATM 5576 O  O     . HOH H 4 .   ? 14.253  -42.673 -10.617 1.00 32.17  ? 538 HOH B O     1 
HETATM 5577 O  O     . HOH H 4 .   ? 10.357  -36.387 -43.021 1.00 32.29  ? 539 HOH B O     1 
HETATM 5578 O  O     . HOH H 4 .   ? 31.220  -8.557  -33.162 1.00 35.07  ? 540 HOH B O     1 
HETATM 5579 O  O     . HOH H 4 .   ? 9.666   -33.213 -40.114 1.00 23.39  ? 541 HOH B O     1 
HETATM 5580 O  O     . HOH H 4 .   ? 20.310  -47.372 -25.067 1.00 29.36  ? 542 HOH B O     1 
HETATM 5581 O  O     . HOH H 4 .   ? 35.558  -29.829 -7.442  1.00 36.45  ? 543 HOH B O     1 
HETATM 5582 O  O     . HOH H 4 .   ? 32.914  -31.669 -5.865  1.00 34.77  ? 544 HOH B O     1 
HETATM 5583 O  O     . HOH H 4 .   ? 28.674  -49.152 -17.006 1.00 31.90  ? 545 HOH B O     1 
HETATM 5584 O  O     . HOH H 4 .   ? 26.102  -48.375 -26.988 1.00 27.92  ? 546 HOH B O     1 
HETATM 5585 O  O     . HOH H 4 .   ? 25.869  -27.312 -29.472 1.00 31.37  ? 547 HOH B O     1 
HETATM 5586 O  O     . HOH H 4 .   ? 27.237  -14.389 -13.067 1.00 29.75  ? 548 HOH B O     1 
HETATM 5587 O  O     . HOH H 4 .   ? 6.276   -30.430 -30.814 1.00 28.56  ? 549 HOH B O     1 
HETATM 5588 O  O     . HOH H 4 .   ? 24.860  -47.079 -24.968 1.00 29.00  ? 550 HOH B O     1 
HETATM 5589 O  O     . HOH H 4 .   ? 30.673  -8.786  -16.965 1.00 38.46  ? 551 HOH B O     1 
HETATM 5590 O  O     . HOH H 4 .   ? 25.168  3.012   -24.234 1.00 35.52  ? 552 HOH B O     1 
HETATM 5591 O  O     . HOH H 4 .   ? 37.175  -47.472 -37.813 1.00 40.40  ? 553 HOH B O     1 
HETATM 5592 O  O     . HOH H 4 .   ? 42.701  -34.955 -34.731 1.00 31.04  ? 554 HOH B O     1 
HETATM 5593 O  O     . HOH H 4 .   ? 38.104  -6.483  -28.550 1.00 35.44  ? 555 HOH B O     1 
HETATM 5594 O  O     . HOH H 4 .   ? 33.650  -44.879 -39.793 1.00 32.87  ? 556 HOH B O     1 
HETATM 5595 O  O     . HOH H 4 .   ? 8.890   -46.882 -35.419 1.00 27.39  ? 557 HOH B O     1 
HETATM 5596 O  O     . HOH H 4 .   ? 26.082  -12.689 -32.204 1.00 37.04  ? 558 HOH B O     1 
HETATM 5597 O  O     . HOH H 4 .   ? 13.504  -25.976 -39.473 1.00 42.68  ? 559 HOH B O     1 
HETATM 5598 O  O     . HOH H 4 .   ? 36.472  -39.959 -43.981 1.00 35.07  ? 560 HOH B O     1 
HETATM 5599 O  O     . HOH H 4 .   ? 16.137  -49.408 -24.096 1.00 38.23  ? 561 HOH B O     1 
HETATM 5600 O  O     . HOH H 4 .   ? 26.138  -49.510 -22.792 1.00 33.68  ? 562 HOH B O     1 
HETATM 5601 O  O     . HOH H 4 .   ? 42.750  -30.676 -13.457 1.00 39.40  ? 563 HOH B O     1 
HETATM 5602 O  O     . HOH H 4 .   ? 8.732   -40.169 -33.433 1.00 28.70  ? 564 HOH B O     1 
HETATM 5603 O  O     . HOH H 4 .   ? 20.551  -46.686 -48.238 1.00 51.89  ? 565 HOH B O     1 
HETATM 5604 O  O     . HOH H 4 .   ? 11.656  -44.961 -20.643 1.00 44.52  ? 566 HOH B O     1 
HETATM 5605 O  O     . HOH H 4 .   ? 22.103  -26.180 -34.920 1.00 40.23  ? 567 HOH B O     1 
HETATM 5606 O  O     . HOH H 4 .   ? 12.332  -47.438 -21.596 1.00 43.58  ? 568 HOH B O     1 
HETATM 5607 O  O     . HOH H 4 .   ? 21.710  -43.815 -42.894 1.00 42.52  ? 569 HOH B O     1 
HETATM 5608 O  O     . HOH H 4 .   ? 37.092  -54.109 -36.476 1.00 31.17  ? 570 HOH B O     1 
HETATM 5609 O  O     . HOH H 4 .   ? 12.970  -45.089 -18.830 1.00 46.23  ? 571 HOH B O     1 
HETATM 5610 O  O     . HOH H 4 .   ? 40.521  -35.454 -40.535 1.00 35.89  ? 572 HOH B O     1 
HETATM 5611 O  O     . HOH H 4 .   ? 17.863  -10.524 -33.142 1.00 45.91  ? 573 HOH B O     1 
HETATM 5612 O  O     . HOH H 4 .   ? 21.860  -28.761 -35.670 1.00 36.15  ? 574 HOH B O     1 
HETATM 5613 O  O     . HOH H 4 .   ? 34.932  -50.125 -17.392 1.00 33.01  ? 575 HOH B O     1 
HETATM 5614 O  O     . HOH H 4 .   ? 42.177  -32.448 -38.025 1.00 36.48  ? 576 HOH B O     1 
HETATM 5615 O  O     . HOH H 4 .   ? 39.319  -41.314 -11.306 1.00 43.33  ? 577 HOH B O     1 
HETATM 5616 O  O     . HOH H 4 .   ? 29.889  -21.419 -42.235 1.00 28.95  ? 578 HOH B O     1 
HETATM 5617 O  O     . HOH H 4 .   ? 15.557  -19.028 -23.860 1.00 38.34  ? 579 HOH B O     1 
HETATM 5618 O  O     . HOH H 4 .   ? 42.395  -25.525 -36.661 1.00 46.48  ? 580 HOH B O     1 
HETATM 5619 O  O     . HOH H 4 .   ? 33.605  -36.596 -48.685 1.00 40.22  ? 581 HOH B O     1 
HETATM 5620 O  O     . HOH H 4 .   ? 35.909  -50.775 -27.570 1.00 36.24  ? 582 HOH B O     1 
HETATM 5621 O  O     . HOH H 4 .   ? 7.782   -38.117 -32.463 1.00 29.85  ? 583 HOH B O     1 
HETATM 5622 O  O     . HOH H 4 .   ? 15.343  -33.443 -7.834  1.00 31.62  ? 584 HOH B O     1 
HETATM 5623 O  O     . HOH H 4 .   ? 9.048   -28.438 -16.021 1.00 42.87  ? 585 HOH B O     1 
HETATM 5624 O  O     . HOH H 4 .   ? 34.795  -13.850 -23.311 1.00 38.46  ? 586 HOH B O     1 
HETATM 5625 O  O     . HOH H 4 .   ? 33.385  -47.283 -39.177 1.00 47.39  ? 587 HOH B O     1 
HETATM 5626 O  O     . HOH H 4 .   ? 39.877  -37.849 -36.440 1.00 29.57  ? 588 HOH B O     1 
HETATM 5627 O  O     . HOH H 4 .   ? 35.641  -53.039 -26.080 1.00 46.79  ? 589 HOH B O     1 
HETATM 5628 O  O     . HOH H 4 .   ? 15.139  -20.889 -16.319 1.00 36.25  ? 590 HOH B O     1 
HETATM 5629 O  O     . HOH H 4 .   ? 14.912  -50.929 -25.643 1.00 47.13  ? 591 HOH B O     1 
HETATM 5630 O  O     . HOH H 4 .   ? 30.667  -48.898 -40.886 1.00 37.92  ? 592 HOH B O     1 
HETATM 5631 O  O     . HOH H 4 .   ? 13.551  -6.642  -22.224 1.00 31.80  ? 593 HOH B O     1 
HETATM 5632 O  O     . HOH H 4 .   ? 29.378  -45.727 -11.176 1.00 32.66  ? 594 HOH B O     1 
HETATM 5633 O  O     . HOH H 4 .   ? 41.765  -39.850 -32.640 1.00 35.58  ? 595 HOH B O     1 
HETATM 5634 O  O     . HOH H 4 .   ? 35.143  -38.355 -3.947  1.00 42.99  ? 596 HOH B O     1 
HETATM 5635 O  O     . HOH H 4 .   ? 9.117   -21.923 -43.718 1.00 40.03  ? 597 HOH B O     1 
HETATM 5636 O  O     . HOH H 4 .   ? 20.821  -41.610 -8.695  1.00 37.26  ? 598 HOH B O     1 
HETATM 5637 O  O     . HOH H 4 .   ? 22.798  -40.764 -10.042 1.00 31.14  ? 599 HOH B O     1 
HETATM 5638 O  O     . HOH H 4 .   ? 42.855  -39.877 -30.022 1.00 44.85  ? 600 HOH B O     1 
HETATM 5639 O  O     . HOH H 4 .   ? 11.093  -37.032 -45.409 1.00 34.29  ? 601 HOH B O     1 
HETATM 5640 O  O     . HOH H 4 .   ? 3.293   -24.961 -19.214 1.00 39.93  ? 602 HOH B O     1 
HETATM 5641 O  O     . HOH H 4 .   ? 22.464  -46.614 -26.074 1.00 35.59  ? 603 HOH B O     1 
HETATM 5642 O  O     . HOH H 4 .   ? 4.281   -23.189 -18.404 1.00 40.27  ? 604 HOH B O     1 
HETATM 5643 O  O     . HOH H 4 .   ? 14.517  0.394   -20.593 1.00 46.87  ? 605 HOH B O     1 
HETATM 5644 O  O     . HOH H 4 .   ? 24.292  -8.556  -18.301 1.00 55.59  ? 606 HOH B O     1 
HETATM 5645 O  O     . HOH H 4 .   ? 19.881  -39.196 -6.849  1.00 49.89  ? 607 HOH B O     1 
HETATM 5646 O  O     . HOH H 4 .   ? 39.894  -26.666 -23.254 1.00 43.05  ? 608 HOH B O     1 
HETATM 5647 O  O     . HOH H 4 .   ? 33.938  -16.048 -23.022 1.00 32.75  ? 609 HOH B O     1 
HETATM 5648 O  O     . HOH H 4 .   ? 6.746   -32.129 -35.102 1.00 39.45  ? 610 HOH B O     1 
HETATM 5649 O  O     . HOH H 4 .   ? 13.846  -49.400 -23.328 1.00 50.64  ? 611 HOH B O     1 
HETATM 5650 O  O     . HOH H 4 .   ? 20.893  -25.687 -4.392  1.00 50.51  ? 612 HOH B O     1 
HETATM 5651 O  O     . HOH H 4 .   ? 8.229   -42.015 -30.893 1.00 39.48  ? 613 HOH B O     1 
HETATM 5652 O  O     . HOH H 4 .   ? 22.872  -48.056 -41.477 1.00 45.74  ? 614 HOH B O     1 
HETATM 5653 O  O     . HOH H 4 .   ? 21.216  -9.769  -12.269 1.00 42.93  ? 615 HOH B O     1 
HETATM 5654 O  O     . HOH H 4 .   ? 43.537  -34.160 -37.023 1.00 46.95  ? 616 HOH B O     1 
HETATM 5655 O  O     . HOH H 4 .   ? 34.316  -32.074 -51.994 1.00 48.80  ? 617 HOH B O     1 
HETATM 5656 O  O     . HOH H 4 .   ? 11.773  -36.072 -13.674 1.00 52.17  ? 618 HOH B O     1 
HETATM 5657 O  O     . HOH H 4 .   ? 10.067  -22.727 -40.844 1.00 44.19  ? 619 HOH B O     1 
HETATM 5658 O  O     . HOH H 4 .   ? 28.017  -50.175 -34.741 1.00 38.03  ? 620 HOH B O     1 
HETATM 5659 O  O     . HOH H 4 .   ? 34.036  -27.148 -6.654  1.00 33.64  ? 621 HOH B O     1 
HETATM 5660 O  O     . HOH H 4 .   ? 19.203  -49.541 -18.098 1.00 36.83  ? 622 HOH B O     1 
HETATM 5661 O  O     . HOH H 4 .   ? 42.425  -36.373 -21.418 1.00 35.69  ? 623 HOH B O     1 
HETATM 5662 O  O     . HOH H 4 .   ? 43.000  -38.529 -22.765 1.00 37.47  ? 624 HOH B O     1 
HETATM 5663 O  O     . HOH H 4 .   ? 41.000  -25.112 -47.784 1.00 45.06  ? 625 HOH B O     1 
HETATM 5664 O  O     . HOH H 4 .   ? 10.858  -11.670 -30.631 1.00 45.84  ? 626 HOH B O     1 
HETATM 5665 O  O     . HOH H 4 .   ? 32.611  -37.202 -50.694 1.00 46.43  ? 627 HOH B O     1 
HETATM 5666 O  O     . HOH H 4 .   ? 26.926  -21.371 -6.968  1.00 49.28  ? 628 HOH B O     1 
HETATM 5667 O  O     . HOH H 4 .   ? 27.261  -48.070 -29.243 1.00 48.93  ? 629 HOH B O     1 
HETATM 5668 O  O     . HOH H 4 .   ? 29.761  -11.169 -34.865 1.00 39.68  ? 630 HOH B O     1 
HETATM 5669 O  O     . HOH H 4 .   ? 7.632   -34.730 -35.584 1.00 33.98  ? 631 HOH B O     1 
HETATM 5670 O  O     . HOH H 4 .   ? 44.673  -34.304 -27.757 1.00 47.63  ? 632 HOH B O     1 
HETATM 5671 O  O     . HOH H 4 .   ? 23.870  -39.908 -8.015  1.00 48.99  ? 633 HOH B O     1 
HETATM 5672 O  O     . HOH H 4 .   ? 40.515  -24.500 -21.273 1.00 46.52  ? 634 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 21  ? 0.8447 0.6944 1.0828 -0.2360 -0.0208 0.0399  3   ASP A N   
2    C CA  . ASP A 21  ? 0.8291 0.6876 1.0588 -0.2239 -0.0281 0.0138  3   ASP A CA  
3    C C   . ASP A 21  ? 0.7645 0.6681 0.9841 -0.2174 -0.0272 0.0107  3   ASP A C   
4    O O   . ASP A 21  ? 0.7724 0.7039 1.0080 -0.2298 -0.0280 0.0076  3   ASP A O   
5    C CB  . ASP A 21  ? 0.9026 0.7491 1.1513 -0.2378 -0.0360 -0.0080 3   ASP A CB  
6    C CG  . ASP A 21  ? 0.9764 0.7745 1.2386 -0.2422 -0.0373 -0.0091 3   ASP A CG  
7    O OD1 . ASP A 21  ? 0.9924 0.7770 1.2777 -0.2610 -0.0405 -0.0161 3   ASP A OD1 
8    O OD2 . ASP A 21  ? 1.0008 0.7744 1.2536 -0.2269 -0.0355 -0.0032 3   ASP A OD2 
9    N N   . LEU A 22  ? 0.6760 0.5860 0.8723 -0.1979 -0.0260 0.0116  4   LEU A N   
10   C CA  . LEU A 22  ? 0.5580 0.5062 0.7452 -0.1895 -0.0247 0.0113  4   LEU A CA  
11   C C   . LEU A 22  ? 0.5114 0.4750 0.6940 -0.1844 -0.0352 -0.0097 4   LEU A C   
12   O O   . LEU A 22  ? 0.4449 0.3891 0.6150 -0.1781 -0.0406 -0.0239 4   LEU A O   
13   C CB  . LEU A 22  ? 0.5173 0.4650 0.6822 -0.1724 -0.0187 0.0234  4   LEU A CB  
14   C CG  . LEU A 22  ? 0.5217 0.4608 0.6837 -0.1764 -0.0096 0.0467  4   LEU A CG  
15   C CD1 . LEU A 22  ? 0.4886 0.4246 0.6275 -0.1586 -0.0072 0.0542  4   LEU A CD1 
16   C CD2 . LEU A 22  ? 0.4272 0.3969 0.6002 -0.1896 -0.0012 0.0559  4   LEU A CD2 
17   N N   . SER A 23  ? 0.4676 0.4672 0.6609 -0.1874 -0.0380 -0.0113 5   SER A N   
18   C CA  . SER A 23  ? 0.4704 0.4896 0.6590 -0.1827 -0.0503 -0.0265 5   SER A CA  
19   C C   . SER A 23  ? 0.4600 0.4745 0.6186 -0.1633 -0.0513 -0.0285 5   SER A C   
20   O O   . SER A 23  ? 0.4435 0.4517 0.5904 -0.1524 -0.0419 -0.0167 5   SER A O   
21   C CB  . SER A 23  ? 0.4812 0.5413 0.6923 -0.1864 -0.0519 -0.0230 5   SER A CB  
22   O OG  . SER A 23  ? 0.5302 0.6102 0.7379 -0.1809 -0.0663 -0.0338 5   SER A OG  
23   N N   . GLU A 24  ? 0.4837 0.5016 0.6287 -0.1606 -0.0628 -0.0431 6   GLU A N   
24   C CA  . GLU A 24  ? 0.5101 0.5264 0.6266 -0.1445 -0.0636 -0.0444 6   GLU A CA  
25   C C   . GLU A 24  ? 0.4402 0.4833 0.5589 -0.1338 -0.0622 -0.0320 6   GLU A C   
26   O O   . GLU A 24  ? 0.3919 0.4619 0.5330 -0.1386 -0.0666 -0.0292 6   GLU A O   
27   C CB  . GLU A 24  ? 0.5822 0.5983 0.6803 -0.1470 -0.0764 -0.0617 6   GLU A CB  
28   C CG  . GLU A 24  ? 0.6700 0.6561 0.7606 -0.1547 -0.0754 -0.0786 6   GLU A CG  
29   C CD  . GLU A 24  ? 0.7369 0.7233 0.8006 -0.1569 -0.0855 -0.0970 6   GLU A CD  
30   O OE1 . GLU A 24  ? 0.7412 0.7501 0.7909 -0.1527 -0.0950 -0.0935 6   GLU A OE1 
31   O OE2 . GLU A 24  ? 0.7773 0.7408 0.8336 -0.1635 -0.0839 -0.1150 6   GLU A OE2 
32   N N   . GLY A 25  ? 0.3521 0.3881 0.4511 -0.1195 -0.0556 -0.0257 7   GLY A N   
33   C CA  . GLY A 25  ? 0.3285 0.3855 0.4297 -0.1089 -0.0529 -0.0153 7   GLY A CA  
34   C C   . GLY A 25  ? 0.3179 0.3883 0.4418 -0.1131 -0.0427 -0.0048 7   GLY A C   
35   O O   . GLY A 25  ? 0.3027 0.3977 0.4397 -0.1087 -0.0416 -0.0007 7   GLY A O   
36   N N   . TYR A 26  ? 0.3292 0.3829 0.4581 -0.1223 -0.0349 -0.0007 8   TYR A N   
37   C CA  . TYR A 26  ? 0.3256 0.3897 0.4701 -0.1293 -0.0235 0.0106  8   TYR A CA  
38   C C   . TYR A 26  ? 0.3253 0.3941 0.4565 -0.1175 -0.0139 0.0202  8   TYR A C   
39   O O   . TYR A 26  ? 0.3195 0.4095 0.4623 -0.1198 -0.0051 0.0254  8   TYR A O   
40   C CB  . TYR A 26  ? 0.3470 0.3857 0.4942 -0.1415 -0.0189 0.0159  8   TYR A CB  
41   C CG  . TYR A 26  ? 0.4100 0.4602 0.5742 -0.1551 -0.0084 0.0273  8   TYR A CG  
42   C CD1 . TYR A 26  ? 0.4044 0.4718 0.5960 -0.1706 -0.0097 0.0231  8   TYR A CD1 
43   C CD2 . TYR A 26  ? 0.3528 0.3978 0.5049 -0.1542 0.0029  0.0422  8   TYR A CD2 
44   C CE1 . TYR A 26  ? 0.4180 0.4975 0.6251 -0.1850 0.0022  0.0335  8   TYR A CE1 
45   C CE2 . TYR A 26  ? 0.3630 0.4191 0.5259 -0.1690 0.0139  0.0531  8   TYR A CE2 
46   C CZ  . TYR A 26  ? 0.3705 0.4440 0.5612 -0.1845 0.0146  0.0487  8   TYR A CZ  
47   O OH  . TYR A 26  ? 0.4374 0.5237 0.6389 -0.2009 0.0277  0.0595  8   TYR A OH  
48   N N   . VAL A 27  ? 0.3059 0.3559 0.4138 -0.1057 -0.0149 0.0206  9   VAL A N   
49   C CA  . VAL A 27  ? 0.2929 0.3440 0.3864 -0.0951 -0.0075 0.0285  9   VAL A CA  
50   C C   . VAL A 27  ? 0.3043 0.3620 0.3871 -0.0812 -0.0129 0.0227  9   VAL A C   
51   O O   . VAL A 27  ? 0.2834 0.3289 0.3548 -0.0772 -0.0203 0.0159  9   VAL A O   
52   C CB  . VAL A 27  ? 0.3079 0.3314 0.3858 -0.0931 -0.0043 0.0362  9   VAL A CB  
53   C CG1 . VAL A 27  ? 0.2903 0.3165 0.3528 -0.0826 0.0011  0.0430  9   VAL A CG1 
54   C CG2 . VAL A 27  ? 0.3215 0.3347 0.4085 -0.1073 0.0001  0.0459  9   VAL A CG2 
55   N N   . PHE A 28  ? 0.2884 0.3649 0.3750 -0.0748 -0.0085 0.0251  10  PHE A N   
56   C CA  . PHE A 28  ? 0.2818 0.3636 0.3611 -0.0622 -0.0137 0.0219  10  PHE A CA  
57   C C   . PHE A 28  ? 0.2574 0.3360 0.3237 -0.0536 -0.0056 0.0270  10  PHE A C   
58   O O   . PHE A 28  ? 0.2567 0.3446 0.3277 -0.0564 0.0041  0.0308  10  PHE A O   
59   C CB  . PHE A 28  ? 0.2465 0.3542 0.3489 -0.0609 -0.0190 0.0181  10  PHE A CB  
60   C CG  . PHE A 28  ? 0.2726 0.3842 0.3703 -0.0482 -0.0256 0.0176  10  PHE A CG  
61   C CD1 . PHE A 28  ? 0.2786 0.3868 0.3686 -0.0463 -0.0398 0.0151  10  PHE A CD1 
62   C CD2 . PHE A 28  ? 0.2277 0.3454 0.3273 -0.0396 -0.0179 0.0196  10  PHE A CD2 
63   C CE1 . PHE A 28  ? 0.2855 0.3951 0.3698 -0.0361 -0.0466 0.0176  10  PHE A CE1 
64   C CE2 . PHE A 28  ? 0.2389 0.3570 0.3363 -0.0287 -0.0244 0.0202  10  PHE A CE2 
65   C CZ  . PHE A 28  ? 0.2810 0.3947 0.3710 -0.0269 -0.0390 0.0206  10  PHE A CZ  
66   N N   . GLY A 29  ? 0.2403 0.3068 0.2895 -0.0444 -0.0091 0.0263  11  GLY A N   
67   C CA  . GLY A 29  ? 0.2404 0.3058 0.2797 -0.0362 -0.0034 0.0296  11  GLY A CA  
68   C C   . GLY A 29  ? 0.2325 0.3016 0.2695 -0.0267 -0.0091 0.0272  11  GLY A C   
69   O O   . GLY A 29  ? 0.2313 0.2967 0.2636 -0.0260 -0.0181 0.0247  11  GLY A O   
70   N N   . MET A 30  ? 0.2638 0.3396 0.3033 -0.0204 -0.0043 0.0279  12  MET A N   
71   C CA  . MET A 30  ? 0.2681 0.3413 0.3032 -0.0115 -0.0090 0.0279  12  MET A CA  
72   C C   . MET A 30  ? 0.2514 0.3174 0.2752 -0.0074 -0.0017 0.0293  12  MET A C   
73   O O   . MET A 30  ? 0.2511 0.3225 0.2767 -0.0101 0.0064  0.0291  12  MET A O   
74   C CB  . MET A 30  ? 0.2925 0.3817 0.3501 -0.0069 -0.0134 0.0259  12  MET A CB  
75   C CG  . MET A 30  ? 0.3377 0.4418 0.4136 -0.0059 -0.0030 0.0217  12  MET A CG  
76   S SD  . MET A 30  ? 0.5191 0.6383 0.6268 0.0039  -0.0079 0.0179  12  MET A SD  
77   C CE  . MET A 30  ? 0.3307 0.4335 0.4246 0.0128  -0.0073 0.0196  12  MET A CE  
78   N N   . GLY A 31  ? 0.2736 0.3287 0.2849 -0.0024 -0.0045 0.0309  13  GLY A N   
79   C CA  . GLY A 31  ? 0.2892 0.3385 0.2921 0.0005  0.0011  0.0318  13  GLY A CA  
80   C C   . GLY A 31  ? 0.3120 0.3516 0.3051 0.0051  -0.0013 0.0334  13  GLY A C   
81   O O   . GLY A 31  ? 0.2961 0.3339 0.2884 0.0069  -0.0076 0.0350  13  GLY A O   
82   N N   . ASN A 32  ? 0.2506 0.2846 0.2363 0.0058  0.0031  0.0340  14  ASN A N   
83   C CA  . ASN A 32  ? 0.2367 0.2628 0.2150 0.0085  0.0028  0.0354  14  ASN A CA  
84   C C   . ASN A 32  ? 0.2392 0.2579 0.2081 0.0067  0.0042  0.0354  14  ASN A C   
85   O O   . ASN A 32  ? 0.2401 0.2575 0.2101 0.0063  0.0070  0.0355  14  ASN A O   
86   C CB  . ASN A 32  ? 0.2183 0.2453 0.1993 0.0102  0.0066  0.0341  14  ASN A CB  
87   C CG  . ASN A 32  ? 0.2342 0.2693 0.2266 0.0116  0.0081  0.0301  14  ASN A CG  
88   O OD1 . ASN A 32  ? 0.2457 0.2843 0.2483 0.0140  0.0049  0.0297  14  ASN A OD1 
89   N ND2 . ASN A 32  ? 0.2015 0.2407 0.1933 0.0100  0.0128  0.0262  14  ASN A ND2 
90   N N   . PRO A 33  ? 0.2615 0.2760 0.2221 0.0054  0.0021  0.0350  15  PRO A N   
91   C CA  . PRO A 33  ? 0.2545 0.2630 0.2086 0.0039  0.0060  0.0315  15  PRO A CA  
92   C C   . PRO A 33  ? 0.2678 0.2745 0.2199 0.0054  0.0111  0.0321  15  PRO A C   
93   O O   . PRO A 33  ? 0.2706 0.2763 0.2159 0.0047  0.0107  0.0351  15  PRO A O   
94   C CB  . PRO A 33  ? 0.2383 0.2448 0.1808 0.0001  0.0026  0.0288  15  PRO A CB  
95   C CG  . PRO A 33  ? 0.2550 0.2652 0.1958 0.0006  -0.0043 0.0345  15  PRO A CG  
96   C CD  . PRO A 33  ? 0.2571 0.2728 0.2138 0.0047  -0.0045 0.0370  15  PRO A CD  
97   N N   . LEU A 34  ? 0.2576 0.2641 0.2178 0.0071  0.0148  0.0305  16  LEU A N   
98   C CA  . LEU A 34  ? 0.2726 0.2808 0.2368 0.0081  0.0191  0.0309  16  LEU A CA  
99   C C   . LEU A 34  ? 0.2968 0.3045 0.2682 0.0091  0.0247  0.0256  16  LEU A C   
100  O O   . LEU A 34  ? 0.2790 0.2834 0.2567 0.0105  0.0240  0.0227  16  LEU A O   
101  C CB  . LEU A 34  ? 0.2801 0.2927 0.2529 0.0097  0.0163  0.0340  16  LEU A CB  
102  C CG  . LEU A 34  ? 0.2754 0.2900 0.2462 0.0095  0.0129  0.0359  16  LEU A CG  
103  C CD1 . LEU A 34  ? 0.2599 0.2797 0.2354 0.0091  0.0115  0.0362  16  LEU A CD1 
104  C CD2 . LEU A 34  ? 0.2371 0.2489 0.2052 0.0093  0.0133  0.0371  16  LEU A CD2 
105  N N   . LEU A 35  ? 0.3016 0.3123 0.2750 0.0082  0.0309  0.0240  17  LEU A N   
106  C CA  . LEU A 35  ? 0.2699 0.2837 0.2573 0.0101  0.0377  0.0175  17  LEU A CA  
107  C C   . LEU A 35  ? 0.2675 0.2874 0.2749 0.0137  0.0339  0.0209  17  LEU A C   
108  O O   . LEU A 35  ? 0.2835 0.3080 0.2917 0.0119  0.0326  0.0247  17  LEU A O   
109  C CB  . LEU A 35  ? 0.2500 0.2668 0.2301 0.0056  0.0483  0.0130  17  LEU A CB  
110  C CG  . LEU A 35  ? 0.2885 0.3114 0.2867 0.0075  0.0586  0.0031  17  LEU A CG  
111  C CD1 . LEU A 35  ? 0.3158 0.3325 0.3122 0.0087  0.0619  -0.0071 17  LEU A CD1 
112  C CD2 . LEU A 35  ? 0.2806 0.3106 0.2740 0.0012  0.0706  0.0005  17  LEU A CD2 
113  N N   . ASP A 36  ? 0.2662 0.2855 0.2902 0.0182  0.0308  0.0201  18  ASP A N   
114  C CA  . ASP A 36  ? 0.2580 0.2845 0.3022 0.0215  0.0250  0.0243  18  ASP A CA  
115  C C   . ASP A 36  ? 0.2671 0.3030 0.3327 0.0233  0.0327  0.0178  18  ASP A C   
116  O O   . ASP A 36  ? 0.2318 0.2668 0.3061 0.0253  0.0417  0.0088  18  ASP A O   
117  C CB  . ASP A 36  ? 0.2514 0.2724 0.3062 0.0254  0.0161  0.0294  18  ASP A CB  
118  C CG  . ASP A 36  ? 0.3199 0.3361 0.3564 0.0218  0.0086  0.0374  18  ASP A CG  
119  O OD1 . ASP A 36  ? 0.3271 0.3458 0.3471 0.0179  0.0098  0.0377  18  ASP A OD1 
120  O OD2 . ASP A 36  ? 0.3331 0.3431 0.3736 0.0226  0.0021  0.0434  18  ASP A OD2 
121  N N   . ILE A 37  ? 0.2582 0.3044 0.3335 0.0218  0.0302  0.0206  19  ILE A N   
122  C CA  . ILE A 37  ? 0.2521 0.3109 0.3535 0.0230  0.0370  0.0149  19  ILE A CA  
123  C C   . ILE A 37  ? 0.2683 0.3361 0.3964 0.0275  0.0243  0.0203  19  ILE A C   
124  O O   . ILE A 37  ? 0.2914 0.3654 0.4180 0.0240  0.0160  0.0257  19  ILE A O   
125  C CB  . ILE A 37  ? 0.2573 0.3222 0.3511 0.0153  0.0451  0.0136  19  ILE A CB  
126  C CG1 . ILE A 37  ? 0.2621 0.3162 0.3251 0.0102  0.0530  0.0128  19  ILE A CG1 
127  C CG2 . ILE A 37  ? 0.2159 0.2962 0.3384 0.0150  0.0553  0.0064  19  ILE A CG2 
128  C CD1 . ILE A 37  ? 0.3235 0.3800 0.3776 0.0018  0.0607  0.0142  19  ILE A CD1 
129  N N   . ILE A 38  ? 0.2482 0.3159 0.4012 0.0352  0.0220  0.0186  20  ILE A N   
130  C CA  . ILE A 38  ? 0.2580 0.3314 0.4356 0.0404  0.0061  0.0271  20  ILE A CA  
131  C C   . ILE A 38  ? 0.2685 0.3610 0.4861 0.0437  0.0077  0.0222  20  ILE A C   
132  O O   . ILE A 38  ? 0.2716 0.3691 0.5140 0.0484  0.0203  0.0111  20  ILE A O   
133  C CB  . ILE A 38  ? 0.2675 0.3275 0.4540 0.0474  -0.0003 0.0310  20  ILE A CB  
134  C CG1 . ILE A 38  ? 0.2582 0.3015 0.4082 0.0428  0.0005  0.0341  20  ILE A CG1 
135  C CG2 . ILE A 38  ? 0.2313 0.2950 0.4382 0.0515  -0.0203 0.0446  20  ILE A CG2 
136  C CD1 . ILE A 38  ? 0.2928 0.3205 0.4504 0.0476  -0.0033 0.0364  20  ILE A CD1 
137  N N   . VAL A 39  ? 0.2594 0.3641 0.4844 0.0407  -0.0049 0.0292  21  VAL A N   
138  C CA  . VAL A 39  ? 0.2582 0.3845 0.5223 0.0419  -0.0046 0.0248  21  VAL A CA  
139  C C   . VAL A 39  ? 0.2633 0.3994 0.5489 0.0448  -0.0280 0.0363  21  VAL A C   
140  O O   . VAL A 39  ? 0.2387 0.3683 0.4969 0.0401  -0.0426 0.0470  21  VAL A O   
141  C CB  . VAL A 39  ? 0.3578 0.4929 0.6101 0.0311  0.0056  0.0194  21  VAL A CB  
142  C CG1 . VAL A 39  ? 0.3418 0.4665 0.5544 0.0231  -0.0027 0.0263  21  VAL A CG1 
143  C CG2 . VAL A 39  ? 0.3768 0.5363 0.6701 0.0300  0.0026  0.0165  21  VAL A CG2 
144  N N   . ASP A 40  ? 0.3238 0.4763 0.6588 0.0524  -0.0317 0.0340  22  ASP A N   
145  C CA  . ASP A 40  ? 0.4094 0.5766 0.7698 0.0539  -0.0555 0.0450  22  ASP A CA  
146  C C   . ASP A 40  ? 0.3934 0.5773 0.7486 0.0425  -0.0573 0.0422  22  ASP A C   
147  O O   . ASP A 40  ? 0.3732 0.5748 0.7574 0.0407  -0.0453 0.0316  22  ASP A O   
148  C CB  . ASP A 40  ? 0.4955 0.6771 0.9177 0.0666  -0.0590 0.0424  22  ASP A CB  
149  C CG  . ASP A 40  ? 0.5886 0.7512 1.0206 0.0782  -0.0630 0.0474  22  ASP A CG  
150  O OD1 . ASP A 40  ? 0.6053 0.7473 0.9994 0.0755  -0.0729 0.0598  22  ASP A OD1 
151  O OD2 . ASP A 40  ? 0.6254 0.7937 1.1049 0.0895  -0.0554 0.0381  22  ASP A OD2 
152  N N   . ALA A 41  ? 0.3800 0.5582 0.6984 0.0339  -0.0711 0.0507  23  ALA A N   
153  C CA  . ALA A 41  ? 0.3628 0.5515 0.6701 0.0217  -0.0720 0.0461  23  ALA A CA  
154  C C   . ALA A 41  ? 0.3925 0.6045 0.7306 0.0194  -0.0938 0.0509  23  ALA A C   
155  O O   . ALA A 41  ? 0.4171 0.6319 0.7645 0.0243  -0.1154 0.0635  23  ALA A O   
156  C CB  . ALA A 41  ? 0.3259 0.4973 0.5790 0.0129  -0.0732 0.0486  23  ALA A CB  
157  N N   . ASP A 42  ? 0.3986 0.6271 0.7531 0.0109  -0.0892 0.0419  24  ASP A N   
158  C CA  . ASP A 42  ? 0.3953 0.6475 0.7764 0.0056  -0.1105 0.0446  24  ASP A CA  
159  C C   . ASP A 42  ? 0.3591 0.6040 0.6947 -0.0055 -0.1274 0.0496  24  ASP A C   
160  O O   . ASP A 42  ? 0.3467 0.5713 0.6369 -0.0108 -0.1169 0.0464  24  ASP A O   
161  C CB  . ASP A 42  ? 0.4628 0.7344 0.8761 -0.0019 -0.0981 0.0320  24  ASP A CB  
162  C CG  . ASP A 42  ? 0.5068 0.7843 0.9549 0.0059  -0.0738 0.0236  24  ASP A CG  
163  O OD1 . ASP A 42  ? 0.4973 0.7954 0.9982 0.0151  -0.0785 0.0234  24  ASP A OD1 
164  O OD2 . ASP A 42  ? 0.5281 0.7903 0.9511 0.0025  -0.0503 0.0169  24  ASP A OD2 
165  N N   . ASP A 43  ? 0.3799 0.6425 0.7287 -0.0094 -0.1537 0.0566  25  ASP A N   
166  C CA  . ASP A 43  ? 0.4174 0.6752 0.7211 -0.0210 -0.1713 0.0609  25  ASP A CA  
167  C C   . ASP A 43  ? 0.3933 0.6468 0.6701 -0.0355 -0.1606 0.0458  25  ASP A C   
168  O O   . ASP A 43  ? 0.4009 0.6415 0.6305 -0.0437 -0.1633 0.0444  25  ASP A O   
169  C CB  . ASP A 43  ? 0.4971 0.7772 0.8216 -0.0233 -0.2039 0.0722  25  ASP A CB  
170  C CG  . ASP A 43  ? 0.5765 0.8593 0.9335 -0.0080 -0.2169 0.0887  25  ASP A CG  
171  O OD1 . ASP A 43  ? 0.6031 0.8672 0.9285 -0.0044 -0.2225 0.1019  25  ASP A OD1 
172  O OD2 . ASP A 43  ? 0.6077 0.9057 1.0158 0.0006  -0.2166 0.0861  25  ASP A OD2 
173  N N   . PHE A 44  ? 0.3620 0.6257 0.6702 -0.0391 -0.1476 0.0343  26  PHE A N   
174  C CA  . PHE A 44  ? 0.3355 0.5928 0.6239 -0.0530 -0.1383 0.0205  26  PHE A CA  
175  C C   . PHE A 44  ? 0.3004 0.5286 0.5470 -0.0522 -0.1176 0.0164  26  PHE A C   
176  O O   . PHE A 44  ? 0.3106 0.5275 0.5279 -0.0622 -0.1152 0.0074  26  PHE A O   
177  C CB  . PHE A 44  ? 0.3388 0.6126 0.6718 -0.0586 -0.1284 0.0111  26  PHE A CB  
178  C CG  . PHE A 44  ? 0.3315 0.5985 0.6817 -0.0513 -0.1012 0.0089  26  PHE A CG  
179  C CD1 . PHE A 44  ? 0.2413 0.4846 0.5624 -0.0550 -0.0800 0.0035  26  PHE A CD1 
180  C CD2 . PHE A 44  ? 0.3077 0.5930 0.7045 -0.0414 -0.0973 0.0117  26  PHE A CD2 
181  C CE1 . PHE A 44  ? 0.2418 0.4796 0.5735 -0.0504 -0.0564 0.0026  26  PHE A CE1 
182  C CE2 . PHE A 44  ? 0.2939 0.5745 0.7026 -0.0368 -0.0709 0.0077  26  PHE A CE2 
183  C CZ  . PHE A 44  ? 0.2218 0.4786 0.5950 -0.0421 -0.0510 0.0039  26  PHE A CZ  
184  N N   . MET A 45  ? 0.2901 0.5069 0.5366 -0.0401 -0.1036 0.0221  27  MET A N   
185  C CA  . MET A 45  ? 0.3110 0.5027 0.5240 -0.0381 -0.0846 0.0193  27  MET A CA  
186  C C   . MET A 45  ? 0.3377 0.5153 0.5049 -0.0425 -0.0911 0.0192  27  MET A C   
187  O O   . MET A 45  ? 0.3268 0.4880 0.4699 -0.0464 -0.0790 0.0116  27  MET A O   
188  C CB  . MET A 45  ? 0.3088 0.4931 0.5286 -0.0250 -0.0731 0.0257  27  MET A CB  
189  C CG  . MET A 45  ? 0.3033 0.4995 0.5638 -0.0212 -0.0597 0.0222  27  MET A CG  
190  S SD  . MET A 45  ? 0.5006 0.6845 0.7515 -0.0290 -0.0347 0.0134  27  MET A SD  
191  C CE  . MET A 45  ? 0.2666 0.4227 0.4739 -0.0224 -0.0246 0.0170  27  MET A CE  
192  N N   . TYR A 46  ? 0.3652 0.5498 0.5216 -0.0421 -0.1101 0.0281  28  TYR A N   
193  C CA  . TYR A 46  ? 0.3787 0.5530 0.4900 -0.0475 -0.1150 0.0284  28  TYR A CA  
194  C C   . TYR A 46  ? 0.3931 0.5703 0.4873 -0.0618 -0.1193 0.0146  28  TYR A C   
195  O O   . TYR A 46  ? 0.3974 0.5616 0.4583 -0.0665 -0.1116 0.0064  28  TYR A O   
196  C CB  . TYR A 46  ? 0.3745 0.5547 0.4768 -0.0448 -0.1341 0.0445  28  TYR A CB  
197  C CG  . TYR A 46  ? 0.3635 0.5374 0.4848 -0.0307 -0.1292 0.0562  28  TYR A CG  
198  C CD1 . TYR A 46  ? 0.3583 0.5136 0.4548 -0.0259 -0.1175 0.0598  28  TYR A CD1 
199  C CD2 . TYR A 46  ? 0.3568 0.5437 0.5241 -0.0223 -0.1353 0.0616  28  TYR A CD2 
200  C CE1 . TYR A 46  ? 0.3211 0.4691 0.4352 -0.0140 -0.1128 0.0683  28  TYR A CE1 
201  C CE2 . TYR A 46  ? 0.3239 0.5037 0.5104 -0.0093 -0.1294 0.0691  28  TYR A CE2 
202  C CZ  . TYR A 46  ? 0.3108 0.4702 0.4692 -0.0056 -0.1185 0.0721  28  TYR A CZ  
203  O OH  . TYR A 46  ? 0.3258 0.4769 0.5035 0.0062  -0.1127 0.0775  28  TYR A OH  
204  N N   . ARG A 47  ? 0.4027 0.5976 0.5228 -0.0687 -0.1311 0.0105  29  ARG A N   
205  C CA  . ARG A 47  ? 0.4482 0.6456 0.5570 -0.0834 -0.1351 -0.0053 29  ARG A CA  
206  C C   . ARG A 47  ? 0.3927 0.5742 0.5092 -0.0850 -0.1138 -0.0182 29  ARG A C   
207  O O   . ARG A 47  ? 0.3619 0.5297 0.4543 -0.0918 -0.1069 -0.0314 29  ARG A O   
208  C CB  . ARG A 47  ? 0.5065 0.7291 0.6440 -0.0913 -0.1561 -0.0054 29  ARG A CB  
209  C CG  . ARG A 47  ? 0.5719 0.8115 0.7127 -0.0877 -0.1802 0.0118  29  ARG A CG  
210  C CD  . ARG A 47  ? 0.6334 0.8992 0.7967 -0.0982 -0.2049 0.0102  29  ARG A CD  
211  N NE  . ARG A 47  ? 0.6509 0.9289 0.8645 -0.0990 -0.1984 0.0024  29  ARG A NE  
212  C CZ  . ARG A 47  ? 0.6263 0.9219 0.8905 -0.0895 -0.2021 0.0115  29  ARG A CZ  
213  N NH1 . ARG A 47  ? 0.5968 0.8977 0.8704 -0.0771 -0.2137 0.0289  29  ARG A NH1 
214  N NH2 . ARG A 47  ? 0.6095 0.9173 0.9172 -0.0928 -0.1933 0.0026  29  ARG A NH2 
215  N N   . LYS A 48  ? 0.3549 0.5381 0.5057 -0.0788 -0.1031 -0.0142 30  LYS A N   
216  C CA  . LYS A 48  ? 0.3066 0.4748 0.4664 -0.0808 -0.0838 -0.0218 30  LYS A CA  
217  C C   . LYS A 48  ? 0.3050 0.4476 0.4329 -0.0766 -0.0696 -0.0246 30  LYS A C   
218  O O   . LYS A 48  ? 0.2936 0.4211 0.4161 -0.0827 -0.0613 -0.0352 30  LYS A O   
219  C CB  . LYS A 48  ? 0.2692 0.4444 0.4637 -0.0741 -0.0730 -0.0142 30  LYS A CB  
220  C CG  . LYS A 48  ? 0.3074 0.4675 0.5092 -0.0775 -0.0531 -0.0181 30  LYS A CG  
221  C CD  . LYS A 48  ? 0.2857 0.4592 0.5223 -0.0745 -0.0428 -0.0124 30  LYS A CD  
222  C CE  . LYS A 48  ? 0.2528 0.4111 0.4916 -0.0797 -0.0231 -0.0131 30  LYS A CE  
223  N NZ  . LYS A 48  ? 0.2455 0.4203 0.5170 -0.0796 -0.0112 -0.0096 30  LYS A NZ  
224  N N   . TYR A 49  ? 0.2779 0.4155 0.3878 -0.0663 -0.0675 -0.0153 31  TYR A N   
225  C CA  . TYR A 49  ? 0.2751 0.3918 0.3595 -0.0615 -0.0547 -0.0171 31  TYR A CA  
226  C C   . TYR A 49  ? 0.3540 0.4688 0.4049 -0.0640 -0.0607 -0.0214 31  TYR A C   
227  O O   . TYR A 49  ? 0.3529 0.4544 0.3850 -0.0592 -0.0509 -0.0223 31  TYR A O   
228  C CB  . TYR A 49  ? 0.2567 0.3675 0.3446 -0.0496 -0.0446 -0.0055 31  TYR A CB  
229  C CG  . TYR A 49  ? 0.3025 0.4126 0.4161 -0.0487 -0.0336 -0.0034 31  TYR A CG  
230  C CD1 . TYR A 49  ? 0.2390 0.3658 0.3804 -0.0459 -0.0356 0.0022  31  TYR A CD1 
231  C CD2 . TYR A 49  ? 0.2727 0.3660 0.3840 -0.0513 -0.0211 -0.0069 31  TYR A CD2 
232  C CE1 . TYR A 49  ? 0.2994 0.4277 0.4626 -0.0470 -0.0228 0.0028  31  TYR A CE1 
233  C CE2 . TYR A 49  ? 0.2633 0.3561 0.3936 -0.0530 -0.0105 -0.0034 31  TYR A CE2 
234  C CZ  . TYR A 49  ? 0.2366 0.3478 0.3913 -0.0515 -0.0101 0.0007  31  TYR A CZ  
235  O OH  . TYR A 49  ? 0.2357 0.3481 0.4073 -0.0550 0.0031  0.0029  31  TYR A OH  
236  N N   . ASN A 50  ? 0.3740 0.5036 0.4177 -0.0725 -0.0767 -0.0242 32  ASN A N   
237  C CA  . ASN A 50  ? 0.4155 0.5465 0.4234 -0.0781 -0.0826 -0.0283 32  ASN A CA  
238  C C   . ASN A 50  ? 0.4284 0.5545 0.4174 -0.0695 -0.0787 -0.0157 32  ASN A C   
239  O O   . ASN A 50  ? 0.4566 0.5739 0.4211 -0.0703 -0.0694 -0.0220 32  ASN A O   
240  C CB  . ASN A 50  ? 0.4439 0.5630 0.4367 -0.0854 -0.0728 -0.0487 32  ASN A CB  
241  C CG  . ASN A 50  ? 0.5076 0.6345 0.4654 -0.0964 -0.0805 -0.0584 32  ASN A CG  
242  O OD1 . ASN A 50  ? 0.5350 0.6780 0.4812 -0.1023 -0.0975 -0.0501 32  ASN A OD1 
243  N ND2 . ASN A 50  ? 0.5388 0.6547 0.4799 -0.0997 -0.0680 -0.0762 32  ASN A ND2 
244  N N   . LEU A 51  ? 0.3929 0.5249 0.3969 -0.0616 -0.0852 0.0010  33  LEU A N   
245  C CA  . LEU A 51  ? 0.3984 0.5239 0.3897 -0.0537 -0.0818 0.0136  33  LEU A CA  
246  C C   . LEU A 51  ? 0.4690 0.6040 0.4386 -0.0590 -0.0984 0.0250  33  LEU A C   
247  O O   . LEU A 51  ? 0.4919 0.6411 0.4671 -0.0648 -0.1162 0.0287  33  LEU A O   
248  C CB  . LEU A 51  ? 0.3396 0.4624 0.3603 -0.0418 -0.0772 0.0237  33  LEU A CB  
249  C CG  . LEU A 51  ? 0.2967 0.4107 0.3356 -0.0381 -0.0613 0.0156  33  LEU A CG  
250  C CD1 . LEU A 51  ? 0.3012 0.4148 0.3644 -0.0281 -0.0558 0.0240  33  LEU A CD1 
251  C CD2 . LEU A 51  ? 0.2875 0.3859 0.3058 -0.0379 -0.0475 0.0078  33  LEU A CD2 
252  N N   . LYS A 52  ? 0.4965 0.6241 0.4423 -0.0577 -0.0934 0.0318  34  LYS A N   
253  C CA  . LYS A 52  ? 0.5855 0.7195 0.5038 -0.0651 -0.1073 0.0442  34  LYS A CA  
254  C C   . LYS A 52  ? 0.6148 0.7424 0.5406 -0.0565 -0.1111 0.0646  34  LYS A C   
255  O O   . LYS A 52  ? 0.5900 0.7066 0.5326 -0.0460 -0.0983 0.0650  34  LYS A O   
256  C CB  . LYS A 52  ? 0.6446 0.7769 0.5232 -0.0757 -0.0975 0.0332  34  LYS A CB  
257  C CG  . LYS A 52  ? 0.7179 0.8546 0.5887 -0.0849 -0.0936 0.0106  34  LYS A CG  
258  C CD  . LYS A 52  ? 0.7869 0.9164 0.6382 -0.0876 -0.0735 -0.0065 34  LYS A CD  
259  C CE  . LYS A 52  ? 0.8553 0.9898 0.6674 -0.0970 -0.0723 -0.0014 34  LYS A CE  
260  N NZ  . LYS A 52  ? 0.8613 0.9921 0.6599 -0.0994 -0.0509 -0.0204 34  LYS A NZ  
261  N N   . LYS A 53  ? 0.6635 0.7970 0.5761 -0.0619 -0.1297 0.0815  35  LYS A N   
262  C CA  . LYS A 53  ? 0.6897 0.8151 0.6096 -0.0551 -0.1364 0.1026  35  LYS A CA  
263  C C   . LYS A 53  ? 0.6258 0.7371 0.5289 -0.0538 -0.1187 0.1029  35  LYS A C   
264  O O   . LYS A 53  ? 0.6379 0.7499 0.5080 -0.0636 -0.1089 0.0950  35  LYS A O   
265  C CB  . LYS A 53  ? 0.7997 0.9327 0.6992 -0.0647 -0.1604 0.1221  35  LYS A CB  
266  C CG  . LYS A 53  ? 0.8784 1.0009 0.7906 -0.0578 -0.1713 0.1467  35  LYS A CG  
267  C CD  . LYS A 53  ? 0.9179 1.0444 0.8810 -0.0445 -0.1855 0.1541  35  LYS A CD  
268  C CE  . LYS A 53  ? 0.9301 1.0413 0.9158 -0.0338 -0.1904 0.1730  35  LYS A CE  
269  N NZ  . LYS A 53  ? 0.8960 0.9925 0.8952 -0.0240 -0.1662 0.1617  35  LYS A NZ  
270  N N   . ASP A 54  ? 0.5788 0.6786 0.5069 -0.0420 -0.1144 0.1106  36  ASP A N   
271  C CA  . ASP A 54  ? 0.6094 0.6961 0.5266 -0.0408 -0.1008 0.1131  36  ASP A CA  
272  C C   . ASP A 54  ? 0.5967 0.6829 0.4984 -0.0437 -0.0805 0.0944  36  ASP A C   
273  O O   . ASP A 54  ? 0.6242 0.7059 0.5071 -0.0482 -0.0708 0.0953  36  ASP A O   
274  C CB  . ASP A 54  ? 0.6898 0.7736 0.5797 -0.0506 -0.1107 0.1324  36  ASP A CB  
275  C CG  . ASP A 54  ? 0.7563 0.8346 0.6675 -0.0451 -0.1307 0.1544  36  ASP A CG  
276  O OD1 . ASP A 54  ? 0.8132 0.8942 0.7035 -0.0547 -0.1478 0.1724  36  ASP A OD1 
277  O OD2 . ASP A 54  ? 0.7505 0.8217 0.6997 -0.0313 -0.1293 0.1535  36  ASP A OD2 
278  N N   . ASN A 55  ? 0.5486 0.6395 0.4612 -0.0413 -0.0745 0.0780  37  ASN A N   
279  C CA  . ASN A 55  ? 0.5200 0.6098 0.4220 -0.0433 -0.0577 0.0606  37  ASN A CA  
280  C C   . ASN A 55  ? 0.4173 0.4985 0.3441 -0.0324 -0.0459 0.0528  37  ASN A C   
281  O O   . ASN A 55  ? 0.3455 0.4240 0.2964 -0.0245 -0.0492 0.0575  37  ASN A O   
282  C CB  . ASN A 55  ? 0.5702 0.6698 0.4595 -0.0522 -0.0597 0.0467  37  ASN A CB  
283  C CG  . ASN A 55  ? 0.6150 0.7141 0.4878 -0.0568 -0.0438 0.0296  37  ASN A CG  
284  O OD1 . ASN A 55  ? 0.6144 0.7109 0.4762 -0.0575 -0.0340 0.0311  37  ASN A OD1 
285  N ND2 . ASN A 55  ? 0.6402 0.7421 0.5148 -0.0600 -0.0408 0.0124  37  ASN A ND2 
286  N N   . ILE A 56  ? 0.4178 0.4956 0.3387 -0.0323 -0.0322 0.0408  38  ILE A N   
287  C CA  . ILE A 56  ? 0.3999 0.4698 0.3398 -0.0239 -0.0227 0.0340  38  ILE A CA  
288  C C   . ILE A 56  ? 0.3707 0.4406 0.3082 -0.0264 -0.0146 0.0181  38  ILE A C   
289  O O   . ILE A 56  ? 0.3913 0.4650 0.3128 -0.0321 -0.0097 0.0104  38  ILE A O   
290  C CB  . ILE A 56  ? 0.3789 0.4410 0.3216 -0.0184 -0.0159 0.0393  38  ILE A CB  
291  C CG1 . ILE A 56  ? 0.4075 0.4619 0.3662 -0.0109 -0.0085 0.0343  38  ILE A CG1 
292  C CG2 . ILE A 56  ? 0.3811 0.4458 0.3063 -0.0238 -0.0092 0.0366  38  ILE A CG2 
293  C CD1 . ILE A 56  ? 0.4220 0.4740 0.3788 -0.0104 0.0006  0.0242  38  ILE A CD1 
294  N N   . VAL A 57  ? 0.3258 0.3910 0.2804 -0.0227 -0.0128 0.0129  39  VAL A N   
295  C CA  . VAL A 57  ? 0.3117 0.3720 0.2697 -0.0235 -0.0054 -0.0007 39  VAL A CA  
296  C C   . VAL A 57  ? 0.3305 0.3797 0.3042 -0.0159 0.0009  0.0012  39  VAL A C   
297  O O   . VAL A 57  ? 0.3729 0.4200 0.3554 -0.0121 -0.0006 0.0100  39  VAL A O   
298  C CB  . VAL A 57  ? 0.3476 0.4115 0.3093 -0.0302 -0.0105 -0.0095 39  VAL A CB  
299  C CG1 . VAL A 57  ? 0.4367 0.5126 0.3782 -0.0394 -0.0185 -0.0115 39  VAL A CG1 
300  C CG2 . VAL A 57  ? 0.2953 0.3596 0.2762 -0.0282 -0.0155 -0.0027 39  VAL A CG2 
301  N N   . LEU A 58  ? 0.2900 0.3325 0.2672 -0.0139 0.0077  -0.0072 40  LEU A N   
302  C CA  . LEU A 58  ? 0.2716 0.3024 0.2617 -0.0081 0.0112  -0.0041 40  LEU A CA  
303  C C   . LEU A 58  ? 0.3232 0.3476 0.3247 -0.0111 0.0102  -0.0071 40  LEU A C   
304  O O   . LEU A 58  ? 0.3720 0.3957 0.3756 -0.0157 0.0102  -0.0185 40  LEU A O   
305  C CB  . LEU A 58  ? 0.2594 0.2859 0.2538 -0.0040 0.0167  -0.0105 40  LEU A CB  
306  C CG  . LEU A 58  ? 0.2955 0.3300 0.2822 -0.0023 0.0193  -0.0088 40  LEU A CG  
307  C CD1 . LEU A 58  ? 0.2885 0.3214 0.2871 0.0022  0.0248  -0.0169 40  LEU A CD1 
308  C CD2 . LEU A 58  ? 0.2213 0.2548 0.2056 0.0008  0.0164  0.0044  40  LEU A CD2 
309  N N   . ALA A 59  ? 0.3310 0.3511 0.3395 -0.0098 0.0103  0.0020  41  ALA A N   
310  C CA  . ALA A 59  ? 0.3570 0.3716 0.3774 -0.0144 0.0105  0.0013  41  ALA A CA  
311  C C   . ALA A 59  ? 0.4158 0.4169 0.4446 -0.0156 0.0125  -0.0065 41  ALA A C   
312  O O   . ALA A 59  ? 0.4425 0.4335 0.4734 -0.0102 0.0146  -0.0047 41  ALA A O   
313  C CB  . ALA A 59  ? 0.2963 0.3076 0.3205 -0.0134 0.0137  0.0124  41  ALA A CB  
314  N N   . GLU A 60  ? 0.4281 0.4294 0.4640 -0.0226 0.0107  -0.0157 42  GLU A N   
315  C CA  . GLU A 60  ? 0.4381 0.4236 0.4870 -0.0250 0.0125  -0.0235 42  GLU A CA  
316  C C   . GLU A 60  ? 0.4603 0.4399 0.5210 -0.0314 0.0127  -0.0158 42  GLU A C   
317  O O   . GLU A 60  ? 0.4006 0.3910 0.4596 -0.0330 0.0128  -0.0069 42  GLU A O   
318  C CB  . GLU A 60  ? 0.4727 0.4623 0.5205 -0.0306 0.0111  -0.0421 42  GLU A CB  
319  C CG  . GLU A 60  ? 0.5395 0.5388 0.5725 -0.0272 0.0129  -0.0505 42  GLU A CG  
320  C CD  . GLU A 60  ? 0.6437 0.6506 0.6688 -0.0355 0.0119  -0.0694 42  GLU A CD  
321  O OE1 . GLU A 60  ? 0.7208 0.7176 0.7581 -0.0407 0.0123  -0.0819 42  GLU A OE1 
322  O OE2 . GLU A 60  ? 0.6344 0.6567 0.6396 -0.0381 0.0103  -0.0715 42  GLU A OE2 
323  N N   . GLU A 61  ? 0.5103 0.4730 0.5852 -0.0355 0.0137  -0.0198 43  GLU A N   
324  C CA  . GLU A 61  ? 0.5028 0.4584 0.5892 -0.0434 0.0153  -0.0107 43  GLU A CA  
325  C C   . GLU A 61  ? 0.4170 0.3912 0.5087 -0.0521 0.0133  -0.0143 43  GLU A C   
326  O O   . GLU A 61  ? 0.3921 0.3723 0.4894 -0.0565 0.0166  -0.0042 43  GLU A O   
327  C CB  . GLU A 61  ? 0.5722 0.5034 0.6751 -0.0472 0.0158  -0.0139 43  GLU A CB  
328  C CG  . GLU A 61  ? 0.6603 0.5792 0.7715 -0.0548 0.0187  0.0018  43  GLU A CG  
329  C CD  . GLU A 61  ? 0.7375 0.6567 0.8341 -0.0501 0.0214  0.0209  43  GLU A CD  
330  O OE1 . GLU A 61  ? 0.7834 0.6981 0.8713 -0.0398 0.0191  0.0240  43  GLU A OE1 
331  O OE2 . GLU A 61  ? 0.7220 0.6473 0.8162 -0.0575 0.0263  0.0317  43  GLU A OE2 
332  N N   . LYS A 62  ? 0.3440 0.3291 0.4338 -0.0550 0.0079  -0.0289 44  LYS A N   
333  C CA  . LYS A 62  ? 0.3572 0.3622 0.4538 -0.0630 0.0024  -0.0322 44  LYS A CA  
334  C C   . LYS A 62  ? 0.3438 0.3680 0.4355 -0.0579 0.0012  -0.0214 44  LYS A C   
335  O O   . LYS A 62  ? 0.3747 0.4157 0.4795 -0.0628 -0.0025 -0.0201 44  LYS A O   
336  C CB  . LYS A 62  ? 0.4111 0.4237 0.5014 -0.0681 -0.0052 -0.0497 44  LYS A CB  
337  C CG  . LYS A 62  ? 0.4537 0.4745 0.5208 -0.0612 -0.0074 -0.0527 44  LYS A CG  
338  C CD  . LYS A 62  ? 0.5165 0.5440 0.5729 -0.0691 -0.0134 -0.0712 44  LYS A CD  
339  C CE  . LYS A 62  ? 0.5585 0.5960 0.5890 -0.0649 -0.0145 -0.0726 44  LYS A CE  
340  N NZ  . LYS A 62  ? 0.5917 0.6331 0.6069 -0.0735 -0.0167 -0.0930 44  LYS A NZ  
341  N N   . HIS A 63  ? 0.2819 0.3038 0.3585 -0.0479 0.0041  -0.0144 45  HIS A N   
342  C CA  . HIS A 63  ? 0.2811 0.3178 0.3540 -0.0423 0.0032  -0.0055 45  HIS A CA  
343  C C   . HIS A 63  ? 0.2874 0.3221 0.3669 -0.0410 0.0119  0.0053  45  HIS A C   
344  O O   . HIS A 63  ? 0.2643 0.3121 0.3483 -0.0379 0.0128  0.0098  45  HIS A O   
345  C CB  . HIS A 63  ? 0.2464 0.2820 0.2996 -0.0339 0.0021  -0.0043 45  HIS A CB  
346  C CG  . HIS A 63  ? 0.2997 0.3413 0.3415 -0.0362 -0.0048 -0.0141 45  HIS A CG  
347  N ND1 . HIS A 63  ? 0.3178 0.3499 0.3491 -0.0352 -0.0020 -0.0230 45  HIS A ND1 
348  C CD2 . HIS A 63  ? 0.3006 0.3578 0.3389 -0.0403 -0.0144 -0.0163 45  HIS A CD2 
349  C CE1 . HIS A 63  ? 0.3311 0.3731 0.3499 -0.0398 -0.0075 -0.0316 45  HIS A CE1 
350  N NE2 . HIS A 63  ? 0.3225 0.3792 0.3433 -0.0433 -0.0163 -0.0265 45  HIS A NE2 
351  N N   . MET A 64  ? 0.3056 0.3235 0.3856 -0.0438 0.0183  0.0092  46  MET A N   
352  C CA  . MET A 64  ? 0.2854 0.2989 0.3613 -0.0431 0.0270  0.0204  46  MET A CA  
353  C C   . MET A 64  ? 0.2922 0.3217 0.3821 -0.0482 0.0334  0.0230  46  MET A C   
354  O O   . MET A 64  ? 0.3156 0.3485 0.3990 -0.0457 0.0408  0.0288  46  MET A O   
355  C CB  . MET A 64  ? 0.2983 0.2894 0.3710 -0.0467 0.0303  0.0269  46  MET A CB  
356  C CG  . MET A 64  ? 0.3383 0.3148 0.3997 -0.0386 0.0259  0.0264  46  MET A CG  
357  S SD  . MET A 64  ? 0.4410 0.4253 0.4838 -0.0278 0.0253  0.0302  46  MET A SD  
358  C CE  . MET A 64  ? 0.6488 0.6192 0.6891 -0.0204 0.0201  0.0261  46  MET A CE  
359  N N   . THR A 65  ? 0.2870 0.3279 0.3978 -0.0556 0.0310  0.0173  47  THR A N   
360  C CA  . THR A 65  ? 0.2875 0.3469 0.4187 -0.0606 0.0379  0.0183  47  THR A CA  
361  C C   . THR A 65  ? 0.2694 0.3474 0.4063 -0.0515 0.0361  0.0169  47  THR A C   
362  O O   . THR A 65  ? 0.2657 0.3587 0.4195 -0.0526 0.0447  0.0171  47  THR A O   
363  C CB  . THR A 65  ? 0.2833 0.3531 0.4405 -0.0713 0.0341  0.0120  47  THR A CB  
364  O OG1 . THR A 65  ? 0.2672 0.3429 0.4252 -0.0689 0.0194  0.0036  47  THR A OG1 
365  C CG2 . THR A 65  ? 0.2793 0.3293 0.4369 -0.0823 0.0389  0.0146  47  THR A CG2 
366  N N   . ILE A 66  ? 0.2635 0.3402 0.3878 -0.0430 0.0258  0.0153  48  ILE A N   
367  C CA  . ILE A 66  ? 0.2216 0.3126 0.3528 -0.0345 0.0212  0.0155  48  ILE A CA  
368  C C   . ILE A 66  ? 0.2319 0.3227 0.3603 -0.0293 0.0333  0.0186  48  ILE A C   
369  O O   . ILE A 66  ? 0.2431 0.3488 0.3913 -0.0249 0.0351  0.0168  48  ILE A O   
370  C CB  . ILE A 66  ? 0.2524 0.3393 0.3659 -0.0283 0.0087  0.0154  48  ILE A CB  
371  C CG1 . ILE A 66  ? 0.2889 0.3918 0.4169 -0.0225 -0.0007 0.0172  48  ILE A CG1 
372  C CG2 . ILE A 66  ? 0.2164 0.2867 0.3040 -0.0226 0.0133  0.0188  48  ILE A CG2 
373  C CD1 . ILE A 66  ? 0.3306 0.4299 0.4390 -0.0189 -0.0125 0.0196  48  ILE A CD1 
374  N N   . TYR A 67  ? 0.2426 0.3170 0.3481 -0.0302 0.0412  0.0224  49  TYR A N   
375  C CA  . TYR A 67  ? 0.3087 0.3819 0.4051 -0.0269 0.0519  0.0239  49  TYR A CA  
376  C C   . TYR A 67  ? 0.3590 0.4448 0.4721 -0.0336 0.0664  0.0217  49  TYR A C   
377  O O   . TYR A 67  ? 0.3839 0.4799 0.5059 -0.0295 0.0743  0.0171  49  TYR A O   
378  C CB  . TYR A 67  ? 0.2739 0.3275 0.3400 -0.0268 0.0533  0.0295  49  TYR A CB  
379  C CG  . TYR A 67  ? 0.2606 0.3056 0.3147 -0.0203 0.0414  0.0298  49  TYR A CG  
380  C CD1 . TYR A 67  ? 0.2917 0.3398 0.3425 -0.0123 0.0368  0.0284  49  TYR A CD1 
381  C CD2 . TYR A 67  ? 0.2497 0.2836 0.2980 -0.0227 0.0358  0.0306  49  TYR A CD2 
382  C CE1 . TYR A 67  ? 0.2929 0.3351 0.3325 -0.0083 0.0279  0.0288  49  TYR A CE1 
383  C CE2 . TYR A 67  ? 0.2740 0.3030 0.3131 -0.0175 0.0276  0.0287  49  TYR A CE2 
384  C CZ  . TYR A 67  ? 0.2858 0.3199 0.3194 -0.0110 0.0242  0.0282  49  TYR A CZ  
385  O OH  . TYR A 67  ? 0.2822 0.3131 0.3061 -0.0078 0.0180  0.0266  49  TYR A OH  
386  N N   . ASP A 68  ? 0.4174 0.5026 0.5367 -0.0444 0.0710  0.0239  50  ASP A N   
387  C CA  . ASP A 68  ? 0.4412 0.5416 0.5798 -0.0530 0.0859  0.0215  50  ASP A CA  
388  C C   . ASP A 68  ? 0.3898 0.5150 0.5678 -0.0492 0.0826  0.0135  50  ASP A C   
389  O O   . ASP A 68  ? 0.4077 0.5508 0.6071 -0.0495 0.0951  0.0077  50  ASP A O   
390  C CB  . ASP A 68  ? 0.5228 0.6153 0.6607 -0.0670 0.0902  0.0274  50  ASP A CB  
391  C CG  . ASP A 68  ? 0.6042 0.6740 0.7074 -0.0722 0.0954  0.0379  50  ASP A CG  
392  O OD1 . ASP A 68  ? 0.6240 0.6924 0.7067 -0.0696 0.1029  0.0390  50  ASP A OD1 
393  O OD2 . ASP A 68  ? 0.6466 0.6997 0.7440 -0.0790 0.0909  0.0449  50  ASP A OD2 
394  N N   . GLU A 69  ? 0.3171 0.4442 0.5048 -0.0457 0.0653  0.0128  51  GLU A N   
395  C CA  . GLU A 69  ? 0.2660 0.4167 0.4915 -0.0429 0.0571  0.0076  51  GLU A CA  
396  C C   . GLU A 69  ? 0.2388 0.3998 0.4785 -0.0300 0.0560  0.0047  51  GLU A C   
397  O O   . GLU A 69  ? 0.2147 0.3972 0.4910 -0.0282 0.0618  -0.0008 51  GLU A O   
398  C CB  . GLU A 69  ? 0.2584 0.4078 0.4841 -0.0442 0.0373  0.0080  51  GLU A CB  
399  C CG  . GLU A 69  ? 0.2787 0.4539 0.5438 -0.0442 0.0260  0.0042  51  GLU A CG  
400  C CD  . GLU A 69  ? 0.3198 0.4950 0.5830 -0.0513 0.0088  0.0027  51  GLU A CD  
401  O OE1 . GLU A 69  ? 0.3268 0.4816 0.5573 -0.0528 0.0044  0.0035  51  GLU A OE1 
402  O OE2 . GLU A 69  ? 0.3203 0.5172 0.6162 -0.0558 -0.0002 -0.0006 51  GLU A OE2 
403  N N   . ILE A 70  ? 0.2443 0.3900 0.4588 -0.0212 0.0490  0.0080  52  ILE A N   
404  C CA  . ILE A 70  ? 0.2851 0.4361 0.5133 -0.0092 0.0469  0.0060  52  ILE A CA  
405  C C   . ILE A 70  ? 0.3207 0.4743 0.5527 -0.0081 0.0675  -0.0010 52  ILE A C   
406  O O   . ILE A 70  ? 0.3176 0.4793 0.5727 0.0010  0.0698  -0.0065 52  ILE A O   
407  C CB  . ILE A 70  ? 0.2854 0.4187 0.4855 -0.0020 0.0347  0.0118  52  ILE A CB  
408  C CG1 . ILE A 70  ? 0.3021 0.4155 0.4644 -0.0043 0.0445  0.0130  52  ILE A CG1 
409  C CG2 . ILE A 70  ? 0.2614 0.3936 0.4540 -0.0044 0.0162  0.0169  52  ILE A CG2 
410  C CD1 . ILE A 70  ? 0.3248 0.4232 0.4627 0.0017  0.0347  0.0176  52  ILE A CD1 
411  N N   . GLN A 71  ? 0.3908 0.5370 0.5999 -0.0179 0.0823  -0.0009 53  GLN A N   
412  C CA  . GLN A 71  ? 0.4646 0.6137 0.6694 -0.0202 0.1032  -0.0080 53  GLN A CA  
413  C C   . GLN A 71  ? 0.4860 0.6617 0.7334 -0.0234 0.1170  -0.0173 53  GLN A C   
414  O O   . GLN A 71  ? 0.5226 0.7065 0.7744 -0.0249 0.1366  -0.0270 53  GLN A O   
415  C CB  . GLN A 71  ? 0.5110 0.6439 0.6748 -0.0314 0.1124  -0.0020 53  GLN A CB  
416  C CG  . GLN A 71  ? 0.5524 0.6796 0.6917 -0.0324 0.1273  -0.0071 53  GLN A CG  
417  C CD  . GLN A 71  ? 0.5664 0.6826 0.6954 -0.0203 0.1182  -0.0097 53  GLN A CD  
418  O OE1 . GLN A 71  ? 0.5976 0.7186 0.7339 -0.0157 0.1279  -0.0207 53  GLN A OE1 
419  N NE2 . GLN A 71  ? 0.5081 0.6095 0.6214 -0.0159 0.1005  -0.0008 53  GLN A NE2 
420  N N   . LYS A 72  ? 0.4627 0.6534 0.7422 -0.0250 0.1070  -0.0157 54  LYS A N   
421  C CA  . LYS A 72  ? 0.4595 0.6793 0.7876 -0.0275 0.1175  -0.0245 54  LYS A CA  
422  C C   . LYS A 72  ? 0.4439 0.6785 0.8146 -0.0120 0.1074  -0.0302 54  LYS A C   
423  O O   . LYS A 72  ? 0.4395 0.7002 0.8587 -0.0100 0.1156  -0.0394 54  LYS A O   
424  C CB  . LYS A 72  ? 0.4366 0.6663 0.7804 -0.0390 0.1109  -0.0199 54  LYS A CB  
425  C CG  . LYS A 72  ? 0.4606 0.6746 0.7692 -0.0548 0.1214  -0.0134 54  LYS A CG  
426  C CD  . LYS A 72  ? 0.4733 0.6911 0.7957 -0.0657 0.1115  -0.0092 54  LYS A CD  
427  C CE  . LYS A 72  ? 0.5113 0.7126 0.8051 -0.0819 0.1236  -0.0020 54  LYS A CE  
428  N NZ  . LYS A 72  ? 0.5305 0.7459 0.8317 -0.0922 0.1503  -0.0056 54  LYS A NZ  
429  N N   . LYS A 73  ? 0.4580 0.6757 0.8122 -0.0013 0.0894  -0.0240 55  LYS A N   
430  C CA  . LYS A 73  ? 0.4605 0.6863 0.8509 0.0135  0.0765  -0.0254 55  LYS A CA  
431  C C   . LYS A 73  ? 0.4424 0.6645 0.8390 0.0220  0.0928  -0.0368 55  LYS A C   
432  O O   . LYS A 73  ? 0.4524 0.6566 0.8080 0.0183  0.1048  -0.0391 55  LYS A O   
433  C CB  . LYS A 73  ? 0.4860 0.6940 0.8528 0.0189  0.0510  -0.0125 55  LYS A CB  
434  C CG  . LYS A 73  ? 0.5313 0.7538 0.9371 0.0269  0.0280  -0.0066 55  LYS A CG  
435  C CD  . LYS A 73  ? 0.5591 0.8035 0.9885 0.0177  0.0212  -0.0060 55  LYS A CD  
436  C CE  . LYS A 73  ? 0.5847 0.8461 1.0540 0.0251  -0.0044 0.0006  55  LYS A CE  
437  N NZ  . LYS A 73  ? 0.6063 0.8914 1.1012 0.0149  -0.0123 -0.0003 55  LYS A NZ  
438  N N   . LYS A 74  ? 0.4280 0.6674 0.8777 0.0334  0.0926  -0.0448 56  LYS A N   
439  C CA  . LYS A 74  ? 0.4461 0.6801 0.9076 0.0434  0.1057  -0.0576 56  LYS A CA  
440  C C   . LYS A 74  ? 0.4537 0.6629 0.8990 0.0541  0.0857  -0.0479 56  LYS A C   
441  O O   . LYS A 74  ? 0.4680 0.6675 0.8933 0.0530  0.0635  -0.0317 56  LYS A O   
442  C CB  . LYS A 74  ? 0.4465 0.7056 0.9726 0.0521  0.1123  -0.0703 56  LYS A CB  
443  C CG  . LYS A 74  ? 0.4683 0.7476 1.0008 0.0396  0.1324  -0.0797 56  LYS A CG  
444  C CD  . LYS A 74  ? 0.4980 0.7937 1.0791 0.0475  0.1337  -0.0898 56  LYS A CD  
445  C CE  . LYS A 74  ? 0.5172 0.8331 1.1034 0.0344  0.1563  -0.1000 56  LYS A CE  
446  N NZ  . LYS A 74  ? 0.4883 0.8153 1.0662 0.0204  0.1517  -0.0888 56  LYS A NZ  
447  N N   . LYS A 75  ? 0.4446 0.6436 0.8980 0.0630  0.0948  -0.0588 57  LYS A N   
448  C CA  . LYS A 75  ? 0.4807 0.6563 0.9269 0.0730  0.0772  -0.0504 57  LYS A CA  
449  C C   . LYS A 75  ? 0.4794 0.6305 0.8632 0.0653  0.0679  -0.0373 57  LYS A C   
450  O O   . LYS A 75  ? 0.4930 0.6287 0.8683 0.0702  0.0481  -0.0239 57  LYS A O   
451  C CB  . LYS A 75  ? 0.5191 0.7025 1.0098 0.0839  0.0513  -0.0376 57  LYS A CB  
452  C CG  . LYS A 75  ? 0.5536 0.7518 1.1068 0.0957  0.0547  -0.0489 57  LYS A CG  
453  C CD  . LYS A 75  ? 0.5896 0.7639 1.1485 0.1060  0.0540  -0.0541 57  LYS A CD  
454  C CE  . LYS A 75  ? 0.6199 0.7991 1.2267 0.1156  0.0476  -0.0584 57  LYS A CE  
455  N NZ  . LYS A 75  ? 0.6348 0.8366 1.2640 0.1119  0.0703  -0.0781 57  LYS A NZ  
456  N N   . LEU A 76  ? 0.4209 0.5692 0.7628 0.0530  0.0820  -0.0402 58  LEU A N   
457  C CA  . LEU A 76  ? 0.3682 0.4953 0.6563 0.0465  0.0745  -0.0295 58  LEU A CA  
458  C C   . LEU A 76  ? 0.3725 0.4788 0.6441 0.0511  0.0760  -0.0339 58  LEU A C   
459  O O   . LEU A 76  ? 0.3774 0.4835 0.6564 0.0527  0.0929  -0.0500 58  LEU A O   
460  C CB  . LEU A 76  ? 0.3414 0.4697 0.5934 0.0330  0.0880  -0.0306 58  LEU A CB  
461  C CG  . LEU A 76  ? 0.3287 0.4700 0.5846 0.0252  0.0834  -0.0230 58  LEU A CG  
462  C CD1 . LEU A 76  ? 0.3539 0.4926 0.5766 0.0119  0.0984  -0.0238 58  LEU A CD1 
463  C CD2 . LEU A 76  ? 0.3002 0.4331 0.5434 0.0262  0.0603  -0.0084 58  LEU A CD2 
464  N N   . ASN A 77  ? 0.3740 0.4635 0.6232 0.0522  0.0591  -0.0207 59  ASN A N   
465  C CA  . ASN A 77  ? 0.3785 0.4475 0.6095 0.0542  0.0592  -0.0233 59  ASN A CA  
466  C C   . ASN A 77  ? 0.3333 0.3911 0.5137 0.0445  0.0596  -0.0182 59  ASN A C   
467  O O   . ASN A 77  ? 0.3266 0.3818 0.4887 0.0413  0.0472  -0.0047 59  ASN A O   
468  C CB  . ASN A 77  ? 0.4110 0.4691 0.6606 0.0627  0.0402  -0.0118 59  ASN A CB  
469  C CG  . ASN A 77  ? 0.4277 0.4637 0.6634 0.0639  0.0404  -0.0147 59  ASN A CG  
470  O OD1 . ASN A 77  ? 0.4424 0.4732 0.6626 0.0603  0.0554  -0.0293 59  ASN A OD1 
471  N ND2 . ASN A 77  ? 0.4072 0.4304 0.6473 0.0674  0.0232  -0.0005 59  ASN A ND2 
472  N N   . TYR A 78  ? 0.3053 0.3575 0.4643 0.0398  0.0739  -0.0298 60  TYR A N   
473  C CA  . TYR A 78  ? 0.2957 0.3381 0.4108 0.0313  0.0731  -0.0252 60  TYR A CA  
474  C C   . TYR A 78  ? 0.3077 0.3331 0.4130 0.0333  0.0669  -0.0259 60  TYR A C   
475  O O   . TYR A 78  ? 0.3159 0.3357 0.4339 0.0365  0.0741  -0.0390 60  TYR A O   
476  C CB  . TYR A 78  ? 0.3122 0.3595 0.4057 0.0227  0.0903  -0.0354 60  TYR A CB  
477  C CG  . TYR A 78  ? 0.2798 0.3434 0.3824 0.0181  0.0991  -0.0350 60  TYR A CG  
478  C CD1 . TYR A 78  ? 0.3294 0.3941 0.4146 0.0120  0.0932  -0.0222 60  TYR A CD1 
479  C CD2 . TYR A 78  ? 0.2782 0.3564 0.4097 0.0196  0.1144  -0.0484 60  TYR A CD2 
480  C CE1 . TYR A 78  ? 0.3543 0.4324 0.4490 0.0063  0.1012  -0.0215 60  TYR A CE1 
481  C CE2 . TYR A 78  ? 0.3209 0.4157 0.4629 0.0138  0.1235  -0.0479 60  TYR A CE2 
482  C CZ  . TYR A 78  ? 0.3611 0.4549 0.4836 0.0065  0.1163  -0.0338 60  TYR A CZ  
483  O OH  . TYR A 78  ? 0.4031 0.5118 0.5373 -0.0007 0.1251  -0.0329 60  TYR A OH  
484  N N   . ILE A 79  ? 0.2693 0.2867 0.3542 0.0309  0.0545  -0.0133 61  ILE A N   
485  C CA  . ILE A 79  ? 0.2953 0.2978 0.3729 0.0312  0.0482  -0.0126 61  ILE A CA  
486  C C   . ILE A 79  ? 0.2879 0.2869 0.3356 0.0251  0.0408  -0.0028 61  ILE A C   
487  O O   . ILE A 79  ? 0.2769 0.2822 0.3185 0.0238  0.0353  0.0072  61  ILE A O   
488  C CB  . ILE A 79  ? 0.3400 0.3359 0.4469 0.0388  0.0378  -0.0061 61  ILE A CB  
489  C CG1 . ILE A 79  ? 0.3929 0.3716 0.4948 0.0376  0.0329  -0.0059 61  ILE A CG1 
490  C CG2 . ILE A 79  ? 0.3309 0.3334 0.4397 0.0394  0.0250  0.0105  61  ILE A CG2 
491  C CD1 . ILE A 79  ? 0.4430 0.4112 0.5759 0.0447  0.0235  0.0006  61  ILE A CD1 
492  N N   . ALA A 80  ? 0.2635 0.2535 0.2949 0.0211  0.0410  -0.0073 62  ALA A N   
493  C CA  . ALA A 80  ? 0.2724 0.2610 0.2812 0.0159  0.0341  0.0006  62  ALA A CA  
494  C C   . ALA A 80  ? 0.2547 0.2432 0.2695 0.0173  0.0238  0.0137  62  ALA A C   
495  O O   . ALA A 80  ? 0.2876 0.2699 0.3184 0.0202  0.0192  0.0174  62  ALA A O   
496  C CB  . ALA A 80  ? 0.2648 0.2450 0.2619 0.0113  0.0341  -0.0070 62  ALA A CB  
497  N N   . GLY A 81  ? 0.2354 0.2302 0.2369 0.0147  0.0206  0.0207  63  GLY A N   
498  C CA  . GLY A 81  ? 0.2248 0.2219 0.2272 0.0142  0.0132  0.0309  63  GLY A CA  
499  C C   . GLY A 81  ? 0.3031 0.3025 0.2912 0.0099  0.0111  0.0334  63  GLY A C   
500  O O   . GLY A 81  ? 0.3000 0.2969 0.2808 0.0075  0.0120  0.0291  63  GLY A O   
501  N N   . GLY A 82  ? 0.3282 0.3338 0.3136 0.0088  0.0081  0.0393  64  GLY A N   
505  N N   . ALA A 83  ? 0.2340 0.2504 0.2625 -0.0291 0.0057  -0.0083 65  ALA A N   
506  C CA  . ALA A 83  ? 0.2328 0.2558 0.2624 -0.0333 0.0027  -0.0082 65  ALA A CA  
507  C C   . ALA A 83  ? 0.1981 0.2195 0.2204 -0.0368 0.0001  -0.0098 65  ALA A C   
508  O O   . ALA A 83  ? 0.2252 0.2414 0.2441 -0.0401 -0.0003 -0.0080 65  ALA A O   
509  C CB  . ALA A 83  ? 0.1391 0.1757 0.1759 -0.0347 0.0004  -0.0100 65  ALA A CB  
510  N N   . THR A 84  ? 0.1831 0.2086 0.2037 -0.0362 -0.0022 -0.0129 66  THR A N   
511  C CA  . THR A 84  ? 0.2038 0.2316 0.2202 -0.0403 -0.0058 -0.0151 66  THR A CA  
512  C C   . THR A 84  ? 0.2421 0.2544 0.2479 -0.0407 -0.0053 -0.0152 66  THR A C   
513  O O   . THR A 84  ? 0.2506 0.2595 0.2531 -0.0464 -0.0072 -0.0159 66  THR A O   
514  C CB  . THR A 84  ? 0.2201 0.2570 0.2383 -0.0377 -0.0094 -0.0185 66  THR A CB  
515  O OG1 . THR A 84  ? 0.1997 0.2499 0.2276 -0.0363 -0.0093 -0.0201 66  THR A OG1 
516  C CG2 . THR A 84  ? 0.1807 0.2235 0.1972 -0.0427 -0.0139 -0.0211 66  THR A CG2 
517  N N   . LEU A 85  ? 0.2356 0.2379 0.2355 -0.0352 -0.0022 -0.0147 67  LEU A N   
518  C CA  . LEU A 85  ? 0.2330 0.2206 0.2207 -0.0343 -0.0008 -0.0162 67  LEU A CA  
519  C C   . LEU A 85  ? 0.2327 0.2107 0.2208 -0.0357 0.0020  -0.0151 67  LEU A C   
520  O O   . LEU A 85  ? 0.2350 0.2020 0.2149 -0.0385 0.0006  -0.0178 67  LEU A O   
521  C CB  . LEU A 85  ? 0.2133 0.1940 0.1938 -0.0281 0.0036  -0.0152 67  LEU A CB  
522  C CG  . LEU A 85  ? 0.2445 0.2104 0.2101 -0.0260 0.0068  -0.0176 67  LEU A CG  
523  C CD1 . LEU A 85  ? 0.2335 0.1959 0.1880 -0.0301 0.0001  -0.0227 67  LEU A CD1 
524  C CD2 . LEU A 85  ? 0.2202 0.1818 0.1779 -0.0205 0.0124  -0.0154 67  LEU A CD2 
525  N N   . ASN A 86  ? 0.2134 0.1949 0.2111 -0.0336 0.0051  -0.0112 68  ASN A N   
526  C CA  . ASN A 86  ? 0.2323 0.2058 0.2321 -0.0335 0.0066  -0.0087 68  ASN A CA  
527  C C   . ASN A 86  ? 0.2814 0.2522 0.2790 -0.0411 0.0021  -0.0084 68  ASN A C   
528  O O   . ASN A 86  ? 0.2772 0.2325 0.2687 -0.0423 0.0021  -0.0093 68  ASN A O   
529  C CB  . ASN A 86  ? 0.2117 0.1945 0.2236 -0.0311 0.0079  -0.0042 68  ASN A CB  
530  C CG  . ASN A 86  ? 0.2513 0.2351 0.2682 -0.0246 0.0133  -0.0037 68  ASN A CG  
531  O OD1 . ASN A 86  ? 0.2865 0.2619 0.2964 -0.0211 0.0176  -0.0059 68  ASN A OD1 
532  N ND2 . ASN A 86  ? 0.1926 0.1874 0.2214 -0.0236 0.0132  -0.0008 68  ASN A ND2 
533  N N   . THR A 87  ? 0.2558 0.2414 0.2585 -0.0465 -0.0011 -0.0076 69  THR A N   
534  C CA  . THR A 87  ? 0.2536 0.2406 0.2560 -0.0553 -0.0043 -0.0061 69  THR A CA  
535  C C   . THR A 87  ? 0.2755 0.2542 0.2705 -0.0605 -0.0072 -0.0110 69  THR A C   
536  O O   . THR A 87  ? 0.3048 0.2705 0.2960 -0.0662 -0.0083 -0.0103 69  THR A O   
537  C CB  . THR A 87  ? 0.1808 0.1892 0.1906 -0.0591 -0.0057 -0.0053 69  THR A CB  
538  O OG1 . THR A 87  ? 0.2062 0.2207 0.2210 -0.0559 -0.0041 -0.0012 69  THR A OG1 
539  C CG2 . THR A 87  ? 0.1874 0.2004 0.1975 -0.0696 -0.0077 -0.0038 69  THR A CG2 
540  N N   . VAL A 88  ? 0.2676 0.2530 0.2604 -0.0588 -0.0091 -0.0159 70  VAL A N   
541  C CA  . VAL A 88  ? 0.2681 0.2494 0.2542 -0.0640 -0.0137 -0.0212 70  VAL A CA  
542  C C   . VAL A 88  ? 0.2818 0.2396 0.2554 -0.0624 -0.0127 -0.0247 70  VAL A C   
543  O O   . VAL A 88  ? 0.3173 0.2652 0.2861 -0.0699 -0.0162 -0.0282 70  VAL A O   
544  C CB  . VAL A 88  ? 0.2988 0.2934 0.2849 -0.0608 -0.0171 -0.0248 70  VAL A CB  
545  C CG1 . VAL A 88  ? 0.3033 0.2927 0.2800 -0.0648 -0.0230 -0.0309 70  VAL A CG1 
546  C CG2 . VAL A 88  ? 0.2767 0.2943 0.2759 -0.0633 -0.0187 -0.0234 70  VAL A CG2 
547  N N   . LYS A 89  ? 0.3124 0.2613 0.2812 -0.0531 -0.0076 -0.0245 71  LYS A N   
548  C CA  . LYS A 89  ? 0.3227 0.2502 0.2791 -0.0501 -0.0053 -0.0290 71  LYS A CA  
549  C C   . LYS A 89  ? 0.3205 0.2323 0.2792 -0.0521 -0.0040 -0.0268 71  LYS A C   
550  O O   . LYS A 89  ? 0.3549 0.2468 0.3040 -0.0532 -0.0045 -0.0321 71  LYS A O   
551  C CB  . LYS A 89  ? 0.3418 0.2664 0.2926 -0.0397 0.0011  -0.0295 71  LYS A CB  
552  C CG  . LYS A 89  ? 0.3397 0.2671 0.3014 -0.0332 0.0074  -0.0237 71  LYS A CG  
553  C CD  . LYS A 89  ? 0.3581 0.2863 0.3156 -0.0250 0.0142  -0.0241 71  LYS A CD  
554  C CE  . LYS A 89  ? 0.3656 0.2961 0.3351 -0.0186 0.0207  -0.0197 71  LYS A CE  
555  N NZ  . LYS A 89  ? 0.3694 0.3024 0.3365 -0.0122 0.0286  -0.0196 71  LYS A NZ  
556  N N   . MET A 90  ? 0.3163 0.2354 0.2864 -0.0525 -0.0029 -0.0192 72  MET A N   
557  C CA  . MET A 90  ? 0.2998 0.2034 0.2714 -0.0545 -0.0029 -0.0152 72  MET A CA  
558  C C   . MET A 90  ? 0.3157 0.2150 0.2859 -0.0676 -0.0081 -0.0151 72  MET A C   
559  O O   . MET A 90  ? 0.3552 0.2327 0.3209 -0.0709 -0.0090 -0.0154 72  MET A O   
560  C CB  . MET A 90  ? 0.2887 0.2010 0.2709 -0.0503 -0.0010 -0.0063 72  MET A CB  
561  C CG  . MET A 90  ? 0.3185 0.2122 0.3010 -0.0500 -0.0015 -0.0008 72  MET A CG  
562  S SD  . MET A 90  ? 0.3213 0.2253 0.3148 -0.0428 -0.0006 0.0095  72  MET A SD  
563  C CE  . MET A 90  ? 0.2922 0.1674 0.2830 -0.0399 -0.0019 0.0148  72  MET A CE  
564  N N   . ILE A 91  ? 0.3161 0.2361 0.2914 -0.0751 -0.0112 -0.0150 73  ILE A N   
565  C CA  . ILE A 91  ? 0.3311 0.2511 0.3071 -0.0888 -0.0157 -0.0159 73  ILE A CA  
566  C C   . ILE A 91  ? 0.3828 0.2832 0.3478 -0.0916 -0.0189 -0.0252 73  ILE A C   
567  O O   . ILE A 91  ? 0.3674 0.2504 0.3297 -0.1006 -0.0213 -0.0260 73  ILE A O   
568  C CB  . ILE A 91  ? 0.2733 0.2221 0.2578 -0.0944 -0.0182 -0.0167 73  ILE A CB  
569  C CG1 . ILE A 91  ? 0.2549 0.2223 0.2486 -0.0929 -0.0151 -0.0091 73  ILE A CG1 
570  C CG2 . ILE A 91  ? 0.2798 0.2309 0.2668 -0.1092 -0.0229 -0.0190 73  ILE A CG2 
571  C CD1 . ILE A 91  ? 0.2261 0.2222 0.2290 -0.0962 -0.0165 -0.0109 73  ILE A CD1 
572  N N   . GLN A 92  ? 0.3883 0.2908 0.3459 -0.0840 -0.0190 -0.0321 74  GLN A N   
573  C CA  . GLN A 92  ? 0.3579 0.2431 0.3017 -0.0849 -0.0220 -0.0422 74  GLN A CA  
574  C C   . GLN A 92  ? 0.3878 0.2424 0.3234 -0.0807 -0.0185 -0.0444 74  GLN A C   
575  O O   . GLN A 92  ? 0.4318 0.2662 0.3593 -0.0874 -0.0221 -0.0512 74  GLN A O   
576  C CB  . GLN A 92  ? 0.3209 0.2152 0.2563 -0.0759 -0.0215 -0.0470 74  GLN A CB  
577  C CG  . GLN A 92  ? 0.3858 0.2622 0.3025 -0.0747 -0.0237 -0.0579 74  GLN A CG  
578  C CD  . GLN A 92  ? 0.4434 0.3206 0.3573 -0.0875 -0.0334 -0.0649 74  GLN A CD  
579  O OE1 . GLN A 92  ? 0.4543 0.3544 0.3760 -0.0927 -0.0392 -0.0638 74  GLN A OE1 
580  N NE2 . GLN A 92  ? 0.4669 0.3190 0.3708 -0.0927 -0.0354 -0.0726 74  GLN A NE2 
581  N N   . TRP A 93  ? 0.3360 0.1873 0.2746 -0.0693 -0.0118 -0.0392 75  TRP A N   
582  C CA  . TRP A 93  ? 0.3570 0.1818 0.2908 -0.0621 -0.0078 -0.0406 75  TRP A CA  
583  C C   . TRP A 93  ? 0.4130 0.2199 0.3507 -0.0707 -0.0108 -0.0356 75  TRP A C   
584  O O   . TRP A 93  ? 0.4027 0.1814 0.3324 -0.0715 -0.0117 -0.0413 75  TRP A O   
585  C CB  . TRP A 93  ? 0.4197 0.2529 0.3611 -0.0487 -0.0008 -0.0346 75  TRP A CB  
586  C CG  . TRP A 93  ? 0.4203 0.2323 0.3606 -0.0378 0.0043  -0.0357 75  TRP A CG  
587  C CD1 . TRP A 93  ? 0.4106 0.2094 0.3407 -0.0282 0.0096  -0.0449 75  TRP A CD1 
588  C CD2 . TRP A 93  ? 0.3867 0.1904 0.3369 -0.0338 0.0048  -0.0269 75  TRP A CD2 
589  N NE1 . TRP A 93  ? 0.4069 0.1901 0.3421 -0.0180 0.0137  -0.0432 75  TRP A NE1 
590  C CE2 . TRP A 93  ? 0.3941 0.1796 0.3418 -0.0210 0.0102  -0.0317 75  TRP A CE2 
591  C CE3 . TRP A 93  ? 0.3837 0.1939 0.3436 -0.0394 0.0013  -0.0153 75  TRP A CE3 
592  C CZ2 . TRP A 93  ? 0.4455 0.2193 0.4021 -0.0129 0.0110  -0.0249 75  TRP A CZ2 
593  C CZ3 . TRP A 93  ? 0.3822 0.1799 0.3483 -0.0322 0.0018  -0.0078 75  TRP A CZ3 
594  C CH2 . TRP A 93  ? 0.4388 0.2184 0.4042 -0.0187 0.0062  -0.0125 75  TRP A CH2 
595  N N   . ILE A 94  ? 0.3793 0.2017 0.3282 -0.0774 -0.0123 -0.0251 76  ILE A N   
596  C CA  . ILE A 94  ? 0.4129 0.2205 0.3647 -0.0872 -0.0148 -0.0178 76  ILE A CA  
597  C C   . ILE A 94  ? 0.4495 0.2440 0.3959 -0.1021 -0.0202 -0.0247 76  ILE A C   
598  O O   . ILE A 94  ? 0.5152 0.2794 0.4563 -0.1058 -0.0217 -0.0260 76  ILE A O   
599  C CB  . ILE A 94  ? 0.3964 0.2274 0.3589 -0.0926 -0.0147 -0.0057 76  ILE A CB  
600  C CG1 . ILE A 94  ? 0.3620 0.2008 0.3298 -0.0790 -0.0108 0.0015  76  ILE A CG1 
601  C CG2 . ILE A 94  ? 0.4108 0.2281 0.3741 -0.1062 -0.0172 0.0024  76  ILE A CG2 
602  C CD1 . ILE A 94  ? 0.3559 0.2189 0.3315 -0.0828 -0.0108 0.0116  76  ILE A CD1 
603  N N   . ILE A 95  ? 0.4339 0.2509 0.3824 -0.1105 -0.0237 -0.0293 77  ILE A N   
604  C CA  . ILE A 95  ? 0.4410 0.2525 0.3880 -0.1266 -0.0300 -0.0355 77  ILE A CA  
605  C C   . ILE A 95  ? 0.4696 0.2544 0.4019 -0.1247 -0.0328 -0.0494 77  ILE A C   
606  O O   . ILE A 95  ? 0.4570 0.2223 0.3860 -0.1372 -0.0376 -0.0545 77  ILE A O   
607  C CB  . ILE A 95  ? 0.4408 0.2879 0.3968 -0.1346 -0.0336 -0.0366 77  ILE A CB  
608  C CG1 . ILE A 95  ? 0.4263 0.2967 0.3956 -0.1376 -0.0300 -0.0238 77  ILE A CG1 
609  C CG2 . ILE A 95  ? 0.3985 0.2436 0.3553 -0.1514 -0.0409 -0.0440 77  ILE A CG2 
610  C CD1 . ILE A 95  ? 0.4242 0.3304 0.4049 -0.1444 -0.0324 -0.0246 77  ILE A CD1 
611  N N   . GLN A 96  ? 0.5071 0.2910 0.4302 -0.1096 -0.0294 -0.0557 78  GLN A N   
612  C CA  . GLN A 96  ? 0.6051 0.3612 0.5117 -0.1040 -0.0294 -0.0685 78  GLN A CA  
613  C C   . GLN A 96  ? 0.6434 0.3976 0.5403 -0.1153 -0.0377 -0.0815 78  GLN A C   
614  O O   . GLN A 96  ? 0.7115 0.4390 0.5934 -0.1145 -0.0393 -0.0936 78  GLN A O   
615  C CB  . GLN A 96  ? 0.6614 0.3820 0.5665 -0.1023 -0.0271 -0.0667 78  GLN A CB  
616  C CG  . GLN A 96  ? 0.7248 0.4208 0.6173 -0.0867 -0.0218 -0.0760 78  GLN A CG  
617  C CD  . GLN A 96  ? 0.8345 0.4933 0.7267 -0.0851 -0.0209 -0.0746 78  GLN A CD  
618  O OE1 . GLN A 96  ? 0.8329 0.4852 0.7344 -0.0950 -0.0236 -0.0638 78  GLN A OE1 
619  N NE2 . GLN A 96  ? 0.8882 0.5219 0.7691 -0.0723 -0.0167 -0.0853 78  GLN A NE2 
620  N N   . LYS A 97  ? 0.5906 0.3735 0.4963 -0.1256 -0.0435 -0.0797 79  LYS A N   
621  C CA  . LYS A 97  ? 0.5450 0.3333 0.4429 -0.1347 -0.0527 -0.0916 79  LYS A CA  
622  C C   . LYS A 97  ? 0.5149 0.3283 0.4070 -0.1241 -0.0530 -0.0935 79  LYS A C   
623  O O   . LYS A 97  ? 0.4553 0.2958 0.3600 -0.1205 -0.0508 -0.0841 79  LYS A O   
624  C CB  . LYS A 97  ? 0.5181 0.3229 0.4318 -0.1540 -0.0600 -0.0888 79  LYS A CB  
625  C CG  . LYS A 97  ? 0.5648 0.3846 0.4770 -0.1594 -0.0697 -0.0996 79  LYS A CG  
626  C CD  . LYS A 97  ? 0.6040 0.4528 0.5393 -0.1726 -0.0747 -0.0948 79  LYS A CD  
627  C CE  . LYS A 97  ? 0.6588 0.5219 0.5937 -0.1766 -0.0854 -0.1061 79  LYS A CE  
628  N NZ  . LYS A 97  ? 0.6971 0.5898 0.6567 -0.1886 -0.0900 -0.1022 79  LYS A NZ  
629  N N   . PRO A 98  ? 0.5343 0.3373 0.4060 -0.1192 -0.0558 -0.1057 80  PRO A N   
630  C CA  . PRO A 98  ? 0.4554 0.2773 0.3175 -0.1081 -0.0554 -0.1064 80  PRO A CA  
631  C C   . PRO A 98  ? 0.5068 0.3632 0.3816 -0.1138 -0.0633 -0.1021 80  PRO A C   
632  O O   . PRO A 98  ? 0.5304 0.3946 0.4114 -0.1275 -0.0731 -0.1067 80  PRO A O   
633  C CB  . PRO A 98  ? 0.4902 0.2929 0.3262 -0.1066 -0.0595 -0.1218 80  PRO A CB  
634  C CG  . PRO A 98  ? 0.5197 0.2876 0.3512 -0.1111 -0.0576 -0.1288 80  PRO A CG  
635  C CD  . PRO A 98  ? 0.5367 0.3079 0.3916 -0.1241 -0.0596 -0.1197 80  PRO A CD  
636  N N   . PHE A 99  ? 0.4926 0.3692 0.3729 -0.1033 -0.0588 -0.0933 81  PHE A N   
637  C CA  . PHE A 99  ? 0.4684 0.3762 0.3578 -0.1038 -0.0656 -0.0900 81  PHE A CA  
638  C C   . PHE A 99  ? 0.4247 0.3550 0.3400 -0.1138 -0.0680 -0.0833 81  PHE A C   
639  O O   . PHE A 99  ? 0.4186 0.3756 0.3442 -0.1155 -0.0748 -0.0824 81  PHE A O   
640  C CB  . PHE A 99  ? 0.4923 0.4036 0.3664 -0.1071 -0.0774 -0.1003 81  PHE A CB  
641  C CG  . PHE A 99  ? 0.5205 0.4077 0.3657 -0.0996 -0.0751 -0.1090 81  PHE A CG  
642  C CD1 . PHE A 99  ? 0.5597 0.4307 0.3889 -0.1077 -0.0830 -0.1225 81  PHE A CD1 
643  C CD2 . PHE A 99  ? 0.5226 0.4038 0.3566 -0.0851 -0.0646 -0.1042 81  PHE A CD2 
644  C CE1 . PHE A 99  ? 0.5970 0.4462 0.3976 -0.1002 -0.0801 -0.1317 81  PHE A CE1 
645  C CE2 . PHE A 99  ? 0.5595 0.4207 0.3667 -0.0781 -0.0608 -0.1123 81  PHE A CE2 
646  C CZ  . PHE A 99  ? 0.5997 0.4448 0.3891 -0.0851 -0.0684 -0.1264 81  PHE A CZ  
647  N N   . VAL A 100 ? 0.3927 0.3131 0.3184 -0.1196 -0.0622 -0.0784 82  VAL A N   
648  C CA  . VAL A 100 ? 0.3648 0.3074 0.3133 -0.1287 -0.0623 -0.0710 82  VAL A CA  
649  C C   . VAL A 100 ? 0.3561 0.3227 0.3151 -0.1181 -0.0577 -0.0628 82  VAL A C   
650  O O   . VAL A 100 ? 0.3371 0.3306 0.3134 -0.1226 -0.0597 -0.0596 82  VAL A O   
651  C CB  . VAL A 100 ? 0.6922 0.6168 0.6466 -0.1375 -0.0570 -0.0659 82  VAL A CB  
652  C CG1 . VAL A 100 ? 0.7035 0.6100 0.6517 -0.1250 -0.0473 -0.0599 82  VAL A CG1 
653  C CG2 . VAL A 100 ? 0.6711 0.6203 0.6468 -0.1482 -0.0564 -0.0583 82  VAL A CG2 
654  N N   . CYS A 101 ? 0.3480 0.3053 0.2971 -0.1042 -0.0513 -0.0602 83  CYS A N   
655  C CA  . CYS A 101 ? 0.3508 0.3266 0.3090 -0.0946 -0.0470 -0.0531 83  CYS A CA  
656  C C   . CYS A 101 ? 0.4117 0.3945 0.3608 -0.0840 -0.0499 -0.0548 83  CYS A C   
657  O O   . CYS A 101 ? 0.4164 0.3838 0.3469 -0.0800 -0.0511 -0.0598 83  CYS A O   
658  C CB  . CYS A 101 ? 0.2993 0.2632 0.2583 -0.0880 -0.0371 -0.0463 83  CYS A CB  
659  S SG  . CYS A 101 ? 0.4383 0.3971 0.4085 -0.0983 -0.0336 -0.0402 83  CYS A SG  
660  N N   . SER A 102 ? 0.3949 0.4001 0.3563 -0.0793 -0.0506 -0.0506 84  SER A N   
661  C CA  . SER A 102 ? 0.3456 0.3573 0.3003 -0.0689 -0.0535 -0.0500 84  SER A CA  
662  C C   . SER A 102 ? 0.3413 0.3568 0.3031 -0.0597 -0.0459 -0.0429 84  SER A C   
663  O O   . SER A 102 ? 0.2862 0.3120 0.2634 -0.0621 -0.0422 -0.0397 84  SER A O   
664  C CB  . SER A 102 ? 0.3014 0.3373 0.2662 -0.0712 -0.0640 -0.0525 84  SER A CB  
665  O OG  . SER A 102 ? 0.3044 0.3386 0.2623 -0.0797 -0.0728 -0.0598 84  SER A OG  
666  N N   . TYR A 103 ? 0.3333 0.3402 0.2829 -0.0500 -0.0437 -0.0406 85  TYR A N   
667  C CA  . TYR A 103 ? 0.3082 0.3171 0.2643 -0.0422 -0.0372 -0.0344 85  TYR A CA  
668  C C   . TYR A 103 ? 0.3314 0.3421 0.2804 -0.0332 -0.0404 -0.0316 85  TYR A C   
669  O O   . TYR A 103 ? 0.2975 0.2985 0.2280 -0.0307 -0.0431 -0.0325 85  TYR A O   
670  C CB  . TYR A 103 ? 0.3029 0.2949 0.2536 -0.0401 -0.0273 -0.0319 85  TYR A CB  
671  C CG  . TYR A 103 ? 0.2767 0.2707 0.2351 -0.0337 -0.0211 -0.0261 85  TYR A CG  
672  C CD1 . TYR A 103 ? 0.2390 0.2429 0.2137 -0.0355 -0.0187 -0.0241 85  TYR A CD1 
673  C CD2 . TYR A 103 ? 0.2861 0.2719 0.2345 -0.0267 -0.0176 -0.0227 85  TYR A CD2 
674  C CE1 . TYR A 103 ? 0.2418 0.2470 0.2234 -0.0306 -0.0139 -0.0203 85  TYR A CE1 
675  C CE2 . TYR A 103 ? 0.2371 0.2238 0.1937 -0.0226 -0.0121 -0.0178 85  TYR A CE2 
676  C CZ  . TYR A 103 ? 0.2508 0.2470 0.2244 -0.0246 -0.0108 -0.0173 85  TYR A CZ  
677  O OH  . TYR A 103 ? 0.2262 0.2230 0.2080 -0.0213 -0.0064 -0.0137 85  TYR A OH  
678  N N   . VAL A 104 ? 0.3174 0.3390 0.2797 -0.0284 -0.0400 -0.0281 86  VAL A N   
679  C CA  . VAL A 104 ? 0.2819 0.3024 0.2396 -0.0193 -0.0424 -0.0238 86  VAL A CA  
680  C C   . VAL A 104 ? 0.2938 0.3081 0.2578 -0.0149 -0.0341 -0.0188 86  VAL A C   
681  O O   . VAL A 104 ? 0.2429 0.2654 0.2225 -0.0168 -0.0310 -0.0198 86  VAL A O   
682  C CB  . VAL A 104 ? 0.2874 0.3274 0.2575 -0.0163 -0.0520 -0.0254 86  VAL A CB  
683  C CG1 . VAL A 104 ? 0.2795 0.3161 0.2479 -0.0056 -0.0539 -0.0199 86  VAL A CG1 
684  C CG2 . VAL A 104 ? 0.2735 0.3214 0.2376 -0.0206 -0.0620 -0.0301 86  VAL A CG2 
685  N N   . GLY A 105 ? 0.3338 0.3339 0.2849 -0.0098 -0.0306 -0.0135 87  GLY A N   
686  C CA  . GLY A 105 ? 0.3059 0.2995 0.2633 -0.0067 -0.0235 -0.0087 87  GLY A CA  
687  C C   . GLY A 105 ? 0.3555 0.3356 0.2980 -0.0011 -0.0223 -0.0017 87  GLY A C   
688  O O   . GLY A 105 ? 0.4026 0.3781 0.3273 0.0006  -0.0264 -0.0006 87  GLY A O   
689  N N   . CYS A 106 ? 0.3326 0.3059 0.2813 0.0010  -0.0170 0.0033  88  CYS A N   
690  C CA  . CYS A 106 ? 0.3291 0.2877 0.2638 0.0051  -0.0147 0.0118  88  CYS A CA  
691  C C   . CYS A 106 ? 0.3435 0.2920 0.2743 0.0017  -0.0026 0.0162  88  CYS A C   
692  O O   . CYS A 106 ? 0.3544 0.3042 0.3008 -0.0011 0.0029  0.0159  88  CYS A O   
693  C CB  . CYS A 106 ? 0.3257 0.2817 0.2695 0.0109  -0.0194 0.0155  88  CYS A CB  
694  S SG  . CYS A 106 ? 0.3797 0.3152 0.3042 0.0159  -0.0185 0.0282  88  CYS A SG  
695  N N   . ILE A 107 ? 0.3447 0.2847 0.2546 0.0020  0.0014  0.0198  89  ILE A N   
696  C CA  . ILE A 107 ? 0.3172 0.2494 0.2224 -0.0005 0.0140  0.0245  89  ILE A CA  
697  C C   . ILE A 107 ? 0.3796 0.2986 0.2689 0.0020  0.0165  0.0354  89  ILE A C   
698  O O   . ILE A 107 ? 0.3928 0.3076 0.2712 0.0067  0.0075  0.0391  89  ILE A O   
699  C CB  . ILE A 107 ? 0.3254 0.2576 0.2173 -0.0019 0.0195  0.0197  89  ILE A CB  
700  C CG1 . ILE A 107 ? 0.3242 0.2522 0.1906 0.0010  0.0127  0.0188  89  ILE A CG1 
701  C CG2 . ILE A 107 ? 0.2765 0.2182 0.1840 -0.0049 0.0183  0.0108  89  ILE A CG2 
702  C CD1 . ILE A 107 ? 0.3329 0.2571 0.1815 0.0002  0.0190  0.0136  89  ILE A CD1 
703  N N   . GLY A 108 ? 0.3480 0.2613 0.2367 -0.0012 0.0288  0.0414  90  GLY A N   
704  C CA  . GLY A 108 ? 0.3753 0.2753 0.2465 -0.0005 0.0336  0.0531  90  GLY A CA  
705  C C   . GLY A 108 ? 0.4506 0.3475 0.2932 0.0008  0.0386  0.0544  90  GLY A C   
706  O O   . GLY A 108 ? 0.4437 0.3476 0.2821 0.0010  0.0390  0.0450  90  GLY A O   
707  N N   . ALA A 109 ? 0.4793 0.3642 0.3007 0.0017  0.0423  0.0659  91  ALA A N   
708  C CA  . ALA A 109 ? 0.5113 0.3928 0.3017 0.0030  0.0483  0.0675  91  ALA A CA  
709  C C   . ALA A 109 ? 0.5121 0.3955 0.3041 -0.0017 0.0670  0.0702  91  ALA A C   
710  O O   . ALA A 109 ? 0.5910 0.4665 0.3650 -0.0032 0.0765  0.0811  91  ALA A O   
711  C CB  . ALA A 109 ? 0.5409 0.4093 0.3039 0.0068  0.0424  0.0796  91  ALA A CB  
712  N N   . ASP A 110 ? 0.4549 0.3497 0.2691 -0.0039 0.0722  0.0606  92  ASP A N   
713  C CA  . ASP A 110 ? 0.4425 0.3435 0.2645 -0.0074 0.0894  0.0615  92  ASP A CA  
714  C C   . ASP A 110 ? 0.4293 0.3392 0.2524 -0.0046 0.0928  0.0484  92  ASP A C   
715  O O   . ASP A 110 ? 0.4204 0.3299 0.2384 -0.0016 0.0817  0.0391  92  ASP A O   
716  C CB  . ASP A 110 ? 0.4363 0.3425 0.2914 -0.0131 0.0930  0.0651  92  ASP A CB  
717  C CG  . ASP A 110 ? 0.4441 0.3560 0.3233 -0.0126 0.0802  0.0569  92  ASP A CG  
718  O OD1 . ASP A 110 ? 0.4419 0.3547 0.3434 -0.0167 0.0790  0.0598  92  ASP A OD1 
719  O OD2 . ASP A 110 ? 0.4218 0.3371 0.2972 -0.0088 0.0718  0.0475  92  ASP A OD2 
720  N N   . ILE A 111 ? 0.4252 0.3428 0.2558 -0.0057 0.1082  0.0475  93  ILE A N   
721  C CA  . ILE A 111 ? 0.4142 0.3379 0.2458 -0.0016 0.1125  0.0353  93  ILE A CA  
722  C C   . ILE A 111 ? 0.3936 0.3235 0.2519 -0.0013 0.1028  0.0268  93  ILE A C   
723  O O   . ILE A 111 ? 0.3916 0.3200 0.2451 0.0022  0.0987  0.0164  93  ILE A O   
724  C CB  . ILE A 111 ? 0.4423 0.3754 0.2791 -0.0013 0.1320  0.0362  93  ILE A CB  
725  C CG1 . ILE A 111 ? 0.4137 0.3486 0.2439 0.0054  0.1363  0.0229  93  ILE A CG1 
726  C CG2 . ILE A 111 ? 0.4028 0.3486 0.2764 -0.0062 0.1370  0.0407  93  ILE A CG2 
727  C CD1 . ILE A 111 ? 0.4232 0.3696 0.2608 0.0078  0.1555  0.0220  93  ILE A CD1 
728  N N   . GLN A 112 ? 0.3455 0.2810 0.2299 -0.0055 0.0991  0.0313  94  GLN A N   
729  C CA  . GLN A 112 ? 0.3899 0.3320 0.2979 -0.0058 0.0901  0.0246  94  GLN A CA  
730  C C   . GLN A 112 ? 0.3894 0.3252 0.2863 -0.0043 0.0755  0.0190  94  GLN A C   
731  O O   . GLN A 112 ? 0.3567 0.2944 0.2588 -0.0029 0.0706  0.0107  94  GLN A O   
732  C CB  . GLN A 112 ? 0.3677 0.3160 0.3017 -0.0109 0.0880  0.0301  94  GLN A CB  
733  C CG  . GLN A 112 ? 0.2981 0.2569 0.2511 -0.0141 0.1010  0.0342  94  GLN A CG  
734  C CD  . GLN A 112 ? 0.3590 0.3127 0.3011 -0.0178 0.1110  0.0448  94  GLN A CD  
735  O OE1 . GLN A 112 ? 0.3395 0.2804 0.2565 -0.0169 0.1085  0.0494  94  GLN A OE1 
736  N NE2 . GLN A 112 ? 0.3406 0.3050 0.3021 -0.0226 0.1222  0.0492  94  GLN A NE2 
737  N N   . GLY A 113 ? 0.3677 0.2963 0.2498 -0.0046 0.0684  0.0241  95  GLY A N   
738  C CA  . GLY A 113 ? 0.3716 0.2975 0.2451 -0.0032 0.0543  0.0193  95  GLY A CA  
739  C C   . GLY A 113 ? 0.4317 0.3532 0.2839 -0.0008 0.0533  0.0111  95  GLY A C   
740  O O   . GLY A 113 ? 0.4052 0.3280 0.2601 -0.0014 0.0445  0.0031  95  GLY A O   
741  N N   . LYS A 114 ? 0.4525 0.3684 0.2829 0.0013  0.0630  0.0128  96  LYS A N   
742  C CA  . LYS A 114 ? 0.4655 0.3755 0.2727 0.0038  0.0628  0.0036  96  LYS A CA  
743  C C   . LYS A 114 ? 0.4538 0.3654 0.2747 0.0047  0.0668  -0.0064 96  LYS A C   
744  O O   . LYS A 114 ? 0.4776 0.3839 0.2901 0.0049  0.0599  -0.0162 96  LYS A O   
745  C CB  . LYS A 114 ? 0.4715 0.3757 0.2500 0.0063  0.0735  0.0073  96  LYS A CB  
746  C CG  . LYS A 114 ? 0.4899 0.3865 0.2397 0.0090  0.0714  -0.0036 96  LYS A CG  
747  C CD  . LYS A 114 ? 0.5191 0.4099 0.2345 0.0113  0.0792  0.0008  96  LYS A CD  
748  C CE  . LYS A 114 ? 0.5379 0.4208 0.2231 0.0135  0.0737  -0.0117 96  LYS A CE  
749  N NZ  . LYS A 114 ? 0.6107 0.4882 0.2576 0.0159  0.0802  -0.0081 96  LYS A NZ  
750  N N   . TYR A 115 ? 0.4457 0.3644 0.2884 0.0051  0.0771  -0.0038 97  TYR A N   
751  C CA  . TYR A 115 ? 0.4496 0.3700 0.3081 0.0072  0.0798  -0.0116 97  TYR A CA  
752  C C   . TYR A 115 ? 0.4401 0.3609 0.3124 0.0040  0.0661  -0.0153 97  TYR A C   
753  O O   . TYR A 115 ? 0.3330 0.2472 0.2027 0.0048  0.0627  -0.0238 97  TYR A O   
754  C CB  . TYR A 115 ? 0.4480 0.3796 0.3308 0.0083  0.0914  -0.0069 97  TYR A CB  
755  C CG  . TYR A 115 ? 0.4251 0.3613 0.3322 0.0095  0.0887  -0.0112 97  TYR A CG  
756  C CD1 . TYR A 115 ? 0.4808 0.4101 0.3845 0.0147  0.0910  -0.0202 97  TYR A CD1 
757  C CD2 . TYR A 115 ? 0.3994 0.3454 0.3314 0.0058  0.0834  -0.0062 97  TYR A CD2 
758  C CE1 . TYR A 115 ? 0.4798 0.4114 0.4046 0.0163  0.0877  -0.0224 97  TYR A CE1 
759  C CE2 . TYR A 115 ? 0.4104 0.3607 0.3621 0.0070  0.0801  -0.0089 97  TYR A CE2 
760  C CZ  . TYR A 115 ? 0.4422 0.3851 0.3904 0.0124  0.0821  -0.0161 97  TYR A CZ  
761  O OH  . TYR A 115 ? 0.4575 0.4030 0.4243 0.0141  0.0782  -0.0170 97  TYR A OH  
762  N N   . ILE A 116 ? 0.3790 0.3068 0.2652 0.0002  0.0589  -0.0092 98  ILE A N   
763  C CA  . ILE A 116 ? 0.3644 0.2951 0.2628 -0.0033 0.0470  -0.0120 98  ILE A CA  
764  C C   . ILE A 116 ? 0.4087 0.3323 0.2888 -0.0049 0.0372  -0.0186 98  ILE A C   
765  O O   . ILE A 116 ? 0.3810 0.3024 0.2656 -0.0074 0.0317  -0.0247 98  ILE A O   
766  C CB  . ILE A 116 ? 0.2943 0.2341 0.2092 -0.0062 0.0418  -0.0054 98  ILE A CB  
767  C CG1 . ILE A 116 ? 0.2735 0.2211 0.2099 -0.0063 0.0494  -0.0011 98  ILE A CG1 
768  C CG2 . ILE A 116 ? 0.2970 0.2414 0.2207 -0.0096 0.0303  -0.0089 98  ILE A CG2 
769  C CD1 . ILE A 116 ? 0.2729 0.2266 0.2226 -0.0090 0.0460  0.0047  98  ILE A CD1 
770  N N   . LYS A 117 ? 0.4615 0.3818 0.3208 -0.0039 0.0348  -0.0170 99  LYS A N   
771  C CA  . LYS A 117 ? 0.4705 0.3860 0.3119 -0.0057 0.0244  -0.0237 99  LYS A CA  
772  C C   . LYS A 117 ? 0.4507 0.3549 0.2789 -0.0052 0.0274  -0.0342 99  LYS A C   
773  O O   . LYS A 117 ? 0.4482 0.3491 0.2754 -0.0093 0.0185  -0.0416 99  LYS A O   
774  C CB  . LYS A 117 ? 0.5068 0.4208 0.3262 -0.0036 0.0207  -0.0192 99  LYS A CB  
775  C CG  . LYS A 117 ? 0.5705 0.4832 0.3737 -0.0058 0.0073  -0.0261 99  LYS A CG  
776  C CD  . LYS A 117 ? 0.6553 0.5645 0.4308 -0.0024 0.0043  -0.0220 99  LYS A CD  
777  C CE  . LYS A 117 ? 0.7103 0.6252 0.4933 0.0001  0.0016  -0.0097 99  LYS A CE  
778  N NZ  . LYS A 117 ? 0.7821 0.6918 0.5366 0.0040  -0.0017 -0.0035 99  LYS A NZ  
779  N N   . ASN A 118 ? 0.4357 0.3340 0.2544 -0.0003 0.0401  -0.0351 100 ASN A N   
780  C CA  . ASN A 118 ? 0.4735 0.3594 0.2795 0.0020  0.0443  -0.0462 100 ASN A CA  
781  C C   . ASN A 118 ? 0.4813 0.3640 0.3083 0.0007  0.0431  -0.0504 100 ASN A C   
782  O O   . ASN A 118 ? 0.5147 0.3846 0.3337 -0.0003 0.0401  -0.0602 100 ASN A O   
783  C CB  . ASN A 118 ? 0.4696 0.3527 0.2635 0.0087  0.0601  -0.0462 100 ASN A CB  
784  C CG  . ASN A 118 ? 0.5707 0.4529 0.3359 0.0098  0.0617  -0.0431 100 ASN A CG  
785  O OD1 . ASN A 118 ? 0.5942 0.4747 0.3440 0.0067  0.0496  -0.0438 100 ASN A OD1 
786  N ND2 . ASN A 118 ? 0.6179 0.5023 0.3760 0.0143  0.0768  -0.0389 100 ASN A ND2 
787  N N   . ASP A 119 ? 0.4628 0.3560 0.3157 0.0004  0.0452  -0.0427 101 ASP A N   
788  C CA  . ASP A 119 ? 0.4910 0.3825 0.3638 -0.0006 0.0436  -0.0440 101 ASP A CA  
789  C C   . ASP A 119 ? 0.4957 0.3844 0.3693 -0.0085 0.0304  -0.0473 101 ASP A C   
790  O O   . ASP A 119 ? 0.4935 0.3711 0.3693 -0.0104 0.0278  -0.0527 101 ASP A O   
791  C CB  . ASP A 119 ? 0.5367 0.4425 0.4346 0.0000  0.0470  -0.0346 101 ASP A CB  
792  C CG  . ASP A 119 ? 0.5981 0.5026 0.5147 0.0010  0.0468  -0.0347 101 ASP A CG  
793  O OD1 . ASP A 119 ? 0.6887 0.5851 0.6052 0.0074  0.0541  -0.0387 101 ASP A OD1 
794  O OD2 . ASP A 119 ? 0.5457 0.4572 0.4766 -0.0039 0.0397  -0.0306 101 ASP A OD2 
795  N N   . CYS A 120 ? 0.4645 0.3633 0.3371 -0.0130 0.0222  -0.0438 102 CYS A N   
796  C CA  . CYS A 120 ? 0.4335 0.3344 0.3085 -0.0210 0.0101  -0.0468 102 CYS A CA  
797  C C   . CYS A 120 ? 0.4655 0.3525 0.3205 -0.0241 0.0049  -0.0574 102 CYS A C   
798  O O   . CYS A 120 ? 0.4160 0.2967 0.2754 -0.0308 -0.0011 -0.0623 102 CYS A O   
799  C CB  . CYS A 120 ? 0.3783 0.2945 0.2567 -0.0229 0.0031  -0.0415 102 CYS A CB  
800  S SG  . CYS A 120 ? 0.3681 0.2996 0.2714 -0.0216 0.0062  -0.0316 102 CYS A SG  
801  N N   . SER A 121 ? 0.4773 0.3592 0.3095 -0.0199 0.0071  -0.0610 103 SER A N   
802  C CA  . SER A 121 ? 0.5394 0.4079 0.3492 -0.0225 0.0019  -0.0725 103 SER A CA  
803  C C   . SER A 121 ? 0.5393 0.3883 0.3475 -0.0214 0.0074  -0.0810 103 SER A C   
804  O O   . SER A 121 ? 0.5485 0.3849 0.3488 -0.0274 0.0002  -0.0907 103 SER A O   
805  C CB  . SER A 121 ? 0.5818 0.4488 0.3644 -0.0172 0.0045  -0.0738 103 SER A CB  
806  O OG  . SER A 121 ? 0.6413 0.5232 0.4239 -0.0182 -0.0031 -0.0661 103 SER A OG  
807  N N   . ALA A 122 ? 0.5161 0.3627 0.3330 -0.0136 0.0196  -0.0775 104 ALA A N   
808  C CA  . ALA A 122 ? 0.5503 0.3788 0.3688 -0.0099 0.0253  -0.0845 104 ALA A CA  
809  C C   . ALA A 122 ? 0.5538 0.3763 0.3893 -0.0177 0.0174  -0.0838 104 ALA A C   
810  O O   . ALA A 122 ? 0.5404 0.3426 0.3727 -0.0180 0.0171  -0.0915 104 ALA A O   
811  C CB  . ALA A 122 ? 0.5395 0.3723 0.3692 0.0004  0.0391  -0.0793 104 ALA A CB  
812  N N   . LEU A 123 ? 0.5328 0.3725 0.3857 -0.0239 0.0114  -0.0745 105 LEU A N   
813  C CA  . LEU A 123 ? 0.5517 0.3893 0.4209 -0.0321 0.0051  -0.0716 105 LEU A CA  
814  C C   . LEU A 123 ? 0.5605 0.3988 0.4252 -0.0445 -0.0070 -0.0765 105 LEU A C   
815  O O   . LEU A 123 ? 0.5520 0.3906 0.4298 -0.0534 -0.0122 -0.0735 105 LEU A O   
816  C CB  . LEU A 123 ? 0.5260 0.3829 0.4172 -0.0317 0.0066  -0.0593 105 LEU A CB  
817  C CG  . LEU A 123 ? 0.5151 0.3716 0.4176 -0.0220 0.0163  -0.0539 105 LEU A CG  
818  C CD1 . LEU A 123 ? 0.5127 0.3905 0.4335 -0.0222 0.0166  -0.0434 105 LEU A CD1 
819  C CD2 . LEU A 123 ? 0.5291 0.3665 0.4364 -0.0215 0.0167  -0.0554 105 LEU A CD2 
820  N N   . ASP A 124 ? 0.5344 0.3740 0.3807 -0.0454 -0.0116 -0.0835 106 ASP A N   
821  C CA  . ASP A 124 ? 0.5348 0.3804 0.3780 -0.0567 -0.0243 -0.0883 106 ASP A CA  
822  C C   . ASP A 124 ? 0.4904 0.3622 0.3532 -0.0619 -0.0298 -0.0791 106 ASP A C   
823  O O   . ASP A 124 ? 0.4870 0.3665 0.3578 -0.0728 -0.0389 -0.0809 106 ASP A O   
824  C CB  . ASP A 124 ? 0.5908 0.4164 0.4333 -0.0667 -0.0294 -0.0965 106 ASP A CB  
825  C CG  . ASP A 124 ? 0.6495 0.4481 0.4702 -0.0618 -0.0257 -0.1088 106 ASP A CG  
826  O OD1 . ASP A 124 ? 0.6440 0.4432 0.4450 -0.0542 -0.0230 -0.1137 106 ASP A OD1 
827  O OD2 . ASP A 124 ? 0.6950 0.4708 0.5173 -0.0653 -0.0253 -0.1136 106 ASP A OD2 
828  N N   . LEU A 125 ? 0.4337 0.3193 0.3048 -0.0541 -0.0238 -0.0699 107 LEU A N   
829  C CA  . LEU A 125 ? 0.4595 0.3691 0.3470 -0.0564 -0.0281 -0.0624 107 LEU A CA  
830  C C   . LEU A 125 ? 0.4784 0.3997 0.3550 -0.0536 -0.0345 -0.0634 107 LEU A C   
831  O O   . LEU A 125 ? 0.5500 0.4678 0.4132 -0.0450 -0.0297 -0.0616 107 LEU A O   
832  C CB  . LEU A 125 ? 0.4443 0.3607 0.3458 -0.0497 -0.0194 -0.0530 107 LEU A CB  
833  C CG  . LEU A 125 ? 0.4400 0.3790 0.3576 -0.0496 -0.0216 -0.0459 107 LEU A CG  
834  C CD1 . LEU A 125 ? 0.4233 0.3740 0.3554 -0.0597 -0.0280 -0.0459 107 LEU A CD1 
835  C CD2 . LEU A 125 ? 0.4376 0.3791 0.3656 -0.0432 -0.0130 -0.0386 107 LEU A CD2 
836  N N   . VAL A 126 ? 0.4442 0.3798 0.3267 -0.0609 -0.0455 -0.0658 108 VAL A N   
837  C CA  . VAL A 126 ? 0.4812 0.4299 0.3556 -0.0573 -0.0535 -0.0656 108 VAL A CA  
838  C C   . VAL A 126 ? 0.4797 0.4424 0.3655 -0.0491 -0.0498 -0.0556 108 VAL A C   
839  O O   . VAL A 126 ? 0.4836 0.4587 0.3906 -0.0511 -0.0482 -0.0512 108 VAL A O   
840  C CB  . VAL A 126 ? 0.5137 0.4783 0.3960 -0.0669 -0.0670 -0.0707 108 VAL A CB  
841  C CG1 . VAL A 126 ? 0.5256 0.5080 0.4053 -0.0609 -0.0758 -0.0680 108 VAL A CG1 
842  C CG2 . VAL A 126 ? 0.5125 0.4616 0.3797 -0.0752 -0.0726 -0.0820 108 VAL A CG2 
843  N N   . THR A 127 ? 0.4508 0.4101 0.3211 -0.0403 -0.0481 -0.0522 109 THR A N   
844  C CA  . THR A 127 ? 0.4331 0.4015 0.3126 -0.0329 -0.0450 -0.0429 109 THR A CA  
845  C C   . THR A 127 ? 0.4531 0.4291 0.3225 -0.0274 -0.0539 -0.0400 109 THR A C   
846  O O   . THR A 127 ? 0.4625 0.4331 0.3106 -0.0272 -0.0599 -0.0440 109 THR A O   
847  C CB  . THR A 127 ? 0.4184 0.3738 0.2926 -0.0268 -0.0317 -0.0377 109 THR A CB  
848  O OG1 . THR A 127 ? 0.4657 0.4074 0.3136 -0.0232 -0.0288 -0.0397 109 THR A OG1 
849  C CG2 . THR A 127 ? 0.3902 0.3399 0.2767 -0.0304 -0.0238 -0.0391 109 THR A CG2 
850  N N   . GLU A 128 ? 0.4265 0.4144 0.3108 -0.0225 -0.0552 -0.0334 110 GLU A N   
851  C CA  . GLU A 128 ? 0.4298 0.4212 0.3052 -0.0146 -0.0620 -0.0278 110 GLU A CA  
852  C C   . GLU A 128 ? 0.4383 0.4256 0.3212 -0.0078 -0.0540 -0.0187 110 GLU A C   
853  O O   . GLU A 128 ? 0.4212 0.4201 0.3242 -0.0053 -0.0562 -0.0165 110 GLU A O   
854  C CB  . GLU A 128 ? 0.4388 0.4514 0.3278 -0.0150 -0.0759 -0.0304 110 GLU A CB  
855  C CG  . GLU A 128 ? 0.4711 0.4884 0.3500 -0.0217 -0.0867 -0.0389 110 GLU A CG  
856  C CD  . GLU A 128 ? 0.5514 0.5580 0.3993 -0.0170 -0.0923 -0.0380 110 GLU A CD  
857  O OE1 . GLU A 128 ? 0.5518 0.5513 0.3885 -0.0078 -0.0901 -0.0289 110 GLU A OE1 
858  O OE2 . GLU A 128 ? 0.5974 0.6018 0.4310 -0.0230 -0.0991 -0.0463 110 GLU A OE2 
859  N N   . PHE A 129 ? 0.4486 0.4196 0.3159 -0.0053 -0.0440 -0.0142 111 PHE A N   
860  C CA  . PHE A 129 ? 0.4138 0.3793 0.2884 -0.0009 -0.0357 -0.0057 111 PHE A CA  
861  C C   . PHE A 129 ? 0.4529 0.4172 0.3212 0.0067  -0.0421 0.0024  111 PHE A C   
862  O O   . PHE A 129 ? 0.4608 0.4216 0.3081 0.0097  -0.0489 0.0043  111 PHE A O   
863  C CB  . PHE A 129 ? 0.3896 0.3405 0.2516 -0.0014 -0.0224 -0.0031 111 PHE A CB  
864  C CG  . PHE A 129 ? 0.4028 0.3538 0.2767 -0.0065 -0.0146 -0.0087 111 PHE A CG  
865  C CD1 . PHE A 129 ? 0.3771 0.3336 0.2740 -0.0078 -0.0100 -0.0071 111 PHE A CD1 
866  C CD2 . PHE A 129 ? 0.3951 0.3396 0.2564 -0.0094 -0.0124 -0.0157 111 PHE A CD2 
867  C CE1 . PHE A 129 ? 0.3378 0.2944 0.2448 -0.0116 -0.0041 -0.0109 111 PHE A CE1 
868  C CE2 . PHE A 129 ? 0.4032 0.3458 0.2757 -0.0128 -0.0059 -0.0199 111 PHE A CE2 
869  C CZ  . PHE A 129 ? 0.3813 0.3306 0.2767 -0.0137 -0.0020 -0.0168 111 PHE A CZ  
870  N N   . GLN A 130 ? 0.4462 0.4122 0.3321 0.0100  -0.0405 0.0070  112 GLN A N   
871  C CA  . GLN A 130 ? 0.4377 0.3960 0.3177 0.0177  -0.0438 0.0165  112 GLN A CA  
872  C C   . GLN A 130 ? 0.4322 0.3731 0.3012 0.0167  -0.0312 0.0244  112 GLN A C   
873  O O   . GLN A 130 ? 0.4091 0.3490 0.2895 0.0119  -0.0209 0.0226  112 GLN A O   
874  C CB  . GLN A 130 ? 0.4270 0.3936 0.3316 0.0219  -0.0478 0.0162  112 GLN A CB  
875  C CG  . GLN A 130 ? 0.4579 0.4133 0.3586 0.0308  -0.0517 0.0259  112 GLN A CG  
876  C CD  . GLN A 130 ? 0.4568 0.4192 0.3826 0.0357  -0.0548 0.0234  112 GLN A CD  
877  O OE1 . GLN A 130 ? 0.4699 0.4493 0.4145 0.0328  -0.0554 0.0142  112 GLN A OE1 
878  N NE2 . GLN A 130 ? 0.4396 0.3878 0.3649 0.0431  -0.0564 0.0315  112 GLN A NE2 
879  N N   . ILE A 131 ? 0.4453 0.3738 0.2921 0.0209  -0.0318 0.0338  113 ILE A N   
880  C CA  . ILE A 131 ? 0.4531 0.3666 0.2898 0.0190  -0.0188 0.0424  113 ILE A CA  
881  C C   . ILE A 131 ? 0.4580 0.3611 0.3029 0.0230  -0.0194 0.0525  113 ILE A C   
882  O O   . ILE A 131 ? 0.4693 0.3687 0.3078 0.0301  -0.0300 0.0580  113 ILE A O   
883  C CB  . ILE A 131 ? 0.5358 0.4404 0.3388 0.0193  -0.0157 0.0468  113 ILE A CB  
884  C CG1 . ILE A 131 ? 0.5579 0.4674 0.3550 0.0141  -0.0090 0.0364  113 ILE A CG1 
885  C CG2 . ILE A 131 ? 0.5124 0.4017 0.3044 0.0185  -0.0038 0.0595  113 ILE A CG2 
886  C CD1 . ILE A 131 ? 0.5598 0.4820 0.3641 0.0125  -0.0195 0.0240  113 ILE A CD1 
887  N N   . ALA A 132 ? 0.4213 0.3194 0.2815 0.0185  -0.0089 0.0544  114 ALA A N   
888  C CA  . ALA A 132 ? 0.4248 0.3102 0.2942 0.0208  -0.0087 0.0627  114 ALA A CA  
889  C C   . ALA A 132 ? 0.4745 0.3410 0.3196 0.0220  -0.0049 0.0775  114 ALA A C   
890  O O   . ALA A 132 ? 0.4818 0.3458 0.3079 0.0181  0.0041  0.0811  114 ALA A O   
891  C CB  . ALA A 132 ? 0.4153 0.3019 0.3079 0.0141  0.0007  0.0594  114 ALA A CB  
892  N N   . GLU A 133 ? 0.5324 0.3852 0.3776 0.0279  -0.0116 0.0863  115 GLU A N   
893  C CA  . GLU A 133 ? 0.6101 0.4415 0.4335 0.0286  -0.0079 0.1027  115 GLU A CA  
894  C C   . GLU A 133 ? 0.5936 0.4170 0.4207 0.0182  0.0090  0.1081  115 GLU A C   
895  O O   . GLU A 133 ? 0.5503 0.3757 0.4031 0.0131  0.0136  0.1029  115 GLU A O   
896  C CB  . GLU A 133 ? 0.7281 0.5440 0.5570 0.0369  -0.0182 0.1103  115 GLU A CB  
897  C CG  . GLU A 133 ? 0.8441 0.6653 0.6626 0.0488  -0.0349 0.1105  115 GLU A CG  
898  C CD  . GLU A 133 ? 0.9781 0.7878 0.7607 0.0518  -0.0372 0.1245  115 GLU A CD  
899  O OE1 . GLU A 133 ? 1.0293 0.8478 0.7994 0.0599  -0.0508 0.1234  115 GLU A OE1 
900  O OE2 . GLU A 133 ? 1.0300 0.8228 0.7966 0.0458  -0.0256 0.1367  115 GLU A OE2 
901  N N   . GLU A 134 ? 0.6409 0.4573 0.4425 0.0148  0.0182  0.1181  116 GLU A N   
902  C CA  . GLU A 134 ? 0.6926 0.5041 0.4977 0.0046  0.0354  0.1243  116 GLU A CA  
903  C C   . GLU A 134 ? 0.7007 0.4918 0.5177 0.0018  0.0363  0.1351  116 GLU A C   
904  O O   . GLU A 134 ? 0.7207 0.4954 0.5289 0.0089  0.0260  0.1435  116 GLU A O   
905  C CB  . GLU A 134 ? 0.7643 0.5729 0.5366 0.0025  0.0454  0.1333  116 GLU A CB  
906  C CG  . GLU A 134 ? 0.8157 0.6400 0.5718 0.0063  0.0427  0.1220  116 GLU A CG  
907  C CD  . GLU A 134 ? 0.9080 0.7316 0.6338 0.0034  0.0559  0.1277  116 GLU A CD  
908  O OE1 . GLU A 134 ? 0.9235 0.7481 0.6203 0.0087  0.0497  0.1263  116 GLU A OE1 
909  O OE2 . GLU A 134 ? 0.9330 0.7566 0.6644 -0.0043 0.0727  0.1328  116 GLU A OE2 
910  N N   . PRO A 135 ? 0.6825 0.4742 0.5202 -0.0086 0.0481  0.1348  117 PRO A N   
911  C CA  . PRO A 135 ? 0.6426 0.4534 0.4919 -0.0165 0.0609  0.1269  117 PRO A CA  
912  C C   . PRO A 135 ? 0.5728 0.4000 0.4537 -0.0177 0.0571  0.1109  117 PRO A C   
913  O O   . PRO A 135 ? 0.5583 0.3955 0.4579 -0.0259 0.0670  0.1075  117 PRO A O   
914  C CB  . PRO A 135 ? 0.6788 0.4787 0.5323 -0.0275 0.0751  0.1395  117 PRO A CB  
915  C CG  . PRO A 135 ? 0.6862 0.4643 0.5504 -0.0272 0.0667  0.1453  117 PRO A CG  
916  C CD  . PRO A 135 ? 0.6898 0.4600 0.5390 -0.0137 0.0500  0.1447  117 PRO A CD  
917  N N   . LEU A 136 ? 0.5111 0.3426 0.3982 -0.0099 0.0432  0.1016  118 LEU A N   
918  C CA  . LEU A 136 ? 0.4479 0.2957 0.3613 -0.0111 0.0399  0.0870  118 LEU A CA  
919  C C   . LEU A 136 ? 0.4321 0.2997 0.3444 -0.0124 0.0453  0.0785  118 LEU A C   
920  O O   . LEU A 136 ? 0.4463 0.3185 0.3407 -0.0072 0.0414  0.0760  118 LEU A O   
921  C CB  . LEU A 136 ? 0.4396 0.2882 0.3595 -0.0025 0.0250  0.0798  118 LEU A CB  
922  C CG  . LEU A 136 ? 0.4542 0.3182 0.3996 -0.0036 0.0214  0.0656  118 LEU A CG  
923  C CD1 . LEU A 136 ? 0.4373 0.2976 0.4031 -0.0122 0.0279  0.0651  118 LEU A CD1 
924  C CD2 . LEU A 136 ? 0.4431 0.3081 0.3940 0.0054  0.0083  0.0596  118 LEU A CD2 
925  N N   . MET A 137 ? 0.3574 0.2360 0.2892 -0.0194 0.0536  0.0739  119 MET A N   
926  C CA  . MET A 137 ? 0.3379 0.2326 0.2699 -0.0203 0.0603  0.0673  119 MET A CA  
927  C C   . MET A 137 ? 0.3578 0.2666 0.3030 -0.0176 0.0522  0.0544  119 MET A C   
928  O O   . MET A 137 ? 0.3481 0.2586 0.3094 -0.0175 0.0445  0.0496  119 MET A O   
929  C CB  . MET A 137 ? 0.3370 0.2383 0.2833 -0.0283 0.0741  0.0703  119 MET A CB  
930  C CG  . MET A 137 ? 0.3673 0.2570 0.2996 -0.0327 0.0853  0.0841  119 MET A CG  
931  S SD  . MET A 137 ? 0.8831 0.7707 0.7792 -0.0277 0.0925  0.0886  119 MET A SD  
932  C CE  . MET A 137 ? 1.1005 0.9688 0.9702 -0.0206 0.0786  0.0952  119 MET A CE  
933  N N   . THR A 138 ? 0.3570 0.2747 0.2942 -0.0155 0.0544  0.0487  120 THR A N   
934  C CA  . THR A 138 ? 0.3429 0.2727 0.2912 -0.0141 0.0482  0.0380  120 THR A CA  
935  C C   . THR A 138 ? 0.3057 0.2447 0.2809 -0.0186 0.0493  0.0345  120 THR A C   
936  O O   . THR A 138 ? 0.2623 0.2040 0.2479 -0.0230 0.0584  0.0380  120 THR A O   
937  C CB  . THR A 138 ? 0.3169 0.2518 0.2545 -0.0124 0.0533  0.0332  120 THR A CB  
938  O OG1 . THR A 138 ? 0.3503 0.2772 0.2613 -0.0085 0.0503  0.0345  120 THR A OG1 
939  C CG2 . THR A 138 ? 0.2605 0.2055 0.2105 -0.0120 0.0475  0.0237  120 THR A CG2 
940  N N   . GLY A 139 ? 0.2627 0.2079 0.2489 -0.0177 0.0401  0.0277  121 GLY A N   
941  C CA  . GLY A 139 ? 0.2788 0.2332 0.2875 -0.0216 0.0394  0.0237  121 GLY A CA  
942  C C   . GLY A 139 ? 0.3097 0.2755 0.3280 -0.0235 0.0458  0.0215  121 GLY A C   
943  O O   . GLY A 139 ? 0.3232 0.2900 0.3312 -0.0208 0.0496  0.0207  121 GLY A O   
944  N N   . LYS A 140 ? 0.2836 0.2579 0.3220 -0.0278 0.0465  0.0200  122 LYS A N   
945  C CA  . LYS A 140 ? 0.2874 0.2742 0.3384 -0.0289 0.0517  0.0187  122 LYS A CA  
946  C C   . LYS A 140 ? 0.3059 0.3044 0.3758 -0.0317 0.0453  0.0139  122 LYS A C   
947  O O   . LYS A 140 ? 0.2857 0.2820 0.3617 -0.0348 0.0400  0.0120  122 LYS A O   
948  C CB  . LYS A 140 ? 0.2658 0.2537 0.3225 -0.0323 0.0630  0.0249  122 LYS A CB  
949  C CG  . LYS A 140 ? 0.3030 0.2849 0.3683 -0.0389 0.0633  0.0290  122 LYS A CG  
950  C CD  . LYS A 140 ? 0.3427 0.3260 0.4131 -0.0439 0.0757  0.0365  122 LYS A CD  
951  C CE  . LYS A 140 ? 0.3801 0.3519 0.4555 -0.0513 0.0759  0.0418  122 LYS A CE  
952  N NZ  . LYS A 140 ? 0.4130 0.3861 0.4929 -0.0579 0.0892  0.0506  122 LYS A NZ  
953  N N   . VAL A 141 ? 0.2529 0.2628 0.3309 -0.0301 0.0456  0.0117  123 VAL A N   
954  C CA  . VAL A 141 ? 0.2121 0.2345 0.3063 -0.0324 0.0394  0.0080  123 VAL A CA  
955  C C   . VAL A 141 ? 0.2030 0.2388 0.3156 -0.0336 0.0446  0.0100  123 VAL A C   
956  O O   . VAL A 141 ? 0.1879 0.2267 0.2998 -0.0290 0.0504  0.0115  123 VAL A O   
957  C CB  . VAL A 141 ? 0.2154 0.2408 0.3034 -0.0289 0.0326  0.0045  123 VAL A CB  
958  C CG1 . VAL A 141 ? 0.1957 0.2339 0.2971 -0.0314 0.0256  0.0015  123 VAL A CG1 
959  C CG2 . VAL A 141 ? 0.1894 0.2053 0.2614 -0.0276 0.0281  0.0023  123 VAL A CG2 
960  N N   . ALA A 142 ? 0.2055 0.2498 0.3355 -0.0397 0.0425  0.0092  124 ALA A N   
961  C CA  . ALA A 142 ? 0.2127 0.2744 0.3638 -0.0410 0.0453  0.0103  124 ALA A CA  
962  C C   . ALA A 142 ? 0.2033 0.2758 0.3592 -0.0376 0.0362  0.0070  124 ALA A C   
963  O O   . ALA A 142 ? 0.1875 0.2621 0.3440 -0.0408 0.0270  0.0030  124 ALA A O   
964  C CB  . ALA A 142 ? 0.1831 0.2505 0.3521 -0.0503 0.0457  0.0105  124 ALA A CB  
965  N N   . VAL A 143 ? 0.1925 0.2706 0.3502 -0.0307 0.0387  0.0088  125 VAL A N   
966  C CA  . VAL A 143 ? 0.1882 0.2748 0.3495 -0.0268 0.0301  0.0077  125 VAL A CA  
967  C C   . VAL A 143 ? 0.2037 0.3110 0.3899 -0.0260 0.0297  0.0091  125 VAL A C   
968  O O   . VAL A 143 ? 0.2140 0.3269 0.4088 -0.0202 0.0372  0.0116  125 VAL A O   
969  C CB  . VAL A 143 ? 0.2317 0.3075 0.3773 -0.0191 0.0312  0.0088  125 VAL A CB  
970  C CG1 . VAL A 143 ? 0.1594 0.2408 0.3062 -0.0161 0.0217  0.0094  125 VAL A CG1 
971  C CG2 . VAL A 143 ? 0.2978 0.3561 0.4212 -0.0204 0.0318  0.0073  125 VAL A CG2 
972  N N   . LEU A 144 ? 0.2206 0.3404 0.4190 -0.0316 0.0208  0.0068  126 LEU A N   
973  C CA  . LEU A 144 ? 0.2334 0.3759 0.4582 -0.0325 0.0186  0.0075  126 LEU A CA  
974  C C   . LEU A 144 ? 0.3033 0.4563 0.5319 -0.0250 0.0096  0.0093  126 LEU A C   
975  O O   . LEU A 144 ? 0.2832 0.4364 0.5032 -0.0265 -0.0012 0.0077  126 LEU A O   
976  C CB  . LEU A 144 ? 0.2136 0.3641 0.4501 -0.0436 0.0128  0.0034  126 LEU A CB  
977  C CG  . LEU A 144 ? 0.2367 0.3861 0.4843 -0.0519 0.0223  0.0040  126 LEU A CG  
978  C CD1 . LEU A 144 ? 0.2155 0.3416 0.4419 -0.0510 0.0318  0.0062  126 LEU A CD1 
979  C CD2 . LEU A 144 ? 0.2789 0.4327 0.5371 -0.0633 0.0146  -0.0013 126 LEU A CD2 
980  N N   . VAL A 145 ? 0.3647 0.5260 0.6054 -0.0163 0.0143  0.0128  127 VAL A N   
987  N N   . SER A 146 ? 0.4212 0.7657 0.8638 0.0417  -0.0572 0.0688  128 SER A N   
988  C CA  . SER A 146 ? 0.3944 0.7700 0.8642 0.0453  -0.0688 0.0709  128 SER A CA  
989  C C   . SER A 146 ? 0.4032 0.7793 0.8593 0.0581  -0.0863 0.0818  128 SER A C   
990  O O   . SER A 146 ? 0.3702 0.7234 0.7937 0.0612  -0.0901 0.0865  128 SER A O   
991  C CB  . SER A 146 ? 0.3479 0.7482 0.8270 0.0274  -0.0805 0.0615  128 SER A CB  
992  O OG  . SER A 146 ? 0.3048 0.6985 0.7516 0.0181  -0.0975 0.0596  128 SER A OG  
993  N N   . GLU A 147 ? 0.4706 0.8727 0.9517 0.0658  -0.0964 0.0860  129 GLU A N   
994  C CA  . GLU A 147 ? 0.5333 0.9364 1.0023 0.0784  -0.1134 0.0970  129 GLU A CA  
995  C C   . GLU A 147 ? 0.5610 0.9650 0.9976 0.0677  -0.1348 0.0951  129 GLU A C   
996  O O   . GLU A 147 ? 0.5636 0.9525 0.9717 0.0749  -0.1447 0.1036  129 GLU A O   
997  C CB  . GLU A 147 ? 0.5487 0.9828 1.0548 0.0886  -0.1204 0.1014  129 GLU A CB  
998  C CG  . GLU A 147 ? 0.5950 1.0286 1.0909 0.1040  -0.1366 0.1144  129 GLU A CG  
999  C CD  . GLU A 147 ? 0.6535 1.1183 1.1895 0.1160  -0.1426 0.1195  129 GLU A CD  
1000 O OE1 . GLU A 147 ? 0.6692 1.1342 1.2341 0.1251  -0.1240 0.1207  129 GLU A OE1 
1001 O OE2 . GLU A 147 ? 0.6800 1.1691 1.2185 0.1164  -0.1658 0.1220  129 GLU A OE2 
1002 N N   . LYS A 148 ? 0.5895 1.0084 1.0289 0.0497  -0.1401 0.0834  130 LYS A N   
1003 C CA  . LYS A 148 ? 0.6095 1.0282 1.0178 0.0372  -0.1588 0.0789  130 LYS A CA  
1004 C C   . LYS A 148 ? 0.6036 0.9899 0.9731 0.0306  -0.1525 0.0772  130 LYS A C   
1005 O O   . LYS A 148 ? 0.6040 0.9763 0.9380 0.0312  -0.1637 0.0811  130 LYS A O   
1006 C CB  . LYS A 148 ? 0.6062 1.0513 1.0328 0.0191  -0.1656 0.0657  130 LYS A CB  
1007 C CG  . LYS A 148 ? 0.6109 1.0728 1.0240 0.0121  -0.1908 0.0628  130 LYS A CG  
1008 C CD  . LYS A 148 ? 0.6008 1.1002 1.0524 0.0185  -0.2018 0.0645  130 LYS A CD  
1009 C CE  . LYS A 148 ? 0.5693 1.0922 1.0639 0.0093  -0.1887 0.0548  130 LYS A CE  
1010 N NZ  . LYS A 148 ? 0.5675 1.1288 1.1047 0.0178  -0.1962 0.0576  130 LYS A NZ  
1011 N N   . LEU A 149 ? 0.5924 0.9669 0.9684 0.0245  -0.1341 0.0713  131 LEU A N   
1012 C CA  . LEU A 149 ? 0.5854 0.9337 0.9293 0.0165  -0.1286 0.0680  131 LEU A CA  
1013 C C   . LEU A 149 ? 0.5676 0.8959 0.9174 0.0222  -0.1063 0.0693  131 LEU A C   
1014 O O   . LEU A 149 ? 0.5748 0.9095 0.9547 0.0268  -0.0921 0.0686  131 LEU A O   
1015 C CB  . LEU A 149 ? 0.5848 0.9388 0.9234 -0.0045 -0.1328 0.0551  131 LEU A CB  
1016 C CG  . LEU A 149 ? 0.6087 0.9794 0.9373 -0.0155 -0.1534 0.0491  131 LEU A CG  
1017 C CD1 . LEU A 149 ? 0.6072 0.9980 0.9630 -0.0316 -0.1517 0.0369  131 LEU A CD1 
1018 C CD2 . LEU A 149 ? 0.6218 0.9713 0.9045 -0.0244 -0.1611 0.0460  131 LEU A CD2 
1019 N N   . ARG A 150 ? 0.5433 0.8376 0.8518 0.0214  -0.0995 0.0666  132 ARG A N   
1020 C CA  . ARG A 150 ? 0.5137 0.7797 0.8108 0.0216  -0.0775 0.0609  132 ARG A CA  
1021 C C   . ARG A 150 ? 0.4367 0.6807 0.6977 0.0088  -0.0757 0.0504  132 ARG A C   
1022 O O   . ARG A 150 ? 0.4281 0.6667 0.6625 0.0053  -0.0873 0.0502  132 ARG A O   
1023 C CB  . ARG A 150 ? 0.5743 0.8200 0.8617 0.0363  -0.0685 0.0691  132 ARG A CB  
1024 C CG  . ARG A 150 ? 0.6670 0.8889 0.9137 0.0368  -0.0726 0.0707  132 ARG A CG  
1025 C CD  . ARG A 150 ? 0.7366 0.9283 0.9656 0.0401  -0.0549 0.0681  132 ARG A CD  
1026 N NE  . ARG A 150 ? 0.7995 0.9709 0.9935 0.0393  -0.0576 0.0687  132 ARG A NE  
1027 C CZ  . ARG A 150 ? 0.8225 0.9825 0.9913 0.0296  -0.0581 0.0606  132 ARG A CZ  
1028 N NH1 . ARG A 150 ? 0.8269 0.9911 0.9989 0.0198  -0.0564 0.0517  132 ARG A NH1 
1029 N NH2 . ARG A 150 ? 0.8230 0.9669 0.9645 0.0298  -0.0590 0.0617  132 ARG A NH2 
1030 N N   . SER A 151 ? 0.3248 0.5556 0.5847 0.0020  -0.0604 0.0420  133 SER A N   
1031 C CA  . SER A 151 ? 0.2509 0.4629 0.4824 -0.0095 -0.0582 0.0326  133 SER A CA  
1032 C C   . SER A 151 ? 0.2093 0.3982 0.4325 -0.0107 -0.0392 0.0279  133 SER A C   
1033 O O   . SER A 151 ? 0.1647 0.3581 0.4099 -0.0088 -0.0274 0.0282  133 SER A O   
1034 C CB  . SER A 151 ? 0.2795 0.5096 0.5219 -0.0236 -0.0675 0.0256  133 SER A CB  
1035 O OG  . SER A 151 ? 0.3232 0.5350 0.5340 -0.0333 -0.0697 0.0178  133 SER A OG  
1036 N N   . MET A 152 ? 0.1808 0.3453 0.3720 -0.0134 -0.0360 0.0239  134 MET A N   
1037 C CA  . MET A 152 ? 0.1988 0.3404 0.3771 -0.0137 -0.0207 0.0206  134 MET A CA  
1038 C C   . MET A 152 ? 0.2260 0.3538 0.3888 -0.0243 -0.0174 0.0132  134 MET A C   
1039 O O   . MET A 152 ? 0.2450 0.3692 0.3921 -0.0287 -0.0256 0.0100  134 MET A O   
1040 C CB  . MET A 152 ? 0.1652 0.2883 0.3208 -0.0052 -0.0183 0.0239  134 MET A CB  
1041 C CG  . MET A 152 ? 0.2553 0.3828 0.4237 0.0050  -0.0152 0.0304  134 MET A CG  
1042 S SD  . MET A 152 ? 0.2959 0.4017 0.4380 0.0116  -0.0124 0.0326  134 MET A SD  
1043 C CE  . MET A 152 ? 0.9127 1.0224 1.0394 0.0106  -0.0271 0.0343  134 MET A CE  
1044 N N   . VAL A 153 ? 0.2404 0.3580 0.4061 -0.0280 -0.0039 0.0106  135 VAL A N   
1045 C CA  . VAL A 153 ? 0.1904 0.2881 0.3380 -0.0359 0.0022  0.0053  135 VAL A CA  
1046 C C   . VAL A 153 ? 0.1941 0.2675 0.3215 -0.0305 0.0138  0.0074  135 VAL A C   
1047 O O   . VAL A 153 ? 0.1981 0.2692 0.3328 -0.0291 0.0249  0.0089  135 VAL A O   
1048 C CB  . VAL A 153 ? 0.2142 0.3196 0.3810 -0.0480 0.0080  0.0003  135 VAL A CB  
1049 C CG1 . VAL A 153 ? 0.2280 0.3084 0.3732 -0.0561 0.0145  -0.0047 135 VAL A CG1 
1050 C CG2 . VAL A 153 ? 0.2182 0.3527 0.4083 -0.0539 -0.0056 -0.0017 135 VAL A CG2 
1051 N N   . THR A 154 ? 0.1967 0.2529 0.2986 -0.0275 0.0110  0.0074  136 THR A N   
1052 C CA  . THR A 154 ? 0.2007 0.2375 0.2826 -0.0214 0.0175  0.0102  136 THR A CA  
1053 C C   . THR A 154 ? 0.2403 0.2545 0.3045 -0.0250 0.0254  0.0092  136 THR A C   
1054 O O   . THR A 154 ? 0.2240 0.2305 0.2800 -0.0281 0.0225  0.0066  136 THR A O   
1055 C CB  . THR A 154 ? 0.1932 0.2281 0.2612 -0.0140 0.0090  0.0122  136 THR A CB  
1056 O OG1 . THR A 154 ? 0.1817 0.2330 0.2630 -0.0100 0.0033  0.0145  136 THR A OG1 
1057 C CG2 . THR A 154 ? 0.1988 0.2170 0.2477 -0.0088 0.0134  0.0146  136 THR A CG2 
1058 N N   . TYR A 155 ? 0.2277 0.2293 0.2843 -0.0245 0.0362  0.0114  137 TYR A N   
1059 C CA  . TYR A 155 ? 0.2587 0.2351 0.2929 -0.0254 0.0435  0.0131  137 TYR A CA  
1060 C C   . TYR A 155 ? 0.2680 0.2335 0.2802 -0.0166 0.0405  0.0174  137 TYR A C   
1061 O O   . TYR A 155 ? 0.2537 0.2170 0.2610 -0.0148 0.0454  0.0189  137 TYR A O   
1062 C CB  . TYR A 155 ? 0.3284 0.2961 0.3657 -0.0325 0.0585  0.0130  137 TYR A CB  
1063 C CG  . TYR A 155 ? 0.4242 0.3627 0.4357 -0.0336 0.0667  0.0162  137 TYR A CG  
1064 C CD1 . TYR A 155 ? 0.4569 0.3839 0.4653 -0.0384 0.0673  0.0145  137 TYR A CD1 
1065 C CD2 . TYR A 155 ? 0.4537 0.3741 0.4420 -0.0298 0.0737  0.0211  137 TYR A CD2 
1066 C CE1 . TYR A 155 ? 0.5234 0.4210 0.5079 -0.0380 0.0753  0.0188  137 TYR A CE1 
1067 C CE2 . TYR A 155 ? 0.5143 0.4067 0.4767 -0.0297 0.0802  0.0259  137 TYR A CE2 
1068 C CZ  . TYR A 155 ? 0.5654 0.4462 0.5270 -0.0331 0.0812  0.0254  137 TYR A CZ  
1069 O OH  . TYR A 155 ? 0.6648 0.5152 0.6006 -0.0317 0.0882  0.0316  137 TYR A OH  
1070 N N   . LEU A 156 ? 0.2508 0.2103 0.2509 -0.0116 0.0326  0.0188  138 LEU A N   
1071 C CA  . LEU A 156 ? 0.2768 0.2329 0.2617 -0.0036 0.0265  0.0223  138 LEU A CA  
1072 C C   . LEU A 156 ? 0.3277 0.2649 0.2901 -0.0021 0.0324  0.0267  138 LEU A C   
1073 O O   . LEU A 156 ? 0.3418 0.2798 0.2943 0.0011  0.0292  0.0280  138 LEU A O   
1074 C CB  . LEU A 156 ? 0.2757 0.2315 0.2568 0.0017  0.0180  0.0228  138 LEU A CB  
1075 C CG  . LEU A 156 ? 0.2993 0.2739 0.2960 0.0016  0.0108  0.0190  138 LEU A CG  
1076 C CD1 . LEU A 156 ? 0.2293 0.2011 0.2218 0.0063  0.0060  0.0187  138 LEU A CD1 
1077 C CD2 . LEU A 156 ? 0.2146 0.2021 0.2161 0.0041  0.0066  0.0195  138 LEU A CD2 
1078 N N   . GLY A 157 ? 0.3357 0.2546 0.2881 -0.0053 0.0410  0.0289  139 GLY A N   
1079 C CA  . GLY A 157 ? 0.3512 0.2490 0.2783 -0.0046 0.0479  0.0341  139 GLY A CA  
1080 C C   . GLY A 157 ? 0.3860 0.2788 0.2922 0.0039  0.0377  0.0393  139 GLY A C   
1081 O O   . GLY A 157 ? 0.3266 0.2200 0.2323 0.0106  0.0289  0.0420  139 GLY A O   
1082 N N   . ALA A 158 ? 0.3387 0.2279 0.2291 0.0034  0.0388  0.0401  140 ALA A N   
1083 C CA  . ALA A 158 ? 0.4242 0.3098 0.2929 0.0096  0.0279  0.0446  140 ALA A CA  
1084 C C   . ALA A 158 ? 0.4360 0.3425 0.3198 0.0151  0.0132  0.0428  140 ALA A C   
1085 O O   . ALA A 158 ? 0.3375 0.2439 0.2110 0.0218  0.0025  0.0477  140 ALA A O   
1086 C CB  . ALA A 158 ? 0.4146 0.2935 0.2638 0.0055  0.0324  0.0429  140 ALA A CB  
1087 N N   . ALA A 159 ? 0.3011 0.2256 0.2096 0.0125  0.0130  0.0366  141 ALA A N   
1088 C CA  . ALA A 159 ? 0.3052 0.2486 0.2282 0.0162  0.0018  0.0345  141 ALA A CA  
1089 C C   . ALA A 159 ? 0.3268 0.2715 0.2538 0.0234  -0.0048 0.0381  141 ALA A C   
1090 O O   . ALA A 159 ? 0.3201 0.2780 0.2537 0.0278  -0.0143 0.0382  141 ALA A O   
1091 C CB  . ALA A 159 ? 0.3185 0.2769 0.2644 0.0124  0.0044  0.0288  141 ALA A CB  
1092 N N   . CYS A 160 ? 0.3281 0.2586 0.2522 0.0242  0.0014  0.0407  142 CYS A N   
1093 C CA  . CYS A 160 ? 0.3362 0.2629 0.2629 0.0318  -0.0020 0.0440  142 CYS A CA  
1094 C C   . CYS A 160 ? 0.3825 0.3047 0.2950 0.0411  -0.0105 0.0520  142 CYS A C   
1095 O O   . CYS A 160 ? 0.3533 0.2819 0.2745 0.0495  -0.0166 0.0544  142 CYS A O   
1096 C CB  . CYS A 160 ? 0.3390 0.2465 0.2629 0.0292  0.0085  0.0445  142 CYS A CB  
1097 S SG  . CYS A 160 ? 0.4901 0.4071 0.4344 0.0189  0.0148  0.0350  142 CYS A SG  
1098 N N   . ASP A 161 ? 0.3991 0.3108 0.2899 0.0397  -0.0108 0.0562  143 ASP A N   
1099 C CA  . ASP A 161 ? 0.4355 0.3415 0.3085 0.0482  -0.0205 0.0651  143 ASP A CA  
1100 C C   . ASP A 161 ? 0.4053 0.3353 0.2861 0.0509  -0.0352 0.0639  143 ASP A C   
1101 O O   . ASP A 161 ? 0.4152 0.3464 0.2847 0.0578  -0.0463 0.0711  143 ASP A O   
1102 C CB  . ASP A 161 ? 0.4969 0.3806 0.3384 0.0448  -0.0155 0.0703  143 ASP A CB  
1103 C CG  . ASP A 161 ? 0.5967 0.4525 0.4253 0.0470  -0.0045 0.0770  143 ASP A CG  
1104 O OD1 . ASP A 161 ? 0.6283 0.4817 0.4742 0.0472  0.0023  0.0744  143 ASP A OD1 
1105 O OD2 . ASP A 161 ? 0.6576 0.4923 0.4568 0.0477  -0.0021 0.0848  143 ASP A OD2 
1106 N N   . LEU A 162 ? 0.3498 0.2988 0.2499 0.0450  -0.0355 0.0551  144 LEU A N   
1107 C CA  . LEU A 162 ? 0.3453 0.3171 0.2560 0.0456  -0.0476 0.0527  144 LEU A CA  
1108 C C   . LEU A 162 ? 0.3856 0.3689 0.3112 0.0569  -0.0559 0.0580  144 LEU A C   
1109 O O   . LEU A 162 ? 0.3502 0.3337 0.2918 0.0611  -0.0500 0.0572  144 LEU A O   
1110 C CB  . LEU A 162 ? 0.2964 0.2827 0.2259 0.0381  -0.0438 0.0435  144 LEU A CB  
1111 C CG  . LEU A 162 ? 0.3034 0.3124 0.2470 0.0368  -0.0535 0.0399  144 LEU A CG  
1112 C CD1 . LEU A 162 ? 0.3013 0.3110 0.2269 0.0314  -0.0614 0.0389  144 LEU A CD1 
1113 C CD2 . LEU A 162 ? 0.2489 0.2672 0.2104 0.0310  -0.0472 0.0328  144 LEU A CD2 
1114 N N   . SER A 163 ? 0.4148 0.4076 0.3350 0.0619  -0.0695 0.0633  145 SER A N   
1115 C CA  . SER A 163 ? 0.4361 0.4396 0.3713 0.0750  -0.0774 0.0703  145 SER A CA  
1116 C C   . SER A 163 ? 0.4347 0.4697 0.3908 0.0755  -0.0905 0.0679  145 SER A C   
1117 O O   . SER A 163 ? 0.4594 0.5048 0.4105 0.0655  -0.0968 0.0624  145 SER A O   
1118 C CB  . SER A 163 ? 0.4548 0.4407 0.3667 0.0845  -0.0830 0.0827  145 SER A CB  
1119 O OG  . SER A 163 ? 0.4950 0.4848 0.3857 0.0804  -0.0954 0.0848  145 SER A OG  
1120 N N   . LEU A 164 ? 0.4269 0.4764 0.4077 0.0867  -0.0935 0.0716  146 LEU A N   
1121 C CA  . LEU A 164 ? 0.4140 0.4964 0.4198 0.0884  -0.1057 0.0704  146 LEU A CA  
1122 C C   . LEU A 164 ? 0.4145 0.5053 0.4056 0.0898  -0.1243 0.0769  146 LEU A C   
1123 O O   . LEU A 164 ? 0.4150 0.5312 0.4171 0.0831  -0.1360 0.0725  146 LEU A O   
1124 C CB  . LEU A 164 ? 0.4203 0.5141 0.4557 0.1024  -0.1029 0.0743  146 LEU A CB  
1125 C CG  . LEU A 164 ? 0.4489 0.5793 0.5196 0.1040  -0.1104 0.0715  146 LEU A CG  
1126 C CD1 . LEU A 164 ? 0.4343 0.5765 0.5135 0.0879  -0.1052 0.0592  146 LEU A CD1 
1127 C CD2 . LEU A 164 ? 0.4571 0.5927 0.5550 0.1186  -0.1023 0.0747  146 LEU A CD2 
1128 N N   . ALA A 165 ? 0.3701 0.4386 0.3346 0.0975  -0.1269 0.0873  147 ALA A N   
1129 C CA  . ALA A 165 ? 0.4447 0.5167 0.3873 0.0990  -0.1450 0.0949  147 ALA A CA  
1130 C C   . ALA A 165 ? 0.4673 0.5396 0.3878 0.0813  -0.1490 0.0856  147 ALA A C   
1131 O O   . ALA A 165 ? 0.4771 0.5681 0.3933 0.0775  -0.1666 0.0856  147 ALA A O   
1132 C CB  . ALA A 165 ? 0.4753 0.5160 0.3873 0.1094  -0.1434 0.1082  147 ALA A CB  
1133 N N   . HIS A 166 ? 0.4523 0.5039 0.3592 0.0704  -0.1327 0.0774  148 HIS A N   
1134 C CA  . HIS A 166 ? 0.4456 0.4926 0.3310 0.0545  -0.1327 0.0681  148 HIS A CA  
1135 C C   . HIS A 166 ? 0.4468 0.5210 0.3587 0.0448  -0.1365 0.0570  148 HIS A C   
1136 O O   . HIS A 166 ? 0.4603 0.5429 0.3614 0.0340  -0.1461 0.0509  148 HIS A O   
1137 C CB  . HIS A 166 ? 0.4146 0.4330 0.2828 0.0477  -0.1130 0.0635  148 HIS A CB  
1138 C CG  . HIS A 166 ? 0.4243 0.4386 0.2788 0.0324  -0.1086 0.0523  148 HIS A CG  
1139 N ND1 . HIS A 166 ? 0.4265 0.4277 0.2450 0.0252  -0.1135 0.0515  148 HIS A ND1 
1140 C CD2 . HIS A 166 ? 0.3813 0.4008 0.2519 0.0233  -0.0991 0.0416  148 HIS A CD2 
1141 C CE1 . HIS A 166 ? 0.4164 0.4143 0.2307 0.0123  -0.1058 0.0398  148 HIS A CE1 
1142 N NE2 . HIS A 166 ? 0.3987 0.4076 0.2451 0.0115  -0.0973 0.0344  148 HIS A NE2 
1143 N N   . ILE A 167 ? 0.4519 0.5379 0.3968 0.0480  -0.1280 0.0540  149 ILE A N   
1144 C CA  . ILE A 167 ? 0.4267 0.5365 0.3986 0.0394  -0.1285 0.0444  149 ILE A CA  
1145 C C   . ILE A 167 ? 0.4478 0.5899 0.4385 0.0408  -0.1474 0.0459  149 ILE A C   
1146 O O   . ILE A 167 ? 0.4846 0.6441 0.4853 0.0287  -0.1524 0.0372  149 ILE A O   
1147 C CB  . ILE A 167 ? 0.3893 0.5017 0.3882 0.0436  -0.1144 0.0424  149 ILE A CB  
1148 C CG1 . ILE A 167 ? 0.4151 0.5005 0.3980 0.0395  -0.0980 0.0395  149 ILE A CG1 
1149 C CG2 . ILE A 167 ? 0.3566 0.4934 0.3837 0.0359  -0.1142 0.0344  149 ILE A CG2 
1150 C CD1 . ILE A 167 ? 0.3950 0.4790 0.3969 0.0442  -0.0856 0.0387  149 ILE A CD1 
1151 N N   . GLU A 168 ? 0.4340 0.5840 0.4300 0.0555  -0.1579 0.0573  150 GLU A N   
1152 C CA  . GLU A 168 ? 0.4193 0.6048 0.4401 0.0594  -0.1767 0.0602  150 GLU A CA  
1153 C C   . GLU A 168 ? 0.4223 0.6132 0.4172 0.0538  -0.1975 0.0624  150 GLU A C   
1154 O O   . GLU A 168 ? 0.4061 0.6257 0.4202 0.0560  -0.2149 0.0636  150 GLU A O   
1155 C CB  . GLU A 168 ? 0.4469 0.6422 0.4926 0.0798  -0.1782 0.0719  150 GLU A CB  
1156 C CG  . GLU A 168 ? 0.4617 0.6622 0.5402 0.0836  -0.1608 0.0676  150 GLU A CG  
1157 C CD  . GLU A 168 ? 0.5276 0.7365 0.6312 0.1039  -0.1605 0.0779  150 GLU A CD  
1158 O OE1 . GLU A 168 ? 0.5737 0.7675 0.6600 0.1170  -0.1665 0.0899  150 GLU A OE1 
1159 O OE2 . GLU A 168 ? 0.5311 0.7601 0.6711 0.1071  -0.1531 0.0742  150 GLU A OE2 
1160 N N   . GLN A 169 ? 0.4625 0.6231 0.4137 0.0463  -0.1941 0.0610  151 GLN A N   
1161 C CA  . GLN A 169 ? 0.4768 0.6385 0.3966 0.0375  -0.2119 0.0604  151 GLN A CA  
1162 C C   . GLN A 169 ? 0.4439 0.6327 0.3816 0.0206  -0.2199 0.0468  151 GLN A C   
1163 O O   . GLN A 169 ? 0.4207 0.6068 0.3723 0.0104  -0.2046 0.0357  151 GLN A O   
1164 C CB  . GLN A 169 ? 0.5045 0.6265 0.3755 0.0295  -0.2008 0.0578  151 GLN A CB  
1165 C CG  . GLN A 169 ? 0.5296 0.6232 0.3739 0.0431  -0.1961 0.0716  151 GLN A CG  
1166 C CD  . GLN A 169 ? 0.5412 0.5977 0.3395 0.0334  -0.1834 0.0679  151 GLN A CD  
1167 O OE1 . GLN A 169 ? 0.5785 0.6213 0.3367 0.0315  -0.1931 0.0727  151 GLN A OE1 
1168 N NE2 . GLN A 169 ? 0.5052 0.5457 0.3089 0.0271  -0.1616 0.0594  151 GLN A NE2 
1169 N N   . PRO A 170 ? 0.4758 0.6836 0.4146 0.0199  -0.2375 0.0439  152 PRO A N   
1170 C CA  . PRO A 170 ? 0.4756 0.7067 0.4326 0.0032  -0.2443 0.0293  152 PRO A CA  
1171 C C   . PRO A 170 ? 0.4761 0.6889 0.4097 -0.0189 -0.2337 0.0165  152 PRO A C   
1172 O O   . PRO A 170 ? 0.4472 0.6749 0.4065 -0.0316 -0.2287 0.0061  152 PRO A O   
1173 C CB  . PRO A 170 ? 0.4897 0.7310 0.4317 0.0057  -0.2647 0.0293  152 PRO A CB  
1174 C CG  . PRO A 170 ? 0.5047 0.7451 0.4490 0.0298  -0.2698 0.0455  152 PRO A CG  
1175 C CD  . PRO A 170 ? 0.5018 0.7114 0.4283 0.0360  -0.2514 0.0543  152 PRO A CD  
1176 N N   . HIS A 171 ? 0.4879 0.6665 0.3737 -0.0231 -0.2282 0.0172  153 HIS A N   
1177 C CA  . HIS A 171 ? 0.5161 0.6714 0.3772 -0.0424 -0.2157 0.0034  153 HIS A CA  
1178 C C   . HIS A 171 ? 0.5274 0.6649 0.4047 -0.0402 -0.1891 0.0001  153 HIS A C   
1179 O O   . HIS A 171 ? 0.5608 0.6817 0.4297 -0.0534 -0.1754 -0.0117 153 HIS A O   
1180 C CB  . HIS A 171 ? 0.5063 0.6291 0.3104 -0.0474 -0.2160 0.0029  153 HIS A CB  
1181 C CG  . HIS A 171 ? 0.5713 0.6630 0.3536 -0.0343 -0.2016 0.0136  153 HIS A CG  
1182 N ND1 . HIS A 171 ? 0.5894 0.6806 0.3628 -0.0179 -0.2114 0.0299  153 HIS A ND1 
1183 C CD2 . HIS A 171 ? 0.5735 0.6335 0.3427 -0.0352 -0.1772 0.0103  153 HIS A CD2 
1184 C CE1 . HIS A 171 ? 0.5947 0.6542 0.3497 -0.0109 -0.1929 0.0353  153 HIS A CE1 
1185 N NE2 . HIS A 171 ? 0.5981 0.6403 0.3518 -0.0212 -0.1726 0.0236  153 HIS A NE2 
1186 N N   . VAL A 172 ? 0.4979 0.6379 0.3974 -0.0235 -0.1821 0.0107  154 VAL A N   
1187 C CA  . VAL A 172 ? 0.4661 0.5932 0.3827 -0.0210 -0.1599 0.0084  154 VAL A CA  
1188 C C   . VAL A 172 ? 0.4531 0.6089 0.4159 -0.0199 -0.1589 0.0064  154 VAL A C   
1189 O O   . VAL A 172 ? 0.4437 0.5955 0.4195 -0.0275 -0.1450 -0.0014 154 VAL A O   
1190 C CB  . VAL A 172 ? 0.4462 0.5527 0.3540 -0.0058 -0.1495 0.0193  154 VAL A CB  
1191 C CG1 . VAL A 172 ? 0.4046 0.5028 0.3324 -0.0040 -0.1296 0.0167  154 VAL A CG1 
1192 C CG2 . VAL A 172 ? 0.4553 0.5308 0.3176 -0.0082 -0.1461 0.0209  154 VAL A CG2 
1193 N N   . TRP A 173 ? 0.4085 0.5926 0.3960 -0.0098 -0.1728 0.0139  155 TRP A N   
1194 C CA  . TRP A 173 ? 0.3788 0.5915 0.4112 -0.0084 -0.1706 0.0121  155 TRP A CA  
1195 C C   . TRP A 173 ? 0.3808 0.6092 0.4257 -0.0275 -0.1729 -0.0008 155 TRP A C   
1196 O O   . TRP A 173 ? 0.3531 0.5937 0.4281 -0.0312 -0.1629 -0.0054 155 TRP A O   
1197 C CB  . TRP A 173 ? 0.3143 0.5563 0.3732 0.0065  -0.1853 0.0225  155 TRP A CB  
1198 C CG  . TRP A 173 ? 0.3127 0.5816 0.4181 0.0091  -0.1789 0.0206  155 TRP A CG  
1199 C CD1 . TRP A 173 ? 0.3101 0.6174 0.4504 0.0036  -0.1898 0.0169  155 TRP A CD1 
1200 C CD2 . TRP A 173 ? 0.2638 0.5232 0.3852 0.0165  -0.1590 0.0216  155 TRP A CD2 
1201 N NE1 . TRP A 173 ? 0.2822 0.6033 0.4594 0.0077  -0.1761 0.0159  155 TRP A NE1 
1202 C CE2 . TRP A 173 ? 0.2723 0.5634 0.4361 0.0156  -0.1575 0.0187  155 TRP A CE2 
1203 C CE3 . TRP A 173 ? 0.3466 0.5747 0.4502 0.0229  -0.1427 0.0244  155 TRP A CE3 
1204 C CZ2 . TRP A 173 ? 0.2628 0.5520 0.4474 0.0211  -0.1394 0.0185  155 TRP A CZ2 
1205 C CZ3 . TRP A 173 ? 0.3170 0.5450 0.4417 0.0279  -0.1269 0.0239  155 TRP A CZ3 
1206 C CH2 . TRP A 173 ? 0.3042 0.5611 0.4668 0.0271  -0.1250 0.0210  155 TRP A CH2 
1207 N N   . SER A 174 ? 0.4184 0.6441 0.4378 -0.0405 -0.1849 -0.0072 156 SER A N   
1208 C CA  . SER A 174 ? 0.4437 0.6801 0.4708 -0.0610 -0.1866 -0.0210 156 SER A CA  
1209 C C   . SER A 174 ? 0.3995 0.6083 0.4203 -0.0704 -0.1633 -0.0297 156 SER A C   
1210 O O   . SER A 174 ? 0.4197 0.6368 0.4582 -0.0844 -0.1583 -0.0393 156 SER A O   
1211 C CB  . SER A 174 ? 0.4800 0.7166 0.4760 -0.0738 -0.2050 -0.0268 156 SER A CB  
1212 O OG  . SER A 174 ? 0.5229 0.7194 0.4725 -0.0777 -0.1954 -0.0298 156 SER A OG  
1213 N N   . LEU A 175 ? 0.3855 0.5618 0.3825 -0.0628 -0.1491 -0.0257 157 LEU A N   
1214 C CA  . LEU A 175 ? 0.3876 0.5397 0.3827 -0.0676 -0.1276 -0.0310 157 LEU A CA  
1215 C C   . LEU A 175 ? 0.3567 0.5220 0.3875 -0.0612 -0.1174 -0.0275 157 LEU A C   
1216 O O   . LEU A 175 ? 0.3375 0.4947 0.3768 -0.0690 -0.1039 -0.0330 157 LEU A O   
1217 C CB  . LEU A 175 ? 0.3724 0.4911 0.3373 -0.0603 -0.1160 -0.0271 157 LEU A CB  
1218 C CG  . LEU A 175 ? 0.4106 0.5084 0.3346 -0.0671 -0.1202 -0.0312 157 LEU A CG  
1219 C CD1 . LEU A 175 ? 0.4100 0.4781 0.3120 -0.0585 -0.1059 -0.0263 157 LEU A CD1 
1220 C CD2 . LEU A 175 ? 0.3787 0.4673 0.2916 -0.0862 -0.1170 -0.0454 157 LEU A CD2 
1221 N N   . VAL A 176 ? 0.3285 0.5115 0.3777 -0.0466 -0.1229 -0.0179 158 VAL A N   
1222 C CA  . VAL A 176 ? 0.2941 0.4894 0.3747 -0.0401 -0.1130 -0.0149 158 VAL A CA  
1223 C C   . VAL A 176 ? 0.2975 0.5221 0.4095 -0.0508 -0.1168 -0.0211 158 VAL A C   
1224 O O   . VAL A 176 ? 0.3029 0.5277 0.4316 -0.0558 -0.1033 -0.0243 158 VAL A O   
1225 C CB  . VAL A 176 ? 0.2962 0.5000 0.3873 -0.0215 -0.1161 -0.0040 158 VAL A CB  
1226 C CG1 . VAL A 176 ? 0.2278 0.4441 0.3497 -0.0162 -0.1048 -0.0025 158 VAL A CG1 
1227 C CG2 . VAL A 176 ? 0.3088 0.4830 0.3708 -0.0126 -0.1104 0.0017  158 VAL A CG2 
1228 N N   . GLU A 177 ? 0.3003 0.5501 0.4199 -0.0547 -0.1355 -0.0226 159 GLU A N   
1229 C CA  . GLU A 177 ? 0.3077 0.5910 0.4617 -0.0657 -0.1413 -0.0288 159 GLU A CA  
1230 C C   . GLU A 177 ? 0.2968 0.5690 0.4466 -0.0869 -0.1320 -0.0413 159 GLU A C   
1231 O O   . GLU A 177 ? 0.2948 0.5829 0.4738 -0.0953 -0.1244 -0.0458 159 GLU A O   
1232 C CB  . GLU A 177 ? 0.3766 0.6912 0.5389 -0.0652 -0.1664 -0.0272 159 GLU A CB  
1233 C CG  . GLU A 177 ? 0.4473 0.7859 0.6349 -0.0444 -0.1741 -0.0149 159 GLU A CG  
1234 C CD  . GLU A 177 ? 0.5536 0.9111 0.7416 -0.0393 -0.1984 -0.0107 159 GLU A CD  
1235 O OE1 . GLU A 177 ? 0.5816 0.9590 0.7998 -0.0244 -0.2036 -0.0035 159 GLU A OE1 
1236 O OE2 . GLU A 177 ? 0.5951 0.9394 0.7502 -0.0486 -0.2098 -0.0152 159 GLU A OE2 
1237 N N   . LYS A 178 ? 0.3038 0.5464 0.4168 -0.0955 -0.1305 -0.0469 160 LYS A N   
1238 C CA  . LYS A 178 ? 0.3264 0.5534 0.4321 -0.1155 -0.1208 -0.0592 160 LYS A CA  
1239 C C   . LYS A 178 ? 0.2905 0.4895 0.3941 -0.1137 -0.0969 -0.0580 160 LYS A C   
1240 O O   . LYS A 178 ? 0.3000 0.4868 0.4047 -0.1283 -0.0858 -0.0662 160 LYS A O   
1241 C CB  . LYS A 178 ? 0.3904 0.5955 0.4568 -0.1260 -0.1277 -0.0669 160 LYS A CB  
1242 C CG  . LYS A 178 ? 0.4671 0.6367 0.4988 -0.1145 -0.1187 -0.0613 160 LYS A CG  
1243 C CD  . LYS A 178 ? 0.5329 0.6736 0.5267 -0.1280 -0.1165 -0.0718 160 LYS A CD  
1244 C CE  . LYS A 178 ? 0.5953 0.7510 0.5726 -0.1365 -0.1389 -0.0765 160 LYS A CE  
1245 N NZ  . LYS A 178 ? 0.6815 0.8084 0.6216 -0.1534 -0.1351 -0.0897 160 LYS A NZ  
1246 N N   . ALA A 179 ? 0.2718 0.4598 0.3715 -0.0961 -0.0895 -0.0476 161 ALA A N   
1247 C CA  . ALA A 179 ? 0.3146 0.4783 0.4115 -0.0929 -0.0696 -0.0450 161 ALA A CA  
1248 C C   . ALA A 179 ? 0.3217 0.5016 0.4494 -0.0951 -0.0604 -0.0441 161 ALA A C   
1249 O O   . ALA A 179 ? 0.3223 0.5326 0.4763 -0.0911 -0.0674 -0.0417 161 ALA A O   
1250 C CB  . ALA A 179 ? 0.2477 0.3963 0.3304 -0.0754 -0.0660 -0.0352 161 ALA A CB  
1251 N N   . GLN A 180 ? 0.3454 0.5038 0.4695 -0.1009 -0.0436 -0.0454 162 GLN A N   
1252 C CA  . GLN A 180 ? 0.2872 0.4546 0.4345 -0.1031 -0.0317 -0.0436 162 GLN A CA  
1253 C C   . GLN A 180 ? 0.2450 0.3932 0.3824 -0.0896 -0.0195 -0.0342 162 GLN A C   
1254 O O   . GLN A 180 ? 0.2396 0.3937 0.3911 -0.0872 -0.0098 -0.0304 162 GLN A O   
1255 C CB  . GLN A 180 ? 0.2826 0.4400 0.4333 -0.1222 -0.0216 -0.0521 162 GLN A CB  
1256 C CG  . GLN A 180 ? 0.3057 0.4846 0.4681 -0.1388 -0.0341 -0.0632 162 GLN A CG  
1257 C CD  . GLN A 180 ? 0.3533 0.5759 0.5505 -0.1369 -0.0451 -0.0624 162 GLN A CD  
1258 O OE1 . GLN A 180 ? 0.3942 0.6404 0.5970 -0.1381 -0.0640 -0.0653 162 GLN A OE1 
1259 N NE2 . GLN A 180 ? 0.3536 0.5872 0.5743 -0.1334 -0.0331 -0.0579 162 GLN A NE2 
1260 N N   . VAL A 181 ? 0.2305 0.3562 0.3432 -0.0816 -0.0201 -0.0309 163 VAL A N   
1261 C CA  . VAL A 181 ? 0.2747 0.3821 0.3763 -0.0699 -0.0109 -0.0225 163 VAL A CA  
1262 C C   . VAL A 181 ? 0.2573 0.3625 0.3462 -0.0568 -0.0192 -0.0179 163 VAL A C   
1263 O O   . VAL A 181 ? 0.2885 0.3875 0.3638 -0.0581 -0.0262 -0.0209 163 VAL A O   
1264 C CB  . VAL A 181 ? 0.2882 0.3651 0.3737 -0.0744 0.0010  -0.0225 163 VAL A CB  
1265 C CG1 . VAL A 181 ? 0.2274 0.2892 0.3025 -0.0616 0.0073  -0.0131 163 VAL A CG1 
1266 C CG2 . VAL A 181 ? 0.2487 0.3227 0.3445 -0.0879 0.0115  -0.0263 163 VAL A CG2 
1267 N N   . TYR A 182 ? 0.2458 0.3542 0.3376 -0.0453 -0.0173 -0.0110 164 TYR A N   
1268 C CA  . TYR A 182 ? 0.2398 0.3435 0.3200 -0.0339 -0.0228 -0.0066 164 TYR A CA  
1269 C C   . TYR A 182 ? 0.2387 0.3252 0.3084 -0.0272 -0.0148 -0.0010 164 TYR A C   
1270 O O   . TYR A 182 ? 0.2420 0.3267 0.3158 -0.0271 -0.0069 0.0018  164 TYR A O   
1271 C CB  . TYR A 182 ? 0.2163 0.3403 0.3093 -0.0258 -0.0301 -0.0043 164 TYR A CB  
1272 C CG  . TYR A 182 ? 0.1955 0.3421 0.3038 -0.0309 -0.0400 -0.0084 164 TYR A CG  
1273 C CD1 . TYR A 182 ? 0.2045 0.3530 0.3029 -0.0320 -0.0521 -0.0101 164 TYR A CD1 
1274 C CD2 . TYR A 182 ? 0.1849 0.3521 0.3179 -0.0352 -0.0372 -0.0105 164 TYR A CD2 
1275 C CE1 . TYR A 182 ? 0.2152 0.3869 0.3274 -0.0369 -0.0638 -0.0134 164 TYR A CE1 
1276 C CE2 . TYR A 182 ? 0.2035 0.3958 0.3549 -0.0402 -0.0477 -0.0142 164 TYR A CE2 
1277 C CZ  . TYR A 182 ? 0.2163 0.4117 0.3572 -0.0409 -0.0622 -0.0155 164 TYR A CZ  
1278 O OH  . TYR A 182 ? 0.2519 0.4748 0.4110 -0.0460 -0.0753 -0.0188 164 TYR A OH  
1279 N N   . TYR A 183 ? 0.2145 0.2889 0.2704 -0.0221 -0.0168 0.0008  165 TYR A N   
1280 C CA  . TYR A 183 ? 0.2285 0.2922 0.2777 -0.0150 -0.0124 0.0063  165 TYR A CA  
1281 C C   . TYR A 183 ? 0.2245 0.2898 0.2688 -0.0074 -0.0180 0.0083  165 TYR A C   
1282 O O   . TYR A 183 ? 0.2163 0.2762 0.2519 -0.0076 -0.0215 0.0067  165 TYR A O   
1283 C CB  . TYR A 183 ? 0.1900 0.2356 0.2306 -0.0167 -0.0062 0.0071  165 TYR A CB  
1284 C CG  . TYR A 183 ? 0.2173 0.2563 0.2548 -0.0092 -0.0036 0.0133  165 TYR A CG  
1285 C CD1 . TYR A 183 ? 0.2301 0.2677 0.2691 -0.0079 0.0006  0.0181  165 TYR A CD1 
1286 C CD2 . TYR A 183 ? 0.2229 0.2582 0.2557 -0.0042 -0.0057 0.0146  165 TYR A CD2 
1287 C CE1 . TYR A 183 ? 0.2266 0.2608 0.2622 -0.0017 0.0004  0.0239  165 TYR A CE1 
1288 C CE2 . TYR A 183 ? 0.2138 0.2472 0.2470 0.0014  -0.0048 0.0197  165 TYR A CE2 
1289 C CZ  . TYR A 183 ? 0.2147 0.2484 0.2493 0.0027  -0.0029 0.0244  165 TYR A CZ  
1290 O OH  . TYR A 183 ? 0.2300 0.2638 0.2643 0.0076  -0.0044 0.0295  165 TYR A OH  
1291 N N   . ILE A 184 ? 0.1896 0.2598 0.2372 -0.0016 -0.0178 0.0112  166 ILE A N   
1292 C CA  . ILE A 184 ? 0.1974 0.2650 0.2395 0.0049  -0.0210 0.0131  166 ILE A CA  
1293 C C   . ILE A 184 ? 0.2046 0.2673 0.2440 0.0080  -0.0173 0.0159  166 ILE A C   
1294 O O   . ILE A 184 ? 0.1966 0.2632 0.2390 0.0083  -0.0143 0.0165  166 ILE A O   
1295 C CB  . ILE A 184 ? 0.2374 0.3157 0.2857 0.0093  -0.0259 0.0130  166 ILE A CB  
1296 C CG1 . ILE A 184 ? 0.2181 0.3067 0.2717 0.0058  -0.0322 0.0105  166 ILE A CG1 
1297 C CG2 . ILE A 184 ? 0.2534 0.3239 0.2932 0.0152  -0.0281 0.0152  166 ILE A CG2 
1298 C CD1 . ILE A 184 ? 0.2034 0.3058 0.2672 0.0120  -0.0382 0.0119  166 ILE A CD1 
1299 N N   . ALA A 185 ? 0.2124 0.2671 0.2457 0.0095  -0.0174 0.0174  167 ALA A N   
1300 C CA  . ALA A 185 ? 0.2370 0.2894 0.2682 0.0113  -0.0164 0.0195  167 ALA A CA  
1301 C C   . ALA A 185 ? 0.2277 0.2812 0.2572 0.0142  -0.0174 0.0182  167 ALA A C   
1302 O O   . ALA A 185 ? 0.2031 0.2566 0.2328 0.0167  -0.0191 0.0173  167 ALA A O   
1303 C CB  . ALA A 185 ? 0.2353 0.2820 0.2654 0.0115  -0.0159 0.0209  167 ALA A CB  
1304 N N   . GLY A 186 ? 0.2231 0.2762 0.2494 0.0140  -0.0164 0.0184  168 GLY A N   
1305 C CA  . GLY A 186 ? 0.2246 0.2751 0.2472 0.0157  -0.0155 0.0159  168 GLY A CA  
1306 C C   . GLY A 186 ? 0.2169 0.2608 0.2376 0.0166  -0.0167 0.0152  168 GLY A C   
1307 O O   . GLY A 186 ? 0.2121 0.2509 0.2306 0.0192  -0.0151 0.0135  168 GLY A O   
1308 N N   . PHE A 187 ? 0.2024 0.2450 0.2243 0.0146  -0.0180 0.0168  169 PHE A N   
1309 C CA  . PHE A 187 ? 0.2231 0.2586 0.2432 0.0141  -0.0171 0.0165  169 PHE A CA  
1310 C C   . PHE A 187 ? 0.2310 0.2602 0.2467 0.0180  -0.0167 0.0171  169 PHE A C   
1311 O O   . PHE A 187 ? 0.2644 0.2840 0.2754 0.0182  -0.0146 0.0172  169 PHE A O   
1312 C CB  . PHE A 187 ? 0.2223 0.2584 0.2462 0.0122  -0.0162 0.0182  169 PHE A CB  
1313 C CG  . PHE A 187 ? 0.2549 0.2973 0.2858 0.0098  -0.0174 0.0190  169 PHE A CG  
1314 C CD1 . PHE A 187 ? 0.2167 0.2634 0.2538 0.0107  -0.0172 0.0218  169 PHE A CD1 
1315 C CD2 . PHE A 187 ? 0.2764 0.3201 0.3077 0.0066  -0.0189 0.0170  169 PHE A CD2 
1316 C CE1 . PHE A 187 ? 0.2085 0.2628 0.2539 0.0102  -0.0197 0.0242  169 PHE A CE1 
1317 C CE2 . PHE A 187 ? 0.2589 0.3119 0.2978 0.0043  -0.0225 0.0182  169 PHE A CE2 
1318 C CZ  . PHE A 187 ? 0.2458 0.3051 0.2926 0.0070  -0.0234 0.0226  169 PHE A CZ  
1319 N N   . VAL A 188 ? 0.2025 0.2372 0.2201 0.0206  -0.0189 0.0180  170 VAL A N   
1320 C CA  . VAL A 188 ? 0.2042 0.2363 0.2185 0.0251  -0.0213 0.0199  170 VAL A CA  
1321 C C   . VAL A 188 ? 0.2269 0.2562 0.2427 0.0309  -0.0201 0.0201  170 VAL A C   
1322 O O   . VAL A 188 ? 0.2261 0.2505 0.2388 0.0364  -0.0218 0.0232  170 VAL A O   
1323 C CB  . VAL A 188 ? 0.2183 0.2603 0.2363 0.0247  -0.0257 0.0201  170 VAL A CB  
1324 C CG1 . VAL A 188 ? 0.2103 0.2512 0.2230 0.0288  -0.0310 0.0229  170 VAL A CG1 
1325 C CG2 . VAL A 188 ? 0.2010 0.2416 0.2166 0.0189  -0.0244 0.0189  170 VAL A CG2 
1326 N N   . ILE A 189 ? 0.2465 0.2772 0.2654 0.0299  -0.0165 0.0171  171 ILE A N   
1327 C CA  . ILE A 189 ? 0.2212 0.2454 0.2401 0.0348  -0.0124 0.0158  171 ILE A CA  
1328 C C   . ILE A 189 ? 0.2760 0.2832 0.2862 0.0361  -0.0100 0.0170  171 ILE A C   
1329 O O   . ILE A 189 ? 0.3208 0.3200 0.3306 0.0434  -0.0079 0.0190  171 ILE A O   
1330 C CB  . ILE A 189 ? 0.2499 0.2743 0.2672 0.0310  -0.0079 0.0109  171 ILE A CB  
1331 C CG1 . ILE A 189 ? 0.2503 0.2885 0.2754 0.0312  -0.0074 0.0105  171 ILE A CG1 
1332 C CG2 . ILE A 189 ? 0.3044 0.3158 0.3173 0.0342  -0.0014 0.0077  171 ILE A CG2 
1333 C CD1 . ILE A 189 ? 0.1930 0.2308 0.2116 0.0261  -0.0037 0.0071  171 ILE A CD1 
1334 N N   . ASN A 190 ? 0.2352 0.2367 0.2398 0.0294  -0.0096 0.0163  172 ASN A N   
1335 C CA  . ASN A 190 ? 0.2489 0.2332 0.2454 0.0282  -0.0055 0.0170  172 ASN A CA  
1336 C C   . ASN A 190 ? 0.3277 0.3041 0.3173 0.0332  -0.0068 0.0234  172 ASN A C   
1337 O O   . ASN A 190 ? 0.3948 0.3534 0.3758 0.0349  -0.0023 0.0257  172 ASN A O   
1338 C CB  . ASN A 190 ? 0.2199 0.2041 0.2166 0.0186  -0.0039 0.0140  172 ASN A CB  
1339 C CG  . ASN A 190 ? 0.2679 0.2583 0.2677 0.0130  -0.0043 0.0083  172 ASN A CG  
1340 O OD1 . ASN A 190 ? 0.2687 0.2704 0.2738 0.0079  -0.0076 0.0075  172 ASN A OD1 
1341 N ND2 . ASN A 190 ? 0.2641 0.2460 0.2593 0.0142  -0.0007 0.0046  172 ASN A ND2 
1342 N N   . THR A 191 ? 0.2792 0.2666 0.2701 0.0349  -0.0127 0.0261  173 THR A N   
1343 C CA  . THR A 191 ? 0.2899 0.2695 0.2694 0.0377  -0.0151 0.0317  173 THR A CA  
1344 C C   . THR A 191 ? 0.3054 0.2914 0.2860 0.0468  -0.0225 0.0365  173 THR A C   
1345 O O   . THR A 191 ? 0.3518 0.3262 0.3214 0.0527  -0.0242 0.0429  173 THR A O   
1346 C CB  . THR A 191 ? 0.2817 0.2656 0.2573 0.0311  -0.0159 0.0306  173 THR A CB  
1347 O OG1 . THR A 191 ? 0.2955 0.2965 0.2815 0.0294  -0.0203 0.0276  173 THR A OG1 
1348 C CG2 . THR A 191 ? 0.2352 0.2129 0.2117 0.0236  -0.0083 0.0276  173 THR A CG2 
1349 N N   . CYS A 192 ? 0.2571 0.2619 0.2516 0.0480  -0.0271 0.0342  174 CYS A N   
1350 C CA  . CYS A 192 ? 0.2862 0.3028 0.2872 0.0558  -0.0352 0.0383  174 CYS A CA  
1351 C C   . CYS A 192 ? 0.2643 0.2995 0.2857 0.0576  -0.0352 0.0347  174 CYS A C   
1352 O O   . CYS A 192 ? 0.2583 0.3112 0.2889 0.0548  -0.0408 0.0331  174 CYS A O   
1353 C CB  . CYS A 192 ? 0.3126 0.3356 0.3052 0.0522  -0.0437 0.0398  174 CYS A CB  
1354 S SG  . CYS A 192 ? 0.4252 0.4633 0.4233 0.0613  -0.0572 0.0461  174 CYS A SG  
1355 N N   . TYR A 193 ? 0.2625 0.2922 0.2897 0.0613  -0.0276 0.0328  175 TYR A N   
1356 C CA  . TYR A 193 ? 0.2628 0.3074 0.3070 0.0628  -0.0245 0.0290  175 TYR A CA  
1357 C C   . TYR A 193 ? 0.2365 0.3005 0.2982 0.0706  -0.0312 0.0327  175 TYR A C   
1358 O O   . TYR A 193 ? 0.2231 0.3060 0.3002 0.0678  -0.0317 0.0296  175 TYR A O   
1359 C CB  . TYR A 193 ? 0.2215 0.2531 0.2650 0.0656  -0.0139 0.0257  175 TYR A CB  
1360 C CG  . TYR A 193 ? 0.2303 0.2749 0.2874 0.0655  -0.0083 0.0210  175 TYR A CG  
1361 C CD1 . TYR A 193 ? 0.2318 0.2852 0.2886 0.0561  -0.0078 0.0170  175 TYR A CD1 
1362 C CD2 . TYR A 193 ? 0.2574 0.3044 0.3277 0.0755  -0.0024 0.0212  175 TYR A CD2 
1363 C CE1 . TYR A 193 ? 0.2585 0.3215 0.3248 0.0553  -0.0011 0.0133  175 TYR A CE1 
1364 C CE2 . TYR A 193 ? 0.2446 0.3027 0.3268 0.0749  0.0051  0.0166  175 TYR A CE2 
1365 C CZ  . TYR A 193 ? 0.2834 0.3490 0.3622 0.0642  0.0058  0.0127  175 TYR A CZ  
1366 O OH  . TYR A 193 ? 0.3186 0.3931 0.4064 0.0629  0.0147  0.0087  175 TYR A OH  
1367 N N   . GLU A 194 ? 0.2301 0.2896 0.2898 0.0803  -0.0366 0.0397  176 GLU A N   
1368 C CA  . GLU A 194 ? 0.3251 0.4054 0.4034 0.0894  -0.0455 0.0446  176 GLU A CA  
1369 C C   . GLU A 194 ? 0.2731 0.3751 0.3566 0.0810  -0.0564 0.0429  176 GLU A C   
1370 O O   . GLU A 194 ? 0.2839 0.4107 0.3907 0.0819  -0.0600 0.0415  176 GLU A O   
1371 C CB  . GLU A 194 ? 0.3972 0.4655 0.4672 0.1016  -0.0511 0.0545  176 GLU A CB  
1372 C CG  . GLU A 194 ? 0.5281 0.5756 0.5687 0.0965  -0.0545 0.0580  176 GLU A CG  
1373 C CD  . GLU A 194 ? 0.6819 0.7178 0.7113 0.1085  -0.0615 0.0695  176 GLU A CD  
1374 O OE1 . GLU A 194 ? 0.7381 0.7764 0.7823 0.1227  -0.0611 0.0753  176 GLU A OE1 
1375 O OE2 . GLU A 194 ? 0.7016 0.7249 0.7066 0.1044  -0.0665 0.0734  176 GLU A OE2 
1376 N N   . GLY A 195 ? 0.2637 0.3557 0.3261 0.0721  -0.0604 0.0421  177 GLY A N   
1377 C CA  . GLY A 195 ? 0.2487 0.3555 0.3116 0.0625  -0.0689 0.0389  177 GLY A CA  
1378 C C   . GLY A 195 ? 0.2584 0.3758 0.3341 0.0530  -0.0622 0.0312  177 GLY A C   
1379 O O   . GLY A 195 ? 0.1984 0.3367 0.2900 0.0484  -0.0672 0.0284  177 GLY A O   
1380 N N   . MET A 196 ? 0.2511 0.3540 0.3197 0.0494  -0.0512 0.0280  178 MET A N   
1381 C CA  . MET A 196 ? 0.2455 0.3550 0.3220 0.0410  -0.0448 0.0224  178 MET A CA  
1382 C C   . MET A 196 ? 0.2530 0.3796 0.3527 0.0446  -0.0404 0.0210  178 MET A C   
1383 O O   . MET A 196 ? 0.2372 0.3765 0.3485 0.0376  -0.0382 0.0174  178 MET A O   
1384 C CB  . MET A 196 ? 0.2139 0.3054 0.2763 0.0368  -0.0363 0.0204  178 MET A CB  
1385 C CG  . MET A 196 ? 0.2255 0.3068 0.2861 0.0425  -0.0289 0.0207  178 MET A CG  
1386 S SD  . MET A 196 ? 0.2811 0.3446 0.3251 0.0362  -0.0234 0.0187  178 MET A SD  
1387 C CE  . MET A 196 ? 0.2031 0.2748 0.2517 0.0286  -0.0199 0.0159  178 MET A CE  
1388 N N   . LEU A 197 ? 0.2963 0.4220 0.4032 0.0555  -0.0378 0.0239  179 LEU A N   
1389 C CA  . LEU A 197 ? 0.2920 0.4342 0.4231 0.0607  -0.0319 0.0226  179 LEU A CA  
1390 C C   . LEU A 197 ? 0.2864 0.4567 0.4410 0.0613  -0.0419 0.0239  179 LEU A C   
1391 O O   . LEU A 197 ? 0.2729 0.4620 0.4488 0.0574  -0.0374 0.0204  179 LEU A O   
1392 C CB  . LEU A 197 ? 0.2666 0.3984 0.3997 0.0735  -0.0256 0.0253  179 LEU A CB  
1393 C CG  . LEU A 197 ? 0.2393 0.3848 0.3969 0.0799  -0.0155 0.0232  179 LEU A CG  
1394 C CD1 . LEU A 197 ? 0.2038 0.3492 0.3596 0.0697  -0.0040 0.0165  179 LEU A CD1 
1395 C CD2 . LEU A 197 ? 0.2556 0.3848 0.4117 0.0926  -0.0072 0.0250  179 LEU A CD2 
1396 N N   . LYS A 198 ? 0.2781 0.4512 0.4280 0.0655  -0.0555 0.0290  180 LYS A N   
1397 C CA  . LYS A 198 ? 0.2762 0.4775 0.4464 0.0651  -0.0685 0.0303  180 LYS A CA  
1398 C C   . LYS A 198 ? 0.2602 0.4719 0.4325 0.0488  -0.0701 0.0233  180 LYS A C   
1399 O O   . LYS A 198 ? 0.2362 0.4741 0.4352 0.0448  -0.0717 0.0203  180 LYS A O   
1400 C CB  . LYS A 198 ? 0.3124 0.5105 0.4684 0.0712  -0.0841 0.0374  180 LYS A CB  
1401 C CG  . LYS A 198 ? 0.3587 0.5890 0.5401 0.0764  -0.0992 0.0413  180 LYS A CG  
1402 C CD  . LYS A 198 ? 0.4271 0.6572 0.5879 0.0738  -0.1175 0.0452  180 LYS A CD  
1403 C CE  . LYS A 198 ? 0.4725 0.7402 0.6609 0.0761  -0.1351 0.0477  180 LYS A CE  
1404 N NZ  . LYS A 198 ? 0.4969 0.7670 0.6628 0.0682  -0.1539 0.0485  180 LYS A NZ  
1405 N N   . ILE A 199 ? 0.1841 0.3751 0.3300 0.0393  -0.0683 0.0205  181 ILE A N   
1406 C CA  . ILE A 199 ? 0.2056 0.4004 0.3506 0.0242  -0.0677 0.0139  181 ILE A CA  
1407 C C   . ILE A 199 ? 0.1915 0.3917 0.3524 0.0193  -0.0540 0.0098  181 ILE A C   
1408 O O   . ILE A 199 ? 0.1927 0.4085 0.3691 0.0094  -0.0536 0.0053  181 ILE A O   
1409 C CB  . ILE A 199 ? 0.2230 0.3920 0.3373 0.0174  -0.0665 0.0124  181 ILE A CB  
1410 C CG1 . ILE A 199 ? 0.2757 0.4403 0.3724 0.0190  -0.0795 0.0152  181 ILE A CG1 
1411 C CG2 . ILE A 199 ? 0.2005 0.3683 0.3143 0.0031  -0.0617 0.0058  181 ILE A CG2 
1412 C CD1 . ILE A 199 ? 0.2912 0.4301 0.3588 0.0135  -0.0761 0.0138  181 ILE A CD1 
1413 N N   . ALA A 200 ? 0.1886 0.3748 0.3440 0.0254  -0.0423 0.0113  182 ALA A N   
1414 C CA  . ALA A 200 ? 0.2172 0.4050 0.3821 0.0214  -0.0283 0.0083  182 ALA A CA  
1415 C C   . ALA A 200 ? 0.2379 0.4538 0.4363 0.0230  -0.0259 0.0068  182 ALA A C   
1416 O O   . ALA A 200 ? 0.2311 0.4561 0.4419 0.0137  -0.0181 0.0030  182 ALA A O   
1417 C CB  . ALA A 200 ? 0.1917 0.3596 0.3416 0.0278  -0.0182 0.0097  182 ALA A CB  
1418 N N   . LYS A 201 ? 0.2551 0.4844 0.4692 0.0352  -0.0317 0.0104  183 LYS A N   
1419 C CA  . LYS A 201 ? 0.2625 0.5226 0.5140 0.0388  -0.0305 0.0098  183 LYS A CA  
1420 C C   . LYS A 201 ? 0.2197 0.5053 0.4893 0.0274  -0.0418 0.0067  183 LYS A C   
1421 O O   . LYS A 201 ? 0.1996 0.5079 0.4978 0.0213  -0.0357 0.0028  183 LYS A O   
1422 C CB  . LYS A 201 ? 0.2619 0.5297 0.5267 0.0565  -0.0356 0.0158  183 LYS A CB  
1423 C CG  . LYS A 201 ? 0.2929 0.5373 0.5452 0.0667  -0.0215 0.0170  183 LYS A CG  
1424 C CD  . LYS A 201 ? 0.3107 0.5578 0.5742 0.0847  -0.0258 0.0235  183 LYS A CD  
1425 C CE  . LYS A 201 ? 0.3416 0.5617 0.5904 0.0929  -0.0102 0.0229  183 LYS A CE  
1426 N NZ  . LYS A 201 ? 0.4038 0.6185 0.6575 0.1105  -0.0138 0.0300  183 LYS A NZ  
1427 N N   . HIS A 202 ? 0.1871 0.4684 0.4395 0.0236  -0.0575 0.0076  184 HIS A N   
1428 C CA  . HIS A 202 ? 0.1856 0.4871 0.4488 0.0104  -0.0692 0.0031  184 HIS A CA  
1429 C C   . HIS A 202 ? 0.1778 0.4731 0.4399 -0.0065 -0.0570 -0.0042 184 HIS A C   
1430 O O   . HIS A 202 ? 0.1939 0.5131 0.4816 -0.0172 -0.0574 -0.0093 184 HIS A O   
1431 C CB  . HIS A 202 ? 0.1901 0.4801 0.4256 0.0083  -0.0855 0.0045  184 HIS A CB  
1432 C CG  . HIS A 202 ? 0.1994 0.5016 0.4362 -0.0085 -0.0956 -0.0025 184 HIS A CG  
1433 N ND1 . HIS A 202 ? 0.2193 0.5547 0.4790 -0.0108 -0.1125 -0.0032 184 HIS A ND1 
1434 C CD2 . HIS A 202 ? 0.2156 0.5007 0.4339 -0.0243 -0.0909 -0.0095 184 HIS A CD2 
1435 C CE1 . HIS A 202 ? 0.2443 0.5819 0.4976 -0.0290 -0.1180 -0.0116 184 HIS A CE1 
1436 N NE2 . HIS A 202 ? 0.2549 0.5606 0.4830 -0.0371 -0.1040 -0.0155 184 HIS A NE2 
1437 N N   . SER A 203 ? 0.1681 0.4316 0.4014 -0.0087 -0.0462 -0.0042 185 SER A N   
1438 C CA  . SER A 203 ? 0.2495 0.5016 0.4775 -0.0225 -0.0336 -0.0090 185 SER A CA  
1439 C C   . SER A 203 ? 0.2365 0.5040 0.4912 -0.0250 -0.0191 -0.0107 185 SER A C   
1440 O O   . SER A 203 ? 0.2823 0.5619 0.5532 -0.0386 -0.0150 -0.0159 185 SER A O   
1441 C CB  . SER A 203 ? 0.2384 0.4556 0.4329 -0.0208 -0.0256 -0.0065 185 SER A CB  
1442 O OG  . SER A 203 ? 0.2278 0.4323 0.4166 -0.0320 -0.0133 -0.0090 185 SER A OG  
1443 N N   . LEU A 204 ? 0.2003 0.4662 0.4589 -0.0128 -0.0100 -0.0071 186 LEU A N   
1444 C CA  . LEU A 204 ? 0.2200 0.4969 0.4999 -0.0143 0.0070  -0.0089 186 LEU A CA  
1445 C C   . LEU A 204 ? 0.2681 0.5843 0.5918 -0.0177 0.0036  -0.0121 186 LEU A C   
1446 O O   . LEU A 204 ? 0.2564 0.5837 0.5988 -0.0290 0.0156  -0.0163 186 LEU A O   
1447 C CB  . LEU A 204 ? 0.1832 0.4493 0.4566 -0.0002 0.0172  -0.0055 186 LEU A CB  
1448 C CG  . LEU A 204 ? 0.2018 0.4666 0.4824 -0.0035 0.0389  -0.0076 186 LEU A CG  
1449 C CD1 . LEU A 204 ? 0.2175 0.4553 0.4681 -0.0149 0.0476  -0.0077 186 LEU A CD1 
1450 C CD2 . LEU A 204 ? 0.2086 0.4658 0.4859 0.0105  0.0490  -0.0062 186 LEU A CD2 
1451 N N   . GLU A 205 ? 0.2835 0.6212 0.6240 -0.0081 -0.0127 -0.0097 187 GLU A N   
1452 C CA  . GLU A 205 ? 0.2968 0.6767 0.6826 -0.0096 -0.0191 -0.0118 187 GLU A CA  
1453 C C   . GLU A 205 ? 0.2407 0.6340 0.6347 -0.0299 -0.0268 -0.0186 187 GLU A C   
1454 O O   . GLU A 205 ? 0.2459 0.6723 0.6786 -0.0379 -0.0254 -0.0228 187 GLU A O   
1455 C CB  . GLU A 205 ? 0.3859 0.7845 0.7853 0.0071  -0.0369 -0.0057 187 GLU A CB  
1456 C CG  . GLU A 205 ? 0.5167 0.9119 0.8950 0.0044  -0.0601 -0.0042 187 GLU A CG  
1457 C CD  . GLU A 205 ? 0.6211 1.0328 1.0105 0.0221  -0.0774 0.0039  187 GLU A CD  
1458 O OE1 . GLU A 205 ? 0.6514 1.0779 1.0400 0.0185  -0.0987 0.0047  187 GLU A OE1 
1459 O OE2 . GLU A 205 ? 0.6515 1.0593 1.0483 0.0395  -0.0693 0.0095  187 GLU A OE2 
1460 N N   . ASN A 206 ? 0.2414 0.6088 0.6001 -0.0388 -0.0334 -0.0202 188 ASN A N   
1461 C CA  . ASN A 206 ? 0.2620 0.6353 0.6227 -0.0591 -0.0392 -0.0279 188 ASN A CA  
1462 C C   . ASN A 206 ? 0.2692 0.6148 0.6125 -0.0733 -0.0205 -0.0318 188 ASN A C   
1463 O O   . ASN A 206 ? 0.2672 0.6082 0.6054 -0.0905 -0.0225 -0.0384 188 ASN A O   
1464 C CB  . ASN A 206 ? 0.2608 0.6257 0.5960 -0.0607 -0.0600 -0.0284 188 ASN A CB  
1465 C CG  . ASN A 206 ? 0.2417 0.6390 0.5972 -0.0509 -0.0813 -0.0249 188 ASN A CG  
1466 O OD1 . ASN A 206 ? 0.2445 0.6310 0.5801 -0.0366 -0.0914 -0.0180 188 ASN A OD1 
1467 N ND2 . ASN A 206 ? 0.2245 0.6624 0.6207 -0.0584 -0.0884 -0.0291 188 ASN A ND2 
1468 N N   . GLU A 207 ? 0.2888 0.6151 0.6217 -0.0662 -0.0022 -0.0276 189 GLU A N   
1469 C CA  . GLU A 207 ? 0.3255 0.6242 0.6401 -0.0770 0.0162  -0.0286 189 GLU A CA  
1470 C C   . GLU A 207 ? 0.3287 0.5954 0.6077 -0.0837 0.0117  -0.0293 189 GLU A C   
1471 O O   . GLU A 207 ? 0.3865 0.6401 0.6603 -0.0988 0.0201  -0.0333 189 GLU A O   
1472 C CB  . GLU A 207 ? 0.3764 0.6945 0.7220 -0.0933 0.0283  -0.0347 189 GLU A CB  
1473 C CG  . GLU A 207 ? 0.4552 0.7907 0.8272 -0.0871 0.0446  -0.0329 189 GLU A CG  
1474 C CD  . GLU A 207 ? 0.5256 0.8279 0.8664 -0.0788 0.0617  -0.0269 189 GLU A CD  
1475 O OE1 . GLU A 207 ? 0.5643 0.8383 0.8811 -0.0884 0.0738  -0.0260 189 GLU A OE1 
1476 O OE2 . GLU A 207 ? 0.5142 0.8176 0.8532 -0.0626 0.0626  -0.0230 189 GLU A OE2 
1477 N N   . LYS A 208 ? 0.2688 0.5221 0.5243 -0.0724 0.0001  -0.0255 190 LYS A N   
1478 C CA  . LYS A 208 ? 0.1981 0.4210 0.4208 -0.0761 -0.0027 -0.0256 190 LYS A CA  
1479 C C   . LYS A 208 ? 0.1971 0.3896 0.3939 -0.0682 0.0093  -0.0189 190 LYS A C   
1480 O O   . LYS A 208 ? 0.2565 0.4503 0.4576 -0.0618 0.0196  -0.0151 190 LYS A O   
1481 C CB  . LYS A 208 ? 0.2383 0.4642 0.4500 -0.0697 -0.0214 -0.0255 190 LYS A CB  
1482 C CG  . LYS A 208 ? 0.2008 0.4563 0.4335 -0.0780 -0.0367 -0.0316 190 LYS A CG  
1483 C CD  . LYS A 208 ? 0.3029 0.5575 0.5182 -0.0711 -0.0548 -0.0301 190 LYS A CD  
1484 C CE  . LYS A 208 ? 0.2843 0.5692 0.5174 -0.0797 -0.0725 -0.0357 190 LYS A CE  
1485 N NZ  . LYS A 208 ? 0.2656 0.5435 0.4733 -0.0757 -0.0894 -0.0345 190 LYS A NZ  
1486 N N   . LEU A 209 ? 0.2022 0.3680 0.3721 -0.0687 0.0079  -0.0177 191 LEU A N   
1487 C CA  . LEU A 209 ? 0.2395 0.3787 0.3863 -0.0616 0.0169  -0.0110 191 LEU A CA  
1488 C C   . LEU A 209 ? 0.2307 0.3631 0.3618 -0.0482 0.0079  -0.0067 191 LEU A C   
1489 O O   . LEU A 209 ? 0.2183 0.3418 0.3372 -0.0482 0.0000  -0.0081 191 LEU A O   
1490 C CB  . LEU A 209 ? 0.2401 0.3531 0.3709 -0.0705 0.0245  -0.0113 191 LEU A CB  
1491 C CG  . LEU A 209 ? 0.2839 0.3720 0.3943 -0.0637 0.0339  -0.0029 191 LEU A CG  
1492 C CD1 . LEU A 209 ? 0.3087 0.3974 0.4242 -0.0668 0.0477  0.0002  191 LEU A CD1 
1493 C CD2 . LEU A 209 ? 0.2923 0.3534 0.3860 -0.0674 0.0376  -0.0019 191 LEU A CD2 
1494 N N   . PHE A 210 ? 0.2404 0.3749 0.3704 -0.0380 0.0105  -0.0023 192 PHE A N   
1495 C CA  . PHE A 210 ? 0.2138 0.3413 0.3301 -0.0266 0.0035  0.0012  192 PHE A CA  
1496 C C   . PHE A 210 ? 0.2232 0.3293 0.3192 -0.0228 0.0099  0.0064  192 PHE A C   
1497 O O   . PHE A 210 ? 0.2745 0.3780 0.3683 -0.0219 0.0187  0.0088  192 PHE A O   
1498 C CB  . PHE A 210 ? 0.2329 0.3773 0.3623 -0.0175 0.0004  0.0016  192 PHE A CB  
1499 C CG  . PHE A 210 ? 0.2247 0.3615 0.3413 -0.0073 -0.0071 0.0044  192 PHE A CG  
1500 C CD1 . PHE A 210 ? 0.2257 0.3691 0.3438 -0.0047 -0.0189 0.0039  192 PHE A CD1 
1501 C CD2 . PHE A 210 ? 0.1891 0.3116 0.2908 -0.0015 -0.0025 0.0075  192 PHE A CD2 
1502 C CE1 . PHE A 210 ? 0.2663 0.4003 0.3717 0.0038  -0.0240 0.0069  192 PHE A CE1 
1503 C CE2 . PHE A 210 ? 0.2287 0.3438 0.3201 0.0060  -0.0082 0.0094  192 PHE A CE2 
1504 C CZ  . PHE A 210 ? 0.2361 0.3560 0.3296 0.0087  -0.0181 0.0093  192 PHE A CZ  
1505 N N   . CYS A 211 ? 0.1977 0.2895 0.2791 -0.0206 0.0053  0.0083  193 CYS A N   
1506 C CA  . CYS A 211 ? 0.2289 0.3037 0.2941 -0.0167 0.0089  0.0138  193 CYS A CA  
1507 C C   . CYS A 211 ? 0.2528 0.3264 0.3105 -0.0081 0.0025  0.0155  193 CYS A C   
1508 O O   . CYS A 211 ? 0.2210 0.2966 0.2792 -0.0060 -0.0043 0.0137  193 CYS A O   
1509 C CB  . CYS A 211 ? 0.2620 0.3209 0.3197 -0.0206 0.0110  0.0150  193 CYS A CB  
1510 S SG  . CYS A 211 ? 0.3072 0.3633 0.3726 -0.0331 0.0194  0.0114  193 CYS A SG  
1511 N N   . PHE A 212 ? 0.2718 0.3410 0.3210 -0.0043 0.0052  0.0189  194 PHE A N   
1512 C CA  . PHE A 212 ? 0.2309 0.2996 0.2742 0.0019  0.0005  0.0192  194 PHE A CA  
1513 C C   . PHE A 212 ? 0.2474 0.3058 0.2776 0.0035  -0.0004 0.0237  194 PHE A C   
1514 O O   . PHE A 212 ? 0.2789 0.3320 0.3017 0.0019  0.0039  0.0275  194 PHE A O   
1515 C CB  . PHE A 212 ? 0.2324 0.3084 0.2794 0.0045  0.0039  0.0167  194 PHE A CB  
1516 C CG  . PHE A 212 ? 0.1991 0.2717 0.2394 0.0097  0.0007  0.0158  194 PHE A CG  
1517 C CD1 . PHE A 212 ? 0.2046 0.2778 0.2480 0.0132  -0.0054 0.0149  194 PHE A CD1 
1518 C CD2 . PHE A 212 ? 0.1833 0.2500 0.2118 0.0102  0.0046  0.0155  194 PHE A CD2 
1519 C CE1 . PHE A 212 ? 0.2613 0.3286 0.2983 0.0169  -0.0067 0.0140  194 PHE A CE1 
1520 C CE2 . PHE A 212 ? 0.2571 0.3188 0.2789 0.0132  0.0025  0.0133  194 PHE A CE2 
1521 C CZ  . PHE A 212 ? 0.2688 0.3305 0.2960 0.0165  -0.0026 0.0126  194 PHE A CZ  
1522 N N   . ASN A 213 ? 0.2105 0.2669 0.2385 0.0066  -0.0060 0.0240  195 ASN A N   
1523 C CA  . ASN A 213 ? 0.2249 0.2765 0.2450 0.0082  -0.0088 0.0281  195 ASN A CA  
1524 C C   . ASN A 213 ? 0.2620 0.3150 0.2763 0.0094  -0.0119 0.0257  195 ASN A C   
1525 O O   . ASN A 213 ? 0.2596 0.3139 0.2776 0.0108  -0.0132 0.0220  195 ASN A O   
1526 C CB  . ASN A 213 ? 0.1963 0.2448 0.2212 0.0095  -0.0112 0.0299  195 ASN A CB  
1527 C CG  . ASN A 213 ? 0.2261 0.2720 0.2486 0.0117  -0.0133 0.0362  195 ASN A CG  
1528 O OD1 . ASN A 213 ? 0.2227 0.2720 0.2405 0.0126  -0.0180 0.0376  195 ASN A OD1 
1529 N ND2 . ASN A 213 ? 0.2176 0.2571 0.2435 0.0128  -0.0102 0.0401  195 ASN A ND2 
1530 N N   . LEU A 214 ? 0.2461 0.2972 0.2493 0.0086  -0.0129 0.0278  196 LEU A N   
1531 C CA  . LEU A 214 ? 0.2437 0.2943 0.2388 0.0077  -0.0158 0.0241  196 LEU A CA  
1532 C C   . LEU A 214 ? 0.2448 0.2976 0.2466 0.0079  -0.0217 0.0235  196 LEU A C   
1533 O O   . LEU A 214 ? 0.2647 0.3158 0.2644 0.0065  -0.0225 0.0188  196 LEU A O   
1534 C CB  . LEU A 214 ? 0.2376 0.2854 0.2157 0.0053  -0.0171 0.0263  196 LEU A CB  
1535 C CG  . LEU A 214 ? 0.2604 0.3036 0.2278 0.0039  -0.0088 0.0266  196 LEU A CG  
1536 C CD1 . LEU A 214 ? 0.3027 0.3408 0.2476 0.0011  -0.0112 0.0295  196 LEU A CD1 
1537 C CD2 . LEU A 214 ? 0.2461 0.2891 0.2171 0.0043  -0.0010 0.0193  196 LEU A CD2 
1538 N N   . SER A 215 ? 0.2063 0.2615 0.2164 0.0095  -0.0241 0.0282  197 SER A N   
1539 C CA  . SER A 215 ? 0.2029 0.2607 0.2234 0.0099  -0.0266 0.0277  197 SER A CA  
1540 C C   . SER A 215 ? 0.2004 0.2638 0.2220 0.0074  -0.0327 0.0271  197 SER A C   
1541 O O   . SER A 215 ? 0.2032 0.2730 0.2362 0.0086  -0.0356 0.0305  197 SER A O   
1542 C CB  . SER A 215 ? 0.2183 0.2722 0.2417 0.0103  -0.0230 0.0232  197 SER A CB  
1543 O OG  . SER A 215 ? 0.2939 0.3460 0.3195 0.0117  -0.0196 0.0239  197 SER A OG  
1544 N N   . ALA A 216 ? 0.2138 0.2754 0.2251 0.0035  -0.0342 0.0223  198 ALA A N   
1545 C CA  . ALA A 216 ? 0.2340 0.3011 0.2457 -0.0015 -0.0404 0.0197  198 ALA A CA  
1546 C C   . ALA A 216 ? 0.2504 0.3117 0.2440 -0.0067 -0.0410 0.0137  198 ALA A C   
1547 O O   . ALA A 216 ? 0.2541 0.3055 0.2397 -0.0056 -0.0338 0.0097  198 ALA A O   
1548 C CB  . ALA A 216 ? 0.2504 0.3171 0.2740 -0.0034 -0.0379 0.0163  198 ALA A CB  
1549 N N   . PRO A 217 ? 0.2379 0.3057 0.2256 -0.0122 -0.0496 0.0127  199 PRO A N   
1550 C CA  . PRO A 217 ? 0.3093 0.3694 0.2757 -0.0187 -0.0499 0.0057  199 PRO A CA  
1551 C C   . PRO A 217 ? 0.3258 0.3728 0.2889 -0.0221 -0.0416 -0.0038 199 PRO A C   
1552 O O   . PRO A 217 ? 0.3414 0.3764 0.2879 -0.0230 -0.0352 -0.0090 199 PRO A O   
1553 C CB  . PRO A 217 ? 0.2555 0.3283 0.2209 -0.0255 -0.0631 0.0059  199 PRO A CB  
1554 C CG  . PRO A 217 ? 0.2861 0.3732 0.2689 -0.0187 -0.0693 0.0167  199 PRO A CG  
1555 C CD  . PRO A 217 ? 0.2220 0.3055 0.2227 -0.0127 -0.0597 0.0181  199 PRO A CD  
1556 N N   . PHE A 218 ? 0.2386 0.2860 0.2167 -0.0233 -0.0403 -0.0056 200 PHE A N   
1557 C CA  . PHE A 218 ? 0.3107 0.3424 0.2843 -0.0261 -0.0320 -0.0134 200 PHE A CA  
1558 C C   . PHE A 218 ? 0.3471 0.3668 0.3167 -0.0178 -0.0219 -0.0130 200 PHE A C   
1559 O O   . PHE A 218 ? 0.3963 0.4009 0.3568 -0.0184 -0.0144 -0.0193 200 PHE A O   
1560 C CB  . PHE A 218 ? 0.2568 0.2891 0.2458 -0.0294 -0.0311 -0.0142 200 PHE A CB  
1561 C CG  . PHE A 218 ? 0.2630 0.2962 0.2654 -0.0212 -0.0269 -0.0075 200 PHE A CG  
1562 C CD1 . PHE A 218 ? 0.3004 0.3192 0.2995 -0.0155 -0.0185 -0.0074 200 PHE A CD1 
1563 C CD2 . PHE A 218 ? 0.2512 0.2989 0.2688 -0.0193 -0.0312 -0.0015 200 PHE A CD2 
1564 C CE1 . PHE A 218 ? 0.2959 0.3152 0.3033 -0.0092 -0.0161 -0.0017 200 PHE A CE1 
1565 C CE2 . PHE A 218 ? 0.2687 0.3146 0.2947 -0.0132 -0.0264 0.0032  200 PHE A CE2 
1566 C CZ  . PHE A 218 ? 0.2618 0.2936 0.2811 -0.0089 -0.0195 0.0029  200 PHE A CZ  
1567 N N   . LEU A 219 ? 0.2925 0.3191 0.2698 -0.0102 -0.0216 -0.0059 201 LEU A N   
1568 C CA  . LEU A 219 ? 0.2917 0.3124 0.2696 -0.0027 -0.0140 -0.0051 201 LEU A CA  
1569 C C   . LEU A 219 ? 0.3144 0.3295 0.2784 -0.0030 -0.0086 -0.0092 201 LEU A C   
1570 O O   . LEU A 219 ? 0.3219 0.3272 0.2842 0.0008  -0.0001 -0.0130 201 LEU A O   
1571 C CB  . LEU A 219 ? 0.2542 0.2847 0.2437 0.0029  -0.0155 0.0021  201 LEU A CB  
1572 C CG  . LEU A 219 ? 0.2669 0.2992 0.2680 0.0045  -0.0174 0.0053  201 LEU A CG  
1573 C CD1 . LEU A 219 ? 0.2457 0.2863 0.2545 0.0076  -0.0192 0.0109  201 LEU A CD1 
1574 C CD2 . LEU A 219 ? 0.2227 0.2448 0.2245 0.0085  -0.0125 0.0040  201 LEU A CD2 
1575 N N   . SER A 220 ? 0.2786 0.2989 0.2320 -0.0068 -0.0126 -0.0079 202 SER A N   
1576 C CA  . SER A 220 ? 0.3128 0.3257 0.2486 -0.0083 -0.0061 -0.0121 202 SER A CA  
1577 C C   . SER A 220 ? 0.3652 0.3639 0.2849 -0.0146 -0.0025 -0.0221 202 SER A C   
1578 O O   . SER A 220 ? 0.3829 0.3703 0.2905 -0.0141 0.0078  -0.0278 202 SER A O   
1579 C CB  . SER A 220 ? 0.3101 0.3293 0.2338 -0.0112 -0.0116 -0.0071 202 SER A CB  
1580 O OG  . SER A 220 ? 0.3402 0.3673 0.2763 -0.0057 -0.0107 0.0008  202 SER A OG  
1581 N N   . GLN A 221 ? 0.3970 0.3959 0.3175 -0.0212 -0.0098 -0.0250 203 GLN A N   
1582 C CA  . GLN A 221 ? 0.4424 0.4267 0.3469 -0.0299 -0.0070 -0.0358 203 GLN A CA  
1583 C C   . GLN A 221 ? 0.4276 0.3952 0.3382 -0.0258 0.0044  -0.0406 203 GLN A C   
1584 O O   . GLN A 221 ? 0.4641 0.4140 0.3604 -0.0271 0.0146  -0.0489 203 GLN A O   
1585 C CB  . GLN A 221 ? 0.4845 0.4775 0.3895 -0.0404 -0.0196 -0.0376 203 GLN A CB  
1586 C CG  . GLN A 221 ? 0.5735 0.5826 0.4713 -0.0437 -0.0325 -0.0322 203 GLN A CG  
1587 C CD  . GLN A 221 ? 0.6018 0.6265 0.5103 -0.0514 -0.0465 -0.0315 203 GLN A CD  
1588 O OE1 . GLN A 221 ? 0.5884 0.6170 0.5176 -0.0516 -0.0461 -0.0312 203 GLN A OE1 
1589 N NE2 . GLN A 221 ? 0.6116 0.6462 0.5065 -0.0579 -0.0588 -0.0309 203 GLN A NE2 
1590 N N   . PHE A 222 ? 0.3476 0.3191 0.2776 -0.0204 0.0033  -0.0349 204 PHE A N   
1591 C CA  . PHE A 222 ? 0.3669 0.3213 0.3013 -0.0163 0.0125  -0.0374 204 PHE A CA  
1592 C C   . PHE A 222 ? 0.3774 0.3323 0.3243 -0.0024 0.0186  -0.0309 204 PHE A C   
1593 O O   . PHE A 222 ? 0.3831 0.3229 0.3324 0.0037  0.0267  -0.0316 204 PHE A O   
1594 C CB  . PHE A 222 ? 0.3817 0.3356 0.3249 -0.0218 0.0082  -0.0365 204 PHE A CB  
1595 C CG  . PHE A 222 ? 0.4708 0.4275 0.4065 -0.0364 0.0014  -0.0435 204 PHE A CG  
1596 C CD1 . PHE A 222 ? 0.5353 0.4735 0.4545 -0.0457 0.0070  -0.0549 204 PHE A CD1 
1597 C CD2 . PHE A 222 ? 0.4683 0.4467 0.4141 -0.0410 -0.0106 -0.0391 204 PHE A CD2 
1598 C CE1 . PHE A 222 ? 0.5729 0.5160 0.4854 -0.0609 -0.0010 -0.0623 204 PHE A CE1 
1599 C CE2 . PHE A 222 ? 0.5042 0.4896 0.4465 -0.0542 -0.0189 -0.0450 204 PHE A CE2 
1600 C CZ  . PHE A 222 ? 0.5507 0.5195 0.4761 -0.0650 -0.0150 -0.0569 204 PHE A CZ  
1601 N N   . ASN A 223 ? 0.3688 0.3411 0.3241 0.0024  0.0142  -0.0242 205 ASN A N   
1609 N N   . THR A 224 ? 0.3493 0.3247 0.3177 0.0366  0.0007  -0.0093 206 THR A N   
1610 C CA  . THR A 224 ? 0.3243 0.3089 0.2855 0.0425  0.0054  -0.0127 206 THR A CA  
1611 C C   . THR A 224 ? 0.3142 0.3169 0.2803 0.0540  0.0144  -0.0108 206 THR A C   
1612 O O   . THR A 224 ? 0.3067 0.3322 0.2832 0.0535  0.0196  -0.0091 206 THR A O   
1613 C CB  . THR A 224 ? 0.3372 0.2948 0.2727 0.0473  0.0017  -0.0196 206 THR A CB  
1614 O OG1 . THR A 224 ? 0.3671 0.3052 0.2998 0.0363  -0.0101 -0.0215 206 THR A OG1 
1615 C CG2 . THR A 224 ? 0.3045 0.2706 0.2314 0.0507  0.0066  -0.0214 206 THR A CG2 
1616 N N   . LYS A 225 ? 0.3357 0.3281 0.2959 0.0639  0.0157  -0.0104 207 LYS A N   
1617 C CA  . LYS A 225 ? 0.3221 0.3334 0.2900 0.0762  0.0228  -0.0079 207 LYS A CA  
1618 C C   . LYS A 225 ? 0.2791 0.3207 0.2695 0.0701  0.0228  -0.0032 207 LYS A C   
1619 O O   . LYS A 225 ? 0.2987 0.3648 0.3016 0.0730  0.0276  -0.0020 207 LYS A O   
1620 C CB  . LYS A 225 ? 0.3413 0.3342 0.2996 0.0877  0.0222  -0.0070 207 LYS A CB  
1621 C CG  . LYS A 225 ? 0.3303 0.3437 0.2985 0.1025  0.0276  -0.0034 207 LYS A CG  
1622 C CD  . LYS A 225 ? 0.3720 0.4049 0.3570 0.0986  0.0234  0.0026  207 LYS A CD  
1623 C CE  . LYS A 225 ? 0.4138 0.4434 0.3965 0.1136  0.0229  0.0067  207 LYS A CE  
1624 N NZ  . LYS A 225 ? 0.3901 0.3858 0.3562 0.1127  0.0192  0.0085  207 LYS A NZ  
1625 N N   . GLU A 226 ? 0.2629 0.3017 0.2581 0.0615  0.0177  -0.0004 208 GLU A N   
1626 C CA  . GLU A 226 ? 0.2689 0.3304 0.2794 0.0566  0.0166  0.0029  208 GLU A CA  
1627 C C   . GLU A 226 ? 0.2690 0.3459 0.2891 0.0471  0.0177  0.0015  208 GLU A C   
1628 O O   . GLU A 226 ? 0.2044 0.3025 0.2370 0.0457  0.0182  0.0024  208 GLU A O   
1629 C CB  . GLU A 226 ? 0.2735 0.3249 0.2822 0.0514  0.0132  0.0067  208 GLU A CB  
1630 C CG  . GLU A 226 ? 0.3484 0.3857 0.3482 0.0607  0.0124  0.0104  208 GLU A CG  
1631 C CD  . GLU A 226 ? 0.3930 0.4001 0.3808 0.0594  0.0115  0.0102  208 GLU A CD  
1632 O OE1 . GLU A 226 ? 0.4109 0.4087 0.3946 0.0554  0.0106  0.0053  208 GLU A OE1 
1633 O OE2 . GLU A 226 ? 0.4296 0.4206 0.4109 0.0618  0.0110  0.0150  208 GLU A OE2 
1634 N N   . VAL A 227 ? 0.2617 0.3266 0.2758 0.0402  0.0170  -0.0005 209 VAL A N   
1635 C CA  . VAL A 227 ? 0.2432 0.3189 0.2638 0.0324  0.0182  -0.0010 209 VAL A CA  
1636 C C   . VAL A 227 ? 0.2384 0.3284 0.2624 0.0370  0.0244  -0.0013 209 VAL A C   
1637 O O   . VAL A 227 ? 0.2576 0.3652 0.2944 0.0322  0.0262  0.0002  209 VAL A O   
1638 C CB  . VAL A 227 ? 0.2458 0.3059 0.2585 0.0260  0.0148  -0.0025 209 VAL A CB  
1639 C CG1 . VAL A 227 ? 0.1978 0.2670 0.2141 0.0207  0.0167  -0.0022 209 VAL A CG1 
1640 C CG2 . VAL A 227 ? 0.1853 0.2376 0.2023 0.0196  0.0100  -0.0002 209 VAL A CG2 
1641 N N   . ASP A 228 ? 0.2531 0.3344 0.2656 0.0465  0.0284  -0.0030 210 ASP A N   
1642 C CA  . ASP A 228 ? 0.3109 0.4063 0.3267 0.0525  0.0373  -0.0019 210 ASP A CA  
1643 C C   . ASP A 228 ? 0.3119 0.4338 0.3490 0.0565  0.0397  0.0014  210 ASP A C   
1644 O O   . ASP A 228 ? 0.3047 0.4479 0.3569 0.0546  0.0456  0.0043  210 ASP A O   
1645 C CB  . ASP A 228 ? 0.3784 0.4554 0.3727 0.0643  0.0423  -0.0048 210 ASP A CB  
1646 C CG  . ASP A 228 ? 0.4173 0.4732 0.3909 0.0601  0.0400  -0.0079 210 ASP A CG  
1647 O OD1 . ASP A 228 ? 0.3832 0.4438 0.3627 0.0491  0.0370  -0.0063 210 ASP A OD1 
1648 O OD2 . ASP A 228 ? 0.4348 0.4678 0.3844 0.0685  0.0404  -0.0121 210 ASP A OD2 
1649 N N   . GLU A 229 ? 0.2882 0.4092 0.3273 0.0616  0.0346  0.0017  211 GLU A N   
1650 C CA  . GLU A 229 ? 0.2836 0.4305 0.3429 0.0656  0.0336  0.0048  211 GLU A CA  
1651 C C   . GLU A 229 ? 0.2583 0.4213 0.3332 0.0523  0.0283  0.0055  211 GLU A C   
1652 O O   . GLU A 229 ? 0.1642 0.3524 0.2598 0.0501  0.0291  0.0076  211 GLU A O   
1653 C CB  . GLU A 229 ? 0.2757 0.4151 0.3298 0.0752  0.0283  0.0056  211 GLU A CB  
1654 C CG  . GLU A 229 ? 0.3391 0.5065 0.4137 0.0812  0.0251  0.0090  211 GLU A CG  
1655 C CD  . GLU A 229 ? 0.4359 0.5955 0.5033 0.0956  0.0218  0.0111  211 GLU A CD  
1656 O OE1 . GLU A 229 ? 0.4622 0.5955 0.5108 0.0955  0.0184  0.0107  211 GLU A OE1 
1657 O OE2 . GLU A 229 ? 0.4810 0.6614 0.5632 0.1075  0.0231  0.0141  211 GLU A OE2 
1658 N N   . MET A 230 ? 0.2033 0.3514 0.2689 0.0435  0.0229  0.0037  212 MET A N   
1659 C CA  . MET A 230 ? 0.1816 0.3382 0.2561 0.0322  0.0183  0.0032  212 MET A CA  
1660 C C   . MET A 230 ? 0.1929 0.3588 0.2771 0.0241  0.0234  0.0038  212 MET A C   
1661 O O   . MET A 230 ? 0.1944 0.3766 0.2944 0.0172  0.0209  0.0043  212 MET A O   
1662 C CB  . MET A 230 ? 0.1535 0.2911 0.2150 0.0269  0.0146  0.0020  212 MET A CB  
1663 C CG  . MET A 230 ? 0.2415 0.3710 0.2946 0.0329  0.0103  0.0032  212 MET A CG  
1664 S SD  . MET A 230 ? 0.3258 0.4744 0.3875 0.0369  0.0027  0.0036  212 MET A SD  
1665 C CE  . MET A 230 ? 0.1911 0.3429 0.2557 0.0244  -0.0015 0.0004  212 MET A CE  
1666 N N   . ILE A 231 ? 0.1769 0.3305 0.2503 0.0246  0.0297  0.0039  213 ILE A N   
1667 C CA  . ILE A 231 ? 0.2042 0.3634 0.2827 0.0185  0.0362  0.0060  213 ILE A CA  
1668 C C   . ILE A 231 ? 0.2645 0.4497 0.3644 0.0201  0.0419  0.0098  213 ILE A C   
1669 O O   . ILE A 231 ? 0.2683 0.4653 0.3829 0.0106  0.0440  0.0124  213 ILE A O   
1670 C CB  . ILE A 231 ? 0.1657 0.3066 0.2245 0.0222  0.0417  0.0059  213 ILE A CB  
1671 C CG1 . ILE A 231 ? 0.1643 0.2847 0.2097 0.0175  0.0347  0.0034  213 ILE A CG1 
1672 C CG2 . ILE A 231 ? 0.1747 0.3215 0.2363 0.0186  0.0507  0.0099  213 ILE A CG2 
1673 C CD1 . ILE A 231 ? 0.1782 0.2799 0.2038 0.0205  0.0358  0.0025  213 ILE A CD1 
1674 N N   . SER A 232 ? 0.2296 0.4243 0.3334 0.0320  0.0442  0.0106  214 SER A N   
1675 C CA  . SER A 232 ? 0.2052 0.4288 0.3335 0.0356  0.0509  0.0154  214 SER A CA  
1676 C C   . SER A 232 ? 0.1663 0.4141 0.3218 0.0264  0.0416  0.0163  214 SER A C   
1677 O O   . SER A 232 ? 0.1495 0.4255 0.3325 0.0253  0.0455  0.0212  214 SER A O   
1678 C CB  . SER A 232 ? 0.2004 0.4272 0.3251 0.0535  0.0569  0.0164  214 SER A CB  
1679 O OG  . SER A 232 ? 0.2068 0.4362 0.3343 0.0598  0.0469  0.0148  214 SER A OG  
1680 N N   . TYR A 233 ? 0.1553 0.3920 0.3034 0.0199  0.0291  0.0119  215 TYR A N   
1681 C CA  . TYR A 233 ? 0.1573 0.4101 0.3241 0.0101  0.0178  0.0108  215 TYR A CA  
1682 C C   . TYR A 233 ? 0.2056 0.4436 0.3661 -0.0048 0.0144  0.0080  215 TYR A C   
1683 O O   . TYR A 233 ? 0.2422 0.4869 0.4137 -0.0146 0.0043  0.0057  215 TYR A O   
1684 C CB  . TYR A 233 ? 0.1622 0.4130 0.3219 0.0168  0.0054  0.0078  215 TYR A CB  
1685 C CG  . TYR A 233 ? 0.1747 0.4396 0.3414 0.0325  0.0066  0.0110  215 TYR A CG  
1686 C CD1 . TYR A 233 ? 0.1678 0.4134 0.3133 0.0452  0.0126  0.0110  215 TYR A CD1 
1687 C CD2 . TYR A 233 ? 0.1723 0.4690 0.3675 0.0347  0.0008  0.0141  215 TYR A CD2 
1688 C CE1 . TYR A 233 ? 0.2015 0.4557 0.3508 0.0610  0.0141  0.0139  215 TYR A CE1 
1689 C CE2 . TYR A 233 ? 0.2047 0.5146 0.4069 0.0513  0.0022  0.0176  215 TYR A CE2 
1690 C CZ  . TYR A 233 ? 0.2263 0.5131 0.4037 0.0651  0.0095  0.0174  215 TYR A CZ  
1691 O OH  . TYR A 233 ? 0.2453 0.5411 0.4272 0.0831  0.0113  0.0208  215 TYR A OH  
1692 N N   . SER A 234 ? 0.1899 0.4062 0.3318 -0.0057 0.0216  0.0078  216 SER A N   
1693 C CA  . SER A 234 ? 0.1732 0.3721 0.3060 -0.0165 0.0189  0.0053  216 SER A CA  
1694 C C   . SER A 234 ? 0.2004 0.4047 0.3464 -0.0271 0.0253  0.0094  216 SER A C   
1695 O O   . SER A 234 ? 0.2003 0.4093 0.3485 -0.0240 0.0369  0.0147  216 SER A O   
1696 C CB  . SER A 234 ? 0.1911 0.3653 0.2995 -0.0120 0.0217  0.0039  216 SER A CB  
1697 O OG  . SER A 234 ? 0.2052 0.3730 0.3027 -0.0040 0.0167  0.0014  216 SER A OG  
1698 N N   . ASN A 235 ? 0.1782 0.3791 0.3306 -0.0393 0.0183  0.0071  217 ASN A N   
1699 C CA  . ASN A 235 ? 0.1998 0.3999 0.3629 -0.0512 0.0240  0.0114  217 ASN A CA  
1700 C C   . ASN A 235 ? 0.2118 0.3842 0.3522 -0.0517 0.0289  0.0117  217 ASN A C   
1701 O O   . ASN A 235 ? 0.1967 0.3646 0.3383 -0.0564 0.0380  0.0176  217 ASN A O   
1702 C CB  . ASN A 235 ? 0.2033 0.4087 0.3831 -0.0651 0.0127  0.0083  217 ASN A CB  
1703 C CG  . ASN A 235 ? 0.2089 0.4432 0.4121 -0.0644 0.0041  0.0077  217 ASN A CG  
1704 O OD1 . ASN A 235 ? 0.1619 0.3947 0.3560 -0.0587 -0.0074 0.0017  217 ASN A OD1 
1705 N ND2 . ASN A 235 ? 0.1964 0.4581 0.4305 -0.0692 0.0102  0.0150  217 ASN A ND2 
1706 N N   . ILE A 236 ? 0.1603 0.3149 0.2807 -0.0462 0.0232  0.0063  218 ILE A N   
1707 C CA  . ILE A 236 ? 0.1858 0.3170 0.2874 -0.0448 0.0263  0.0067  218 ILE A CA  
1708 C C   . ILE A 236 ? 0.1962 0.3205 0.2825 -0.0337 0.0254  0.0048  218 ILE A C   
1709 O O   . ILE A 236 ? 0.1649 0.2917 0.2491 -0.0296 0.0196  0.0008  218 ILE A O   
1710 C CB  . ILE A 236 ? 0.1917 0.3050 0.2874 -0.0520 0.0200  0.0024  218 ILE A CB  
1711 C CG1 . ILE A 236 ? 0.2065 0.3237 0.3184 -0.0656 0.0185  0.0036  218 ILE A CG1 
1712 C CG2 . ILE A 236 ? 0.1921 0.2836 0.2713 -0.0486 0.0238  0.0042  218 ILE A CG2 
1713 C CD1 . ILE A 236 ? 0.2416 0.3354 0.3442 -0.0726 0.0119  -0.0016 218 ILE A CD1 
1714 N N   . VAL A 237 ? 0.1582 0.2733 0.2335 -0.0292 0.0306  0.0080  219 VAL A N   
1715 C CA  . VAL A 237 ? 0.1536 0.2614 0.2171 -0.0210 0.0285  0.0066  219 VAL A CA  
1716 C C   . VAL A 237 ? 0.2055 0.2970 0.2592 -0.0207 0.0276  0.0077  219 VAL A C   
1717 O O   . VAL A 237 ? 0.2397 0.3239 0.2884 -0.0223 0.0311  0.0116  219 VAL A O   
1718 C CB  . VAL A 237 ? 0.2054 0.3171 0.2637 -0.0140 0.0326  0.0084  219 VAL A CB  
1719 C CG1 . VAL A 237 ? 0.1539 0.2555 0.2013 -0.0080 0.0282  0.0064  219 VAL A CG1 
1720 C CG2 . VAL A 237 ? 0.2004 0.3300 0.2704 -0.0117 0.0346  0.0081  219 VAL A CG2 
1721 N N   . PHE A 238 ? 0.1746 0.2610 0.2258 -0.0179 0.0235  0.0054  220 PHE A N   
1722 C CA  . PHE A 238 ? 0.1695 0.2447 0.2160 -0.0158 0.0224  0.0072  220 PHE A CA  
1723 C C   . PHE A 238 ? 0.2457 0.3209 0.2899 -0.0110 0.0194  0.0083  220 PHE A C   
1724 O O   . PHE A 238 ? 0.2841 0.3645 0.3300 -0.0090 0.0181  0.0066  220 PHE A O   
1725 C CB  . PHE A 238 ? 0.1606 0.2308 0.2078 -0.0152 0.0214  0.0048  220 PHE A CB  
1726 C CG  . PHE A 238 ? 0.1849 0.2490 0.2312 -0.0205 0.0218  0.0023  220 PHE A CG  
1727 C CD1 . PHE A 238 ? 0.1992 0.2493 0.2414 -0.0219 0.0235  0.0040  220 PHE A CD1 
1728 C CD2 . PHE A 238 ? 0.1800 0.2505 0.2290 -0.0242 0.0192  -0.0019 220 PHE A CD2 
1729 C CE1 . PHE A 238 ? 0.2320 0.2721 0.2722 -0.0279 0.0228  0.0010  220 PHE A CE1 
1730 C CE2 . PHE A 238 ? 0.1831 0.2463 0.2316 -0.0308 0.0169  -0.0052 220 PHE A CE2 
1731 C CZ  . PHE A 238 ? 0.2243 0.2709 0.2680 -0.0333 0.0190  -0.0040 220 PHE A CZ  
1732 N N   . GLY A 239 ? 0.2359 0.3043 0.2764 -0.0093 0.0172  0.0113  221 GLY A N   
1733 C CA  . GLY A 239 ? 0.2071 0.2747 0.2475 -0.0066 0.0115  0.0120  221 GLY A CA  
1734 C C   . GLY A 239 ? 0.2183 0.2813 0.2604 -0.0048 0.0074  0.0157  221 GLY A C   
1735 O O   . GLY A 239 ? 0.2647 0.3223 0.3039 -0.0044 0.0099  0.0180  221 GLY A O   
1736 N N   . ASN A 240 ? 0.2340 0.2991 0.2823 -0.0039 0.0004  0.0168  222 ASN A N   
1737 C CA  . ASN A 240 ? 0.2424 0.3059 0.2940 -0.0016 -0.0064 0.0208  222 ASN A CA  
1738 C C   . ASN A 240 ? 0.2410 0.2983 0.2813 -0.0016 -0.0167 0.0199  222 ASN A C   
1739 O O   . ASN A 240 ? 0.2860 0.3387 0.3150 -0.0026 -0.0166 0.0159  222 ASN A O   
1740 C CB  . ASN A 240 ? 0.2434 0.3169 0.3162 -0.0003 -0.0071 0.0241  222 ASN A CB  
1741 C CG  . ASN A 240 ? 0.2714 0.3518 0.3561 -0.0038 -0.0110 0.0237  222 ASN A CG  
1742 O OD1 . ASN A 240 ? 0.2670 0.3420 0.3433 -0.0067 -0.0173 0.0206  222 ASN A OD1 
1743 N ND2 . ASN A 240 ? 0.2915 0.3818 0.3946 -0.0031 -0.0063 0.0272  222 ASN A ND2 
1744 N N   . GLU A 241 ? 0.2383 0.2944 0.2804 0.0006  -0.0261 0.0234  223 GLU A N   
1745 C CA  . GLU A 241 ? 0.2911 0.3377 0.3171 0.0013  -0.0383 0.0219  223 GLU A CA  
1746 C C   . GLU A 241 ? 0.2981 0.3439 0.3270 -0.0032 -0.0464 0.0171  223 GLU A C   
1747 O O   . GLU A 241 ? 0.2941 0.3265 0.3005 -0.0024 -0.0497 0.0123  223 GLU A O   
1748 C CB  . GLU A 241 ? 0.3257 0.3730 0.3553 0.0049  -0.0495 0.0270  223 GLU A CB  
1749 C CG  . GLU A 241 ? 0.3935 0.4269 0.3985 0.0070  -0.0632 0.0252  223 GLU A CG  
1750 C CD  . GLU A 241 ? 0.5191 0.5480 0.5160 0.0135  -0.0699 0.0314  223 GLU A CD  
1751 O OE1 . GLU A 241 ? 0.6039 0.6159 0.5691 0.0179  -0.0719 0.0316  223 GLU A OE1 
1752 O OE2 . GLU A 241 ? 0.5394 0.5810 0.5604 0.0155  -0.0724 0.0369  223 GLU A OE2 
1753 N N   . SER A 242 ? 0.2797 0.3377 0.3348 -0.0073 -0.0483 0.0189  224 SER A N   
1754 C CA  . SER A 242 ? 0.3150 0.3699 0.3749 -0.0131 -0.0561 0.0155  224 SER A CA  
1755 C C   . SER A 242 ? 0.3405 0.3870 0.3865 -0.0129 -0.0469 0.0105  224 SER A C   
1756 O O   . SER A 242 ? 0.3480 0.3814 0.3819 -0.0147 -0.0535 0.0056  224 SER A O   
1757 C CB  . SER A 242 ? 0.3490 0.4204 0.4432 -0.0181 -0.0576 0.0209  224 SER A CB  
1758 O OG  . SER A 242 ? 0.4060 0.4875 0.5114 -0.0161 -0.0418 0.0240  224 SER A OG  
1759 N N   . GLU A 243 ? 0.3108 0.3636 0.3579 -0.0103 -0.0328 0.0115  225 GLU A N   
1760 C CA  . GLU A 243 ? 0.2830 0.3314 0.3195 -0.0088 -0.0247 0.0077  225 GLU A CA  
1761 C C   . GLU A 243 ? 0.2623 0.2987 0.2727 -0.0042 -0.0238 0.0037  225 GLU A C   
1762 O O   . GLU A 243 ? 0.3116 0.3391 0.3096 -0.0018 -0.0228 -0.0005 225 GLU A O   
1763 C CB  . GLU A 243 ? 0.2723 0.3316 0.3176 -0.0077 -0.0126 0.0096  225 GLU A CB  
1764 C CG  . GLU A 243 ? 0.3188 0.3875 0.3845 -0.0100 -0.0102 0.0134  225 GLU A CG  
1765 C CD  . GLU A 243 ? 0.3607 0.4368 0.4314 -0.0077 -0.0012 0.0154  225 GLU A CD  
1766 O OE1 . GLU A 243 ? 0.3591 0.4332 0.4194 -0.0063 0.0027  0.0132  225 GLU A OE1 
1767 O OE2 . GLU A 243 ? 0.3706 0.4535 0.4552 -0.0075 0.0023  0.0191  225 GLU A OE2 
1768 N N   . ALA A 244 ? 0.2378 0.2732 0.2392 -0.0018 -0.0226 0.0058  226 ALA A N   
1769 C CA  . ALA A 244 ? 0.3014 0.3257 0.2770 0.0034  -0.0195 0.0040  226 ALA A CA  
1770 C C   . ALA A 244 ? 0.3314 0.3381 0.2868 0.0053  -0.0317 -0.0007 226 ALA A C   
1771 O O   . ALA A 244 ? 0.3440 0.3385 0.2773 0.0106  -0.0283 -0.0049 226 ALA A O   
1772 C CB  . ALA A 244 ? 0.2326 0.2569 0.2022 0.0050  -0.0161 0.0091  226 ALA A CB  
1773 N N   . GLU A 245 ? 0.3397 0.3450 0.3032 0.0013  -0.0461 -0.0002 227 GLU A N   
1774 C CA  . GLU A 245 ? 0.4337 0.4209 0.3794 0.0010  -0.0620 -0.0055 227 GLU A CA  
1775 C C   . GLU A 245 ? 0.4093 0.3865 0.3528 -0.0008 -0.0629 -0.0114 227 GLU A C   
1776 O O   . GLU A 245 ? 0.4527 0.4084 0.3673 0.0039  -0.0667 -0.0180 227 GLU A O   
1777 C CB  . GLU A 245 ? 0.5330 0.5267 0.4976 -0.0049 -0.0786 -0.0026 227 GLU A CB  
1778 C CG  . GLU A 245 ? 0.6951 0.6699 0.6356 -0.0039 -0.0979 -0.0071 227 GLU A CG  
1779 C CD  . GLU A 245 ? 0.8008 0.7723 0.7224 0.0030  -0.1001 -0.0031 227 GLU A CD  
1780 O OE1 . GLU A 245 ? 0.8096 0.7983 0.7527 0.0031  -0.0966 0.0045  227 GLU A OE1 
1781 O OE2 . GLU A 245 ? 0.8688 0.8184 0.7516 0.0096  -0.1046 -0.0073 227 GLU A OE2 
1782 N N   . ALA A 246 ? 0.3572 0.3475 0.3282 -0.0063 -0.0586 -0.0089 228 ALA A N   
1783 C CA  . ALA A 246 ? 0.3447 0.3241 0.3144 -0.0078 -0.0588 -0.0129 228 ALA A CA  
1784 C C   . ALA A 246 ? 0.3684 0.3413 0.3180 0.0016  -0.0456 -0.0162 228 ALA A C   
1785 O O   . ALA A 246 ? 0.3604 0.3133 0.2907 0.0055  -0.0478 -0.0220 228 ALA A O   
1786 C CB  . ALA A 246 ? 0.2882 0.2831 0.2901 -0.0148 -0.0554 -0.0075 228 ALA A CB  
1787 N N   . TYR A 247 ? 0.3355 0.3251 0.2908 0.0054  -0.0321 -0.0122 229 TYR A N   
1788 C CA  . TYR A 247 ? 0.2699 0.2597 0.2126 0.0141  -0.0191 -0.0136 229 TYR A CA  
1789 C C   . TYR A 247 ? 0.3253 0.2959 0.2346 0.0223  -0.0194 -0.0181 229 TYR A C   
1790 O O   . TYR A 247 ? 0.3403 0.2987 0.2323 0.0307  -0.0144 -0.0223 229 TYR A O   
1791 C CB  . TYR A 247 ? 0.2460 0.2577 0.2035 0.0139  -0.0072 -0.0082 229 TYR A CB  
1792 C CG  . TYR A 247 ? 0.2806 0.2993 0.2340 0.0213  0.0059  -0.0081 229 TYR A CG  
1793 C CD1 . TYR A 247 ? 0.2688 0.3007 0.2389 0.0217  0.0111  -0.0071 229 TYR A CD1 
1794 C CD2 . TYR A 247 ? 0.3055 0.3191 0.2392 0.0284  0.0132  -0.0081 229 TYR A CD2 
1795 C CE1 . TYR A 247 ? 0.2896 0.3321 0.2609 0.0285  0.0215  -0.0063 229 TYR A CE1 
1796 C CE2 . TYR A 247 ? 0.3365 0.3609 0.2720 0.0353  0.0264  -0.0066 229 TYR A CE2 
1797 C CZ  . TYR A 247 ? 0.3352 0.3756 0.2917 0.0351  0.0297  -0.0058 229 TYR A CZ  
1798 O OH  . TYR A 247 ? 0.3935 0.4485 0.3565 0.0421  0.0412  -0.0036 229 TYR A OH  
1799 N N   . GLY A 248 ? 0.3251 0.2918 0.2233 0.0216  -0.0247 -0.0167 230 GLY A N   
1800 C CA  . GLY A 248 ? 0.3866 0.3335 0.2483 0.0303  -0.0247 -0.0199 230 GLY A CA  
1801 C C   . GLY A 248 ? 0.4663 0.3847 0.3025 0.0334  -0.0366 -0.0289 230 GLY A C   
1802 O O   . GLY A 248 ? 0.5135 0.4148 0.3204 0.0445  -0.0297 -0.0335 230 GLY A O   
1803 N N   . GLU A 249 ? 0.4765 0.3891 0.3245 0.0237  -0.0542 -0.0314 231 GLU A N   
1804 C CA  . GLU A 249 ? 0.5687 0.4514 0.3945 0.0236  -0.0688 -0.0405 231 GLU A CA  
1805 C C   . GLU A 249 ? 0.5580 0.4293 0.3766 0.0303  -0.0592 -0.0447 231 GLU A C   
1806 O O   . GLU A 249 ? 0.5933 0.4355 0.3760 0.0397  -0.0605 -0.0527 231 GLU A O   
1807 C CB  . GLU A 249 ? 0.6362 0.5207 0.4870 0.0092  -0.0882 -0.0403 231 GLU A CB  
1808 C CG  . GLU A 249 ? 0.7649 0.6168 0.5968 0.0060  -0.1046 -0.0499 231 GLU A CG  
1809 C CD  . GLU A 249 ? 0.8354 0.6918 0.6973 -0.0103 -0.1240 -0.0484 231 GLU A CD  
1810 O OE1 . GLU A 249 ? 0.9185 0.7470 0.7664 -0.0157 -0.1415 -0.0563 231 GLU A OE1 
1811 O OE2 . GLU A 249 ? 0.8145 0.7015 0.7145 -0.0176 -0.1215 -0.0393 231 GLU A OE2 
1812 N N   . VAL A 250 ? 0.4790 0.3714 0.3292 0.0268  -0.0497 -0.0394 232 VAL A N   
1813 C CA  . VAL A 250 ? 0.5457 0.4303 0.3928 0.0339  -0.0408 -0.0416 232 VAL A CA  
1814 C C   . VAL A 250 ? 0.5405 0.4220 0.3631 0.0504  -0.0248 -0.0432 232 VAL A C   
1815 O O   . VAL A 250 ? 0.5398 0.4035 0.3454 0.0607  -0.0201 -0.0479 232 VAL A O   
1816 C CB  . VAL A 250 ? 0.5451 0.4554 0.4291 0.0281  -0.0336 -0.0342 232 VAL A CB  
1817 C CG1 . VAL A 250 ? 0.5650 0.4684 0.4449 0.0375  -0.0245 -0.0354 232 VAL A CG1 
1818 C CG2 . VAL A 250 ? 0.5660 0.4774 0.4730 0.0135  -0.0466 -0.0318 232 VAL A CG2 
1819 N N   . HIS A 251 ? 0.5117 0.4096 0.3327 0.0534  -0.0158 -0.0387 233 HIS A N   
1820 C CA  . HIS A 251 ? 0.5023 0.4022 0.3052 0.0682  0.0018  -0.0378 233 HIS A CA  
1821 C C   . HIS A 251 ? 0.5085 0.3809 0.2666 0.0779  0.0006  -0.0431 233 HIS A C   
1822 O O   . HIS A 251 ? 0.5661 0.4407 0.3075 0.0907  0.0173  -0.0408 233 HIS A O   
1823 C CB  . HIS A 251 ? 0.4489 0.3843 0.2792 0.0658  0.0159  -0.0282 233 HIS A CB  
1824 C CG  . HIS A 251 ? 0.4334 0.3934 0.2997 0.0612  0.0200  -0.0241 233 HIS A CG  
1825 N ND1 . HIS A 251 ? 0.4068 0.3760 0.2979 0.0485  0.0101  -0.0222 233 HIS A ND1 
1826 C CD2 . HIS A 251 ? 0.4311 0.4079 0.3111 0.0686  0.0324  -0.0214 233 HIS A CD2 
1827 C CE1 . HIS A 251 ? 0.3645 0.3524 0.2789 0.0484  0.0161  -0.0190 233 HIS A CE1 
1828 N NE2 . HIS A 251 ? 0.3976 0.3912 0.3070 0.0601  0.0283  -0.0185 233 HIS A NE2 
1829 N N   . GLY A 252 ? 0.4841 0.3308 0.2224 0.0722  -0.0191 -0.0496 234 GLY A N   
1830 C CA  . GLY A 252 ? 0.5301 0.3461 0.2199 0.0818  -0.0236 -0.0558 234 GLY A CA  
1831 C C   . GLY A 252 ? 0.6843 0.5108 0.3652 0.0828  -0.0187 -0.0489 234 GLY A C   
1832 O O   . GLY A 252 ? 0.7198 0.5232 0.3570 0.0940  -0.0168 -0.0518 234 GLY A O   
1833 N N   . LEU A 253 ? 0.6332 0.4915 0.3522 0.0719  -0.0163 -0.0395 235 LEU A N   
1834 C CA  . LEU A 253 ? 0.6258 0.4921 0.3388 0.0715  -0.0131 -0.0320 235 LEU A CA  
1835 C C   . LEU A 253 ? 0.6535 0.5033 0.3528 0.0650  -0.0376 -0.0354 235 LEU A C   
1836 O O   . LEU A 253 ? 0.6451 0.5125 0.3756 0.0534  -0.0475 -0.0308 235 LEU A O   
1837 C CB  . LEU A 253 ? 0.5448 0.4472 0.3019 0.0627  -0.0022 -0.0216 235 LEU A CB  
1838 C CG  . LEU A 253 ? 0.5049 0.4282 0.2834 0.0666  0.0177  -0.0183 235 LEU A CG  
1839 C CD1 . LEU A 253 ? 0.3733 0.3285 0.1923 0.0566  0.0250  -0.0095 235 LEU A CD1 
1840 C CD2 . LEU A 253 ? 0.5001 0.4154 0.2492 0.0818  0.0362  -0.0169 235 LEU A CD2 
1841 N N   . LEU A 254 ? 0.7035 0.5191 0.3553 0.0736  -0.0475 -0.0435 236 LEU A N   
1842 C CA  . LEU A 254 ? 0.7726 0.5692 0.4086 0.0678  -0.0752 -0.0488 236 LEU A CA  
1843 C C   . LEU A 254 ? 0.8133 0.6204 0.4506 0.0656  -0.0805 -0.0400 236 LEU A C   
1844 O O   . LEU A 254 ? 0.8452 0.6640 0.5093 0.0545  -0.0987 -0.0381 236 LEU A O   
1845 C CB  . LEU A 254 ? 0.8302 0.5832 0.4082 0.0789  -0.0850 -0.0609 236 LEU A CB  
1846 N N   . GLU A 255 ? 0.8092 0.6119 0.4180 0.0770  -0.0638 -0.0337 237 GLU A N   
1847 C CA  . GLU A 255 ? 0.7895 0.5967 0.3929 0.0770  -0.0676 -0.0244 237 GLU A CA  
1848 C C   . GLU A 255 ? 0.7613 0.6013 0.4056 0.0716  -0.0484 -0.0119 237 GLU A C   
1849 O O   . GLU A 255 ? 0.7550 0.6102 0.4175 0.0720  -0.0275 -0.0096 237 GLU A O   
1850 C CB  . GLU A 255 ? 0.8226 0.6006 0.3651 0.0928  -0.0613 -0.0237 237 GLU A CB  
1851 N N   . ASP A 256 ? 0.7485 0.5981 0.4068 0.0668  -0.0569 -0.0042 238 ASP A N   
1852 C CA  . ASP A 256 ? 0.7459 0.6199 0.4370 0.0619  -0.0409 0.0073  238 ASP A CA  
1853 C C   . ASP A 256 ? 0.6441 0.5442 0.3829 0.0522  -0.0330 0.0059  238 ASP A C   
1854 O O   . ASP A 256 ? 0.5556 0.4719 0.3133 0.0504  -0.0134 0.0119  238 ASP A O   
1855 C CB  . ASP A 256 ? 0.8685 0.7363 0.5339 0.0708  -0.0168 0.0158  238 ASP A CB  
1856 C CG  . ASP A 256 ? 0.9521 0.8328 0.6366 0.0666  -0.0071 0.0287  238 ASP A CG  
1857 O OD1 . ASP A 256 ? 0.9796 0.8633 0.6778 0.0624  -0.0227 0.0312  238 ASP A OD1 
1858 O OD2 . ASP A 256 ? 0.9814 0.8687 0.6683 0.0676  0.0161  0.0366  238 ASP A OD2 
1859 N N   . THR A 257 ? 0.6127 0.5159 0.3702 0.0455  -0.0492 -0.0017 239 THR A N   
1860 C CA  . THR A 257 ? 0.5447 0.4651 0.3360 0.0389  -0.0429 -0.0049 239 THR A CA  
1861 C C   . THR A 257 ? 0.4964 0.4430 0.3247 0.0329  -0.0286 0.0027  239 THR A C   
1862 O O   . THR A 257 ? 0.4910 0.4485 0.3313 0.0329  -0.0137 0.0027  239 THR A O   
1863 C CB  . THR A 257 ? 0.5077 0.4272 0.3162 0.0310  -0.0633 -0.0115 239 THR A CB  
1864 O OG1 . THR A 257 ? 0.5799 0.4715 0.3521 0.0353  -0.0793 -0.0197 239 THR A OG1 
1865 C CG2 . THR A 257 ? 0.4825 0.4129 0.3157 0.0266  -0.0555 -0.0147 239 THR A CG2 
1866 N N   . VAL A 258 ? 0.4289 0.3843 0.2738 0.0288  -0.0339 0.0088  240 VAL A N   
1867 C CA  . VAL A 258 ? 0.4238 0.3996 0.3013 0.0230  -0.0229 0.0142  240 VAL A CA  
1868 C C   . VAL A 258 ? 0.3915 0.3695 0.2627 0.0251  -0.0033 0.0202  240 VAL A C   
1869 O O   . VAL A 258 ? 0.3506 0.3433 0.2429 0.0209  0.0080  0.0205  240 VAL A O   
1870 C CB  . VAL A 258 ? 0.4134 0.3960 0.3098 0.0198  -0.0329 0.0191  240 VAL A CB  
1871 C CG1 . VAL A 258 ? 0.3538 0.3519 0.2778 0.0151  -0.0211 0.0231  240 VAL A CG1 
1872 C CG2 . VAL A 258 ? 0.4072 0.3936 0.3189 0.0160  -0.0508 0.0146  240 VAL A CG2 
1873 N N   . HIS A 259 ? 0.3764 0.3398 0.2188 0.0311  0.0001  0.0253  241 HIS A N   
1874 C CA  . HIS A 259 ? 0.4228 0.3872 0.2580 0.0328  0.0201  0.0324  241 HIS A CA  
1875 C C   . HIS A 259 ? 0.4578 0.4273 0.2895 0.0363  0.0326  0.0286  241 HIS A C   
1876 O O   . HIS A 259 ? 0.4535 0.4390 0.3050 0.0327  0.0475  0.0322  241 HIS A O   
1877 C CB  . HIS A 259 ? 0.4723 0.4166 0.2717 0.0402  0.0219  0.0397  241 HIS A CB  
1878 C CG  . HIS A 259 ? 0.5482 0.4888 0.3532 0.0379  0.0151  0.0467  241 HIS A CG  
1879 N ND1 . HIS A 259 ? 0.5891 0.5269 0.3942 0.0361  0.0287  0.0574  241 HIS A ND1 
1880 C CD2 . HIS A 259 ? 0.5672 0.5066 0.3793 0.0377  -0.0035 0.0454  241 HIS A CD2 
1881 C CE1 . HIS A 259 ? 0.5803 0.5124 0.3891 0.0361  0.0187  0.0617  241 HIS A CE1 
1882 N NE2 . HIS A 259 ? 0.5983 0.5331 0.4126 0.0377  -0.0006 0.0548  241 HIS A NE2 
1883 N N   . ALA A 260 ? 0.4739 0.4293 0.2807 0.0438  0.0255  0.0212  242 ALA A N   
1884 C CA  . ALA A 260 ? 0.4592 0.4162 0.2596 0.0501  0.0369  0.0170  242 ALA A CA  
1885 C C   . ALA A 260 ? 0.4036 0.3830 0.2420 0.0435  0.0392  0.0139  242 ALA A C   
1886 O O   . ALA A 260 ? 0.3939 0.3868 0.2428 0.0462  0.0540  0.0156  242 ALA A O   
1887 C CB  . ALA A 260 ? 0.4406 0.3725 0.2048 0.0592  0.0257  0.0078  242 ALA A CB  
1888 N N   . THR A 261 ? 0.3794 0.3637 0.2386 0.0357  0.0247  0.0102  243 THR A N   
1889 C CA  . THR A 261 ? 0.3630 0.3657 0.2542 0.0300  0.0258  0.0078  243 THR A CA  
1890 C C   . THR A 261 ? 0.3662 0.3894 0.2826 0.0242  0.0379  0.0143  243 THR A C   
1891 O O   . THR A 261 ? 0.3336 0.3723 0.2674 0.0238  0.0457  0.0139  243 THR A O   
1892 C CB  . THR A 261 ? 0.3576 0.3608 0.2650 0.0231  0.0098  0.0044  243 THR A CB  
1893 O OG1 . THR A 261 ? 0.4075 0.3932 0.2970 0.0262  -0.0025 -0.0024 243 THR A OG1 
1894 C CG2 . THR A 261 ? 0.3391 0.3604 0.2764 0.0178  0.0128  0.0037  243 THR A CG2 
1895 N N   . ALA A 262 ? 0.3683 0.3899 0.2861 0.0197  0.0383  0.0203  244 ALA A N   
1896 C CA  . ALA A 262 ? 0.3358 0.3716 0.2755 0.0124  0.0480  0.0260  244 ALA A CA  
1897 C C   . ALA A 262 ? 0.3344 0.3796 0.2743 0.0150  0.0646  0.0306  244 ALA A C   
1898 O O   . ALA A 262 ? 0.3166 0.3808 0.2819 0.0098  0.0707  0.0317  244 ALA A O   
1899 C CB  . ALA A 262 ? 0.2933 0.3192 0.2285 0.0089  0.0458  0.0320  244 ALA A CB  
1900 N N   . ARG A 263 ? 0.3670 0.3993 0.2785 0.0236  0.0715  0.0335  245 ARG A N   
1901 C CA  . ARG A 263 ? 0.3770 0.4181 0.2863 0.0287  0.0900  0.0392  245 ARG A CA  
1902 C C   . ARG A 263 ? 0.3623 0.4180 0.2840 0.0341  0.0932  0.0337  245 ARG A C   
1903 O O   . ARG A 263 ? 0.3375 0.4159 0.2838 0.0323  0.1048  0.0380  245 ARG A O   
1904 C CB  . ARG A 263 ? 0.4558 0.4749 0.3239 0.0396  0.0962  0.0426  245 ARG A CB  
1905 C CG  . ARG A 263 ? 0.4991 0.5245 0.3581 0.0490  0.1176  0.0484  245 ARG A CG  
1906 C CD  . ARG A 263 ? 0.5139 0.5630 0.4052 0.0399  0.1341  0.0596  245 ARG A CD  
1907 N NE  . ARG A 263 ? 0.5594 0.6011 0.4543 0.0290  0.1317  0.0667  245 ARG A NE  
1908 C CZ  . ARG A 263 ? 0.5237 0.5816 0.4538 0.0147  0.1334  0.0712  245 ARG A CZ  
1909 N NH1 . ARG A 263 ? 0.4592 0.5442 0.4251 0.0092  0.1362  0.0695  245 ARG A NH1 
1910 N NH2 . ARG A 263 ? 0.5431 0.5883 0.4714 0.0065  0.1312  0.0773  245 ARG A NH2 
1911 N N   . TYR A 264 ? 0.3634 0.4060 0.2694 0.0406  0.0819  0.0247  246 TYR A N   
1912 C CA  . TYR A 264 ? 0.3776 0.4281 0.2902 0.0478  0.0839  0.0194  246 TYR A CA  
1913 C C   . TYR A 264 ? 0.3379 0.4134 0.2892 0.0396  0.0816  0.0193  246 TYR A C   
1914 O O   . TYR A 264 ? 0.3497 0.4444 0.3180 0.0438  0.0909  0.0211  246 TYR A O   
1915 C CB  . TYR A 264 ? 0.3960 0.4226 0.2844 0.0535  0.0697  0.0097  246 TYR A CB  
1916 C CG  . TYR A 264 ? 0.3946 0.4216 0.2828 0.0630  0.0720  0.0043  246 TYR A CG  
1917 C CD1 . TYR A 264 ? 0.4409 0.4538 0.3003 0.0781  0.0817  0.0022  246 TYR A CD1 
1918 C CD2 . TYR A 264 ? 0.3411 0.3800 0.2546 0.0584  0.0649  0.0014  246 TYR A CD2 
1919 C CE1 . TYR A 264 ? 0.4707 0.4811 0.3285 0.0885  0.0840  -0.0028 246 TYR A CE1 
1920 C CE2 . TYR A 264 ? 0.3887 0.4257 0.3007 0.0681  0.0666  -0.0027 246 TYR A CE2 
1921 C CZ  . TYR A 264 ? 0.4546 0.4772 0.3396 0.0833  0.0760  -0.0049 246 TYR A CZ  
1922 O OH  . TYR A 264 ? 0.4807 0.4989 0.3631 0.0946  0.0781  -0.0090 246 TYR A OH  
1923 N N   . ILE A 265 ? 0.2911 0.3665 0.2552 0.0292  0.0692  0.0173  247 ILE A N   
1924 C CA  . ILE A 265 ? 0.2776 0.3721 0.2718 0.0221  0.0653  0.0163  247 ILE A CA  
1925 C C   . ILE A 265 ? 0.2818 0.3981 0.3002 0.0154  0.0751  0.0229  247 ILE A C   
1926 O O   . ILE A 265 ? 0.2811 0.4180 0.3224 0.0146  0.0763  0.0230  247 ILE A O   
1927 C CB  . ILE A 265 ? 0.2758 0.3631 0.2748 0.0138  0.0521  0.0134  247 ILE A CB  
1928 C CG1 . ILE A 265 ? 0.2631 0.3343 0.2475 0.0183  0.0418  0.0075  247 ILE A CG1 
1929 C CG2 . ILE A 265 ? 0.1878 0.2921 0.2126 0.0068  0.0493  0.0128  247 ILE A CG2 
1930 C CD1 . ILE A 265 ? 0.2207 0.2890 0.2143 0.0113  0.0310  0.0060  247 ILE A CD1 
1931 N N   . ALA A 266 ? 0.2837 0.3949 0.2972 0.0104  0.0811  0.0290  248 ALA A N   
1932 C CA  . ALA A 266 ? 0.2912 0.4202 0.3282 0.0017  0.0906  0.0364  248 ALA A CA  
1933 C C   . ALA A 266 ? 0.3145 0.4643 0.3634 0.0085  0.1050  0.0413  248 ALA A C   
1934 O O   . ALA A 266 ? 0.3277 0.5021 0.4080 0.0013  0.1089  0.0453  248 ALA A O   
1935 C CB  . ALA A 266 ? 0.2402 0.3542 0.2647 -0.0036 0.0956  0.0433  248 ALA A CB  
1936 N N   . ASP A 267 ? 0.3093 0.4492 0.3333 0.0226  0.1124  0.0407  249 ASP A N   
1937 C CA  . ASP A 267 ? 0.3516 0.5092 0.3829 0.0323  0.1298  0.0465  249 ASP A CA  
1938 C C   . ASP A 267 ? 0.3445 0.5162 0.3870 0.0426  0.1279  0.0415  249 ASP A C   
1939 O O   . ASP A 267 ? 0.3938 0.5846 0.4480 0.0519  0.1424  0.0466  249 ASP A O   
1940 C CB  . ASP A 267 ? 0.4070 0.5437 0.4003 0.0444  0.1424  0.0498  249 ASP A CB  
1941 C CG  . ASP A 267 ? 0.4786 0.6059 0.4634 0.0362  0.1494  0.0588  249 ASP A CG  
1942 O OD1 . ASP A 267 ? 0.4889 0.6270 0.5003 0.0208  0.1462  0.0629  249 ASP A OD1 
1943 O OD2 . ASP A 267 ? 0.5283 0.6349 0.4772 0.0459  0.1579  0.0617  249 ASP A OD2 
1944 N N   . LEU A 268 ? 0.3298 0.4922 0.3691 0.0421  0.1115  0.0325  250 LEU A N   
1945 C CA  . LEU A 268 ? 0.3306 0.5031 0.3788 0.0522  0.1088  0.0284  250 LEU A CA  
1946 C C   . LEU A 268 ? 0.2849 0.4947 0.3745 0.0485  0.1132  0.0343  250 LEU A C   
1947 O O   . LEU A 268 ? 0.2479 0.4707 0.3606 0.0333  0.1073  0.0365  250 LEU A O   
1948 C CB  . LEU A 268 ? 0.2933 0.4509 0.3350 0.0492  0.0908  0.0200  250 LEU A CB  
1949 C CG  . LEU A 268 ? 0.3412 0.4662 0.3479 0.0568  0.0846  0.0130  250 LEU A CG  
1950 C CD1 . LEU A 268 ? 0.3341 0.4497 0.3430 0.0502  0.0685  0.0076  250 LEU A CD1 
1951 C CD2 . LEU A 268 ? 0.3637 0.4829 0.3559 0.0746  0.0927  0.0111  250 LEU A CD2 
1952 N N   . PRO A 269 ? 0.2558 0.4826 0.3551 0.0627  0.1230  0.0367  251 PRO A N   
1953 C CA  . PRO A 269 ? 0.2370 0.5038 0.3803 0.0599  0.1254  0.0428  251 PRO A CA  
1954 C C   . PRO A 269 ? 0.2348 0.5091 0.3958 0.0504  0.1055  0.0378  251 PRO A C   
1955 O O   . PRO A 269 ? 0.2534 0.5051 0.3930 0.0533  0.0937  0.0302  251 PRO A O   
1956 C CB  . PRO A 269 ? 0.2365 0.5126 0.3791 0.0815  0.1367  0.0442  251 PRO A CB  
1957 C CG  . PRO A 269 ? 0.2863 0.5299 0.3848 0.0937  0.1478  0.0418  251 PRO A CG  
1958 C CD  . PRO A 269 ? 0.3043 0.5139 0.3744 0.0827  0.1322  0.0340  251 PRO A CD  
1959 N N   . PHE A 270 ? 0.2107 0.5150 0.4093 0.0384  0.1016  0.0422  252 PHE A N   
1960 C CA  . PHE A 270 ? 0.2197 0.5335 0.4340 0.0326  0.0830  0.0376  252 PHE A CA  
1961 C C   . PHE A 270 ? 0.2604 0.5920 0.4858 0.0496  0.0822  0.0382  252 PHE A C   
1962 O O   . PHE A 270 ? 0.2434 0.5871 0.4757 0.0622  0.0964  0.0432  252 PHE A O   
1963 C CB  . PHE A 270 ? 0.1953 0.5326 0.4440 0.0139  0.0764  0.0411  252 PHE A CB  
1964 C CG  . PHE A 270 ? 0.2363 0.5499 0.4707 -0.0025 0.0718  0.0384  252 PHE A CG  
1965 C CD1 . PHE A 270 ? 0.2279 0.5250 0.4512 -0.0101 0.0548  0.0305  252 PHE A CD1 
1966 C CD2 . PHE A 270 ? 0.2676 0.5739 0.4975 -0.0086 0.0856  0.0443  252 PHE A CD2 
1967 C CE1 . PHE A 270 ? 0.2404 0.5150 0.4502 -0.0228 0.0515  0.0281  252 PHE A CE1 
1968 C CE2 . PHE A 270 ? 0.2499 0.5329 0.4660 -0.0219 0.0812  0.0424  252 PHE A CE2 
1969 C CZ  . PHE A 270 ? 0.2216 0.4891 0.4286 -0.0286 0.0642  0.0341  252 PHE A CZ  
1970 N N   . ALA A 271 ? 0.2847 0.6128 0.5079 0.0507  0.0657  0.0329  253 ALA A N   
1971 C CA  . ALA A 271 ? 0.2823 0.6200 0.5093 0.0685  0.0631  0.0332  253 ALA A CA  
1972 C C   . ALA A 271 ? 0.2750 0.6497 0.5398 0.0735  0.0673  0.0400  253 ALA A C   
1973 O O   . ALA A 271 ? 0.3155 0.6909 0.5779 0.0910  0.0731  0.0414  253 ALA A O   
1974 C CB  . ALA A 271 ? 0.3004 0.6266 0.5175 0.0666  0.0442  0.0277  253 ALA A CB  
1975 N N   . ASP A 272 ? 0.2560 0.6519 0.5513 0.0565  0.0626  0.0427  254 ASP A N   
1976 C CA  . ASP A 272 ? 0.2687 0.6935 0.5993 0.0576  0.0647  0.0475  254 ASP A CA  
1977 C C   . ASP A 272 ? 0.2978 0.7256 0.6328 0.0586  0.0864  0.0532  254 ASP A C   
1978 O O   . ASP A 272 ? 0.2998 0.7526 0.6643 0.0600  0.0920  0.0580  254 ASP A O   
1979 C CB  . ASP A 272 ? 0.2840 0.7307 0.6473 0.0393  0.0472  0.0468  254 ASP A CB  
1980 C CG  . ASP A 272 ? 0.3042 0.7426 0.6679 0.0175  0.0467  0.0460  254 ASP A CG  
1981 O OD1 . ASP A 272 ? 0.2967 0.7465 0.6818 0.0015  0.0311  0.0439  254 ASP A OD1 
1982 O OD2 . ASP A 272 ? 0.3324 0.7509 0.6735 0.0167  0.0608  0.0473  254 ASP A OD2 
1983 N N   . GLY A 273 ? 0.3128 0.7152 0.6174 0.0585  0.0984  0.0528  255 GLY A N   
1984 C CA  . GLY A 273 ? 0.3363 0.7360 0.6361 0.0609  0.1191  0.0583  255 GLY A CA  
1985 C C   . GLY A 273 ? 0.3608 0.7768 0.6881 0.0409  0.1222  0.0635  255 GLY A C   
1986 O O   . GLY A 273 ? 0.3784 0.7958 0.7057 0.0413  0.1396  0.0696  255 GLY A O   
1987 N N   . LYS A 274 ? 0.3653 0.7912 0.7139 0.0234  0.1052  0.0611  256 LYS A N   
1988 C CA  . LYS A 274 ? 0.3687 0.8067 0.7434 0.0025  0.1054  0.0649  256 LYS A CA  
1989 C C   . LYS A 274 ? 0.3694 0.7807 0.7180 -0.0067 0.1147  0.0668  256 LYS A C   
1990 O O   . LYS A 274 ? 0.3463 0.7332 0.6651 -0.0049 0.1099  0.0624  256 LYS A O   
1991 C CB  . LYS A 274 ? 0.3986 0.8486 0.7971 -0.0128 0.0819  0.0599  256 LYS A CB  
1992 C CG  . LYS A 274 ? 0.4602 0.9342 0.8983 -0.0307 0.0792  0.0632  256 LYS A CG  
1993 C CD  . LYS A 274 ? 0.4996 1.0081 0.9713 -0.0217 0.0799  0.0662  256 LYS A CD  
1994 C CE  . LYS A 274 ? 0.5036 1.0231 0.9848 -0.0162 0.0571  0.0597  256 LYS A CE  
1995 N NZ  . LYS A 274 ? 0.5038 1.0265 1.0009 -0.0370 0.0347  0.0539  256 LYS A NZ  
1996 N N   . LYS A 275 ? 0.3839 0.8003 0.7439 -0.0160 0.1282  0.0741  257 LYS A N   
1997 C CA  . LYS A 275 ? 0.3944 0.7857 0.7315 -0.0255 0.1367  0.0775  257 LYS A CA  
1998 C C   . LYS A 275 ? 0.3877 0.7701 0.7310 -0.0452 0.1195  0.0732  257 LYS A C   
1999 O O   . LYS A 275 ? 0.3893 0.7886 0.7646 -0.0605 0.1090  0.0726  257 LYS A O   
2000 C CB  . LYS A 275 ? 0.4109 0.8107 0.7598 -0.0308 0.1552  0.0876  257 LYS A CB  
2001 N N   . ARG A 276 ? 0.3838 0.7387 0.6955 -0.0445 0.1162  0.0700  258 ARG A N   
2002 C CA  . ARG A 276 ? 0.3738 0.7174 0.6862 -0.0597 0.0991  0.0650  258 ARG A CA  
2003 C C   . ARG A 276 ? 0.3563 0.6687 0.6337 -0.0595 0.1040  0.0661  258 ARG A C   
2004 O O   . ARG A 276 ? 0.3538 0.6520 0.6016 -0.0441 0.1141  0.0665  258 ARG A O   
2005 C CB  . ARG A 276 ? 0.3921 0.7452 0.7084 -0.0542 0.0804  0.0564  258 ARG A CB  
2006 C CG  . ARG A 276 ? 0.3943 0.7414 0.7163 -0.0704 0.0598  0.0500  258 ARG A CG  
2007 C CD  . ARG A 276 ? 0.3934 0.7422 0.7079 -0.0613 0.0420  0.0403  258 ARG A CD  
2008 N NE  . ARG A 276 ? 0.3602 0.7431 0.7091 -0.0593 0.0346  0.0415  258 ARG A NE  
2009 C CZ  . ARG A 276 ? 0.3225 0.7204 0.6751 -0.0413 0.0406  0.0432  258 ARG A CZ  
2010 N NH1 . ARG A 276 ? 0.3181 0.7041 0.6450 -0.0250 0.0543  0.0449  258 ARG A NH1 
2011 N NH2 . ARG A 276 ? 0.3013 0.7248 0.6826 -0.0393 0.0321  0.0430  258 ARG A NH2 
2012 N N   . LYS A 277 ? 0.3627 0.6556 0.6365 -0.0753 0.0941  0.0634  259 LYS A N   
2013 C CA  . LYS A 277 ? 0.3838 0.6377 0.6188 -0.0741 0.0948  0.0608  259 LYS A CA  
2014 C C   . LYS A 277 ? 0.3665 0.5997 0.5745 -0.0662 0.0793  0.0482  259 LYS A C   
2015 O O   . LYS A 277 ? 0.3960 0.6310 0.6123 -0.0722 0.0635  0.0406  259 LYS A O   
2016 C CB  . LYS A 277 ? 0.4290 0.6681 0.6713 -0.0931 0.0932  0.0645  259 LYS A CB  
2017 C CG  . LYS A 277 ? 0.5020 0.7012 0.7084 -0.0927 0.0881  0.0597  259 LYS A CG  
2018 C CD  . LYS A 277 ? 0.6020 0.7844 0.8153 -0.1104 0.0887  0.0648  259 LYS A CD  
2019 C CE  . LYS A 277 ? 0.6636 0.8071 0.8434 -0.1083 0.0822  0.0595  259 LYS A CE  
2020 N NZ  . LYS A 277 ? 0.7172 0.8389 0.8984 -0.1229 0.0856  0.0661  259 LYS A NZ  
2021 N N   . ARG A 278 ? 0.2718 0.4853 0.4474 -0.0530 0.0837  0.0465  260 ARG A N   
2022 C CA  . ARG A 278 ? 0.2486 0.4412 0.4003 -0.0474 0.0710  0.0368  260 ARG A CA  
2023 C C   . ARG A 278 ? 0.2527 0.4152 0.3785 -0.0485 0.0719  0.0374  260 ARG A C   
2024 O O   . ARG A 278 ? 0.2647 0.4186 0.3759 -0.0439 0.0829  0.0437  260 ARG A O   
2025 C CB  . ARG A 278 ? 0.2299 0.4248 0.3683 -0.0314 0.0711  0.0329  260 ARG A CB  
2026 C CG  . ARG A 278 ? 0.2323 0.4057 0.3482 -0.0270 0.0598  0.0249  260 ARG A CG  
2027 C CD  . ARG A 278 ? 0.2716 0.4481 0.3804 -0.0144 0.0568  0.0206  260 ARG A CD  
2028 N NE  . ARG A 278 ? 0.3644 0.5423 0.4637 -0.0036 0.0681  0.0241  260 ARG A NE  
2029 C CZ  . ARG A 278 ? 0.3363 0.5338 0.4484 0.0043  0.0745  0.0263  260 ARG A CZ  
2030 N NH1 . ARG A 278 ? 0.2996 0.5197 0.4370 0.0021  0.0688  0.0258  260 ARG A NH1 
2031 N NH2 . ARG A 278 ? 0.3363 0.5301 0.4341 0.0158  0.0861  0.0289  260 ARG A NH2 
2032 N N   . LEU A 279 ? 0.1888 0.3352 0.3076 -0.0530 0.0605  0.0311  261 LEU A N   
2033 C CA  . LEU A 279 ? 0.2080 0.3274 0.3053 -0.0528 0.0599  0.0318  261 LEU A CA  
2034 C C   . LEU A 279 ? 0.1903 0.2989 0.2676 -0.0414 0.0539  0.0264  261 LEU A C   
2035 O O   . LEU A 279 ? 0.1782 0.2919 0.2583 -0.0386 0.0460  0.0199  261 LEU A O   
2036 C CB  . LEU A 279 ? 0.2380 0.3448 0.3405 -0.0641 0.0525  0.0288  261 LEU A CB  
2037 C CG  . LEU A 279 ? 0.2870 0.3655 0.3696 -0.0630 0.0518  0.0298  261 LEU A CG  
2038 C CD1 . LEU A 279 ? 0.3025 0.3724 0.3776 -0.0638 0.0632  0.0402  261 LEU A CD1 
2039 C CD2 . LEU A 279 ? 0.2913 0.3549 0.3767 -0.0719 0.0441  0.0248  261 LEU A CD2 
2040 N N   . VAL A 280 ? 0.1998 0.2934 0.2573 -0.0353 0.0572  0.0298  262 VAL A N   
2041 C CA  . VAL A 280 ? 0.1948 0.2789 0.2369 -0.0265 0.0502  0.0255  262 VAL A CA  
2042 C C   . VAL A 280 ? 0.2634 0.3280 0.2938 -0.0264 0.0465  0.0273  262 VAL A C   
2043 O O   . VAL A 280 ? 0.2196 0.2734 0.2412 -0.0276 0.0517  0.0337  262 VAL A O   
2044 C CB  . VAL A 280 ? 0.3065 0.3910 0.3341 -0.0170 0.0541  0.0266  262 VAL A CB  
2045 C CG1 . VAL A 280 ? 0.1982 0.2729 0.2134 -0.0105 0.0445  0.0218  262 VAL A CG1 
2046 C CG2 . VAL A 280 ? 0.1959 0.2996 0.2357 -0.0147 0.0595  0.0258  262 VAL A CG2 
2047 N N   . ILE A 281 ? 0.2319 0.2925 0.2627 -0.0240 0.0384  0.0226  263 ILE A N   
2048 C CA  . ILE A 281 ? 0.2345 0.2798 0.2582 -0.0220 0.0349  0.0244  263 ILE A CA  
2049 C C   . ILE A 281 ? 0.2788 0.3245 0.2990 -0.0147 0.0277  0.0224  263 ILE A C   
2050 O O   . ILE A 281 ? 0.3131 0.3666 0.3413 -0.0138 0.0244  0.0179  263 ILE A O   
2051 C CB  . ILE A 281 ? 0.2095 0.2489 0.2406 -0.0265 0.0334  0.0214  263 ILE A CB  
2052 C CG1 . ILE A 281 ? 0.2108 0.2494 0.2486 -0.0365 0.0380  0.0227  263 ILE A CG1 
2053 C CG2 . ILE A 281 ? 0.2118 0.2353 0.2359 -0.0215 0.0311  0.0238  263 ILE A CG2 
2054 C CD1 . ILE A 281 ? 0.2168 0.2457 0.2583 -0.0418 0.0346  0.0178  263 ILE A CD1 
2055 N N   . ILE A 282 ? 0.2623 0.2993 0.2706 -0.0100 0.0246  0.0262  264 ILE A N   
2056 C CA  . ILE A 282 ? 0.2510 0.2892 0.2589 -0.0048 0.0157  0.0249  264 ILE A CA  
2057 C C   . ILE A 282 ? 0.2573 0.2887 0.2673 -0.0012 0.0110  0.0287  264 ILE A C   
2058 O O   . ILE A 282 ? 0.2912 0.3115 0.2891 0.0016  0.0103  0.0338  264 ILE A O   
2059 C CB  . ILE A 282 ? 0.2867 0.3207 0.2780 -0.0011 0.0122  0.0252  264 ILE A CB  
2060 C CG1 . ILE A 282 ? 0.3084 0.3486 0.2970 -0.0021 0.0188  0.0221  264 ILE A CG1 
2061 C CG2 . ILE A 282 ? 0.2490 0.2835 0.2422 0.0018  0.0001  0.0232  264 ILE A CG2 
2062 C CD1 . ILE A 282 ? 0.2980 0.3494 0.3014 -0.0037 0.0173  0.0168  264 ILE A CD1 
2063 N N   . THR A 283 ? 0.2232 0.2611 0.2480 0.0001  0.0087  0.0270  265 THR A N   
2064 C CA  . THR A 283 ? 0.2487 0.2832 0.2790 0.0057  0.0053  0.0311  265 THR A CA  
2065 C C   . THR A 283 ? 0.2499 0.2895 0.2829 0.0095  -0.0059 0.0337  265 THR A C   
2066 O O   . THR A 283 ? 0.2365 0.2822 0.2703 0.0069  -0.0110 0.0305  265 THR A O   
2067 C CB  . THR A 283 ? 0.2382 0.2777 0.2828 0.0074  0.0096  0.0293  265 THR A CB  
2068 O OG1 . THR A 283 ? 0.2042 0.2570 0.2597 0.0057  0.0083  0.0263  265 THR A OG1 
2069 C CG2 . THR A 283 ? 0.2107 0.2406 0.2491 0.0035  0.0174  0.0259  265 THR A CG2 
2070 N N   . ARG A 284 ? 0.2686 0.3043 0.3026 0.0157  -0.0110 0.0392  266 ARG A N   
2071 C CA  . ARG A 284 ? 0.2687 0.3091 0.3049 0.0190  -0.0248 0.0420  266 ARG A CA  
2072 C C   . ARG A 284 ? 0.2888 0.3382 0.3454 0.0261  -0.0295 0.0476  266 ARG A C   
2073 O O   . ARG A 284 ? 0.2803 0.3277 0.3340 0.0319  -0.0400 0.0527  266 ARG A O   
2074 C CB  . ARG A 284 ? 0.2925 0.3172 0.3012 0.0213  -0.0295 0.0445  266 ARG A CB  
2075 C CG  . ARG A 284 ? 0.2858 0.3040 0.2750 0.0165  -0.0249 0.0399  266 ARG A CG  
2076 C CD  . ARG A 284 ? 0.3389 0.3403 0.2976 0.0206  -0.0269 0.0436  266 ARG A CD  
2077 N NE  . ARG A 284 ? 0.3410 0.3395 0.2922 0.0260  -0.0440 0.0455  266 ARG A NE  
2078 C CZ  . ARG A 284 ? 0.3992 0.3880 0.3391 0.0332  -0.0498 0.0527  266 ARG A CZ  
2079 N NH1 . ARG A 284 ? 0.3274 0.3058 0.2614 0.0355  -0.0383 0.0590  266 ARG A NH1 
2080 N NH2 . ARG A 284 ? 0.3814 0.3694 0.3155 0.0379  -0.0682 0.0538  266 ARG A NH2 
2081 N N   . GLY A 285 ? 0.2835 0.3429 0.3598 0.0271  -0.0214 0.0472  267 GLY A N   
2082 C CA  . GLY A 285 ? 0.2995 0.3699 0.3979 0.0356  -0.0225 0.0532  267 GLY A CA  
2083 C C   . GLY A 285 ? 0.3118 0.3672 0.3995 0.0451  -0.0202 0.0581  267 GLY A C   
2084 O O   . GLY A 285 ? 0.3076 0.3452 0.3788 0.0447  -0.0099 0.0559  267 GLY A O   
2085 N N   . LYS A 286 ? 0.3153 0.3773 0.4128 0.0533  -0.0307 0.0651  268 LYS A N   
2086 C CA  . LYS A 286 ? 0.3311 0.3778 0.4184 0.0644  -0.0297 0.0713  268 LYS A CA  
2087 C C   . LYS A 286 ? 0.3898 0.4132 0.4438 0.0619  -0.0331 0.0721  268 LYS A C   
2088 O O   . LYS A 286 ? 0.4668 0.4694 0.5045 0.0679  -0.0282 0.0765  268 LYS A O   
2089 C CB  . LYS A 286 ? 0.3624 0.4268 0.4737 0.0754  -0.0412 0.0795  268 LYS A CB  
2090 C CG  . LYS A 286 ? 0.4177 0.4917 0.5293 0.0720  -0.0616 0.0812  268 LYS A CG  
2091 C CD  . LYS A 286 ? 0.4487 0.5421 0.5869 0.0830  -0.0753 0.0901  268 LYS A CD  
2092 C CE  . LYS A 286 ? 0.4765 0.5737 0.6080 0.0798  -0.0989 0.0909  268 LYS A CE  
2093 N NZ  . LYS A 286 ? 0.5138 0.6288 0.6690 0.0916  -0.1151 0.1003  268 LYS A NZ  
2094 N N   . ASN A 287 ? 0.3476 0.3729 0.3904 0.0535  -0.0403 0.0683  269 ASN A N   
2095 C CA  . ASN A 287 ? 0.3385 0.3435 0.3484 0.0518  -0.0417 0.0696  269 ASN A CA  
2096 C C   . ASN A 287 ? 0.3360 0.3261 0.3309 0.0443  -0.0255 0.0662  269 ASN A C   
2097 O O   . ASN A 287 ? 0.3297 0.3272 0.3379 0.0385  -0.0168 0.0604  269 ASN A O   
2098 C CB  . ASN A 287 ? 0.3043 0.3152 0.3057 0.0472  -0.0548 0.0660  269 ASN A CB  
2099 C CG  . ASN A 287 ? 0.3724 0.3946 0.3851 0.0536  -0.0745 0.0700  269 ASN A CG  
2100 O OD1 . ASN A 287 ? 0.3559 0.3728 0.3656 0.0638  -0.0801 0.0778  269 ASN A OD1 
2101 N ND2 . ASN A 287 ? 0.3760 0.4134 0.4025 0.0475  -0.0863 0.0651  269 ASN A ND2 
2102 N N   . PRO A 288 ? 0.3604 0.3300 0.3281 0.0443  -0.0216 0.0705  270 PRO A N   
2103 C CA  . PRO A 288 ? 0.3232 0.2811 0.2814 0.0357  -0.0067 0.0688  270 PRO A CA  
2104 C C   . PRO A 288 ? 0.3179 0.2897 0.2825 0.0260  -0.0027 0.0604  270 PRO A C   
2105 O O   . PRO A 288 ? 0.3119 0.2915 0.2710 0.0254  -0.0094 0.0576  270 PRO A O   
2106 C CB  . PRO A 288 ? 0.3537 0.2915 0.2821 0.0378  -0.0048 0.0766  270 PRO A CB  
2107 C CG  . PRO A 288 ? 0.3901 0.3217 0.3124 0.0501  -0.0169 0.0838  270 PRO A CG  
2108 C CD  . PRO A 288 ? 0.3536 0.3092 0.2990 0.0527  -0.0304 0.0788  270 PRO A CD  
2109 N N   . LEU A 289 ? 0.2967 0.2699 0.2718 0.0191  0.0072  0.0561  271 LEU A N   
2110 C CA  . LEU A 289 ? 0.2688 0.2547 0.2501 0.0109  0.0114  0.0491  271 LEU A CA  
2111 C C   . LEU A 289 ? 0.2814 0.2604 0.2462 0.0062  0.0188  0.0519  271 LEU A C   
2112 O O   . LEU A 289 ? 0.3037 0.2663 0.2547 0.0068  0.0237  0.0592  271 LEU A O   
2113 C CB  . LEU A 289 ? 0.3105 0.2999 0.3069 0.0058  0.0175  0.0437  271 LEU A CB  
2114 C CG  . LEU A 289 ? 0.3123 0.2846 0.3047 0.0010  0.0255  0.0452  271 LEU A CG  
2115 C CD1 . LEU A 289 ? 0.3053 0.2794 0.2957 -0.0096 0.0325  0.0446  271 LEU A CD1 
2116 C CD2 . LEU A 289 ? 0.2776 0.2482 0.2803 0.0017  0.0266  0.0396  271 LEU A CD2 
2117 N N   . LEU A 290 ? 0.2695 0.2606 0.2357 0.0025  0.0206  0.0471  272 LEU A N   
2118 C CA  . LEU A 290 ? 0.2807 0.2695 0.2343 -0.0005 0.0299  0.0499  272 LEU A CA  
2119 C C   . LEU A 290 ? 0.3352 0.3355 0.3060 -0.0095 0.0384  0.0464  272 LEU A C   
2120 O O   . LEU A 290 ? 0.3215 0.3337 0.3081 -0.0117 0.0349  0.0395  272 LEU A O   
2121 C CB  . LEU A 290 ? 0.2851 0.2773 0.2242 0.0048  0.0254  0.0472  272 LEU A CB  
2122 C CG  . LEU A 290 ? 0.3581 0.3405 0.2804 0.0131  0.0124  0.0489  272 LEU A CG  
2123 C CD1 . LEU A 290 ? 0.3762 0.3592 0.2839 0.0167  0.0061  0.0435  272 LEU A CD1 
2124 C CD2 . LEU A 290 ? 0.3716 0.3352 0.2714 0.0175  0.0155  0.0587  272 LEU A CD2 
2125 N N   . TYR A 291 ? 0.2780 0.2750 0.2462 -0.0150 0.0494  0.0520  273 TYR A N   
2126 C CA  . TYR A 291 ? 0.2657 0.2776 0.2526 -0.0238 0.0563  0.0495  273 TYR A CA  
2127 C C   . TYR A 291 ? 0.2801 0.2959 0.2622 -0.0258 0.0692  0.0567  273 TYR A C   
2128 O O   . TYR A 291 ? 0.3042 0.3056 0.2679 -0.0229 0.0752  0.0653  273 TYR A O   
2129 C CB  . TYR A 291 ? 0.2884 0.2950 0.2899 -0.0329 0.0558  0.0481  273 TYR A CB  
2130 C CG  . TYR A 291 ? 0.2895 0.2766 0.2846 -0.0380 0.0623  0.0568  273 TYR A CG  
2131 C CD1 . TYR A 291 ? 0.3273 0.3176 0.3314 -0.0483 0.0727  0.0629  273 TYR A CD1 
2132 C CD2 . TYR A 291 ? 0.3419 0.3074 0.3238 -0.0324 0.0582  0.0599  273 TYR A CD2 
2133 C CE1 . TYR A 291 ? 0.3264 0.2962 0.3248 -0.0543 0.0793  0.0721  273 TYR A CE1 
2134 C CE2 . TYR A 291 ? 0.3703 0.3141 0.3442 -0.0364 0.0643  0.0686  273 TYR A CE2 
2135 C CZ  . TYR A 291 ? 0.3875 0.3321 0.3689 -0.0480 0.0750  0.0747  273 TYR A CZ  
2136 O OH  . TYR A 291 ? 0.4488 0.3693 0.4225 -0.0532 0.0816  0.0845  273 TYR A OH  
2137 N N   . THR A 292 ? 0.3233 0.3594 0.3220 -0.0294 0.0740  0.0539  274 THR A N   
2138 C CA  . THR A 292 ? 0.3320 0.3779 0.3338 -0.0314 0.0885  0.0614  274 THR A CA  
2139 C C   . THR A 292 ? 0.3219 0.3930 0.3536 -0.0383 0.0895  0.0573  274 THR A C   
2140 O O   . THR A 292 ? 0.3055 0.3824 0.3482 -0.0400 0.0785  0.0486  274 THR A O   
2141 C CB  . THR A 292 ? 0.3313 0.3752 0.3086 -0.0185 0.0936  0.0627  274 THR A CB  
2142 O OG1 . THR A 292 ? 0.3440 0.3955 0.3218 -0.0187 0.1113  0.0722  274 THR A OG1 
2143 C CG2 . THR A 292 ? 0.2987 0.3552 0.2800 -0.0121 0.0861  0.0526  274 THR A CG2 
2144 N N   . ASP A 293 ? 0.3409 0.4277 0.3858 -0.0417 0.1028  0.0645  275 ASP A N   
2145 C CA  . ASP A 293 ? 0.3468 0.4620 0.4209 -0.0455 0.1034  0.0616  275 ASP A CA  
2146 C C   . ASP A 293 ? 0.3629 0.4946 0.4387 -0.0380 0.1197  0.0687  275 ASP A C   
2147 O O   . ASP A 293 ? 0.4064 0.5257 0.4602 -0.0321 0.1316  0.0766  275 ASP A O   
2148 C CB  . ASP A 293 ? 0.3482 0.4714 0.4517 -0.0624 0.1003  0.0627  275 ASP A CB  
2149 C CG  . ASP A 293 ? 0.4079 0.5244 0.5162 -0.0723 0.1130  0.0750  275 ASP A CG  
2150 O OD1 . ASP A 293 ? 0.4079 0.5457 0.5354 -0.0751 0.1267  0.0837  275 ASP A OD1 
2151 O OD2 . ASP A 293 ? 0.4698 0.5600 0.5637 -0.0767 0.1103  0.0769  275 ASP A OD2 
2152 N N   . SER A 294 ? 0.3397 0.4988 0.4400 -0.0367 0.1206  0.0663  276 SER A N   
2153 C CA  . SER A 294 ? 0.3892 0.5657 0.4915 -0.0259 0.1365  0.0721  276 SER A CA  
2154 C C   . SER A 294 ? 0.4141 0.5987 0.5265 -0.0311 0.1567  0.0867  276 SER A C   
2155 O O   . SER A 294 ? 0.4296 0.6197 0.5314 -0.0191 0.1736  0.0932  276 SER A O   
2156 C CB  . SER A 294 ? 0.4140 0.6200 0.5445 -0.0229 0.1325  0.0674  276 SER A CB  
2157 O OG  . SER A 294 ? 0.4191 0.6401 0.5821 -0.0382 0.1212  0.0653  276 SER A OG  
2158 N N   . SER A 295 ? 0.4199 0.6030 0.5511 -0.0485 0.1556  0.0922  277 SER A N   
2159 C CA  . SER A 295 ? 0.4682 0.6561 0.6109 -0.0566 0.1739  0.1069  277 SER A CA  
2160 C C   . SER A 295 ? 0.5135 0.6672 0.6182 -0.0536 0.1817  0.1145  277 SER A C   
2161 O O   . SER A 295 ? 0.5142 0.6625 0.6162 -0.0580 0.1937  0.1242  277 SER A O   
2162 C CB  . SER A 295 ? 0.5007 0.7002 0.6821 -0.0785 0.1662  0.1079  277 SER A CB  
2163 O OG  . SER A 295 ? 0.5546 0.7856 0.7700 -0.0810 0.1576  0.1012  277 SER A OG  
2164 N N   . ASP A 296 ? 0.5283 0.6549 0.5993 -0.0457 0.1674  0.1050  278 ASP A N   
2165 C CA  . ASP A 296 ? 0.5188 0.6118 0.5536 -0.0425 0.1691  0.1103  278 ASP A CA  
2166 C C   . ASP A 296 ? 0.4915 0.5708 0.4844 -0.0227 0.1736  0.1093  278 ASP A C   
2167 O O   . ASP A 296 ? 0.4720 0.5523 0.4546 -0.0128 0.1624  0.0976  278 ASP A O   
2168 C CB  . ASP A 296 ? 0.5480 0.6205 0.5769 -0.0478 0.1487  0.1012  278 ASP A CB  
2169 C CG  . ASP A 296 ? 0.6250 0.6661 0.6300 -0.0496 0.1506  0.1097  278 ASP A CG  
2170 O OD1 . ASP A 296 ? 0.6451 0.6725 0.6569 -0.0587 0.1398  0.1066  278 ASP A OD1 
2171 O OD2 . ASP A 296 ? 0.6659 0.6942 0.6430 -0.0408 0.1632  0.1194  278 ASP A OD2 
2172 N N   . SER A 297 ? 0.5456 0.6096 0.5123 -0.0172 0.1898  0.1217  279 SER A N   
2173 C CA  . SER A 297 ? 0.5609 0.6068 0.4811 0.0020  0.1935  0.1207  279 SER A CA  
2174 C C   . SER A 297 ? 0.5598 0.5757 0.4469 0.0072  0.1733  0.1133  279 SER A C   
2175 O O   . SER A 297 ? 0.5764 0.5782 0.4293 0.0214  0.1663  0.1065  279 SER A O   
2176 C CB  . SER A 297 ? 0.6017 0.6395 0.5036 0.0064  0.2123  0.1332  279 SER A CB  
2177 O OG  . SER A 297 ? 0.6206 0.6337 0.5067 0.0004  0.2123  0.1428  279 SER A OG  
2178 N N   . GLU A 298 ? 0.5437 0.5500 0.4424 -0.0043 0.1633  0.1145  280 GLU A N   
2179 C CA  . GLU A 298 ? 0.5713 0.5513 0.4427 0.0010  0.1460  0.1106  280 GLU A CA  
2180 C C   . GLU A 298 ? 0.5769 0.5627 0.4678 -0.0033 0.1247  0.0970  280 GLU A C   
2181 O O   . GLU A 298 ? 0.5196 0.5245 0.4453 -0.0136 0.1226  0.0920  280 GLU A O   
2182 C CB  . GLU A 298 ? 0.6198 0.5781 0.4816 -0.0044 0.1515  0.1236  280 GLU A CB  
2183 C CG  . GLU A 298 ? 0.7488 0.6938 0.5804 0.0026  0.1718  0.1386  280 GLU A CG  
2184 C CD  . GLU A 298 ? 0.8375 0.7599 0.6623 -0.0043 0.1785  0.1531  280 GLU A CD  
2185 O OE1 . GLU A 298 ? 0.8150 0.7415 0.6729 -0.0199 0.1767  0.1540  280 GLU A OE1 
2186 O OE2 . GLU A 298 ? 0.9325 0.8304 0.7165 0.0063  0.1849  0.1633  280 GLU A OE2 
2187 N N   . ILE A 299 ? 0.6204 0.5895 0.4879 0.0052  0.1088  0.0917  281 ILE A N   
2195 N N   . HIS A 300 ? 0.4770 0.4707 0.4929 0.0339  -0.1207 0.0318  282 HIS A N   
2196 C CA  . HIS A 300 ? 0.4062 0.4151 0.4233 0.0344  -0.1275 0.0259  282 HIS A CA  
2197 C C   . HIS A 300 ? 0.3871 0.4037 0.4210 0.0292  -0.1199 0.0241  282 HIS A C   
2198 O O   . HIS A 300 ? 0.3924 0.4032 0.4299 0.0269  -0.1091 0.0305  282 HIS A O   
2199 C CB  . HIS A 300 ? 0.4168 0.4279 0.4132 0.0397  -0.1294 0.0334  282 HIS A CB  
2200 C CG  . HIS A 300 ? 0.4452 0.4524 0.4247 0.0441  -0.1366 0.0385  282 HIS A CG  
2201 N ND1 . HIS A 300 ? 0.4556 0.4642 0.4313 0.0471  -0.1478 0.0307  282 HIS A ND1 
2202 C CD2 . HIS A 300 ? 0.4351 0.4403 0.4019 0.0460  -0.1342 0.0526  282 HIS A CD2 
2203 C CE1 . HIS A 300 ? 0.4449 0.4505 0.4058 0.0508  -0.1517 0.0388  282 HIS A CE1 
2204 N NE2 . HIS A 300 ? 0.4340 0.4392 0.3899 0.0502  -0.1437 0.0531  282 HIS A NE2 
2205 N N   . GLN A 301 ? 0.3169 0.3489 0.3627 0.0281  -0.1251 0.0173  283 GLN A N   
2206 C CA  . GLN A 301 ? 0.3190 0.3631 0.3816 0.0255  -0.1180 0.0183  283 GLN A CA  
2207 C C   . GLN A 301 ? 0.3591 0.4040 0.4106 0.0333  -0.1133 0.0231  283 GLN A C   
2208 O O   . GLN A 301 ? 0.3143 0.3572 0.3504 0.0391  -0.1186 0.0220  283 GLN A O   
2209 C CB  . GLN A 301 ? 0.3131 0.3788 0.3967 0.0205  -0.1247 0.0125  283 GLN A CB  
2210 C CG  . GLN A 301 ? 0.3534 0.4187 0.4441 0.0080  -0.1293 0.0052  283 GLN A CG  
2211 C CD  . GLN A 301 ? 0.3597 0.4539 0.4690 0.0008  -0.1384 0.0015  283 GLN A CD  
2212 O OE1 . GLN A 301 ? 0.3634 0.4777 0.4928 -0.0058 -0.1350 0.0045  283 GLN A OE1 
2213 N NE2 . GLN A 301 ? 0.3052 0.4050 0.4085 0.0019  -0.1502 -0.0031 283 GLN A NE2 
2214 N N   . PHE A 302 ? 0.3697 0.4151 0.4272 0.0322  -0.1015 0.0278  284 PHE A N   
2215 C CA  . PHE A 302 ? 0.3328 0.3748 0.3784 0.0375  -0.0927 0.0313  284 PHE A CA  
2216 C C   . PHE A 302 ? 0.3348 0.3909 0.4050 0.0383  -0.0838 0.0335  284 PHE A C   
2217 O O   . PHE A 302 ? 0.3393 0.3980 0.4234 0.0329  -0.0774 0.0361  284 PHE A O   
2218 C CB  . PHE A 302 ? 0.3449 0.3717 0.3680 0.0345  -0.0848 0.0374  284 PHE A CB  
2219 C CG  . PHE A 302 ? 0.4999 0.5181 0.5041 0.0357  -0.0730 0.0395  284 PHE A CG  
2220 C CD1 . PHE A 302 ? 0.3644 0.3726 0.3399 0.0366  -0.0744 0.0377  284 PHE A CD1 
2221 C CD2 . PHE A 302 ? 0.3694 0.3867 0.3818 0.0346  -0.0587 0.0429  284 PHE A CD2 
2222 C CE1 . PHE A 302 ? 0.3840 0.3785 0.3367 0.0347  -0.0604 0.0380  284 PHE A CE1 
2223 C CE2 . PHE A 302 ? 0.4527 0.4569 0.4441 0.0344  -0.0447 0.0440  284 PHE A CE2 
2224 C CZ  . PHE A 302 ? 0.4708 0.4620 0.4308 0.0337  -0.0447 0.0410  284 PHE A CZ  
2225 N N   . MET A 303 ? 0.3757 0.4423 0.4532 0.0457  -0.0824 0.0341  285 MET A N   
2226 C CA  . MET A 303 ? 0.4325 0.5181 0.5377 0.0485  -0.0735 0.0400  285 MET A CA  
2227 C C   . MET A 303 ? 0.4987 0.5711 0.5976 0.0496  -0.0552 0.0451  285 MET A C   
2228 O O   . MET A 303 ? 0.5336 0.5829 0.6029 0.0508  -0.0470 0.0443  285 MET A O   
2229 C CB  . MET A 303 ? 0.4502 0.5502 0.5649 0.0590  -0.0733 0.0434  285 MET A CB  
2230 C CG  . MET A 303 ? 0.4674 0.5997 0.6195 0.0614  -0.0689 0.0531  285 MET A CG  
2231 S SD  . MET A 303 ? 1.1058 1.2760 1.2832 0.0568  -0.0891 0.0534  285 MET A SD  
2232 C CE  . MET A 303 ? 0.3047 0.4659 0.4649 0.0712  -0.0905 0.0530  285 MET A CE  
2233 N N   . VAL A 304 ? 0.5450 0.6333 0.6706 0.0474  -0.0486 0.0505  286 VAL A N   
2234 C CA  . VAL A 304 ? 0.5934 0.6703 0.7159 0.0476  -0.0309 0.0555  286 VAL A CA  
2235 C C   . VAL A 304 ? 0.6293 0.7222 0.7758 0.0568  -0.0168 0.0651  286 VAL A C   
2236 O O   . VAL A 304 ? 0.5749 0.6993 0.7531 0.0581  -0.0231 0.0705  286 VAL A O   
2237 C CB  . VAL A 304 ? 0.4674 0.5454 0.5991 0.0368  -0.0326 0.0550  286 VAL A CB  
2238 C CG1 . VAL A 304 ? 0.5076 0.5848 0.6491 0.0373  -0.0153 0.0619  286 VAL A CG1 
2239 C CG2 . VAL A 304 ? 0.4241 0.4807 0.5280 0.0314  -0.0381 0.0508  286 VAL A CG2 
2240 N N   . GLU A 305 ? 0.7119 0.7839 0.8423 0.0625  0.0035  0.0686  287 GLU A N   
2241 C CA  . GLU A 305 ? 0.7585 0.8399 0.9096 0.0738  0.0227  0.0799  287 GLU A CA  
2242 C C   . GLU A 305 ? 0.7623 0.8772 0.9547 0.0712  0.0216  0.0891  287 GLU A C   
2243 O O   . GLU A 305 ? 0.7630 0.8747 0.9571 0.0618  0.0220  0.0873  287 GLU A O   
2244 C CB  . GLU A 305 ? 0.7914 0.8377 0.9130 0.0762  0.0473  0.0801  287 GLU A CB  
2245 N N   . GLN A 306 ? 0.7530 0.9023 0.9792 0.0789  0.0205  0.1005  288 GLN A N   
2246 C CA  . GLN A 306 ? 0.7467 0.9357 1.0138 0.0742  0.0177  0.1113  288 GLN A CA  
2247 C C   . GLN A 306 ? 0.7824 0.9678 1.0610 0.0810  0.0418  0.1227  288 GLN A C   
2248 O O   . GLN A 306 ? 0.8181 0.9897 1.0924 0.0963  0.0636  0.1312  288 GLN A O   
2249 C CB  . GLN A 306 ? 0.7336 0.9671 1.0334 0.0794  0.0087  0.1235  288 GLN A CB  
2250 N N   . PHE A 307 ? 0.7657 0.9610 1.0580 0.0695  0.0396  0.1228  289 PHE A N   
2251 C CA  . PHE A 307 ? 0.7673 0.9621 1.0732 0.0744  0.0610  0.1337  289 PHE A CA  
2252 C C   . PHE A 307 ? 0.7250 0.9721 1.0800 0.0756  0.0609  0.1525  289 PHE A C   
2253 O O   . PHE A 307 ? 0.6988 0.9802 1.0740 0.0614  0.0406  0.1519  289 PHE A O   
2254 C CB  . PHE A 307 ? 0.8113 0.9843 1.1015 0.0611  0.0605  0.1237  289 PHE A CB  
2255 C CG  . PHE A 307 ? 0.8552 0.9804 1.1014 0.0626  0.0719  0.1139  289 PHE A CG  
2256 C CD1 . PHE A 307 ? 0.8895 0.9932 1.1259 0.0690  0.0968  0.1194  289 PHE A CD1 
2257 C CD2 . PHE A 307 ? 0.8541 0.9574 1.0678 0.0562  0.0582  0.1005  289 PHE A CD2 
2258 C CE1 . PHE A 307 ? 0.9074 0.9696 1.0999 0.0661  0.1068  0.1105  289 PHE A CE1 
2259 C CE2 . PHE A 307 ? 0.8785 0.9443 1.0515 0.0545  0.0674  0.0938  289 PHE A CE2 
2260 C CZ  . PHE A 307 ? 0.9014 0.9470 1.0624 0.0580  0.0912  0.0983  289 PHE A CZ  
2261 N N   . LYS A 308 ? 0.7297 0.9834 1.1030 0.0912  0.0847  0.1702  290 LYS A N   
2262 C CA  . LYS A 308 ? 0.7065 1.0127 1.1285 0.0925  0.0874  0.1920  290 LYS A CA  
2263 C C   . LYS A 308 ? 0.7122 1.0212 1.1413 0.0768  0.0856  0.1882  290 LYS A C   
2264 O O   . LYS A 308 ? 0.7222 0.9888 1.1194 0.0709  0.0892  0.1724  290 LYS A O   
2265 C CB  . LYS A 308 ? 0.7173 1.0257 1.1565 0.1165  0.1178  0.2143  290 LYS A CB  
2266 C CG  . LYS A 308 ? 0.7008 1.0597 1.1781 0.1291  0.1166  0.2378  290 LYS A CG  
2267 C CD  . LYS A 308 ? 0.6912 1.0356 1.1462 0.1341  0.1066  0.2282  290 LYS A CD  
2268 C CE  . LYS A 308 ? 0.6910 1.0874 1.1854 0.1483  0.1073  0.2545  290 LYS A CE  
2269 N NZ  . LYS A 308 ? 0.6976 1.0781 1.1701 0.1546  0.0995  0.2458  290 LYS A NZ  
2270 N N   . ASP A 309 ? 0.7104 1.0712 1.1812 0.0693  0.0803  0.2039  291 ASP A N   
2271 C CA  . ASP A 309 ? 0.7243 1.0905 1.2040 0.0530  0.0788  0.2010  291 ASP A CA  
2272 C C   . ASP A 309 ? 0.7811 1.1178 1.2551 0.0650  0.1062  0.2062  291 ASP A C   
2273 O O   . ASP A 309 ? 0.7768 1.0858 1.2329 0.0547  0.1078  0.1938  291 ASP A O   
2274 C CB  . ASP A 309 ? 0.6875 1.1202 1.2128 0.0397  0.0672  0.2182  291 ASP A CB  
2275 C CG  . ASP A 309 ? 0.6565 1.1135 1.1804 0.0183  0.0387  0.2077  291 ASP A CG  
2276 O OD1 . ASP A 309 ? 0.6573 1.0750 1.1454 0.0116  0.0281  0.1847  291 ASP A OD1 
2277 O OD2 . ASP A 309 ? 0.6354 1.1520 1.1935 0.0071  0.0274  0.2233  291 ASP A OD2 
2278 N N   . ASP A 310 ? 0.8218 1.1630 1.3103 0.0870  0.1294  0.2254  292 ASP A N   
2279 C CA  . ASP A 310 ? 0.8611 1.1736 1.3440 0.0991  0.1591  0.2319  292 ASP A CA  
2280 C C   . ASP A 310 ? 0.8738 1.1184 1.3028 0.1029  0.1718  0.2124  292 ASP A C   
2281 O O   . ASP A 310 ? 0.8967 1.1104 1.3112 0.1070  0.1941  0.2124  292 ASP A O   
2282 C CB  . ASP A 310 ? 0.8939 1.2335 1.4121 0.1220  0.1837  0.2615  292 ASP A CB  
2283 C CG  . ASP A 310 ? 0.9239 1.2670 1.4412 0.1378  0.1860  0.2685  292 ASP A CG  
2284 O OD1 . ASP A 310 ? 0.9285 1.3201 1.4883 0.1509  0.1923  0.2961  292 ASP A OD1 
2285 O OD2 . ASP A 310 ? 0.9405 1.2402 1.4157 0.1373  0.1819  0.2484  292 ASP A OD2 
2286 N N   . GLN A 311 ? 0.8646 1.0883 1.2631 0.0998  0.1575  0.1965  293 GLN A N   
2287 C CA  . GLN A 311 ? 0.8765 1.0421 1.2224 0.0993  0.1661  0.1787  293 GLN A CA  
2288 C C   . GLN A 311 ? 0.8480 0.9939 1.1717 0.0813  0.1550  0.1628  293 GLN A C   
2289 O O   . GLN A 311 ? 0.8849 0.9903 1.1735 0.0796  0.1687  0.1549  293 GLN A O   
2290 C CB  . GLN A 311 ? 0.8894 1.0429 1.2118 0.1014  0.1536  0.1686  293 GLN A CB  
2291 C CG  . GLN A 311 ? 0.9187 1.0797 1.2539 0.1214  0.1698  0.1834  293 GLN A CG  
2292 C CD  . GLN A 311 ? 0.9193 1.0607 1.2250 0.1228  0.1598  0.1714  293 GLN A CD  
2293 O OE1 . GLN A 311 ? 0.9040 1.0766 1.2261 0.1200  0.1367  0.1715  293 GLN A OE1 
2294 N NE2 . GLN A 311 ? 0.9389 1.0283 1.1987 0.1253  0.1776  0.1609  293 GLN A NE2 
2295 N N   . ILE A 312 ? 0.7613 0.9361 1.1046 0.0671  0.1314  0.1591  294 ILE A N   
2296 C CA  . ILE A 312 ? 0.6876 0.8449 1.0127 0.0511  0.1210  0.1457  294 ILE A CA  
2297 C C   . ILE A 312 ? 0.6426 0.7942 0.9752 0.0488  0.1372  0.1513  294 ILE A C   
2298 O O   . ILE A 312 ? 0.6174 0.8016 0.9871 0.0476  0.1400  0.1632  294 ILE A O   
2299 C CB  . ILE A 312 ? 0.6385 0.8233 0.9807 0.0358  0.0954  0.1398  294 ILE A CB  
2300 C CG1 . ILE A 312 ? 0.5899 0.7744 0.9185 0.0368  0.0787  0.1318  294 ILE A CG1 
2301 C CG2 . ILE A 312 ? 0.6508 0.8166 0.9786 0.0214  0.0902  0.1292  294 ILE A CG2 
2302 C CD1 . ILE A 312 ? 0.5529 0.7634 0.8965 0.0211  0.0557  0.1261  294 ILE A CD1 
2303 N N   . ILE A 313 ? 0.6167 0.7292 0.9135 0.0469  0.1476  0.1435  295 ILE A N   
2304 C CA  . ILE A 313 ? 0.6054 0.7085 0.9041 0.0437  0.1625  0.1474  295 ILE A CA  
2305 C C   . ILE A 313 ? 0.5692 0.6714 0.8655 0.0282  0.1484  0.1396  295 ILE A C   
2306 O O   . ILE A 313 ? 0.4851 0.6067 0.8090 0.0218  0.1485  0.1446  295 ILE A O   
2307 C CB  . ILE A 313 ? 0.6249 0.6865 0.8842 0.0486  0.1849  0.1452  295 ILE A CB  
2308 C CG1 . ILE A 313 ? 0.6345 0.6908 0.8968 0.0648  0.2067  0.1545  295 ILE A CG1 
2309 C CG2 . ILE A 313 ? 0.6278 0.6791 0.8855 0.0429  0.1978  0.1480  295 ILE A CG2 
2310 C CD1 . ILE A 313 ? 0.6206 0.7065 0.9280 0.0747  0.2210  0.1725  295 ILE A CD1 
2311 N N   . ASP A 314 ? 0.5582 0.6381 0.8220 0.0224  0.1377  0.1287  296 ASP A N   
2312 C CA  . ASP A 314 ? 0.5760 0.6511 0.8356 0.0103  0.1274  0.1233  296 ASP A CA  
2313 C C   . ASP A 314 ? 0.5798 0.6406 0.8117 0.0073  0.1124  0.1144  296 ASP A C   
2314 O O   . ASP A 314 ? 0.4876 0.5261 0.6853 0.0092  0.1164  0.1125  296 ASP A O   
2315 C CB  . ASP A 314 ? 0.5978 0.6548 0.8451 0.0077  0.1428  0.1269  296 ASP A CB  
2316 C CG  . ASP A 314 ? 0.6310 0.6852 0.8803 -0.0029 0.1360  0.1249  296 ASP A CG  
2317 O OD1 . ASP A 314 ? 0.6494 0.7167 0.9159 -0.0093 0.1227  0.1207  296 ASP A OD1 
2318 O OD2 . ASP A 314 ? 0.6374 0.6754 0.8703 -0.0053 0.1456  0.1280  296 ASP A OD2 
2319 N N   . THR A 315 ? 0.5575 0.6314 0.8029 0.0010  0.0959  0.1093  297 THR A N   
2320 C CA  . THR A 315 ? 0.5472 0.6100 0.7707 -0.0007 0.0818  0.1021  297 THR A CA  
2321 C C   . THR A 315 ? 0.5508 0.5955 0.7570 -0.0064 0.0821  0.1023  297 THR A C   
2322 O O   . THR A 315 ? 0.4578 0.4932 0.6456 -0.0068 0.0727  0.0994  297 THR A O   
2323 C CB  . THR A 315 ? 0.5074 0.5893 0.7499 -0.0057 0.0657  0.0965  297 THR A CB  
2324 O OG1 . THR A 315 ? 0.4413 0.5323 0.7054 -0.0175 0.0652  0.0957  297 THR A OG1 
2325 C CG2 . THR A 315 ? 0.4832 0.5886 0.7440 0.0011  0.0642  0.0998  297 THR A CG2 
2326 N N   . ASN A 316 ? 0.5598 0.6013 0.7740 -0.0099 0.0938  0.1077  298 ASN A N   
2327 C CA  . ASN A 316 ? 0.6061 0.6329 0.8070 -0.0137 0.0972  0.1118  298 ASN A CA  
2328 C C   . ASN A 316 ? 0.6020 0.6157 0.7673 -0.0105 0.0975  0.1157  298 ASN A C   
2329 O O   . ASN A 316 ? 0.4969 0.5055 0.6462 -0.0086 0.1065  0.1177  298 ASN A O   
2330 C CB  . ASN A 316 ? 0.6720 0.6986 0.8876 -0.0171 0.1115  0.1180  298 ASN A CB  
2331 C CG  . ASN A 316 ? 0.7229 0.7363 0.9287 -0.0199 0.1168  0.1250  298 ASN A CG  
2332 O OD1 . ASN A 316 ? 0.7319 0.7408 0.9452 -0.0235 0.1136  0.1237  298 ASN A OD1 
2333 N ND2 . ASN A 316 ? 0.7331 0.7400 0.9220 -0.0185 0.1270  0.1335  298 ASN A ND2 
2334 N N   . GLY A 317 ? 0.6048 0.6133 0.7566 -0.0111 0.0887  0.1172  299 GLY A N   
2338 N N   . ALA A 318 ? 0.3403 0.3681 0.4519 -0.0076 0.0042  0.0162  300 ALA A N   
2339 C CA  . ALA A 318 ? 0.3146 0.3301 0.4084 -0.0018 0.0007  0.0127  300 ALA A CA  
2340 C C   . ALA A 318 ? 0.2727 0.2737 0.3539 -0.0051 0.0005  0.0123  300 ALA A C   
2341 O O   . ALA A 318 ? 0.2869 0.2781 0.3531 -0.0036 0.0022  0.0123  300 ALA A O   
2342 C CB  . ALA A 318 ? 0.3086 0.3290 0.4057 0.0027  -0.0073 0.0091  300 ALA A CB  
2343 N N   . GLY A 319 ? 0.2209 0.2203 0.3089 -0.0098 -0.0007 0.0119  301 GLY A N   
2344 C CA  . GLY A 319 ? 0.2127 0.2018 0.2924 -0.0110 0.0010  0.0121  301 GLY A CA  
2345 C C   . GLY A 319 ? 0.2314 0.2230 0.3095 -0.0121 0.0061  0.0177  301 GLY A C   
2346 O O   . GLY A 319 ? 0.2435 0.2315 0.3132 -0.0120 0.0074  0.0183  301 GLY A O   
2347 N N   . ASP A 320 ? 0.1877 0.1873 0.2736 -0.0136 0.0088  0.0223  302 ASP A N   
2348 C CA  . ASP A 320 ? 0.2125 0.2166 0.2944 -0.0144 0.0118  0.0278  302 ASP A CA  
2349 C C   . ASP A 320 ? 0.2095 0.2121 0.2775 -0.0144 0.0113  0.0250  302 ASP A C   
2350 O O   . ASP A 320 ? 0.2010 0.2050 0.2626 -0.0170 0.0108  0.0263  302 ASP A O   
2351 C CB  . ASP A 320 ? 0.2604 0.2720 0.3492 -0.0154 0.0155  0.0338  302 ASP A CB  
2352 C CG  . ASP A 320 ? 0.3264 0.3350 0.4285 -0.0174 0.0171  0.0373  302 ASP A CG  
2353 O OD1 . ASP A 320 ? 0.3724 0.3721 0.4759 -0.0168 0.0158  0.0361  302 ASP A OD1 
2354 O OD2 . ASP A 320 ? 0.3255 0.3391 0.4360 -0.0200 0.0209  0.0410  302 ASP A OD2 
2355 N N   . ALA A 321 ? 0.1767 0.1765 0.2409 -0.0115 0.0113  0.0210  303 ALA A N   
2356 C CA  . ALA A 321 ? 0.2387 0.2298 0.2870 -0.0106 0.0119  0.0174  303 ALA A CA  
2357 C C   . ALA A 321 ? 0.2533 0.2333 0.2928 -0.0126 0.0099  0.0152  303 ALA A C   
2358 O O   . ALA A 321 ? 0.1988 0.1723 0.2270 -0.0174 0.0105  0.0140  303 ALA A O   
2359 C CB  . ALA A 321 ? 0.2299 0.2197 0.2778 -0.0036 0.0134  0.0147  303 ALA A CB  
2360 N N   . PHE A 322 ? 0.1880 0.1656 0.2317 -0.0101 0.0077  0.0144  304 PHE A N   
2361 C CA  . PHE A 322 ? 0.2388 0.2060 0.2725 -0.0112 0.0075  0.0134  304 PHE A CA  
2362 C C   . PHE A 322 ? 0.2588 0.2312 0.2941 -0.0179 0.0098  0.0160  304 PHE A C   
2363 O O   . PHE A 322 ? 0.3203 0.2862 0.3463 -0.0228 0.0116  0.0158  304 PHE A O   
2364 C CB  . PHE A 322 ? 0.2290 0.1948 0.2652 -0.0075 0.0047  0.0118  304 PHE A CB  
2365 C CG  . PHE A 322 ? 0.2402 0.1948 0.2626 -0.0075 0.0062  0.0115  304 PHE A CG  
2366 C CD1 . PHE A 322 ? 0.2206 0.1622 0.2277 -0.0030 0.0045  0.0110  304 PHE A CD1 
2367 C CD2 . PHE A 322 ? 0.2088 0.1661 0.2331 -0.0108 0.0103  0.0130  304 PHE A CD2 
2368 C CE1 . PHE A 322 ? 0.2348 0.1645 0.2264 -0.0031 0.0073  0.0123  304 PHE A CE1 
2369 C CE2 . PHE A 322 ? 0.2719 0.2203 0.2833 -0.0109 0.0139  0.0135  304 PHE A CE2 
2370 C CZ  . PHE A 322 ? 0.2327 0.1663 0.2266 -0.0078 0.0127  0.0133  304 PHE A CZ  
2371 N N   . ALA A 323 ? 0.2239 0.2086 0.2722 -0.0180 0.0100  0.0191  305 ALA A N   
2372 C CA  . ALA A 323 ? 0.2095 0.2050 0.2635 -0.0218 0.0114  0.0230  305 ALA A CA  
2373 C C   . ALA A 323 ? 0.2052 0.2059 0.2537 -0.0287 0.0098  0.0233  305 ALA A C   
2374 O O   . ALA A 323 ? 0.2151 0.2208 0.2631 -0.0353 0.0101  0.0239  305 ALA A O   
2375 C CB  . ALA A 323 ? 0.1734 0.1783 0.2410 -0.0177 0.0119  0.0276  305 ALA A CB  
2376 N N   . ALA A 324 ? 0.1863 0.1864 0.2303 -0.0281 0.0085  0.0225  306 ALA A N   
2377 C CA  . ALA A 324 ? 0.2813 0.2825 0.3145 -0.0346 0.0066  0.0206  306 ALA A CA  
2378 C C   . ALA A 324 ? 0.2879 0.2723 0.3069 -0.0409 0.0074  0.0149  306 ALA A C   
2379 O O   . ALA A 324 ? 0.2205 0.2080 0.2358 -0.0511 0.0054  0.0137  306 ALA A O   
2380 C CB  . ALA A 324 ? 0.2007 0.2001 0.2275 -0.0307 0.0076  0.0197  306 ALA A CB  
2381 N N   . GLY A 325 ? 0.2529 0.2196 0.2644 -0.0350 0.0099  0.0120  307 GLY A N   
2382 C CA  . GLY A 325 ? 0.2440 0.1885 0.2393 -0.0386 0.0119  0.0082  307 GLY A CA  
2383 C C   . GLY A 325 ? 0.2541 0.1995 0.2517 -0.0473 0.0132  0.0105  307 GLY A C   
2384 O O   . GLY A 325 ? 0.2665 0.2007 0.2540 -0.0580 0.0143  0.0082  307 GLY A O   
2385 N N   . PHE A 326 ? 0.2340 0.1920 0.2446 -0.0433 0.0142  0.0147  308 PHE A N   
2386 C CA  . PHE A 326 ? 0.2452 0.2078 0.2597 -0.0499 0.0178  0.0176  308 PHE A CA  
2387 C C   . PHE A 326 ? 0.2384 0.2218 0.2641 -0.0615 0.0160  0.0191  308 PHE A C   
2388 O O   . PHE A 326 ? 0.2601 0.2409 0.2829 -0.0737 0.0179  0.0188  308 PHE A O   
2389 C CB  . PHE A 326 ? 0.2166 0.1877 0.2404 -0.0415 0.0204  0.0206  308 PHE A CB  
2390 C CG  . PHE A 326 ? 0.2322 0.2086 0.2588 -0.0464 0.0269  0.0240  308 PHE A CG  
2391 C CD1 . PHE A 326 ? 0.2399 0.1969 0.2503 -0.0467 0.0321  0.0246  308 PHE A CD1 
2392 C CD2 . PHE A 326 ? 0.2141 0.2163 0.2596 -0.0501 0.0285  0.0277  308 PHE A CD2 
2393 C CE1 . PHE A 326 ? 0.3337 0.2963 0.3460 -0.0518 0.0403  0.0286  308 PHE A CE1 
2394 C CE2 . PHE A 326 ? 0.2725 0.2838 0.3236 -0.0543 0.0363  0.0313  308 PHE A CE2 
2395 C CZ  . PHE A 326 ? 0.3185 0.3096 0.3525 -0.0558 0.0431  0.0317  308 PHE A CZ  
2396 N N   . ILE A 327 ? 0.2326 0.2375 0.2719 -0.0579 0.0119  0.0216  309 ILE A N   
2397 C CA  . ILE A 327 ? 0.2215 0.2529 0.2744 -0.0660 0.0081  0.0247  309 ILE A CA  
2398 C C   . ILE A 327 ? 0.2493 0.2769 0.2909 -0.0804 0.0031  0.0195  309 ILE A C   
2399 O O   . ILE A 327 ? 0.2484 0.2904 0.2977 -0.0936 0.0014  0.0199  309 ILE A O   
2400 C CB  . ILE A 327 ? 0.1949 0.2460 0.2607 -0.0565 0.0045  0.0299  309 ILE A CB  
2401 C CG1 . ILE A 327 ? 0.1853 0.2385 0.2626 -0.0445 0.0101  0.0340  309 ILE A CG1 
2402 C CG2 . ILE A 327 ? 0.1978 0.2786 0.2759 -0.0633 -0.0019 0.0340  309 ILE A CG2 
2403 C CD1 . ILE A 327 ? 0.1769 0.2379 0.2626 -0.0341 0.0083  0.0391  309 ILE A CD1 
2404 N N   . ALA A 328 ? 0.2616 0.2701 0.2851 -0.0782 0.0011  0.0140  310 ALA A N   
2405 C CA  . ALA A 328 ? 0.2933 0.2920 0.3001 -0.0906 -0.0033 0.0067  310 ALA A CA  
2406 C C   . ALA A 328 ? 0.3465 0.3280 0.3458 -0.1053 -0.0004 0.0029  310 ALA A C   
2407 O O   . ALA A 328 ? 0.3561 0.3417 0.3519 -0.1220 -0.0053 -0.0016 310 ALA A O   
2408 C CB  . ALA A 328 ? 0.2681 0.2436 0.2544 -0.0824 -0.0020 0.0011  310 ALA A CB  
2409 N N   . ASP A 329 ? 0.3875 0.3492 0.3832 -0.1000 0.0074  0.0049  311 ASP A N   
2410 C CA  . ASP A 329 ? 0.4233 0.3640 0.4097 -0.1131 0.0125  0.0035  311 ASP A CA  
2411 C C   . ASP A 329 ? 0.3758 0.3436 0.3842 -0.1232 0.0149  0.0100  311 ASP A C   
2412 O O   . ASP A 329 ? 0.3694 0.3385 0.3795 -0.1424 0.0150  0.0084  311 ASP A O   
2413 C CB  . ASP A 329 ? 0.4345 0.3413 0.4040 -0.1018 0.0197  0.0045  311 ASP A CB  
2414 C CG  . ASP A 329 ? 0.5299 0.3987 0.4728 -0.1015 0.0205  -0.0028 311 ASP A CG  
2415 O OD1 . ASP A 329 ? 0.5532 0.4232 0.4898 -0.1022 0.0157  -0.0095 311 ASP A OD1 
2416 O OD2 . ASP A 329 ? 0.5983 0.4346 0.5246 -0.0995 0.0267  -0.0017 311 ASP A OD2 
2417 N N   . TYR A 330 ? 0.3240 0.3140 0.3499 -0.1106 0.0174  0.0167  312 TYR A N   
2418 C CA  . TYR A 330 ? 0.2958 0.3124 0.3432 -0.1155 0.0227  0.0235  312 TYR A CA  
2419 C C   . TYR A 330 ? 0.3089 0.3628 0.3779 -0.1294 0.0158  0.0245  312 TYR A C   
2420 O O   . TYR A 330 ? 0.3411 0.4121 0.4247 -0.1431 0.0199  0.0278  312 TYR A O   
2421 C CB  . TYR A 330 ? 0.2746 0.3035 0.3328 -0.0967 0.0268  0.0287  312 TYR A CB  
2422 C CG  . TYR A 330 ? 0.3392 0.3875 0.4135 -0.0977 0.0363  0.0351  312 TYR A CG  
2423 C CD1 . TYR A 330 ? 0.3984 0.4260 0.4594 -0.0999 0.0467  0.0370  312 TYR A CD1 
2424 C CD2 . TYR A 330 ? 0.3797 0.4671 0.4813 -0.0947 0.0358  0.0402  312 TYR A CD2 
2425 C CE1 . TYR A 330 ? 0.4087 0.4545 0.4826 -0.1002 0.0577  0.0431  312 TYR A CE1 
2426 C CE2 . TYR A 330 ? 0.4049 0.5120 0.5223 -0.0936 0.0467  0.0462  312 TYR A CE2 
2427 C CZ  . TYR A 330 ? 0.4263 0.5126 0.5295 -0.0969 0.0582  0.0473  312 TYR A CZ  
2428 O OH  . TYR A 330 ? 0.4777 0.5839 0.5947 -0.0954 0.0712  0.0534  312 TYR A OH  
2429 N N   . ILE A 331 ? 0.2952 0.3639 0.3668 -0.1259 0.0054  0.0225  313 ILE A N   
2430 C CA  . ILE A 331 ? 0.2848 0.3923 0.3758 -0.1374 -0.0040 0.0241  313 ILE A CA  
2431 C C   . ILE A 331 ? 0.3302 0.4282 0.4094 -0.1615 -0.0102 0.0156  313 ILE A C   
2432 O O   . ILE A 331 ? 0.3201 0.4515 0.4156 -0.1758 -0.0192 0.0158  313 ILE A O   
2433 C CB  . ILE A 331 ? 0.3018 0.4287 0.3967 -0.1246 -0.0134 0.0265  313 ILE A CB  
2434 C CG1 . ILE A 331 ? 0.2850 0.3829 0.3506 -0.1245 -0.0187 0.0181  313 ILE A CG1 
2435 C CG2 . ILE A 331 ? 0.3057 0.4386 0.4122 -0.1024 -0.0071 0.0344  313 ILE A CG2 
2436 C CD1 . ILE A 331 ? 0.2434 0.3590 0.3093 -0.1136 -0.0269 0.0216  313 ILE A CD1 
2437 N N   . ARG A 332 ? 0.3591 0.4111 0.4096 -0.1659 -0.0060 0.0081  314 ARG A N   
2438 C CA  . ARG A 332 ? 0.3908 0.4234 0.4259 -0.1896 -0.0096 -0.0012 314 ARG A CA  
2439 C C   . ARG A 332 ? 0.3909 0.4073 0.4280 -0.2044 0.0013  0.0012  314 ARG A C   
2440 O O   . ARG A 332 ? 0.4400 0.4278 0.4603 -0.2241 0.0016  -0.0061 314 ARG A O   
2441 C CB  . ARG A 332 ? 0.4023 0.3916 0.4019 -0.1853 -0.0115 -0.0117 314 ARG A CB  
2442 C CG  . ARG A 332 ? 0.4228 0.4294 0.4176 -0.1771 -0.0223 -0.0148 314 ARG A CG  
2443 C CD  . ARG A 332 ? 0.4924 0.4574 0.4519 -0.1721 -0.0215 -0.0254 314 ARG A CD  
2444 N NE  . ARG A 332 ? 0.5287 0.4669 0.4798 -0.1514 -0.0110 -0.0223 314 ARG A NE  
2445 C CZ  . ARG A 332 ? 0.5419 0.4444 0.4664 -0.1422 -0.0070 -0.0294 314 ARG A CZ  
2446 N NH1 . ARG A 332 ? 0.5378 0.4223 0.4377 -0.1514 -0.0113 -0.0410 314 ARG A NH1 
2447 N NH2 . ARG A 332 ? 0.5241 0.4100 0.4463 -0.1233 0.0011  -0.0253 314 ARG A NH2 
2448 N N   . GLY A 333 ? 0.3356 0.3681 0.3910 -0.1948 0.0111  0.0115  315 GLY A N   
2449 C CA  . GLY A 333 ? 0.3818 0.4086 0.4432 -0.2089 0.0228  0.0166  315 GLY A CA  
2450 C C   . GLY A 333 ? 0.3991 0.3759 0.4329 -0.2014 0.0351  0.0183  315 GLY A C   
2451 O O   . GLY A 333 ? 0.4553 0.4212 0.4886 -0.2134 0.0461  0.0234  315 GLY A O   
2452 N N   . LYS A 334 ? 0.4091 0.3570 0.4204 -0.1816 0.0334  0.0149  316 LYS A N   
2453 C CA  . LYS A 334 ? 0.4406 0.3449 0.4263 -0.1711 0.0430  0.0176  316 LYS A CA  
2454 C C   . LYS A 334 ? 0.4253 0.3450 0.4213 -0.1585 0.0523  0.0276  316 LYS A C   
2455 O O   . LYS A 334 ? 0.4559 0.4091 0.4714 -0.1464 0.0496  0.0298  316 LYS A O   
2456 C CB  . LYS A 334 ? 0.4775 0.3561 0.4422 -0.1519 0.0378  0.0120  316 LYS A CB  
2457 C CG  . LYS A 334 ? 0.5593 0.4250 0.5117 -0.1602 0.0294  0.0010  316 LYS A CG  
2458 C CD  . LYS A 334 ? 0.6919 0.5189 0.6240 -0.1805 0.0332  -0.0039 316 LYS A CD  
2459 C CE  . LYS A 334 ? 0.7859 0.6007 0.7035 -0.1898 0.0244  -0.0170 316 LYS A CE  
2460 N NZ  . LYS A 334 ? 0.8125 0.6206 0.7183 -0.1664 0.0212  -0.0209 316 LYS A NZ  
2461 N N   . PRO A 335 ? 0.4528 0.3453 0.4331 -0.1612 0.0639  0.0337  317 PRO A N   
2462 C CA  . PRO A 335 ? 0.4029 0.3063 0.3866 -0.1492 0.0738  0.0425  317 PRO A CA  
2463 C C   . PRO A 335 ? 0.4054 0.3061 0.3807 -0.1231 0.0695  0.0414  317 PRO A C   
2464 O O   . PRO A 335 ? 0.3882 0.2741 0.3533 -0.1139 0.0605  0.0354  317 PRO A O   
2465 C CB  . PRO A 335 ? 0.4229 0.2877 0.3820 -0.1572 0.0861  0.0492  317 PRO A CB  
2466 C CG  . PRO A 335 ? 0.5504 0.3755 0.4892 -0.1670 0.0815  0.0430  317 PRO A CG  
2467 C CD  . PRO A 335 ? 0.5055 0.3559 0.4635 -0.1776 0.0695  0.0333  317 PRO A CD  
2468 N N   . MET A 336 ? 0.4292 0.3446 0.4089 -0.1125 0.0765  0.0466  318 MET A N   
2469 C CA  . MET A 336 ? 0.4174 0.3343 0.3920 -0.0907 0.0723  0.0447  318 MET A CA  
2470 C C   . MET A 336 ? 0.4149 0.2974 0.3630 -0.0786 0.0664  0.0422  318 MET A C   
2471 O O   . MET A 336 ? 0.4224 0.3089 0.3738 -0.0675 0.0568  0.0369  318 MET A O   
2472 C CB  . MET A 336 ? 0.3973 0.3237 0.3703 -0.0832 0.0834  0.0501  318 MET A CB  
2473 C CG  . MET A 336 ? 0.3544 0.2788 0.3188 -0.0631 0.0790  0.0465  318 MET A CG  
2474 S SD  . MET A 336 ? 0.4468 0.4040 0.4409 -0.0560 0.0707  0.0410  318 MET A SD  
2475 C CE  . MET A 336 ? 0.4445 0.3866 0.4217 -0.0371 0.0645  0.0355  318 MET A CE  
2476 N N   . ILE A 337 ? 0.4135 0.2635 0.3364 -0.0803 0.0726  0.0473  319 ILE A N   
2477 C CA  . ILE A 337 ? 0.4492 0.2685 0.3471 -0.0659 0.0674  0.0471  319 ILE A CA  
2478 C C   . ILE A 337 ? 0.4588 0.2664 0.3571 -0.0661 0.0590  0.0405  319 ILE A C   
2479 O O   . ILE A 337 ? 0.4128 0.2187 0.3085 -0.0511 0.0508  0.0369  319 ILE A O   
2480 C CB  . ILE A 337 ? 0.4912 0.2756 0.3595 -0.0664 0.0767  0.0562  319 ILE A CB  
2481 C CG1 . ILE A 337 ? 0.5054 0.3009 0.3685 -0.0638 0.0862  0.0627  319 ILE A CG1 
2482 C CG2 . ILE A 337 ? 0.5076 0.2629 0.3517 -0.0489 0.0699  0.0572  319 ILE A CG2 
2483 C CD1 . ILE A 337 ? 0.4633 0.2694 0.3210 -0.0445 0.0790  0.0596  319 ILE A CD1 
2484 N N   . THR A 338 ? 0.4488 0.2491 0.3500 -0.0837 0.0614  0.0385  320 THR A N   
2485 C CA  . THR A 338 ? 0.4446 0.2329 0.3434 -0.0855 0.0548  0.0306  320 THR A CA  
2486 C C   . THR A 338 ? 0.4057 0.2261 0.3247 -0.0774 0.0454  0.0244  320 THR A C   
2487 O O   . THR A 338 ? 0.3952 0.2076 0.3089 -0.0663 0.0401  0.0199  320 THR A O   
2488 C CB  . THR A 338 ? 0.4595 0.2402 0.3600 -0.1098 0.0577  0.0274  320 THR A CB  
2489 O OG1 . THR A 338 ? 0.4692 0.2138 0.3488 -0.1185 0.0678  0.0338  320 THR A OG1 
2490 C CG2 . THR A 338 ? 0.4354 0.2032 0.3295 -0.1116 0.0509  0.0172  320 THR A CG2 
2491 N N   . SER A 339 ? 0.3841 0.2404 0.3263 -0.0818 0.0447  0.0254  321 SER A N   
2492 C CA  . SER A 339 ? 0.3481 0.2330 0.3090 -0.0747 0.0370  0.0216  321 SER A CA  
2493 C C   . SER A 339 ? 0.3380 0.2224 0.2964 -0.0557 0.0336  0.0216  321 SER A C   
2494 O O   . SER A 339 ? 0.3186 0.2109 0.2833 -0.0486 0.0276  0.0179  321 SER A O   
2495 C CB  . SER A 339 ? 0.3367 0.2575 0.3222 -0.0815 0.0381  0.0243  321 SER A CB  
2496 O OG  . SER A 339 ? 0.3749 0.3049 0.3682 -0.1004 0.0383  0.0236  321 SER A OG  
2497 N N   . LEU A 340 ? 0.3414 0.2174 0.2901 -0.0485 0.0374  0.0258  322 LEU A N   
2498 C CA  . LEU A 340 ? 0.3564 0.2317 0.3010 -0.0325 0.0325  0.0250  322 LEU A CA  
2499 C C   . LEU A 340 ? 0.3720 0.2292 0.3053 -0.0235 0.0277  0.0231  322 LEU A C   
2500 O O   . LEU A 340 ? 0.3980 0.2663 0.3401 -0.0140 0.0214  0.0202  322 LEU A O   
2501 C CB  . LEU A 340 ? 0.3362 0.2036 0.2664 -0.0272 0.0367  0.0295  322 LEU A CB  
2502 C CG  . LEU A 340 ? 0.3388 0.2261 0.2800 -0.0304 0.0425  0.0305  322 LEU A CG  
2503 C CD1 . LEU A 340 ? 0.3266 0.2019 0.2467 -0.0238 0.0475  0.0341  322 LEU A CD1 
2504 C CD2 . LEU A 340 ? 0.3174 0.2273 0.2789 -0.0252 0.0367  0.0256  322 LEU A CD2 
2505 N N   . HIS A 341 ? 0.3707 0.1996 0.2855 -0.0264 0.0318  0.0251  323 HIS A N   
2506 C CA  . HIS A 341 ? 0.4208 0.2304 0.3246 -0.0161 0.0292  0.0233  323 HIS A CA  
2507 C C   . HIS A 341 ? 0.4179 0.2399 0.3345 -0.0180 0.0263  0.0164  323 HIS A C   
2508 O O   . HIS A 341 ? 0.3899 0.2138 0.3086 -0.0055 0.0231  0.0143  323 HIS A O   
2509 C CB  . HIS A 341 ? 0.4699 0.2405 0.3489 -0.0195 0.0359  0.0266  323 HIS A CB  
2510 C CG  . HIS A 341 ? 0.5239 0.2754 0.3832 -0.0091 0.0377  0.0351  323 HIS A CG  
2511 N ND1 . HIS A 341 ? 0.5589 0.2984 0.4060 -0.0184 0.0453  0.0419  323 HIS A ND1 
2512 C CD2 . HIS A 341 ? 0.5535 0.2985 0.4030 0.0103  0.0327  0.0388  323 HIS A CD2 
2513 C CE1 . HIS A 341 ? 0.5882 0.3110 0.4148 -0.0049 0.0451  0.0495  323 HIS A CE1 
2514 N NE2 . HIS A 341 ? 0.5930 0.3198 0.4211 0.0129  0.0364  0.0477  323 HIS A NE2 
2515 N N   . ALA A 342 ? 0.3314 0.1641 0.2566 -0.0333 0.0275  0.0135  324 ALA A N   
2516 C CA  . ALA A 342 ? 0.3695 0.2149 0.3033 -0.0358 0.0244  0.0076  324 ALA A CA  
2517 C C   . ALA A 342 ? 0.3537 0.2287 0.3074 -0.0272 0.0198  0.0081  324 ALA A C   
2518 O O   . ALA A 342 ? 0.3405 0.2225 0.2983 -0.0218 0.0182  0.0052  324 ALA A O   
2519 C CB  . ALA A 342 ? 0.3439 0.1977 0.2821 -0.0545 0.0246  0.0052  324 ALA A CB  
2520 N N   . ALA A 343 ? 0.3438 0.2338 0.3083 -0.0262 0.0189  0.0118  325 ALA A N   
2521 C CA  . ALA A 343 ? 0.2983 0.2112 0.2804 -0.0199 0.0150  0.0121  325 ALA A CA  
2522 C C   . ALA A 343 ? 0.2839 0.1944 0.2653 -0.0069 0.0117  0.0114  325 ALA A C   
2523 O O   . ALA A 343 ? 0.2643 0.1892 0.2585 -0.0029 0.0095  0.0102  325 ALA A O   
2524 C CB  . ALA A 343 ? 0.2393 0.1634 0.2293 -0.0219 0.0159  0.0147  325 ALA A CB  
2525 N N   . VAL A 344 ? 0.2969 0.1905 0.2639 -0.0003 0.0115  0.0132  326 VAL A N   
2526 C CA  . VAL A 344 ? 0.2858 0.1798 0.2525 0.0133  0.0069  0.0136  326 VAL A CA  
2527 C C   . VAL A 344 ? 0.3047 0.1952 0.2718 0.0196  0.0089  0.0116  326 VAL A C   
2528 O O   . VAL A 344 ? 0.3484 0.2556 0.3294 0.0278  0.0060  0.0110  326 VAL A O   
2529 C CB  . VAL A 344 ? 0.3308 0.2051 0.2773 0.0205  0.0061  0.0177  326 VAL A CB  
2530 C CG1 . VAL A 344 ? 0.3221 0.1996 0.2692 0.0365  -0.0001 0.0191  326 VAL A CG1 
2531 C CG2 . VAL A 344 ? 0.2937 0.1727 0.2373 0.0164  0.0051  0.0190  326 VAL A CG2 
2532 N N   . LYS A 345 ? 0.3259 0.1948 0.2778 0.0148  0.0145  0.0101  327 LYS A N   
2533 C CA  . LYS A 345 ? 0.3632 0.2240 0.3104 0.0206  0.0182  0.0065  327 LYS A CA  
2534 C C   . LYS A 345 ? 0.3553 0.2425 0.3205 0.0181  0.0181  0.0040  327 LYS A C   
2535 O O   . LYS A 345 ? 0.3384 0.2353 0.3111 0.0286  0.0197  0.0033  327 LYS A O   
2536 C CB  . LYS A 345 ? 0.3931 0.2230 0.3181 0.0117  0.0238  0.0032  327 LYS A CB  
2537 C CG  . LYS A 345 ? 0.4261 0.2425 0.3406 0.0171  0.0288  -0.0028 327 LYS A CG  
2538 C CD  . LYS A 345 ? 0.4479 0.2298 0.3379 0.0051  0.0332  -0.0081 327 LYS A CD  
2539 C CE  . LYS A 345 ? 0.5156 0.2804 0.3904 0.0107  0.0387  -0.0162 327 LYS A CE  
2540 N NZ  . LYS A 345 ? 0.5666 0.2949 0.4154 -0.0037 0.0419  -0.0237 327 LYS A NZ  
2541 N N   . ALA A 346 ? 0.3588 0.2585 0.3313 0.0051  0.0169  0.0038  328 ALA A N   
2542 C CA  . ALA A 346 ? 0.3378 0.2603 0.3248 0.0026  0.0169  0.0036  328 ALA A CA  
2543 C C   . ALA A 346 ? 0.3314 0.2747 0.3385 0.0106  0.0148  0.0063  328 ALA A C   
2544 O O   . ALA A 346 ? 0.3211 0.2767 0.3366 0.0152  0.0178  0.0063  328 ALA A O   
2545 C CB  . ALA A 346 ? 0.2393 0.1728 0.2322 -0.0098 0.0148  0.0052  328 ALA A CB  
2546 N N   . ALA A 347 ? 0.3533 0.3005 0.3671 0.0112  0.0098  0.0082  329 ALA A N   
2547 C CA  . ALA A 347 ? 0.2829 0.2494 0.3159 0.0153  0.0057  0.0093  329 ALA A CA  
2548 C C   . ALA A 347 ? 0.2911 0.2630 0.3285 0.0277  0.0054  0.0094  329 ALA A C   
2549 O O   . ALA A 347 ? 0.2446 0.2379 0.3015 0.0298  0.0056  0.0102  329 ALA A O   
2550 C CB  . ALA A 347 ? 0.2448 0.2098 0.2774 0.0132  0.0000  0.0094  329 ALA A CB  
2551 N N   . ALA A 348 ? 0.3305 0.2832 0.3507 0.0362  0.0057  0.0094  330 ALA A N   
2552 C CA  . ALA A 348 ? 0.3495 0.3056 0.3725 0.0518  0.0059  0.0105  330 ALA A CA  
2553 C C   . ALA A 348 ? 0.3438 0.3069 0.3722 0.0566  0.0146  0.0090  330 ALA A C   
2554 O O   . ALA A 348 ? 0.3387 0.3226 0.3844 0.0671  0.0156  0.0105  330 ALA A O   
2555 C CB  . ALA A 348 ? 0.3748 0.3016 0.3735 0.0608  0.0061  0.0121  330 ALA A CB  
2556 N N   . TYR A 349 ? 0.3389 0.2865 0.3523 0.0488  0.0210  0.0059  331 TYR A N   
2557 C CA  . TYR A 349 ? 0.3425 0.2943 0.3550 0.0523  0.0300  0.0036  331 TYR A CA  
2558 C C   . TYR A 349 ? 0.3491 0.3346 0.3881 0.0490  0.0310  0.0069  331 TYR A C   
2559 O O   . TYR A 349 ? 0.3583 0.3599 0.4087 0.0581  0.0377  0.0079  331 TYR A O   
2560 C CB  . TYR A 349 ? 0.3168 0.2473 0.3062 0.0414  0.0336  -0.0009 331 TYR A CB  
2561 C CG  . TYR A 349 ? 0.3558 0.2893 0.3383 0.0432  0.0423  -0.0041 331 TYR A CG  
2562 C CD1 . TYR A 349 ? 0.3811 0.2954 0.3457 0.0555  0.0508  -0.0092 331 TYR A CD1 
2563 C CD2 . TYR A 349 ? 0.3743 0.3273 0.3650 0.0339  0.0430  -0.0018 331 TYR A CD2 
2564 C CE1 . TYR A 349 ? 0.3830 0.2986 0.3369 0.0578  0.0601  -0.0131 331 TYR A CE1 
2565 C CE2 . TYR A 349 ? 0.3676 0.3229 0.3476 0.0359  0.0516  -0.0040 331 TYR A CE2 
2566 C CZ  . TYR A 349 ? 0.3642 0.3014 0.3253 0.0476  0.0602  -0.0102 331 TYR A CZ  
2567 O OH  . TYR A 349 ? 0.3686 0.3071 0.3154 0.0502  0.0698  -0.0132 331 TYR A OH  
2568 N N   . ILE A 350 ? 0.3122 0.3070 0.3610 0.0361  0.0256  0.0090  332 ILE A N   
2569 C CA  . ILE A 350 ? 0.3154 0.3360 0.3875 0.0305  0.0268  0.0129  332 ILE A CA  
2570 C C   . ILE A 350 ? 0.3309 0.3754 0.4291 0.0356  0.0227  0.0148  332 ILE A C   
2571 O O   . ILE A 350 ? 0.3325 0.4003 0.4510 0.0359  0.0279  0.0177  332 ILE A O   
2572 C CB  . ILE A 350 ? 0.2949 0.3138 0.3681 0.0171  0.0226  0.0147  332 ILE A CB  
2573 C CG1 . ILE A 350 ? 0.3103 0.3187 0.3655 0.0118  0.0269  0.0147  332 ILE A CG1 
2574 C CG2 . ILE A 350 ? 0.2815 0.3209 0.3793 0.0111  0.0223  0.0189  332 ILE A CG2 
2575 C CD1 . ILE A 350 ? 0.2991 0.3151 0.3510 0.0153  0.0364  0.0159  332 ILE A CD1 
2576 N N   . ILE A 351 ? 0.3185 0.3584 0.4156 0.0391  0.0134  0.0134  333 ILE A N   
2577 C CA  . ILE A 351 ? 0.2985 0.3624 0.4184 0.0436  0.0060  0.0144  333 ILE A CA  
2578 C C   . ILE A 351 ? 0.3451 0.4284 0.4788 0.0580  0.0120  0.0165  333 ILE A C   
2579 O O   . ILE A 351 ? 0.3207 0.4364 0.4837 0.0582  0.0099  0.0186  333 ILE A O   
2580 C CB  . ILE A 351 ? 0.5295 0.5810 0.6370 0.0475  -0.0053 0.0129  333 ILE A CB  
2581 C CG1 . ILE A 351 ? 0.5251 0.5680 0.6280 0.0336  -0.0111 0.0107  333 ILE A CG1 
2582 C CG2 . ILE A 351 ? 0.5024 0.5787 0.6283 0.0572  -0.0142 0.0142  333 ILE A CG2 
2583 C CD1 . ILE A 351 ? 0.5347 0.5623 0.6195 0.0368  -0.0197 0.0093  333 ILE A CD1 
2584 N N   . CYS A 352 ? 0.3720 0.4357 0.4852 0.0696  0.0203  0.0155  334 CYS A N   
2585 C CA  . CYS A 352 ? 0.3644 0.4426 0.4874 0.0868  0.0283  0.0170  334 CYS A CA  
2586 C C   . CYS A 352 ? 0.3773 0.4686 0.5075 0.0845  0.0425  0.0178  334 CYS A C   
2587 O O   . CYS A 352 ? 0.3984 0.4973 0.5311 0.0995  0.0533  0.0181  334 CYS A O   
2588 C CB  . CYS A 352 ? 0.3572 0.4028 0.4517 0.1027  0.0313  0.0151  334 CYS A CB  
2589 S SG  . CYS A 352 ? 0.6978 0.7330 0.7853 0.1113  0.0166  0.0177  334 CYS A SG  
2590 N N   . ARG A 353 ? 0.3588 0.4522 0.4910 0.0671  0.0434  0.0186  335 ARG A N   
2591 C CA  . ARG A 353 ? 0.3733 0.4778 0.5089 0.0636  0.0567  0.0211  335 ARG A CA  
2592 C C   . ARG A 353 ? 0.3925 0.5211 0.5547 0.0478  0.0555  0.0266  335 ARG A C   
2593 O O   . ARG A 353 ? 0.3873 0.5129 0.5554 0.0364  0.0442  0.0263  335 ARG A O   
2594 C CB  . ARG A 353 ? 0.3570 0.4302 0.4571 0.0596  0.0618  0.0175  335 ARG A CB  
2595 C CG  . ARG A 353 ? 0.3604 0.4044 0.4318 0.0725  0.0647  0.0110  335 ARG A CG  
2596 C CD  . ARG A 353 ? 0.3468 0.3612 0.3842 0.0641  0.0662  0.0060  335 ARG A CD  
2597 N NE  . ARG A 353 ? 0.3458 0.3677 0.3755 0.0616  0.0770  0.0069  335 ARG A NE  
2598 C CZ  . ARG A 353 ? 0.4152 0.4292 0.4270 0.0729  0.0897  0.0025  335 ARG A CZ  
2599 N NH1 . ARG A 353 ? 0.3984 0.3950 0.3999 0.0883  0.0933  -0.0031 335 ARG A NH1 
2600 N NH2 . ARG A 353 ? 0.4143 0.4355 0.4161 0.0700  0.0994  0.0040  335 ARG A NH2 
2601 N N   . SER A 354 ? 0.4003 0.5502 0.5764 0.0471  0.0684  0.0315  336 SER A N   
2602 C CA  . SER A 354 ? 0.3911 0.5624 0.5935 0.0316  0.0698  0.0380  336 SER A CA  
2603 C C   . SER A 354 ? 0.3824 0.5326 0.5655 0.0189  0.0715  0.0411  336 SER A C   
2604 O O   . SER A 354 ? 0.4116 0.5512 0.5720 0.0219  0.0816  0.0428  336 SER A O   
2605 C CB  . SER A 354 ? 0.4271 0.6322 0.6543 0.0357  0.0849  0.0439  336 SER A CB  
2606 O OG  . SER A 354 ? 0.4621 0.6901 0.7084 0.0509  0.0840  0.0420  336 SER A OG  
2607 N N   . GLY A 355 ? 0.3429 0.4869 0.5337 0.0057  0.0615  0.0419  337 GLY A N   
2608 C CA  . GLY A 355 ? 0.3506 0.4741 0.5245 -0.0036 0.0616  0.0456  337 GLY A CA  
2609 C C   . GLY A 355 ? 0.3392 0.4370 0.4807 0.0019  0.0567  0.0405  337 GLY A C   
2610 O O   . GLY A 355 ? 0.3362 0.4275 0.4676 0.0112  0.0532  0.0338  337 GLY A O   
2611 N N   . PHE A 356 ? 0.3342 0.4176 0.4600 -0.0039 0.0564  0.0443  338 PHE A N   
2612 C CA  . PHE A 356 ? 0.3222 0.3866 0.4206 -0.0009 0.0516  0.0398  338 PHE A CA  
2613 C C   . PHE A 356 ? 0.3391 0.4011 0.4152 0.0053  0.0603  0.0387  338 PHE A C   
2614 O O   . PHE A 356 ? 0.3796 0.4376 0.4389 0.0025  0.0629  0.0431  338 PHE A O   
2615 C CB  . PHE A 356 ? 0.2976 0.3516 0.3901 -0.0081 0.0462  0.0441  338 PHE A CB  
2616 C CG  . PHE A 356 ? 0.3015 0.3413 0.3772 -0.0075 0.0379  0.0383  338 PHE A CG  
2617 C CD1 . PHE A 356 ? 0.2535 0.2869 0.3356 -0.0083 0.0303  0.0336  338 PHE A CD1 
2618 C CD2 . PHE A 356 ? 0.2543 0.2879 0.3070 -0.0071 0.0380  0.0373  338 PHE A CD2 
2619 C CE1 . PHE A 356 ? 0.2528 0.2748 0.3211 -0.0088 0.0248  0.0294  338 PHE A CE1 
2620 C CE2 . PHE A 356 ? 0.2493 0.2726 0.2900 -0.0092 0.0307  0.0321  338 PHE A CE2 
2621 C CZ  . PHE A 356 ? 0.2768 0.2946 0.3264 -0.0101 0.0251  0.0288  338 PHE A CZ  
2622 N N   . SER A 357 ? 0.2983 0.3620 0.3726 0.0150  0.0645  0.0328  339 SER A N   
2623 C CA  . SER A 357 ? 0.3151 0.3739 0.3666 0.0228  0.0746  0.0297  339 SER A CA  
2624 C C   . SER A 357 ? 0.3250 0.3583 0.3487 0.0260  0.0693  0.0197  339 SER A C   
2625 O O   . SER A 357 ? 0.3931 0.4181 0.4202 0.0315  0.0649  0.0145  339 SER A O   
2626 C CB  . SER A 357 ? 0.3218 0.3992 0.3905 0.0336  0.0857  0.0301  339 SER A CB  
2627 O OG  . SER A 357 ? 0.4189 0.4885 0.4630 0.0436  0.0972  0.0256  339 SER A OG  
2628 N N   . LEU A 358 ? 0.3243 0.3447 0.3197 0.0218  0.0692  0.0172  340 LEU A N   
2629 C CA  . LEU A 358 ? 0.3560 0.3507 0.3234 0.0216  0.0649  0.0067  340 LEU A CA  
2630 C C   . LEU A 358 ? 0.3664 0.3495 0.3076 0.0308  0.0763  -0.0005 340 LEU A C   
2631 O O   . LEU A 358 ? 0.4150 0.4015 0.3383 0.0291  0.0816  0.0007  340 LEU A O   
2632 C CB  . LEU A 358 ? 0.3461 0.3356 0.2995 0.0089  0.0548  0.0071  340 LEU A CB  
2633 C CG  . LEU A 358 ? 0.3249 0.3213 0.2990 0.0010  0.0443  0.0126  340 LEU A CG  
2634 C CD1 . LEU A 358 ? 0.2727 0.2714 0.2357 -0.0089 0.0362  0.0148  340 LEU A CD1 
2635 C CD2 . LEU A 358 ? 0.2934 0.2758 0.2716 0.0020  0.0396  0.0068  340 LEU A CD2 
2636 N N   . GLY A 359 ? 0.3828 0.3506 0.3193 0.0420  0.0807  -0.0077 341 GLY A N   
2637 C CA  . GLY A 359 ? 0.4389 0.3915 0.3495 0.0537  0.0934  -0.0158 341 GLY A CA  
2638 C C   . GLY A 359 ? 0.4600 0.3782 0.3298 0.0469  0.0897  -0.0281 341 GLY A C   
2639 O O   . GLY A 359 ? 0.4439 0.3596 0.3059 0.0312  0.0780  -0.0283 341 GLY A O   
2640 N N   . SER A 360 ? 0.4908 0.3824 0.3348 0.0585  0.0996  -0.0387 342 SER A N   
2641 C CA  . SER A 360 ? 0.5625 0.4172 0.3651 0.0500  0.0961  -0.0525 342 SER A CA  
2642 C C   . SER A 360 ? 0.5441 0.3781 0.3493 0.0391  0.0836  -0.0550 342 SER A C   
2643 O O   . SER A 360 ? 0.5336 0.3629 0.3567 0.0479  0.0839  -0.0515 342 SER A O   
2644 C CB  . SER A 360 ? 0.6368 0.4619 0.4069 0.0657  0.1115  -0.0647 342 SER A CB  
2645 O OG  . SER A 360 ? 0.6650 0.4761 0.4464 0.0829  0.1180  -0.0650 342 SER A OG  
2646 N N   . ARG A 361 ? 0.5505 0.3750 0.3380 0.0198  0.0724  -0.0603 343 ARG A N   
2647 C CA  . ARG A 361 ? 0.5449 0.3571 0.3382 0.0055  0.0607  -0.0608 343 ARG A CA  
2648 C C   . ARG A 361 ? 0.5943 0.3627 0.3700 0.0110  0.0656  -0.0693 343 ARG A C   
2649 O O   . ARG A 361 ? 0.5494 0.3095 0.3377 0.0068  0.0605  -0.0653 343 ARG A O   
2650 C CB  . ARG A 361 ? 0.5068 0.3222 0.2851 -0.0162 0.0486  -0.0653 343 ARG A CB  
2651 C CG  . ARG A 361 ? 0.4964 0.3053 0.2837 -0.0332 0.0375  -0.0651 343 ARG A CG  
2652 C CD  . ARG A 361 ? 0.4734 0.3056 0.2987 -0.0292 0.0351  -0.0515 343 ARG A CD  
2653 N NE  . ARG A 361 ? 0.5010 0.3301 0.3338 -0.0456 0.0262  -0.0507 343 ARG A NE  
2654 C CZ  . ARG A 361 ? 0.5085 0.3055 0.3318 -0.0495 0.0280  -0.0550 343 ARG A CZ  
2655 N NH1 . ARG A 361 ? 0.4831 0.2463 0.2882 -0.0361 0.0376  -0.0605 343 ARG A NH1 
2656 N NH2 . ARG A 361 ? 0.4715 0.2700 0.3036 -0.0658 0.0213  -0.0529 343 ARG A NH2 
2657 N N   . ASP A 362 ? 0.6550 0.3938 0.3998 0.0216  0.0766  -0.0805 344 ASP A N   
2658 C CA  . ASP A 362 ? 0.7554 0.4462 0.4791 0.0301  0.0836  -0.0887 344 ASP A CA  
2659 C C   . ASP A 362 ? 0.7463 0.4418 0.4962 0.0503  0.0885  -0.0780 344 ASP A C   
2660 O O   . ASP A 362 ? 0.7996 0.4592 0.5395 0.0545  0.0900  -0.0795 344 ASP A O   
2661 C CB  . ASP A 362 ? 0.8949 0.5543 0.5799 0.0416  0.0968  -0.1029 344 ASP A CB  
2662 C CG  . ASP A 362 ? 1.0030 0.6371 0.6493 0.0199  0.0905  -0.1184 344 ASP A CG  
2663 O OD1 . ASP A 362 ? 1.0803 0.7003 0.6941 0.0260  0.0991  -0.1298 344 ASP A OD1 
2664 O OD2 . ASP A 362 ? 1.0141 0.6442 0.6624 -0.0035 0.0769  -0.1193 344 ASP A OD2 
2665 N N   . SER A 363 ? 0.7034 0.4425 0.4857 0.0624  0.0907  -0.0669 345 SER A N   
2666 C CA  . SER A 363 ? 0.7227 0.4732 0.5315 0.0821  0.0938  -0.0572 345 SER A CA  
2667 C C   . SER A 363 ? 0.7204 0.4926 0.5582 0.0726  0.0810  -0.0461 345 SER A C   
2668 O O   . SER A 363 ? 0.7208 0.5122 0.5840 0.0861  0.0803  -0.0372 345 SER A O   
2669 C CB  . SER A 363 ? 0.7249 0.5115 0.5545 0.1002  0.1040  -0.0520 345 SER A CB  
2670 O OG  . SER A 363 ? 0.8221 0.5854 0.6240 0.1149  0.1190  -0.0619 345 SER A OG  
2671 N N   . TYR A 364 ? 0.7300 0.5009 0.5640 0.0498  0.0709  -0.0472 346 TYR A N   
2672 C CA  . TYR A 364 ? 0.7026 0.4914 0.5602 0.0405  0.0604  -0.0379 346 TYR A CA  
2673 C C   . TYR A 364 ? 0.8258 0.5829 0.6750 0.0455  0.0600  -0.0361 346 TYR A C   
2674 O O   . TYR A 364 ? 0.8097 0.5803 0.6774 0.0464  0.0540  -0.0273 346 TYR A O   
2675 C CB  . TYR A 364 ? 0.5924 0.3900 0.4484 0.0166  0.0515  -0.0394 346 TYR A CB  
2676 C CG  . TYR A 364 ? 0.5227 0.3434 0.4041 0.0079  0.0426  -0.0301 346 TYR A CG  
2677 C CD1 . TYR A 364 ? 0.4539 0.3041 0.3633 0.0174  0.0411  -0.0213 346 TYR A CD1 
2678 C CD2 . TYR A 364 ? 0.4884 0.3022 0.3658 -0.0105 0.0361  -0.0308 346 TYR A CD2 
2679 C CE1 . TYR A 364 ? 0.3913 0.2585 0.3195 0.0102  0.0338  -0.0146 346 TYR A CE1 
2680 C CE2 . TYR A 364 ? 0.4329 0.2674 0.3320 -0.0165 0.0302  -0.0227 346 TYR A CE2 
2681 C CZ  . TYR A 364 ? 0.3950 0.2538 0.3172 -0.0055 0.0292  -0.0152 346 TYR A CZ  
2682 O OH  . TYR A 364 ? 0.3585 0.2339 0.2982 -0.0106 0.0241  -0.0088 346 TYR A OH  
2683 N N   . SER A 365 ? 0.9730 0.6852 0.7913 0.0493  0.0670  -0.0444 347 SER A N   
2689 N N   . ASP B 21  ? 0.9071 0.7347 0.9655 -0.0721 0.0820  0.0572  3   ASP B N   
2690 C CA  . ASP B 21  ? 0.8788 0.7257 0.9316 -0.0559 0.0857  0.0616  3   ASP B CA  
2691 C C   . ASP B 21  ? 0.8088 0.6485 0.8285 -0.0415 0.0832  0.0570  3   ASP B C   
2692 O O   . ASP B 21  ? 0.8691 0.6862 0.8712 -0.0402 0.0853  0.0534  3   ASP B O   
2693 C CB  . ASP B 21  ? 0.9227 0.7692 0.9821 -0.0486 0.1056  0.0738  3   ASP B CB  
2694 C CG  . ASP B 21  ? 0.9487 0.8139 1.0485 -0.0588 0.1101  0.0787  3   ASP B CG  
2695 O OD1 . ASP B 21  ? 0.9809 0.8379 1.1031 -0.0725 0.1149  0.0813  3   ASP B OD1 
2696 O OD2 . ASP B 21  ? 0.9341 0.8221 1.0462 -0.0533 0.1095  0.0798  3   ASP B OD2 
2697 N N   . LEU B 22  ? 0.6526 0.5113 0.6673 -0.0307 0.0794  0.0570  4   LEU B N   
2698 C CA  . LEU B 22  ? 0.5340 0.3901 0.5237 -0.0170 0.0768  0.0535  4   LEU B CA  
2699 C C   . LEU B 22  ? 0.4992 0.3556 0.4770 -0.0016 0.0868  0.0626  4   LEU B C   
2700 O O   . LEU B 22  ? 0.5180 0.3852 0.5040 -0.0003 0.0932  0.0686  4   LEU B O   
2701 C CB  . LEU B 22  ? 0.4403 0.3150 0.4297 -0.0174 0.0630  0.0457  4   LEU B CB  
2702 C CG  . LEU B 22  ? 0.4090 0.2834 0.4042 -0.0331 0.0498  0.0374  4   LEU B CG  
2703 C CD1 . LEU B 22  ? 0.3329 0.2255 0.3267 -0.0316 0.0377  0.0330  4   LEU B CD1 
2704 C CD2 . LEU B 22  ? 0.3912 0.2404 0.3677 -0.0380 0.0503  0.0296  4   LEU B CD2 
2705 N N   . SER B 23  ? 0.4670 0.3100 0.4250 0.0100  0.0881  0.0638  5   SER B N   
2706 C CA  . SER B 23  ? 0.4620 0.3020 0.4028 0.0245  0.0932  0.0728  5   SER B CA  
2707 C C   . SER B 23  ? 0.4624 0.3234 0.3983 0.0313  0.0853  0.0695  5   SER B C   
2708 O O   . SER B 23  ? 0.4243 0.3005 0.3689 0.0272  0.0755  0.0603  5   SER B O   
2709 C CB  . SER B 23  ? 0.4920 0.3134 0.4179 0.0353  0.0926  0.0755  5   SER B CB  
2710 O OG  . SER B 23  ? 0.4989 0.3285 0.4263 0.0389  0.0823  0.0657  5   SER B OG  
2711 N N   . GLU B 24  ? 0.4742 0.3330 0.3929 0.0411  0.0898  0.0769  6   GLU B N   
2712 C CA  . GLU B 24  ? 0.4447 0.3191 0.3549 0.0477  0.0828  0.0734  6   GLU B CA  
2713 C C   . GLU B 24  ? 0.4172 0.2978 0.3235 0.0545  0.0686  0.0667  6   GLU B C   
2714 O O   . GLU B 24  ? 0.4025 0.2711 0.3031 0.0608  0.0660  0.0691  6   GLU B O   
2715 C CB  . GLU B 24  ? 0.5246 0.3883 0.4093 0.0560  0.0908  0.0824  6   GLU B CB  
2716 C CG  . GLU B 24  ? 0.6298 0.4882 0.5209 0.0491  0.1093  0.0887  6   GLU B CG  
2717 C CD  . GLU B 24  ? 0.7043 0.5527 0.5667 0.0558  0.1198  0.0947  6   GLU B CD  
2718 O OE1 . GLU B 24  ? 0.7219 0.5602 0.5524 0.0660  0.1114  0.0970  6   GLU B OE1 
2719 O OE2 . GLU B 24  ? 0.7171 0.5671 0.5894 0.0506  0.1365  0.0970  6   GLU B OE2 
2720 N N   . GLY B 25  ? 0.3932 0.2924 0.3058 0.0533  0.0603  0.0586  7   GLY B N   
2721 C CA  . GLY B 25  ? 0.3808 0.2878 0.2935 0.0583  0.0487  0.0518  7   GLY B CA  
2722 C C   . GLY B 25  ? 0.3718 0.2758 0.2971 0.0524  0.0476  0.0454  7   GLY B C   
2723 O O   . GLY B 25  ? 0.3852 0.2913 0.3128 0.0575  0.0424  0.0409  7   GLY B O   
2724 N N   . TYR B 26  ? 0.3355 0.2335 0.2694 0.0410  0.0530  0.0444  8   TYR B N   
2725 C CA  . TYR B 26  ? 0.3349 0.2243 0.2742 0.0330  0.0529  0.0372  8   TYR B CA  
2726 C C   . TYR B 26  ? 0.3341 0.2348 0.2748 0.0297  0.0454  0.0273  8   TYR B C   
2727 O O   . TYR B 26  ? 0.3399 0.2321 0.2791 0.0283  0.0470  0.0207  8   TYR B O   
2728 C CB  . TYR B 26  ? 0.3333 0.2158 0.2803 0.0190  0.0564  0.0377  8   TYR B CB  
2729 C CG  . TYR B 26  ? 0.4063 0.2700 0.3519 0.0100  0.0587  0.0316  8   TYR B CG  
2730 C CD1 . TYR B 26  ? 0.4070 0.2497 0.3497 0.0130  0.0676  0.0354  8   TYR B CD1 
2731 C CD2 . TYR B 26  ? 0.4296 0.2928 0.3733 -0.0021 0.0520  0.0222  8   TYR B CD2 
2732 C CE1 . TYR B 26  ? 0.3979 0.2198 0.3375 0.0043  0.0713  0.0286  8   TYR B CE1 
2733 C CE2 . TYR B 26  ? 0.4131 0.2542 0.3491 -0.0116 0.0549  0.0154  8   TYR B CE2 
2734 C CZ  . TYR B 26  ? 0.4062 0.2268 0.3410 -0.0083 0.0652  0.0179  8   TYR B CZ  
2735 O OH  . TYR B 26  ? 0.4330 0.2284 0.3585 -0.0179 0.0696  0.0098  8   TYR B OH  
2736 N N   . VAL B 27  ? 0.2950 0.2125 0.2381 0.0284  0.0392  0.0265  9   VAL B N   
2737 C CA  . VAL B 27  ? 0.2821 0.2091 0.2252 0.0246  0.0322  0.0186  9   VAL B CA  
2738 C C   . VAL B 27  ? 0.3179 0.2582 0.2599 0.0351  0.0279  0.0185  9   VAL B C   
2739 O O   . VAL B 27  ? 0.3332 0.2796 0.2731 0.0408  0.0274  0.0236  9   VAL B O   
2740 C CB  . VAL B 27  ? 0.3148 0.2488 0.2635 0.0134  0.0261  0.0178  9   VAL B CB  
2741 C CG1 . VAL B 27  ? 0.2832 0.2221 0.2274 0.0087  0.0190  0.0107  9   VAL B CG1 
2742 C CG2 . VAL B 27  ? 0.2876 0.2092 0.2396 0.0017  0.0273  0.0186  9   VAL B CG2 
2743 N N   . PHE B 28  ? 0.2673 0.2107 0.2103 0.0368  0.0258  0.0121  10  PHE B N   
2744 C CA  . PHE B 28  ? 0.2587 0.2150 0.2039 0.0452  0.0200  0.0110  10  PHE B CA  
2745 C C   . PHE B 28  ? 0.3069 0.2712 0.2545 0.0388  0.0165  0.0036  10  PHE B C   
2746 O O   . PHE B 28  ? 0.2958 0.2530 0.2427 0.0320  0.0206  -0.0019 10  PHE B O   
2747 C CB  . PHE B 28  ? 0.2669 0.2208 0.2178 0.0557  0.0206  0.0123  10  PHE B CB  
2748 C CG  . PHE B 28  ? 0.3559 0.3237 0.3123 0.0632  0.0118  0.0109  10  PHE B CG  
2749 C CD1 . PHE B 28  ? 0.3728 0.3423 0.3205 0.0717  0.0045  0.0171  10  PHE B CD1 
2750 C CD2 . PHE B 28  ? 0.3051 0.2820 0.2735 0.0605  0.0108  0.0033  10  PHE B CD2 
2751 C CE1 . PHE B 28  ? 0.3484 0.3289 0.2998 0.0771  -0.0064 0.0152  10  PHE B CE1 
2752 C CE2 . PHE B 28  ? 0.2870 0.2772 0.2643 0.0660  0.0017  0.0017  10  PHE B CE2 
2753 C CZ  . PHE B 28  ? 0.3214 0.3138 0.2905 0.0741  -0.0084 0.0074  10  PHE B CZ  
2754 N N   . GLY B 29  ? 0.3012 0.2770 0.2487 0.0406  0.0101  0.0034  11  GLY B N   
2755 C CA  . GLY B 29  ? 0.2988 0.2812 0.2487 0.0355  0.0066  -0.0026 11  GLY B CA  
2756 C C   . GLY B 29  ? 0.2987 0.2921 0.2542 0.0428  0.0012  -0.0048 11  GLY B C   
2757 O O   . GLY B 29  ? 0.2680 0.2643 0.2198 0.0505  -0.0031 -0.0013 11  GLY B O   
2758 N N   . MET B 30  ? 0.3124 0.3101 0.2754 0.0394  0.0015  -0.0107 12  MET B N   
2759 C CA  . MET B 30  ? 0.3214 0.3306 0.2937 0.0437  -0.0051 -0.0137 12  MET B CA  
2760 C C   . MET B 30  ? 0.2969 0.3082 0.2701 0.0350  -0.0049 -0.0188 12  MET B C   
2761 O O   . MET B 30  ? 0.2742 0.2782 0.2452 0.0271  0.0023  -0.0214 12  MET B O   
2762 C CB  . MET B 30  ? 0.3606 0.3745 0.3507 0.0498  -0.0039 -0.0150 12  MET B CB  
2763 C CG  . MET B 30  ? 0.4300 0.4560 0.4388 0.0488  -0.0070 -0.0207 12  MET B CG  
2764 S SD  . MET B 30  ? 0.6281 0.6620 0.6683 0.0569  -0.0048 -0.0212 12  MET B SD  
2765 C CE  . MET B 30  ? 0.3408 0.3877 0.4062 0.0503  -0.0021 -0.0291 12  MET B CE  
2766 N N   . GLY B 31  ? 0.2340 0.2518 0.2070 0.0360  -0.0124 -0.0203 13  GLY B N   
2767 C CA  . GLY B 31  ? 0.2586 0.2759 0.2318 0.0279  -0.0122 -0.0240 13  GLY B CA  
2768 C C   . GLY B 31  ? 0.2629 0.2852 0.2369 0.0289  -0.0199 -0.0266 13  GLY B C   
2769 O O   . GLY B 31  ? 0.2825 0.3104 0.2583 0.0355  -0.0268 -0.0277 13  GLY B O   
2770 N N   . ASN B 32  ? 0.2562 0.2737 0.2265 0.0219  -0.0195 -0.0276 14  ASN B N   
2771 C CA  . ASN B 32  ? 0.2483 0.2669 0.2192 0.0215  -0.0252 -0.0308 14  ASN B CA  
2772 C C   . ASN B 32  ? 0.2337 0.2468 0.1949 0.0246  -0.0269 -0.0275 14  ASN B C   
2773 O O   . ASN B 32  ? 0.2404 0.2474 0.1995 0.0203  -0.0257 -0.0238 14  ASN B O   
2774 C CB  . ASN B 32  ? 0.2337 0.2482 0.2085 0.0121  -0.0223 -0.0333 14  ASN B CB  
2775 C CG  . ASN B 32  ? 0.2691 0.2880 0.2565 0.0081  -0.0158 -0.0367 14  ASN B CG  
2776 O OD1 . ASN B 32  ? 0.2849 0.3145 0.2864 0.0136  -0.0175 -0.0389 14  ASN B OD1 
2777 N ND2 . ASN B 32  ? 0.2332 0.2426 0.2159 -0.0012 -0.0077 -0.0366 14  ASN B ND2 
2778 N N   . PRO B 33  ? 0.2449 0.2589 0.2001 0.0321  -0.0296 -0.0284 15  PRO B N   
2779 C CA  . PRO B 33  ? 0.2441 0.2522 0.1927 0.0357  -0.0273 -0.0264 15  PRO B CA  
2780 C C   . PRO B 33  ? 0.2733 0.2763 0.2234 0.0332  -0.0294 -0.0308 15  PRO B C   
2781 O O   . PRO B 33  ? 0.2686 0.2705 0.2147 0.0337  -0.0338 -0.0374 15  PRO B O   
2782 C CB  . PRO B 33  ? 0.2273 0.2337 0.1631 0.0435  -0.0275 -0.0270 15  PRO B CB  
2783 C CG  . PRO B 33  ? 0.2429 0.2545 0.1798 0.0435  -0.0359 -0.0317 15  PRO B CG  
2784 C CD  . PRO B 33  ? 0.2324 0.2512 0.1858 0.0376  -0.0347 -0.0311 15  PRO B CD  
2785 N N   . LEU B 34  ? 0.2669 0.2657 0.2232 0.0303  -0.0277 -0.0268 16  LEU B N   
2786 C CA  . LEU B 34  ? 0.2915 0.2832 0.2509 0.0277  -0.0295 -0.0297 16  LEU B CA  
2787 C C   . LEU B 34  ? 0.2828 0.2690 0.2478 0.0326  -0.0257 -0.0262 16  LEU B C   
2788 O O   . LEU B 34  ? 0.2818 0.2713 0.2541 0.0344  -0.0235 -0.0193 16  LEU B O   
2789 C CB  . LEU B 34  ? 0.2695 0.2584 0.2329 0.0185  -0.0320 -0.0269 16  LEU B CB  
2790 C CG  . LEU B 34  ? 0.2595 0.2535 0.2227 0.0128  -0.0315 -0.0300 16  LEU B CG  
2791 C CD1 . LEU B 34  ? 0.2418 0.2281 0.2021 0.0034  -0.0302 -0.0258 16  LEU B CD1 
2792 C CD2 . LEU B 34  ? 0.3015 0.2981 0.2685 0.0121  -0.0340 -0.0383 16  LEU B CD2 
2793 N N   . LEU B 35  ? 0.2972 0.2747 0.2617 0.0346  -0.0246 -0.0312 17  LEU B N   
2794 C CA  . LEU B 35  ? 0.3305 0.3017 0.3061 0.0399  -0.0195 -0.0281 17  LEU B CA  
2795 C C   . LEU B 35  ? 0.3266 0.2930 0.3152 0.0351  -0.0253 -0.0220 17  LEU B C   
2796 O O   . LEU B 35  ? 0.3487 0.3073 0.3331 0.0301  -0.0289 -0.0255 17  LEU B O   
2797 C CB  . LEU B 35  ? 0.3551 0.3147 0.3213 0.0453  -0.0131 -0.0373 17  LEU B CB  
2798 C CG  . LEU B 35  ? 0.4162 0.3693 0.3974 0.0528  -0.0032 -0.0346 17  LEU B CG  
2799 C CD1 . LEU B 35  ? 0.3863 0.3454 0.3692 0.0588  0.0069  -0.0312 17  LEU B CD1 
2800 C CD2 . LEU B 35  ? 0.4622 0.3979 0.4348 0.0559  0.0029  -0.0445 17  LEU B CD2 
2801 N N   . ASP B 36  ? 0.2842 0.2541 0.2885 0.0361  -0.0274 -0.0123 18  ASP B N   
2802 C CA  . ASP B 36  ? 0.2722 0.2348 0.2872 0.0324  -0.0356 -0.0045 18  ASP B CA  
2803 C C   . ASP B 36  ? 0.3396 0.2934 0.3712 0.0400  -0.0312 -0.0049 18  ASP B C   
2804 O O   . ASP B 36  ? 0.3182 0.2761 0.3657 0.0486  -0.0228 -0.0046 18  ASP B O   
2805 C CB  . ASP B 36  ? 0.2858 0.2544 0.3110 0.0291  -0.0439 0.0067  18  ASP B CB  
2806 C CG  . ASP B 36  ? 0.3923 0.3642 0.3987 0.0205  -0.0472 0.0066  18  ASP B CG  
2807 O OD1 . ASP B 36  ? 0.4192 0.3888 0.4089 0.0166  -0.0443 -0.0004 18  ASP B OD1 
2808 O OD2 . ASP B 36  ? 0.4154 0.3919 0.4260 0.0176  -0.0524 0.0132  18  ASP B OD2 
2809 N N   . ILE B 37  ? 0.3639 0.3043 0.3926 0.0368  -0.0350 -0.0056 19  ILE B N   
2810 C CA  . ILE B 37  ? 0.3849 0.3136 0.4299 0.0440  -0.0309 -0.0059 19  ILE B CA  
2811 C C   . ILE B 37  ? 0.3721 0.2950 0.4345 0.0427  -0.0428 0.0079  19  ILE B C   
2812 O O   . ILE B 37  ? 0.3298 0.2410 0.3798 0.0347  -0.0511 0.0116  19  ILE B O   
2813 C CB  . ILE B 37  ? 0.4115 0.3256 0.4408 0.0416  -0.0267 -0.0172 19  ILE B CB  
2814 C CG1 . ILE B 37  ? 0.4038 0.3234 0.4133 0.0415  -0.0201 -0.0297 19  ILE B CG1 
2815 C CG2 . ILE B 37  ? 0.3917 0.2900 0.4366 0.0495  -0.0202 -0.0189 19  ILE B CG2 
2816 C CD1 . ILE B 37  ? 0.4375 0.3459 0.4310 0.0358  -0.0207 -0.0411 19  ILE B CD1 
2817 N N   . ILE B 38  ? 0.3816 0.3122 0.4732 0.0502  -0.0438 0.0163  20  ILE B N   
2818 C CA  . ILE B 38  ? 0.3966 0.3246 0.5073 0.0489  -0.0598 0.0315  20  ILE B CA  
2819 C C   . ILE B 38  ? 0.3971 0.3103 0.5299 0.0566  -0.0594 0.0352  20  ILE B C   
2820 O O   . ILE B 38  ? 0.4285 0.3425 0.5846 0.0678  -0.0456 0.0301  20  ILE B O   
2821 C CB  . ILE B 38  ? 0.3947 0.3408 0.5343 0.0525  -0.0643 0.0402  20  ILE B CB  
2822 C CG1 . ILE B 38  ? 0.3727 0.3329 0.4956 0.0483  -0.0583 0.0342  20  ILE B CG1 
2823 C CG2 . ILE B 38  ? 0.3721 0.3150 0.5219 0.0470  -0.0874 0.0564  20  ILE B CG2 
2824 C CD1 . ILE B 38  ? 0.3514 0.3086 0.4412 0.0354  -0.0689 0.0353  20  ILE B CD1 
2825 N N   . VAL B 39  ? 0.3984 0.2956 0.5228 0.0507  -0.0734 0.0441  21  VAL B N   
2826 C CA  . VAL B 39  ? 0.4588 0.3388 0.6037 0.0579  -0.0742 0.0490  21  VAL B CA  
2827 C C   . VAL B 39  ? 0.4614 0.3300 0.6105 0.0537  -0.0970 0.0676  21  VAL B C   
2828 O O   . VAL B 39  ? 0.4536 0.3173 0.5719 0.0412  -0.1093 0.0731  21  VAL B O   
2829 C CB  . VAL B 39  ? 0.5508 0.4118 0.6731 0.0555  -0.0624 0.0363  21  VAL B CB  
2830 C CG1 . VAL B 39  ? 0.3678 0.2164 0.4543 0.0408  -0.0711 0.0384  21  VAL B CG1 
2831 C CG2 . VAL B 39  ? 0.6074 0.4502 0.7550 0.0657  -0.0580 0.0382  21  VAL B CG2 
2832 N N   . ASP B 40  ? 0.5148 0.3777 0.7016 0.0643  -0.1024 0.0775  22  ASP B N   
2833 C CA  . ASP B 40  ? 0.5836 0.4302 0.7731 0.0613  -0.1257 0.0962  22  ASP B CA  
2834 C C   . ASP B 40  ? 0.5633 0.3805 0.7226 0.0556  -0.1230 0.0945  22  ASP B C   
2835 O O   . ASP B 40  ? 0.5781 0.3840 0.7502 0.0635  -0.1088 0.0868  22  ASP B O   
2836 C CB  . ASP B 40  ? 0.6732 0.5251 0.9198 0.0758  -0.1328 0.1081  22  ASP B CB  
2837 C CG  . ASP B 40  ? 0.7293 0.6093 0.9978 0.0736  -0.1445 0.1151  22  ASP B CG  
2838 O OD1 . ASP B 40  ? 0.7913 0.6703 1.0583 0.0667  -0.1660 0.1280  22  ASP B OD1 
2839 O OD2 . ASP B 40  ? 0.6964 0.5976 0.9823 0.0778  -0.1322 0.1072  22  ASP B OD2 
2840 N N   . ALA B 41  ? 0.5594 0.3620 0.6771 0.0410  -0.1350 0.1010  23  ALA B N   
2841 C CA  . ALA B 41  ? 0.6067 0.3821 0.6926 0.0327  -0.1296 0.0985  23  ALA B CA  
2842 C C   . ALA B 41  ? 0.6842 0.4309 0.7684 0.0319  -0.1479 0.1180  23  ALA B C   
2843 O O   . ALA B 41  ? 0.7170 0.4611 0.7984 0.0291  -0.1704 0.1347  23  ALA B O   
2844 C CB  . ALA B 41  ? 0.5801 0.3552 0.6200 0.0165  -0.1252 0.0916  23  ALA B CB  
2845 N N   . ASP B 42  ? 0.7346 0.4575 0.8185 0.0338  -0.1395 0.1162  24  ASP B N   
2846 C CA  . ASP B 42  ? 0.8044 0.4958 0.8793 0.0316  -0.1544 0.1343  24  ASP B CA  
2847 C C   . ASP B 42  ? 0.7731 0.4439 0.7917 0.0124  -0.1610 0.1408  24  ASP B C   
2848 O O   . ASP B 42  ? 0.7504 0.4294 0.7414 0.0016  -0.1477 0.1276  24  ASP B O   
2849 C CB  . ASP B 42  ? 0.8830 0.5528 0.9719 0.0381  -0.1407 0.1289  24  ASP B CB  
2850 C CG  . ASP B 42  ? 0.9233 0.6099 1.0632 0.0566  -0.1294 0.1206  24  ASP B CG  
2851 O OD1 . ASP B 42  ? 0.9367 0.6280 1.1054 0.0668  -0.1357 0.1303  24  ASP B OD1 
2852 O OD2 . ASP B 42  ? 0.9268 0.6255 1.0736 0.0598  -0.1111 0.1019  24  ASP B OD2 
2853 N N   . ASP B 43  ? 0.7739 0.4299 0.7756 0.0080  -0.1744 0.1554  25  ASP B N   
2854 C CA  . ASP B 43  ? 0.8224 0.4578 0.7682 -0.0099 -0.1791 0.1618  25  ASP B CA  
2855 C C   . ASP B 43  ? 0.8162 0.4262 0.7300 -0.0221 -0.1598 0.1539  25  ASP B C   
2856 O O   . ASP B 43  ? 0.8145 0.4155 0.6853 -0.0376 -0.1549 0.1523  25  ASP B O   
2857 C CB  . ASP B 43  ? 0.9148 0.5352 0.8500 -0.0110 -0.1968 0.1784  25  ASP B CB  
2858 C CG  . ASP B 43  ? 0.9632 0.6090 0.9338 -0.0012 -0.2169 0.1856  25  ASP B CG  
2859 O OD1 . ASP B 43  ? 1.0281 0.6638 0.9872 -0.0044 -0.2357 0.1988  25  ASP B OD1 
2860 O OD2 . ASP B 43  ? 0.9418 0.6169 0.9523 0.0088  -0.2136 0.1778  25  ASP B OD2 
2861 N N   . PHE B 44  ? 0.7616 0.3606 0.6977 -0.0160 -0.1473 0.1476  26  PHE B N   
2862 C CA  . PHE B 44  ? 0.7358 0.3138 0.6478 -0.0288 -0.1283 0.1383  26  PHE B CA  
2863 C C   . PHE B 44  ? 0.6772 0.2842 0.5818 -0.0363 -0.1105 0.1175  26  PHE B C   
2864 O O   . PHE B 44  ? 0.6428 0.2399 0.5203 -0.0511 -0.0967 0.1116  26  PHE B O   
2865 C CB  . PHE B 44  ? 0.7517 0.3144 0.6912 -0.0210 -0.1181 0.1328  26  PHE B CB  
2866 C CG  . PHE B 44  ? 0.7161 0.3077 0.6941 -0.0090 -0.1049 0.1120  26  PHE B CG  
2867 C CD1 . PHE B 44  ? 0.6469 0.2550 0.6195 -0.0165 -0.0865 0.0904  26  PHE B CD1 
2868 C CD2 . PHE B 44  ? 0.7495 0.3493 0.7688 0.0097  -0.1106 0.1144  26  PHE B CD2 
2869 C CE1 . PHE B 44  ? 0.6287 0.2583 0.6286 -0.0065 -0.0759 0.0720  26  PHE B CE1 
2870 C CE2 . PHE B 44  ? 0.7187 0.3397 0.7664 0.0199  -0.0959 0.0950  26  PHE B CE2 
2871 C CZ  . PHE B 44  ? 0.6658 0.3001 0.7000 0.0114  -0.0794 0.0740  26  PHE B CZ  
2872 N N   . MET B 45  ? 0.6494 0.2917 0.5806 -0.0259 -0.1105 0.1072  27  MET B N   
2873 C CA  . MET B 45  ? 0.6506 0.3216 0.5794 -0.0304 -0.0958 0.0883  27  MET B CA  
2874 C C   . MET B 45  ? 0.6657 0.3349 0.5554 -0.0458 -0.0941 0.0905  27  MET B C   
2875 O O   . MET B 45  ? 0.6185 0.2978 0.4998 -0.0545 -0.0781 0.0770  27  MET B O   
2876 C CB  . MET B 45  ? 0.6319 0.3364 0.5913 -0.0165 -0.0985 0.0814  27  MET B CB  
2877 C CG  . MET B 45  ? 0.6257 0.3340 0.6223 -0.0017 -0.0927 0.0738  27  MET B CG  
2878 S SD  . MET B 45  ? 0.6749 0.3899 0.6726 -0.0051 -0.0711 0.0489  27  MET B SD  
2879 C CE  . MET B 45  ? 0.4542 0.2081 0.4536 -0.0027 -0.0670 0.0367  27  MET B CE  
2880 N N   . TYR B 46  ? 0.7062 0.3613 0.5725 -0.0493 -0.1107 0.1074  28  TYR B N   
2881 C CA  . TYR B 46  ? 0.7188 0.3678 0.5432 -0.0638 -0.1084 0.1092  28  TYR B CA  
2882 C C   . TYR B 46  ? 0.7636 0.3815 0.5536 -0.0796 -0.0941 0.1109  28  TYR B C   
2883 O O   . TYR B 46  ? 0.7705 0.3914 0.5394 -0.0912 -0.0780 0.1022  28  TYR B O   
2884 C CB  . TYR B 46  ? 0.6912 0.3311 0.4969 -0.0640 -0.1325 0.1261  28  TYR B CB  
2885 C CG  . TYR B 46  ? 0.6630 0.3367 0.5069 -0.0502 -0.1435 0.1232  28  TYR B CG  
2886 C CD1 . TYR B 46  ? 0.6358 0.3350 0.4773 -0.0520 -0.1388 0.1129  28  TYR B CD1 
2887 C CD2 . TYR B 46  ? 0.6736 0.3533 0.5588 -0.0351 -0.1563 0.1305  28  TYR B CD2 
2888 C CE1 . TYR B 46  ? 0.6275 0.3563 0.5042 -0.0403 -0.1468 0.1106  28  TYR B CE1 
2889 C CE2 . TYR B 46  ? 0.6505 0.3613 0.5738 -0.0230 -0.1629 0.1277  28  TYR B CE2 
2890 C CZ  . TYR B 46  ? 0.6532 0.3880 0.5709 -0.0262 -0.1582 0.1179  28  TYR B CZ  
2891 O OH  . TYR B 46  ? 0.6648 0.4290 0.6203 -0.0151 -0.1632 0.1157  28  TYR B OH  
2892 N N   . ARG B 47  ? 0.7798 0.3678 0.5674 -0.0797 -0.0985 0.1221  29  ARG B N   
2893 C CA  . ARG B 47  ? 0.8124 0.3683 0.5710 -0.0947 -0.0834 0.1246  29  ARG B CA  
2894 C C   . ARG B 47  ? 0.7567 0.3307 0.5417 -0.0974 -0.0601 0.1044  29  ARG B C   
2895 O O   . ARG B 47  ? 0.7167 0.2865 0.4848 -0.1115 -0.0412 0.0976  29  ARG B O   
2896 C CB  . ARG B 47  ? 0.8744 0.3998 0.6307 -0.0912 -0.0943 0.1408  29  ARG B CB  
2897 C CG  . ARG B 47  ? 0.9298 0.4612 0.6928 -0.0789 -0.1207 0.1550  29  ARG B CG  
2898 C CD  . ARG B 47  ? 0.9957 0.5014 0.7484 -0.0776 -0.1292 0.1701  29  ARG B CD  
2899 N NE  . ARG B 47  ? 1.0189 0.5163 0.8064 -0.0685 -0.1239 0.1694  29  ARG B NE  
2900 C CZ  . ARG B 47  ? 1.0323 0.5374 0.8587 -0.0514 -0.1375 0.1750  29  ARG B CZ  
2901 N NH1 . ARG B 47  ? 1.0200 0.5446 0.8597 -0.0420 -0.1581 0.1821  29  ARG B NH1 
2902 N NH2 . ARG B 47  ? 1.0507 0.5445 0.9049 -0.0440 -0.1291 0.1723  29  ARG B NH2 
2903 N N   . LYS B 48  ? 0.6493 0.2429 0.4764 -0.0840 -0.0618 0.0946  30  LYS B N   
2904 C CA  . LYS B 48  ? 0.6608 0.2691 0.5133 -0.0861 -0.0449 0.0756  30  LYS B CA  
2905 C C   . LYS B 48  ? 0.6145 0.2540 0.4692 -0.0919 -0.0325 0.0601  30  LYS B C   
2906 O O   . LYS B 48  ? 0.6146 0.2560 0.4732 -0.1030 -0.0164 0.0498  30  LYS B O   
2907 C CB  . LYS B 48  ? 0.6052 0.2264 0.4955 -0.0696 -0.0507 0.0678  30  LYS B CB  
2908 C CG  . LYS B 48  ? 0.6389 0.2730 0.5524 -0.0712 -0.0373 0.0473  30  LYS B CG  
2909 C CD  . LYS B 48  ? 0.5765 0.2146 0.5188 -0.0550 -0.0418 0.0407  30  LYS B CD  
2910 C CE  . LYS B 48  ? 0.6032 0.2488 0.5621 -0.0576 -0.0309 0.0197  30  LYS B CE  
2911 N NZ  . LYS B 48  ? 0.5977 0.2428 0.5783 -0.0422 -0.0326 0.0121  30  LYS B NZ  
2912 N N   . TYR B 49  ? 0.5919 0.2557 0.4473 -0.0845 -0.0402 0.0590  31  TYR B N   
2913 C CA  . TYR B 49  ? 0.5383 0.2316 0.3986 -0.0878 -0.0297 0.0452  31  TYR B CA  
2914 C C   . TYR B 49  ? 0.5851 0.2703 0.4106 -0.0986 -0.0250 0.0517  31  TYR B C   
2915 O O   . TYR B 49  ? 0.5693 0.2775 0.3978 -0.0999 -0.0173 0.0422  31  TYR B O   
2916 C CB  . TYR B 49  ? 0.5251 0.2513 0.4107 -0.0728 -0.0375 0.0366  31  TYR B CB  
2917 C CG  . TYR B 49  ? 0.5690 0.3029 0.4844 -0.0641 -0.0367 0.0256  31  TYR B CG  
2918 C CD1 . TYR B 49  ? 0.4883 0.2142 0.4172 -0.0516 -0.0466 0.0311  31  TYR B CD1 
2919 C CD2 . TYR B 49  ? 0.4703 0.2176 0.4004 -0.0687 -0.0262 0.0094  31  TYR B CD2 
2920 C CE1 . TYR B 49  ? 0.4905 0.2187 0.4419 -0.0440 -0.0433 0.0196  31  TYR B CE1 
2921 C CE2 . TYR B 49  ? 0.5066 0.2563 0.4570 -0.0623 -0.0265 -0.0017 31  TYR B CE2 
2922 C CZ  . TYR B 49  ? 0.4943 0.2327 0.4527 -0.0501 -0.0336 0.0029  31  TYR B CZ  
2923 O OH  . TYR B 49  ? 0.4802 0.2167 0.4545 -0.0441 -0.0313 -0.0096 31  TYR B OH  
2924 N N   . ASN B 50  ? 0.6335 0.2831 0.4240 -0.1064 -0.0295 0.0679  32  ASN B N   
2925 C CA  . ASN B 50  ? 0.7406 0.3725 0.4878 -0.1188 -0.0237 0.0745  32  ASN B CA  
2926 C C   . ASN B 50  ? 0.7563 0.4109 0.5000 -0.1133 -0.0314 0.0713  32  ASN B C   
2927 O O   . ASN B 50  ? 0.7978 0.4619 0.5320 -0.1199 -0.0167 0.0627  32  ASN B O   
2928 C CB  . ASN B 50  ? 0.7949 0.4228 0.5372 -0.1333 0.0032  0.0653  32  ASN B CB  
2929 C CG  . ASN B 50  ? 0.8800 0.4761 0.5698 -0.1484 0.0141  0.0738  32  ASN B CG  
2930 O OD1 . ASN B 50  ? 0.9100 0.4748 0.5591 -0.1511 -0.0001 0.0898  32  ASN B OD1 
2931 N ND2 . ASN B 50  ? 0.8963 0.4991 0.5865 -0.1585 0.0395  0.0632  32  ASN B ND2 
2932 N N   . LEU B 51  ? 0.7174 0.3809 0.4728 -0.1011 -0.0532 0.0780  33  LEU B N   
2933 C CA  . LEU B 51  ? 0.7000 0.3867 0.4587 -0.0952 -0.0616 0.0748  33  LEU B CA  
2934 C C   . LEU B 51  ? 0.8021 0.4644 0.5211 -0.1008 -0.0791 0.0901  33  LEU B C   
2935 O O   . LEU B 51  ? 0.8382 0.4797 0.5500 -0.0988 -0.0978 0.1053  33  LEU B O   
2936 C CB  . LEU B 51  ? 0.6129 0.3298 0.4167 -0.0780 -0.0722 0.0703  33  LEU B CB  
2937 C CG  . LEU B 51  ? 0.5730 0.3130 0.4120 -0.0719 -0.0584 0.0544  33  LEU B CG  
2938 C CD1 . LEU B 51  ? 0.5473 0.3086 0.4221 -0.0556 -0.0678 0.0515  33  LEU B CD1 
2939 C CD2 . LEU B 51  ? 0.5105 0.2707 0.3499 -0.0769 -0.0425 0.0406  33  LEU B CD2 
2940 N N   . LYS B 52  ? 0.8704 0.5341 0.5639 -0.1078 -0.0743 0.0859  34  LYS B N   
2941 C CA  . LYS B 52  ? 0.9705 0.6095 0.6213 -0.1151 -0.0920 0.0983  34  LYS B CA  
2942 C C   . LYS B 52  ? 0.9875 0.6483 0.6658 -0.1034 -0.1171 0.1031  34  LYS B C   
2943 O O   . LYS B 52  ? 0.9614 0.6539 0.6895 -0.0894 -0.1180 0.0973  34  LYS B O   
2944 C CB  . LYS B 52  ? 1.0147 0.6436 0.6261 -0.1277 -0.0756 0.0905  34  LYS B CB  
2945 C CG  . LYS B 52  ? 1.0949 0.6872 0.6615 -0.1436 -0.0546 0.0919  34  LYS B CG  
2946 C CD  . LYS B 52  ? 1.1416 0.7285 0.6772 -0.1530 -0.0360 0.0807  34  LYS B CD  
2947 C CE  . LYS B 52  ? 1.1881 0.7720 0.7030 -0.1531 -0.0574 0.0820  34  LYS B CE  
2948 N NZ  . LYS B 52  ? 1.2142 0.7938 0.7053 -0.1605 -0.0390 0.0692  34  LYS B NZ  
2949 N N   . LYS B 53  ? 1.0531 0.6966 0.6994 -0.1099 -0.1364 0.1128  35  LYS B N   
2950 C CA  . LYS B 53  ? 1.0748 0.7413 0.7519 -0.1006 -0.1599 0.1164  35  LYS B CA  
2951 C C   . LYS B 53  ? 1.0746 0.7629 0.7564 -0.1004 -0.1534 0.1056  35  LYS B C   
2952 O O   . LYS B 53  ? 1.1158 0.7910 0.7593 -0.1118 -0.1406 0.0983  35  LYS B O   
2953 C CB  . LYS B 53  ? 1.1272 0.7782 0.7856 -0.1067 -0.1811 0.1242  35  LYS B CB  
2954 N N   . ASP B 54  ? 1.0233 0.7476 0.7573 -0.0865 -0.1583 0.1017  36  ASP B N   
2955 C CA  . ASP B 54  ? 1.0160 0.7649 0.7629 -0.0845 -0.1541 0.0916  36  ASP B CA  
2956 C C   . ASP B 54  ? 0.9784 0.7325 0.7116 -0.0885 -0.1258 0.0756  36  ASP B C   
2957 O O   . ASP B 54  ? 1.0258 0.7801 0.7412 -0.0943 -0.1213 0.0694  36  ASP B O   
2958 C CB  . ASP B 54  ? 1.0936 0.8282 0.8141 -0.0941 -0.1754 0.0989  36  ASP B CB  
2959 C CG  . ASP B 54  ? 1.1198 0.8842 0.8776 -0.0870 -0.1847 0.0965  36  ASP B CG  
2960 O OD1 . ASP B 54  ? 1.1624 0.9236 0.9027 -0.0953 -0.1856 0.0912  36  ASP B OD1 
2961 O OD2 . ASP B 54  ? 1.1053 0.8970 0.9147 -0.0728 -0.1865 0.0975  36  ASP B OD2 
2962 N N   . ASN B 55  ? 0.8773 0.6358 0.6221 -0.0855 -0.1072 0.0689  37  ASN B N   
2963 C CA  . ASN B 55  ? 0.7463 0.5075 0.4809 -0.0903 -0.0814 0.0555  37  ASN B CA  
2964 C C   . ASN B 55  ? 0.6295 0.4259 0.4090 -0.0781 -0.0688 0.0432  37  ASN B C   
2965 O O   . ASN B 55  ? 0.5643 0.3786 0.3778 -0.0665 -0.0770 0.0444  37  ASN B O   
2966 C CB  . ASN B 55  ? 0.7567 0.4893 0.4625 -0.1009 -0.0693 0.0580  37  ASN B CB  
2967 C CG  . ASN B 55  ? 0.7379 0.4666 0.4272 -0.1093 -0.0426 0.0464  37  ASN B CG  
2968 O OD1 . ASN B 55  ? 0.7485 0.4832 0.4299 -0.1110 -0.0362 0.0395  37  ASN B OD1 
2969 N ND2 . ASN B 55  ? 0.6948 0.4132 0.3821 -0.1148 -0.0259 0.0443  37  ASN B ND2 
2970 N N   . ILE B 56  ? 0.6212 0.4259 0.3998 -0.0807 -0.0490 0.0315  38  ILE B N   
2971 C CA  . ILE B 56  ? 0.5576 0.3920 0.3738 -0.0707 -0.0386 0.0204  38  ILE B CA  
2972 C C   . ILE B 56  ? 0.5469 0.3783 0.3635 -0.0770 -0.0189 0.0125  38  ILE B C   
2973 O O   . ILE B 56  ? 0.6119 0.4275 0.4038 -0.0875 -0.0056 0.0108  38  ILE B O   
2974 C CB  . ILE B 56  ? 0.6905 0.5469 0.5201 -0.0640 -0.0374 0.0140  38  ILE B CB  
2975 C CG1 . ILE B 56  ? 0.6267 0.5114 0.4925 -0.0523 -0.0326 0.0052  38  ILE B CG1 
2976 C CG2 . ILE B 56  ? 0.7556 0.6023 0.5615 -0.0727 -0.0237 0.0088  38  ILE B CG2 
2977 C CD1 . ILE B 56  ? 0.6261 0.5206 0.5006 -0.0539 -0.0160 -0.0053 38  ILE B CD1 
2978 N N   . VAL B 57  ? 0.4648 0.3105 0.3103 -0.0713 -0.0166 0.0074  39  VAL B N   
2979 C CA  . VAL B 57  ? 0.4581 0.3040 0.3127 -0.0776 -0.0005 0.0002  39  VAL B CA  
2980 C C   . VAL B 57  ? 0.4285 0.3036 0.3209 -0.0684 0.0002  -0.0104 39  VAL B C   
2981 O O   . VAL B 57  ? 0.4310 0.3168 0.3377 -0.0583 -0.0114 -0.0106 39  VAL B O   
2982 C CB  . VAL B 57  ? 0.6081 0.4296 0.4514 -0.0851 -0.0008 0.0070  39  VAL B CB  
2983 C CG1 . VAL B 57  ? 0.5650 0.3899 0.4263 -0.0916 0.0152  -0.0011 39  VAL B CG1 
2984 C CG2 . VAL B 57  ? 0.6730 0.4608 0.4720 -0.0960 -0.0016 0.0183  39  VAL B CG2 
2985 N N   . LEU B 58  ? 0.3854 0.2724 0.2938 -0.0718 0.0139  -0.0192 40  LEU B N   
2986 C CA  . LEU B 58  ? 0.3740 0.2858 0.3165 -0.0653 0.0120  -0.0287 40  LEU B CA  
2987 C C   . LEU B 58  ? 0.4194 0.3238 0.3724 -0.0702 0.0114  -0.0306 40  LEU B C   
2988 O O   . LEU B 58  ? 0.4235 0.3114 0.3697 -0.0816 0.0224  -0.0285 40  LEU B O   
2989 C CB  . LEU B 58  ? 0.3733 0.3018 0.3352 -0.0669 0.0244  -0.0364 40  LEU B CB  
2990 C CG  . LEU B 58  ? 0.3914 0.3273 0.3465 -0.0612 0.0261  -0.0361 40  LEU B CG  
2991 C CD1 . LEU B 58  ? 0.3763 0.3274 0.3560 -0.0622 0.0400  -0.0433 40  LEU B CD1 
2992 C CD2 . LEU B 58  ? 0.3465 0.2966 0.3063 -0.0484 0.0105  -0.0357 40  LEU B CD2 
2993 N N   . ALA B 59  ? 0.3924 0.3059 0.3594 -0.0622 0.0000  -0.0346 41  ALA B N   
2994 C CA  . ALA B 59  ? 0.4449 0.3488 0.4205 -0.0661 -0.0020 -0.0374 41  ALA B CA  
2995 C C   . ALA B 59  ? 0.4936 0.4031 0.4905 -0.0768 0.0082  -0.0447 41  ALA B C   
2996 O O   . ALA B 59  ? 0.5057 0.4379 0.5263 -0.0751 0.0080  -0.0530 41  ALA B O   
2997 C CB  . ALA B 59  ? 0.4084 0.3204 0.3931 -0.0554 -0.0141 -0.0431 41  ALA B CB  
2998 N N   . GLU B 60  ? 0.5145 0.4029 0.5047 -0.0880 0.0168  -0.0407 42  GLU B N   
2999 C CA  . GLU B 60  ? 0.5447 0.4366 0.5597 -0.0994 0.0268  -0.0475 42  GLU B CA  
3000 C C   . GLU B 60  ? 0.5084 0.3944 0.5343 -0.0997 0.0168  -0.0528 42  GLU B C   
3001 O O   . GLU B 60  ? 0.4409 0.3193 0.4537 -0.0903 0.0052  -0.0509 42  GLU B O   
3002 C CB  . GLU B 60  ? 0.6315 0.4999 0.6304 -0.1131 0.0451  -0.0401 42  GLU B CB  
3003 C CG  . GLU B 60  ? 0.7195 0.5837 0.6956 -0.1139 0.0561  -0.0345 42  GLU B CG  
3004 C CD  . GLU B 60  ? 0.8563 0.6912 0.8085 -0.1286 0.0759  -0.0276 42  GLU B CD  
3005 O OE1 . GLU B 60  ? 0.9025 0.7403 0.8779 -0.1393 0.0929  -0.0325 42  GLU B OE1 
3006 O OE2 . GLU B 60  ? 0.9074 0.7153 0.8171 -0.1302 0.0742  -0.0167 42  GLU B OE2 
3007 N N   . GLU B 61  ? 0.5352 0.4239 0.5865 -0.1106 0.0223  -0.0598 43  GLU B N   
3008 C CA  . GLU B 61  ? 0.5563 0.4370 0.6176 -0.1126 0.0129  -0.0667 43  GLU B CA  
3009 C C   . GLU B 61  ? 0.5379 0.3853 0.5731 -0.1125 0.0125  -0.0580 43  GLU B C   
3010 O O   . GLU B 61  ? 0.5075 0.3462 0.5392 -0.1059 0.0019  -0.0617 43  GLU B O   
3011 C CB  . GLU B 61  ? 0.6055 0.4939 0.7013 -0.1270 0.0192  -0.0751 43  GLU B CB  
3012 C CG  . GLU B 61  ? 0.6859 0.5666 0.7929 -0.1304 0.0076  -0.0848 43  GLU B CG  
3013 C CD  . GLU B 61  ? 0.7502 0.6441 0.8543 -0.1180 -0.0116 -0.0936 43  GLU B CD  
3014 O OE1 . GLU B 61  ? 0.7660 0.6851 0.8777 -0.1108 -0.0171 -0.0956 43  GLU B OE1 
3015 O OE2 . GLU B 61  ? 0.7777 0.6538 0.8698 -0.1156 -0.0200 -0.0985 43  GLU B OE2 
3016 N N   . LYS B 62  ? 0.5345 0.3610 0.5499 -0.1194 0.0244  -0.0461 44  LYS B N   
3017 C CA  . LYS B 62  ? 0.5604 0.3535 0.5510 -0.1193 0.0226  -0.0351 44  LYS B CA  
3018 C C   . LYS B 62  ? 0.5248 0.3163 0.4991 -0.1032 0.0084  -0.0294 44  LYS B C   
3019 O O   . LYS B 62  ? 0.5701 0.3384 0.5340 -0.0993 0.0028  -0.0225 44  LYS B O   
3020 C CB  . LYS B 62  ? 0.6430 0.4124 0.6091 -0.1305 0.0369  -0.0223 44  LYS B CB  
3021 C CG  . LYS B 62  ? 0.7179 0.4876 0.6560 -0.1249 0.0356  -0.0130 44  LYS B CG  
3022 C CD  . LYS B 62  ? 0.8454 0.5907 0.7550 -0.1384 0.0523  -0.0031 44  LYS B CD  
3023 C CE  . LYS B 62  ? 0.9019 0.6659 0.8312 -0.1474 0.0718  -0.0122 44  LYS B CE  
3024 N NZ  . LYS B 62  ? 0.9674 0.7052 0.8631 -0.1599 0.0915  -0.0035 44  LYS B NZ  
3025 N N   . HIS B 63  ? 0.4724 0.2882 0.4479 -0.0938 0.0034  -0.0321 45  HIS B N   
3026 C CA  . HIS B 63  ? 0.4605 0.2778 0.4250 -0.0794 -0.0080 -0.0266 45  HIS B CA  
3027 C C   . HIS B 63  ? 0.4213 0.2497 0.4000 -0.0685 -0.0165 -0.0372 45  HIS B C   
3028 O O   . HIS B 63  ? 0.3934 0.2183 0.3674 -0.0569 -0.0232 -0.0330 45  HIS B O   
3029 C CB  . HIS B 63  ? 0.4600 0.2941 0.4152 -0.0755 -0.0080 -0.0230 45  HIS B CB  
3030 C CG  . HIS B 63  ? 0.4832 0.3011 0.4146 -0.0851 -0.0002 -0.0122 45  HIS B CG  
3031 N ND1 . HIS B 63  ? 0.4653 0.2918 0.3964 -0.0934 0.0127  -0.0156 45  HIS B ND1 
3032 C CD2 . HIS B 63  ? 0.5173 0.3083 0.4222 -0.0878 -0.0036 0.0018  45  HIS B CD2 
3033 C CE1 . HIS B 63  ? 0.5310 0.3342 0.4317 -0.1015 0.0190  -0.0050 45  HIS B CE1 
3034 N NE2 . HIS B 63  ? 0.5508 0.3319 0.4335 -0.0987 0.0076  0.0062  45  HIS B NE2 
3035 N N   . MET B 64  ? 0.4172 0.2580 0.4130 -0.0726 -0.0161 -0.0507 46  MET B N   
3036 C CA  . MET B 64  ? 0.4129 0.2650 0.4150 -0.0634 -0.0242 -0.0622 46  MET B CA  
3037 C C   . MET B 64  ? 0.4466 0.2785 0.4427 -0.0551 -0.0275 -0.0632 46  MET B C   
3038 O O   . MET B 64  ? 0.4735 0.3114 0.4663 -0.0440 -0.0314 -0.0684 46  MET B O   
3039 C CB  . MET B 64  ? 0.4214 0.2865 0.4415 -0.0716 -0.0265 -0.0760 46  MET B CB  
3040 C CG  . MET B 64  ? 0.4321 0.3233 0.4652 -0.0753 -0.0243 -0.0767 46  MET B CG  
3041 S SD  . MET B 64  ? 0.4764 0.3869 0.4982 -0.0606 -0.0286 -0.0726 46  MET B SD  
3042 C CE  . MET B 64  ? 1.0169 0.9516 1.0582 -0.0671 -0.0223 -0.0730 46  MET B CE  
3043 N N   . THR B 65  ? 0.4664 0.2726 0.4611 -0.0601 -0.0242 -0.0580 47  THR B N   
3044 C CA  . THR B 65  ? 0.4666 0.2510 0.4594 -0.0517 -0.0255 -0.0588 47  THR B CA  
3045 C C   . THR B 65  ? 0.4519 0.2370 0.4408 -0.0373 -0.0280 -0.0477 47  THR B C   
3046 O O   . THR B 65  ? 0.4750 0.2481 0.4674 -0.0270 -0.0276 -0.0497 47  THR B O   
3047 C CB  . THR B 65  ? 0.5030 0.2569 0.4966 -0.0602 -0.0216 -0.0541 47  THR B CB  
3048 O OG1 . THR B 65  ? 0.4719 0.2180 0.4567 -0.0652 -0.0197 -0.0373 47  THR B OG1 
3049 C CG2 . THR B 65  ? 0.4778 0.2292 0.4808 -0.0748 -0.0190 -0.0668 47  THR B CG2 
3050 N N   . ILE B 66  ? 0.4229 0.2211 0.4062 -0.0370 -0.0300 -0.0366 48  ILE B N   
3051 C CA  . ILE B 66  ? 0.4211 0.2214 0.4043 -0.0254 -0.0346 -0.0250 48  ILE B CA  
3052 C C   . ILE B 66  ? 0.4359 0.2498 0.4265 -0.0121 -0.0341 -0.0330 48  ILE B C   
3053 O O   . ILE B 66  ? 0.4644 0.2734 0.4641 -0.0009 -0.0350 -0.0268 48  ILE B O   
3054 C CB  . ILE B 66  ? 0.4464 0.2578 0.4187 -0.0294 -0.0377 -0.0138 48  ILE B CB  
3055 C CG1 . ILE B 66  ? 0.4410 0.2458 0.4140 -0.0214 -0.0461 0.0016  48  ILE B CG1 
3056 C CG2 . ILE B 66  ? 0.3682 0.2074 0.3407 -0.0278 -0.0364 -0.0216 48  ILE B CG2 
3057 C CD1 . ILE B 66  ? 0.4309 0.2411 0.3882 -0.0268 -0.0510 0.0120  48  ILE B CD1 
3058 N N   . TYR B 67  ? 0.4157 0.2454 0.4034 -0.0133 -0.0323 -0.0461 49  TYR B N   
3059 C CA  . TYR B 67  ? 0.4224 0.2632 0.4098 -0.0021 -0.0307 -0.0528 49  TYR B CA  
3060 C C   . TYR B 67  ? 0.4715 0.2931 0.4611 0.0054  -0.0253 -0.0609 49  TYR B C   
3061 O O   . TYR B 67  ? 0.5106 0.3312 0.5070 0.0174  -0.0209 -0.0579 49  TYR B O   
3062 C CB  . TYR B 67  ? 0.4019 0.2626 0.3822 -0.0058 -0.0326 -0.0625 49  TYR B CB  
3063 C CG  . TYR B 67  ? 0.3808 0.2592 0.3612 -0.0106 -0.0349 -0.0542 49  TYR B CG  
3064 C CD1 . TYR B 67  ? 0.3490 0.2385 0.3290 -0.0037 -0.0354 -0.0452 49  TYR B CD1 
3065 C CD2 . TYR B 67  ? 0.3734 0.2556 0.3558 -0.0227 -0.0349 -0.0555 49  TYR B CD2 
3066 C CE1 . TYR B 67  ? 0.3115 0.2129 0.2884 -0.0087 -0.0366 -0.0387 49  TYR B CE1 
3067 C CE2 . TYR B 67  ? 0.3452 0.2399 0.3262 -0.0270 -0.0337 -0.0489 49  TYR B CE2 
3068 C CZ  . TYR B 67  ? 0.3555 0.2584 0.3315 -0.0200 -0.0349 -0.0408 49  TYR B CZ  
3069 O OH  . TYR B 67  ? 0.3264 0.2379 0.2978 -0.0248 -0.0330 -0.0355 49  TYR B OH  
3070 N N   . ASP B 68  ? 0.4931 0.2982 0.4788 -0.0019 -0.0245 -0.0713 50  ASP B N   
3071 C CA  . ASP B 68  ? 0.5580 0.3387 0.5434 0.0041  -0.0179 -0.0799 50  ASP B CA  
3072 C C   . ASP B 68  ? 0.5442 0.3090 0.5456 0.0120  -0.0148 -0.0670 50  ASP B C   
3073 O O   . ASP B 68  ? 0.5678 0.3197 0.5761 0.0234  -0.0067 -0.0699 50  ASP B O   
3074 C CB  . ASP B 68  ? 0.6370 0.4005 0.6157 -0.0076 -0.0193 -0.0931 50  ASP B CB  
3075 C CG  . ASP B 68  ? 0.7163 0.4897 0.6800 -0.0125 -0.0239 -0.1087 50  ASP B CG  
3076 O OD1 . ASP B 68  ? 0.7177 0.5033 0.6712 -0.0042 -0.0229 -0.1110 50  ASP B OD1 
3077 O OD2 . ASP B 68  ? 0.7815 0.5497 0.7441 -0.0252 -0.0293 -0.1180 50  ASP B OD2 
3078 N N   . GLU B 69  ? 0.5254 0.2897 0.5323 0.0060  -0.0210 -0.0525 51  GLU B N   
3079 C CA  . GLU B 69  ? 0.5399 0.2867 0.5610 0.0122  -0.0223 -0.0381 51  GLU B CA  
3080 C C   . GLU B 69  ? 0.5360 0.2953 0.5737 0.0269  -0.0226 -0.0289 51  GLU B C   
3081 O O   . GLU B 69  ? 0.5635 0.3091 0.6201 0.0381  -0.0185 -0.0253 51  GLU B O   
3082 C CB  . GLU B 69  ? 0.5536 0.2944 0.5687 0.0010  -0.0300 -0.0237 51  GLU B CB  
3083 C CG  . GLU B 69  ? 0.6180 0.3310 0.6423 0.0040  -0.0330 -0.0102 51  GLU B CG  
3084 C CD  . GLU B 69  ? 0.6379 0.3382 0.6472 -0.0094 -0.0389 0.0030  51  GLU B CD  
3085 O OE1 . GLU B 69  ? 0.6676 0.3832 0.6619 -0.0197 -0.0397 0.0027  51  GLU B OE1 
3086 O OE2 . GLU B 69  ? 0.6544 0.3274 0.6659 -0.0094 -0.0417 0.0140  51  GLU B OE2 
3087 N N   . ILE B 70  ? 0.4830 0.2682 0.5171 0.0268  -0.0266 -0.0252 52  ILE B N   
3088 C CA  . ILE B 70  ? 0.4956 0.2945 0.5489 0.0387  -0.0277 -0.0157 52  ILE B CA  
3089 C C   . ILE B 70  ? 0.5344 0.3369 0.5954 0.0503  -0.0141 -0.0275 52  ILE B C   
3090 O O   . ILE B 70  ? 0.5186 0.3244 0.6047 0.0622  -0.0101 -0.0210 52  ILE B O   
3091 C CB  . ILE B 70  ? 0.4928 0.3150 0.5395 0.0338  -0.0367 -0.0070 52  ILE B CB  
3092 C CG1 . ILE B 70  ? 0.4621 0.3024 0.4924 0.0306  -0.0314 -0.0198 52  ILE B CG1 
3093 C CG2 . ILE B 70  ? 0.4945 0.3080 0.5274 0.0216  -0.0474 0.0042  52  ILE B CG2 
3094 C CD1 . ILE B 70  ? 0.4277 0.2877 0.4507 0.0255  -0.0382 -0.0128 52  ILE B CD1 
3095 N N   . GLN B 71  ? 0.6097 0.4103 0.6492 0.0465  -0.0070 -0.0444 53  GLN B N   
3096 C CA  . GLN B 71  ? 0.6997 0.4992 0.7356 0.0558  0.0069  -0.0564 53  GLN B CA  
3097 C C   . GLN B 71  ? 0.7703 0.5450 0.8206 0.0659  0.0199  -0.0611 53  GLN B C   
3098 O O   . GLN B 71  ? 0.7961 0.5687 0.8513 0.0764  0.0348  -0.0670 53  GLN B O   
3099 C CB  . GLN B 71  ? 0.7423 0.5421 0.7466 0.0481  0.0076  -0.0727 53  GLN B CB  
3100 C CG  . GLN B 71  ? 0.7815 0.6077 0.7750 0.0437  0.0006  -0.0701 53  GLN B CG  
3101 C CD  . GLN B 71  ? 0.8145 0.6541 0.8128 0.0540  0.0089  -0.0670 53  GLN B CD  
3102 O OE1 . GLN B 71  ? 0.8435 0.6737 0.8541 0.0646  0.0219  -0.0678 53  GLN B OE1 
3103 N NE2 . GLN B 71  ? 0.8039 0.6646 0.7944 0.0509  0.0032  -0.0635 53  GLN B NE2 
3104 N N   . LYS B 72  ? 0.8073 0.5612 0.8641 0.0629  0.0162  -0.0585 54  LYS B N   
3105 C CA  . LYS B 72  ? 0.8760 0.6032 0.9485 0.0728  0.0290  -0.0629 54  LYS B CA  
3106 C C   . LYS B 72  ? 0.8946 0.6274 1.0085 0.0855  0.0279  -0.0449 54  LYS B C   
3107 O O   . LYS B 72  ? 0.9493 0.6617 1.0864 0.0956  0.0371  -0.0442 54  LYS B O   
3108 C CB  . LYS B 72  ? 0.8745 0.5738 0.9368 0.0638  0.0258  -0.0682 54  LYS B CB  
3109 C CG  . LYS B 72  ? 0.8695 0.5674 0.9436 0.0578  0.0108  -0.0500 54  LYS B CG  
3110 C CD  . LYS B 72  ? 0.8994 0.5703 0.9599 0.0461  0.0091  -0.0561 54  LYS B CD  
3111 C CE  . LYS B 72  ? 0.9069 0.5729 0.9734 0.0392  -0.0041 -0.0368 54  LYS B CE  
3112 N NZ  . LYS B 72  ? 0.9255 0.5651 0.9797 0.0263  -0.0042 -0.0416 54  LYS B NZ  
3113 N N   . LYS B 73  ? 0.8233 0.5831 0.9481 0.0848  0.0160  -0.0306 55  LYS B N   
3114 C CA  . LYS B 73  ? 0.8027 0.5705 0.9682 0.0946  0.0091  -0.0119 55  LYS B CA  
3115 C C   . LYS B 73  ? 0.7850 0.5700 0.9780 0.1075  0.0227  -0.0125 55  LYS B C   
3116 O O   . LYS B 73  ? 0.7785 0.5736 0.9520 0.1065  0.0339  -0.0242 55  LYS B O   
3117 C CB  . LYS B 73  ? 0.7713 0.5538 0.9320 0.0849  -0.0136 0.0050  55  LYS B CB  
3118 C CG  . LYS B 73  ? 0.7975 0.5787 0.9934 0.0917  -0.0280 0.0260  55  LYS B CG  
3119 C CD  . LYS B 73  ? 0.8276 0.6059 1.0026 0.0787  -0.0499 0.0402  55  LYS B CD  
3120 C CE  . LYS B 73  ? 0.8782 0.6513 1.0841 0.0849  -0.0680 0.0623  55  LYS B CE  
3121 N NZ  . LYS B 73  ? 0.9035 0.6684 1.0805 0.0712  -0.0892 0.0765  55  LYS B NZ  
3122 N N   . LYS B 74  ? 0.7866 0.5740 1.0266 0.1196  0.0215  0.0009  56  LYS B N   
3123 C CA  . LYS B 74  ? 0.7890 0.5925 1.0661 0.1325  0.0364  0.0017  56  LYS B CA  
3124 C C   . LYS B 74  ? 0.7340 0.5700 1.0234 0.1288  0.0221  0.0143  56  LYS B C   
3125 O O   . LYS B 74  ? 0.7126 0.5557 0.9908 0.1188  -0.0017 0.0261  56  LYS B O   
3126 C CB  . LYS B 74  ? 0.8574 0.6582 1.1732 0.1421  0.0391  0.0104  56  LYS B CB  
3127 C CG  . LYS B 74  ? 0.9101 0.7112 1.2419 0.1390  0.0118  0.0307  56  LYS B CG  
3128 C CD  . LYS B 74  ? 0.9619 0.7595 1.3296 0.1482  0.0143  0.0382  56  LYS B CD  
3129 C CE  . LYS B 74  ? 0.9867 0.7791 1.3612 0.1442  -0.0134 0.0579  56  LYS B CE  
3130 N NZ  . LYS B 74  ? 1.0071 0.7699 1.3410 0.1351  -0.0212 0.0559  56  LYS B NZ  
3131 N N   . LYS B 75  ? 0.7239 0.5768 1.0346 0.1362  0.0384  0.0111  57  LYS B N   
3132 C CA  . LYS B 75  ? 0.6968 0.5800 1.0263 0.1336  0.0278  0.0224  57  LYS B CA  
3133 C C   . LYS B 75  ? 0.6526 0.5456 0.9372 0.1179  0.0102  0.0229  57  LYS B C   
3134 O O   . LYS B 75  ? 0.6667 0.5752 0.9613 0.1120  -0.0111 0.0369  57  LYS B O   
3135 C CB  . LYS B 75  ? 0.7388 0.6379 1.1113 0.1347  0.0097  0.0411  57  LYS B CB  
3136 C CG  . LYS B 75  ? 0.7834 0.6847 1.1932 0.1443  0.0271  0.0402  57  LYS B CG  
3137 C CD  . LYS B 75  ? 0.7833 0.7102 1.2416 0.1441  0.0124  0.0568  57  LYS B CD  
3138 C CE  . LYS B 75  ? 0.7859 0.7087 1.2487 0.1392  -0.0191 0.0730  57  LYS B CE  
3139 N NZ  . LYS B 75  ? 0.8076 0.7057 1.2703 0.1452  -0.0161 0.0722  57  LYS B NZ  
3140 N N   . LEU B 76  ? 0.5815 0.4642 0.8174 0.1110  0.0187  0.0076  58  LEU B N   
3141 C CA  . LEU B 76  ? 0.5331 0.4269 0.7311 0.0981  0.0075  0.0061  58  LEU B CA  
3142 C C   . LEU B 76  ? 0.5146 0.4315 0.7227 0.0993  0.0128  0.0083  58  LEU B C   
3143 O O   . LEU B 76  ? 0.5098 0.4305 0.7416 0.1091  0.0317  0.0053  58  LEU B O   
3144 C CB  . LEU B 76  ? 0.4833 0.3626 0.6349 0.0921  0.0158  -0.0110 58  LEU B CB  
3145 C CG  . LEU B 76  ? 0.4951 0.3535 0.6280 0.0855  0.0078  -0.0142 58  LEU B CG  
3146 C CD1 . LEU B 76  ? 0.4905 0.3356 0.5858 0.0809  0.0176  -0.0327 58  LEU B CD1 
3147 C CD2 . LEU B 76  ? 0.4855 0.3504 0.6074 0.0737  -0.0132 -0.0032 58  LEU B CD2 
3148 N N   . ASN B 77  ? 0.4650 0.3954 0.6552 0.0891  -0.0020 0.0133  59  ASN B N   
3149 C CA  . ASN B 77  ? 0.4293 0.3782 0.6201 0.0883  0.0037  0.0133  59  ASN B CA  
3150 C C   . ASN B 77  ? 0.4043 0.3536 0.5486 0.0788  0.0016  0.0049  59  ASN B C   
3151 O O   . ASN B 77  ? 0.4157 0.3584 0.5364 0.0702  -0.0110 0.0045  59  ASN B O   
3152 C CB  . ASN B 77  ? 0.4493 0.4162 0.6729 0.0859  -0.0125 0.0289  59  ASN B CB  
3153 C CG  . ASN B 77  ? 0.5033 0.4883 0.7388 0.0867  -0.0028 0.0293  59  ASN B CG  
3154 O OD1 . ASN B 77  ? 0.5373 0.5206 0.7671 0.0926  0.0197  0.0199  59  ASN B OD1 
3155 N ND2 . ASN B 77  ? 0.5008 0.5004 0.7500 0.0799  -0.0196 0.0400  59  ASN B ND2 
3156 N N   . TYR B 78  ? 0.4007 0.3566 0.5332 0.0806  0.0147  -0.0012 60  TYR B N   
3157 C CA  . TYR B 78  ? 0.3891 0.3455 0.4816 0.0735  0.0128  -0.0086 60  TYR B CA  
3158 C C   . TYR B 78  ? 0.3915 0.3644 0.4864 0.0705  0.0111  -0.0027 60  TYR B C   
3159 O O   . TYR B 78  ? 0.4246 0.4034 0.5343 0.0762  0.0246  -0.0016 60  TYR B O   
3160 C CB  . TYR B 78  ? 0.3784 0.3209 0.4436 0.0778  0.0289  -0.0226 60  TYR B CB  
3161 C CG  . TYR B 78  ? 0.3955 0.3181 0.4567 0.0805  0.0330  -0.0306 60  TYR B CG  
3162 C CD1 . TYR B 78  ? 0.4149 0.3282 0.4531 0.0730  0.0221  -0.0366 60  TYR B CD1 
3163 C CD2 . TYR B 78  ? 0.3727 0.2849 0.4551 0.0905  0.0494  -0.0327 60  TYR B CD2 
3164 C CE1 . TYR B 78  ? 0.4689 0.3620 0.5034 0.0743  0.0258  -0.0444 60  TYR B CE1 
3165 C CE2 . TYR B 78  ? 0.4547 0.3454 0.5325 0.0930  0.0542  -0.0408 60  TYR B CE2 
3166 C CZ  . TYR B 78  ? 0.5120 0.3927 0.5646 0.0844  0.0416  -0.0467 60  TYR B CZ  
3167 O OH  . TYR B 78  ? 0.5886 0.4461 0.6367 0.0858  0.0462  -0.0552 60  TYR B OH  
3168 N N   . ILE B 79  ? 0.3714 0.3500 0.4517 0.0613  -0.0035 0.0007  61  ILE B N   
3169 C CA  . ILE B 79  ? 0.3519 0.3432 0.4322 0.0575  -0.0056 0.0055  61  ILE B CA  
3170 C C   . ILE B 79  ? 0.3261 0.3163 0.3719 0.0523  -0.0074 -0.0009 61  ILE B C   
3171 O O   . ILE B 79  ? 0.3330 0.3176 0.3622 0.0471  -0.0153 -0.0045 61  ILE B O   
3172 C CB  . ILE B 79  ? 0.3656 0.3639 0.4644 0.0508  -0.0224 0.0171  61  ILE B CB  
3173 C CG1 . ILE B 79  ? 0.4187 0.4183 0.5561 0.0559  -0.0259 0.0251  61  ILE B CG1 
3174 C CG2 . ILE B 79  ? 0.3310 0.3407 0.4340 0.0471  -0.0227 0.0212  61  ILE B CG2 
3175 C CD1 . ILE B 79  ? 0.4366 0.4477 0.6093 0.0634  -0.0130 0.0282  61  ILE B CD1 
3176 N N   . ALA B 80  ? 0.3009 0.2961 0.3385 0.0541  0.0006  -0.0019 62  ALA B N   
3177 C CA  . ALA B 80  ? 0.3221 0.3182 0.3338 0.0500  -0.0029 -0.0055 62  ALA B CA  
3178 C C   . ALA B 80  ? 0.3628 0.3636 0.3767 0.0410  -0.0153 0.0000  62  ALA B C   
3179 O O   . ALA B 80  ? 0.3970 0.4029 0.4280 0.0383  -0.0192 0.0076  62  ALA B O   
3180 C CB  . ALA B 80  ? 0.3051 0.3030 0.3089 0.0540  0.0079  -0.0052 62  ALA B CB  
3181 N N   . GLY B 81  ? 0.3650 0.3627 0.3617 0.0359  -0.0213 -0.0043 63  GLY B N   
3182 C CA  . GLY B 81  ? 0.3509 0.3476 0.3438 0.0267  -0.0301 -0.0006 63  GLY B CA  
3183 C C   . GLY B 81  ? 0.3472 0.3447 0.3236 0.0233  -0.0291 -0.0054 63  GLY B C   
3184 O O   . GLY B 81  ? 0.3524 0.3540 0.3235 0.0283  -0.0240 -0.0085 63  GLY B O   
3185 N N   . GLY B 82  ? 0.3468 0.3389 0.3153 0.0150  -0.0334 -0.0055 64  GLY B N   
3189 N N   . ALA B 83  ? 0.2456 0.2181 0.2487 0.0110  -0.0155 0.0173  65  ALA B N   
3190 C CA  . ALA B 83  ? 0.2473 0.2271 0.2527 0.0097  -0.0144 0.0218  65  ALA B CA  
3191 C C   . ALA B 83  ? 0.2154 0.2005 0.2168 0.0118  -0.0089 0.0200  65  ALA B C   
3192 O O   . ALA B 83  ? 0.2218 0.2097 0.2279 0.0130  -0.0062 0.0205  65  ALA B O   
3193 C CB  . ALA B 83  ? 0.2242 0.2070 0.2270 0.0035  -0.0171 0.0265  65  ALA B CB  
3194 N N   . THR B 84  ? 0.2103 0.1964 0.2042 0.0122  -0.0079 0.0183  66  THR B N   
3195 C CA  . THR B 84  ? 0.2008 0.1878 0.1887 0.0146  -0.0034 0.0180  66  THR B CA  
3196 C C   . THR B 84  ? 0.2177 0.2005 0.2030 0.0179  0.0020  0.0162  66  THR B C   
3197 O O   . THR B 84  ? 0.2277 0.2107 0.2133 0.0176  0.0070  0.0176  66  THR B O   
3198 C CB  . THR B 84  ? 0.2192 0.2075 0.2002 0.0162  -0.0054 0.0171  66  THR B CB  
3199 O OG1 . THR B 84  ? 0.2012 0.1967 0.1876 0.0130  -0.0081 0.0184  66  THR B OG1 
3200 C CG2 . THR B 84  ? 0.2221 0.2074 0.1955 0.0197  -0.0016 0.0183  66  THR B CG2 
3201 N N   . LEU B 85  ? 0.2234 0.2018 0.2058 0.0202  0.0018  0.0125  67  LEU B N   
3202 C CA  . LEU B 85  ? 0.2314 0.2064 0.2098 0.0236  0.0092  0.0097  67  LEU B CA  
3203 C C   . LEU B 85  ? 0.2551 0.2360 0.2493 0.0235  0.0136  0.0106  67  LEU B C   
3204 O O   . LEU B 85  ? 0.2332 0.2163 0.2281 0.0236  0.0218  0.0109  67  LEU B O   
3205 C CB  . LEU B 85  ? 0.2359 0.2037 0.2070 0.0265  0.0082  0.0035  67  LEU B CB  
3206 C CG  . LEU B 85  ? 0.2710 0.2350 0.2344 0.0307  0.0178  -0.0009 67  LEU B CG  
3207 C CD1 . LEU B 85  ? 0.2337 0.1963 0.1817 0.0304  0.0241  0.0024  67  LEU B CD1 
3208 C CD2 . LEU B 85  ? 0.2891 0.2433 0.2413 0.0335  0.0156  -0.0089 67  LEU B CD2 
3209 N N   . ASN B 86  ? 0.1834 0.1670 0.1905 0.0228  0.0077  0.0116  68  ASN B N   
3210 C CA  . ASN B 86  ? 0.2120 0.2033 0.2368 0.0233  0.0085  0.0128  68  ASN B CA  
3211 C C   . ASN B 86  ? 0.2154 0.2135 0.2434 0.0188  0.0108  0.0158  68  ASN B C   
3212 O O   . ASN B 86  ? 0.1989 0.2041 0.2380 0.0184  0.0168  0.0151  68  ASN B O   
3213 C CB  . ASN B 86  ? 0.2062 0.1969 0.2398 0.0231  -0.0011 0.0157  68  ASN B CB  
3214 C CG  . ASN B 86  ? 0.2669 0.2486 0.3026 0.0279  -0.0033 0.0126  68  ASN B CG  
3215 O OD1 . ASN B 86  ? 0.3184 0.2964 0.3519 0.0325  0.0031  0.0065  68  ASN B OD1 
3216 N ND2 . ASN B 86  ? 0.2224 0.1983 0.2605 0.0266  -0.0119 0.0166  68  ASN B ND2 
3217 N N   . THR B 87  ? 0.1943 0.1903 0.2135 0.0149  0.0065  0.0185  69  THR B N   
3218 C CA  . THR B 87  ? 0.2006 0.1990 0.2203 0.0103  0.0076  0.0201  69  THR B CA  
3219 C C   . THR B 87  ? 0.2215 0.2161 0.2352 0.0099  0.0168  0.0198  69  THR B C   
3220 O O   . THR B 87  ? 0.2318 0.2303 0.2546 0.0062  0.0214  0.0201  69  THR B O   
3221 C CB  . THR B 87  ? 0.2010 0.1962 0.2104 0.0079  0.0030  0.0214  69  THR B CB  
3222 O OG1 . THR B 87  ? 0.2352 0.2332 0.2478 0.0065  -0.0044 0.0231  69  THR B OG1 
3223 C CG2 . THR B 87  ? 0.1688 0.1622 0.1760 0.0040  0.0049  0.0212  69  THR B CG2 
3224 N N   . VAL B 88  ? 0.1804 0.1671 0.1786 0.0131  0.0190  0.0197  70  VAL B N   
3225 C CA  . VAL B 88  ? 0.2580 0.2373 0.2449 0.0131  0.0268  0.0213  70  VAL B CA  
3226 C C   . VAL B 88  ? 0.2476 0.2304 0.2402 0.0128  0.0366  0.0203  70  VAL B C   
3227 O O   . VAL B 88  ? 0.2199 0.2013 0.2134 0.0086  0.0445  0.0227  70  VAL B O   
3228 C CB  . VAL B 88  ? 0.2645 0.2354 0.2326 0.0177  0.0246  0.0218  70  VAL B CB  
3229 C CG1 . VAL B 88  ? 0.3110 0.2719 0.2633 0.0184  0.0322  0.0249  70  VAL B CG1 
3230 C CG2 . VAL B 88  ? 0.2551 0.2253 0.2215 0.0181  0.0175  0.0228  70  VAL B CG2 
3231 N N   . LYS B 89  ? 0.2350 0.2223 0.2328 0.0169  0.0371  0.0164  71  LYS B N   
3232 C CA  . LYS B 89  ? 0.2669 0.2595 0.2717 0.0179  0.0484  0.0140  71  LYS B CA  
3233 C C   . LYS B 89  ? 0.2317 0.2385 0.2629 0.0136  0.0509  0.0146  71  LYS B C   
3234 O O   . LYS B 89  ? 0.2171 0.2300 0.2558 0.0109  0.0625  0.0146  71  LYS B O   
3235 C CB  . LYS B 89  ? 0.2872 0.2789 0.2903 0.0248  0.0490  0.0079  71  LYS B CB  
3236 C CG  . LYS B 89  ? 0.3039 0.3027 0.3281 0.0280  0.0417  0.0053  71  LYS B CG  
3237 C CD  . LYS B 89  ? 0.3255 0.3175 0.3442 0.0350  0.0429  -0.0016 71  LYS B CD  
3238 C CE  . LYS B 89  ? 0.3831 0.3782 0.4225 0.0395  0.0358  -0.0034 71  LYS B CE  
3239 N NZ  . LYS B 89  ? 0.4248 0.4087 0.4577 0.0463  0.0366  -0.0112 71  LYS B NZ  
3240 N N   . MET B 90  ? 0.1969 0.2096 0.2416 0.0121  0.0399  0.0153  72  MET B N   
3241 C CA  . MET B 90  ? 0.2026 0.2296 0.2722 0.0074  0.0390  0.0156  72  MET B CA  
3242 C C   . MET B 90  ? 0.2111 0.2353 0.2784 -0.0018 0.0420  0.0184  72  MET B C   
3243 O O   . MET B 90  ? 0.1883 0.2234 0.2743 -0.0076 0.0475  0.0183  72  MET B O   
3244 C CB  . MET B 90  ? 0.1722 0.2055 0.2542 0.0089  0.0250  0.0158  72  MET B CB  
3245 C CG  . MET B 90  ? 0.1952 0.2458 0.3049 0.0050  0.0219  0.0156  72  MET B CG  
3246 S SD  . MET B 90  ? 0.2314 0.2894 0.3549 0.0085  0.0043  0.0171  72  MET B SD  
3247 C CE  . MET B 90  ? 0.1643 0.2476 0.3259 0.0057  0.0037  0.0154  72  MET B CE  
3248 N N   . ILE B 91  ? 0.2064 0.2158 0.2525 -0.0030 0.0386  0.0206  73  ILE B N   
3249 C CA  . ILE B 91  ? 0.2131 0.2134 0.2528 -0.0103 0.0424  0.0230  73  ILE B CA  
3250 C C   . ILE B 91  ? 0.2726 0.2707 0.3103 -0.0131 0.0570  0.0254  73  ILE B C   
3251 O O   . ILE B 91  ? 0.2872 0.2888 0.3373 -0.0218 0.0630  0.0265  73  ILE B O   
3252 C CB  . ILE B 91  ? 0.2147 0.1981 0.2313 -0.0077 0.0381  0.0247  73  ILE B CB  
3253 C CG1 . ILE B 91  ? 0.1908 0.1767 0.2085 -0.0069 0.0265  0.0224  73  ILE B CG1 
3254 C CG2 . ILE B 91  ? 0.2763 0.2452 0.2843 -0.0135 0.0436  0.0277  73  ILE B CG2 
3255 C CD1 . ILE B 91  ? 0.1937 0.1676 0.1933 -0.0030 0.0234  0.0229  73  ILE B CD1 
3256 N N   . GLN B 92  ? 0.2595 0.2515 0.2804 -0.0066 0.0626  0.0259  74  GLN B N   
3257 C CA  . GLN B 92  ? 0.2783 0.2671 0.2910 -0.0084 0.0777  0.0284  74  GLN B CA  
3258 C C   . GLN B 92  ? 0.2854 0.2942 0.3264 -0.0126 0.0874  0.0258  74  GLN B C   
3259 O O   . GLN B 92  ? 0.2851 0.2952 0.3313 -0.0209 0.0994  0.0289  74  GLN B O   
3260 C CB  . GLN B 92  ? 0.2867 0.2678 0.2763 0.0004  0.0795  0.0271  74  GLN B CB  
3261 C CG  . GLN B 92  ? 0.3345 0.3132 0.3119 -0.0003 0.0960  0.0283  74  GLN B CG  
3262 C CD  . GLN B 92  ? 0.3779 0.3407 0.3371 -0.0073 0.1038  0.0368  74  GLN B CD  
3263 O OE1 . GLN B 92  ? 0.3958 0.3412 0.3344 -0.0056 0.0960  0.0415  74  GLN B OE1 
3264 N NE2 . GLN B 92  ? 0.3667 0.3355 0.3351 -0.0152 0.1196  0.0392  74  GLN B NE2 
3265 N N   . TRP B 93  ? 0.2524 0.2770 0.3134 -0.0068 0.0820  0.0204  75  TRP B N   
3266 C CA  . TRP B 93  ? 0.2464 0.2936 0.3393 -0.0078 0.0894  0.0170  75  TRP B CA  
3267 C C   . TRP B 93  ? 0.2566 0.3168 0.3762 -0.0188 0.0870  0.0184  75  TRP B C   
3268 O O   . TRP B 93  ? 0.2476 0.3239 0.3898 -0.0247 0.0988  0.0179  75  TRP B O   
3269 C CB  . TRP B 93  ? 0.2437 0.3006 0.3505 0.0027  0.0805  0.0117  75  TRP B CB  
3270 C CG  . TRP B 93  ? 0.2414 0.3225 0.3840 0.0055  0.0859  0.0074  75  TRP B CG  
3271 C CD1 . TRP B 93  ? 0.2399 0.3298 0.3899 0.0111  0.1015  0.0028  75  TRP B CD1 
3272 C CD2 . TRP B 93  ? 0.2614 0.3620 0.4380 0.0041  0.0749  0.0068  75  TRP B CD2 
3273 N NE1 . TRP B 93  ? 0.2727 0.3881 0.4632 0.0140  0.1017  -0.0008 75  TRP B NE1 
3274 C CE2 . TRP B 93  ? 0.2664 0.3891 0.4742 0.0098  0.0842  0.0021  75  TRP B CE2 
3275 C CE3 . TRP B 93  ? 0.2655 0.3673 0.4484 -0.0010 0.0578  0.0093  75  TRP B CE3 
3276 C CZ2 . TRP B 93  ? 0.2524 0.3996 0.5001 0.0111  0.0752  0.0006  75  TRP B CZ2 
3277 C CZ3 . TRP B 93  ? 0.2397 0.3640 0.4577 -0.0008 0.0484  0.0080  75  TRP B CZ3 
3278 C CH2 . TRP B 93  ? 0.2488 0.3961 0.5002 0.0055  0.0563  0.0041  75  TRP B CH2 
3279 N N   . ILE B 94  ? 0.2702 0.3242 0.3873 -0.0221 0.0720  0.0193  76  ILE B N   
3280 C CA  . ILE B 94  ? 0.2604 0.3234 0.3985 -0.0333 0.0669  0.0193  76  ILE B CA  
3281 C C   . ILE B 94  ? 0.2677 0.3198 0.3991 -0.0453 0.0789  0.0232  76  ILE B C   
3282 O O   . ILE B 94  ? 0.2272 0.2936 0.3841 -0.0558 0.0847  0.0229  76  ILE B O   
3283 C CB  . ILE B 94  ? 0.2606 0.3147 0.3893 -0.0338 0.0489  0.0185  76  ILE B CB  
3284 C CG1 . ILE B 94  ? 0.2426 0.3091 0.3828 -0.0252 0.0359  0.0162  76  ILE B CG1 
3285 C CG2 . ILE B 94  ? 0.2031 0.2588 0.3439 -0.0470 0.0442  0.0175  76  ILE B CG2 
3286 C CD1 . ILE B 94  ? 0.2543 0.3098 0.3776 -0.0246 0.0209  0.0162  76  ILE B CD1 
3287 N N   . ILE B 95  ? 0.2332 0.2597 0.3311 -0.0437 0.0820  0.0274  77  ILE B N   
3288 C CA  . ILE B 95  ? 0.2803 0.2891 0.3661 -0.0540 0.0913  0.0328  77  ILE B CA  
3289 C C   . ILE B 95  ? 0.3431 0.3575 0.4325 -0.0589 0.1116  0.0366  77  ILE B C   
3290 O O   . ILE B 95  ? 0.3892 0.3983 0.4836 -0.0718 0.1210  0.0407  77  ILE B O   
3291 C CB  . ILE B 95  ? 0.2875 0.2670 0.3373 -0.0485 0.0867  0.0367  77  ILE B CB  
3292 C CG1 . ILE B 95  ? 0.2707 0.2470 0.3200 -0.0458 0.0697  0.0322  77  ILE B CG1 
3293 C CG2 . ILE B 95  ? 0.2906 0.2470 0.3254 -0.0577 0.0960  0.0437  77  ILE B CG2 
3294 C CD1 . ILE B 95  ? 0.2760 0.2272 0.2965 -0.0399 0.0651  0.0347  77  ILE B CD1 
3295 N N   . GLN B 96  ? 0.3797 0.4035 0.4656 -0.0491 0.1188  0.0347  78  GLN B N   
3296 C CA  . GLN B 96  ? 0.4585 0.4916 0.5480 -0.0519 0.1398  0.0363  78  GLN B CA  
3297 C C   . GLN B 96  ? 0.5073 0.5146 0.5584 -0.0543 0.1530  0.0447  78  GLN B C   
3298 O O   . GLN B 96  ? 0.5711 0.5806 0.6097 -0.0508 0.1680  0.0450  78  GLN B O   
3299 C CB  . GLN B 96  ? 0.4850 0.5433 0.6156 -0.0645 0.1485  0.0350  78  GLN B CB  
3300 C CG  . GLN B 96  ? 0.5094 0.5991 0.6803 -0.0593 0.1390  0.0268  78  GLN B CG  
3301 C CD  . GLN B 96  ? 0.5378 0.6567 0.7533 -0.0715 0.1474  0.0252  78  GLN B CD  
3302 O OE1 . GLN B 96  ? 0.5342 0.6576 0.7686 -0.0828 0.1372  0.0250  78  GLN B OE1 
3303 N NE2 . GLN B 96  ? 0.5475 0.6874 0.7807 -0.0694 0.1664  0.0231  78  GLN B NE2 
3304 N N   . LYS B 97  ? 0.4697 0.4513 0.5005 -0.0595 0.1473  0.0514  79  LYS B N   
3305 C CA  . LYS B 97  ? 0.4439 0.3975 0.4358 -0.0606 0.1567  0.0612  79  LYS B CA  
3306 C C   . LYS B 97  ? 0.4057 0.3498 0.3654 -0.0458 0.1521  0.0603  79  LYS B C   
3307 O O   . LYS B 97  ? 0.3445 0.2845 0.2986 -0.0364 0.1352  0.0567  79  LYS B O   
3308 C CB  . LYS B 97  ? 0.4661 0.3922 0.4452 -0.0668 0.1486  0.0678  79  LYS B CB  
3309 C CG  . LYS B 97  ? 0.5378 0.4319 0.4776 -0.0684 0.1574  0.0802  79  LYS B CG  
3310 C CD  . LYS B 97  ? 0.5835 0.4500 0.5175 -0.0758 0.1513  0.0863  79  LYS B CD  
3311 C CE  . LYS B 97  ? 0.6512 0.4829 0.5463 -0.0774 0.1593  0.1005  79  LYS B CE  
3312 N NZ  . LYS B 97  ? 0.6902 0.5082 0.5510 -0.0605 0.1493  0.1031  79  LYS B NZ  
3313 N N   . PRO B 98  ? 0.4419 0.3829 0.3798 -0.0444 0.1676  0.0631  80  PRO B N   
3314 C CA  . PRO B 98  ? 0.4177 0.3509 0.3248 -0.0313 0.1629  0.0605  80  PRO B CA  
3315 C C   . PRO B 98  ? 0.4249 0.3317 0.3009 -0.0252 0.1471  0.0666  80  PRO B C   
3316 O O   . PRO B 98  ? 0.4660 0.3514 0.3270 -0.0309 0.1483  0.0767  80  PRO B O   
3317 C CB  . PRO B 98  ? 0.4276 0.3573 0.3116 -0.0344 0.1847  0.0642  80  PRO B CB  
3318 C CG  . PRO B 98  ? 0.4290 0.3769 0.3460 -0.0477 0.2023  0.0652  80  PRO B CG  
3319 C CD  . PRO B 98  ? 0.4137 0.3576 0.3527 -0.0561 0.1908  0.0687  80  PRO B CD  
3320 N N   . PHE B 99  ? 0.4061 0.3150 0.2756 -0.0137 0.1324  0.0602  81  PHE B N   
3321 C CA  . PHE B 99  ? 0.4005 0.2898 0.2427 -0.0058 0.1172  0.0644  81  PHE B CA  
3322 C C   . PHE B 99  ? 0.4043 0.2862 0.2586 -0.0062 0.1040  0.0670  81  PHE B C   
3323 O O   . PHE B 99  ? 0.4047 0.2697 0.2391 0.0001  0.0934  0.0719  81  PHE B O   
3324 C CB  . PHE B 99  ? 0.4463 0.3122 0.2464 -0.0055 0.1242  0.0747  81  PHE B CB  
3325 C CG  . PHE B 99  ? 0.4675 0.3387 0.2512 -0.0063 0.1406  0.0720  81  PHE B CG  
3326 C CD1 . PHE B 99  ? 0.5170 0.3762 0.2798 -0.0146 0.1592  0.0815  81  PHE B CD1 
3327 C CD2 . PHE B 99  ? 0.4518 0.3382 0.2395 0.0008  0.1383  0.0599  81  PHE B CD2 
3328 C CE1 . PHE B 99  ? 0.5364 0.4039 0.2870 -0.0150 0.1733  0.0768  81  PHE B CE1 
3329 C CE2 . PHE B 99  ? 0.5175 0.4074 0.2890 0.0011  0.1544  0.0556  81  PHE B CE2 
3330 C CZ  . PHE B 99  ? 0.5419 0.4222 0.2924 -0.0066 0.1739  0.0643  81  PHE B CZ  
3331 N N   . VAL B 100 ? 0.3557 0.2506 0.2424 -0.0128 0.1040  0.0629  82  VAL B N   
3332 C CA  . VAL B 100 ? 0.3586 0.2470 0.2557 -0.0131 0.0922  0.0628  82  VAL B CA  
3333 C C   . VAL B 100 ? 0.3544 0.2487 0.2518 -0.0024 0.0765  0.0571  82  VAL B C   
3334 O O   . VAL B 100 ? 0.3759 0.2594 0.2689 0.0018  0.0669  0.0585  82  VAL B O   
3335 C CB  . VAL B 100 ? 0.4257 0.3280 0.3558 -0.0234 0.0944  0.0584  82  VAL B CB  
3336 C CG1 . VAL B 100 ? 0.4150 0.3114 0.3528 -0.0226 0.0816  0.0555  82  VAL B CG1 
3337 C CG2 . VAL B 100 ? 0.4533 0.3480 0.3853 -0.0360 0.1092  0.0648  82  VAL B CG2 
3338 N N   . CYS B 101 ? 0.3416 0.2524 0.2447 0.0020  0.0746  0.0505  83  CYS B N   
3339 C CA  . CYS B 101 ? 0.3329 0.2506 0.2387 0.0099  0.0610  0.0452  83  CYS B CA  
3340 C C   . CYS B 101 ? 0.3588 0.2713 0.2411 0.0177  0.0565  0.0452  83  CYS B C   
3341 O O   . CYS B 101 ? 0.3392 0.2488 0.2057 0.0178  0.0648  0.0457  83  CYS B O   
3342 C CB  . CYS B 101 ? 0.3085 0.2464 0.2398 0.0087  0.0587  0.0374  83  CYS B CB  
3343 S SG  . CYS B 101 ? 0.3789 0.3254 0.3375 0.0004  0.0577  0.0359  83  CYS B SG  
3344 N N   . SER B 102 ? 0.3517 0.2645 0.2325 0.0239  0.0435  0.0438  84  SER B N   
3345 C CA  . SER B 102 ? 0.3736 0.2848 0.2368 0.0307  0.0354  0.0424  84  SER B CA  
3346 C C   . SER B 102 ? 0.3446 0.2710 0.2252 0.0326  0.0256  0.0348  84  SER B C   
3347 O O   . SER B 102 ? 0.3150 0.2491 0.2153 0.0308  0.0228  0.0333  84  SER B O   
3348 C CB  . SER B 102 ? 0.4182 0.3152 0.2636 0.0366  0.0278  0.0496  84  SER B CB  
3349 O OG  . SER B 102 ? 0.4768 0.3559 0.3055 0.0340  0.0367  0.0584  84  SER B OG  
3350 N N   . TYR B 103 ? 0.3384 0.2673 0.2098 0.0354  0.0207  0.0301  85  TYR B N   
3351 C CA  . TYR B 103 ? 0.3319 0.2727 0.2185 0.0356  0.0117  0.0235  85  TYR B CA  
3352 C C   . TYR B 103 ? 0.3330 0.2725 0.2051 0.0394  0.0008  0.0206  85  TYR B C   
3353 O O   . TYR B 103 ? 0.3936 0.3243 0.2425 0.0412  0.0021  0.0196  85  TYR B O   
3354 C CB  . TYR B 103 ? 0.3065 0.2537 0.2067 0.0323  0.0175  0.0176  85  TYR B CB  
3355 C CG  . TYR B 103 ? 0.3211 0.2761 0.2346 0.0316  0.0087  0.0122  85  TYR B CG  
3356 C CD1 . TYR B 103 ? 0.3173 0.2808 0.2507 0.0287  0.0054  0.0133  85  TYR B CD1 
3357 C CD2 . TYR B 103 ? 0.3358 0.2877 0.2399 0.0328  0.0039  0.0058  85  TYR B CD2 
3358 C CE1 . TYR B 103 ? 0.3077 0.2764 0.2516 0.0266  -0.0015 0.0099  85  TYR B CE1 
3359 C CE2 . TYR B 103 ? 0.3278 0.2843 0.2445 0.0304  -0.0039 0.0014  85  TYR B CE2 
3360 C CZ  . TYR B 103 ? 0.3324 0.2972 0.2691 0.0271  -0.0061 0.0043  85  TYR B CZ  
3361 O OH  . TYR B 103 ? 0.3143 0.2819 0.2618 0.0235  -0.0127 0.0015  85  TYR B OH  
3362 N N   . VAL B 104 ? 0.3156 0.2651 0.2015 0.0401  -0.0098 0.0189  86  VAL B N   
3363 C CA  . VAL B 104 ? 0.3610 0.3136 0.2399 0.0422  -0.0223 0.0153  86  VAL B CA  
3364 C C   . VAL B 104 ? 0.3393 0.3027 0.2376 0.0372  -0.0270 0.0086  86  VAL B C   
3365 O O   . VAL B 104 ? 0.3171 0.2889 0.2359 0.0342  -0.0247 0.0097  86  VAL B O   
3366 C CB  . VAL B 104 ? 0.3690 0.3252 0.2485 0.0479  -0.0319 0.0204  86  VAL B CB  
3367 C CG1 . VAL B 104 ? 0.3623 0.3287 0.2448 0.0487  -0.0467 0.0157  86  VAL B CG1 
3368 C CG2 . VAL B 104 ? 0.4099 0.3502 0.2644 0.0532  -0.0294 0.0280  86  VAL B CG2 
3369 N N   . GLY B 105 ? 0.3652 0.3261 0.2548 0.0356  -0.0333 0.0017  87  GLY B N   
3370 C CA  . GLY B 105 ? 0.3400 0.3069 0.2460 0.0297  -0.0381 -0.0044 87  GLY B CA  
3371 C C   . GLY B 105 ? 0.4003 0.3612 0.2915 0.0284  -0.0473 -0.0127 87  GLY B C   
3372 O O   . GLY B 105 ? 0.4130 0.3647 0.2785 0.0325  -0.0485 -0.0139 87  GLY B O   
3373 N N   . CYS B 106 ? 0.3880 0.3524 0.2932 0.0218  -0.0538 -0.0185 88  CYS B N   
3374 C CA  . CYS B 106 ? 0.3849 0.3426 0.2772 0.0190  -0.0641 -0.0281 88  CYS B CA  
3375 C C   . CYS B 106 ? 0.4047 0.3475 0.2954 0.0155  -0.0595 -0.0364 88  CYS B C   
3376 O O   . CYS B 106 ? 0.3016 0.2454 0.2130 0.0101  -0.0581 -0.0360 88  CYS B O   
3377 C CB  . CYS B 106 ? 0.3587 0.3319 0.2682 0.0133  -0.0787 -0.0295 88  CYS B CB  
3378 S SG  . CYS B 106 ? 0.4929 0.4593 0.3854 0.0087  -0.0956 -0.0421 88  CYS B SG  
3379 N N   . ILE B 107 ? 0.4062 0.3339 0.2705 0.0193  -0.0567 -0.0438 89  ILE B N   
3380 C CA  . ILE B 107 ? 0.3861 0.2974 0.2460 0.0183  -0.0525 -0.0541 89  ILE B CA  
3381 C C   . ILE B 107 ? 0.4368 0.3387 0.2808 0.0139  -0.0658 -0.0663 89  ILE B C   
3382 O O   . ILE B 107 ? 0.4637 0.3741 0.3004 0.0120  -0.0785 -0.0658 89  ILE B O   
3383 C CB  . ILE B 107 ? 0.3812 0.2823 0.2232 0.0262  -0.0370 -0.0559 89  ILE B CB  
3384 C CG1 . ILE B 107 ? 0.4020 0.3014 0.2124 0.0305  -0.0370 -0.0547 89  ILE B CG1 
3385 C CG2 . ILE B 107 ? 0.3392 0.2487 0.2023 0.0288  -0.0248 -0.0463 89  ILE B CG2 
3386 C CD1 . ILE B 107 ? 0.4118 0.3012 0.2010 0.0367  -0.0202 -0.0574 89  ILE B CD1 
3387 N N   . GLY B 108 ? 0.4601 0.3440 0.2995 0.0125  -0.0640 -0.0776 90  GLY B N   
3388 C CA  . GLY B 108 ? 0.4682 0.3390 0.2897 0.0076  -0.0763 -0.0916 90  GLY B CA  
3389 C C   . GLY B 108 ? 0.5092 0.3645 0.2922 0.0150  -0.0702 -0.1013 90  GLY B C   
3390 O O   . GLY B 108 ? 0.4863 0.3405 0.2609 0.0232  -0.0541 -0.0974 90  GLY B O   
3391 N N   . ALA B 109 ? 0.5256 0.3693 0.2843 0.0113  -0.0826 -0.1143 91  ALA B N   
3392 C CA  . ALA B 109 ? 0.5852 0.4113 0.3022 0.0176  -0.0764 -0.1256 91  ALA B CA  
3393 C C   . ALA B 109 ? 0.6115 0.4151 0.3275 0.0198  -0.0662 -0.1400 91  ALA B C   
3394 O O   . ALA B 109 ? 0.6434 0.4279 0.3404 0.0163  -0.0745 -0.1567 91  ALA B O   
3395 C CB  . ALA B 109 ? 0.5828 0.4055 0.2697 0.0133  -0.0956 -0.1338 91  ALA B CB  
3396 N N   . ASP B 110 ? 0.5731 0.3787 0.3105 0.0260  -0.0493 -0.1341 92  ASP B N   
3397 C CA  . ASP B 110 ? 0.6014 0.3873 0.3444 0.0306  -0.0392 -0.1460 92  ASP B CA  
3398 C C   . ASP B 110 ? 0.5801 0.3707 0.3276 0.0422  -0.0167 -0.1420 92  ASP B C   
3399 O O   . ASP B 110 ? 0.5547 0.3626 0.3004 0.0448  -0.0088 -0.1297 92  ASP B O   
3400 C CB  . ASP B 110 ? 0.6026 0.3847 0.3813 0.0237  -0.0475 -0.1433 92  ASP B CB  
3401 C CG  . ASP B 110 ? 0.5740 0.3801 0.3850 0.0206  -0.0481 -0.1235 92  ASP B CG  
3402 O OD1 . ASP B 110 ? 0.5986 0.4078 0.4311 0.0107  -0.0597 -0.1189 92  ASP B OD1 
3403 O OD2 . ASP B 110 ? 0.5196 0.3409 0.3341 0.0272  -0.0365 -0.1130 92  ASP B OD2 
3404 N N   . ILE B 111 ? 0.5993 0.3742 0.3546 0.0490  -0.0067 -0.1527 93  ILE B N   
3405 C CA  . ILE B 111 ? 0.5912 0.3728 0.3573 0.0604  0.0144  -0.1508 93  ILE B CA  
3406 C C   . ILE B 111 ? 0.5544 0.3577 0.3588 0.0600  0.0164  -0.1320 93  ILE B C   
3407 O O   . ILE B 111 ? 0.5325 0.3517 0.3443 0.0656  0.0308  -0.1246 93  ILE B O   
3408 C CB  . ILE B 111 ? 0.5868 0.3462 0.3555 0.0696  0.0234  -0.1680 93  ILE B CB  
3409 C CG1 . ILE B 111 ? 0.6078 0.3785 0.3885 0.0823  0.0465  -0.1676 93  ILE B CG1 
3410 C CG2 . ILE B 111 ? 0.5780 0.3245 0.3763 0.0663  0.0113  -0.1674 93  ILE B CG2 
3411 C CD1 . ILE B 111 ? 0.6007 0.3799 0.3487 0.0847  0.0615  -0.1693 93  ILE B CD1 
3412 N N   . GLN B 112 ? 0.5338 0.3378 0.3612 0.0525  0.0020  -0.1246 94  GLN B N   
3413 C CA  . GLN B 112 ? 0.4881 0.3110 0.3472 0.0510  0.0019  -0.1074 94  GLN B CA  
3414 C C   . GLN B 112 ? 0.4598 0.3044 0.3129 0.0479  0.0033  -0.0948 94  GLN B C   
3415 O O   . GLN B 112 ? 0.4005 0.2607 0.2698 0.0510  0.0121  -0.0846 94  GLN B O   
3416 C CB  . GLN B 112 ? 0.4346 0.2524 0.3136 0.0420  -0.0131 -0.1021 94  GLN B CB  
3417 C CG  . GLN B 112 ? 0.4522 0.2474 0.3445 0.0453  -0.0143 -0.1094 94  GLN B CG  
3418 C CD  . GLN B 112 ? 0.5206 0.2896 0.3902 0.0447  -0.0182 -0.1283 94  GLN B CD  
3419 O OE1 . GLN B 112 ? 0.5351 0.3030 0.3824 0.0371  -0.0266 -0.1342 94  GLN B OE1 
3420 N NE2 . GLN B 112 ? 0.5616 0.3091 0.4367 0.0533  -0.0130 -0.1385 94  GLN B NE2 
3421 N N   . GLY B 113 ? 0.4347 0.2793 0.2653 0.0420  -0.0067 -0.0959 95  GLY B N   
3422 C CA  . GLY B 113 ? 0.4201 0.2811 0.2425 0.0403  -0.0068 -0.0845 95  GLY B CA  
3423 C C   . GLY B 113 ? 0.4712 0.3341 0.2752 0.0473  0.0101  -0.0843 95  GLY B C   
3424 O O   . GLY B 113 ? 0.4696 0.3463 0.2809 0.0478  0.0169  -0.0724 95  GLY B O   
3425 N N   . LYS B 114 ? 0.4858 0.3340 0.2654 0.0519  0.0178  -0.0980 96  LYS B N   
3426 C CA  . LYS B 114 ? 0.5253 0.3749 0.2857 0.0579  0.0368  -0.0990 96  LYS B CA  
3427 C C   . LYS B 114 ? 0.5276 0.3904 0.3209 0.0627  0.0523  -0.0936 96  LYS B C   
3428 O O   . LYS B 114 ? 0.5118 0.3856 0.3035 0.0639  0.0663  -0.0863 96  LYS B O   
3429 C CB  . LYS B 114 ? 0.5851 0.4156 0.3134 0.0624  0.0432  -0.1171 96  LYS B CB  
3430 C CG  . LYS B 114 ? 0.6467 0.4776 0.3457 0.0668  0.0630  -0.1182 96  LYS B CG  
3431 C CD  . LYS B 114 ? 0.7196 0.5544 0.3913 0.0618  0.0572  -0.1056 96  LYS B CD  
3432 C CE  . LYS B 114 ? 0.8280 0.6565 0.4587 0.0645  0.0751  -0.1076 96  LYS B CE  
3433 N NZ  . LYS B 114 ? 0.8526 0.6928 0.5030 0.0687  0.1009  -0.1055 96  LYS B NZ  
3434 N N   . TYR B 115 ? 0.5116 0.3727 0.3350 0.0650  0.0489  -0.0969 97  TYR B N   
3435 C CA  . TYR B 115 ? 0.4907 0.3653 0.3484 0.0702  0.0598  -0.0919 97  TYR B CA  
3436 C C   . TYR B 115 ? 0.4554 0.3491 0.3315 0.0647  0.0571  -0.0749 97  TYR B C   
3437 O O   . TYR B 115 ? 0.3788 0.2872 0.2702 0.0668  0.0696  -0.0694 97  TYR B O   
3438 C CB  . TYR B 115 ? 0.5041 0.3697 0.3877 0.0742  0.0532  -0.0972 97  TYR B CB  
3439 C CG  . TYR B 115 ? 0.4962 0.3770 0.4164 0.0806  0.0613  -0.0915 97  TYR B CG  
3440 C CD1 . TYR B 115 ? 0.5096 0.3932 0.4392 0.0913  0.0778  -0.1007 97  TYR B CD1 
3441 C CD2 . TYR B 115 ? 0.4838 0.3776 0.4293 0.0760  0.0524  -0.0775 97  TYR B CD2 
3442 C CE1 . TYR B 115 ? 0.5147 0.4155 0.4813 0.0974  0.0835  -0.0956 97  TYR B CE1 
3443 C CE2 . TYR B 115 ? 0.4950 0.4034 0.4729 0.0814  0.0574  -0.0724 97  TYR B CE2 
3444 C CZ  . TYR B 115 ? 0.5199 0.4327 0.5100 0.0922  0.0721  -0.0812 97  TYR B CZ  
3445 O OH  . TYR B 115 ? 0.5415 0.4720 0.5677 0.0980  0.0753  -0.0764 97  TYR B OH  
3446 N N   . ILE B 116 ? 0.3742 0.2680 0.2503 0.0575  0.0411  -0.0676 98  ILE B N   
3447 C CA  . ILE B 116 ? 0.3725 0.2818 0.2639 0.0526  0.0379  -0.0532 98  ILE B CA  
3448 C C   . ILE B 116 ? 0.3843 0.2986 0.2554 0.0511  0.0459  -0.0472 98  ILE B C   
3449 O O   . ILE B 116 ? 0.3625 0.2887 0.2470 0.0499  0.0534  -0.0385 98  ILE B O   
3450 C CB  . ILE B 116 ? 0.3285 0.2373 0.2249 0.0458  0.0205  -0.0481 98  ILE B CB  
3451 C CG1 . ILE B 116 ? 0.3433 0.2468 0.2618 0.0456  0.0136  -0.0502 98  ILE B CG1 
3452 C CG2 . ILE B 116 ? 0.3031 0.2262 0.2090 0.0418  0.0187  -0.0351 98  ILE B CG2 
3453 C CD1 . ILE B 116 ? 0.3123 0.2150 0.2349 0.0375  -0.0013 -0.0462 98  ILE B CD1 
3454 N N   . LYS B 117 ? 0.4639 0.3675 0.3017 0.0507  0.0434  -0.0516 99  LYS B N   
3455 C CA  . LYS B 117 ? 0.5084 0.4117 0.3206 0.0497  0.0497  -0.0449 99  LYS B CA  
3456 C C   . LYS B 117 ? 0.5133 0.4214 0.3261 0.0523  0.0713  -0.0449 99  LYS B C   
3457 O O   . LYS B 117 ? 0.5338 0.4480 0.3463 0.0494  0.0792  -0.0346 99  LYS B O   
3458 C CB  . LYS B 117 ? 0.5568 0.4459 0.3301 0.0498  0.0419  -0.0513 99  LYS B CB  
3459 C CG  . LYS B 117 ? 0.6508 0.5361 0.3928 0.0490  0.0445  -0.0424 99  LYS B CG  
3460 C CD  . LYS B 117 ? 0.7654 0.6355 0.4650 0.0502  0.0371  -0.0505 99  LYS B CD  
3461 C CE  . LYS B 117 ? 0.8062 0.6749 0.5113 0.0478  0.0147  -0.0565 99  LYS B CE  
3462 N NZ  . LYS B 117 ? 0.8646 0.7182 0.5316 0.0483  0.0065  -0.0687 99  LYS B NZ  
3463 N N   . ASN B 118 ? 0.5079 0.4130 0.3234 0.0577  0.0814  -0.0569 100 ASN B N   
3464 C CA  . ASN B 118 ? 0.5291 0.4426 0.3507 0.0607  0.1035  -0.0586 100 ASN B CA  
3465 C C   . ASN B 118 ? 0.4725 0.4056 0.3363 0.0591  0.1077  -0.0501 100 ASN B C   
3466 O O   . ASN B 118 ? 0.4161 0.3601 0.2862 0.0568  0.1232  -0.0448 100 ASN B O   
3467 C CB  . ASN B 118 ? 0.5900 0.4964 0.4088 0.0688  0.1127  -0.0753 100 ASN B CB  
3468 C CG  . ASN B 118 ? 0.6974 0.6149 0.5230 0.0728  0.1380  -0.0786 100 ASN B CG  
3469 O OD1 . ASN B 118 ? 0.7027 0.6357 0.5674 0.0770  0.1451  -0.0799 100 ASN B OD1 
3470 N ND2 . ASN B 118 ? 0.7545 0.6653 0.5422 0.0714  0.1518  -0.0798 100 ASN B ND2 
3471 N N   . ASP B 119 ? 0.4417 0.3786 0.3331 0.0593  0.0935  -0.0487 101 ASP B N   
3472 C CA  . ASP B 119 ? 0.4575 0.4119 0.3870 0.0579  0.0936  -0.0414 101 ASP B CA  
3473 C C   . ASP B 119 ? 0.4237 0.3846 0.3514 0.0498  0.0935  -0.0286 101 ASP B C   
3474 O O   . ASP B 119 ? 0.4404 0.4159 0.3907 0.0470  0.1016  -0.0235 101 ASP B O   
3475 C CB  . ASP B 119 ? 0.5090 0.4616 0.4591 0.0590  0.0766  -0.0413 101 ASP B CB  
3476 C CG  . ASP B 119 ? 0.5626 0.5313 0.5515 0.0611  0.0771  -0.0379 101 ASP B CG  
3477 O OD1 . ASP B 119 ? 0.5924 0.5648 0.5981 0.0692  0.0847  -0.0455 101 ASP B OD1 
3478 O OD2 . ASP B 119 ? 0.5760 0.5532 0.5782 0.0554  0.0693  -0.0284 101 ASP B OD2 
3479 N N   . CYS B 120 ? 0.3604 0.3103 0.2628 0.0462  0.0835  -0.0239 102 CYS B N   
3480 C CA  . CYS B 120 ? 0.3730 0.3246 0.2715 0.0399  0.0823  -0.0122 102 CYS B CA  
3481 C C   . CYS B 120 ? 0.4183 0.3684 0.3001 0.0373  0.0997  -0.0084 102 CYS B C   
3482 O O   . CYS B 120 ? 0.4409 0.3986 0.3366 0.0318  0.1064  -0.0008 102 CYS B O   
3483 C CB  . CYS B 120 ? 0.3621 0.3033 0.2408 0.0388  0.0665  -0.0087 102 CYS B CB  
3484 S SG  . CYS B 120 ? 0.4407 0.3851 0.3404 0.0390  0.0482  -0.0113 102 CYS B SG  
3485 N N   . SER B 121 ? 0.3945 0.3341 0.2454 0.0404  0.1074  -0.0140 103 SER B N   
3486 C CA  . SER B 121 ? 0.4460 0.3824 0.2756 0.0375  0.1262  -0.0102 103 SER B CA  
3487 C C   . SER B 121 ? 0.4281 0.3828 0.2888 0.0352  0.1446  -0.0107 103 SER B C   
3488 O O   . SER B 121 ? 0.4696 0.4269 0.3291 0.0282  0.1571  -0.0021 103 SER B O   
3489 C CB  . SER B 121 ? 0.5140 0.4369 0.3048 0.0421  0.1322  -0.0189 103 SER B CB  
3490 O OG  . SER B 121 ? 0.5918 0.4993 0.3529 0.0433  0.1143  -0.0179 103 SER B OG  
3491 N N   . ALA B 122 ? 0.4032 0.3704 0.2932 0.0411  0.1458  -0.0206 104 ALA B N   
3492 C CA  . ALA B 122 ? 0.3874 0.3764 0.3137 0.0406  0.1614  -0.0225 104 ALA B CA  
3493 C C   . ALA B 122 ? 0.3942 0.3961 0.3501 0.0322  0.1567  -0.0121 104 ALA B C   
3494 O O   . ALA B 122 ? 0.4098 0.4282 0.3885 0.0270  0.1711  -0.0097 104 ALA B O   
3495 C CB  . ALA B 122 ? 0.3898 0.3874 0.3427 0.0507  0.1591  -0.0345 104 ALA B CB  
3496 N N   . LEU B 123 ? 0.3716 0.3662 0.3272 0.0302  0.1371  -0.0067 105 LEU B N   
3497 C CA  . LEU B 123 ? 0.3819 0.3854 0.3612 0.0223  0.1311  0.0015  105 LEU B CA  
3498 C C   . LEU B 123 ? 0.4139 0.4037 0.3693 0.0138  0.1338  0.0121  105 LEU B C   
3499 O O   . LEU B 123 ? 0.4525 0.4442 0.4216 0.0069  0.1281  0.0184  105 LEU B O   
3500 C CB  . LEU B 123 ? 0.3331 0.3365 0.3260 0.0248  0.1101  0.0013  105 LEU B CB  
3501 C CG  . LEU B 123 ? 0.3095 0.3242 0.3291 0.0324  0.1050  -0.0065 105 LEU B CG  
3502 C CD1 . LEU B 123 ? 0.3039 0.3119 0.3245 0.0341  0.0851  -0.0054 105 LEU B CD1 
3503 C CD2 . LEU B 123 ? 0.2657 0.3035 0.3245 0.0303  0.1110  -0.0064 105 LEU B CD2 
3504 N N   . ASP B 124 ? 0.3718 0.3460 0.2899 0.0147  0.1419  0.0138  106 ASP B N   
3505 C CA  . ASP B 124 ? 0.4239 0.3801 0.3138 0.0086  0.1428  0.0250  106 ASP B CA  
3506 C C   . ASP B 124 ? 0.4316 0.3772 0.3171 0.0099  0.1222  0.0294  106 ASP B C   
3507 O O   . ASP B 124 ? 0.4123 0.3492 0.2957 0.0042  0.1200  0.0382  106 ASP B O   
3508 C CB  . ASP B 124 ? 0.4581 0.4202 0.3630 -0.0025 0.1578  0.0325  106 ASP B CB  
3509 C CG  . ASP B 124 ? 0.5315 0.5050 0.4390 -0.0046 0.1813  0.0292  106 ASP B CG  
3510 O OD1 . ASP B 124 ? 0.5930 0.5577 0.4693 0.0010  0.1889  0.0255  106 ASP B OD1 
3511 O OD2 . ASP B 124 ? 0.5617 0.5541 0.5029 -0.0121 0.1924  0.0296  106 ASP B OD2 
3512 N N   . LEU B 125 ? 0.4738 0.4199 0.3588 0.0173  0.1080  0.0228  107 LEU B N   
3513 C CA  . LEU B 125 ? 0.4722 0.4108 0.3525 0.0193  0.0899  0.0258  107 LEU B CA  
3514 C C   . LEU B 125 ? 0.4926 0.4145 0.3351 0.0238  0.0847  0.0279  107 LEU B C   
3515 O O   . LEU B 125 ? 0.5633 0.4825 0.3884 0.0278  0.0869  0.0214  107 LEU B O   
3516 C CB  . LEU B 125 ? 0.4689 0.4185 0.3716 0.0231  0.0779  0.0182  107 LEU B CB  
3517 C CG  . LEU B 125 ? 0.4973 0.4432 0.3977 0.0256  0.0606  0.0189  107 LEU B CG  
3518 C CD1 . LEU B 125 ? 0.5027 0.4464 0.4095 0.0220  0.0565  0.0261  107 LEU B CD1 
3519 C CD2 . LEU B 125 ? 0.4719 0.4277 0.3931 0.0277  0.0525  0.0122  107 LEU B CD2 
3520 N N   . VAL B 126 ? 0.4784 0.3880 0.3072 0.0235  0.0774  0.0366  108 VAL B N   
3521 C CA  . VAL B 126 ? 0.4825 0.3776 0.2778 0.0288  0.0684  0.0396  108 VAL B CA  
3522 C C   . VAL B 126 ? 0.4935 0.3957 0.2971 0.0340  0.0507  0.0328  108 VAL B C   
3523 O O   . VAL B 126 ? 0.4963 0.4078 0.3256 0.0335  0.0433  0.0319  108 VAL B O   
3524 C CB  . VAL B 126 ? 0.4856 0.3644 0.2660 0.0283  0.0658  0.0521  108 VAL B CB  
3525 C CG1 . VAL B 126 ? 0.5343 0.4016 0.2868 0.0358  0.0509  0.0552  108 VAL B CG1 
3526 C CG2 . VAL B 126 ? 0.4479 0.3159 0.2139 0.0215  0.0841  0.0601  108 VAL B CG2 
3527 N N   . THR B 127 ? 0.4735 0.3714 0.2549 0.0381  0.0444  0.0275  109 THR B N   
3528 C CA  . THR B 127 ? 0.4482 0.3532 0.2387 0.0411  0.0279  0.0207  109 THR B CA  
3529 C C   . THR B 127 ? 0.4775 0.3738 0.2394 0.0455  0.0142  0.0216  109 THR B C   
3530 O O   . THR B 127 ? 0.5315 0.4149 0.2596 0.0468  0.0182  0.0236  109 THR B O   
3531 C CB  . THR B 127 ? 0.4190 0.3315 0.2221 0.0404  0.0300  0.0087  109 THR B CB  
3532 O OG1 . THR B 127 ? 0.4427 0.3463 0.2190 0.0417  0.0390  0.0032  109 THR B OG1 
3533 C CG2 . THR B 127 ? 0.3535 0.2772 0.1890 0.0373  0.0391  0.0080  109 THR B CG2 
3534 N N   . GLU B 128 ? 0.4595 0.3641 0.2353 0.0476  -0.0020 0.0203  110 GLU B N   
3535 C CA  . GLU B 128 ? 0.4842 0.3863 0.2409 0.0513  -0.0184 0.0183  110 GLU B CA  
3536 C C   . GLU B 128 ? 0.4763 0.3919 0.2551 0.0490  -0.0294 0.0082  110 GLU B C   
3537 O O   . GLU B 128 ? 0.4672 0.3953 0.2691 0.0494  -0.0396 0.0096  110 GLU B O   
3538 C CB  . GLU B 128 ? 0.4947 0.3943 0.2473 0.0569  -0.0290 0.0289  110 GLU B CB  
3539 C CG  . GLU B 128 ? 0.5534 0.4336 0.2750 0.0593  -0.0214 0.0402  110 GLU B CG  
3540 C CD  . GLU B 128 ? 0.6527 0.5191 0.3312 0.0604  -0.0225 0.0390  110 GLU B CD  
3541 O OE1 . GLU B 128 ? 0.6491 0.5205 0.3205 0.0606  -0.0339 0.0292  110 GLU B OE1 
3542 O OE2 . GLU B 128 ? 0.6871 0.5364 0.3369 0.0600  -0.0116 0.0479  110 GLU B OE2 
3543 N N   . PHE B 129 ? 0.4535 0.3658 0.2256 0.0462  -0.0261 -0.0023 111 PHE B N   
3544 C CA  . PHE B 129 ? 0.4056 0.3260 0.1962 0.0425  -0.0358 -0.0120 111 PHE B CA  
3545 C C   . PHE B 129 ? 0.4144 0.3374 0.1948 0.0428  -0.0553 -0.0156 111 PHE B C   
3546 O O   . PHE B 129 ? 0.4624 0.3758 0.2105 0.0462  -0.0610 -0.0149 111 PHE B O   
3547 C CB  . PHE B 129 ? 0.3937 0.3063 0.1806 0.0404  -0.0263 -0.0227 111 PHE B CB  
3548 C CG  . PHE B 129 ? 0.4039 0.3204 0.2139 0.0396  -0.0114 -0.0206 111 PHE B CG  
3549 C CD1 . PHE B 129 ? 0.3405 0.2676 0.1829 0.0363  -0.0143 -0.0191 111 PHE B CD1 
3550 C CD2 . PHE B 129 ? 0.4599 0.3706 0.2594 0.0416  0.0054  -0.0198 111 PHE B CD2 
3551 C CE1 . PHE B 129 ? 0.3524 0.2833 0.2147 0.0358  -0.0032 -0.0168 111 PHE B CE1 
3552 C CE2 . PHE B 129 ? 0.4351 0.3526 0.2595 0.0409  0.0171  -0.0181 111 PHE B CE2 
3553 C CZ  . PHE B 129 ? 0.3847 0.3118 0.2397 0.0384  0.0116  -0.0166 111 PHE B CZ  
3554 N N   . GLN B 130 ? 0.4007 0.3376 0.2089 0.0387  -0.0659 -0.0187 112 GLN B N   
3555 C CA  . GLN B 130 ? 0.4328 0.3752 0.2382 0.0365  -0.0849 -0.0250 112 GLN B CA  
3556 C C   . GLN B 130 ? 0.4494 0.3827 0.2506 0.0301  -0.0855 -0.0385 112 GLN B C   
3557 O O   . GLN B 130 ? 0.4146 0.3458 0.2330 0.0267  -0.0750 -0.0410 112 GLN B O   
3558 C CB  . GLN B 130 ? 0.3803 0.3446 0.2214 0.0343  -0.0944 -0.0216 112 GLN B CB  
3559 C CG  . GLN B 130 ? 0.3834 0.3589 0.2282 0.0316  -0.1152 -0.0272 112 GLN B CG  
3560 C CD  . GLN B 130 ? 0.4101 0.4108 0.2948 0.0291  -0.1214 -0.0241 112 GLN B CD  
3561 O OE1 . GLN B 130 ? 0.4133 0.4214 0.3162 0.0320  -0.1112 -0.0164 112 GLN B OE1 
3562 N NE2 . GLN B 130 ? 0.3975 0.4121 0.2963 0.0230  -0.1376 -0.0307 112 GLN B NE2 
3563 N N   . ILE B 131 ? 0.4773 0.4033 0.2541 0.0290  -0.0983 -0.0472 113 ILE B N   
3564 C CA  . ILE B 131 ? 0.4860 0.4003 0.2572 0.0227  -0.1005 -0.0619 113 ILE B CA  
3565 C C   . ILE B 131 ? 0.4947 0.4213 0.2875 0.0141  -0.1196 -0.0678 113 ILE B C   
3566 O O   . ILE B 131 ? 0.4800 0.4150 0.2647 0.0142  -0.1371 -0.0683 113 ILE B O   
3567 C CB  . ILE B 131 ? 0.5134 0.4077 0.2382 0.0259  -0.1007 -0.0710 113 ILE B CB  
3568 C CG1 . ILE B 131 ? 0.5066 0.3919 0.2079 0.0338  -0.0823 -0.0630 113 ILE B CG1 
3569 C CG2 . ILE B 131 ? 0.5373 0.4156 0.2574 0.0210  -0.0984 -0.0872 113 ILE B CG2 
3570 C CD1 . ILE B 131 ? 0.5078 0.3899 0.2262 0.0346  -0.0611 -0.0631 113 ILE B CD1 
3571 N N   . ALA B 132 ? 0.4876 0.4158 0.3088 0.0063  -0.1167 -0.0714 114 ALA B N   
3572 C CA  . ALA B 132 ? 0.4944 0.4342 0.3393 -0.0045 -0.1326 -0.0767 114 ALA B CA  
3573 C C   . ALA B 132 ? 0.5258 0.4520 0.3457 -0.0094 -0.1475 -0.0920 114 ALA B C   
3574 O O   . ALA B 132 ? 0.5460 0.4487 0.3342 -0.0060 -0.1411 -0.1010 114 ALA B O   
3575 C CB  . ALA B 132 ? 0.4642 0.4031 0.3395 -0.0126 -0.1244 -0.0762 114 ALA B CB  
3576 N N   . GLU B 133 ? 0.5490 0.4909 0.3835 -0.0173 -0.1672 -0.0956 115 GLU B N   
3577 C CA  . GLU B 133 ? 0.6320 0.5622 0.4452 -0.0241 -0.1844 -0.1113 115 GLU B CA  
3578 C C   . GLU B 133 ? 0.6314 0.5390 0.4484 -0.0336 -0.1791 -0.1236 115 GLU B C   
3579 O O   . GLU B 133 ? 0.5682 0.4805 0.4191 -0.0409 -0.1725 -0.1193 115 GLU B O   
3580 C CB  . GLU B 133 ? 0.6938 0.6505 0.5301 -0.0316 -0.2077 -0.1120 115 GLU B CB  
3581 C CG  . GLU B 133 ? 0.8324 0.7840 0.6495 -0.0381 -0.2218 -0.1242 115 GLU B CG  
3582 C CD  . GLU B 133 ? 0.8897 0.8729 0.7420 -0.0478 -0.2389 -0.1234 115 GLU B CD  
3583 O OE1 . GLU B 133 ? 0.8664 0.8716 0.7614 -0.0533 -0.2386 -0.1171 115 GLU B OE1 
3584 O OE2 . GLU B 133 ? 0.9481 0.9355 0.7858 -0.0502 -0.2519 -0.1292 115 GLU B OE2 
3585 N N   . GLU B 134 ? 0.7138 0.5951 0.4940 -0.0331 -0.1816 -0.1386 116 GLU B N   
3586 C CA  . GLU B 134 ? 0.7753 0.6305 0.5555 -0.0410 -0.1785 -0.1527 116 GLU B CA  
3587 C C   . GLU B 134 ? 0.7623 0.6282 0.5775 -0.0582 -0.1930 -0.1561 116 GLU B C   
3588 O O   . GLU B 134 ? 0.7405 0.6330 0.5701 -0.0636 -0.2071 -0.1526 116 GLU B O   
3589 C CB  . GLU B 134 ? 0.8552 0.6877 0.5936 -0.0376 -0.1767 -0.1673 116 GLU B CB  
3590 C CG  . GLU B 134 ? 0.8879 0.7037 0.5924 -0.0227 -0.1577 -0.1672 116 GLU B CG  
3591 C CD  . GLU B 134 ? 0.9339 0.7637 0.6129 -0.0137 -0.1584 -0.1574 116 GLU B CD  
3592 O OE1 . GLU B 134 ? 0.9350 0.7885 0.6317 -0.0136 -0.1682 -0.1445 116 GLU B OE1 
3593 O OE2 . GLU B 134 ? 0.9446 0.7616 0.5869 -0.0069 -0.1484 -0.1620 116 GLU B OE2 
3594 N N   . PRO B 135 ? 0.7632 0.6095 0.5946 -0.0667 -0.1875 -0.1614 117 PRO B N   
3595 C CA  . PRO B 135 ? 0.7586 0.5766 0.5799 -0.0588 -0.1686 -0.1635 117 PRO B CA  
3596 C C   . PRO B 135 ? 0.7136 0.5436 0.5661 -0.0555 -0.1525 -0.1454 117 PRO B C   
3597 O O   . PRO B 135 ? 0.7439 0.5533 0.6031 -0.0543 -0.1412 -0.1456 117 PRO B O   
3598 C CB  . PRO B 135 ? 0.7696 0.5625 0.5954 -0.0710 -0.1731 -0.1773 117 PRO B CB  
3599 C CG  . PRO B 135 ? 0.7441 0.5607 0.6050 -0.0881 -0.1867 -0.1722 117 PRO B CG  
3600 C CD  . PRO B 135 ? 0.7529 0.6048 0.6145 -0.0849 -0.1972 -0.1650 117 PRO B CD  
3601 N N   . LEU B 136 ? 0.6279 0.4894 0.4981 -0.0534 -0.1522 -0.1304 118 LEU B N   
3602 C CA  . LEU B 136 ? 0.5456 0.4192 0.4416 -0.0504 -0.1378 -0.1140 118 LEU B CA  
3603 C C   . LEU B 136 ? 0.5551 0.4157 0.4339 -0.0354 -0.1200 -0.1109 118 LEU B C   
3604 O O   . LEU B 136 ? 0.5657 0.4298 0.4209 -0.0248 -0.1163 -0.1106 118 LEU B O   
3605 C CB  . LEU B 136 ? 0.4775 0.3864 0.3928 -0.0500 -0.1414 -0.1011 118 LEU B CB  
3606 C CG  . LEU B 136 ? 0.4479 0.3705 0.3900 -0.0492 -0.1282 -0.0855 118 LEU B CG  
3607 C CD1 . LEU B 136 ? 0.4208 0.3321 0.3843 -0.0618 -0.1259 -0.0847 118 LEU B CD1 
3608 C CD2 . LEU B 136 ? 0.4178 0.3744 0.3797 -0.0493 -0.1328 -0.0760 118 LEU B CD2 
3609 N N   . MET B 137 ? 0.4562 0.3020 0.3475 -0.0348 -0.1092 -0.1079 119 MET B N   
3610 C CA  . MET B 137 ? 0.4548 0.2881 0.3340 -0.0212 -0.0933 -0.1074 119 MET B CA  
3611 C C   . MET B 137 ? 0.4166 0.2686 0.3120 -0.0147 -0.0817 -0.0907 119 MET B C   
3612 O O   . MET B 137 ? 0.3920 0.2613 0.3102 -0.0213 -0.0840 -0.0795 119 MET B O   
3613 C CB  . MET B 137 ? 0.5279 0.3312 0.4090 -0.0214 -0.0897 -0.1160 119 MET B CB  
3614 C CG  . MET B 137 ? 0.6123 0.3909 0.4708 -0.0252 -0.0987 -0.1359 119 MET B CG  
3615 S SD  . MET B 137 ? 1.1233 0.8940 0.9391 -0.0116 -0.0919 -0.1493 119 MET B SD  
3616 C CE  . MET B 137 ? 0.6288 0.4221 0.4287 -0.0181 -0.1085 -0.1486 119 MET B CE  
3617 N N   . THR B 138 ? 0.4144 0.2632 0.2977 -0.0024 -0.0687 -0.0901 120 THR B N   
3618 C CA  . THR B 138 ? 0.4447 0.3083 0.3420 0.0036  -0.0577 -0.0763 120 THR B CA  
3619 C C   . THR B 138 ? 0.4508 0.3123 0.3743 -0.0013 -0.0570 -0.0683 120 THR B C   
3620 O O   . THR B 138 ? 0.4407 0.2814 0.3678 -0.0021 -0.0575 -0.0738 120 THR B O   
3621 C CB  . THR B 138 ? 0.4164 0.2740 0.3008 0.0160  -0.0432 -0.0791 120 THR B CB  
3622 O OG1 . THR B 138 ? 0.4322 0.2923 0.2890 0.0197  -0.0423 -0.0836 120 THR B OG1 
3623 C CG2 . THR B 138 ? 0.3575 0.2298 0.2602 0.0204  -0.0334 -0.0658 120 THR B CG2 
3624 N N   . GLY B 139 ? 0.4298 0.3110 0.3693 -0.0043 -0.0563 -0.0552 121 GLY B N   
3625 C CA  . GLY B 139 ? 0.4315 0.3120 0.3914 -0.0094 -0.0554 -0.0457 121 GLY B CA  
3626 C C   . GLY B 139 ? 0.4293 0.2972 0.3927 -0.0005 -0.0472 -0.0440 121 GLY B C   
3627 O O   . GLY B 139 ? 0.4591 0.3275 0.4142 0.0099  -0.0394 -0.0475 121 GLY B O   
3628 N N   . LYS B 140 ? 0.3997 0.2569 0.3762 -0.0048 -0.0491 -0.0378 122 LYS B N   
3629 C CA  . LYS B 140 ? 0.3840 0.2280 0.3665 0.0044  -0.0443 -0.0361 122 LYS B CA  
3630 C C   . LYS B 140 ? 0.3834 0.2278 0.3797 -0.0002 -0.0462 -0.0218 122 LYS B C   
3631 O O   . LYS B 140 ? 0.3865 0.2349 0.3866 -0.0122 -0.0505 -0.0151 122 LYS B O   
3632 C CB  . LYS B 140 ? 0.3692 0.1847 0.3462 0.0074  -0.0465 -0.0486 122 LYS B CB  
3633 C CG  . LYS B 140 ? 0.3896 0.1890 0.3658 -0.0062 -0.0563 -0.0521 122 LYS B CG  
3634 C CD  . LYS B 140 ? 0.4575 0.2256 0.4249 -0.0027 -0.0584 -0.0674 122 LYS B CD  
3635 C CE  . LYS B 140 ? 0.4930 0.2430 0.4615 -0.0184 -0.0690 -0.0709 122 LYS B CE  
3636 N NZ  . LYS B 140 ? 0.5281 0.2431 0.4871 -0.0157 -0.0717 -0.0869 122 LYS B NZ  
3637 N N   . VAL B 141 ? 0.3860 0.2274 0.3896 0.0095  -0.0429 -0.0169 123 VAL B N   
3638 C CA  . VAL B 141 ? 0.3218 0.1609 0.3343 0.0065  -0.0460 -0.0030 123 VAL B CA  
3639 C C   . VAL B 141 ? 0.3545 0.1697 0.3736 0.0154  -0.0485 -0.0033 123 VAL B C   
3640 O O   . VAL B 141 ? 0.3502 0.1664 0.3744 0.0287  -0.0442 -0.0092 123 VAL B O   
3641 C CB  . VAL B 141 ? 0.4036 0.2665 0.4201 0.0100  -0.0422 0.0056  123 VAL B CB  
3642 C CG1 . VAL B 141 ? 0.2975 0.1569 0.3183 0.0062  -0.0467 0.0200  123 VAL B CG1 
3643 C CG2 . VAL B 141 ? 0.2757 0.1602 0.2862 0.0041  -0.0391 0.0048  123 VAL B CG2 
3644 N N   . ALA B 142 ? 0.3712 0.1644 0.3911 0.0080  -0.0551 0.0032  124 ALA B N   
3645 C CA  . ALA B 142 ? 0.3973 0.1655 0.4239 0.0169  -0.0592 0.0064  124 ALA B CA  
3646 C C   . ALA B 142 ? 0.3895 0.1700 0.4230 0.0222  -0.0611 0.0207  124 ALA B C   
3647 O O   . ALA B 142 ? 0.3938 0.1788 0.4227 0.0119  -0.0641 0.0339  124 ALA B O   
3648 C CB  . ALA B 142 ? 0.4197 0.1574 0.4428 0.0057  -0.0659 0.0104  124 ALA B CB  
3649 N N   . VAL B 143 ? 0.4051 0.1930 0.4497 0.0377  -0.0592 0.0174  125 VAL B N   
3650 C CA  . VAL B 143 ? 0.4224 0.2226 0.4754 0.0433  -0.0634 0.0297  125 VAL B CA  
3651 C C   . VAL B 143 ? 0.4735 0.2491 0.5362 0.0541  -0.0719 0.0356  125 VAL B C   
3652 O O   . VAL B 143 ? 0.4958 0.2677 0.5729 0.0694  -0.0701 0.0267  125 VAL B O   
3653 C CB  . VAL B 143 ? 0.3895 0.2196 0.4526 0.0520  -0.0566 0.0241  125 VAL B CB  
3654 C CG1 . VAL B 143 ? 0.3601 0.2064 0.4291 0.0529  -0.0625 0.0368  125 VAL B CG1 
3655 C CG2 . VAL B 143 ? 0.3843 0.2319 0.4367 0.0439  -0.0479 0.0164  125 VAL B CG2 
3656 N N   . LEU B 144 ? 0.4912 0.2495 0.5458 0.0465  -0.0806 0.0507  126 LEU B N   
3657 C CA  . LEU B 144 ? 0.5474 0.2786 0.6084 0.0562  -0.0909 0.0596  126 LEU B CA  
3658 C C   . LEU B 144 ? 0.5437 0.2940 0.6147 0.0664  -0.0976 0.0693  126 LEU B C   
3659 O O   . LEU B 144 ? 0.5133 0.2768 0.5742 0.0579  -0.1014 0.0811  126 LEU B O   
3660 C CB  . LEU B 144 ? 0.5495 0.2542 0.5932 0.0416  -0.0953 0.0719  126 LEU B CB  
3661 C CG  . LEU B 144 ? 0.5777 0.2536 0.6166 0.0351  -0.0924 0.0631  126 LEU B CG  
3662 C CD1 . LEU B 144 ? 0.5303 0.2151 0.5672 0.0267  -0.0855 0.0483  126 LEU B CD1 
3663 C CD2 . LEU B 144 ? 0.6236 0.2791 0.6477 0.0199  -0.0951 0.0774  126 LEU B CD2 
3664 N N   . VAL B 145 ? 0.5563 0.3109 0.6463 0.0838  -0.0978 0.0629  127 VAL B N   
3665 C CA  . VAL B 145 ? 0.5828 0.3603 0.6862 0.0935  -0.1042 0.0695  127 VAL B CA  
3666 C C   . VAL B 145 ? 0.6472 0.4080 0.7513 0.1015  -0.1130 0.0788  127 VAL B C   
3667 O O   . VAL B 145 ? 0.6841 0.4268 0.7963 0.1117  -0.1107 0.0721  127 VAL B O   
3668 C CB  . VAL B 145 ? 0.5635 0.3676 0.6934 0.1073  -0.0972 0.0557  127 VAL B CB  
3669 C CG1 . VAL B 145 ? 0.5754 0.4058 0.7218 0.1150  -0.1049 0.0624  127 VAL B CG1 
3670 C CG2 . VAL B 145 ? 0.5020 0.3236 0.6276 0.0987  -0.0864 0.0465  127 VAL B CG2 
3671 N N   . SER B 146 ? 0.6955 0.4614 0.7893 0.0971  -0.1230 0.0939  128 SER B N   
3672 C CA  . SER B 146 ? 0.7533 0.5032 0.8446 0.1043  -0.1331 0.1050  128 SER B CA  
3673 C C   . SER B 146 ? 0.7449 0.5202 0.8436 0.1102  -0.1437 0.1126  128 SER B C   
3674 O O   . SER B 146 ? 0.7251 0.5179 0.8127 0.1000  -0.1460 0.1174  128 SER B O   
3675 C CB  . SER B 146 ? 0.7858 0.5067 0.8481 0.0897  -0.1353 0.1182  128 SER B CB  
3676 O OG  . SER B 146 ? 0.8528 0.5584 0.9095 0.0961  -0.1457 0.1311  128 SER B OG  
3677 N N   . LEU B 149 ? 0.7487 0.6067 0.8421 0.0871  -0.1446 0.1111  131 LEU B N   
3678 C CA  . LEU B 149 ? 0.7407 0.5899 0.8073 0.0706  -0.1385 0.1147  131 LEU B CA  
3679 C C   . LEU B 149 ? 0.7310 0.5700 0.8022 0.0686  -0.1261 0.1048  131 LEU B C   
3680 O O   . LEU B 149 ? 0.7211 0.5651 0.8158 0.0797  -0.1208 0.0931  131 LEU B O   
3681 C CB  . LEU B 149 ? 0.7712 0.5963 0.8073 0.0614  -0.1434 0.1290  131 LEU B CB  
3682 C CG  . LEU B 149 ? 0.7821 0.6158 0.7986 0.0561  -0.1532 0.1396  131 LEU B CG  
3683 C CD1 . LEU B 149 ? 0.7957 0.6400 0.8294 0.0701  -0.1664 0.1413  131 LEU B CD1 
3684 C CD2 . LEU B 149 ? 0.8128 0.6220 0.7961 0.0444  -0.1526 0.1526  131 LEU B CD2 
3685 N N   . ARG B 150 ? 0.7382 0.5636 0.7864 0.0540  -0.1209 0.1090  132 ARG B N   
3686 C CA  . ARG B 150 ? 0.7630 0.5829 0.8116 0.0488  -0.1082 0.0978  132 ARG B CA  
3687 C C   . ARG B 150 ? 0.7874 0.5880 0.8122 0.0324  -0.1047 0.1050  132 ARG B C   
3688 O O   . ARG B 150 ? 0.8458 0.6355 0.8523 0.0250  -0.1110 0.1198  132 ARG B O   
3689 C CB  . ARG B 150 ? 0.7207 0.5718 0.7750 0.0460  -0.0967 0.0851  132 ARG B CB  
3690 C CG  . ARG B 150 ? 0.7331 0.5938 0.8100 0.0579  -0.0893 0.0700  132 ARG B CG  
3691 C CD  . ARG B 150 ? 0.7373 0.6257 0.8339 0.0664  -0.0910 0.0672  132 ARG B CD  
3692 N NE  . ARG B 150 ? 0.7473 0.6406 0.8697 0.0811  -0.0865 0.0565  132 ARG B NE  
3693 C CZ  . ARG B 150 ? 0.7211 0.6287 0.8510 0.0827  -0.0726 0.0431  132 ARG B CZ  
3694 N NH1 . ARG B 150 ? 0.6959 0.6132 0.8100 0.0710  -0.0637 0.0395  132 ARG B NH1 
3695 N NH2 . ARG B 150 ? 0.7120 0.6238 0.8645 0.0964  -0.0673 0.0335  132 ARG B NH2 
3696 N N   . SER B 151 ? 0.6763 0.4742 0.7017 0.0265  -0.0943 0.0940  133 SER B N   
3697 C CA  . SER B 151 ? 0.5682 0.3568 0.5774 0.0094  -0.0887 0.0972  133 SER B CA  
3698 C C   . SER B 151 ? 0.4947 0.2883 0.5108 0.0070  -0.0793 0.0810  133 SER B C   
3699 O O   . SER B 151 ? 0.4808 0.2613 0.5075 0.0161  -0.0796 0.0713  133 SER B O   
3700 C CB  . SER B 151 ? 0.5608 0.3138 0.5603 0.0043  -0.0957 0.1101  133 SER B CB  
3701 O OG  . SER B 151 ? 0.5303 0.2798 0.5151 -0.0145 -0.0895 0.1155  133 SER B OG  
3702 N N   . MET B 152 ? 0.4170 0.2292 0.4264 -0.0044 -0.0715 0.0776  134 MET B N   
3703 C CA  . MET B 152 ? 0.3875 0.2090 0.4020 -0.0057 -0.0644 0.0626  134 MET B CA  
3704 C C   . MET B 152 ? 0.4087 0.2241 0.4177 -0.0214 -0.0617 0.0621  134 MET B C   
3705 O O   . MET B 152 ? 0.4296 0.2525 0.4313 -0.0333 -0.0593 0.0711  134 MET B O   
3706 C CB  . MET B 152 ? 0.3446 0.1969 0.3607 -0.0028 -0.0581 0.0564  134 MET B CB  
3707 C CG  . MET B 152 ? 0.3770 0.2392 0.4029 0.0112  -0.0593 0.0539  134 MET B CG  
3708 S SD  . MET B 152 ? 0.4885 0.3817 0.5160 0.0129  -0.0510 0.0460  134 MET B SD  
3709 C CE  . MET B 152 ? 0.9891 0.8940 1.0031 0.0004  -0.0502 0.0553  134 MET B CE  
3710 N N   . VAL B 153 ? 0.3908 0.1938 0.4039 -0.0215 -0.0618 0.0507  135 VAL B N   
3711 C CA  . VAL B 153 ? 0.3667 0.1679 0.3788 -0.0365 -0.0604 0.0471  135 VAL B CA  
3712 C C   . VAL B 153 ? 0.3914 0.2103 0.4059 -0.0334 -0.0572 0.0316  135 VAL B C   
3713 O O   . VAL B 153 ? 0.4238 0.2339 0.4388 -0.0231 -0.0578 0.0203  135 VAL B O   
3714 C CB  . VAL B 153 ? 0.4025 0.1684 0.4150 -0.0418 -0.0659 0.0470  135 VAL B CB  
3715 C CG1 . VAL B 153 ? 0.4096 0.1762 0.4240 -0.0597 -0.0653 0.0432  135 VAL B CG1 
3716 C CG2 . VAL B 153 ? 0.4264 0.1705 0.4340 -0.0429 -0.0702 0.0639  135 VAL B CG2 
3717 N N   . THR B 154 ? 0.3619 0.2052 0.3769 -0.0416 -0.0536 0.0313  136 THR B N   
3718 C CA  . THR B 154 ? 0.3111 0.1733 0.3260 -0.0371 -0.0515 0.0195  136 THR B CA  
3719 C C   . THR B 154 ? 0.3631 0.2267 0.3807 -0.0477 -0.0550 0.0111  136 THR B C   
3720 O O   . THR B 154 ? 0.3990 0.2699 0.4229 -0.0612 -0.0552 0.0163  136 THR B O   
3721 C CB  . THR B 154 ? 0.3392 0.2300 0.3539 -0.0350 -0.0461 0.0238  136 THR B CB  
3722 O OG1 . THR B 154 ? 0.3240 0.2151 0.3366 -0.0251 -0.0442 0.0291  136 THR B OG1 
3723 C CG2 . THR B 154 ? 0.2695 0.1767 0.2826 -0.0306 -0.0449 0.0134  136 THR B CG2 
3724 N N   . TYR B 155 ? 0.3488 0.2061 0.3612 -0.0418 -0.0577 -0.0023 137 TYR B N   
3725 C CA  . TYR B 155 ? 0.3336 0.1954 0.3467 -0.0504 -0.0632 -0.0121 137 TYR B CA  
3726 C C   . TYR B 155 ? 0.3616 0.2456 0.3684 -0.0424 -0.0619 -0.0182 137 TYR B C   
3727 O O   . TYR B 155 ? 0.3400 0.2179 0.3353 -0.0310 -0.0600 -0.0257 137 TYR B O   
3728 C CB  . TYR B 155 ? 0.4150 0.2474 0.4220 -0.0509 -0.0689 -0.0239 137 TYR B CB  
3729 C CG  . TYR B 155 ? 0.4691 0.3050 0.4755 -0.0608 -0.0770 -0.0352 137 TYR B CG  
3730 C CD1 . TYR B 155 ? 0.5386 0.3781 0.5584 -0.0784 -0.0819 -0.0320 137 TYR B CD1 
3731 C CD2 . TYR B 155 ? 0.4777 0.3140 0.4698 -0.0532 -0.0799 -0.0490 137 TYR B CD2 
3732 C CE1 . TYR B 155 ? 0.5954 0.4408 0.6179 -0.0883 -0.0912 -0.0429 137 TYR B CE1 
3733 C CE2 . TYR B 155 ? 0.5300 0.3698 0.5200 -0.0624 -0.0899 -0.0596 137 TYR B CE2 
3734 C CZ  . TYR B 155 ? 0.5989 0.4441 0.6058 -0.0799 -0.0964 -0.0568 137 TYR B CZ  
3735 O OH  . TYR B 155 ? 0.6635 0.5148 0.6716 -0.0898 -0.1082 -0.0679 137 TYR B OH  
3736 N N   . LEU B 156 ? 0.3296 0.2391 0.3443 -0.0480 -0.0622 -0.0144 138 LEU B N   
3737 C CA  . LEU B 156 ? 0.3028 0.2324 0.3120 -0.0396 -0.0609 -0.0168 138 LEU B CA  
3738 C C   . LEU B 156 ? 0.3559 0.2813 0.3527 -0.0365 -0.0680 -0.0295 138 LEU B C   
3739 O O   . LEU B 156 ? 0.3493 0.2777 0.3325 -0.0259 -0.0653 -0.0322 138 LEU B O   
3740 C CB  . LEU B 156 ? 0.2842 0.2409 0.3070 -0.0451 -0.0598 -0.0102 138 LEU B CB  
3741 C CG  . LEU B 156 ? 0.2832 0.2467 0.3108 -0.0446 -0.0508 0.0013  138 LEU B CG  
3742 C CD1 . LEU B 156 ? 0.2705 0.2588 0.3128 -0.0517 -0.0483 0.0061  138 LEU B CD1 
3743 C CD2 . LEU B 156 ? 0.2600 0.2244 0.2771 -0.0314 -0.0453 0.0028  138 LEU B CD2 
3744 N N   . GLY B 157 ? 0.3169 0.2343 0.3168 -0.0467 -0.0770 -0.0369 139 GLY B N   
3745 C CA  . GLY B 157 ? 0.3366 0.2486 0.3220 -0.0455 -0.0859 -0.0500 139 GLY B CA  
3746 C C   . GLY B 157 ? 0.4594 0.3926 0.4370 -0.0383 -0.0887 -0.0504 139 GLY B C   
3747 O O   . GLY B 157 ? 0.3105 0.2680 0.3035 -0.0416 -0.0913 -0.0445 139 GLY B O   
3748 N N   . ALA B 158 ? 0.3382 0.2613 0.2916 -0.0280 -0.0874 -0.0568 140 ALA B N   
3749 C CA  . ALA B 158 ? 0.3959 0.3327 0.3357 -0.0206 -0.0909 -0.0566 140 ALA B CA  
3750 C C   . ALA B 158 ? 0.3700 0.3274 0.3211 -0.0153 -0.0843 -0.0441 140 ALA B C   
3751 O O   . ALA B 158 ? 0.3394 0.3122 0.2887 -0.0117 -0.0901 -0.0419 140 ALA B O   
3752 C CB  . ALA B 158 ? 0.3565 0.2759 0.2658 -0.0107 -0.0862 -0.0637 140 ALA B CB  
3753 N N   . ALA B 159 ? 0.3720 0.3286 0.3341 -0.0143 -0.0731 -0.0363 141 ALA B N   
3754 C CA  . ALA B 159 ? 0.3310 0.3035 0.3012 -0.0094 -0.0662 -0.0261 141 ALA B CA  
3755 C C   . ALA B 159 ? 0.3446 0.3404 0.3338 -0.0142 -0.0724 -0.0227 141 ALA B C   
3756 O O   . ALA B 159 ? 0.3562 0.3657 0.3482 -0.0079 -0.0703 -0.0174 141 ALA B O   
3757 C CB  . ALA B 159 ? 0.2793 0.2467 0.2578 -0.0094 -0.0558 -0.0194 141 ALA B CB  
3758 N N   . CYS B 160 ? 0.3158 0.3156 0.3194 -0.0254 -0.0797 -0.0263 142 CYS B N   
3759 C CA  . CYS B 160 ? 0.3440 0.3693 0.3707 -0.0314 -0.0852 -0.0244 142 CYS B CA  
3760 C C   . CYS B 160 ? 0.3781 0.4173 0.4015 -0.0252 -0.0968 -0.0280 142 CYS B C   
3761 O O   . CYS B 160 ? 0.4332 0.4966 0.4756 -0.0237 -0.0991 -0.0246 142 CYS B O   
3762 C CB  . CYS B 160 ? 0.3769 0.4022 0.4206 -0.0470 -0.0903 -0.0278 142 CYS B CB  
3763 S SG  . CYS B 160 ? 0.4741 0.4894 0.5277 -0.0560 -0.0778 -0.0192 142 CYS B SG  
3764 N N   . ASP B 161 ? 0.3776 0.4014 0.3763 -0.0210 -0.1043 -0.0349 143 ASP B N   
3765 C CA  . ASP B 161 ? 0.3876 0.4220 0.3788 -0.0155 -0.1182 -0.0380 143 ASP B CA  
3766 C C   . ASP B 161 ? 0.3790 0.4170 0.3589 -0.0013 -0.1140 -0.0302 143 ASP B C   
3767 O O   . ASP B 161 ? 0.4079 0.4533 0.3802 0.0053  -0.1256 -0.0303 143 ASP B O   
3768 C CB  . ASP B 161 ? 0.4253 0.4406 0.3896 -0.0171 -0.1286 -0.0489 143 ASP B CB  
3769 C CG  . ASP B 161 ? 0.4801 0.4984 0.4596 -0.0316 -0.1408 -0.0582 143 ASP B CG  
3770 O OD1 . ASP B 161 ? 0.4868 0.5162 0.4958 -0.0420 -0.1372 -0.0554 143 ASP B OD1 
3771 O OD2 . ASP B 161 ? 0.5209 0.5293 0.4811 -0.0336 -0.1540 -0.0685 143 ASP B OD2 
3772 N N   . LEU B 162 ? 0.3810 0.4125 0.3596 0.0030  -0.0986 -0.0234 144 LEU B N   
3773 C CA  . LEU B 162 ? 0.3778 0.4112 0.3490 0.0146  -0.0935 -0.0157 144 LEU B CA  
3774 C C   . LEU B 162 ? 0.3834 0.4417 0.3774 0.0183  -0.1011 -0.0126 144 LEU B C   
3775 O O   . LEU B 162 ? 0.4035 0.4802 0.4261 0.0121  -0.0986 -0.0123 144 LEU B O   
3776 C CB  . LEU B 162 ? 0.3400 0.3664 0.3133 0.0157  -0.0770 -0.0100 144 LEU B CB  
3777 C CG  . LEU B 162 ? 0.3352 0.3585 0.2993 0.0261  -0.0707 -0.0029 144 LEU B CG  
3778 C CD1 . LEU B 162 ? 0.3349 0.3420 0.2683 0.0327  -0.0737 -0.0028 144 LEU B CD1 
3779 C CD2 . LEU B 162 ? 0.2822 0.2994 0.2498 0.0250  -0.0562 0.0011  144 LEU B CD2 
3780 N N   . SER B 163 ? 0.3677 0.4268 0.3494 0.0286  -0.1100 -0.0101 145 SER B N   
3781 C CA  . SER B 163 ? 0.3877 0.4715 0.3928 0.0341  -0.1203 -0.0083 145 SER B CA  
3782 C C   . SER B 163 ? 0.4057 0.4863 0.4040 0.0488  -0.1182 -0.0001 145 SER B C   
3783 O O   . SER B 163 ? 0.4161 0.4735 0.3857 0.0541  -0.1120 0.0043  145 SER B O   
3784 C CB  . SER B 163 ? 0.3788 0.4717 0.3828 0.0322  -0.1411 -0.0142 145 SER B CB  
3785 O OG  . SER B 163 ? 0.4084 0.4812 0.3747 0.0398  -0.1487 -0.0130 145 SER B OG  
3786 N N   . LEU B 164 ? 0.3736 0.4777 0.4000 0.0551  -0.1230 0.0015  146 LEU B N   
3787 C CA  . LEU B 164 ? 0.3871 0.4881 0.4110 0.0703  -0.1229 0.0086  146 LEU B CA  
3788 C C   . LEU B 164 ? 0.3903 0.4758 0.3838 0.0793  -0.1377 0.0126  146 LEU B C   
3789 O O   . LEU B 164 ? 0.4379 0.5036 0.4104 0.0891  -0.1341 0.0202  146 LEU B O   
3790 C CB  . LEU B 164 ? 0.3847 0.5172 0.4489 0.0761  -0.1261 0.0077  146 LEU B CB  
3791 C CG  . LEU B 164 ? 0.3920 0.5231 0.4620 0.0928  -0.1235 0.0135  146 LEU B CG  
3792 C CD1 . LEU B 164 ? 0.3445 0.4544 0.4016 0.0927  -0.1038 0.0163  146 LEU B CD1 
3793 C CD2 . LEU B 164 ? 0.3722 0.5394 0.4866 0.0982  -0.1266 0.0101  146 LEU B CD2 
3794 N N   . ALA B 165 ? 0.3578 0.4507 0.3470 0.0750  -0.1544 0.0075  147 ALA B N   
3795 C CA  . ALA B 165 ? 0.3968 0.4752 0.3528 0.0826  -0.1703 0.0109  147 ALA B CA  
3796 C C   . ALA B 165 ? 0.4454 0.4887 0.3559 0.0820  -0.1594 0.0148  147 ALA B C   
3797 O O   . ALA B 165 ? 0.4824 0.5076 0.3635 0.0917  -0.1640 0.0229  147 ALA B O   
3798 C CB  . ALA B 165 ? 0.3682 0.4608 0.3269 0.0755  -0.1904 0.0024  147 ALA B CB  
3799 N N   . HIS B 166 ? 0.4152 0.4493 0.3207 0.0707  -0.1447 0.0094  148 HIS B N   
3800 C CA  . HIS B 166 ? 0.4386 0.4439 0.3071 0.0697  -0.1320 0.0120  148 HIS B CA  
3801 C C   . HIS B 166 ? 0.4785 0.4718 0.3446 0.0765  -0.1177 0.0220  148 HIS B C   
3802 O O   . HIS B 166 ? 0.4940 0.4647 0.3282 0.0804  -0.1125 0.0287  148 HIS B O   
3803 C CB  . HIS B 166 ? 0.4078 0.4086 0.2777 0.0576  -0.1204 0.0034  148 HIS B CB  
3804 C CG  . HIS B 166 ? 0.4267 0.4030 0.2662 0.0569  -0.1050 0.0052  148 HIS B CG  
3805 N ND1 . HIS B 166 ? 0.4812 0.4396 0.2816 0.0582  -0.1078 0.0037  148 HIS B ND1 
3806 C CD2 . HIS B 166 ? 0.3941 0.3626 0.2376 0.0550  -0.0866 0.0080  148 HIS B CD2 
3807 C CE1 . HIS B 166 ? 0.4892 0.4314 0.2732 0.0570  -0.0900 0.0055  148 HIS B CE1 
3808 N NE2 . HIS B 166 ? 0.4488 0.3975 0.2600 0.0550  -0.0778 0.0082  148 HIS B NE2 
3809 N N   . ILE B 167 ? 0.4706 0.4785 0.3698 0.0769  -0.1108 0.0224  149 ILE B N   
3810 C CA  . ILE B 167 ? 0.4940 0.4909 0.3943 0.0822  -0.0980 0.0297  149 ILE B CA  
3811 C C   . ILE B 167 ? 0.4880 0.4765 0.3781 0.0960  -0.1074 0.0388  149 ILE B C   
3812 O O   . ILE B 167 ? 0.4820 0.4482 0.3534 0.1001  -0.0991 0.0467  149 ILE B O   
3813 C CB  . ILE B 167 ? 0.4452 0.4599 0.3810 0.0790  -0.0891 0.0262  149 ILE B CB  
3814 C CG1 . ILE B 167 ? 0.4400 0.4560 0.3801 0.0661  -0.0789 0.0201  149 ILE B CG1 
3815 C CG2 . ILE B 167 ? 0.4503 0.4541 0.3880 0.0856  -0.0786 0.0321  149 ILE B CG2 
3816 C CD1 . ILE B 167 ? 0.4473 0.4814 0.4183 0.0611  -0.0719 0.0168  149 ILE B CD1 
3817 N N   . GLU B 168 ? 0.4925 0.4986 0.3956 0.1028  -0.1254 0.0379  150 GLU B N   
3818 C CA  . GLU B 168 ? 0.5162 0.5172 0.4157 0.1181  -0.1370 0.0467  150 GLU B CA  
3819 C C   . GLU B 168 ? 0.5869 0.5636 0.4431 0.1215  -0.1456 0.0546  150 GLU B C   
3820 O O   . GLU B 168 ? 0.6395 0.6070 0.4910 0.1298  -0.1502 0.0632  150 GLU B O   
3821 C CB  . GLU B 168 ? 0.5184 0.5520 0.4545 0.1248  -0.1532 0.0426  150 GLU B CB  
3822 C CG  . GLU B 168 ? 0.5418 0.5969 0.5199 0.1253  -0.1420 0.0379  150 GLU B CG  
3823 C CD  . GLU B 168 ? 0.6014 0.6930 0.6197 0.1309  -0.1560 0.0331  150 GLU B CD  
3824 O OE1 . GLU B 168 ? 0.6519 0.7556 0.6696 0.1274  -0.1724 0.0308  150 GLU B OE1 
3825 O OE2 . GLU B 168 ? 0.5831 0.6914 0.6340 0.1368  -0.1484 0.0311  150 GLU B OE2 
3826 N N   . GLN B 169 ? 0.5826 0.5495 0.4104 0.1122  -0.1441 0.0507  151 GLN B N   
3827 C CA  . GLN B 169 ? 0.5934 0.5368 0.3798 0.1109  -0.1443 0.0571  151 GLN B CA  
3828 C C   . GLN B 169 ? 0.5895 0.5062 0.3588 0.1142  -0.1296 0.0686  151 GLN B C   
3829 O O   . GLN B 169 ? 0.6181 0.5280 0.3927 0.1119  -0.1144 0.0687  151 GLN B O   
3830 C CB  . GLN B 169 ? 0.6259 0.5617 0.3853 0.1004  -0.1396 0.0492  151 GLN B CB  
3831 C CG  . GLN B 169 ? 0.6667 0.6211 0.4327 0.0952  -0.1557 0.0379  151 GLN B CG  
3832 C CD  . GLN B 169 ? 0.7121 0.6548 0.4501 0.0857  -0.1492 0.0287  151 GLN B CD  
3833 O OE1 . GLN B 169 ? 0.7081 0.6483 0.4536 0.0794  -0.1332 0.0238  151 GLN B OE1 
3834 N NE2 . GLN B 169 ? 0.7299 0.6670 0.4416 0.0828  -0.1581 0.0255  151 GLN B NE2 
3835 N N   . PRO B 170 ? 0.5883 0.4899 0.3377 0.1189  -0.1345 0.0787  152 PRO B N   
3836 C CA  . PRO B 170 ? 0.5987 0.4734 0.3322 0.1208  -0.1219 0.0904  152 PRO B CA  
3837 C C   . PRO B 170 ? 0.6284 0.4854 0.3409 0.1109  -0.1010 0.0906  152 PRO B C   
3838 O O   . PRO B 170 ? 0.5240 0.3688 0.2433 0.1103  -0.0879 0.0950  152 PRO B O   
3839 C CB  . PRO B 170 ? 0.6442 0.5065 0.3504 0.1241  -0.1324 0.0996  152 PRO B CB  
3840 C CG  . PRO B 170 ? 0.6509 0.5389 0.3763 0.1296  -0.1537 0.0944  152 PRO B CG  
3841 C CD  . PRO B 170 ? 0.6130 0.5227 0.3552 0.1225  -0.1536 0.0800  152 PRO B CD  
3842 N N   . HIS B 171 ? 0.6357 0.4919 0.3247 0.1030  -0.0977 0.0850  153 HIS B N   
3843 C CA  . HIS B 171 ? 0.6427 0.4843 0.3127 0.0938  -0.0767 0.0850  153 HIS B CA  
3844 C C   . HIS B 171 ? 0.6372 0.4894 0.3303 0.0904  -0.0669 0.0772  153 HIS B C   
3845 O O   . HIS B 171 ? 0.6828 0.5279 0.3741 0.0823  -0.0479 0.0770  153 HIS B O   
3846 C CB  . HIS B 171 ? 0.6674 0.5044 0.3043 0.0877  -0.0748 0.0806  153 HIS B CB  
3847 C CG  . HIS B 171 ? 0.6502 0.5052 0.2934 0.0859  -0.0848 0.0664  153 HIS B CG  
3848 N ND1 . HIS B 171 ? 0.6653 0.5336 0.3127 0.0895  -0.1062 0.0623  153 HIS B ND1 
3849 C CD2 . HIS B 171 ? 0.6136 0.4747 0.2607 0.0803  -0.0767 0.0552  153 HIS B CD2 
3850 C CE1 . HIS B 171 ? 0.6297 0.5108 0.2834 0.0850  -0.1108 0.0488  153 HIS B CE1 
3851 N NE2 . HIS B 171 ? 0.6114 0.4872 0.2640 0.0799  -0.0933 0.0443  153 HIS B NE2 
3852 N N   . VAL B 172 ? 0.5849 0.4613 0.3124 0.0925  -0.0775 0.0687  154 VAL B N   
3853 C CA  . VAL B 172 ? 0.4992 0.3927 0.2624 0.0853  -0.0668 0.0597  154 VAL B CA  
3854 C C   . VAL B 172 ? 0.4808 0.3762 0.2707 0.0897  -0.0636 0.0637  154 VAL B C   
3855 O O   . VAL B 172 ? 0.4524 0.3454 0.2546 0.0836  -0.0489 0.0627  154 VAL B O   
3856 C CB  . VAL B 172 ? 0.4874 0.4054 0.2721 0.0822  -0.0773 0.0476  154 VAL B CB  
3857 C CG1 . VAL B 172 ? 0.4060 0.3387 0.2243 0.0749  -0.0665 0.0404  154 VAL B CG1 
3858 C CG2 . VAL B 172 ? 0.5084 0.4213 0.2654 0.0776  -0.0801 0.0414  154 VAL B CG2 
3859 N N   . TRP B 173 ? 0.5087 0.4083 0.3074 0.1007  -0.0779 0.0676  155 TRP B N   
3860 C CA  . TRP B 173 ? 0.4856 0.3854 0.3082 0.1069  -0.0749 0.0700  155 TRP B CA  
3861 C C   . TRP B 173 ? 0.5205 0.3908 0.3251 0.1061  -0.0624 0.0795  155 TRP B C   
3862 O O   . TRP B 173 ? 0.5244 0.3919 0.3470 0.1051  -0.0531 0.0782  155 TRP B O   
3863 C CB  . TRP B 173 ? 0.4589 0.3689 0.2949 0.1211  -0.0929 0.0723  155 TRP B CB  
3864 C CG  . TRP B 173 ? 0.4515 0.3644 0.3153 0.1284  -0.0887 0.0718  155 TRP B CG  
3865 C CD1 . TRP B 173 ? 0.4684 0.3608 0.3271 0.1403  -0.0909 0.0805  155 TRP B CD1 
3866 C CD2 . TRP B 173 ? 0.3997 0.3347 0.2979 0.1244  -0.0807 0.0618  155 TRP B CD2 
3867 N NE1 . TRP B 173 ? 0.4497 0.3507 0.3385 0.1445  -0.0846 0.0748  155 TRP B NE1 
3868 C CE2 . TRP B 173 ? 0.4090 0.3368 0.3210 0.1346  -0.0779 0.0634  155 TRP B CE2 
3869 C CE3 . TRP B 173 ? 0.3855 0.3436 0.3020 0.1132  -0.0756 0.0519  155 TRP B CE3 
3870 C CZ2 . TRP B 173 ? 0.3892 0.3336 0.3309 0.1337  -0.0693 0.0546  155 TRP B CZ2 
3871 C CZ3 . TRP B 173 ? 0.3653 0.3391 0.3106 0.1119  -0.0676 0.0451  155 TRP B CZ3 
3872 C CH2 . TRP B 173 ? 0.3585 0.3262 0.3152 0.1220  -0.0641 0.0460  155 TRP B CH2 
3873 N N   . SER B 174 ? 0.4926 0.3403 0.2604 0.1056  -0.0618 0.0887  156 SER B N   
3874 C CA  . SER B 174 ? 0.5471 0.3659 0.2953 0.1015  -0.0480 0.0985  156 SER B CA  
3875 C C   . SER B 174 ? 0.5514 0.3744 0.3151 0.0882  -0.0292 0.0922  156 SER B C   
3876 O O   . SER B 174 ? 0.5903 0.3968 0.3565 0.0847  -0.0190 0.0966  156 SER B O   
3877 C CB  . SER B 174 ? 0.6300 0.4343 0.3434 0.0970  -0.0468 0.1055  156 SER B CB  
3878 O OG  . SER B 174 ? 0.7121 0.5009 0.4108 0.0857  -0.0277 0.1093  156 SER B OG  
3879 N N   . LEU B 175 ? 0.4823 0.3265 0.2568 0.0808  -0.0257 0.0818  157 LEU B N   
3880 C CA  . LEU B 175 ? 0.4540 0.3058 0.2464 0.0697  -0.0108 0.0755  157 LEU B CA  
3881 C C   . LEU B 175 ? 0.4160 0.2779 0.2400 0.0706  -0.0110 0.0702  157 LEU B C   
3882 O O   . LEU B 175 ? 0.3807 0.2397 0.2156 0.0631  -0.0002 0.0686  157 LEU B O   
3883 C CB  . LEU B 175 ? 0.4276 0.2974 0.2235 0.0636  -0.0087 0.0660  157 LEU B CB  
3884 C CG  . LEU B 175 ? 0.4688 0.3299 0.2326 0.0619  -0.0061 0.0678  157 LEU B CG  
3885 C CD1 . LEU B 175 ? 0.4364 0.3137 0.2091 0.0563  -0.0023 0.0564  157 LEU B CD1 
3886 C CD2 . LEU B 175 ? 0.4803 0.3202 0.2224 0.0568  0.0087  0.0772  157 LEU B CD2 
3887 N N   . VAL B 176 ? 0.3884 0.2634 0.2271 0.0795  -0.0233 0.0670  158 VAL B N   
3888 C CA  . VAL B 176 ? 0.3845 0.2691 0.2502 0.0817  -0.0226 0.0615  158 VAL B CA  
3889 C C   . VAL B 176 ? 0.4345 0.2953 0.2958 0.0868  -0.0196 0.0677  158 VAL B C   
3890 O O   . VAL B 176 ? 0.4146 0.2720 0.2882 0.0824  -0.0116 0.0637  158 VAL B O   
3891 C CB  . VAL B 176 ? 0.3323 0.2400 0.2173 0.0899  -0.0349 0.0562  158 VAL B CB  
3892 C CG1 . VAL B 176 ? 0.3168 0.2333 0.2270 0.0931  -0.0318 0.0507  158 VAL B CG1 
3893 C CG2 . VAL B 176 ? 0.3231 0.2519 0.2146 0.0827  -0.0374 0.0493  158 VAL B CG2 
3894 N N   . GLU B 177 ? 0.3983 0.2402 0.2400 0.0959  -0.0268 0.0775  159 GLU B N   
3895 C CA  . GLU B 177 ? 0.4248 0.2394 0.2606 0.1023  -0.0256 0.0845  159 GLU B CA  
3896 C C   . GLU B 177 ? 0.4468 0.2374 0.2705 0.0904  -0.0114 0.0890  159 GLU B C   
3897 O O   . GLU B 177 ? 0.4579 0.2311 0.2877 0.0909  -0.0071 0.0888  159 GLU B O   
3898 C CB  . GLU B 177 ? 0.4924 0.2915 0.3088 0.1160  -0.0388 0.0956  159 GLU B CB  
3899 C CG  . GLU B 177 ? 0.5795 0.4039 0.4147 0.1290  -0.0545 0.0909  159 GLU B CG  
3900 C CD  . GLU B 177 ? 0.7420 0.5558 0.5769 0.1424  -0.0662 0.0978  159 GLU B CD  
3901 O OE1 . GLU B 177 ? 0.8115 0.6238 0.6676 0.1515  -0.0661 0.0945  159 GLU B OE1 
3902 O OE2 . GLU B 177 ? 0.7785 0.5876 0.5941 0.1427  -0.0747 0.1054  159 GLU B OE2 
3903 N N   . LYS B 178 ? 0.4394 0.2294 0.2475 0.0794  -0.0037 0.0920  160 LYS B N   
3904 C CA  . LYS B 178 ? 0.5235 0.2950 0.3240 0.0665  0.0107  0.0962  160 LYS B CA  
3905 C C   . LYS B 178 ? 0.4549 0.2426 0.2814 0.0557  0.0190  0.0851  160 LYS B C   
3906 O O   . LYS B 178 ? 0.4584 0.2324 0.2871 0.0457  0.0286  0.0863  160 LYS B O   
3907 C CB  . LYS B 178 ? 0.5606 0.3271 0.3359 0.0590  0.0181  0.1033  160 LYS B CB  
3908 C CG  . LYS B 178 ? 0.5667 0.3618 0.3506 0.0536  0.0208  0.0939  160 LYS B CG  
3909 C CD  . LYS B 178 ? 0.6326 0.4223 0.3941 0.0450  0.0328  0.0988  160 LYS B CD  
3910 C CE  . LYS B 178 ? 0.6923 0.4649 0.4167 0.0522  0.0266  0.1090  160 LYS B CE  
3911 N NZ  . LYS B 178 ? 0.7318 0.5008 0.4317 0.0438  0.0402  0.1122  160 LYS B NZ  
3912 N N   . ALA B 179 ? 0.3849 0.2010 0.2305 0.0570  0.0147  0.0748  161 ALA B N   
3913 C CA  . ALA B 179 ? 0.3657 0.1972 0.2330 0.0477  0.0205  0.0653  161 ALA B CA  
3914 C C   . ALA B 179 ? 0.3773 0.2014 0.2572 0.0500  0.0195  0.0601  161 ALA B C   
3915 O O   . ALA B 179 ? 0.3961 0.2149 0.2768 0.0619  0.0127  0.0601  161 ALA B O   
3916 C CB  . ALA B 179 ? 0.3292 0.1898 0.2095 0.0478  0.0164  0.0574  161 ALA B CB  
3917 N N   . GLN B 180 ? 0.3484 0.1725 0.2386 0.0390  0.0261  0.0550  162 GLN B N   
3918 C CA  . GLN B 180 ? 0.3781 0.1948 0.2777 0.0398  0.0255  0.0478  162 GLN B CA  
3919 C C   . GLN B 180 ? 0.3522 0.1938 0.2682 0.0352  0.0247  0.0373  162 GLN B C   
3920 O O   . GLN B 180 ? 0.3362 0.1764 0.2583 0.0366  0.0240  0.0295  162 GLN B O   
3921 C CB  . GLN B 180 ? 0.4006 0.1915 0.2956 0.0299  0.0320  0.0501  162 GLN B CB  
3922 C CG  . GLN B 180 ? 0.4979 0.2614 0.3736 0.0314  0.0346  0.0630  162 GLN B CG  
3923 C CD  . GLN B 180 ? 0.5291 0.2761 0.3951 0.0483  0.0270  0.0674  162 GLN B CD  
3924 O OE1 . GLN B 180 ? 0.4929 0.2359 0.3674 0.0565  0.0234  0.0601  162 GLN B OE1 
3925 N NE2 . GLN B 180 ? 0.5440 0.2817 0.3916 0.0542  0.0245  0.0791  162 GLN B NE2 
3926 N N   . VAL B 181 ? 0.3130 0.1753 0.2339 0.0301  0.0250  0.0373  163 VAL B N   
3927 C CA  . VAL B 181 ? 0.2895 0.1739 0.2237 0.0255  0.0235  0.0298  163 VAL B CA  
3928 C C   . VAL B 181 ? 0.2993 0.2035 0.2363 0.0298  0.0196  0.0303  163 VAL B C   
3929 O O   . VAL B 181 ? 0.3197 0.2245 0.2502 0.0299  0.0203  0.0351  163 VAL B O   
3930 C CB  . VAL B 181 ? 0.2938 0.1822 0.2352 0.0126  0.0275  0.0286  163 VAL B CB  
3931 C CG1 . VAL B 181 ? 0.2905 0.2000 0.2434 0.0091  0.0239  0.0227  163 VAL B CG1 
3932 C CG2 . VAL B 181 ? 0.3127 0.1816 0.2530 0.0057  0.0306  0.0271  163 VAL B CG2 
3933 N N   . TYR B 182 ? 0.2806 0.1997 0.2258 0.0326  0.0159  0.0250  164 TYR B N   
3934 C CA  . TYR B 182 ? 0.2607 0.1976 0.2104 0.0347  0.0119  0.0249  164 TYR B CA  
3935 C C   . TYR B 182 ? 0.2721 0.2236 0.2311 0.0277  0.0116  0.0209  164 TYR B C   
3936 O O   . TYR B 182 ? 0.2511 0.2030 0.2127 0.0243  0.0128  0.0170  164 TYR B O   
3937 C CB  . TYR B 182 ? 0.2674 0.2108 0.2204 0.0445  0.0073  0.0239  164 TYR B CB  
3938 C CG  . TYR B 182 ? 0.3139 0.2422 0.2577 0.0535  0.0051  0.0287  164 TYR B CG  
3939 C CD1 . TYR B 182 ? 0.3199 0.2444 0.2529 0.0560  0.0014  0.0346  164 TYR B CD1 
3940 C CD2 . TYR B 182 ? 0.3380 0.2535 0.2818 0.0601  0.0062  0.0275  164 TYR B CD2 
3941 C CE1 . TYR B 182 ? 0.3555 0.2640 0.2766 0.0646  -0.0021 0.0407  164 TYR B CE1 
3942 C CE2 . TYR B 182 ? 0.3942 0.2929 0.3291 0.0696  0.0029  0.0333  164 TYR B CE2 
3943 C CZ  . TYR B 182 ? 0.3891 0.2845 0.3120 0.0717  -0.0017 0.0408  164 TYR B CZ  
3944 O OH  . TYR B 182 ? 0.4037 0.2807 0.3144 0.0813  -0.0063 0.0482  164 TYR B OH  
3945 N N   . TYR B 183 ? 0.2547 0.2160 0.2165 0.0257  0.0096  0.0221  165 TYR B N   
3946 C CA  . TYR B 183 ? 0.2345 0.2078 0.2041 0.0207  0.0078  0.0200  165 TYR B CA  
3947 C C   . TYR B 183 ? 0.2647 0.2477 0.2372 0.0228  0.0037  0.0201  165 TYR B C   
3948 O O   . TYR B 183 ? 0.2645 0.2453 0.2329 0.0248  0.0023  0.0213  165 TYR B O   
3949 C CB  . TYR B 183 ? 0.2008 0.1742 0.1742 0.0148  0.0091  0.0207  165 TYR B CB  
3950 C CG  . TYR B 183 ? 0.2020 0.1848 0.1824 0.0107  0.0055  0.0199  165 TYR B CG  
3951 C CD1 . TYR B 183 ? 0.2002 0.1843 0.1809 0.0065  0.0041  0.0183  165 TYR B CD1 
3952 C CD2 . TYR B 183 ? 0.2288 0.2167 0.2130 0.0110  0.0029  0.0208  165 TYR B CD2 
3953 C CE1 . TYR B 183 ? 0.2165 0.2070 0.1998 0.0029  -0.0002 0.0193  165 TYR B CE1 
3954 C CE2 . TYR B 183 ? 0.2417 0.2344 0.2307 0.0076  -0.0010 0.0216  165 TYR B CE2 
3955 C CZ  . TYR B 183 ? 0.2346 0.2288 0.2226 0.0036  -0.0027 0.0217  165 TYR B CZ  
3956 O OH  . TYR B 183 ? 0.2447 0.2417 0.2341 0.0004  -0.0075 0.0243  165 TYR B OH  
3957 N N   . ILE B 184 ? 0.2434 0.2364 0.2219 0.0215  0.0022  0.0185  166 ILE B N   
3958 C CA  . ILE B 184 ? 0.2464 0.2492 0.2305 0.0208  -0.0017 0.0184  166 ILE B CA  
3959 C C   . ILE B 184 ? 0.2315 0.2412 0.2203 0.0141  -0.0013 0.0187  166 ILE B C   
3960 O O   . ILE B 184 ? 0.2464 0.2598 0.2351 0.0129  0.0020  0.0177  166 ILE B O   
3961 C CB  . ILE B 184 ? 0.2701 0.2808 0.2588 0.0266  -0.0039 0.0172  166 ILE B CB  
3962 C CG1 . ILE B 184 ? 0.2234 0.2245 0.2039 0.0342  -0.0057 0.0187  166 ILE B CG1 
3963 C CG2 . ILE B 184 ? 0.2347 0.2563 0.2313 0.0237  -0.0091 0.0165  166 ILE B CG2 
3964 C CD1 . ILE B 184 ? 0.2147 0.2239 0.2013 0.0419  -0.0102 0.0181  166 ILE B CD1 
3965 N N   . ALA B 185 ? 0.2474 0.2567 0.2384 0.0101  -0.0044 0.0201  167 ALA B N   
3966 C CA  . ALA B 185 ? 0.2212 0.2335 0.2145 0.0035  -0.0049 0.0224  167 ALA B CA  
3967 C C   . ALA B 185 ? 0.2475 0.2710 0.2473 0.0005  -0.0040 0.0223  167 ALA B C   
3968 O O   . ALA B 185 ? 0.2622 0.2919 0.2683 0.0031  -0.0062 0.0201  167 ALA B O   
3969 C CB  . ALA B 185 ? 0.1981 0.2033 0.1926 0.0012  -0.0088 0.0242  167 ALA B CB  
3970 N N   . GLY B 186 ? 0.2216 0.2488 0.2199 -0.0054 -0.0009 0.0248  168 GLY B N   
3971 C CA  . GLY B 186 ? 0.2210 0.2608 0.2272 -0.0102 0.0023  0.0253  168 GLY B CA  
3972 C C   . GLY B 186 ? 0.2498 0.2909 0.2652 -0.0151 -0.0027 0.0262  168 GLY B C   
3973 O O   . GLY B 186 ? 0.2513 0.3060 0.2787 -0.0185 -0.0014 0.0251  168 GLY B O   
3974 N N   . PHE B 187 ? 0.1985 0.2256 0.2097 -0.0154 -0.0083 0.0274  169 PHE B N   
3975 C CA  . PHE B 187 ? 0.2229 0.2463 0.2402 -0.0197 -0.0138 0.0265  169 PHE B CA  
3976 C C   . PHE B 187 ? 0.2558 0.2893 0.2812 -0.0164 -0.0174 0.0209  169 PHE B C   
3977 O O   . PHE B 187 ? 0.2905 0.3266 0.3240 -0.0222 -0.0220 0.0190  169 PHE B O   
3978 C CB  . PHE B 187 ? 0.2031 0.2090 0.2141 -0.0170 -0.0182 0.0263  169 PHE B CB  
3979 C CG  . PHE B 187 ? 0.2169 0.2118 0.2234 -0.0205 -0.0185 0.0326  169 PHE B CG  
3980 C CD1 . PHE B 187 ? 0.2291 0.2175 0.2305 -0.0149 -0.0190 0.0338  169 PHE B CD1 
3981 C CD2 . PHE B 187 ? 0.2155 0.2066 0.2233 -0.0299 -0.0189 0.0381  169 PHE B CD2 
3982 C CE1 . PHE B 187 ? 0.1964 0.1755 0.1944 -0.0169 -0.0218 0.0401  169 PHE B CE1 
3983 C CE2 . PHE B 187 ? 0.2440 0.2224 0.2450 -0.0323 -0.0207 0.0455  169 PHE B CE2 
3984 C CZ  . PHE B 187 ? 0.2877 0.2605 0.2838 -0.0250 -0.0231 0.0464  169 PHE B CZ  
3985 N N   . VAL B 188 ? 0.2511 0.2888 0.2737 -0.0075 -0.0165 0.0184  170 VAL B N   
3986 C CA  . VAL B 188 ? 0.2379 0.2828 0.2647 -0.0024 -0.0221 0.0143  170 VAL B CA  
3987 C C   . VAL B 188 ? 0.2182 0.2846 0.2628 -0.0050 -0.0220 0.0132  170 VAL B C   
3988 O O   . VAL B 188 ? 0.2544 0.3307 0.3074 -0.0026 -0.0291 0.0100  170 VAL B O   
3989 C CB  . VAL B 188 ? 0.2511 0.2897 0.2670 0.0080  -0.0213 0.0137  170 VAL B CB  
3990 C CG1 . VAL B 188 ? 0.2940 0.3367 0.3095 0.0140  -0.0289 0.0110  170 VAL B CG1 
3991 C CG2 . VAL B 188 ? 0.2046 0.2263 0.2075 0.0089  -0.0196 0.0146  170 VAL B CG2 
3992 N N   . ILE B 189 ? 0.2026 0.2773 0.2533 -0.0101 -0.0139 0.0159  171 ILE B N   
3993 C CA  . ILE B 189 ? 0.2354 0.3332 0.3062 -0.0142 -0.0109 0.0149  171 ILE B CA  
3994 C C   . ILE B 189 ? 0.2495 0.3545 0.3344 -0.0241 -0.0180 0.0136  171 ILE B C   
3995 O O   . ILE B 189 ? 0.2536 0.3799 0.3585 -0.0242 -0.0214 0.0104  171 ILE B O   
3996 C CB  . ILE B 189 ? 0.2309 0.3340 0.3010 -0.0199 0.0013  0.0183  171 ILE B CB  
3997 C CG1 . ILE B 189 ? 0.1683 0.2662 0.2263 -0.0102 0.0072  0.0171  171 ILE B CG1 
3998 C CG2 . ILE B 189 ? 0.2178 0.3469 0.3108 -0.0259 0.0069  0.0173  171 ILE B CG2 
3999 C CD1 . ILE B 189 ? 0.1750 0.2738 0.2248 -0.0154 0.0183  0.0194  171 ILE B CD1 
4000 N N   . ASN B 190 ? 0.2570 0.3439 0.3327 -0.0318 -0.0212 0.0154  172 ASN B N   
4001 C CA  . ASN B 190 ? 0.2912 0.3792 0.3779 -0.0426 -0.0283 0.0134  172 ASN B CA  
4002 C C   . ASN B 190 ? 0.2900 0.3764 0.3762 -0.0382 -0.0411 0.0064  172 ASN B C   
4003 O O   . ASN B 190 ? 0.2882 0.3811 0.3871 -0.0469 -0.0487 0.0027  172 ASN B O   
4004 C CB  . ASN B 190 ? 0.3509 0.4159 0.4271 -0.0517 -0.0276 0.0176  172 ASN B CB  
4005 C CG  . ASN B 190 ? 0.3700 0.4350 0.4442 -0.0587 -0.0169 0.0258  172 ASN B CG  
4006 O OD1 . ASN B 190 ? 0.3816 0.4263 0.4406 -0.0595 -0.0156 0.0310  172 ASN B OD1 
4007 N ND2 . ASN B 190 ? 0.3559 0.4443 0.4449 -0.0633 -0.0091 0.0269  172 ASN B ND2 
4008 N N   . THR B 191 ? 0.2861 0.3630 0.3561 -0.0258 -0.0437 0.0047  173 THR B N   
4009 C CA  . THR B 191 ? 0.3175 0.3880 0.3789 -0.0216 -0.0553 -0.0013 173 THR B CA  
4010 C C   . THR B 191 ? 0.3348 0.4204 0.3996 -0.0111 -0.0613 -0.0029 173 THR B C   
4011 O O   . THR B 191 ? 0.3373 0.4285 0.4042 -0.0110 -0.0736 -0.0078 173 THR B O   
4012 C CB  . THR B 191 ? 0.3312 0.3758 0.3682 -0.0164 -0.0542 -0.0022 173 THR B CB  
4013 O OG1 . THR B 191 ? 0.3283 0.3692 0.3566 -0.0082 -0.0454 0.0026  173 THR B OG1 
4014 C CG2 . THR B 191 ? 0.3133 0.3409 0.3483 -0.0255 -0.0527 -0.0022 173 THR B CG2 
4015 N N   . CYS B 192 ? 0.3212 0.4115 0.3854 -0.0020 -0.0539 0.0010  174 CYS B N   
4016 C CA  . CYS B 192 ? 0.2857 0.3871 0.3531 0.0097  -0.0594 0.0008  174 CYS B CA  
4017 C C   . CYS B 192 ? 0.2589 0.3687 0.3343 0.0167  -0.0490 0.0039  174 CYS B C   
4018 O O   . CYS B 192 ? 0.2505 0.3467 0.3105 0.0258  -0.0453 0.0064  174 CYS B O   
4019 C CB  . CYS B 192 ? 0.2830 0.3645 0.3238 0.0184  -0.0650 0.0008  174 CYS B CB  
4020 S SG  . CYS B 192 ? 0.3753 0.4651 0.4154 0.0330  -0.0754 0.0023  174 CYS B SG  
4021 N N   . TYR B 193 ? 0.2420 0.3737 0.3413 0.0118  -0.0435 0.0034  175 TYR B N   
4022 C CA  . TYR B 193 ? 0.2624 0.4024 0.3687 0.0183  -0.0323 0.0045  175 TYR B CA  
4023 C C   . TYR B 193 ? 0.2616 0.4085 0.3736 0.0338  -0.0376 0.0035  175 TYR B C   
4024 O O   . TYR B 193 ? 0.2296 0.3663 0.3325 0.0430  -0.0311 0.0046  175 TYR B O   
4025 C CB  . TYR B 193 ? 0.1660 0.3296 0.2960 0.0092  -0.0233 0.0037  175 TYR B CB  
4026 C CG  . TYR B 193 ? 0.1645 0.3351 0.2983 0.0162  -0.0101 0.0031  175 TYR B CG  
4027 C CD1 . TYR B 193 ? 0.2101 0.3607 0.3214 0.0162  -0.0008 0.0051  175 TYR B CD1 
4028 C CD2 . TYR B 193 ? 0.1760 0.3735 0.3363 0.0235  -0.0074 -0.0004 175 TYR B CD2 
4029 C CE1 . TYR B 193 ? 0.2206 0.3750 0.3320 0.0222  0.0107  0.0029  175 TYR B CE1 
4030 C CE2 . TYR B 193 ? 0.2234 0.4255 0.3857 0.0310  0.0058  -0.0027 175 TYR B CE2 
4031 C CZ  . TYR B 193 ? 0.2494 0.4284 0.3851 0.0298  0.0149  -0.0014 175 TYR B CZ  
4032 O OH  . TYR B 193 ? 0.2735 0.4544 0.4078 0.0367  0.0275  -0.0053 175 TYR B OH  
4033 N N   . GLU B 194 ? 0.2619 0.4250 0.3891 0.0366  -0.0506 0.0016  176 GLU B N   
4034 C CA  . GLU B 194 ? 0.3287 0.4976 0.4615 0.0526  -0.0591 0.0018  176 GLU B CA  
4035 C C   . GLU B 194 ? 0.3267 0.4645 0.4274 0.0618  -0.0605 0.0060  176 GLU B C   
4036 O O   . GLU B 194 ? 0.3494 0.4816 0.4486 0.0747  -0.0585 0.0079  176 GLU B O   
4037 C CB  . GLU B 194 ? 0.4292 0.6174 0.5784 0.0526  -0.0769 -0.0005 176 GLU B CB  
4038 C CG  . GLU B 194 ? 0.5897 0.7667 0.7238 0.0397  -0.0856 -0.0022 176 GLU B CG  
4039 C CD  . GLU B 194 ? 0.7161 0.9109 0.8639 0.0390  -0.1052 -0.0058 176 GLU B CD  
4040 O OE1 . GLU B 194 ? 0.7460 0.9702 0.9251 0.0452  -0.1111 -0.0072 176 GLU B OE1 
4041 O OE2 . GLU B 194 ? 0.7504 0.9303 0.8781 0.0326  -0.1152 -0.0081 176 GLU B OE2 
4042 N N   . GLY B 195 ? 0.2988 0.4157 0.3746 0.0548  -0.0626 0.0073  177 GLY B N   
4043 C CA  . GLY B 195 ? 0.2727 0.3616 0.3186 0.0608  -0.0621 0.0115  177 GLY B CA  
4044 C C   . GLY B 195 ? 0.2664 0.3404 0.3037 0.0620  -0.0479 0.0135  177 GLY B C   
4045 O O   . GLY B 195 ? 0.2691 0.3282 0.2949 0.0714  -0.0468 0.0169  177 GLY B O   
4046 N N   . MET B 196 ? 0.2764 0.3528 0.3181 0.0520  -0.0380 0.0117  178 MET B N   
4047 C CA  . MET B 196 ? 0.2824 0.3455 0.3151 0.0516  -0.0264 0.0127  178 MET B CA  
4048 C C   . MET B 196 ? 0.2911 0.3623 0.3364 0.0603  -0.0209 0.0107  178 MET B C   
4049 O O   . MET B 196 ? 0.2870 0.3424 0.3218 0.0645  -0.0147 0.0111  178 MET B O   
4050 C CB  . MET B 196 ? 0.2528 0.3160 0.2849 0.0392  -0.0194 0.0120  178 MET B CB  
4051 C CG  . MET B 196 ? 0.2557 0.3406 0.3078 0.0325  -0.0162 0.0098  178 MET B CG  
4052 S SD  . MET B 196 ? 0.2478 0.3277 0.2949 0.0175  -0.0118 0.0116  178 MET B SD  
4053 C CE  . MET B 196 ? 0.1657 0.2317 0.1978 0.0181  -0.0021 0.0128  178 MET B CE  
4054 N N   . LEU B 197 ? 0.2488 0.3446 0.3178 0.0629  -0.0229 0.0079  179 LEU B N   
4055 C CA  . LEU B 197 ? 0.2462 0.3520 0.3301 0.0732  -0.0170 0.0047  179 LEU B CA  
4056 C C   . LEU B 197 ? 0.2755 0.3671 0.3530 0.0886  -0.0239 0.0072  179 LEU B C   
4057 O O   . LEU B 197 ? 0.2884 0.3686 0.3630 0.0969  -0.0172 0.0055  179 LEU B O   
4058 C CB  . LEU B 197 ? 0.2476 0.3875 0.3631 0.0724  -0.0169 0.0009  179 LEU B CB  
4059 C CG  . LEU B 197 ? 0.2725 0.4277 0.4081 0.0838  -0.0085 -0.0040 179 LEU B CG  
4060 C CD1 . LEU B 197 ? 0.2923 0.4355 0.4144 0.0803  0.0075  -0.0072 179 LEU B CD1 
4061 C CD2 . LEU B 197 ? 0.2276 0.4209 0.3987 0.0819  -0.0081 -0.0075 179 LEU B CD2 
4062 N N   . LYS B 198 ? 0.2799 0.3694 0.3526 0.0920  -0.0376 0.0112  180 LYS B N   
4063 C CA  . LYS B 198 ? 0.3113 0.3852 0.3746 0.1066  -0.0460 0.0158  180 LYS B CA  
4064 C C   . LYS B 198 ? 0.2867 0.3265 0.3217 0.1061  -0.0396 0.0199  180 LYS B C   
4065 O O   . LYS B 198 ? 0.3174 0.3403 0.3470 0.1171  -0.0391 0.0223  180 LYS B O   
4066 C CB  . LYS B 198 ? 0.3171 0.3948 0.3755 0.1087  -0.0630 0.0196  180 LYS B CB  
4067 C CG  . LYS B 198 ? 0.3742 0.4392 0.4251 0.1253  -0.0742 0.0257  180 LYS B CG  
4068 C CD  . LYS B 198 ? 0.4688 0.5340 0.5065 0.1259  -0.0917 0.0298  180 LYS B CD  
4069 C CE  . LYS B 198 ? 0.5463 0.6000 0.5763 0.1433  -0.1051 0.0373  180 LYS B CE  
4070 N NZ  . LYS B 198 ? 0.5760 0.6548 0.6427 0.1574  -0.1101 0.0342  180 LYS B NZ  
4071 N N   . ILE B 199 ? 0.2808 0.3108 0.2998 0.0930  -0.0347 0.0206  181 ILE B N   
4072 C CA  . ILE B 199 ? 0.2957 0.2978 0.2925 0.0900  -0.0276 0.0238  181 ILE B CA  
4073 C C   . ILE B 199 ? 0.2733 0.2704 0.2753 0.0903  -0.0165 0.0191  181 ILE B C   
4074 O O   . ILE B 199 ? 0.2821 0.2564 0.2728 0.0945  -0.0132 0.0209  181 ILE B O   
4075 C CB  . ILE B 199 ? 0.2800 0.2770 0.2633 0.0771  -0.0253 0.0248  181 ILE B CB  
4076 C CG1 . ILE B 199 ? 0.3195 0.3132 0.2895 0.0783  -0.0353 0.0288  181 ILE B CG1 
4077 C CG2 . ILE B 199 ? 0.2973 0.2725 0.2657 0.0721  -0.0163 0.0266  181 ILE B CG2 
4078 C CD1 . ILE B 199 ? 0.3127 0.3027 0.2712 0.0675  -0.0327 0.0280  181 ILE B CD1 
4079 N N   . ALA B 200 ? 0.2354 0.2522 0.2526 0.0851  -0.0106 0.0131  182 ALA B N   
4080 C CA  . ALA B 200 ? 0.2292 0.2423 0.2478 0.0845  0.0000  0.0073  182 ALA B CA  
4081 C C   . ALA B 200 ? 0.2503 0.2583 0.2766 0.0996  0.0010  0.0045  182 ALA B C   
4082 O O   . ALA B 200 ? 0.2750 0.2621 0.2914 0.1020  0.0067  0.0018  182 ALA B O   
4083 C CB  . ALA B 200 ? 0.2248 0.2610 0.2557 0.0762  0.0062  0.0025  182 ALA B CB  
4084 N N   . LYS B 201 ? 0.2484 0.2750 0.2935 0.1101  -0.0055 0.0046  183 LYS B N   
4085 C CA  . LYS B 201 ? 0.3150 0.3380 0.3711 0.1274  -0.0062 0.0023  183 LYS B CA  
4086 C C   . LYS B 201 ? 0.3430 0.3312 0.3788 0.1346  -0.0114 0.0091  183 LYS B C   
4087 O O   . LYS B 201 ? 0.3426 0.3118 0.3764 0.1442  -0.0073 0.0063  183 LYS B O   
4088 C CB  . LYS B 201 ? 0.3483 0.4009 0.4315 0.1373  -0.0150 0.0023  183 LYS B CB  
4089 C CG  . LYS B 201 ? 0.3449 0.4327 0.4539 0.1325  -0.0066 -0.0053 183 LYS B CG  
4090 C CD  . LYS B 201 ? 0.3331 0.4536 0.4736 0.1409  -0.0162 -0.0055 183 LYS B CD  
4091 C CE  . LYS B 201 ? 0.3311 0.4874 0.4986 0.1338  -0.0054 -0.0126 183 LYS B CE  
4092 N NZ  . LYS B 201 ? 0.3475 0.5398 0.5495 0.1383  -0.0154 -0.0130 183 LYS B NZ  
4093 N N   . HIS B 202 ? 0.3470 0.3251 0.3662 0.1293  -0.0197 0.0178  184 HIS B N   
4094 C CA  . HIS B 202 ? 0.3707 0.3151 0.3673 0.1335  -0.0236 0.0262  184 HIS B CA  
4095 C C   . HIS B 202 ? 0.3769 0.2954 0.3577 0.1243  -0.0127 0.0245  184 HIS B C   
4096 O O   . HIS B 202 ? 0.3460 0.2356 0.3160 0.1303  -0.0117 0.0274  184 HIS B O   
4097 C CB  . HIS B 202 ? 0.4054 0.3471 0.3853 0.1280  -0.0325 0.0350  184 HIS B CB  
4098 C CG  . HIS B 202 ? 0.3395 0.2465 0.2916 0.1260  -0.0315 0.0440  184 HIS B CG  
4099 N ND1 . HIS B 202 ? 0.3711 0.2561 0.3112 0.1384  -0.0393 0.0529  184 HIS B ND1 
4100 C CD2 . HIS B 202 ? 0.3380 0.2288 0.2732 0.1126  -0.0231 0.0460  184 HIS B CD2 
4101 C CE1 . HIS B 202 ? 0.4160 0.2714 0.3309 0.1314  -0.0346 0.0605  184 HIS B CE1 
4102 N NE2 . HIS B 202 ? 0.3683 0.2284 0.2817 0.1157  -0.0244 0.0559  184 HIS B NE2 
4103 N N   . SER B 203 ? 0.2995 0.2279 0.2793 0.1096  -0.0058 0.0200  185 SER B N   
4104 C CA  . SER B 203 ? 0.3677 0.2769 0.3355 0.0993  0.0027  0.0174  185 SER B CA  
4105 C C   . SER B 203 ? 0.3704 0.2680 0.3421 0.1058  0.0090  0.0089  185 SER B C   
4106 O O   . SER B 203 ? 0.3656 0.2341 0.3254 0.1050  0.0116  0.0094  185 SER B O   
4107 C CB  . SER B 203 ? 0.3241 0.2502 0.2934 0.0845  0.0068  0.0139  185 SER B CB  
4108 O OG  . SER B 203 ? 0.3248 0.2356 0.2851 0.0749  0.0130  0.0105  185 SER B OG  
4109 N N   . LEU B 204 ? 0.3099 0.2298 0.2982 0.1115  0.0122  0.0007  186 LEU B N   
4110 C CA  . LEU B 204 ? 0.3256 0.2373 0.3170 0.1179  0.0202  -0.0098 186 LEU B CA  
4111 C C   . LEU B 204 ? 0.3850 0.2726 0.3769 0.1346  0.0171  -0.0082 186 LEU B C   
4112 O O   . LEU B 204 ? 0.4360 0.2959 0.4184 0.1363  0.0218  -0.0135 186 LEU B O   
4113 C CB  . LEU B 204 ? 0.3124 0.2565 0.3224 0.1210  0.0260  -0.0182 186 LEU B CB  
4114 C CG  . LEU B 204 ? 0.3856 0.3246 0.3937 0.1232  0.0375  -0.0312 186 LEU B CG  
4115 C CD1 . LEU B 204 ? 0.3623 0.2864 0.3492 0.1066  0.0411  -0.0342 186 LEU B CD1 
4116 C CD2 . LEU B 204 ? 0.3636 0.3371 0.3909 0.1267  0.0452  -0.0382 186 LEU B CD2 
4117 N N   . GLU B 205 ? 0.3842 0.2809 0.3864 0.1468  0.0079  -0.0009 187 GLU B N   
4118 C CA  . GLU B 205 ? 0.4451 0.3191 0.4481 0.1646  0.0021  0.0031  187 GLU B CA  
4119 C C   . GLU B 205 ? 0.4496 0.2807 0.4272 0.1596  0.0009  0.0111  187 GLU B C   
4120 O O   . GLU B 205 ? 0.5120 0.3129 0.4853 0.1702  0.0014  0.0105  187 GLU B O   
4121 C CB  . GLU B 205 ? 0.5075 0.4007 0.5235 0.1765  -0.0108 0.0114  187 GLU B CB  
4122 C CG  . GLU B 205 ? 0.6471 0.5530 0.6890 0.1981  -0.0132 0.0061  187 GLU B CG  
4123 C CD  . GLU B 205 ? 0.7682 0.6650 0.8112 0.2131  -0.0289 0.0178  187 GLU B CD  
4124 O OE1 . GLU B 205 ? 0.8274 0.7220 0.8548 0.2071  -0.0391 0.0291  187 GLU B OE1 
4125 O OE2 . GLU B 205 ? 0.7965 0.6902 0.8559 0.2256  -0.0304 0.0156  187 GLU B OE2 
4126 N N   . ASN B 206 ? 0.4194 0.2473 0.3812 0.1434  0.0002  0.0184  188 ASN B N   
4127 C CA  . ASN B 206 ? 0.4700 0.2607 0.4096 0.1361  0.0009  0.0267  188 ASN B CA  
4128 C C   . ASN B 206 ? 0.4692 0.2477 0.4012 0.1193  0.0104  0.0195  188 ASN B C   
4129 O O   . ASN B 206 ? 0.4365 0.1908 0.3535 0.1084  0.0123  0.0259  188 ASN B O   
4130 C CB  . ASN B 206 ? 0.4645 0.2560 0.3902 0.1303  -0.0053 0.0404  188 ASN B CB  
4131 C CG  . ASN B 206 ? 0.4368 0.2308 0.3636 0.1471  -0.0174 0.0491  188 ASN B CG  
4132 O OD1 . ASN B 206 ? 0.4391 0.2653 0.3821 0.1530  -0.0236 0.0463  188 ASN B OD1 
4133 N ND2 . ASN B 206 ? 0.4740 0.2334 0.3838 0.1544  -0.0218 0.0601  188 ASN B ND2 
4134 N N   . GLU B 207 ? 0.4546 0.2509 0.3971 0.1168  0.0162  0.0062  189 GLU B N   
4135 C CA  . GLU B 207 ? 0.4474 0.2348 0.3829 0.1018  0.0230  -0.0022 189 GLU B CA  
4136 C C   . GLU B 207 ? 0.4176 0.2100 0.3458 0.0836  0.0228  0.0044  189 GLU B C   
4137 O O   . GLU B 207 ? 0.4169 0.1899 0.3368 0.0713  0.0255  0.0038  189 GLU B O   
4138 C CB  . GLU B 207 ? 0.4674 0.2150 0.3937 0.1043  0.0258  -0.0067 189 GLU B CB  
4139 C CG  . GLU B 207 ? 0.5606 0.3022 0.4953 0.1232  0.0279  -0.0165 189 GLU B CG  
4140 C CD  . GLU B 207 ? 0.6515 0.4157 0.5930 0.1224  0.0351  -0.0325 189 GLU B CD  
4141 O OE1 . GLU B 207 ? 0.6537 0.4409 0.5939 0.1082  0.0368  -0.0345 189 GLU B OE1 
4142 O OE2 . GLU B 207 ? 0.7133 0.4712 0.6606 0.1367  0.0396  -0.0430 189 GLU B OE2 
4143 N N   . LYS B 208 ? 0.3912 0.2106 0.3247 0.0821  0.0195  0.0100  190 LYS B N   
4144 C CA  . LYS B 208 ? 0.3778 0.2056 0.3073 0.0672  0.0200  0.0149  190 LYS B CA  
4145 C C   . LYS B 208 ? 0.3715 0.2215 0.3077 0.0576  0.0222  0.0063  190 LYS B C   
4146 O O   . LYS B 208 ? 0.3869 0.2449 0.3278 0.0620  0.0243  -0.0028 190 LYS B O   
4147 C CB  . LYS B 208 ? 0.3363 0.1767 0.2646 0.0708  0.0150  0.0247  190 LYS B CB  
4148 C CG  . LYS B 208 ? 0.3645 0.1801 0.2803 0.0789  0.0118  0.0352  190 LYS B CG  
4149 C CD  . LYS B 208 ? 0.3591 0.1869 0.2700 0.0831  0.0054  0.0437  190 LYS B CD  
4150 C CE  . LYS B 208 ? 0.3929 0.1937 0.2866 0.0913  0.0013  0.0555  190 LYS B CE  
4151 N NZ  . LYS B 208 ? 0.3933 0.2027 0.2755 0.0931  -0.0050 0.0637  190 LYS B NZ  
4152 N N   . LEU B 209 ? 0.3348 0.1940 0.2708 0.0452  0.0223  0.0093  191 LEU B N   
4153 C CA  . LEU B 209 ? 0.3396 0.2170 0.2804 0.0361  0.0226  0.0032  191 LEU B CA  
4154 C C   . LEU B 209 ? 0.3595 0.2628 0.3072 0.0370  0.0200  0.0063  191 LEU B C   
4155 O O   . LEU B 209 ? 0.3476 0.2557 0.2957 0.0333  0.0185  0.0127  191 LEU B O   
4156 C CB  . LEU B 209 ? 0.3531 0.2243 0.2927 0.0221  0.0232  0.0037  191 LEU B CB  
4157 C CG  . LEU B 209 ? 0.3134 0.1990 0.2560 0.0130  0.0212  -0.0028 191 LEU B CG  
4158 C CD1 . LEU B 209 ? 0.3083 0.1806 0.2437 0.0116  0.0220  -0.0132 191 LEU B CD1 
4159 C CD2 . LEU B 209 ? 0.3013 0.1926 0.2503 0.0011  0.0197  0.0007  191 LEU B CD2 
4160 N N   . PHE B 210 ? 0.3348 0.2539 0.2877 0.0413  0.0203  0.0014  192 PHE B N   
4161 C CA  . PHE B 210 ? 0.3031 0.2450 0.2635 0.0406  0.0178  0.0041  192 PHE B CA  
4162 C C   . PHE B 210 ? 0.3001 0.2533 0.2604 0.0307  0.0181  0.0016  192 PHE B C   
4163 O O   . PHE B 210 ? 0.2326 0.1875 0.1894 0.0292  0.0210  -0.0046 192 PHE B O   
4164 C CB  . PHE B 210 ? 0.2364 0.1914 0.2057 0.0508  0.0180  0.0021  192 PHE B CB  
4165 C CG  . PHE B 210 ? 0.3202 0.2960 0.2984 0.0494  0.0143  0.0056  192 PHE B CG  
4166 C CD1 . PHE B 210 ? 0.3145 0.2912 0.2942 0.0541  0.0085  0.0110  192 PHE B CD1 
4167 C CD2 . PHE B 210 ? 0.3125 0.3046 0.2952 0.0428  0.0163  0.0035  192 PHE B CD2 
4168 C CE1 . PHE B 210 ? 0.2971 0.2909 0.2843 0.0518  0.0042  0.0126  192 PHE B CE1 
4169 C CE2 . PHE B 210 ? 0.2785 0.2866 0.2696 0.0402  0.0128  0.0065  192 PHE B CE2 
4170 C CZ  . PHE B 210 ? 0.2983 0.3072 0.2924 0.0445  0.0065  0.0103  192 PHE B CZ  
4171 N N   . CYS B 211 ? 0.2136 0.1735 0.1763 0.0246  0.0149  0.0064  193 CYS B N   
4172 C CA  . CYS B 211 ? 0.2343 0.2030 0.1970 0.0163  0.0131  0.0059  193 CYS B CA  
4173 C C   . CYS B 211 ? 0.2621 0.2463 0.2305 0.0161  0.0114  0.0088  193 CYS B C   
4174 O O   . CYS B 211 ? 0.2466 0.2341 0.2198 0.0184  0.0092  0.0124  193 CYS B O   
4175 C CB  . CYS B 211 ? 0.2201 0.1842 0.1843 0.0098  0.0107  0.0085  193 CYS B CB  
4176 S SG  . CYS B 211 ? 0.3006 0.2458 0.2609 0.0069  0.0130  0.0060  193 CYS B SG  
4177 N N   . PHE B 212 ? 0.2589 0.2510 0.2249 0.0125  0.0126  0.0071  194 PHE B N   
4178 C CA  . PHE B 212 ? 0.2695 0.2748 0.2408 0.0106  0.0122  0.0101  194 PHE B CA  
4179 C C   . PHE B 212 ? 0.2826 0.2891 0.2486 0.0025  0.0091  0.0134  194 PHE B C   
4180 O O   . PHE B 212 ? 0.3220 0.3236 0.2780 -0.0012 0.0086  0.0116  194 PHE B O   
4181 C CB  . PHE B 212 ? 0.2298 0.2446 0.2035 0.0141  0.0185  0.0062  194 PHE B CB  
4182 C CG  . PHE B 212 ? 0.2006 0.2308 0.1833 0.0110  0.0194  0.0091  194 PHE B CG  
4183 C CD1 . PHE B 212 ? 0.1921 0.2273 0.1856 0.0122  0.0145  0.0121  194 PHE B CD1 
4184 C CD2 . PHE B 212 ? 0.2370 0.2760 0.2162 0.0061  0.0257  0.0084  194 PHE B CD2 
4185 C CE1 . PHE B 212 ? 0.1862 0.2350 0.1898 0.0076  0.0147  0.0141  194 PHE B CE1 
4186 C CE2 . PHE B 212 ? 0.2418 0.2950 0.2310 0.0013  0.0276  0.0117  194 PHE B CE2 
4187 C CZ  . PHE B 212 ? 0.1884 0.2464 0.1912 0.0017  0.0216  0.0144  194 PHE B CZ  
4188 N N   . ASN B 213 ? 0.2480 0.2593 0.2198 -0.0001 0.0060  0.0183  195 ASN B N   
4189 C CA  . ASN B 213 ? 0.2399 0.2499 0.2068 -0.0067 0.0021  0.0231  195 ASN B CA  
4190 C C   . ASN B 213 ? 0.2573 0.2746 0.2245 -0.0112 0.0049  0.0265  195 ASN B C   
4191 O O   . ASN B 213 ? 0.2902 0.3136 0.2680 -0.0103 0.0057  0.0266  195 ASN B O   
4192 C CB  . ASN B 213 ? 0.2070 0.2121 0.1807 -0.0061 -0.0042 0.0263  195 ASN B CB  
4193 C CG  . ASN B 213 ? 0.2446 0.2459 0.2141 -0.0102 -0.0104 0.0310  195 ASN B CG  
4194 O OD1 . ASN B 213 ? 0.2297 0.2308 0.1918 -0.0149 -0.0113 0.0354  195 ASN B OD1 
4195 N ND2 . ASN B 213 ? 0.2659 0.2646 0.2409 -0.0086 -0.0149 0.0306  195 ASN B ND2 
4196 N N   . LEU B 214 ? 0.2579 0.2742 0.2125 -0.0171 0.0061  0.0294  196 LEU B N   
4197 C CA  . LEU B 214 ? 0.2648 0.2868 0.2181 -0.0236 0.0103  0.0342  196 LEU B CA  
4198 C C   . LEU B 214 ? 0.2717 0.2892 0.2335 -0.0269 0.0043  0.0406  196 LEU B C   
4199 O O   . LEU B 214 ? 0.2633 0.2862 0.2313 -0.0323 0.0077  0.0433  196 LEU B O   
4200 C CB  . LEU B 214 ? 0.2914 0.3104 0.2240 -0.0296 0.0130  0.0372  196 LEU B CB  
4201 C CG  . LEU B 214 ? 0.3198 0.3421 0.2417 -0.0269 0.0206  0.0290  196 LEU B CG  
4202 C CD1 . LEU B 214 ? 0.3090 0.3273 0.2053 -0.0337 0.0235  0.0316  196 LEU B CD1 
4203 C CD2 . LEU B 214 ? 0.3189 0.3554 0.2551 -0.0229 0.0310  0.0232  196 LEU B CD2 
4204 N N   . SER B 215 ? 0.2530 0.2606 0.2163 -0.0239 -0.0040 0.0422  197 SER B N   
4205 C CA  . SER B 215 ? 0.2851 0.2858 0.2577 -0.0240 -0.0097 0.0452  197 SER B CA  
4206 C C   . SER B 215 ? 0.2993 0.2911 0.2669 -0.0313 -0.0125 0.0540  197 SER B C   
4207 O O   . SER B 215 ? 0.3021 0.2820 0.2694 -0.0297 -0.0200 0.0583  197 SER B O   
4208 C CB  . SER B 215 ? 0.3205 0.3276 0.3060 -0.0217 -0.0078 0.0401  197 SER B CB  
4209 O OG  . SER B 215 ? 0.3478 0.3568 0.3361 -0.0139 -0.0075 0.0341  197 SER B OG  
4210 N N   . ALA B 216 ? 0.2822 0.2793 0.2469 -0.0392 -0.0061 0.0571  198 ALA B N   
4211 C CA  . ALA B 216 ? 0.3030 0.2891 0.2610 -0.0479 -0.0076 0.0669  198 ALA B CA  
4212 C C   . ALA B 216 ? 0.3382 0.3331 0.2873 -0.0572 0.0027  0.0706  198 ALA B C   
4213 O O   . ALA B 216 ? 0.3052 0.3174 0.2632 -0.0572 0.0113  0.0641  198 ALA B O   
4214 C CB  . ALA B 216 ? 0.2907 0.2698 0.2631 -0.0501 -0.0113 0.0668  198 ALA B CB  
4215 N N   . PRO B 217 ? 0.3424 0.3252 0.2737 -0.0648 0.0022  0.0815  199 PRO B N   
4216 C CA  . PRO B 217 ? 0.3586 0.3482 0.2772 -0.0751 0.0140  0.0865  199 PRO B CA  
4217 C C   . PRO B 217 ? 0.3514 0.3563 0.2898 -0.0826 0.0239  0.0841  199 PRO B C   
4218 O O   . PRO B 217 ? 0.3635 0.3861 0.3019 -0.0859 0.0366  0.0809  199 PRO B O   
4219 C CB  . PRO B 217 ? 0.3512 0.3188 0.2493 -0.0823 0.0084  0.1012  199 PRO B CB  
4220 C CG  . PRO B 217 ? 0.3288 0.2830 0.2242 -0.0720 -0.0066 0.1015  199 PRO B CG  
4221 C CD  . PRO B 217 ? 0.2983 0.2600 0.2197 -0.0632 -0.0097 0.0903  199 PRO B CD  
4222 N N   . PHE B 218 ? 0.2919 0.2913 0.2481 -0.0851 0.0181  0.0844  200 PHE B N   
4223 C CA  . PHE B 218 ? 0.3859 0.4003 0.3627 -0.0945 0.0253  0.0825  200 PHE B CA  
4224 C C   . PHE B 218 ? 0.3639 0.4057 0.3601 -0.0879 0.0310  0.0703  200 PHE B C   
4225 O O   . PHE B 218 ? 0.3710 0.4331 0.3835 -0.0952 0.0402  0.0686  200 PHE B O   
4226 C CB  . PHE B 218 ? 0.3821 0.3814 0.3718 -0.0996 0.0161  0.0843  200 PHE B CB  
4227 C CG  . PHE B 218 ? 0.3872 0.3842 0.3886 -0.0877 0.0056  0.0741  200 PHE B CG  
4228 C CD1 . PHE B 218 ? 0.3575 0.3747 0.3790 -0.0847 0.0059  0.0636  200 PHE B CD1 
4229 C CD2 . PHE B 218 ? 0.3786 0.3539 0.3711 -0.0796 -0.0046 0.0754  200 PHE B CD2 
4230 C CE1 . PHE B 218 ? 0.3464 0.3597 0.3736 -0.0744 -0.0032 0.0552  200 PHE B CE1 
4231 C CE2 . PHE B 218 ? 0.3622 0.3360 0.3637 -0.0693 -0.0119 0.0659  200 PHE B CE2 
4232 C CZ  . PHE B 218 ? 0.3243 0.3159 0.3407 -0.0672 -0.0109 0.0561  200 PHE B CZ  
4233 N N   . LEU B 219 ? 0.3395 0.3822 0.3354 -0.0741 0.0254  0.0624  201 LEU B N   
4234 C CA  . LEU B 219 ? 0.2951 0.3595 0.3069 -0.0659 0.0291  0.0520  201 LEU B CA  
4235 C C   . LEU B 219 ? 0.3196 0.4004 0.3268 -0.0660 0.0430  0.0500  201 LEU B C   
4236 O O   . LEU B 219 ? 0.3058 0.4094 0.3324 -0.0646 0.0501  0.0441  201 LEU B O   
4237 C CB  . LEU B 219 ? 0.2667 0.3238 0.2760 -0.0523 0.0205  0.0457  201 LEU B CB  
4238 C CG  . LEU B 219 ? 0.2541 0.2993 0.2703 -0.0503 0.0090  0.0446  201 LEU B CG  
4239 C CD1 . LEU B 219 ? 0.2359 0.2704 0.2441 -0.0391 0.0030  0.0412  201 LEU B CD1 
4240 C CD2 . LEU B 219 ? 0.2467 0.3072 0.2843 -0.0510 0.0070  0.0388  201 LEU B CD2 
4241 N N   . SER B 220 ? 0.3282 0.3974 0.3095 -0.0672 0.0464  0.0543  202 SER B N   
4242 C CA  . SER B 220 ? 0.3715 0.4530 0.3426 -0.0680 0.0607  0.0517  202 SER B CA  
4243 C C   . SER B 220 ? 0.3983 0.4932 0.3754 -0.0816 0.0738  0.0574  202 SER B C   
4244 O O   . SER B 220 ? 0.4151 0.5308 0.3986 -0.0816 0.0885  0.0522  202 SER B O   
4245 C CB  . SER B 220 ? 0.4286 0.4923 0.3664 -0.0670 0.0590  0.0546  202 SER B CB  
4246 O OG  . SER B 220 ? 0.4621 0.5201 0.3974 -0.0550 0.0516  0.0466  202 SER B OG  
4247 N N   . GLN B 221 ? 0.4231 0.5058 0.3991 -0.0933 0.0694  0.0678  203 GLN B N   
4248 C CA  . GLN B 221 ? 0.4672 0.5589 0.4468 -0.1092 0.0821  0.0755  203 GLN B CA  
4249 C C   . GLN B 221 ? 0.4237 0.5415 0.4422 -0.1135 0.0858  0.0702  203 GLN B C   
4250 O O   . GLN B 221 ? 0.4261 0.5668 0.4571 -0.1220 0.1015  0.0702  203 GLN B O   
4251 C CB  . GLN B 221 ? 0.5162 0.5802 0.4777 -0.1208 0.0754  0.0901  203 GLN B CB  
4252 C CG  . GLN B 221 ? 0.5916 0.6317 0.5148 -0.1179 0.0706  0.0973  203 GLN B CG  
4253 C CD  . GLN B 221 ? 0.6295 0.6398 0.5379 -0.1258 0.0602  0.1119  203 GLN B CD  
4254 O OE1 . GLN B 221 ? 0.6230 0.6252 0.5501 -0.1292 0.0525  0.1137  203 GLN B OE1 
4255 N NE2 . GLN B 221 ? 0.6630 0.6551 0.5363 -0.1281 0.0591  0.1221  203 GLN B NE2 
4256 N N   . PHE B 222 ? 0.3994 0.5150 0.4371 -0.1079 0.0714  0.0652  204 PHE B N   
4257 C CA  . PHE B 222 ? 0.4406 0.5780 0.5138 -0.1135 0.0705  0.0608  204 PHE B CA  
4258 C C   . PHE B 222 ? 0.4433 0.6015 0.5391 -0.0983 0.0652  0.0482  204 PHE B C   
4259 O O   . PHE B 222 ? 0.4317 0.6125 0.5586 -0.1010 0.0632  0.0434  204 PHE B O   
4260 C CB  . PHE B 222 ? 0.4758 0.5923 0.5522 -0.1229 0.0576  0.0660  204 PHE B CB  
4261 C CG  . PHE B 222 ? 0.5461 0.6388 0.6010 -0.1373 0.0615  0.0799  204 PHE B CG  
4262 C CD1 . PHE B 222 ? 0.5832 0.6874 0.6355 -0.1511 0.0786  0.0873  204 PHE B CD1 
4263 C CD2 . PHE B 222 ? 0.5645 0.6230 0.6010 -0.1364 0.0487  0.0860  204 PHE B CD2 
4264 C CE1 . PHE B 222 ? 0.6185 0.6978 0.6472 -0.1647 0.0819  0.1020  204 PHE B CE1 
4265 C CE2 . PHE B 222 ? 0.6088 0.6429 0.6248 -0.1484 0.0508  0.1001  204 PHE B CE2 
4266 C CZ  . PHE B 222 ? 0.6321 0.6752 0.6425 -0.1629 0.0670  0.1088  204 PHE B CZ  
4267 N N   . ASN B 223 ? 0.4700 0.6197 0.5500 -0.0829 0.0620  0.0434  205 ASN B N   
4275 N N   . THR B 224 ? 0.4409 0.5841 0.5872 -0.0621 0.0336  0.0696  206 THR B N   
4276 C CA  . THR B 224 ? 0.3611 0.5102 0.4782 -0.0467 0.0502  0.0738  206 THR B CA  
4277 C C   . THR B 224 ? 0.3506 0.5200 0.4603 -0.0319 0.0569  0.0653  206 THR B C   
4278 O O   . THR B 224 ? 0.3542 0.5113 0.4360 -0.0173 0.0617  0.0559  206 THR B O   
4279 C CB  . THR B 224 ? 0.3401 0.5104 0.4622 -0.0511 0.0637  0.0976  206 THR B CB  
4280 O OG1 . THR B 224 ? 0.3297 0.4834 0.4659 -0.0676 0.0556  0.1108  206 THR B OG1 
4281 C CG2 . THR B 224 ? 0.3387 0.5076 0.4245 -0.0344 0.0781  0.0973  206 THR B CG2 
4282 N N   . LYS B 225 ? 0.3423 0.5423 0.4793 -0.0361 0.0560  0.0697  207 LYS B N   
4283 C CA  . LYS B 225 ? 0.3706 0.5917 0.5059 -0.0218 0.0605  0.0639  207 LYS B CA  
4284 C C   . LYS B 225 ? 0.3328 0.5320 0.4493 -0.0141 0.0507  0.0456  207 LYS B C   
4285 O O   . LYS B 225 ? 0.3419 0.5375 0.4387 0.0015  0.0564  0.0407  207 LYS B O   
4286 C CB  . LYS B 225 ? 0.4242 0.6834 0.5969 -0.0300 0.0574  0.0720  207 LYS B CB  
4287 C CG  . LYS B 225 ? 0.4972 0.7764 0.6728 -0.0167 0.0561  0.0652  207 LYS B CG  
4288 C CD  . LYS B 225 ? 0.5697 0.8521 0.7623 -0.0271 0.0370  0.0558  207 LYS B CD  
4289 C CE  . LYS B 225 ? 0.6125 0.9154 0.8436 -0.0481 0.0291  0.0651  207 LYS B CE  
4290 N NZ  . LYS B 225 ? 0.6394 0.9418 0.8843 -0.0588 0.0079  0.0518  207 LYS B NZ  
4291 N N   . GLU B 226 ? 0.2829 0.4676 0.4057 -0.0249 0.0356  0.0358  208 GLU B N   
4292 C CA  . GLU B 226 ? 0.3001 0.4712 0.4061 -0.0189 0.0268  0.0198  208 GLU B CA  
4293 C C   . GLU B 226 ? 0.2832 0.4260 0.3580 -0.0099 0.0317  0.0145  208 GLU B C   
4294 O O   . GLU B 226 ? 0.2838 0.4227 0.3416 0.0004  0.0324  0.0090  208 GLU B O   
4295 C CB  . GLU B 226 ? 0.3354 0.5002 0.4542 -0.0311 0.0101  0.0077  208 GLU B CB  
4296 C CG  . GLU B 226 ? 0.3679 0.5613 0.5155 -0.0397 0.0005  0.0081  208 GLU B CG  
4297 C CD  . GLU B 226 ? 0.4525 0.6561 0.6316 -0.0549 -0.0001 0.0215  208 GLU B CD  
4298 O OE1 . GLU B 226 ? 0.4564 0.6506 0.6333 -0.0568 0.0103  0.0344  208 GLU B OE1 
4299 O OE2 . GLU B 226 ? 0.5279 0.7507 0.7345 -0.0661 -0.0118 0.0203  208 GLU B OE2 
4300 N N   . VAL B 227 ? 0.2639 0.3879 0.3332 -0.0147 0.0340  0.0181  209 VAL B N   
4301 C CA  . VAL B 227 ? 0.2272 0.3267 0.2694 -0.0074 0.0375  0.0142  209 VAL B CA  
4302 C C   . VAL B 227 ? 0.2468 0.3496 0.2710 0.0061  0.0490  0.0176  209 VAL B C   
4303 O O   . VAL B 227 ? 0.2702 0.3596 0.2759 0.0140  0.0481  0.0103  209 VAL B O   
4304 C CB  . VAL B 227 ? 0.3054 0.3876 0.3470 -0.0148 0.0371  0.0206  209 VAL B CB  
4305 C CG1 . VAL B 227 ? 0.2202 0.2823 0.2337 -0.0067 0.0413  0.0186  209 VAL B CG1 
4306 C CG2 . VAL B 227 ? 0.2203 0.2898 0.2779 -0.0252 0.0229  0.0127  209 VAL B CG2 
4307 N N   . ASP B 228 ? 0.2508 0.3726 0.2819 0.0091  0.0594  0.0284  210 ASP B N   
4308 C CA  . ASP B 228 ? 0.2817 0.4063 0.2962 0.0245  0.0701  0.0284  210 ASP B CA  
4309 C C   . ASP B 228 ? 0.2717 0.4028 0.2890 0.0345  0.0675  0.0229  210 ASP B C   
4310 O O   . ASP B 228 ? 0.2672 0.3831 0.2663 0.0462  0.0693  0.0175  210 ASP B O   
4311 C CB  . ASP B 228 ? 0.2759 0.4254 0.2973 0.0274  0.0835  0.0404  210 ASP B CB  
4312 C CG  . ASP B 228 ? 0.3503 0.4898 0.3564 0.0229  0.0883  0.0471  210 ASP B CG  
4313 O OD1 . ASP B 228 ? 0.3299 0.4407 0.3170 0.0216  0.0818  0.0403  210 ASP B OD1 
4314 O OD2 . ASP B 228 ? 0.4251 0.5885 0.4387 0.0208  0.0986  0.0607  210 ASP B OD2 
4315 N N   . GLU B 229 ? 0.2489 0.4011 0.2893 0.0293  0.0616  0.0250  211 GLU B N   
4316 C CA  . GLU B 229 ? 0.2158 0.3752 0.2588 0.0379  0.0569  0.0222  211 GLU B CA  
4317 C C   . GLU B 229 ? 0.2538 0.3880 0.2769 0.0382  0.0490  0.0142  211 GLU B C   
4318 O O   . GLU B 229 ? 0.2612 0.3855 0.2733 0.0489  0.0494  0.0138  211 GLU B O   
4319 C CB  . GLU B 229 ? 0.2296 0.4180 0.2995 0.0307  0.0492  0.0253  211 GLU B CB  
4320 C CG  . GLU B 229 ? 0.3079 0.5072 0.3800 0.0410  0.0441  0.0257  211 GLU B CG  
4321 C CD  . GLU B 229 ? 0.3579 0.5925 0.4581 0.0367  0.0373  0.0303  211 GLU B CD  
4322 O OE1 . GLU B 229 ? 0.3684 0.6114 0.4818 0.0215  0.0292  0.0274  211 GLU B OE1 
4323 O OE2 . GLU B 229 ? 0.4021 0.6554 0.5124 0.0489  0.0386  0.0363  211 GLU B OE2 
4324 N N   . MET B 230 ? 0.2496 0.3738 0.2699 0.0268  0.0418  0.0084  212 MET B N   
4325 C CA  . MET B 230 ? 0.2495 0.3563 0.2530 0.0265  0.0359  0.0017  212 MET B CA  
4326 C C   . MET B 230 ? 0.2617 0.3438 0.2446 0.0330  0.0409  0.0012  212 MET B C   
4327 O O   . MET B 230 ? 0.2513 0.3229 0.2234 0.0363  0.0378  0.0003  212 MET B O   
4328 C CB  . MET B 230 ? 0.2019 0.3045 0.2077 0.0157  0.0283  -0.0066 212 MET B CB  
4329 C CG  . MET B 230 ? 0.2290 0.3529 0.2516 0.0092  0.0193  -0.0112 212 MET B CG  
4330 S SD  . MET B 230 ? 0.3039 0.4482 0.3226 0.0151  0.0138  -0.0101 212 MET B SD  
4331 C CE  . MET B 230 ? 0.2389 0.3677 0.2346 0.0167  0.0130  -0.0150 212 MET B CE  
4332 N N   . ILE B 231 ? 0.3026 0.3767 0.2804 0.0339  0.0478  0.0026  213 ILE B N   
4333 C CA  . ILE B 231 ? 0.2971 0.3486 0.2540 0.0400  0.0510  0.0001  213 ILE B CA  
4334 C C   . ILE B 231 ? 0.2822 0.3298 0.2342 0.0529  0.0535  0.0002  213 ILE B C   
4335 O O   . ILE B 231 ? 0.2673 0.2939 0.2062 0.0560  0.0497  -0.0031 213 ILE B O   
4336 C CB  . ILE B 231 ? 0.2721 0.3210 0.2220 0.0395  0.0580  0.0025  213 ILE B CB  
4337 C CG1 . ILE B 231 ? 0.2333 0.2747 0.1849 0.0279  0.0526  0.0024  213 ILE B CG1 
4338 C CG2 . ILE B 231 ? 0.2803 0.3110 0.2074 0.0492  0.0615  -0.0020 213 ILE B CG2 
4339 C CD1 . ILE B 231 ? 0.2314 0.2752 0.1810 0.0248  0.0582  0.0102  213 ILE B CD1 
4340 N N   . SER B 232 ? 0.2934 0.3615 0.2593 0.0602  0.0586  0.0046  214 SER B N   
4341 C CA  . SER B 232 ? 0.3055 0.3707 0.2713 0.0753  0.0602  0.0046  214 SER B CA  
4342 C C   . SER B 232 ? 0.2883 0.3423 0.2541 0.0752  0.0502  0.0067  214 SER B C   
4343 O O   . SER B 232 ? 0.2980 0.3386 0.2616 0.0868  0.0486  0.0070  214 SER B O   
4344 C CB  . SER B 232 ? 0.3060 0.4023 0.2923 0.0831  0.0669  0.0101  214 SER B CB  
4345 O OG  . SER B 232 ? 0.3003 0.4168 0.3054 0.0774  0.0596  0.0159  214 SER B OG  
4346 N N   . TYR B 233 ? 0.2512 0.3110 0.2194 0.0627  0.0432  0.0085  215 TYR B N   
4347 C CA  . TYR B 233 ? 0.2630 0.3185 0.2295 0.0608  0.0347  0.0134  215 TYR B CA  
4348 C C   . TYR B 233 ? 0.2495 0.2869 0.2022 0.0516  0.0307  0.0105  215 TYR B C   
4349 O O   . TYR B 233 ? 0.2719 0.3081 0.2227 0.0481  0.0247  0.0166  215 TYR B O   
4350 C CB  . TYR B 233 ? 0.2648 0.3496 0.2442 0.0554  0.0296  0.0178  215 TYR B CB  
4351 C CG  . TYR B 233 ? 0.2541 0.3608 0.2509 0.0642  0.0306  0.0234  215 TYR B CG  
4352 C CD1 . TYR B 233 ? 0.2408 0.3694 0.2523 0.0616  0.0346  0.0214  215 TYR B CD1 
4353 C CD2 . TYR B 233 ? 0.2498 0.3562 0.2511 0.0746  0.0266  0.0324  215 TYR B CD2 
4354 C CE1 . TYR B 233 ? 0.2390 0.3927 0.2700 0.0693  0.0353  0.0274  215 TYR B CE1 
4355 C CE2 . TYR B 233 ? 0.2599 0.3892 0.2797 0.0842  0.0269  0.0379  215 TYR B CE2 
4356 C CZ  . TYR B 233 ? 0.2623 0.4172 0.2972 0.0815  0.0316  0.0350  215 TYR B CZ  
4357 O OH  . TYR B 233 ? 0.2899 0.4726 0.3468 0.0908  0.0318  0.0412  215 TYR B OH  
4358 N N   . SER B 234 ? 0.2390 0.2655 0.1832 0.0476  0.0339  0.0032  216 SER B N   
4359 C CA  . SER B 234 ? 0.2703 0.2859 0.2054 0.0388  0.0299  0.0002  216 SER B CA  
4360 C C   . SER B 234 ? 0.2799 0.2677 0.2027 0.0409  0.0277  -0.0013 216 SER B C   
4361 O O   . SER B 234 ? 0.2846 0.2584 0.1997 0.0484  0.0311  -0.0062 216 SER B O   
4362 C CB  . SER B 234 ? 0.2847 0.3045 0.2200 0.0327  0.0318  -0.0061 216 SER B CB  
4363 O OG  . SER B 234 ? 0.2546 0.2962 0.2027 0.0288  0.0309  -0.0068 216 SER B OG  
4364 N N   . ASN B 235 ? 0.2575 0.2398 0.1788 0.0339  0.0215  0.0026  217 ASN B N   
4365 C CA  . ASN B 235 ? 0.3148 0.2708 0.2276 0.0323  0.0165  0.0012  217 ASN B CA  
4366 C C   . ASN B 235 ? 0.3272 0.2793 0.2326 0.0261  0.0159  -0.0062 217 ASN B C   
4367 O O   . ASN B 235 ? 0.3314 0.2622 0.2266 0.0270  0.0126  -0.0117 217 ASN B O   
4368 C CB  . ASN B 235 ? 0.2676 0.2222 0.1863 0.0254  0.0095  0.0126  217 ASN B CB  
4369 C CG  . ASN B 235 ? 0.3262 0.2864 0.2529 0.0315  0.0086  0.0229  217 ASN B CG  
4370 O OD1 . ASN B 235 ? 0.3007 0.2884 0.2334 0.0305  0.0105  0.0283  217 ASN B OD1 
4371 N ND2 . ASN B 235 ? 0.3425 0.2763 0.2697 0.0390  0.0043  0.0248  217 ASN B ND2 
4372 N N   . ILE B 236 ? 0.2726 0.2452 0.1836 0.0208  0.0176  -0.0071 218 ILE B N   
4373 C CA  . ILE B 236 ? 0.3067 0.2777 0.2141 0.0165  0.0163  -0.0128 218 ILE B CA  
4374 C C   . ILE B 236 ? 0.3165 0.3004 0.2289 0.0176  0.0204  -0.0165 218 ILE B C   
4375 O O   . ILE B 236 ? 0.3178 0.3200 0.2402 0.0165  0.0214  -0.0163 218 ILE B O   
4376 C CB  . ILE B 236 ? 0.2623 0.2434 0.1756 0.0081  0.0114  -0.0105 218 ILE B CB  
4377 C CG1 . ILE B 236 ? 0.2855 0.2527 0.1977 0.0037  0.0056  -0.0039 218 ILE B CG1 
4378 C CG2 . ILE B 236 ? 0.2429 0.2235 0.1555 0.0058  0.0090  -0.0164 218 ILE B CG2 
4379 C CD1 . ILE B 236 ? 0.2551 0.2373 0.1760 -0.0061 0.0016  0.0014  218 ILE B CD1 
4380 N N   . VAL B 237 ? 0.3245 0.2988 0.2301 0.0191  0.0217  -0.0192 219 VAL B N   
4381 C CA  . VAL B 237 ? 0.2865 0.2691 0.1996 0.0180  0.0237  -0.0198 219 VAL B CA  
4382 C C   . VAL B 237 ? 0.2737 0.2506 0.1859 0.0149  0.0187  -0.0221 219 VAL B C   
4383 O O   . VAL B 237 ? 0.2849 0.2492 0.1846 0.0156  0.0163  -0.0218 219 VAL B O   
4384 C CB  . VAL B 237 ? 0.2949 0.2769 0.2045 0.0221  0.0304  -0.0162 219 VAL B CB  
4385 C CG1 . VAL B 237 ? 0.2517 0.2406 0.1729 0.0178  0.0307  -0.0136 219 VAL B CG1 
4386 C CG2 . VAL B 237 ? 0.2253 0.2164 0.1399 0.0271  0.0350  -0.0141 219 VAL B CG2 
4387 N N   . PHE B 238 ? 0.2538 0.2404 0.1794 0.0127  0.0158  -0.0255 220 PHE B N   
4388 C CA  . PHE B 238 ? 0.2560 0.2381 0.1857 0.0119  0.0103  -0.0277 220 PHE B CA  
4389 C C   . PHE B 238 ? 0.3013 0.2780 0.2382 0.0112  0.0101  -0.0243 220 PHE B C   
4390 O O   . PHE B 238 ? 0.2923 0.2754 0.2394 0.0096  0.0122  -0.0245 220 PHE B O   
4391 C CB  . PHE B 238 ? 0.2668 0.2633 0.2092 0.0122  0.0066  -0.0357 220 PHE B CB  
4392 C CG  . PHE B 238 ? 0.2627 0.2692 0.2018 0.0107  0.0064  -0.0354 220 PHE B CG  
4393 C CD1 . PHE B 238 ? 0.2270 0.2310 0.1647 0.0094  0.0019  -0.0344 220 PHE B CD1 
4394 C CD2 . PHE B 238 ? 0.2626 0.2830 0.2020 0.0095  0.0097  -0.0343 220 PHE B CD2 
4395 C CE1 . PHE B 238 ? 0.2354 0.2505 0.1742 0.0054  0.0010  -0.0317 220 PHE B CE1 
4396 C CE2 . PHE B 238 ? 0.2676 0.2981 0.2062 0.0061  0.0091  -0.0301 220 PHE B CE2 
4397 C CZ  . PHE B 238 ? 0.2529 0.2808 0.1923 0.0033  0.0050  -0.0286 220 PHE B CZ  
4398 N N   . GLY B 239 ? 0.3062 0.2720 0.2394 0.0113  0.0062  -0.0197 221 GLY B N   
4399 C CA  . GLY B 239 ? 0.3017 0.2608 0.2439 0.0091  0.0043  -0.0128 221 GLY B CA  
4400 C C   . GLY B 239 ? 0.3210 0.2700 0.2654 0.0106  -0.0042 -0.0101 221 GLY B C   
4401 O O   . GLY B 239 ? 0.3141 0.2635 0.2507 0.0132  -0.0077 -0.0133 221 GLY B O   
4402 N N   . ASN B 240 ? 0.3455 0.2856 0.3033 0.0085  -0.0088 -0.0033 222 ASN B N   
4403 C CA  . ASN B 240 ? 0.3431 0.2719 0.3023 0.0103  -0.0174 0.0041  222 ASN B CA  
4404 C C   . ASN B 240 ? 0.3863 0.3094 0.3362 0.0058  -0.0153 0.0237  222 ASN B C   
4405 O O   . ASN B 240 ? 0.3890 0.3195 0.3338 0.0016  -0.0061 0.0299  222 ASN B O   
4406 C CB  . ASN B 240 ? 0.3445 0.2656 0.3290 0.0138  -0.0276 -0.0039 222 ASN B CB  
4407 C CG  . ASN B 240 ? 0.3963 0.3081 0.4008 0.0087  -0.0301 -0.0020 222 ASN B CG  
4408 O OD1 . ASN B 240 ? 0.4043 0.3134 0.4073 0.0011  -0.0264 0.0133  222 ASN B OD1 
4409 N ND2 . ASN B 240 ? 0.2855 0.1941 0.3103 0.0129  -0.0371 -0.0182 222 ASN B ND2 
4410 N N   . GLU B 241 ? 0.3729 0.2867 0.3214 0.0070  -0.0235 0.0347  223 GLU B N   
4411 C CA  . GLU B 241 ? 0.4026 0.3151 0.3387 0.0028  -0.0216 0.0564  223 GLU B CA  
4412 C C   . GLU B 241 ? 0.3843 0.2946 0.3392 -0.0058 -0.0189 0.0692  223 GLU B C   
4413 O O   . GLU B 241 ? 0.3983 0.3208 0.3423 -0.0105 -0.0086 0.0818  223 GLU B O   
4414 C CB  . GLU B 241 ? 0.4730 0.3760 0.4069 0.0058  -0.0336 0.0675  223 GLU B CB  
4415 C CG  . GLU B 241 ? 0.5716 0.4774 0.4878 0.0016  -0.0319 0.0925  223 GLU B CG  
4416 C CD  . GLU B 241 ? 0.6546 0.5537 0.5649 0.0055  -0.0451 0.1041  223 GLU B CD  
4417 O OE1 . GLU B 241 ? 0.7451 0.6396 0.6569 0.0013  -0.0493 0.1286  223 GLU B OE1 
4418 O OE2 . GLU B 241 ? 0.6346 0.5348 0.5402 0.0122  -0.0519 0.0907  223 GLU B OE2 
4419 N N   . SER B 242 ? 0.3388 0.2348 0.3232 -0.0075 -0.0285 0.0651  224 SER B N   
4420 C CA  . SER B 242 ? 0.3601 0.2503 0.3671 -0.0179 -0.0296 0.0778  224 SER B CA  
4421 C C   . SER B 242 ? 0.3702 0.2778 0.3792 -0.0231 -0.0182 0.0717  224 SER B C   
4422 O O   . SER B 242 ? 0.3634 0.2782 0.3817 -0.0330 -0.0136 0.0884  224 SER B O   
4423 C CB  . SER B 242 ? 0.4265 0.2930 0.4656 -0.0175 -0.0452 0.0705  224 SER B CB  
4424 O OG  . SER B 242 ? 0.5129 0.3818 0.5597 -0.0107 -0.0466 0.0423  224 SER B OG  
4425 N N   . GLU B 243 ? 0.3437 0.2605 0.3454 -0.0165 -0.0140 0.0500  225 GLU B N   
4426 C CA  . GLU B 243 ? 0.3427 0.2780 0.3434 -0.0190 -0.0036 0.0448  225 GLU B CA  
4427 C C   . GLU B 243 ? 0.3512 0.3030 0.3275 -0.0178 0.0098  0.0569  225 GLU B C   
4428 O O   . GLU B 243 ? 0.3477 0.3160 0.3288 -0.0225 0.0187  0.0653  225 GLU B O   
4429 C CB  . GLU B 243 ? 0.3431 0.2842 0.3403 -0.0119 -0.0034 0.0217  225 GLU B CB  
4430 C CG  . GLU B 243 ? 0.3847 0.3181 0.4048 -0.0118 -0.0140 0.0057  225 GLU B CG  
4431 C CD  . GLU B 243 ? 0.4341 0.3723 0.4467 -0.0024 -0.0156 -0.0136 225 GLU B CD  
4432 O OE1 . GLU B 243 ? 0.4162 0.3642 0.4088 0.0015  -0.0084 -0.0143 225 GLU B OE1 
4433 O OE2 . GLU B 243 ? 0.4807 0.4134 0.5085 0.0011  -0.0245 -0.0282 225 GLU B OE2 
4434 N N   . ALA B 244 ? 0.3027 0.2520 0.2536 -0.0107 0.0107  0.0563  226 ALA B N   
4435 C CA  . ALA B 244 ? 0.3098 0.2731 0.2336 -0.0068 0.0221  0.0626  226 ALA B CA  
4436 C C   . ALA B 244 ? 0.3624 0.3358 0.2849 -0.0130 0.0275  0.0869  226 ALA B C   
4437 O O   . ALA B 244 ? 0.3954 0.3896 0.3082 -0.0119 0.0404  0.0931  226 ALA B O   
4438 C CB  . ALA B 244 ? 0.3141 0.2701 0.2121 0.0010  0.0183  0.0547  226 ALA B CB  
4439 N N   . GLU B 245 ? 0.3787 0.3391 0.3123 -0.0190 0.0177  0.1017  227 GLU B N   
4440 C CA  . GLU B 245 ? 0.4199 0.3902 0.3564 -0.0277 0.0215  0.1299  227 GLU B CA  
4441 C C   . GLU B 245 ? 0.3975 0.3818 0.3614 -0.0381 0.0278  0.1385  227 GLU B C   
4442 O O   . GLU B 245 ? 0.3992 0.4087 0.3590 -0.0424 0.0399  0.1569  227 GLU B O   
4443 C CB  . GLU B 245 ? 0.5055 0.4541 0.4537 -0.0324 0.0066  0.1453  227 GLU B CB  
4444 C CG  . GLU B 245 ? 0.6246 0.5712 0.5422 -0.0249 0.0027  0.1508  227 GLU B CG  
4445 C CD  . GLU B 245 ? 0.7223 0.6435 0.6553 -0.0251 -0.0154 0.1576  227 GLU B CD  
4446 O OE1 . GLU B 245 ? 0.7283 0.6303 0.6948 -0.0288 -0.0250 0.1523  227 GLU B OE1 
4447 O OE2 . GLU B 245 ? 0.7646 0.6853 0.6764 -0.0205 -0.0210 0.1669  227 GLU B OE2 
4448 N N   . ALA B 246 ? 0.3582 0.3297 0.3502 -0.0420 0.0194  0.1246  228 ALA B N   
4449 C CA  . ALA B 246 ? 0.3697 0.3540 0.3908 -0.0530 0.0220  0.1304  228 ALA B CA  
4450 C C   . ALA B 246 ? 0.3578 0.3726 0.3680 -0.0475 0.0380  0.1243  228 ALA B C   
4451 O O   . ALA B 246 ? 0.3667 0.4070 0.3892 -0.0547 0.0474  0.1404  228 ALA B O   
4452 C CB  . ALA B 246 ? 0.3512 0.3147 0.4004 -0.0565 0.0074  0.1124  228 ALA B CB  
4453 N N   . TYR B 247 ? 0.3396 0.3526 0.3290 -0.0344 0.0406  0.1022  229 TYR B N   
4454 C CA  . TYR B 247 ? 0.3134 0.3500 0.2924 -0.0262 0.0538  0.0945  229 TYR B CA  
4455 C C   . TYR B 247 ? 0.3413 0.4016 0.2994 -0.0220 0.0687  0.1099  229 TYR B C   
4456 O O   . TYR B 247 ? 0.3372 0.4267 0.3033 -0.0216 0.0807  0.1168  229 TYR B O   
4457 C CB  . TYR B 247 ? 0.2899 0.3145 0.2499 -0.0140 0.0515  0.0709  229 TYR B CB  
4458 C CG  . TYR B 247 ? 0.3361 0.3783 0.2879 -0.0042 0.0621  0.0617  229 TYR B CG  
4459 C CD1 . TYR B 247 ? 0.3245 0.3714 0.2932 -0.0040 0.0594  0.0507  229 TYR B CD1 
4460 C CD2 . TYR B 247 ? 0.3665 0.4203 0.2930 0.0063  0.0735  0.0629  229 TYR B CD2 
4461 C CE1 . TYR B 247 ? 0.3472 0.4085 0.3104 0.0061  0.0675  0.0441  229 TYR B CE1 
4462 C CE2 . TYR B 247 ? 0.3807 0.4471 0.3019 0.0175  0.0818  0.0533  229 TYR B CE2 
4463 C CZ  . TYR B 247 ? 0.3782 0.4476 0.3191 0.0173  0.0785  0.0452  229 TYR B CZ  
4464 O OH  . TYR B 247 ? 0.4159 0.4966 0.3537 0.0294  0.0854  0.0375  229 TYR B OH  
4465 N N   . GLY B 248 ? 0.3692 0.4203 0.3007 -0.0178 0.0677  0.1147  230 GLY B N   
4466 C CA  . GLY B 248 ? 0.3788 0.4535 0.2839 -0.0118 0.0810  0.1268  230 GLY B CA  
4467 C C   . GLY B 248 ? 0.3911 0.4937 0.3124 -0.0232 0.0898  0.1559  230 GLY B C   
4468 O O   . GLY B 248 ? 0.4083 0.5452 0.3202 -0.0176 0.1061  0.1627  230 GLY B O   
4469 N N   . GLU B 249 ? 0.4005 0.4895 0.3483 -0.0390 0.0788  0.1735  231 GLU B N   
4470 C CA  . GLU B 249 ? 0.4892 0.6023 0.4583 -0.0539 0.0847  0.2054  231 GLU B CA  
4471 C C   . GLU B 249 ? 0.4631 0.6063 0.4599 -0.0583 0.0945  0.2062  231 GLU B C   
4472 O O   . GLU B 249 ? 0.4719 0.6511 0.4734 -0.0613 0.1073  0.2232  231 GLU B O   
4473 C CB  . GLU B 249 ? 0.5793 0.6629 0.5766 -0.0703 0.0668  0.2215  231 GLU B CB  
4474 C CG  . GLU B 249 ? 0.6935 0.7968 0.7210 -0.0894 0.0692  0.2555  231 GLU B CG  
4475 C CD  . GLU B 249 ? 0.7961 0.8624 0.8556 -0.1049 0.0482  0.2677  231 GLU B CD  
4476 O OE1 . GLU B 249 ? 0.8199 0.8484 0.8807 -0.0994 0.0330  0.2470  231 GLU B OE1 
4477 O OE2 . GLU B 249 ? 0.8306 0.9038 0.9128 -0.1177 0.0449  0.2876  231 GLU B OE2 
4478 N N   . VAL B 250 ? 0.4319 0.5603 0.4471 -0.0572 0.0863  0.1835  232 VAL B N   
4479 C CA  . VAL B 250 ? 0.4368 0.5923 0.4795 -0.0604 0.0924  0.1814  232 VAL B CA  
4480 C C   . VAL B 250 ? 0.4315 0.6210 0.4526 -0.0426 0.1115  0.1734  232 VAL B C   
4481 O O   . VAL B 250 ? 0.4048 0.6322 0.4461 -0.0441 0.1225  0.1819  232 VAL B O   
4482 C CB  . VAL B 250 ? 0.6417 0.7720 0.7046 -0.0623 0.0769  0.1579  232 VAL B CB  
4483 C CG1 . VAL B 250 ? 0.6043 0.7590 0.6739 -0.0536 0.0842  0.1436  232 VAL B CG1 
4484 C CG2 . VAL B 250 ? 0.6430 0.7589 0.7449 -0.0830 0.0614  0.1692  232 VAL B CG2 
4485 N N   . HIS B 251 ? 0.4124 0.5888 0.3945 -0.0254 0.1145  0.1568  233 HIS B N   
4486 C CA  . HIS B 251 ? 0.3863 0.5882 0.3460 -0.0062 0.1305  0.1458  233 HIS B CA  
4487 C C   . HIS B 251 ? 0.4376 0.6555 0.3709 -0.0002 0.1394  0.1533  233 HIS B C   
4488 O O   . HIS B 251 ? 0.4658 0.6935 0.3776 0.0169  0.1472  0.1370  233 HIS B O   
4489 C CB  . HIS B 251 ? 0.3510 0.5228 0.2874 0.0092  0.1239  0.1161  233 HIS B CB  
4490 C CG  . HIS B 251 ? 0.3390 0.4975 0.2998 0.0069  0.1140  0.1019  233 HIS B CG  
4491 N ND1 . HIS B 251 ? 0.3561 0.4887 0.3350 -0.0062 0.0980  0.1002  233 HIS B ND1 
4492 C CD2 . HIS B 251 ? 0.3416 0.5113 0.3113 0.0170  0.1174  0.0893  233 HIS B CD2 
4493 C CE1 . HIS B 251 ? 0.3457 0.4764 0.3406 -0.0046 0.0926  0.0867  233 HIS B CE1 
4494 N NE2 . HIS B 251 ? 0.3648 0.5173 0.3551 0.0087  0.1037  0.0815  233 HIS B NE2 
4495 N N   . GLY B 252 ? 0.4007 0.6175 0.3374 -0.0144 0.1354  0.1760  234 GLY B N   
4496 C CA  . GLY B 252 ? 0.4349 0.6692 0.3495 -0.0107 0.1422  0.1847  234 GLY B CA  
4497 C C   . GLY B 252 ? 0.5366 0.7529 0.4062 0.0031  0.1401  0.1691  234 GLY B C   
4498 O O   . GLY B 252 ? 0.5523 0.7863 0.3983 0.0123  0.1478  0.1663  234 GLY B O   
4499 N N   . LEU B 253 ? 0.5262 0.7088 0.3847 0.0043  0.1290  0.1584  235 LEU B N   
4500 C CA  . LEU B 253 ? 0.5136 0.6767 0.3325 0.0149  0.1234  0.1439  235 LEU B CA  
4501 C C   . LEU B 253 ? 0.5690 0.7215 0.3804 0.0040  0.1140  0.1653  235 LEU B C   
4502 O O   . LEU B 253 ? 0.5896 0.7143 0.3994 0.0002  0.1011  0.1665  235 LEU B O   
4503 C CB  . LEU B 253 ? 0.4409 0.5746 0.2528 0.0223  0.1151  0.1220  235 LEU B CB  
4504 C CG  . LEU B 253 ? 0.4197 0.5578 0.2453 0.0315  0.1212  0.1035  235 LEU B CG  
4505 C CD1 . LEU B 253 ? 0.3921 0.4947 0.2151 0.0354  0.1085  0.0817  235 LEU B CD1 
4506 C CD2 . LEU B 253 ? 0.4215 0.5776 0.2330 0.0461  0.1308  0.0882  235 LEU B CD2 
4507 N N   . LEU B 254 ? 0.5935 0.7691 0.4013 -0.0002 0.1200  0.1830  236 LEU B N   
4508 C CA  . LEU B 254 ? 0.6211 0.7884 0.4286 -0.0120 0.1107  0.2079  236 LEU B CA  
4509 C C   . LEU B 254 ? 0.6701 0.8223 0.4379 -0.0040 0.1022  0.2003  236 LEU B C   
4510 O O   . LEU B 254 ? 0.6845 0.8199 0.4524 -0.0116 0.0898  0.2170  236 LEU B O   
4511 C CB  . LEU B 254 ? 0.6172 0.8166 0.4391 -0.0211 0.1197  0.2333  236 LEU B CB  
4512 C CG  . LEU B 254 ? 0.5809 0.7978 0.4463 -0.0322 0.1256  0.2448  236 LEU B CG  
4513 C CD1 . LEU B 254 ? 0.6076 0.8489 0.4905 -0.0457 0.1286  0.2761  236 LEU B CD1 
4514 C CD2 . LEU B 254 ? 0.5444 0.7314 0.4412 -0.0427 0.1133  0.2446  236 LEU B CD2 
4515 N N   . GLU B 255 ? 0.6804 0.8372 0.4169 0.0113  0.1070  0.1746  237 GLU B N   
4516 C CA  . GLU B 255 ? 0.6988 0.8426 0.3979 0.0184  0.0976  0.1642  237 GLU B CA  
4517 C C   . GLU B 255 ? 0.6794 0.7925 0.3710 0.0245  0.0857  0.1406  237 GLU B C   
4518 O O   . GLU B 255 ? 0.6303 0.7399 0.3263 0.0323  0.0903  0.1188  237 GLU B O   
4519 C CB  . GLU B 255 ? 0.7173 0.8846 0.3862 0.0304  0.1080  0.1506  237 GLU B CB  
4520 N N   . ASP B 256 ? 0.7006 0.7929 0.3825 0.0212  0.0698  0.1462  238 ASP B N   
4521 C CA  . ASP B 256 ? 0.6718 0.7372 0.3508 0.0254  0.0567  0.1283  238 ASP B CA  
4522 C C   . ASP B 256 ? 0.5730 0.6302 0.2806 0.0247  0.0607  0.1226  238 ASP B C   
4523 O O   . ASP B 256 ? 0.5712 0.6178 0.2751 0.0329  0.0609  0.0970  238 ASP B O   
4524 C CB  . ASP B 256 ? 0.7543 0.8148 0.4018 0.0366  0.0533  0.0986  238 ASP B CB  
4525 C CG  . ASP B 256 ? 0.8809 0.9378 0.5012 0.0362  0.0400  0.1015  238 ASP B CG  
4526 O OD1 . ASP B 256 ? 0.9330 0.9710 0.5539 0.0347  0.0236  0.1004  238 ASP B OD1 
4527 O OD2 . ASP B 256 ? 0.8824 0.9572 0.4809 0.0382  0.0456  0.1050  238 ASP B OD2 
4528 N N   . THR B 257 ? 0.5292 0.5871 0.2708 0.0128  0.0614  0.1442  239 THR B N   
4529 C CA  . THR B 257 ? 0.4856 0.5373 0.2638 0.0083  0.0646  0.1363  239 THR B CA  
4530 C C   . THR B 257 ? 0.4504 0.4754 0.2377 0.0125  0.0547  0.1085  239 THR B C   
4531 O O   . THR B 257 ? 0.4586 0.4862 0.2528 0.0174  0.0615  0.0923  239 THR B O   
4532 C CB  . THR B 257 ? 0.4874 0.5350 0.3033 -0.0072 0.0600  0.1609  239 THR B CB  
4533 O OG1 . THR B 257 ? 0.5507 0.6268 0.3607 -0.0132 0.0703  0.1907  239 THR B OG1 
4534 C CG2 . THR B 257 ? 0.4547 0.5003 0.3060 -0.0120 0.0629  0.1515  239 THR B CG2 
4535 N N   . VAL B 258 ? 0.4318 0.4342 0.2196 0.0111  0.0389  0.1045  240 VAL B N   
4536 C CA  . VAL B 258 ? 0.4130 0.3950 0.2130 0.0133  0.0298  0.0821  240 VAL B CA  
4537 C C   . VAL B 258 ? 0.4658 0.4470 0.2413 0.0233  0.0328  0.0597  240 VAL B C   
4538 O O   . VAL B 258 ? 0.4387 0.4151 0.2262 0.0253  0.0352  0.0448  240 VAL B O   
4539 C CB  . VAL B 258 ? 0.4244 0.3881 0.2322 0.0108  0.0128  0.0840  240 VAL B CB  
4540 C CG1 . VAL B 258 ? 0.4215 0.3714 0.2442 0.0126  0.0056  0.0627  240 VAL B CG1 
4541 C CG2 . VAL B 258 ? 0.4176 0.3762 0.2523 0.0021  0.0078  0.1053  240 VAL B CG2 
4542 N N   . HIS B 259 ? 0.4749 0.4603 0.2162 0.0294  0.0313  0.0576  241 HIS B N   
4543 C CA  . HIS B 259 ? 0.4619 0.4436 0.1787 0.0392  0.0326  0.0352  241 HIS B CA  
4544 C C   . HIS B 259 ? 0.4678 0.4637 0.1849 0.0464  0.0489  0.0296  241 HIS B C   
4545 O O   . HIS B 259 ? 0.4792 0.4647 0.2007 0.0516  0.0494  0.0118  241 HIS B O   
4546 C CB  . HIS B 259 ? 0.4641 0.4500 0.1418 0.0449  0.0273  0.0332  241 HIS B CB  
4547 C CG  . HIS B 259 ? 0.5696 0.5409 0.2464 0.0401  0.0086  0.0329  241 HIS B CG  
4548 N ND1 . HIS B 259 ? 0.5896 0.5472 0.2511 0.0430  -0.0036 0.0129  241 HIS B ND1 
4549 C CD2 . HIS B 259 ? 0.5859 0.5547 0.2784 0.0328  -0.0010 0.0503  241 HIS B CD2 
4550 C CE1 . HIS B 259 ? 0.5886 0.5401 0.2567 0.0375  -0.0191 0.0186  241 HIS B CE1 
4551 N NE2 . HIS B 259 ? 0.5954 0.5530 0.2819 0.0325  -0.0177 0.0408  241 HIS B NE2 
4552 N N   . ALA B 260 ? 0.4580 0.4791 0.1728 0.0464  0.0620  0.0468  242 ALA B N   
4553 C CA  . ALA B 260 ? 0.4647 0.5066 0.1841 0.0537  0.0786  0.0444  242 ALA B CA  
4554 C C   . ALA B 260 ? 0.4582 0.4930 0.2142 0.0492  0.0790  0.0404  242 ALA B C   
4555 O O   . ALA B 260 ? 0.4659 0.5061 0.2253 0.0582  0.0867  0.0285  242 ALA B O   
4556 C CB  . ALA B 260 ? 0.4522 0.5244 0.1770 0.0481  0.0895  0.0666  242 ALA B CB  
4557 N N   . THR B 261 ? 0.4331 0.4563 0.2159 0.0366  0.0699  0.0496  243 THR B N   
4558 C CA  . THR B 261 ? 0.4014 0.4198 0.2163 0.0319  0.0687  0.0452  243 THR B CA  
4559 C C   . THR B 261 ? 0.3885 0.3873 0.2007 0.0374  0.0616  0.0241  243 THR B C   
4560 O O   . THR B 261 ? 0.4068 0.4087 0.2308 0.0414  0.0658  0.0165  243 THR B O   
4561 C CB  . THR B 261 ? 0.3720 0.3820 0.2145 0.0186  0.0595  0.0571  243 THR B CB  
4562 O OG1 . THR B 261 ? 0.3985 0.4267 0.2525 0.0110  0.0661  0.0792  243 THR B OG1 
4563 C CG2 . THR B 261 ? 0.3285 0.3320 0.1980 0.0154  0.0554  0.0469  243 THR B CG2 
4564 N N   . ALA B 262 ? 0.3613 0.3415 0.1595 0.0370  0.0502  0.0168  244 ALA B N   
4565 C CA  . ALA B 262 ? 0.3719 0.3346 0.1689 0.0397  0.0425  -0.0001 244 ALA B CA  
4566 C C   . ALA B 262 ? 0.4113 0.3733 0.1919 0.0517  0.0490  -0.0128 244 ALA B C   
4567 O O   . ALA B 262 ? 0.3715 0.3250 0.1622 0.0542  0.0476  -0.0216 244 ALA B O   
4568 C CB  . ALA B 262 ? 0.3664 0.3142 0.1519 0.0365  0.0291  -0.0041 244 ALA B CB  
4569 N N   . ARG B 263 ? 0.4596 0.4314 0.2149 0.0600  0.0557  -0.0133 245 ARG B N   
4570 C CA  . ARG B 263 ? 0.5014 0.4738 0.2398 0.0749  0.0624  -0.0279 245 ARG B CA  
4571 C C   . ARG B 263 ? 0.5203 0.5093 0.2805 0.0800  0.0745  -0.0246 245 ARG B C   
4572 O O   . ARG B 263 ? 0.5113 0.4896 0.2766 0.0883  0.0738  -0.0366 245 ARG B O   
4573 C CB  . ARG B 263 ? 0.4975 0.4849 0.2122 0.0799  0.0664  -0.0284 245 ARG B CB  
4574 C CG  . ARG B 263 ? 0.5458 0.5399 0.2558 0.0929  0.0727  -0.0430 245 ARG B CG  
4575 C CD  . ARG B 263 ? 0.6083 0.5730 0.3198 0.0992  0.0629  -0.0631 245 ARG B CD  
4576 N NE  . ARG B 263 ? 0.6307 0.5697 0.3289 0.0929  0.0465  -0.0717 245 ARG B NE  
4577 C CZ  . ARG B 263 ? 0.5944 0.5052 0.2997 0.0901  0.0348  -0.0803 245 ARG B CZ  
4578 N NH1 . ARG B 263 ? 0.5353 0.4385 0.2584 0.0940  0.0379  -0.0814 245 ARG B NH1 
4579 N NH2 . ARG B 263 ? 0.6419 0.5339 0.3373 0.0826  0.0195  -0.0865 245 ARG B NH2 
4580 N N   . TYR B 264 ? 0.5060 0.5207 0.2812 0.0743  0.0841  -0.0070 246 TYR B N   
4581 C CA  . TYR B 264 ? 0.4406 0.4777 0.2394 0.0775  0.0951  -0.0013 246 TYR B CA  
4582 C C   . TYR B 264 ? 0.4040 0.4283 0.2280 0.0736  0.0878  -0.0057 246 TYR B C   
4583 O O   . TYR B 264 ? 0.4063 0.4365 0.2400 0.0832  0.0923  -0.0112 246 TYR B O   
4584 C CB  . TYR B 264 ? 0.4326 0.4966 0.2479 0.0665  0.1025  0.0209  246 TYR B CB  
4585 C CG  . TYR B 264 ? 0.4255 0.5190 0.2669 0.0683  0.1139  0.0286  246 TYR B CG  
4586 C CD1 . TYR B 264 ? 0.4718 0.5945 0.3110 0.0764  0.1264  0.0318  246 TYR B CD1 
4587 C CD2 . TYR B 264 ? 0.4188 0.5111 0.2918 0.0595  0.1083  0.0314  246 TYR B CD2 
4588 C CE1 . TYR B 264 ? 0.4842 0.6361 0.3516 0.0772  0.1350  0.0393  246 TYR B CE1 
4589 C CE2 . TYR B 264 ? 0.4510 0.5726 0.3497 0.0605  0.1167  0.0386  246 TYR B CE2 
4590 C CZ  . TYR B 264 ? 0.4852 0.6401 0.3803 0.0708  0.1326  0.0443  246 TYR B CZ  
4591 O OH  . TYR B 264 ? 0.5184 0.7048 0.4434 0.0708  0.1394  0.0519  246 TYR B OH  
4592 N N   . ILE B 265 ? 0.3888 0.3983 0.2235 0.0605  0.0766  -0.0026 247 ILE B N   
4593 C CA  . ILE B 265 ? 0.3349 0.3373 0.1909 0.0558  0.0699  -0.0054 247 ILE B CA  
4594 C C   . ILE B 265 ? 0.3788 0.3607 0.2254 0.0640  0.0643  -0.0188 247 ILE B C   
4595 O O   . ILE B 265 ? 0.3894 0.3727 0.2498 0.0676  0.0641  -0.0202 247 ILE B O   
4596 C CB  . ILE B 265 ? 0.3316 0.3260 0.1993 0.0421  0.0601  -0.0011 247 ILE B CB  
4597 C CG1 . ILE B 265 ? 0.3583 0.3688 0.2413 0.0335  0.0635  0.0126  247 ILE B CG1 
4598 C CG2 . ILE B 265 ? 0.2890 0.2797 0.1734 0.0386  0.0536  -0.0056 247 ILE B CG2 
4599 C CD1 . ILE B 265 ? 0.3166 0.3170 0.2123 0.0225  0.0531  0.0150  247 ILE B CD1 
4600 N N   . ALA B 266 ? 0.3890 0.3516 0.2130 0.0663  0.0584  -0.0274 248 ALA B N   
4601 C CA  . ALA B 266 ? 0.4377 0.3764 0.2539 0.0721  0.0508  -0.0397 248 ALA B CA  
4602 C C   . ALA B 266 ? 0.4860 0.4264 0.3005 0.0885  0.0579  -0.0470 248 ALA B C   
4603 O O   . ALA B 266 ? 0.5072 0.4326 0.3302 0.0926  0.0525  -0.0513 248 ALA B O   
4604 C CB  . ALA B 266 ? 0.4243 0.3439 0.2166 0.0711  0.0420  -0.0488 248 ALA B CB  
4605 N N   . ASP B 267 ? 0.4156 0.3762 0.2205 0.0985  0.0700  -0.0471 249 ASP B N   
4606 C CA  . ASP B 267 ? 0.4426 0.4068 0.2428 0.1179  0.0775  -0.0574 249 ASP B CA  
4607 C C   . ASP B 267 ? 0.4255 0.4178 0.2516 0.1234  0.0879  -0.0481 249 ASP B C   
4608 O O   . ASP B 267 ? 0.4672 0.4670 0.2968 0.1389  0.0933  -0.0550 249 ASP B O   
4609 C CB  . ASP B 267 ? 0.4715 0.4469 0.2530 0.1232  0.0820  -0.0634 249 ASP B CB  
4610 C CG  . ASP B 267 ? 0.5291 0.4769 0.2870 0.1204  0.0693  -0.0761 249 ASP B CG  
4611 O OD1 . ASP B 267 ? 0.5848 0.5037 0.3418 0.1145  0.0569  -0.0804 249 ASP B OD1 
4612 O OD2 . ASP B 267 ? 0.5754 0.5322 0.3160 0.1237  0.0713  -0.0816 249 ASP B OD2 
4613 N N   . LEU B 268 ? 0.3696 0.3783 0.2182 0.1089  0.0879  -0.0330 250 LEU B N   
4614 C CA  . LEU B 268 ? 0.3839 0.4198 0.2594 0.1120  0.0947  -0.0243 250 LEU B CA  
4615 C C   . LEU B 268 ? 0.3928 0.4133 0.2776 0.1227  0.0884  -0.0307 250 LEU B C   
4616 O O   . LEU B 268 ? 0.3381 0.3299 0.2193 0.1171  0.0762  -0.0340 250 LEU B O   
4617 C CB  . LEU B 268 ? 0.3831 0.4328 0.2804 0.0934  0.0912  -0.0105 250 LEU B CB  
4618 C CG  . LEU B 268 ? 0.3963 0.4721 0.2996 0.0842  0.0995  0.0018  250 LEU B CG  
4619 C CD1 . LEU B 268 ? 0.3555 0.4326 0.2785 0.0656  0.0913  0.0106  250 LEU B CD1 
4620 C CD2 . LEU B 268 ? 0.3871 0.4995 0.3049 0.0941  0.1132  0.0079  250 LEU B CD2 
4621 N N   . PRO B 269 ? 0.3963 0.4372 0.2945 0.1384  0.0964  -0.0309 251 PRO B N   
4622 C CA  . PRO B 269 ? 0.4073 0.4326 0.3171 0.1495  0.0889  -0.0344 251 PRO B CA  
4623 C C   . PRO B 269 ? 0.3899 0.4141 0.3182 0.1346  0.0783  -0.0224 251 PRO B C   
4624 O O   . PRO B 269 ? 0.3664 0.4151 0.3080 0.1212  0.0800  -0.0122 251 PRO B O   
4625 C CB  . PRO B 269 ? 0.4268 0.4843 0.3523 0.1688  0.1009  -0.0343 251 PRO B CB  
4626 C CG  . PRO B 269 ? 0.4136 0.5094 0.3410 0.1619  0.1144  -0.0262 251 PRO B CG  
4627 C CD  . PRO B 269 ? 0.3976 0.4759 0.2995 0.1487  0.1125  -0.0283 251 PRO B CD  
4628 N N   . PHE B 270 ? 0.4060 0.4020 0.3346 0.1364  0.0667  -0.0237 252 PHE B N   
4629 C CA  . PHE B 270 ? 0.3648 0.3659 0.3098 0.1257  0.0577  -0.0112 252 PHE B CA  
4630 C C   . PHE B 270 ? 0.3903 0.4209 0.3591 0.1364  0.0611  -0.0037 252 PHE B C   
4631 O O   . PHE B 270 ? 0.3808 0.4163 0.3542 0.1558  0.0673  -0.0091 252 PHE B O   
4632 C CB  . PHE B 270 ? 0.3605 0.3263 0.3004 0.1237  0.0447  -0.0105 252 PHE B CB  
4633 C CG  . PHE B 270 ? 0.3518 0.2993 0.2766 0.1070  0.0390  -0.0124 252 PHE B CG  
4634 C CD1 . PHE B 270 ? 0.3034 0.2636 0.2334 0.0902  0.0348  -0.0030 252 PHE B CD1 
4635 C CD2 . PHE B 270 ? 0.3598 0.2802 0.2655 0.1090  0.0373  -0.0248 252 PHE B CD2 
4636 C CE1 . PHE B 270 ? 0.3501 0.2980 0.2694 0.0766  0.0302  -0.0049 252 PHE B CE1 
4637 C CE2 . PHE B 270 ? 0.3644 0.2717 0.2594 0.0937  0.0312  -0.0257 252 PHE B CE2 
4638 C CZ  . PHE B 270 ? 0.3162 0.2381 0.2194 0.0779  0.0283  -0.0152 252 PHE B CZ  
4639 N N   . ALA B 271 ? 0.3758 0.4282 0.3598 0.1249  0.0564  0.0076  253 ALA B N   
4640 C CA  . ALA B 271 ? 0.3580 0.4451 0.3666 0.1319  0.0582  0.0156  253 ALA B CA  
4641 C C   . ALA B 271 ? 0.3704 0.4498 0.3895 0.1519  0.0541  0.0181  253 ALA B C   
4642 O O   . ALA B 271 ? 0.4112 0.5175 0.4493 0.1659  0.0595  0.0201  253 ALA B O   
4643 C CB  . ALA B 271 ? 0.3403 0.4483 0.3594 0.1152  0.0507  0.0247  253 ALA B CB  
4644 N N   . ASP B 272 ? 0.3324 0.3758 0.3419 0.1531  0.0439  0.0190  254 ASP B N   
4645 C CA  . ASP B 272 ? 0.3687 0.3978 0.3899 0.1717  0.0371  0.0230  254 ASP B CA  
4646 C C   . ASP B 272 ? 0.4086 0.4081 0.4207 0.1918  0.0410  0.0068  254 ASP B C   
4647 O O   . ASP B 272 ? 0.4123 0.3891 0.4327 0.2088  0.0338  0.0067  254 ASP B O   
4648 C CB  . ASP B 272 ? 0.3563 0.3634 0.3760 0.1618  0.0222  0.0366  254 ASP B CB  
4649 C CG  . ASP B 272 ? 0.4306 0.4000 0.4292 0.1493  0.0179  0.0311  254 ASP B CG  
4650 O OD1 . ASP B 272 ? 0.4575 0.4077 0.4556 0.1411  0.0065  0.0433  254 ASP B OD1 
4651 O OD2 . ASP B 272 ? 0.3876 0.3488 0.3710 0.1473  0.0255  0.0163  254 ASP B OD2 
4652 N N   . GLY B 273 ? 0.4367 0.4353 0.4310 0.1902  0.0514  -0.0073 255 GLY B N   
4653 C CA  . GLY B 273 ? 0.4856 0.4626 0.4672 0.2101  0.0563  -0.0262 255 GLY B CA  
4654 C C   . GLY B 273 ? 0.5450 0.4674 0.5108 0.2101  0.0433  -0.0350 255 GLY B C   
4655 O O   . GLY B 273 ? 0.5606 0.4596 0.5137 0.2267  0.0444  -0.0540 255 GLY B O   
4656 N N   . LYS B 274 ? 0.5563 0.4601 0.5233 0.1913  0.0306  -0.0218 256 LYS B N   
4657 C CA  . LYS B 274 ? 0.5742 0.4280 0.5312 0.1871  0.0167  -0.0263 256 LYS B CA  
4658 C C   . LYS B 274 ? 0.5623 0.4034 0.4944 0.1736  0.0182  -0.0388 256 LYS B C   
4659 O O   . LYS B 274 ? 0.5029 0.3716 0.4281 0.1596  0.0264  -0.0355 256 LYS B O   
4660 C CB  . LYS B 274 ? 0.5952 0.4400 0.5651 0.1718  0.0033  -0.0037 256 LYS B CB  
4661 C CG  . LYS B 274 ? 0.6781 0.5292 0.6718 0.1866  -0.0020 0.0100  256 LYS B CG  
4662 C CD  . LYS B 274 ? 0.7070 0.5597 0.7108 0.1701  -0.0136 0.0361  256 LYS B CD  
4663 C CE  . LYS B 274 ? 0.7192 0.5872 0.7462 0.1849  -0.0184 0.0519  256 LYS B CE  
4664 N NZ  . LYS B 274 ? 0.7054 0.5899 0.7387 0.1680  -0.0272 0.0789  256 LYS B NZ  
4665 N N   . LYS B 275 ? 0.6119 0.4101 0.5315 0.1785  0.0089  -0.0537 257 LYS B N   
4666 C CA  . LYS B 275 ? 0.6165 0.4021 0.5119 0.1678  0.0083  -0.0672 257 LYS B CA  
4667 C C   . LYS B 275 ? 0.5701 0.3454 0.4667 0.1412  -0.0023 -0.0535 257 LYS B C   
4668 O O   . LYS B 275 ? 0.5919 0.3372 0.4985 0.1348  -0.0166 -0.0457 257 LYS B O   
4669 C CB  . LYS B 275 ? 0.7025 0.4477 0.5837 0.1844  0.0008  -0.0917 257 LYS B CB  
4670 C CG  . LYS B 275 ? 0.7545 0.5016 0.6062 0.1839  0.0059  -0.1111 257 LYS B CG  
4671 C CD  . LYS B 275 ? 0.8409 0.5731 0.6876 0.1952  0.0021  -0.1321 257 LYS B CD  
4672 C CE  . LYS B 275 ? 0.8948 0.6475 0.7162 0.1932  0.0101  -0.1460 257 LYS B CE  
4673 N NZ  . LYS B 275 ? 0.9671 0.7097 0.7820 0.2075  0.0085  -0.1674 257 LYS B NZ  
4674 N N   . ARG B 276 ? 0.5526 0.3543 0.4410 0.1259  0.0047  -0.0494 258 ARG B N   
4675 C CA  . ARG B 276 ? 0.5523 0.3520 0.4423 0.1025  -0.0030 -0.0379 258 ARG B CA  
4676 C C   . ARG B 276 ? 0.5148 0.3198 0.3861 0.0937  -0.0002 -0.0478 258 ARG B C   
4677 O O   . ARG B 276 ? 0.5258 0.3439 0.3834 0.1034  0.0098  -0.0587 258 ARG B O   
4678 C CB  . ARG B 276 ? 0.5341 0.3684 0.4392 0.0922  0.0017  -0.0185 258 ARG B CB  
4679 C CG  . ARG B 276 ? 0.5443 0.3787 0.4679 0.0974  -0.0030 -0.0038 258 ARG B CG  
4680 C CD  . ARG B 276 ? 0.4808 0.3515 0.4141 0.0853  0.0001  0.0131  258 ARG B CD  
4681 N NE  . ARG B 276 ? 0.4576 0.3349 0.4069 0.0917  -0.0040 0.0283  258 ARG B NE  
4682 C CZ  . ARG B 276 ? 0.4311 0.3267 0.3896 0.1069  0.0017  0.0279  258 ARG B CZ  
4683 N NH1 . ARG B 276 ? 0.3654 0.2757 0.3191 0.1159  0.0130  0.0140  258 ARG B NH1 
4684 N NH2 . ARG B 276 ? 0.3921 0.2942 0.3659 0.1126  -0.0041 0.0434  258 ARG B NH2 
4685 N N   . LYS B 277 ? 0.4792 0.2774 0.3512 0.0754  -0.0090 -0.0420 259 LYS B N   
4686 C CA  . LYS B 277 ? 0.5258 0.3335 0.3840 0.0660  -0.0074 -0.0477 259 LYS B CA  
4687 C C   . LYS B 277 ? 0.4897 0.3338 0.3561 0.0576  0.0017  -0.0360 259 LYS B C   
4688 O O   . LYS B 277 ? 0.4848 0.3402 0.3654 0.0465  -0.0010 -0.0229 259 LYS B O   
4689 C CB  . LYS B 277 ? 0.6025 0.3890 0.4606 0.0509  -0.0219 -0.0478 259 LYS B CB  
4690 C CG  . LYS B 277 ? 0.7125 0.4619 0.5565 0.0570  -0.0332 -0.0659 259 LYS B CG  
4691 C CD  . LYS B 277 ? 0.7304 0.4653 0.5766 0.0388  -0.0482 -0.0651 259 LYS B CD  
4692 C CE  . LYS B 277 ? 0.7878 0.4823 0.6214 0.0435  -0.0630 -0.0848 259 LYS B CE  
4693 N NZ  . LYS B 277 ? 0.8204 0.4823 0.6649 0.0526  -0.0702 -0.0865 259 LYS B NZ  
4694 N N   . ARG B 278 ? 0.4399 0.3030 0.2977 0.0629  0.0122  -0.0405 260 ARG B N   
4695 C CA  . ARG B 278 ? 0.4244 0.3151 0.2893 0.0535  0.0176  -0.0324 260 ARG B CA  
4696 C C   . ARG B 278 ? 0.4070 0.2952 0.2611 0.0451  0.0138  -0.0364 260 ARG B C   
4697 O O   . ARG B 278 ? 0.4557 0.3360 0.2922 0.0506  0.0146  -0.0451 260 ARG B O   
4698 C CB  . ARG B 278 ? 0.4285 0.3430 0.2969 0.0610  0.0297  -0.0306 260 ARG B CB  
4699 C CG  . ARG B 278 ? 0.4199 0.3565 0.2963 0.0508  0.0326  -0.0245 260 ARG B CG  
4700 C CD  . ARG B 278 ? 0.4264 0.3873 0.3158 0.0543  0.0411  -0.0191 260 ARG B CD  
4701 N NE  . ARG B 278 ? 0.5282 0.4925 0.4102 0.0663  0.0497  -0.0224 260 ARG B NE  
4702 C CZ  . ARG B 278 ? 0.4618 0.4362 0.3526 0.0773  0.0550  -0.0213 260 ARG B CZ  
4703 N NH1 . ARG B 278 ? 0.3888 0.3696 0.2959 0.0770  0.0514  -0.0156 260 ARG B NH1 
4704 N NH2 . ARG B 278 ? 0.4892 0.4709 0.3724 0.0893  0.0642  -0.0254 260 ARG B NH2 
4705 N N   . LEU B 279 ? 0.3550 0.2528 0.2195 0.0330  0.0095  -0.0299 261 LEU B N   
4706 C CA  . LEU B 279 ? 0.3561 0.2551 0.2153 0.0257  0.0050  -0.0321 261 LEU B CA  
4707 C C   . LEU B 279 ? 0.3503 0.2691 0.2127 0.0255  0.0119  -0.0293 261 LEU B C   
4708 O O   . LEU B 279 ? 0.2745 0.2102 0.1508 0.0242  0.0165  -0.0244 261 LEU B O   
4709 C CB  . LEU B 279 ? 0.3573 0.2592 0.2291 0.0140  -0.0031 -0.0267 261 LEU B CB  
4710 C CG  . LEU B 279 ? 0.4407 0.3484 0.3133 0.0064  -0.0091 -0.0278 261 LEU B CG  
4711 C CD1 . LEU B 279 ? 0.4776 0.3655 0.3322 0.0081  -0.0164 -0.0364 261 LEU B CD1 
4712 C CD2 . LEU B 279 ? 0.4680 0.3855 0.3570 -0.0045 -0.0150 -0.0207 261 LEU B CD2 
4713 N N   . VAL B 280 ? 0.3710 0.2867 0.2205 0.0266  0.0113  -0.0320 262 VAL B N   
4714 C CA  . VAL B 280 ? 0.3450 0.2747 0.1993 0.0252  0.0155  -0.0270 262 VAL B CA  
4715 C C   . VAL B 280 ? 0.3238 0.2516 0.1765 0.0199  0.0071  -0.0268 262 VAL B C   
4716 O O   . VAL B 280 ? 0.2969 0.2137 0.1335 0.0206  0.0012  -0.0305 262 VAL B O   
4717 C CB  . VAL B 280 ? 0.3582 0.2919 0.2008 0.0323  0.0243  -0.0250 262 VAL B CB  
4718 C CG1 . VAL B 280 ? 0.3271 0.2726 0.1785 0.0280  0.0266  -0.0163 262 VAL B CG1 
4719 C CG2 . VAL B 280 ? 0.3368 0.2766 0.1847 0.0391  0.0326  -0.0252 262 VAL B CG2 
4720 N N   . ILE B 281 ? 0.2993 0.2384 0.1692 0.0158  0.0057  -0.0236 263 ILE B N   
4721 C CA  . ILE B 281 ? 0.3049 0.2450 0.1786 0.0128  -0.0024 -0.0231 263 ILE B CA  
4722 C C   . ILE B 281 ? 0.3528 0.2975 0.2356 0.0136  -0.0012 -0.0178 263 ILE B C   
4723 O O   . ILE B 281 ? 0.3549 0.3076 0.2536 0.0132  0.0022  -0.0182 263 ILE B O   
4724 C CB  . ILE B 281 ? 0.2698 0.2203 0.1601 0.0083  -0.0070 -0.0256 263 ILE B CB  
4725 C CG1 . ILE B 281 ? 0.2847 0.2290 0.1704 0.0047  -0.0097 -0.0271 263 ILE B CG1 
4726 C CG2 . ILE B 281 ? 0.2490 0.2047 0.1473 0.0073  -0.0152 -0.0254 263 ILE B CG2 
4727 C CD1 . ILE B 281 ? 0.3012 0.2620 0.2042 -0.0006 -0.0105 -0.0252 263 ILE B CD1 
4728 N N   . ILE B 282 ? 0.3228 0.2620 0.1959 0.0145  -0.0056 -0.0126 264 ILE B N   
4729 C CA  . ILE B 282 ? 0.2747 0.2141 0.1575 0.0144  -0.0066 -0.0042 264 ILE B CA  
4730 C C   . ILE B 282 ? 0.2996 0.2373 0.1897 0.0149  -0.0178 -0.0027 264 ILE B C   
4731 O O   . ILE B 282 ? 0.3023 0.2365 0.1770 0.0155  -0.0240 0.0006  264 ILE B O   
4732 C CB  . ILE B 282 ? 0.4059 0.3434 0.2717 0.0152  -0.0012 0.0066  264 ILE B CB  
4733 C CG1 . ILE B 282 ? 0.3845 0.3278 0.2448 0.0168  0.0106  0.0050  264 ILE B CG1 
4734 C CG2 . ILE B 282 ? 0.2984 0.2344 0.1782 0.0126  -0.0037 0.0194  264 ILE B CG2 
4735 C CD1 . ILE B 282 ? 0.3677 0.3178 0.2515 0.0142  0.0145  0.0034  264 ILE B CD1 
4736 N N   . THR B 283 ? 0.2687 0.2102 0.1826 0.0160  -0.0212 -0.0063 265 THR B N   
4737 C CA  . THR B 283 ? 0.3346 0.2762 0.2604 0.0192  -0.0319 -0.0055 265 THR B CA  
4738 C C   . THR B 283 ? 0.3635 0.2935 0.2905 0.0201  -0.0369 0.0080  265 THR B C   
4739 O O   . THR B 283 ? 0.3583 0.2824 0.2878 0.0173  -0.0319 0.0150  265 THR B O   
4740 C CB  . THR B 283 ? 0.3411 0.2934 0.2919 0.0229  -0.0333 -0.0170 265 THR B CB  
4741 O OG1 . THR B 283 ? 0.3529 0.3015 0.3148 0.0228  -0.0289 -0.0200 265 THR B OG1 
4742 C CG2 . THR B 283 ? 0.3159 0.2838 0.2650 0.0207  -0.0292 -0.0254 265 THR B CG2 
4743 N N   . ARG B 284 ? 0.3714 0.2996 0.2980 0.0231  -0.0476 0.0140  266 ARG B N   
4744 C CA  . ARG B 284 ? 0.3939 0.3110 0.3213 0.0238  -0.0541 0.0309  266 ARG B CA  
4745 C C   . ARG B 284 ? 0.3919 0.3063 0.3424 0.0308  -0.0675 0.0314  266 ARG B C   
4746 O O   . ARG B 284 ? 0.4179 0.3298 0.3627 0.0330  -0.0776 0.0440  266 ARG B O   
4747 C CB  . ARG B 284 ? 0.4450 0.3632 0.3407 0.0213  -0.0544 0.0431  266 ARG B CB  
4748 C CG  . ARG B 284 ? 0.4881 0.4109 0.3598 0.0178  -0.0413 0.0396  266 ARG B CG  
4749 C CD  . ARG B 284 ? 0.5724 0.4980 0.4116 0.0176  -0.0407 0.0516  266 ARG B CD  
4750 N NE  . ARG B 284 ? 0.6770 0.6015 0.5180 0.0149  -0.0377 0.0726  266 ARG B NE  
4751 C CZ  . ARG B 284 ? 0.7390 0.6717 0.5532 0.0142  -0.0332 0.0871  266 ARG B CZ  
4752 N NH1 . ARG B 284 ? 0.7233 0.6640 0.5042 0.0178  -0.0317 0.0791  266 ARG B NH1 
4753 N NH2 . ARG B 284 ? 0.7859 0.7198 0.6068 0.0096  -0.0304 0.1097  266 ARG B NH2 
4754 N N   . GLY B 285 ? 0.3616 0.2786 0.3378 0.0359  -0.0679 0.0171  267 GLY B N   
4755 C CA  . GLY B 285 ? 0.3279 0.2434 0.3299 0.0458  -0.0797 0.0141  267 GLY B CA  
4756 C C   . GLY B 285 ? 0.4020 0.3346 0.4027 0.0499  -0.0868 0.0124  267 GLY B C   
4757 O O   . GLY B 285 ? 0.3678 0.3182 0.3619 0.0469  -0.0814 0.0024  267 GLY B O   
4758 N N   . LYS B 286 ? 0.4135 0.3410 0.4223 0.0560  -0.1002 0.0238  268 LYS B N   
4759 C CA  . LYS B 286 ? 0.4202 0.3659 0.4311 0.0599  -0.1098 0.0239  268 LYS B CA  
4760 C C   . LYS B 286 ? 0.4157 0.3646 0.3926 0.0504  -0.1107 0.0331  268 LYS B C   
4761 O O   . LYS B 286 ? 0.3930 0.3581 0.3672 0.0497  -0.1182 0.0310  268 LYS B O   
4762 C CB  . LYS B 286 ? 0.4693 0.4088 0.5027 0.0715  -0.1255 0.0335  268 LYS B CB  
4763 C CG  . LYS B 286 ? 0.5426 0.4630 0.5595 0.0683  -0.1339 0.0582  268 LYS B CG  
4764 C CD  . LYS B 286 ? 0.6122 0.5270 0.6535 0.0806  -0.1517 0.0695  268 LYS B CD  
4765 C CE  . LYS B 286 ? 0.6861 0.5715 0.7490 0.0851  -0.1553 0.0768  268 LYS B CE  
4766 N NZ  . LYS B 286 ? 0.7385 0.6063 0.7775 0.0720  -0.1504 0.0977  268 LYS B NZ  
4767 N N   . ASN B 287 ? 0.3628 0.2977 0.3146 0.0434  -0.1036 0.0424  269 ASN B N   
4768 C CA  . ASN B 287 ? 0.3748 0.3122 0.2908 0.0367  -0.1034 0.0482  269 ASN B CA  
4769 C C   . ASN B 287 ? 0.3917 0.3359 0.2951 0.0304  -0.0931 0.0321  269 ASN B C   
4770 O O   . ASN B 287 ? 0.3456 0.2916 0.2644 0.0300  -0.0836 0.0213  269 ASN B O   
4771 C CB  . ASN B 287 ? 0.3954 0.3202 0.2910 0.0336  -0.0992 0.0662  269 ASN B CB  
4772 C CG  . ASN B 287 ? 0.4498 0.3660 0.3575 0.0383  -0.1118 0.0867  269 ASN B CG  
4773 O OD1 . ASN B 287 ? 0.4668 0.3894 0.3800 0.0436  -0.1264 0.0911  269 ASN B OD1 
4774 N ND2 . ASN B 287 ? 0.4449 0.3469 0.3596 0.0358  -0.1074 0.1008  269 ASN B ND2 
4775 N N   . PRO B 288 ? 0.4205 0.3680 0.2963 0.0259  -0.0964 0.0301  270 PRO B N   
4776 C CA  . PRO B 288 ? 0.3886 0.3379 0.2551 0.0202  -0.0894 0.0155  270 PRO B CA  
4777 C C   . PRO B 288 ? 0.3741 0.3153 0.2356 0.0189  -0.0729 0.0122  270 PRO B C   
4778 O O   . PRO B 288 ? 0.3768 0.3111 0.2248 0.0199  -0.0665 0.0215  270 PRO B O   
4779 C CB  . PRO B 288 ? 0.4170 0.3644 0.2500 0.0174  -0.0971 0.0147  270 PRO B CB  
4780 C CG  . PRO B 288 ? 0.4007 0.3544 0.2343 0.0208  -0.1125 0.0265  270 PRO B CG  
4781 C CD  . PRO B 288 ? 0.3968 0.3461 0.2495 0.0264  -0.1090 0.0402  270 PRO B CD  
4782 N N   . LEU B 289 ? 0.3243 0.2694 0.1980 0.0161  -0.0663 0.0010  271 LEU B N   
4783 C CA  . LEU B 289 ? 0.3186 0.2583 0.1878 0.0151  -0.0523 -0.0024 271 LEU B CA  
4784 C C   . LEU B 289 ? 0.3813 0.3130 0.2207 0.0136  -0.0490 -0.0064 271 LEU B C   
4785 O O   . LEU B 289 ? 0.3914 0.3209 0.2152 0.0119  -0.0583 -0.0104 271 LEU B O   
4786 C CB  . LEU B 289 ? 0.3386 0.2874 0.2299 0.0134  -0.0472 -0.0112 271 LEU B CB  
4787 C CG  . LEU B 289 ? 0.3599 0.3173 0.2562 0.0081  -0.0519 -0.0180 271 LEU B CG  
4788 C CD1 . LEU B 289 ? 0.4006 0.3475 0.2799 0.0039  -0.0470 -0.0226 271 LEU B CD1 
4789 C CD2 . LEU B 289 ? 0.3251 0.3016 0.2495 0.0085  -0.0492 -0.0217 271 LEU B CD2 
4790 N N   . LEU B 290 ? 0.3515 0.2795 0.1841 0.0149  -0.0365 -0.0065 272 LEU B N   
4791 C CA  . LEU B 290 ? 0.3878 0.3090 0.1947 0.0167  -0.0317 -0.0125 272 LEU B CA  
4792 C C   . LEU B 290 ? 0.4198 0.3385 0.2371 0.0152  -0.0258 -0.0212 272 LEU B C   
4793 O O   . LEU B 290 ? 0.3865 0.3120 0.2260 0.0137  -0.0208 -0.0195 272 LEU B O   
4794 C CB  . LEU B 290 ? 0.3914 0.3155 0.1836 0.0209  -0.0211 -0.0038 272 LEU B CB  
4795 C CG  . LEU B 290 ? 0.4370 0.3654 0.2209 0.0213  -0.0258 0.0108  272 LEU B CG  
4796 C CD1 . LEU B 290 ? 0.4286 0.3646 0.2009 0.0235  -0.0134 0.0225  272 LEU B CD1 
4797 C CD2 . LEU B 290 ? 0.4847 0.4115 0.2448 0.0224  -0.0384 0.0071  272 LEU B CD2 
4798 N N   . TYR B 291 ? 0.4097 0.3180 0.2111 0.0160  -0.0278 -0.0307 273 TYR B N   
4799 C CA  . TYR B 291 ? 0.4345 0.3375 0.2441 0.0156  -0.0226 -0.0362 273 TYR B CA  
4800 C C   . TYR B 291 ? 0.4568 0.3445 0.2433 0.0216  -0.0222 -0.0465 273 TYR B C   
4801 O O   . TYR B 291 ? 0.4823 0.3609 0.2485 0.0225  -0.0313 -0.0539 273 TYR B O   
4802 C CB  . TYR B 291 ? 0.4086 0.3143 0.2395 0.0073  -0.0301 -0.0369 273 TYR B CB  
4803 C CG  . TYR B 291 ? 0.4378 0.3337 0.2626 0.0015  -0.0443 -0.0429 273 TYR B CG  
4804 C CD1 . TYR B 291 ? 0.4792 0.3567 0.2972 -0.0002 -0.0489 -0.0507 273 TYR B CD1 
4805 C CD2 . TYR B 291 ? 0.4454 0.3496 0.2737 -0.0024 -0.0550 -0.0407 273 TYR B CD2 
4806 C CE1 . TYR B 291 ? 0.4612 0.3276 0.2762 -0.0074 -0.0644 -0.0569 273 TYR B CE1 
4807 C CE2 . TYR B 291 ? 0.4524 0.3500 0.2776 -0.0092 -0.0699 -0.0462 273 TYR B CE2 
4808 C CZ  . TYR B 291 ? 0.4892 0.3671 0.3077 -0.0126 -0.0748 -0.0547 273 TYR B CZ  
4809 O OH  . TYR B 291 ? 0.5214 0.3905 0.3390 -0.0212 -0.0920 -0.0609 273 TYR B OH  
4810 N N   . THR B 292 ? 0.4031 0.2887 0.1928 0.0267  -0.0125 -0.0482 274 THR B N   
4811 C CA  . THR B 292 ? 0.4371 0.3073 0.2087 0.0354  -0.0117 -0.0598 274 THR B CA  
4812 C C   . THR B 292 ? 0.4549 0.3215 0.2427 0.0378  -0.0059 -0.0591 274 THR B C   
4813 O O   . THR B 292 ? 0.4107 0.2896 0.2204 0.0322  -0.0022 -0.0495 274 THR B O   
4814 C CB  . THR B 292 ? 0.4916 0.3705 0.2393 0.0464  -0.0019 -0.0614 274 THR B CB  
4815 O OG1 . THR B 292 ? 0.5819 0.4456 0.3086 0.0572  -0.0032 -0.0775 274 THR B OG1 
4816 C CG2 . THR B 292 ? 0.4344 0.3326 0.1957 0.0496  0.0134  -0.0505 274 THR B CG2 
4817 N N   . ASP B 293 ? 0.4678 0.3175 0.2446 0.0471  -0.0063 -0.0701 275 ASP B N   
4818 C CA  . ASP B 293 ? 0.4784 0.3250 0.2697 0.0524  -0.0009 -0.0683 275 ASP B CA  
4819 C C   . ASP B 293 ? 0.4991 0.3392 0.2742 0.0699  0.0059  -0.0801 275 ASP B C   
4820 O O   . ASP B 293 ? 0.5549 0.3889 0.3051 0.0772  0.0043  -0.0924 275 ASP B O   
4821 C CB  . ASP B 293 ? 0.5070 0.3355 0.3143 0.0432  -0.0127 -0.0664 275 ASP B CB  
4822 C CG  . ASP B 293 ? 0.6147 0.4113 0.4094 0.0447  -0.0264 -0.0807 275 ASP B CG  
4823 O OD1 . ASP B 293 ? 0.6635 0.4420 0.4513 0.0576  -0.0260 -0.0913 275 ASP B OD1 
4824 O OD2 . ASP B 293 ? 0.6555 0.4452 0.4491 0.0332  -0.0388 -0.0824 275 ASP B OD2 
4825 N N   . SER B 294 ? 0.4999 0.3445 0.2890 0.0778  0.0134  -0.0767 276 SER B N   
4826 C CA  . SER B 294 ? 0.5755 0.4205 0.3546 0.0971  0.0220  -0.0871 276 SER B CA  
4827 C C   . SER B 294 ? 0.6099 0.4230 0.3700 0.1079  0.0121  -0.1081 276 SER B C   
4828 O O   . SER B 294 ? 0.6099 0.4318 0.3609 0.1220  0.0190  -0.1181 276 SER B O   
4829 C CB  . SER B 294 ? 0.5780 0.4324 0.3806 0.1031  0.0284  -0.0786 276 SER B CB  
4830 O OG  . SER B 294 ? 0.5961 0.4329 0.4161 0.0936  0.0172  -0.0718 276 SER B OG  
4831 N N   . SER B 295 ? 0.6303 0.4142 0.3943 0.0970  -0.0048 -0.1112 277 SER B N   
4832 C CA  . SER B 295 ? 0.6956 0.4474 0.4473 0.1028  -0.0181 -0.1308 277 SER B CA  
4833 C C   . SER B 295 ? 0.7077 0.4665 0.4407 0.0961  -0.0238 -0.1384 277 SER B C   
4834 O O   . SER B 295 ? 0.7191 0.4638 0.4440 0.1000  -0.0323 -0.1538 277 SER B O   
4835 C CB  . SER B 295 ? 0.7217 0.4378 0.4907 0.0919  -0.0357 -0.1284 277 SER B CB  
4836 O OG  . SER B 295 ? 0.7841 0.4940 0.5739 0.0996  -0.0325 -0.1208 277 SER B OG  
4837 N N   . ASP B 296 ? 0.7083 0.4884 0.4351 0.0866  -0.0198 -0.1276 278 ASP B N   
4838 C CA  . ASP B 296 ? 0.7382 0.5254 0.4489 0.0796  -0.0269 -0.1315 278 ASP B CA  
4839 C C   . ASP B 296 ? 0.7437 0.5628 0.4383 0.0883  -0.0126 -0.1298 278 ASP B C   
4840 O O   . ASP B 296 ? 0.7351 0.5782 0.4339 0.0895  0.0014  -0.1158 278 ASP B O   
4841 C CB  . ASP B 296 ? 0.7415 0.5305 0.4574 0.0630  -0.0347 -0.1196 278 ASP B CB  
4842 C CG  . ASP B 296 ? 0.8237 0.6094 0.5296 0.0538  -0.0498 -0.1254 278 ASP B CG  
4843 O OD1 . ASP B 296 ? 0.8635 0.6446 0.5790 0.0395  -0.0614 -0.1189 278 ASP B OD1 
4844 O OD2 . ASP B 296 ? 0.8491 0.6391 0.5381 0.0608  -0.0505 -0.1364 278 ASP B OD2 
4845 N N   . SER B 297 ? 0.7560 0.5752 0.4324 0.0933  -0.0166 -0.1433 279 SER B N   
4846 C CA  . SER B 297 ? 0.7616 0.6111 0.4196 0.1002  -0.0044 -0.1412 279 SER B CA  
4847 C C   . SER B 297 ? 0.7610 0.6262 0.4086 0.0890  -0.0077 -0.1285 279 SER B C   
4848 O O   . SER B 297 ? 0.7499 0.6413 0.3834 0.0916  0.0021  -0.1207 279 SER B O   
4849 C CB  . SER B 297 ? 0.7837 0.6279 0.4232 0.1109  -0.0073 -0.1619 279 SER B CB  
4850 O OG  . SER B 297 ? 0.7862 0.6084 0.4175 0.1027  -0.0265 -0.1736 279 SER B OG  
4851 N N   . GLU B 298 ? 0.7476 0.5973 0.4034 0.0763  -0.0219 -0.1250 280 GLU B N   
4852 C CA  . GLU B 298 ? 0.7481 0.6105 0.3967 0.0667  -0.0277 -0.1131 280 GLU B CA  
4853 C C   . GLU B 298 ? 0.6916 0.5578 0.3577 0.0588  -0.0250 -0.0956 280 GLU B C   
4854 O O   . GLU B 298 ? 0.6413 0.4945 0.3254 0.0565  -0.0244 -0.0949 280 GLU B O   
4855 C CB  . GLU B 298 ? 0.8131 0.6600 0.4567 0.0582  -0.0483 -0.1235 280 GLU B CB  
4856 C CG  . GLU B 298 ? 0.9423 0.7827 0.5671 0.0650  -0.0535 -0.1433 280 GLU B CG  
4857 C CD  . GLU B 298 ? 1.0411 0.8671 0.6639 0.0547  -0.0752 -0.1529 280 GLU B CD  
4858 O OE1 . GLU B 298 ? 1.0432 0.8691 0.6794 0.0426  -0.0854 -0.1423 280 GLU B OE1 
4859 O OE2 . GLU B 298 ? 1.1095 0.9255 0.7186 0.0588  -0.0824 -0.1713 280 GLU B OE2 
4860 N N   . ILE B 299 ? 0.6414 0.5248 0.3009 0.0550  -0.0240 -0.0810 281 ILE B N   
4861 C CA  . ILE B 299 ? 0.5792 0.4656 0.2568 0.0470  -0.0242 -0.0653 281 ILE B CA  
4862 C C   . ILE B 299 ? 0.6054 0.4890 0.2868 0.0372  -0.0419 -0.0633 281 ILE B C   
4863 O O   . ILE B 299 ? 0.6416 0.5305 0.2989 0.0388  -0.0497 -0.0634 281 ILE B O   
4864 C CB  . ILE B 299 ? 0.5285 0.4374 0.2077 0.0489  -0.0102 -0.0467 281 ILE B CB  
4865 C CG1 . ILE B 299 ? 0.5104 0.4273 0.1909 0.0578  0.0073  -0.0479 281 ILE B CG1 
4866 C CG2 . ILE B 299 ? 0.4704 0.3843 0.1820 0.0386  -0.0124 -0.0311 281 ILE B CG2 
4867 C CD1 . ILE B 299 ? 0.5345 0.4762 0.2135 0.0593  0.0212  -0.0299 281 ILE B CD1 
4868 N N   . HIS B 300 ? 0.5678 0.4466 0.2794 0.0276  -0.0483 -0.0608 282 HIS B N   
4869 C CA  . HIS B 300 ? 0.5583 0.4373 0.2783 0.0186  -0.0654 -0.0603 282 HIS B CA  
4870 C C   . HIS B 300 ? 0.4931 0.3891 0.2354 0.0147  -0.0652 -0.0437 282 HIS B C   
4871 O O   . HIS B 300 ? 0.4378 0.3405 0.2002 0.0151  -0.0539 -0.0353 282 HIS B O   
4872 C CB  . HIS B 300 ? 0.5670 0.4331 0.3068 0.0099  -0.0742 -0.0684 282 HIS B CB  
4873 C CG  . HIS B 300 ? 0.6187 0.4621 0.3426 0.0142  -0.0759 -0.0848 282 HIS B CG  
4874 N ND1 . HIS B 300 ? 0.6733 0.5035 0.3703 0.0171  -0.0880 -0.1006 282 HIS B ND1 
4875 C CD2 . HIS B 300 ? 0.6291 0.4602 0.3617 0.0172  -0.0678 -0.0885 282 HIS B CD2 
4876 C CE1 . HIS B 300 ? 0.7010 0.5133 0.3976 0.0219  -0.0857 -0.1129 282 HIS B CE1 
4877 N NE2 . HIS B 300 ? 0.6696 0.4773 0.3815 0.0229  -0.0756 -0.1069 282 HIS B NE2 
4878 N N   . GLN B 301 ? 0.5037 0.4060 0.2424 0.0119  -0.0791 -0.0402 283 GLN B N   
4879 C CA  . GLN B 301 ? 0.5134 0.4296 0.2767 0.0098  -0.0825 -0.0265 283 GLN B CA  
4880 C C   . GLN B 301 ? 0.5030 0.4249 0.2960 0.0018  -0.0920 -0.0298 283 GLN B C   
4881 O O   . GLN B 301 ? 0.5158 0.4320 0.3055 -0.0045 -0.1031 -0.0394 283 GLN B O   
4882 C CB  . GLN B 301 ? 0.5797 0.5032 0.3251 0.0126  -0.0928 -0.0177 283 GLN B CB  
4883 C CG  . GLN B 301 ? 0.6278 0.5531 0.3465 0.0195  -0.0826 -0.0085 283 GLN B CG  
4884 C CD  . GLN B 301 ? 0.6832 0.6181 0.3863 0.0214  -0.0938 0.0048  283 GLN B CD  
4885 O OE1 . GLN B 301 ? 0.6960 0.6365 0.4176 0.0220  -0.0948 0.0221  283 GLN B OE1 
4886 N NE2 . GLN B 301 ? 0.7292 0.6653 0.3983 0.0230  -0.1039 -0.0034 283 GLN B NE2 
4887 N N   . PHE B 302 ? 0.4575 0.3920 0.2804 0.0019  -0.0882 -0.0219 284 PHE B N   
4888 C CA  . PHE B 302 ? 0.3967 0.3447 0.2497 -0.0043 -0.0943 -0.0234 284 PHE B CA  
4889 C C   . PHE B 302 ? 0.3589 0.3235 0.2342 0.0006  -0.0985 -0.0148 284 PHE B C   
4890 O O   . PHE B 302 ? 0.3587 0.3256 0.2469 0.0065  -0.0890 -0.0107 284 PHE B O   
4891 C CB  . PHE B 302 ? 0.3736 0.3224 0.2422 -0.0072 -0.0819 -0.0264 284 PHE B CB  
4892 C CG  . PHE B 302 ? 0.3642 0.3335 0.2640 -0.0136 -0.0849 -0.0255 284 PHE B CG  
4893 C CD1 . PHE B 302 ? 0.3852 0.3543 0.2903 -0.0246 -0.0928 -0.0283 284 PHE B CD1 
4894 C CD2 . PHE B 302 ? 0.3243 0.3139 0.2490 -0.0084 -0.0798 -0.0219 284 PHE B CD2 
4895 C CE1 . PHE B 302 ? 0.3727 0.3665 0.3081 -0.0319 -0.0941 -0.0241 284 PHE B CE1 
4896 C CE2 . PHE B 302 ? 0.3564 0.3717 0.3089 -0.0129 -0.0804 -0.0212 284 PHE B CE2 
4897 C CZ  . PHE B 302 ? 0.3686 0.3884 0.3268 -0.0253 -0.0868 -0.0206 284 PHE B CZ  
4898 N N   . MET B 303 ? 0.3529 0.3284 0.2338 -0.0013 -0.1142 -0.0129 285 MET B N   
4899 C CA  . MET B 303 ? 0.4086 0.4003 0.3127 0.0054  -0.1208 -0.0049 285 MET B CA  
4900 C C   . MET B 303 ? 0.3876 0.3965 0.3267 0.0082  -0.1121 -0.0071 285 MET B C   
4901 O O   . MET B 303 ? 0.3316 0.3510 0.2828 0.0011  -0.1076 -0.0125 285 MET B O   
4902 C CB  . MET B 303 ? 0.4215 0.4268 0.3295 0.0018  -0.1402 -0.0034 285 MET B CB  
4903 C CG  . MET B 303 ? 0.5150 0.5245 0.4230 0.0110  -0.1509 0.0081  285 MET B CG  
4904 S SD  . MET B 303 ? 1.0276 1.0545 0.9357 0.0064  -0.1761 0.0099  285 MET B SD  
4905 C CE  . MET B 303 ? 0.3995 0.4590 0.3589 0.0033  -0.1776 0.0064  285 MET B CE  
4906 N N   . VAL B 304 ? 0.3564 0.3680 0.3113 0.0189  -0.1104 -0.0025 286 VAL B N   
4907 C CA  . VAL B 304 ? 0.3630 0.3901 0.3478 0.0250  -0.1019 -0.0079 286 VAL B CA  
4908 C C   . VAL B 304 ? 0.3809 0.4303 0.3961 0.0344  -0.1121 -0.0063 286 VAL B C   
4909 O O   . VAL B 304 ? 0.3138 0.3577 0.3272 0.0396  -0.1244 0.0021  286 VAL B O   
4910 C CB  . VAL B 304 ? 0.4166 0.4252 0.3974 0.0310  -0.0910 -0.0083 286 VAL B CB  
4911 C CG1 . VAL B 304 ? 0.4420 0.4659 0.4516 0.0394  -0.0845 -0.0172 286 VAL B CG1 
4912 C CG2 . VAL B 304 ? 0.4040 0.3972 0.3598 0.0230  -0.0801 -0.0102 286 VAL B CG2 
4913 N N   . GLU B 305 ? 0.4290 0.5063 0.4720 0.0373  -0.1068 -0.0137 287 GLU B N   
4914 C CA  . GLU B 305 ? 0.4711 0.5749 0.5474 0.0495  -0.1139 -0.0148 287 GLU B CA  
4915 C C   . GLU B 305 ? 0.4932 0.5796 0.5787 0.0658  -0.1162 -0.0149 287 GLU B C   
4916 O O   . GLU B 305 ? 0.4885 0.5530 0.5649 0.0678  -0.1072 -0.0188 287 GLU B O   
4917 C CB  . GLU B 305 ? 0.4540 0.5953 0.5560 0.0505  -0.1038 -0.0236 287 GLU B CB  
4918 N N   . GLN B 306 ? 0.4985 0.5940 0.6042 0.0769  -0.1297 -0.0100 288 GLN B N   
4919 C CA  . GLN B 306 ? 0.5350 0.6111 0.6541 0.0930  -0.1352 -0.0085 288 GLN B CA  
4920 C C   . GLN B 306 ? 0.5705 0.6712 0.7271 0.1107  -0.1321 -0.0234 288 GLN B C   
4921 O O   . GLN B 306 ? 0.5592 0.7004 0.7360 0.1127  -0.1305 -0.0290 288 GLN B O   
4922 C CB  . GLN B 306 ? 0.5281 0.5952 0.6454 0.0965  -0.1539 0.0083  288 GLN B CB  
4923 C CG  . GLN B 306 ? 0.5049 0.5549 0.5826 0.0809  -0.1580 0.0213  288 GLN B CG  
4924 C CD  . GLN B 306 ? 0.4809 0.4956 0.5324 0.0762  -0.1501 0.0274  288 GLN B CD  
4925 O OE1 . GLN B 306 ? 0.5419 0.5353 0.5980 0.0837  -0.1559 0.0381  288 GLN B OE1 
4926 N NE2 . GLN B 306 ? 0.4168 0.4258 0.4432 0.0637  -0.1374 0.0219  288 GLN B NE2 
4927 N N   . PHE B 307 ? 0.6135 0.6911 0.7802 0.1236  -0.1315 -0.0302 289 PHE B N   
4928 C CA  . PHE B 307 ? 0.6431 0.7397 0.8426 0.1435  -0.1285 -0.0490 289 PHE B CA  
4929 C C   . PHE B 307 ? 0.7154 0.7872 0.9380 0.1627  -0.1433 -0.0476 289 PHE B C   
4930 O O   . PHE B 307 ? 0.7205 0.7602 0.9327 0.1587  -0.1551 -0.0288 289 PHE B O   
4931 C CB  . PHE B 307 ? 0.6052 0.6989 0.7968 0.1419  -0.1127 -0.0664 289 PHE B CB  
4932 C CG  . PHE B 307 ? 0.5834 0.6943 0.7514 0.1228  -0.0992 -0.0649 289 PHE B CG  
4933 C CD1 . PHE B 307 ? 0.5620 0.7199 0.7415 0.1220  -0.0907 -0.0715 289 PHE B CD1 
4934 C CD2 . PHE B 307 ? 0.5804 0.6618 0.7169 0.1060  -0.0953 -0.0557 289 PHE B CD2 
4935 C CE1 . PHE B 307 ? 0.5232 0.6934 0.6835 0.1039  -0.0800 -0.0675 289 PHE B CE1 
4936 C CE2 . PHE B 307 ? 0.5448 0.6390 0.6621 0.0903  -0.0844 -0.0544 289 PHE B CE2 
4937 C CZ  . PHE B 307 ? 0.5102 0.6463 0.6395 0.0887  -0.0776 -0.0597 289 PHE B CZ  
4938 N N   . LYS B 308 ? 0.7941 0.8812 1.0480 0.1843  -0.1426 -0.0672 290 LYS B N   
4939 C CA  . LYS B 308 ? 0.8747 0.9363 1.1541 0.2042  -0.1569 -0.0683 290 LYS B CA  
4940 C C   . LYS B 308 ? 0.9307 0.9414 1.2018 0.2021  -0.1574 -0.0722 290 LYS B C   
4941 O O   . LYS B 308 ? 0.9644 0.9709 1.2436 0.2103  -0.1504 -0.0941 290 LYS B O   
4942 C CB  . LYS B 308 ? 0.8957 0.9915 1.2007 0.2214  -0.1500 -0.0870 290 LYS B CB  
4943 C CG  . LYS B 308 ? 0.9064 1.0564 1.2248 0.2219  -0.1490 -0.0812 290 LYS B CG  
4944 C CD  . LYS B 308 ? 0.9508 1.0925 1.2726 0.2196  -0.1672 -0.0561 290 LYS B CD  
4945 C CE  . LYS B 308 ? 0.9403 1.1112 1.2503 0.2025  -0.1707 -0.0424 290 LYS B CE  
4946 N NZ  . LYS B 308 ? 0.9264 1.1577 1.2548 0.2021  -0.1604 -0.0507 290 LYS B NZ  
4947 N N   . ASP B 309 ? 0.9463 0.9210 1.1982 0.1883  -0.1652 -0.0496 291 ASP B N   
4948 C CA  . ASP B 309 ? 0.9187 0.8451 1.1645 0.1822  -0.1679 -0.0460 291 ASP B CA  
4949 C C   . ASP B 309 ? 0.9093 0.8332 1.1351 0.1692  -0.1519 -0.0599 291 ASP B C   
4950 O O   . ASP B 309 ? 0.9562 0.8473 1.1870 0.1685  -0.1544 -0.0661 291 ASP B O   
4951 C CB  . ASP B 309 ? 0.8929 0.7960 1.1611 0.1937  -0.1743 -0.0541 291 ASP B CB  
4952 N N   . ASP B 310 ? 0.8268 0.7845 1.0311 0.1576  -0.1370 -0.0632 292 ASP B N   
4953 C CA  . ASP B 310 ? 0.7790 0.7384 0.9635 0.1452  -0.1220 -0.0742 292 ASP B CA  
4954 C C   . ASP B 310 ? 0.7075 0.6735 0.8581 0.1235  -0.1127 -0.0574 292 ASP B C   
4955 O O   . ASP B 310 ? 0.6961 0.6749 0.8381 0.1188  -0.1162 -0.0431 292 ASP B O   
4956 C CB  . ASP B 310 ? 0.7827 0.7799 0.9776 0.1563  -0.1112 -0.1014 292 ASP B CB  
4957 C CG  . ASP B 310 ? 0.8263 0.8174 1.0523 0.1802  -0.1189 -0.1246 292 ASP B CG  
4958 O OD1 . ASP B 310 ? 0.8460 0.8573 1.0925 0.1951  -0.1236 -0.1278 292 ASP B OD1 
4959 O OD2 . ASP B 310 ? 0.8357 0.8030 1.0611 0.1800  -0.1187 -0.1383 292 ASP B OD2 
4960 N N   . GLN B 311 ? 0.6899 0.6475 0.8222 0.1114  -0.1021 -0.0608 293 GLN B N   
4961 C CA  . GLN B 311 ? 0.7084 0.6698 0.8097 0.0932  -0.0929 -0.0480 293 GLN B CA  
4962 C C   . GLN B 311 ? 0.6634 0.6476 0.7544 0.0875  -0.0783 -0.0619 293 GLN B C   
4963 O O   . GLN B 311 ? 0.6394 0.6310 0.7424 0.0951  -0.0745 -0.0804 293 GLN B O   
4964 C CB  . GLN B 311 ? 0.7893 0.7175 0.8762 0.0822  -0.0944 -0.0315 293 GLN B CB  
4965 C CG  . GLN B 311 ? 0.9031 0.8120 0.9906 0.0830  -0.1074 -0.0096 293 GLN B CG  
4966 C CD  . GLN B 311 ? 1.0024 0.8850 1.0764 0.0711  -0.1067 0.0090  293 GLN B CD  
4967 O OE1 . GLN B 311 ? 1.0215 0.8926 1.0994 0.0661  -0.1014 0.0030  293 GLN B OE1 
4968 N NE2 . GLN B 311 ? 1.0409 0.9174 1.0988 0.0661  -0.1123 0.0322  293 GLN B NE2 
4969 N N   . ILE B 312 ? 0.6488 0.6432 0.7172 0.0746  -0.0712 -0.0530 294 ILE B N   
4970 C CA  . ILE B 312 ? 0.6378 0.6506 0.6952 0.0675  -0.0584 -0.0611 294 ILE B CA  
4971 C C   . ILE B 312 ? 0.6638 0.6560 0.7071 0.0596  -0.0526 -0.0596 294 ILE B C   
4972 O O   . ILE B 312 ? 0.6485 0.6526 0.6835 0.0547  -0.0432 -0.0656 294 ILE B O   
4973 C CB  . ILE B 312 ? 0.6240 0.6509 0.6651 0.0565  -0.0552 -0.0517 294 ILE B CB  
4974 C CG1 . ILE B 312 ? 0.6112 0.6126 0.6269 0.0460  -0.0556 -0.0379 294 ILE B CG1 
4975 C CG2 . ILE B 312 ? 0.6192 0.6664 0.6747 0.0610  -0.0632 -0.0493 294 ILE B CG2 
4976 C CD1 . ILE B 312 ? 0.6044 0.6129 0.6021 0.0354  -0.0529 -0.0329 294 ILE B CD1 
4977 N N   . ILE B 313 ? 0.6999 0.6637 0.7423 0.0580  -0.0587 -0.0494 295 ILE B N   
4978 C CA  . ILE B 313 ? 0.7221 0.6692 0.7522 0.0485  -0.0534 -0.0430 295 ILE B CA  
4979 C C   . ILE B 313 ? 0.7453 0.6859 0.7916 0.0517  -0.0541 -0.0569 295 ILE B C   
4980 O O   . ILE B 313 ? 0.7403 0.6792 0.7797 0.0442  -0.0479 -0.0576 295 ILE B O   
4981 C CB  . ILE B 313 ? 0.4411 0.3657 0.4628 0.0434  -0.0589 -0.0222 295 ILE B CB  
4982 C CG1 . ILE B 313 ? 0.4331 0.3551 0.4315 0.0323  -0.0493 -0.0117 295 ILE B CG1 
4983 C CG2 . ILE B 313 ? 0.4988 0.4001 0.5426 0.0474  -0.0692 -0.0190 295 ILE B CG2 
4984 C CD1 . ILE B 313 ? 0.5100 0.4139 0.5034 0.0269  -0.0521 0.0085  295 ILE B CD1 
4985 N N   . ASP B 314 ? 0.7663 0.7041 0.8351 0.0638  -0.0626 -0.0694 296 ASP B N   
4986 C CA  . ASP B 314 ? 0.7996 0.7263 0.8851 0.0683  -0.0670 -0.0857 296 ASP B CA  
4987 C C   . ASP B 314 ? 0.7820 0.7097 0.8914 0.0859  -0.0762 -0.1031 296 ASP B C   
4988 O O   . ASP B 314 ? 0.7807 0.6847 0.9063 0.0917  -0.0882 -0.0963 296 ASP B O   
4989 C CB  . ASP B 314 ? 0.8458 0.7399 0.9367 0.0588  -0.0734 -0.0716 296 ASP B CB  
4990 N N   . THR B 315 ? 0.7790 0.7360 0.8906 0.0955  -0.0705 -0.1249 297 THR B N   
4991 C CA  . THR B 315 ? 0.8564 0.8178 0.9911 0.1152  -0.0778 -0.1481 297 THR B CA  
4992 C C   . THR B 315 ? 0.9046 0.8439 1.0542 0.1219  -0.0868 -0.1706 297 THR B C   
4993 O O   . THR B 315 ? 0.9344 0.8669 1.1031 0.1354  -0.0959 -0.1824 297 THR B O   
4994 C CB  . THR B 315 ? 0.8554 0.8651 0.9884 0.1256  -0.0676 -0.1627 297 THR B CB  
4995 N N   . ASN B 316 ? 0.9059 0.8366 1.0460 0.1098  -0.0849 -0.1734 298 ASN B N   
5000 N N   . GLY B 317 ? 0.8703 0.5062 0.6797 0.0016  -0.0438 0.0109  299 GLY B N   
5001 C CA  . GLY B 317 ? 0.6828 0.3602 0.5024 0.0057  -0.0355 0.0025  299 GLY B CA  
5002 C C   . GLY B 317 ? 0.5324 0.2532 0.3770 0.0159  -0.0332 0.0114  299 GLY B C   
5003 O O   . GLY B 317 ? 0.4727 0.2256 0.3259 0.0170  -0.0269 0.0069  299 GLY B O   
5004 N N   . ALA B 318 ? 0.5049 0.2268 0.3602 0.0218  -0.0388 0.0244  300 ALA B N   
5005 C CA  . ALA B 318 ? 0.4884 0.2515 0.3664 0.0294  -0.0378 0.0313  300 ALA B CA  
5006 C C   . ALA B 318 ? 0.4543 0.2484 0.3361 0.0123  -0.0391 0.0351  300 ALA B C   
5007 O O   . ALA B 318 ? 0.4540 0.2804 0.3511 0.0150  -0.0352 0.0340  300 ALA B O   
5008 C CB  . ALA B 318 ? 0.4953 0.2544 0.3819 0.0399  -0.0447 0.0444  300 ALA B CB  
5009 N N   . GLY B 319 ? 0.4536 0.2373 0.3216 -0.0053 -0.0445 0.0394  301 GLY B N   
5010 C CA  . GLY B 319 ? 0.3699 0.1833 0.2410 -0.0194 -0.0454 0.0416  301 GLY B CA  
5011 C C   . GLY B 319 ? 0.3611 0.1887 0.2328 -0.0212 -0.0393 0.0322  301 GLY B C   
5012 O O   . GLY B 319 ? 0.3609 0.2169 0.2437 -0.0226 -0.0374 0.0326  301 GLY B O   
5013 N N   . ASP B 320 ? 0.3894 0.1964 0.2481 -0.0207 -0.0363 0.0237  302 ASP B N   
5014 C CA  . ASP B 320 ? 0.4067 0.2288 0.2636 -0.0219 -0.0309 0.0165  302 ASP B CA  
5015 C C   . ASP B 320 ? 0.3776 0.2189 0.2508 -0.0081 -0.0238 0.0153  302 ASP B C   
5016 O O   . ASP B 320 ? 0.3667 0.2296 0.2457 -0.0099 -0.0206 0.0160  302 ASP B O   
5017 C CB  . ASP B 320 ? 0.4556 0.2528 0.2921 -0.0253 -0.0293 0.0060  302 ASP B CB  
5018 C CG  . ASP B 320 ? 0.5203 0.2968 0.3396 -0.0433 -0.0367 0.0067  302 ASP B CG  
5019 O OD1 . ASP B 320 ? 0.5155 0.3105 0.3385 -0.0557 -0.0417 0.0152  302 ASP B OD1 
5020 O OD2 . ASP B 320 ? 0.5393 0.2816 0.3412 -0.0456 -0.0373 -0.0021 302 ASP B OD2 
5021 N N   . ALA B 321 ? 0.3736 0.2077 0.2545 0.0055  -0.0218 0.0148  303 ALA B N   
5022 C CA  . ALA B 321 ? 0.3623 0.2189 0.2604 0.0167  -0.0152 0.0143  303 ALA B CA  
5023 C C   . ALA B 321 ? 0.3248 0.2061 0.2403 0.0130  -0.0178 0.0218  303 ALA B C   
5024 O O   . ALA B 321 ? 0.3227 0.2244 0.2498 0.0133  -0.0132 0.0221  303 ALA B O   
5025 C CB  . ALA B 321 ? 0.3654 0.2128 0.2689 0.0334  -0.0130 0.0117  303 ALA B CB  
5026 N N   . PHE B 322 ? 0.3171 0.1956 0.2328 0.0082  -0.0252 0.0275  304 PHE B N   
5027 C CA  . PHE B 322 ? 0.3009 0.2020 0.2297 0.0037  -0.0281 0.0316  304 PHE B CA  
5028 C C   . PHE B 322 ? 0.2881 0.2001 0.2175 -0.0041 -0.0259 0.0296  304 PHE B C   
5029 O O   . PHE B 322 ? 0.2664 0.1937 0.2087 -0.0041 -0.0238 0.0290  304 PHE B O   
5030 C CB  . PHE B 322 ? 0.2907 0.1888 0.2146 -0.0018 -0.0360 0.0379  304 PHE B CB  
5031 C CG  . PHE B 322 ? 0.3386 0.2619 0.2730 -0.0067 -0.0387 0.0392  304 PHE B CG  
5032 C CD1 . PHE B 322 ? 0.2697 0.2077 0.2151 -0.0019 -0.0417 0.0423  304 PHE B CD1 
5033 C CD2 . PHE B 322 ? 0.2992 0.2334 0.2324 -0.0152 -0.0383 0.0362  304 PHE B CD2 
5034 C CE1 . PHE B 322 ? 0.3138 0.2752 0.2664 -0.0079 -0.0442 0.0405  304 PHE B CE1 
5035 C CE2 . PHE B 322 ? 0.2941 0.2493 0.2356 -0.0183 -0.0400 0.0339  304 PHE B CE2 
5036 C CZ  . PHE B 322 ? 0.2574 0.2253 0.2073 -0.0159 -0.0429 0.0351  304 PHE B CZ  
5037 N N   . ALA B 323 ? 0.2768 0.1803 0.1925 -0.0110 -0.0271 0.0289  305 ALA B N   
5038 C CA  . ALA B 323 ? 0.2660 0.1812 0.1828 -0.0156 -0.0259 0.0286  305 ALA B CA  
5039 C C   . ALA B 323 ? 0.3089 0.2278 0.2304 -0.0109 -0.0196 0.0281  305 ALA B C   
5040 O O   . ALA B 323 ? 0.3286 0.2571 0.2596 -0.0109 -0.0183 0.0301  305 ALA B O   
5041 C CB  . ALA B 323 ? 0.2752 0.1866 0.1770 -0.0243 -0.0292 0.0287  305 ALA B CB  
5042 N N   . ALA B 324 ? 0.3197 0.2301 0.2341 -0.0067 -0.0154 0.0253  306 ALA B N   
5043 C CA  . ALA B 324 ? 0.3253 0.2437 0.2420 -0.0038 -0.0085 0.0259  306 ALA B CA  
5044 C C   . ALA B 324 ? 0.2663 0.1976 0.2020 -0.0013 -0.0053 0.0288  306 ALA B C   
5045 O O   . ALA B 324 ? 0.3157 0.2543 0.2570 -0.0044 -0.0025 0.0334  306 ALA B O   
5046 C CB  . ALA B 324 ? 0.2964 0.2068 0.2009 0.0012  -0.0035 0.0196  306 ALA B CB  
5047 N N   . GLY B 325 ? 0.2690 0.2030 0.2143 0.0031  -0.0066 0.0272  307 GLY B N   
5048 C CA  . GLY B 325 ? 0.2611 0.2116 0.2249 0.0031  -0.0046 0.0290  307 GLY B CA  
5049 C C   . GLY B 325 ? 0.2860 0.2390 0.2579 -0.0046 -0.0081 0.0304  307 GLY B C   
5050 O O   . GLY B 325 ? 0.2805 0.2404 0.2629 -0.0093 -0.0052 0.0325  307 GLY B O   
5051 N N   . PHE B 326 ? 0.2841 0.2312 0.2506 -0.0065 -0.0141 0.0288  308 PHE B N   
5052 C CA  . PHE B 326 ? 0.2369 0.1857 0.2096 -0.0111 -0.0167 0.0271  308 PHE B CA  
5053 C C   . PHE B 326 ? 0.2812 0.2232 0.2531 -0.0123 -0.0137 0.0306  308 PHE B C   
5054 O O   . PHE B 326 ? 0.3106 0.2503 0.2922 -0.0153 -0.0125 0.0310  308 PHE B O   
5055 C CB  . PHE B 326 ? 0.2489 0.1984 0.2147 -0.0122 -0.0222 0.0245  308 PHE B CB  
5056 C CG  . PHE B 326 ? 0.2664 0.2205 0.2390 -0.0143 -0.0239 0.0194  308 PHE B CG  
5057 C CD1 . PHE B 326 ? 0.2572 0.2211 0.2372 -0.0172 -0.0264 0.0136  308 PHE B CD1 
5058 C CD2 . PHE B 326 ? 0.2802 0.2296 0.2520 -0.0122 -0.0230 0.0195  308 PHE B CD2 
5059 C CE1 . PHE B 326 ? 0.2900 0.2563 0.2746 -0.0186 -0.0272 0.0053  308 PHE B CE1 
5060 C CE2 . PHE B 326 ? 0.2839 0.2346 0.2625 -0.0109 -0.0238 0.0126  308 PHE B CE2 
5061 C CZ  . PHE B 326 ? 0.3051 0.2627 0.2893 -0.0144 -0.0254 0.0041  308 PHE B CZ  
5062 N N   . ILE B 327 ? 0.2927 0.2305 0.2522 -0.0105 -0.0132 0.0339  309 ILE B N   
5063 C CA  . ILE B 327 ? 0.2923 0.2265 0.2494 -0.0102 -0.0121 0.0399  309 ILE B CA  
5064 C C   . ILE B 327 ? 0.3210 0.2543 0.2822 -0.0125 -0.0064 0.0466  309 ILE B C   
5065 O O   . ILE B 327 ? 0.3317 0.2579 0.2990 -0.0139 -0.0061 0.0524  309 ILE B O   
5066 C CB  . ILE B 327 ? 0.3002 0.2363 0.2418 -0.0096 -0.0139 0.0419  309 ILE B CB  
5067 C CG1 . ILE B 327 ? 0.2495 0.1903 0.1889 -0.0102 -0.0194 0.0376  309 ILE B CG1 
5068 C CG2 . ILE B 327 ? 0.2645 0.2016 0.2030 -0.0083 -0.0132 0.0509  309 ILE B CG2 
5069 C CD1 . ILE B 327 ? 0.2548 0.1990 0.1787 -0.0140 -0.0221 0.0379  309 ILE B CD1 
5070 N N   . ALA B 328 ? 0.2612 0.2016 0.2194 -0.0127 -0.0018 0.0461  310 ALA B N   
5071 C CA  . ALA B 328 ? 0.3787 0.3258 0.3402 -0.0164 0.0049  0.0530  310 ALA B CA  
5072 C C   . ALA B 328 ? 0.3954 0.3416 0.3739 -0.0232 0.0054  0.0553  310 ALA B C   
5073 O O   . ALA B 328 ? 0.3843 0.3292 0.3654 -0.0297 0.0089  0.0648  310 ALA B O   
5074 C CB  . ALA B 328 ? 0.2712 0.2312 0.2291 -0.0129 0.0107  0.0487  310 ALA B CB  
5075 N N   . ASP B 329 ? 0.3904 0.3372 0.3788 -0.0236 0.0014  0.0472  311 ASP B N   
5076 C CA  . ASP B 329 ? 0.3884 0.3338 0.3915 -0.0325 0.0008  0.0463  311 ASP B CA  
5077 C C   . ASP B 329 ? 0.3370 0.2610 0.3410 -0.0331 -0.0036 0.0446  311 ASP B C   
5078 O O   . ASP B 329 ? 0.3481 0.2588 0.3588 -0.0408 -0.0029 0.0483  311 ASP B O   
5079 C CB  . ASP B 329 ? 0.4153 0.3768 0.4285 -0.0335 -0.0018 0.0378  311 ASP B CB  
5080 C CG  . ASP B 329 ? 0.4711 0.4558 0.4952 -0.0381 0.0033  0.0408  311 ASP B CG  
5081 O OD1 . ASP B 329 ? 0.4546 0.4479 0.4737 -0.0345 0.0096  0.0463  311 ASP B OD1 
5082 O OD2 . ASP B 329 ? 0.5250 0.5232 0.5627 -0.0456 0.0010  0.0369  311 ASP B OD2 
5083 N N   . TYR B 330 ? 0.2993 0.2199 0.2968 -0.0250 -0.0079 0.0390  312 TYR B N   
5084 C CA  . TYR B 330 ? 0.3291 0.2342 0.3287 -0.0219 -0.0113 0.0347  312 TYR B CA  
5085 C C   . TYR B 330 ? 0.3558 0.2431 0.3533 -0.0192 -0.0103 0.0461  312 TYR B C   
5086 O O   . TYR B 330 ? 0.3578 0.2247 0.3618 -0.0192 -0.0115 0.0451  312 TYR B O   
5087 C CB  . TYR B 330 ? 0.3518 0.2655 0.3450 -0.0142 -0.0152 0.0276  312 TYR B CB  
5088 C CG  . TYR B 330 ? 0.3956 0.3017 0.3930 -0.0091 -0.0178 0.0188  312 TYR B CG  
5089 C CD1 . TYR B 330 ? 0.4188 0.3250 0.4228 -0.0133 -0.0192 0.0059  312 TYR B CD1 
5090 C CD2 . TYR B 330 ? 0.4160 0.3182 0.4109 0.0008  -0.0189 0.0223  312 TYR B CD2 
5091 C CE1 . TYR B 330 ? 0.4449 0.3447 0.4515 -0.0072 -0.0205 -0.0055 312 TYR B CE1 
5092 C CE2 . TYR B 330 ? 0.4859 0.3837 0.4861 0.0088  -0.0203 0.0126  312 TYR B CE2 
5093 C CZ  . TYR B 330 ? 0.5066 0.4018 0.5120 0.0051  -0.0206 -0.0023 312 TYR B CZ  
5094 O OH  . TYR B 330 ? 0.5790 0.4702 0.5884 0.0145  -0.0209 -0.0149 312 TYR B OH  
5095 N N   . ILE B 331 ? 0.3620 0.2563 0.3497 -0.0169 -0.0083 0.0571  313 ILE B N   
5096 C CA  . ILE B 331 ? 0.3719 0.2540 0.3556 -0.0138 -0.0084 0.0713  313 ILE B CA  
5097 C C   . ILE B 331 ? 0.3797 0.2508 0.3676 -0.0245 -0.0044 0.0827  313 ILE B C   
5098 O O   . ILE B 331 ? 0.3786 0.2344 0.3642 -0.0237 -0.0050 0.0971  313 ILE B O   
5099 C CB  . ILE B 331 ? 0.3625 0.2602 0.3316 -0.0092 -0.0087 0.0787  313 ILE B CB  
5100 C CG1 . ILE B 331 ? 0.3055 0.2176 0.2669 -0.0163 -0.0029 0.0819  313 ILE B CG1 
5101 C CG2 . ILE B 331 ? 0.3176 0.2272 0.2826 -0.0027 -0.0128 0.0684  313 ILE B CG2 
5102 C CD1 . ILE B 331 ? 0.3066 0.2324 0.2507 -0.0137 -0.0029 0.0869  313 ILE B CD1 
5103 N N   . ARG B 332 ? 0.3720 0.2530 0.3666 -0.0350 -0.0008 0.0777  314 ARG B N   
5104 C CA  . ARG B 332 ? 0.4001 0.2755 0.4009 -0.0491 0.0032  0.0877  314 ARG B CA  
5105 C C   . ARG B 332 ? 0.4290 0.2846 0.4430 -0.0581 0.0006  0.0792  314 ARG B C   
5106 O O   . ARG B 332 ? 0.4399 0.2953 0.4617 -0.0741 0.0034  0.0835  314 ARG B O   
5107 C CB  . ARG B 332 ? 0.3636 0.2697 0.3641 -0.0558 0.0099  0.0894  314 ARG B CB  
5108 C CG  . ARG B 332 ? 0.3671 0.2876 0.3520 -0.0509 0.0139  0.0995  314 ARG B CG  
5109 C CD  . ARG B 332 ? 0.3292 0.2808 0.3143 -0.0557 0.0221  0.0993  314 ARG B CD  
5110 N NE  . ARG B 332 ? 0.3182 0.2847 0.3073 -0.0478 0.0218  0.0834  314 ARG B NE  
5111 C CZ  . ARG B 332 ? 0.3410 0.3347 0.3346 -0.0473 0.0281  0.0792  314 ARG B CZ  
5112 N NH1 . ARG B 332 ? 0.3334 0.3475 0.3282 -0.0558 0.0363  0.0886  314 ARG B NH1 
5113 N NH2 . ARG B 332 ? 0.3534 0.3553 0.3506 -0.0378 0.0263  0.0667  314 ARG B NH2 
5114 N N   . GLY B 333 ? 0.4259 0.2673 0.4419 -0.0491 -0.0045 0.0661  315 GLY B N   
5115 C CA  . GLY B 333 ? 0.4309 0.2489 0.4561 -0.0562 -0.0073 0.0551  315 GLY B CA  
5116 C C   . GLY B 333 ? 0.4510 0.2882 0.4834 -0.0637 -0.0087 0.0375  315 GLY B C   
5117 O O   . GLY B 333 ? 0.4973 0.3180 0.5359 -0.0722 -0.0113 0.0259  315 GLY B O   
5118 N N   . LYS B 334 ? 0.3896 0.2602 0.4202 -0.0605 -0.0078 0.0354  316 LYS B N   
5119 C CA  . LYS B 334 ? 0.3668 0.2594 0.4040 -0.0661 -0.0103 0.0220  316 LYS B CA  
5120 C C   . LYS B 334 ? 0.3804 0.2688 0.4139 -0.0577 -0.0151 0.0064  316 LYS B C   
5121 O O   . LYS B 334 ? 0.4116 0.2959 0.4370 -0.0441 -0.0157 0.0071  316 LYS B O   
5122 C CB  . LYS B 334 ? 0.3388 0.2650 0.3757 -0.0625 -0.0082 0.0261  316 LYS B CB  
5123 C CG  . LYS B 334 ? 0.3412 0.2810 0.3825 -0.0701 -0.0020 0.0387  316 LYS B CG  
5124 C CD  . LYS B 334 ? 0.4325 0.3789 0.4879 -0.0892 -0.0017 0.0379  316 LYS B CD  
5125 C CE  . LYS B 334 ? 0.5154 0.4799 0.5755 -0.0982 0.0058  0.0519  316 LYS B CE  
5126 N NZ  . LYS B 334 ? 0.5759 0.5412 0.6487 -0.1215 0.0061  0.0542  316 LYS B NZ  
5127 N N   . PRO B 335 ? 0.3559 0.2496 0.3950 -0.0669 -0.0186 -0.0079 317 PRO B N   
5128 C CA  . PRO B 335 ? 0.3652 0.2613 0.3995 -0.0604 -0.0224 -0.0242 317 PRO B CA  
5129 C C   . PRO B 335 ? 0.3486 0.2724 0.3757 -0.0504 -0.0239 -0.0222 317 PRO B C   
5130 O O   . PRO B 335 ? 0.3348 0.2742 0.3617 -0.0491 -0.0226 -0.0110 317 PRO B O   
5131 C CB  . PRO B 335 ? 0.3370 0.2420 0.3777 -0.0763 -0.0259 -0.0383 317 PRO B CB  
5132 C CG  . PRO B 335 ? 0.3620 0.2572 0.4122 -0.0921 -0.0239 -0.0300 317 PRO B CG  
5133 C CD  . PRO B 335 ? 0.3464 0.2489 0.3962 -0.0858 -0.0191 -0.0099 317 PRO B CD  
5134 N N   . MET B 336 ? 0.3625 0.2913 0.3833 -0.0439 -0.0262 -0.0335 318 MET B N   
5135 C CA  . MET B 336 ? 0.3914 0.3445 0.4040 -0.0377 -0.0283 -0.0317 318 MET B CA  
5136 C C   . MET B 336 ? 0.3514 0.3292 0.3657 -0.0432 -0.0313 -0.0260 318 MET B C   
5137 O O   . MET B 336 ? 0.3859 0.3696 0.3969 -0.0379 -0.0308 -0.0143 318 MET B O   
5138 C CB  . MET B 336 ? 0.4274 0.3895 0.4346 -0.0352 -0.0302 -0.0474 318 MET B CB  
5139 C CG  . MET B 336 ? 0.4443 0.4324 0.4419 -0.0319 -0.0326 -0.0436 318 MET B CG  
5140 S SD  . MET B 336 ? 0.5474 0.5289 0.5392 -0.0218 -0.0300 -0.0293 318 MET B SD  
5141 C CE  . MET B 336 ? 0.3735 0.3815 0.3539 -0.0244 -0.0339 -0.0230 318 MET B CE  
5142 N N   . ILE B 337 ? 0.2998 0.2920 0.3193 -0.0532 -0.0349 -0.0353 319 ILE B N   
5143 C CA  . ILE B 337 ? 0.3067 0.3277 0.3298 -0.0569 -0.0392 -0.0300 319 ILE B CA  
5144 C C   . ILE B 337 ? 0.3143 0.3377 0.3462 -0.0553 -0.0362 -0.0164 319 ILE B C   
5145 O O   . ILE B 337 ? 0.2784 0.3160 0.3093 -0.0478 -0.0375 -0.0069 319 ILE B O   
5146 C CB  . ILE B 337 ? 0.3433 0.3819 0.3721 -0.0705 -0.0440 -0.0429 319 ILE B CB  
5147 C CG1 . ILE B 337 ? 0.3906 0.4351 0.4083 -0.0713 -0.0469 -0.0581 319 ILE B CG1 
5148 C CG2 . ILE B 337 ? 0.3403 0.4133 0.3767 -0.0734 -0.0491 -0.0347 319 ILE B CG2 
5149 C CD1 . ILE B 337 ? 0.4181 0.4835 0.4248 -0.0637 -0.0500 -0.0505 319 ILE B CD1 
5150 N N   . THR B 338 ? 0.2893 0.2984 0.3293 -0.0622 -0.0318 -0.0158 320 THR B N   
5151 C CA  . THR B 338 ? 0.2773 0.2932 0.3257 -0.0621 -0.0272 -0.0040 320 THR B CA  
5152 C C   . THR B 338 ? 0.2651 0.2722 0.3039 -0.0478 -0.0235 0.0058  320 THR B C   
5153 O O   . THR B 338 ? 0.2602 0.2820 0.3016 -0.0413 -0.0218 0.0129  320 THR B O   
5154 C CB  . THR B 338 ? 0.2728 0.2712 0.3282 -0.0742 -0.0228 -0.0029 320 THR B CB  
5155 O OG1 . THR B 338 ? 0.2879 0.2916 0.3514 -0.0903 -0.0268 -0.0139 320 THR B OG1 
5156 C CG2 . THR B 338 ? 0.2691 0.2814 0.3323 -0.0753 -0.0168 0.0096  320 THR B CG2 
5157 N N   . SER B 339 ? 0.2474 0.2317 0.2752 -0.0427 -0.0226 0.0048  321 SER B N   
5158 C CA  . SER B 339 ? 0.2408 0.2165 0.2576 -0.0323 -0.0201 0.0123  321 SER B CA  
5159 C C   . SER B 339 ? 0.2761 0.2629 0.2860 -0.0254 -0.0240 0.0137  321 SER B C   
5160 O O   . SER B 339 ? 0.2829 0.2676 0.2874 -0.0185 -0.0219 0.0197  321 SER B O   
5161 C CB  . SER B 339 ? 0.2465 0.2020 0.2553 -0.0292 -0.0196 0.0109  321 SER B CB  
5162 O OG  . SER B 339 ? 0.2591 0.1988 0.2726 -0.0332 -0.0160 0.0145  321 SER B OG  
5163 N N   . LEU B 340 ? 0.2638 0.2610 0.2724 -0.0277 -0.0296 0.0081  322 LEU B N   
5164 C CA  . LEU B 340 ? 0.2728 0.2797 0.2744 -0.0229 -0.0344 0.0125  322 LEU B CA  
5165 C C   . LEU B 340 ? 0.3071 0.3276 0.3173 -0.0180 -0.0350 0.0189  322 LEU B C   
5166 O O   . LEU B 340 ? 0.3272 0.3429 0.3312 -0.0094 -0.0363 0.0257  322 LEU B O   
5167 C CB  . LEU B 340 ? 0.2580 0.2794 0.2562 -0.0281 -0.0402 0.0064  322 LEU B CB  
5168 C CG  . LEU B 340 ? 0.2385 0.2530 0.2272 -0.0292 -0.0395 0.0000  322 LEU B CG  
5169 C CD1 . LEU B 340 ? 0.2586 0.2935 0.2444 -0.0349 -0.0439 -0.0088 322 LEU B CD1 
5170 C CD2 . LEU B 340 ? 0.2291 0.2347 0.2056 -0.0250 -0.0394 0.0084  322 LEU B CD2 
5171 N N   . HIS B 341 ? 0.2776 0.3148 0.3025 -0.0233 -0.0342 0.0164  323 HIS B N   
5172 C CA  . HIS B 341 ? 0.2783 0.3357 0.3150 -0.0170 -0.0338 0.0223  323 HIS B CA  
5173 C C   . HIS B 341 ? 0.2725 0.3180 0.3075 -0.0081 -0.0259 0.0266  323 HIS B C   
5174 O O   . HIS B 341 ? 0.2568 0.3085 0.2940 0.0043  -0.0252 0.0311  323 HIS B O   
5175 C CB  . HIS B 341 ? 0.3140 0.3977 0.3682 -0.0280 -0.0344 0.0185  323 HIS B CB  
5176 C CG  . HIS B 341 ? 0.3554 0.4608 0.4120 -0.0352 -0.0433 0.0140  323 HIS B CG  
5177 N ND1 . HIS B 341 ? 0.4331 0.5356 0.4881 -0.0497 -0.0454 0.0026  323 HIS B ND1 
5178 C CD2 . HIS B 341 ? 0.3305 0.4610 0.3895 -0.0295 -0.0511 0.0193  323 HIS B CD2 
5179 C CE1 . HIS B 341 ? 0.4263 0.5545 0.4816 -0.0541 -0.0537 -0.0006 323 HIS B CE1 
5180 N NE2 . HIS B 341 ? 0.3930 0.5398 0.4508 -0.0422 -0.0577 0.0110  323 HIS B NE2 
5181 N N   . ALA B 342 ? 0.2816 0.3100 0.3119 -0.0134 -0.0200 0.0250  324 ALA B N   
5182 C CA  . ALA B 342 ? 0.2981 0.3177 0.3232 -0.0068 -0.0124 0.0283  324 ALA B CA  
5183 C C   . ALA B 342 ? 0.2712 0.2703 0.2793 0.0027  -0.0140 0.0290  324 ALA B C   
5184 O O   . ALA B 342 ? 0.2691 0.2635 0.2721 0.0120  -0.0096 0.0296  324 ALA B O   
5185 C CB  . ALA B 342 ? 0.2366 0.2442 0.2593 -0.0158 -0.0073 0.0292  324 ALA B CB  
5186 N N   . ALA B 343 ? 0.2362 0.2238 0.2350 -0.0008 -0.0200 0.0279  325 ALA B N   
5187 C CA  . ALA B 343 ? 0.2864 0.2552 0.2689 0.0035  -0.0226 0.0294  325 ALA B CA  
5188 C C   . ALA B 343 ? 0.3008 0.2694 0.2832 0.0134  -0.0261 0.0332  325 ALA B C   
5189 O O   . ALA B 343 ? 0.3066 0.2567 0.2787 0.0209  -0.0246 0.0336  325 ALA B O   
5190 C CB  . ALA B 343 ? 0.2640 0.2292 0.2391 -0.0041 -0.0277 0.0282  325 ALA B CB  
5191 N N   . VAL B 344 ? 0.2503 0.2385 0.2435 0.0139  -0.0315 0.0358  326 VAL B N   
5192 C CA  . VAL B 344 ? 0.2638 0.2549 0.2595 0.0256  -0.0361 0.0422  326 VAL B CA  
5193 C C   . VAL B 344 ? 0.2705 0.2664 0.2757 0.0397  -0.0297 0.0411  326 VAL B C   
5194 O O   . VAL B 344 ? 0.3184 0.2991 0.3192 0.0537  -0.0305 0.0438  326 VAL B O   
5195 C CB  . VAL B 344 ? 0.2575 0.2772 0.2640 0.0223  -0.0438 0.0459  326 VAL B CB  
5196 C CG1 . VAL B 344 ? 0.2699 0.3026 0.2862 0.0376  -0.0481 0.0539  326 VAL B CG1 
5197 C CG2 . VAL B 344 ? 0.2582 0.2726 0.2510 0.0124  -0.0504 0.0481  326 VAL B CG2 
5198 N N   . LYS B 345 ? 0.2766 0.2932 0.2946 0.0358  -0.0230 0.0369  327 LYS B N   
5199 C CA  . LYS B 345 ? 0.3052 0.3359 0.3335 0.0476  -0.0151 0.0351  327 LYS B CA  
5200 C C   . LYS B 345 ? 0.3446 0.3467 0.3562 0.0561  -0.0087 0.0304  327 LYS B C   
5201 O O   . LYS B 345 ? 0.3689 0.3712 0.3829 0.0729  -0.0047 0.0280  327 LYS B O   
5202 C CB  . LYS B 345 ? 0.3110 0.3689 0.3535 0.0363  -0.0087 0.0333  327 LYS B CB  
5203 C CG  . LYS B 345 ? 0.3400 0.4184 0.3919 0.0457  0.0016  0.0315  327 LYS B CG  
5204 C CD  . LYS B 345 ? 0.3339 0.4396 0.3994 0.0298  0.0072  0.0327  327 LYS B CD  
5205 C CE  . LYS B 345 ? 0.3878 0.5187 0.4607 0.0370  0.0190  0.0316  327 LYS B CE  
5206 N NZ  . LYS B 345 ? 0.4099 0.5715 0.4979 0.0189  0.0238  0.0356  327 LYS B NZ  
5207 N N   . ALA B 346 ? 0.3273 0.3066 0.3220 0.0450  -0.0080 0.0281  328 ALA B N   
5208 C CA  . ALA B 346 ? 0.3754 0.3288 0.3513 0.0489  -0.0034 0.0225  328 ALA B CA  
5209 C C   . ALA B 346 ? 0.3777 0.3006 0.3410 0.0576  -0.0092 0.0225  328 ALA B C   
5210 O O   . ALA B 346 ? 0.3425 0.2479 0.2972 0.0694  -0.0051 0.0160  328 ALA B O   
5211 C CB  . ALA B 346 ? 0.2876 0.2306 0.2506 0.0341  -0.0029 0.0219  328 ALA B CB  
5212 N N   . ALA B 347 ? 0.3710 0.2864 0.3319 0.0510  -0.0186 0.0295  329 ALA B N   
5213 C CA  . ALA B 347 ? 0.3774 0.2626 0.3261 0.0560  -0.0254 0.0336  329 ALA B CA  
5214 C C   . ALA B 347 ? 0.3858 0.2722 0.3455 0.0773  -0.0258 0.0358  329 ALA B C   
5215 O O   . ALA B 347 ? 0.3954 0.2484 0.3442 0.0883  -0.0268 0.0344  329 ALA B O   
5216 C CB  . ALA B 347 ? 0.3381 0.2253 0.2839 0.0436  -0.0347 0.0428  329 ALA B CB  
5217 N N   . ALA B 348 ? 0.3534 0.2784 0.3352 0.0830  -0.0252 0.0390  330 ALA B N   
5218 C CA  . ALA B 348 ? 0.3835 0.3217 0.3810 0.1050  -0.0258 0.0423  330 ALA B CA  
5219 C C   . ALA B 348 ? 0.4013 0.3318 0.3983 0.1223  -0.0152 0.0308  330 ALA B C   
5220 O O   . ALA B 348 ? 0.4300 0.3454 0.4289 0.1442  -0.0158 0.0306  330 ALA B O   
5221 C CB  . ALA B 348 ? 0.3476 0.3372 0.3698 0.1032  -0.0271 0.0467  330 ALA B CB  
5222 N N   . TYR B 349 ? 0.3688 0.3101 0.3627 0.1131  -0.0054 0.0214  331 TYR B N   
5223 C CA  . TYR B 349 ? 0.4193 0.3610 0.4107 0.1269  0.0062  0.0090  331 TYR B CA  
5224 C C   . TYR B 349 ? 0.4190 0.3084 0.3855 0.1334  0.0059  0.0003  331 TYR B C   
5225 O O   . TYR B 349 ? 0.4505 0.3275 0.4163 0.1551  0.0110  -0.0088 331 TYR B O   
5226 C CB  . TYR B 349 ? 0.4028 0.3683 0.3931 0.1117  0.0156  0.0042  331 TYR B CB  
5227 C CG  . TYR B 349 ? 0.3972 0.3663 0.3800 0.1224  0.0283  -0.0091 331 TYR B CG  
5228 C CD1 . TYR B 349 ? 0.3838 0.3924 0.3859 0.1385  0.0376  -0.0127 331 TYR B CD1 
5229 C CD2 . TYR B 349 ? 0.3971 0.3354 0.3533 0.1157  0.0312  -0.0186 331 TYR B CD2 
5230 C CE1 . TYR B 349 ? 0.4037 0.4205 0.3978 0.1486  0.0505  -0.0263 331 TYR B CE1 
5231 C CE2 . TYR B 349 ? 0.4647 0.4089 0.4113 0.1247  0.0431  -0.0326 331 TYR B CE2 
5232 C CZ  . TYR B 349 ? 0.4463 0.4295 0.4112 0.1416  0.0532  -0.0367 331 TYR B CZ  
5233 O OH  . TYR B 349 ? 0.4815 0.4748 0.4354 0.1507  0.0662  -0.0521 331 TYR B OH  
5234 N N   . ILE B 350 ? 0.4495 0.3091 0.3961 0.1143  0.0000  0.0021  332 ILE B N   
5235 C CA  . ILE B 350 ? 0.5203 0.3294 0.4417 0.1139  -0.0017 -0.0059 332 ILE B CA  
5236 C C   . ILE B 350 ? 0.5904 0.3655 0.5114 0.1299  -0.0095 0.0000  332 ILE B C   
5237 O O   . ILE B 350 ? 0.6717 0.4072 0.5793 0.1427  -0.0076 -0.0104 332 ILE B O   
5238 C CB  . ILE B 350 ? 0.4966 0.2910 0.4001 0.0875  -0.0071 -0.0031 332 ILE B CB  
5239 C CG1 . ILE B 350 ? 0.5178 0.3348 0.4163 0.0766  0.0011  -0.0108 332 ILE B CG1 
5240 C CG2 . ILE B 350 ? 0.5115 0.2535 0.3907 0.0828  -0.0125 -0.0073 332 ILE B CG2 
5241 C CD1 . ILE B 350 ? 0.5559 0.3656 0.4427 0.0874  0.0112  -0.0274 332 ILE B CD1 
5242 N N   . ILE B 351 ? 0.5610 0.3507 0.4959 0.1295  -0.0185 0.0166  333 ILE B N   
5243 C CA  . ILE B 351 ? 0.6170 0.3800 0.5537 0.1458  -0.0272 0.0271  333 ILE B CA  
5244 C C   . ILE B 351 ? 0.6365 0.4035 0.5875 0.1787  -0.0213 0.0202  333 ILE B C   
5245 O O   . ILE B 351 ? 0.6559 0.3771 0.5977 0.1960  -0.0235 0.0179  333 ILE B O   
5246 C CB  . ILE B 351 ? 0.5682 0.3589 0.5179 0.1387  -0.0378 0.0468  333 ILE B CB  
5247 C CG1 . ILE B 351 ? 0.5792 0.3545 0.5110 0.1106  -0.0447 0.0539  333 ILE B CG1 
5248 C CG2 . ILE B 351 ? 0.5575 0.3349 0.5152 0.1611  -0.0462 0.0602  333 ILE B CG2 
5249 C CD1 . ILE B 351 ? 0.5933 0.4076 0.5363 0.0988  -0.0517 0.0671  333 ILE B CD1 
5250 N N   . CYS B 352 ? 0.6279 0.4496 0.6018 0.1873  -0.0133 0.0165  334 CYS B N   
5251 C CA  . CYS B 352 ? 0.6618 0.5011 0.6538 0.2194  -0.0066 0.0100  334 CYS B CA  
5252 C C   . CYS B 352 ? 0.7300 0.5396 0.7066 0.2327  0.0051  -0.0122 334 CYS B C   
5253 O O   . CYS B 352 ? 0.7736 0.5835 0.7604 0.2635  0.0105  -0.0203 334 CYS B O   
5254 C CB  . CYS B 352 ? 0.6016 0.5139 0.6228 0.2206  -0.0009 0.0125  334 CYS B CB  
5255 S SG  . CYS B 352 ? 1.5863 1.5380 1.6295 0.2142  -0.0151 0.0355  334 CYS B SG  
5256 N N   . ARG B 353 ? 0.7464 0.5333 0.6984 0.2105  0.0088  -0.0229 335 ARG B N   
5257 C CA  . ARG B 353 ? 0.7779 0.5343 0.7098 0.2188  0.0187  -0.0457 335 ARG B CA  
5258 C C   . ARG B 353 ? 0.8180 0.5003 0.7208 0.2116  0.0107  -0.0495 335 ARG B C   
5259 O O   . ARG B 353 ? 0.7979 0.4592 0.6934 0.1920  -0.0011 -0.0340 335 ARG B O   
5260 C CB  . ARG B 353 ? 0.7513 0.5395 0.6748 0.1994  0.0291  -0.0562 335 ARG B CB  
5261 C CG  . ARG B 353 ? 0.7003 0.5565 0.6494 0.2077  0.0397  -0.0558 335 ARG B CG  
5262 C CD  . ARG B 353 ? 0.6603 0.5434 0.5984 0.1885  0.0495  -0.0636 335 ARG B CD  
5263 N NE  . ARG B 353 ? 0.7003 0.5587 0.6127 0.1936  0.0584  -0.0858 335 ARG B NE  
5264 C CZ  . ARG B 353 ? 0.7469 0.6293 0.6621 0.2138  0.0725  -0.1024 335 ARG B CZ  
5265 N NH1 . ARG B 353 ? 0.7299 0.6645 0.6749 0.2311  0.0792  -0.0977 335 ARG B NH1 
5266 N NH2 . ARG B 353 ? 0.7794 0.6375 0.6674 0.2162  0.0800  -0.1247 335 ARG B NH2 
5267 N N   . SER B 354 ? 0.9069 0.5511 0.7928 0.2262  0.0176  -0.0712 336 SER B N   
5268 C CA  . SER B 354 ? 0.9915 0.5606 0.8481 0.2177  0.0105  -0.0776 336 SER B CA  
5269 C C   . SER B 354 ? 0.9466 0.5088 0.7792 0.1800  0.0080  -0.0805 336 SER B C   
5270 O O   . SER B 354 ? 0.9249 0.4990 0.7433 0.1723  0.0172  -0.0992 336 SER B O   
5271 C CB  . SER B 354 ? 1.0828 0.6283 0.9359 0.2357  0.0193  -0.1011 336 SER B CB  
5272 O OG  . SER B 354 ? 1.0951 0.6718 0.9404 0.2401  0.0341  -0.1238 336 SER B OG  
5273 N N   . GLY B 355 ? 0.9312 0.4786 0.7595 0.1570  -0.0046 -0.0612 337 GLY B N   
5274 C CA  . GLY B 355 ? 0.9269 0.4736 0.7361 0.1222  -0.0082 -0.0612 337 GLY B CA  
5275 C C   . GLY B 355 ? 0.8355 0.4466 0.6563 0.1108  -0.0020 -0.0591 337 GLY B C   
5276 O O   . GLY B 355 ? 0.8154 0.4711 0.6614 0.1220  0.0009  -0.0493 337 GLY B O   
5277 N N   . PHE B 356 ? 0.7867 0.4023 0.5890 0.0880  -0.0006 -0.0675 338 PHE B N   
5278 C CA  . PHE B 356 ? 0.7728 0.4434 0.5837 0.0774  0.0046  -0.0640 338 PHE B CA  
5279 C C   . PHE B 356 ? 0.8272 0.5198 0.6332 0.0882  0.0178  -0.0821 338 PHE B C   
5280 O O   . PHE B 356 ? 0.8729 0.5652 0.6576 0.0745  0.0205  -0.0940 338 PHE B O   
5281 C CB  . PHE B 356 ? 0.7147 0.3882 0.5119 0.0476  -0.0023 -0.0585 338 PHE B CB  
5282 C CG  . PHE B 356 ? 0.6264 0.3513 0.4383 0.0388  -0.0006 -0.0472 338 PHE B CG  
5283 C CD1 . PHE B 356 ? 0.5633 0.3039 0.3904 0.0307  -0.0077 -0.0296 338 PHE B CD1 
5284 C CD2 . PHE B 356 ? 0.5001 0.2564 0.3097 0.0388  0.0082  -0.0542 338 PHE B CD2 
5285 C CE1 . PHE B 356 ? 0.5013 0.2823 0.3415 0.0241  -0.0061 -0.0210 338 PHE B CE1 
5286 C CE2 . PHE B 356 ? 0.4586 0.2549 0.2812 0.0311  0.0091  -0.0422 338 PHE B CE2 
5287 C CZ  . PHE B 356 ? 0.4463 0.2524 0.2847 0.0244  0.0020  -0.0265 338 PHE B CZ  
5288 N N   . SER B 357 ? 0.7984 0.5156 0.6244 0.1121  0.0261  -0.0835 339 SER B N   
5289 C CA  . SER B 357 ? 0.7468 0.4916 0.5701 0.1241  0.0401  -0.0999 339 SER B CA  
5290 C C   . SER B 357 ? 0.6881 0.4943 0.5367 0.1251  0.0464  -0.0872 339 SER B C   
5291 O O   . SER B 357 ? 0.6637 0.4875 0.5380 0.1343  0.0435  -0.0737 339 SER B O   
5292 C CB  . SER B 357 ? 0.7175 0.4372 0.5409 0.1540  0.0465  -0.1169 339 SER B CB  
5293 O OG  . SER B 357 ? 0.6958 0.4562 0.5238 0.1691  0.0617  -0.1306 339 SER B OG  
5294 N N   . LEU B 358 ? 0.6470 0.4857 0.4873 0.1139  0.0541  -0.0907 340 LEU B N   
5295 C CA  . LEU B 358 ? 0.5725 0.4659 0.4340 0.1113  0.0605  -0.0782 340 LEU B CA  
5296 C C   . LEU B 358 ? 0.5868 0.5138 0.4526 0.1293  0.0760  -0.0914 340 LEU B C   
5297 O O   . LEU B 358 ? 0.6435 0.5767 0.4875 0.1267  0.0844  -0.1055 340 LEU B O   
5298 C CB  . LEU B 358 ? 0.5027 0.4122 0.3538 0.0862  0.0582  -0.0681 340 LEU B CB  
5299 C CG  . LEU B 358 ? 0.4920 0.3786 0.3408 0.0687  0.0443  -0.0553 340 LEU B CG  
5300 C CD1 . LEU B 358 ? 0.4345 0.3400 0.2741 0.0489  0.0430  -0.0464 340 LEU B CD1 
5301 C CD2 . LEU B 358 ? 0.4723 0.3647 0.3478 0.0718  0.0379  -0.0405 340 LEU B CD2 
5302 N N   . GLY B 359 ? 0.5443 0.4974 0.4380 0.1474  0.0798  -0.0870 341 GLY B N   
5303 C CA  . GLY B 359 ? 0.5494 0.5437 0.4522 0.1660  0.0952  -0.0984 341 GLY B CA  
5304 C C   . GLY B 359 ? 0.5285 0.5812 0.4425 0.1504  0.1032  -0.0861 341 GLY B C   
5305 O O   . GLY B 359 ? 0.5161 0.5689 0.4215 0.1258  0.0982  -0.0733 341 GLY B O   
5306 N N   . SER B 360 ? 0.5355 0.6385 0.4695 0.1650  0.1155  -0.0889 342 SER B N   
5307 C CA  . SER B 360 ? 0.5420 0.7024 0.4872 0.1486  0.1240  -0.0761 342 SER B CA  
5308 C C   . SER B 360 ? 0.5014 0.6679 0.4669 0.1286  0.1130  -0.0522 342 SER B C   
5309 O O   . SER B 360 ? 0.4932 0.6529 0.4795 0.1364  0.1043  -0.0464 342 SER B O   
5310 C CB  . SER B 360 ? 0.5859 0.8045 0.5518 0.1683  0.1395  -0.0839 342 SER B CB  
5311 O OG  . SER B 360 ? 0.6171 0.8451 0.6142 0.1868  0.1346  -0.0799 342 SER B OG  
5312 N N   . ARG B 361 ? 0.4922 0.6711 0.4501 0.1031  0.1134  -0.0387 343 ARG B N   
5313 C CA  . ARG B 361 ? 0.4724 0.6480 0.4440 0.0824  0.1030  -0.0186 343 ARG B CA  
5314 C C   . ARG B 361 ? 0.4869 0.7036 0.4930 0.0828  0.1040  -0.0093 343 ARG B C   
5315 O O   . ARG B 361 ? 0.4436 0.6499 0.4640 0.0733  0.0929  0.0012  343 ARG B O   
5316 C CB  . ARG B 361 ? 0.4349 0.6159 0.3909 0.0582  0.1048  -0.0061 343 ARG B CB  
5317 C CG  . ARG B 361 ? 0.3762 0.5452 0.3428 0.0378  0.0942  0.0127  343 ARG B CG  
5318 C CD  . ARG B 361 ? 0.3557 0.4808 0.3226 0.0413  0.0798  0.0108  343 ARG B CD  
5319 N NE  . ARG B 361 ? 0.3231 0.4373 0.2987 0.0235  0.0708  0.0255  343 ARG B NE  
5320 C CZ  . ARG B 361 ? 0.3920 0.5241 0.3919 0.0166  0.0685  0.0331  343 ARG B CZ  
5321 N NH1 . ARG B 361 ? 0.3936 0.5100 0.3983 0.0008  0.0606  0.0433  343 ARG B NH1 
5322 N NH2 . ARG B 361 ? 0.3768 0.5441 0.3967 0.0258  0.0740  0.0294  343 ARG B NH2 
5323 N N   . ASP B 362 ? 0.5345 0.8014 0.5539 0.0935  0.1173  -0.0145 344 ASP B N   
5324 C CA  . ASP B 362 ? 0.5867 0.9034 0.6403 0.0922  0.1190  -0.0059 344 ASP B CA  
5325 C C   . ASP B 362 ? 0.5965 0.9069 0.6703 0.1137  0.1102  -0.0101 344 ASP B C   
5326 O O   . ASP B 362 ? 0.5849 0.9298 0.6869 0.1096  0.1064  -0.0011 344 ASP B O   
5327 C CB  . ASP B 362 ? 0.6665 1.0469 0.7292 0.0970  0.1369  -0.0097 344 ASP B CB  
5328 C CG  . ASP B 362 ? 0.7269 1.1221 0.7723 0.0714  0.1450  0.0004  344 ASP B CG  
5329 O OD1 . ASP B 362 ? 0.7370 1.0870 0.7561 0.0594  0.1387  0.0039  344 ASP B OD1 
5330 O OD2 . ASP B 362 ? 0.7595 1.2141 0.8180 0.0630  0.1573  0.0064  344 ASP B OD2 
5331 N N   . SER B 363 ? 0.6257 0.8916 0.6842 0.1350  0.1060  -0.0228 345 SER B N   
5332 C CA  . SER B 363 ? 0.6277 0.8806 0.7016 0.1566  0.0965  -0.0243 345 SER B CA  
5333 C C   . SER B 363 ? 0.6007 0.8098 0.6693 0.1426  0.0794  -0.0139 345 SER B C   
5334 O O   . SER B 363 ? 0.6249 0.8083 0.6963 0.1579  0.0697  -0.0142 345 SER B O   
5335 C CB  . SER B 363 ? 0.6811 0.9040 0.7413 0.1874  0.1006  -0.0426 345 SER B CB  
5336 O OG  . SER B 363 ? 0.7207 0.9893 0.7882 0.2048  0.1172  -0.0548 345 SER B OG  
5337 N N   . TYR B 364 ? 0.5710 0.7726 0.6317 0.1142  0.0760  -0.0044 346 TYR B N   
5338 C CA  . TYR B 364 ? 0.5736 0.7382 0.6285 0.1005  0.0615  0.0036  346 TYR B CA  
5339 C C   . TYR B 364 ? 0.6560 0.8514 0.7375 0.0912  0.0542  0.0141  346 TYR B C   
5340 O O   . TYR B 364 ? 0.6292 0.8057 0.7128 0.0916  0.0420  0.0179  346 TYR B O   
5341 C CB  . TYR B 364 ? 0.5020 0.6423 0.5359 0.0777  0.0612  0.0074  346 TYR B CB  
5342 C CG  . TYR B 364 ? 0.4346 0.5348 0.4586 0.0668  0.0480  0.0123  346 TYR B CG  
5343 C CD1 . TYR B 364 ? 0.4180 0.4815 0.4304 0.0782  0.0401  0.0075  346 TYR B CD1 
5344 C CD2 . TYR B 364 ? 0.4057 0.5041 0.4312 0.0450  0.0439  0.0215  346 TYR B CD2 
5345 C CE1 . TYR B 364 ? 0.3925 0.4263 0.3960 0.0671  0.0292  0.0122  346 TYR B CE1 
5346 C CE2 . TYR B 364 ? 0.3644 0.4311 0.3816 0.0370  0.0332  0.0240  346 TYR B CE2 
5347 C CZ  . TYR B 364 ? 0.3533 0.3914 0.3598 0.0477  0.0263  0.0195  346 TYR B CZ  
5348 O OH  . TYR B 364 ? 0.2931 0.3066 0.2918 0.0389  0.0167  0.0223  346 TYR B OH  
5349 N N   . SER B 365 ? 0.7698 1.0152 0.8703 0.0813  0.0618  0.0186  347 SER B N   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17 ?   ?   ?   A . n 
A 1 2   GLY 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   SER 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  HIS 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  SER 12  -6  ?   ?   ?   A . n 
A 1 13  GLY 13  -5  ?   ?   ?   A . n 
A 1 14  LEU 14  -4  ?   ?   ?   A . n 
A 1 15  VAL 15  -3  ?   ?   ?   A . n 
A 1 16  PRO 16  -2  ?   ?   ?   A . n 
A 1 17  ARG 17  -1  ?   ?   ?   A . n 
A 1 18  GLY 18  0   ?   ?   ?   A . n 
A 1 19  SER 19  1   ?   ?   ?   A . n 
A 1 20  HIS 20  2   ?   ?   ?   A . n 
A 1 21  ASP 21  3   3   ASP ASP A . n 
A 1 22  LEU 22  4   4   LEU LEU A . n 
A 1 23  SER 23  5   5   SER SER A . n 
A 1 24  GLU 24  6   6   GLU GLU A . n 
A 1 25  GLY 25  7   7   GLY GLY A . n 
A 1 26  TYR 26  8   8   TYR TYR A . n 
A 1 27  VAL 27  9   9   VAL VAL A . n 
A 1 28  PHE 28  10  10  PHE PHE A . n 
A 1 29  GLY 29  11  11  GLY GLY A . n 
A 1 30  MET 30  12  12  MET MET A . n 
A 1 31  GLY 31  13  13  GLY GLY A . n 
A 1 32  ASN 32  14  14  ASN ASN A . n 
A 1 33  PRO 33  15  15  PRO PRO A . n 
A 1 34  LEU 34  16  16  LEU LEU A . n 
A 1 35  LEU 35  17  17  LEU LEU A . n 
A 1 36  ASP 36  18  18  ASP ASP A . n 
A 1 37  ILE 37  19  19  ILE ILE A . n 
A 1 38  ILE 38  20  20  ILE ILE A . n 
A 1 39  VAL 39  21  21  VAL VAL A . n 
A 1 40  ASP 40  22  22  ASP ASP A . n 
A 1 41  ALA 41  23  23  ALA ALA A . n 
A 1 42  ASP 42  24  24  ASP ASP A . n 
A 1 43  ASP 43  25  25  ASP ASP A . n 
A 1 44  PHE 44  26  26  PHE PHE A . n 
A 1 45  MET 45  27  27  MET MET A . n 
A 1 46  TYR 46  28  28  TYR TYR A . n 
A 1 47  ARG 47  29  29  ARG ARG A . n 
A 1 48  LYS 48  30  30  LYS LYS A . n 
A 1 49  TYR 49  31  31  TYR TYR A . n 
A 1 50  ASN 50  32  32  ASN ASN A . n 
A 1 51  LEU 51  33  33  LEU LEU A . n 
A 1 52  LYS 52  34  34  LYS LYS A . n 
A 1 53  LYS 53  35  35  LYS LYS A . n 
A 1 54  ASP 54  36  36  ASP ASP A . n 
A 1 55  ASN 55  37  37  ASN ASN A . n 
A 1 56  ILE 56  38  38  ILE ILE A . n 
A 1 57  VAL 57  39  39  VAL VAL A . n 
A 1 58  LEU 58  40  40  LEU LEU A . n 
A 1 59  ALA 59  41  41  ALA ALA A . n 
A 1 60  GLU 60  42  42  GLU GLU A . n 
A 1 61  GLU 61  43  43  GLU GLU A . n 
A 1 62  LYS 62  44  44  LYS LYS A . n 
A 1 63  HIS 63  45  45  HIS HIS A . n 
A 1 64  MET 64  46  46  MET MET A . n 
A 1 65  THR 65  47  47  THR THR A . n 
A 1 66  ILE 66  48  48  ILE ILE A . n 
A 1 67  TYR 67  49  49  TYR TYR A . n 
A 1 68  ASP 68  50  50  ASP ASP A . n 
A 1 69  GLU 69  51  51  GLU GLU A . n 
A 1 70  ILE 70  52  52  ILE ILE A . n 
A 1 71  GLN 71  53  53  GLN GLN A . n 
A 1 72  LYS 72  54  54  LYS LYS A . n 
A 1 73  LYS 73  55  55  LYS LYS A . n 
A 1 74  LYS 74  56  56  LYS LYS A . n 
A 1 75  LYS 75  57  57  LYS LYS A . n 
A 1 76  LEU 76  58  58  LEU LEU A . n 
A 1 77  ASN 77  59  59  ASN ASN A . n 
A 1 78  TYR 78  60  60  TYR TYR A . n 
A 1 79  ILE 79  61  61  ILE ILE A . n 
A 1 80  ALA 80  62  62  ALA ALA A . n 
A 1 81  GLY 81  63  63  GLY GLY A . n 
A 1 82  GLY 82  64  64  GLY GLY A . n 
A 1 83  ALA 83  65  65  ALA ALA A . n 
A 1 84  THR 84  66  66  THR THR A . n 
A 1 85  LEU 85  67  67  LEU LEU A . n 
A 1 86  ASN 86  68  68  ASN ASN A . n 
A 1 87  THR 87  69  69  THR THR A . n 
A 1 88  VAL 88  70  70  VAL VAL A . n 
A 1 89  LYS 89  71  71  LYS LYS A . n 
A 1 90  MET 90  72  72  MET MET A . n 
A 1 91  ILE 91  73  73  ILE ILE A . n 
A 1 92  GLN 92  74  74  GLN GLN A . n 
A 1 93  TRP 93  75  75  TRP TRP A . n 
A 1 94  ILE 94  76  76  ILE ILE A . n 
A 1 95  ILE 95  77  77  ILE ILE A . n 
A 1 96  GLN 96  78  78  GLN GLN A . n 
A 1 97  LYS 97  79  79  LYS LYS A . n 
A 1 98  PRO 98  80  80  PRO PRO A . n 
A 1 99  PHE 99  81  81  PHE PHE A . n 
A 1 100 VAL 100 82  82  VAL VAL A . n 
A 1 101 CYS 101 83  83  CYS CYS A . n 
A 1 102 SER 102 84  84  SER SER A . n 
A 1 103 TYR 103 85  85  TYR TYR A . n 
A 1 104 VAL 104 86  86  VAL VAL A . n 
A 1 105 GLY 105 87  87  GLY GLY A . n 
A 1 106 CYS 106 88  88  CYS CYS A . n 
A 1 107 ILE 107 89  89  ILE ILE A . n 
A 1 108 GLY 108 90  90  GLY GLY A . n 
A 1 109 ALA 109 91  91  ALA ALA A . n 
A 1 110 ASP 110 92  92  ASP ASP A . n 
A 1 111 ILE 111 93  93  ILE ILE A . n 
A 1 112 GLN 112 94  94  GLN GLN A . n 
A 1 113 GLY 113 95  95  GLY GLY A . n 
A 1 114 LYS 114 96  96  LYS LYS A . n 
A 1 115 TYR 115 97  97  TYR TYR A . n 
A 1 116 ILE 116 98  98  ILE ILE A . n 
A 1 117 LYS 117 99  99  LYS LYS A . n 
A 1 118 ASN 118 100 100 ASN ASN A . n 
A 1 119 ASP 119 101 101 ASP ASP A . n 
A 1 120 CYS 120 102 102 CYS CYS A . n 
A 1 121 SER 121 103 103 SER SER A . n 
A 1 122 ALA 122 104 104 ALA ALA A . n 
A 1 123 LEU 123 105 105 LEU LEU A . n 
A 1 124 ASP 124 106 106 ASP ASP A . n 
A 1 125 LEU 125 107 107 LEU LEU A . n 
A 1 126 VAL 126 108 108 VAL VAL A . n 
A 1 127 THR 127 109 109 THR THR A . n 
A 1 128 GLU 128 110 110 GLU GLU A . n 
A 1 129 PHE 129 111 111 PHE PHE A . n 
A 1 130 GLN 130 112 112 GLN GLN A . n 
A 1 131 ILE 131 113 113 ILE ILE A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 GLU 133 115 115 GLU GLU A . n 
A 1 134 GLU 134 116 116 GLU GLU A . n 
A 1 135 PRO 135 117 117 PRO PRO A . n 
A 1 136 LEU 136 118 118 LEU LEU A . n 
A 1 137 MET 137 119 119 MET MET A . n 
A 1 138 THR 138 120 120 THR THR A . n 
A 1 139 GLY 139 121 121 GLY GLY A . n 
A 1 140 LYS 140 122 122 LYS LYS A . n 
A 1 141 VAL 141 123 123 VAL VAL A . n 
A 1 142 ALA 142 124 124 ALA ALA A . n 
A 1 143 VAL 143 125 125 VAL VAL A . n 
A 1 144 LEU 144 126 126 LEU LEU A . n 
A 1 145 VAL 145 127 127 VAL VAL A . n 
A 1 146 SER 146 128 128 SER SER A . n 
A 1 147 GLU 147 129 129 GLU GLU A . n 
A 1 148 LYS 148 130 130 LYS LYS A . n 
A 1 149 LEU 149 131 131 LEU LEU A . n 
A 1 150 ARG 150 132 132 ARG ARG A . n 
A 1 151 SER 151 133 133 SER SER A . n 
A 1 152 MET 152 134 134 MET MET A . n 
A 1 153 VAL 153 135 135 VAL VAL A . n 
A 1 154 THR 154 136 136 THR THR A . n 
A 1 155 TYR 155 137 137 TYR TYR A . n 
A 1 156 LEU 156 138 138 LEU LEU A . n 
A 1 157 GLY 157 139 139 GLY GLY A . n 
A 1 158 ALA 158 140 140 ALA ALA A . n 
A 1 159 ALA 159 141 141 ALA ALA A . n 
A 1 160 CYS 160 142 142 CYS CYS A . n 
A 1 161 ASP 161 143 143 ASP ASP A . n 
A 1 162 LEU 162 144 144 LEU LEU A . n 
A 1 163 SER 163 145 145 SER SER A . n 
A 1 164 LEU 164 146 146 LEU LEU A . n 
A 1 165 ALA 165 147 147 ALA ALA A . n 
A 1 166 HIS 166 148 148 HIS HIS A . n 
A 1 167 ILE 167 149 149 ILE ILE A . n 
A 1 168 GLU 168 150 150 GLU GLU A . n 
A 1 169 GLN 169 151 151 GLN GLN A . n 
A 1 170 PRO 170 152 152 PRO PRO A . n 
A 1 171 HIS 171 153 153 HIS HIS A . n 
A 1 172 VAL 172 154 154 VAL VAL A . n 
A 1 173 TRP 173 155 155 TRP TRP A . n 
A 1 174 SER 174 156 156 SER SER A . n 
A 1 175 LEU 175 157 157 LEU LEU A . n 
A 1 176 VAL 176 158 158 VAL VAL A . n 
A 1 177 GLU 177 159 159 GLU GLU A . n 
A 1 178 LYS 178 160 160 LYS LYS A . n 
A 1 179 ALA 179 161 161 ALA ALA A . n 
A 1 180 GLN 180 162 162 GLN GLN A . n 
A 1 181 VAL 181 163 163 VAL VAL A . n 
A 1 182 TYR 182 164 164 TYR TYR A . n 
A 1 183 TYR 183 165 165 TYR TYR A . n 
A 1 184 ILE 184 166 166 ILE ILE A . n 
A 1 185 ALA 185 167 167 ALA ALA A . n 
A 1 186 GLY 186 168 168 GLY GLY A . n 
A 1 187 PHE 187 169 169 PHE PHE A . n 
A 1 188 VAL 188 170 170 VAL VAL A . n 
A 1 189 ILE 189 171 171 ILE ILE A . n 
A 1 190 ASN 190 172 172 ASN ASN A . n 
A 1 191 THR 191 173 173 THR THR A . n 
A 1 192 CYS 192 174 174 CYS CYS A . n 
A 1 193 TYR 193 175 175 TYR TYR A . n 
A 1 194 GLU 194 176 176 GLU GLU A . n 
A 1 195 GLY 195 177 177 GLY GLY A . n 
A 1 196 MET 196 178 178 MET MET A . n 
A 1 197 LEU 197 179 179 LEU LEU A . n 
A 1 198 LYS 198 180 180 LYS LYS A . n 
A 1 199 ILE 199 181 181 ILE ILE A . n 
A 1 200 ALA 200 182 182 ALA ALA A . n 
A 1 201 LYS 201 183 183 LYS LYS A . n 
A 1 202 HIS 202 184 184 HIS HIS A . n 
A 1 203 SER 203 185 185 SER SER A . n 
A 1 204 LEU 204 186 186 LEU LEU A . n 
A 1 205 GLU 205 187 187 GLU GLU A . n 
A 1 206 ASN 206 188 188 ASN ASN A . n 
A 1 207 GLU 207 189 189 GLU GLU A . n 
A 1 208 LYS 208 190 190 LYS LYS A . n 
A 1 209 LEU 209 191 191 LEU LEU A . n 
A 1 210 PHE 210 192 192 PHE PHE A . n 
A 1 211 CYS 211 193 193 CYS CYS A . n 
A 1 212 PHE 212 194 194 PHE PHE A . n 
A 1 213 ASN 213 195 195 ASN ASN A . n 
A 1 214 LEU 214 196 196 LEU LEU A . n 
A 1 215 SER 215 197 197 SER SER A . n 
A 1 216 ALA 216 198 198 ALA ALA A . n 
A 1 217 PRO 217 199 199 PRO PRO A . n 
A 1 218 PHE 218 200 200 PHE PHE A . n 
A 1 219 LEU 219 201 201 LEU LEU A . n 
A 1 220 SER 220 202 202 SER SER A . n 
A 1 221 GLN 221 203 203 GLN GLN A . n 
A 1 222 PHE 222 204 204 PHE PHE A . n 
A 1 223 ASN 223 205 205 ASN ASN A . n 
A 1 224 THR 224 206 206 THR THR A . n 
A 1 225 LYS 225 207 207 LYS LYS A . n 
A 1 226 GLU 226 208 208 GLU GLU A . n 
A 1 227 VAL 227 209 209 VAL VAL A . n 
A 1 228 ASP 228 210 210 ASP ASP A . n 
A 1 229 GLU 229 211 211 GLU GLU A . n 
A 1 230 MET 230 212 212 MET MET A . n 
A 1 231 ILE 231 213 213 ILE ILE A . n 
A 1 232 SER 232 214 214 SER SER A . n 
A 1 233 TYR 233 215 215 TYR TYR A . n 
A 1 234 SER 234 216 216 SER SER A . n 
A 1 235 ASN 235 217 217 ASN ASN A . n 
A 1 236 ILE 236 218 218 ILE ILE A . n 
A 1 237 VAL 237 219 219 VAL VAL A . n 
A 1 238 PHE 238 220 220 PHE PHE A . n 
A 1 239 GLY 239 221 221 GLY GLY A . n 
A 1 240 ASN 240 222 222 ASN ASN A . n 
A 1 241 GLU 241 223 223 GLU GLU A . n 
A 1 242 SER 242 224 224 SER SER A . n 
A 1 243 GLU 243 225 225 GLU GLU A . n 
A 1 244 ALA 244 226 226 ALA ALA A . n 
A 1 245 GLU 245 227 227 GLU GLU A . n 
A 1 246 ALA 246 228 228 ALA ALA A . n 
A 1 247 TYR 247 229 229 TYR TYR A . n 
A 1 248 GLY 248 230 230 GLY GLY A . n 
A 1 249 GLU 249 231 231 GLU GLU A . n 
A 1 250 VAL 250 232 232 VAL VAL A . n 
A 1 251 HIS 251 233 233 HIS HIS A . n 
A 1 252 GLY 252 234 234 GLY GLY A . n 
A 1 253 LEU 253 235 235 LEU LEU A . n 
A 1 254 LEU 254 236 236 LEU LEU A . n 
A 1 255 GLU 255 237 237 GLU GLU A . n 
A 1 256 ASP 256 238 238 ASP ASP A . n 
A 1 257 THR 257 239 239 THR THR A . n 
A 1 258 VAL 258 240 240 VAL VAL A . n 
A 1 259 HIS 259 241 241 HIS HIS A . n 
A 1 260 ALA 260 242 242 ALA ALA A . n 
A 1 261 THR 261 243 243 THR THR A . n 
A 1 262 ALA 262 244 244 ALA ALA A . n 
A 1 263 ARG 263 245 245 ARG ARG A . n 
A 1 264 TYR 264 246 246 TYR TYR A . n 
A 1 265 ILE 265 247 247 ILE ILE A . n 
A 1 266 ALA 266 248 248 ALA ALA A . n 
A 1 267 ASP 267 249 249 ASP ASP A . n 
A 1 268 LEU 268 250 250 LEU LEU A . n 
A 1 269 PRO 269 251 251 PRO PRO A . n 
A 1 270 PHE 270 252 252 PHE PHE A . n 
A 1 271 ALA 271 253 253 ALA ALA A . n 
A 1 272 ASP 272 254 254 ASP ASP A . n 
A 1 273 GLY 273 255 255 GLY GLY A . n 
A 1 274 LYS 274 256 256 LYS LYS A . n 
A 1 275 LYS 275 257 257 LYS LYS A . n 
A 1 276 ARG 276 258 258 ARG ARG A . n 
A 1 277 LYS 277 259 259 LYS LYS A . n 
A 1 278 ARG 278 260 260 ARG ARG A . n 
A 1 279 LEU 279 261 261 LEU LEU A . n 
A 1 280 VAL 280 262 262 VAL VAL A . n 
A 1 281 ILE 281 263 263 ILE ILE A . n 
A 1 282 ILE 282 264 264 ILE ILE A . n 
A 1 283 THR 283 265 265 THR THR A . n 
A 1 284 ARG 284 266 266 ARG ARG A . n 
A 1 285 GLY 285 267 267 GLY GLY A . n 
A 1 286 LYS 286 268 268 LYS LYS A . n 
A 1 287 ASN 287 269 269 ASN ASN A . n 
A 1 288 PRO 288 270 270 PRO PRO A . n 
A 1 289 LEU 289 271 271 LEU LEU A . n 
A 1 290 LEU 290 272 272 LEU LEU A . n 
A 1 291 TYR 291 273 273 TYR TYR A . n 
A 1 292 THR 292 274 274 THR THR A . n 
A 1 293 ASP 293 275 275 ASP ASP A . n 
A 1 294 SER 294 276 276 SER SER A . n 
A 1 295 SER 295 277 277 SER SER A . n 
A 1 296 ASP 296 278 278 ASP ASP A . n 
A 1 297 SER 297 279 279 SER SER A . n 
A 1 298 GLU 298 280 280 GLU GLU A . n 
A 1 299 ILE 299 281 281 ILE ILE A . n 
A 1 300 HIS 300 282 282 HIS HIS A . n 
A 1 301 GLN 301 283 283 GLN GLN A . n 
A 1 302 PHE 302 284 284 PHE PHE A . n 
A 1 303 MET 303 285 285 MET MET A . n 
A 1 304 VAL 304 286 286 VAL VAL A . n 
A 1 305 GLU 305 287 287 GLU GLU A . n 
A 1 306 GLN 306 288 288 GLN GLN A . n 
A 1 307 PHE 307 289 289 PHE PHE A . n 
A 1 308 LYS 308 290 290 LYS LYS A . n 
A 1 309 ASP 309 291 291 ASP ASP A . n 
A 1 310 ASP 310 292 292 ASP ASP A . n 
A 1 311 GLN 311 293 293 GLN GLN A . n 
A 1 312 ILE 312 294 294 ILE ILE A . n 
A 1 313 ILE 313 295 295 ILE ILE A . n 
A 1 314 ASP 314 296 296 ASP ASP A . n 
A 1 315 THR 315 297 297 THR THR A . n 
A 1 316 ASN 316 298 298 ASN ASN A . n 
A 1 317 GLY 317 299 299 GLY GLY A . n 
A 1 318 ALA 318 300 300 ALA ALA A . n 
A 1 319 GLY 319 301 301 GLY GLY A . n 
A 1 320 ASP 320 302 302 ASP ASP A . n 
A 1 321 ALA 321 303 303 ALA ALA A . n 
A 1 322 PHE 322 304 304 PHE PHE A . n 
A 1 323 ALA 323 305 305 ALA ALA A . n 
A 1 324 ALA 324 306 306 ALA ALA A . n 
A 1 325 GLY 325 307 307 GLY GLY A . n 
A 1 326 PHE 326 308 308 PHE PHE A . n 
A 1 327 ILE 327 309 309 ILE ILE A . n 
A 1 328 ALA 328 310 310 ALA ALA A . n 
A 1 329 ASP 329 311 311 ASP ASP A . n 
A 1 330 TYR 330 312 312 TYR TYR A . n 
A 1 331 ILE 331 313 313 ILE ILE A . n 
A 1 332 ARG 332 314 314 ARG ARG A . n 
A 1 333 GLY 333 315 315 GLY GLY A . n 
A 1 334 LYS 334 316 316 LYS LYS A . n 
A 1 335 PRO 335 317 317 PRO PRO A . n 
A 1 336 MET 336 318 318 MET MET A . n 
A 1 337 ILE 337 319 319 ILE ILE A . n 
A 1 338 THR 338 320 320 THR THR A . n 
A 1 339 SER 339 321 321 SER SER A . n 
A 1 340 LEU 340 322 322 LEU LEU A . n 
A 1 341 HIS 341 323 323 HIS HIS A . n 
A 1 342 ALA 342 324 324 ALA ALA A . n 
A 1 343 ALA 343 325 325 ALA ALA A . n 
A 1 344 VAL 344 326 326 VAL VAL A . n 
A 1 345 LYS 345 327 327 LYS LYS A . n 
A 1 346 ALA 346 328 328 ALA ALA A . n 
A 1 347 ALA 347 329 329 ALA ALA A . n 
A 1 348 ALA 348 330 330 ALA ALA A . n 
A 1 349 TYR 349 331 331 TYR TYR A . n 
A 1 350 ILE 350 332 332 ILE ILE A . n 
A 1 351 ILE 351 333 333 ILE ILE A . n 
A 1 352 CYS 352 334 334 CYS CYS A . n 
A 1 353 ARG 353 335 335 ARG ARG A . n 
A 1 354 SER 354 336 336 SER SER A . n 
A 1 355 GLY 355 337 337 GLY GLY A . n 
A 1 356 PHE 356 338 338 PHE PHE A . n 
A 1 357 SER 357 339 339 SER SER A . n 
A 1 358 LEU 358 340 340 LEU LEU A . n 
A 1 359 GLY 359 341 341 GLY GLY A . n 
A 1 360 SER 360 342 342 SER SER A . n 
A 1 361 ARG 361 343 343 ARG ARG A . n 
A 1 362 ASP 362 344 344 ASP ASP A . n 
A 1 363 SER 363 345 345 SER SER A . n 
A 1 364 TYR 364 346 346 TYR TYR A . n 
A 1 365 SER 365 347 347 SER SER A . n 
A 1 366 LEU 366 348 ?   ?   ?   A . n 
A 1 367 LYS 367 349 ?   ?   ?   A . n 
A 1 368 ILE 368 350 ?   ?   ?   A . n 
A 1 369 ASN 369 351 ?   ?   ?   A . n 
A 1 370 LYS 370 352 ?   ?   ?   A . n 
B 1 1   MET 1   -17 ?   ?   ?   B . n 
B 1 2   GLY 2   -16 ?   ?   ?   B . n 
B 1 3   SER 3   -15 ?   ?   ?   B . n 
B 1 4   SER 4   -14 ?   ?   ?   B . n 
B 1 5   HIS 5   -13 ?   ?   ?   B . n 
B 1 6   HIS 6   -12 ?   ?   ?   B . n 
B 1 7   HIS 7   -11 ?   ?   ?   B . n 
B 1 8   HIS 8   -10 ?   ?   ?   B . n 
B 1 9   HIS 9   -9  ?   ?   ?   B . n 
B 1 10  HIS 10  -8  ?   ?   ?   B . n 
B 1 11  SER 11  -7  ?   ?   ?   B . n 
B 1 12  SER 12  -6  ?   ?   ?   B . n 
B 1 13  GLY 13  -5  ?   ?   ?   B . n 
B 1 14  LEU 14  -4  ?   ?   ?   B . n 
B 1 15  VAL 15  -3  ?   ?   ?   B . n 
B 1 16  PRO 16  -2  ?   ?   ?   B . n 
B 1 17  ARG 17  -1  ?   ?   ?   B . n 
B 1 18  GLY 18  0   ?   ?   ?   B . n 
B 1 19  SER 19  1   ?   ?   ?   B . n 
B 1 20  HIS 20  2   ?   ?   ?   B . n 
B 1 21  ASP 21  3   3   ASP ASP B . n 
B 1 22  LEU 22  4   4   LEU LEU B . n 
B 1 23  SER 23  5   5   SER SER B . n 
B 1 24  GLU 24  6   6   GLU GLU B . n 
B 1 25  GLY 25  7   7   GLY GLY B . n 
B 1 26  TYR 26  8   8   TYR TYR B . n 
B 1 27  VAL 27  9   9   VAL VAL B . n 
B 1 28  PHE 28  10  10  PHE PHE B . n 
B 1 29  GLY 29  11  11  GLY GLY B . n 
B 1 30  MET 30  12  12  MET MET B . n 
B 1 31  GLY 31  13  13  GLY GLY B . n 
B 1 32  ASN 32  14  14  ASN ASN B . n 
B 1 33  PRO 33  15  15  PRO PRO B . n 
B 1 34  LEU 34  16  16  LEU LEU B . n 
B 1 35  LEU 35  17  17  LEU LEU B . n 
B 1 36  ASP 36  18  18  ASP ASP B . n 
B 1 37  ILE 37  19  19  ILE ILE B . n 
B 1 38  ILE 38  20  20  ILE ILE B . n 
B 1 39  VAL 39  21  21  VAL VAL B . n 
B 1 40  ASP 40  22  22  ASP ASP B . n 
B 1 41  ALA 41  23  23  ALA ALA B . n 
B 1 42  ASP 42  24  24  ASP ASP B . n 
B 1 43  ASP 43  25  25  ASP ASP B . n 
B 1 44  PHE 44  26  26  PHE PHE B . n 
B 1 45  MET 45  27  27  MET MET B . n 
B 1 46  TYR 46  28  28  TYR TYR B . n 
B 1 47  ARG 47  29  29  ARG ARG B . n 
B 1 48  LYS 48  30  30  LYS LYS B . n 
B 1 49  TYR 49  31  31  TYR TYR B . n 
B 1 50  ASN 50  32  32  ASN ASN B . n 
B 1 51  LEU 51  33  33  LEU LEU B . n 
B 1 52  LYS 52  34  34  LYS LYS B . n 
B 1 53  LYS 53  35  35  LYS LYS B . n 
B 1 54  ASP 54  36  36  ASP ASP B . n 
B 1 55  ASN 55  37  37  ASN ASN B . n 
B 1 56  ILE 56  38  38  ILE ILE B . n 
B 1 57  VAL 57  39  39  VAL VAL B . n 
B 1 58  LEU 58  40  40  LEU LEU B . n 
B 1 59  ALA 59  41  41  ALA ALA B . n 
B 1 60  GLU 60  42  42  GLU GLU B . n 
B 1 61  GLU 61  43  43  GLU GLU B . n 
B 1 62  LYS 62  44  44  LYS LYS B . n 
B 1 63  HIS 63  45  45  HIS HIS B . n 
B 1 64  MET 64  46  46  MET MET B . n 
B 1 65  THR 65  47  47  THR THR B . n 
B 1 66  ILE 66  48  48  ILE ILE B . n 
B 1 67  TYR 67  49  49  TYR TYR B . n 
B 1 68  ASP 68  50  50  ASP ASP B . n 
B 1 69  GLU 69  51  51  GLU GLU B . n 
B 1 70  ILE 70  52  52  ILE ILE B . n 
B 1 71  GLN 71  53  53  GLN GLN B . n 
B 1 72  LYS 72  54  54  LYS LYS B . n 
B 1 73  LYS 73  55  55  LYS LYS B . n 
B 1 74  LYS 74  56  56  LYS LYS B . n 
B 1 75  LYS 75  57  57  LYS LYS B . n 
B 1 76  LEU 76  58  58  LEU LEU B . n 
B 1 77  ASN 77  59  59  ASN ASN B . n 
B 1 78  TYR 78  60  60  TYR TYR B . n 
B 1 79  ILE 79  61  61  ILE ILE B . n 
B 1 80  ALA 80  62  62  ALA ALA B . n 
B 1 81  GLY 81  63  63  GLY GLY B . n 
B 1 82  GLY 82  64  64  GLY GLY B . n 
B 1 83  ALA 83  65  65  ALA ALA B . n 
B 1 84  THR 84  66  66  THR THR B . n 
B 1 85  LEU 85  67  67  LEU LEU B . n 
B 1 86  ASN 86  68  68  ASN ASN B . n 
B 1 87  THR 87  69  69  THR THR B . n 
B 1 88  VAL 88  70  70  VAL VAL B . n 
B 1 89  LYS 89  71  71  LYS LYS B . n 
B 1 90  MET 90  72  72  MET MET B . n 
B 1 91  ILE 91  73  73  ILE ILE B . n 
B 1 92  GLN 92  74  74  GLN GLN B . n 
B 1 93  TRP 93  75  75  TRP TRP B . n 
B 1 94  ILE 94  76  76  ILE ILE B . n 
B 1 95  ILE 95  77  77  ILE ILE B . n 
B 1 96  GLN 96  78  78  GLN GLN B . n 
B 1 97  LYS 97  79  79  LYS LYS B . n 
B 1 98  PRO 98  80  80  PRO PRO B . n 
B 1 99  PHE 99  81  81  PHE PHE B . n 
B 1 100 VAL 100 82  82  VAL VAL B . n 
B 1 101 CYS 101 83  83  CYS CYS B . n 
B 1 102 SER 102 84  84  SER SER B . n 
B 1 103 TYR 103 85  85  TYR TYR B . n 
B 1 104 VAL 104 86  86  VAL VAL B . n 
B 1 105 GLY 105 87  87  GLY GLY B . n 
B 1 106 CYS 106 88  88  CYS CYS B . n 
B 1 107 ILE 107 89  89  ILE ILE B . n 
B 1 108 GLY 108 90  90  GLY GLY B . n 
B 1 109 ALA 109 91  91  ALA ALA B . n 
B 1 110 ASP 110 92  92  ASP ASP B . n 
B 1 111 ILE 111 93  93  ILE ILE B . n 
B 1 112 GLN 112 94  94  GLN GLN B . n 
B 1 113 GLY 113 95  95  GLY GLY B . n 
B 1 114 LYS 114 96  96