data_3VPM
# 
_entry.id   3VPM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VPM         
RCSB  RCSB095342   
WWPDB D_1000095342 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OLJ . unspecified 
PDB 3VPN . unspecified 
PDB 3VPO . unspecified 
# 
_pdbx_database_status.entry_id                        3VPM 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-05 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, X.'  1 
'Xu, Z.'    2 
'Liu, H.'   3 
'Zhang, L.' 4 
'Chen, B.'  5 
'Zhu, L.'   6 
'Yang, C.'  7 
'Zhu, W.'   8 
'Shao, J.'  9 
# 
_citation.id                        primary 
_citation.title                     
'Essential role of E106 in the proton-coupled electron transfer in human ribonucleotide reductase M2 subunit' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, X.'  1 
primary 'Xu, Z.'    2 
primary 'Liu, H.'   3 
primary 'Zhang, L.' 4 
primary 'Chen, B.'  5 
primary 'Zhu, L.'   6 
primary 'Yang, C.'  7 
primary 'Zhu, W.'   8 
primary 'Shao, J.'  9 
# 
_cell.entry_id           3VPM 
_cell.length_a           108.998 
_cell.length_b           108.998 
_cell.length_c           174.948 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3VPM 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonucleoside-diphosphate reductase subunit M2' 33561.695 2  1.17.4.1 E106A 'UNP residues 66-350' ? 
2 non-polymer syn 'MAGNESIUM ION'                                   24.305    2  ?        ?     ?                     ? 
3 non-polymer syn 'FE (III) ION'                                    55.845    2  ?        ?     ?                     ? 
4 water       nat water                                             18.015    46 ?        ?     ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ribonucleotide reductase small chain, Ribonucleotide reductase small subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNEN
LVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGER
VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFL
TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNEN
LVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGER
VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFL
TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   VAL n 
1 4   GLU n 
1 5   ASP n 
1 6   GLU n 
1 7   PRO n 
1 8   LEU n 
1 9   LEU n 
1 10  ARG n 
1 11  GLU n 
1 12  ASN n 
1 13  PRO n 
1 14  ARG n 
1 15  ARG n 
1 16  PHE n 
1 17  VAL n 
1 18  ILE n 
1 19  PHE n 
1 20  PRO n 
1 21  ILE n 
1 22  GLU n 
1 23  TYR n 
1 24  HIS n 
1 25  ASP n 
1 26  ILE n 
1 27  TRP n 
1 28  GLN n 
1 29  MET n 
1 30  TYR n 
1 31  LYS n 
1 32  LYS n 
1 33  ALA n 
1 34  GLU n 
1 35  ALA n 
1 36  SER n 
1 37  PHE n 
1 38  TRP n 
1 39  THR n 
1 40  ALA n 
1 41  GLU n 
1 42  ALA n 
1 43  VAL n 
1 44  ASP n 
1 45  LEU n 
1 46  SER n 
1 47  LYS n 
1 48  ASP n 
1 49  ILE n 
1 50  GLN n 
1 51  HIS n 
1 52  TRP n 
1 53  GLU n 
1 54  SER n 
1 55  LEU n 
1 56  LYS n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ARG n 
1 61  TYR n 
1 62  PHE n 
1 63  ILE n 
1 64  SER n 
1 65  HIS n 
1 66  VAL n 
1 67  LEU n 
1 68  ALA n 
1 69  PHE n 
1 70  PHE n 
1 71  ALA n 
1 72  ALA n 
1 73  SER n 
1 74  ASP n 
1 75  GLY n 
1 76  ILE n 
1 77  VAL n 
1 78  ASN n 
1 79  GLU n 
1 80  ASN n 
1 81  LEU n 
1 82  VAL n 
1 83  GLU n 
1 84  ARG n 
1 85  PHE n 
1 86  SER n 
1 87  GLN n 
1 88  GLU n 
1 89  VAL n 
1 90  GLN n 
1 91  ILE n 
1 92  THR n 
1 93  GLU n 
1 94  ALA n 
1 95  ARG n 
1 96  CYS n 
1 97  PHE n 
1 98  TYR n 
1 99  GLY n 
1 100 PHE n 
1 101 GLN n 
1 102 ILE n 
1 103 ALA n 
1 104 MET n 
1 105 GLU n 
1 106 ASN n 
1 107 ILE n 
1 108 HIS n 
1 109 SER n 
1 110 GLU n 
1 111 MET n 
1 112 TYR n 
1 113 SER n 
1 114 LEU n 
1 115 LEU n 
1 116 ILE n 
1 117 ASP n 
1 118 THR n 
1 119 TYR n 
1 120 ILE n 
1 121 LYS n 
1 122 ASP n 
1 123 PRO n 
1 124 LYS n 
1 125 GLU n 
1 126 ARG n 
1 127 GLU n 
1 128 PHE n 
1 129 LEU n 
1 130 PHE n 
1 131 ASN n 
1 132 ALA n 
1 133 ILE n 
1 134 GLU n 
1 135 THR n 
1 136 MET n 
1 137 PRO n 
1 138 CYS n 
1 139 VAL n 
1 140 LYS n 
1 141 LYS n 
1 142 LYS n 
1 143 ALA n 
1 144 ASP n 
1 145 TRP n 
1 146 ALA n 
1 147 LEU n 
1 148 ARG n 
1 149 TRP n 
1 150 ILE n 
1 151 GLY n 
1 152 ASP n 
1 153 LYS n 
1 154 GLU n 
1 155 ALA n 
1 156 THR n 
1 157 TYR n 
1 158 GLY n 
1 159 GLU n 
1 160 ARG n 
1 161 VAL n 
1 162 VAL n 
1 163 ALA n 
1 164 PHE n 
1 165 ALA n 
1 166 ALA n 
1 167 VAL n 
1 168 GLU n 
1 169 GLY n 
1 170 ILE n 
1 171 PHE n 
1 172 PHE n 
1 173 SER n 
1 174 GLY n 
1 175 SER n 
1 176 PHE n 
1 177 ALA n 
1 178 SER n 
1 179 ILE n 
1 180 PHE n 
1 181 TRP n 
1 182 LEU n 
1 183 LYS n 
1 184 LYS n 
1 185 ARG n 
1 186 GLY n 
1 187 LEU n 
1 188 MET n 
1 189 PRO n 
1 190 GLY n 
1 191 LEU n 
1 192 THR n 
1 193 PHE n 
1 194 SER n 
1 195 ASN n 
1 196 GLU n 
1 197 LEU n 
1 198 ILE n 
1 199 SER n 
1 200 ARG n 
1 201 ASP n 
1 202 GLU n 
1 203 GLY n 
1 204 LEU n 
1 205 HIS n 
1 206 CYS n 
1 207 ASP n 
1 208 PHE n 
1 209 ALA n 
1 210 CYS n 
1 211 LEU n 
1 212 MET n 
1 213 PHE n 
1 214 LYS n 
1 215 HIS n 
1 216 LEU n 
1 217 VAL n 
1 218 HIS n 
1 219 LYS n 
1 220 PRO n 
1 221 SER n 
1 222 GLU n 
1 223 GLU n 
1 224 ARG n 
1 225 VAL n 
1 226 ARG n 
1 227 GLU n 
1 228 ILE n 
1 229 ILE n 
1 230 ILE n 
1 231 ASN n 
1 232 ALA n 
1 233 VAL n 
1 234 ARG n 
1 235 ILE n 
1 236 GLU n 
1 237 GLN n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 THR n 
1 242 GLU n 
1 243 ALA n 
1 244 LEU n 
1 245 PRO n 
1 246 VAL n 
1 247 LYS n 
1 248 LEU n 
1 249 ILE n 
1 250 GLY n 
1 251 MET n 
1 252 ASN n 
1 253 CYS n 
1 254 THR n 
1 255 LEU n 
1 256 MET n 
1 257 LYS n 
1 258 GLN n 
1 259 TYR n 
1 260 ILE n 
1 261 GLU n 
1 262 PHE n 
1 263 VAL n 
1 264 ALA n 
1 265 ASP n 
1 266 ARG n 
1 267 LEU n 
1 268 MET n 
1 269 LEU n 
1 270 GLU n 
1 271 LEU n 
1 272 GLY n 
1 273 PHE n 
1 274 SER n 
1 275 LYS n 
1 276 VAL n 
1 277 PHE n 
1 278 ARG n 
1 279 VAL n 
1 280 GLU n 
1 281 ASN n 
1 282 PRO n 
1 283 PHE n 
1 284 ASP n 
1 285 PHE n 
1 286 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RR2, RRM2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RIR2_HUMAN 
_struct_ref.pdbx_db_accession          P31350 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENL
VERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERV
VAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLT
EALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
;
_struct_ref.pdbx_align_begin           66 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VPM A 2 ? 286 ? P31350 66 ? 350 ? 66 350 
2 1 3VPM B 2 ? 286 ? P31350 66 ? 350 ? 66 350 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VPM MET A 1  ? UNP P31350 ?   ?   'EXPRESSION TAG'      65  1 
1 3VPM ALA A 42 ? UNP P31350 GLU 106 'ENGINEERED MUTATION' 106 2 
2 3VPM MET B 1  ? UNP P31350 ?   ?   'EXPRESSION TAG'      65  3 
2 3VPM ALA B 42 ? UNP P31350 GLU 106 'ENGINEERED MUTATION' 106 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3VPM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.87 
_exptl_crystal.density_percent_sol   68.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50mM Tris-HCl, 0.1mM KCl, pH 7.5, temperature 293K, VAPOR DIFFUSION, HANGING DROP' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2011-05-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97906 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97906 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3VPM 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   29863 
_reflns.number_all                   30012 
_reflns.percent_possible_obs         99.500 
_reflns.pdbx_Rmerge_I_obs            0.100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.400 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  2.700 2.800  99.800 0.700 ? ? 14.500 ? ? ? ? ? ? 
1 2  2.800 2.910  99.800 0.504 ? ? 14.500 ? ? ? ? ? ? 
1 3  2.910 3.040  99.800 0.400 ? ? 14.400 ? ? ? ? ? ? 
1 4  3.040 3.200  99.800 0.292 ? ? 14.400 ? ? ? ? ? ? 
1 5  3.200 3.400  99.900 0.200 ? ? 14.300 ? ? ? ? ? ? 
1 6  3.400 3.660  98.500 0.149 ? ? 11.300 ? ? ? ? ? ? 
1 7  3.660 4.030  99.100 0.110 ? ? 11.600 ? ? ? ? ? ? 
1 8  4.030 4.620  99.500 0.072 ? ? 13.200 ? ? ? ? ? ? 
1 9  4.620 5.810  99.900 0.063 ? ? 14.300 ? ? ? ? ? ? 
1 10 5.810 50.000 99.400 0.042 ? ? 13.400 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3VPM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27951 
_refine.ls_number_reflns_all                     29701 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.63 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.14 
_refine.ls_R_factor_obs                          0.20944 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20738 
_refine.ls_R_factor_R_free                       0.24899 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1494 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.500 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.B_iso_mean                               56.556 
_refine.aniso_B[1][1]                            1.97 
_refine.aniso_B[2][2]                            1.97 
_refine.aniso_B[3][3]                            -3.94 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3OLJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.421 
_refine.pdbx_overall_ESU_R_Free                  0.284 
_refine.overall_SU_ML                            0.203 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.703 
_refine.overall_SU_R_Cruickshank_DPI             0.3919 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4726 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               4776 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        37.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 4860 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.168  1.946  ? 6560 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.856  5.000  ? 574  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.365 23.710 ? 248  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.342 15.000 ? 868  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.181 15.000 ? 32   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.088  0.200  ? 694  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 3714 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.513  1.500  ? 2862 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.020  2.000  ? 4628 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.443  3.000  ? 1998 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.521  4.500  ? 1930 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             2042 
_refine_ls_shell.R_factor_R_work                  0.260 
_refine_ls_shell.percent_reflns_obs               99.49 
_refine_ls_shell.R_factor_R_free                  0.312 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3VPM 
_struct.title                     'Crystal structure of human ribonucleotide reductase subunit M2 (hRRM2) mutant' 
_struct.pdbx_descriptor           'Ribonucleoside-diphosphate reductase subunit M2 (E.C.1.17.4.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VPM 
_struct_keywords.text            'Metal-binding, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 23  ? SER A 36  ? TYR A 87  SER A 100 1 ? 14 
HELX_P HELX_P2  2  THR A 39  ? VAL A 43  ? THR A 103 VAL A 107 5 ? 5  
HELX_P HELX_P3  3  ASP A 48  ? LEU A 55  ? ASP A 112 LEU A 119 1 ? 8  
HELX_P HELX_P4  4  LYS A 56  ? ARG A 84  ? LYS A 120 ARG A 148 1 ? 29 
HELX_P HELX_P5  5  ARG A 84  ? VAL A 89  ? ARG A 148 VAL A 153 1 ? 6  
HELX_P HELX_P6  6  ILE A 91  ? ILE A 120 ? ILE A 155 ILE A 184 1 ? 30 
HELX_P HELX_P7  7  ASP A 122 ? ASN A 131 ? ASP A 186 ASN A 195 1 ? 10 
HELX_P HELX_P8  8  ASN A 131 ? MET A 136 ? ASN A 195 MET A 200 1 ? 6  
HELX_P HELX_P9  9  VAL A 139 ? ASP A 152 ? VAL A 203 ASP A 216 1 ? 14 
HELX_P HELX_P10 10 THR A 156 ? ILE A 170 ? THR A 220 ILE A 234 1 ? 15 
HELX_P HELX_P11 11 PHE A 172 ? ARG A 185 ? PHE A 236 ARG A 249 1 ? 14 
HELX_P HELX_P12 12 MET A 188 ? HIS A 215 ? MET A 252 HIS A 279 1 ? 28 
HELX_P HELX_P13 13 SER A 221 ? GLU A 242 ? SER A 285 GLU A 306 1 ? 22 
HELX_P HELX_P14 14 PRO A 245 ? GLY A 250 ? PRO A 309 GLY A 314 5 ? 6  
HELX_P HELX_P15 15 ASN A 252 ? LEU A 271 ? ASN A 316 LEU A 335 1 ? 20 
HELX_P HELX_P16 16 TYR B 23  ? SER B 36  ? TYR B 87  SER B 100 1 ? 14 
HELX_P HELX_P17 17 THR B 39  ? VAL B 43  ? THR B 103 VAL B 107 5 ? 5  
HELX_P HELX_P18 18 LYS B 47  ? LEU B 55  ? LYS B 111 LEU B 119 1 ? 9  
HELX_P HELX_P19 19 LYS B 56  ? ARG B 84  ? LYS B 120 ARG B 148 1 ? 29 
HELX_P HELX_P20 20 ARG B 84  ? VAL B 89  ? ARG B 148 VAL B 153 1 ? 6  
HELX_P HELX_P21 21 ILE B 91  ? ILE B 120 ? ILE B 155 ILE B 184 1 ? 30 
HELX_P HELX_P22 22 ASP B 122 ? ASN B 131 ? ASP B 186 ASN B 195 1 ? 10 
HELX_P HELX_P23 23 ASN B 131 ? MET B 136 ? ASN B 195 MET B 200 1 ? 6  
HELX_P HELX_P24 24 MET B 136 ? ASP B 152 ? MET B 200 ASP B 216 1 ? 17 
HELX_P HELX_P25 25 THR B 156 ? ILE B 170 ? THR B 220 ILE B 234 1 ? 15 
HELX_P HELX_P26 26 PHE B 172 ? ARG B 185 ? PHE B 236 ARG B 249 1 ? 14 
HELX_P HELX_P27 27 MET B 188 ? HIS B 215 ? MET B 252 HIS B 279 1 ? 28 
HELX_P HELX_P28 28 SER B 221 ? GLU B 242 ? SER B 285 GLU B 306 1 ? 22 
HELX_P HELX_P29 29 PRO B 245 ? GLY B 250 ? PRO B 309 GLY B 314 5 ? 6  
HELX_P HELX_P30 30 ASN B 252 ? LEU B 271 ? ASN B 316 LEU B 335 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B GLU 168 OE1 ? ? ? 1_555 F FE . FE ? ? B GLU 232 B FE 402 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc2  metalc ? ? A GLU 168 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 232 A FE 402 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc3  metalc ? ? A GLU 202 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 266 A FE 402 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc4  metalc ? ? B GLU 202 OE1 ? ? ? 1_555 F FE . FE ? ? B GLU 266 B FE 402 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc5  metalc ? ? B GLU 105 OE2 ? ? ? 1_555 F FE . FE ? ? B GLU 169 B FE 402 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc6  metalc ? ? A GLU 202 OE2 ? ? ? 1_555 D FE . FE ? ? A GLU 266 A FE 402 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc7  metalc ? ? A GLU 105 OE2 ? ? ? 1_555 D FE . FE ? ? A GLU 169 A FE 402 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc8  metalc ? ? B GLU 202 OE2 ? ? ? 1_555 F FE . FE ? ? B GLU 266 B FE 402 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc9  metalc ? ? A VAL 17  O   ? ? ? 1_555 C MG . MG ? ? A VAL 81  A MG 401 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc10 metalc ? ? A HIS 205 ND1 ? ? ? 1_555 D FE . FE ? ? A HIS 269 A FE 402 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc11 metalc ? ? B HIS 205 ND1 ? ? ? 1_555 F FE . FE ? ? B HIS 269 B FE 402 1_555 ? ? ? ? ? ? ? 2.571 ? 
metalc12 metalc ? ? A THR 92  OG1 ? ? ? 1_555 C MG . MG ? ? A THR 156 A MG 401 1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc13 metalc ? ? B THR 92  OG1 ? ? ? 1_555 E MG . MG ? ? B THR 156 B MG 401 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc14 metalc ? ? A ARG 14  O   ? ? ? 1_555 C MG . MG ? ? A ARG 78  A MG 401 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc15 metalc ? ? B ARG 14  O   ? ? ? 1_555 E MG . MG ? ? B ARG 78  B MG 401 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc16 metalc ? ? B VAL 17  O   ? ? ? 1_555 E MG . MG ? ? B VAL 81  B MG 401 1_555 ? ? ? ? ? ? ? 2.873 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 1  A . ? MET 65 A GLY 2  A ? GLY 66 A 1 7.39  
2 PHE 19 A . ? PHE 83 A PRO 20 A ? PRO 84 A 1 -3.40 
3 MET 1  B . ? MET 65 B GLY 2  B ? GLY 66 B 1 4.52  
4 PHE 19 B . ? PHE 83 B PRO 20 B ? PRO 84 B 1 -7.16 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 401' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 402' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG B 401' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE B 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ARG A 14  ? ARG A 78  . ? 1_555 ? 
2  AC1 3 VAL A 17  ? VAL A 81  . ? 1_555 ? 
3  AC1 3 THR A 92  ? THR A 156 . ? 1_555 ? 
4  AC2 5 GLN A 101 ? GLN A 165 . ? 1_555 ? 
5  AC2 5 GLU A 105 ? GLU A 169 . ? 1_555 ? 
6  AC2 5 GLU A 168 ? GLU A 232 . ? 1_555 ? 
7  AC2 5 GLU A 202 ? GLU A 266 . ? 1_555 ? 
8  AC2 5 HIS A 205 ? HIS A 269 . ? 1_555 ? 
9  AC3 3 ARG B 14  ? ARG B 78  . ? 1_555 ? 
10 AC3 3 VAL B 17  ? VAL B 81  . ? 1_555 ? 
11 AC3 3 THR B 92  ? THR B 156 . ? 1_555 ? 
12 AC4 4 GLU B 105 ? GLU B 169 . ? 1_555 ? 
13 AC4 4 GLU B 168 ? GLU B 232 . ? 1_555 ? 
14 AC4 4 GLU B 202 ? GLU B 266 . ? 1_555 ? 
15 AC4 4 HIS B 205 ? HIS B 269 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3VPM 
_atom_sites.fract_transf_matrix[1][1]   0.009174 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009174 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005716 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -19.130 -50.064 -57.083 1.00 89.02 ? 65  MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -19.620 -51.406 -56.647 1.00 89.00 ? 65  MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -18.695 -52.520 -57.194 1.00 88.70 ? 65  MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -18.996 -53.123 -58.234 1.00 88.89 ? 65  MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -21.082 -51.593 -57.077 1.00 89.13 ? 65  MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? -22.017 -50.493 -56.538 1.00 90.16 ? 65  MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? -23.424 -50.103 -57.616 1.00 91.99 ? 65  MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? -23.987 -48.502 -57.008 1.00 90.78 ? 65  MET A CE  1 
ATOM   9    N  N   . GLY A 1 2   ? -17.580 -52.815 -56.506 1.00 87.99 ? 66  GLY A N   1 
ATOM   10   C  CA  . GLY A 1 2   ? -17.223 -52.273 -55.174 1.00 86.57 ? 66  GLY A CA  1 
ATOM   11   C  C   . GLY A 1 2   ? -17.024 -50.768 -55.038 1.00 85.36 ? 66  GLY A C   1 
ATOM   12   O  O   . GLY A 1 2   ? -17.747 -50.106 -54.281 1.00 85.42 ? 66  GLY A O   1 
ATOM   13   N  N   . VAL A 1 3   ? -16.064 -50.222 -55.785 1.00 83.87 ? 67  VAL A N   1 
ATOM   14   C  CA  . VAL A 1 3   ? -15.713 -48.797 -55.678 1.00 81.99 ? 67  VAL A CA  1 
ATOM   15   C  C   . VAL A 1 3   ? -15.640 -48.071 -57.040 1.00 80.70 ? 67  VAL A C   1 
ATOM   16   O  O   . VAL A 1 3   ? -15.325 -46.881 -57.102 1.00 80.39 ? 67  VAL A O   1 
ATOM   17   C  CB  . VAL A 1 3   ? -14.413 -48.620 -54.829 1.00 82.19 ? 67  VAL A CB  1 
ATOM   18   C  CG1 . VAL A 1 3   ? -13.140 -48.531 -55.712 1.00 81.47 ? 67  VAL A CG1 1 
ATOM   19   C  CG2 . VAL A 1 3   ? -14.556 -47.441 -53.891 1.00 82.00 ? 67  VAL A CG2 1 
ATOM   20   N  N   . GLU A 1 4   ? -15.966 -48.795 -58.117 1.00 79.10 ? 68  GLU A N   1 
ATOM   21   C  CA  . GLU A 1 4   ? -15.931 -48.263 -59.493 1.00 77.36 ? 68  GLU A CA  1 
ATOM   22   C  C   . GLU A 1 4   ? -17.061 -47.269 -59.751 1.00 75.29 ? 68  GLU A C   1 
ATOM   23   O  O   . GLU A 1 4   ? -17.170 -46.705 -60.849 1.00 75.03 ? 68  GLU A O   1 
ATOM   24   C  CB  . GLU A 1 4   ? -15.949 -49.397 -60.542 1.00 77.87 ? 68  GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 4   ? -14.663 -50.266 -60.596 1.00 79.56 ? 68  GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 4   ? -13.397 -49.480 -61.026 1.00 81.98 ? 68  GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 4   ? -13.380 -48.882 -62.143 1.00 83.11 ? 68  GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 4   ? -12.417 -49.469 -60.242 1.00 80.53 ? 68  GLU A OE2 1 
ATOM   29   N  N   . ASP A 1 5   ? -17.889 -47.070 -58.725 1.00 73.43 ? 69  ASP A N   1 
ATOM   30   C  CA  A ASP A 1 5   ? -18.983 -46.096 -58.767 0.50 72.31 ? 69  ASP A CA  1 
ATOM   31   C  CA  B ASP A 1 5   ? -18.973 -46.091 -58.772 0.50 72.32 ? 69  ASP A CA  1 
ATOM   32   C  C   . ASP A 1 5   ? -18.516 -44.725 -58.250 1.00 71.37 ? 69  ASP A C   1 
ATOM   33   O  O   . ASP A 1 5   ? -19.271 -43.743 -58.273 1.00 71.38 ? 69  ASP A O   1 
ATOM   34   C  CB  A ASP A 1 5   ? -20.178 -46.617 -57.949 0.50 72.34 ? 69  ASP A CB  1 
ATOM   35   C  CB  B ASP A 1 5   ? -20.219 -46.597 -58.016 0.50 72.40 ? 69  ASP A CB  1 
ATOM   36   C  CG  A ASP A 1 5   ? -21.433 -45.768 -58.116 0.50 72.06 ? 69  ASP A CG  1 
ATOM   37   C  CG  B ASP A 1 5   ? -19.919 -47.059 -56.588 0.50 72.14 ? 69  ASP A CG  1 
ATOM   38   O  OD1 A ASP A 1 5   ? -21.548 -45.045 -59.131 0.50 71.37 ? 69  ASP A OD1 1 
ATOM   39   O  OD1 B ASP A 1 5   ? -18.806 -46.830 -56.070 0.50 72.33 ? 69  ASP A OD1 1 
ATOM   40   O  OD2 A ASP A 1 5   ? -22.305 -45.824 -57.222 0.50 71.69 ? 69  ASP A OD2 1 
ATOM   41   O  OD2 B ASP A 1 5   ? -20.818 -47.662 -55.975 0.50 71.69 ? 69  ASP A OD2 1 
ATOM   42   N  N   . GLU A 1 6   ? -17.266 -44.662 -57.797 1.00 69.55 ? 70  GLU A N   1 
ATOM   43   C  CA  . GLU A 1 6   ? -16.730 -43.446 -57.198 1.00 67.34 ? 70  GLU A CA  1 
ATOM   44   C  C   . GLU A 1 6   ? -15.788 -42.719 -58.122 1.00 66.30 ? 70  GLU A C   1 
ATOM   45   O  O   . GLU A 1 6   ? -14.746 -43.263 -58.478 1.00 66.11 ? 70  GLU A O   1 
ATOM   46   C  CB  . GLU A 1 6   ? -16.019 -43.765 -55.881 1.00 67.16 ? 70  GLU A CB  1 
ATOM   47   C  CG  . GLU A 1 6   ? -16.955 -44.199 -54.742 1.00 65.20 ? 70  GLU A CG  1 
ATOM   48   C  CD  . GLU A 1 6   ? -17.772 -43.051 -54.174 1.00 62.31 ? 70  GLU A CD  1 
ATOM   49   O  OE1 . GLU A 1 6   ? -17.719 -41.934 -54.730 1.00 59.16 ? 70  GLU A OE1 1 
ATOM   50   O  OE2 . GLU A 1 6   ? -18.468 -43.274 -53.162 1.00 63.59 ? 70  GLU A OE2 1 
ATOM   51   N  N   . PRO A 1 7   ? -16.150 -41.485 -58.517 1.00 65.20 ? 71  PRO A N   1 
ATOM   52   C  CA  . PRO A 1 7   ? -15.255 -40.684 -59.345 1.00 64.63 ? 71  PRO A CA  1 
ATOM   53   C  C   . PRO A 1 7   ? -13.853 -40.545 -58.729 1.00 64.22 ? 71  PRO A C   1 
ATOM   54   O  O   . PRO A 1 7   ? -12.858 -40.551 -59.452 1.00 64.25 ? 71  PRO A O   1 
ATOM   55   C  CB  . PRO A 1 7   ? -15.968 -39.330 -59.423 1.00 64.55 ? 71  PRO A CB  1 
ATOM   56   C  CG  . PRO A 1 7   ? -17.401 -39.657 -59.263 1.00 64.43 ? 71  PRO A CG  1 
ATOM   57   C  CD  . PRO A 1 7   ? -17.457 -40.829 -58.326 1.00 65.09 ? 71  PRO A CD  1 
ATOM   58   N  N   . LEU A 1 8   ? -13.778 -40.454 -57.405 1.00 63.70 ? 72  LEU A N   1 
ATOM   59   C  CA  . LEU A 1 8   ? -12.499 -40.289 -56.722 1.00 63.16 ? 72  LEU A CA  1 
ATOM   60   C  C   . LEU A 1 8   ? -11.640 -41.554 -56.684 1.00 63.15 ? 72  LEU A C   1 
ATOM   61   O  O   . LEU A 1 8   ? -10.414 -41.459 -56.632 1.00 63.22 ? 72  LEU A O   1 
ATOM   62   C  CB  . LEU A 1 8   ? -12.716 -39.746 -55.304 1.00 62.89 ? 72  LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 8   ? -12.566 -38.247 -55.005 1.00 61.70 ? 72  LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 8   ? -13.030 -37.337 -56.130 1.00 60.83 ? 72  LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 8   ? -13.315 -37.931 -53.742 1.00 61.51 ? 72  LEU A CD2 1 
ATOM   66   N  N   . LEU A 1 9   ? -12.279 -42.723 -56.744 1.00 63.11 ? 73  LEU A N   1 
ATOM   67   C  CA  . LEU A 1 9   ? -11.606 -43.997 -56.449 1.00 63.21 ? 73  LEU A CA  1 
ATOM   68   C  C   . LEU A 1 9   ? -11.530 -45.003 -57.600 1.00 63.85 ? 73  LEU A C   1 
ATOM   69   O  O   . LEU A 1 9   ? -10.814 -45.998 -57.511 1.00 63.95 ? 73  LEU A O   1 
ATOM   70   C  CB  . LEU A 1 9   ? -12.259 -44.652 -55.233 1.00 62.74 ? 73  LEU A CB  1 
ATOM   71   C  CG  . LEU A 1 9   ? -12.318 -43.757 -53.994 1.00 61.90 ? 73  LEU A CG  1 
ATOM   72   C  CD1 . LEU A 1 9   ? -13.267 -44.300 -52.952 1.00 59.54 ? 73  LEU A CD1 1 
ATOM   73   C  CD2 . LEU A 1 9   ? -10.917 -43.546 -53.425 1.00 60.79 ? 73  LEU A CD2 1 
ATOM   74   N  N   . ARG A 1 10  ? -12.271 -44.750 -58.671 1.00 64.76 ? 74  ARG A N   1 
ATOM   75   C  CA  . ARG A 1 10  ? -12.301 -45.657 -59.820 1.00 65.40 ? 74  ARG A CA  1 
ATOM   76   C  C   . ARG A 1 10  ? -11.094 -45.451 -60.727 1.00 66.19 ? 74  ARG A C   1 
ATOM   77   O  O   . ARG A 1 10  ? -10.528 -44.352 -60.774 1.00 66.28 ? 74  ARG A O   1 
ATOM   78   C  CB  . ARG A 1 10  ? -13.586 -45.464 -60.631 1.00 65.10 ? 74  ARG A CB  1 
ATOM   79   C  CG  . ARG A 1 10  ? -13.656 -44.153 -61.410 1.00 63.87 ? 74  ARG A CG  1 
ATOM   80   C  CD  . ARG A 1 10  ? -15.075 -43.861 -61.808 1.00 62.32 ? 74  ARG A CD  1 
ATOM   81   N  NE  . ARG A 1 10  ? -15.191 -42.563 -62.459 1.00 62.10 ? 74  ARG A NE  1 
ATOM   82   C  CZ  . ARG A 1 10  ? -16.345 -42.032 -62.859 1.00 61.78 ? 74  ARG A CZ  1 
ATOM   83   N  NH1 . ARG A 1 10  ? -17.483 -42.695 -62.675 1.00 59.92 ? 74  ARG A NH1 1 
ATOM   84   N  NH2 . ARG A 1 10  ? -16.365 -40.833 -63.436 1.00 60.63 ? 74  ARG A NH2 1 
ATOM   85   N  N   . GLU A 1 11  ? -10.744 -46.510 -61.464 1.00 67.10 ? 75  GLU A N   1 
ATOM   86   C  CA  . GLU A 1 11  ? -9.633  -46.511 -62.419 1.00 67.84 ? 75  GLU A CA  1 
ATOM   87   C  C   . GLU A 1 11  ? -9.550  -45.226 -63.238 1.00 67.54 ? 75  GLU A C   1 
ATOM   88   O  O   . GLU A 1 11  ? -10.512 -44.832 -63.912 1.00 67.32 ? 75  GLU A O   1 
ATOM   89   C  CB  . GLU A 1 11  ? -9.699  -47.738 -63.351 1.00 68.28 ? 75  GLU A CB  1 
ATOM   90   C  CG  . GLU A 1 11  ? -8.575  -47.771 -64.419 1.00 70.74 ? 75  GLU A CG  1 
ATOM   91   C  CD  . GLU A 1 11  ? -8.487  -49.094 -65.197 1.00 73.66 ? 75  GLU A CD  1 
ATOM   92   O  OE1 . GLU A 1 11  ? -9.522  -49.581 -65.730 1.00 74.75 ? 75  GLU A OE1 1 
ATOM   93   O  OE2 . GLU A 1 11  ? -7.362  -49.639 -65.285 1.00 73.86 ? 75  GLU A OE2 1 
ATOM   94   N  N   . ASN A 1 12  ? -8.393  -44.576 -63.148 1.00 67.48 ? 76  ASN A N   1 
ATOM   95   C  CA  . ASN A 1 12  ? -8.101  -43.396 -63.934 1.00 67.28 ? 76  ASN A CA  1 
ATOM   96   C  C   . ASN A 1 12  ? -6.808  -43.606 -64.724 1.00 67.65 ? 76  ASN A C   1 
ATOM   97   O  O   . ASN A 1 12  ? -5.706  -43.411 -64.194 1.00 67.91 ? 76  ASN A O   1 
ATOM   98   C  CB  . ASN A 1 12  ? -8.017  -42.162 -63.037 1.00 67.07 ? 76  ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 12  ? -7.763  -40.879 -63.815 1.00 66.97 ? 76  ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 12  ? -7.928  -40.821 -65.037 1.00 67.21 ? 76  ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 12  ? -7.360  -39.840 -63.104 1.00 66.35 ? 76  ASN A ND2 1 
ATOM   102  N  N   . PRO A 1 13  ? -6.934  -44.017 -66.003 1.00 67.61 ? 77  PRO A N   1 
ATOM   103  C  CA  . PRO A 1 13  ? -5.745  -44.245 -66.823 1.00 67.22 ? 77  PRO A CA  1 
ATOM   104  C  C   . PRO A 1 13  ? -4.960  -42.954 -67.059 1.00 66.63 ? 77  PRO A C   1 
ATOM   105  O  O   . PRO A 1 13  ? -3.834  -43.010 -67.549 1.00 66.71 ? 77  PRO A O   1 
ATOM   106  C  CB  . PRO A 1 13  ? -6.332  -44.747 -68.150 1.00 67.42 ? 77  PRO A CB  1 
ATOM   107  C  CG  . PRO A 1 13  ? -7.691  -44.116 -68.215 1.00 67.41 ? 77  PRO A CG  1 
ATOM   108  C  CD  . PRO A 1 13  ? -8.176  -44.187 -66.786 1.00 67.55 ? 77  PRO A CD  1 
ATOM   109  N  N   . ARG A 1 14  ? -5.561  -41.813 -66.720 1.00 65.75 ? 78  ARG A N   1 
ATOM   110  C  CA  . ARG A 1 14  ? -4.923  -40.511 -66.886 1.00 65.27 ? 78  ARG A CA  1 
ATOM   111  C  C   . ARG A 1 14  ? -4.381  -39.948 -65.551 1.00 64.97 ? 78  ARG A C   1 
ATOM   112  O  O   . ARG A 1 14  ? -4.070  -38.755 -65.453 1.00 64.49 ? 78  ARG A O   1 
ATOM   113  C  CB  . ARG A 1 14  ? -5.902  -39.520 -67.532 1.00 65.32 ? 78  ARG A CB  1 
ATOM   114  C  CG  . ARG A 1 14  ? -6.330  -39.828 -68.977 1.00 66.04 ? 78  ARG A CG  1 
ATOM   115  C  CD  . ARG A 1 14  ? -5.319  -39.334 -70.030 1.00 67.02 ? 78  ARG A CD  1 
ATOM   116  N  NE  . ARG A 1 14  ? -5.199  -37.872 -70.082 1.00 66.88 ? 78  ARG A NE  1 
ATOM   117  C  CZ  . ARG A 1 14  ? -5.516  -37.118 -71.134 1.00 67.28 ? 78  ARG A CZ  1 
ATOM   118  N  NH1 . ARG A 1 14  ? -5.979  -37.674 -72.247 1.00 69.13 ? 78  ARG A NH1 1 
ATOM   119  N  NH2 . ARG A 1 14  ? -5.359  -35.802 -71.085 1.00 66.57 ? 78  ARG A NH2 1 
ATOM   120  N  N   . ARG A 1 15  ? -4.250  -40.808 -64.538 1.00 64.61 ? 79  ARG A N   1 
ATOM   121  C  CA  . ARG A 1 15  ? -3.916  -40.349 -63.183 1.00 64.89 ? 79  ARG A CA  1 
ATOM   122  C  C   . ARG A 1 15  ? -2.551  -39.659 -63.032 1.00 64.33 ? 79  ARG A C   1 
ATOM   123  O  O   . ARG A 1 15  ? -2.358  -38.831 -62.133 1.00 64.46 ? 79  ARG A O   1 
ATOM   124  C  CB  . ARG A 1 15  ? -4.081  -41.468 -62.136 1.00 65.28 ? 79  ARG A CB  1 
ATOM   125  C  CG  . ARG A 1 15  ? -3.262  -42.730 -62.362 1.00 67.26 ? 79  ARG A CG  1 
ATOM   126  C  CD  . ARG A 1 15  ? -3.481  -43.712 -61.213 1.00 70.65 ? 79  ARG A CD  1 
ATOM   127  N  NE  . ARG A 1 15  ? -2.886  -45.035 -61.450 1.00 73.24 ? 79  ARG A NE  1 
ATOM   128  C  CZ  . ARG A 1 15  ? -2.657  -45.934 -60.487 1.00 75.17 ? 79  ARG A CZ  1 
ATOM   129  N  NH1 . ARG A 1 15  ? -2.964  -45.662 -59.217 1.00 75.57 ? 79  ARG A NH1 1 
ATOM   130  N  NH2 . ARG A 1 15  ? -2.120  -47.112 -60.788 1.00 75.14 ? 79  ARG A NH2 1 
ATOM   131  N  N   . PHE A 1 16  ? -1.613  -39.984 -63.911 1.00 63.43 ? 80  PHE A N   1 
ATOM   132  C  CA  . PHE A 1 16  ? -0.296  -39.364 -63.854 1.00 62.20 ? 80  PHE A CA  1 
ATOM   133  C  C   . PHE A 1 16  ? -0.078  -38.346 -64.958 1.00 61.23 ? 80  PHE A C   1 
ATOM   134  O  O   . PHE A 1 16  ? 1.022   -37.811 -65.105 1.00 61.49 ? 80  PHE A O   1 
ATOM   135  C  CB  . PHE A 1 16  ? 0.795   -40.436 -63.848 1.00 62.49 ? 80  PHE A CB  1 
ATOM   136  C  CG  . PHE A 1 16  ? 0.760   -41.304 -62.630 1.00 62.78 ? 80  PHE A CG  1 
ATOM   137  C  CD1 . PHE A 1 16  ? 0.342   -42.628 -62.719 1.00 63.44 ? 80  PHE A CD1 1 
ATOM   138  C  CD2 . PHE A 1 16  ? 1.109   -40.782 -61.387 1.00 63.05 ? 80  PHE A CD2 1 
ATOM   139  C  CE1 . PHE A 1 16  ? 0.291   -43.432 -61.592 1.00 63.37 ? 80  PHE A CE1 1 
ATOM   140  C  CE2 . PHE A 1 16  ? 1.062   -41.566 -60.257 1.00 64.21 ? 80  PHE A CE2 1 
ATOM   141  C  CZ  . PHE A 1 16  ? 0.652   -42.907 -60.358 1.00 64.22 ? 80  PHE A CZ  1 
ATOM   142  N  N   . VAL A 1 17  ? -1.128  -38.083 -65.730 1.00 59.83 ? 81  VAL A N   1 
ATOM   143  C  CA  . VAL A 1 17  ? -1.121  -36.992 -66.697 1.00 58.65 ? 81  VAL A CA  1 
ATOM   144  C  C   . VAL A 1 17  ? -1.745  -35.785 -66.011 1.00 57.95 ? 81  VAL A C   1 
ATOM   145  O  O   . VAL A 1 17  ? -2.860  -35.859 -65.488 1.00 57.82 ? 81  VAL A O   1 
ATOM   146  C  CB  . VAL A 1 17  ? -1.894  -37.349 -67.995 1.00 58.71 ? 81  VAL A CB  1 
ATOM   147  C  CG1 . VAL A 1 17  ? -1.950  -36.158 -68.921 1.00 57.99 ? 81  VAL A CG1 1 
ATOM   148  C  CG2 . VAL A 1 17  ? -1.256  -38.563 -68.699 1.00 58.51 ? 81  VAL A CG2 1 
ATOM   149  N  N   . ILE A 1 18  ? -1.016  -34.680 -66.001 1.00 57.19 ? 82  ILE A N   1 
ATOM   150  C  CA  . ILE A 1 18  ? -1.426  -33.514 -65.231 1.00 56.75 ? 82  ILE A CA  1 
ATOM   151  C  C   . ILE A 1 18  ? -2.638  -32.810 -65.869 1.00 56.10 ? 82  ILE A C   1 
ATOM   152  O  O   . ILE A 1 18  ? -3.636  -32.569 -65.211 1.00 55.79 ? 82  ILE A O   1 
ATOM   153  C  CB  . ILE A 1 18  ? -0.192  -32.538 -64.968 1.00 57.03 ? 82  ILE A CB  1 
ATOM   154  C  CG1 . ILE A 1 18  ? -0.359  -31.734 -63.672 1.00 57.06 ? 82  ILE A CG1 1 
ATOM   155  C  CG2 . ILE A 1 18  ? 0.106   -31.628 -66.153 1.00 56.81 ? 82  ILE A CG2 1 
ATOM   156  C  CD1 . ILE A 1 18  ? 0.231   -32.430 -62.458 1.00 57.18 ? 82  ILE A CD1 1 
ATOM   157  N  N   . PHE A 1 19  ? -2.548  -32.528 -67.164 1.00 55.76 ? 83  PHE A N   1 
ATOM   158  C  CA  . PHE A 1 19  ? -3.532  -31.706 -67.859 1.00 55.36 ? 83  PHE A CA  1 
ATOM   159  C  C   . PHE A 1 19  ? -4.442  -32.529 -68.792 1.00 54.79 ? 83  PHE A C   1 
ATOM   160  O  O   . PHE A 1 19  ? -4.087  -33.643 -69.193 1.00 54.60 ? 83  PHE A O   1 
ATOM   161  C  CB  . PHE A 1 19  ? -2.823  -30.570 -68.626 1.00 55.46 ? 83  PHE A CB  1 
ATOM   162  C  CG  . PHE A 1 19  ? -2.580  -29.325 -67.805 1.00 55.50 ? 83  PHE A CG  1 
ATOM   163  C  CD1 . PHE A 1 19  ? -2.558  -29.368 -66.408 1.00 56.36 ? 83  PHE A CD1 1 
ATOM   164  C  CD2 . PHE A 1 19  ? -2.350  -28.104 -68.434 1.00 56.18 ? 83  PHE A CD2 1 
ATOM   165  C  CE1 . PHE A 1 19  ? -2.321  -28.199 -65.654 1.00 57.82 ? 83  PHE A CE1 1 
ATOM   166  C  CE2 . PHE A 1 19  ? -2.110  -26.926 -67.691 1.00 57.21 ? 83  PHE A CE2 1 
ATOM   167  C  CZ  . PHE A 1 19  ? -2.099  -26.971 -66.303 1.00 57.31 ? 83  PHE A CZ  1 
ATOM   168  N  N   . PRO A 1 20  ? -5.633  -31.987 -69.113 1.00 54.18 ? 84  PRO A N   1 
ATOM   169  C  CA  . PRO A 1 20  ? -6.094  -30.717 -68.556 1.00 53.72 ? 84  PRO A CA  1 
ATOM   170  C  C   . PRO A 1 20  ? -6.719  -30.927 -67.176 1.00 53.57 ? 84  PRO A C   1 
ATOM   171  O  O   . PRO A 1 20  ? -7.104  -32.052 -66.819 1.00 53.23 ? 84  PRO A O   1 
ATOM   172  C  CB  . PRO A 1 20  ? -7.144  -30.253 -69.576 1.00 53.46 ? 84  PRO A CB  1 
ATOM   173  C  CG  . PRO A 1 20  ? -7.718  -31.514 -70.108 1.00 53.18 ? 84  PRO A CG  1 
ATOM   174  C  CD  . PRO A 1 20  ? -6.630  -32.579 -70.028 1.00 53.86 ? 84  PRO A CD  1 
ATOM   175  N  N   . ILE A 1 21  ? -6.809  -29.844 -66.417 1.00 53.57 ? 85  ILE A N   1 
ATOM   176  C  CA  . ILE A 1 21  ? -7.422  -29.872 -65.099 1.00 53.89 ? 85  ILE A CA  1 
ATOM   177  C  C   . ILE A 1 21  ? -8.914  -30.068 -65.294 1.00 54.35 ? 85  ILE A C   1 
ATOM   178  O  O   . ILE A 1 21  ? -9.526  -29.365 -66.104 1.00 54.44 ? 85  ILE A O   1 
ATOM   179  C  CB  . ILE A 1 21  ? -7.127  -28.547 -64.305 1.00 53.55 ? 85  ILE A CB  1 
ATOM   180  C  CG1 . ILE A 1 21  ? -5.621  -28.392 -64.045 1.00 53.37 ? 85  ILE A CG1 1 
ATOM   181  C  CG2 . ILE A 1 21  ? -7.889  -28.505 -62.996 1.00 53.12 ? 85  ILE A CG2 1 
ATOM   182  C  CD1 . ILE A 1 21  ? -4.897  -29.686 -63.546 1.00 51.59 ? 85  ILE A CD1 1 
ATOM   183  N  N   . GLU A 1 22  ? -9.498  -31.031 -64.585 1.00 54.84 ? 86  GLU A N   1 
ATOM   184  C  CA  . GLU A 1 22  ? -10.950 -31.216 -64.646 1.00 55.52 ? 86  GLU A CA  1 
ATOM   185  C  C   . GLU A 1 22  ? -11.653 -30.870 -63.330 1.00 55.39 ? 86  GLU A C   1 
ATOM   186  O  O   . GLU A 1 22  ? -12.779 -30.397 -63.343 1.00 55.25 ? 86  GLU A O   1 
ATOM   187  C  CB  . GLU A 1 22  ? -11.340 -32.619 -65.131 1.00 55.78 ? 86  GLU A CB  1 
ATOM   188  C  CG  . GLU A 1 22  ? -10.840 -33.026 -66.531 1.00 59.22 ? 86  GLU A CG  1 
ATOM   189  C  CD  . GLU A 1 22  ? -11.343 -32.140 -67.702 1.00 65.81 ? 86  GLU A CD  1 
ATOM   190  O  OE1 . GLU A 1 22  ? -11.858 -31.010 -67.470 1.00 68.40 ? 86  GLU A OE1 1 
ATOM   191  O  OE2 . GLU A 1 22  ? -11.194 -32.573 -68.883 1.00 67.69 ? 86  GLU A OE2 1 
ATOM   192  N  N   . TYR A 1 23  ? -10.989 -31.100 -62.196 1.00 55.59 ? 87  TYR A N   1 
ATOM   193  C  CA  . TYR A 1 23  ? -11.565 -30.762 -60.895 1.00 55.16 ? 87  TYR A CA  1 
ATOM   194  C  C   . TYR A 1 23  ? -10.956 -29.472 -60.384 1.00 55.05 ? 87  TYR A C   1 
ATOM   195  O  O   . TYR A 1 23  ? -9.986  -29.475 -59.631 1.00 54.89 ? 87  TYR A O   1 
ATOM   196  C  CB  . TYR A 1 23  ? -11.355 -31.894 -59.907 1.00 55.04 ? 87  TYR A CB  1 
ATOM   197  C  CG  . TYR A 1 23  ? -12.117 -33.148 -60.240 1.00 55.55 ? 87  TYR A CG  1 
ATOM   198  C  CD1 . TYR A 1 23  ? -13.379 -33.386 -59.683 1.00 56.75 ? 87  TYR A CD1 1 
ATOM   199  C  CD2 . TYR A 1 23  ? -11.586 -34.105 -61.098 1.00 55.40 ? 87  TYR A CD2 1 
ATOM   200  C  CE1 . TYR A 1 23  ? -14.098 -34.552 -59.971 1.00 56.49 ? 87  TYR A CE1 1 
ATOM   201  C  CE2 . TYR A 1 23  ? -12.293 -35.277 -61.392 1.00 56.45 ? 87  TYR A CE2 1 
ATOM   202  C  CZ  . TYR A 1 23  ? -13.550 -35.488 -60.822 1.00 57.23 ? 87  TYR A CZ  1 
ATOM   203  O  OH  . TYR A 1 23  ? -14.258 -36.637 -61.103 1.00 58.69 ? 87  TYR A OH  1 
ATOM   204  N  N   . HIS A 1 24  ? -11.537 -28.360 -60.814 1.00 55.23 ? 88  HIS A N   1 
ATOM   205  C  CA  . HIS A 1 24  ? -10.983 -27.043 -60.536 1.00 55.37 ? 88  HIS A CA  1 
ATOM   206  C  C   . HIS A 1 24  ? -11.007 -26.709 -59.046 1.00 55.05 ? 88  HIS A C   1 
ATOM   207  O  O   . HIS A 1 24  ? -10.058 -26.120 -58.520 1.00 55.37 ? 88  HIS A O   1 
ATOM   208  C  CB  . HIS A 1 24  ? -11.711 -25.974 -61.359 1.00 55.62 ? 88  HIS A CB  1 
ATOM   209  C  CG  . HIS A 1 24  ? -11.387 -26.024 -62.824 1.00 57.48 ? 88  HIS A CG  1 
ATOM   210  N  ND1 . HIS A 1 24  ? -12.194 -26.663 -63.747 1.00 57.67 ? 88  HIS A ND1 1 
ATOM   211  C  CD2 . HIS A 1 24  ? -10.333 -25.530 -63.522 1.00 58.00 ? 88  HIS A CD2 1 
ATOM   212  C  CE1 . HIS A 1 24  ? -11.654 -26.557 -64.949 1.00 57.91 ? 88  HIS A CE1 1 
ATOM   213  N  NE2 . HIS A 1 24  ? -10.528 -25.872 -64.841 1.00 58.64 ? 88  HIS A NE2 1 
ATOM   214  N  N   . ASP A 1 25  ? -12.077 -27.103 -58.368 1.00 54.27 ? 89  ASP A N   1 
ATOM   215  C  CA  . ASP A 1 25  ? -12.213 -26.813 -56.954 1.00 53.87 ? 89  ASP A CA  1 
ATOM   216  C  C   . ASP A 1 25  ? -11.063 -27.457 -56.189 1.00 53.28 ? 89  ASP A C   1 
ATOM   217  O  O   . ASP A 1 25  ? -10.406 -26.805 -55.370 1.00 53.59 ? 89  ASP A O   1 
ATOM   218  C  CB  . ASP A 1 25  ? -13.602 -27.236 -56.408 1.00 53.99 ? 89  ASP A CB  1 
ATOM   219  C  CG  . ASP A 1 25  ? -13.989 -28.686 -56.764 1.00 54.75 ? 89  ASP A CG  1 
ATOM   220  O  OD1 . ASP A 1 25  ? -13.488 -29.254 -57.756 1.00 56.33 ? 89  ASP A OD1 1 
ATOM   221  O  OD2 . ASP A 1 25  ? -14.825 -29.263 -56.045 1.00 54.64 ? 89  ASP A OD2 1 
ATOM   222  N  N   . ILE A 1 26  ? -10.815 -28.725 -56.497 1.00 52.33 ? 90  ILE A N   1 
ATOM   223  C  CA  . ILE A 1 26  ? -9.790  -29.526 -55.849 1.00 51.60 ? 90  ILE A CA  1 
ATOM   224  C  C   . ILE A 1 26  ? -8.420  -29.020 -56.224 1.00 51.21 ? 90  ILE A C   1 
ATOM   225  O  O   . ILE A 1 26  ? -7.519  -29.003 -55.409 1.00 51.39 ? 90  ILE A O   1 
ATOM   226  C  CB  . ILE A 1 26  ? -9.944  -31.023 -56.222 1.00 51.81 ? 90  ILE A CB  1 
ATOM   227  C  CG1 . ILE A 1 26  ? -11.246 -31.559 -55.617 1.00 52.16 ? 90  ILE A CG1 1 
ATOM   228  C  CG2 . ILE A 1 26  ? -8.738  -31.847 -55.761 1.00 50.62 ? 90  ILE A CG2 1 
ATOM   229  C  CD1 . ILE A 1 26  ? -11.756 -32.855 -56.208 1.00 52.28 ? 90  ILE A CD1 1 
ATOM   230  N  N   . TRP A 1 27  ? -8.274  -28.589 -57.464 1.00 50.92 ? 91  TRP A N   1 
ATOM   231  C  CA  . TRP A 1 27  ? -7.009  -28.079 -57.938 1.00 50.50 ? 91  TRP A CA  1 
ATOM   232  C  C   . TRP A 1 27  ? -6.644  -26.741 -57.298 1.00 50.90 ? 91  TRP A C   1 
ATOM   233  O  O   . TRP A 1 27  ? -5.471  -26.488 -57.053 1.00 51.12 ? 91  TRP A O   1 
ATOM   234  C  CB  . TRP A 1 27  ? -7.053  -27.967 -59.457 1.00 50.18 ? 91  TRP A CB  1 
ATOM   235  C  CG  . TRP A 1 27  ? -5.825  -27.433 -60.072 1.00 48.51 ? 91  TRP A CG  1 
ATOM   236  C  CD1 . TRP A 1 27  ? -5.655  -26.186 -60.586 1.00 47.10 ? 91  TRP A CD1 1 
ATOM   237  C  CD2 . TRP A 1 27  ? -4.583  -28.123 -60.261 1.00 47.12 ? 91  TRP A CD2 1 
ATOM   238  N  NE1 . TRP A 1 27  ? -4.380  -26.051 -61.082 1.00 47.83 ? 91  TRP A NE1 1 
ATOM   239  C  CE2 . TRP A 1 27  ? -3.699  -27.225 -60.891 1.00 46.45 ? 91  TRP A CE2 1 
ATOM   240  C  CE3 . TRP A 1 27  ? -4.135  -29.413 -59.968 1.00 47.49 ? 91  TRP A CE3 1 
ATOM   241  C  CZ2 . TRP A 1 27  ? -2.394  -27.571 -61.231 1.00 45.50 ? 91  TRP A CZ2 1 
ATOM   242  C  CZ3 . TRP A 1 27  ? -2.828  -29.756 -60.306 1.00 47.52 ? 91  TRP A CZ3 1 
ATOM   243  C  CH2 . TRP A 1 27  ? -1.976  -28.833 -60.934 1.00 45.53 ? 91  TRP A CH2 1 
ATOM   244  N  N   . GLN A 1 28  ? -7.630  -25.879 -57.035 1.00 51.46 ? 92  GLN A N   1 
ATOM   245  C  CA  . GLN A 1 28  ? -7.328  -24.541 -56.490 1.00 52.06 ? 92  GLN A CA  1 
ATOM   246  C  C   . GLN A 1 28  ? -6.808  -24.668 -55.066 1.00 51.51 ? 92  GLN A C   1 
ATOM   247  O  O   . GLN A 1 28  ? -6.031  -23.833 -54.598 1.00 51.50 ? 92  GLN A O   1 
ATOM   248  C  CB  . GLN A 1 28  ? -8.520  -23.569 -56.554 1.00 52.26 ? 92  GLN A CB  1 
ATOM   249  C  CG  . GLN A 1 28  ? -9.113  -23.284 -57.961 1.00 56.57 ? 92  GLN A CG  1 
ATOM   250  C  CD  . GLN A 1 28  ? -8.075  -22.898 -59.070 1.00 62.22 ? 92  GLN A CD  1 
ATOM   251  O  OE1 . GLN A 1 28  ? -7.063  -22.201 -58.816 1.00 63.40 ? 92  GLN A OE1 1 
ATOM   252  N  NE2 . GLN A 1 28  ? -8.351  -23.346 -60.312 1.00 62.11 ? 92  GLN A NE2 1 
ATOM   253  N  N   . MET A 1 29  ? -7.213  -25.736 -54.392 1.00 50.78 ? 93  MET A N   1 
ATOM   254  C  CA  . MET A 1 29  ? -6.676  -26.013 -53.073 1.00 50.96 ? 93  MET A CA  1 
ATOM   255  C  C   . MET A 1 29  ? -5.237  -26.493 -53.122 1.00 50.17 ? 93  MET A C   1 
ATOM   256  O  O   . MET A 1 29  ? -4.445  -26.179 -52.224 1.00 50.08 ? 93  MET A O   1 
ATOM   257  C  CB  . MET A 1 29  ? -7.556  -26.986 -52.307 1.00 51.26 ? 93  MET A CB  1 
ATOM   258  C  CG  . MET A 1 29  ? -8.749  -26.285 -51.775 1.00 54.23 ? 93  MET A CG  1 
ATOM   259  S  SD  . MET A 1 29  ? -9.687  -27.325 -50.708 1.00 61.74 ? 93  MET A SD  1 
ATOM   260  C  CE  . MET A 1 29  ? -8.766  -27.128 -49.197 1.00 61.37 ? 93  MET A CE  1 
ATOM   261  N  N   . TYR A 1 30  ? -4.891  -27.228 -54.174 1.00 48.90 ? 94  TYR A N   1 
ATOM   262  C  CA  . TYR A 1 30  ? -3.502  -27.564 -54.383 1.00 48.25 ? 94  TYR A CA  1 
ATOM   263  C  C   . TYR A 1 30  ? -2.691  -26.293 -54.638 1.00 48.29 ? 94  TYR A C   1 
ATOM   264  O  O   . TYR A 1 30  ? -1.570  -26.146 -54.135 1.00 48.23 ? 94  TYR A O   1 
ATOM   265  C  CB  . TYR A 1 30  ? -3.325  -28.555 -55.531 1.00 47.55 ? 94  TYR A CB  1 
ATOM   266  C  CG  . TYR A 1 30  ? -1.900  -28.627 -55.999 1.00 46.84 ? 94  TYR A CG  1 
ATOM   267  C  CD1 . TYR A 1 30  ? -0.865  -28.972 -55.113 1.00 45.82 ? 94  TYR A CD1 1 
ATOM   268  C  CD2 . TYR A 1 30  ? -1.566  -28.331 -57.327 1.00 46.04 ? 94  TYR A CD2 1 
ATOM   269  C  CE1 . TYR A 1 30  ? 0.453   -29.031 -55.549 1.00 45.56 ? 94  TYR A CE1 1 
ATOM   270  C  CE2 . TYR A 1 30  ? -0.247  -28.392 -57.774 1.00 44.72 ? 94  TYR A CE2 1 
ATOM   271  C  CZ  . TYR A 1 30  ? 0.753   -28.739 -56.877 1.00 44.83 ? 94  TYR A CZ  1 
ATOM   272  O  OH  . TYR A 1 30  ? 2.046   -28.797 -57.304 1.00 44.84 ? 94  TYR A OH  1 
ATOM   273  N  N   . LYS A 1 31  ? -3.264  -25.368 -55.405 1.00 48.16 ? 95  LYS A N   1 
ATOM   274  C  CA  . LYS A 1 31  ? -2.540  -24.157 -55.752 1.00 48.19 ? 95  LYS A CA  1 
ATOM   275  C  C   . LYS A 1 31  ? -2.359  -23.329 -54.511 1.00 47.86 ? 95  LYS A C   1 
ATOM   276  O  O   . LYS A 1 31  ? -1.328  -22.676 -54.338 1.00 47.76 ? 95  LYS A O   1 
ATOM   277  C  CB  . LYS A 1 31  ? -3.260  -23.351 -56.833 1.00 48.37 ? 95  LYS A CB  1 
ATOM   278  C  CG  . LYS A 1 31  ? -3.506  -24.114 -58.131 1.00 48.66 ? 95  LYS A CG  1 
ATOM   279  C  CD  . LYS A 1 31  ? -2.224  -24.628 -58.760 1.00 48.57 ? 95  LYS A CD  1 
ATOM   280  C  CE  . LYS A 1 31  ? -1.321  -23.491 -59.209 1.00 47.41 ? 95  LYS A CE  1 
ATOM   281  N  NZ  . LYS A 1 31  ? -0.068  -24.075 -59.765 1.00 45.44 ? 95  LYS A NZ  1 
ATOM   282  N  N   . LYS A 1 32  ? -3.359  -23.385 -53.639 1.00 47.55 ? 96  LYS A N   1 
ATOM   283  C  CA  . LYS A 1 32  ? -3.297  -22.659 -52.381 1.00 47.42 ? 96  LYS A CA  1 
ATOM   284  C  C   . LYS A 1 32  ? -2.244  -23.263 -51.455 1.00 46.59 ? 96  LYS A C   1 
ATOM   285  O  O   . LYS A 1 32  ? -1.424  -22.534 -50.895 1.00 46.37 ? 96  LYS A O   1 
ATOM   286  C  CB  . LYS A 1 32  ? -4.675  -22.537 -51.718 1.00 47.58 ? 96  LYS A CB  1 
ATOM   287  C  CG  . LYS A 1 32  ? -4.604  -21.920 -50.337 1.00 49.90 ? 96  LYS A CG  1 
ATOM   288  C  CD  . LYS A 1 32  ? -5.610  -20.812 -50.118 1.00 55.00 ? 96  LYS A CD  1 
ATOM   289  C  CE  . LYS A 1 32  ? -6.995  -21.359 -49.797 1.00 56.35 ? 96  LYS A CE  1 
ATOM   290  N  NZ  . LYS A 1 32  ? -7.548  -20.593 -48.646 1.00 57.89 ? 96  LYS A NZ  1 
ATOM   291  N  N   . ALA A 1 33  ? -2.242  -24.587 -51.315 1.00 45.76 ? 97  ALA A N   1 
ATOM   292  C  CA  . ALA A 1 33  ? -1.152  -25.250 -50.583 1.00 45.36 ? 97  ALA A CA  1 
ATOM   293  C  C   . ALA A 1 33  ? 0.194   -24.738 -51.109 1.00 45.32 ? 97  ALA A C   1 
ATOM   294  O  O   . ALA A 1 33  ? 0.984   -24.172 -50.365 1.00 45.23 ? 97  ALA A O   1 
ATOM   295  C  CB  . ALA A 1 33  ? -1.238  -26.748 -50.715 1.00 44.14 ? 97  ALA A CB  1 
ATOM   296  N  N   . GLU A 1 34  ? 0.403   -24.898 -52.411 1.00 45.12 ? 98  GLU A N   1 
ATOM   297  C  CA  . GLU A 1 34  ? 1.653   -24.583 -53.064 1.00 45.21 ? 98  GLU A CA  1 
ATOM   298  C  C   . GLU A 1 34  ? 2.058   -23.104 -52.931 1.00 45.42 ? 98  GLU A C   1 
ATOM   299  O  O   . GLU A 1 34  ? 3.244   -22.775 -52.880 1.00 45.24 ? 98  GLU A O   1 
ATOM   300  C  CB  . GLU A 1 34  ? 1.539   -25.024 -54.517 1.00 45.34 ? 98  GLU A CB  1 
ATOM   301  C  CG  . GLU A 1 34  ? 2.659   -24.604 -55.441 1.00 46.62 ? 98  GLU A CG  1 
ATOM   302  C  CD  . GLU A 1 34  ? 2.451   -25.101 -56.869 1.00 47.73 ? 98  GLU A CD  1 
ATOM   303  O  OE1 . GLU A 1 34  ? 1.285   -25.263 -57.290 1.00 48.14 ? 98  GLU A OE1 1 
ATOM   304  O  OE2 . GLU A 1 34  ? 3.458   -25.317 -57.574 1.00 48.53 ? 98  GLU A OE2 1 
ATOM   305  N  N   . ALA A 1 35  ? 1.075   -22.212 -52.843 1.00 45.55 ? 99  ALA A N   1 
ATOM   306  C  CA  . ALA A 1 35  ? 1.375   -20.789 -52.748 1.00 45.48 ? 99  ALA A CA  1 
ATOM   307  C  C   . ALA A 1 35  ? 1.802   -20.401 -51.336 1.00 45.48 ? 99  ALA A C   1 
ATOM   308  O  O   . ALA A 1 35  ? 2.347   -19.310 -51.117 1.00 45.58 ? 99  ALA A O   1 
ATOM   309  C  CB  . ALA A 1 35  ? 0.172   -19.961 -53.184 1.00 45.47 ? 99  ALA A CB  1 
ATOM   310  N  N   . SER A 1 36  ? 1.540   -21.284 -50.377 1.00 45.02 ? 100 SER A N   1 
ATOM   311  C  CA  . SER A 1 36  ? 1.852   -20.991 -48.993 1.00 45.03 ? 100 SER A CA  1 
ATOM   312  C  C   . SER A 1 36  ? 3.067   -21.771 -48.470 1.00 45.01 ? 100 SER A C   1 
ATOM   313  O  O   . SER A 1 36  ? 3.386   -21.708 -47.290 1.00 45.44 ? 100 SER A O   1 
ATOM   314  C  CB  . SER A 1 36  ? 0.619   -21.184 -48.107 1.00 44.93 ? 100 SER A CB  1 
ATOM   315  O  OG  . SER A 1 36  ? -0.003  -22.418 -48.378 1.00 45.35 ? 100 SER A OG  1 
ATOM   316  N  N   . PHE A 1 37  ? 3.758   -22.472 -49.361 1.00 44.80 ? 101 PHE A N   1 
ATOM   317  C  CA  . PHE A 1 37  ? 4.996   -23.151 -49.020 1.00 44.78 ? 101 PHE A CA  1 
ATOM   318  C  C   . PHE A 1 37  ? 5.911   -22.305 -48.136 1.00 45.17 ? 101 PHE A C   1 
ATOM   319  O  O   . PHE A 1 37  ? 6.076   -21.108 -48.367 1.00 45.78 ? 101 PHE A O   1 
ATOM   320  C  CB  . PHE A 1 37  ? 5.747   -23.534 -50.294 1.00 44.66 ? 101 PHE A CB  1 
ATOM   321  C  CG  . PHE A 1 37  ? 7.073   -24.203 -50.040 1.00 43.14 ? 101 PHE A CG  1 
ATOM   322  C  CD1 . PHE A 1 37  ? 7.136   -25.562 -49.785 1.00 41.09 ? 101 PHE A CD1 1 
ATOM   323  C  CD2 . PHE A 1 37  ? 8.255   -23.462 -50.049 1.00 43.48 ? 101 PHE A CD2 1 
ATOM   324  C  CE1 . PHE A 1 37  ? 8.352   -26.185 -49.538 1.00 42.43 ? 101 PHE A CE1 1 
ATOM   325  C  CE2 . PHE A 1 37  ? 9.499   -24.073 -49.806 1.00 42.64 ? 101 PHE A CE2 1 
ATOM   326  C  CZ  . PHE A 1 37  ? 9.549   -25.432 -49.545 1.00 42.76 ? 101 PHE A CZ  1 
ATOM   327  N  N   . TRP A 1 38  ? 6.492   -22.944 -47.123 1.00 45.36 ? 102 TRP A N   1 
ATOM   328  C  CA  . TRP A 1 38  ? 7.516   -22.334 -46.259 1.00 45.56 ? 102 TRP A CA  1 
ATOM   329  C  C   . TRP A 1 38  ? 8.496   -23.388 -45.757 1.00 45.65 ? 102 TRP A C   1 
ATOM   330  O  O   . TRP A 1 38  ? 8.248   -24.591 -45.871 1.00 44.99 ? 102 TRP A O   1 
ATOM   331  C  CB  . TRP A 1 38  ? 6.875   -21.637 -45.063 1.00 45.35 ? 102 TRP A CB  1 
ATOM   332  C  CG  . TRP A 1 38  ? 5.952   -22.523 -44.268 1.00 45.86 ? 102 TRP A CG  1 
ATOM   333  C  CD1 . TRP A 1 38  ? 4.694   -22.921 -44.622 1.00 45.44 ? 102 TRP A CD1 1 
ATOM   334  C  CD2 . TRP A 1 38  ? 6.208   -23.108 -42.979 1.00 45.73 ? 102 TRP A CD2 1 
ATOM   335  N  NE1 . TRP A 1 38  ? 4.156   -23.715 -43.641 1.00 46.08 ? 102 TRP A NE1 1 
ATOM   336  C  CE2 . TRP A 1 38  ? 5.056   -23.840 -42.618 1.00 45.56 ? 102 TRP A CE2 1 
ATOM   337  C  CE3 . TRP A 1 38  ? 7.291   -23.075 -42.092 1.00 44.88 ? 102 TRP A CE3 1 
ATOM   338  C  CZ2 . TRP A 1 38  ? 4.961   -24.545 -41.415 1.00 46.92 ? 102 TRP A CZ2 1 
ATOM   339  C  CZ3 . TRP A 1 38  ? 7.198   -23.770 -40.892 1.00 44.42 ? 102 TRP A CZ3 1 
ATOM   340  C  CH2 . TRP A 1 38  ? 6.042   -24.496 -40.563 1.00 46.13 ? 102 TRP A CH2 1 
ATOM   341  N  N   . THR A 1 39  ? 9.613   -22.934 -45.205 1.00 46.24 ? 103 THR A N   1 
ATOM   342  C  CA  . THR A 1 39  ? 10.556  -23.849 -44.584 1.00 47.36 ? 103 THR A CA  1 
ATOM   343  C  C   . THR A 1 39  ? 10.738  -23.521 -43.103 1.00 48.22 ? 103 THR A C   1 
ATOM   344  O  O   . THR A 1 39  ? 10.420  -22.423 -42.649 1.00 48.32 ? 103 THR A O   1 
ATOM   345  C  CB  . THR A 1 39  ? 11.917  -23.867 -45.304 1.00 47.35 ? 103 THR A CB  1 
ATOM   346  O  OG1 . THR A 1 39  ? 12.508  -22.566 -45.233 1.00 48.86 ? 103 THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 39  ? 11.772  -24.276 -46.777 1.00 46.40 ? 103 THR A CG2 1 
ATOM   348  N  N   . ALA A 1 40  ? 11.237  -24.496 -42.357 1.00 49.64 ? 104 ALA A N   1 
ATOM   349  C  CA  . ALA A 1 40  ? 11.536  -24.340 -40.947 1.00 50.91 ? 104 ALA A CA  1 
ATOM   350  C  C   . ALA A 1 40  ? 12.589  -23.255 -40.744 1.00 52.07 ? 104 ALA A C   1 
ATOM   351  O  O   . ALA A 1 40  ? 12.509  -22.466 -39.797 1.00 52.91 ? 104 ALA A O   1 
ATOM   352  C  CB  . ALA A 1 40  ? 12.021  -25.652 -40.385 1.00 50.51 ? 104 ALA A CB  1 
ATOM   353  N  N   . GLU A 1 41  ? 13.568  -23.205 -41.641 1.00 52.90 ? 105 GLU A N   1 
ATOM   354  C  CA  . GLU A 1 41  ? 14.631  -22.221 -41.536 1.00 53.63 ? 105 GLU A CA  1 
ATOM   355  C  C   . GLU A 1 41  ? 14.095  -20.803 -41.533 1.00 53.78 ? 105 GLU A C   1 
ATOM   356  O  O   . GLU A 1 41  ? 14.709  -19.917 -40.955 1.00 54.66 ? 105 GLU A O   1 
ATOM   357  C  CB  . GLU A 1 41  ? 15.645  -22.386 -42.671 1.00 53.95 ? 105 GLU A CB  1 
ATOM   358  C  CG  . GLU A 1 41  ? 16.568  -23.582 -42.496 1.00 54.16 ? 105 GLU A CG  1 
ATOM   359  C  CD  . GLU A 1 41  ? 15.941  -24.877 -42.965 1.00 55.30 ? 105 GLU A CD  1 
ATOM   360  O  OE1 . GLU A 1 41  ? 14.744  -24.886 -43.349 1.00 56.51 ? 105 GLU A OE1 1 
ATOM   361  O  OE2 . GLU A 1 41  ? 16.658  -25.892 -42.961 1.00 55.27 ? 105 GLU A OE2 1 
ATOM   362  N  N   . ALA A 1 42  ? 12.960  -20.574 -42.179 1.00 53.69 ? 106 ALA A N   1 
ATOM   363  C  CA  . ALA A 1 42  ? 12.423  -19.216 -42.253 1.00 53.82 ? 106 ALA A CA  1 
ATOM   364  C  C   . ALA A 1 42  ? 12.018  -18.667 -40.882 1.00 53.79 ? 106 ALA A C   1 
ATOM   365  O  O   . ALA A 1 42  ? 11.964  -17.462 -40.700 1.00 54.40 ? 106 ALA A O   1 
ATOM   366  C  CB  . ALA A 1 42  ? 11.255  -19.138 -43.223 1.00 53.59 ? 106 ALA A CB  1 
ATOM   367  N  N   . VAL A 1 43  ? 11.724  -19.543 -39.926 1.00 53.43 ? 107 VAL A N   1 
ATOM   368  C  CA  . VAL A 1 43  ? 11.255  -19.101 -38.606 1.00 53.10 ? 107 VAL A CA  1 
ATOM   369  C  C   . VAL A 1 43  ? 12.428  -18.708 -37.700 1.00 53.51 ? 107 VAL A C   1 
ATOM   370  O  O   . VAL A 1 43  ? 13.378  -19.482 -37.513 1.00 53.33 ? 107 VAL A O   1 
ATOM   371  C  CB  . VAL A 1 43  ? 10.372  -20.175 -37.919 1.00 52.80 ? 107 VAL A CB  1 
ATOM   372  C  CG1 . VAL A 1 43  ? 9.845   -19.667 -36.589 1.00 51.58 ? 107 VAL A CG1 1 
ATOM   373  C  CG2 . VAL A 1 43  ? 9.224   -20.574 -38.831 1.00 51.32 ? 107 VAL A CG2 1 
ATOM   374  N  N   . ASP A 1 44  ? 12.354  -17.500 -37.152 1.00 54.02 ? 108 ASP A N   1 
ATOM   375  C  CA  . ASP A 1 44  ? 13.398  -16.984 -36.261 1.00 54.72 ? 108 ASP A CA  1 
ATOM   376  C  C   . ASP A 1 44  ? 13.144  -17.397 -34.814 1.00 54.63 ? 108 ASP A C   1 
ATOM   377  O  O   . ASP A 1 44  ? 12.124  -17.033 -34.224 1.00 54.30 ? 108 ASP A O   1 
ATOM   378  C  CB  . ASP A 1 44  ? 13.476  -15.453 -36.377 1.00 55.16 ? 108 ASP A CB  1 
ATOM   379  C  CG  . ASP A 1 44  ? 14.618  -14.847 -35.561 1.00 55.93 ? 108 ASP A CG  1 
ATOM   380  O  OD1 . ASP A 1 44  ? 15.516  -15.595 -35.092 1.00 56.07 ? 108 ASP A OD1 1 
ATOM   381  O  OD2 . ASP A 1 44  ? 14.606  -13.601 -35.408 1.00 56.69 ? 108 ASP A OD2 1 
ATOM   382  N  N   . LEU A 1 45  ? 14.072  -18.156 -34.245 1.00 55.04 ? 109 LEU A N   1 
ATOM   383  C  CA  . LEU A 1 45  ? 13.906  -18.632 -32.876 1.00 55.79 ? 109 LEU A CA  1 
ATOM   384  C  C   . LEU A 1 45  ? 14.822  -17.914 -31.891 1.00 56.75 ? 109 LEU A C   1 
ATOM   385  O  O   . LEU A 1 45  ? 14.683  -18.075 -30.683 1.00 57.13 ? 109 LEU A O   1 
ATOM   386  C  CB  . LEU A 1 45  ? 14.120  -20.140 -32.796 1.00 55.48 ? 109 LEU A CB  1 
ATOM   387  C  CG  . LEU A 1 45  ? 13.253  -21.076 -33.650 1.00 55.31 ? 109 LEU A CG  1 
ATOM   388  C  CD1 . LEU A 1 45  ? 13.695  -22.525 -33.424 1.00 54.39 ? 109 LEU A CD1 1 
ATOM   389  C  CD2 . LEU A 1 45  ? 11.755  -20.909 -33.361 1.00 53.88 ? 109 LEU A CD2 1 
ATOM   390  N  N   . SER A 1 46  ? 15.748  -17.111 -32.416 1.00 57.76 ? 110 SER A N   1 
ATOM   391  C  CA  . SER A 1 46  ? 16.737  -16.379 -31.618 1.00 58.32 ? 110 SER A CA  1 
ATOM   392  C  C   . SER A 1 46  ? 16.145  -15.647 -30.390 1.00 58.36 ? 110 SER A C   1 
ATOM   393  O  O   . SER A 1 46  ? 16.737  -15.669 -29.311 1.00 58.67 ? 110 SER A O   1 
ATOM   394  C  CB  . SER A 1 46  ? 17.476  -15.380 -32.520 1.00 58.73 ? 110 SER A CB  1 
ATOM   395  O  OG  . SER A 1 46  ? 16.595  -14.342 -32.943 1.00 59.83 ? 110 SER A OG  1 
ATOM   396  N  N   . LYS A 1 47  ? 14.977  -15.022 -30.557 1.00 58.00 ? 111 LYS A N   1 
ATOM   397  C  CA  . LYS A 1 47  ? 14.360  -14.222 -29.497 1.00 57.62 ? 111 LYS A CA  1 
ATOM   398  C  C   . LYS A 1 47  ? 13.529  -15.028 -28.502 1.00 56.87 ? 111 LYS A C   1 
ATOM   399  O  O   . LYS A 1 47  ? 12.785  -14.446 -27.712 1.00 56.85 ? 111 LYS A O   1 
ATOM   400  C  CB  . LYS A 1 47  ? 13.473  -13.116 -30.091 1.00 57.94 ? 111 LYS A CB  1 
ATOM   401  C  CG  . LYS A 1 47  ? 14.184  -12.096 -30.992 1.00 60.80 ? 111 LYS A CG  1 
ATOM   402  C  CD  . LYS A 1 47  ? 13.228  -10.947 -31.353 1.00 65.63 ? 111 LYS A CD  1 
ATOM   403  C  CE  . LYS A 1 47  ? 13.405  -10.460 -32.813 1.00 67.42 ? 111 LYS A CE  1 
ATOM   404  N  NZ  . LYS A 1 47  ? 14.516  -9.463  -32.975 1.00 67.43 ? 111 LYS A NZ  1 
ATOM   405  N  N   . ASP A 1 48  ? 13.652  -16.354 -28.516 1.00 56.11 ? 112 ASP A N   1 
ATOM   406  C  CA  . ASP A 1 48  ? 12.719  -17.203 -27.753 1.00 55.46 ? 112 ASP A CA  1 
ATOM   407  C  C   . ASP A 1 48  ? 13.185  -17.661 -26.381 1.00 54.95 ? 112 ASP A C   1 
ATOM   408  O  O   . ASP A 1 48  ? 12.368  -17.815 -25.482 1.00 54.70 ? 112 ASP A O   1 
ATOM   409  C  CB  . ASP A 1 48  ? 12.294  -18.430 -28.569 1.00 55.49 ? 112 ASP A CB  1 
ATOM   410  C  CG  . ASP A 1 48  ? 11.078  -18.166 -29.436 1.00 55.38 ? 112 ASP A CG  1 
ATOM   411  O  OD1 . ASP A 1 48  ? 10.693  -16.993 -29.618 1.00 55.51 ? 112 ASP A OD1 1 
ATOM   412  O  OD2 . ASP A 1 48  ? 10.501  -19.147 -29.943 1.00 56.11 ? 112 ASP A OD2 1 
ATOM   413  N  N   . ILE A 1 49  ? 14.490  -17.875 -26.240 1.00 54.68 ? 113 ILE A N   1 
ATOM   414  C  CA  . ILE A 1 49  ? 15.081  -18.550 -25.083 1.00 54.56 ? 113 ILE A CA  1 
ATOM   415  C  C   . ILE A 1 49  ? 14.915  -17.802 -23.753 1.00 54.43 ? 113 ILE A C   1 
ATOM   416  O  O   . ILE A 1 49  ? 14.623  -18.402 -22.717 1.00 54.04 ? 113 ILE A O   1 
ATOM   417  C  CB  . ILE A 1 49  ? 16.554  -18.908 -25.364 1.00 54.68 ? 113 ILE A CB  1 
ATOM   418  C  CG1 . ILE A 1 49  ? 16.632  -19.898 -26.533 1.00 55.89 ? 113 ILE A CG1 1 
ATOM   419  C  CG2 . ILE A 1 49  ? 17.230  -19.507 -24.150 1.00 54.50 ? 113 ILE A CG2 1 
ATOM   420  C  CD1 . ILE A 1 49  ? 16.753  -19.222 -27.922 1.00 57.64 ? 113 ILE A CD1 1 
ATOM   421  N  N   . GLN A 1 50  ? 15.060  -16.485 -23.784 1.00 54.64 ? 114 GLN A N   1 
ATOM   422  C  CA  . GLN A 1 50  ? 14.878  -15.712 -22.563 1.00 54.70 ? 114 GLN A CA  1 
ATOM   423  C  C   . GLN A 1 50  ? 13.458  -15.838 -21.984 1.00 54.28 ? 114 GLN A C   1 
ATOM   424  O  O   . GLN A 1 50  ? 13.288  -15.895 -20.762 1.00 54.20 ? 114 GLN A O   1 
ATOM   425  C  CB  . GLN A 1 50  ? 15.276  -14.251 -22.763 1.00 54.62 ? 114 GLN A CB  1 
ATOM   426  C  CG  . GLN A 1 50  ? 15.366  -13.496 -21.455 1.00 55.96 ? 114 GLN A CG  1 
ATOM   427  C  CD  . GLN A 1 50  ? 15.899  -12.087 -21.608 1.00 58.77 ? 114 GLN A CD  1 
ATOM   428  O  OE1 . GLN A 1 50  ? 16.043  -11.566 -22.734 1.00 58.74 ? 114 GLN A OE1 1 
ATOM   429  N  NE2 . GLN A 1 50  ? 16.199  -11.454 -20.469 1.00 57.98 ? 114 GLN A NE2 1 
ATOM   430  N  N   . HIS A 1 51  ? 12.452  -15.889 -22.853 1.00 53.81 ? 115 HIS A N   1 
ATOM   431  C  CA  . HIS A 1 51  ? 11.087  -16.125 -22.400 1.00 53.66 ? 115 HIS A CA  1 
ATOM   432  C  C   . HIS A 1 51  ? 10.942  -17.538 -21.849 1.00 53.12 ? 115 HIS A C   1 
ATOM   433  O  O   . HIS A 1 51  ? 10.325  -17.751 -20.800 1.00 52.72 ? 115 HIS A O   1 
ATOM   434  C  CB  . HIS A 1 51  ? 10.091  -15.909 -23.529 1.00 54.07 ? 115 HIS A CB  1 
ATOM   435  C  CG  . HIS A 1 51  ? 10.046  -14.504 -24.034 1.00 56.20 ? 115 HIS A CG  1 
ATOM   436  N  ND1 . HIS A 1 51  ? 9.697   -14.192 -25.329 1.00 57.93 ? 115 HIS A ND1 1 
ATOM   437  C  CD2 . HIS A 1 51  ? 10.324  -13.327 -23.425 1.00 58.45 ? 115 HIS A CD2 1 
ATOM   438  C  CE1 . HIS A 1 51  ? 9.755   -12.883 -25.496 1.00 58.49 ? 115 HIS A CE1 1 
ATOM   439  N  NE2 . HIS A 1 51  ? 10.134  -12.335 -24.356 1.00 59.50 ? 115 HIS A NE2 1 
ATOM   440  N  N   . TRP A 1 52  ? 11.531  -18.489 -22.569 1.00 52.31 ? 116 TRP A N   1 
ATOM   441  C  CA  . TRP A 1 52  ? 11.535  -19.880 -22.194 1.00 51.76 ? 116 TRP A CA  1 
ATOM   442  C  C   . TRP A 1 52  ? 12.021  -20.027 -20.779 1.00 52.50 ? 116 TRP A C   1 
ATOM   443  O  O   . TRP A 1 52  ? 11.415  -20.735 -19.984 1.00 52.86 ? 116 TRP A O   1 
ATOM   444  C  CB  . TRP A 1 52  ? 12.458  -20.636 -23.125 1.00 51.04 ? 116 TRP A CB  1 
ATOM   445  C  CG  . TRP A 1 52  ? 12.564  -22.101 -22.883 1.00 49.59 ? 116 TRP A CG  1 
ATOM   446  C  CD1 . TRP A 1 52  ? 13.693  -22.791 -22.548 1.00 48.70 ? 116 TRP A CD1 1 
ATOM   447  C  CD2 . TRP A 1 52  ? 11.518  -23.077 -23.003 1.00 47.49 ? 116 TRP A CD2 1 
ATOM   448  N  NE1 . TRP A 1 52  ? 13.418  -24.136 -22.449 1.00 47.55 ? 116 TRP A NE1 1 
ATOM   449  C  CE2 . TRP A 1 52  ? 12.090  -24.338 -22.727 1.00 47.80 ? 116 TRP A CE2 1 
ATOM   450  C  CE3 . TRP A 1 52  ? 10.160  -23.010 -23.317 1.00 46.22 ? 116 TRP A CE3 1 
ATOM   451  C  CZ2 . TRP A 1 52  ? 11.340  -25.525 -22.745 1.00 47.02 ? 116 TRP A CZ2 1 
ATOM   452  C  CZ3 . TRP A 1 52  ? 9.417   -24.197 -23.342 1.00 46.44 ? 116 TRP A CZ3 1 
ATOM   453  C  CH2 . TRP A 1 52  ? 10.011  -25.430 -23.058 1.00 46.00 ? 116 TRP A CH2 1 
ATOM   454  N  N   . GLU A 1 53  ? 13.114  -19.342 -20.455 1.00 53.20 ? 117 GLU A N   1 
ATOM   455  C  CA  . GLU A 1 53  ? 13.730  -19.468 -19.139 1.00 53.42 ? 117 GLU A CA  1 
ATOM   456  C  C   . GLU A 1 53  ? 12.923  -18.802 -18.019 1.00 53.87 ? 117 GLU A C   1 
ATOM   457  O  O   . GLU A 1 53  ? 13.059  -19.176 -16.862 1.00 53.72 ? 117 GLU A O   1 
ATOM   458  C  CB  . GLU A 1 53  ? 15.170  -18.978 -19.180 1.00 53.02 ? 117 GLU A CB  1 
ATOM   459  C  CG  . GLU A 1 53  ? 16.076  -19.943 -19.905 1.00 52.89 ? 117 GLU A CG  1 
ATOM   460  C  CD  . GLU A 1 53  ? 17.450  -19.368 -20.210 1.00 53.89 ? 117 GLU A CD  1 
ATOM   461  O  OE1 . GLU A 1 53  ? 17.737  -18.226 -19.779 1.00 54.21 ? 117 GLU A OE1 1 
ATOM   462  O  OE2 . GLU A 1 53  ? 18.241  -20.064 -20.892 1.00 53.42 ? 117 GLU A OE2 1 
ATOM   463  N  N   . SER A 1 54  ? 12.061  -17.855 -18.386 1.00 54.59 ? 118 SER A N   1 
ATOM   464  C  CA  . SER A 1 54  ? 11.204  -17.146 -17.438 1.00 55.68 ? 118 SER A CA  1 
ATOM   465  C  C   . SER A 1 54  ? 9.992   -17.954 -16.984 1.00 56.01 ? 118 SER A C   1 
ATOM   466  O  O   . SER A 1 54  ? 9.378   -17.629 -15.972 1.00 56.68 ? 118 SER A O   1 
ATOM   467  C  CB  . SER A 1 54  ? 10.706  -15.828 -18.042 1.00 55.91 ? 118 SER A CB  1 
ATOM   468  O  OG  . SER A 1 54  ? 9.453   -16.004 -18.715 1.00 57.92 ? 118 SER A OG  1 
ATOM   469  N  N   . LEU A 1 55  ? 9.625   -18.979 -17.747 1.00 56.39 ? 119 LEU A N   1 
ATOM   470  C  CA  . LEU A 1 55  ? 8.440   -19.779 -17.450 1.00 56.33 ? 119 LEU A CA  1 
ATOM   471  C  C   . LEU A 1 55  ? 8.623   -20.591 -16.178 1.00 56.47 ? 119 LEU A C   1 
ATOM   472  O  O   . LEU A 1 55  ? 9.744   -20.869 -15.766 1.00 56.46 ? 119 LEU A O   1 
ATOM   473  C  CB  . LEU A 1 55  ? 8.120   -20.726 -18.617 1.00 56.17 ? 119 LEU A CB  1 
ATOM   474  C  CG  . LEU A 1 55  ? 7.792   -20.174 -20.016 1.00 56.00 ? 119 LEU A CG  1 
ATOM   475  C  CD1 . LEU A 1 55  ? 7.673   -21.322 -21.007 1.00 55.80 ? 119 LEU A CD1 1 
ATOM   476  C  CD2 . LEU A 1 55  ? 6.529   -19.331 -20.041 1.00 54.50 ? 119 LEU A CD2 1 
ATOM   477  N  N   . LYS A 1 56  ? 7.511   -20.974 -15.563 1.00 56.92 ? 120 LYS A N   1 
ATOM   478  C  CA  . LYS A 1 56  ? 7.525   -21.929 -14.461 1.00 57.35 ? 120 LYS A CA  1 
ATOM   479  C  C   . LYS A 1 56  ? 7.915   -23.319 -14.997 1.00 57.00 ? 120 LYS A C   1 
ATOM   480  O  O   . LYS A 1 56  ? 7.588   -23.669 -16.131 1.00 56.77 ? 120 LYS A O   1 
ATOM   481  C  CB  . LYS A 1 56  ? 6.148   -21.967 -13.786 1.00 57.94 ? 120 LYS A CB  1 
ATOM   482  C  CG  . LYS A 1 56  ? 5.642   -20.617 -13.277 1.00 60.01 ? 120 LYS A CG  1 
ATOM   483  C  CD  . LYS A 1 56  ? 4.103   -20.523 -13.336 1.00 64.72 ? 120 LYS A CD  1 
ATOM   484  C  CE  . LYS A 1 56  ? 3.428   -20.884 -12.002 1.00 67.21 ? 120 LYS A CE  1 
ATOM   485  N  NZ  . LYS A 1 56  ? 3.532   -19.760 -11.000 1.00 68.15 ? 120 LYS A NZ  1 
ATOM   486  N  N   . PRO A 1 57  ? 8.625   -24.121 -14.193 1.00 57.16 ? 121 PRO A N   1 
ATOM   487  C  CA  . PRO A 1 57  ? 9.058   -25.423 -14.752 1.00 57.04 ? 121 PRO A CA  1 
ATOM   488  C  C   . PRO A 1 57  ? 7.931   -26.261 -15.369 1.00 56.88 ? 121 PRO A C   1 
ATOM   489  O  O   . PRO A 1 57  ? 8.169   -26.983 -16.342 1.00 57.05 ? 121 PRO A O   1 
ATOM   490  C  CB  . PRO A 1 57  ? 9.690   -26.154 -13.557 1.00 56.94 ? 121 PRO A CB  1 
ATOM   491  C  CG  . PRO A 1 57  ? 9.539   -25.220 -12.352 1.00 57.06 ? 121 PRO A CG  1 
ATOM   492  C  CD  . PRO A 1 57  ? 9.190   -23.856 -12.855 1.00 56.99 ? 121 PRO A CD  1 
ATOM   493  N  N   . GLU A 1 58  ? 6.715   -26.164 -14.833 1.00 56.71 ? 122 GLU A N   1 
ATOM   494  C  CA  . GLU A 1 58  ? 5.606   -26.974 -15.358 1.00 56.52 ? 122 GLU A CA  1 
ATOM   495  C  C   . GLU A 1 58  ? 4.989   -26.367 -16.631 1.00 55.52 ? 122 GLU A C   1 
ATOM   496  O  O   . GLU A 1 58  ? 4.194   -27.000 -17.328 1.00 55.24 ? 122 GLU A O   1 
ATOM   497  C  CB  . GLU A 1 58  ? 4.557   -27.286 -14.275 1.00 56.80 ? 122 GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 58  ? 3.406   -26.296 -14.168 1.00 60.82 ? 122 GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 58  ? 3.542   -25.297 -13.023 1.00 66.92 ? 122 GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 58  ? 4.599   -25.314 -12.315 1.00 68.22 ? 122 GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 58  ? 2.574   -24.495 -12.847 1.00 68.15 ? 122 GLU A OE2 1 
ATOM   502  N  N   . GLU A 1 59  ? 5.379   -25.137 -16.937 1.00 54.57 ? 123 GLU A N   1 
ATOM   503  C  CA  . GLU A 1 59  ? 5.023   -24.530 -18.205 1.00 53.22 ? 123 GLU A CA  1 
ATOM   504  C  C   . GLU A 1 59  ? 5.909   -25.084 -19.301 1.00 52.03 ? 123 GLU A C   1 
ATOM   505  O  O   . GLU A 1 59  ? 5.438   -25.330 -20.396 1.00 52.27 ? 123 GLU A O   1 
ATOM   506  C  CB  . GLU A 1 59  ? 5.108   -23.014 -18.120 1.00 53.55 ? 123 GLU A CB  1 
ATOM   507  C  CG  . GLU A 1 59  ? 4.068   -22.433 -17.182 1.00 54.56 ? 123 GLU A CG  1 
ATOM   508  C  CD  . GLU A 1 59  ? 4.056   -20.925 -17.169 1.00 57.35 ? 123 GLU A CD  1 
ATOM   509  O  OE1 . GLU A 1 59  ? 5.095   -20.317 -16.813 1.00 56.80 ? 123 GLU A OE1 1 
ATOM   510  O  OE2 . GLU A 1 59  ? 2.989   -20.353 -17.499 1.00 58.92 ? 123 GLU A OE2 1 
ATOM   511  N  N   . ARG A 1 60  ? 7.184   -25.307 -18.997 1.00 50.73 ? 124 ARG A N   1 
ATOM   512  C  CA  . ARG A 1 60  ? 8.113   -25.902 -19.958 1.00 49.27 ? 124 ARG A CA  1 
ATOM   513  C  C   . ARG A 1 60  ? 7.784   -27.354 -20.231 1.00 48.79 ? 124 ARG A C   1 
ATOM   514  O  O   . ARG A 1 60  ? 7.929   -27.827 -21.359 1.00 48.79 ? 124 ARG A O   1 
ATOM   515  C  CB  . ARG A 1 60  ? 9.567   -25.751 -19.503 1.00 49.20 ? 124 ARG A CB  1 
ATOM   516  C  CG  . ARG A 1 60  ? 10.125  -24.315 -19.657 1.00 47.21 ? 124 ARG A CG  1 
ATOM   517  C  CD  . ARG A 1 60  ? 11.633  -24.218 -19.349 1.00 45.10 ? 124 ARG A CD  1 
ATOM   518  N  NE  . ARG A 1 60  ? 11.934  -24.378 -17.930 1.00 43.96 ? 124 ARG A NE  1 
ATOM   519  C  CZ  . ARG A 1 60  ? 11.780  -23.428 -17.008 1.00 44.33 ? 124 ARG A CZ  1 
ATOM   520  N  NH1 . ARG A 1 60  ? 11.331  -22.222 -17.334 1.00 44.34 ? 124 ARG A NH1 1 
ATOM   521  N  NH2 . ARG A 1 60  ? 12.070  -23.687 -15.746 1.00 44.38 ? 124 ARG A NH2 1 
ATOM   522  N  N   . TYR A 1 61  ? 7.332   -28.052 -19.196 1.00 48.34 ? 125 TYR A N   1 
ATOM   523  C  CA  . TYR A 1 61  ? 6.890   -29.444 -19.305 1.00 47.73 ? 125 TYR A CA  1 
ATOM   524  C  C   . TYR A 1 61  ? 5.735   -29.545 -20.298 1.00 47.74 ? 125 TYR A C   1 
ATOM   525  O  O   . TYR A 1 61  ? 5.774   -30.341 -21.245 1.00 47.56 ? 125 TYR A O   1 
ATOM   526  C  CB  . TYR A 1 61  ? 6.461   -29.952 -17.922 1.00 47.64 ? 125 TYR A CB  1 
ATOM   527  C  CG  . TYR A 1 61  ? 5.794   -31.310 -17.906 1.00 46.39 ? 125 TYR A CG  1 
ATOM   528  C  CD1 . TYR A 1 61  ? 6.554   -32.477 -17.882 1.00 46.09 ? 125 TYR A CD1 1 
ATOM   529  C  CD2 . TYR A 1 61  ? 4.399   -31.427 -17.886 1.00 44.84 ? 125 TYR A CD2 1 
ATOM   530  C  CE1 . TYR A 1 61  ? 5.939   -33.740 -17.858 1.00 47.31 ? 125 TYR A CE1 1 
ATOM   531  C  CE2 . TYR A 1 61  ? 3.766   -32.686 -17.861 1.00 44.63 ? 125 TYR A CE2 1 
ATOM   532  C  CZ  . TYR A 1 61  ? 4.545   -33.832 -17.850 1.00 47.59 ? 125 TYR A CZ  1 
ATOM   533  O  OH  . TYR A 1 61  ? 3.953   -35.082 -17.832 1.00 50.39 ? 125 TYR A OH  1 
ATOM   534  N  N   . PHE A 1 62  ? 4.722   -28.711 -20.072 1.00 47.37 ? 126 PHE A N   1 
ATOM   535  C  CA  . PHE A 1 62  ? 3.561   -28.647 -20.921 1.00 47.11 ? 126 PHE A CA  1 
ATOM   536  C  C   . PHE A 1 62  ? 3.900   -28.391 -22.392 1.00 47.27 ? 126 PHE A C   1 
ATOM   537  O  O   . PHE A 1 62  ? 3.392   -29.081 -23.293 1.00 47.26 ? 126 PHE A O   1 
ATOM   538  C  CB  . PHE A 1 62  ? 2.617   -27.555 -20.447 1.00 46.87 ? 126 PHE A CB  1 
ATOM   539  C  CG  . PHE A 1 62  ? 1.404   -27.424 -21.309 1.00 48.12 ? 126 PHE A CG  1 
ATOM   540  C  CD1 . PHE A 1 62  ? 0.310   -28.278 -21.119 1.00 48.57 ? 126 PHE A CD1 1 
ATOM   541  C  CD2 . PHE A 1 62  ? 1.372   -26.504 -22.352 1.00 47.02 ? 126 PHE A CD2 1 
ATOM   542  C  CE1 . PHE A 1 62  ? -0.803  -28.193 -21.928 1.00 48.13 ? 126 PHE A CE1 1 
ATOM   543  C  CE2 . PHE A 1 62  ? 0.262   -26.405 -23.165 1.00 47.90 ? 126 PHE A CE2 1 
ATOM   544  C  CZ  . PHE A 1 62  ? -0.834  -27.249 -22.958 1.00 48.81 ? 126 PHE A CZ  1 
ATOM   545  N  N   . ILE A 1 63  ? 4.734   -27.382 -22.636 1.00 47.24 ? 127 ILE A N   1 
ATOM   546  C  CA  . ILE A 1 63  ? 5.020   -26.952 -23.999 1.00 46.94 ? 127 ILE A CA  1 
ATOM   547  C  C   . ILE A 1 63  ? 5.800   -28.022 -24.729 1.00 47.31 ? 127 ILE A C   1 
ATOM   548  O  O   . ILE A 1 63  ? 5.411   -28.430 -25.805 1.00 47.59 ? 127 ILE A O   1 
ATOM   549  C  CB  . ILE A 1 63  ? 5.739   -25.605 -24.038 1.00 46.88 ? 127 ILE A CB  1 
ATOM   550  C  CG1 . ILE A 1 63  ? 4.840   -24.524 -23.419 1.00 46.51 ? 127 ILE A CG1 1 
ATOM   551  C  CG2 . ILE A 1 63  ? 6.100   -25.249 -25.468 1.00 46.21 ? 127 ILE A CG2 1 
ATOM   552  C  CD1 . ILE A 1 63  ? 5.478   -23.160 -23.319 1.00 46.96 ? 127 ILE A CD1 1 
ATOM   553  N  N   . SER A 1 64  ? 6.868   -28.514 -24.113 1.00 47.81 ? 128 SER A N   1 
ATOM   554  C  CA  . SER A 1 64  ? 7.703   -29.532 -24.730 1.00 48.07 ? 128 SER A CA  1 
ATOM   555  C  C   . SER A 1 64  ? 6.906   -30.790 -24.935 1.00 47.99 ? 128 SER A C   1 
ATOM   556  O  O   . SER A 1 64  ? 7.179   -31.562 -25.850 1.00 48.57 ? 128 SER A O   1 
ATOM   557  C  CB  . SER A 1 64  ? 8.931   -29.837 -23.874 1.00 48.33 ? 128 SER A CB  1 
ATOM   558  O  OG  . SER A 1 64  ? 8.550   -30.275 -22.587 1.00 49.84 ? 128 SER A OG  1 
ATOM   559  N  N   . HIS A 1 65  ? 5.903   -30.996 -24.094 1.00 47.75 ? 129 HIS A N   1 
ATOM   560  C  CA  . HIS A 1 65  ? 5.035   -32.136 -24.285 1.00 47.24 ? 129 HIS A CA  1 
ATOM   561  C  C   . HIS A 1 65  ? 4.034   -31.914 -25.433 1.00 46.77 ? 129 HIS A C   1 
ATOM   562  O  O   . HIS A 1 65  ? 3.729   -32.844 -26.178 1.00 46.82 ? 129 HIS A O   1 
ATOM   563  C  CB  . HIS A 1 65  ? 4.422   -32.570 -22.950 1.00 47.54 ? 129 HIS A CB  1 
ATOM   564  C  CG  . HIS A 1 65  ? 5.348   -33.422 -22.128 1.00 49.36 ? 129 HIS A CG  1 
ATOM   565  N  ND1 . HIS A 1 65  ? 6.612   -33.003 -21.749 1.00 50.73 ? 129 HIS A ND1 1 
ATOM   566  C  CD2 . HIS A 1 65  ? 5.212   -34.682 -21.648 1.00 50.10 ? 129 HIS A CD2 1 
ATOM   567  C  CE1 . HIS A 1 65  ? 7.206   -33.967 -21.065 1.00 51.22 ? 129 HIS A CE1 1 
ATOM   568  N  NE2 . HIS A 1 65  ? 6.380   -34.997 -20.992 1.00 51.56 ? 129 HIS A NE2 1 
ATOM   569  N  N   . VAL A 1 66  ? 3.572   -30.680 -25.621 1.00 46.07 ? 130 VAL A N   1 
ATOM   570  C  CA  . VAL A 1 66  ? 2.756   -30.365 -26.791 1.00 45.58 ? 130 VAL A CA  1 
ATOM   571  C  C   . VAL A 1 66  ? 3.602   -30.511 -28.052 1.00 45.79 ? 130 VAL A C   1 
ATOM   572  O  O   . VAL A 1 66  ? 3.161   -31.086 -29.043 1.00 46.20 ? 130 VAL A O   1 
ATOM   573  C  CB  . VAL A 1 66  ? 2.128   -28.958 -26.708 1.00 45.46 ? 130 VAL A CB  1 
ATOM   574  C  CG1 . VAL A 1 66  ? 1.741   -28.446 -28.083 1.00 44.44 ? 130 VAL A CG1 1 
ATOM   575  C  CG2 . VAL A 1 66  ? 0.909   -28.993 -25.817 1.00 44.94 ? 130 VAL A CG2 1 
ATOM   576  N  N   . LEU A 1 67  ? 4.829   -30.010 -28.008 1.00 45.49 ? 131 LEU A N   1 
ATOM   577  C  CA  . LEU A 1 67  ? 5.745   -30.197 -29.127 1.00 45.02 ? 131 LEU A CA  1 
ATOM   578  C  C   . LEU A 1 67  ? 5.947   -31.678 -29.458 1.00 44.87 ? 131 LEU A C   1 
ATOM   579  O  O   . LEU A 1 67  ? 5.855   -32.063 -30.612 1.00 44.78 ? 131 LEU A O   1 
ATOM   580  C  CB  . LEU A 1 67  ? 7.084   -29.494 -28.883 1.00 44.55 ? 131 LEU A CB  1 
ATOM   581  C  CG  . LEU A 1 67  ? 7.017   -27.972 -28.778 1.00 43.39 ? 131 LEU A CG  1 
ATOM   582  C  CD1 . LEU A 1 67  ? 8.330   -27.416 -28.287 1.00 43.14 ? 131 LEU A CD1 1 
ATOM   583  C  CD2 . LEU A 1 67  ? 6.668   -27.368 -30.102 1.00 43.89 ? 131 LEU A CD2 1 
ATOM   584  N  N   . ALA A 1 68  ? 6.195   -32.511 -28.456 1.00 44.75 ? 132 ALA A N   1 
ATOM   585  C  CA  . ALA A 1 68  ? 6.435   -33.935 -28.732 1.00 45.16 ? 132 ALA A CA  1 
ATOM   586  C  C   . ALA A 1 68  ? 5.199   -34.626 -29.325 1.00 45.39 ? 132 ALA A C   1 
ATOM   587  O  O   . ALA A 1 68  ? 5.312   -35.415 -30.268 1.00 45.42 ? 132 ALA A O   1 
ATOM   588  C  CB  . ALA A 1 68  ? 6.948   -34.668 -27.482 1.00 44.82 ? 132 ALA A CB  1 
ATOM   589  N  N   . PHE A 1 69  ? 4.023   -34.292 -28.793 1.00 45.68 ? 133 PHE A N   1 
ATOM   590  C  CA  . PHE A 1 69  ? 2.767   -34.774 -29.340 1.00 45.90 ? 133 PHE A CA  1 
ATOM   591  C  C   . PHE A 1 69  ? 2.635   -34.437 -30.821 1.00 46.43 ? 133 PHE A C   1 
ATOM   592  O  O   . PHE A 1 69  ? 2.241   -35.297 -31.624 1.00 47.43 ? 133 PHE A O   1 
ATOM   593  C  CB  . PHE A 1 69  ? 1.580   -34.201 -28.569 1.00 45.86 ? 133 PHE A CB  1 
ATOM   594  C  CG  . PHE A 1 69  ? 0.286   -34.245 -29.334 1.00 46.06 ? 133 PHE A CG  1 
ATOM   595  C  CD1 . PHE A 1 69  ? -0.243  -35.457 -29.769 1.00 46.19 ? 133 PHE A CD1 1 
ATOM   596  C  CD2 . PHE A 1 69  ? -0.396  -33.071 -29.631 1.00 46.27 ? 133 PHE A CD2 1 
ATOM   597  C  CE1 . PHE A 1 69  ? -1.430  -35.498 -30.471 1.00 46.60 ? 133 PHE A CE1 1 
ATOM   598  C  CE2 . PHE A 1 69  ? -1.581  -33.104 -30.340 1.00 46.73 ? 133 PHE A CE2 1 
ATOM   599  C  CZ  . PHE A 1 69  ? -2.099  -34.317 -30.767 1.00 46.23 ? 133 PHE A CZ  1 
ATOM   600  N  N   . PHE A 1 70  ? 2.967   -33.199 -31.182 1.00 45.97 ? 134 PHE A N   1 
ATOM   601  C  CA  . PHE A 1 70  ? 2.865   -32.758 -32.562 1.00 45.82 ? 134 PHE A CA  1 
ATOM   602  C  C   . PHE A 1 70  ? 3.807   -33.518 -33.493 1.00 46.12 ? 134 PHE A C   1 
ATOM   603  O  O   . PHE A 1 70  ? 3.369   -34.035 -34.537 1.00 46.56 ? 134 PHE A O   1 
ATOM   604  C  CB  . PHE A 1 70  ? 3.106   -31.263 -32.672 1.00 45.61 ? 134 PHE A CB  1 
ATOM   605  C  CG  . PHE A 1 70  ? 1.879   -30.422 -32.473 1.00 45.36 ? 134 PHE A CG  1 
ATOM   606  C  CD1 . PHE A 1 70  ? 0.640   -30.834 -32.957 1.00 46.30 ? 134 PHE A CD1 1 
ATOM   607  C  CD2 . PHE A 1 70  ? 1.969   -29.184 -31.842 1.00 45.17 ? 134 PHE A CD2 1 
ATOM   608  C  CE1 . PHE A 1 70  ? -0.494  -30.037 -32.786 1.00 45.59 ? 134 PHE A CE1 1 
ATOM   609  C  CE2 . PHE A 1 70  ? 0.849   -28.373 -31.691 1.00 44.86 ? 134 PHE A CE2 1 
ATOM   610  C  CZ  . PHE A 1 70  ? -0.382  -28.801 -32.165 1.00 44.71 ? 134 PHE A CZ  1 
ATOM   611  N  N   . ALA A 1 71  ? 5.085   -33.607 -33.133 1.00 45.67 ? 135 ALA A N   1 
ATOM   612  C  CA  . ALA A 1 71  ? 6.020   -34.344 -33.979 1.00 46.08 ? 135 ALA A CA  1 
ATOM   613  C  C   . ALA A 1 71  ? 5.575   -35.806 -34.158 1.00 46.45 ? 135 ALA A C   1 
ATOM   614  O  O   . ALA A 1 71  ? 5.626   -36.333 -35.255 1.00 46.58 ? 135 ALA A O   1 
ATOM   615  C  CB  . ALA A 1 71  ? 7.447   -34.256 -33.452 1.00 45.69 ? 135 ALA A CB  1 
ATOM   616  N  N   . ALA A 1 72  ? 5.112   -36.442 -33.088 1.00 46.98 ? 136 ALA A N   1 
ATOM   617  C  CA  . ALA A 1 72  ? 4.550   -37.790 -33.179 1.00 47.74 ? 136 ALA A CA  1 
ATOM   618  C  C   . ALA A 1 72  ? 3.349   -37.881 -34.151 1.00 48.04 ? 136 ALA A C   1 
ATOM   619  O  O   . ALA A 1 72  ? 3.397   -38.640 -35.122 1.00 47.99 ? 136 ALA A O   1 
ATOM   620  C  CB  . ALA A 1 72  ? 4.165   -38.302 -31.793 1.00 47.73 ? 136 ALA A CB  1 
ATOM   621  N  N   . SER A 1 73  ? 2.298   -37.095 -33.906 1.00 48.22 ? 137 SER A N   1 
ATOM   622  C  CA  . SER A 1 73  ? 1.100   -37.109 -34.767 1.00 48.41 ? 137 SER A CA  1 
ATOM   623  C  C   . SER A 1 73  ? 1.377   -36.862 -36.251 1.00 48.32 ? 137 SER A C   1 
ATOM   624  O  O   . SER A 1 73  ? 0.859   -37.589 -37.102 1.00 48.82 ? 137 SER A O   1 
ATOM   625  C  CB  . SER A 1 73  ? 0.063   -36.118 -34.266 1.00 48.45 ? 137 SER A CB  1 
ATOM   626  O  OG  . SER A 1 73  ? -0.355  -36.477 -32.965 1.00 49.22 ? 137 SER A OG  1 
ATOM   627  N  N   . ASP A 1 74  ? 2.197   -35.857 -36.561 1.00 47.96 ? 138 ASP A N   1 
ATOM   628  C  CA  . ASP A 1 74  ? 2.611   -35.610 -37.947 1.00 47.65 ? 138 ASP A CA  1 
ATOM   629  C  C   . ASP A 1 74  ? 3.049   -36.883 -38.639 1.00 47.32 ? 138 ASP A C   1 
ATOM   630  O  O   . ASP A 1 74  ? 2.591   -37.166 -39.740 1.00 48.37 ? 138 ASP A O   1 
ATOM   631  C  CB  . ASP A 1 74  ? 3.755   -34.624 -38.027 1.00 47.70 ? 138 ASP A CB  1 
ATOM   632  C  CG  . ASP A 1 74  ? 3.325   -33.200 -37.802 1.00 49.28 ? 138 ASP A CG  1 
ATOM   633  O  OD1 . ASP A 1 74  ? 2.124   -32.910 -37.571 1.00 47.87 ? 138 ASP A OD1 1 
ATOM   634  O  OD2 . ASP A 1 74  ? 4.234   -32.347 -37.874 1.00 53.76 ? 138 ASP A OD2 1 
ATOM   635  N  N   . GLY A 1 75  ? 3.928   -37.655 -38.011 1.00 46.21 ? 139 GLY A N   1 
ATOM   636  C  CA  . GLY A 1 75  ? 4.346   -38.929 -38.592 1.00 45.50 ? 139 GLY A CA  1 
ATOM   637  C  C   . GLY A 1 75  ? 3.212   -39.898 -38.888 1.00 44.83 ? 139 GLY A C   1 
ATOM   638  O  O   . GLY A 1 75  ? 3.255   -40.609 -39.883 1.00 44.86 ? 139 GLY A O   1 
ATOM   639  N  N   . ILE A 1 76  ? 2.191   -39.925 -38.035 1.00 44.17 ? 140 ILE A N   1 
ATOM   640  C  CA  . ILE A 1 76  ? 1.045   -40.790 -38.275 1.00 43.76 ? 140 ILE A CA  1 
ATOM   641  C  C   . ILE A 1 76  ? 0.250   -40.284 -39.475 1.00 43.90 ? 140 ILE A C   1 
ATOM   642  O  O   . ILE A 1 76  ? -0.096  -41.059 -40.375 1.00 43.53 ? 140 ILE A O   1 
ATOM   643  C  CB  . ILE A 1 76  ? 0.151   -40.937 -37.032 1.00 43.63 ? 140 ILE A CB  1 
ATOM   644  C  CG1 . ILE A 1 76  ? 0.980   -41.517 -35.864 1.00 44.54 ? 140 ILE A CG1 1 
ATOM   645  C  CG2 . ILE A 1 76  ? -1.029  -41.843 -37.336 1.00 41.83 ? 140 ILE A CG2 1 
ATOM   646  C  CD1 . ILE A 1 76  ? 0.231   -41.612 -34.528 1.00 43.48 ? 140 ILE A CD1 1 
ATOM   647  N  N   . VAL A 1 77  ? -0.013  -38.978 -39.493 1.00 43.90 ? 141 VAL A N   1 
ATOM   648  C  CA  . VAL A 1 77  ? -0.670  -38.338 -40.629 1.00 43.75 ? 141 VAL A CA  1 
ATOM   649  C  C   . VAL A 1 77  ? 0.104   -38.690 -41.885 1.00 44.23 ? 141 VAL A C   1 
ATOM   650  O  O   . VAL A 1 77  ? -0.457  -39.160 -42.873 1.00 44.30 ? 141 VAL A O   1 
ATOM   651  C  CB  . VAL A 1 77  ? -0.752  -36.811 -40.433 1.00 43.75 ? 141 VAL A CB  1 
ATOM   652  C  CG1 . VAL A 1 77  ? -1.179  -36.109 -41.717 1.00 42.76 ? 141 VAL A CG1 1 
ATOM   653  C  CG2 . VAL A 1 77  ? -1.694  -36.477 -39.254 1.00 42.54 ? 141 VAL A CG2 1 
ATOM   654  N  N   . ASN A 1 78  ? 1.414   -38.512 -41.801 1.00 44.92 ? 142 ASN A N   1 
ATOM   655  C  CA  . ASN A 1 78  ? 2.326   -38.797 -42.891 1.00 45.51 ? 142 ASN A CA  1 
ATOM   656  C  C   . ASN A 1 78  ? 2.193   -40.226 -43.360 1.00 44.96 ? 142 ASN A C   1 
ATOM   657  O  O   . ASN A 1 78  ? 2.026   -40.471 -44.540 1.00 44.91 ? 142 ASN A O   1 
ATOM   658  C  CB  . ASN A 1 78  ? 3.757   -38.526 -42.436 1.00 46.40 ? 142 ASN A CB  1 
ATOM   659  C  CG  . ASN A 1 78  ? 4.620   -37.943 -43.531 1.00 48.20 ? 142 ASN A CG  1 
ATOM   660  O  OD1 . ASN A 1 78  ? 4.721   -38.500 -44.611 1.00 50.11 ? 142 ASN A OD1 1 
ATOM   661  N  ND2 . ASN A 1 78  ? 5.272   -36.813 -43.239 1.00 52.36 ? 142 ASN A ND2 1 
ATOM   662  N  N   . GLU A 1 79  ? 2.248   -41.168 -42.429 1.00 45.03 ? 143 GLU A N   1 
ATOM   663  C  CA  . GLU A 1 79  ? 2.114   -42.574 -42.775 1.00 45.46 ? 143 GLU A CA  1 
ATOM   664  C  C   . GLU A 1 79  ? 0.837   -42.803 -43.571 1.00 45.06 ? 143 GLU A C   1 
ATOM   665  O  O   . GLU A 1 79  ? 0.840   -43.492 -44.596 1.00 45.22 ? 143 GLU A O   1 
ATOM   666  C  CB  . GLU A 1 79  ? 2.102   -43.450 -41.529 1.00 45.55 ? 143 GLU A CB  1 
ATOM   667  C  CG  . GLU A 1 79  ? 1.687   -44.865 -41.844 1.00 48.61 ? 143 GLU A CG  1 
ATOM   668  C  CD  . GLU A 1 79  ? 2.036   -45.865 -40.763 1.00 53.38 ? 143 GLU A CD  1 
ATOM   669  O  OE1 . GLU A 1 79  ? 2.264   -45.447 -39.607 1.00 54.64 ? 143 GLU A OE1 1 
ATOM   670  O  OE2 . GLU A 1 79  ? 2.064   -47.080 -41.076 1.00 55.41 ? 143 GLU A OE2 1 
ATOM   671  N  N   . ASN A 1 80  ? -0.248  -42.201 -43.102 1.00 44.63 ? 144 ASN A N   1 
ATOM   672  C  CA  . ASN A 1 80  ? -1.528  -42.391 -43.724 1.00 44.38 ? 144 ASN A CA  1 
ATOM   673  C  C   . ASN A 1 80  ? -1.585  -41.888 -45.154 1.00 44.39 ? 144 ASN A C   1 
ATOM   674  O  O   . ASN A 1 80  ? -2.080  -42.588 -46.037 1.00 44.71 ? 144 ASN A O   1 
ATOM   675  C  CB  . ASN A 1 80  ? -2.618  -41.741 -42.909 1.00 44.61 ? 144 ASN A CB  1 
ATOM   676  C  CG  . ASN A 1 80  ? -3.980  -42.032 -43.456 1.00 44.76 ? 144 ASN A CG  1 
ATOM   677  O  OD1 . ASN A 1 80  ? -4.383  -43.190 -43.567 1.00 44.20 ? 144 ASN A OD1 1 
ATOM   678  N  ND2 . ASN A 1 80  ? -4.699  -40.982 -43.818 1.00 45.61 ? 144 ASN A ND2 1 
ATOM   679  N  N   . LEU A 1 81  ? -1.069  -40.687 -45.386 1.00 44.08 ? 145 LEU A N   1 
ATOM   680  C  CA  . LEU A 1 81  ? -1.046  -40.130 -46.724 1.00 43.74 ? 145 LEU A CA  1 
ATOM   681  C  C   . LEU A 1 81  ? -0.187  -40.966 -47.662 1.00 44.34 ? 145 LEU A C   1 
ATOM   682  O  O   . LEU A 1 81  ? -0.611  -41.290 -48.784 1.00 44.28 ? 145 LEU A O   1 
ATOM   683  C  CB  . LEU A 1 81  ? -0.572  -38.690 -46.685 1.00 43.28 ? 145 LEU A CB  1 
ATOM   684  C  CG  . LEU A 1 81  ? -1.553  -37.809 -45.914 1.00 42.89 ? 145 LEU A CG  1 
ATOM   685  C  CD1 . LEU A 1 81  ? -0.902  -36.488 -45.525 1.00 42.90 ? 145 LEU A CD1 1 
ATOM   686  C  CD2 . LEU A 1 81  ? -2.810  -37.582 -46.715 1.00 40.37 ? 145 LEU A CD2 1 
ATOM   687  N  N   . VAL A 1 82  ? 1.000   -41.336 -47.185 1.00 44.83 ? 146 VAL A N   1 
ATOM   688  C  CA  . VAL A 1 82  ? 1.964   -42.097 -47.975 1.00 45.42 ? 146 VAL A CA  1 
ATOM   689  C  C   . VAL A 1 82  ? 1.428   -43.497 -48.307 1.00 46.63 ? 146 VAL A C   1 
ATOM   690  O  O   . VAL A 1 82  ? 1.443   -43.918 -49.462 1.00 46.63 ? 146 VAL A O   1 
ATOM   691  C  CB  . VAL A 1 82  ? 3.339   -42.159 -47.253 1.00 45.51 ? 146 VAL A CB  1 
ATOM   692  C  CG1 . VAL A 1 82  ? 4.256   -43.199 -47.870 1.00 44.54 ? 146 VAL A CG1 1 
ATOM   693  C  CG2 . VAL A 1 82  ? 4.016   -40.762 -47.225 1.00 43.57 ? 146 VAL A CG2 1 
ATOM   694  N  N   . GLU A 1 83  ? 0.919   -44.200 -47.302 1.00 47.75 ? 147 GLU A N   1 
ATOM   695  C  CA  . GLU A 1 83  ? 0.489   -45.583 -47.491 1.00 48.74 ? 147 GLU A CA  1 
ATOM   696  C  C   . GLU A 1 83  ? -0.921  -45.722 -48.045 1.00 48.84 ? 147 GLU A C   1 
ATOM   697  O  O   . GLU A 1 83  ? -1.268  -46.771 -48.602 1.00 48.86 ? 147 GLU A O   1 
ATOM   698  C  CB  . GLU A 1 83  ? 0.598   -46.368 -46.175 1.00 49.03 ? 147 GLU A CB  1 
ATOM   699  C  CG  . GLU A 1 83  ? 2.036   -46.673 -45.776 1.00 51.14 ? 147 GLU A CG  1 
ATOM   700  C  CD  . GLU A 1 83  ? 2.153   -47.419 -44.461 1.00 54.07 ? 147 GLU A CD  1 
ATOM   701  O  OE1 . GLU A 1 83  ? 1.103   -47.750 -43.851 1.00 53.12 ? 147 GLU A OE1 1 
ATOM   702  O  OE2 . GLU A 1 83  ? 3.312   -47.671 -44.043 1.00 56.08 ? 147 GLU A OE2 1 
ATOM   703  N  N   . ARG A 1 84  ? -1.746  -44.684 -47.880 1.00 48.62 ? 148 ARG A N   1 
ATOM   704  C  CA  . ARG A 1 84  ? -3.178  -44.852 -48.157 1.00 47.97 ? 148 ARG A CA  1 
ATOM   705  C  C   . ARG A 1 84  ? -3.831  -43.806 -49.055 1.00 47.57 ? 148 ARG A C   1 
ATOM   706  O  O   . ARG A 1 84  ? -4.209  -44.121 -50.176 1.00 47.22 ? 148 ARG A O   1 
ATOM   707  C  CB  . ARG A 1 84  ? -3.963  -45.071 -46.858 1.00 47.72 ? 148 ARG A CB  1 
ATOM   708  C  CG  . ARG A 1 84  ? -3.471  -46.291 -46.099 1.00 48.32 ? 148 ARG A CG  1 
ATOM   709  C  CD  . ARG A 1 84  ? -4.557  -46.976 -45.291 1.00 48.94 ? 148 ARG A CD  1 
ATOM   710  N  NE  . ARG A 1 84  ? -5.526  -47.660 -46.143 1.00 47.53 ? 148 ARG A NE  1 
ATOM   711  C  CZ  . ARG A 1 84  ? -6.653  -48.199 -45.693 1.00 47.12 ? 148 ARG A CZ  1 
ATOM   712  N  NH1 . ARG A 1 84  ? -6.950  -48.144 -44.404 1.00 47.87 ? 148 ARG A NH1 1 
ATOM   713  N  NH2 . ARG A 1 84  ? -7.493  -48.783 -46.530 1.00 46.40 ? 148 ARG A NH2 1 
ATOM   714  N  N   . PHE A 1 85  ? -3.977  -42.576 -48.575 1.00 47.48 ? 149 PHE A N   1 
ATOM   715  C  CA  . PHE A 1 85  ? -4.741  -41.597 -49.334 1.00 47.45 ? 149 PHE A CA  1 
ATOM   716  C  C   . PHE A 1 85  ? -4.128  -41.362 -50.702 1.00 47.95 ? 149 PHE A C   1 
ATOM   717  O  O   . PHE A 1 85  ? -4.827  -41.420 -51.706 1.00 48.38 ? 149 PHE A O   1 
ATOM   718  C  CB  . PHE A 1 85  ? -4.917  -40.276 -48.577 1.00 47.27 ? 149 PHE A CB  1 
ATOM   719  C  CG  . PHE A 1 85  ? -5.893  -40.346 -47.434 1.00 46.00 ? 149 PHE A CG  1 
ATOM   720  C  CD1 . PHE A 1 85  ? -6.602  -41.519 -47.158 1.00 43.42 ? 149 PHE A CD1 1 
ATOM   721  C  CD2 . PHE A 1 85  ? -6.116  -39.226 -46.632 1.00 44.71 ? 149 PHE A CD2 1 
ATOM   722  C  CE1 . PHE A 1 85  ? -7.505  -41.574 -46.094 1.00 42.78 ? 149 PHE A CE1 1 
ATOM   723  C  CE2 . PHE A 1 85  ? -7.038  -39.275 -45.560 1.00 43.28 ? 149 PHE A CE2 1 
ATOM   724  C  CZ  . PHE A 1 85  ? -7.735  -40.457 -45.303 1.00 41.51 ? 149 PHE A CZ  1 
ATOM   725  N  N   . SER A 1 86  ? -2.822  -41.126 -50.757 1.00 48.33 ? 150 SER A N   1 
ATOM   726  C  CA  . SER A 1 86  ? -2.202  -40.789 -52.037 1.00 48.35 ? 150 SER A CA  1 
ATOM   727  C  C   . SER A 1 86  ? -2.181  -42.002 -52.967 1.00 49.00 ? 150 SER A C   1 
ATOM   728  O  O   . SER A 1 86  ? -2.119  -41.856 -54.193 1.00 49.10 ? 150 SER A O   1 
ATOM   729  C  CB  . SER A 1 86  ? -0.801  -40.203 -51.844 1.00 47.52 ? 150 SER A CB  1 
ATOM   730  O  OG  . SER A 1 86  ? 0.064   -41.182 -51.322 1.00 46.97 ? 150 SER A OG  1 
ATOM   731  N  N   . GLN A 1 87  ? -2.229  -43.195 -52.387 1.00 49.68 ? 151 GLN A N   1 
ATOM   732  C  CA  . GLN A 1 87  ? -2.321  -44.405 -53.192 1.00 50.90 ? 151 GLN A CA  1 
ATOM   733  C  C   . GLN A 1 87  ? -3.709  -44.577 -53.793 1.00 51.26 ? 151 GLN A C   1 
ATOM   734  O  O   . GLN A 1 87  ? -3.839  -44.793 -54.996 1.00 52.08 ? 151 GLN A O   1 
ATOM   735  C  CB  . GLN A 1 87  ? -1.985  -45.657 -52.371 1.00 51.57 ? 151 GLN A CB  1 
ATOM   736  C  CG  . GLN A 1 87  ? -0.594  -45.689 -51.750 1.00 52.04 ? 151 GLN A CG  1 
ATOM   737  C  CD  . GLN A 1 87  ? 0.470   -45.273 -52.727 1.00 53.50 ? 151 GLN A CD  1 
ATOM   738  O  OE1 . GLN A 1 87  ? 0.626   -45.876 -53.791 1.00 53.92 ? 151 GLN A OE1 1 
ATOM   739  N  NE2 . GLN A 1 87  ? 1.203   -44.219 -52.380 1.00 54.09 ? 151 GLN A NE2 1 
ATOM   740  N  N   . GLU A 1 88  ? -4.742  -44.466 -52.966 1.00 51.21 ? 152 GLU A N   1 
ATOM   741  C  CA  . GLU A 1 88  ? -6.067  -44.921 -53.369 1.00 51.71 ? 152 GLU A CA  1 
ATOM   742  C  C   . GLU A 1 88  ? -6.891  -43.890 -54.139 1.00 51.81 ? 152 GLU A C   1 
ATOM   743  O  O   . GLU A 1 88  ? -7.759  -44.265 -54.948 1.00 52.05 ? 152 GLU A O   1 
ATOM   744  C  CB  . GLU A 1 88  ? -6.850  -45.462 -52.168 1.00 51.75 ? 152 GLU A CB  1 
ATOM   745  C  CG  . GLU A 1 88  ? -7.456  -44.388 -51.298 1.00 52.58 ? 152 GLU A CG  1 
ATOM   746  C  CD  . GLU A 1 88  ? -7.697  -44.861 -49.884 1.00 53.99 ? 152 GLU A CD  1 
ATOM   747  O  OE1 . GLU A 1 88  ? -7.236  -44.168 -48.968 1.00 54.50 ? 152 GLU A OE1 1 
ATOM   748  O  OE2 . GLU A 1 88  ? -8.345  -45.911 -49.679 1.00 54.81 ? 152 GLU A OE2 1 
ATOM   749  N  N   . VAL A 1 89  ? -6.638  -42.605 -53.899 1.00 51.23 ? 153 VAL A N   1 
ATOM   750  C  CA  . VAL A 1 89  ? -7.373  -41.578 -54.618 1.00 50.84 ? 153 VAL A CA  1 
ATOM   751  C  C   . VAL A 1 89  ? -6.823  -41.531 -56.035 1.00 51.22 ? 153 VAL A C   1 
ATOM   752  O  O   . VAL A 1 89  ? -5.612  -41.551 -56.217 1.00 51.90 ? 153 VAL A O   1 
ATOM   753  C  CB  . VAL A 1 89  ? -7.285  -40.224 -53.918 1.00 50.73 ? 153 VAL A CB  1 
ATOM   754  C  CG1 . VAL A 1 89  ? -7.646  -39.114 -54.864 1.00 50.11 ? 153 VAL A CG1 1 
ATOM   755  C  CG2 . VAL A 1 89  ? -8.188  -40.206 -52.679 1.00 49.56 ? 153 VAL A CG2 1 
ATOM   756  N  N   . GLN A 1 90  ? -7.708  -41.500 -57.032 1.00 51.33 ? 154 GLN A N   1 
ATOM   757  C  CA  . GLN A 1 90  ? -7.303  -41.654 -58.437 1.00 51.46 ? 154 GLN A CA  1 
ATOM   758  C  C   . GLN A 1 90  ? -7.328  -40.360 -59.271 1.00 51.01 ? 154 GLN A C   1 
ATOM   759  O  O   . GLN A 1 90  ? -6.753  -40.313 -60.356 1.00 50.55 ? 154 GLN A O   1 
ATOM   760  C  CB  . GLN A 1 90  ? -8.165  -42.725 -59.112 1.00 51.99 ? 154 GLN A CB  1 
ATOM   761  C  CG  . GLN A 1 90  ? -8.024  -44.122 -58.522 1.00 53.68 ? 154 GLN A CG  1 
ATOM   762  C  CD  . GLN A 1 90  ? -6.661  -44.701 -58.779 1.00 56.59 ? 154 GLN A CD  1 
ATOM   763  O  OE1 . GLN A 1 90  ? -6.317  -45.052 -59.914 1.00 59.25 ? 154 GLN A OE1 1 
ATOM   764  N  NE2 . GLN A 1 90  ? -5.865  -44.795 -57.730 1.00 58.12 ? 154 GLN A NE2 1 
ATOM   765  N  N   . ILE A 1 91  ? -8.000  -39.325 -58.778 1.00 50.62 ? 155 ILE A N   1 
ATOM   766  C  CA  . ILE A 1 91  ? -8.024  -38.048 -59.474 1.00 50.46 ? 155 ILE A CA  1 
ATOM   767  C  C   . ILE A 1 91  ? -6.709  -37.268 -59.308 1.00 50.40 ? 155 ILE A C   1 
ATOM   768  O  O   . ILE A 1 91  ? -6.217  -37.050 -58.200 1.00 50.50 ? 155 ILE A O   1 
ATOM   769  C  CB  . ILE A 1 91  ? -9.262  -37.206 -59.115 1.00 50.52 ? 155 ILE A CB  1 
ATOM   770  C  CG1 . ILE A 1 91  ? -9.383  -37.034 -57.601 1.00 51.78 ? 155 ILE A CG1 1 
ATOM   771  C  CG2 . ILE A 1 91  ? -10.511 -37.880 -59.645 1.00 49.39 ? 155 ILE A CG2 1 
ATOM   772  C  CD1 . ILE A 1 91  ? -9.999  -35.694 -57.169 1.00 52.21 ? 155 ILE A CD1 1 
ATOM   773  N  N   . THR A 1 92  ? -6.142  -36.872 -60.441 1.00 50.16 ? 156 THR A N   1 
ATOM   774  C  CA  . THR A 1 92  ? -4.831  -36.234 -60.501 1.00 49.86 ? 156 THR A CA  1 
ATOM   775  C  C   . THR A 1 92  ? -4.691  -35.048 -59.551 1.00 49.65 ? 156 THR A C   1 
ATOM   776  O  O   . THR A 1 92  ? -3.649  -34.880 -58.899 1.00 49.31 ? 156 THR A O   1 
ATOM   777  C  CB  . THR A 1 92  ? -4.512  -35.814 -61.955 1.00 49.56 ? 156 THR A CB  1 
ATOM   778  O  OG1 . THR A 1 92  ? -4.477  -36.995 -62.765 1.00 50.36 ? 156 THR A OG1 1 
ATOM   779  C  CG2 . THR A 1 92  ? -3.154  -35.119 -62.065 1.00 49.41 ? 156 THR A CG2 1 
ATOM   780  N  N   . GLU A 1 93  ? -5.751  -34.246 -59.477 1.00 49.33 ? 157 GLU A N   1 
ATOM   781  C  CA  . GLU A 1 93  ? -5.762  -33.011 -58.704 1.00 49.15 ? 157 GLU A CA  1 
ATOM   782  C  C   . GLU A 1 93  ? -5.542  -33.289 -57.224 1.00 48.93 ? 157 GLU A C   1 
ATOM   783  O  O   . GLU A 1 93  ? -4.811  -32.559 -56.556 1.00 48.79 ? 157 GLU A O   1 
ATOM   784  C  CB  . GLU A 1 93  ? -7.078  -32.249 -58.924 1.00 48.94 ? 157 GLU A CB  1 
ATOM   785  C  CG  . GLU A 1 93  ? -7.249  -31.694 -60.330 1.00 49.87 ? 157 GLU A CG  1 
ATOM   786  C  CD  . GLU A 1 93  ? -7.882  -32.669 -61.318 1.00 51.06 ? 157 GLU A CD  1 
ATOM   787  O  OE1 . GLU A 1 93  ? -7.882  -33.895 -61.086 1.00 52.55 ? 157 GLU A OE1 1 
ATOM   788  O  OE2 . GLU A 1 93  ? -8.395  -32.196 -62.348 1.00 53.06 ? 157 GLU A OE2 1 
ATOM   789  N  N   . ALA A 1 94  ? -6.176  -34.352 -56.732 1.00 48.74 ? 158 ALA A N   1 
ATOM   790  C  CA  . ALA A 1 94  ? -6.103  -34.733 -55.341 1.00 48.60 ? 158 ALA A CA  1 
ATOM   791  C  C   . ALA A 1 94  ? -4.741  -35.344 -55.008 1.00 49.05 ? 158 ALA A C   1 
ATOM   792  O  O   . ALA A 1 94  ? -4.210  -35.139 -53.900 1.00 49.20 ? 158 ALA A O   1 
ATOM   793  C  CB  . ALA A 1 94  ? -7.204  -35.688 -55.016 1.00 48.23 ? 158 ALA A CB  1 
ATOM   794  N  N   . ARG A 1 95  ? -4.177  -36.097 -55.949 1.00 49.02 ? 159 ARG A N   1 
ATOM   795  C  CA  . ARG A 1 95  ? -2.856  -36.678 -55.741 1.00 49.67 ? 159 ARG A CA  1 
ATOM   796  C  C   . ARG A 1 95  ? -1.777  -35.597 -55.660 1.00 49.37 ? 159 ARG A C   1 
ATOM   797  O  O   . ARG A 1 95  ? -0.817  -35.725 -54.888 1.00 49.79 ? 159 ARG A O   1 
ATOM   798  C  CB  . ARG A 1 95  ? -2.524  -37.718 -56.810 1.00 50.21 ? 159 ARG A CB  1 
ATOM   799  C  CG  . ARG A 1 95  ? -3.351  -39.007 -56.649 1.00 52.81 ? 159 ARG A CG  1 
ATOM   800  C  CD  . ARG A 1 95  ? -3.312  -39.857 -57.919 1.00 55.59 ? 159 ARG A CD  1 
ATOM   801  N  NE  . ARG A 1 95  ? -3.353  -41.277 -57.591 1.00 58.13 ? 159 ARG A NE  1 
ATOM   802  C  CZ  . ARG A 1 95  ? -2.278  -42.051 -57.452 1.00 59.54 ? 159 ARG A CZ  1 
ATOM   803  N  NH1 . ARG A 1 95  ? -1.058  -41.545 -57.623 1.00 60.89 ? 159 ARG A NH1 1 
ATOM   804  N  NH2 . ARG A 1 95  ? -2.423  -43.335 -57.147 1.00 60.04 ? 159 ARG A NH2 1 
ATOM   805  N  N   . CYS A 1 96  ? -1.936  -34.530 -56.435 1.00 48.42 ? 160 CYS A N   1 
ATOM   806  C  CA  . CYS A 1 96  ? -1.056  -33.384 -56.278 1.00 47.97 ? 160 CYS A CA  1 
ATOM   807  C  C   . CYS A 1 96  ? -1.169  -32.796 -54.869 1.00 47.59 ? 160 CYS A C   1 
ATOM   808  O  O   . CYS A 1 96  ? -0.155  -32.523 -54.233 1.00 48.16 ? 160 CYS A O   1 
ATOM   809  C  CB  . CYS A 1 96  ? -1.328  -32.319 -57.333 1.00 47.47 ? 160 CYS A CB  1 
ATOM   810  S  SG  . CYS A 1 96  ? -0.765  -32.842 -58.960 1.00 48.50 ? 160 CYS A SG  1 
ATOM   811  N  N   . PHE A 1 97  ? -2.392  -32.620 -54.379 1.00 46.60 ? 161 PHE A N   1 
ATOM   812  C  CA  . PHE A 1 97  ? -2.585  -32.045 -53.065 1.00 45.59 ? 161 PHE A CA  1 
ATOM   813  C  C   . PHE A 1 97  ? -1.901  -32.882 -51.999 1.00 45.12 ? 161 PHE A C   1 
ATOM   814  O  O   . PHE A 1 97  ? -1.085  -32.376 -51.238 1.00 45.73 ? 161 PHE A O   1 
ATOM   815  C  CB  . PHE A 1 97  ? -4.064  -31.894 -52.733 1.00 45.17 ? 161 PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 97  ? -4.308  -31.162 -51.454 1.00 44.09 ? 161 PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 97  ? -4.273  -31.833 -50.236 1.00 43.01 ? 161 PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 97  ? -4.545  -29.783 -51.458 1.00 43.26 ? 161 PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 97  ? -4.486  -31.143 -49.032 1.00 42.46 ? 161 PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 97  ? -4.754  -29.084 -50.261 1.00 40.96 ? 161 PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 97  ? -4.728  -29.766 -49.054 1.00 41.51 ? 161 PHE A CZ  1 
ATOM   822  N  N   . TYR A 1 98  ? -2.255  -34.158 -51.950 1.00 44.58 ? 162 TYR A N   1 
ATOM   823  C  CA  . TYR A 1 98  ? -1.674  -35.101 -51.008 1.00 43.77 ? 162 TYR A CA  1 
ATOM   824  C  C   . TYR A 1 98  ? -0.158  -35.205 -51.172 1.00 43.23 ? 162 TYR A C   1 
ATOM   825  O  O   . TYR A 1 98  ? 0.577   -35.292 -50.188 1.00 43.78 ? 162 TYR A O   1 
ATOM   826  C  CB  . TYR A 1 98  ? -2.296  -36.473 -51.208 1.00 43.69 ? 162 TYR A CB  1 
ATOM   827  C  CG  . TYR A 1 98  ? -3.692  -36.629 -50.666 1.00 43.38 ? 162 TYR A CG  1 
ATOM   828  C  CD1 . TYR A 1 98  ? -4.094  -35.970 -49.509 1.00 42.82 ? 162 TYR A CD1 1 
ATOM   829  C  CD2 . TYR A 1 98  ? -4.600  -37.496 -51.282 1.00 43.70 ? 162 TYR A CD2 1 
ATOM   830  C  CE1 . TYR A 1 98  ? -5.375  -36.155 -48.992 1.00 43.98 ? 162 TYR A CE1 1 
ATOM   831  C  CE2 . TYR A 1 98  ? -5.887  -37.674 -50.781 1.00 42.66 ? 162 TYR A CE2 1 
ATOM   832  C  CZ  . TYR A 1 98  ? -6.265  -37.011 -49.640 1.00 42.11 ? 162 TYR A CZ  1 
ATOM   833  O  OH  . TYR A 1 98  ? -7.526  -37.186 -49.143 1.00 42.64 ? 162 TYR A OH  1 
ATOM   834  N  N   . GLY A 1 99  ? 0.300   -35.186 -52.417 1.00 42.12 ? 163 GLY A N   1 
ATOM   835  C  CA  . GLY A 1 99  ? 1.716   -35.152 -52.712 1.00 41.06 ? 163 GLY A CA  1 
ATOM   836  C  C   . GLY A 1 99  ? 2.373   -34.015 -51.969 1.00 40.66 ? 163 GLY A C   1 
ATOM   837  O  O   . GLY A 1 99  ? 3.449   -34.196 -51.364 1.00 40.96 ? 163 GLY A O   1 
ATOM   838  N  N   . PHE A 1 100 ? 1.700   -32.859 -51.973 1.00 39.66 ? 164 PHE A N   1 
ATOM   839  C  CA  . PHE A 1 100 ? 2.212   -31.649 -51.351 1.00 38.94 ? 164 PHE A CA  1 
ATOM   840  C  C   . PHE A 1 100 ? 1.983   -31.662 -49.835 1.00 39.27 ? 164 PHE A C   1 
ATOM   841  O  O   . PHE A 1 100 ? 2.810   -31.144 -49.067 1.00 39.33 ? 164 PHE A O   1 
ATOM   842  C  CB  . PHE A 1 100 ? 1.570   -30.413 -51.976 1.00 38.77 ? 164 PHE A CB  1 
ATOM   843  C  CG  . PHE A 1 100 ? 2.386   -29.166 -51.829 1.00 37.91 ? 164 PHE A CG  1 
ATOM   844  C  CD1 . PHE A 1 100 ? 3.385   -28.859 -52.752 1.00 38.73 ? 164 PHE A CD1 1 
ATOM   845  C  CD2 . PHE A 1 100 ? 2.164   -28.296 -50.770 1.00 36.30 ? 164 PHE A CD2 1 
ATOM   846  C  CE1 . PHE A 1 100 ? 4.161   -27.695 -52.606 1.00 39.06 ? 164 PHE A CE1 1 
ATOM   847  C  CE2 . PHE A 1 100 ? 2.930   -27.132 -50.620 1.00 36.98 ? 164 PHE A CE2 1 
ATOM   848  C  CZ  . PHE A 1 100 ? 3.934   -26.838 -51.527 1.00 37.50 ? 164 PHE A CZ  1 
ATOM   849  N  N   . GLN A 1 101 ? 0.872   -32.242 -49.389 1.00 38.76 ? 165 GLN A N   1 
ATOM   850  C  CA  . GLN A 1 101 ? 0.650   -32.333 -47.969 1.00 38.86 ? 165 GLN A CA  1 
ATOM   851  C  C   . GLN A 1 101 ? 1.780   -33.186 -47.364 1.00 39.68 ? 165 GLN A C   1 
ATOM   852  O  O   . GLN A 1 101 ? 2.361   -32.796 -46.347 1.00 40.28 ? 165 GLN A O   1 
ATOM   853  C  CB  . GLN A 1 101 ? -0.731  -32.895 -47.642 1.00 38.82 ? 165 GLN A CB  1 
ATOM   854  C  CG  . GLN A 1 101 ? -1.079  -32.787 -46.162 1.00 39.24 ? 165 GLN A CG  1 
ATOM   855  C  CD  . GLN A 1 101 ? -2.414  -33.438 -45.788 1.00 40.41 ? 165 GLN A CD  1 
ATOM   856  O  OE1 . GLN A 1 101 ? -3.274  -33.659 -46.634 1.00 41.04 ? 165 GLN A OE1 1 
ATOM   857  N  NE2 . GLN A 1 101 ? -2.590  -33.727 -44.504 1.00 40.65 ? 165 GLN A NE2 1 
ATOM   858  N  N   . ILE A 1 102 ? 2.135   -34.313 -48.000 1.00 39.22 ? 166 ILE A N   1 
ATOM   859  C  CA  . ILE A 1 102 ? 3.244   -35.106 -47.492 1.00 38.80 ? 166 ILE A CA  1 
ATOM   860  C  C   . ILE A 1 102 ? 4.480   -34.219 -47.287 1.00 39.45 ? 166 ILE A C   1 
ATOM   861  O  O   . ILE A 1 102 ? 5.042   -34.178 -46.202 1.00 40.53 ? 166 ILE A O   1 
ATOM   862  C  CB  . ILE A 1 102 ? 3.549   -36.343 -48.367 1.00 38.51 ? 166 ILE A CB  1 
ATOM   863  C  CG1 . ILE A 1 102 ? 2.464   -37.417 -48.166 1.00 38.02 ? 166 ILE A CG1 1 
ATOM   864  C  CG2 . ILE A 1 102 ? 4.914   -36.906 -48.032 1.00 36.23 ? 166 ILE A CG2 1 
ATOM   865  C  CD1 . ILE A 1 102 ? 2.263   -38.374 -49.358 1.00 34.78 ? 166 ILE A CD1 1 
ATOM   866  N  N   . ALA A 1 103 ? 4.882   -33.476 -48.305 1.00 39.63 ? 167 ALA A N   1 
ATOM   867  C  CA  . ALA A 1 103 ? 6.023   -32.582 -48.162 1.00 39.64 ? 167 ALA A CA  1 
ATOM   868  C  C   . ALA A 1 103 ? 5.830   -31.603 -47.008 1.00 39.91 ? 167 ALA A C   1 
ATOM   869  O  O   . ALA A 1 103 ? 6.775   -31.327 -46.279 1.00 40.67 ? 167 ALA A O   1 
ATOM   870  C  CB  . ALA A 1 103 ? 6.289   -31.827 -49.463 1.00 39.19 ? 167 ALA A CB  1 
ATOM   871  N  N   . MET A 1 104 ? 4.617   -31.084 -46.825 1.00 39.73 ? 168 MET A N   1 
ATOM   872  C  CA  . MET A 1 104 ? 4.414   -30.108 -45.761 1.00 39.56 ? 168 MET A CA  1 
ATOM   873  C  C   . MET A 1 104 ? 4.403   -30.741 -44.358 1.00 39.69 ? 168 MET A C   1 
ATOM   874  O  O   . MET A 1 104 ? 4.915   -30.153 -43.397 1.00 39.58 ? 168 MET A O   1 
ATOM   875  C  CB  . MET A 1 104 ? 3.191   -29.217 -46.012 1.00 39.21 ? 168 MET A CB  1 
ATOM   876  C  CG  . MET A 1 104 ? 3.330   -28.257 -47.199 1.00 38.46 ? 168 MET A CG  1 
ATOM   877  S  SD  . MET A 1 104 ? 4.820   -27.225 -47.225 1.00 39.90 ? 168 MET A SD  1 
ATOM   878  C  CE  . MET A 1 104 ? 4.792   -26.441 -45.591 1.00 37.60 ? 168 MET A CE  1 
ATOM   879  N  N   . GLU A 1 105 ? 3.847   -31.943 -44.246 1.00 39.62 ? 169 GLU A N   1 
ATOM   880  C  CA  . GLU A 1 105 ? 3.978   -32.715 -43.014 1.00 40.08 ? 169 GLU A CA  1 
ATOM   881  C  C   . GLU A 1 105 ? 5.448   -32.892 -42.616 1.00 40.10 ? 169 GLU A C   1 
ATOM   882  O  O   . GLU A 1 105 ? 5.803   -32.695 -41.451 1.00 40.05 ? 169 GLU A O   1 
ATOM   883  C  CB  . GLU A 1 105 ? 3.271   -34.078 -43.105 1.00 40.58 ? 169 GLU A CB  1 
ATOM   884  C  CG  . GLU A 1 105 ? 1.748   -34.046 -43.366 1.00 41.20 ? 169 GLU A CG  1 
ATOM   885  C  CD  . GLU A 1 105 ? 0.959   -33.186 -42.387 1.00 44.00 ? 169 GLU A CD  1 
ATOM   886  O  OE1 . GLU A 1 105 ? 1.396   -32.978 -41.232 1.00 46.59 ? 169 GLU A OE1 1 
ATOM   887  O  OE2 . GLU A 1 105 ? -0.124  -32.705 -42.777 1.00 44.94 ? 169 GLU A OE2 1 
ATOM   888  N  N   . ASN A 1 106 ? 6.320   -33.213 -43.568 1.00 40.12 ? 170 ASN A N   1 
ATOM   889  C  CA  . ASN A 1 106 ? 7.740   -33.345 -43.202 1.00 40.53 ? 170 ASN A CA  1 
ATOM   890  C  C   . ASN A 1 106 ? 8.360   -32.040 -42.734 1.00 40.85 ? 170 ASN A C   1 
ATOM   891  O  O   . ASN A 1 106 ? 9.202   -32.031 -41.824 1.00 41.49 ? 170 ASN A O   1 
ATOM   892  C  CB  . ASN A 1 106 ? 8.580   -33.972 -44.317 1.00 39.86 ? 170 ASN A CB  1 
ATOM   893  C  CG  . ASN A 1 106 ? 8.230   -35.413 -44.548 1.00 38.94 ? 170 ASN A CG  1 
ATOM   894  O  OD1 . ASN A 1 106 ? 7.814   -36.126 -43.627 1.00 37.01 ? 170 ASN A OD1 1 
ATOM   895  N  ND2 . ASN A 1 106 ? 8.394   -35.860 -45.784 1.00 37.87 ? 170 ASN A ND2 1 
ATOM   896  N  N   . ILE A 1 107 ? 7.952   -30.936 -43.346 1.00 40.35 ? 171 ILE A N   1 
ATOM   897  C  CA  . ILE A 1 107 ? 8.411   -29.660 -42.854 1.00 40.43 ? 171 ILE A CA  1 
ATOM   898  C  C   . ILE A 1 107 ? 7.842   -29.374 -41.445 1.00 40.81 ? 171 ILE A C   1 
ATOM   899  O  O   . ILE A 1 107 ? 8.576   -28.909 -40.564 1.00 41.19 ? 171 ILE A O   1 
ATOM   900  C  CB  . ILE A 1 107 ? 8.166   -28.527 -43.879 1.00 40.51 ? 171 ILE A CB  1 
ATOM   901  C  CG1 . ILE A 1 107 ? 9.088   -28.743 -45.089 1.00 40.05 ? 171 ILE A CG1 1 
ATOM   902  C  CG2 . ILE A 1 107 ? 8.383   -27.151 -43.250 1.00 39.38 ? 171 ILE A CG2 1 
ATOM   903  C  CD1 . ILE A 1 107 ? 8.742   -27.937 -46.289 1.00 39.27 ? 171 ILE A CD1 1 
ATOM   904  N  N   . HIS A 1 108 ? 6.569   -29.688 -41.217 1.00 40.51 ? 172 HIS A N   1 
ATOM   905  C  CA  . HIS A 1 108 ? 5.973   -29.538 -39.879 1.00 40.85 ? 172 HIS A CA  1 
ATOM   906  C  C   . HIS A 1 108 ? 6.738   -30.346 -38.809 1.00 41.11 ? 172 HIS A C   1 
ATOM   907  O  O   . HIS A 1 108 ? 7.067   -29.823 -37.745 1.00 41.03 ? 172 HIS A O   1 
ATOM   908  C  CB  . HIS A 1 108 ? 4.490   -29.946 -39.881 1.00 40.90 ? 172 HIS A CB  1 
ATOM   909  C  CG  . HIS A 1 108 ? 3.604   -29.058 -40.702 1.00 40.51 ? 172 HIS A CG  1 
ATOM   910  N  ND1 . HIS A 1 108 ? 2.233   -29.177 -40.698 1.00 41.52 ? 172 HIS A ND1 1 
ATOM   911  C  CD2 . HIS A 1 108 ? 3.889   -28.041 -41.544 1.00 39.93 ? 172 HIS A CD2 1 
ATOM   912  C  CE1 . HIS A 1 108 ? 1.713   -28.280 -41.512 1.00 40.48 ? 172 HIS A CE1 1 
ATOM   913  N  NE2 . HIS A 1 108 ? 2.698   -27.576 -42.036 1.00 39.86 ? 172 HIS A NE2 1 
ATOM   914  N  N   . SER A 1 109 ? 7.010   -31.615 -39.096 1.00 41.52 ? 173 SER A N   1 
ATOM   915  C  CA  . SER A 1 109 ? 7.805   -32.461 -38.210 1.00 42.18 ? 173 SER A CA  1 
ATOM   916  C  C   . SER A 1 109 ? 9.157   -31.851 -37.889 1.00 42.01 ? 173 SER A C   1 
ATOM   917  O  O   . SER A 1 109 ? 9.562   -31.776 -36.713 1.00 41.84 ? 173 SER A O   1 
ATOM   918  C  CB  . SER A 1 109 ? 8.018   -33.831 -38.833 1.00 42.21 ? 173 SER A CB  1 
ATOM   919  O  OG  . SER A 1 109 ? 6.803   -34.545 -38.814 1.00 44.97 ? 173 SER A OG  1 
ATOM   920  N  N   . GLU A 1 110 ? 9.850   -31.416 -38.937 1.00 41.84 ? 174 GLU A N   1 
ATOM   921  C  CA  . GLU A 1 110 ? 11.137  -30.765 -38.761 1.00 42.09 ? 174 GLU A CA  1 
ATOM   922  C  C   . GLU A 1 110 ? 11.016  -29.569 -37.829 1.00 41.77 ? 174 GLU A C   1 
ATOM   923  O  O   . GLU A 1 110 ? 11.747  -29.500 -36.858 1.00 42.41 ? 174 GLU A O   1 
ATOM   924  C  CB  . GLU A 1 110 ? 11.760  -30.364 -40.096 1.00 42.13 ? 174 GLU A CB  1 
ATOM   925  C  CG  . GLU A 1 110 ? 13.030  -29.569 -39.940 1.00 43.66 ? 174 GLU A CG  1 
ATOM   926  C  CD  . GLU A 1 110 ? 13.783  -29.404 -41.239 1.00 48.34 ? 174 GLU A CD  1 
ATOM   927  O  OE1 . GLU A 1 110 ? 13.137  -29.359 -42.322 1.00 50.29 ? 174 GLU A OE1 1 
ATOM   928  O  OE2 . GLU A 1 110 ? 15.034  -29.312 -41.181 1.00 49.73 ? 174 GLU A OE2 1 
ATOM   929  N  N   . MET A 1 111 ? 10.088  -28.655 -38.111 1.00 41.41 ? 175 MET A N   1 
ATOM   930  C  CA  . MET A 1 111 ? 9.843   -27.478 -37.273 1.00 41.29 ? 175 MET A CA  1 
ATOM   931  C  C   . MET A 1 111 ? 9.768   -27.851 -35.783 1.00 41.75 ? 175 MET A C   1 
ATOM   932  O  O   . MET A 1 111 ? 10.539  -27.337 -34.954 1.00 41.32 ? 175 MET A O   1 
ATOM   933  C  CB  . MET A 1 111 ? 8.545   -26.795 -37.709 1.00 40.94 ? 175 MET A CB  1 
ATOM   934  C  CG  . MET A 1 111 ? 8.349   -25.363 -37.229 1.00 40.01 ? 175 MET A CG  1 
ATOM   935  S  SD  . MET A 1 111 ? 9.692   -24.246 -37.706 1.00 41.61 ? 175 MET A SD  1 
ATOM   936  C  CE  . MET A 1 111 ? 10.318  -23.768 -36.091 1.00 39.35 ? 175 MET A CE  1 
ATOM   937  N  N   . TYR A 1 112 ? 8.853   -28.764 -35.462 1.00 42.01 ? 176 TYR A N   1 
ATOM   938  C  CA  . TYR A 1 112 ? 8.653   -29.217 -34.100 1.00 42.51 ? 176 TYR A CA  1 
ATOM   939  C  C   . TYR A 1 112 ? 9.930   -29.768 -33.500 1.00 43.07 ? 176 TYR A C   1 
ATOM   940  O  O   . TYR A 1 112 ? 10.246  -29.508 -32.342 1.00 43.80 ? 176 TYR A O   1 
ATOM   941  C  CB  . TYR A 1 112 ? 7.551   -30.270 -34.048 1.00 42.26 ? 176 TYR A CB  1 
ATOM   942  C  CG  . TYR A 1 112 ? 6.181   -29.686 -34.285 1.00 42.60 ? 176 TYR A CG  1 
ATOM   943  C  CD1 . TYR A 1 112 ? 5.707   -28.647 -33.491 1.00 42.40 ? 176 TYR A CD1 1 
ATOM   944  C  CD2 . TYR A 1 112 ? 5.353   -30.168 -35.298 1.00 42.76 ? 176 TYR A CD2 1 
ATOM   945  C  CE1 . TYR A 1 112 ? 4.461   -28.102 -33.695 1.00 42.75 ? 176 TYR A CE1 1 
ATOM   946  C  CE2 . TYR A 1 112 ? 4.088   -29.623 -35.511 1.00 42.42 ? 176 TYR A CE2 1 
ATOM   947  C  CZ  . TYR A 1 112 ? 3.653   -28.594 -34.701 1.00 42.22 ? 176 TYR A CZ  1 
ATOM   948  O  OH  . TYR A 1 112 ? 2.409   -28.043 -34.875 1.00 42.99 ? 176 TYR A OH  1 
ATOM   949  N  N   . SER A 1 113 ? 10.677  -30.521 -34.287 1.00 43.34 ? 177 SER A N   1 
ATOM   950  C  CA  . SER A 1 113 ? 11.931  -31.061 -33.805 1.00 43.71 ? 177 SER A CA  1 
ATOM   951  C  C   . SER A 1 113 ? 12.967  -29.971 -33.572 1.00 43.71 ? 177 SER A C   1 
ATOM   952  O  O   . SER A 1 113 ? 13.712  -30.017 -32.604 1.00 43.31 ? 177 SER A O   1 
ATOM   953  C  CB  . SER A 1 113 ? 12.442  -32.097 -34.784 1.00 43.63 ? 177 SER A CB  1 
ATOM   954  O  OG  . SER A 1 113 ? 11.526  -33.167 -34.789 1.00 45.69 ? 177 SER A OG  1 
ATOM   955  N  N   . LEU A 1 114 ? 13.002  -28.986 -34.464 1.00 44.26 ? 178 LEU A N   1 
ATOM   956  C  CA  . LEU A 1 114 ? 13.874  -27.839 -34.296 1.00 44.60 ? 178 LEU A CA  1 
ATOM   957  C  C   . LEU A 1 114 ? 13.503  -27.083 -33.042 1.00 44.32 ? 178 LEU A C   1 
ATOM   958  O  O   . LEU A 1 114 ? 14.384  -26.637 -32.324 1.00 45.04 ? 178 LEU A O   1 
ATOM   959  C  CB  . LEU A 1 114 ? 13.807  -26.914 -35.497 1.00 45.00 ? 178 LEU A CB  1 
ATOM   960  C  CG  . LEU A 1 114 ? 14.906  -27.070 -36.538 1.00 47.90 ? 178 LEU A CG  1 
ATOM   961  C  CD1 . LEU A 1 114 ? 14.513  -26.301 -37.806 1.00 49.73 ? 178 LEU A CD1 1 
ATOM   962  C  CD2 . LEU A 1 114 ? 16.255  -26.552 -35.990 1.00 49.37 ? 178 LEU A CD2 1 
ATOM   963  N  N   . LEU A 1 115 ? 12.209  -26.939 -32.771 1.00 43.84 ? 179 LEU A N   1 
ATOM   964  C  CA  . LEU A 1 115 ? 11.777  -26.263 -31.559 1.00 43.62 ? 179 LEU A CA  1 
ATOM   965  C  C   . LEU A 1 115 ? 12.313  -27.020 -30.336 1.00 43.91 ? 179 LEU A C   1 
ATOM   966  O  O   . LEU A 1 115 ? 12.913  -26.434 -29.433 1.00 43.67 ? 179 LEU A O   1 
ATOM   967  C  CB  . LEU A 1 115 ? 10.256  -26.120 -31.523 1.00 43.20 ? 179 LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 115 ? 9.702   -25.085 -32.508 1.00 43.44 ? 179 LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 115 ? 8.259   -25.347 -32.835 1.00 42.66 ? 179 LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 115 ? 9.860   -23.669 -31.984 1.00 44.91 ? 179 LEU A CD2 1 
ATOM   971  N  N   . ILE A 1 116 ? 12.123  -28.330 -30.339 1.00 44.06 ? 180 ILE A N   1 
ATOM   972  C  CA  . ILE A 1 116 ? 12.645  -29.163 -29.291 1.00 44.63 ? 180 ILE A CA  1 
ATOM   973  C  C   . ILE A 1 116 ? 14.179  -29.023 -29.161 1.00 45.29 ? 180 ILE A C   1 
ATOM   974  O  O   . ILE A 1 116 ? 14.676  -28.770 -28.069 1.00 45.65 ? 180 ILE A O   1 
ATOM   975  C  CB  . ILE A 1 116 ? 12.180  -30.618 -29.475 1.00 44.43 ? 180 ILE A CB  1 
ATOM   976  C  CG1 . ILE A 1 116 ? 10.688  -30.713 -29.160 1.00 43.92 ? 180 ILE A CG1 1 
ATOM   977  C  CG2 . ILE A 1 116 ? 12.978  -31.556 -28.595 1.00 44.01 ? 180 ILE A CG2 1 
ATOM   978  C  CD1 . ILE A 1 116 ? 10.002  -31.883 -29.812 1.00 43.73 ? 180 ILE A CD1 1 
ATOM   979  N  N   . ASP A 1 117 ? 14.923  -29.140 -30.255 1.00 45.73 ? 181 ASP A N   1 
ATOM   980  C  CA  . ASP A 1 117 ? 16.380  -29.047 -30.166 1.00 46.72 ? 181 ASP A CA  1 
ATOM   981  C  C   . ASP A 1 117 ? 16.852  -27.687 -29.646 1.00 47.18 ? 181 ASP A C   1 
ATOM   982  O  O   . ASP A 1 117 ? 17.887  -27.584 -28.979 1.00 47.30 ? 181 ASP A O   1 
ATOM   983  C  CB  . ASP A 1 117 ? 17.053  -29.408 -31.498 1.00 46.76 ? 181 ASP A CB  1 
ATOM   984  C  CG  . ASP A 1 117 ? 16.999  -30.924 -31.790 1.00 48.50 ? 181 ASP A CG  1 
ATOM   985  O  OD1 . ASP A 1 117 ? 16.579  -31.681 -30.895 1.00 49.18 ? 181 ASP A OD1 1 
ATOM   986  O  OD2 . ASP A 1 117 ? 17.357  -31.366 -32.907 1.00 49.68 ? 181 ASP A OD2 1 
ATOM   987  N  N   . THR A 1 118 ? 16.072  -26.653 -29.927 1.00 47.36 ? 182 THR A N   1 
ATOM   988  C  CA  . THR A 1 118 ? 16.431  -25.312 -29.546 1.00 47.66 ? 182 THR A CA  1 
ATOM   989  C  C   . THR A 1 118 ? 16.160  -25.047 -28.066 1.00 48.16 ? 182 THR A C   1 
ATOM   990  O  O   . THR A 1 118 ? 16.979  -24.424 -27.396 1.00 48.75 ? 182 THR A O   1 
ATOM   991  C  CB  . THR A 1 118 ? 15.716  -24.286 -30.442 1.00 47.94 ? 182 THR A CB  1 
ATOM   992  O  OG1 . THR A 1 118 ? 16.092  -24.531 -31.803 1.00 47.18 ? 182 THR A OG1 1 
ATOM   993  C  CG2 . THR A 1 118 ? 16.081  -22.837 -30.061 1.00 47.15 ? 182 THR A CG2 1 
ATOM   994  N  N   . TYR A 1 119 ? 15.038  -25.532 -27.555 1.00 48.26 ? 183 TYR A N   1 
ATOM   995  C  CA  . TYR A 1 119 ? 14.681  -25.289 -26.168 1.00 48.76 ? 183 TYR A CA  1 
ATOM   996  C  C   . TYR A 1 119 ? 15.309  -26.291 -25.209 1.00 49.59 ? 183 TYR A C   1 
ATOM   997  O  O   . TYR A 1 119 ? 15.483  -26.000 -24.022 1.00 50.14 ? 183 TYR A O   1 
ATOM   998  C  CB  . TYR A 1 119 ? 13.156  -25.310 -25.973 1.00 48.58 ? 183 TYR A CB  1 
ATOM   999  C  CG  . TYR A 1 119 ? 12.381  -24.378 -26.863 1.00 48.01 ? 183 TYR A CG  1 
ATOM   1000 C  CD1 . TYR A 1 119 ? 12.945  -23.197 -27.338 1.00 47.17 ? 183 TYR A CD1 1 
ATOM   1001 C  CD2 . TYR A 1 119 ? 11.068  -24.668 -27.216 1.00 47.80 ? 183 TYR A CD2 1 
ATOM   1002 C  CE1 . TYR A 1 119 ? 12.233  -22.337 -28.165 1.00 47.50 ? 183 TYR A CE1 1 
ATOM   1003 C  CE2 . TYR A 1 119 ? 10.343  -23.820 -28.041 1.00 48.12 ? 183 TYR A CE2 1 
ATOM   1004 C  CZ  . TYR A 1 119 ? 10.935  -22.654 -28.517 1.00 47.71 ? 183 TYR A CZ  1 
ATOM   1005 O  OH  . TYR A 1 119 ? 10.222  -21.796 -29.320 1.00 46.45 ? 183 TYR A OH  1 
ATOM   1006 N  N   . ILE A 1 120 ? 15.627  -27.475 -25.709 1.00 50.05 ? 184 ILE A N   1 
ATOM   1007 C  CA  . ILE A 1 120 ? 16.048  -28.559 -24.853 1.00 50.87 ? 184 ILE A CA  1 
ATOM   1008 C  C   . ILE A 1 120 ? 17.399  -29.019 -25.316 1.00 51.88 ? 184 ILE A C   1 
ATOM   1009 O  O   . ILE A 1 120 ? 17.513  -29.547 -26.408 1.00 52.41 ? 184 ILE A O   1 
ATOM   1010 C  CB  . ILE A 1 120 ? 15.086  -29.770 -24.994 1.00 51.08 ? 184 ILE A CB  1 
ATOM   1011 C  CG1 . ILE A 1 120 ? 13.606  -29.337 -24.888 1.00 49.88 ? 184 ILE A CG1 1 
ATOM   1012 C  CG2 . ILE A 1 120 ? 15.508  -30.919 -24.070 1.00 49.82 ? 184 ILE A CG2 1 
ATOM   1013 C  CD1 . ILE A 1 120 ? 13.006  -29.402 -23.516 1.00 48.91 ? 184 ILE A CD1 1 
ATOM   1014 N  N   . LYS A 1 121 ? 18.423  -28.867 -24.487 1.00 53.33 ? 185 LYS A N   1 
ATOM   1015 C  CA  . LYS A 1 121 ? 19.770  -29.286 -24.898 1.00 54.59 ? 185 LYS A CA  1 
ATOM   1016 C  C   . LYS A 1 121 ? 20.163  -30.674 -24.385 1.00 55.23 ? 185 LYS A C   1 
ATOM   1017 O  O   . LYS A 1 121 ? 21.070  -31.311 -24.929 1.00 55.35 ? 185 LYS A O   1 
ATOM   1018 C  CB  . LYS A 1 121 ? 20.811  -28.229 -24.518 1.00 54.46 ? 185 LYS A CB  1 
ATOM   1019 C  CG  . LYS A 1 121 ? 20.619  -26.896 -25.230 1.00 56.96 ? 185 LYS A CG  1 
ATOM   1020 C  CD  . LYS A 1 121 ? 20.891  -26.994 -26.745 1.00 60.30 ? 185 LYS A CD  1 
ATOM   1021 C  CE  . LYS A 1 121 ? 20.375  -25.744 -27.481 1.00 62.63 ? 185 LYS A CE  1 
ATOM   1022 N  NZ  . LYS A 1 121 ? 20.916  -25.634 -28.878 1.00 63.60 ? 185 LYS A NZ  1 
ATOM   1023 N  N   . ASP A 1 122 ? 19.477  -31.134 -23.343 1.00 56.03 ? 186 ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 122 ? 19.738  -32.436 -22.768 1.00 57.25 ? 186 ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 122 ? 19.411  -33.518 -23.803 1.00 57.53 ? 186 ASP A C   1 
ATOM   1026 O  O   . ASP A 1 122 ? 18.271  -33.610 -24.265 1.00 57.46 ? 186 ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 122 ? 18.910  -32.616 -21.485 1.00 57.73 ? 186 ASP A CB  1 
ATOM   1028 C  CG  . ASP A 1 122 ? 19.317  -33.844 -20.662 1.00 59.35 ? 186 ASP A CG  1 
ATOM   1029 O  OD1 . ASP A 1 122 ? 19.862  -34.828 -21.210 1.00 61.84 ? 186 ASP A OD1 1 
ATOM   1030 O  OD2 . ASP A 1 122 ? 19.064  -33.827 -19.439 1.00 62.53 ? 186 ASP A OD2 1 
ATOM   1031 N  N   . PRO A 1 123 ? 20.422  -34.323 -24.182 1.00 57.87 ? 187 PRO A N   1 
ATOM   1032 C  CA  . PRO A 1 123 ? 20.263  -35.403 -25.162 1.00 58.19 ? 187 PRO A CA  1 
ATOM   1033 C  C   . PRO A 1 123 ? 19.221  -36.446 -24.762 1.00 58.23 ? 187 PRO A C   1 
ATOM   1034 O  O   . PRO A 1 123 ? 18.499  -36.953 -25.627 1.00 58.34 ? 187 PRO A O   1 
ATOM   1035 C  CB  . PRO A 1 123 ? 21.658  -36.056 -25.201 1.00 58.17 ? 187 PRO A CB  1 
ATOM   1036 C  CG  . PRO A 1 123 ? 22.582  -34.972 -24.790 1.00 58.35 ? 187 PRO A CG  1 
ATOM   1037 C  CD  . PRO A 1 123 ? 21.825  -34.188 -23.746 1.00 57.76 ? 187 PRO A CD  1 
ATOM   1038 N  N   . LYS A 1 124 ? 19.161  -36.772 -23.473 1.00 58.37 ? 188 LYS A N   1 
ATOM   1039 C  CA  . LYS A 1 124 ? 18.255  -37.813 -22.971 1.00 58.63 ? 188 LYS A CA  1 
ATOM   1040 C  C   . LYS A 1 124 ? 16.803  -37.339 -23.041 1.00 58.07 ? 188 LYS A C   1 
ATOM   1041 O  O   . LYS A 1 124 ? 15.912  -38.098 -23.440 1.00 58.08 ? 188 LYS A O   1 
ATOM   1042 C  CB  . LYS A 1 124 ? 18.630  -38.228 -21.539 1.00 58.95 ? 188 LYS A CB  1 
ATOM   1043 C  CG  . LYS A 1 124 ? 19.808  -39.227 -21.454 1.00 61.18 ? 188 LYS A CG  1 
ATOM   1044 C  CD  . LYS A 1 124 ? 20.301  -39.450 -20.010 1.00 63.49 ? 188 LYS A CD  1 
ATOM   1045 C  CE  . LYS A 1 124 ? 21.553  -38.631 -19.671 1.00 66.41 ? 188 LYS A CE  1 
ATOM   1046 N  NZ  . LYS A 1 124 ? 21.292  -37.165 -19.465 1.00 68.00 ? 188 LYS A NZ  1 
ATOM   1047 N  N   . GLU A 1 125 ? 16.593  -36.078 -22.664 1.00 57.45 ? 189 GLU A N   1 
ATOM   1048 C  CA  . GLU A 1 125 ? 15.298  -35.414 -22.763 1.00 56.75 ? 189 GLU A CA  1 
ATOM   1049 C  C   . GLU A 1 125 ? 14.868  -35.268 -24.234 1.00 56.15 ? 189 GLU A C   1 
ATOM   1050 O  O   . GLU A 1 125 ? 13.685  -35.428 -24.563 1.00 56.09 ? 189 GLU A O   1 
ATOM   1051 C  CB  . GLU A 1 125 ? 15.332  -34.067 -22.026 1.00 56.56 ? 189 GLU A CB  1 
ATOM   1052 C  CG  . GLU A 1 125 ? 14.003  -33.317 -21.959 1.00 57.99 ? 189 GLU A CG  1 
ATOM   1053 C  CD  . GLU A 1 125 ? 12.903  -34.036 -21.167 1.00 60.69 ? 189 GLU A CD  1 
ATOM   1054 O  OE1 . GLU A 1 125 ? 13.225  -34.922 -20.329 1.00 61.13 ? 189 GLU A OE1 1 
ATOM   1055 O  OE2 . GLU A 1 125 ? 11.705  -33.693 -21.375 1.00 61.06 ? 189 GLU A OE2 1 
ATOM   1056 N  N   . ARG A 1 126 ? 15.820  -35.004 -25.124 1.00 55.27 ? 190 ARG A N   1 
ATOM   1057 C  CA  . ARG A 1 126 ? 15.507  -35.000 -26.554 1.00 54.95 ? 190 ARG A CA  1 
ATOM   1058 C  C   . ARG A 1 126 ? 14.990  -36.376 -26.980 1.00 55.03 ? 190 ARG A C   1 
ATOM   1059 O  O   . ARG A 1 126 ? 13.865  -36.494 -27.455 1.00 55.20 ? 190 ARG A O   1 
ATOM   1060 C  CB  . ARG A 1 126 ? 16.705  -34.580 -27.408 1.00 54.72 ? 190 ARG A CB  1 
ATOM   1061 C  CG  . ARG A 1 126 ? 16.992  -33.088 -27.420 1.00 53.77 ? 190 ARG A CG  1 
ATOM   1062 C  CD  . ARG A 1 126 ? 18.346  -32.798 -28.047 1.00 50.94 ? 190 ARG A CD  1 
ATOM   1063 N  NE  . ARG A 1 126 ? 18.607  -31.363 -28.104 1.00 49.78 ? 190 ARG A NE  1 
ATOM   1064 C  CZ  . ARG A 1 126 ? 19.540  -30.789 -28.865 1.00 48.69 ? 190 ARG A CZ  1 
ATOM   1065 N  NH1 . ARG A 1 126 ? 20.314  -31.521 -29.647 1.00 48.34 ? 190 ARG A NH1 1 
ATOM   1066 N  NH2 . ARG A 1 126 ? 19.693  -29.477 -28.853 1.00 47.09 ? 190 ARG A NH2 1 
ATOM   1067 N  N   . GLU A 1 127 ? 15.797  -37.415 -26.788 1.00 54.95 ? 191 GLU A N   1 
ATOM   1068 C  CA  . GLU A 1 127 ? 15.367  -38.772 -27.119 1.00 55.13 ? 191 GLU A CA  1 
ATOM   1069 C  C   . GLU A 1 127 ? 13.975  -39.129 -26.549 1.00 54.28 ? 191 GLU A C   1 
ATOM   1070 O  O   . GLU A 1 127 ? 13.121  -39.665 -27.259 1.00 54.17 ? 191 GLU A O   1 
ATOM   1071 C  CB  . GLU A 1 127 ? 16.426  -39.820 -26.714 1.00 55.50 ? 191 GLU A CB  1 
ATOM   1072 C  CG  . GLU A 1 127 ? 16.160  -41.199 -27.321 1.00 57.52 ? 191 GLU A CG  1 
ATOM   1073 C  CD  . GLU A 1 127 ? 15.576  -41.102 -28.746 1.00 61.06 ? 191 GLU A CD  1 
ATOM   1074 O  OE1 . GLU A 1 127 ? 16.238  -40.508 -29.641 1.00 61.27 ? 191 GLU A OE1 1 
ATOM   1075 O  OE2 . GLU A 1 127 ? 14.444  -41.606 -28.962 1.00 62.59 ? 191 GLU A OE2 1 
ATOM   1076 N  N   . PHE A 1 128 ? 13.751  -38.818 -25.277 1.00 53.31 ? 192 PHE A N   1 
ATOM   1077 C  CA  . PHE A 1 128 ? 12.464  -39.078 -24.647 1.00 52.33 ? 192 PHE A CA  1 
ATOM   1078 C  C   . PHE A 1 128 ? 11.305  -38.411 -25.404 1.00 51.85 ? 192 PHE A C   1 
ATOM   1079 O  O   . PHE A 1 128 ? 10.273  -39.034 -25.628 1.00 51.66 ? 192 PHE A O   1 
ATOM   1080 C  CB  . PHE A 1 128 ? 12.493  -38.629 -23.181 1.00 52.26 ? 192 PHE A CB  1 
ATOM   1081 C  CG  . PHE A 1 128 ? 11.151  -38.639 -22.514 1.00 51.71 ? 192 PHE A CG  1 
ATOM   1082 C  CD1 . PHE A 1 128 ? 10.597  -39.829 -22.058 1.00 50.97 ? 192 PHE A CD1 1 
ATOM   1083 C  CD2 . PHE A 1 128 ? 10.442  -37.452 -22.332 1.00 51.22 ? 192 PHE A CD2 1 
ATOM   1084 C  CE1 . PHE A 1 128 ? 9.338   -39.846 -21.442 1.00 50.51 ? 192 PHE A CE1 1 
ATOM   1085 C  CE2 . PHE A 1 128 ? 9.187   -37.458 -21.708 1.00 51.72 ? 192 PHE A CE2 1 
ATOM   1086 C  CZ  . PHE A 1 128 ? 8.638   -38.665 -21.266 1.00 50.76 ? 192 PHE A CZ  1 
ATOM   1087 N  N   . LEU A 1 129 ? 11.481  -37.148 -25.790 1.00 51.03 ? 193 LEU A N   1 
ATOM   1088 C  CA  . LEU A 1 129 ? 10.442  -36.425 -26.515 1.00 50.37 ? 193 LEU A CA  1 
ATOM   1089 C  C   . LEU A 1 129 ? 10.207  -36.911 -27.967 1.00 50.36 ? 193 LEU A C   1 
ATOM   1090 O  O   . LEU A 1 129 ? 9.067   -36.948 -28.428 1.00 50.19 ? 193 LEU A O   1 
ATOM   1091 C  CB  . LEU A 1 129 ? 10.707  -34.915 -26.477 1.00 50.09 ? 193 LEU A CB  1 
ATOM   1092 C  CG  . LEU A 1 129 ? 10.687  -34.238 -25.107 1.00 48.71 ? 193 LEU A CG  1 
ATOM   1093 C  CD1 . LEU A 1 129 ? 11.241  -32.829 -25.197 1.00 46.17 ? 193 LEU A CD1 1 
ATOM   1094 C  CD2 . LEU A 1 129 ? 9.287   -34.243 -24.499 1.00 48.33 ? 193 LEU A CD2 1 
ATOM   1095 N  N   . PHE A 1 130 ? 11.272  -37.266 -28.682 1.00 50.52 ? 194 PHE A N   1 
ATOM   1096 C  CA  . PHE A 1 130 ? 11.145  -37.753 -30.059 1.00 51.02 ? 194 PHE A CA  1 
ATOM   1097 C  C   . PHE A 1 130 ? 10.497  -39.122 -30.100 1.00 51.94 ? 194 PHE A C   1 
ATOM   1098 O  O   . PHE A 1 130 ? 9.860   -39.492 -31.093 1.00 52.13 ? 194 PHE A O   1 
ATOM   1099 C  CB  . PHE A 1 130 ? 12.498  -37.818 -30.765 1.00 50.52 ? 194 PHE A CB  1 
ATOM   1100 C  CG  . PHE A 1 130 ? 13.143  -36.476 -30.963 1.00 49.36 ? 194 PHE A CG  1 
ATOM   1101 C  CD1 . PHE A 1 130 ? 12.377  -35.359 -31.284 1.00 48.37 ? 194 PHE A CD1 1 
ATOM   1102 C  CD2 . PHE A 1 130 ? 14.517  -36.332 -30.849 1.00 46.86 ? 194 PHE A CD2 1 
ATOM   1103 C  CE1 . PHE A 1 130 ? 12.981  -34.112 -31.464 1.00 47.78 ? 194 PHE A CE1 1 
ATOM   1104 C  CE2 . PHE A 1 130 ? 15.120  -35.097 -31.035 1.00 46.14 ? 194 PHE A CE2 1 
ATOM   1105 C  CZ  . PHE A 1 130 ? 14.347  -33.985 -31.344 1.00 45.91 ? 194 PHE A CZ  1 
ATOM   1106 N  N   . ASN A 1 131 ? 10.659  -39.867 -29.012 1.00 52.73 ? 195 ASN A N   1 
ATOM   1107 C  CA  . ASN A 1 131 ? 10.090  -41.195 -28.914 1.00 53.64 ? 195 ASN A CA  1 
ATOM   1108 C  C   . ASN A 1 131 ? 8.753   -41.166 -28.141 1.00 53.59 ? 195 ASN A C   1 
ATOM   1109 O  O   . ASN A 1 131 ? 8.337   -42.160 -27.521 1.00 53.44 ? 195 ASN A O   1 
ATOM   1110 C  CB  . ASN A 1 131 ? 11.118  -42.174 -28.315 1.00 53.89 ? 195 ASN A CB  1 
ATOM   1111 C  CG  . ASN A 1 131 ? 10.797  -43.637 -28.635 1.00 56.29 ? 195 ASN A CG  1 
ATOM   1112 O  OD1 . ASN A 1 131 ? 10.040  -43.937 -29.564 1.00 59.65 ? 195 ASN A OD1 1 
ATOM   1113 N  ND2 . ASN A 1 131 ? 11.360  -44.548 -27.857 1.00 57.10 ? 195 ASN A ND2 1 
ATOM   1114 N  N   . ALA A 1 132 ? 8.069   -40.026 -28.223 1.00 53.19 ? 196 ALA A N   1 
ATOM   1115 C  CA  . ALA A 1 132 ? 6.851   -39.804 -27.461 1.00 53.51 ? 196 ALA A CA  1 
ATOM   1116 C  C   . ALA A 1 132 ? 5.769   -40.891 -27.612 1.00 54.03 ? 196 ALA A C   1 
ATOM   1117 O  O   . ALA A 1 132 ? 5.029   -41.150 -26.661 1.00 53.99 ? 196 ALA A O   1 
ATOM   1118 C  CB  . ALA A 1 132 ? 6.288   -38.421 -27.737 1.00 52.99 ? 196 ALA A CB  1 
ATOM   1119 N  N   . ILE A 1 133 ? 5.674   -41.533 -28.778 1.00 54.72 ? 197 ILE A N   1 
ATOM   1120 C  CA  . ILE A 1 133 ? 4.691   -42.616 -28.952 1.00 55.85 ? 197 ILE A CA  1 
ATOM   1121 C  C   . ILE A 1 133 ? 4.967   -43.796 -28.007 1.00 56.50 ? 197 ILE A C   1 
ATOM   1122 O  O   . ILE A 1 133 ? 4.038   -44.345 -27.414 1.00 56.29 ? 197 ILE A O   1 
ATOM   1123 C  CB  . ILE A 1 133 ? 4.594   -43.136 -30.407 1.00 55.83 ? 197 ILE A CB  1 
ATOM   1124 C  CG1 . ILE A 1 133 ? 4.040   -42.051 -31.328 1.00 55.76 ? 197 ILE A CG1 1 
ATOM   1125 C  CG2 . ILE A 1 133 ? 3.682   -44.387 -30.470 1.00 56.15 ? 197 ILE A CG2 1 
ATOM   1126 C  CD1 . ILE A 1 133 ? 4.139   -42.366 -32.803 1.00 54.88 ? 197 ILE A CD1 1 
ATOM   1127 N  N   . GLU A 1 134 ? 6.237   -44.176 -27.875 1.00 57.35 ? 198 GLU A N   1 
ATOM   1128 C  CA  . GLU A 1 134 ? 6.616   -45.249 -26.951 1.00 58.41 ? 198 GLU A CA  1 
ATOM   1129 C  C   . GLU A 1 134 ? 6.704   -44.770 -25.513 1.00 58.42 ? 198 GLU A C   1 
ATOM   1130 O  O   . GLU A 1 134 ? 6.475   -45.562 -24.598 1.00 59.22 ? 198 GLU A O   1 
ATOM   1131 C  CB  . GLU A 1 134 ? 7.949   -45.887 -27.339 1.00 58.47 ? 198 GLU A CB  1 
ATOM   1132 C  CG  . GLU A 1 134 ? 7.977   -46.456 -28.740 1.00 61.36 ? 198 GLU A CG  1 
ATOM   1133 C  CD  . GLU A 1 134 ? 8.784   -47.742 -28.831 1.00 65.39 ? 198 GLU A CD  1 
ATOM   1134 O  OE1 . GLU A 1 134 ? 9.938   -47.782 -28.325 1.00 65.00 ? 198 GLU A OE1 1 
ATOM   1135 O  OE2 . GLU A 1 134 ? 8.251   -48.718 -29.416 1.00 66.89 ? 198 GLU A OE2 1 
ATOM   1136 N  N   . THR A 1 135 ? 7.005   -43.481 -25.321 1.00 58.36 ? 199 THR A N   1 
ATOM   1137 C  CA  . THR A 1 135 ? 7.434   -42.957 -24.013 1.00 58.25 ? 199 THR A CA  1 
ATOM   1138 C  C   . THR A 1 135 ? 6.454   -42.054 -23.262 1.00 58.86 ? 199 THR A C   1 
ATOM   1139 O  O   . THR A 1 135 ? 6.662   -41.784 -22.076 1.00 59.11 ? 199 THR A O   1 
ATOM   1140 C  CB  . THR A 1 135 ? 8.786   -42.180 -24.105 1.00 58.03 ? 199 THR A CB  1 
ATOM   1141 O  OG1 . THR A 1 135 ? 8.615   -41.001 -24.893 1.00 56.72 ? 199 THR A OG1 1 
ATOM   1142 C  CG2 . THR A 1 135 ? 9.918   -43.038 -24.685 1.00 57.22 ? 199 THR A CG2 1 
ATOM   1143 N  N   . MET A 1 136 ? 5.416   -41.562 -23.934 1.00 59.44 ? 200 MET A N   1 
ATOM   1144 C  CA  . MET A 1 136 ? 4.496   -40.612 -23.304 1.00 60.26 ? 200 MET A CA  1 
ATOM   1145 C  C   . MET A 1 136 ? 3.060   -41.100 -23.298 1.00 60.81 ? 200 MET A C   1 
ATOM   1146 O  O   . MET A 1 136 ? 2.417   -41.142 -24.334 1.00 60.95 ? 200 MET A O   1 
ATOM   1147 C  CB  . MET A 1 136 ? 4.571   -39.243 -23.979 1.00 60.22 ? 200 MET A CB  1 
ATOM   1148 C  CG  . MET A 1 136 ? 5.760   -38.421 -23.574 1.00 60.20 ? 200 MET A CG  1 
ATOM   1149 S  SD  . MET A 1 136 ? 5.984   -36.928 -24.562 1.00 60.68 ? 200 MET A SD  1 
ATOM   1150 C  CE  . MET A 1 136 ? 4.385   -36.156 -24.429 1.00 59.46 ? 200 MET A CE  1 
ATOM   1151 N  N   . PRO A 1 137 ? 2.549   -41.475 -22.121 1.00 61.75 ? 201 PRO A N   1 
ATOM   1152 C  CA  . PRO A 1 137 ? 1.185   -41.996 -22.003 1.00 62.52 ? 201 PRO A CA  1 
ATOM   1153 C  C   . PRO A 1 137 ? 0.115   -41.016 -22.487 1.00 63.17 ? 201 PRO A C   1 
ATOM   1154 O  O   . PRO A 1 137 ? -0.899  -41.449 -23.055 1.00 63.60 ? 201 PRO A O   1 
ATOM   1155 C  CB  . PRO A 1 137 ? 1.033   -42.248 -20.498 1.00 62.70 ? 201 PRO A CB  1 
ATOM   1156 C  CG  . PRO A 1 137 ? 2.434   -42.486 -20.019 1.00 62.64 ? 201 PRO A CG  1 
ATOM   1157 C  CD  . PRO A 1 137 ? 3.288   -41.562 -20.850 1.00 61.98 ? 201 PRO A CD  1 
ATOM   1158 N  N   . CYS A 1 138 ? 0.343   -39.715 -22.288 1.00 63.44 ? 202 CYS A N   1 
ATOM   1159 C  CA  . CYS A 1 138 ? -0.636  -38.700 -22.687 1.00 63.84 ? 202 CYS A CA  1 
ATOM   1160 C  C   . CYS A 1 138 ? -1.021  -38.761 -24.179 1.00 63.65 ? 202 CYS A C   1 
ATOM   1161 O  O   . CYS A 1 138 ? -2.166  -38.434 -24.551 1.00 64.03 ? 202 CYS A O   1 
ATOM   1162 C  CB  . CYS A 1 138 ? -0.214  -37.285 -22.232 1.00 64.11 ? 202 CYS A CB  1 
ATOM   1163 S  SG  . CYS A 1 138 ? 1.372   -36.570 -22.853 1.00 66.87 ? 202 CYS A SG  1 
ATOM   1164 N  N   . VAL A 1 139 ? -0.087  -39.223 -25.015 1.00 63.15 ? 203 VAL A N   1 
ATOM   1165 C  CA  . VAL A 1 139 ? -0.308  -39.282 -26.461 1.00 62.49 ? 203 VAL A CA  1 
ATOM   1166 C  C   . VAL A 1 139 ? -0.754  -40.657 -26.943 1.00 62.83 ? 203 VAL A C   1 
ATOM   1167 O  O   . VAL A 1 139 ? -1.067  -40.828 -28.120 1.00 62.95 ? 203 VAL A O   1 
ATOM   1168 C  CB  . VAL A 1 139 ? 0.926   -38.763 -27.299 1.00 62.34 ? 203 VAL A CB  1 
ATOM   1169 C  CG1 . VAL A 1 139 ? 1.477   -37.476 -26.718 1.00 61.37 ? 203 VAL A CG1 1 
ATOM   1170 C  CG2 . VAL A 1 139 ? 2.024   -39.808 -27.432 1.00 61.02 ? 203 VAL A CG2 1 
ATOM   1171 N  N   . LYS A 1 140 ? -0.789  -41.636 -26.039 1.00 63.10 ? 204 LYS A N   1 
ATOM   1172 C  CA  . LYS A 1 140 ? -1.143  -43.012 -26.420 1.00 63.15 ? 204 LYS A CA  1 
ATOM   1173 C  C   . LYS A 1 140 ? -2.509  -43.067 -27.092 1.00 62.36 ? 204 LYS A C   1 
ATOM   1174 O  O   . LYS A 1 140 ? -2.627  -43.550 -28.211 1.00 62.14 ? 204 LYS A O   1 
ATOM   1175 C  CB  . LYS A 1 140 ? -1.101  -43.963 -25.210 1.00 63.78 ? 204 LYS A CB  1 
ATOM   1176 C  CG  . LYS A 1 140 ? -0.999  -45.467 -25.573 1.00 65.03 ? 204 LYS A CG  1 
ATOM   1177 C  CD  . LYS A 1 140 ? -1.061  -46.351 -24.321 1.00 67.98 ? 204 LYS A CD  1 
ATOM   1178 C  CE  . LYS A 1 140 ? -1.750  -47.710 -24.587 1.00 69.46 ? 204 LYS A CE  1 
ATOM   1179 N  NZ  . LYS A 1 140 ? -1.029  -48.561 -25.589 1.00 69.81 ? 204 LYS A NZ  1 
ATOM   1180 N  N   . LYS A 1 141 ? -3.522  -42.552 -26.398 1.00 62.00 ? 205 LYS A N   1 
ATOM   1181 C  CA  . LYS A 1 141 ? -4.903  -42.542 -26.879 1.00 61.75 ? 205 LYS A CA  1 
ATOM   1182 C  C   . LYS A 1 141 ? -5.019  -41.967 -28.285 1.00 61.01 ? 205 LYS A C   1 
ATOM   1183 O  O   . LYS A 1 141 ? -5.483  -42.656 -29.203 1.00 61.21 ? 205 LYS A O   1 
ATOM   1184 C  CB  . LYS A 1 141 ? -5.821  -41.777 -25.916 1.00 61.90 ? 205 LYS A CB  1 
ATOM   1185 C  CG  . LYS A 1 141 ? -6.573  -42.671 -24.945 1.00 64.13 ? 205 LYS A CG  1 
ATOM   1186 C  CD  . LYS A 1 141 ? -7.815  -41.970 -24.388 1.00 68.02 ? 205 LYS A CD  1 
ATOM   1187 C  CE  . LYS A 1 141 ? -8.905  -42.965 -23.941 1.00 70.21 ? 205 LYS A CE  1 
ATOM   1188 N  NZ  . LYS A 1 141 ? -8.512  -43.793 -22.749 1.00 70.82 ? 205 LYS A NZ  1 
ATOM   1189 N  N   . LYS A 1 142 ? -4.581  -40.717 -28.448 1.00 59.85 ? 206 LYS A N   1 
ATOM   1190 C  CA  . LYS A 1 142 ? -4.639  -40.040 -29.732 1.00 58.49 ? 206 LYS A CA  1 
ATOM   1191 C  C   . LYS A 1 142 ? -3.880  -40.796 -30.815 1.00 58.16 ? 206 LYS A C   1 
ATOM   1192 O  O   . LYS A 1 142 ? -4.416  -41.012 -31.903 1.00 58.40 ? 206 LYS A O   1 
ATOM   1193 C  CB  . LYS A 1 142 ? -4.168  -38.597 -29.608 1.00 58.16 ? 206 LYS A CB  1 
ATOM   1194 C  CG  . LYS A 1 142 ? -5.153  -37.770 -28.839 1.00 57.09 ? 206 LYS A CG  1 
ATOM   1195 C  CD  . LYS A 1 142 ? -5.144  -36.324 -29.242 1.00 55.41 ? 206 LYS A CD  1 
ATOM   1196 C  CE  . LYS A 1 142 ? -4.286  -35.503 -28.323 1.00 54.51 ? 206 LYS A CE  1 
ATOM   1197 N  NZ  . LYS A 1 142 ? -4.356  -34.057 -28.664 1.00 53.82 ? 206 LYS A NZ  1 
ATOM   1198 N  N   . ALA A 1 143 ? -2.661  -41.226 -30.507 1.00 57.42 ? 207 ALA A N   1 
ATOM   1199 C  CA  . ALA A 1 143 ? -1.862  -41.997 -31.450 1.00 57.06 ? 207 ALA A CA  1 
ATOM   1200 C  C   . ALA A 1 143 ? -2.504  -43.323 -31.861 1.00 57.05 ? 207 ALA A C   1 
ATOM   1201 O  O   . ALA A 1 143 ? -2.593  -43.627 -33.059 1.00 56.99 ? 207 ALA A O   1 
ATOM   1202 C  CB  . ALA A 1 143 ? -0.461  -42.224 -30.911 1.00 56.86 ? 207 ALA A CB  1 
ATOM   1203 N  N   . ASP A 1 144 ? -2.944  -44.113 -30.882 1.00 57.06 ? 208 ASP A N   1 
ATOM   1204 C  CA  . ASP A 1 144 ? -3.552  -45.419 -31.179 1.00 57.30 ? 208 ASP A CA  1 
ATOM   1205 C  C   . ASP A 1 144 ? -4.817  -45.277 -32.036 1.00 56.85 ? 208 ASP A C   1 
ATOM   1206 O  O   . ASP A 1 144 ? -5.047  -46.061 -32.964 1.00 56.40 ? 208 ASP A O   1 
ATOM   1207 C  CB  . ASP A 1 144 ? -3.842  -46.211 -29.894 1.00 57.52 ? 208 ASP A CB  1 
ATOM   1208 C  CG  . ASP A 1 144 ? -2.612  -46.963 -29.368 1.00 59.12 ? 208 ASP A CG  1 
ATOM   1209 O  OD1 . ASP A 1 144 ? -1.626  -47.108 -30.135 1.00 59.16 ? 208 ASP A OD1 1 
ATOM   1210 O  OD2 . ASP A 1 144 ? -2.637  -47.408 -28.187 1.00 59.86 ? 208 ASP A OD2 1 
ATOM   1211 N  N   . TRP A 1 145 ? -5.609  -44.258 -31.718 1.00 56.51 ? 209 TRP A N   1 
ATOM   1212 C  CA  . TRP A 1 145 ? -6.803  -43.927 -32.460 1.00 56.72 ? 209 TRP A CA  1 
ATOM   1213 C  C   . TRP A 1 145 ? -6.490  -43.702 -33.938 1.00 57.10 ? 209 TRP A C   1 
ATOM   1214 O  O   . TRP A 1 145 ? -7.028  -44.394 -34.799 1.00 57.41 ? 209 TRP A O   1 
ATOM   1215 C  CB  . TRP A 1 145 ? -7.423  -42.679 -31.869 1.00 56.58 ? 209 TRP A CB  1 
ATOM   1216 C  CG  . TRP A 1 145 ? -8.849  -42.502 -32.217 1.00 57.16 ? 209 TRP A CG  1 
ATOM   1217 C  CD1 . TRP A 1 145 ? -9.925  -43.034 -31.562 1.00 57.31 ? 209 TRP A CD1 1 
ATOM   1218 C  CD2 . TRP A 1 145 ? -9.379  -41.731 -33.301 1.00 57.60 ? 209 TRP A CD2 1 
ATOM   1219 N  NE1 . TRP A 1 145 ? -11.095 -42.634 -32.164 1.00 56.98 ? 209 TRP A NE1 1 
ATOM   1220 C  CE2 . TRP A 1 145 ? -10.794 -41.836 -33.235 1.00 57.08 ? 209 TRP A CE2 1 
ATOM   1221 C  CE3 . TRP A 1 145 ? -8.801  -40.966 -34.325 1.00 56.83 ? 209 TRP A CE3 1 
ATOM   1222 C  CZ2 . TRP A 1 145 ? -11.639 -41.201 -34.149 1.00 56.32 ? 209 TRP A CZ2 1 
ATOM   1223 C  CZ3 . TRP A 1 145 ? -9.644  -40.331 -35.240 1.00 56.68 ? 209 TRP A CZ3 1 
ATOM   1224 C  CH2 . TRP A 1 145 ? -11.048 -40.450 -35.140 1.00 56.88 ? 209 TRP A CH2 1 
ATOM   1225 N  N   . ALA A 1 146 ? -5.608  -42.749 -34.223 1.00 57.25 ? 210 ALA A N   1 
ATOM   1226 C  CA  . ALA A 1 146 ? -5.170  -42.498 -35.585 1.00 57.77 ? 210 ALA A CA  1 
ATOM   1227 C  C   . ALA A 1 146 ? -4.621  -43.755 -36.247 1.00 58.27 ? 210 ALA A C   1 
ATOM   1228 O  O   . ALA A 1 146 ? -5.080  -44.128 -37.324 1.00 58.45 ? 210 ALA A O   1 
ATOM   1229 C  CB  . ALA A 1 146 ? -4.149  -41.375 -35.627 1.00 57.65 ? 210 ALA A CB  1 
ATOM   1230 N  N   . LEU A 1 147 ? -3.669  -44.424 -35.599 1.00 58.84 ? 211 LEU A N   1 
ATOM   1231 C  CA  . LEU A 1 147 ? -3.070  -45.619 -36.179 1.00 59.68 ? 211 LEU A CA  1 
ATOM   1232 C  C   . LEU A 1 147 ? -4.097  -46.707 -36.492 1.00 60.48 ? 211 LEU A C   1 
ATOM   1233 O  O   . LEU A 1 147 ? -3.957  -47.430 -37.472 1.00 60.66 ? 211 LEU A O   1 
ATOM   1234 C  CB  . LEU A 1 147 ? -1.935  -46.155 -35.304 1.00 59.72 ? 211 LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1 147 ? -0.594  -45.398 -35.363 1.00 59.41 ? 211 LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1 147 ? 0.273   -45.741 -34.164 1.00 58.63 ? 211 LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1 147 ? 0.169   -45.670 -36.659 1.00 58.75 ? 211 LEU A CD2 1 
ATOM   1238 N  N   . ARG A 1 148 ? -5.146  -46.798 -35.683 1.00 61.50 ? 212 ARG A N   1 
ATOM   1239 C  CA  . ARG A 1 148 ? -6.223  -47.764 -35.925 1.00 62.53 ? 212 ARG A CA  1 
ATOM   1240 C  C   . ARG A 1 148 ? -6.859  -47.584 -37.309 1.00 62.37 ? 212 ARG A C   1 
ATOM   1241 O  O   . ARG A 1 148 ? -7.185  -48.565 -37.969 1.00 62.54 ? 212 ARG A O   1 
ATOM   1242 C  CB  . ARG A 1 148 ? -7.281  -47.676 -34.810 1.00 63.12 ? 212 ARG A CB  1 
ATOM   1243 C  CG  . ARG A 1 148 ? -8.246  -48.864 -34.700 1.00 65.14 ? 212 ARG A CG  1 
ATOM   1244 C  CD  . ARG A 1 148 ? -8.519  -49.249 -33.220 1.00 69.59 ? 212 ARG A CD  1 
ATOM   1245 N  NE  . ARG A 1 148 ? -9.033  -48.143 -32.387 1.00 71.80 ? 212 ARG A NE  1 
ATOM   1246 C  CZ  . ARG A 1 148 ? -8.434  -47.638 -31.299 1.00 71.45 ? 212 ARG A CZ  1 
ATOM   1247 N  NH1 . ARG A 1 148 ? -7.270  -48.117 -30.852 1.00 70.60 ? 212 ARG A NH1 1 
ATOM   1248 N  NH2 . ARG A 1 148 ? -9.014  -46.643 -30.644 1.00 70.73 ? 212 ARG A NH2 1 
ATOM   1249 N  N   . TRP A 1 149 ? -7.012  -46.335 -37.744 1.00 62.32 ? 213 TRP A N   1 
ATOM   1250 C  CA  . TRP A 1 149 ? -7.611  -46.033 -39.048 1.00 62.35 ? 213 TRP A CA  1 
ATOM   1251 C  C   . TRP A 1 149 ? -6.712  -46.340 -40.243 1.00 62.56 ? 213 TRP A C   1 
ATOM   1252 O  O   . TRP A 1 149 ? -7.195  -46.421 -41.370 1.00 62.80 ? 213 TRP A O   1 
ATOM   1253 C  CB  . TRP A 1 149 ? -8.051  -44.575 -39.122 1.00 62.34 ? 213 TRP A CB  1 
ATOM   1254 C  CG  . TRP A 1 149 ? -9.103  -44.239 -38.156 1.00 62.05 ? 213 TRP A CG  1 
ATOM   1255 C  CD1 . TRP A 1 149 ? -8.945  -43.566 -36.993 1.00 63.11 ? 213 TRP A CD1 1 
ATOM   1256 C  CD2 . TRP A 1 149 ? -10.487 -44.572 -38.249 1.00 62.14 ? 213 TRP A CD2 1 
ATOM   1257 N  NE1 . TRP A 1 149 ? -10.148 -43.449 -36.342 1.00 63.90 ? 213 TRP A NE1 1 
ATOM   1258 C  CE2 . TRP A 1 149 ? -11.116 -44.057 -37.095 1.00 63.27 ? 213 TRP A CE2 1 
ATOM   1259 C  CE3 . TRP A 1 149 ? -11.261 -45.251 -39.196 1.00 61.67 ? 213 TRP A CE3 1 
ATOM   1260 C  CZ2 . TRP A 1 149 ? -12.488 -44.196 -36.860 1.00 62.89 ? 213 TRP A CZ2 1 
ATOM   1261 C  CZ3 . TRP A 1 149 ? -12.623 -45.387 -38.965 1.00 61.69 ? 213 TRP A CZ3 1 
ATOM   1262 C  CH2 . TRP A 1 149 ? -13.223 -44.861 -37.806 1.00 62.39 ? 213 TRP A CH2 1 
ATOM   1263 N  N   . ILE A 1 150 ? -5.410  -46.476 -40.014 1.00 62.66 ? 214 ILE A N   1 
ATOM   1264 C  CA  . ILE A 1 150 ? -4.505  -46.869 -41.079 1.00 62.70 ? 214 ILE A CA  1 
ATOM   1265 C  C   . ILE A 1 150 ? -4.623  -48.375 -41.231 1.00 63.52 ? 214 ILE A C   1 
ATOM   1266 O  O   . ILE A 1 150 ? -4.648  -48.897 -42.348 1.00 63.91 ? 214 ILE A O   1 
ATOM   1267 C  CB  . ILE A 1 150 ? -3.046  -46.438 -40.791 1.00 62.42 ? 214 ILE A CB  1 
ATOM   1268 C  CG1 . ILE A 1 150 ? -2.956  -44.904 -40.720 1.00 62.67 ? 214 ILE A CG1 1 
ATOM   1269 C  CG2 . ILE A 1 150 ? -2.111  -46.970 -41.849 1.00 61.43 ? 214 ILE A CG2 1 
ATOM   1270 C  CD1 . ILE A 1 150 ? -1.675  -44.349 -40.120 1.00 61.03 ? 214 ILE A CD1 1 
ATOM   1271 N  N   . GLY A 1 151 ? -4.733  -49.067 -40.100 1.00 63.96 ? 215 GLY A N   1 
ATOM   1272 C  CA  . GLY A 1 151 ? -4.771  -50.520 -40.089 1.00 64.80 ? 215 GLY A CA  1 
ATOM   1273 C  C   . GLY A 1 151 ? -6.109  -51.090 -40.516 1.00 65.40 ? 215 GLY A C   1 
ATOM   1274 O  O   . GLY A 1 151 ? -6.172  -52.198 -41.057 1.00 65.41 ? 215 GLY A O   1 
ATOM   1275 N  N   . ASP A 1 152 ? -7.175  -50.326 -40.275 1.00 65.97 ? 216 ASP A N   1 
ATOM   1276 C  CA  . ASP A 1 152 ? -8.543  -50.757 -40.545 1.00 66.41 ? 216 ASP A CA  1 
ATOM   1277 C  C   . ASP A 1 152 ? -8.739  -51.043 -42.024 1.00 66.92 ? 216 ASP A C   1 
ATOM   1278 O  O   . ASP A 1 152 ? -8.841  -50.128 -42.837 1.00 67.14 ? 216 ASP A O   1 
ATOM   1279 C  CB  . ASP A 1 152 ? -9.532  -49.693 -40.074 1.00 66.38 ? 216 ASP A CB  1 
ATOM   1280 C  CG  . ASP A 1 152 ? -10.963 -50.204 -40.003 1.00 67.08 ? 216 ASP A CG  1 
ATOM   1281 O  OD1 . ASP A 1 152 ? -11.415 -50.937 -40.920 1.00 68.47 ? 216 ASP A OD1 1 
ATOM   1282 O  OD2 . ASP A 1 152 ? -11.648 -49.854 -39.024 1.00 66.43 ? 216 ASP A OD2 1 
ATOM   1283 N  N   . LYS A 1 153 ? -8.795  -52.325 -42.366 1.00 67.53 ? 217 LYS A N   1 
ATOM   1284 C  CA  . LYS A 1 153 ? -8.913  -52.744 -43.761 1.00 67.96 ? 217 LYS A CA  1 
ATOM   1285 C  C   . LYS A 1 153 ? -10.357 -52.703 -44.295 1.00 67.69 ? 217 LYS A C   1 
ATOM   1286 O  O   . LYS A 1 153 ? -10.572 -52.799 -45.503 1.00 67.47 ? 217 LYS A O   1 
ATOM   1287 C  CB  . LYS A 1 153 ? -8.273  -54.117 -43.945 1.00 68.23 ? 217 LYS A CB  1 
ATOM   1288 C  CG  . LYS A 1 153 ? -6.745  -54.071 -43.986 1.00 70.56 ? 217 LYS A CG  1 
ATOM   1289 C  CD  . LYS A 1 153 ? -6.132  -55.460 -43.740 1.00 74.52 ? 217 LYS A CD  1 
ATOM   1290 C  CE  . LYS A 1 153 ? -4.758  -55.624 -44.423 1.00 76.03 ? 217 LYS A CE  1 
ATOM   1291 N  NZ  . LYS A 1 153 ? -3.732  -54.637 -43.954 1.00 76.57 ? 217 LYS A NZ  1 
ATOM   1292 N  N   . GLU A 1 154 ? -11.327 -52.533 -43.390 1.00 67.36 ? 218 GLU A N   1 
ATOM   1293 C  CA  . GLU A 1 154 ? -12.753 -52.536 -43.738 1.00 67.14 ? 218 GLU A CA  1 
ATOM   1294 C  C   . GLU A 1 154 ? -13.380 -51.143 -43.917 1.00 65.94 ? 218 GLU A C   1 
ATOM   1295 O  O   . GLU A 1 154 ? -14.271 -50.969 -44.753 1.00 65.87 ? 218 GLU A O   1 
ATOM   1296 C  CB  . GLU A 1 154 ? -13.579 -53.335 -42.704 1.00 67.97 ? 218 GLU A CB  1 
ATOM   1297 C  CG  . GLU A 1 154 ? -13.115 -54.787 -42.428 1.00 71.49 ? 218 GLU A CG  1 
ATOM   1298 C  CD  . GLU A 1 154 ? -12.993 -55.663 -43.700 1.00 76.35 ? 218 GLU A CD  1 
ATOM   1299 O  OE1 . GLU A 1 154 ? -13.794 -55.481 -44.658 1.00 76.21 ? 218 GLU A OE1 1 
ATOM   1300 O  OE2 . GLU A 1 154 ? -12.083 -56.539 -43.731 1.00 78.01 ? 218 GLU A OE2 1 
ATOM   1301 N  N   . ALA A 1 155 ? -12.945 -50.161 -43.128 1.00 64.44 ? 219 ALA A N   1 
ATOM   1302 C  CA  . ALA A 1 155 ? -13.514 -48.806 -43.223 1.00 62.93 ? 219 ALA A CA  1 
ATOM   1303 C  C   . ALA A 1 155 ? -13.315 -48.175 -44.603 1.00 61.93 ? 219 ALA A C   1 
ATOM   1304 O  O   . ALA A 1 155 ? -12.270 -48.343 -45.237 1.00 61.59 ? 219 ALA A O   1 
ATOM   1305 C  CB  . ALA A 1 155 ? -12.960 -47.897 -42.131 1.00 62.75 ? 219 ALA A CB  1 
ATOM   1306 N  N   . THR A 1 156 ? -14.336 -47.459 -45.056 1.00 60.89 ? 220 THR A N   1 
ATOM   1307 C  CA  . THR A 1 156 ? -14.312 -46.795 -46.352 1.00 60.01 ? 220 THR A CA  1 
ATOM   1308 C  C   . THR A 1 156 ? -13.375 -45.592 -46.325 1.00 59.46 ? 220 THR A C   1 
ATOM   1309 O  O   . THR A 1 156 ? -13.010 -45.094 -45.251 1.00 59.48 ? 220 THR A O   1 
ATOM   1310 C  CB  . THR A 1 156 ? -15.714 -46.278 -46.752 1.00 60.02 ? 220 THR A CB  1 
ATOM   1311 O  OG1 . THR A 1 156 ? -16.130 -45.269 -45.826 1.00 59.82 ? 220 THR A OG1 1 
ATOM   1312 C  CG2 . THR A 1 156 ? -16.739 -47.409 -46.770 1.00 59.49 ? 220 THR A CG2 1 
ATOM   1313 N  N   . TYR A 1 157 ? -12.994 -45.129 -47.510 1.00 58.36 ? 221 TYR A N   1 
ATOM   1314 C  CA  . TYR A 1 157 ? -12.278 -43.877 -47.634 1.00 57.22 ? 221 TYR A CA  1 
ATOM   1315 C  C   . TYR A 1 157 ? -13.120 -42.770 -46.999 1.00 57.26 ? 221 TYR A C   1 
ATOM   1316 O  O   . TYR A 1 157 ? -12.595 -41.895 -46.314 1.00 57.56 ? 221 TYR A O   1 
ATOM   1317 C  CB  . TYR A 1 157 ? -11.963 -43.577 -49.102 1.00 56.72 ? 221 TYR A CB  1 
ATOM   1318 C  CG  . TYR A 1 157 ? -11.382 -42.208 -49.328 1.00 55.16 ? 221 TYR A CG  1 
ATOM   1319 C  CD1 . TYR A 1 157 ? -10.054 -41.930 -49.000 1.00 52.76 ? 221 TYR A CD1 1 
ATOM   1320 C  CD2 . TYR A 1 157 ? -12.163 -41.186 -49.861 1.00 53.54 ? 221 TYR A CD2 1 
ATOM   1321 C  CE1 . TYR A 1 157 ? -9.521  -40.676 -49.196 1.00 52.20 ? 221 TYR A CE1 1 
ATOM   1322 C  CE2 . TYR A 1 157 ? -11.643 -39.927 -50.064 1.00 53.02 ? 221 TYR A CE2 1 
ATOM   1323 C  CZ  . TYR A 1 157 ? -10.317 -39.674 -49.729 1.00 53.34 ? 221 TYR A CZ  1 
ATOM   1324 O  OH  . TYR A 1 157 ? -9.799  -38.409 -49.929 1.00 53.69 ? 221 TYR A OH  1 
ATOM   1325 N  N   . GLY A 1 158 ? -14.432 -42.838 -47.197 1.00 57.15 ? 222 GLY A N   1 
ATOM   1326 C  CA  . GLY A 1 158 ? -15.341 -41.833 -46.680 1.00 56.94 ? 222 GLY A CA  1 
ATOM   1327 C  C   . GLY A 1 158 ? -15.225 -41.680 -45.184 1.00 57.08 ? 222 GLY A C   1 
ATOM   1328 O  O   . GLY A 1 158 ? -15.249 -40.562 -44.668 1.00 57.44 ? 222 GLY A O   1 
ATOM   1329 N  N   . GLU A 1 159 ? -15.100 -42.808 -44.484 1.00 56.95 ? 223 GLU A N   1 
ATOM   1330 C  CA  . GLU A 1 159 ? -14.950 -42.802 -43.025 1.00 56.68 ? 223 GLU A CA  1 
ATOM   1331 C  C   . GLU A 1 159 ? -13.566 -42.312 -42.614 1.00 55.90 ? 223 GLU A C   1 
ATOM   1332 O  O   . GLU A 1 159 ? -13.425 -41.524 -41.671 1.00 55.93 ? 223 GLU A O   1 
ATOM   1333 C  CB  . GLU A 1 159 ? -15.212 -44.192 -42.448 1.00 56.82 ? 223 GLU A CB  1 
ATOM   1334 C  CG  . GLU A 1 159 ? -16.699 -44.555 -42.369 1.00 58.76 ? 223 GLU A CG  1 
ATOM   1335 C  CD  . GLU A 1 159 ? -16.948 -46.055 -42.264 1.00 61.93 ? 223 GLU A CD  1 
ATOM   1336 O  OE1 . GLU A 1 159 ? -16.315 -46.830 -43.019 1.00 63.36 ? 223 GLU A OE1 1 
ATOM   1337 O  OE2 . GLU A 1 159 ? -17.787 -46.464 -41.433 1.00 63.88 ? 223 GLU A OE2 1 
ATOM   1338 N  N   . ARG A 1 160 ? -12.554 -42.758 -43.350 1.00 54.70 ? 224 ARG A N   1 
ATOM   1339 C  CA  . ARG A 1 160 ? -11.168 -42.478 -42.997 1.00 53.35 ? 224 ARG A CA  1 
ATOM   1340 C  C   . ARG A 1 160 ? -10.738 -41.011 -43.222 1.00 52.76 ? 224 ARG A C   1 
ATOM   1341 O  O   . ARG A 1 160 ? -9.999  -40.472 -42.400 1.00 51.95 ? 224 ARG A O   1 
ATOM   1342 C  CB  . ARG A 1 160 ? -10.237 -43.521 -43.619 1.00 52.91 ? 224 ARG A CB  1 
ATOM   1343 C  CG  . ARG A 1 160 ? -10.498 -44.946 -43.049 1.00 53.40 ? 224 ARG A CG  1 
ATOM   1344 C  CD  . ARG A 1 160 ? -10.149 -46.096 -44.034 1.00 54.21 ? 224 ARG A CD  1 
ATOM   1345 N  NE  . ARG A 1 160 ? -9.006  -45.695 -44.839 1.00 56.10 ? 224 ARG A NE  1 
ATOM   1346 C  CZ  . ARG A 1 160 ? -8.934  -45.696 -46.163 1.00 54.62 ? 224 ARG A CZ  1 
ATOM   1347 N  NH1 . ARG A 1 160 ? -9.913  -46.166 -46.930 1.00 51.89 ? 224 ARG A NH1 1 
ATOM   1348 N  NH2 . ARG A 1 160 ? -7.822  -45.239 -46.712 1.00 55.91 ? 224 ARG A NH2 1 
ATOM   1349 N  N   . VAL A 1 161 ? -11.232 -40.351 -44.280 1.00 52.27 ? 225 VAL A N   1 
ATOM   1350 C  CA  . VAL A 1 161 ? -11.053 -38.891 -44.386 1.00 52.09 ? 225 VAL A CA  1 
ATOM   1351 C  C   . VAL A 1 161 ? -11.702 -38.157 -43.231 1.00 51.67 ? 225 VAL A C   1 
ATOM   1352 O  O   . VAL A 1 161 ? -11.200 -37.119 -42.803 1.00 52.30 ? 225 VAL A O   1 
ATOM   1353 C  CB  . VAL A 1 161 ? -11.610 -38.221 -45.667 1.00 52.16 ? 225 VAL A CB  1 
ATOM   1354 C  CG1 . VAL A 1 161 ? -10.537 -38.111 -46.720 1.00 53.17 ? 225 VAL A CG1 1 
ATOM   1355 C  CG2 . VAL A 1 161 ? -12.879 -38.886 -46.179 1.00 52.41 ? 225 VAL A CG2 1 
ATOM   1356 N  N   . VAL A 1 162 ? -12.825 -38.663 -42.740 1.00 50.78 ? 226 VAL A N   1 
ATOM   1357 C  CA  . VAL A 1 162 ? -13.429 -38.044 -41.577 1.00 50.16 ? 226 VAL A CA  1 
ATOM   1358 C  C   . VAL A 1 162 ? -12.463 -38.194 -40.401 1.00 49.90 ? 226 VAL A C   1 
ATOM   1359 O  O   . VAL A 1 162 ? -12.099 -37.193 -39.762 1.00 50.26 ? 226 VAL A O   1 
ATOM   1360 C  CB  . VAL A 1 162 ? -14.831 -38.611 -41.274 1.00 50.15 ? 226 VAL A CB  1 
ATOM   1361 C  CG1 . VAL A 1 162 ? -15.298 -38.182 -39.910 1.00 49.46 ? 226 VAL A CG1 1 
ATOM   1362 C  CG2 . VAL A 1 162 ? -15.813 -38.129 -42.323 1.00 49.64 ? 226 VAL A CG2 1 
ATOM   1363 N  N   . ALA A 1 163 ? -12.011 -39.431 -40.169 1.00 48.77 ? 227 ALA A N   1 
ATOM   1364 C  CA  . ALA A 1 163 ? -11.055 -39.754 -39.105 1.00 47.57 ? 227 ALA A CA  1 
ATOM   1365 C  C   . ALA A 1 163 ? -9.807  -38.858 -39.106 1.00 47.29 ? 227 ALA A C   1 
ATOM   1366 O  O   . ALA A 1 163 ? -9.363  -38.371 -38.052 1.00 47.11 ? 227 ALA A O   1 
ATOM   1367 C  CB  . ALA A 1 163 ? -10.656 -41.224 -39.189 1.00 46.98 ? 227 ALA A CB  1 
ATOM   1368 N  N   . PHE A 1 164 ? -9.236  -38.635 -40.283 1.00 46.76 ? 228 PHE A N   1 
ATOM   1369 C  CA  . PHE A 1 164 ? -8.028  -37.828 -40.338 1.00 46.42 ? 228 PHE A CA  1 
ATOM   1370 C  C   . PHE A 1 164 ? -8.286  -36.342 -40.352 1.00 46.55 ? 228 PHE A C   1 
ATOM   1371 O  O   . PHE A 1 164 ? -7.402  -35.552 -39.973 1.00 46.24 ? 228 PHE A O   1 
ATOM   1372 C  CB  . PHE A 1 164 ? -7.047  -38.306 -41.403 1.00 45.83 ? 228 PHE A CB  1 
ATOM   1373 C  CG  . PHE A 1 164 ? -6.176  -39.418 -40.913 1.00 45.85 ? 228 PHE A CG  1 
ATOM   1374 C  CD1 . PHE A 1 164 ? -6.548  -40.752 -41.107 1.00 46.00 ? 228 PHE A CD1 1 
ATOM   1375 C  CD2 . PHE A 1 164 ? -5.024  -39.138 -40.173 1.00 44.24 ? 228 PHE A CD2 1 
ATOM   1376 C  CE1 . PHE A 1 164 ? -5.748  -41.805 -40.621 1.00 45.71 ? 228 PHE A CE1 1 
ATOM   1377 C  CE2 . PHE A 1 164 ? -4.217  -40.174 -39.682 1.00 43.74 ? 228 PHE A CE2 1 
ATOM   1378 C  CZ  . PHE A 1 164 ? -4.580  -41.512 -39.909 1.00 45.25 ? 228 PHE A CZ  1 
ATOM   1379 N  N   . ALA A 1 165 ? -9.509  -35.962 -40.728 1.00 46.43 ? 229 ALA A N   1 
ATOM   1380 C  CA  . ALA A 1 165 ? -9.916  -34.576 -40.568 1.00 46.72 ? 229 ALA A CA  1 
ATOM   1381 C  C   . ALA A 1 165 ? -10.116 -34.368 -39.078 1.00 47.15 ? 229 ALA A C   1 
ATOM   1382 O  O   . ALA A 1 165 ? -9.863  -33.284 -38.553 1.00 47.63 ? 229 ALA A O   1 
ATOM   1383 C  CB  . ALA A 1 165 ? -11.170 -34.290 -41.319 1.00 46.57 ? 229 ALA A CB  1 
ATOM   1384 N  N   . ALA A 1 166 ? -10.555 -35.416 -38.387 1.00 47.06 ? 230 ALA A N   1 
ATOM   1385 C  CA  . ALA A 1 166 ? -10.656 -35.332 -36.943 1.00 47.16 ? 230 ALA A CA  1 
ATOM   1386 C  C   . ALA A 1 166 ? -9.256  -35.238 -36.346 1.00 47.22 ? 230 ALA A C   1 
ATOM   1387 O  O   . ALA A 1 166 ? -9.015  -34.411 -35.478 1.00 47.53 ? 230 ALA A O   1 
ATOM   1388 C  CB  . ALA A 1 166 ? -11.434 -36.510 -36.371 1.00 46.96 ? 230 ALA A CB  1 
ATOM   1389 N  N   . VAL A 1 167 ? -8.327  -36.060 -36.832 1.00 47.07 ? 231 VAL A N   1 
ATOM   1390 C  CA  . VAL A 1 167 ? -6.952  -35.994 -36.347 1.00 46.69 ? 231 VAL A CA  1 
ATOM   1391 C  C   . VAL A 1 167 ? -6.367  -34.589 -36.497 1.00 46.52 ? 231 VAL A C   1 
ATOM   1392 O  O   . VAL A 1 167 ? -5.879  -34.017 -35.536 1.00 46.85 ? 231 VAL A O   1 
ATOM   1393 C  CB  . VAL A 1 167 ? -6.041  -37.042 -37.023 1.00 46.33 ? 231 VAL A CB  1 
ATOM   1394 C  CG1 . VAL A 1 167 ? -4.590  -36.835 -36.626 1.00 45.83 ? 231 VAL A CG1 1 
ATOM   1395 C  CG2 . VAL A 1 167 ? -6.474  -38.421 -36.627 1.00 46.85 ? 231 VAL A CG2 1 
ATOM   1396 N  N   . GLU A 1 168 ? -6.424  -34.031 -37.696 1.00 46.42 ? 232 GLU A N   1 
ATOM   1397 C  CA  . GLU A 1 168 ? -5.752  -32.759 -37.958 1.00 46.13 ? 232 GLU A CA  1 
ATOM   1398 C  C   . GLU A 1 168 ? -6.591  -31.570 -37.494 1.00 46.41 ? 232 GLU A C   1 
ATOM   1399 O  O   . GLU A 1 168 ? -6.086  -30.455 -37.356 1.00 46.75 ? 232 GLU A O   1 
ATOM   1400 C  CB  . GLU A 1 168 ? -5.397  -32.631 -39.445 1.00 46.02 ? 232 GLU A CB  1 
ATOM   1401 C  CG  . GLU A 1 168 ? -4.503  -33.753 -39.978 1.00 44.91 ? 232 GLU A CG  1 
ATOM   1402 C  CD  . GLU A 1 168 ? -4.191  -33.607 -41.453 1.00 44.72 ? 232 GLU A CD  1 
ATOM   1403 O  OE1 . GLU A 1 168 ? -3.410  -32.716 -41.803 1.00 46.14 ? 232 GLU A OE1 1 
ATOM   1404 O  OE2 . GLU A 1 168 ? -4.716  -34.387 -42.272 1.00 46.64 ? 232 GLU A OE2 1 
ATOM   1405 N  N   . GLY A 1 169 ? -7.871  -31.818 -37.247 1.00 46.67 ? 233 GLY A N   1 
ATOM   1406 C  CA  . GLY A 1 169 ? -8.808  -30.782 -36.847 1.00 47.13 ? 233 GLY A CA  1 
ATOM   1407 C  C   . GLY A 1 169 ? -9.081  -30.779 -35.359 1.00 47.67 ? 233 GLY A C   1 
ATOM   1408 O  O   . GLY A 1 169 ? -9.109  -29.726 -34.739 1.00 48.86 ? 233 GLY A O   1 
ATOM   1409 N  N   . ILE A 1 170 ? -9.271  -31.948 -34.768 1.00 47.54 ? 234 ILE A N   1 
ATOM   1410 C  CA  . ILE A 1 170 ? -9.695  -32.020 -33.376 1.00 47.33 ? 234 ILE A CA  1 
ATOM   1411 C  C   . ILE A 1 170 ? -8.524  -32.370 -32.457 1.00 47.31 ? 234 ILE A C   1 
ATOM   1412 O  O   . ILE A 1 170 ? -8.306  -31.698 -31.452 1.00 47.50 ? 234 ILE A O   1 
ATOM   1413 C  CB  . ILE A 1 170 ? -10.916 -32.986 -33.217 1.00 47.58 ? 234 ILE A CB  1 
ATOM   1414 C  CG1 . ILE A 1 170 ? -12.154 -32.369 -33.911 1.00 47.99 ? 234 ILE A CG1 1 
ATOM   1415 C  CG2 . ILE A 1 170 ? -11.181 -33.340 -31.740 1.00 46.67 ? 234 ILE A CG2 1 
ATOM   1416 C  CD1 . ILE A 1 170 ? -13.335 -33.317 -34.109 1.00 46.27 ? 234 ILE A CD1 1 
ATOM   1417 N  N   . PHE A 1 171 ? -7.759  -33.398 -32.812 1.00 46.63 ? 235 PHE A N   1 
ATOM   1418 C  CA  . PHE A 1 171 ? -6.582  -33.754 -32.048 1.00 46.48 ? 235 PHE A CA  1 
ATOM   1419 C  C   . PHE A 1 171 ? -5.529  -32.638 -31.970 1.00 46.90 ? 235 PHE A C   1 
ATOM   1420 O  O   . PHE A 1 171 ? -4.706  -32.630 -31.058 1.00 47.48 ? 235 PHE A O   1 
ATOM   1421 C  CB  . PHE A 1 171 ? -5.971  -35.036 -32.604 1.00 46.22 ? 235 PHE A CB  1 
ATOM   1422 C  CG  . PHE A 1 171 ? -6.751  -36.273 -32.262 1.00 46.11 ? 235 PHE A CG  1 
ATOM   1423 C  CD1 . PHE A 1 171 ? -8.017  -36.186 -31.676 1.00 44.99 ? 235 PHE A CD1 1 
ATOM   1424 C  CD2 . PHE A 1 171 ? -6.230  -37.532 -32.538 1.00 46.21 ? 235 PHE A CD2 1 
ATOM   1425 C  CE1 . PHE A 1 171 ? -8.738  -37.333 -31.353 1.00 44.86 ? 235 PHE A CE1 1 
ATOM   1426 C  CE2 . PHE A 1 171 ? -6.944  -38.690 -32.222 1.00 45.68 ? 235 PHE A CE2 1 
ATOM   1427 C  CZ  . PHE A 1 171 ? -8.204  -38.585 -31.631 1.00 45.80 ? 235 PHE A CZ  1 
ATOM   1428 N  N   . PHE A 1 172 ? -5.548  -31.693 -32.903 1.00 46.71 ? 236 PHE A N   1 
ATOM   1429 C  CA  . PHE A 1 172 ? -4.591  -30.604 -32.850 1.00 46.66 ? 236 PHE A CA  1 
ATOM   1430 C  C   . PHE A 1 172 ? -5.162  -29.314 -32.247 1.00 47.32 ? 236 PHE A C   1 
ATOM   1431 O  O   . PHE A 1 172 ? -4.404  -28.445 -31.811 1.00 47.39 ? 236 PHE A O   1 
ATOM   1432 C  CB  . PHE A 1 172 ? -3.998  -30.308 -34.245 1.00 46.52 ? 236 PHE A CB  1 
ATOM   1433 C  CG  . PHE A 1 172 ? -3.154  -31.430 -34.838 1.00 44.27 ? 236 PHE A CG  1 
ATOM   1434 C  CD1 . PHE A 1 172 ? -2.688  -32.493 -34.059 1.00 42.37 ? 236 PHE A CD1 1 
ATOM   1435 C  CD2 . PHE A 1 172 ? -2.799  -31.387 -36.188 1.00 41.39 ? 236 PHE A CD2 1 
ATOM   1436 C  CE1 . PHE A 1 172 ? -1.915  -33.520 -34.628 1.00 42.48 ? 236 PHE A CE1 1 
ATOM   1437 C  CE2 . PHE A 1 172 ? -2.023  -32.399 -36.770 1.00 40.74 ? 236 PHE A CE2 1 
ATOM   1438 C  CZ  . PHE A 1 172 ? -1.575  -33.472 -35.993 1.00 40.67 ? 236 PHE A CZ  1 
ATOM   1439 N  N   . SER A 1 173 ? -6.483  -29.173 -32.225 1.00 47.89 ? 237 SER A N   1 
ATOM   1440 C  CA  . SER A 1 173 ? -7.093  -27.869 -31.897 1.00 48.89 ? 237 SER A CA  1 
ATOM   1441 C  C   . SER A 1 173 ? -6.769  -27.345 -30.503 1.00 49.32 ? 237 SER A C   1 
ATOM   1442 O  O   . SER A 1 173 ? -6.512  -26.148 -30.336 1.00 50.30 ? 237 SER A O   1 
ATOM   1443 C  CB  . SER A 1 173 ? -8.602  -27.897 -32.082 1.00 48.69 ? 237 SER A CB  1 
ATOM   1444 O  OG  . SER A 1 173 ? -9.158  -28.979 -31.357 1.00 49.64 ? 237 SER A OG  1 
ATOM   1445 N  N   . GLY A 1 174 ? -6.794  -28.225 -29.504 1.00 49.19 ? 238 GLY A N   1 
ATOM   1446 C  CA  . GLY A 1 174 ? -6.430  -27.833 -28.149 1.00 48.86 ? 238 GLY A CA  1 
ATOM   1447 C  C   . GLY A 1 174 ? -4.995  -27.347 -28.063 1.00 48.77 ? 238 GLY A C   1 
ATOM   1448 O  O   . GLY A 1 174 ? -4.714  -26.304 -27.447 1.00 48.48 ? 238 GLY A O   1 
ATOM   1449 N  N   . SER A 1 175 ? -4.084  -28.092 -28.687 1.00 48.10 ? 239 SER A N   1 
ATOM   1450 C  CA  . SER A 1 175 ? -2.685  -27.729 -28.635 1.00 48.17 ? 239 SER A CA  1 
ATOM   1451 C  C   . SER A 1 175 ? -2.425  -26.401 -29.343 1.00 48.22 ? 239 SER A C   1 
ATOM   1452 O  O   . SER A 1 175 ? -1.663  -25.564 -28.841 1.00 47.86 ? 239 SER A O   1 
ATOM   1453 C  CB  . SER A 1 175 ? -1.817  -28.836 -29.194 1.00 48.06 ? 239 SER A CB  1 
ATOM   1454 O  OG  . SER A 1 175 ? -1.932  -29.994 -28.395 1.00 49.14 ? 239 SER A OG  1 
ATOM   1455 N  N   . PHE A 1 176 ? -3.076  -26.206 -30.486 1.00 48.18 ? 240 PHE A N   1 
ATOM   1456 C  CA  . PHE A 1 176 ? -2.996  -24.940 -31.205 1.00 48.74 ? 240 PHE A CA  1 
ATOM   1457 C  C   . PHE A 1 176 ? -3.467  -23.777 -30.339 1.00 49.07 ? 240 PHE A C   1 
ATOM   1458 O  O   . PHE A 1 176 ? -2.811  -22.721 -30.290 1.00 49.43 ? 240 PHE A O   1 
ATOM   1459 C  CB  . PHE A 1 176 ? -3.850  -24.962 -32.475 1.00 48.71 ? 240 PHE A CB  1 
ATOM   1460 C  CG  . PHE A 1 176 ? -3.258  -25.750 -33.614 1.00 48.00 ? 240 PHE A CG  1 
ATOM   1461 C  CD1 . PHE A 1 176 ? -1.880  -25.817 -33.802 1.00 47.04 ? 240 PHE A CD1 1 
ATOM   1462 C  CD2 . PHE A 1 176 ? -4.101  -26.388 -34.537 1.00 46.04 ? 240 PHE A CD2 1 
ATOM   1463 C  CE1 . PHE A 1 176 ? -1.343  -26.534 -34.874 1.00 47.13 ? 240 PHE A CE1 1 
ATOM   1464 C  CE2 . PHE A 1 176 ? -3.578  -27.099 -35.605 1.00 45.61 ? 240 PHE A CE2 1 
ATOM   1465 C  CZ  . PHE A 1 176 ? -2.197  -27.180 -35.774 1.00 46.86 ? 240 PHE A CZ  1 
ATOM   1466 N  N   . ALA A 1 177 ? -4.607  -23.967 -29.675 1.00 49.02 ? 241 ALA A N   1 
ATOM   1467 C  CA  . ALA A 1 177 ? -5.147  -22.967 -28.753 1.00 49.35 ? 241 ALA A CA  1 
ATOM   1468 C  C   . ALA A 1 177 ? -4.140  -22.606 -27.646 1.00 49.51 ? 241 ALA A C   1 
ATOM   1469 O  O   . ALA A 1 177 ? -3.937  -21.424 -27.335 1.00 49.49 ? 241 ALA A O   1 
ATOM   1470 C  CB  . ALA A 1 177 ? -6.457  -23.464 -28.151 1.00 49.59 ? 241 ALA A CB  1 
ATOM   1471 N  N   . SER A 1 178 ? -3.514  -23.630 -27.068 1.00 49.47 ? 242 SER A N   1 
ATOM   1472 C  CA  . SER A 1 178 ? -2.417  -23.448 -26.134 1.00 50.05 ? 242 SER A CA  1 
ATOM   1473 C  C   . SER A 1 178 ? -1.385  -22.444 -26.615 1.00 50.09 ? 242 SER A C   1 
ATOM   1474 O  O   . SER A 1 178 ? -0.977  -21.560 -25.860 1.00 49.98 ? 242 SER A O   1 
ATOM   1475 C  CB  . SER A 1 178 ? -1.698  -24.774 -25.921 1.00 50.30 ? 242 SER A CB  1 
ATOM   1476 O  OG  . SER A 1 178 ? -2.491  -25.642 -25.149 1.00 52.50 ? 242 SER A OG  1 
ATOM   1477 N  N   . ILE A 1 179 ? -0.935  -22.601 -27.858 1.00 50.16 ? 243 ILE A N   1 
ATOM   1478 C  CA  . ILE A 1 179 ? 0.195   -21.822 -28.325 1.00 50.48 ? 243 ILE A CA  1 
ATOM   1479 C  C   . ILE A 1 179 ? -0.278  -20.412 -28.642 1.00 51.05 ? 243 ILE A C   1 
ATOM   1480 O  O   . ILE A 1 179 ? 0.471   -19.450 -28.488 1.00 51.19 ? 243 ILE A O   1 
ATOM   1481 C  CB  . ILE A 1 179 ? 0.907   -22.426 -29.562 1.00 50.32 ? 243 ILE A CB  1 
ATOM   1482 C  CG1 . ILE A 1 179 ? 1.071   -23.957 -29.482 1.00 49.64 ? 243 ILE A CG1 1 
ATOM   1483 C  CG2 . ILE A 1 179 ? 2.229   -21.731 -29.804 1.00 50.04 ? 243 ILE A CG2 1 
ATOM   1484 C  CD1 . ILE A 1 179 ? 1.980   -24.450 -28.431 1.00 49.27 ? 243 ILE A CD1 1 
ATOM   1485 N  N   . PHE A 1 180 ? -1.523  -20.286 -29.081 1.00 51.47 ? 244 PHE A N   1 
ATOM   1486 C  CA  . PHE A 1 180 ? -2.085  -18.962 -29.296 1.00 51.94 ? 244 PHE A CA  1 
ATOM   1487 C  C   . PHE A 1 180 ? -2.268  -18.267 -27.953 1.00 52.50 ? 244 PHE A C   1 
ATOM   1488 O  O   . PHE A 1 180 ? -2.094  -17.055 -27.857 1.00 53.00 ? 244 PHE A O   1 
ATOM   1489 C  CB  . PHE A 1 180 ? -3.398  -19.016 -30.091 1.00 51.74 ? 244 PHE A CB  1 
ATOM   1490 C  CG  . PHE A 1 180 ? -3.210  -19.052 -31.604 1.00 51.03 ? 244 PHE A CG  1 
ATOM   1491 C  CD1 . PHE A 1 180 ? -2.820  -17.914 -32.304 1.00 49.61 ? 244 PHE A CD1 1 
ATOM   1492 C  CD2 . PHE A 1 180 ? -3.462  -20.223 -32.326 1.00 50.25 ? 244 PHE A CD2 1 
ATOM   1493 C  CE1 . PHE A 1 180 ? -2.667  -17.945 -33.700 1.00 50.56 ? 244 PHE A CE1 1 
ATOM   1494 C  CE2 . PHE A 1 180 ? -3.321  -20.263 -33.723 1.00 49.53 ? 244 PHE A CE2 1 
ATOM   1495 C  CZ  . PHE A 1 180 ? -2.921  -19.129 -34.411 1.00 49.71 ? 244 PHE A CZ  1 
ATOM   1496 N  N   . TRP A 1 181 ? -2.590  -19.036 -26.915 1.00 53.03 ? 245 TRP A N   1 
ATOM   1497 C  CA  . TRP A 1 181 ? -2.628  -18.510 -25.551 1.00 53.53 ? 245 TRP A CA  1 
ATOM   1498 C  C   . TRP A 1 181 ? -1.288  -17.873 -25.188 1.00 53.45 ? 245 TRP A C   1 
ATOM   1499 O  O   . TRP A 1 181 ? -1.250  -16.742 -24.714 1.00 53.48 ? 245 TRP A O   1 
ATOM   1500 C  CB  . TRP A 1 181 ? -3.008  -19.608 -24.560 1.00 53.79 ? 245 TRP A CB  1 
ATOM   1501 C  CG  . TRP A 1 181 ? -3.064  -19.171 -23.136 1.00 56.09 ? 245 TRP A CG  1 
ATOM   1502 C  CD1 . TRP A 1 181 ? -2.223  -19.549 -22.139 1.00 57.60 ? 245 TRP A CD1 1 
ATOM   1503 C  CD2 . TRP A 1 181 ? -4.020  -18.283 -22.539 1.00 59.61 ? 245 TRP A CD2 1 
ATOM   1504 N  NE1 . TRP A 1 181 ? -2.583  -18.953 -20.956 1.00 59.04 ? 245 TRP A NE1 1 
ATOM   1505 C  CE2 . TRP A 1 181 ? -3.682  -18.167 -21.170 1.00 60.16 ? 245 TRP A CE2 1 
ATOM   1506 C  CE3 . TRP A 1 181 ? -5.131  -17.570 -23.027 1.00 60.95 ? 245 TRP A CE3 1 
ATOM   1507 C  CZ2 . TRP A 1 181 ? -4.414  -17.362 -20.274 1.00 61.81 ? 245 TRP A CZ2 1 
ATOM   1508 C  CZ3 . TRP A 1 181 ? -5.867  -16.771 -22.133 1.00 62.10 ? 245 TRP A CZ3 1 
ATOM   1509 C  CH2 . TRP A 1 181 ? -5.499  -16.673 -20.774 1.00 62.27 ? 245 TRP A CH2 1 
ATOM   1510 N  N   . LEU A 1 182 ? -0.190  -18.575 -25.456 1.00 53.39 ? 246 LEU A N   1 
ATOM   1511 C  CA  . LEU A 1 182 ? 1.134   -18.029 -25.185 1.00 53.35 ? 246 LEU A CA  1 
ATOM   1512 C  C   . LEU A 1 182 ? 1.383   -16.760 -25.963 1.00 54.00 ? 246 LEU A C   1 
ATOM   1513 O  O   . LEU A 1 182 ? 2.108   -15.887 -25.489 1.00 54.20 ? 246 LEU A O   1 
ATOM   1514 C  CB  . LEU A 1 182 ? 2.235   -19.031 -25.506 1.00 52.88 ? 246 LEU A CB  1 
ATOM   1515 C  CG  . LEU A 1 182 ? 2.219   -20.322 -24.703 1.00 52.02 ? 246 LEU A CG  1 
ATOM   1516 C  CD1 . LEU A 1 182 ? 3.173   -21.292 -25.329 1.00 51.04 ? 246 LEU A CD1 1 
ATOM   1517 C  CD2 . LEU A 1 182 ? 2.575   -20.083 -23.246 1.00 51.50 ? 246 LEU A CD2 1 
ATOM   1518 N  N   . LYS A 1 183 ? 0.792   -16.661 -27.154 1.00 54.71 ? 247 LYS A N   1 
ATOM   1519 C  CA  . LYS A 1 183 ? 0.926   -15.460 -27.966 1.00 55.81 ? 247 LYS A CA  1 
ATOM   1520 C  C   . LYS A 1 183 ? 0.250   -14.285 -27.268 1.00 56.37 ? 247 LYS A C   1 
ATOM   1521 O  O   . LYS A 1 183 ? 0.796   -13.175 -27.222 1.00 56.49 ? 247 LYS A O   1 
ATOM   1522 C  CB  . LYS A 1 183 ? 0.322   -15.640 -29.359 1.00 56.05 ? 247 LYS A CB  1 
ATOM   1523 C  CG  . LYS A 1 183 ? 0.629   -14.462 -30.273 1.00 56.68 ? 247 LYS A CG  1 
ATOM   1524 C  CD  . LYS A 1 183 ? -0.146  -14.504 -31.568 1.00 58.51 ? 247 LYS A CD  1 
ATOM   1525 C  CE  . LYS A 1 183 ? 0.191   -13.260 -32.394 1.00 59.71 ? 247 LYS A CE  1 
ATOM   1526 N  NZ  . LYS A 1 183 ? -0.825  -13.027 -33.447 1.00 60.01 ? 247 LYS A NZ  1 
ATOM   1527 N  N   . LYS A 1 184 ? -0.938  -14.546 -26.726 1.00 56.65 ? 248 LYS A N   1 
ATOM   1528 C  CA  . LYS A 1 184 ? -1.673  -13.552 -25.973 1.00 57.01 ? 248 LYS A CA  1 
ATOM   1529 C  C   . LYS A 1 184 ? -0.820  -13.066 -24.793 1.00 56.71 ? 248 LYS A C   1 
ATOM   1530 O  O   . LYS A 1 184 ? -0.755  -11.864 -24.519 1.00 56.71 ? 248 LYS A O   1 
ATOM   1531 C  CB  . LYS A 1 184 ? -3.029  -14.114 -25.523 1.00 57.04 ? 248 LYS A CB  1 
ATOM   1532 C  CG  . LYS A 1 184 ? -3.880  -13.133 -24.737 1.00 58.92 ? 248 LYS A CG  1 
ATOM   1533 C  CD  . LYS A 1 184 ? -5.345  -13.210 -25.152 1.00 61.85 ? 248 LYS A CD  1 
ATOM   1534 C  CE  . LYS A 1 184 ? -6.082  -11.884 -24.888 1.00 62.78 ? 248 LYS A CE  1 
ATOM   1535 N  NZ  . LYS A 1 184 ? -7.186  -11.710 -25.877 1.00 61.99 ? 248 LYS A NZ  1 
ATOM   1536 N  N   . ARG A 1 185 ? -0.137  -13.997 -24.132 1.00 56.15 ? 249 ARG A N   1 
ATOM   1537 C  CA  . ARG A 1 185 ? 0.737   -13.656 -23.016 1.00 55.84 ? 249 ARG A CA  1 
ATOM   1538 C  C   . ARG A 1 185 ? 2.045   -13.015 -23.457 1.00 55.78 ? 249 ARG A C   1 
ATOM   1539 O  O   . ARG A 1 185 ? 2.890   -12.721 -22.621 1.00 55.58 ? 249 ARG A O   1 
ATOM   1540 C  CB  . ARG A 1 185 ? 1.035   -14.887 -22.170 1.00 55.81 ? 249 ARG A CB  1 
ATOM   1541 C  CG  . ARG A 1 185 ? -0.177  -15.429 -21.423 1.00 55.92 ? 249 ARG A CG  1 
ATOM   1542 C  CD  . ARG A 1 185 ? 0.105   -16.809 -20.863 1.00 54.86 ? 249 ARG A CD  1 
ATOM   1543 N  NE  . ARG A 1 185 ? 1.253   -16.801 -19.959 1.00 54.50 ? 249 ARG A NE  1 
ATOM   1544 C  CZ  . ARG A 1 185 ? 1.712   -17.869 -19.317 1.00 53.27 ? 249 ARG A CZ  1 
ATOM   1545 N  NH1 . ARG A 1 185 ? 1.121   -19.053 -19.469 1.00 53.39 ? 249 ARG A NH1 1 
ATOM   1546 N  NH2 . ARG A 1 185 ? 2.764   -17.752 -18.521 1.00 52.35 ? 249 ARG A NH2 1 
ATOM   1547 N  N   . GLY A 1 186 ? 2.208   -12.798 -24.764 1.00 55.83 ? 250 GLY A N   1 
ATOM   1548 C  CA  . GLY A 1 186 ? 3.395   -12.127 -25.312 1.00 55.58 ? 250 GLY A CA  1 
ATOM   1549 C  C   . GLY A 1 186 ? 4.664   -12.962 -25.235 1.00 55.76 ? 250 GLY A C   1 
ATOM   1550 O  O   . GLY A 1 186 ? 5.774   -12.419 -25.229 1.00 56.09 ? 250 GLY A O   1 
ATOM   1551 N  N   . LEU A 1 187 ? 4.502   -14.285 -25.197 1.00 55.41 ? 251 LEU A N   1 
ATOM   1552 C  CA  . LEU A 1 187 ? 5.620   -15.205 -24.992 1.00 55.20 ? 251 LEU A CA  1 
ATOM   1553 C  C   . LEU A 1 187 ? 6.049   -15.982 -26.255 1.00 54.91 ? 251 LEU A C   1 
ATOM   1554 O  O   . LEU A 1 187 ? 5.212   -16.564 -26.966 1.00 54.91 ? 251 LEU A O   1 
ATOM   1555 C  CB  . LEU A 1 187 ? 5.302   -16.177 -23.839 1.00 55.25 ? 251 LEU A CB  1 
ATOM   1556 C  CG  . LEU A 1 187 ? 4.871   -15.579 -22.476 1.00 55.87 ? 251 LEU A CG  1 
ATOM   1557 C  CD1 . LEU A 1 187 ? 4.350   -16.644 -21.515 1.00 55.03 ? 251 LEU A CD1 1 
ATOM   1558 C  CD2 . LEU A 1 187 ? 5.977   -14.776 -21.805 1.00 54.75 ? 251 LEU A CD2 1 
ATOM   1559 N  N   . MET A 1 188 ? 7.356   -15.961 -26.525 1.00 54.12 ? 252 MET A N   1 
ATOM   1560 C  CA  . MET A 1 188 ? 8.005   -16.834 -27.528 1.00 53.39 ? 252 MET A CA  1 
ATOM   1561 C  C   . MET A 1 188 ? 7.595   -16.671 -29.007 1.00 52.74 ? 252 MET A C   1 
ATOM   1562 O  O   . MET A 1 188 ? 7.027   -17.594 -29.591 1.00 52.44 ? 252 MET A O   1 
ATOM   1563 C  CB  . MET A 1 188 ? 7.898   -18.294 -27.085 1.00 53.12 ? 252 MET A CB  1 
ATOM   1564 C  CG  . MET A 1 188 ? 8.828   -18.581 -25.946 1.00 52.89 ? 252 MET A CG  1 
ATOM   1565 S  SD  . MET A 1 188 ? 8.410   -20.042 -25.026 1.00 52.09 ? 252 MET A SD  1 
ATOM   1566 C  CE  . MET A 1 188 ? 9.064   -21.333 -26.094 1.00 50.70 ? 252 MET A CE  1 
ATOM   1567 N  N   . PRO A 1 189 ? 7.931   -15.518 -29.624 1.00 52.43 ? 253 PRO A N   1 
ATOM   1568 C  CA  . PRO A 1 189 ? 7.452   -15.221 -30.993 1.00 52.09 ? 253 PRO A CA  1 
ATOM   1569 C  C   . PRO A 1 189 ? 7.759   -16.312 -32.029 1.00 51.42 ? 253 PRO A C   1 
ATOM   1570 O  O   . PRO A 1 189 ? 6.958   -16.536 -32.937 1.00 51.33 ? 253 PRO A O   1 
ATOM   1571 C  CB  . PRO A 1 189 ? 8.158   -13.898 -31.352 1.00 51.97 ? 253 PRO A CB  1 
ATOM   1572 C  CG  . PRO A 1 189 ? 9.217   -13.714 -30.325 1.00 52.11 ? 253 PRO A CG  1 
ATOM   1573 C  CD  . PRO A 1 189 ? 8.754   -14.418 -29.087 1.00 52.07 ? 253 PRO A CD  1 
ATOM   1574 N  N   . GLY A 1 190 ? 8.892   -16.991 -31.877 1.00 50.77 ? 254 GLY A N   1 
ATOM   1575 C  CA  . GLY A 1 190 ? 9.277   -18.064 -32.795 1.00 50.28 ? 254 GLY A CA  1 
ATOM   1576 C  C   . GLY A 1 190 ? 8.290   -19.217 -32.757 1.00 50.19 ? 254 GLY A C   1 
ATOM   1577 O  O   . GLY A 1 190 ? 7.813   -19.687 -33.793 1.00 50.19 ? 254 GLY A O   1 
ATOM   1578 N  N   . LEU A 1 191 ? 7.980   -19.670 -31.549 1.00 49.92 ? 255 LEU A N   1 
ATOM   1579 C  CA  . LEU A 1 191 ? 7.014   -20.730 -31.356 1.00 49.44 ? 255 LEU A CA  1 
ATOM   1580 C  C   . LEU A 1 191 ? 5.652   -20.330 -31.884 1.00 49.70 ? 255 LEU A C   1 
ATOM   1581 O  O   . LEU A 1 191 ? 5.036   -21.067 -32.648 1.00 50.34 ? 255 LEU A O   1 
ATOM   1582 C  CB  . LEU A 1 191 ? 6.899   -21.049 -29.880 1.00 49.41 ? 255 LEU A CB  1 
ATOM   1583 C  CG  . LEU A 1 191 ? 5.834   -22.051 -29.480 1.00 48.28 ? 255 LEU A CG  1 
ATOM   1584 C  CD1 . LEU A 1 191 ? 6.206   -23.415 -30.005 1.00 48.17 ? 255 LEU A CD1 1 
ATOM   1585 C  CD2 . LEU A 1 191 ? 5.737   -22.055 -27.987 1.00 46.92 ? 255 LEU A CD2 1 
ATOM   1586 N  N   . THR A 1 192 ? 5.181   -19.155 -31.486 1.00 49.60 ? 256 THR A N   1 
ATOM   1587 C  CA  . THR A 1 192 ? 3.825   -18.758 -31.819 1.00 49.36 ? 256 THR A CA  1 
ATOM   1588 C  C   . THR A 1 192 ? 3.671   -18.453 -33.302 1.00 49.02 ? 256 THR A C   1 
ATOM   1589 O  O   . THR A 1 192 ? 2.611   -18.693 -33.872 1.00 48.66 ? 256 THR A O   1 
ATOM   1590 C  CB  . THR A 1 192 ? 3.366   -17.589 -30.961 1.00 49.49 ? 256 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 192 ? 4.284   -16.503 -31.122 1.00 50.49 ? 256 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 192 ? 3.334   -18.013 -29.502 1.00 48.82 ? 256 THR A CG2 1 
ATOM   1593 N  N   . PHE A 1 193 ? 4.733   -17.935 -33.920 1.00 48.99 ? 257 PHE A N   1 
ATOM   1594 C  CA  . PHE A 1 193 ? 4.735   -17.702 -35.363 1.00 49.09 ? 257 PHE A CA  1 
ATOM   1595 C  C   . PHE A 1 193 ? 4.712   -19.015 -36.146 1.00 48.75 ? 257 PHE A C   1 
ATOM   1596 O  O   . PHE A 1 193 ? 3.937   -19.162 -37.084 1.00 48.97 ? 257 PHE A O   1 
ATOM   1597 C  CB  . PHE A 1 193 ? 5.922   -16.847 -35.812 1.00 49.05 ? 257 PHE A CB  1 
ATOM   1598 C  CG  . PHE A 1 193 ? 5.912   -16.549 -37.286 1.00 51.64 ? 257 PHE A CG  1 
ATOM   1599 C  CD1 . PHE A 1 193 ? 4.870   -15.791 -37.855 1.00 54.13 ? 257 PHE A CD1 1 
ATOM   1600 C  CD2 . PHE A 1 193 ? 6.917   -17.037 -38.119 1.00 53.14 ? 257 PHE A CD2 1 
ATOM   1601 C  CE1 . PHE A 1 193 ? 4.832   -15.510 -39.240 1.00 54.09 ? 257 PHE A CE1 1 
ATOM   1602 C  CE2 . PHE A 1 193 ? 6.899   -16.763 -39.500 1.00 54.48 ? 257 PHE A CE2 1 
ATOM   1603 C  CZ  . PHE A 1 193 ? 5.846   -15.997 -40.063 1.00 54.60 ? 257 PHE A CZ  1 
ATOM   1604 N  N   . SER A 1 194 ? 5.560   -19.967 -35.767 1.00 48.24 ? 258 SER A N   1 
ATOM   1605 C  CA  . SER A 1 194 ? 5.539   -21.268 -36.413 1.00 47.96 ? 258 SER A CA  1 
ATOM   1606 C  C   . SER A 1 194 ? 4.174   -21.926 -36.184 1.00 47.69 ? 258 SER A C   1 
ATOM   1607 O  O   . SER A 1 194 ? 3.637   -22.575 -37.073 1.00 47.50 ? 258 SER A O   1 
ATOM   1608 C  CB  . SER A 1 194 ? 6.689   -22.164 -35.933 1.00 47.89 ? 258 SER A CB  1 
ATOM   1609 O  OG  . SER A 1 194 ? 6.527   -22.518 -34.574 1.00 46.96 ? 258 SER A OG  1 
ATOM   1610 N  N   . ASN A 1 195 ? 3.612   -21.734 -34.999 1.00 47.44 ? 259 ASN A N   1 
ATOM   1611 C  CA  . ASN A 1 195 ? 2.242   -22.152 -34.752 1.00 47.72 ? 259 ASN A CA  1 
ATOM   1612 C  C   . ASN A 1 195 ? 1.197   -21.508 -35.691 1.00 48.36 ? 259 ASN A C   1 
ATOM   1613 O  O   . ASN A 1 195 ? 0.226   -22.162 -36.080 1.00 48.58 ? 259 ASN A O   1 
ATOM   1614 C  CB  . ASN A 1 195 ? 1.849   -21.916 -33.304 1.00 47.16 ? 259 ASN A CB  1 
ATOM   1615 C  CG  . ASN A 1 195 ? 0.624   -22.685 -32.926 1.00 46.74 ? 259 ASN A CG  1 
ATOM   1616 O  OD1 . ASN A 1 195 ? 0.644   -23.911 -32.876 1.00 47.02 ? 259 ASN A OD1 1 
ATOM   1617 N  ND2 . ASN A 1 195 ? -0.455  -21.981 -32.658 1.00 46.82 ? 259 ASN A ND2 1 
ATOM   1618 N  N   . GLU A 1 196 ? 1.383   -20.241 -36.056 1.00 48.59 ? 260 GLU A N   1 
ATOM   1619 C  CA  . GLU A 1 196 ? 0.474   -19.632 -37.009 1.00 49.39 ? 260 GLU A CA  1 
ATOM   1620 C  C   . GLU A 1 196 ? 0.527   -20.389 -38.348 1.00 48.66 ? 260 GLU A C   1 
ATOM   1621 O  O   . GLU A 1 196 ? -0.513  -20.756 -38.903 1.00 48.92 ? 260 GLU A O   1 
ATOM   1622 C  CB  . GLU A 1 196 ? 0.757   -18.127 -37.175 1.00 50.09 ? 260 GLU A CB  1 
ATOM   1623 C  CG  . GLU A 1 196 ? 0.162   -17.248 -36.047 1.00 53.94 ? 260 GLU A CG  1 
ATOM   1624 C  CD  . GLU A 1 196 ? 0.927   -15.938 -35.814 1.00 58.56 ? 260 GLU A CD  1 
ATOM   1625 O  OE1 . GLU A 1 196 ? 1.360   -15.297 -36.804 1.00 61.85 ? 260 GLU A OE1 1 
ATOM   1626 O  OE2 . GLU A 1 196 ? 1.099   -15.547 -34.634 1.00 59.83 ? 260 GLU A OE2 1 
ATOM   1627 N  N   . LEU A 1 197 ? 1.736   -20.644 -38.843 1.00 47.52 ? 261 LEU A N   1 
ATOM   1628 C  CA  . LEU A 1 197 ? 1.913   -21.281 -40.145 1.00 46.42 ? 261 LEU A CA  1 
ATOM   1629 C  C   . LEU A 1 197 ? 1.317   -22.676 -40.152 1.00 46.08 ? 261 LEU A C   1 
ATOM   1630 O  O   . LEU A 1 197 ? 0.611   -23.039 -41.093 1.00 46.12 ? 261 LEU A O   1 
ATOM   1631 C  CB  . LEU A 1 197 ? 3.392   -21.309 -40.577 1.00 45.94 ? 261 LEU A CB  1 
ATOM   1632 C  CG  . LEU A 1 197 ? 4.138   -19.952 -40.612 1.00 45.09 ? 261 LEU A CG  1 
ATOM   1633 C  CD1 . LEU A 1 197 ? 5.627   -20.131 -40.857 1.00 41.10 ? 261 LEU A CD1 1 
ATOM   1634 C  CD2 . LEU A 1 197 ? 3.541   -18.961 -41.627 1.00 42.56 ? 261 LEU A CD2 1 
ATOM   1635 N  N   . ILE A 1 198 ? 1.578   -23.445 -39.098 1.00 45.28 ? 262 ILE A N   1 
ATOM   1636 C  CA  . ILE A 1 198 ? 1.128   -24.833 -39.046 1.00 45.01 ? 262 ILE A CA  1 
ATOM   1637 C  C   . ILE A 1 198 ? -0.394  -24.993 -38.865 1.00 45.07 ? 262 ILE A C   1 
ATOM   1638 O  O   . ILE A 1 198 ? -0.998  -25.850 -39.497 1.00 44.87 ? 262 ILE A O   1 
ATOM   1639 C  CB  . ILE A 1 198 ? 1.917   -25.676 -38.008 1.00 44.87 ? 262 ILE A CB  1 
ATOM   1640 C  CG1 . ILE A 1 198 ? 3.410   -25.681 -38.367 1.00 45.19 ? 262 ILE A CG1 1 
ATOM   1641 C  CG2 . ILE A 1 198 ? 1.398   -27.094 -37.979 1.00 43.07 ? 262 ILE A CG2 1 
ATOM   1642 C  CD1 . ILE A 1 198 ? 4.321   -26.264 -37.292 1.00 44.47 ? 262 ILE A CD1 1 
ATOM   1643 N  N   . SER A 1 199 ? -1.018  -24.175 -38.027 1.00 45.28 ? 263 SER A N   1 
ATOM   1644 C  CA  . SER A 1 199 ? -2.470  -24.253 -37.900 1.00 45.84 ? 263 SER A CA  1 
ATOM   1645 C  C   . SER A 1 199 ? -3.155  -23.804 -39.186 1.00 45.77 ? 263 SER A C   1 
ATOM   1646 O  O   . SER A 1 199 ? -4.191  -24.363 -39.568 1.00 46.35 ? 263 SER A O   1 
ATOM   1647 C  CB  . SER A 1 199 ? -3.001  -23.499 -36.686 1.00 45.54 ? 263 SER A CB  1 
ATOM   1648 O  OG  . SER A 1 199 ? -2.691  -22.133 -36.784 1.00 48.28 ? 263 SER A OG  1 
ATOM   1649 N  N   . ARG A 1 200 ? -2.572  -22.836 -39.882 1.00 45.31 ? 264 ARG A N   1 
ATOM   1650 C  CA  . ARG A 1 200 ? -3.112  -22.498 -41.190 1.00 45.42 ? 264 ARG A CA  1 
ATOM   1651 C  C   . ARG A 1 200 ? -3.080  -23.731 -42.127 1.00 45.41 ? 264 ARG A C   1 
ATOM   1652 O  O   . ARG A 1 200 ? -4.113  -24.110 -42.689 1.00 45.46 ? 264 ARG A O   1 
ATOM   1653 C  CB  . ARG A 1 200 ? -2.410  -21.293 -41.805 1.00 45.03 ? 264 ARG A CB  1 
ATOM   1654 C  CG  . ARG A 1 200 ? -2.857  -21.023 -43.211 1.00 45.68 ? 264 ARG A CG  1 
ATOM   1655 C  CD  . ARG A 1 200 ? -1.795  -20.321 -44.013 1.00 48.41 ? 264 ARG A CD  1 
ATOM   1656 N  NE  . ARG A 1 200 ? -0.547  -21.084 -44.015 1.00 51.38 ? 264 ARG A NE  1 
ATOM   1657 C  CZ  . ARG A 1 200 ? 0.605   -20.643 -44.512 1.00 52.08 ? 264 ARG A CZ  1 
ATOM   1658 N  NH1 . ARG A 1 200 ? 0.679   -19.443 -45.066 1.00 51.86 ? 264 ARG A NH1 1 
ATOM   1659 N  NH2 . ARG A 1 200 ? 1.682   -21.413 -44.464 1.00 53.41 ? 264 ARG A NH2 1 
ATOM   1660 N  N   . ASP A 1 201 ? -1.917  -24.371 -42.241 1.00 44.89 ? 265 ASP A N   1 
ATOM   1661 C  CA  . ASP A 1 201 ? -1.761  -25.532 -43.090 1.00 45.08 ? 265 ASP A CA  1 
ATOM   1662 C  C   . ASP A 1 201 ? -2.731  -26.648 -42.724 1.00 45.26 ? 265 ASP A C   1 
ATOM   1663 O  O   . ASP A 1 201 ? -3.236  -27.351 -43.608 1.00 45.35 ? 265 ASP A O   1 
ATOM   1664 C  CB  . ASP A 1 201 ? -0.329  -26.061 -43.051 1.00 45.08 ? 265 ASP A CB  1 
ATOM   1665 C  CG  . ASP A 1 201 ? 0.695   -25.049 -43.547 1.00 46.37 ? 265 ASP A CG  1 
ATOM   1666 O  OD1 . ASP A 1 201 ? 0.336   -23.941 -44.025 1.00 47.58 ? 265 ASP A OD1 1 
ATOM   1667 O  OD2 . ASP A 1 201 ? 1.891   -25.362 -43.436 1.00 47.14 ? 265 ASP A OD2 1 
ATOM   1668 N  N   . GLU A 1 202 ? -2.994  -26.812 -41.432 1.00 45.14 ? 266 GLU A N   1 
ATOM   1669 C  CA  . GLU A 1 202 ? -3.829  -27.908 -40.989 1.00 45.45 ? 266 GLU A CA  1 
ATOM   1670 C  C   . GLU A 1 202 ? -5.310  -27.598 -41.205 1.00 45.53 ? 266 GLU A C   1 
ATOM   1671 O  O   . GLU A 1 202 ? -6.099  -28.504 -41.482 1.00 45.77 ? 266 GLU A O   1 
ATOM   1672 C  CB  . GLU A 1 202 ? -3.546  -28.265 -39.527 1.00 45.78 ? 266 GLU A CB  1 
ATOM   1673 C  CG  . GLU A 1 202 ? -2.131  -28.749 -39.240 1.00 46.96 ? 266 GLU A CG  1 
ATOM   1674 C  CD  . GLU A 1 202 ? -1.737  -29.965 -40.050 1.00 50.36 ? 266 GLU A CD  1 
ATOM   1675 O  OE1 . GLU A 1 202 ? -2.280  -31.071 -39.811 1.00 50.28 ? 266 GLU A OE1 1 
ATOM   1676 O  OE2 . GLU A 1 202 ? -0.860  -29.824 -40.935 1.00 53.20 ? 266 GLU A OE2 1 
ATOM   1677 N  N   . GLY A 1 203 ? -5.688  -26.329 -41.060 1.00 45.13 ? 267 GLY A N   1 
ATOM   1678 C  CA  . GLY A 1 203 ? -7.004  -25.902 -41.451 1.00 45.00 ? 267 GLY A CA  1 
ATOM   1679 C  C   . GLY A 1 203 ? -7.219  -26.310 -42.901 1.00 45.65 ? 267 GLY A C   1 
ATOM   1680 O  O   . GLY A 1 203 ? -8.215  -26.960 -43.253 1.00 46.01 ? 267 GLY A O   1 
ATOM   1681 N  N   . LEU A 1 204 ? -6.261  -25.969 -43.745 1.00 45.54 ? 268 LEU A N   1 
ATOM   1682 C  CA  . LEU A 1 204 ? -6.352  -26.318 -45.144 1.00 45.90 ? 268 LEU A CA  1 
ATOM   1683 C  C   . LEU A 1 204 ? -6.495  -27.832 -45.327 1.00 45.93 ? 268 LEU A C   1 
ATOM   1684 O  O   . LEU A 1 204 ? -7.311  -28.278 -46.129 1.00 46.30 ? 268 LEU A O   1 
ATOM   1685 C  CB  . LEU A 1 204 ? -5.140  -25.784 -45.915 1.00 46.10 ? 268 LEU A CB  1 
ATOM   1686 C  CG  . LEU A 1 204 ? -5.209  -25.898 -47.438 1.00 46.48 ? 268 LEU A CG  1 
ATOM   1687 C  CD1 . LEU A 1 204 ? -6.198  -24.894 -47.969 1.00 47.53 ? 268 LEU A CD1 1 
ATOM   1688 C  CD2 . LEU A 1 204 ? -3.842  -25.664 -48.066 1.00 45.75 ? 268 LEU A CD2 1 
ATOM   1689 N  N   . HIS A 1 205 ? -5.726  -28.623 -44.584 1.00 45.39 ? 269 HIS A N   1 
ATOM   1690 C  CA  . HIS A 1 205 ? -5.756  -30.047 -44.814 1.00 45.53 ? 269 HIS A CA  1 
ATOM   1691 C  C   . HIS A 1 205 ? -7.115  -30.623 -44.422 1.00 46.20 ? 269 HIS A C   1 
ATOM   1692 O  O   . HIS A 1 205 ? -7.575  -31.599 -45.008 1.00 46.07 ? 269 HIS A O   1 
ATOM   1693 C  CB  . HIS A 1 205 ? -4.618  -30.762 -44.093 1.00 45.48 ? 269 HIS A CB  1 
ATOM   1694 C  CG  . HIS A 1 205 ? -3.254  -30.323 -44.524 1.00 44.27 ? 269 HIS A CG  1 
ATOM   1695 N  ND1 . HIS A 1 205 ? -2.150  -30.438 -43.711 1.00 42.46 ? 269 HIS A ND1 1 
ATOM   1696 C  CD2 . HIS A 1 205 ? -2.823  -29.737 -45.664 1.00 44.42 ? 269 HIS A CD2 1 
ATOM   1697 C  CE1 . HIS A 1 205 ? -1.093  -29.956 -44.341 1.00 43.85 ? 269 HIS A CE1 1 
ATOM   1698 N  NE2 . HIS A 1 205 ? -1.473  -29.525 -45.529 1.00 43.59 ? 269 HIS A NE2 1 
ATOM   1699 N  N   . CYS A 1 206 ? -7.742  -29.998 -43.432 1.00 46.91 ? 270 CYS A N   1 
ATOM   1700 C  CA  . CYS A 1 206 ? -9.117  -30.274 -43.061 1.00 47.68 ? 270 CYS A CA  1 
ATOM   1701 C  C   . CYS A 1 206 ? -10.100 -29.796 -44.129 1.00 47.41 ? 270 CYS A C   1 
ATOM   1702 O  O   . CYS A 1 206 ? -10.990 -30.548 -44.550 1.00 47.03 ? 270 CYS A O   1 
ATOM   1703 C  CB  . CYS A 1 206 ? -9.436  -29.606 -41.729 1.00 47.92 ? 270 CYS A CB  1 
ATOM   1704 S  SG  . CYS A 1 206 ? -8.724  -30.470 -40.323 1.00 52.47 ? 270 CYS A SG  1 
ATOM   1705 N  N   . ASP A 1 207 ? -9.948  -28.550 -44.573 1.00 47.09 ? 271 ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 207 ? -10.795 -28.066 -45.652 1.00 46.98 ? 271 ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 207 ? -10.756 -29.099 -46.798 1.00 47.02 ? 271 ASP A C   1 
ATOM   1708 O  O   . ASP A 1 207 ? -11.802 -29.521 -47.310 1.00 47.15 ? 271 ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 207 ? -10.374 -26.666 -46.106 1.00 46.51 ? 271 ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 207 ? -10.529 -25.622 -45.009 1.00 47.07 ? 271 ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 207 ? -11.391 -25.797 -44.117 1.00 46.77 ? 271 ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 207 ? -9.777  -24.623 -45.022 1.00 47.38 ? 271 ASP A OD2 1 
ATOM   1713 N  N   . PHE A 1 208 ? -9.554  -29.562 -47.133 1.00 46.59 ? 272 PHE A N   1 
ATOM   1714 C  CA  . PHE A 1 208 ? -9.391  -30.495 -48.228 1.00 46.25 ? 272 PHE A CA  1 
ATOM   1715 C  C   . PHE A 1 208 ? -10.124 -31.787 -47.975 1.00 46.45 ? 272 PHE A C   1 
ATOM   1716 O  O   . PHE A 1 208 ? -10.755 -32.320 -48.882 1.00 46.92 ? 272 PHE A O   1 
ATOM   1717 C  CB  . PHE A 1 208 ? -7.921  -30.774 -48.507 1.00 45.76 ? 272 PHE A CB  1 
ATOM   1718 C  CG  . PHE A 1 208 ? -7.688  -31.611 -49.732 1.00 43.75 ? 272 PHE A CG  1 
ATOM   1719 C  CD1 . PHE A 1 208 ? -7.729  -31.034 -50.999 1.00 43.07 ? 272 PHE A CD1 1 
ATOM   1720 C  CD2 . PHE A 1 208 ? -7.422  -32.967 -49.622 1.00 40.75 ? 272 PHE A CD2 1 
ATOM   1721 C  CE1 . PHE A 1 208 ? -7.508  -31.800 -52.144 1.00 42.09 ? 272 PHE A CE1 1 
ATOM   1722 C  CE2 . PHE A 1 208 ? -7.202  -33.734 -50.744 1.00 41.55 ? 272 PHE A CE2 1 
ATOM   1723 C  CZ  . PHE A 1 208 ? -7.239  -33.152 -52.020 1.00 41.29 ? 272 PHE A CZ  1 
ATOM   1724 N  N   . ALA A 1 209 ? -10.032 -32.291 -46.754 1.00 46.75 ? 273 ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 209 ? -10.792 -33.460 -46.352 1.00 47.51 ? 273 ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 209 ? -12.282 -33.258 -46.662 1.00 48.31 ? 273 ALA A C   1 
ATOM   1727 O  O   . ALA A 1 209 ? -12.907 -34.119 -47.278 1.00 48.38 ? 273 ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 209 ? -10.597 -33.738 -44.866 1.00 47.27 ? 273 ALA A CB  1 
ATOM   1729 N  N   . CYS A 1 210 ? -12.829 -32.109 -46.258 1.00 48.87 ? 274 CYS A N   1 
ATOM   1730 C  CA  . CYS A 1 210 ? -14.250 -31.810 -46.444 1.00 49.71 ? 274 CYS A CA  1 
ATOM   1731 C  C   . CYS A 1 210 ? -14.670 -31.819 -47.898 1.00 50.17 ? 274 CYS A C   1 
ATOM   1732 O  O   . CYS A 1 210 ? -15.703 -32.416 -48.249 1.00 50.27 ? 274 CYS A O   1 
ATOM   1733 C  CB  . CYS A 1 210 ? -14.619 -30.497 -45.773 1.00 49.33 ? 274 CYS A CB  1 
ATOM   1734 S  SG  . CYS A 1 210 ? -14.463 -30.657 -43.975 1.00 50.64 ? 274 CYS A SG  1 
ATOM   1735 N  N   . LEU A 1 211 ? -13.847 -31.188 -48.733 1.00 50.76 ? 275 LEU A N   1 
ATOM   1736 C  CA  . LEU A 1 211 ? -14.025 -31.189 -50.177 1.00 51.17 ? 275 LEU A CA  1 
ATOM   1737 C  C   . LEU A 1 211 ? -13.984 -32.605 -50.774 1.00 51.72 ? 275 LEU A C   1 
ATOM   1738 O  O   . LEU A 1 211 ? -14.828 -32.945 -51.610 1.00 52.14 ? 275 LEU A O   1 
ATOM   1739 C  CB  . LEU A 1 211 ? -12.980 -30.296 -50.830 1.00 51.19 ? 275 LEU A CB  1 
ATOM   1740 C  CG  . LEU A 1 211 ? -13.189 -29.989 -52.313 1.00 52.46 ? 275 LEU A CG  1 
ATOM   1741 C  CD1 . LEU A 1 211 ? -14.503 -29.249 -52.549 1.00 53.22 ? 275 LEU A CD1 1 
ATOM   1742 C  CD2 . LEU A 1 211 ? -12.027 -29.163 -52.852 1.00 53.13 ? 275 LEU A CD2 1 
ATOM   1743 N  N   . MET A 1 212 ? -13.036 -33.441 -50.346 1.00 51.54 ? 276 MET A N   1 
ATOM   1744 C  CA  . MET A 1 212 ? -13.050 -34.825 -50.805 1.00 51.64 ? 276 MET A CA  1 
ATOM   1745 C  C   . MET A 1 212 ? -14.380 -35.494 -50.428 1.00 51.75 ? 276 MET A C   1 
ATOM   1746 O  O   . MET A 1 212 ? -15.022 -36.137 -51.257 1.00 51.38 ? 276 MET A O   1 
ATOM   1747 C  CB  . MET A 1 212 ? -11.879 -35.634 -50.243 1.00 51.69 ? 276 MET A CB  1 
ATOM   1748 C  CG  . MET A 1 212 ? -10.497 -35.278 -50.762 1.00 51.87 ? 276 MET A CG  1 
ATOM   1749 S  SD  . MET A 1 212 ? -10.306 -35.339 -52.555 1.00 52.72 ? 276 MET A SD  1 
ATOM   1750 C  CE  . MET A 1 212 ? -10.483 -33.600 -52.873 1.00 52.68 ? 276 MET A CE  1 
ATOM   1751 N  N   . PHE A 1 213 ? -14.783 -35.320 -49.173 1.00 52.07 ? 277 PHE A N   1 
ATOM   1752 C  CA  . PHE A 1 213 ? -15.985 -35.940 -48.628 1.00 52.30 ? 277 PHE A CA  1 
ATOM   1753 C  C   . PHE A 1 213 ? -17.209 -35.578 -49.462 1.00 53.23 ? 277 PHE A C   1 
ATOM   1754 O  O   . PHE A 1 213 ? -18.023 -36.435 -49.785 1.00 53.09 ? 277 PHE A O   1 
ATOM   1755 C  CB  . PHE A 1 213 ? -16.176 -35.513 -47.168 1.00 51.61 ? 277 PHE A CB  1 
ATOM   1756 C  CG  . PHE A 1 213 ? -17.204 -36.315 -46.432 1.00 50.20 ? 277 PHE A CG  1 
ATOM   1757 C  CD1 . PHE A 1 213 ? -16.892 -37.571 -45.932 1.00 49.27 ? 277 PHE A CD1 1 
ATOM   1758 C  CD2 . PHE A 1 213 ? -18.489 -35.808 -46.228 1.00 49.60 ? 277 PHE A CD2 1 
ATOM   1759 C  CE1 . PHE A 1 213 ? -17.843 -38.322 -45.245 1.00 49.77 ? 277 PHE A CE1 1 
ATOM   1760 C  CE2 . PHE A 1 213 ? -19.459 -36.546 -45.549 1.00 48.83 ? 277 PHE A CE2 1 
ATOM   1761 C  CZ  . PHE A 1 213 ? -19.139 -37.807 -45.053 1.00 50.35 ? 277 PHE A CZ  1 
ATOM   1762 N  N   . LYS A 1 214 ? -17.303 -34.303 -49.825 1.00 54.50 ? 278 LYS A N   1 
ATOM   1763 C  CA  . LYS A 1 214 ? -18.415 -33.770 -50.597 1.00 55.68 ? 278 LYS A CA  1 
ATOM   1764 C  C   . LYS A 1 214 ? -18.496 -34.413 -51.988 1.00 55.95 ? 278 LYS A C   1 
ATOM   1765 O  O   . LYS A 1 214 ? -19.567 -34.516 -52.559 1.00 56.29 ? 278 LYS A O   1 
ATOM   1766 C  CB  . LYS A 1 214 ? -18.301 -32.234 -50.638 1.00 55.99 ? 278 LYS A CB  1 
ATOM   1767 C  CG  . LYS A 1 214 ? -19.115 -31.479 -51.690 1.00 57.94 ? 278 LYS A CG  1 
ATOM   1768 C  CD  . LYS A 1 214 ? -18.825 -29.956 -51.612 1.00 61.21 ? 278 LYS A CD  1 
ATOM   1769 C  CE  . LYS A 1 214 ? -19.404 -29.164 -52.813 1.00 64.05 ? 278 LYS A CE  1 
ATOM   1770 N  NZ  . LYS A 1 214 ? -18.822 -29.538 -54.165 1.00 63.74 ? 278 LYS A NZ  1 
ATOM   1771 N  N   . HIS A 1 215 ? -17.367 -34.879 -52.506 1.00 56.66 ? 279 HIS A N   1 
ATOM   1772 C  CA  . HIS A 1 215 ? -17.305 -35.489 -53.837 1.00 57.06 ? 279 HIS A CA  1 
ATOM   1773 C  C   . HIS A 1 215 ? -17.579 -36.985 -53.831 1.00 57.71 ? 279 HIS A C   1 
ATOM   1774 O  O   . HIS A 1 215 ? -17.572 -37.636 -54.881 1.00 57.89 ? 279 HIS A O   1 
ATOM   1775 C  CB  . HIS A 1 215 ? -15.945 -35.233 -54.475 1.00 56.80 ? 279 HIS A CB  1 
ATOM   1776 C  CG  . HIS A 1 215 ? -15.815 -33.877 -55.080 1.00 56.83 ? 279 HIS A CG  1 
ATOM   1777 N  ND1 . HIS A 1 215 ? -15.962 -33.652 -56.431 1.00 57.27 ? 279 HIS A ND1 1 
ATOM   1778 C  CD2 . HIS A 1 215 ? -15.559 -32.672 -54.521 1.00 57.14 ? 279 HIS A CD2 1 
ATOM   1779 C  CE1 . HIS A 1 215 ? -15.797 -32.365 -56.680 1.00 58.18 ? 279 HIS A CE1 1 
ATOM   1780 N  NE2 . HIS A 1 215 ? -15.550 -31.748 -55.537 1.00 58.15 ? 279 HIS A NE2 1 
ATOM   1781 N  N   . LEU A 1 216 ? -17.811 -37.541 -52.651 1.00 58.40 ? 280 LEU A N   1 
ATOM   1782 C  CA  . LEU A 1 216 ? -18.122 -38.948 -52.568 1.00 59.13 ? 280 LEU A CA  1 
ATOM   1783 C  C   . LEU A 1 216 ? -19.605 -39.176 -52.830 1.00 60.22 ? 280 LEU A C   1 
ATOM   1784 O  O   . LEU A 1 216 ? -20.458 -38.361 -52.444 1.00 60.60 ? 280 LEU A O   1 
ATOM   1785 C  CB  . LEU A 1 216 ? -17.697 -39.510 -51.221 1.00 59.01 ? 280 LEU A CB  1 
ATOM   1786 C  CG  . LEU A 1 216 ? -16.188 -39.710 -51.066 1.00 58.63 ? 280 LEU A CG  1 
ATOM   1787 C  CD1 . LEU A 1 216 ? -15.854 -39.937 -49.615 1.00 57.96 ? 280 LEU A CD1 1 
ATOM   1788 C  CD2 . LEU A 1 216 ? -15.698 -40.869 -51.919 1.00 56.79 ? 280 LEU A CD2 1 
ATOM   1789 N  N   . VAL A 1 217 ? -19.899 -40.273 -53.515 1.00 61.18 ? 281 VAL A N   1 
ATOM   1790 C  CA  . VAL A 1 217 ? -21.262 -40.650 -53.827 1.00 62.43 ? 281 VAL A CA  1 
ATOM   1791 C  C   . VAL A 1 217 ? -21.832 -41.469 -52.667 1.00 63.40 ? 281 VAL A C   1 
ATOM   1792 O  O   . VAL A 1 217 ? -22.936 -41.200 -52.191 1.00 63.11 ? 281 VAL A O   1 
ATOM   1793 C  CB  . VAL A 1 217 ? -21.310 -41.419 -55.162 1.00 62.61 ? 281 VAL A CB  1 
ATOM   1794 C  CG1 . VAL A 1 217 ? -22.671 -42.111 -55.367 1.00 62.66 ? 281 VAL A CG1 1 
ATOM   1795 C  CG2 . VAL A 1 217 ? -20.968 -40.471 -56.327 1.00 62.22 ? 281 VAL A CG2 1 
ATOM   1796 N  N   . HIS A 1 218 ? -21.055 -42.445 -52.204 1.00 64.69 ? 282 HIS A N   1 
ATOM   1797 C  CA  . HIS A 1 218 ? -21.424 -43.231 -51.028 1.00 66.41 ? 282 HIS A CA  1 
ATOM   1798 C  C   . HIS A 1 218 ? -20.761 -42.769 -49.718 1.00 66.48 ? 282 HIS A C   1 
ATOM   1799 O  O   . HIS A 1 218 ? -19.876 -43.449 -49.171 1.00 66.33 ? 282 HIS A O   1 
ATOM   1800 C  CB  . HIS A 1 218 ? -21.193 -44.724 -51.281 1.00 67.02 ? 282 HIS A CB  1 
ATOM   1801 C  CG  . HIS A 1 218 ? -22.003 -45.256 -52.417 1.00 70.01 ? 282 HIS A CG  1 
ATOM   1802 N  ND1 . HIS A 1 218 ? -23.380 -45.147 -52.461 1.00 72.64 ? 282 HIS A ND1 1 
ATOM   1803 C  CD2 . HIS A 1 218 ? -21.635 -45.870 -53.566 1.00 72.55 ? 282 HIS A CD2 1 
ATOM   1804 C  CE1 . HIS A 1 218 ? -23.824 -45.678 -53.587 1.00 73.69 ? 282 HIS A CE1 1 
ATOM   1805 N  NE2 . HIS A 1 218 ? -22.786 -46.124 -54.275 1.00 74.31 ? 282 HIS A NE2 1 
ATOM   1806 N  N   . LYS A 1 219 ? -21.220 -41.605 -49.242 1.00 66.48 ? 283 LYS A N   1 
ATOM   1807 C  CA  . LYS A 1 219 ? -20.869 -41.041 -47.935 1.00 66.31 ? 283 LYS A CA  1 
ATOM   1808 C  C   . LYS A 1 219 ? -21.340 -41.953 -46.784 1.00 66.70 ? 283 LYS A C   1 
ATOM   1809 O  O   . LYS A 1 219 ? -22.320 -42.688 -46.935 1.00 67.00 ? 283 LYS A O   1 
ATOM   1810 C  CB  . LYS A 1 219 ? -21.527 -39.661 -47.767 1.00 66.06 ? 283 LYS A CB  1 
ATOM   1811 C  CG  . LYS A 1 219 ? -21.109 -38.566 -48.776 1.00 65.18 ? 283 LYS A CG  1 
ATOM   1812 C  CD  . LYS A 1 219 ? -21.882 -37.270 -48.511 1.00 62.98 ? 283 LYS A CD  1 
ATOM   1813 C  CE  . LYS A 1 219 ? -21.298 -36.068 -49.245 1.00 63.01 ? 283 LYS A CE  1 
ATOM   1814 N  NZ  . LYS A 1 219 ? -21.517 -36.061 -50.729 1.00 62.17 ? 283 LYS A NZ  1 
ATOM   1815 N  N   . PRO A 1 220 ? -20.638 -41.922 -45.631 1.00 66.88 ? 284 PRO A N   1 
ATOM   1816 C  CA  . PRO A 1 220 ? -21.219 -42.517 -44.421 1.00 66.78 ? 284 PRO A CA  1 
ATOM   1817 C  C   . PRO A 1 220 ? -22.370 -41.672 -43.875 1.00 67.01 ? 284 PRO A C   1 
ATOM   1818 O  O   . PRO A 1 220 ? -22.502 -40.498 -44.221 1.00 67.00 ? 284 PRO A O   1 
ATOM   1819 C  CB  . PRO A 1 220 ? -20.050 -42.537 -43.431 1.00 66.62 ? 284 PRO A CB  1 
ATOM   1820 C  CG  . PRO A 1 220 ? -19.066 -41.564 -43.966 1.00 66.74 ? 284 PRO A CG  1 
ATOM   1821 C  CD  . PRO A 1 220 ? -19.213 -41.585 -45.451 1.00 66.79 ? 284 PRO A CD  1 
ATOM   1822 N  N   . SER A 1 221 ? -23.202 -42.278 -43.034 1.00 67.36 ? 285 SER A N   1 
ATOM   1823 C  CA  . SER A 1 221 ? -24.365 -41.599 -42.461 1.00 67.58 ? 285 SER A CA  1 
ATOM   1824 C  C   . SER A 1 221 ? -23.958 -40.521 -41.452 1.00 67.56 ? 285 SER A C   1 
ATOM   1825 O  O   . SER A 1 221 ? -22.885 -40.613 -40.853 1.00 67.75 ? 285 SER A O   1 
ATOM   1826 C  CB  . SER A 1 221 ? -25.277 -42.625 -41.785 1.00 67.66 ? 285 SER A CB  1 
ATOM   1827 O  OG  . SER A 1 221 ? -24.573 -43.361 -40.796 1.00 68.02 ? 285 SER A OG  1 
ATOM   1828 N  N   . GLU A 1 222 ? -24.815 -39.511 -41.273 1.00 67.42 ? 286 GLU A N   1 
ATOM   1829 C  CA  . GLU A 1 222 ? -24.633 -38.500 -40.226 1.00 67.27 ? 286 GLU A CA  1 
ATOM   1830 C  C   . GLU A 1 222 ? -24.415 -39.160 -38.866 1.00 67.31 ? 286 GLU A C   1 
ATOM   1831 O  O   . GLU A 1 222 ? -23.562 -38.746 -38.090 1.00 67.15 ? 286 GLU A O   1 
ATOM   1832 C  CB  . GLU A 1 222 ? -25.825 -37.522 -40.173 1.00 67.19 ? 286 GLU A CB  1 
ATOM   1833 C  CG  . GLU A 1 222 ? -25.822 -36.575 -38.947 1.00 66.87 ? 286 GLU A CG  1 
ATOM   1834 C  CD  . GLU A 1 222 ? -26.382 -35.187 -39.228 1.00 67.07 ? 286 GLU A CD  1 
ATOM   1835 O  OE1 . GLU A 1 222 ? -27.121 -35.025 -40.219 1.00 66.81 ? 286 GLU A OE1 1 
ATOM   1836 O  OE2 . GLU A 1 222 ? -26.078 -34.245 -38.455 1.00 67.45 ? 286 GLU A OE2 1 
ATOM   1837 N  N   . GLU A 1 223 ? -25.190 -40.197 -38.591 1.00 67.77 ? 287 GLU A N   1 
ATOM   1838 C  CA  . GLU A 1 223 ? -25.046 -40.948 -37.362 1.00 68.38 ? 287 GLU A CA  1 
ATOM   1839 C  C   . GLU A 1 223 ? -23.609 -41.478 -37.224 1.00 68.03 ? 287 GLU A C   1 
ATOM   1840 O  O   . GLU A 1 223 ? -22.980 -41.308 -36.173 1.00 68.03 ? 287 GLU A O   1 
ATOM   1841 C  CB  . GLU A 1 223 ? -26.099 -42.071 -37.297 1.00 68.64 ? 287 GLU A CB  1 
ATOM   1842 C  CG  . GLU A 1 223 ? -25.810 -43.227 -36.313 1.00 71.13 ? 287 GLU A CG  1 
ATOM   1843 C  CD  . GLU A 1 223 ? -26.105 -42.881 -34.842 1.00 75.05 ? 287 GLU A CD  1 
ATOM   1844 O  OE1 . GLU A 1 223 ? -26.136 -41.671 -34.487 1.00 75.68 ? 287 GLU A OE1 1 
ATOM   1845 O  OE2 . GLU A 1 223 ? -26.305 -43.832 -34.040 1.00 75.60 ? 287 GLU A OE2 1 
ATOM   1846 N  N   . ARG A 1 224 ? -23.088 -42.089 -38.288 1.00 67.68 ? 288 ARG A N   1 
ATOM   1847 C  CA  . ARG A 1 224 ? -21.762 -42.714 -38.234 1.00 67.42 ? 288 ARG A CA  1 
ATOM   1848 C  C   . ARG A 1 224 ? -20.633 -41.683 -38.100 1.00 66.95 ? 288 ARG A C   1 
ATOM   1849 O  O   . ARG A 1 224 ? -19.636 -41.930 -37.416 1.00 66.54 ? 288 ARG A O   1 
ATOM   1850 C  CB  . ARG A 1 224 ? -21.547 -43.635 -39.440 1.00 67.59 ? 288 ARG A CB  1 
ATOM   1851 C  CG  . ARG A 1 224 ? -20.182 -44.321 -39.518 1.00 68.45 ? 288 ARG A CG  1 
ATOM   1852 C  CD  . ARG A 1 224 ? -19.817 -45.083 -38.251 1.00 69.80 ? 288 ARG A CD  1 
ATOM   1853 N  NE  . ARG A 1 224 ? -18.534 -45.770 -38.404 1.00 71.84 ? 288 ARG A NE  1 
ATOM   1854 C  CZ  . ARG A 1 224 ? -17.695 -46.058 -37.407 1.00 73.20 ? 288 ARG A CZ  1 
ATOM   1855 N  NH1 . ARG A 1 224 ? -16.560 -46.693 -37.668 1.00 72.39 ? 288 ARG A NH1 1 
ATOM   1856 N  NH2 . ARG A 1 224 ? -17.983 -45.715 -36.150 1.00 74.45 ? 288 ARG A NH2 1 
ATOM   1857 N  N   . VAL A 1 225 ? -20.814 -40.532 -38.744 1.00 66.43 ? 289 VAL A N   1 
ATOM   1858 C  CA  . VAL A 1 225 ? -19.872 -39.427 -38.653 1.00 66.03 ? 289 VAL A CA  1 
ATOM   1859 C  C   . VAL A 1 225 ? -19.910 -38.788 -37.262 1.00 66.13 ? 289 VAL A C   1 
ATOM   1860 O  O   . VAL A 1 225 ? -18.854 -38.489 -36.695 1.00 66.40 ? 289 VAL A O   1 
ATOM   1861 C  CB  . VAL A 1 225 ? -20.092 -38.385 -39.782 1.00 65.87 ? 289 VAL A CB  1 
ATOM   1862 C  CG1 . VAL A 1 225 ? -19.310 -37.100 -39.522 1.00 65.14 ? 289 VAL A CG1 1 
ATOM   1863 C  CG2 . VAL A 1 225 ? -19.695 -38.977 -41.119 1.00 65.48 ? 289 VAL A CG2 1 
ATOM   1864 N  N   . ARG A 1 226 ? -21.112 -38.591 -36.717 1.00 66.03 ? 290 ARG A N   1 
ATOM   1865 C  CA  . ARG A 1 226 ? -21.271 -38.088 -35.346 1.00 65.88 ? 290 ARG A CA  1 
ATOM   1866 C  C   . ARG A 1 226 ? -20.473 -38.956 -34.380 1.00 65.57 ? 290 ARG A C   1 
ATOM   1867 O  O   . ARG A 1 226 ? -19.663 -38.448 -33.608 1.00 65.74 ? 290 ARG A O   1 
ATOM   1868 C  CB  . ARG A 1 226 ? -22.741 -38.085 -34.914 1.00 66.10 ? 290 ARG A CB  1 
ATOM   1869 C  CG  . ARG A 1 226 ? -23.519 -36.836 -35.277 1.00 66.78 ? 290 ARG A CG  1 
ATOM   1870 C  CD  . ARG A 1 226 ? -25.007 -36.998 -34.944 1.00 68.23 ? 290 ARG A CD  1 
ATOM   1871 N  NE  . ARG A 1 226 ? -25.299 -36.775 -33.525 1.00 68.57 ? 290 ARG A NE  1 
ATOM   1872 C  CZ  . ARG A 1 226 ? -25.758 -35.628 -33.020 1.00 68.89 ? 290 ARG A CZ  1 
ATOM   1873 N  NH1 . ARG A 1 226 ? -25.994 -34.574 -33.813 1.00 67.45 ? 290 ARG A NH1 1 
ATOM   1874 N  NH2 . ARG A 1 226 ? -25.980 -35.534 -31.712 1.00 68.33 ? 290 ARG A NH2 1 
ATOM   1875 N  N   . GLU A 1 227 ? -20.705 -40.263 -34.448 1.00 65.01 ? 291 GLU A N   1 
ATOM   1876 C  CA  . GLU A 1 227 ? -20.046 -41.230 -33.589 1.00 64.90 ? 291 GLU A CA  1 
ATOM   1877 C  C   . GLU A 1 227 ? -18.519 -41.084 -33.612 1.00 63.85 ? 291 GLU A C   1 
ATOM   1878 O  O   . GLU A 1 227 ? -17.873 -41.156 -32.573 1.00 63.80 ? 291 GLU A O   1 
ATOM   1879 C  CB  . GLU A 1 227 ? -20.479 -42.653 -33.979 1.00 65.48 ? 291 GLU A CB  1 
ATOM   1880 C  CG  . GLU A 1 227 ? -19.781 -43.788 -33.213 1.00 68.47 ? 291 GLU A CG  1 
ATOM   1881 C  CD  . GLU A 1 227 ? -20.467 -45.147 -33.391 1.00 73.48 ? 291 GLU A CD  1 
ATOM   1882 O  OE1 . GLU A 1 227 ? -21.318 -45.296 -34.309 1.00 74.24 ? 291 GLU A OE1 1 
ATOM   1883 O  OE2 . GLU A 1 227 ? -20.146 -46.072 -32.603 1.00 75.44 ? 291 GLU A OE2 1 
ATOM   1884 N  N   . ILE A 1 228 ? -17.957 -40.859 -34.793 1.00 62.77 ? 292 ILE A N   1 
ATOM   1885 C  CA  . ILE A 1 228 ? -16.515 -40.722 -34.947 1.00 61.78 ? 292 ILE A CA  1 
ATOM   1886 C  C   . ILE A 1 228 ? -16.022 -39.406 -34.339 1.00 61.16 ? 292 ILE A C   1 
ATOM   1887 O  O   . ILE A 1 228 ? -15.099 -39.392 -33.519 1.00 60.87 ? 292 ILE A O   1 
ATOM   1888 C  CB  . ILE A 1 228 ? -16.104 -40.836 -36.427 1.00 61.69 ? 292 ILE A CB  1 
ATOM   1889 C  CG1 . ILE A 1 228 ? -16.287 -42.282 -36.905 1.00 62.08 ? 292 ILE A CG1 1 
ATOM   1890 C  CG2 . ILE A 1 228 ? -14.649 -40.399 -36.625 1.00 61.89 ? 292 ILE A CG2 1 
ATOM   1891 C  CD1 . ILE A 1 228 ? -16.288 -42.448 -38.423 1.00 61.85 ? 292 ILE A CD1 1 
ATOM   1892 N  N   . ILE A 1 229 ? -16.660 -38.311 -34.735 1.00 60.35 ? 293 ILE A N   1 
ATOM   1893 C  CA  . ILE A 1 229 ? -16.309 -36.988 -34.259 1.00 59.46 ? 293 ILE A CA  1 
ATOM   1894 C  C   . ILE A 1 229 ? -16.473 -36.859 -32.747 1.00 59.37 ? 293 ILE A C   1 
ATOM   1895 O  O   . ILE A 1 229 ? -15.607 -36.288 -32.077 1.00 59.64 ? 293 ILE A O   1 
ATOM   1896 C  CB  . ILE A 1 229 ? -17.131 -35.916 -34.988 1.00 59.65 ? 293 ILE A CB  1 
ATOM   1897 C  CG1 . ILE A 1 229 ? -16.811 -35.934 -36.484 1.00 59.08 ? 293 ILE A CG1 1 
ATOM   1898 C  CG2 . ILE A 1 229 ? -16.906 -34.519 -34.388 1.00 59.15 ? 293 ILE A CG2 1 
ATOM   1899 C  CD1 . ILE A 1 229 ? -15.352 -35.769 -36.813 1.00 59.15 ? 293 ILE A CD1 1 
ATOM   1900 N  N   . ILE A 1 230 ? -17.566 -37.395 -32.203 1.00 58.69 ? 294 ILE A N   1 
ATOM   1901 C  CA  . ILE A 1 230 ? -17.778 -37.358 -30.754 1.00 57.98 ? 294 ILE A CA  1 
ATOM   1902 C  C   . ILE A 1 230 ? -16.656 -38.105 -30.027 1.00 57.32 ? 294 ILE A C   1 
ATOM   1903 O  O   . ILE A 1 230 ? -16.041 -37.546 -29.120 1.00 57.23 ? 294 ILE A O   1 
ATOM   1904 C  CB  . ILE A 1 230 ? -19.208 -37.832 -30.349 1.00 58.33 ? 294 ILE A CB  1 
ATOM   1905 C  CG1 . ILE A 1 230 ? -20.224 -36.734 -30.689 1.00 58.95 ? 294 ILE A CG1 1 
ATOM   1906 C  CG2 . ILE A 1 230 ? -19.298 -38.160 -28.859 1.00 57.13 ? 294 ILE A CG2 1 
ATOM   1907 C  CD1 . ILE A 1 230 ? -21.674 -37.190 -30.605 1.00 61.11 ? 294 ILE A CD1 1 
ATOM   1908 N  N   . ASN A 1 231 ? -16.381 -39.342 -30.452 1.00 56.59 ? 295 ASN A N   1 
ATOM   1909 C  CA  . ASN A 1 231 ? -15.255 -40.154 -29.946 1.00 55.96 ? 295 ASN A CA  1 
ATOM   1910 C  C   . ASN A 1 231 ? -13.945 -39.333 -29.946 1.00 55.39 ? 295 ASN A C   1 
ATOM   1911 O  O   . ASN A 1 231 ? -13.168 -39.370 -28.980 1.00 54.84 ? 295 ASN A O   1 
ATOM   1912 C  CB  . ASN A 1 231 ? -15.142 -41.447 -30.787 1.00 56.10 ? 295 ASN A CB  1 
ATOM   1913 C  CG  . ASN A 1 231 ? -14.066 -42.438 -30.287 1.00 56.64 ? 295 ASN A CG  1 
ATOM   1914 O  OD1 . ASN A 1 231 ? -13.602 -42.388 -29.149 1.00 57.54 ? 295 ASN A OD1 1 
ATOM   1915 N  ND2 . ASN A 1 231 ? -13.697 -43.372 -31.159 1.00 57.63 ? 295 ASN A ND2 1 
ATOM   1916 N  N   . ALA A 1 232 ? -13.733 -38.559 -31.011 1.00 54.41 ? 296 ALA A N   1 
ATOM   1917 C  CA  . ALA A 1 232 ? -12.542 -37.729 -31.125 1.00 53.99 ? 296 ALA A CA  1 
ATOM   1918 C  C   . ALA A 1 232 ? -12.536 -36.588 -30.105 1.00 53.72 ? 296 ALA A C   1 
ATOM   1919 O  O   . ALA A 1 232 ? -11.504 -36.296 -29.501 1.00 53.51 ? 296 ALA A O   1 
ATOM   1920 C  CB  . ALA A 1 232 ? -12.400 -37.191 -32.538 1.00 54.01 ? 296 ALA A CB  1 
ATOM   1921 N  N   . VAL A 1 233 ? -13.692 -35.957 -29.916 1.00 53.44 ? 297 VAL A N   1 
ATOM   1922 C  CA  . VAL A 1 233 ? -13.820 -34.851 -28.970 1.00 53.20 ? 297 VAL A CA  1 
ATOM   1923 C  C   . VAL A 1 233 ? -13.517 -35.306 -27.540 1.00 53.61 ? 297 VAL A C   1 
ATOM   1924 O  O   . VAL A 1 233 ? -12.802 -34.625 -26.807 1.00 53.52 ? 297 VAL A O   1 
ATOM   1925 C  CB  . VAL A 1 233 ? -15.207 -34.196 -29.035 1.00 52.91 ? 297 VAL A CB  1 
ATOM   1926 C  CG1 . VAL A 1 233 ? -15.375 -33.188 -27.907 1.00 52.28 ? 297 VAL A CG1 1 
ATOM   1927 C  CG2 . VAL A 1 233 ? -15.421 -33.535 -30.385 1.00 51.96 ? 297 VAL A CG2 1 
ATOM   1928 N  N   . ARG A 1 234 ? -14.040 -36.466 -27.157 1.00 53.94 ? 298 ARG A N   1 
ATOM   1929 C  CA  . ARG A 1 234 ? -13.808 -36.983 -25.808 1.00 54.54 ? 298 ARG A CA  1 
ATOM   1930 C  C   . ARG A 1 234 ? -12.325 -37.293 -25.573 1.00 54.48 ? 298 ARG A C   1 
ATOM   1931 O  O   . ARG A 1 234 ? -11.791 -37.008 -24.493 1.00 54.86 ? 298 ARG A O   1 
ATOM   1932 C  CB  . ARG A 1 234 ? -14.699 -38.202 -25.490 1.00 54.76 ? 298 ARG A CB  1 
ATOM   1933 C  CG  . ARG A 1 234 ? -16.225 -37.934 -25.560 1.00 55.46 ? 298 ARG A CG  1 
ATOM   1934 C  CD  . ARG A 1 234 ? -16.616 -36.572 -24.960 1.00 56.53 ? 298 ARG A CD  1 
ATOM   1935 N  NE  . ARG A 1 234 ? -18.060 -36.355 -24.992 1.00 57.90 ? 298 ARG A NE  1 
ATOM   1936 C  CZ  . ARG A 1 234 ? -18.652 -35.160 -24.945 1.00 59.49 ? 298 ARG A CZ  1 
ATOM   1937 N  NH1 . ARG A 1 234 ? -17.930 -34.041 -24.876 1.00 58.79 ? 298 ARG A NH1 1 
ATOM   1938 N  NH2 . ARG A 1 234 ? -19.980 -35.083 -24.982 1.00 60.30 ? 298 ARG A NH2 1 
ATOM   1939 N  N   . ILE A 1 235 ? -11.656 -37.835 -26.586 1.00 54.12 ? 299 ILE A N   1 
ATOM   1940 C  CA  . ILE A 1 235 ? -10.232 -38.133 -26.460 1.00 53.66 ? 299 ILE A CA  1 
ATOM   1941 C  C   . ILE A 1 235 ? -9.405  -36.846 -26.354 1.00 54.08 ? 299 ILE A C   1 
ATOM   1942 O  O   . ILE A 1 235 ? -8.498  -36.754 -25.515 1.00 54.47 ? 299 ILE A O   1 
ATOM   1943 C  CB  . ILE A 1 235 ? -9.744  -39.062 -27.576 1.00 53.22 ? 299 ILE A CB  1 
ATOM   1944 C  CG1 . ILE A 1 235 ? -10.468 -40.407 -27.460 1.00 52.53 ? 299 ILE A CG1 1 
ATOM   1945 C  CG2 . ILE A 1 235 ? -8.234  -39.259 -27.499 1.00 52.70 ? 299 ILE A CG2 1 
ATOM   1946 C  CD1 . ILE A 1 235 ? -10.365 -41.294 -28.689 1.00 51.45 ? 299 ILE A CD1 1 
ATOM   1947 N  N   . GLU A 1 236 ? -9.734  -35.848 -27.168 1.00 54.10 ? 300 GLU A N   1 
ATOM   1948 C  CA  . GLU A 1 236 ? -9.037  -34.571 -27.097 1.00 54.30 ? 300 GLU A CA  1 
ATOM   1949 C  C   . GLU A 1 236 ? -9.286  -33.876 -25.760 1.00 54.95 ? 300 GLU A C   1 
ATOM   1950 O  O   . GLU A 1 236 ? -8.392  -33.227 -25.218 1.00 55.19 ? 300 GLU A O   1 
ATOM   1951 C  CB  . GLU A 1 236 ? -9.420  -33.656 -28.260 1.00 53.72 ? 300 GLU A CB  1 
ATOM   1952 C  CG  . GLU A 1 236 ? -8.867  -32.225 -28.155 1.00 52.48 ? 300 GLU A CG  1 
ATOM   1953 C  CD  . GLU A 1 236 ? -7.347  -32.119 -28.348 1.00 50.34 ? 300 GLU A CD  1 
ATOM   1954 O  OE1 . GLU A 1 236 ? -6.682  -33.154 -28.530 1.00 48.23 ? 300 GLU A OE1 1 
ATOM   1955 O  OE2 . GLU A 1 236 ? -6.818  -30.984 -28.330 1.00 49.81 ? 300 GLU A OE2 1 
ATOM   1956 N  N   . GLN A 1 237 ? -10.498 -34.029 -25.233 1.00 55.68 ? 301 GLN A N   1 
ATOM   1957 C  CA  . GLN A 1 237 ? -10.890 -33.369 -23.981 1.00 56.20 ? 301 GLN A CA  1 
ATOM   1958 C  C   . GLN A 1 237 ? -10.178 -33.973 -22.781 1.00 56.49 ? 301 GLN A C   1 
ATOM   1959 O  O   . GLN A 1 237 ? -9.714  -33.250 -21.895 1.00 56.35 ? 301 GLN A O   1 
ATOM   1960 C  CB  . GLN A 1 237 ? -12.402 -33.431 -23.793 1.00 55.92 ? 301 GLN A CB  1 
ATOM   1961 C  CG  . GLN A 1 237 ? -13.142 -32.392 -24.618 1.00 56.56 ? 301 GLN A CG  1 
ATOM   1962 C  CD  . GLN A 1 237 ? -14.646 -32.527 -24.529 1.00 56.71 ? 301 GLN A CD  1 
ATOM   1963 O  OE1 . GLN A 1 237 ? -15.174 -33.606 -24.239 1.00 57.16 ? 301 GLN A OE1 1 
ATOM   1964 N  NE2 . GLN A 1 237 ? -15.346 -31.434 -24.786 1.00 55.97 ? 301 GLN A NE2 1 
ATOM   1965 N  N   . GLU A 1 238 ? -10.100 -35.299 -22.773 1.00 57.02 ? 302 GLU A N   1 
ATOM   1966 C  CA  . GLU A 1 238 ? -9.348  -36.029 -21.777 1.00 57.91 ? 302 GLU A CA  1 
ATOM   1967 C  C   . GLU A 1 238 ? -7.902  -35.553 -21.818 1.00 57.87 ? 302 GLU A C   1 
ATOM   1968 O  O   . GLU A 1 238 ? -7.320  -35.218 -20.786 1.00 57.89 ? 302 GLU A O   1 
ATOM   1969 C  CB  . GLU A 1 238 ? -9.408  -37.525 -22.067 1.00 58.10 ? 302 GLU A CB  1 
ATOM   1970 C  CG  . GLU A 1 238 ? -9.177  -38.391 -20.851 1.00 60.70 ? 302 GLU A CG  1 
ATOM   1971 C  CD  . GLU A 1 238 ? -8.146  -39.485 -21.110 1.00 65.45 ? 302 GLU A CD  1 
ATOM   1972 O  OE1 . GLU A 1 238 ? -6.919  -39.163 -21.110 1.00 66.72 ? 302 GLU A OE1 1 
ATOM   1973 O  OE2 . GLU A 1 238 ? -8.562  -40.662 -21.309 1.00 65.92 ? 302 GLU A OE2 1 
ATOM   1974 N  N   . PHE A 1 239 ? -7.344  -35.512 -23.025 1.00 57.88 ? 303 PHE A N   1 
ATOM   1975 C  CA  . PHE A 1 239 ? -5.980  -35.064 -23.248 1.00 57.84 ? 303 PHE A CA  1 
ATOM   1976 C  C   . PHE A 1 239 ? -5.704  -33.713 -22.577 1.00 58.12 ? 303 PHE A C   1 
ATOM   1977 O  O   . PHE A 1 239 ? -4.723  -33.561 -21.852 1.00 58.48 ? 303 PHE A O   1 
ATOM   1978 C  CB  . PHE A 1 239 ? -5.697  -34.988 -24.754 1.00 57.52 ? 303 PHE A CB  1 
ATOM   1979 C  CG  . PHE A 1 239 ? -4.301  -34.543 -25.091 1.00 56.70 ? 303 PHE A CG  1 
ATOM   1980 C  CD1 . PHE A 1 239 ? -3.241  -35.446 -25.056 1.00 56.95 ? 303 PHE A CD1 1 
ATOM   1981 C  CD2 . PHE A 1 239 ? -4.045  -33.222 -25.446 1.00 55.35 ? 303 PHE A CD2 1 
ATOM   1982 C  CE1 . PHE A 1 239 ? -1.941  -35.040 -25.366 1.00 56.69 ? 303 PHE A CE1 1 
ATOM   1983 C  CE2 . PHE A 1 239 ? -2.758  -32.806 -25.763 1.00 55.85 ? 303 PHE A CE2 1 
ATOM   1984 C  CZ  . PHE A 1 239 ? -1.696  -33.715 -25.722 1.00 55.81 ? 303 PHE A CZ  1 
ATOM   1985 N  N   . LEU A 1 240 ? -6.579  -32.745 -22.806 1.00 58.26 ? 304 LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 240 ? -6.322  -31.378 -22.384 1.00 58.73 ? 304 LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 240 ? -6.701  -31.088 -20.936 1.00 59.52 ? 304 LEU A C   1 
ATOM   1988 O  O   . LEU A 1 240 ? -6.364  -30.021 -20.409 1.00 59.45 ? 304 LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 240 ? -7.046  -30.395 -23.303 1.00 58.36 ? 304 LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 240 ? -6.731  -30.447 -24.795 1.00 58.05 ? 304 LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 240 ? -7.841  -29.755 -25.569 1.00 57.36 ? 304 LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 240 ? -5.364  -29.852 -25.118 1.00 56.80 ? 304 LEU A CD2 1 
ATOM   1993 N  N   . THR A 1 241 ? -7.414  -32.014 -20.295 1.00 60.27 ? 305 THR A N   1 
ATOM   1994 C  CA  . THR A 1 241 ? -7.862  -31.778 -18.919 1.00 61.10 ? 305 THR A CA  1 
ATOM   1995 C  C   . THR A 1 241 ? -7.330  -32.800 -17.919 1.00 61.50 ? 305 THR A C   1 
ATOM   1996 O  O   . THR A 1 241 ? -7.118  -32.476 -16.758 1.00 61.56 ? 305 THR A O   1 
ATOM   1997 C  CB  . THR A 1 241 ? -9.400  -31.639 -18.800 1.00 61.00 ? 305 THR A CB  1 
ATOM   1998 O  OG1 . THR A 1 241 ? -10.025 -32.885 -19.105 1.00 61.36 ? 305 THR A OG1 1 
ATOM   1999 C  CG2 . THR A 1 241 ? -9.930  -30.574 -19.758 1.00 61.26 ? 305 THR A CG2 1 
ATOM   2000 N  N   . GLU A 1 242 ? -7.092  -34.022 -18.377 1.00 62.13 ? 306 GLU A N   1 
ATOM   2001 C  CA  . GLU A 1 242 ? -6.633  -35.082 -17.491 1.00 62.79 ? 306 GLU A CA  1 
ATOM   2002 C  C   . GLU A 1 242 ? -5.136  -35.382 -17.710 1.00 62.05 ? 306 GLU A C   1 
ATOM   2003 O  O   . GLU A 1 242 ? -4.330  -35.205 -16.789 1.00 62.25 ? 306 GLU A O   1 
ATOM   2004 C  CB  . GLU A 1 242 ? -7.522  -36.334 -17.655 1.00 63.61 ? 306 GLU A CB  1 
ATOM   2005 C  CG  . GLU A 1 242 ? -7.598  -37.312 -16.442 1.00 67.59 ? 306 GLU A CG  1 
ATOM   2006 C  CD  . GLU A 1 242 ? -8.356  -38.646 -16.755 1.00 72.49 ? 306 GLU A CD  1 
ATOM   2007 O  OE1 . GLU A 1 242 ? -7.805  -39.743 -16.458 1.00 73.39 ? 306 GLU A OE1 1 
ATOM   2008 O  OE2 . GLU A 1 242 ? -9.496  -38.601 -17.298 1.00 73.95 ? 306 GLU A OE2 1 
ATOM   2009 N  N   . ALA A 1 243 ? -4.766  -35.786 -18.929 1.00 61.07 ? 307 ALA A N   1 
ATOM   2010 C  CA  . ALA A 1 243 ? -3.410  -36.284 -19.234 1.00 60.16 ? 307 ALA A CA  1 
ATOM   2011 C  C   . ALA A 1 243 ? -2.305  -35.207 -19.333 1.00 59.78 ? 307 ALA A C   1 
ATOM   2012 O  O   . ALA A 1 243 ? -1.182  -35.414 -18.855 1.00 59.29 ? 307 ALA A O   1 
ATOM   2013 C  CB  . ALA A 1 243 ? -3.436  -37.135 -20.498 1.00 60.14 ? 307 ALA A CB  1 
ATOM   2014 N  N   . LEU A 1 244 ? -2.615  -34.082 -19.975 1.00 58.82 ? 308 LEU A N   1 
ATOM   2015 C  CA  . LEU A 1 244 ? -1.699  -32.951 -20.026 1.00 58.08 ? 308 LEU A CA  1 
ATOM   2016 C  C   . LEU A 1 244 ? -2.505  -31.688 -19.802 1.00 57.50 ? 308 LEU A C   1 
ATOM   2017 O  O   . LEU A 1 244 ? -2.793  -30.961 -20.743 1.00 57.67 ? 308 LEU A O   1 
ATOM   2018 C  CB  . LEU A 1 244 ? -0.933  -32.900 -21.360 1.00 58.03 ? 308 LEU A CB  1 
ATOM   2019 C  CG  . LEU A 1 244 ? 0.151   -31.819 -21.554 1.00 58.32 ? 308 LEU A CG  1 
ATOM   2020 C  CD1 . LEU A 1 244 ? 1.166   -31.778 -20.416 1.00 58.02 ? 308 LEU A CD1 1 
ATOM   2021 C  CD2 . LEU A 1 244 ? 0.880   -31.978 -22.872 1.00 57.84 ? 308 LEU A CD2 1 
ATOM   2022 N  N   . PRO A 1 245 ? -2.879  -31.426 -18.542 1.00 57.08 ? 309 PRO A N   1 
ATOM   2023 C  CA  . PRO A 1 245 ? -3.827  -30.356 -18.253 1.00 56.74 ? 309 PRO A CA  1 
ATOM   2024 C  C   . PRO A 1 245 ? -3.330  -28.978 -18.677 1.00 56.60 ? 309 PRO A C   1 
ATOM   2025 O  O   . PRO A 1 245 ? -2.237  -28.561 -18.304 1.00 56.22 ? 309 PRO A O   1 
ATOM   2026 C  CB  . PRO A 1 245 ? -4.002  -30.434 -16.723 1.00 56.67 ? 309 PRO A CB  1 
ATOM   2027 C  CG  . PRO A 1 245 ? -3.534  -31.790 -16.339 1.00 56.48 ? 309 PRO A CG  1 
ATOM   2028 C  CD  . PRO A 1 245 ? -2.440  -32.112 -17.313 1.00 56.99 ? 309 PRO A CD  1 
ATOM   2029 N  N   . VAL A 1 246 ? -4.162  -28.289 -19.452 1.00 56.79 ? 310 VAL A N   1 
ATOM   2030 C  CA  . VAL A 1 246 ? -3.900  -26.925 -19.912 1.00 56.82 ? 310 VAL A CA  1 
ATOM   2031 C  C   . VAL A 1 246 ? -3.833  -25.909 -18.767 1.00 57.13 ? 310 VAL A C   1 
ATOM   2032 O  O   . VAL A 1 246 ? -3.464  -24.746 -18.966 1.00 56.97 ? 310 VAL A O   1 
ATOM   2033 C  CB  . VAL A 1 246 ? -4.948  -26.469 -20.949 1.00 56.66 ? 310 VAL A CB  1 
ATOM   2034 C  CG1 . VAL A 1 246 ? -4.845  -27.320 -22.214 1.00 56.41 ? 310 VAL A CG1 1 
ATOM   2035 C  CG2 . VAL A 1 246 ? -6.358  -26.500 -20.357 1.00 55.63 ? 310 VAL A CG2 1 
ATOM   2036 N  N   . LYS A 1 247 ? -4.213  -26.365 -17.579 1.00 57.65 ? 311 LYS A N   1 
ATOM   2037 C  CA  . LYS A 1 247 ? -4.093  -25.601 -16.341 1.00 58.25 ? 311 LYS A CA  1 
ATOM   2038 C  C   . LYS A 1 247 ? -2.620  -25.222 -16.149 1.00 57.73 ? 311 LYS A C   1 
ATOM   2039 O  O   . LYS A 1 247 ? -2.306  -24.113 -15.719 1.00 57.78 ? 311 LYS A O   1 
ATOM   2040 C  CB  . LYS A 1 247 ? -4.572  -26.484 -15.185 1.00 58.89 ? 311 LYS A CB  1 
ATOM   2041 C  CG  . LYS A 1 247 ? -5.007  -25.803 -13.890 1.00 61.57 ? 311 LYS A CG  1 
ATOM   2042 C  CD  . LYS A 1 247 ? -5.126  -26.903 -12.795 1.00 66.58 ? 311 LYS A CD  1 
ATOM   2043 C  CE  . LYS A 1 247 ? -6.192  -26.612 -11.725 1.00 69.15 ? 311 LYS A CE  1 
ATOM   2044 N  NZ  . LYS A 1 247 ? -5.756  -25.560 -10.753 1.00 70.89 ? 311 LYS A NZ  1 
ATOM   2045 N  N   . LEU A 1 248 ? -1.727  -26.143 -16.516 1.00 56.88 ? 312 LEU A N   1 
ATOM   2046 C  CA  . LEU A 1 248 ? -0.292  -25.948 -16.388 1.00 56.27 ? 312 LEU A CA  1 
ATOM   2047 C  C   . LEU A 1 248 ? 0.270   -24.707 -17.088 1.00 56.23 ? 312 LEU A C   1 
ATOM   2048 O  O   . LEU A 1 248 ? 1.403   -24.318 -16.817 1.00 56.31 ? 312 LEU A O   1 
ATOM   2049 C  CB  . LEU A 1 248 ? 0.457   -27.191 -16.872 1.00 56.04 ? 312 LEU A CB  1 
ATOM   2050 C  CG  . LEU A 1 248 ? 0.178   -28.509 -16.153 1.00 55.82 ? 312 LEU A CG  1 
ATOM   2051 C  CD1 . LEU A 1 248 ? 0.692   -29.688 -16.964 1.00 56.00 ? 312 LEU A CD1 1 
ATOM   2052 C  CD2 . LEU A 1 248 ? 0.748   -28.537 -14.734 1.00 55.48 ? 312 LEU A CD2 1 
ATOM   2053 N  N   . ILE A 1 249 ? -0.498  -24.104 -17.993 1.00 56.32 ? 313 ILE A N   1 
ATOM   2054 C  CA  . ILE A 1 249 ? -0.094  -22.850 -18.637 1.00 56.54 ? 313 ILE A CA  1 
ATOM   2055 C  C   . ILE A 1 249 ? -1.120  -21.735 -18.458 1.00 57.19 ? 313 ILE A C   1 
ATOM   2056 O  O   . ILE A 1 249 ? -1.130  -20.758 -19.219 1.00 56.92 ? 313 ILE A O   1 
ATOM   2057 C  CB  . ILE A 1 249 ? 0.243   -23.000 -20.153 1.00 56.56 ? 313 ILE A CB  1 
ATOM   2058 C  CG1 . ILE A 1 249 ? -0.892  -23.694 -20.907 1.00 56.48 ? 313 ILE A CG1 1 
ATOM   2059 C  CG2 . ILE A 1 249 ? 1.594   -23.677 -20.359 1.00 55.54 ? 313 ILE A CG2 1 
ATOM   2060 C  CD1 . ILE A 1 249 ? -1.035  -23.215 -22.310 1.00 56.44 ? 313 ILE A CD1 1 
ATOM   2061 N  N   . GLY A 1 250 ? -1.975  -21.891 -17.449 1.00 58.12 ? 314 GLY A N   1 
ATOM   2062 C  CA  . GLY A 1 250 ? -2.897  -20.835 -17.028 1.00 59.41 ? 314 GLY A CA  1 
ATOM   2063 C  C   . GLY A 1 250 ? -4.217  -20.745 -17.777 1.00 60.44 ? 314 GLY A C   1 
ATOM   2064 O  O   . GLY A 1 250 ? -4.879  -19.708 -17.739 1.00 60.69 ? 314 GLY A O   1 
ATOM   2065 N  N   . MET A 1 251 ? -4.606  -21.820 -18.457 1.00 61.37 ? 315 MET A N   1 
ATOM   2066 C  CA  . MET A 1 251 ? -5.877  -21.847 -19.181 1.00 62.35 ? 315 MET A CA  1 
ATOM   2067 C  C   . MET A 1 251 ? -6.913  -22.559 -18.340 1.00 63.02 ? 315 MET A C   1 
ATOM   2068 O  O   . MET A 1 251 ? -6.562  -23.358 -17.464 1.00 62.96 ? 315 MET A O   1 
ATOM   2069 C  CB  . MET A 1 251 ? -5.738  -22.575 -20.519 1.00 62.27 ? 315 MET A CB  1 
ATOM   2070 C  CG  . MET A 1 251 ? -4.638  -22.050 -21.415 1.00 62.26 ? 315 MET A CG  1 
ATOM   2071 S  SD  . MET A 1 251 ? -4.843  -22.588 -23.119 1.00 61.58 ? 315 MET A SD  1 
ATOM   2072 C  CE  . MET A 1 251 ? -6.137  -21.458 -23.675 1.00 59.73 ? 315 MET A CE  1 
ATOM   2073 N  N   . ASN A 1 252 ? -8.186  -22.279 -18.617 1.00 63.90 ? 316 ASN A N   1 
ATOM   2074 C  CA  . ASN A 1 252 ? -9.282  -22.912 -17.893 1.00 64.86 ? 316 ASN A CA  1 
ATOM   2075 C  C   . ASN A 1 252 ? -9.709  -24.209 -18.569 1.00 65.02 ? 316 ASN A C   1 
ATOM   2076 O  O   . ASN A 1 252 ? -10.118 -24.191 -19.727 1.00 65.12 ? 316 ASN A O   1 
ATOM   2077 C  CB  . ASN A 1 252 ? -10.472 -21.950 -17.762 1.00 65.26 ? 316 ASN A CB  1 
ATOM   2078 C  CG  . ASN A 1 252 ? -11.664 -22.588 -17.061 1.00 66.37 ? 316 ASN A CG  1 
ATOM   2079 O  OD1 . ASN A 1 252 ? -12.699 -22.836 -17.678 1.00 68.13 ? 316 ASN A OD1 1 
ATOM   2080 N  ND2 . ASN A 1 252 ? -11.515 -22.875 -15.772 1.00 66.95 ? 316 ASN A ND2 1 
ATOM   2081 N  N   . CYS A 1 253 ? -9.608  -25.323 -17.845 1.00 65.38 ? 317 CYS A N   1 
ATOM   2082 C  CA  . CYS A 1 253 ? -9.974  -26.634 -18.385 1.00 66.02 ? 317 CYS A CA  1 
ATOM   2083 C  C   . CYS A 1 253 ? -11.450 -26.707 -18.841 1.00 66.08 ? 317 CYS A C   1 
ATOM   2084 O  O   . CYS A 1 253 ? -11.776 -27.405 -19.807 1.00 66.39 ? 317 CYS A O   1 
ATOM   2085 C  CB  . CYS A 1 253 ? -9.640  -27.758 -17.390 1.00 66.20 ? 317 CYS A CB  1 
ATOM   2086 S  SG  . CYS A 1 253 ? -7.831  -28.052 -17.066 1.00 68.20 ? 317 CYS A SG  1 
ATOM   2087 N  N   . THR A 1 254 ? -12.334 -25.973 -18.173 1.00 66.02 ? 318 THR A N   1 
ATOM   2088 C  CA  . THR A 1 254 ? -13.755 -25.964 -18.560 1.00 65.91 ? 318 THR A CA  1 
ATOM   2089 C  C   . THR A 1 254 ? -13.996 -25.253 -19.904 1.00 65.51 ? 318 THR A C   1 
ATOM   2090 O  O   . THR A 1 254 ? -14.738 -25.760 -20.754 1.00 65.94 ? 318 THR A O   1 
ATOM   2091 C  CB  . THR A 1 254 ? -14.688 -25.437 -17.408 1.00 66.10 ? 318 THR A CB  1 
ATOM   2092 O  OG1 . THR A 1 254 ? -14.829 -26.461 -16.413 1.00 65.95 ? 318 THR A OG1 1 
ATOM   2093 C  CG2 . THR A 1 254 ? -16.086 -25.054 -17.922 1.00 65.76 ? 318 THR A CG2 1 
ATOM   2094 N  N   . LEU A 1 255 ? -13.358 -24.103 -20.106 1.00 64.75 ? 319 LEU A N   1 
ATOM   2095 C  CA  . LEU A 1 255 ? -13.482 -23.379 -21.374 1.00 64.21 ? 319 LEU A CA  1 
ATOM   2096 C  C   . LEU A 1 255 ? -12.790 -24.083 -22.559 1.00 63.85 ? 319 LEU A C   1 
ATOM   2097 O  O   . LEU A 1 255 ? -13.120 -23.823 -23.716 1.00 64.13 ? 319 LEU A O   1 
ATOM   2098 C  CB  . LEU A 1 255 ? -12.978 -21.936 -21.234 1.00 64.13 ? 319 LEU A CB  1 
ATOM   2099 C  CG  . LEU A 1 255 ? -13.775 -20.953 -20.351 1.00 64.70 ? 319 LEU A CG  1 
ATOM   2100 C  CD1 . LEU A 1 255 ? -13.184 -19.533 -20.422 1.00 63.23 ? 319 LEU A CD1 1 
ATOM   2101 C  CD2 . LEU A 1 255 ? -15.289 -20.937 -20.678 1.00 64.11 ? 319 LEU A CD2 1 
ATOM   2102 N  N   . MET A 1 256 ? -11.827 -24.961 -22.271 1.00 62.98 ? 320 MET A N   1 
ATOM   2103 C  CA  . MET A 1 256 ? -11.099 -25.667 -23.312 1.00 61.64 ? 320 MET A CA  1 
ATOM   2104 C  C   . MET A 1 256 ? -11.959 -26.802 -23.808 1.00 61.29 ? 320 MET A C   1 
ATOM   2105 O  O   . MET A 1 256 ? -12.111 -26.969 -25.013 1.00 60.91 ? 320 MET A O   1 
ATOM   2106 C  CB  . MET A 1 256 ? -9.751  -26.184 -22.791 1.00 61.64 ? 320 MET A CB  1 
ATOM   2107 C  CG  . MET A 1 256 ? -8.867  -26.858 -23.846 1.00 59.76 ? 320 MET A CG  1 
ATOM   2108 S  SD  . MET A 1 256 ? -8.410  -25.808 -25.255 1.00 55.99 ? 320 MET A SD  1 
ATOM   2109 C  CE  . MET A 1 256 ? -7.225  -24.711 -24.502 1.00 56.92 ? 320 MET A CE  1 
ATOM   2110 N  N   . LYS A 1 257 ? -12.521 -27.569 -22.864 1.00 60.99 ? 321 LYS A N   1 
ATOM   2111 C  CA  . LYS A 1 257 ? -13.534 -28.595 -23.141 1.00 60.46 ? 321 LYS A CA  1 
ATOM   2112 C  C   . LYS A 1 257 ? -14.536 -28.062 -24.160 1.00 59.72 ? 321 LYS A C   1 
ATOM   2113 O  O   . LYS A 1 257 ? -14.907 -28.746 -25.113 1.00 59.21 ? 321 LYS A O   1 
ATOM   2114 C  CB  . LYS A 1 257 ? -14.302 -28.939 -21.863 1.00 60.93 ? 321 LYS A CB  1 
ATOM   2115 C  CG  . LYS A 1 257 ? -13.683 -29.986 -20.928 1.00 63.21 ? 321 LYS A CG  1 
ATOM   2116 C  CD  . LYS A 1 257 ? -14.806 -30.814 -20.262 1.00 66.41 ? 321 LYS A CD  1 
ATOM   2117 C  CE  . LYS A 1 257 ? -14.393 -31.456 -18.932 1.00 68.61 ? 321 LYS A CE  1 
ATOM   2118 N  NZ  . LYS A 1 257 ? -14.771 -30.619 -17.743 1.00 69.49 ? 321 LYS A NZ  1 
ATOM   2119 N  N   . GLN A 1 258 ? -14.953 -26.816 -23.942 1.00 58.88 ? 322 GLN A N   1 
ATOM   2120 C  CA  . GLN A 1 258 ? -15.961 -26.182 -24.755 1.00 58.06 ? 322 GLN A CA  1 
ATOM   2121 C  C   . GLN A 1 258 ? -15.431 -25.834 -26.136 1.00 57.55 ? 322 GLN A C   1 
ATOM   2122 O  O   . GLN A 1 258 ? -16.148 -25.964 -27.131 1.00 57.67 ? 322 GLN A O   1 
ATOM   2123 C  CB  . GLN A 1 258 ? -16.459 -24.925 -24.066 1.00 58.09 ? 322 GLN A CB  1 
ATOM   2124 C  CG  . GLN A 1 258 ? -17.777 -24.406 -24.618 1.00 58.28 ? 322 GLN A CG  1 
ATOM   2125 C  CD  . GLN A 1 258 ? -18.129 -23.048 -24.060 1.00 58.22 ? 322 GLN A CD  1 
ATOM   2126 O  OE1 . GLN A 1 258 ? -18.326 -22.890 -22.846 1.00 57.76 ? 322 GLN A OE1 1 
ATOM   2127 N  NE2 . GLN A 1 258 ? -18.202 -22.050 -24.939 1.00 57.15 ? 322 GLN A NE2 1 
ATOM   2128 N  N   . TYR A 1 259 ? -14.182 -25.380 -26.192 1.00 56.74 ? 323 TYR A N   1 
ATOM   2129 C  CA  . TYR A 1 259 ? -13.574 -24.993 -27.455 1.00 55.67 ? 323 TYR A CA  1 
ATOM   2130 C  C   . TYR A 1 259 ? -13.454 -26.186 -28.418 1.00 55.38 ? 323 TYR A C   1 
ATOM   2131 O  O   . TYR A 1 259 ? -13.675 -26.049 -29.617 1.00 54.94 ? 323 TYR A O   1 
ATOM   2132 C  CB  . TYR A 1 259 ? -12.220 -24.310 -27.232 1.00 55.32 ? 323 TYR A CB  1 
ATOM   2133 C  CG  . TYR A 1 259 ? -11.517 -24.000 -28.529 1.00 54.59 ? 323 TYR A CG  1 
ATOM   2134 C  CD1 . TYR A 1 259 ? -11.926 -22.931 -29.323 1.00 53.75 ? 323 TYR A CD1 1 
ATOM   2135 C  CD2 . TYR A 1 259 ? -10.463 -24.805 -28.986 1.00 53.69 ? 323 TYR A CD2 1 
ATOM   2136 C  CE1 . TYR A 1 259 ? -11.293 -22.655 -30.538 1.00 54.40 ? 323 TYR A CE1 1 
ATOM   2137 C  CE2 . TYR A 1 259 ? -9.825  -24.540 -30.196 1.00 52.64 ? 323 TYR A CE2 1 
ATOM   2138 C  CZ  . TYR A 1 259 ? -10.243 -23.472 -30.970 1.00 53.42 ? 323 TYR A CZ  1 
ATOM   2139 O  OH  . TYR A 1 259 ? -9.623  -23.206 -32.172 1.00 52.64 ? 323 TYR A OH  1 
ATOM   2140 N  N   . ILE A 1 260 ? -13.125 -27.353 -27.877 1.00 55.16 ? 324 ILE A N   1 
ATOM   2141 C  CA  . ILE A 1 260 ? -13.029 -28.564 -28.671 1.00 55.32 ? 324 ILE A CA  1 
ATOM   2142 C  C   . ILE A 1 260 ? -14.396 -28.861 -29.285 1.00 55.85 ? 324 ILE A C   1 
ATOM   2143 O  O   . ILE A 1 260 ? -14.502 -29.153 -30.489 1.00 56.11 ? 324 ILE A O   1 
ATOM   2144 C  CB  . ILE A 1 260 ? -12.512 -29.753 -27.820 1.00 55.08 ? 324 ILE A CB  1 
ATOM   2145 C  CG1 . ILE A 1 260 ? -11.175 -29.394 -27.179 1.00 55.45 ? 324 ILE A CG1 1 
ATOM   2146 C  CG2 . ILE A 1 260 ? -12.382 -31.036 -28.640 1.00 54.27 ? 324 ILE A CG2 1 
ATOM   2147 C  CD1 . ILE A 1 260 ? -10.160 -28.796 -28.153 1.00 57.08 ? 324 ILE A CD1 1 
ATOM   2148 N  N   . GLU A 1 261 ? -15.439 -28.739 -28.462 1.00 55.95 ? 325 GLU A N   1 
ATOM   2149 C  CA  . GLU A 1 261 ? -16.813 -28.948 -28.910 1.00 55.71 ? 325 GLU A CA  1 
ATOM   2150 C  C   . GLU A 1 261 ? -17.212 -27.975 -30.018 1.00 55.23 ? 325 GLU A C   1 
ATOM   2151 O  O   . GLU A 1 261 ? -17.926 -28.360 -30.942 1.00 55.46 ? 325 GLU A O   1 
ATOM   2152 C  CB  . GLU A 1 261 ? -17.782 -28.879 -27.731 1.00 56.10 ? 325 GLU A CB  1 
ATOM   2153 C  CG  . GLU A 1 261 ? -17.812 -30.156 -26.864 1.00 57.46 ? 325 GLU A CG  1 
ATOM   2154 C  CD  . GLU A 1 261 ? -18.700 -30.026 -25.625 1.00 60.16 ? 325 GLU A CD  1 
ATOM   2155 O  OE1 . GLU A 1 261 ? -19.544 -29.087 -25.574 1.00 62.23 ? 325 GLU A OE1 1 
ATOM   2156 O  OE2 . GLU A 1 261 ? -18.553 -30.868 -24.703 1.00 60.35 ? 325 GLU A OE2 1 
ATOM   2157 N  N   . PHE A 1 262 ? -16.730 -26.734 -29.944 1.00 54.36 ? 326 PHE A N   1 
ATOM   2158 C  CA  . PHE A 1 262 ? -17.010 -25.738 -30.981 1.00 54.02 ? 326 PHE A CA  1 
ATOM   2159 C  C   . PHE A 1 262 ? -16.302 -26.030 -32.322 1.00 53.91 ? 326 PHE A C   1 
ATOM   2160 O  O   . PHE A 1 262 ? -16.894 -25.820 -33.392 1.00 53.54 ? 326 PHE A O   1 
ATOM   2161 C  CB  . PHE A 1 262 ? -16.660 -24.337 -30.482 1.00 54.02 ? 326 PHE A CB  1 
ATOM   2162 C  CG  . PHE A 1 262 ? -16.535 -23.309 -31.573 1.00 54.24 ? 326 PHE A CG  1 
ATOM   2163 C  CD1 . PHE A 1 262 ? -17.662 -22.665 -32.077 1.00 54.71 ? 326 PHE A CD1 1 
ATOM   2164 C  CD2 . PHE A 1 262 ? -15.286 -22.974 -32.090 1.00 55.23 ? 326 PHE A CD2 1 
ATOM   2165 C  CE1 . PHE A 1 262 ? -17.551 -21.690 -33.088 1.00 54.90 ? 326 PHE A CE1 1 
ATOM   2166 C  CE2 . PHE A 1 262 ? -15.160 -22.011 -33.105 1.00 55.54 ? 326 PHE A CE2 1 
ATOM   2167 C  CZ  . PHE A 1 262 ? -16.299 -21.362 -33.599 1.00 55.23 ? 326 PHE A CZ  1 
ATOM   2168 N  N   . VAL A 1 263 ? -15.044 -26.487 -32.243 1.00 53.46 ? 327 VAL A N   1 
ATOM   2169 C  CA  . VAL A 1 263 ? -14.238 -26.897 -33.401 1.00 52.92 ? 327 VAL A CA  1 
ATOM   2170 C  C   . VAL A 1 263 ? -14.910 -28.054 -34.137 1.00 52.96 ? 327 VAL A C   1 
ATOM   2171 O  O   . VAL A 1 263 ? -14.948 -28.086 -35.375 1.00 52.38 ? 327 VAL A O   1 
ATOM   2172 C  CB  . VAL A 1 263 ? -12.770 -27.273 -32.978 1.00 52.90 ? 327 VAL A CB  1 
ATOM   2173 C  CG1 . VAL A 1 263 ? -12.037 -28.076 -34.058 1.00 52.53 ? 327 VAL A CG1 1 
ATOM   2174 C  CG2 . VAL A 1 263 ? -11.988 -26.039 -32.663 1.00 52.49 ? 327 VAL A CG2 1 
ATOM   2175 N  N   . ALA A 1 264 ? -15.454 -28.989 -33.365 1.00 53.31 ? 328 ALA A N   1 
ATOM   2176 C  CA  . ALA A 1 264 ? -16.118 -30.163 -33.927 1.00 54.07 ? 328 ALA A CA  1 
ATOM   2177 C  C   . ALA A 1 264 ? -17.434 -29.804 -34.620 1.00 54.82 ? 328 ALA A C   1 
ATOM   2178 O  O   . ALA A 1 264 ? -17.725 -30.317 -35.701 1.00 54.88 ? 328 ALA A O   1 
ATOM   2179 C  CB  . ALA A 1 264 ? -16.334 -31.213 -32.861 1.00 53.67 ? 328 ALA A CB  1 
ATOM   2180 N  N   . ASP A 1 265 ? -18.220 -28.914 -34.014 1.00 55.79 ? 329 ASP A N   1 
ATOM   2181 C  CA  . ASP A 1 265 ? -19.453 -28.437 -34.647 1.00 56.67 ? 329 ASP A CA  1 
ATOM   2182 C  C   . ASP A 1 265 ? -19.135 -27.795 -35.983 1.00 56.87 ? 329 ASP A C   1 
ATOM   2183 O  O   . ASP A 1 265 ? -19.891 -27.955 -36.943 1.00 57.35 ? 329 ASP A O   1 
ATOM   2184 C  CB  . ASP A 1 265 ? -20.187 -27.415 -33.774 1.00 57.06 ? 329 ASP A CB  1 
ATOM   2185 C  CG  . ASP A 1 265 ? -20.970 -28.052 -32.629 1.00 58.42 ? 329 ASP A CG  1 
ATOM   2186 O  OD1 . ASP A 1 265 ? -21.062 -29.298 -32.527 1.00 58.41 ? 329 ASP A OD1 1 
ATOM   2187 O  OD2 . ASP A 1 265 ? -21.499 -27.273 -31.813 1.00 62.07 ? 329 ASP A OD2 1 
ATOM   2188 N  N   . ARG A 1 266 ? -18.015 -27.075 -36.039 1.00 56.89 ? 330 ARG A N   1 
ATOM   2189 C  CA  . ARG A 1 266 ? -17.616 -26.375 -37.246 1.00 57.06 ? 330 ARG A CA  1 
ATOM   2190 C  C   . ARG A 1 266 ? -17.199 -27.371 -38.321 1.00 57.14 ? 330 ARG A C   1 
ATOM   2191 O  O   . ARG A 1 266 ? -17.585 -27.245 -39.488 1.00 57.18 ? 330 ARG A O   1 
ATOM   2192 C  CB  . ARG A 1 266 ? -16.499 -25.387 -36.946 1.00 56.97 ? 330 ARG A CB  1 
ATOM   2193 C  CG  . ARG A 1 266 ? -16.240 -24.423 -38.082 1.00 58.33 ? 330 ARG A CG  1 
ATOM   2194 C  CD  . ARG A 1 266 ? -15.263 -23.342 -37.687 1.00 61.55 ? 330 ARG A CD  1 
ATOM   2195 N  NE  . ARG A 1 266 ? -14.027 -23.888 -37.109 1.00 63.24 ? 330 ARG A NE  1 
ATOM   2196 C  CZ  . ARG A 1 266 ? -13.099 -23.160 -36.490 1.00 62.51 ? 330 ARG A CZ  1 
ATOM   2197 N  NH1 . ARG A 1 266 ? -13.251 -21.845 -36.363 1.00 62.01 ? 330 ARG A NH1 1 
ATOM   2198 N  NH2 . ARG A 1 266 ? -12.022 -23.753 -35.994 1.00 62.00 ? 330 ARG A NH2 1 
ATOM   2199 N  N   . LEU A 1 267 ? -16.432 -28.374 -37.911 1.00 57.14 ? 331 LEU A N   1 
ATOM   2200 C  CA  . LEU A 1 267 ? -16.073 -29.464 -38.799 1.00 57.35 ? 331 LEU A CA  1 
ATOM   2201 C  C   . LEU A 1 267 ? -17.312 -30.194 -39.316 1.00 57.42 ? 331 LEU A C   1 
ATOM   2202 O  O   . LEU A 1 267 ? -17.397 -30.500 -40.510 1.00 57.93 ? 331 LEU A O   1 
ATOM   2203 C  CB  . LEU A 1 267 ? -15.115 -30.444 -38.113 1.00 57.21 ? 331 LEU A CB  1 
ATOM   2204 C  CG  . LEU A 1 267 ? -14.621 -31.617 -38.956 1.00 57.13 ? 331 LEU A CG  1 
ATOM   2205 C  CD1 . LEU A 1 267 ? -13.934 -31.111 -40.214 1.00 56.85 ? 331 LEU A CD1 1 
ATOM   2206 C  CD2 . LEU A 1 267 ? -13.688 -32.507 -38.145 1.00 57.12 ? 331 LEU A CD2 1 
ATOM   2207 N  N   . MET A 1 268 ? -18.264 -30.471 -38.431 1.00 57.24 ? 332 MET A N   1 
ATOM   2208 C  CA  . MET A 1 268 ? -19.483 -31.175 -38.829 1.00 57.33 ? 332 MET A CA  1 
ATOM   2209 C  C   . MET A 1 268 ? -20.284 -30.368 -39.865 1.00 57.60 ? 332 MET A C   1 
ATOM   2210 O  O   . MET A 1 268 ? -20.734 -30.923 -40.875 1.00 57.46 ? 332 MET A O   1 
ATOM   2211 C  CB  . MET A 1 268 ? -20.342 -31.507 -37.618 1.00 57.12 ? 332 MET A CB  1 
ATOM   2212 C  CG  . MET A 1 268 ? -19.746 -32.567 -36.707 1.00 56.98 ? 332 MET A CG  1 
ATOM   2213 S  SD  . MET A 1 268 ? -19.863 -34.243 -37.353 1.00 57.58 ? 332 MET A SD  1 
ATOM   2214 C  CE  . MET A 1 268 ? -21.639 -34.471 -37.382 1.00 57.55 ? 332 MET A CE  1 
ATOM   2215 N  N   . LEU A 1 269 ? -20.429 -29.064 -39.626 1.00 57.49 ? 333 LEU A N   1 
ATOM   2216 C  CA  . LEU A 1 269 ? -21.090 -28.184 -40.576 1.00 57.88 ? 333 LEU A CA  1 
ATOM   2217 C  C   . LEU A 1 269 ? -20.401 -28.241 -41.930 1.00 58.40 ? 333 LEU A C   1 
ATOM   2218 O  O   . LEU A 1 269 ? -21.046 -28.163 -42.987 1.00 58.35 ? 333 LEU A O   1 
ATOM   2219 C  CB  . LEU A 1 269 ? -21.070 -26.736 -40.088 1.00 57.94 ? 333 LEU A CB  1 
ATOM   2220 C  CG  . LEU A 1 269 ? -22.062 -26.207 -39.043 1.00 58.34 ? 333 LEU A CG  1 
ATOM   2221 C  CD1 . LEU A 1 269 ? -22.035 -24.681 -39.098 1.00 58.37 ? 333 LEU A CD1 1 
ATOM   2222 C  CD2 . LEU A 1 269 ? -23.496 -26.736 -39.224 1.00 56.75 ? 333 LEU A CD2 1 
ATOM   2223 N  N   . GLU A 1 270 ? -19.080 -28.373 -41.890 1.00 58.77 ? 334 GLU A N   1 
ATOM   2224 C  CA  . GLU A 1 270 ? -18.286 -28.322 -43.097 1.00 58.91 ? 334 GLU A CA  1 
ATOM   2225 C  C   . GLU A 1 270 ? -18.406 -29.615 -43.873 1.00 58.74 ? 334 GLU A C   1 
ATOM   2226 O  O   . GLU A 1 270 ? -18.319 -29.612 -45.088 1.00 58.64 ? 334 GLU A O   1 
ATOM   2227 C  CB  . GLU A 1 270 ? -16.839 -28.036 -42.754 1.00 58.98 ? 334 GLU A CB  1 
ATOM   2228 C  CG  . GLU A 1 270 ? -16.084 -27.391 -43.877 1.00 60.01 ? 334 GLU A CG  1 
ATOM   2229 C  CD  . GLU A 1 270 ? -14.681 -27.004 -43.468 1.00 61.45 ? 334 GLU A CD  1 
ATOM   2230 O  OE1 . GLU A 1 270 ? -14.385 -27.034 -42.247 1.00 59.92 ? 334 GLU A OE1 1 
ATOM   2231 O  OE2 . GLU A 1 270 ? -13.884 -26.668 -44.372 1.00 61.42 ? 334 GLU A OE2 1 
ATOM   2232 N  N   . LEU A 1 271 ? -18.616 -30.716 -43.166 1.00 58.99 ? 335 LEU A N   1 
ATOM   2233 C  CA  . LEU A 1 271 ? -18.843 -32.001 -43.813 1.00 59.58 ? 335 LEU A CA  1 
ATOM   2234 C  C   . LEU A 1 271 ? -20.242 -32.127 -44.428 1.00 60.25 ? 335 LEU A C   1 
ATOM   2235 O  O   . LEU A 1 271 ? -20.553 -33.130 -45.068 1.00 60.67 ? 335 LEU A O   1 
ATOM   2236 C  CB  . LEU A 1 271 ? -18.583 -33.145 -42.831 1.00 59.10 ? 335 LEU A CB  1 
ATOM   2237 C  CG  . LEU A 1 271 ? -17.111 -33.425 -42.525 1.00 58.65 ? 335 LEU A CG  1 
ATOM   2238 C  CD1 . LEU A 1 271 ? -16.962 -34.372 -41.338 1.00 58.80 ? 335 LEU A CD1 1 
ATOM   2239 C  CD2 . LEU A 1 271 ? -16.406 -33.989 -43.732 1.00 57.29 ? 335 LEU A CD2 1 
ATOM   2240 N  N   . GLY A 1 272 ? -21.074 -31.105 -44.233 1.00 61.07 ? 336 GLY A N   1 
ATOM   2241 C  CA  . GLY A 1 272 ? -22.426 -31.063 -44.776 1.00 61.59 ? 336 GLY A CA  1 
ATOM   2242 C  C   . GLY A 1 272 ? -23.450 -31.592 -43.796 1.00 62.46 ? 336 GLY A C   1 
ATOM   2243 O  O   . GLY A 1 272 ? -24.553 -31.981 -44.194 1.00 62.90 ? 336 GLY A O   1 
ATOM   2244 N  N   . PHE A 1 273 ? -23.092 -31.610 -42.513 1.00 62.77 ? 337 PHE A N   1 
ATOM   2245 C  CA  . PHE A 1 273 ? -23.987 -32.100 -41.467 1.00 63.15 ? 337 PHE A CA  1 
ATOM   2246 C  C   . PHE A 1 273 ? -24.449 -31.005 -40.489 1.00 63.29 ? 337 PHE A C   1 
ATOM   2247 O  O   . PHE A 1 273 ? -24.197 -29.813 -40.698 1.00 62.99 ? 337 PHE A O   1 
ATOM   2248 C  CB  . PHE A 1 273 ? -23.325 -33.253 -40.711 1.00 63.45 ? 337 PHE A CB  1 
ATOM   2249 C  CG  . PHE A 1 273 ? -23.016 -34.454 -41.571 1.00 64.62 ? 337 PHE A CG  1 
ATOM   2250 C  CD1 . PHE A 1 273 ? -24.043 -35.189 -42.168 1.00 65.12 ? 337 PHE A CD1 1 
ATOM   2251 C  CD2 . PHE A 1 273 ? -21.698 -34.862 -41.770 1.00 64.65 ? 337 PHE A CD2 1 
ATOM   2252 C  CE1 . PHE A 1 273 ? -23.761 -36.310 -42.963 1.00 65.35 ? 337 PHE A CE1 1 
ATOM   2253 C  CE2 . PHE A 1 273 ? -21.406 -35.974 -42.558 1.00 65.05 ? 337 PHE A CE2 1 
ATOM   2254 C  CZ  . PHE A 1 273 ? -22.443 -36.702 -43.158 1.00 65.65 ? 337 PHE A CZ  1 
ATOM   2255 N  N   . SER A 1 274 ? -25.138 -31.419 -39.428 1.00 63.66 ? 338 SER A N   1 
ATOM   2256 C  CA  . SER A 1 274 ? -25.626 -30.484 -38.401 1.00 64.21 ? 338 SER A CA  1 
ATOM   2257 C  C   . SER A 1 274 ? -24.681 -30.407 -37.197 1.00 64.19 ? 338 SER A C   1 
ATOM   2258 O  O   . SER A 1 274 ? -23.889 -31.325 -36.962 1.00 64.26 ? 338 SER A O   1 
ATOM   2259 C  CB  . SER A 1 274 ? -27.036 -30.885 -37.929 1.00 64.16 ? 338 SER A CB  1 
ATOM   2260 O  OG  . SER A 1 274 ? -27.990 -30.704 -38.957 1.00 63.75 ? 338 SER A OG  1 
ATOM   2261 N  N   . LYS A 1 275 ? -24.782 -29.324 -36.428 1.00 64.07 ? 339 LYS A N   1 
ATOM   2262 C  CA  . LYS A 1 275 ? -24.025 -29.201 -35.182 1.00 64.21 ? 339 LYS A CA  1 
ATOM   2263 C  C   . LYS A 1 275 ? -24.305 -30.359 -34.215 1.00 64.52 ? 339 LYS A C   1 
ATOM   2264 O  O   . LYS A 1 275 ? -25.283 -31.092 -34.368 1.00 64.88 ? 339 LYS A O   1 
ATOM   2265 C  CB  . LYS A 1 275 ? -24.314 -27.863 -34.506 1.00 63.83 ? 339 LYS A CB  1 
ATOM   2266 C  CG  . LYS A 1 275 ? -24.044 -26.660 -35.379 1.00 63.43 ? 339 LYS A CG  1 
ATOM   2267 C  CD  . LYS A 1 275 ? -24.101 -25.382 -34.569 1.00 62.64 ? 339 LYS A CD  1 
ATOM   2268 C  CE  . LYS A 1 275 ? -23.618 -24.207 -35.387 1.00 62.96 ? 339 LYS A CE  1 
ATOM   2269 N  NZ  . LYS A 1 275 ? -22.978 -23.203 -34.522 1.00 62.31 ? 339 LYS A NZ  1 
ATOM   2270 N  N   . VAL A 1 276 ? -23.441 -30.532 -33.226 1.00 64.84 ? 340 VAL A N   1 
ATOM   2271 C  CA  . VAL A 1 276 ? -23.627 -31.599 -32.245 1.00 65.27 ? 340 VAL A CA  1 
ATOM   2272 C  C   . VAL A 1 276 ? -23.795 -31.052 -30.826 1.00 65.56 ? 340 VAL A C   1 
ATOM   2273 O  O   . VAL A 1 276 ? -24.657 -31.515 -30.074 1.00 65.56 ? 340 VAL A O   1 
ATOM   2274 C  CB  . VAL A 1 276 ? -22.468 -32.642 -32.296 1.00 65.14 ? 340 VAL A CB  1 
ATOM   2275 C  CG1 . VAL A 1 276 ? -22.475 -33.549 -31.054 1.00 65.28 ? 340 VAL A CG1 1 
ATOM   2276 C  CG2 . VAL A 1 276 ? -22.553 -33.473 -33.562 1.00 64.64 ? 340 VAL A CG2 1 
ATOM   2277 N  N   . PHE A 1 277 ? -22.974 -30.066 -30.483 1.00 66.01 ? 341 PHE A N   1 
ATOM   2278 C  CA  . PHE A 1 277 ? -22.882 -29.568 -29.118 1.00 66.68 ? 341 PHE A CA  1 
ATOM   2279 C  C   . PHE A 1 277 ? -23.574 -28.224 -28.957 1.00 67.31 ? 341 PHE A C   1 
ATOM   2280 O  O   . PHE A 1 277 ? -24.041 -27.892 -27.870 1.00 67.16 ? 341 PHE A O   1 
ATOM   2281 C  CB  . PHE A 1 277 ? -21.411 -29.453 -28.701 1.00 66.60 ? 341 PHE A CB  1 
ATOM   2282 C  CG  . PHE A 1 277 ? -20.646 -30.736 -28.823 1.00 65.95 ? 341 PHE A CG  1 
ATOM   2283 C  CD1 . PHE A 1 277 ? -20.702 -31.692 -27.816 1.00 65.58 ? 341 PHE A CD1 1 
ATOM   2284 C  CD2 . PHE A 1 277 ? -19.874 -30.994 -29.948 1.00 65.53 ? 341 PHE A CD2 1 
ATOM   2285 C  CE1 . PHE A 1 277 ? -19.999 -32.889 -27.928 1.00 64.82 ? 341 PHE A CE1 1 
ATOM   2286 C  CE2 . PHE A 1 277 ? -19.171 -32.184 -30.070 1.00 64.39 ? 341 PHE A CE2 1 
ATOM   2287 C  CZ  . PHE A 1 277 ? -19.232 -33.132 -29.060 1.00 64.65 ? 341 PHE A CZ  1 
ATOM   2288 N  N   . ARG A 1 278 ? -23.623 -27.459 -30.046 1.00 68.30 ? 342 ARG A N   1 
ATOM   2289 C  CA  . ARG A 1 278 ? -24.276 -26.135 -30.090 1.00 69.67 ? 342 ARG A CA  1 
ATOM   2290 C  C   . ARG A 1 278 ? -23.683 -25.058 -29.157 1.00 69.71 ? 342 ARG A C   1 
ATOM   2291 O  O   . ARG A 1 278 ? -24.339 -24.057 -28.861 1.00 70.13 ? 342 ARG A O   1 
ATOM   2292 C  CB  . ARG A 1 278 ? -25.808 -26.264 -29.915 1.00 69.91 ? 342 ARG A CB  1 
ATOM   2293 C  CG  . ARG A 1 278 ? -26.534 -26.488 -31.238 1.00 71.51 ? 342 ARG A CG  1 
ATOM   2294 C  CD  . ARG A 1 278 ? -27.832 -27.280 -31.091 1.00 74.57 ? 342 ARG A CD  1 
ATOM   2295 N  NE  . ARG A 1 278 ? -28.260 -27.781 -32.401 1.00 77.06 ? 342 ARG A NE  1 
ATOM   2296 C  CZ  . ARG A 1 278 ? -28.236 -29.064 -32.778 1.00 78.27 ? 342 ARG A CZ  1 
ATOM   2297 N  NH1 . ARG A 1 278 ? -27.827 -30.018 -31.937 1.00 78.32 ? 342 ARG A NH1 1 
ATOM   2298 N  NH2 . ARG A 1 278 ? -28.634 -29.398 -34.005 1.00 77.77 ? 342 ARG A NH2 1 
ATOM   2299 N  N   . VAL A 1 279 ? -22.438 -25.254 -28.730 1.00 69.63 ? 343 VAL A N   1 
ATOM   2300 C  CA  . VAL A 1 279 ? -21.767 -24.322 -27.828 1.00 69.55 ? 343 VAL A CA  1 
ATOM   2301 C  C   . VAL A 1 279 ? -20.984 -23.291 -28.622 1.00 69.55 ? 343 VAL A C   1 
ATOM   2302 O  O   . VAL A 1 279 ? -20.434 -23.616 -29.662 1.00 69.78 ? 343 VAL A O   1 
ATOM   2303 C  CB  . VAL A 1 279 ? -20.816 -25.062 -26.868 1.00 69.71 ? 343 VAL A CB  1 
ATOM   2304 C  CG1 . VAL A 1 279 ? -21.607 -25.986 -25.921 1.00 69.71 ? 343 VAL A CG1 1 
ATOM   2305 C  CG2 . VAL A 1 279 ? -19.767 -25.856 -27.646 1.00 69.53 ? 343 VAL A CG2 1 
ATOM   2306 N  N   . GLU A 1 280 ? -20.934 -22.053 -28.141 1.00 69.68 ? 344 GLU A N   1 
ATOM   2307 C  CA  . GLU A 1 280 ? -20.191 -20.994 -28.840 1.00 69.99 ? 344 GLU A CA  1 
ATOM   2308 C  C   . GLU A 1 280 ? -18.669 -21.042 -28.550 1.00 69.39 ? 344 GLU A C   1 
ATOM   2309 O  O   . GLU A 1 280 ? -18.199 -21.796 -27.690 1.00 69.01 ? 344 GLU A O   1 
ATOM   2310 C  CB  . GLU A 1 280 ? -20.787 -19.596 -28.546 1.00 70.48 ? 344 GLU A CB  1 
ATOM   2311 C  CG  . GLU A 1 280 ? -22.316 -19.453 -28.789 1.00 73.26 ? 344 GLU A CG  1 
ATOM   2312 C  CD  . GLU A 1 280 ? -22.724 -19.500 -30.281 1.00 77.86 ? 344 GLU A CD  1 
ATOM   2313 O  OE1 . GLU A 1 280 ? -22.269 -18.623 -31.059 1.00 79.52 ? 344 GLU A OE1 1 
ATOM   2314 O  OE2 . GLU A 1 280 ? -23.513 -20.403 -30.676 1.00 78.61 ? 344 GLU A OE2 1 
ATOM   2315 N  N   . ASN A 1 281 ? -17.907 -20.236 -29.285 1.00 68.98 ? 345 ASN A N   1 
ATOM   2316 C  CA  . ASN A 1 281 ? -16.451 -20.202 -29.158 1.00 68.62 ? 345 ASN A CA  1 
ATOM   2317 C  C   . ASN A 1 281 ? -15.980 -19.383 -27.951 1.00 68.37 ? 345 ASN A C   1 
ATOM   2318 O  O   . ASN A 1 281 ? -16.061 -18.155 -27.959 1.00 68.28 ? 345 ASN A O   1 
ATOM   2319 C  CB  . ASN A 1 281 ? -15.818 -19.677 -30.458 1.00 68.61 ? 345 ASN A CB  1 
ATOM   2320 C  CG  . ASN A 1 281 ? -14.300 -19.508 -30.366 1.00 68.23 ? 345 ASN A CG  1 
ATOM   2321 O  OD1 . ASN A 1 281 ? -13.639 -20.102 -29.511 1.00 67.89 ? 345 ASN A OD1 1 
ATOM   2322 N  ND2 . ASN A 1 281 ? -13.744 -18.696 -31.261 1.00 67.51 ? 345 ASN A ND2 1 
ATOM   2323 N  N   . PRO A 1 282 ? -15.439 -20.057 -26.926 1.00 68.07 ? 346 PRO A N   1 
ATOM   2324 C  CA  . PRO A 1 282 ? -15.099 -19.311 -25.720 1.00 68.00 ? 346 PRO A CA  1 
ATOM   2325 C  C   . PRO A 1 282 ? -13.823 -18.452 -25.815 1.00 68.08 ? 346 PRO A C   1 
ATOM   2326 O  O   . PRO A 1 282 ? -13.640 -17.554 -24.993 1.00 68.13 ? 346 PRO A O   1 
ATOM   2327 C  CB  . PRO A 1 282 ? -14.969 -20.408 -24.657 1.00 67.90 ? 346 PRO A CB  1 
ATOM   2328 C  CG  . PRO A 1 282 ? -14.664 -21.664 -25.419 1.00 67.77 ? 346 PRO A CG  1 
ATOM   2329 C  CD  . PRO A 1 282 ? -14.991 -21.460 -26.864 1.00 67.84 ? 346 PRO A CD  1 
ATOM   2330 N  N   . PHE A 1 283 ? -12.963 -18.709 -26.801 1.00 68.28 ? 347 PHE A N   1 
ATOM   2331 C  CA  . PHE A 1 283 ? -11.698 -17.973 -26.927 1.00 68.40 ? 347 PHE A CA  1 
ATOM   2332 C  C   . PHE A 1 283 ? -11.745 -16.931 -28.033 1.00 68.99 ? 347 PHE A C   1 
ATOM   2333 O  O   . PHE A 1 283 ? -11.819 -17.265 -29.219 1.00 69.07 ? 347 PHE A O   1 
ATOM   2334 C  CB  . PHE A 1 283 ? -10.504 -18.915 -27.157 1.00 68.11 ? 347 PHE A CB  1 
ATOM   2335 C  CG  . PHE A 1 283 ? -10.349 -19.989 -26.111 1.00 66.80 ? 347 PHE A CG  1 
ATOM   2336 C  CD1 . PHE A 1 283 ? -10.362 -19.680 -24.762 1.00 65.37 ? 347 PHE A CD1 1 
ATOM   2337 C  CD2 . PHE A 1 283 ? -10.165 -21.315 -26.486 1.00 65.38 ? 347 PHE A CD2 1 
ATOM   2338 C  CE1 . PHE A 1 283 ? -10.217 -20.681 -23.800 1.00 65.44 ? 347 PHE A CE1 1 
ATOM   2339 C  CE2 . PHE A 1 283 ? -10.010 -22.318 -25.530 1.00 64.92 ? 347 PHE A CE2 1 
ATOM   2340 C  CZ  . PHE A 1 283 ? -10.039 -22.003 -24.188 1.00 64.86 ? 347 PHE A CZ  1 
ATOM   2341 N  N   . ASP A 1 284 ? -11.682 -15.665 -27.632 1.00 69.56 ? 348 ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 284 ? -11.734 -14.539 -28.561 1.00 70.14 ? 348 ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 284 ? -10.506 -14.471 -29.467 1.00 70.03 ? 348 ASP A C   1 
ATOM   2344 O  O   . ASP A 1 284 ? -10.476 -13.682 -30.414 1.00 70.21 ? 348 ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 284 ? -11.899 -13.222 -27.788 1.00 70.55 ? 348 ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 284 ? -10.983 -13.139 -26.561 1.00 72.50 ? 348 ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 284 ? -11.078 -14.026 -25.668 1.00 73.97 ? 348 ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 284 ? -10.176 -12.182 -26.486 1.00 73.17 ? 348 ASP A OD2 1 
ATOM   2349 N  N   . PHE A 1 285 ? -9.505  -15.305 -29.181 1.00 69.76 ? 349 PHE A N   1 
ATOM   2350 C  CA  . PHE A 1 285 ? -8.255  -15.324 -29.957 1.00 69.47 ? 349 PHE A CA  1 
ATOM   2351 C  C   . PHE A 1 285 ? -8.130  -16.455 -31.013 1.00 69.26 ? 349 PHE A C   1 
ATOM   2352 O  O   . PHE A 1 285 ? -7.047  -16.652 -31.584 1.00 69.06 ? 349 PHE A O   1 
ATOM   2353 C  CB  . PHE A 1 285 ? -7.036  -15.284 -29.020 1.00 69.46 ? 349 PHE A CB  1 
ATOM   2354 C  CG  . PHE A 1 285 ? -7.049  -16.346 -27.949 1.00 69.52 ? 349 PHE A CG  1 
ATOM   2355 C  CD1 . PHE A 1 285 ? -6.367  -17.544 -28.132 1.00 69.25 ? 349 PHE A CD1 1 
ATOM   2356 C  CD2 . PHE A 1 285 ? -7.732  -16.142 -26.750 1.00 69.86 ? 349 PHE A CD2 1 
ATOM   2357 C  CE1 . PHE A 1 285 ? -6.372  -18.529 -27.151 1.00 68.78 ? 349 PHE A CE1 1 
ATOM   2358 C  CE2 . PHE A 1 285 ? -7.746  -17.125 -25.757 1.00 69.43 ? 349 PHE A CE2 1 
ATOM   2359 C  CZ  . PHE A 1 285 ? -7.067  -18.320 -25.962 1.00 69.56 ? 349 PHE A CZ  1 
ATOM   2360 N  N   . MET A 1 286 ? -9.236  -17.169 -31.273 1.00 68.86 ? 350 MET A N   1 
ATOM   2361 C  CA  . MET A 1 286 ? -9.334  -18.160 -32.369 1.00 68.48 ? 350 MET A CA  1 
ATOM   2362 C  C   . MET A 1 286 ? -10.395 -17.767 -33.441 1.00 68.85 ? 350 MET A C   1 
ATOM   2363 O  O   . MET A 1 286 ? -10.789 -18.491 -34.369 1.00 68.75 ? 350 MET A O   1 
ATOM   2364 C  CB  . MET A 1 286 ? -9.601  -19.571 -31.814 1.00 68.17 ? 350 MET A CB  1 
ATOM   2365 C  CG  . MET A 1 286 ? -8.706  -20.012 -30.634 1.00 66.09 ? 350 MET A CG  1 
ATOM   2366 S  SD  . MET A 1 286 ? -6.922  -20.164 -30.953 1.00 61.36 ? 350 MET A SD  1 
ATOM   2367 C  CE  . MET A 1 286 ? -6.857  -21.559 -32.062 1.00 61.07 ? 350 MET A CE  1 
ATOM   2368 O  OXT . MET A 1 286 ? -10.908 -16.653 -33.430 1.00 69.19 ? 350 MET A OXT 1 
ATOM   2369 N  N   . MET B 1 1   ? 18.078  -60.570 -45.181 1.00 90.06 ? 65  MET B N   1 
ATOM   2370 C  CA  . MET B 1 1   ? 18.424  -61.412 -46.368 1.00 90.19 ? 65  MET B CA  1 
ATOM   2371 C  C   . MET B 1 1   ? 17.172  -62.085 -46.949 1.00 89.93 ? 65  MET B C   1 
ATOM   2372 O  O   . MET B 1 1   ? 16.561  -62.936 -46.293 1.00 90.00 ? 65  MET B O   1 
ATOM   2373 C  CB  . MET B 1 1   ? 19.505  -62.453 -46.029 1.00 90.35 ? 65  MET B CB  1 
ATOM   2374 C  CG  . MET B 1 1   ? 20.862  -61.842 -45.673 1.00 91.32 ? 65  MET B CG  1 
ATOM   2375 S  SD  . MET B 1 1   ? 22.298  -62.852 -46.118 1.00 93.93 ? 65  MET B SD  1 
ATOM   2376 C  CE  . MET B 1 1   ? 23.669  -61.715 -45.846 1.00 92.83 ? 65  MET B CE  1 
ATOM   2377 N  N   . GLY B 1 2   ? 16.790  -61.715 -48.177 1.00 89.55 ? 66  GLY B N   1 
ATOM   2378 C  CA  . GLY B 1 2   ? 17.555  -60.777 -49.030 1.00 88.60 ? 66  GLY B CA  1 
ATOM   2379 C  C   . GLY B 1 2   ? 17.460  -59.274 -48.744 1.00 87.73 ? 66  GLY B C   1 
ATOM   2380 O  O   . GLY B 1 2   ? 18.380  -58.519 -49.105 1.00 87.75 ? 66  GLY B O   1 
ATOM   2381 N  N   . VAL B 1 3   ? 16.367  -58.848 -48.092 1.00 86.41 ? 67  VAL B N   1 
ATOM   2382 C  CA  . VAL B 1 3   ? 16.086  -57.423 -47.812 1.00 84.75 ? 67  VAL B CA  1 
ATOM   2383 C  C   . VAL B 1 3   ? 16.515  -56.960 -46.405 1.00 83.39 ? 67  VAL B C   1 
ATOM   2384 O  O   . VAL B 1 3   ? 16.928  -55.808 -46.222 1.00 83.08 ? 67  VAL B O   1 
ATOM   2385 C  CB  . VAL B 1 3   ? 14.575  -57.087 -48.080 1.00 85.09 ? 67  VAL B CB  1 
ATOM   2386 C  CG1 . VAL B 1 3   ? 14.095  -55.874 -47.271 1.00 84.59 ? 67  VAL B CG1 1 
ATOM   2387 C  CG2 . VAL B 1 3   ? 14.320  -56.875 -49.580 1.00 85.20 ? 67  VAL B CG2 1 
ATOM   2388 N  N   . GLU B 1 4   ? 16.431  -57.861 -45.425 1.00 81.75 ? 68  GLU B N   1 
ATOM   2389 C  CA  . GLU B 1 4   ? 16.687  -57.507 -44.018 1.00 80.07 ? 68  GLU B CA  1 
ATOM   2390 C  C   . GLU B 1 4   ? 18.154  -57.232 -43.656 1.00 77.98 ? 68  GLU B C   1 
ATOM   2391 O  O   . GLU B 1 4   ? 18.455  -56.891 -42.501 1.00 78.05 ? 68  GLU B O   1 
ATOM   2392 C  CB  . GLU B 1 4   ? 16.054  -58.533 -43.053 1.00 80.52 ? 68  GLU B CB  1 
ATOM   2393 C  CG  . GLU B 1 4   ? 14.524  -58.370 -42.852 1.00 82.32 ? 68  GLU B CG  1 
ATOM   2394 C  CD  . GLU B 1 4   ? 14.091  -56.963 -42.338 1.00 85.34 ? 68  GLU B CD  1 
ATOM   2395 O  OE1 . GLU B 1 4   ? 14.730  -56.417 -41.390 1.00 86.32 ? 68  GLU B OE1 1 
ATOM   2396 O  OE2 . GLU B 1 4   ? 13.095  -56.410 -42.879 1.00 84.37 ? 68  GLU B OE2 1 
ATOM   2397 N  N   . ASP B 1 5   ? 19.050  -57.379 -44.636 1.00 76.06 ? 69  ASP B N   1 
ATOM   2398 C  CA  A ASP B 1 5   ? 20.472  -57.045 -44.472 0.50 74.77 ? 69  ASP B CA  1 
ATOM   2399 C  CA  B ASP B 1 5   ? 20.458  -57.033 -44.451 0.50 74.83 ? 69  ASP B CA  1 
ATOM   2400 C  C   . ASP B 1 5   ? 20.759  -55.661 -45.054 1.00 73.95 ? 69  ASP B C   1 
ATOM   2401 O  O   . ASP B 1 5   ? 21.907  -55.202 -45.053 1.00 74.04 ? 69  ASP B O   1 
ATOM   2402 C  CB  A ASP B 1 5   ? 21.368  -58.108 -45.128 0.50 74.62 ? 69  ASP B CB  1 
ATOM   2403 C  CB  B ASP B 1 5   ? 21.375  -58.114 -45.032 0.50 74.73 ? 69  ASP B CB  1 
ATOM   2404 C  CG  A ASP B 1 5   ? 22.865  -57.777 -45.031 0.50 74.35 ? 69  ASP B CG  1 
ATOM   2405 C  CG  B ASP B 1 5   ? 21.048  -58.450 -46.473 0.50 74.70 ? 69  ASP B CG  1 
ATOM   2406 O  OD1 A ASP B 1 5   ? 23.296  -57.158 -44.030 0.50 73.24 ? 69  ASP B OD1 1 
ATOM   2407 O  OD1 B ASP B 1 5   ? 20.084  -57.874 -47.019 0.50 74.16 ? 69  ASP B OD1 1 
ATOM   2408 O  OD2 A ASP B 1 5   ? 23.615  -58.145 -45.965 0.50 73.81 ? 69  ASP B OD2 1 
ATOM   2409 O  OD2 B ASP B 1 5   ? 21.757  -59.297 -47.059 0.50 74.22 ? 69  ASP B OD2 1 
ATOM   2410 N  N   . GLU B 1 6   ? 19.715  -55.000 -45.553 1.00 72.14 ? 70  GLU B N   1 
ATOM   2411 C  CA  . GLU B 1 6   ? 19.878  -53.682 -46.161 1.00 69.91 ? 70  GLU B CA  1 
ATOM   2412 C  C   . GLU B 1 6   ? 19.424  -52.572 -45.227 1.00 68.53 ? 70  GLU B C   1 
ATOM   2413 O  O   . GLU B 1 6   ? 18.238  -52.462 -44.937 1.00 68.30 ? 70  GLU B O   1 
ATOM   2414 C  CB  . GLU B 1 6   ? 19.155  -53.586 -47.517 1.00 69.86 ? 70  GLU B CB  1 
ATOM   2415 C  CG  . GLU B 1 6   ? 19.794  -54.402 -48.659 1.00 68.28 ? 70  GLU B CG  1 
ATOM   2416 C  CD  . GLU B 1 6   ? 21.083  -53.799 -49.198 1.00 66.64 ? 70  GLU B CD  1 
ATOM   2417 O  OE1 . GLU B 1 6   ? 21.513  -52.736 -48.698 1.00 65.56 ? 70  GLU B OE1 1 
ATOM   2418 O  OE2 . GLU B 1 6   ? 21.663  -54.397 -50.134 1.00 67.09 ? 70  GLU B OE2 1 
ATOM   2419 N  N   . PRO B 1 7   ? 20.371  -51.742 -44.753 1.00 67.19 ? 71  PRO B N   1 
ATOM   2420 C  CA  . PRO B 1 7   ? 20.024  -50.587 -43.930 1.00 66.32 ? 71  PRO B CA  1 
ATOM   2421 C  C   . PRO B 1 7   ? 18.946  -49.693 -44.560 1.00 65.32 ? 71  PRO B C   1 
ATOM   2422 O  O   . PRO B 1 7   ? 18.150  -49.100 -43.840 1.00 65.43 ? 71  PRO B O   1 
ATOM   2423 C  CB  . PRO B 1 7   ? 21.353  -49.833 -43.805 1.00 66.21 ? 71  PRO B CB  1 
ATOM   2424 C  CG  . PRO B 1 7   ? 22.378  -50.888 -43.903 1.00 66.61 ? 71  PRO B CG  1 
ATOM   2425 C  CD  . PRO B 1 7   ? 21.832  -51.897 -44.880 1.00 67.19 ? 71  PRO B CD  1 
ATOM   2426 N  N   . LEU B 1 8   ? 18.922  -49.615 -45.887 1.00 64.15 ? 72  LEU B N   1 
ATOM   2427 C  CA  . LEU B 1 8   ? 17.975  -48.776 -46.599 1.00 62.95 ? 72  LEU B CA  1 
ATOM   2428 C  C   . LEU B 1 8   ? 16.579  -49.380 -46.668 1.00 62.62 ? 72  LEU B C   1 
ATOM   2429 O  O   . LEU B 1 8   ? 15.588  -48.652 -46.682 1.00 62.01 ? 72  LEU B O   1 
ATOM   2430 C  CB  . LEU B 1 8   ? 18.492  -48.493 -48.008 1.00 62.82 ? 72  LEU B CB  1 
ATOM   2431 C  CG  . LEU B 1 8   ? 19.171  -47.160 -48.341 1.00 62.40 ? 72  LEU B CG  1 
ATOM   2432 C  CD1 . LEU B 1 8   ? 20.119  -46.667 -47.259 1.00 62.21 ? 72  LEU B CD1 1 
ATOM   2433 C  CD2 . LEU B 1 8   ? 19.902  -47.283 -49.661 1.00 62.44 ? 72  LEU B CD2 1 
ATOM   2434 N  N   . LEU B 1 9   ? 16.509  -50.708 -46.685 1.00 62.62 ? 73  LEU B N   1 
ATOM   2435 C  CA  . LEU B 1 9   ? 15.267  -51.414 -46.987 1.00 62.94 ? 73  LEU B CA  1 
ATOM   2436 C  C   . LEU B 1 9   ? 14.656  -52.191 -45.819 1.00 63.55 ? 73  LEU B C   1 
ATOM   2437 O  O   . LEU B 1 9   ? 13.508  -52.646 -45.902 1.00 63.62 ? 73  LEU B O   1 
ATOM   2438 C  CB  . LEU B 1 9   ? 15.464  -52.343 -48.189 1.00 62.54 ? 73  LEU B CB  1 
ATOM   2439 C  CG  . LEU B 1 9   ? 16.044  -51.751 -49.477 1.00 62.38 ? 73  LEU B CG  1 
ATOM   2440 C  CD1 . LEU B 1 9   ? 16.062  -52.770 -50.605 1.00 61.68 ? 73  LEU B CD1 1 
ATOM   2441 C  CD2 . LEU B 1 9   ? 15.295  -50.495 -49.910 1.00 62.81 ? 73  LEU B CD2 1 
ATOM   2442 N  N   . ARG B 1 10  ? 15.415  -52.341 -44.739 1.00 64.30 ? 74  ARG B N   1 
ATOM   2443 C  CA  . ARG B 1 10  ? 14.967  -53.133 -43.598 1.00 65.13 ? 74  ARG B CA  1 
ATOM   2444 C  C   . ARG B 1 10  ? 14.064  -52.310 -42.697 1.00 65.83 ? 74  ARG B C   1 
ATOM   2445 O  O   . ARG B 1 10  ? 14.234  -51.089 -42.580 1.00 65.71 ? 74  ARG B O   1 
ATOM   2446 C  CB  . ARG B 1 10  ? 16.160  -53.683 -42.798 1.00 64.91 ? 74  ARG B CB  1 
ATOM   2447 C  CG  . ARG B 1 10  ? 16.849  -52.657 -41.912 1.00 64.65 ? 74  ARG B CG  1 
ATOM   2448 C  CD  . ARG B 1 10  ? 18.278  -53.043 -41.632 1.00 64.90 ? 74  ARG B CD  1 
ATOM   2449 N  NE  . ARG B 1 10  ? 19.031  -51.928 -41.051 1.00 66.05 ? 74  ARG B NE  1 
ATOM   2450 C  CZ  . ARG B 1 10  ? 20.231  -52.051 -40.479 1.00 66.45 ? 74  ARG B CZ  1 
ATOM   2451 N  NH1 . ARG B 1 10  ? 20.808  -53.246 -40.404 1.00 66.22 ? 74  ARG B NH1 1 
ATOM   2452 N  NH2 . ARG B 1 10  ? 20.855  -50.985 -39.975 1.00 65.08 ? 74  ARG B NH2 1 
ATOM   2453 N  N   . GLU B 1 11  ? 13.111  -53.006 -42.073 1.00 66.95 ? 75  GLU B N   1 
ATOM   2454 C  CA  . GLU B 1 11  ? 12.186  -52.450 -41.070 1.00 67.68 ? 75  GLU B CA  1 
ATOM   2455 C  C   . GLU B 1 11  ? 12.794  -51.356 -40.177 1.00 67.59 ? 75  GLU B C   1 
ATOM   2456 O  O   . GLU B 1 11  ? 13.808  -51.559 -39.487 1.00 67.28 ? 75  GLU B O   1 
ATOM   2457 C  CB  . GLU B 1 11  ? 11.583  -53.579 -40.207 1.00 68.05 ? 75  GLU B CB  1 
ATOM   2458 C  CG  . GLU B 1 11  ? 10.836  -53.096 -38.954 1.00 69.85 ? 75  GLU B CG  1 
ATOM   2459 C  CD  . GLU B 1 11  ? 10.042  -54.202 -38.256 1.00 72.20 ? 75  GLU B CD  1 
ATOM   2460 O  OE1 . GLU B 1 11  ? 10.669  -55.127 -37.656 1.00 70.88 ? 75  GLU B OE1 1 
ATOM   2461 O  OE2 . GLU B 1 11  ? 8.784   -54.121 -38.307 1.00 71.87 ? 75  GLU B OE2 1 
ATOM   2462 N  N   . ASN B 1 12  ? 12.157  -50.191 -40.218 1.00 67.55 ? 76  ASN B N   1 
ATOM   2463 C  CA  . ASN B 1 12  ? 12.530  -49.081 -39.373 1.00 67.32 ? 76  ASN B CA  1 
ATOM   2464 C  C   . ASN B 1 12  ? 11.299  -48.616 -38.610 1.00 67.73 ? 76  ASN B C   1 
ATOM   2465 O  O   . ASN B 1 12  ? 10.387  -48.020 -39.193 1.00 67.91 ? 76  ASN B O   1 
ATOM   2466 C  CB  . ASN B 1 12  ? 13.126  -47.955 -40.212 1.00 67.07 ? 76  ASN B CB  1 
ATOM   2467 C  CG  . ASN B 1 12  ? 13.616  -46.799 -39.374 1.00 66.86 ? 76  ASN B CG  1 
ATOM   2468 O  OD1 . ASN B 1 12  ? 13.650  -46.871 -38.141 1.00 67.94 ? 76  ASN B OD1 1 
ATOM   2469 N  ND2 . ASN B 1 12  ? 13.998  -45.717 -40.037 1.00 65.94 ? 76  ASN B ND2 1 
ATOM   2470 N  N   . PRO B 1 13  ? 11.257  -48.896 -37.295 1.00 68.05 ? 77  PRO B N   1 
ATOM   2471 C  CA  . PRO B 1 13  ? 10.114  -48.461 -36.485 1.00 67.94 ? 77  PRO B CA  1 
ATOM   2472 C  C   . PRO B 1 13  ? 10.132  -46.945 -36.225 1.00 67.68 ? 77  PRO B C   1 
ATOM   2473 O  O   . PRO B 1 13  ? 9.194   -46.420 -35.613 1.00 67.90 ? 77  PRO B O   1 
ATOM   2474 C  CB  . PRO B 1 13  ? 10.308  -49.232 -35.168 1.00 68.06 ? 77  PRO B CB  1 
ATOM   2475 C  CG  . PRO B 1 13  ? 11.797  -49.398 -35.053 1.00 67.97 ? 77  PRO B CG  1 
ATOM   2476 C  CD  . PRO B 1 13  ? 12.296  -49.560 -36.478 1.00 68.15 ? 77  PRO B CD  1 
ATOM   2477 N  N   . ARG B 1 14  ? 11.190  -46.266 -36.674 1.00 66.82 ? 78  ARG B N   1 
ATOM   2478 C  CA  . ARG B 1 14  ? 11.318  -44.819 -36.512 1.00 66.54 ? 78  ARG B CA  1 
ATOM   2479 C  C   . ARG B 1 14  ? 11.159  -44.058 -37.847 1.00 65.91 ? 78  ARG B C   1 
ATOM   2480 O  O   . ARG B 1 14  ? 11.445  -42.857 -37.930 1.00 65.50 ? 78  ARG B O   1 
ATOM   2481 C  CB  . ARG B 1 14  ? 12.662  -44.471 -35.854 1.00 66.92 ? 78  ARG B CB  1 
ATOM   2482 C  CG  . ARG B 1 14  ? 12.905  -45.092 -34.479 1.00 67.92 ? 78  ARG B CG  1 
ATOM   2483 C  CD  . ARG B 1 14  ? 12.516  -44.163 -33.328 1.00 70.34 ? 78  ARG B CD  1 
ATOM   2484 N  NE  . ARG B 1 14  ? 13.339  -42.945 -33.264 1.00 70.81 ? 78  ARG B NE  1 
ATOM   2485 C  CZ  . ARG B 1 14  ? 13.562  -42.239 -32.154 1.00 70.57 ? 78  ARG B CZ  1 
ATOM   2486 N  NH1 . ARG B 1 14  ? 13.043  -42.633 -30.996 1.00 71.65 ? 78  ARG B NH1 1 
ATOM   2487 N  NH2 . ARG B 1 14  ? 14.315  -41.143 -32.194 1.00 69.70 ? 78  ARG B NH2 1 
ATOM   2488 N  N   . ARG B 1 15  ? 10.683  -44.756 -38.875 1.00 65.15 ? 79  ARG B N   1 
ATOM   2489 C  CA  . ARG B 1 15  ? 10.599  -44.194 -40.221 1.00 65.04 ? 79  ARG B CA  1 
ATOM   2490 C  C   . ARG B 1 15  ? 9.785   -42.907 -40.325 1.00 64.36 ? 79  ARG B C   1 
ATOM   2491 O  O   . ARG B 1 15  ? 10.045  -42.077 -41.201 1.00 64.58 ? 79  ARG B O   1 
ATOM   2492 C  CB  . ARG B 1 15  ? 10.068  -45.225 -41.221 1.00 65.38 ? 79  ARG B CB  1 
ATOM   2493 C  CG  . ARG B 1 15  ? 8.871   -46.000 -40.739 1.00 67.25 ? 79  ARG B CG  1 
ATOM   2494 C  CD  . ARG B 1 15  ? 8.358   -46.933 -41.817 1.00 70.43 ? 79  ARG B CD  1 
ATOM   2495 N  NE  . ARG B 1 15  ? 7.460   -47.947 -41.262 1.00 72.46 ? 79  ARG B NE  1 
ATOM   2496 C  CZ  . ARG B 1 15  ? 6.615   -48.673 -41.990 1.00 74.11 ? 79  ARG B CZ  1 
ATOM   2497 N  NH1 . ARG B 1 15  ? 6.540   -48.491 -43.306 1.00 74.57 ? 79  ARG B NH1 1 
ATOM   2498 N  NH2 . ARG B 1 15  ? 5.844   -49.579 -41.403 1.00 74.54 ? 79  ARG B NH2 1 
ATOM   2499 N  N   . PHE B 1 16  ? 8.806   -42.744 -39.443 1.00 63.41 ? 80  PHE B N   1 
ATOM   2500 C  CA  . PHE B 1 16  ? 7.947   -41.565 -39.470 1.00 62.48 ? 80  PHE B CA  1 
ATOM   2501 C  C   . PHE B 1 16  ? 8.336   -40.585 -38.387 1.00 61.80 ? 80  PHE B C   1 
ATOM   2502 O  O   . PHE B 1 16  ? 7.790   -39.477 -38.297 1.00 62.01 ? 80  PHE B O   1 
ATOM   2503 C  CB  . PHE B 1 16  ? 6.481   -41.964 -39.382 1.00 62.49 ? 80  PHE B CB  1 
ATOM   2504 C  CG  . PHE B 1 16  ? 6.059   -42.895 -40.481 1.00 63.21 ? 80  PHE B CG  1 
ATOM   2505 C  CD1 . PHE B 1 16  ? 5.790   -44.236 -40.211 1.00 64.38 ? 80  PHE B CD1 1 
ATOM   2506 C  CD2 . PHE B 1 16  ? 5.961   -42.441 -41.792 1.00 63.31 ? 80  PHE B CD2 1 
ATOM   2507 C  CE1 . PHE B 1 16  ? 5.403   -45.105 -41.234 1.00 64.74 ? 80  PHE B CE1 1 
ATOM   2508 C  CE2 . PHE B 1 16  ? 5.583   -43.299 -42.818 1.00 64.04 ? 80  PHE B CE2 1 
ATOM   2509 C  CZ  . PHE B 1 16  ? 5.306   -44.632 -42.543 1.00 63.99 ? 80  PHE B CZ  1 
ATOM   2510 N  N   . VAL B 1 17  ? 9.302   -40.993 -37.577 1.00 60.65 ? 81  VAL B N   1 
ATOM   2511 C  CA  . VAL B 1 17  ? 9.939   -40.068 -36.667 1.00 59.67 ? 81  VAL B CA  1 
ATOM   2512 C  C   . VAL B 1 17  ? 11.113  -39.386 -37.380 1.00 59.15 ? 81  VAL B C   1 
ATOM   2513 O  O   . VAL B 1 17  ? 12.049  -40.029 -37.889 1.00 59.22 ? 81  VAL B O   1 
ATOM   2514 C  CB  . VAL B 1 17  ? 10.383  -40.740 -35.361 1.00 59.75 ? 81  VAL B CB  1 
ATOM   2515 C  CG1 . VAL B 1 17  ? 10.940  -39.683 -34.395 1.00 59.53 ? 81  VAL B CG1 1 
ATOM   2516 C  CG2 . VAL B 1 17  ? 9.215   -41.520 -34.733 1.00 59.12 ? 81  VAL B CG2 1 
ATOM   2517 N  N   . ILE B 1 18  ? 11.034  -38.068 -37.399 1.00 58.11 ? 82  ILE B N   1 
ATOM   2518 C  CA  . ILE B 1 18  ? 11.935  -37.221 -38.157 1.00 57.80 ? 82  ILE B CA  1 
ATOM   2519 C  C   . ILE B 1 18  ? 13.364  -37.212 -37.583 1.00 57.27 ? 82  ILE B C   1 
ATOM   2520 O  O   . ILE B 1 18  ? 14.335  -37.450 -38.293 1.00 57.04 ? 82  ILE B O   1 
ATOM   2521 C  CB  . ILE B 1 18  ? 11.312  -35.776 -38.254 1.00 57.92 ? 82  ILE B CB  1 
ATOM   2522 C  CG1 . ILE B 1 18  ? 12.184  -34.813 -39.059 1.00 57.58 ? 82  ILE B CG1 1 
ATOM   2523 C  CG2 . ILE B 1 18  ? 10.932  -35.234 -36.861 1.00 58.44 ? 82  ILE B CG2 1 
ATOM   2524 C  CD1 . ILE B 1 18  ? 11.874  -34.841 -40.543 1.00 57.60 ? 82  ILE B CD1 1 
ATOM   2525 N  N   . PHE B 1 19  ? 13.470  -36.950 -36.288 1.00 57.11 ? 83  PHE B N   1 
ATOM   2526 C  CA  . PHE B 1 19  ? 14.748  -36.797 -35.627 1.00 56.84 ? 83  PHE B CA  1 
ATOM   2527 C  C   . PHE B 1 19  ? 15.113  -38.006 -34.751 1.00 56.80 ? 83  PHE B C   1 
ATOM   2528 O  O   . PHE B 1 19  ? 14.250  -38.857 -34.456 1.00 56.65 ? 83  PHE B O   1 
ATOM   2529 C  CB  . PHE B 1 19  ? 14.776  -35.483 -34.827 1.00 56.78 ? 83  PHE B CB  1 
ATOM   2530 C  CG  . PHE B 1 19  ? 15.133  -34.272 -35.653 1.00 56.73 ? 83  PHE B CG  1 
ATOM   2531 C  CD1 . PHE B 1 19  ? 14.990  -34.277 -37.045 1.00 57.50 ? 83  PHE B CD1 1 
ATOM   2532 C  CD2 . PHE B 1 19  ? 15.593  -33.113 -35.039 1.00 57.07 ? 83  PHE B CD2 1 
ATOM   2533 C  CE1 . PHE B 1 19  ? 15.317  -33.143 -37.811 1.00 58.39 ? 83  PHE B CE1 1 
ATOM   2534 C  CE2 . PHE B 1 19  ? 15.919  -31.961 -35.793 1.00 57.27 ? 83  PHE B CE2 1 
ATOM   2535 C  CZ  . PHE B 1 19  ? 15.784  -31.976 -37.176 1.00 57.18 ? 83  PHE B CZ  1 
ATOM   2536 N  N   . PRO B 1 20  ? 16.411  -38.115 -34.389 1.00 56.58 ? 84  PRO B N   1 
ATOM   2537 C  CA  . PRO B 1 20  ? 17.426  -37.214 -34.945 1.00 56.20 ? 84  PRO B CA  1 
ATOM   2538 C  C   . PRO B 1 20  ? 17.985  -37.762 -36.255 1.00 55.79 ? 84  PRO B C   1 
ATOM   2539 O  O   . PRO B 1 20  ? 17.811  -38.947 -36.558 1.00 55.23 ? 84  PRO B O   1 
ATOM   2540 C  CB  . PRO B 1 20  ? 18.501  -37.172 -33.851 1.00 56.27 ? 84  PRO B CB  1 
ATOM   2541 C  CG  . PRO B 1 20  ? 18.385  -38.501 -33.156 1.00 56.37 ? 84  PRO B CG  1 
ATOM   2542 C  CD  . PRO B 1 20  ? 16.989  -39.057 -33.410 1.00 56.48 ? 84  PRO B CD  1 
ATOM   2543 N  N   . ILE B 1 21  ? 18.648  -36.892 -37.011 1.00 55.66 ? 85  ILE B N   1 
ATOM   2544 C  CA  . ILE B 1 21  ? 19.263  -37.245 -38.286 1.00 55.70 ? 85  ILE B CA  1 
ATOM   2545 C  C   . ILE B 1 21  ? 20.452  -38.179 -38.077 1.00 56.06 ? 85  ILE B C   1 
ATOM   2546 O  O   . ILE B 1 21  ? 21.329  -37.911 -37.255 1.00 56.13 ? 85  ILE B O   1 
ATOM   2547 C  CB  . ILE B 1 21  ? 19.707  -35.965 -39.057 1.00 55.66 ? 85  ILE B CB  1 
ATOM   2548 C  CG1 . ILE B 1 21  ? 18.518  -35.004 -39.271 1.00 56.15 ? 85  ILE B CG1 1 
ATOM   2549 C  CG2 . ILE B 1 21  ? 20.412  -36.311 -40.381 1.00 55.26 ? 85  ILE B CG2 1 
ATOM   2550 C  CD1 . ILE B 1 21  ? 17.234  -35.635 -39.879 1.00 54.98 ? 85  ILE B CD1 1 
ATOM   2551 N  N   . GLU B 1 22  ? 20.473  -39.280 -38.822 1.00 56.50 ? 86  GLU B N   1 
ATOM   2552 C  CA  . GLU B 1 22  ? 21.557  -40.263 -38.733 1.00 56.62 ? 86  GLU B CA  1 
ATOM   2553 C  C   . GLU B 1 22  ? 22.358  -40.291 -40.025 1.00 56.07 ? 86  GLU B C   1 
ATOM   2554 O  O   . GLU B 1 22  ? 23.575  -40.429 -39.999 1.00 56.40 ? 86  GLU B O   1 
ATOM   2555 C  CB  . GLU B 1 22  ? 20.998  -41.664 -38.469 1.00 57.24 ? 86  GLU B CB  1 
ATOM   2556 C  CG  . GLU B 1 22  ? 20.017  -41.779 -37.305 1.00 60.16 ? 86  GLU B CG  1 
ATOM   2557 C  CD  . GLU B 1 22  ? 20.704  -42.102 -35.983 1.00 64.01 ? 86  GLU B CD  1 
ATOM   2558 O  OE1 . GLU B 1 22  ? 21.444  -41.229 -35.449 1.00 65.58 ? 86  GLU B OE1 1 
ATOM   2559 O  OE2 . GLU B 1 22  ? 20.489  -43.232 -35.478 1.00 64.72 ? 86  GLU B OE2 1 
ATOM   2560 N  N   . TYR B 1 23  ? 21.659  -40.187 -41.152 1.00 55.43 ? 87  TYR B N   1 
ATOM   2561 C  CA  . TYR B 1 23  ? 22.271  -40.151 -42.468 1.00 54.57 ? 87  TYR B CA  1 
ATOM   2562 C  C   . TYR B 1 23  ? 22.432  -38.716 -42.965 1.00 54.43 ? 87  TYR B C   1 
ATOM   2563 O  O   . TYR B 1 23  ? 21.527  -38.164 -43.597 1.00 54.61 ? 87  TYR B O   1 
ATOM   2564 C  CB  . TYR B 1 23  ? 21.388  -40.924 -43.418 1.00 54.30 ? 87  TYR B CB  1 
ATOM   2565 C  CG  . TYR B 1 23  ? 21.343  -42.406 -43.134 1.00 54.46 ? 87  TYR B CG  1 
ATOM   2566 C  CD1 . TYR B 1 23  ? 22.312  -43.258 -43.663 1.00 54.06 ? 87  TYR B CD1 1 
ATOM   2567 C  CD2 . TYR B 1 23  ? 20.323  -42.960 -42.365 1.00 54.14 ? 87  TYR B CD2 1 
ATOM   2568 C  CE1 . TYR B 1 23  ? 22.285  -44.611 -43.436 1.00 54.71 ? 87  TYR B CE1 1 
ATOM   2569 C  CE2 . TYR B 1 23  ? 20.274  -44.328 -42.123 1.00 55.34 ? 87  TYR B CE2 1 
ATOM   2570 C  CZ  . TYR B 1 23  ? 21.269  -45.156 -42.666 1.00 56.84 ? 87  TYR B CZ  1 
ATOM   2571 O  OH  . TYR B 1 23  ? 21.258  -46.528 -42.442 1.00 57.09 ? 87  TYR B OH  1 
ATOM   2572 N  N   . HIS B 1 24  ? 23.575  -38.098 -42.686 1.00 53.99 ? 88  HIS B N   1 
ATOM   2573 C  CA  . HIS B 1 24  ? 23.715  -36.667 -42.966 1.00 53.87 ? 88  HIS B CA  1 
ATOM   2574 C  C   . HIS B 1 24  ? 23.846  -36.352 -44.443 1.00 53.36 ? 88  HIS B C   1 
ATOM   2575 O  O   . HIS B 1 24  ? 23.343  -35.326 -44.923 1.00 53.52 ? 88  HIS B O   1 
ATOM   2576 C  CB  . HIS B 1 24  ? 24.839  -36.050 -42.134 1.00 53.86 ? 88  HIS B CB  1 
ATOM   2577 C  CG  . HIS B 1 24  ? 24.516  -36.002 -40.674 1.00 56.45 ? 88  HIS B CG  1 
ATOM   2578 N  ND1 . HIS B 1 24  ? 24.745  -37.068 -39.824 1.00 57.41 ? 88  HIS B ND1 1 
ATOM   2579 C  CD2 . HIS B 1 24  ? 23.913  -35.044 -39.924 1.00 57.95 ? 88  HIS B CD2 1 
ATOM   2580 C  CE1 . HIS B 1 24  ? 24.331  -36.755 -38.608 1.00 57.61 ? 88  HIS B CE1 1 
ATOM   2581 N  NE2 . HIS B 1 24  ? 23.820  -35.534 -38.641 1.00 57.92 ? 88  HIS B NE2 1 
ATOM   2582 N  N   . ASP B 1 25  ? 24.500  -37.252 -45.167 1.00 52.81 ? 89  ASP B N   1 
ATOM   2583 C  CA  . ASP B 1 25  ? 24.687  -37.071 -46.598 1.00 52.25 ? 89  ASP B CA  1 
ATOM   2584 C  C   . ASP B 1 25  ? 23.326  -37.064 -47.300 1.00 51.49 ? 89  ASP B C   1 
ATOM   2585 O  O   . ASP B 1 25  ? 23.047  -36.168 -48.096 1.00 51.40 ? 89  ASP B O   1 
ATOM   2586 C  CB  . ASP B 1 25  ? 25.671  -38.105 -47.189 1.00 52.13 ? 89  ASP B CB  1 
ATOM   2587 C  CG  . ASP B 1 25  ? 25.350  -39.531 -46.792 1.00 52.89 ? 89  ASP B CG  1 
ATOM   2588 O  OD1 . ASP B 1 25  ? 24.799  -39.761 -45.697 1.00 55.89 ? 89  ASP B OD1 1 
ATOM   2589 O  OD2 . ASP B 1 25  ? 25.675  -40.445 -47.571 1.00 53.60 ? 89  ASP B OD2 1 
ATOM   2590 N  N   . ILE B 1 26  ? 22.486  -38.040 -46.955 1.00 50.27 ? 90  ILE B N   1 
ATOM   2591 C  CA  . ILE B 1 26  ? 21.139  -38.147 -47.487 1.00 49.65 ? 90  ILE B CA  1 
ATOM   2592 C  C   . ILE B 1 26  ? 20.274  -36.987 -47.042 1.00 49.59 ? 90  ILE B C   1 
ATOM   2593 O  O   . ILE B 1 26  ? 19.565  -36.396 -47.851 1.00 49.89 ? 90  ILE B O   1 
ATOM   2594 C  CB  . ILE B 1 26  ? 20.493  -39.478 -47.094 1.00 49.70 ? 90  ILE B CB  1 
ATOM   2595 C  CG1 . ILE B 1 26  ? 21.334  -40.616 -47.651 1.00 49.78 ? 90  ILE B CG1 1 
ATOM   2596 C  CG2 . ILE B 1 26  ? 19.065  -39.577 -47.612 1.00 47.98 ? 90  ILE B CG2 1 
ATOM   2597 C  CD1 . ILE B 1 26  ? 21.089  -41.931 -46.988 1.00 51.50 ? 90  ILE B CD1 1 
ATOM   2598 N  N   . TRP B 1 27  ? 20.343  -36.645 -45.765 1.00 49.57 ? 91  TRP B N   1 
ATOM   2599 C  CA  . TRP B 1 27  ? 19.633  -35.468 -45.273 1.00 49.47 ? 91  TRP B CA  1 
ATOM   2600 C  C   . TRP B 1 27  ? 19.967  -34.196 -46.055 1.00 49.95 ? 91  TRP B C   1 
ATOM   2601 O  O   . TRP B 1 27  ? 19.063  -33.412 -46.342 1.00 50.00 ? 91  TRP B O   1 
ATOM   2602 C  CB  . TRP B 1 27  ? 19.873  -35.253 -43.771 1.00 49.09 ? 91  TRP B CB  1 
ATOM   2603 C  CG  . TRP B 1 27  ? 18.970  -34.208 -43.135 1.00 46.56 ? 91  TRP B CG  1 
ATOM   2604 C  CD1 . TRP B 1 27  ? 19.358  -33.033 -42.572 1.00 44.76 ? 91  TRP B CD1 1 
ATOM   2605 C  CD2 . TRP B 1 27  ? 17.536  -34.250 -43.027 1.00 45.26 ? 91  TRP B CD2 1 
ATOM   2606 N  NE1 . TRP B 1 27  ? 18.262  -32.335 -42.112 1.00 45.49 ? 91  TRP B NE1 1 
ATOM   2607 C  CE2 . TRP B 1 27  ? 17.132  -33.063 -42.377 1.00 45.24 ? 91  TRP B CE2 1 
ATOM   2608 C  CE3 . TRP B 1 27  ? 16.555  -35.175 -43.414 1.00 44.71 ? 91  TRP B CE3 1 
ATOM   2609 C  CZ2 . TRP B 1 27  ? 15.794  -32.784 -42.093 1.00 44.37 ? 91  TRP B CZ2 1 
ATOM   2610 C  CZ3 . TRP B 1 27  ? 15.228  -34.899 -43.129 1.00 43.94 ? 91  TRP B CZ3 1 
ATOM   2611 C  CH2 . TRP B 1 27  ? 14.860  -33.712 -42.478 1.00 44.24 ? 91  TRP B CH2 1 
ATOM   2612 N  N   . GLN B 1 28  ? 21.241  -33.987 -46.393 1.00 50.77 ? 92  GLN B N   1 
ATOM   2613 C  CA  . GLN B 1 28  ? 21.644  -32.733 -47.064 1.00 51.75 ? 92  GLN B CA  1 
ATOM   2614 C  C   . GLN B 1 28  ? 21.127  -32.673 -48.492 1.00 51.00 ? 92  GLN B C   1 
ATOM   2615 O  O   . GLN B 1 28  ? 20.806  -31.594 -48.998 1.00 50.72 ? 92  GLN B O   1 
ATOM   2616 C  CB  . GLN B 1 28  ? 23.166  -32.484 -47.029 1.00 52.54 ? 92  GLN B CB  1 
ATOM   2617 C  CG  . GLN B 1 28  ? 23.724  -32.069 -45.656 1.00 56.37 ? 92  GLN B CG  1 
ATOM   2618 C  CD  . GLN B 1 28  ? 22.920  -30.933 -44.961 1.00 62.70 ? 92  GLN B CD  1 
ATOM   2619 O  OE1 . GLN B 1 28  ? 22.792  -29.811 -45.487 1.00 64.29 ? 92  GLN B OE1 1 
ATOM   2620 N  NE2 . GLN B 1 28  ? 22.402  -31.225 -43.759 1.00 63.53 ? 92  GLN B NE2 1 
ATOM   2621 N  N   . MET B 1 29  ? 21.036  -33.831 -49.139 1.00 50.45 ? 93  MET B N   1 
ATOM   2622 C  CA  . MET B 1 29  ? 20.417  -33.894 -50.460 1.00 50.33 ? 93  MET B CA  1 
ATOM   2623 C  C   . MET B 1 29  ? 18.972  -33.386 -50.333 1.00 49.47 ? 93  MET B C   1 
ATOM   2624 O  O   . MET B 1 29  ? 18.471  -32.641 -51.195 1.00 49.34 ? 93  MET B O   1 
ATOM   2625 C  CB  . MET B 1 29  ? 20.436  -35.318 -51.012 1.00 50.71 ? 93  MET B CB  1 
ATOM   2626 C  CG  . MET B 1 29  ? 21.818  -35.880 -51.304 1.00 52.88 ? 93  MET B CG  1 
ATOM   2627 S  SD  . MET B 1 29  ? 22.196  -35.969 -53.066 1.00 58.97 ? 93  MET B SD  1 
ATOM   2628 C  CE  . MET B 1 29  ? 22.907  -34.328 -53.270 1.00 59.42 ? 93  MET B CE  1 
ATOM   2629 N  N   . TYR B 1 30  ? 18.319  -33.749 -49.233 1.00 47.88 ? 94  TYR B N   1 
ATOM   2630 C  CA  . TYR B 1 30  ? 16.971  -33.277 -49.016 1.00 46.82 ? 94  TYR B CA  1 
ATOM   2631 C  C   . TYR B 1 30  ? 16.934  -31.781 -48.737 1.00 46.58 ? 94  TYR B C   1 
ATOM   2632 O  O   . TYR B 1 30  ? 16.030  -31.094 -49.192 1.00 46.60 ? 94  TYR B O   1 
ATOM   2633 C  CB  . TYR B 1 30  ? 16.245  -34.073 -47.926 1.00 46.17 ? 94  TYR B CB  1 
ATOM   2634 C  CG  . TYR B 1 30  ? 15.044  -33.340 -47.422 1.00 44.59 ? 94  TYR B CG  1 
ATOM   2635 C  CD1 . TYR B 1 30  ? 13.943  -33.111 -48.250 1.00 44.04 ? 94  TYR B CD1 1 
ATOM   2636 C  CD2 . TYR B 1 30  ? 15.016  -32.826 -46.126 1.00 44.40 ? 94  TYR B CD2 1 
ATOM   2637 C  CE1 . TYR B 1 30  ? 12.840  -32.408 -47.788 1.00 42.85 ? 94  TYR B CE1 1 
ATOM   2638 C  CE2 . TYR B 1 30  ? 13.920  -32.126 -45.654 1.00 43.03 ? 94  TYR B CE2 1 
ATOM   2639 C  CZ  . TYR B 1 30  ? 12.837  -31.918 -46.494 1.00 42.47 ? 94  TYR B CZ  1 
ATOM   2640 O  OH  . TYR B 1 30  ? 11.756  -31.221 -46.027 1.00 42.43 ? 94  TYR B OH  1 
ATOM   2641 N  N   . LYS B 1 31  ? 17.915  -31.265 -48.007 1.00 46.45 ? 95  LYS B N   1 
ATOM   2642 C  CA  . LYS B 1 31  ? 17.915  -29.836 -47.714 1.00 46.64 ? 95  LYS B CA  1 
ATOM   2643 C  C   . LYS B 1 31  ? 18.210  -29.020 -48.947 1.00 46.98 ? 95  LYS B C   1 
ATOM   2644 O  O   . LYS B 1 31  ? 17.627  -27.952 -49.139 1.00 47.54 ? 95  LYS B O   1 
ATOM   2645 C  CB  . LYS B 1 31  ? 18.865  -29.481 -46.575 1.00 46.37 ? 95  LYS B CB  1 
ATOM   2646 C  CG  . LYS B 1 31  ? 18.573  -30.240 -45.278 1.00 46.69 ? 95  LYS B CG  1 
ATOM   2647 C  CD  . LYS B 1 31  ? 17.167  -29.997 -44.730 1.00 46.11 ? 95  LYS B CD  1 
ATOM   2648 C  CE  . LYS B 1 31  ? 17.078  -28.638 -44.066 1.00 45.51 ? 95  LYS B CE  1 
ATOM   2649 N  NZ  . LYS B 1 31  ? 15.723  -28.378 -43.512 1.00 45.09 ? 95  LYS B NZ  1 
ATOM   2650 N  N   . LYS B 1 32  ? 19.078  -29.533 -49.806 1.00 47.66 ? 96  LYS B N   1 
ATOM   2651 C  CA  . LYS B 1 32  ? 19.368  -28.850 -51.059 1.00 48.37 ? 96  LYS B CA  1 
ATOM   2652 C  C   . LYS B 1 32  ? 18.112  -28.760 -51.922 1.00 48.13 ? 96  LYS B C   1 
ATOM   2653 O  O   . LYS B 1 32  ? 17.832  -27.705 -52.516 1.00 48.58 ? 96  LYS B O   1 
ATOM   2654 C  CB  . LYS B 1 32  ? 20.540  -29.501 -51.810 1.00 48.61 ? 96  LYS B CB  1 
ATOM   2655 C  CG  . LYS B 1 32  ? 21.039  -28.725 -53.062 1.00 51.77 ? 96  LYS B CG  1 
ATOM   2656 C  CD  . LYS B 1 32  ? 21.842  -27.398 -52.772 1.00 57.85 ? 96  LYS B CD  1 
ATOM   2657 C  CE  . LYS B 1 32  ? 20.977  -26.125 -52.369 1.00 60.08 ? 96  LYS B CE  1 
ATOM   2658 N  NZ  . LYS B 1 32  ? 19.927  -25.664 -53.380 1.00 58.67 ? 96  LYS B NZ  1 
ATOM   2659 N  N   . ALA B 1 33  ? 17.356  -29.856 -51.964 1.00 47.73 ? 97  ALA B N   1 
ATOM   2660 C  CA  . ALA B 1 33  ? 16.120  -29.928 -52.742 1.00 47.71 ? 97  ALA B CA  1 
ATOM   2661 C  C   . ALA B 1 33  ? 15.132  -28.887 -52.239 1.00 47.78 ? 97  ALA B C   1 
ATOM   2662 O  O   . ALA B 1 33  ? 14.611  -28.069 -53.008 1.00 47.71 ? 97  ALA B O   1 
ATOM   2663 C  CB  . ALA B 1 33  ? 15.515  -31.338 -52.650 1.00 47.60 ? 97  ALA B CB  1 
ATOM   2664 N  N   . GLU B 1 34  ? 14.910  -28.922 -50.927 1.00 47.58 ? 98  GLU B N   1 
ATOM   2665 C  CA  . GLU B 1 34  ? 14.024  -28.012 -50.243 1.00 47.55 ? 98  GLU B CA  1 
ATOM   2666 C  C   . GLU B 1 34  ? 14.400  -26.542 -50.477 1.00 47.64 ? 98  GLU B C   1 
ATOM   2667 O  O   . GLU B 1 34  ? 13.542  -25.713 -50.765 1.00 47.41 ? 98  GLU B O   1 
ATOM   2668 C  CB  . GLU B 1 34  ? 14.053  -28.357 -48.761 1.00 47.68 ? 98  GLU B CB  1 
ATOM   2669 C  CG  . GLU B 1 34  ? 12.985  -27.705 -47.924 1.00 47.64 ? 98  GLU B CG  1 
ATOM   2670 C  CD  . GLU B 1 34  ? 13.098  -28.057 -46.460 1.00 48.35 ? 98  GLU B CD  1 
ATOM   2671 O  OE1 . GLU B 1 34  ? 14.060  -28.754 -46.072 1.00 47.94 ? 98  GLU B OE1 1 
ATOM   2672 O  OE2 . GLU B 1 34  ? 12.223  -27.618 -45.685 1.00 51.14 ? 98  GLU B OE2 1 
ATOM   2673 N  N   . ALA B 1 35  ? 15.689  -26.228 -50.371 1.00 47.96 ? 99  ALA B N   1 
ATOM   2674 C  CA  . ALA B 1 35  ? 16.162  -24.851 -50.544 1.00 47.78 ? 99  ALA B CA  1 
ATOM   2675 C  C   . ALA B 1 35  ? 16.064  -24.335 -51.995 1.00 47.61 ? 99  ALA B C   1 
ATOM   2676 O  O   . ALA B 1 35  ? 16.213  -23.133 -52.245 1.00 47.56 ? 99  ALA B O   1 
ATOM   2677 C  CB  . ALA B 1 35  ? 17.591  -24.697 -49.993 1.00 47.66 ? 99  ALA B CB  1 
ATOM   2678 N  N   . SER B 1 36  ? 15.819  -25.228 -52.952 1.00 47.28 ? 100 SER B N   1 
ATOM   2679 C  CA  . SER B 1 36  ? 15.666  -24.777 -54.337 1.00 46.95 ? 100 SER B CA  1 
ATOM   2680 C  C   . SER B 1 36  ? 14.243  -24.903 -54.882 1.00 46.80 ? 100 SER B C   1 
ATOM   2681 O  O   . SER B 1 36  ? 14.037  -24.936 -56.102 1.00 47.15 ? 100 SER B O   1 
ATOM   2682 C  CB  . SER B 1 36  ? 16.662  -25.471 -55.255 1.00 46.62 ? 100 SER B CB  1 
ATOM   2683 O  OG  . SER B 1 36  ? 16.515  -26.847 -55.132 1.00 46.26 ? 100 SER B OG  1 
ATOM   2684 N  N   . PHE B 1 37  ? 13.272  -24.955 -53.974 1.00 46.02 ? 101 PHE B N   1 
ATOM   2685 C  CA  . PHE B 1 37  ? 11.883  -25.028 -54.343 1.00 45.55 ? 101 PHE B CA  1 
ATOM   2686 C  C   . PHE B 1 37  ? 11.512  -23.882 -55.276 1.00 46.05 ? 101 PHE B C   1 
ATOM   2687 O  O   . PHE B 1 37  ? 11.907  -22.739 -55.057 1.00 46.17 ? 101 PHE B O   1 
ATOM   2688 C  CB  . PHE B 1 37  ? 11.015  -24.978 -53.100 1.00 44.94 ? 101 PHE B CB  1 
ATOM   2689 C  CG  . PHE B 1 37  ? 9.547   -25.053 -53.383 1.00 43.77 ? 101 PHE B CG  1 
ATOM   2690 C  CD1 . PHE B 1 37  ? 8.934   -26.289 -53.649 1.00 42.53 ? 101 PHE B CD1 1 
ATOM   2691 C  CD2 . PHE B 1 37  ? 8.764   -23.892 -53.369 1.00 41.03 ? 101 PHE B CD2 1 
ATOM   2692 C  CE1 . PHE B 1 37  ? 7.549   -26.363 -53.908 1.00 42.33 ? 101 PHE B CE1 1 
ATOM   2693 C  CE2 . PHE B 1 37  ? 7.383   -23.947 -53.618 1.00 39.89 ? 101 PHE B CE2 1 
ATOM   2694 C  CZ  . PHE B 1 37  ? 6.771   -25.182 -53.893 1.00 41.22 ? 101 PHE B CZ  1 
ATOM   2695 N  N   . TRP B 1 38  ? 10.750  -24.210 -56.318 1.00 46.41 ? 102 TRP B N   1 
ATOM   2696 C  CA  . TRP B 1 38  ? 10.172  -23.212 -57.215 1.00 46.59 ? 102 TRP B CA  1 
ATOM   2697 C  C   . TRP B 1 38  ? 8.808   -23.656 -57.735 1.00 47.08 ? 102 TRP B C   1 
ATOM   2698 O  O   . TRP B 1 38  ? 8.538   -24.847 -57.906 1.00 47.22 ? 102 TRP B O   1 
ATOM   2699 C  CB  . TRP B 1 38  ? 11.099  -22.960 -58.390 1.00 45.98 ? 102 TRP B CB  1 
ATOM   2700 C  CG  . TRP B 1 38  ? 11.404  -24.209 -59.184 1.00 45.85 ? 102 TRP B CG  1 
ATOM   2701 C  CD1 . TRP B 1 38  ? 12.274  -25.207 -58.841 1.00 45.16 ? 102 TRP B CD1 1 
ATOM   2702 C  CD2 . TRP B 1 38  ? 10.849  -24.582 -60.457 1.00 44.93 ? 102 TRP B CD2 1 
ATOM   2703 N  NE1 . TRP B 1 38  ? 12.293  -26.173 -59.816 1.00 44.93 ? 102 TRP B NE1 1 
ATOM   2704 C  CE2 . TRP B 1 38  ? 11.437  -25.815 -60.822 1.00 44.20 ? 102 TRP B CE2 1 
ATOM   2705 C  CE3 . TRP B 1 38  ? 9.920   -23.989 -61.327 1.00 44.30 ? 102 TRP B CE3 1 
ATOM   2706 C  CZ2 . TRP B 1 38  ? 11.119  -26.476 -62.010 1.00 44.68 ? 102 TRP B CZ2 1 
ATOM   2707 C  CZ3 . TRP B 1 38  ? 9.605   -24.646 -62.514 1.00 43.89 ? 102 TRP B CZ3 1 
ATOM   2708 C  CH2 . TRP B 1 38  ? 10.202  -25.881 -62.842 1.00 44.24 ? 102 TRP B CH2 1 
ATOM   2709 N  N   . THR B 1 39  ? 7.954   -22.685 -58.006 1.00 47.71 ? 103 THR B N   1 
ATOM   2710 C  CA  . THR B 1 39  ? 6.689   -22.969 -58.659 1.00 48.07 ? 103 THR B CA  1 
ATOM   2711 C  C   . THR B 1 39  ? 6.733   -22.549 -60.128 1.00 48.37 ? 103 THR B C   1 
ATOM   2712 O  O   . THR B 1 39  ? 7.552   -21.712 -60.522 1.00 48.41 ? 103 THR B O   1 
ATOM   2713 C  CB  . THR B 1 39  ? 5.542   -22.270 -57.947 1.00 48.22 ? 103 THR B CB  1 
ATOM   2714 O  OG1 . THR B 1 39  ? 5.752   -20.854 -57.995 1.00 48.35 ? 103 THR B OG1 1 
ATOM   2715 C  CG2 . THR B 1 39  ? 5.465   -22.732 -56.497 1.00 47.26 ? 103 THR B CG2 1 
ATOM   2716 N  N   . ALA B 1 40  ? 5.856   -23.159 -60.924 1.00 48.77 ? 104 ALA B N   1 
ATOM   2717 C  CA  . ALA B 1 40  ? 5.687   -22.860 -62.342 1.00 49.21 ? 104 ALA B CA  1 
ATOM   2718 C  C   . ALA B 1 40  ? 5.385   -21.389 -62.583 1.00 50.00 ? 104 ALA B C   1 
ATOM   2719 O  O   . ALA B 1 40  ? 5.774   -20.815 -63.606 1.00 50.80 ? 104 ALA B O   1 
ATOM   2720 C  CB  . ALA B 1 40  ? 4.572   -23.706 -62.910 1.00 48.77 ? 104 ALA B CB  1 
ATOM   2721 N  N   . GLU B 1 41  ? 4.683   -20.783 -61.636 1.00 50.76 ? 105 GLU B N   1 
ATOM   2722 C  CA  . GLU B 1 41  ? 4.259   -19.397 -61.751 1.00 51.57 ? 105 GLU B CA  1 
ATOM   2723 C  C   . GLU B 1 41  ? 5.452   -18.435 -61.708 1.00 51.99 ? 105 GLU B C   1 
ATOM   2724 O  O   . GLU B 1 41  ? 5.358   -17.307 -62.176 1.00 52.45 ? 105 GLU B O   1 
ATOM   2725 C  CB  . GLU B 1 41  ? 3.233   -19.065 -60.664 1.00 51.49 ? 105 GLU B CB  1 
ATOM   2726 C  CG  . GLU B 1 41  ? 1.863   -19.750 -60.874 1.00 51.74 ? 105 GLU B CG  1 
ATOM   2727 C  CD  . GLU B 1 41  ? 1.803   -21.224 -60.420 1.00 53.61 ? 105 GLU B CD  1 
ATOM   2728 O  OE1 . GLU B 1 41  ? 2.834   -21.830 -60.022 1.00 52.76 ? 105 GLU B OE1 1 
ATOM   2729 O  OE2 . GLU B 1 41  ? 0.690   -21.790 -60.464 1.00 54.71 ? 105 GLU B OE2 1 
ATOM   2730 N  N   . ALA B 1 42  ? 6.578   -18.896 -61.178 1.00 52.00 ? 106 ALA B N   1 
ATOM   2731 C  CA  . ALA B 1 42  ? 7.768   -18.071 -61.090 1.00 52.33 ? 106 ALA B CA  1 
ATOM   2732 C  C   . ALA B 1 42  ? 8.380   -17.763 -62.464 1.00 52.53 ? 106 ALA B C   1 
ATOM   2733 O  O   . ALA B 1 42  ? 9.103   -16.779 -62.621 1.00 52.16 ? 106 ALA B O   1 
ATOM   2734 C  CB  . ALA B 1 42  ? 8.792   -18.739 -60.202 1.00 52.61 ? 106 ALA B CB  1 
ATOM   2735 N  N   . VAL B 1 43  ? 8.078   -18.604 -63.450 1.00 52.73 ? 107 VAL B N   1 
ATOM   2736 C  CA  . VAL B 1 43  ? 8.683   -18.494 -64.772 1.00 52.69 ? 107 VAL B CA  1 
ATOM   2737 C  C   . VAL B 1 43  ? 7.901   -17.502 -65.620 1.00 53.32 ? 107 VAL B C   1 
ATOM   2738 O  O   . VAL B 1 43  ? 6.711   -17.650 -65.819 1.00 53.46 ? 107 VAL B O   1 
ATOM   2739 C  CB  . VAL B 1 43  ? 8.784   -19.878 -65.460 1.00 52.24 ? 107 VAL B CB  1 
ATOM   2740 C  CG1 . VAL B 1 43  ? 9.378   -19.750 -66.841 1.00 51.98 ? 107 VAL B CG1 1 
ATOM   2741 C  CG2 . VAL B 1 43  ? 9.631   -20.817 -64.632 1.00 51.42 ? 107 VAL B CG2 1 
ATOM   2742 N  N   . ASP B 1 44  ? 8.584   -16.479 -66.105 1.00 54.54 ? 108 ASP B N   1 
ATOM   2743 C  CA  . ASP B 1 44  ? 7.962   -15.468 -66.940 1.00 55.93 ? 108 ASP B CA  1 
ATOM   2744 C  C   . ASP B 1 44  ? 7.871   -15.945 -68.386 1.00 56.58 ? 108 ASP B C   1 
ATOM   2745 O  O   . ASP B 1 44  ? 8.878   -16.037 -69.085 1.00 56.10 ? 108 ASP B O   1 
ATOM   2746 C  CB  . ASP B 1 44  ? 8.758   -14.163 -66.852 1.00 56.21 ? 108 ASP B CB  1 
ATOM   2747 C  CG  . ASP B 1 44  ? 8.188   -13.055 -67.729 1.00 57.07 ? 108 ASP B CG  1 
ATOM   2748 O  OD1 . ASP B 1 44  ? 7.020   -13.149 -68.162 1.00 57.35 ? 108 ASP B OD1 1 
ATOM   2749 O  OD2 . ASP B 1 44  ? 8.920   -12.072 -67.975 1.00 58.74 ? 108 ASP B OD2 1 
ATOM   2750 N  N   . LEU B 1 45  ? 6.650   -16.236 -68.824 1.00 57.82 ? 109 LEU B N   1 
ATOM   2751 C  CA  . LEU B 1 45  ? 6.409   -16.733 -70.178 1.00 59.14 ? 109 LEU B CA  1 
ATOM   2752 C  C   . LEU B 1 45  ? 6.014   -15.649 -71.174 1.00 60.51 ? 109 LEU B C   1 
ATOM   2753 O  O   . LEU B 1 45  ? 5.939   -15.911 -72.372 1.00 61.18 ? 109 LEU B O   1 
ATOM   2754 C  CB  . LEU B 1 45  ? 5.336   -17.825 -70.158 1.00 58.82 ? 109 LEU B CB  1 
ATOM   2755 C  CG  . LEU B 1 45  ? 5.644   -19.109 -69.380 1.00 57.76 ? 109 LEU B CG  1 
ATOM   2756 C  CD1 . LEU B 1 45  ? 4.514   -20.115 -69.574 1.00 56.10 ? 109 LEU B CD1 1 
ATOM   2757 C  CD2 . LEU B 1 45  ? 6.985   -19.694 -69.795 1.00 54.72 ? 109 LEU B CD2 1 
ATOM   2758 N  N   . SER B 1 46  ? 5.791   -14.434 -70.681 1.00 62.07 ? 110 SER B N   1 
ATOM   2759 C  CA  . SER B 1 46  ? 5.189   -13.341 -71.467 1.00 63.48 ? 110 SER B CA  1 
ATOM   2760 C  C   . SER B 1 46  ? 5.987   -12.795 -72.672 1.00 64.25 ? 110 SER B C   1 
ATOM   2761 O  O   . SER B 1 46  ? 5.511   -11.887 -73.357 1.00 64.49 ? 110 SER B O   1 
ATOM   2762 C  CB  . SER B 1 46  ? 4.772   -12.184 -70.539 1.00 63.52 ? 110 SER B CB  1 
ATOM   2763 O  OG  . SER B 1 46  ? 5.911   -11.451 -70.114 1.00 64.13 ? 110 SER B OG  1 
ATOM   2764 N  N   . LYS B 1 47  ? 7.173   -13.330 -72.948 1.00 65.12 ? 111 LYS B N   1 
ATOM   2765 C  CA  . LYS B 1 47  ? 7.893   -12.922 -74.156 1.00 66.26 ? 111 LYS B CA  1 
ATOM   2766 C  C   . LYS B 1 47  ? 8.141   -14.101 -75.094 1.00 66.66 ? 111 LYS B C   1 
ATOM   2767 O  O   . LYS B 1 47  ? 8.821   -13.961 -76.127 1.00 66.96 ? 111 LYS B O   1 
ATOM   2768 C  CB  . LYS B 1 47  ? 9.242   -12.239 -73.828 1.00 66.88 ? 111 LYS B CB  1 
ATOM   2769 C  CG  . LYS B 1 47  ? 9.306   -11.326 -72.574 1.00 68.49 ? 111 LYS B CG  1 
ATOM   2770 C  CD  . LYS B 1 47  ? 8.427   -10.065 -72.668 1.00 69.91 ? 111 LYS B CD  1 
ATOM   2771 C  CE  . LYS B 1 47  ? 9.141   -8.875  -72.031 1.00 70.38 ? 111 LYS B CE  1 
ATOM   2772 N  NZ  . LYS B 1 47  ? 8.219   -8.045  -71.223 1.00 70.57 ? 111 LYS B NZ  1 
ATOM   2773 N  N   . ASP B 1 48  ? 7.598   -15.263 -74.741 1.00 67.17 ? 112 ASP B N   1 
ATOM   2774 C  CA  . ASP B 1 48  ? 7.927   -16.498 -75.460 1.00 67.95 ? 112 ASP B CA  1 
ATOM   2775 C  C   . ASP B 1 48  ? 7.186   -16.631 -76.797 1.00 68.51 ? 112 ASP B C   1 
ATOM   2776 O  O   . ASP B 1 48  ? 7.750   -17.108 -77.789 1.00 68.37 ? 112 ASP B O   1 
ATOM   2777 C  CB  . ASP B 1 48  ? 7.723   -17.728 -74.563 1.00 67.78 ? 112 ASP B CB  1 
ATOM   2778 C  CG  . ASP B 1 48  ? 8.945   -18.041 -73.695 1.00 68.01 ? 112 ASP B CG  1 
ATOM   2779 O  OD1 . ASP B 1 48  ? 9.697   -17.111 -73.332 1.00 69.15 ? 112 ASP B OD1 1 
ATOM   2780 O  OD2 . ASP B 1 48  ? 9.161   -19.226 -73.371 1.00 67.13 ? 112 ASP B OD2 1 
ATOM   2781 N  N   . ILE B 1 49  ? 5.939   -16.172 -76.811 1.00 69.39 ? 113 ILE B N   1 
ATOM   2782 C  CA  . ILE B 1 49  ? 5.052   -16.255 -77.970 1.00 70.46 ? 113 ILE B CA  1 
ATOM   2783 C  C   . ILE B 1 49  ? 5.663   -15.670 -79.263 1.00 70.97 ? 113 ILE B C   1 
ATOM   2784 O  O   . ILE B 1 49  ? 5.754   -16.373 -80.277 1.00 70.76 ? 113 ILE B O   1 
ATOM   2785 C  CB  . ILE B 1 49  ? 3.683   -15.597 -77.673 1.00 70.53 ? 113 ILE B CB  1 
ATOM   2786 C  CG1 . ILE B 1 49  ? 3.259   -15.820 -76.206 1.00 71.87 ? 113 ILE B CG1 1 
ATOM   2787 C  CG2 . ILE B 1 49  ? 2.634   -16.142 -78.606 1.00 70.77 ? 113 ILE B CG2 1 
ATOM   2788 C  CD1 . ILE B 1 49  ? 3.817   -14.769 -75.154 1.00 71.48 ? 113 ILE B CD1 1 
ATOM   2789 N  N   . GLN B 1 50  ? 6.092   -14.403 -79.221 1.00 71.53 ? 114 GLN B N   1 
ATOM   2790 C  CA  . GLN B 1 50  ? 6.743   -13.768 -80.373 1.00 72.02 ? 114 GLN B CA  1 
ATOM   2791 C  C   . GLN B 1 50  ? 7.899   -14.610 -80.939 1.00 71.72 ? 114 GLN B C   1 
ATOM   2792 O  O   . GLN B 1 50  ? 7.982   -14.815 -82.158 1.00 71.95 ? 114 GLN B O   1 
ATOM   2793 C  CB  . GLN B 1 50  ? 7.182   -12.326 -80.056 1.00 72.49 ? 114 GLN B CB  1 
ATOM   2794 C  CG  . GLN B 1 50  ? 8.259   -11.751 -81.014 1.00 75.04 ? 114 GLN B CG  1 
ATOM   2795 C  CD  . GLN B 1 50  ? 8.142   -10.236 -81.249 1.00 79.35 ? 114 GLN B CD  1 
ATOM   2796 O  OE1 . GLN B 1 50  ? 7.899   -9.453  -80.317 1.00 80.48 ? 114 GLN B OE1 1 
ATOM   2797 N  NE2 . GLN B 1 50  ? 8.323   -9.820  -82.508 1.00 79.75 ? 114 GLN B NE2 1 
ATOM   2798 N  N   . HIS B 1 51  ? 8.775   -15.101 -80.061 1.00 71.43 ? 115 HIS B N   1 
ATOM   2799 C  CA  . HIS B 1 51  ? 9.864   -16.005 -80.464 1.00 71.11 ? 115 HIS B CA  1 
ATOM   2800 C  C   . HIS B 1 51  ? 9.335   -17.300 -81.092 1.00 70.41 ? 115 HIS B C   1 
ATOM   2801 O  O   . HIS B 1 51  ? 9.860   -17.766 -82.094 1.00 70.47 ? 115 HIS B O   1 
ATOM   2802 C  CB  . HIS B 1 51  ? 10.774  -16.327 -79.276 1.00 71.48 ? 115 HIS B CB  1 
ATOM   2803 C  CG  . HIS B 1 51  ? 11.655  -15.189 -78.864 1.00 73.24 ? 115 HIS B CG  1 
ATOM   2804 N  ND1 . HIS B 1 51  ? 11.165  -14.038 -78.282 1.00 74.64 ? 115 HIS B ND1 1 
ATOM   2805 C  CD2 . HIS B 1 51  ? 12.999  -15.029 -78.942 1.00 74.50 ? 115 HIS B CD2 1 
ATOM   2806 C  CE1 . HIS B 1 51  ? 12.167  -13.215 -78.027 1.00 75.10 ? 115 HIS B CE1 1 
ATOM   2807 N  NE2 . HIS B 1 51  ? 13.291  -13.795 -78.414 1.00 75.17 ? 115 HIS B NE2 1 
ATOM   2808 N  N   . TRP B 1 52  ? 8.284   -17.859 -80.502 1.00 69.65 ? 116 TRP B N   1 
ATOM   2809 C  CA  . TRP B 1 52  ? 7.655   -19.086 -80.984 1.00 68.79 ? 116 TRP B CA  1 
ATOM   2810 C  C   . TRP B 1 52  ? 7.048   -18.938 -82.377 1.00 69.23 ? 116 TRP B C   1 
ATOM   2811 O  O   . TRP B 1 52  ? 7.103   -19.869 -83.180 1.00 69.21 ? 116 TRP B O   1 
ATOM   2812 C  CB  . TRP B 1 52  ? 6.588   -19.498 -79.982 1.00 68.24 ? 116 TRP B CB  1 
ATOM   2813 C  CG  . TRP B 1 52  ? 5.700   -20.617 -80.368 1.00 65.87 ? 116 TRP B CG  1 
ATOM   2814 C  CD1 . TRP B 1 52  ? 4.407   -20.523 -80.803 1.00 63.73 ? 116 TRP B CD1 1 
ATOM   2815 C  CD2 . TRP B 1 52  ? 6.002   -22.007 -80.301 1.00 64.29 ? 116 TRP B CD2 1 
ATOM   2816 N  NE1 . TRP B 1 52  ? 3.886   -21.770 -81.017 1.00 62.92 ? 116 TRP B NE1 1 
ATOM   2817 C  CE2 . TRP B 1 52  ? 4.843   -22.705 -80.719 1.00 63.95 ? 116 TRP B CE2 1 
ATOM   2818 C  CE3 . TRP B 1 52  ? 7.138   -22.738 -79.933 1.00 63.66 ? 116 TRP B CE3 1 
ATOM   2819 C  CZ2 . TRP B 1 52  ? 4.789   -24.105 -80.785 1.00 63.16 ? 116 TRP B CZ2 1 
ATOM   2820 C  CZ3 . TRP B 1 52  ? 7.088   -24.135 -79.996 1.00 63.45 ? 116 TRP B CZ3 1 
ATOM   2821 C  CH2 . TRP B 1 52  ? 5.918   -24.800 -80.419 1.00 63.27 ? 116 TRP B CH2 1 
ATOM   2822 N  N   . GLU B 1 53  ? 6.463   -17.775 -82.664 1.00 69.46 ? 117 GLU B N   1 
ATOM   2823 C  CA  . GLU B 1 53  ? 5.895   -17.528 -83.988 1.00 69.66 ? 117 GLU B CA  1 
ATOM   2824 C  C   . GLU B 1 53  ? 6.971   -17.266 -85.043 1.00 70.01 ? 117 GLU B C   1 
ATOM   2825 O  O   . GLU B 1 53  ? 6.785   -17.582 -86.218 1.00 70.02 ? 117 GLU B O   1 
ATOM   2826 C  CB  . GLU B 1 53  ? 4.853   -16.415 -83.946 1.00 69.50 ? 117 GLU B CB  1 
ATOM   2827 C  CG  . GLU B 1 53  ? 3.482   -16.904 -83.481 1.00 69.30 ? 117 GLU B CG  1 
ATOM   2828 C  CD  . GLU B 1 53  ? 2.642   -15.802 -82.855 1.00 69.90 ? 117 GLU B CD  1 
ATOM   2829 O  OE1 . GLU B 1 53  ? 3.065   -14.621 -82.891 1.00 69.51 ? 117 GLU B OE1 1 
ATOM   2830 O  OE2 . GLU B 1 53  ? 1.552   -16.118 -82.324 1.00 69.92 ? 117 GLU B OE2 1 
ATOM   2831 N  N   . SER B 1 54  ? 8.103   -16.716 -84.609 1.00 70.43 ? 118 SER B N   1 
ATOM   2832 C  CA  . SER B 1 54  ? 9.226   -16.439 -85.502 1.00 70.84 ? 118 SER B CA  1 
ATOM   2833 C  C   . SER B 1 54  ? 9.928   -17.723 -85.944 1.00 70.93 ? 118 SER B C   1 
ATOM   2834 O  O   . SER B 1 54  ? 10.623  -17.735 -86.960 1.00 71.01 ? 118 SER B O   1 
ATOM   2835 C  CB  . SER B 1 54  ? 10.234  -15.505 -84.821 1.00 71.09 ? 118 SER B CB  1 
ATOM   2836 O  OG  . SER B 1 54  ? 11.310  -16.238 -84.233 1.00 71.64 ? 118 SER B OG  1 
ATOM   2837 N  N   . LEU B 1 55  ? 9.748   -18.790 -85.164 1.00 71.18 ? 119 LEU B N   1 
ATOM   2838 C  CA  . LEU B 1 55  ? 10.363  -20.096 -85.424 1.00 71.15 ? 119 LEU B CA  1 
ATOM   2839 C  C   . LEU B 1 55  ? 9.850   -20.730 -86.713 1.00 71.35 ? 119 LEU B C   1 
ATOM   2840 O  O   . LEU B 1 55  ? 8.739   -20.434 -87.157 1.00 71.30 ? 119 LEU B O   1 
ATOM   2841 C  CB  . LEU B 1 55  ? 10.095  -21.051 -84.256 1.00 70.97 ? 119 LEU B CB  1 
ATOM   2842 C  CG  . LEU B 1 55  ? 10.679  -20.798 -82.858 1.00 70.64 ? 119 LEU B CG  1 
ATOM   2843 C  CD1 . LEU B 1 55  ? 10.366  -21.970 -81.946 1.00 69.62 ? 119 LEU B CD1 1 
ATOM   2844 C  CD2 . LEU B 1 55  ? 12.182  -20.555 -82.883 1.00 70.73 ? 119 LEU B CD2 1 
ATOM   2845 N  N   . LYS B 1 56  ? 10.666  -21.595 -87.310 1.00 71.52 ? 120 LYS B N   1 
ATOM   2846 C  CA  . LYS B 1 56  ? 10.242  -22.385 -88.460 1.00 72.05 ? 120 LYS B CA  1 
ATOM   2847 C  C   . LYS B 1 56  ? 9.231   -23.448 -87.995 1.00 71.85 ? 120 LYS B C   1 
ATOM   2848 O  O   . LYS B 1 56  ? 9.321   -23.910 -86.856 1.00 72.12 ? 120 LYS B O   1 
ATOM   2849 C  CB  . LYS B 1 56  ? 11.453  -23.067 -89.100 1.00 72.50 ? 120 LYS B CB  1 
ATOM   2850 C  CG  . LYS B 1 56  ? 12.443  -22.135 -89.793 1.00 74.40 ? 120 LYS B CG  1 
ATOM   2851 C  CD  . LYS B 1 56  ? 13.567  -22.943 -90.467 1.00 77.63 ? 120 LYS B CD  1 
ATOM   2852 C  CE  . LYS B 1 56  ? 14.207  -22.169 -91.634 1.00 79.65 ? 120 LYS B CE  1 
ATOM   2853 N  NZ  . LYS B 1 56  ? 14.970  -23.057 -92.571 1.00 80.04 ? 120 LYS B NZ  1 
ATOM   2854 N  N   . PRO B 1 57  ? 8.268   -23.838 -88.865 1.00 71.59 ? 121 PRO B N   1 
ATOM   2855 C  CA  . PRO B 1 57  ? 7.249   -24.857 -88.516 1.00 71.25 ? 121 PRO B CA  1 
ATOM   2856 C  C   . PRO B 1 57  ? 7.788   -26.194 -87.977 1.00 70.78 ? 121 PRO B C   1 
ATOM   2857 O  O   . PRO B 1 57  ? 7.117   -26.832 -87.164 1.00 70.97 ? 121 PRO B O   1 
ATOM   2858 C  CB  . PRO B 1 57  ? 6.513   -25.099 -89.847 1.00 71.24 ? 121 PRO B CB  1 
ATOM   2859 C  CG  . PRO B 1 57  ? 6.680   -23.842 -90.605 1.00 71.30 ? 121 PRO B CG  1 
ATOM   2860 C  CD  . PRO B 1 57  ? 8.045   -23.295 -90.221 1.00 71.54 ? 121 PRO B CD  1 
ATOM   2861 N  N   . GLU B 1 58  ? 8.967   -26.615 -88.434 1.00 70.11 ? 122 GLU B N   1 
ATOM   2862 C  CA  . GLU B 1 58  ? 9.555   -27.893 -88.007 1.00 69.58 ? 122 GLU B CA  1 
ATOM   2863 C  C   . GLU B 1 58  ? 10.231  -27.797 -86.634 1.00 68.61 ? 122 GLU B C   1 
ATOM   2864 O  O   . GLU B 1 58  ? 10.361  -28.800 -85.922 1.00 68.62 ? 122 GLU B O   1 
ATOM   2865 C  CB  . GLU B 1 58  ? 10.520  -28.472 -89.067 1.00 69.81 ? 122 GLU B CB  1 
ATOM   2866 C  CG  . GLU B 1 58  ? 11.608  -27.503 -89.606 1.00 72.64 ? 122 GLU B CG  1 
ATOM   2867 C  CD  . GLU B 1 58  ? 11.265  -26.857 -90.975 1.00 75.91 ? 122 GLU B CD  1 
ATOM   2868 O  OE1 . GLU B 1 58  ? 10.259  -27.250 -91.619 1.00 75.74 ? 122 GLU B OE1 1 
ATOM   2869 O  OE2 . GLU B 1 58  ? 12.021  -25.953 -91.414 1.00 77.32 ? 122 GLU B OE2 1 
ATOM   2870 N  N   . GLU B 1 59  ? 10.663  -26.591 -86.276 1.00 67.31 ? 123 GLU B N   1 
ATOM   2871 C  CA  . GLU B 1 59  ? 11.220  -26.330 -84.959 1.00 66.02 ? 123 GLU B CA  1 
ATOM   2872 C  C   . GLU B 1 59  ? 10.082  -26.358 -83.941 1.00 64.92 ? 123 GLU B C   1 
ATOM   2873 O  O   . GLU B 1 59  ? 10.182  -27.044 -82.926 1.00 65.18 ? 123 GLU B O   1 
ATOM   2874 C  CB  . GLU B 1 59  ? 11.964  -24.994 -84.933 1.00 66.33 ? 123 GLU B CB  1 
ATOM   2875 C  CG  . GLU B 1 59  ? 13.177  -24.930 -85.875 1.00 67.80 ? 123 GLU B CG  1 
ATOM   2876 C  CD  . GLU B 1 59  ? 13.897  -23.574 -85.855 1.00 69.92 ? 123 GLU B CD  1 
ATOM   2877 O  OE1 . GLU B 1 59  ? 13.250  -22.530 -86.126 1.00 71.69 ? 123 GLU B OE1 1 
ATOM   2878 O  OE2 . GLU B 1 59  ? 15.119  -23.559 -85.581 1.00 68.92 ? 123 GLU B OE2 1 
ATOM   2879 N  N   . ARG B 1 60  ? 8.986   -25.654 -84.236 1.00 63.14 ? 124 ARG B N   1 
ATOM   2880 C  CA  . ARG B 1 60  ? 7.790   -25.687 -83.397 1.00 61.46 ? 124 ARG B CA  1 
ATOM   2881 C  C   . ARG B 1 60  ? 7.260   -27.098 -83.219 1.00 60.48 ? 124 ARG B C   1 
ATOM   2882 O  O   . ARG B 1 60  ? 6.577   -27.400 -82.257 1.00 60.45 ? 124 ARG B O   1 
ATOM   2883 C  CB  . ARG B 1 60  ? 6.684   -24.826 -83.986 1.00 61.38 ? 124 ARG B CB  1 
ATOM   2884 C  CG  . ARG B 1 60  ? 6.753   -23.359 -83.623 1.00 61.08 ? 124 ARG B CG  1 
ATOM   2885 C  CD  . ARG B 1 60  ? 5.442   -22.645 -83.957 1.00 61.16 ? 124 ARG B CD  1 
ATOM   2886 N  NE  . ARG B 1 60  ? 5.095   -22.750 -85.374 1.00 61.49 ? 124 ARG B NE  1 
ATOM   2887 C  CZ  . ARG B 1 60  ? 5.598   -21.978 -86.333 1.00 61.65 ? 124 ARG B CZ  1 
ATOM   2888 N  NH1 . ARG B 1 60  ? 6.467   -21.015 -86.039 1.00 61.97 ? 124 ARG B NH1 1 
ATOM   2889 N  NH2 . ARG B 1 60  ? 5.220   -22.162 -87.588 1.00 61.73 ? 124 ARG B NH2 1 
ATOM   2890 N  N   . TYR B 1 61  ? 7.575   -27.961 -84.164 1.00 59.44 ? 125 TYR B N   1 
ATOM   2891 C  CA  . TYR B 1 61  ? 7.156   -29.346 -84.090 1.00 58.36 ? 125 TYR B CA  1 
ATOM   2892 C  C   . TYR B 1 61  ? 8.044   -30.107 -83.095 1.00 57.44 ? 125 TYR B C   1 
ATOM   2893 O  O   . TYR B 1 61  ? 7.541   -30.763 -82.167 1.00 56.85 ? 125 TYR B O   1 
ATOM   2894 C  CB  . TYR B 1 61  ? 7.173   -29.975 -85.496 1.00 58.35 ? 125 TYR B CB  1 
ATOM   2895 C  CG  . TYR B 1 61  ? 6.939   -31.465 -85.517 1.00 57.69 ? 125 TYR B CG  1 
ATOM   2896 C  CD1 . TYR B 1 61  ? 5.649   -31.990 -85.401 1.00 57.93 ? 125 TYR B CD1 1 
ATOM   2897 C  CD2 . TYR B 1 61  ? 8.007   -32.353 -85.655 1.00 56.33 ? 125 TYR B CD2 1 
ATOM   2898 C  CE1 . TYR B 1 61  ? 5.436   -33.367 -85.421 1.00 57.48 ? 125 TYR B CE1 1 
ATOM   2899 C  CE2 . TYR B 1 61  ? 7.807   -33.724 -85.672 1.00 56.57 ? 125 TYR B CE2 1 
ATOM   2900 C  CZ  . TYR B 1 61  ? 6.524   -34.224 -85.550 1.00 57.32 ? 125 TYR B CZ  1 
ATOM   2901 O  OH  . TYR B 1 61  ? 6.327   -35.583 -85.568 1.00 58.50 ? 125 TYR B OH  1 
ATOM   2902 N  N   . PHE B 1 62  ? 9.357   -30.001 -83.295 1.00 56.33 ? 126 PHE B N   1 
ATOM   2903 C  CA  . PHE B 1 62  ? 10.331  -30.622 -82.413 1.00 55.62 ? 126 PHE B CA  1 
ATOM   2904 C  C   . PHE B 1 62  ? 10.064  -30.254 -80.955 1.00 55.62 ? 126 PHE B C   1 
ATOM   2905 O  O   . PHE B 1 62  ? 9.919   -31.121 -80.093 1.00 55.68 ? 126 PHE B O   1 
ATOM   2906 C  CB  . PHE B 1 62  ? 11.730  -30.158 -82.784 1.00 55.39 ? 126 PHE B CB  1 
ATOM   2907 C  CG  . PHE B 1 62  ? 12.808  -30.767 -81.940 1.00 55.07 ? 126 PHE B CG  1 
ATOM   2908 C  CD1 . PHE B 1 62  ? 13.352  -32.005 -82.275 1.00 53.23 ? 126 PHE B CD1 1 
ATOM   2909 C  CD2 . PHE B 1 62  ? 13.271  -30.112 -80.801 1.00 54.04 ? 126 PHE B CD2 1 
ATOM   2910 C  CE1 . PHE B 1 62  ? 14.342  -32.576 -81.505 1.00 53.36 ? 126 PHE B CE1 1 
ATOM   2911 C  CE2 . PHE B 1 62  ? 14.256  -30.677 -80.020 1.00 53.89 ? 126 PHE B CE2 1 
ATOM   2912 C  CZ  . PHE B 1 62  ? 14.798  -31.914 -80.369 1.00 54.11 ? 126 PHE B CZ  1 
ATOM   2913 N  N   . ILE B 1 63  ? 9.995   -28.950 -80.707 1.00 55.11 ? 127 ILE B N   1 
ATOM   2914 C  CA  . ILE B 1 63  ? 9.838   -28.401 -79.377 1.00 54.36 ? 127 ILE B CA  1 
ATOM   2915 C  C   . ILE B 1 63  ? 8.552   -28.861 -78.716 1.00 53.91 ? 127 ILE B C   1 
ATOM   2916 O  O   . ILE B 1 63  ? 8.577   -29.278 -77.565 1.00 54.23 ? 127 ILE B O   1 
ATOM   2917 C  CB  . ILE B 1 63  ? 9.970   -26.850 -79.396 1.00 54.34 ? 127 ILE B CB  1 
ATOM   2918 C  CG1 . ILE B 1 63  ? 11.440  -26.467 -79.578 1.00 53.61 ? 127 ILE B CG1 1 
ATOM   2919 C  CG2 . ILE B 1 63  ? 9.418   -26.221 -78.116 1.00 54.20 ? 127 ILE B CG2 1 
ATOM   2920 C  CD1 . ILE B 1 63  ? 11.657  -25.078 -80.105 1.00 53.23 ? 127 ILE B CD1 1 
ATOM   2921 N  N   . SER B 1 64  ? 7.443   -28.810 -79.442 1.00 53.50 ? 128 SER B N   1 
ATOM   2922 C  CA  . SER B 1 64  ? 6.158   -29.254 -78.897 1.00 53.18 ? 128 SER B CA  1 
ATOM   2923 C  C   . SER B 1 64  ? 6.221   -30.733 -78.557 1.00 52.91 ? 128 SER B C   1 
ATOM   2924 O  O   . SER B 1 64  ? 5.570   -31.182 -77.633 1.00 53.04 ? 128 SER B O   1 
ATOM   2925 C  CB  . SER B 1 64  ? 5.022   -29.021 -79.895 1.00 53.21 ? 128 SER B CB  1 
ATOM   2926 O  OG  . SER B 1 64  ? 5.170   -29.868 -81.025 1.00 53.33 ? 128 SER B OG  1 
ATOM   2927 N  N   . HIS B 1 65  ? 7.004   -31.483 -79.319 1.00 52.53 ? 129 HIS B N   1 
ATOM   2928 C  CA  . HIS B 1 65  ? 7.125   -32.914 -79.104 1.00 52.25 ? 129 HIS B CA  1 
ATOM   2929 C  C   . HIS B 1 65  ? 8.030   -33.240 -77.922 1.00 51.66 ? 129 HIS B C   1 
ATOM   2930 O  O   . HIS B 1 65  ? 7.794   -34.214 -77.210 1.00 51.90 ? 129 HIS B O   1 
ATOM   2931 C  CB  . HIS B 1 65  ? 7.582   -33.611 -80.389 1.00 52.44 ? 129 HIS B CB  1 
ATOM   2932 C  CG  . HIS B 1 65  ? 6.447   -33.998 -81.295 1.00 54.19 ? 129 HIS B CG  1 
ATOM   2933 N  ND1 . HIS B 1 65  ? 5.412   -33.135 -81.610 1.00 55.48 ? 129 HIS B ND1 1 
ATOM   2934 C  CD2 . HIS B 1 65  ? 6.179   -35.158 -81.942 1.00 54.74 ? 129 HIS B CD2 1 
ATOM   2935 C  CE1 . HIS B 1 65  ? 4.553   -33.751 -82.401 1.00 55.59 ? 129 HIS B CE1 1 
ATOM   2936 N  NE2 . HIS B 1 65  ? 4.997   -34.979 -82.618 1.00 56.63 ? 129 HIS B NE2 1 
ATOM   2937 N  N   . VAL B 1 66  ? 9.050   -32.416 -77.699 1.00 50.62 ? 130 VAL B N   1 
ATOM   2938 C  CA  . VAL B 1 66  ? 9.914   -32.586 -76.538 1.00 49.49 ? 130 VAL B CA  1 
ATOM   2939 C  C   . VAL B 1 66  ? 9.105   -32.281 -75.266 1.00 48.87 ? 130 VAL B C   1 
ATOM   2940 O  O   . VAL B 1 66  ? 9.128   -33.066 -74.308 1.00 48.53 ? 130 VAL B O   1 
ATOM   2941 C  CB  . VAL B 1 66  ? 11.229  -31.748 -76.663 1.00 49.81 ? 130 VAL B CB  1 
ATOM   2942 C  CG1 . VAL B 1 66  ? 11.804  -31.361 -75.292 1.00 48.82 ? 130 VAL B CG1 1 
ATOM   2943 C  CG2 . VAL B 1 66  ? 12.265  -32.515 -77.499 1.00 48.64 ? 130 VAL B CG2 1 
ATOM   2944 N  N   . LEU B 1 67  ? 8.352   -31.183 -75.289 1.00 47.55 ? 131 LEU B N   1 
ATOM   2945 C  CA  . LEU B 1 67  ? 7.509   -30.829 -74.162 1.00 47.09 ? 131 LEU B CA  1 
ATOM   2946 C  C   . LEU B 1 67  ? 6.556   -31.961 -73.798 1.00 47.57 ? 131 LEU B C   1 
ATOM   2947 O  O   . LEU B 1 67  ? 6.487   -32.382 -72.649 1.00 48.05 ? 131 LEU B O   1 
ATOM   2948 C  CB  . LEU B 1 67  ? 6.740   -29.535 -74.429 1.00 46.33 ? 131 LEU B CB  1 
ATOM   2949 C  CG  . LEU B 1 67  ? 7.550   -28.258 -74.657 1.00 44.34 ? 131 LEU B CG  1 
ATOM   2950 C  CD1 . LEU B 1 67  ? 6.616   -27.092 -74.805 1.00 42.13 ? 131 LEU B CD1 1 
ATOM   2951 C  CD2 . LEU B 1 67  ? 8.554   -27.990 -73.533 1.00 43.73 ? 131 LEU B CD2 1 
ATOM   2952 N  N   . ALA B 1 68  ? 5.846   -32.474 -74.787 1.00 48.02 ? 132 ALA B N   1 
ATOM   2953 C  CA  . ALA B 1 68  ? 4.946   -33.592 -74.584 1.00 48.28 ? 132 ALA B CA  1 
ATOM   2954 C  C   . ALA B 1 68  ? 5.690   -34.774 -74.006 1.00 48.63 ? 132 ALA B C   1 
ATOM   2955 O  O   . ALA B 1 68  ? 5.199   -35.394 -73.067 1.00 49.56 ? 132 ALA B O   1 
ATOM   2956 C  CB  . ALA B 1 68  ? 4.272   -33.973 -75.881 1.00 48.21 ? 132 ALA B CB  1 
ATOM   2957 N  N   . PHE B 1 69  ? 6.870   -35.090 -74.532 1.00 48.54 ? 133 PHE B N   1 
ATOM   2958 C  CA  . PHE B 1 69  ? 7.627   -36.216 -73.989 1.00 48.69 ? 133 PHE B CA  1 
ATOM   2959 C  C   . PHE B 1 69  ? 7.980   -36.009 -72.514 1.00 48.83 ? 133 PHE B C   1 
ATOM   2960 O  O   . PHE B 1 69  ? 7.791   -36.901 -71.704 1.00 49.34 ? 133 PHE B O   1 
ATOM   2961 C  CB  . PHE B 1 69  ? 8.887   -36.497 -74.812 1.00 48.83 ? 133 PHE B CB  1 
ATOM   2962 C  CG  . PHE B 1 69  ? 10.010  -37.147 -74.016 1.00 49.57 ? 133 PHE B CG  1 
ATOM   2963 C  CD1 . PHE B 1 69  ? 9.925   -38.488 -73.613 1.00 49.31 ? 133 PHE B CD1 1 
ATOM   2964 C  CD2 . PHE B 1 69  ? 11.150  -36.415 -73.672 1.00 48.59 ? 133 PHE B CD2 1 
ATOM   2965 C  CE1 . PHE B 1 69  ? 10.954  -39.083 -72.886 1.00 48.60 ? 133 PHE B CE1 1 
ATOM   2966 C  CE2 . PHE B 1 69  ? 12.179  -37.004 -72.948 1.00 48.28 ? 133 PHE B CE2 1 
ATOM   2967 C  CZ  . PHE B 1 69  ? 12.082  -38.338 -72.547 1.00 47.43 ? 133 PHE B CZ  1 
ATOM   2968 N  N   . PHE B 1 70  ? 8.506   -34.837 -72.178 1.00 48.65 ? 134 PHE B N   1 
ATOM   2969 C  CA  . PHE B 1 70  ? 8.869   -34.529 -70.807 1.00 48.27 ? 134 PHE B CA  1 
ATOM   2970 C  C   . PHE B 1 70  ? 7.661   -34.653 -69.887 1.00 48.98 ? 134 PHE B C   1 
ATOM   2971 O  O   . PHE B 1 70  ? 7.727   -35.341 -68.861 1.00 49.64 ? 134 PHE B O   1 
ATOM   2972 C  CB  . PHE B 1 70  ? 9.442   -33.123 -70.699 1.00 47.80 ? 134 PHE B CB  1 
ATOM   2973 C  CG  . PHE B 1 70  ? 10.910  -33.024 -70.985 1.00 46.29 ? 134 PHE B CG  1 
ATOM   2974 C  CD1 . PHE B 1 70  ? 11.775  -34.055 -70.670 1.00 46.14 ? 134 PHE B CD1 1 
ATOM   2975 C  CD2 . PHE B 1 70  ? 11.438  -31.854 -71.526 1.00 46.10 ? 134 PHE B CD2 1 
ATOM   2976 C  CE1 . PHE B 1 70  ? 13.139  -33.946 -70.910 1.00 45.52 ? 134 PHE B CE1 1 
ATOM   2977 C  CE2 . PHE B 1 70  ? 12.804  -31.724 -71.765 1.00 45.50 ? 134 PHE B CE2 1 
ATOM   2978 C  CZ  . PHE B 1 70  ? 13.656  -32.771 -71.454 1.00 45.91 ? 134 PHE B CZ  1 
ATOM   2979 N  N   . ALA B 1 71  ? 6.561   -33.999 -70.250 1.00 48.93 ? 135 ALA B N   1 
ATOM   2980 C  CA  . ALA B 1 71  ? 5.346   -34.065 -69.457 1.00 49.31 ? 135 ALA B CA  1 
ATOM   2981 C  C   . ALA B 1 71  ? 4.903   -35.506 -69.199 1.00 49.80 ? 135 ALA B C   1 
ATOM   2982 O  O   . ALA B 1 71  ? 4.551   -35.851 -68.080 1.00 50.46 ? 135 ALA B O   1 
ATOM   2983 C  CB  . ALA B 1 71  ? 4.228   -33.264 -70.113 1.00 49.20 ? 135 ALA B CB  1 
ATOM   2984 N  N   . ALA B 1 72  ? 4.950   -36.354 -70.216 1.00 50.11 ? 136 ALA B N   1 
ATOM   2985 C  CA  . ALA B 1 72  ? 4.529   -37.739 -70.061 1.00 50.87 ? 136 ALA B CA  1 
ATOM   2986 C  C   . ALA B 1 72  ? 5.468   -38.546 -69.145 1.00 51.54 ? 136 ALA B C   1 
ATOM   2987 O  O   . ALA B 1 72  ? 5.001   -39.282 -68.266 1.00 51.97 ? 136 ALA B O   1 
ATOM   2988 C  CB  . ALA B 1 72  ? 4.415   -38.397 -71.417 1.00 50.85 ? 136 ALA B CB  1 
ATOM   2989 N  N   . SER B 1 73  ? 6.777   -38.404 -69.348 1.00 51.70 ? 137 SER B N   1 
ATOM   2990 C  CA  . SER B 1 73  ? 7.778   -39.139 -68.564 1.00 52.21 ? 137 SER B CA  1 
ATOM   2991 C  C   . SER B 1 73  ? 7.776   -38.801 -67.073 1.00 52.36 ? 137 SER B C   1 
ATOM   2992 O  O   . SER B 1 73  ? 7.932   -39.695 -66.234 1.00 52.53 ? 137 SER B O   1 
ATOM   2993 C  CB  . SER B 1 73  ? 9.171   -38.896 -69.118 1.00 52.01 ? 137 SER B CB  1 
ATOM   2994 O  OG  . SER B 1 73  ? 9.124   -38.833 -70.524 1.00 53.39 ? 137 SER B OG  1 
ATOM   2995 N  N   . ASP B 1 74  ? 7.625   -37.516 -66.745 1.00 52.21 ? 138 ASP B N   1 
ATOM   2996 C  CA  . ASP B 1 74  ? 7.517   -37.088 -65.350 1.00 51.77 ? 138 ASP B CA  1 
ATOM   2997 C  C   . ASP B 1 74  ? 6.466   -37.909 -64.640 1.00 51.55 ? 138 ASP B C   1 
ATOM   2998 O  O   . ASP B 1 74  ? 6.661   -38.313 -63.495 1.00 51.96 ? 138 ASP B O   1 
ATOM   2999 C  CB  . ASP B 1 74  ? 7.101   -35.632 -65.252 1.00 51.78 ? 138 ASP B CB  1 
ATOM   3000 C  CG  . ASP B 1 74  ? 8.242   -34.688 -65.408 1.00 52.33 ? 138 ASP B CG  1 
ATOM   3001 O  OD1 . ASP B 1 74  ? 9.412   -35.118 -65.506 1.00 52.40 ? 138 ASP B OD1 1 
ATOM   3002 O  OD2 . ASP B 1 74  ? 7.951   -33.484 -65.414 1.00 55.24 ? 138 ASP B OD2 1 
ATOM   3003 N  N   . GLY B 1 75  ? 5.343   -38.135 -65.322 1.00 50.80 ? 139 GLY B N   1 
ATOM   3004 C  CA  . GLY B 1 75  ? 4.244   -38.904 -64.765 1.00 49.83 ? 139 GLY B CA  1 
ATOM   3005 C  C   . GLY B 1 75  ? 4.684   -40.306 -64.446 1.00 49.32 ? 139 GLY B C   1 
ATOM   3006 O  O   . GLY B 1 75  ? 4.296   -40.858 -63.427 1.00 49.75 ? 139 GLY B O   1 
ATOM   3007 N  N   . ILE B 1 76  ? 5.508   -40.881 -65.318 1.00 48.90 ? 140 ILE B N   1 
ATOM   3008 C  CA  . ILE B 1 76  ? 6.059   -42.216 -65.100 1.00 48.11 ? 140 ILE B CA  1 
ATOM   3009 C  C   . ILE B 1 76  ? 7.056   -42.204 -63.937 1.00 48.17 ? 140 ILE B C   1 
ATOM   3010 O  O   . ILE B 1 76  ? 7.015   -43.098 -63.089 1.00 48.15 ? 140 ILE B O   1 
ATOM   3011 C  CB  . ILE B 1 76  ? 6.696   -42.793 -66.379 1.00 47.93 ? 140 ILE B CB  1 
ATOM   3012 C  CG1 . ILE B 1 76  ? 5.621   -42.955 -67.457 1.00 48.00 ? 140 ILE B CG1 1 
ATOM   3013 C  CG2 . ILE B 1 76  ? 7.383   -44.128 -66.098 1.00 46.95 ? 140 ILE B CG2 1 
ATOM   3014 C  CD1 . ILE B 1 76  ? 6.170   -43.097 -68.846 1.00 48.71 ? 140 ILE B CD1 1 
ATOM   3015 N  N   . VAL B 1 77  ? 7.925   -41.191 -63.881 1.00 47.75 ? 141 VAL B N   1 
ATOM   3016 C  CA  . VAL B 1 77  ? 8.840   -41.040 -62.756 1.00 47.56 ? 141 VAL B CA  1 
ATOM   3017 C  C   . VAL B 1 77  ? 8.026   -40.958 -61.453 1.00 47.88 ? 141 VAL B C   1 
ATOM   3018 O  O   . VAL B 1 77  ? 8.275   -41.692 -60.495 1.00 47.35 ? 141 VAL B O   1 
ATOM   3019 C  CB  . VAL B 1 77  ? 9.803   -39.838 -62.952 1.00 47.42 ? 141 VAL B CB  1 
ATOM   3020 C  CG1 . VAL B 1 77  ? 10.718  -39.662 -61.754 1.00 46.68 ? 141 VAL B CG1 1 
ATOM   3021 C  CG2 . VAL B 1 77  ? 10.650  -40.029 -64.205 1.00 47.15 ? 141 VAL B CG2 1 
ATOM   3022 N  N   . ASN B 1 78  ? 7.021   -40.093 -61.460 1.00 48.88 ? 142 ASN B N   1 
ATOM   3023 C  CA  . ASN B 1 78  ? 6.112   -39.898 -60.338 1.00 49.80 ? 142 ASN B CA  1 
ATOM   3024 C  C   . ASN B 1 78  ? 5.460   -41.229 -59.924 1.00 49.86 ? 142 ASN B C   1 
ATOM   3025 O  O   . ASN B 1 78  ? 5.468   -41.580 -58.738 1.00 49.98 ? 142 ASN B O   1 
ATOM   3026 C  CB  . ASN B 1 78  ? 5.068   -38.856 -60.737 1.00 50.46 ? 142 ASN B CB  1 
ATOM   3027 C  CG  . ASN B 1 78  ? 4.288   -38.296 -59.554 1.00 52.97 ? 142 ASN B CG  1 
ATOM   3028 O  OD1 . ASN B 1 78  ? 3.337   -38.920 -59.067 1.00 56.00 ? 142 ASN B OD1 1 
ATOM   3029 N  ND2 . ASN B 1 78  ? 4.642   -37.080 -59.133 1.00 54.33 ? 142 ASN B ND2 1 
ATOM   3030 N  N   . GLU B 1 79  ? 4.941   -41.991 -60.889 1.00 49.49 ? 143 GLU B N   1 
ATOM   3031 C  CA  . GLU B 1 79  ? 4.318   -43.276 -60.561 1.00 49.78 ? 143 GLU B CA  1 
ATOM   3032 C  C   . GLU B 1 79  ? 5.249   -44.185 -59.755 1.00 49.12 ? 143 GLU B C   1 
ATOM   3033 O  O   . GLU B 1 79  ? 4.823   -44.855 -58.814 1.00 48.92 ? 143 GLU B O   1 
ATOM   3034 C  CB  . GLU B 1 79  ? 3.835   -44.024 -61.800 1.00 50.04 ? 143 GLU B CB  1 
ATOM   3035 C  CG  . GLU B 1 79  ? 3.034   -45.272 -61.426 1.00 53.21 ? 143 GLU B CG  1 
ATOM   3036 C  CD  . GLU B 1 79  ? 2.642   -46.144 -62.608 1.00 57.82 ? 143 GLU B CD  1 
ATOM   3037 O  OE1 . GLU B 1 79  ? 2.499   -45.610 -63.739 1.00 59.01 ? 143 GLU B OE1 1 
ATOM   3038 O  OE2 . GLU B 1 79  ? 2.472   -47.372 -62.392 1.00 59.14 ? 143 GLU B OE2 1 
ATOM   3039 N  N   . ASN B 1 80  ? 6.517   -44.196 -60.139 1.00 48.64 ? 144 ASN B N   1 
ATOM   3040 C  CA  . ASN B 1 80  ? 7.499   -45.044 -59.519 1.00 48.14 ? 144 ASN B CA  1 
ATOM   3041 C  C   . ASN B 1 80  ? 7.835   -44.569 -58.109 1.00 47.92 ? 144 ASN B C   1 
ATOM   3042 O  O   . ASN B 1 80  ? 7.933   -45.370 -57.192 1.00 48.01 ? 144 ASN B O   1 
ATOM   3043 C  CB  . ASN B 1 80  ? 8.744   -45.080 -60.374 1.00 48.21 ? 144 ASN B CB  1 
ATOM   3044 C  CG  . ASN B 1 80  ? 9.774   -46.021 -59.833 1.00 49.44 ? 144 ASN B CG  1 
ATOM   3045 O  OD1 . ASN B 1 80  ? 9.550   -47.234 -59.763 1.00 50.60 ? 144 ASN B OD1 1 
ATOM   3046 N  ND2 . ASN B 1 80  ? 10.923  -45.475 -59.445 1.00 49.79 ? 144 ASN B ND2 1 
ATOM   3047 N  N   . LEU B 1 81  ? 7.983   -43.259 -57.936 1.00 47.37 ? 145 LEU B N   1 
ATOM   3048 C  CA  . LEU B 1 81  ? 8.231   -42.697 -56.625 1.00 46.80 ? 145 LEU B CA  1 
ATOM   3049 C  C   . LEU B 1 81  ? 7.091   -43.028 -55.671 1.00 47.01 ? 145 LEU B C   1 
ATOM   3050 O  O   . LEU B 1 81  ? 7.321   -43.533 -54.565 1.00 46.54 ? 145 LEU B O   1 
ATOM   3051 C  CB  . LEU B 1 81  ? 8.429   -41.188 -56.728 1.00 46.40 ? 145 LEU B CB  1 
ATOM   3052 C  CG  . LEU B 1 81  ? 9.644   -40.774 -57.563 1.00 45.71 ? 145 LEU B CG  1 
ATOM   3053 C  CD1 . LEU B 1 81  ? 9.669   -39.288 -57.740 1.00 43.91 ? 145 LEU B CD1 1 
ATOM   3054 C  CD2 . LEU B 1 81  ? 10.937  -41.250 -56.937 1.00 44.20 ? 145 LEU B CD2 1 
ATOM   3055 N  N   . VAL B 1 82  ? 5.864   -42.765 -56.128 1.00 47.25 ? 146 VAL B N   1 
ATOM   3056 C  CA  . VAL B 1 82  ? 4.650   -42.917 -55.312 1.00 47.14 ? 146 VAL B CA  1 
ATOM   3057 C  C   . VAL B 1 82  ? 4.347   -44.375 -54.960 1.00 47.50 ? 146 VAL B C   1 
ATOM   3058 O  O   . VAL B 1 82  ? 4.069   -44.686 -53.800 1.00 47.50 ? 146 VAL B O   1 
ATOM   3059 C  CB  . VAL B 1 82  ? 3.419   -42.252 -55.995 1.00 47.13 ? 146 VAL B CB  1 
ATOM   3060 C  CG1 . VAL B 1 82  ? 2.120   -42.696 -55.339 1.00 46.85 ? 146 VAL B CG1 1 
ATOM   3061 C  CG2 . VAL B 1 82  ? 3.542   -40.733 -55.961 1.00 45.27 ? 146 VAL B CG2 1 
ATOM   3062 N  N   . GLU B 1 83  ? 4.426   -45.258 -55.954 1.00 47.87 ? 147 GLU B N   1 
ATOM   3063 C  CA  . GLU B 1 83  ? 4.062   -46.663 -55.775 1.00 48.49 ? 147 GLU B CA  1 
ATOM   3064 C  C   . GLU B 1 83  ? 5.196   -47.537 -55.267 1.00 48.57 ? 147 GLU B C   1 
ATOM   3065 O  O   . GLU B 1 83  ? 4.940   -48.607 -54.720 1.00 48.97 ? 147 GLU B O   1 
ATOM   3066 C  CB  . GLU B 1 83  ? 3.529   -47.265 -57.082 1.00 48.80 ? 147 GLU B CB  1 
ATOM   3067 C  CG  . GLU B 1 83  ? 2.030   -47.114 -57.266 1.00 50.35 ? 147 GLU B CG  1 
ATOM   3068 C  CD  . GLU B 1 83  ? 1.595   -47.262 -58.707 1.00 52.84 ? 147 GLU B CD  1 
ATOM   3069 O  OE1 . GLU B 1 83  ? 2.322   -47.911 -59.495 1.00 52.34 ? 147 GLU B OE1 1 
ATOM   3070 O  OE2 . GLU B 1 83  ? 0.517   -46.715 -59.047 1.00 55.57 ? 147 GLU B OE2 1 
ATOM   3071 N  N   . ARG B 1 84  ? 6.443   -47.120 -55.461 1.00 48.19 ? 148 ARG B N   1 
ATOM   3072 C  CA  . ARG B 1 84  ? 7.551   -48.024 -55.137 1.00 48.13 ? 148 ARG B CA  1 
ATOM   3073 C  C   . ARG B 1 84  ? 8.615   -47.418 -54.261 1.00 47.83 ? 148 ARG B C   1 
ATOM   3074 O  O   . ARG B 1 84  ? 8.644   -47.690 -53.063 1.00 47.86 ? 148 ARG B O   1 
ATOM   3075 C  CB  . ARG B 1 84  ? 8.152   -48.656 -56.399 1.00 48.27 ? 148 ARG B CB  1 
ATOM   3076 C  CG  . ARG B 1 84  ? 7.102   -49.387 -57.235 1.00 49.07 ? 148 ARG B CG  1 
ATOM   3077 C  CD  . ARG B 1 84  ? 7.706   -50.465 -58.084 1.00 49.40 ? 148 ARG B CD  1 
ATOM   3078 N  NE  . ARG B 1 84  ? 8.245   -51.527 -57.240 1.00 48.70 ? 148 ARG B NE  1 
ATOM   3079 C  CZ  . ARG B 1 84  ? 8.890   -52.584 -57.708 1.00 47.04 ? 148 ARG B CZ  1 
ATOM   3080 N  NH1 . ARG B 1 84  ? 9.082   -52.711 -59.011 1.00 46.71 ? 148 ARG B NH1 1 
ATOM   3081 N  NH2 . ARG B 1 84  ? 9.355   -53.500 -56.876 1.00 46.00 ? 148 ARG B NH2 1 
ATOM   3082 N  N   . PHE B 1 85  ? 9.474   -46.593 -54.845 1.00 48.03 ? 149 PHE B N   1 
ATOM   3083 C  CA  . PHE B 1 85  ? 10.609  -46.024 -54.117 1.00 48.56 ? 149 PHE B CA  1 
ATOM   3084 C  C   . PHE B 1 85  ? 10.242  -45.475 -52.745 1.00 49.11 ? 149 PHE B C   1 
ATOM   3085 O  O   . PHE B 1 85  ? 10.888  -45.821 -51.767 1.00 50.20 ? 149 PHE B O   1 
ATOM   3086 C  CB  . PHE B 1 85  ? 11.320  -44.952 -54.947 1.00 48.22 ? 149 PHE B CB  1 
ATOM   3087 C  CG  . PHE B 1 85  ? 12.207  -45.499 -56.030 1.00 47.51 ? 149 PHE B CG  1 
ATOM   3088 C  CD1 . PHE B 1 85  ? 12.171  -46.854 -56.381 1.00 46.82 ? 149 PHE B CD1 1 
ATOM   3089 C  CD2 . PHE B 1 85  ? 13.066  -44.649 -56.727 1.00 45.53 ? 149 PHE B CD2 1 
ATOM   3090 C  CE1 . PHE B 1 85  ? 12.994  -47.348 -57.396 1.00 45.74 ? 149 PHE B CE1 1 
ATOM   3091 C  CE2 . PHE B 1 85  ? 13.885  -45.133 -57.739 1.00 43.66 ? 149 PHE B CE2 1 
ATOM   3092 C  CZ  . PHE B 1 85  ? 13.849  -46.480 -58.075 1.00 44.11 ? 149 PHE B CZ  1 
ATOM   3093 N  N   . SER B 1 86  ? 9.208   -44.646 -52.655 1.00 49.45 ? 150 SER B N   1 
ATOM   3094 C  CA  . SER B 1 86  ? 8.904   -43.991 -51.386 1.00 50.04 ? 150 SER B CA  1 
ATOM   3095 C  C   . SER B 1 86  ? 8.242   -44.941 -50.390 1.00 50.75 ? 150 SER B C   1 
ATOM   3096 O  O   . SER B 1 86  ? 8.196   -44.662 -49.189 1.00 50.80 ? 150 SER B O   1 
ATOM   3097 C  CB  . SER B 1 86  ? 8.034   -42.751 -51.595 1.00 49.85 ? 150 SER B CB  1 
ATOM   3098 O  OG  . SER B 1 86  ? 6.695   -43.124 -51.863 1.00 49.86 ? 150 SER B OG  1 
ATOM   3099 N  N   . GLN B 1 87  ? 7.719   -46.050 -50.900 1.00 51.50 ? 151 GLN B N   1 
ATOM   3100 C  CA  . GLN B 1 87  ? 7.182   -47.110 -50.065 1.00 52.46 ? 151 GLN B CA  1 
ATOM   3101 C  C   . GLN B 1 87  ? 8.300   -47.982 -49.485 1.00 52.64 ? 151 GLN B C   1 
ATOM   3102 O  O   . GLN B 1 87  ? 8.446   -48.096 -48.265 1.00 52.70 ? 151 GLN B O   1 
ATOM   3103 C  CB  . GLN B 1 87  ? 6.222   -47.989 -50.876 1.00 52.86 ? 151 GLN B CB  1 
ATOM   3104 C  CG  . GLN B 1 87  ? 5.047   -47.244 -51.502 1.00 54.45 ? 151 GLN B CG  1 
ATOM   3105 C  CD  . GLN B 1 87  ? 4.102   -46.676 -50.452 1.00 56.50 ? 151 GLN B CD  1 
ATOM   3106 O  OE1 . GLN B 1 87  ? 3.520   -47.419 -49.648 1.00 56.96 ? 151 GLN B OE1 1 
ATOM   3107 N  NE2 . GLN B 1 87  ? 3.943   -45.358 -50.458 1.00 55.68 ? 151 GLN B NE2 1 
ATOM   3108 N  N   . GLU B 1 88  ? 9.090   -48.586 -50.370 1.00 52.82 ? 152 GLU B N   1 
ATOM   3109 C  CA  . GLU B 1 88  ? 10.034  -49.632 -49.982 1.00 53.03 ? 152 GLU B CA  1 
ATOM   3110 C  C   . GLU B 1 88  ? 11.259  -49.110 -49.223 1.00 53.15 ? 152 GLU B C   1 
ATOM   3111 O  O   . GLU B 1 88  ? 11.854  -49.846 -48.432 1.00 53.46 ? 152 GLU B O   1 
ATOM   3112 C  CB  . GLU B 1 88  ? 10.462  -50.453 -51.208 1.00 53.16 ? 152 GLU B CB  1 
ATOM   3113 C  CG  . GLU B 1 88  ? 11.505  -49.771 -52.096 1.00 54.12 ? 152 GLU B CG  1 
ATOM   3114 C  CD  . GLU B 1 88  ? 11.579  -50.366 -53.496 1.00 55.14 ? 152 GLU B CD  1 
ATOM   3115 O  OE1 . GLU B 1 88  ? 11.184  -49.652 -54.430 1.00 55.38 ? 152 GLU B OE1 1 
ATOM   3116 O  OE2 . GLU B 1 88  ? 12.038  -51.525 -53.680 1.00 56.19 ? 152 GLU B OE2 1 
ATOM   3117 N  N   . VAL B 1 89  ? 11.640  -47.855 -49.449 1.00 52.71 ? 153 VAL B N   1 
ATOM   3118 C  CA  . VAL B 1 89  ? 12.810  -47.313 -48.758 1.00 52.33 ? 153 VAL B CA  1 
ATOM   3119 C  C   . VAL B 1 89  ? 12.420  -46.892 -47.341 1.00 52.33 ? 153 VAL B C   1 
ATOM   3120 O  O   . VAL B 1 89  ? 11.459  -46.155 -47.169 1.00 52.74 ? 153 VAL B O   1 
ATOM   3121 C  CB  . VAL B 1 89  ? 13.426  -46.135 -49.520 1.00 52.20 ? 153 VAL B CB  1 
ATOM   3122 C  CG1 . VAL B 1 89  ? 14.444  -45.446 -48.651 1.00 52.73 ? 153 VAL B CG1 1 
ATOM   3123 C  CG2 . VAL B 1 89  ? 14.064  -46.611 -50.818 1.00 51.00 ? 153 VAL B CG2 1 
ATOM   3124 N  N   . GLN B 1 90  ? 13.169  -47.340 -46.334 1.00 52.12 ? 154 GLN B N   1 
ATOM   3125 C  CA  . GLN B 1 90  ? 12.720  -47.226 -44.936 1.00 51.78 ? 154 GLN B CA  1 
ATOM   3126 C  C   . GLN B 1 90  ? 13.392  -46.148 -44.100 1.00 51.37 ? 154 GLN B C   1 
ATOM   3127 O  O   . GLN B 1 90  ? 12.923  -45.830 -43.013 1.00 51.43 ? 154 GLN B O   1 
ATOM   3128 C  CB  . GLN B 1 90  ? 12.853  -48.571 -44.206 1.00 52.06 ? 154 GLN B CB  1 
ATOM   3129 C  CG  . GLN B 1 90  ? 12.078  -49.722 -44.818 1.00 52.44 ? 154 GLN B CG  1 
ATOM   3130 C  CD  . GLN B 1 90  ? 10.594  -49.601 -44.582 1.00 54.71 ? 154 GLN B CD  1 
ATOM   3131 O  OE1 . GLN B 1 90  ? 10.138  -49.435 -43.444 1.00 56.78 ? 154 GLN B OE1 1 
ATOM   3132 N  NE2 . GLN B 1 90  ? 9.823   -49.683 -45.655 1.00 55.40 ? 154 GLN B NE2 1 
ATOM   3133 N  N   . ILE B 1 91  ? 14.496  -45.593 -44.579 1.00 51.05 ? 155 ILE B N   1 
ATOM   3134 C  CA  . ILE B 1 91  ? 15.171  -44.554 -43.812 1.00 50.39 ? 155 ILE B CA  1 
ATOM   3135 C  C   . ILE B 1 91  ? 14.464  -43.229 -44.016 1.00 49.87 ? 155 ILE B C   1 
ATOM   3136 O  O   . ILE B 1 91  ? 14.133  -42.857 -45.128 1.00 50.23 ? 155 ILE B O   1 
ATOM   3137 C  CB  . ILE B 1 91  ? 16.692  -44.458 -44.115 1.00 50.52 ? 155 ILE B CB  1 
ATOM   3138 C  CG1 . ILE B 1 91  ? 16.944  -44.129 -45.579 1.00 51.15 ? 155 ILE B CG1 1 
ATOM   3139 C  CG2 . ILE B 1 91  ? 17.406  -45.772 -43.757 1.00 50.16 ? 155 ILE B CG2 1 
ATOM   3140 C  CD1 . ILE B 1 91  ? 18.141  -43.228 -45.802 1.00 51.37 ? 155 ILE B CD1 1 
ATOM   3141 N  N   . THR B 1 92  ? 14.217  -42.536 -42.919 1.00 49.49 ? 156 THR B N   1 
ATOM   3142 C  CA  . THR B 1 92  ? 13.497  -41.272 -42.926 1.00 49.41 ? 156 THR B CA  1 
ATOM   3143 C  C   . THR B 1 92  ? 14.053  -40.242 -43.908 1.00 49.09 ? 156 THR B C   1 
ATOM   3144 O  O   . THR B 1 92  ? 13.294  -39.600 -44.637 1.00 49.08 ? 156 THR B O   1 
ATOM   3145 C  CB  . THR B 1 92  ? 13.463  -40.690 -41.507 1.00 49.41 ? 156 THR B CB  1 
ATOM   3146 O  OG1 . THR B 1 92  ? 12.841  -41.654 -40.649 1.00 50.33 ? 156 THR B OG1 1 
ATOM   3147 C  CG2 . THR B 1 92  ? 12.670  -39.369 -41.445 1.00 49.33 ? 156 THR B CG2 1 
ATOM   3148 N  N   . GLU B 1 93  ? 15.373  -40.100 -43.924 1.00 48.57 ? 157 GLU B N   1 
ATOM   3149 C  CA  . GLU B 1 93  ? 16.031  -39.085 -44.727 1.00 48.23 ? 157 GLU B CA  1 
ATOM   3150 C  C   . GLU B 1 93  ? 15.738  -39.310 -46.204 1.00 48.13 ? 157 GLU B C   1 
ATOM   3151 O  O   . GLU B 1 93  ? 15.492  -38.368 -46.950 1.00 47.82 ? 157 GLU B O   1 
ATOM   3152 C  CB  . GLU B 1 93  ? 17.538  -39.075 -44.451 1.00 48.10 ? 157 GLU B CB  1 
ATOM   3153 C  CG  . GLU B 1 93  ? 17.916  -38.679 -43.024 1.00 48.09 ? 157 GLU B CG  1 
ATOM   3154 C  CD  . GLU B 1 93  ? 17.967  -39.863 -42.036 1.00 49.80 ? 157 GLU B CD  1 
ATOM   3155 O  OE1 . GLU B 1 93  ? 17.413  -40.963 -42.317 1.00 48.44 ? 157 GLU B OE1 1 
ATOM   3156 O  OE2 . GLU B 1 93  ? 18.581  -39.681 -40.954 1.00 51.02 ? 157 GLU B OE2 1 
ATOM   3157 N  N   . ALA B 1 94  ? 15.736  -40.571 -46.617 1.00 48.12 ? 158 ALA B N   1 
ATOM   3158 C  CA  . ALA B 1 94  ? 15.406  -40.892 -47.983 1.00 48.17 ? 158 ALA B CA  1 
ATOM   3159 C  C   . ALA B 1 94  ? 13.925  -40.645 -48.255 1.00 48.47 ? 158 ALA B C   1 
ATOM   3160 O  O   . ALA B 1 94  ? 13.560  -40.199 -49.352 1.00 48.64 ? 158 ALA B O   1 
ATOM   3161 C  CB  . ALA B 1 94  ? 15.793  -42.303 -48.329 1.00 47.78 ? 158 ALA B CB  1 
ATOM   3162 N  N   . ARG B 1 95  ? 13.070  -40.924 -47.280 1.00 48.33 ? 159 ARG B N   1 
ATOM   3163 C  CA  . ARG B 1 95  ? 11.652  -40.689 -47.518 1.00 48.95 ? 159 ARG B CA  1 
ATOM   3164 C  C   . ARG B 1 95  ? 11.336  -39.210 -47.708 1.00 48.32 ? 159 ARG B C   1 
ATOM   3165 O  O   . ARG B 1 95  ? 10.583  -38.859 -48.610 1.00 48.36 ? 159 ARG B O   1 
ATOM   3166 C  CB  . ARG B 1 95  ? 10.779  -41.338 -46.457 1.00 49.41 ? 159 ARG B CB  1 
ATOM   3167 C  CG  . ARG B 1 95  ? 10.486  -42.791 -46.808 1.00 51.84 ? 159 ARG B CG  1 
ATOM   3168 C  CD  . ARG B 1 95  ? 10.338  -43.643 -45.560 1.00 54.38 ? 159 ARG B CD  1 
ATOM   3169 N  NE  . ARG B 1 95  ? 9.551   -44.842 -45.834 1.00 56.63 ? 159 ARG B NE  1 
ATOM   3170 C  CZ  . ARG B 1 95  ? 8.230   -44.911 -45.715 1.00 58.59 ? 159 ARG B CZ  1 
ATOM   3171 N  NH1 . ARG B 1 95  ? 7.540   -43.839 -45.325 1.00 60.36 ? 159 ARG B NH1 1 
ATOM   3172 N  NH2 . ARG B 1 95  ? 7.597   -46.047 -45.984 1.00 59.19 ? 159 ARG B NH2 1 
ATOM   3173 N  N   . CYS B 1 96  ? 11.943  -38.346 -46.897 1.00 47.76 ? 160 CYS B N   1 
ATOM   3174 C  CA  . CYS B 1 96  ? 11.771  -36.901 -47.072 1.00 47.26 ? 160 CYS B CA  1 
ATOM   3175 C  C   . CYS B 1 96  ? 12.194  -36.472 -48.466 1.00 46.87 ? 160 CYS B C   1 
ATOM   3176 O  O   . CYS B 1 96  ? 11.481  -35.703 -49.118 1.00 47.25 ? 160 CYS B O   1 
ATOM   3177 C  CB  . CYS B 1 96  ? 12.518  -36.092 -46.005 1.00 47.11 ? 160 CYS B CB  1 
ATOM   3178 S  SG  . CYS B 1 96  ? 11.813  -36.342 -44.343 1.00 46.77 ? 160 CYS B SG  1 
ATOM   3179 N  N   . PHE B 1 97  ? 13.328  -36.993 -48.939 1.00 45.73 ? 161 PHE B N   1 
ATOM   3180 C  CA  . PHE B 1 97  ? 13.802  -36.630 -50.257 1.00 44.36 ? 161 PHE B CA  1 
ATOM   3181 C  C   . PHE B 1 97  ? 12.777  -36.996 -51.325 1.00 43.72 ? 161 PHE B C   1 
ATOM   3182 O  O   . PHE B 1 97  ? 12.351  -36.142 -52.113 1.00 43.58 ? 161 PHE B O   1 
ATOM   3183 C  CB  . PHE B 1 97  ? 15.159  -37.260 -50.585 1.00 44.34 ? 161 PHE B CB  1 
ATOM   3184 C  CG  . PHE B 1 97  ? 15.724  -36.774 -51.892 1.00 42.73 ? 161 PHE B CG  1 
ATOM   3185 C  CD1 . PHE B 1 97  ? 15.358  -37.387 -53.093 1.00 40.41 ? 161 PHE B CD1 1 
ATOM   3186 C  CD2 . PHE B 1 97  ? 16.569  -35.666 -51.926 1.00 40.84 ? 161 PHE B CD2 1 
ATOM   3187 C  CE1 . PHE B 1 97  ? 15.844  -36.920 -54.305 1.00 41.22 ? 161 PHE B CE1 1 
ATOM   3188 C  CE2 . PHE B 1 97  ? 17.076  -35.181 -53.147 1.00 41.81 ? 161 PHE B CE2 1 
ATOM   3189 C  CZ  . PHE B 1 97  ? 16.713  -35.802 -54.340 1.00 40.90 ? 161 PHE B CZ  1 
ATOM   3190 N  N   . TYR B 1 98  ? 12.392  -38.268 -51.329 1.00 43.00 ? 162 TYR B N   1 
ATOM   3191 C  CA  . TYR B 1 98  ? 11.408  -38.792 -52.260 1.00 42.70 ? 162 TYR B CA  1 
ATOM   3192 C  C   . TYR B 1 98  ? 10.029  -38.098 -52.150 1.00 42.60 ? 162 TYR B C   1 
ATOM   3193 O  O   . TYR B 1 98  ? 9.355   -37.851 -53.158 1.00 42.51 ? 162 TYR B O   1 
ATOM   3194 C  CB  . TYR B 1 98  ? 11.288  -40.303 -52.093 1.00 42.68 ? 162 TYR B CB  1 
ATOM   3195 C  CG  . TYR B 1 98  ? 12.405  -41.105 -52.745 1.00 43.25 ? 162 TYR B CG  1 
ATOM   3196 C  CD1 . TYR B 1 98  ? 12.967  -40.709 -53.960 1.00 43.82 ? 162 TYR B CD1 1 
ATOM   3197 C  CD2 . TYR B 1 98  ? 12.870  -42.286 -52.167 1.00 44.01 ? 162 TYR B CD2 1 
ATOM   3198 C  CE1 . TYR B 1 98  ? 13.968  -41.455 -54.571 1.00 44.05 ? 162 TYR B CE1 1 
ATOM   3199 C  CE2 . TYR B 1 98  ? 13.892  -43.036 -52.765 1.00 44.59 ? 162 TYR B CE2 1 
ATOM   3200 C  CZ  . TYR B 1 98  ? 14.435  -42.618 -53.965 1.00 44.83 ? 162 TYR B CZ  1 
ATOM   3201 O  OH  . TYR B 1 98  ? 15.431  -43.361 -54.576 1.00 45.42 ? 162 TYR B OH  1 
ATOM   3202 N  N   . GLY B 1 99  ? 9.623   -37.761 -50.933 1.00 42.22 ? 163 GLY B N   1 
ATOM   3203 C  CA  . GLY B 1 99  ? 8.390   -37.028 -50.737 1.00 41.99 ? 163 GLY B CA  1 
ATOM   3204 C  C   . GLY B 1 99  ? 8.461   -35.722 -51.503 1.00 42.39 ? 163 GLY B C   1 
ATOM   3205 O  O   . GLY B 1 99  ? 7.495   -35.314 -52.173 1.00 42.94 ? 163 GLY B O   1 
ATOM   3206 N  N   . PHE B 1 100 ? 9.625   -35.077 -51.429 1.00 41.76 ? 164 PHE B N   1 
ATOM   3207 C  CA  . PHE B 1 100 ? 9.806   -33.779 -52.041 1.00 40.86 ? 164 PHE B CA  1 
ATOM   3208 C  C   . PHE B 1 100 ? 9.950   -33.903 -53.551 1.00 40.80 ? 164 PHE B C   1 
ATOM   3209 O  O   . PHE B 1 100 ? 9.516   -33.025 -54.312 1.00 40.72 ? 164 PHE B O   1 
ATOM   3210 C  CB  . PHE B 1 100 ? 11.020  -33.092 -51.459 1.00 40.38 ? 164 PHE B CB  1 
ATOM   3211 C  CG  . PHE B 1 100 ? 10.983  -31.618 -51.590 1.00 39.34 ? 164 PHE B CG  1 
ATOM   3212 C  CD1 . PHE B 1 100 ? 10.284  -30.849 -50.672 1.00 38.54 ? 164 PHE B CD1 1 
ATOM   3213 C  CD2 . PHE B 1 100 ? 11.655  -30.982 -52.622 1.00 38.69 ? 164 PHE B CD2 1 
ATOM   3214 C  CE1 . PHE B 1 100 ? 10.257  -29.466 -50.781 1.00 38.53 ? 164 PHE B CE1 1 
ATOM   3215 C  CE2 . PHE B 1 100 ? 11.627  -29.588 -52.735 1.00 36.61 ? 164 PHE B CE2 1 
ATOM   3216 C  CZ  . PHE B 1 100 ? 10.922  -28.839 -51.819 1.00 36.63 ? 164 PHE B CZ  1 
ATOM   3217 N  N   . GLN B 1 101 ? 10.562  -34.995 -53.990 1.00 40.35 ? 165 GLN B N   1 
ATOM   3218 C  CA  . GLN B 1 101 ? 10.758  -35.172 -55.408 1.00 40.08 ? 165 GLN B CA  1 
ATOM   3219 C  C   . GLN B 1 101 ? 9.395   -35.294 -56.082 1.00 40.51 ? 165 GLN B C   1 
ATOM   3220 O  O   . GLN B 1 101 ? 9.170   -34.666 -57.096 1.00 41.09 ? 165 GLN B O   1 
ATOM   3221 C  CB  . GLN B 1 101 ? 11.643  -36.370 -55.688 1.00 39.68 ? 165 GLN B CB  1 
ATOM   3222 C  CG  . GLN B 1 101 ? 11.989  -36.486 -57.142 1.00 39.86 ? 165 GLN B CG  1 
ATOM   3223 C  CD  . GLN B 1 101 ? 12.820  -37.704 -57.458 1.00 40.10 ? 165 GLN B CD  1 
ATOM   3224 O  OE1 . GLN B 1 101 ? 13.406  -38.333 -56.563 1.00 40.48 ? 165 GLN B OE1 1 
ATOM   3225 N  NE2 . GLN B 1 101 ? 12.879  -38.052 -58.739 1.00 38.50 ? 165 GLN B NE2 1 
ATOM   3226 N  N   . ILE B 1 102 ? 8.478   -36.066 -55.484 1.00 40.84 ? 166 ILE B N   1 
ATOM   3227 C  CA  . ILE B 1 102 ? 7.125   -36.218 -55.995 1.00 40.26 ? 166 ILE B CA  1 
ATOM   3228 C  C   . ILE B 1 102 ? 6.501   -34.856 -56.172 1.00 40.65 ? 166 ILE B C   1 
ATOM   3229 O  O   . ILE B 1 102 ? 5.991   -34.546 -57.244 1.00 41.28 ? 166 ILE B O   1 
ATOM   3230 C  CB  . ILE B 1 102 ? 6.249   -37.077 -55.081 1.00 40.33 ? 166 ILE B CB  1 
ATOM   3231 C  CG1 . ILE B 1 102 ? 6.651   -38.558 -55.196 1.00 40.23 ? 166 ILE B CG1 1 
ATOM   3232 C  CG2 . ILE B 1 102 ? 4.781   -36.888 -55.429 1.00 38.56 ? 166 ILE B CG2 1 
ATOM   3233 C  CD1 . ILE B 1 102 ? 6.328   -39.417 -53.968 1.00 37.98 ? 166 ILE B CD1 1 
ATOM   3234 N  N   . ALA B 1 103 ? 6.571   -34.027 -55.138 1.00 40.79 ? 167 ALA B N   1 
ATOM   3235 C  CA  . ALA B 1 103 ? 6.052   -32.672 -55.230 1.00 40.75 ? 167 ALA B CA  1 
ATOM   3236 C  C   . ALA B 1 103 ? 6.654   -31.965 -56.439 1.00 41.49 ? 167 ALA B C   1 
ATOM   3237 O  O   . ALA B 1 103 ? 5.904   -31.436 -57.269 1.00 42.56 ? 167 ALA B O   1 
ATOM   3238 C  CB  . ALA B 1 103 ? 6.338   -31.913 -53.975 1.00 40.57 ? 167 ALA B CB  1 
ATOM   3239 N  N   . MET B 1 104 ? 7.987   -32.003 -56.562 1.00 41.29 ? 168 MET B N   1 
ATOM   3240 C  CA  . MET B 1 104 ? 8.710   -31.369 -57.675 1.00 41.34 ? 168 MET B CA  1 
ATOM   3241 C  C   . MET B 1 104 ? 8.393   -31.918 -59.066 1.00 41.65 ? 168 MET B C   1 
ATOM   3242 O  O   . MET B 1 104 ? 8.281   -31.147 -60.035 1.00 41.57 ? 168 MET B O   1 
ATOM   3243 C  CB  . MET B 1 104 ? 10.233  -31.409 -57.452 1.00 41.19 ? 168 MET B CB  1 
ATOM   3244 C  CG  . MET B 1 104 ? 10.728  -30.489 -56.340 1.00 40.82 ? 168 MET B CG  1 
ATOM   3245 S  SD  . MET B 1 104 ? 9.895   -28.883 -56.299 1.00 42.48 ? 168 MET B SD  1 
ATOM   3246 C  CE  . MET B 1 104 ? 10.378  -28.173 -57.894 1.00 40.39 ? 168 MET B CE  1 
ATOM   3247 N  N   . GLU B 1 105 ? 8.271   -33.241 -59.180 1.00 41.70 ? 169 GLU B N   1 
ATOM   3248 C  CA  . GLU B 1 105 ? 7.818   -33.834 -60.432 1.00 42.00 ? 169 GLU B CA  1 
ATOM   3249 C  C   . GLU B 1 105 ? 6.454   -33.245 -60.844 1.00 41.72 ? 169 GLU B C   1 
ATOM   3250 O  O   . GLU B 1 105 ? 6.217   -32.957 -62.019 1.00 41.97 ? 169 GLU B O   1 
ATOM   3251 C  CB  . GLU B 1 105 ? 7.759   -35.362 -60.351 1.00 42.48 ? 169 GLU B CB  1 
ATOM   3252 C  CG  . GLU B 1 105 ? 9.095   -36.067 -60.045 1.00 43.75 ? 169 GLU B CG  1 
ATOM   3253 C  CD  . GLU B 1 105 ? 10.211  -35.795 -61.055 1.00 47.31 ? 169 GLU B CD  1 
ATOM   3254 O  OE1 . GLU B 1 105 ? 9.954   -35.263 -62.165 1.00 48.71 ? 169 GLU B OE1 1 
ATOM   3255 O  OE2 . GLU B 1 105 ? 11.372  -36.128 -60.732 1.00 48.24 ? 169 GLU B OE2 1 
ATOM   3256 N  N   . ASN B 1 106 ? 5.571   -33.010 -59.882 1.00 41.05 ? 170 ASN B N   1 
ATOM   3257 C  CA  . ASN B 1 106 ? 4.292   -32.429 -60.240 1.00 40.62 ? 170 ASN B CA  1 
ATOM   3258 C  C   . ASN B 1 106 ? 4.411   -31.017 -60.751 1.00 41.01 ? 170 ASN B C   1 
ATOM   3259 O  O   . ASN B 1 106 ? 3.671   -30.622 -61.642 1.00 41.56 ? 170 ASN B O   1 
ATOM   3260 C  CB  . ASN B 1 106 ? 3.307   -32.528 -59.088 1.00 40.35 ? 170 ASN B CB  1 
ATOM   3261 C  CG  . ASN B 1 106 ? 2.819   -33.942 -58.891 1.00 38.26 ? 170 ASN B CG  1 
ATOM   3262 O  OD1 . ASN B 1 106 ? 2.849   -34.744 -59.822 1.00 37.83 ? 170 ASN B OD1 1 
ATOM   3263 N  ND2 . ASN B 1 106 ? 2.387   -34.263 -57.684 1.00 35.72 ? 170 ASN B ND2 1 
ATOM   3264 N  N   . ILE B 1 107 ? 5.346   -30.258 -60.191 1.00 41.15 ? 171 ILE B N   1 
ATOM   3265 C  CA  . ILE B 1 107 ? 5.624   -28.909 -60.657 1.00 40.69 ? 171 ILE B CA  1 
ATOM   3266 C  C   . ILE B 1 107 ? 6.344   -28.939 -62.011 1.00 41.18 ? 171 ILE B C   1 
ATOM   3267 O  O   . ILE B 1 107 ? 6.051   -28.113 -62.879 1.00 41.68 ? 171 ILE B O   1 
ATOM   3268 C  CB  . ILE B 1 107 ? 6.381   -28.105 -59.587 1.00 40.50 ? 171 ILE B CB  1 
ATOM   3269 C  CG1 . ILE B 1 107 ? 5.421   -27.762 -58.445 1.00 39.04 ? 171 ILE B CG1 1 
ATOM   3270 C  CG2 . ILE B 1 107 ? 6.990   -26.840 -60.171 1.00 40.48 ? 171 ILE B CG2 1 
ATOM   3271 C  CD1 . ILE B 1 107 ? 6.091   -27.388 -57.169 1.00 36.38 ? 171 ILE B CD1 1 
ATOM   3272 N  N   . HIS B 1 108 ? 7.245   -29.898 -62.206 1.00 41.07 ? 172 HIS B N   1 
ATOM   3273 C  CA  . HIS B 1 108 ? 7.834   -30.125 -63.516 1.00 41.77 ? 172 HIS B CA  1 
ATOM   3274 C  C   . HIS B 1 108 ? 6.744   -30.386 -64.586 1.00 42.57 ? 172 HIS B C   1 
ATOM   3275 O  O   . HIS B 1 108 ? 6.685   -29.694 -65.605 1.00 42.50 ? 172 HIS B O   1 
ATOM   3276 C  CB  . HIS B 1 108 ? 8.806   -31.298 -63.455 1.00 41.71 ? 172 HIS B CB  1 
ATOM   3277 C  CG  . HIS B 1 108 ? 10.076  -31.012 -62.706 1.00 42.78 ? 172 HIS B CG  1 
ATOM   3278 N  ND1 . HIS B 1 108 ? 11.133  -31.901 -62.674 1.00 42.38 ? 172 HIS B ND1 1 
ATOM   3279 C  CD2 . HIS B 1 108 ? 10.466  -29.937 -61.978 1.00 41.57 ? 172 HIS B CD2 1 
ATOM   3280 C  CE1 . HIS B 1 108 ? 12.107  -31.391 -61.946 1.00 40.88 ? 172 HIS B CE1 1 
ATOM   3281 N  NE2 . HIS B 1 108 ? 11.730  -30.201 -61.517 1.00 41.35 ? 172 HIS B NE2 1 
ATOM   3282 N  N   . SER B 1 109 ? 5.877   -31.370 -64.341 1.00 43.37 ? 173 SER B N   1 
ATOM   3283 C  CA  . SER B 1 109 ? 4.743   -31.649 -65.219 1.00 44.39 ? 173 SER B CA  1 
ATOM   3284 C  C   . SER B 1 109 ? 3.841   -30.445 -65.481 1.00 44.40 ? 173 SER B C   1 
ATOM   3285 O  O   . SER B 1 109 ? 3.437   -30.197 -66.625 1.00 44.36 ? 173 SER B O   1 
ATOM   3286 C  CB  . SER B 1 109 ? 3.896   -32.798 -64.685 1.00 44.39 ? 173 SER B CB  1 
ATOM   3287 O  OG  . SER B 1 109 ? 4.385   -34.026 -65.182 1.00 46.83 ? 173 SER B OG  1 
ATOM   3288 N  N   . GLU B 1 110 ? 3.517   -29.705 -64.433 1.00 44.43 ? 174 GLU B N   1 
ATOM   3289 C  CA  . GLU B 1 110 ? 2.712   -28.511 -64.614 1.00 44.95 ? 174 GLU B CA  1 
ATOM   3290 C  C   . GLU B 1 110 ? 3.398   -27.516 -65.545 1.00 45.01 ? 174 GLU B C   1 
ATOM   3291 O  O   . GLU B 1 110 ? 2.756   -26.986 -66.457 1.00 45.08 ? 174 GLU B O   1 
ATOM   3292 C  CB  . GLU B 1 110 ? 2.379   -27.845 -63.287 1.00 44.91 ? 174 GLU B CB  1 
ATOM   3293 C  CG  . GLU B 1 110 ? 1.455   -26.676 -63.481 1.00 47.07 ? 174 GLU B CG  1 
ATOM   3294 C  CD  . GLU B 1 110 ? 1.047   -26.018 -62.195 1.00 50.61 ? 174 GLU B CD  1 
ATOM   3295 O  OE1 . GLU B 1 110 ? 1.768   -26.152 -61.182 1.00 51.95 ? 174 GLU B OE1 1 
ATOM   3296 O  OE2 . GLU B 1 110 ? -0.003  -25.344 -62.203 1.00 52.69 ? 174 GLU B OE2 1 
ATOM   3297 N  N   . MET B 1 111 ? 4.693   -27.275 -65.311 1.00 45.00 ? 175 MET B N   1 
ATOM   3298 C  CA  . MET B 1 111 ? 5.475   -26.338 -66.102 1.00 44.85 ? 175 MET B CA  1 
ATOM   3299 C  C   . MET B 1 111 ? 5.387   -26.728 -67.575 1.00 45.49 ? 175 MET B C   1 
ATOM   3300 O  O   . MET B 1 111 ? 5.036   -25.918 -68.428 1.00 45.31 ? 175 MET B O   1 
ATOM   3301 C  CB  . MET B 1 111 ? 6.931   -26.363 -65.642 1.00 44.52 ? 175 MET B CB  1 
ATOM   3302 C  CG  . MET B 1 111 ? 7.827   -25.281 -66.239 1.00 43.70 ? 175 MET B CG  1 
ATOM   3303 S  SD  . MET B 1 111 ? 7.391   -23.617 -65.694 1.00 44.07 ? 175 MET B SD  1 
ATOM   3304 C  CE  . MET B 1 111 ? 6.752   -22.903 -67.220 1.00 42.69 ? 175 MET B CE  1 
ATOM   3305 N  N   . TYR B 1 112 ? 5.686   -27.986 -67.870 1.00 46.13 ? 176 TYR B N   1 
ATOM   3306 C  CA  . TYR B 1 112 ? 5.686   -28.437 -69.243 1.00 46.79 ? 176 TYR B CA  1 
ATOM   3307 C  C   . TYR B 1 112 ? 4.315   -28.197 -69.890 1.00 47.41 ? 176 TYR B C   1 
ATOM   3308 O  O   . TYR B 1 112 ? 4.237   -27.747 -71.031 1.00 48.01 ? 176 TYR B O   1 
ATOM   3309 C  CB  . TYR B 1 112 ? 6.127   -29.896 -69.335 1.00 46.78 ? 176 TYR B CB  1 
ATOM   3310 C  CG  . TYR B 1 112 ? 7.620   -30.113 -69.093 1.00 46.98 ? 176 TYR B CG  1 
ATOM   3311 C  CD1 . TYR B 1 112 ? 8.577   -29.491 -69.893 1.00 47.10 ? 176 TYR B CD1 1 
ATOM   3312 C  CD2 . TYR B 1 112 ? 8.070   -30.950 -68.068 1.00 47.29 ? 176 TYR B CD2 1 
ATOM   3313 C  CE1 . TYR B 1 112 ? 9.938   -29.694 -69.685 1.00 46.84 ? 176 TYR B CE1 1 
ATOM   3314 C  CE2 . TYR B 1 112 ? 9.429   -31.156 -67.844 1.00 46.98 ? 176 TYR B CE2 1 
ATOM   3315 C  CZ  . TYR B 1 112 ? 10.359  -30.527 -68.661 1.00 46.66 ? 176 TYR B CZ  1 
ATOM   3316 O  OH  . TYR B 1 112 ? 11.701  -30.732 -68.458 1.00 44.33 ? 176 TYR B OH  1 
ATOM   3317 N  N   . SER B 1 113 ? 3.248   -28.453 -69.140 1.00 47.55 ? 177 SER B N   1 
ATOM   3318 C  CA  . SER B 1 113 ? 1.890   -28.244 -69.608 1.00 47.81 ? 177 SER B CA  1 
ATOM   3319 C  C   . SER B 1 113 ? 1.503   -26.770 -69.721 1.00 47.95 ? 177 SER B C   1 
ATOM   3320 O  O   . SER B 1 113 ? 0.700   -26.397 -70.577 1.00 48.15 ? 177 SER B O   1 
ATOM   3321 C  CB  . SER B 1 113 ? 0.919   -28.971 -68.693 1.00 48.04 ? 177 SER B CB  1 
ATOM   3322 O  OG  . SER B 1 113 ? 1.266   -30.347 -68.635 1.00 49.60 ? 177 SER B OG  1 
ATOM   3323 N  N   . LEU B 1 114 ? 2.061   -25.927 -68.866 1.00 47.76 ? 178 LEU B N   1 
ATOM   3324 C  CA  . LEU B 1 114 ? 1.929   -24.497 -69.073 1.00 47.81 ? 178 LEU B CA  1 
ATOM   3325 C  C   . LEU B 1 114 ? 2.645   -24.063 -70.360 1.00 47.58 ? 178 LEU B C   1 
ATOM   3326 O  O   . LEU B 1 114 ? 2.172   -23.175 -71.086 1.00 47.57 ? 178 LEU B O   1 
ATOM   3327 C  CB  . LEU B 1 114 ? 2.469   -23.713 -67.880 1.00 47.64 ? 178 LEU B CB  1 
ATOM   3328 C  CG  . LEU B 1 114 ? 1.418   -23.232 -66.886 1.00 49.88 ? 178 LEU B CG  1 
ATOM   3329 C  CD1 . LEU B 1 114 ? 2.099   -22.768 -65.600 1.00 52.16 ? 178 LEU B CD1 1 
ATOM   3330 C  CD2 . LEU B 1 114 ? 0.549   -22.092 -67.460 1.00 51.25 ? 178 LEU B CD2 1 
ATOM   3331 N  N   . LEU B 1 115 ? 3.790   -24.669 -70.642 1.00 47.17 ? 179 LEU B N   1 
ATOM   3332 C  CA  . LEU B 1 115 ? 4.519   -24.264 -71.824 1.00 47.48 ? 179 LEU B CA  1 
ATOM   3333 C  C   . LEU B 1 115 ? 3.676   -24.633 -73.047 1.00 48.00 ? 179 LEU B C   1 
ATOM   3334 O  O   . LEU B 1 115 ? 3.472   -23.806 -73.940 1.00 48.21 ? 179 LEU B O   1 
ATOM   3335 C  CB  . LEU B 1 115 ? 5.928   -24.864 -71.854 1.00 46.89 ? 179 LEU B CB  1 
ATOM   3336 C  CG  . LEU B 1 115 ? 6.879   -24.176 -70.859 1.00 47.06 ? 179 LEU B CG  1 
ATOM   3337 C  CD1 . LEU B 1 115 ? 8.098   -25.038 -70.481 1.00 46.54 ? 179 LEU B CD1 1 
ATOM   3338 C  CD2 . LEU B 1 115 ? 7.330   -22.802 -71.336 1.00 45.90 ? 179 LEU B CD2 1 
ATOM   3339 N  N   . ILE B 1 116 ? 3.147   -25.854 -73.039 1.00 48.06 ? 180 ILE B N   1 
ATOM   3340 C  CA  . ILE B 1 116 ? 2.280   -26.343 -74.086 1.00 48.58 ? 180 ILE B CA  1 
ATOM   3341 C  C   . ILE B 1 116 ? 1.067   -25.424 -74.264 1.00 49.35 ? 180 ILE B C   1 
ATOM   3342 O  O   . ILE B 1 116 ? 0.804   -24.952 -75.370 1.00 49.42 ? 180 ILE B O   1 
ATOM   3343 C  CB  . ILE B 1 116 ? 1.882   -27.820 -73.831 1.00 48.47 ? 180 ILE B CB  1 
ATOM   3344 C  CG1 . ILE B 1 116 ? 3.041   -28.737 -74.255 1.00 48.33 ? 180 ILE B CG1 1 
ATOM   3345 C  CG2 . ILE B 1 116 ? 0.636   -28.195 -74.607 1.00 47.93 ? 180 ILE B CG2 1 
ATOM   3346 C  CD1 . ILE B 1 116 ? 3.050   -30.129 -73.601 1.00 45.75 ? 180 ILE B CD1 1 
ATOM   3347 N  N   . ASP B 1 117 ? 0.358   -25.143 -73.178 1.00 50.09 ? 181 ASP B N   1 
ATOM   3348 C  CA  . ASP B 1 117 ? -0.818  -24.283 -73.243 1.00 51.00 ? 181 ASP B CA  1 
ATOM   3349 C  C   . ASP B 1 117 ? -0.516  -22.881 -73.759 1.00 51.58 ? 181 ASP B C   1 
ATOM   3350 O  O   . ASP B 1 117 ? -1.355  -22.266 -74.419 1.00 52.15 ? 181 ASP B O   1 
ATOM   3351 C  CB  . ASP B 1 117 ? -1.502  -24.188 -71.884 1.00 51.04 ? 181 ASP B CB  1 
ATOM   3352 C  CG  . ASP B 1 117 ? -2.451  -25.348 -71.621 1.00 52.19 ? 181 ASP B CG  1 
ATOM   3353 O  OD1 . ASP B 1 117 ? -2.558  -26.267 -72.461 1.00 52.05 ? 181 ASP B OD1 1 
ATOM   3354 O  OD2 . ASP B 1 117 ? -3.097  -25.339 -70.551 1.00 55.14 ? 181 ASP B OD2 1 
ATOM   3355 N  N   . THR B 1 118 ? 0.675   -22.378 -73.467 1.00 51.96 ? 182 THR B N   1 
ATOM   3356 C  CA  . THR B 1 118 ? 1.008   -21.013 -73.822 1.00 52.37 ? 182 THR B CA  1 
ATOM   3357 C  C   . THR B 1 118 ? 1.277   -20.925 -75.322 1.00 52.83 ? 182 THR B C   1 
ATOM   3358 O  O   . THR B 1 118 ? 0.791   -20.016 -75.991 1.00 53.15 ? 182 THR B O   1 
ATOM   3359 C  CB  . THR B 1 118 ? 2.190   -20.489 -72.956 1.00 52.61 ? 182 THR B CB  1 
ATOM   3360 O  OG1 . THR B 1 118 ? 1.740   -20.298 -71.607 1.00 51.60 ? 182 THR B OG1 1 
ATOM   3361 C  CG2 . THR B 1 118 ? 2.765   -19.184 -73.489 1.00 52.05 ? 182 THR B CG2 1 
ATOM   3362 N  N   . TYR B 1 119 ? 2.014   -21.894 -75.852 1.00 53.37 ? 183 TYR B N   1 
ATOM   3363 C  CA  . TYR B 1 119 ? 2.395   -21.904 -77.275 1.00 53.76 ? 183 TYR B CA  1 
ATOM   3364 C  C   . TYR B 1 119 ? 1.329   -22.441 -78.230 1.00 54.12 ? 183 TYR B C   1 
ATOM   3365 O  O   . TYR B 1 119 ? 1.259   -22.011 -79.376 1.00 54.43 ? 183 TYR B O   1 
ATOM   3366 C  CB  . TYR B 1 119 ? 3.666   -22.726 -77.487 1.00 53.40 ? 183 TYR B CB  1 
ATOM   3367 C  CG  . TYR B 1 119 ? 4.819   -22.356 -76.597 1.00 53.85 ? 183 TYR B CG  1 
ATOM   3368 C  CD1 . TYR B 1 119 ? 4.987   -21.050 -76.136 1.00 54.06 ? 183 TYR B CD1 1 
ATOM   3369 C  CD2 . TYR B 1 119 ? 5.772   -23.307 -76.243 1.00 54.29 ? 183 TYR B CD2 1 
ATOM   3370 C  CE1 . TYR B 1 119 ? 6.063   -20.711 -75.330 1.00 54.58 ? 183 TYR B CE1 1 
ATOM   3371 C  CE2 . TYR B 1 119 ? 6.851   -22.977 -75.436 1.00 54.09 ? 183 TYR B CE2 1 
ATOM   3372 C  CZ  . TYR B 1 119 ? 6.988   -21.678 -74.984 1.00 54.75 ? 183 TYR B CZ  1 
ATOM   3373 O  OH  . TYR B 1 119 ? 8.054   -21.344 -74.181 1.00 56.17 ? 183 TYR B OH  1 
ATOM   3374 N  N   . ILE B 1 120 ? 0.539   -23.406 -77.767 1.00 54.53 ? 184 ILE B N   1 
ATOM   3375 C  CA  . ILE B 1 120 ? -0.385  -24.148 -78.613 1.00 54.90 ? 184 ILE B CA  1 
ATOM   3376 C  C   . ILE B 1 120 ? -1.799  -23.882 -78.139 1.00 55.39 ? 184 ILE B C   1 
ATOM   3377 O  O   . ILE B 1 120 ? -2.213  -24.397 -77.102 1.00 55.86 ? 184 ILE B O   1 
ATOM   3378 C  CB  . ILE B 1 120 ? -0.141  -25.669 -78.494 1.00 54.92 ? 184 ILE B CB  1 
ATOM   3379 C  CG1 . ILE B 1 120 ? 1.335   -26.044 -78.764 1.00 54.71 ? 184 ILE B CG1 1 
ATOM   3380 C  CG2 . ILE B 1 120 ? -1.178  -26.446 -79.306 1.00 54.87 ? 184 ILE B CG2 1 
ATOM   3381 C  CD1 . ILE B 1 120 ? 1.737   -26.194 -80.202 1.00 54.76 ? 184 ILE B CD1 1 
ATOM   3382 N  N   . LYS B 1 121 ? -2.544  -23.089 -78.897 1.00 56.05 ? 185 LYS B N   1 
ATOM   3383 C  CA  . LYS B 1 121 ? -3.894  -22.682 -78.494 1.00 56.71 ? 185 LYS B CA  1 
ATOM   3384 C  C   . LYS B 1 121 ? -4.965  -23.697 -78.881 1.00 56.83 ? 185 LYS B C   1 
ATOM   3385 O  O   . LYS B 1 121 ? -5.949  -23.864 -78.167 1.00 56.54 ? 185 LYS B O   1 
ATOM   3386 C  CB  . LYS B 1 121 ? -4.226  -21.287 -79.051 1.00 56.84 ? 185 LYS B CB  1 
ATOM   3387 C  CG  . LYS B 1 121 ? -3.341  -20.182 -78.476 1.00 57.86 ? 185 LYS B CG  1 
ATOM   3388 C  CD  . LYS B 1 121 ? -3.489  -20.084 -76.948 1.00 59.27 ? 185 LYS B CD  1 
ATOM   3389 C  CE  . LYS B 1 121 ? -2.372  -19.242 -76.326 1.00 59.43 ? 185 LYS B CE  1 
ATOM   3390 N  NZ  . LYS B 1 121 ? -2.450  -19.275 -74.836 1.00 59.58 ? 185 LYS B NZ  1 
ATOM   3391 N  N   . ASP B 1 122 ? -4.745  -24.371 -80.008 1.00 57.55 ? 186 ASP B N   1 
ATOM   3392 C  CA  . ASP B 1 122 ? -5.618  -25.430 -80.514 1.00 58.37 ? 186 ASP B CA  1 
ATOM   3393 C  C   . ASP B 1 122 ? -5.818  -26.568 -79.496 1.00 58.46 ? 186 ASP B C   1 
ATOM   3394 O  O   . ASP B 1 122 ? -4.880  -27.310 -79.211 1.00 59.00 ? 186 ASP B O   1 
ATOM   3395 C  CB  . ASP B 1 122 ? -5.011  -25.985 -81.808 1.00 58.54 ? 186 ASP B CB  1 
ATOM   3396 C  CG  . ASP B 1 122 ? -5.979  -26.857 -82.597 1.00 60.09 ? 186 ASP B CG  1 
ATOM   3397 O  OD1 . ASP B 1 122 ? -7.007  -27.308 -82.042 1.00 62.28 ? 186 ASP B OD1 1 
ATOM   3398 O  OD2 . ASP B 1 122 ? -5.703  -27.094 -83.793 1.00 61.11 ? 186 ASP B OD2 1 
ATOM   3399 N  N   . PRO B 1 123 ? -7.041  -26.719 -78.951 1.00 58.48 ? 187 PRO B N   1 
ATOM   3400 C  CA  . PRO B 1 123 ? -7.269  -27.745 -77.916 1.00 58.53 ? 187 PRO B CA  1 
ATOM   3401 C  C   . PRO B 1 123 ? -7.130  -29.205 -78.389 1.00 58.48 ? 187 PRO B C   1 
ATOM   3402 O  O   . PRO B 1 123 ? -6.849  -30.080 -77.558 1.00 58.69 ? 187 PRO B O   1 
ATOM   3403 C  CB  . PRO B 1 123 ? -8.697  -27.461 -77.434 1.00 58.42 ? 187 PRO B CB  1 
ATOM   3404 C  CG  . PRO B 1 123 ? -9.341  -26.724 -78.548 1.00 58.72 ? 187 PRO B CG  1 
ATOM   3405 C  CD  . PRO B 1 123 ? -8.255  -25.928 -79.220 1.00 58.43 ? 187 PRO B CD  1 
ATOM   3406 N  N   . LYS B 1 124 ? -7.326  -29.457 -79.687 1.00 58.18 ? 188 LYS B N   1 
ATOM   3407 C  CA  . LYS B 1 124 ? -7.117  -30.786 -80.284 1.00 58.29 ? 188 LYS B CA  1 
ATOM   3408 C  C   . LYS B 1 124 ? -5.631  -31.137 -80.235 1.00 57.76 ? 188 LYS B C   1 
ATOM   3409 O  O   . LYS B 1 124 ? -5.256  -32.288 -79.977 1.00 57.36 ? 188 LYS B O   1 
ATOM   3410 C  CB  . LYS B 1 124 ? -7.575  -30.832 -81.751 1.00 58.44 ? 188 LYS B CB  1 
ATOM   3411 C  CG  . LYS B 1 124 ? -9.091  -30.720 -82.016 1.00 60.65 ? 188 LYS B CG  1 
ATOM   3412 C  CD  . LYS B 1 124 ? -9.379  -30.157 -83.447 1.00 62.98 ? 188 LYS B CD  1 
ATOM   3413 C  CE  . LYS B 1 124 ? -10.832 -29.662 -83.579 1.00 65.74 ? 188 LYS B CE  1 
ATOM   3414 N  NZ  . LYS B 1 124 ? -11.110 -28.755 -84.757 1.00 66.87 ? 188 LYS B NZ  1 
ATOM   3415 N  N   . GLU B 1 125 ? -4.798  -30.130 -80.493 1.00 57.14 ? 189 GLU B N   1 
ATOM   3416 C  CA  . GLU B 1 125 ? -3.344  -30.282 -80.474 1.00 56.69 ? 189 GLU B CA  1 
ATOM   3417 C  C   . GLU B 1 125 ? -2.811  -30.438 -79.034 1.00 55.81 ? 189 GLU B C   1 
ATOM   3418 O  O   . GLU B 1 125 ? -1.994  -31.330 -78.754 1.00 55.32 ? 189 GLU B O   1 
ATOM   3419 C  CB  . GLU B 1 125 ? -2.673  -29.126 -81.222 1.00 56.64 ? 189 GLU B CB  1 
ATOM   3420 C  CG  . GLU B 1 125 ? -1.178  -29.302 -81.444 1.00 58.46 ? 189 GLU B CG  1 
ATOM   3421 C  CD  . GLU B 1 125 ? -0.822  -30.419 -82.421 1.00 61.32 ? 189 GLU B CD  1 
ATOM   3422 O  OE1 . GLU B 1 125 ? -1.708  -30.860 -83.204 1.00 60.47 ? 189 GLU B OE1 1 
ATOM   3423 O  OE2 . GLU B 1 125 ? 0.369   -30.836 -82.413 1.00 62.79 ? 189 GLU B OE2 1 
ATOM   3424 N  N   . ARG B 1 126 ? -3.295  -29.587 -78.133 1.00 54.83 ? 190 ARG B N   1 
ATOM   3425 C  CA  . ARG B 1 126 ? -3.094  -29.788 -76.699 1.00 54.24 ? 190 ARG B CA  1 
ATOM   3426 C  C   . ARG B 1 126 ? -3.360  -31.258 -76.319 1.00 54.06 ? 190 ARG B C   1 
ATOM   3427 O  O   . ARG B 1 126 ? -2.451  -31.950 -75.846 1.00 54.42 ? 190 ARG B O   1 
ATOM   3428 C  CB  . ARG B 1 126 ? -3.983  -28.843 -75.885 1.00 53.86 ? 190 ARG B CB  1 
ATOM   3429 C  CG  . ARG B 1 126 ? -3.637  -27.374 -76.039 1.00 53.70 ? 190 ARG B CG  1 
ATOM   3430 C  CD  . ARG B 1 126 ? -4.546  -26.501 -75.187 1.00 54.34 ? 190 ARG B CD  1 
ATOM   3431 N  NE  . ARG B 1 126 ? -4.121  -25.102 -75.212 1.00 54.91 ? 190 ARG B NE  1 
ATOM   3432 C  CZ  . ARG B 1 126 ? -4.657  -24.132 -74.471 1.00 55.17 ? 190 ARG B CZ  1 
ATOM   3433 N  NH1 . ARG B 1 126 ? -5.647  -24.407 -73.633 1.00 55.99 ? 190 ARG B NH1 1 
ATOM   3434 N  NH2 . ARG B 1 126 ? -4.194  -22.887 -74.553 1.00 53.02 ? 190 ARG B NH2 1 
ATOM   3435 N  N   . GLU B 1 127 ? -4.583  -31.740 -76.557 1.00 53.38 ? 191 GLU B N   1 
ATOM   3436 C  CA  . GLU B 1 127 ? -4.947  -33.110 -76.194 1.00 52.94 ? 191 GLU B CA  1 
ATOM   3437 C  C   . GLU B 1 127 ? -4.000  -34.163 -76.796 1.00 51.88 ? 191 GLU B C   1 
ATOM   3438 O  O   . GLU B 1 127 ? -3.543  -35.072 -76.106 1.00 51.90 ? 191 GLU B O   1 
ATOM   3439 C  CB  . GLU B 1 127 ? -6.415  -33.412 -76.529 1.00 53.01 ? 191 GLU B CB  1 
ATOM   3440 C  CG  . GLU B 1 127 ? -6.892  -34.791 -76.030 1.00 55.81 ? 191 GLU B CG  1 
ATOM   3441 C  CD  . GLU B 1 127 ? -6.418  -35.145 -74.588 1.00 60.36 ? 191 GLU B CD  1 
ATOM   3442 O  OE1 . GLU B 1 127 ? -6.657  -34.330 -73.640 1.00 61.47 ? 191 GLU B OE1 1 
ATOM   3443 O  OE2 . GLU B 1 127 ? -5.818  -36.245 -74.412 1.00 59.33 ? 191 GLU B OE2 1 
ATOM   3444 N  N   . PHE B 1 128 ? -3.696  -34.019 -78.076 1.00 50.75 ? 192 PHE B N   1 
ATOM   3445 C  CA  . PHE B 1 128 ? -2.757  -34.896 -78.725 1.00 49.80 ? 192 PHE B CA  1 
ATOM   3446 C  C   . PHE B 1 128 ? -1.464  -34.938 -77.899 1.00 49.70 ? 192 PHE B C   1 
ATOM   3447 O  O   . PHE B 1 128 ? -1.017  -36.014 -77.508 1.00 49.79 ? 192 PHE B O   1 
ATOM   3448 C  CB  . PHE B 1 128 ? -2.514  -34.429 -80.164 1.00 49.59 ? 192 PHE B CB  1 
ATOM   3449 C  CG  . PHE B 1 128 ? -1.358  -35.114 -80.845 1.00 49.66 ? 192 PHE B CG  1 
ATOM   3450 C  CD1 . PHE B 1 128 ? -1.510  -36.389 -81.398 1.00 50.06 ? 192 PHE B CD1 1 
ATOM   3451 C  CD2 . PHE B 1 128 ? -0.121  -34.478 -80.950 1.00 48.65 ? 192 PHE B CD2 1 
ATOM   3452 C  CE1 . PHE B 1 128 ? -0.441  -37.030 -82.034 1.00 50.22 ? 192 PHE B CE1 1 
ATOM   3453 C  CE2 . PHE B 1 128 ? 0.966   -35.101 -81.584 1.00 49.19 ? 192 PHE B CE2 1 
ATOM   3454 C  CZ  . PHE B 1 128 ? 0.810   -36.378 -82.126 1.00 50.50 ? 192 PHE B CZ  1 
ATOM   3455 N  N   . LEU B 1 129 ? -0.897  -33.766 -77.604 1.00 49.09 ? 193 LEU B N   1 
ATOM   3456 C  CA  . LEU B 1 129 ? 0.358   -33.671 -76.891 1.00 48.33 ? 193 LEU B CA  1 
ATOM   3457 C  C   . LEU B 1 129 ? 0.295   -34.195 -75.446 1.00 48.87 ? 193 LEU B C   1 
ATOM   3458 O  O   . LEU B 1 129 ? 1.220   -34.877 -74.996 1.00 48.57 ? 193 LEU B O   1 
ATOM   3459 C  CB  . LEU B 1 129 ? 0.864   -32.236 -76.914 1.00 48.03 ? 193 LEU B CB  1 
ATOM   3460 C  CG  . LEU B 1 129 ? 1.198   -31.616 -78.265 1.00 46.06 ? 193 LEU B CG  1 
ATOM   3461 C  CD1 . LEU B 1 129 ? 1.355   -30.126 -78.093 1.00 45.26 ? 193 LEU B CD1 1 
ATOM   3462 C  CD2 . LEU B 1 129 ? 2.433   -32.211 -78.874 1.00 44.57 ? 193 LEU B CD2 1 
ATOM   3463 N  N   . PHE B 1 130 ? -0.783  -33.899 -74.723 1.00 49.24 ? 194 PHE B N   1 
ATOM   3464 C  CA  . PHE B 1 130 ? -0.906  -34.400 -73.352 1.00 50.20 ? 194 PHE B CA  1 
ATOM   3465 C  C   . PHE B 1 130 ? -1.022  -35.918 -73.310 1.00 51.24 ? 194 PHE B C   1 
ATOM   3466 O  O   . PHE B 1 130 ? -0.580  -36.537 -72.345 1.00 51.74 ? 194 PHE B O   1 
ATOM   3467 C  CB  . PHE B 1 130 ? -2.106  -33.808 -72.603 1.00 49.84 ? 194 PHE B CB  1 
ATOM   3468 C  CG  . PHE B 1 130 ? -2.084  -32.310 -72.464 1.00 49.50 ? 194 PHE B CG  1 
ATOM   3469 C  CD1 . PHE B 1 130 ? -0.891  -31.619 -72.238 1.00 49.24 ? 194 PHE B CD1 1 
ATOM   3470 C  CD2 . PHE B 1 130 ? -3.269  -31.593 -72.513 1.00 48.63 ? 194 PHE B CD2 1 
ATOM   3471 C  CE1 . PHE B 1 130 ? -0.882  -30.234 -72.097 1.00 47.80 ? 194 PHE B CE1 1 
ATOM   3472 C  CE2 . PHE B 1 130 ? -3.266  -30.206 -72.371 1.00 49.93 ? 194 PHE B CE2 1 
ATOM   3473 C  CZ  . PHE B 1 130 ? -2.061  -29.526 -72.168 1.00 48.12 ? 194 PHE B CZ  1 
ATOM   3474 N  N   . ASN B 1 131 ? -1.634  -36.517 -74.331 1.00 52.13 ? 195 ASN B N   1 
ATOM   3475 C  CA  . ASN B 1 131 ? -1.843  -37.959 -74.327 1.00 53.15 ? 195 ASN B CA  1 
ATOM   3476 C  C   . ASN B 1 131 ? -0.699  -38.680 -75.032 1.00 53.19 ? 195 ASN B C   1 
ATOM   3477 O  O   . ASN B 1 131 ? -0.854  -39.796 -75.535 1.00 52.63 ? 195 ASN B O   1 
ATOM   3478 C  CB  . ASN B 1 131 ? -3.219  -38.329 -74.912 1.00 53.66 ? 195 ASN B CB  1 
ATOM   3479 C  CG  . ASN B 1 131 ? -3.630  -39.791 -74.600 1.00 55.80 ? 195 ASN B CG  1 
ATOM   3480 O  OD1 . ASN B 1 131 ? -3.110  -40.427 -73.663 1.00 57.43 ? 195 ASN B OD1 1 
ATOM   3481 N  ND2 . ASN B 1 131 ? -4.551  -40.326 -75.404 1.00 55.90 ? 195 ASN B ND2 1 
ATOM   3482 N  N   . ALA B 1 132 ? 0.461   -38.028 -75.010 1.00 53.63 ? 196 ALA B N   1 
ATOM   3483 C  CA  . ALA B 1 132 ? 1.650   -38.455 -75.747 1.00 54.56 ? 196 ALA B CA  1 
ATOM   3484 C  C   . ALA B 1 132 ? 2.042   -39.928 -75.601 1.00 55.06 ? 196 ALA B C   1 
ATOM   3485 O  O   . ALA B 1 132 ? 2.623   -40.493 -76.501 1.00 55.03 ? 196 ALA B O   1 
ATOM   3486 C  CB  . ALA B 1 132 ? 2.836   -37.543 -75.418 1.00 54.33 ? 196 ALA B CB  1 
ATOM   3487 N  N   . ILE B 1 133 ? 1.718   -40.547 -74.479 1.00 56.37 ? 197 ILE B N   1 
ATOM   3488 C  CA  . ILE B 1 133 ? 2.012   -41.968 -74.295 1.00 57.72 ? 197 ILE B CA  1 
ATOM   3489 C  C   . ILE B 1 133 ? 1.204   -42.839 -75.276 1.00 58.47 ? 197 ILE B C   1 
ATOM   3490 O  O   . ILE B 1 133 ? 1.712   -43.826 -75.830 1.00 58.69 ? 197 ILE B O   1 
ATOM   3491 C  CB  . ILE B 1 133 ? 1.797   -42.404 -72.811 1.00 57.91 ? 197 ILE B CB  1 
ATOM   3492 C  CG1 . ILE B 1 133 ? 2.944   -41.865 -71.948 1.00 57.49 ? 197 ILE B CG1 1 
ATOM   3493 C  CG2 . ILE B 1 133 ? 1.702   -43.932 -72.685 1.00 57.80 ? 197 ILE B CG2 1 
ATOM   3494 C  CD1 . ILE B 1 133 ? 2.659   -41.853 -70.462 1.00 57.33 ? 197 ILE B CD1 1 
ATOM   3495 N  N   . GLU B 1 134 ? -0.047  -42.463 -75.497 1.00 59.33 ? 198 GLU B N   1 
ATOM   3496 C  CA  . GLU B 1 134 ? -0.884  -43.163 -76.461 1.00 60.33 ? 198 GLU B CA  1 
ATOM   3497 C  C   . GLU B 1 134 ? -0.738  -42.674 -77.898 1.00 60.29 ? 198 GLU B C   1 
ATOM   3498 O  O   . GLU B 1 134 ? -0.887  -43.469 -78.826 1.00 60.55 ? 198 GLU B O   1 
ATOM   3499 C  CB  . GLU B 1 134 ? -2.348  -43.085 -76.043 1.00 60.62 ? 198 GLU B CB  1 
ATOM   3500 C  CG  . GLU B 1 134 ? -2.824  -44.333 -75.356 1.00 62.59 ? 198 GLU B CG  1 
ATOM   3501 C  CD  . GLU B 1 134 ? -3.841  -44.032 -74.295 1.00 65.40 ? 198 GLU B CD  1 
ATOM   3502 O  OE1 . GLU B 1 134 ? -4.960  -43.558 -74.648 1.00 65.94 ? 198 GLU B OE1 1 
ATOM   3503 O  OE2 . GLU B 1 134 ? -3.508  -44.268 -73.109 1.00 65.62 ? 198 GLU B OE2 1 
ATOM   3504 N  N   . THR B 1 135 ? -0.440  -41.382 -78.066 1.00 60.29 ? 199 THR B N   1 
ATOM   3505 C  CA  . THR B 1 135 ? -0.523  -40.704 -79.365 1.00 60.33 ? 199 THR B CA  1 
ATOM   3506 C  C   . THR B 1 135 ? 0.807   -40.516 -80.101 1.00 60.66 ? 199 THR B C   1 
ATOM   3507 O  O   . THR B 1 135 ? 0.817   -40.299 -81.315 1.00 60.44 ? 199 THR B O   1 
ATOM   3508 C  CB  . THR B 1 135 ? -1.203  -39.309 -79.246 1.00 60.39 ? 199 THR B CB  1 
ATOM   3509 O  OG1 . THR B 1 135 ? -0.356  -38.415 -78.501 1.00 60.65 ? 199 THR B OG1 1 
ATOM   3510 C  CG2 . THR B 1 135 ? -2.584  -39.402 -78.595 1.00 59.16 ? 199 THR B CG2 1 
ATOM   3511 N  N   . MET B 1 136 ? 1.921   -40.566 -79.376 1.00 61.31 ? 200 MET B N   1 
ATOM   3512 C  CA  . MET B 1 136 ? 3.236   -40.296 -79.978 1.00 62.28 ? 200 MET B CA  1 
ATOM   3513 C  C   . MET B 1 136 ? 4.149   -41.517 -80.036 1.00 62.81 ? 200 MET B C   1 
ATOM   3514 O  O   . MET B 1 136 ? 4.693   -41.931 -79.019 1.00 62.99 ? 200 MET B O   1 
ATOM   3515 C  CB  . MET B 1 136 ? 3.945   -39.138 -79.266 1.00 61.85 ? 200 MET B CB  1 
ATOM   3516 C  CG  . MET B 1 136 ? 3.707   -37.821 -79.909 1.00 62.39 ? 200 MET B CG  1 
ATOM   3517 S  SD  . MET B 1 136 ? 4.013   -36.409 -78.833 1.00 64.11 ? 200 MET B SD  1 
ATOM   3518 C  CE  . MET B 1 136 ? 5.787   -36.527 -78.656 1.00 63.27 ? 200 MET B CE  1 
ATOM   3519 N  N   . PRO B 1 137 ? 4.328   -42.089 -81.233 1.00 63.79 ? 201 PRO B N   1 
ATOM   3520 C  CA  . PRO B 1 137 ? 5.219   -43.245 -81.415 1.00 64.59 ? 201 PRO B CA  1 
ATOM   3521 C  C   . PRO B 1 137 ? 6.637   -42.996 -80.902 1.00 65.15 ? 201 PRO B C   1 
ATOM   3522 O  O   . PRO B 1 137 ? 7.257   -43.915 -80.360 1.00 65.07 ? 201 PRO B O   1 
ATOM   3523 C  CB  . PRO B 1 137 ? 5.238   -43.439 -82.938 1.00 64.58 ? 201 PRO B CB  1 
ATOM   3524 C  CG  . PRO B 1 137 ? 3.920   -42.899 -83.393 1.00 64.64 ? 201 PRO B CG  1 
ATOM   3525 C  CD  . PRO B 1 137 ? 3.636   -41.722 -82.482 1.00 64.00 ? 201 PRO B CD  1 
ATOM   3526 N  N   . CYS B 1 138 ? 7.132   -41.765 -81.051 1.00 65.87 ? 202 CYS B N   1 
ATOM   3527 C  CA  . CYS B 1 138 ? 8.496   -41.436 -80.625 1.00 66.81 ? 202 CYS B CA  1 
ATOM   3528 C  C   . CYS B 1 138 ? 8.775   -41.658 -79.123 1.00 67.07 ? 202 CYS B C   1 
ATOM   3529 O  O   . CYS B 1 138 ? 9.902   -42.022 -78.748 1.00 67.40 ? 202 CYS B O   1 
ATOM   3530 C  CB  . CYS B 1 138 ? 8.915   -40.027 -81.083 1.00 66.89 ? 202 CYS B CB  1 
ATOM   3531 S  SG  . CYS B 1 138 ? 7.852   -38.626 -80.611 1.00 68.76 ? 202 CYS B SG  1 
ATOM   3532 N  N   . VAL B 1 139 ? 7.760   -41.476 -78.276 1.00 66.85 ? 203 VAL B N   1 
ATOM   3533 C  CA  . VAL B 1 139 ? 7.943   -41.683 -76.837 1.00 66.78 ? 203 VAL B CA  1 
ATOM   3534 C  C   . VAL B 1 139 ? 7.777   -43.138 -76.397 1.00 66.83 ? 203 VAL B C   1 
ATOM   3535 O  O   . VAL B 1 139 ? 8.258   -43.519 -75.330 1.00 67.00 ? 203 VAL B O   1 
ATOM   3536 C  CB  . VAL B 1 139 ? 7.039   -40.752 -75.967 1.00 66.68 ? 203 VAL B CB  1 
ATOM   3537 C  CG1 . VAL B 1 139 ? 7.003   -39.345 -76.530 1.00 66.51 ? 203 VAL B CG1 1 
ATOM   3538 C  CG2 . VAL B 1 139 ? 5.649   -41.304 -75.843 1.00 66.89 ? 203 VAL B CG2 1 
ATOM   3539 N  N   . LYS B 1 140 ? 7.107   -43.942 -77.221 1.00 66.95 ? 204 LYS B N   1 
ATOM   3540 C  CA  . LYS B 1 140 ? 6.755   -45.334 -76.886 1.00 66.87 ? 204 LYS B CA  1 
ATOM   3541 C  C   . LYS B 1 140 ? 7.907   -46.113 -76.268 1.00 66.20 ? 204 LYS B C   1 
ATOM   3542 O  O   . LYS B 1 140 ? 7.800   -46.594 -75.147 1.00 66.08 ? 204 LYS B O   1 
ATOM   3543 C  CB  . LYS B 1 140 ? 6.253   -46.073 -78.137 1.00 67.28 ? 204 LYS B CB  1 
ATOM   3544 C  CG  . LYS B 1 140 ? 5.569   -47.428 -77.882 1.00 68.58 ? 204 LYS B CG  1 
ATOM   3545 C  CD  . LYS B 1 140 ? 4.180   -47.257 -77.237 1.00 70.73 ? 204 LYS B CD  1 
ATOM   3546 C  CE  . LYS B 1 140 ? 3.220   -48.354 -77.692 1.00 72.14 ? 204 LYS B CE  1 
ATOM   3547 N  NZ  . LYS B 1 140 ? 3.683   -49.727 -77.300 1.00 72.83 ? 204 LYS B NZ  1 
ATOM   3548 N  N   . LYS B 1 141 ? 9.006   -46.219 -77.008 1.00 65.86 ? 205 LYS B N   1 
ATOM   3549 C  CA  . LYS B 1 141 ? 10.174  -46.972 -76.566 1.00 65.53 ? 205 LYS B CA  1 
ATOM   3550 C  C   . LYS B 1 141 ? 10.612  -46.550 -75.166 1.00 64.98 ? 205 LYS B C   1 
ATOM   3551 O  O   . LYS B 1 141 ? 10.828  -47.402 -74.300 1.00 65.05 ? 205 LYS B O   1 
ATOM   3552 C  CB  . LYS B 1 141 ? 11.326  -46.842 -77.570 1.00 65.69 ? 205 LYS B CB  1 
ATOM   3553 C  CG  . LYS B 1 141 ? 11.618  -48.108 -78.370 1.00 66.53 ? 205 LYS B CG  1 
ATOM   3554 C  CD  . LYS B 1 141 ? 12.304  -47.777 -79.699 1.00 68.39 ? 205 LYS B CD  1 
ATOM   3555 C  CE  . LYS B 1 141 ? 13.235  -48.899 -80.179 1.00 70.44 ? 205 LYS B CE  1 
ATOM   3556 N  NZ  . LYS B 1 141 ? 12.536  -50.187 -80.456 1.00 71.03 ? 205 LYS B NZ  1 
ATOM   3557 N  N   . LYS B 1 142 ? 10.710  -45.238 -74.945 1.00 64.02 ? 206 LYS B N   1 
ATOM   3558 C  CA  . LYS B 1 142 ? 11.127  -44.706 -73.649 1.00 62.84 ? 206 LYS B CA  1 
ATOM   3559 C  C   . LYS B 1 142 ? 10.087  -44.919 -72.547 1.00 62.62 ? 206 LYS B C   1 
ATOM   3560 O  O   . LYS B 1 142 ? 10.439  -45.339 -71.446 1.00 62.55 ? 206 LYS B O   1 
ATOM   3561 C  CB  . LYS B 1 142 ? 11.526  -43.230 -73.756 1.00 62.40 ? 206 LYS B CB  1 
ATOM   3562 C  CG  . LYS B 1 142 ? 12.853  -43.030 -74.463 1.00 60.71 ? 206 LYS B CG  1 
ATOM   3563 C  CD  . LYS B 1 142 ? 13.558  -41.741 -74.064 1.00 57.33 ? 206 LYS B CD  1 
ATOM   3564 C  CE  . LYS B 1 142 ? 13.297  -40.613 -75.026 1.00 54.45 ? 206 LYS B CE  1 
ATOM   3565 N  NZ  . LYS B 1 142 ? 14.197  -39.470 -74.771 1.00 51.67 ? 206 LYS B NZ  1 
ATOM   3566 N  N   . ALA B 1 143 ? 8.818   -44.649 -72.845 1.00 62.19 ? 207 ALA B N   1 
ATOM   3567 C  CA  . ALA B 1 143 ? 7.749   -44.826 -71.864 1.00 62.05 ? 207 ALA B CA  1 
ATOM   3568 C  C   . ALA B 1 143 ? 7.560   -46.296 -71.497 1.00 61.99 ? 207 ALA B C   1 
ATOM   3569 O  O   . ALA B 1 143 ? 7.403   -46.626 -70.318 1.00 62.14 ? 207 ALA B O   1 
ATOM   3570 C  CB  . ALA B 1 143 ? 6.437   -44.205 -72.352 1.00 61.79 ? 207 ALA B CB  1 
ATOM   3571 N  N   . ASP B 1 144 ? 7.593   -47.173 -72.497 1.00 61.87 ? 208 ASP B N   1 
ATOM   3572 C  CA  . ASP B 1 144 ? 7.485   -48.614 -72.255 1.00 62.14 ? 208 ASP B CA  1 
ATOM   3573 C  C   . ASP B 1 144 ? 8.614   -49.159 -71.373 1.00 61.97 ? 208 ASP B C   1 
ATOM   3574 O  O   . ASP B 1 144 ? 8.388   -50.010 -70.506 1.00 61.91 ? 208 ASP B O   1 
ATOM   3575 C  CB  . ASP B 1 144 ? 7.435   -49.394 -73.577 1.00 62.04 ? 208 ASP B CB  1 
ATOM   3576 C  CG  . ASP B 1 144 ? 6.028   -49.464 -74.172 1.00 62.69 ? 208 ASP B CG  1 
ATOM   3577 O  OD1 . ASP B 1 144 ? 5.043   -49.164 -73.448 1.00 61.25 ? 208 ASP B OD1 1 
ATOM   3578 O  OD2 . ASP B 1 144 ? 5.921   -49.824 -75.377 1.00 62.58 ? 208 ASP B OD2 1 
ATOM   3579 N  N   . TRP B 1 145 ? 9.822   -48.662 -71.611 1.00 61.75 ? 209 TRP B N   1 
ATOM   3580 C  CA  . TRP B 1 145 ? 11.023  -49.129 -70.930 1.00 61.90 ? 209 TRP B CA  1 
ATOM   3581 C  C   . TRP B 1 145 ? 10.975  -48.768 -69.451 1.00 61.86 ? 209 TRP B C   1 
ATOM   3582 O  O   . TRP B 1 145 ? 11.390  -49.547 -68.593 1.00 61.69 ? 209 TRP B O   1 
ATOM   3583 C  CB  . TRP B 1 145 ? 12.241  -48.480 -71.577 1.00 61.99 ? 209 TRP B CB  1 
ATOM   3584 C  CG  . TRP B 1 145 ? 13.571  -49.029 -71.182 1.00 61.51 ? 209 TRP B CG  1 
ATOM   3585 C  CD1 . TRP B 1 145 ? 14.253  -50.040 -71.794 1.00 61.44 ? 209 TRP B CD1 1 
ATOM   3586 C  CD2 . TRP B 1 145 ? 14.411  -48.563 -70.116 1.00 60.63 ? 209 TRP B CD2 1 
ATOM   3587 N  NE1 . TRP B 1 145 ? 15.466  -50.240 -71.170 1.00 61.27 ? 209 TRP B NE1 1 
ATOM   3588 C  CE2 . TRP B 1 145 ? 15.586  -49.354 -70.133 1.00 60.23 ? 209 TRP B CE2 1 
ATOM   3589 C  CE3 . TRP B 1 145 ? 14.279  -47.568 -69.137 1.00 59.19 ? 209 TRP B CE3 1 
ATOM   3590 C  CZ2 . TRP B 1 145 ? 16.626  -49.175 -69.214 1.00 59.71 ? 209 TRP B CZ2 1 
ATOM   3591 C  CZ3 . TRP B 1 145 ? 15.310  -47.393 -68.219 1.00 58.39 ? 209 TRP B CZ3 1 
ATOM   3592 C  CH2 . TRP B 1 145 ? 16.470  -48.191 -68.268 1.00 59.31 ? 209 TRP B CH2 1 
ATOM   3593 N  N   . ALA B 1 146 ? 10.462  -47.579 -69.164 1.00 61.72 ? 210 ALA B N   1 
ATOM   3594 C  CA  . ALA B 1 146 ? 10.383  -47.114 -67.799 1.00 61.75 ? 210 ALA B CA  1 
ATOM   3595 C  C   . ALA B 1 146 ? 9.264   -47.825 -67.058 1.00 61.64 ? 210 ALA B C   1 
ATOM   3596 O  O   . ALA B 1 146 ? 9.463   -48.273 -65.931 1.00 61.72 ? 210 ALA B O   1 
ATOM   3597 C  CB  . ALA B 1 146 ? 10.212  -45.609 -67.752 1.00 61.64 ? 210 ALA B CB  1 
ATOM   3598 N  N   . LEU B 1 147 ? 8.103   -47.953 -67.695 1.00 61.54 ? 211 LEU B N   1 
ATOM   3599 C  CA  . LEU B 1 147 ? 6.987   -48.668 -67.082 1.00 61.92 ? 211 LEU B CA  1 
ATOM   3600 C  C   . LEU B 1 147 ? 7.315   -50.142 -66.776 1.00 62.47 ? 211 LEU B C   1 
ATOM   3601 O  O   . LEU B 1 147 ? 6.856   -50.681 -65.773 1.00 62.43 ? 211 LEU B O   1 
ATOM   3602 C  CB  . LEU B 1 147 ? 5.725   -48.539 -67.927 1.00 61.64 ? 211 LEU B CB  1 
ATOM   3603 C  CG  . LEU B 1 147 ? 5.018   -47.178 -67.955 1.00 61.46 ? 211 LEU B CG  1 
ATOM   3604 C  CD1 . LEU B 1 147 ? 4.286   -46.958 -69.283 1.00 59.89 ? 211 LEU B CD1 1 
ATOM   3605 C  CD2 . LEU B 1 147 ? 4.061   -47.018 -66.779 1.00 60.71 ? 211 LEU B CD2 1 
ATOM   3606 N  N   . ARG B 1 148 ? 8.122   -50.778 -67.625 1.00 63.22 ? 212 ARG B N   1 
ATOM   3607 C  CA  . ARG B 1 148 ? 8.605   -52.143 -67.375 1.00 64.14 ? 212 ARG B CA  1 
ATOM   3608 C  C   . ARG B 1 148 ? 9.178   -52.217 -65.950 1.00 63.86 ? 212 ARG B C   1 
ATOM   3609 O  O   . ARG B 1 148 ? 8.770   -53.066 -65.152 1.00 63.91 ? 212 ARG B O   1 
ATOM   3610 C  CB  . ARG B 1 148 ? 9.680   -52.538 -68.410 1.00 64.64 ? 212 ARG B CB  1 
ATOM   3611 C  CG  . ARG B 1 148 ? 9.775   -54.036 -68.804 1.00 67.30 ? 212 ARG B CG  1 
ATOM   3612 C  CD  . ARG B 1 148 ? 10.072  -55.020 -67.615 1.00 72.15 ? 212 ARG B CD  1 
ATOM   3613 N  NE  . ARG B 1 148 ? 11.482  -55.350 -67.292 1.00 74.32 ? 212 ARG B NE  1 
ATOM   3614 C  CZ  . ARG B 1 148 ? 12.587  -54.789 -67.798 1.00 76.62 ? 212 ARG B CZ  1 
ATOM   3615 N  NH1 . ARG B 1 148 ? 12.531  -53.808 -68.704 1.00 78.16 ? 212 ARG B NH1 1 
ATOM   3616 N  NH2 . ARG B 1 148 ? 13.777  -55.216 -67.385 1.00 75.93 ? 212 ARG B NH2 1 
ATOM   3617 N  N   . TRP B 1 149 ? 10.097  -51.300 -65.641 1.00 63.61 ? 213 TRP B N   1 
ATOM   3618 C  CA  . TRP B 1 149 ? 10.800  -51.267 -64.359 1.00 63.41 ? 213 TRP B CA  1 
ATOM   3619 C  C   . TRP B 1 149 ? 9.900   -50.991 -63.154 1.00 63.81 ? 213 TRP B C   1 
ATOM   3620 O  O   . TRP B 1 149 ? 10.264  -51.299 -62.028 1.00 64.11 ? 213 TRP B O   1 
ATOM   3621 C  CB  . TRP B 1 149 ? 11.934  -50.245 -64.398 1.00 63.12 ? 213 TRP B CB  1 
ATOM   3622 C  CG  . TRP B 1 149 ? 13.061  -50.608 -65.309 1.00 62.22 ? 213 TRP B CG  1 
ATOM   3623 C  CD1 . TRP B 1 149 ? 13.350  -50.044 -66.510 1.00 62.00 ? 213 TRP B CD1 1 
ATOM   3624 C  CD2 . TRP B 1 149 ? 14.057  -51.614 -65.089 1.00 62.03 ? 213 TRP B CD2 1 
ATOM   3625 N  NE1 . TRP B 1 149 ? 14.466  -50.630 -67.060 1.00 61.75 ? 213 TRP B NE1 1 
ATOM   3626 C  CE2 . TRP B 1 149 ? 14.919  -51.600 -66.209 1.00 62.10 ? 213 TRP B CE2 1 
ATOM   3627 C  CE3 . TRP B 1 149 ? 14.302  -52.531 -64.057 1.00 61.38 ? 213 TRP B CE3 1 
ATOM   3628 C  CZ2 . TRP B 1 149 ? 16.014  -52.464 -66.327 1.00 62.42 ? 213 TRP B CZ2 1 
ATOM   3629 C  CZ3 . TRP B 1 149 ? 15.395  -53.398 -64.175 1.00 61.52 ? 213 TRP B CZ3 1 
ATOM   3630 C  CH2 . TRP B 1 149 ? 16.236  -53.354 -65.303 1.00 62.24 ? 213 TRP B CH2 1 
ATOM   3631 N  N   . ILE B 1 150 ? 8.734   -50.399 -63.384 1.00 64.31 ? 214 ILE B N   1 
ATOM   3632 C  CA  . ILE B 1 150 ? 7.739   -50.266 -62.329 1.00 64.62 ? 214 ILE B CA  1 
ATOM   3633 C  C   . ILE B 1 150 ? 7.066   -51.624 -62.096 1.00 65.39 ? 214 ILE B C   1 
ATOM   3634 O  O   . ILE B 1 150 ? 6.928   -52.080 -60.964 1.00 65.60 ? 214 ILE B O   1 
ATOM   3635 C  CB  . ILE B 1 150 ? 6.704   -49.160 -62.660 1.00 64.36 ? 214 ILE B CB  1 
ATOM   3636 C  CG1 . ILE B 1 150 ? 7.384   -47.790 -62.644 1.00 63.21 ? 214 ILE B CG1 1 
ATOM   3637 C  CG2 . ILE B 1 150 ? 5.524   -49.202 -61.685 1.00 64.17 ? 214 ILE B CG2 1 
ATOM   3638 C  CD1 . ILE B 1 150 ? 6.503   -46.636 -63.027 1.00 61.59 ? 214 ILE B CD1 1 
ATOM   3639 N  N   . GLY B 1 151 ? 6.678   -52.277 -63.180 1.00 66.36 ? 215 GLY B N   1 
ATOM   3640 C  CA  . GLY B 1 151 ? 5.980   -53.548 -63.097 1.00 67.75 ? 215 GLY B CA  1 
ATOM   3641 C  C   . GLY B 1 151 ? 6.854   -54.756 -62.809 1.00 68.60 ? 215 GLY B C   1 
ATOM   3642 O  O   . GLY B 1 151 ? 6.328   -55.824 -62.482 1.00 68.77 ? 215 GLY B O   1 
ATOM   3643 N  N   . ASP B 1 152 ? 8.175   -54.602 -62.930 1.00 69.27 ? 216 ASP B N   1 
ATOM   3644 C  CA  . ASP B 1 152 ? 9.093   -55.722 -62.714 1.00 70.08 ? 216 ASP B CA  1 
ATOM   3645 C  C   . ASP B 1 152 ? 9.133   -56.090 -61.233 1.00 70.60 ? 216 ASP B C   1 
ATOM   3646 O  O   . ASP B 1 152 ? 9.564   -55.297 -60.386 1.00 70.58 ? 216 ASP B O   1 
ATOM   3647 C  CB  . ASP B 1 152 ? 10.497  -55.410 -63.252 1.00 70.36 ? 216 ASP B CB  1 
ATOM   3648 C  CG  . ASP B 1 152 ? 11.440  -56.626 -63.224 1.00 70.73 ? 216 ASP B CG  1 
ATOM   3649 O  OD1 . ASP B 1 152 ? 11.122  -57.636 -62.568 1.00 71.77 ? 216 ASP B OD1 1 
ATOM   3650 O  OD2 . ASP B 1 152 ? 12.518  -56.567 -63.856 1.00 70.96 ? 216 ASP B OD2 1 
ATOM   3651 N  N   . LYS B 1 153 ? 8.678   -57.307 -60.940 1.00 71.00 ? 217 LYS B N   1 
ATOM   3652 C  CA  . LYS B 1 153 ? 8.504   -57.764 -59.567 1.00 71.37 ? 217 LYS B CA  1 
ATOM   3653 C  C   . LYS B 1 153 ? 9.699   -58.532 -59.019 1.00 70.89 ? 217 LYS B C   1 
ATOM   3654 O  O   . LYS B 1 153 ? 9.840   -58.663 -57.805 1.00 70.88 ? 217 LYS B O   1 
ATOM   3655 C  CB  . LYS B 1 153 ? 7.199   -58.557 -59.423 1.00 72.03 ? 217 LYS B CB  1 
ATOM   3656 C  CG  . LYS B 1 153 ? 5.991   -57.658 -59.126 1.00 74.02 ? 217 LYS B CG  1 
ATOM   3657 C  CD  . LYS B 1 153 ? 4.671   -58.239 -59.634 1.00 77.62 ? 217 LYS B CD  1 
ATOM   3658 C  CE  . LYS B 1 153 ? 3.581   -57.146 -59.612 1.00 79.80 ? 217 LYS B CE  1 
ATOM   3659 N  NZ  . LYS B 1 153 ? 2.183   -57.654 -59.803 1.00 80.24 ? 217 LYS B NZ  1 
ATOM   3660 N  N   . GLU B 1 154 ? 10.561  -59.015 -59.911 1.00 70.28 ? 218 GLU B N   1 
ATOM   3661 C  CA  . GLU B 1 154 ? 11.811  -59.671 -59.512 1.00 69.78 ? 218 GLU B CA  1 
ATOM   3662 C  C   . GLU B 1 154 ? 12.905  -58.664 -59.154 1.00 68.64 ? 218 GLU B C   1 
ATOM   3663 O  O   . GLU B 1 154 ? 13.595  -58.825 -58.144 1.00 68.75 ? 218 GLU B O   1 
ATOM   3664 C  CB  . GLU B 1 154 ? 12.330  -60.621 -60.612 1.00 70.36 ? 218 GLU B CB  1 
ATOM   3665 C  CG  . GLU B 1 154 ? 11.349  -61.710 -61.057 1.00 72.89 ? 218 GLU B CG  1 
ATOM   3666 C  CD  . GLU B 1 154 ? 10.625  -62.367 -59.876 1.00 76.74 ? 218 GLU B CD  1 
ATOM   3667 O  OE1 . GLU B 1 154 ? 11.301  -62.975 -59.002 1.00 78.40 ? 218 GLU B OE1 1 
ATOM   3668 O  OE2 . GLU B 1 154 ? 9.377   -62.264 -59.822 1.00 76.65 ? 218 GLU B OE2 1 
ATOM   3669 N  N   . ALA B 1 155 ? 13.046  -57.625 -59.976 1.00 67.22 ? 219 ALA B N   1 
ATOM   3670 C  CA  . ALA B 1 155 ? 14.204  -56.723 -59.928 1.00 65.72 ? 219 ALA B CA  1 
ATOM   3671 C  C   . ALA B 1 155 ? 14.438  -56.036 -58.579 1.00 64.71 ? 219 ALA B C   1 
ATOM   3672 O  O   . ALA B 1 155 ? 13.520  -55.468 -57.978 1.00 64.45 ? 219 ALA B O   1 
ATOM   3673 C  CB  . ALA B 1 155 ? 14.120  -55.699 -61.042 1.00 65.54 ? 219 ALA B CB  1 
ATOM   3674 N  N   . THR B 1 156 ? 15.681  -56.107 -58.114 1.00 63.44 ? 220 THR B N   1 
ATOM   3675 C  CA  . THR B 1 156 ? 16.079  -55.463 -56.868 1.00 62.65 ? 220 THR B CA  1 
ATOM   3676 C  C   . THR B 1 156 ? 15.954  -53.943 -56.944 1.00 61.61 ? 220 THR B C   1 
ATOM   3677 O  O   . THR B 1 156 ? 15.945  -53.360 -58.027 1.00 61.31 ? 220 THR B O   1 
ATOM   3678 C  CB  . THR B 1 156 ? 17.537  -55.840 -56.462 1.00 63.01 ? 220 THR B CB  1 
ATOM   3679 O  OG1 . THR B 1 156 ? 18.483  -55.182 -57.321 1.00 62.70 ? 220 THR B OG1 1 
ATOM   3680 C  CG2 . THR B 1 156 ? 17.747  -57.363 -56.521 1.00 63.41 ? 220 THR B CG2 1 
ATOM   3681 N  N   . TYR B 1 157 ? 15.858  -53.308 -55.785 1.00 60.64 ? 221 TYR B N   1 
ATOM   3682 C  CA  . TYR B 1 157 ? 15.899  -51.857 -55.713 1.00 60.00 ? 221 TYR B CA  1 
ATOM   3683 C  C   . TYR B 1 157 ? 17.152  -51.325 -56.409 1.00 59.93 ? 221 TYR B C   1 
ATOM   3684 O  O   . TYR B 1 157 ? 17.087  -50.331 -57.131 1.00 60.18 ? 221 TYR B O   1 
ATOM   3685 C  CB  . TYR B 1 157 ? 15.847  -51.385 -54.254 1.00 59.80 ? 221 TYR B CB  1 
ATOM   3686 C  CG  . TYR B 1 157 ? 16.033  -49.889 -54.057 1.00 58.85 ? 221 TYR B CG  1 
ATOM   3687 C  CD1 . TYR B 1 157 ? 15.049  -48.982 -54.457 1.00 56.40 ? 221 TYR B CD1 1 
ATOM   3688 C  CD2 . TYR B 1 157 ? 17.197  -49.379 -53.465 1.00 57.52 ? 221 TYR B CD2 1 
ATOM   3689 C  CE1 . TYR B 1 157 ? 15.213  -47.618 -54.278 1.00 54.66 ? 221 TYR B CE1 1 
ATOM   3690 C  CE2 . TYR B 1 157 ? 17.368  -48.003 -53.286 1.00 56.21 ? 221 TYR B CE2 1 
ATOM   3691 C  CZ  . TYR B 1 157 ? 16.363  -47.137 -53.694 1.00 55.98 ? 221 TYR B CZ  1 
ATOM   3692 O  OH  . TYR B 1 157 ? 16.513  -45.779 -53.519 1.00 57.86 ? 221 TYR B OH  1 
ATOM   3693 N  N   . GLY B 1 158 ? 18.281  -52.001 -56.206 1.00 59.56 ? 222 GLY B N   1 
ATOM   3694 C  CA  . GLY B 1 158 ? 19.551  -51.580 -56.784 1.00 59.03 ? 222 GLY B CA  1 
ATOM   3695 C  C   . GLY B 1 158 ? 19.505  -51.460 -58.289 1.00 58.92 ? 222 GLY B C   1 
ATOM   3696 O  O   . GLY B 1 158 ? 20.019  -50.509 -58.864 1.00 59.20 ? 222 GLY B O   1 
ATOM   3697 N  N   . GLU B 1 159 ? 18.881  -52.430 -58.933 1.00 58.92 ? 223 GLU B N   1 
ATOM   3698 C  CA  . GLU B 1 159 ? 18.731  -52.400 -60.376 1.00 58.98 ? 223 GLU B CA  1 
ATOM   3699 C  C   . GLU B 1 159 ? 17.723  -51.327 -60.777 1.00 58.34 ? 223 GLU B C   1 
ATOM   3700 O  O   . GLU B 1 159 ? 17.847  -50.705 -61.835 1.00 58.50 ? 223 GLU B O   1 
ATOM   3701 C  CB  . GLU B 1 159 ? 18.267  -53.762 -60.891 1.00 59.30 ? 223 GLU B CB  1 
ATOM   3702 C  CG  . GLU B 1 159 ? 19.289  -54.876 -60.722 1.00 60.56 ? 223 GLU B CG  1 
ATOM   3703 C  CD  . GLU B 1 159 ? 18.744  -56.216 -61.162 1.00 62.99 ? 223 GLU B CD  1 
ATOM   3704 O  OE1 . GLU B 1 159 ? 17.813  -56.733 -60.499 1.00 64.84 ? 223 GLU B OE1 1 
ATOM   3705 O  OE2 . GLU B 1 159 ? 19.248  -56.751 -62.171 1.00 63.39 ? 223 GLU B OE2 1 
ATOM   3706 N  N   . ARG B 1 160 ? 16.729  -51.104 -59.927 1.00 57.20 ? 224 ARG B N   1 
ATOM   3707 C  CA  . ARG B 1 160 ? 15.648  -50.200 -60.289 1.00 55.93 ? 224 ARG B CA  1 
ATOM   3708 C  C   . ARG B 1 160 ? 16.006  -48.738 -60.054 1.00 55.40 ? 224 ARG B C   1 
ATOM   3709 O  O   . ARG B 1 160 ? 15.592  -47.884 -60.839 1.00 54.93 ? 224 ARG B O   1 
ATOM   3710 C  CB  . ARG B 1 160 ? 14.327  -50.621 -59.648 1.00 55.46 ? 224 ARG B CB  1 
ATOM   3711 C  CG  . ARG B 1 160 ? 13.685  -51.853 -60.365 1.00 55.36 ? 224 ARG B CG  1 
ATOM   3712 C  CD  . ARG B 1 160 ? 12.802  -52.739 -59.453 1.00 53.83 ? 224 ARG B CD  1 
ATOM   3713 N  NE  . ARG B 1 160 ? 11.994  -51.906 -58.578 1.00 55.39 ? 224 ARG B NE  1 
ATOM   3714 C  CZ  . ARG B 1 160 ? 12.072  -51.876 -57.253 1.00 54.64 ? 224 ARG B CZ  1 
ATOM   3715 N  NH1 . ARG B 1 160 ? 12.882  -52.683 -56.593 1.00 55.17 ? 224 ARG B NH1 1 
ATOM   3716 N  NH2 . ARG B 1 160 ? 11.305  -51.032 -56.591 1.00 55.60 ? 224 ARG B NH2 1 
ATOM   3717 N  N   . VAL B 1 161 ? 16.797  -48.439 -59.019 1.00 54.57 ? 225 VAL B N   1 
ATOM   3718 C  CA  . VAL B 1 161 ? 17.308  -47.072 -58.902 1.00 54.01 ? 225 VAL B CA  1 
ATOM   3719 C  C   . VAL B 1 161 ? 18.187  -46.758 -60.089 1.00 53.62 ? 225 VAL B C   1 
ATOM   3720 O  O   . VAL B 1 161 ? 18.216  -45.613 -60.525 1.00 54.13 ? 225 VAL B O   1 
ATOM   3721 C  CB  . VAL B 1 161 ? 18.130  -46.723 -57.619 1.00 54.34 ? 225 VAL B CB  1 
ATOM   3722 C  CG1 . VAL B 1 161 ? 17.285  -45.950 -56.625 1.00 54.33 ? 225 VAL B CG1 1 
ATOM   3723 C  CG2 . VAL B 1 161 ? 18.866  -47.926 -57.003 1.00 54.14 ? 225 VAL B CG2 1 
ATOM   3724 N  N   . VAL B 1 162 ? 18.915  -47.757 -60.593 1.00 52.57 ? 226 VAL B N   1 
ATOM   3725 C  CA  . VAL B 1 162 ? 19.763  -47.539 -61.763 1.00 51.63 ? 226 VAL B CA  1 
ATOM   3726 C  C   . VAL B 1 162 ? 18.898  -47.144 -62.961 1.00 50.87 ? 226 VAL B C   1 
ATOM   3727 O  O   . VAL B 1 162 ? 19.156  -46.138 -63.607 1.00 50.54 ? 226 VAL B O   1 
ATOM   3728 C  CB  . VAL B 1 162 ? 20.713  -48.745 -62.078 1.00 51.67 ? 226 VAL B CB  1 
ATOM   3729 C  CG1 . VAL B 1 162 ? 21.419  -48.552 -63.407 1.00 51.02 ? 226 VAL B CG1 1 
ATOM   3730 C  CG2 . VAL B 1 162 ? 21.763  -48.878 -61.009 1.00 51.17 ? 226 VAL B CG2 1 
ATOM   3731 N  N   . ALA B 1 163 ? 17.856  -47.921 -63.220 1.00 50.42 ? 227 ALA B N   1 
ATOM   3732 C  CA  . ALA B 1 163 ? 16.971  -47.669 -64.348 1.00 50.19 ? 227 ALA B CA  1 
ATOM   3733 C  C   . ALA B 1 163 ? 16.374  -46.252 -64.316 1.00 50.26 ? 227 ALA B C   1 
ATOM   3734 O  O   . ALA B 1 163 ? 16.246  -45.598 -65.367 1.00 50.73 ? 227 ALA B O   1 
ATOM   3735 C  CB  . ALA B 1 163 ? 15.876  -48.712 -64.404 1.00 49.82 ? 227 ALA B CB  1 
ATOM   3736 N  N   . PHE B 1 164 ? 16.034  -45.762 -63.125 1.00 49.37 ? 228 PHE B N   1 
ATOM   3737 C  CA  . PHE B 1 164 ? 15.427  -44.440 -63.039 1.00 48.53 ? 228 PHE B CA  1 
ATOM   3738 C  C   . PHE B 1 164 ? 16.418  -43.308 -63.026 1.00 48.45 ? 228 PHE B C   1 
ATOM   3739 O  O   . PHE B 1 164 ? 16.055  -42.162 -63.321 1.00 48.75 ? 228 PHE B O   1 
ATOM   3740 C  CB  . PHE B 1 164 ? 14.370  -44.349 -61.941 1.00 47.89 ? 228 PHE B CB  1 
ATOM   3741 C  CG  . PHE B 1 164 ? 13.060  -44.905 -62.375 1.00 47.12 ? 228 PHE B CG  1 
ATOM   3742 C  CD1 . PHE B 1 164 ? 12.770  -46.252 -62.198 1.00 47.64 ? 228 PHE B CD1 1 
ATOM   3743 C  CD2 . PHE B 1 164 ? 12.142  -44.107 -63.045 1.00 47.11 ? 228 PHE B CD2 1 
ATOM   3744 C  CE1 . PHE B 1 164 ? 11.551  -46.798 -62.637 1.00 46.49 ? 228 PHE B CE1 1 
ATOM   3745 C  CE2 . PHE B 1 164 ? 10.931  -44.631 -63.484 1.00 47.28 ? 228 PHE B CE2 1 
ATOM   3746 C  CZ  . PHE B 1 164 ? 10.636  -45.991 -63.275 1.00 46.37 ? 228 PHE B CZ  1 
ATOM   3747 N  N   . ALA B 1 165 ? 17.669  -43.637 -62.721 1.00 48.03 ? 229 ALA B N   1 
ATOM   3748 C  CA  . ALA B 1 165 ? 18.768  -42.715 -62.963 1.00 48.10 ? 229 ALA B CA  1 
ATOM   3749 C  C   . ALA B 1 165 ? 18.978  -42.654 -64.488 1.00 48.20 ? 229 ALA B C   1 
ATOM   3750 O  O   . ALA B 1 165 ? 19.148  -41.572 -65.058 1.00 48.33 ? 229 ALA B O   1 
ATOM   3751 C  CB  . ALA B 1 165 ? 20.029  -43.160 -62.242 1.00 47.71 ? 229 ALA B CB  1 
ATOM   3752 N  N   . ALA B 1 166 ? 18.928  -43.809 -65.147 1.00 47.49 ? 230 ALA B N   1 
ATOM   3753 C  CA  . ALA B 1 166 ? 18.929  -43.822 -66.597 1.00 47.51 ? 230 ALA B CA  1 
ATOM   3754 C  C   . ALA B 1 166 ? 17.750  -43.006 -67.160 1.00 47.56 ? 230 ALA B C   1 
ATOM   3755 O  O   . ALA B 1 166 ? 17.927  -42.254 -68.111 1.00 47.51 ? 230 ALA B O   1 
ATOM   3756 C  CB  . ALA B 1 166 ? 18.916  -45.238 -67.127 1.00 47.41 ? 230 ALA B CB  1 
ATOM   3757 N  N   . VAL B 1 167 ? 16.560  -43.121 -66.570 1.00 47.38 ? 231 VAL B N   1 
ATOM   3758 C  CA  . VAL B 1 167 ? 15.441  -42.324 -67.073 1.00 47.21 ? 231 VAL B CA  1 
ATOM   3759 C  C   . VAL B 1 167 ? 15.711  -40.835 -66.892 1.00 47.43 ? 231 VAL B C   1 
ATOM   3760 O  O   . VAL B 1 167 ? 15.793  -40.108 -67.870 1.00 47.85 ? 231 VAL B O   1 
ATOM   3761 C  CB  . VAL B 1 167 ? 14.092  -42.718 -66.467 1.00 47.16 ? 231 VAL B CB  1 
ATOM   3762 C  CG1 . VAL B 1 167 ? 13.018  -41.716 -66.857 1.00 46.39 ? 231 VAL B CG1 1 
ATOM   3763 C  CG2 . VAL B 1 167 ? 13.704  -44.103 -66.933 1.00 46.82 ? 231 VAL B CG2 1 
ATOM   3764 N  N   . GLU B 1 168 ? 15.889  -40.392 -65.656 1.00 47.47 ? 232 GLU B N   1 
ATOM   3765 C  CA  . GLU B 1 168 ? 16.073  -38.967 -65.384 1.00 47.77 ? 232 GLU B CA  1 
ATOM   3766 C  C   . GLU B 1 168 ? 17.409  -38.413 -65.862 1.00 47.96 ? 232 GLU B C   1 
ATOM   3767 O  O   . GLU B 1 168 ? 17.547  -37.212 -66.025 1.00 48.36 ? 232 GLU B O   1 
ATOM   3768 C  CB  . GLU B 1 168 ? 15.896  -38.682 -63.888 1.00 47.84 ? 232 GLU B CB  1 
ATOM   3769 C  CG  . GLU B 1 168 ? 14.484  -38.931 -63.400 1.00 48.42 ? 232 GLU B CG  1 
ATOM   3770 C  CD  . GLU B 1 168 ? 14.345  -38.838 -61.909 1.00 49.95 ? 232 GLU B CD  1 
ATOM   3771 O  OE1 . GLU B 1 168 ? 13.896  -37.780 -61.418 1.00 49.96 ? 232 GLU B OE1 1 
ATOM   3772 O  OE2 . GLU B 1 168 ? 14.684  -39.831 -61.227 1.00 52.65 ? 232 GLU B OE2 1 
ATOM   3773 N  N   . GLY B 1 169 ? 18.394  -39.282 -66.062 1.00 48.29 ? 233 GLY B N   1 
ATOM   3774 C  CA  . GLY B 1 169 ? 19.726  -38.867 -66.497 1.00 48.59 ? 233 GLY B CA  1 
ATOM   3775 C  C   . GLY B 1 169 ? 19.988  -39.018 -67.990 1.00 49.13 ? 233 GLY B C   1 
ATOM   3776 O  O   . GLY B 1 169 ? 20.514  -38.106 -68.617 1.00 50.10 ? 233 GLY B O   1 
ATOM   3777 N  N   . ILE B 1 170 ? 19.619  -40.153 -68.569 1.00 48.73 ? 234 ILE B N   1 
ATOM   3778 C  CA  . ILE B 1 170 ? 19.953  -40.440 -69.956 1.00 48.63 ? 234 ILE B CA  1 
ATOM   3779 C  C   . ILE B 1 170 ? 18.771  -40.114 -70.889 1.00 48.81 ? 234 ILE B C   1 
ATOM   3780 O  O   . ILE B 1 170 ? 18.914  -39.377 -71.856 1.00 49.07 ? 234 ILE B O   1 
ATOM   3781 C  CB  . ILE B 1 170 ? 20.470  -41.909 -70.096 1.00 48.50 ? 234 ILE B CB  1 
ATOM   3782 C  CG1 . ILE B 1 170 ? 21.873  -42.030 -69.483 1.00 48.65 ? 234 ILE B CG1 1 
ATOM   3783 C  CG2 . ILE B 1 170 ? 20.482  -42.356 -71.530 1.00 48.19 ? 234 ILE B CG2 1 
ATOM   3784 C  CD1 . ILE B 1 170 ? 22.335  -43.462 -69.137 1.00 48.01 ? 234 ILE B CD1 1 
ATOM   3785 N  N   . PHE B 1 171 ? 17.593  -40.638 -70.582 1.00 48.75 ? 235 PHE B N   1 
ATOM   3786 C  CA  . PHE B 1 171 ? 16.405  -40.333 -71.357 1.00 48.41 ? 235 PHE B CA  1 
ATOM   3787 C  C   . PHE B 1 171 ? 16.114  -38.827 -71.457 1.00 48.61 ? 235 PHE B C   1 
ATOM   3788 O  O   . PHE B 1 171 ? 15.457  -38.397 -72.382 1.00 49.33 ? 235 PHE B O   1 
ATOM   3789 C  CB  . PHE B 1 171 ? 15.197  -41.069 -70.770 1.00 47.82 ? 235 PHE B CB  1 
ATOM   3790 C  CG  . PHE B 1 171 ? 15.111  -42.517 -71.157 1.00 47.55 ? 235 PHE B CG  1 
ATOM   3791 C  CD1 . PHE B 1 171 ? 16.177  -43.162 -71.801 1.00 47.26 ? 235 PHE B CD1 1 
ATOM   3792 C  CD2 . PHE B 1 171 ? 13.963  -43.254 -70.860 1.00 46.88 ? 235 PHE B CD2 1 
ATOM   3793 C  CE1 . PHE B 1 171 ? 16.090  -44.517 -72.173 1.00 46.73 ? 235 PHE B CE1 1 
ATOM   3794 C  CE2 . PHE B 1 171 ? 13.871  -44.604 -71.212 1.00 47.24 ? 235 PHE B CE2 1 
ATOM   3795 C  CZ  . PHE B 1 171 ? 14.939  -45.240 -71.872 1.00 46.95 ? 235 PHE B CZ  1 
ATOM   3796 N  N   . PHE B 1 172 ? 16.578  -38.021 -70.514 1.00 48.63 ? 236 PHE B N   1 
ATOM   3797 C  CA  . PHE B 1 172 ? 16.263  -36.601 -70.571 1.00 48.86 ? 236 PHE B CA  1 
ATOM   3798 C  C   . PHE B 1 172 ? 17.388  -35.787 -71.220 1.00 49.16 ? 236 PHE B C   1 
ATOM   3799 O  O   . PHE B 1 172 ? 17.193  -34.622 -71.586 1.00 49.09 ? 236 PHE B O   1 
ATOM   3800 C  CB  . PHE B 1 172 ? 15.950  -36.033 -69.172 1.00 48.69 ? 236 PHE B CB  1 
ATOM   3801 C  CG  . PHE B 1 172 ? 14.628  -36.483 -68.586 1.00 47.92 ? 236 PHE B CG  1 
ATOM   3802 C  CD1 . PHE B 1 172 ? 13.662  -37.141 -69.365 1.00 48.17 ? 236 PHE B CD1 1 
ATOM   3803 C  CD2 . PHE B 1 172 ? 14.331  -36.212 -67.246 1.00 45.83 ? 236 PHE B CD2 1 
ATOM   3804 C  CE1 . PHE B 1 172 ? 12.434  -37.553 -68.801 1.00 46.87 ? 236 PHE B CE1 1 
ATOM   3805 C  CE2 . PHE B 1 172 ? 13.105  -36.616 -66.678 1.00 45.31 ? 236 PHE B CE2 1 
ATOM   3806 C  CZ  . PHE B 1 172 ? 12.159  -37.283 -67.458 1.00 45.50 ? 236 PHE B CZ  1 
ATOM   3807 N  N   . SER B 1 173 ? 18.555  -36.403 -71.370 1.00 49.38 ? 237 SER B N   1 
ATOM   3808 C  CA  . SER B 1 173 ? 19.774  -35.651 -71.694 1.00 50.06 ? 237 SER B CA  1 
ATOM   3809 C  C   . SER B 1 173 ? 19.785  -35.017 -73.075 1.00 50.22 ? 237 SER B C   1 
ATOM   3810 O  O   . SER B 1 173 ? 20.265  -33.887 -73.233 1.00 50.42 ? 237 SER B O   1 
ATOM   3811 C  CB  . SER B 1 173 ? 21.038  -36.496 -71.489 1.00 49.98 ? 237 SER B CB  1 
ATOM   3812 O  OG  . SER B 1 173 ? 20.899  -37.766 -72.084 1.00 50.42 ? 237 SER B OG  1 
ATOM   3813 N  N   . GLY B 1 174 ? 19.283  -35.753 -74.066 1.00 50.21 ? 238 GLY B N   1 
ATOM   3814 C  CA  . GLY B 1 174 ? 19.151  -35.226 -75.412 1.00 49.91 ? 238 GLY B CA  1 
ATOM   3815 C  C   . GLY B 1 174 ? 18.224  -34.025 -75.432 1.00 50.00 ? 238 GLY B C   1 
ATOM   3816 O  O   . GLY B 1 174 ? 18.539  -32.978 -76.015 1.00 50.07 ? 238 GLY B O   1 
ATOM   3817 N  N   . SER B 1 175 ? 17.079  -34.160 -74.783 1.00 49.76 ? 239 SER B N   1 
ATOM   3818 C  CA  . SER B 1 175 ? 16.105  -33.090 -74.843 1.00 49.62 ? 239 SER B CA  1 
ATOM   3819 C  C   . SER B 1 175 ? 16.619  -31.867 -74.086 1.00 49.97 ? 239 SER B C   1 
ATOM   3820 O  O   . SER B 1 175 ? 16.464  -30.737 -74.563 1.00 50.02 ? 239 SER B O   1 
ATOM   3821 C  CB  . SER B 1 175 ? 14.749  -33.561 -74.334 1.00 49.37 ? 239 SER B CB  1 
ATOM   3822 O  OG  . SER B 1 175 ? 14.399  -34.780 -74.952 1.00 48.05 ? 239 SER B OG  1 
ATOM   3823 N  N   . PHE B 1 176 ? 17.256  -32.087 -72.931 1.00 49.97 ? 240 PHE B N   1 
ATOM   3824 C  CA  . PHE B 1 176 ? 17.913  -30.986 -72.209 1.00 50.09 ? 240 PHE B CA  1 
ATOM   3825 C  C   . PHE B 1 176 ? 18.919  -30.250 -73.088 1.00 50.16 ? 240 PHE B C   1 
ATOM   3826 O  O   . PHE B 1 176 ? 18.840  -29.034 -73.250 1.00 49.87 ? 240 PHE B O   1 
ATOM   3827 C  CB  . PHE B 1 176 ? 18.598  -31.465 -70.932 1.00 49.78 ? 240 PHE B CB  1 
ATOM   3828 C  CG  . PHE B 1 176 ? 17.646  -31.772 -69.819 1.00 49.67 ? 240 PHE B CG  1 
ATOM   3829 C  CD1 . PHE B 1 176 ? 16.466  -31.040 -69.676 1.00 49.25 ? 240 PHE B CD1 1 
ATOM   3830 C  CD2 . PHE B 1 176 ? 17.932  -32.783 -68.900 1.00 48.34 ? 240 PHE B CD2 1 
ATOM   3831 C  CE1 . PHE B 1 176 ? 15.581  -31.318 -68.641 1.00 49.05 ? 240 PHE B CE1 1 
ATOM   3832 C  CE2 . PHE B 1 176 ? 17.060  -33.066 -67.865 1.00 47.25 ? 240 PHE B CE2 1 
ATOM   3833 C  CZ  . PHE B 1 176 ? 15.882  -32.334 -67.732 1.00 49.06 ? 240 PHE B CZ  1 
ATOM   3834 N  N   . ALA B 1 177 ? 19.853  -30.997 -73.658 1.00 50.55 ? 241 ALA B N   1 
ATOM   3835 C  CA  . ALA B 1 177 ? 20.790  -30.440 -74.618 1.00 51.49 ? 241 ALA B CA  1 
ATOM   3836 C  C   . ALA B 1 177 ? 20.055  -29.583 -75.665 1.00 52.08 ? 241 ALA B C   1 
ATOM   3837 O  O   . ALA B 1 177 ? 20.429  -28.425 -75.897 1.00 51.86 ? 241 ALA B O   1 
ATOM   3838 C  CB  . ALA B 1 177 ? 21.581  -31.550 -75.280 1.00 51.44 ? 241 ALA B CB  1 
ATOM   3839 N  N   . SER B 1 178 ? 18.992  -30.142 -76.250 1.00 52.35 ? 242 SER B N   1 
ATOM   3840 C  CA  . SER B 1 178 ? 18.197  -29.448 -77.263 1.00 53.38 ? 242 SER B CA  1 
ATOM   3841 C  C   . SER B 1 178 ? 17.782  -28.042 -76.869 1.00 53.70 ? 242 SER B C   1 
ATOM   3842 O  O   . SER B 1 178 ? 17.909  -27.113 -77.660 1.00 53.43 ? 242 SER B O   1 
ATOM   3843 C  CB  . SER B 1 178 ? 16.934  -30.236 -77.585 1.00 53.46 ? 242 SER B CB  1 
ATOM   3844 O  OG  . SER B 1 178 ? 17.262  -31.548 -77.970 1.00 55.56 ? 242 SER B OG  1 
ATOM   3845 N  N   . ILE B 1 179 ? 17.252  -27.901 -75.657 1.00 54.49 ? 243 ILE B N   1 
ATOM   3846 C  CA  . ILE B 1 179 ? 16.732  -26.625 -75.200 1.00 55.26 ? 243 ILE B CA  1 
ATOM   3847 C  C   . ILE B 1 179 ? 17.891  -25.678 -74.906 1.00 56.07 ? 243 ILE B C   1 
ATOM   3848 O  O   . ILE B 1 179 ? 17.770  -24.464 -75.082 1.00 56.28 ? 243 ILE B O   1 
ATOM   3849 C  CB  . ILE B 1 179 ? 15.848  -26.766 -73.946 1.00 55.16 ? 243 ILE B CB  1 
ATOM   3850 C  CG1 . ILE B 1 179 ? 14.934  -28.000 -74.036 1.00 55.01 ? 243 ILE B CG1 1 
ATOM   3851 C  CG2 . ILE B 1 179 ? 15.064  -25.466 -73.672 1.00 55.01 ? 243 ILE B CG2 1 
ATOM   3852 C  CD1 . ILE B 1 179 ? 13.782  -27.864 -74.953 1.00 54.14 ? 243 ILE B CD1 1 
ATOM   3853 N  N   . PHE B 1 180 ? 19.013  -26.228 -74.463 1.00 57.01 ? 244 PHE B N   1 
ATOM   3854 C  CA  . PHE B 1 180 ? 20.183  -25.409 -74.224 1.00 58.20 ? 244 PHE B CA  1 
ATOM   3855 C  C   . PHE B 1 180 ? 20.721  -24.895 -75.560 1.00 59.58 ? 244 PHE B C   1 
ATOM   3856 O  O   . PHE B 1 180 ? 21.213  -23.764 -75.644 1.00 59.92 ? 244 PHE B O   1 
ATOM   3857 C  CB  . PHE B 1 180 ? 21.243  -26.174 -73.420 1.00 57.97 ? 244 PHE B CB  1 
ATOM   3858 C  CG  . PHE B 1 180 ? 21.074  -26.065 -71.919 1.00 56.57 ? 244 PHE B CG  1 
ATOM   3859 C  CD1 . PHE B 1 180 ? 21.348  -24.864 -71.255 1.00 55.29 ? 244 PHE B CD1 1 
ATOM   3860 C  CD2 . PHE B 1 180 ? 20.657  -27.165 -71.167 1.00 56.41 ? 244 PHE B CD2 1 
ATOM   3861 C  CE1 . PHE B 1 180 ? 21.203  -24.751 -69.864 1.00 54.87 ? 244 PHE B CE1 1 
ATOM   3862 C  CE2 . PHE B 1 180 ? 20.503  -27.071 -69.765 1.00 56.31 ? 244 PHE B CE2 1 
ATOM   3863 C  CZ  . PHE B 1 180 ? 20.777  -25.853 -69.114 1.00 55.39 ? 244 PHE B CZ  1 
ATOM   3864 N  N   . TRP B 1 181 ? 20.582  -25.712 -76.608 1.00 61.25 ? 245 TRP B N   1 
ATOM   3865 C  CA  . TRP B 1 181 ? 20.921  -25.306 -77.977 1.00 62.49 ? 245 TRP B CA  1 
ATOM   3866 C  C   . TRP B 1 181 ? 20.090  -24.099 -78.379 1.00 62.74 ? 245 TRP B C   1 
ATOM   3867 O  O   . TRP B 1 181 ? 20.631  -23.122 -78.889 1.00 63.18 ? 245 TRP B O   1 
ATOM   3868 C  CB  . TRP B 1 181 ? 20.727  -26.465 -78.966 1.00 62.90 ? 245 TRP B CB  1 
ATOM   3869 C  CG  . TRP B 1 181 ? 21.098  -26.136 -80.399 1.00 65.26 ? 245 TRP B CG  1 
ATOM   3870 C  CD1 . TRP B 1 181 ? 20.239  -25.859 -81.429 1.00 66.36 ? 245 TRP B CD1 1 
ATOM   3871 C  CD2 . TRP B 1 181 ? 22.422  -26.048 -80.949 1.00 67.21 ? 245 TRP B CD2 1 
ATOM   3872 N  NE1 . TRP B 1 181 ? 20.944  -25.608 -82.583 1.00 66.90 ? 245 TRP B NE1 1 
ATOM   3873 C  CE2 . TRP B 1 181 ? 22.284  -25.715 -82.318 1.00 67.88 ? 245 TRP B CE2 1 
ATOM   3874 C  CE3 . TRP B 1 181 ? 23.711  -26.220 -80.419 1.00 68.62 ? 245 TRP B CE3 1 
ATOM   3875 C  CZ2 . TRP B 1 181 ? 23.391  -25.551 -83.170 1.00 69.54 ? 245 TRP B CZ2 1 
ATOM   3876 C  CZ3 . TRP B 1 181 ? 24.823  -26.057 -81.270 1.00 70.15 ? 245 TRP B CZ3 1 
ATOM   3877 C  CH2 . TRP B 1 181 ? 24.648  -25.726 -82.630 1.00 70.54 ? 245 TRP B CH2 1 
ATOM   3878 N  N   . LEU B 1 182 ? 18.788  -24.155 -78.114 1.00 63.18 ? 246 LEU B N   1 
ATOM   3879 C  CA  . LEU B 1 182 ? 17.891  -23.027 -78.376 1.00 63.99 ? 246 LEU B CA  1 
ATOM   3880 C  C   . LEU B 1 182 ? 18.276  -21.759 -77.623 1.00 64.75 ? 246 LEU B C   1 
ATOM   3881 O  O   . LEU B 1 182 ? 18.058  -20.657 -78.128 1.00 65.17 ? 246 LEU B O   1 
ATOM   3882 C  CB  . LEU B 1 182 ? 16.447  -23.373 -78.012 1.00 63.87 ? 246 LEU B CB  1 
ATOM   3883 C  CG  . LEU B 1 182 ? 15.725  -24.506 -78.731 1.00 63.92 ? 246 LEU B CG  1 
ATOM   3884 C  CD1 . LEU B 1 182 ? 14.378  -24.702 -78.077 1.00 63.93 ? 246 LEU B CD1 1 
ATOM   3885 C  CD2 . LEU B 1 182 ? 15.565  -24.208 -80.213 1.00 63.97 ? 246 LEU B CD2 1 
ATOM   3886 N  N   . LYS B 1 183 ? 18.803  -21.914 -76.406 1.00 65.46 ? 247 LYS B N   1 
ATOM   3887 C  CA  . LYS B 1 183 ? 19.287  -20.778 -75.629 1.00 66.24 ? 247 LYS B CA  1 
ATOM   3888 C  C   . LYS B 1 183 ? 20.459  -20.167 -76.373 1.00 66.73 ? 247 LYS B C   1 
ATOM   3889 O  O   . LYS B 1 183 ? 20.542  -18.943 -76.511 1.00 66.66 ? 247 LYS B O   1 
ATOM   3890 C  CB  . LYS B 1 183 ? 19.696  -21.180 -74.202 1.00 66.33 ? 247 LYS B CB  1 
ATOM   3891 C  CG  . LYS B 1 183 ? 20.243  -20.021 -73.363 1.00 66.82 ? 247 LYS B CG  1 
ATOM   3892 C  CD  . LYS B 1 183 ? 20.683  -20.448 -71.965 1.00 69.05 ? 247 LYS B CD  1 
ATOM   3893 C  CE  . LYS B 1 183 ? 21.635  -19.404 -71.369 1.00 70.09 ? 247 LYS B CE  1 
ATOM   3894 N  NZ  . LYS B 1 183 ? 21.615  -19.337 -69.874 1.00 70.11 ? 247 LYS B NZ  1 
ATOM   3895 N  N   . LYS B 1 184 ? 21.344  -21.029 -76.877 1.00 67.25 ? 248 LYS B N   1 
ATOM   3896 C  CA  . LYS B 1 184 ? 22.486  -20.572 -77.660 1.00 67.86 ? 248 LYS B CA  1 
ATOM   3897 C  C   . LYS B 1 184 ? 22.022  -19.636 -78.788 1.00 67.82 ? 248 LYS B C   1 
ATOM   3898 O  O   . LYS B 1 184 ? 22.693  -18.651 -79.097 1.00 67.97 ? 248 LYS B O   1 
ATOM   3899 C  CB  . LYS B 1 184 ? 23.306  -21.760 -78.190 1.00 67.97 ? 248 LYS B CB  1 
ATOM   3900 C  CG  . LYS B 1 184 ? 24.675  -21.377 -78.758 1.00 68.95 ? 248 LYS B CG  1 
ATOM   3901 C  CD  . LYS B 1 184 ? 25.703  -22.500 -78.606 1.00 70.63 ? 248 LYS B CD  1 
ATOM   3902 C  CE  . LYS B 1 184 ? 26.838  -22.380 -79.637 1.00 72.69 ? 248 LYS B CE  1 
ATOM   3903 N  NZ  . LYS B 1 184 ? 27.851  -21.312 -79.329 1.00 72.94 ? 248 LYS B NZ  1 
ATOM   3904 N  N   . ARG B 1 185 ? 20.855  -19.921 -79.362 1.00 67.71 ? 249 ARG B N   1 
ATOM   3905 C  CA  . ARG B 1 185 ? 20.322  -19.103 -80.463 1.00 67.78 ? 249 ARG B CA  1 
ATOM   3906 C  C   . ARG B 1 185 ? 19.394  -17.955 -80.014 1.00 67.55 ? 249 ARG B C   1 
ATOM   3907 O  O   . ARG B 1 185 ? 18.689  -17.365 -80.843 1.00 67.61 ? 249 ARG B O   1 
ATOM   3908 C  CB  . ARG B 1 185 ? 19.606  -19.990 -81.486 1.00 67.91 ? 249 ARG B CB  1 
ATOM   3909 C  CG  . ARG B 1 185 ? 20.432  -21.173 -82.022 1.00 68.36 ? 249 ARG B CG  1 
ATOM   3910 C  CD  . ARG B 1 185 ? 19.534  -22.188 -82.720 1.00 69.71 ? 249 ARG B CD  1 
ATOM   3911 N  NE  . ARG B 1 185 ? 18.544  -21.520 -83.568 1.00 71.32 ? 249 ARG B NE  1 
ATOM   3912 C  CZ  . ARG B 1 185 ? 17.569  -22.125 -84.238 1.00 71.27 ? 249 ARG B CZ  1 
ATOM   3913 N  NH1 . ARG B 1 185 ? 17.420  -23.447 -84.179 1.00 71.63 ? 249 ARG B NH1 1 
ATOM   3914 N  NH2 . ARG B 1 185 ? 16.736  -21.396 -84.971 1.00 70.06 ? 249 ARG B NH2 1 
ATOM   3915 N  N   . GLY B 1 186 ? 19.390  -17.657 -78.709 1.00 66.96 ? 250 GLY B N   1 
ATOM   3916 C  CA  . GLY B 1 186 ? 18.631  -16.529 -78.148 1.00 66.15 ? 250 GLY B CA  1 
ATOM   3917 C  C   . GLY B 1 186 ? 17.122  -16.637 -78.266 1.00 65.71 ? 250 GLY B C   1 
ATOM   3918 O  O   . GLY B 1 186 ? 16.413  -15.620 -78.340 1.00 65.67 ? 250 GLY B O   1 
ATOM   3919 N  N   . LEU B 1 187 ? 16.625  -17.872 -78.263 1.00 65.17 ? 251 LEU B N   1 
ATOM   3920 C  CA  . LEU B 1 187 ? 15.206  -18.132 -78.497 1.00 64.46 ? 251 LEU B CA  1 
ATOM   3921 C  C   . LEU B 1 187 ? 14.481  -18.610 -77.245 1.00 63.45 ? 251 LEU B C   1 
ATOM   3922 O  O   . LEU B 1 187 ? 14.961  -19.506 -76.551 1.00 63.88 ? 251 LEU B O   1 
ATOM   3923 C  CB  . LEU B 1 187 ? 15.040  -19.147 -79.629 1.00 64.93 ? 251 LEU B CB  1 
ATOM   3924 C  CG  . LEU B 1 187 ? 15.601  -18.741 -81.006 1.00 66.41 ? 251 LEU B CG  1 
ATOM   3925 C  CD1 . LEU B 1 187 ? 15.932  -19.966 -81.859 1.00 67.44 ? 251 LEU B CD1 1 
ATOM   3926 C  CD2 . LEU B 1 187 ? 14.657  -17.790 -81.758 1.00 67.72 ? 251 LEU B CD2 1 
ATOM   3927 N  N   . MET B 1 188 ? 13.338  -17.984 -76.965 1.00 61.88 ? 252 MET B N   1 
ATOM   3928 C  CA  . MET B 1 188 ? 12.412  -18.377 -75.886 1.00 60.42 ? 252 MET B CA  1 
ATOM   3929 C  C   . MET B 1 188 ? 12.961  -18.428 -74.451 1.00 59.20 ? 252 MET B C   1 
ATOM   3930 O  O   . MET B 1 188 ? 13.103  -19.508 -73.870 1.00 58.84 ? 252 MET B O   1 
ATOM   3931 C  CB  . MET B 1 188 ? 11.719  -19.686 -76.239 1.00 60.42 ? 252 MET B CB  1 
ATOM   3932 C  CG  . MET B 1 188 ? 10.373  -19.478 -76.866 1.00 60.63 ? 252 MET B CG  1 
ATOM   3933 S  SD  . MET B 1 188 ? 10.326  -20.328 -78.430 1.00 59.61 ? 252 MET B SD  1 
ATOM   3934 C  CE  . MET B 1 188 ? 11.144  -21.868 -78.012 1.00 61.42 ? 252 MET B CE  1 
ATOM   3935 N  N   . PRO B 1 189 ? 13.233  -17.250 -73.864 1.00 58.14 ? 253 PRO B N   1 
ATOM   3936 C  CA  . PRO B 1 189 ? 13.788  -17.173 -72.513 1.00 57.13 ? 253 PRO B CA  1 
ATOM   3937 C  C   . PRO B 1 189 ? 13.004  -17.994 -71.483 1.00 55.83 ? 253 PRO B C   1 
ATOM   3938 O  O   . PRO B 1 189 ? 13.618  -18.614 -70.611 1.00 55.84 ? 253 PRO B O   1 
ATOM   3939 C  CB  . PRO B 1 189 ? 13.718  -15.671 -72.184 1.00 57.07 ? 253 PRO B CB  1 
ATOM   3940 C  CG  . PRO B 1 189 ? 12.869  -15.069 -73.224 1.00 57.38 ? 253 PRO B CG  1 
ATOM   3941 C  CD  . PRO B 1 189 ? 13.031  -15.909 -74.434 1.00 57.95 ? 253 PRO B CD  1 
ATOM   3942 N  N   . GLY B 1 190 ? 11.676  -18.002 -71.597 1.00 54.38 ? 254 GLY B N   1 
ATOM   3943 C  CA  . GLY B 1 190 ? 10.811  -18.716 -70.664 1.00 52.63 ? 254 GLY B CA  1 
ATOM   3944 C  C   . GLY B 1 190 ? 11.074  -20.204 -70.699 1.00 51.63 ? 254 GLY B C   1 
ATOM   3945 O  O   . GLY B 1 190 ? 11.278  -20.837 -69.664 1.00 51.56 ? 254 GLY B O   1 
ATOM   3946 N  N   . LEU B 1 191 ? 11.090  -20.763 -71.901 1.00 50.70 ? 255 LEU B N   1 
ATOM   3947 C  CA  . LEU B 1 191 ? 11.398  -22.167 -72.067 1.00 49.68 ? 255 LEU B CA  1 
ATOM   3948 C  C   . LEU B 1 191 ? 12.769  -22.488 -71.534 1.00 49.25 ? 255 LEU B C   1 
ATOM   3949 O  O   . LEU B 1 191 ? 12.945  -23.470 -70.819 1.00 49.56 ? 255 LEU B O   1 
ATOM   3950 C  CB  . LEU B 1 191 ? 11.330  -22.572 -73.530 1.00 49.66 ? 255 LEU B CB  1 
ATOM   3951 C  CG  . LEU B 1 191 ? 11.798  -24.005 -73.796 1.00 49.95 ? 255 LEU B CG  1 
ATOM   3952 C  CD1 . LEU B 1 191 ? 10.894  -25.026 -73.117 1.00 49.58 ? 255 LEU B CD1 1 
ATOM   3953 C  CD2 . LEU B 1 191 ? 11.860  -24.255 -75.280 1.00 50.22 ? 255 LEU B CD2 1 
ATOM   3954 N  N   . THR B 1 192 ? 13.744  -21.653 -71.879 1.00 48.92 ? 256 THR B N   1 
ATOM   3955 C  CA  . THR B 1 192 ? 15.131  -21.966 -71.585 1.00 47.99 ? 256 THR B CA  1 
ATOM   3956 C  C   . THR B 1 192 ? 15.477  -21.761 -70.114 1.00 47.58 ? 256 THR B C   1 
ATOM   3957 O  O   . THR B 1 192 ? 16.333  -22.484 -69.572 1.00 48.03 ? 256 THR B O   1 
ATOM   3958 C  CB  . THR B 1 192 ? 16.109  -21.222 -72.500 1.00 48.02 ? 256 THR B CB  1 
ATOM   3959 O  OG1 . THR B 1 192 ? 15.899  -19.816 -72.385 1.00 48.18 ? 256 THR B OG1 1 
ATOM   3960 C  CG2 . THR B 1 192 ? 15.924  -21.660 -73.944 1.00 47.38 ? 256 THR B CG2 1 
ATOM   3961 N  N   . PHE B 1 193 ? 14.813  -20.812 -69.463 1.00 46.28 ? 257 PHE B N   1 
ATOM   3962 C  CA  . PHE B 1 193 ? 15.032  -20.625 -68.034 1.00 45.76 ? 257 PHE B CA  1 
ATOM   3963 C  C   . PHE B 1 193 ? 14.381  -21.756 -67.251 1.00 45.74 ? 257 PHE B C   1 
ATOM   3964 O  O   . PHE B 1 193 ? 14.989  -22.293 -66.315 1.00 45.24 ? 257 PHE B O   1 
ATOM   3965 C  CB  . PHE B 1 193 ? 14.519  -19.268 -67.543 1.00 45.25 ? 257 PHE B CB  1 
ATOM   3966 C  CG  . PHE B 1 193 ? 14.596  -19.093 -66.045 1.00 45.04 ? 257 PHE B CG  1 
ATOM   3967 C  CD1 . PHE B 1 193 ? 15.831  -18.990 -65.397 1.00 45.95 ? 257 PHE B CD1 1 
ATOM   3968 C  CD2 . PHE B 1 193 ? 13.433  -19.013 -65.279 1.00 45.06 ? 257 PHE B CD2 1 
ATOM   3969 C  CE1 . PHE B 1 193 ? 15.903  -18.818 -63.998 1.00 45.61 ? 257 PHE B CE1 1 
ATOM   3970 C  CE2 . PHE B 1 193 ? 13.484  -18.839 -63.887 1.00 43.84 ? 257 PHE B CE2 1 
ATOM   3971 C  CZ  . PHE B 1 193 ? 14.717  -18.750 -63.244 1.00 44.93 ? 257 PHE B CZ  1 
ATOM   3972 N  N   . SER B 1 194 ? 13.147  -22.109 -67.629 1.00 45.54 ? 258 SER B N   1 
ATOM   3973 C  CA  . SER B 1 194 ? 12.461  -23.238 -66.996 1.00 45.64 ? 258 SER B CA  1 
ATOM   3974 C  C   . SER B 1 194 ? 13.295  -24.479 -67.211 1.00 45.22 ? 258 SER B C   1 
ATOM   3975 O  O   . SER B 1 194 ? 13.359  -25.337 -66.342 1.00 45.09 ? 258 SER B O   1 
ATOM   3976 C  CB  . SER B 1 194 ? 11.059  -23.454 -67.550 1.00 45.55 ? 258 SER B CB  1 
ATOM   3977 O  OG  . SER B 1 194 ? 11.138  -23.958 -68.867 1.00 46.77 ? 258 SER B OG  1 
ATOM   3978 N  N   . ASN B 1 195 ? 13.953  -24.554 -68.366 1.00 44.96 ? 259 ASN B N   1 
ATOM   3979 C  CA  . ASN B 1 195 ? 14.810  -25.688 -68.663 1.00 44.48 ? 259 ASN B CA  1 
ATOM   3980 C  C   . ASN B 1 195 ? 16.035  -25.779 -67.754 1.00 44.46 ? 259 ASN B C   1 
ATOM   3981 O  O   . ASN B 1 195 ? 16.534  -26.874 -67.455 1.00 44.19 ? 259 ASN B O   1 
ATOM   3982 C  CB  . ASN B 1 195 ? 15.260  -25.669 -70.104 1.00 44.15 ? 259 ASN B CB  1 
ATOM   3983 C  CG  . ASN B 1 195 ? 15.893  -26.968 -70.500 1.00 44.47 ? 259 ASN B CG  1 
ATOM   3984 O  OD1 . ASN B 1 195 ? 15.217  -28.003 -70.523 1.00 44.26 ? 259 ASN B OD1 1 
ATOM   3985 N  ND2 . ASN B 1 195 ? 17.203  -26.946 -70.782 1.00 43.43 ? 259 ASN B ND2 1 
ATOM   3986 N  N   . GLU B 1 196 ? 16.526  -24.626 -67.323 1.00 44.41 ? 260 GLU B N   1 
ATOM   3987 C  CA  . GLU B 1 196 ? 17.653  -24.606 -66.413 1.00 44.72 ? 260 GLU B CA  1 
ATOM   3988 C  C   . GLU B 1 196 ? 17.244  -25.148 -65.042 1.00 44.37 ? 260 GLU B C   1 
ATOM   3989 O  O   . GLU B 1 196 ? 17.997  -25.926 -64.438 1.00 44.50 ? 260 GLU B O   1 
ATOM   3990 C  CB  . GLU B 1 196 ? 18.207  -23.198 -66.268 1.00 44.99 ? 260 GLU B CB  1 
ATOM   3991 C  CG  . GLU B 1 196 ? 19.007  -22.708 -67.450 1.00 46.65 ? 260 GLU B CG  1 
ATOM   3992 C  CD  . GLU B 1 196 ? 19.022  -21.208 -67.532 1.00 49.50 ? 260 GLU B CD  1 
ATOM   3993 O  OE1 . GLU B 1 196 ? 18.914  -20.532 -66.485 1.00 52.08 ? 260 GLU B OE1 1 
ATOM   3994 O  OE2 . GLU B 1 196 ? 19.126  -20.700 -68.655 1.00 52.92 ? 260 GLU B OE2 1 
ATOM   3995 N  N   . LEU B 1 197 ? 16.055  -24.752 -64.572 1.00 43.29 ? 261 LEU B N   1 
ATOM   3996 C  CA  . LEU B 1 197 ? 15.559  -25.191 -63.272 1.00 42.68 ? 261 LEU B CA  1 
ATOM   3997 C  C   . LEU B 1 197 ? 15.353  -26.667 -63.275 1.00 42.90 ? 261 LEU B C   1 
ATOM   3998 O  O   . LEU B 1 197 ? 15.797  -27.346 -62.365 1.00 43.74 ? 261 LEU B O   1 
ATOM   3999 C  CB  . LEU B 1 197 ? 14.258  -24.501 -62.877 1.00 41.84 ? 261 LEU B CB  1 
ATOM   4000 C  CG  . LEU B 1 197 ? 14.332  -22.978 -62.754 1.00 41.70 ? 261 LEU B CG  1 
ATOM   4001 C  CD1 . LEU B 1 197 ? 13.005  -22.409 -62.280 1.00 40.51 ? 261 LEU B CD1 1 
ATOM   4002 C  CD2 . LEU B 1 197 ? 15.489  -22.527 -61.851 1.00 39.07 ? 261 LEU B CD2 1 
ATOM   4003 N  N   . ILE B 1 198 ? 14.708  -27.175 -64.313 1.00 43.16 ? 262 ILE B N   1 
ATOM   4004 C  CA  . ILE B 1 198 ? 14.298  -28.566 -64.335 1.00 43.14 ? 262 ILE B CA  1 
ATOM   4005 C  C   . ILE B 1 198 ? 15.483  -29.511 -64.503 1.00 44.00 ? 262 ILE B C   1 
ATOM   4006 O  O   . ILE B 1 198 ? 15.544  -30.544 -63.846 1.00 44.47 ? 262 ILE B O   1 
ATOM   4007 C  CB  . ILE B 1 198 ? 13.203  -28.819 -65.382 1.00 42.82 ? 262 ILE B CB  1 
ATOM   4008 C  CG1 . ILE B 1 198 ? 11.973  -27.961 -65.049 1.00 40.98 ? 262 ILE B CG1 1 
ATOM   4009 C  CG2 . ILE B 1 198 ? 12.853  -30.307 -65.425 1.00 42.14 ? 262 ILE B CG2 1 
ATOM   4010 C  CD1 . ILE B 1 198 ? 10.940  -27.900 -66.134 1.00 40.22 ? 262 ILE B CD1 1 
ATOM   4011 N  N   . SER B 1 199 ? 16.441  -29.162 -65.350 1.00 44.76 ? 263 SER B N   1 
ATOM   4012 C  CA  . SER B 1 199 ? 17.586  -30.051 -65.528 1.00 45.63 ? 263 SER B CA  1 
ATOM   4013 C  C   . SER B 1 199 ? 18.444  -30.095 -64.270 1.00 45.87 ? 263 SER B C   1 
ATOM   4014 O  O   . SER B 1 199 ? 18.936  -31.170 -63.890 1.00 46.85 ? 263 SER B O   1 
ATOM   4015 C  CB  . SER B 1 199 ? 18.405  -29.693 -66.758 1.00 45.37 ? 263 SER B CB  1 
ATOM   4016 O  OG  . SER B 1 199 ? 18.822  -28.354 -66.689 1.00 47.58 ? 263 SER B OG  1 
ATOM   4017 N  N   . ARG B 1 200 ? 18.596  -28.951 -63.608 1.00 45.63 ? 264 ARG B N   1 
ATOM   4018 C  CA  . ARG B 1 200 ? 19.246  -28.917 -62.303 1.00 45.87 ? 264 ARG B CA  1 
ATOM   4019 C  C   . ARG B 1 200 ? 18.539  -29.884 -61.338 1.00 45.88 ? 264 ARG B C   1 
ATOM   4020 O  O   . ARG B 1 200 ? 19.206  -30.732 -60.712 1.00 45.43 ? 264 ARG B O   1 
ATOM   4021 C  CB  . ARG B 1 200 ? 19.298  -27.489 -61.731 1.00 46.06 ? 264 ARG B CB  1 
ATOM   4022 C  CG  . ARG B 1 200 ? 19.791  -27.410 -60.274 1.00 47.48 ? 264 ARG B CG  1 
ATOM   4023 C  CD  . ARG B 1 200 ? 19.145  -26.257 -59.503 1.00 50.28 ? 264 ARG B CD  1 
ATOM   4024 N  NE  . ARG B 1 200 ? 17.685  -26.376 -59.508 1.00 52.34 ? 264 ARG B NE  1 
ATOM   4025 C  CZ  . ARG B 1 200 ? 16.826  -25.443 -59.090 1.00 53.23 ? 264 ARG B CZ  1 
ATOM   4026 N  NH1 . ARG B 1 200 ? 17.260  -24.271 -58.602 1.00 51.42 ? 264 ARG B NH1 1 
ATOM   4027 N  NH2 . ARG B 1 200 ? 15.515  -25.698 -59.164 1.00 52.98 ? 264 ARG B NH2 1 
ATOM   4028 N  N   . ASP B 1 201 ? 17.200  -29.772 -61.259 1.00 45.57 ? 265 ASP B N   1 
ATOM   4029 C  CA  . ASP B 1 201 ? 16.373  -30.650 -60.428 1.00 45.55 ? 265 ASP B CA  1 
ATOM   4030 C  C   . ASP B 1 201 ? 16.569  -32.115 -60.785 1.00 45.78 ? 265 ASP B C   1 
ATOM   4031 O  O   . ASP B 1 201 ? 16.614  -32.973 -59.898 1.00 46.20 ? 265 ASP B O   1 
ATOM   4032 C  CB  . ASP B 1 201 ? 14.887  -30.316 -60.542 1.00 45.44 ? 265 ASP B CB  1 
ATOM   4033 C  CG  . ASP B 1 201 ? 14.523  -28.961 -59.958 1.00 45.55 ? 265 ASP B CG  1 
ATOM   4034 O  OD1 . ASP B 1 201 ? 15.380  -28.268 -59.350 1.00 45.24 ? 265 ASP B OD1 1 
ATOM   4035 O  OD2 . ASP B 1 201 ? 13.351  -28.582 -60.126 1.00 44.24 ? 265 ASP B OD2 1 
ATOM   4036 N  N   . GLU B 1 202 ? 16.694  -32.396 -62.076 1.00 45.76 ? 266 GLU B N   1 
ATOM   4037 C  CA  . GLU B 1 202 ? 16.816  -33.765 -62.549 1.00 46.24 ? 266 GLU B CA  1 
ATOM   4038 C  C   . GLU B 1 202 ? 18.190  -34.347 -62.277 1.00 46.17 ? 266 GLU B C   1 
ATOM   4039 O  O   . GLU B 1 202 ? 18.319  -35.525 -61.926 1.00 46.04 ? 266 GLU B O   1 
ATOM   4040 C  CB  . GLU B 1 202 ? 16.483  -33.840 -64.042 1.00 46.83 ? 266 GLU B CB  1 
ATOM   4041 C  CG  . GLU B 1 202 ? 15.010  -33.659 -64.322 1.00 47.00 ? 266 GLU B CG  1 
ATOM   4042 C  CD  . GLU B 1 202 ? 14.157  -34.519 -63.415 1.00 48.44 ? 266 GLU B CD  1 
ATOM   4043 O  OE1 . GLU B 1 202 ? 14.225  -35.762 -63.539 1.00 47.55 ? 266 GLU B OE1 1 
ATOM   4044 O  OE2 . GLU B 1 202 ? 13.421  -33.958 -62.570 1.00 49.73 ? 266 GLU B OE2 1 
ATOM   4045 N  N   . GLY B 1 203 ? 19.212  -33.511 -62.445 1.00 46.08 ? 267 GLY B N   1 
ATOM   4046 C  CA  . GLY B 1 203 ? 20.570  -33.876 -62.084 1.00 45.72 ? 267 GLY B CA  1 
ATOM   4047 C  C   . GLY B 1 203 ? 20.649  -34.188 -60.607 1.00 45.78 ? 267 GLY B C   1 
ATOM   4048 O  O   . GLY B 1 203 ? 21.249  -35.169 -60.216 1.00 46.38 ? 267 GLY B O   1 
ATOM   4049 N  N   . LEU B 1 204 ? 20.031  -33.359 -59.778 1.00 45.98 ? 268 LEU B N   1 
ATOM   4050 C  CA  . LEU B 1 204 ? 19.934  -33.653 -58.355 1.00 46.32 ? 268 LEU B CA  1 
ATOM   4051 C  C   . LEU B 1 204 ? 19.239  -35.007 -58.101 1.00 46.61 ? 268 LEU B C   1 
ATOM   4052 O  O   . LEU B 1 204 ? 19.719  -35.791 -57.279 1.00 46.70 ? 268 LEU B O   1 
ATOM   4053 C  CB  . LEU B 1 204 ? 19.225  -32.514 -57.618 1.00 46.23 ? 268 LEU B CB  1 
ATOM   4054 C  CG  . LEU B 1 204 ? 18.977  -32.719 -56.123 1.00 46.78 ? 268 LEU B CG  1 
ATOM   4055 C  CD1 . LEU B 1 204 ? 20.260  -32.615 -55.311 1.00 46.62 ? 268 LEU B CD1 1 
ATOM   4056 C  CD2 . LEU B 1 204 ? 17.942  -31.726 -55.620 1.00 46.67 ? 268 LEU B CD2 1 
ATOM   4057 N  N   . HIS B 1 205 ? 18.146  -35.300 -58.817 1.00 46.30 ? 269 HIS B N   1 
ATOM   4058 C  CA  . HIS B 1 205 ? 17.488  -36.593 -58.651 1.00 46.48 ? 269 HIS B CA  1 
ATOM   4059 C  C   . HIS B 1 205 ? 18.355  -37.790 -59.035 1.00 47.46 ? 269 HIS B C   1 
ATOM   4060 O  O   . HIS B 1 205 ? 18.227  -38.858 -58.430 1.00 48.55 ? 269 HIS B O   1 
ATOM   4061 C  CB  . HIS B 1 205 ? 16.143  -36.659 -59.366 1.00 46.23 ? 269 HIS B CB  1 
ATOM   4062 C  CG  . HIS B 1 205 ? 15.196  -35.579 -58.961 1.00 44.39 ? 269 HIS B CG  1 
ATOM   4063 N  ND1 . HIS B 1 205 ? 14.220  -35.097 -59.801 1.00 42.67 ? 269 HIS B ND1 1 
ATOM   4064 C  CD2 . HIS B 1 205 ? 15.101  -34.857 -57.821 1.00 44.49 ? 269 HIS B CD2 1 
ATOM   4065 C  CE1 . HIS B 1 205 ? 13.548  -34.137 -59.191 1.00 42.14 ? 269 HIS B CE1 1 
ATOM   4066 N  NE2 . HIS B 1 205 ? 14.066  -33.967 -57.989 1.00 43.88 ? 269 HIS B NE2 1 
ATOM   4067 N  N   . CYS B 1 206 ? 19.225  -37.630 -60.028 1.00 47.87 ? 270 CYS B N   1 
ATOM   4068 C  CA  . CYS B 1 206 ? 20.227  -38.658 -60.332 1.00 48.19 ? 270 CYS B CA  1 
ATOM   4069 C  C   . CYS B 1 206 ? 21.321  -38.726 -59.262 1.00 48.45 ? 270 CYS B C   1 
ATOM   4070 O  O   . CYS B 1 206 ? 21.753  -39.821 -58.860 1.00 48.57 ? 270 CYS B O   1 
ATOM   4071 C  CB  . CYS B 1 206 ? 20.869  -38.404 -61.688 1.00 47.99 ? 270 CYS B CB  1 
ATOM   4072 S  SG  . CYS B 1 206 ? 19.710  -38.505 -63.035 1.00 50.54 ? 270 CYS B SG  1 
ATOM   4073 N  N   . ASP B 1 207 ? 21.793  -37.567 -58.809 1.00 48.00 ? 271 ASP B N   1 
ATOM   4074 C  CA  . ASP B 1 207 ? 22.795  -37.575 -57.760 1.00 48.27 ? 271 ASP B CA  1 
ATOM   4075 C  C   . ASP B 1 207 ? 22.236  -38.426 -56.616 1.00 48.08 ? 271 ASP B C   1 
ATOM   4076 O  O   . ASP B 1 207 ? 22.878  -39.355 -56.121 1.00 48.11 ? 271 ASP B O   1 
ATOM   4077 C  CB  . ASP B 1 207 ? 23.150  -36.146 -57.318 1.00 48.27 ? 271 ASP B CB  1 
ATOM   4078 C  CG  . ASP B 1 207 ? 23.866  -35.350 -58.417 1.00 48.88 ? 271 ASP B CG  1 
ATOM   4079 O  OD1 . ASP B 1 207 ? 24.558  -35.976 -59.255 1.00 50.05 ? 271 ASP B OD1 1 
ATOM   4080 O  OD2 . ASP B 1 207 ? 23.724  -34.104 -58.462 1.00 48.47 ? 271 ASP B OD2 1 
ATOM   4081 N  N   . PHE B 1 208 ? 20.992  -38.147 -56.257 1.00 47.70 ? 272 PHE B N   1 
ATOM   4082 C  CA  . PHE B 1 208 ? 20.382  -38.835 -55.160 1.00 46.91 ? 272 PHE B CA  1 
ATOM   4083 C  C   . PHE B 1 208 ? 20.308  -40.326 -55.401 1.00 47.38 ? 272 PHE B C   1 
ATOM   4084 O  O   . PHE B 1 208 ? 20.571  -41.101 -54.487 1.00 47.97 ? 272 PHE B O   1 
ATOM   4085 C  CB  . PHE B 1 208 ? 19.002  -38.289 -54.869 1.00 45.92 ? 272 PHE B CB  1 
ATOM   4086 C  CG  . PHE B 1 208 ? 18.389  -38.894 -53.670 1.00 43.39 ? 272 PHE B CG  1 
ATOM   4087 C  CD1 . PHE B 1 208 ? 18.708  -38.408 -52.400 1.00 42.17 ? 272 PHE B CD1 1 
ATOM   4088 C  CD2 . PHE B 1 208 ? 17.530  -39.980 -53.792 1.00 41.25 ? 272 PHE B CD2 1 
ATOM   4089 C  CE1 . PHE B 1 208 ? 18.145  -38.977 -51.245 1.00 41.48 ? 272 PHE B CE1 1 
ATOM   4090 C  CE2 . PHE B 1 208 ? 16.963  -40.567 -52.659 1.00 43.64 ? 272 PHE B CE2 1 
ATOM   4091 C  CZ  . PHE B 1 208 ? 17.268  -40.055 -51.364 1.00 41.86 ? 272 PHE B CZ  1 
ATOM   4092 N  N   . ALA B 1 209 ? 19.926  -40.731 -56.608 1.00 47.34 ? 273 ALA B N   1 
ATOM   4093 C  CA  . ALA B 1 209 ? 19.900  -42.140 -56.938 1.00 47.77 ? 273 ALA B CA  1 
ATOM   4094 C  C   . ALA B 1 209 ? 21.289  -42.746 -56.715 1.00 48.52 ? 273 ALA B C   1 
ATOM   4095 O  O   . ALA B 1 209 ? 21.404  -43.832 -56.157 1.00 48.65 ? 273 ALA B O   1 
ATOM   4096 C  CB  . ALA B 1 209 ? 19.477  -42.334 -58.371 1.00 47.73 ? 273 ALA B CB  1 
ATOM   4097 N  N   . CYS B 1 210 ? 22.334  -42.036 -57.152 1.00 48.97 ? 274 CYS B N   1 
ATOM   4098 C  CA  . CYS B 1 210 ? 23.708  -42.513 -57.025 1.00 49.32 ? 274 CYS B CA  1 
ATOM   4099 C  C   . CYS B 1 210 ? 24.062  -42.685 -55.565 1.00 50.13 ? 274 CYS B C   1 
ATOM   4100 O  O   . CYS B 1 210 ? 24.644  -43.708 -55.178 1.00 50.23 ? 274 CYS B O   1 
ATOM   4101 C  CB  . CYS B 1 210 ? 24.695  -41.562 -57.713 1.00 49.23 ? 274 CYS B CB  1 
ATOM   4102 S  SG  . CYS B 1 210 ? 24.609  -41.628 -59.515 1.00 47.12 ? 274 CYS B SG  1 
ATOM   4103 N  N   . LEU B 1 211 ? 23.685  -41.696 -54.757 1.00 50.71 ? 275 LEU B N   1 
ATOM   4104 C  CA  . LEU B 1 211 ? 23.913  -41.754 -53.324 1.00 51.48 ? 275 LEU B CA  1 
ATOM   4105 C  C   . LEU B 1 211 ? 23.186  -42.935 -52.693 1.00 52.01 ? 275 LEU B C   1 
ATOM   4106 O  O   . LEU B 1 211 ? 23.760  -43.640 -51.864 1.00 52.71 ? 275 LEU B O   1 
ATOM   4107 C  CB  . LEU B 1 211 ? 23.501  -40.448 -52.662 1.00 51.60 ? 275 LEU B CB  1 
ATOM   4108 C  CG  . LEU B 1 211 ? 23.776  -40.329 -51.165 1.00 52.31 ? 275 LEU B CG  1 
ATOM   4109 C  CD1 . LEU B 1 211 ? 25.264  -40.489 -50.824 1.00 51.34 ? 275 LEU B CD1 1 
ATOM   4110 C  CD2 . LEU B 1 211 ? 23.242  -38.994 -50.676 1.00 52.58 ? 275 LEU B CD2 1 
ATOM   4111 N  N   . MET B 1 212 ? 21.942  -43.175 -53.101 1.00 52.15 ? 276 MET B N   1 
ATOM   4112 C  CA  . MET B 1 212 ? 21.213  -44.342 -52.628 1.00 52.56 ? 276 MET B CA  1 
ATOM   4113 C  C   . MET B 1 212 ? 21.952  -45.627 -53.000 1.00 53.18 ? 276 MET B C   1 
ATOM   4114 O  O   . MET B 1 212 ? 22.023  -46.556 -52.211 1.00 53.28 ? 276 MET B O   1 
ATOM   4115 C  CB  . MET B 1 212 ? 19.795  -44.375 -53.192 1.00 52.28 ? 276 MET B CB  1 
ATOM   4116 C  CG  . MET B 1 212 ? 18.834  -43.374 -52.610 1.00 52.10 ? 276 MET B CG  1 
ATOM   4117 S  SD  . MET B 1 212 ? 18.552  -43.528 -50.831 1.00 54.44 ? 276 MET B SD  1 
ATOM   4118 C  CE  . MET B 1 212 ? 19.537  -42.184 -50.245 1.00 53.25 ? 276 MET B CE  1 
ATOM   4119 N  N   . PHE B 1 213 ? 22.511  -45.663 -54.205 1.00 54.01 ? 277 PHE B N   1 
ATOM   4120 C  CA  . PHE B 1 213 ? 23.229  -46.827 -54.702 1.00 54.71 ? 277 PHE B CA  1 
ATOM   4121 C  C   . PHE B 1 213 ? 24.433  -47.175 -53.817 1.00 55.83 ? 277 PHE B C   1 
ATOM   4122 O  O   . PHE B 1 213 ? 24.593  -48.323 -53.403 1.00 55.69 ? 277 PHE B O   1 
ATOM   4123 C  CB  . PHE B 1 213 ? 23.662  -46.593 -56.151 1.00 54.36 ? 277 PHE B CB  1 
ATOM   4124 C  CG  . PHE B 1 213 ? 24.060  -47.844 -56.868 1.00 53.52 ? 277 PHE B CG  1 
ATOM   4125 C  CD1 . PHE B 1 213 ? 23.092  -48.703 -57.376 1.00 50.92 ? 277 PHE B CD1 1 
ATOM   4126 C  CD2 . PHE B 1 213 ? 25.413  -48.175 -57.020 1.00 52.92 ? 277 PHE B CD2 1 
ATOM   4127 C  CE1 . PHE B 1 213 ? 23.454  -49.874 -58.021 1.00 51.45 ? 277 PHE B CE1 1 
ATOM   4128 C  CE2 . PHE B 1 213 ? 25.790  -49.343 -57.680 1.00 51.71 ? 277 PHE B CE2 1 
ATOM   4129 C  CZ  . PHE B 1 213 ? 24.807  -50.195 -58.182 1.00 52.32 ? 277 PHE B CZ  1 
ATOM   4130 N  N   . LYS B 1 214 ? 25.256  -46.172 -53.521 1.00 57.06 ? 278 LYS B N   1 
ATOM   4131 C  CA  . LYS B 1 214 ? 26.398  -46.317 -52.629 1.00 58.37 ? 278 LYS B CA  1 
ATOM   4132 C  C   . LYS B 1 214 ? 26.012  -47.009 -51.313 1.00 58.80 ? 278 LYS B C   1 
ATOM   4133 O  O   . LYS B 1 214 ? 26.706  -47.918 -50.870 1.00 59.28 ? 278 LYS B O   1 
ATOM   4134 C  CB  . LYS B 1 214 ? 27.034  -44.942 -52.370 1.00 58.92 ? 278 LYS B CB  1 
ATOM   4135 C  CG  . LYS B 1 214 ? 28.293  -44.940 -51.479 1.00 61.02 ? 278 LYS B CG  1 
ATOM   4136 C  CD  . LYS B 1 214 ? 29.186  -43.694 -51.735 1.00 64.28 ? 278 LYS B CD  1 
ATOM   4137 C  CE  . LYS B 1 214 ? 30.586  -43.831 -51.087 1.00 67.05 ? 278 LYS B CE  1 
ATOM   4138 N  NZ  . LYS B 1 214 ? 31.340  -45.101 -51.460 1.00 66.35 ? 278 LYS B NZ  1 
ATOM   4139 N  N   . HIS B 1 215 ? 24.900  -46.598 -50.702 1.00 59.32 ? 279 HIS B N   1 
ATOM   4140 C  CA  . HIS B 1 215 ? 24.449  -47.193 -49.433 1.00 59.26 ? 279 HIS B CA  1 
ATOM   4141 C  C   . HIS B 1 215 ? 23.870  -48.597 -49.564 1.00 59.72 ? 279 HIS B C   1 
ATOM   4142 O  O   . HIS B 1 215 ? 23.506  -49.208 -48.561 1.00 60.08 ? 279 HIS B O   1 
ATOM   4143 C  CB  . HIS B 1 215 ? 23.428  -46.299 -48.738 1.00 59.08 ? 279 HIS B CB  1 
ATOM   4144 C  CG  . HIS B 1 215 ? 24.009  -45.054 -48.149 1.00 57.87 ? 279 HIS B CG  1 
ATOM   4145 N  ND1 . HIS B 1 215 ? 24.459  -44.989 -46.850 1.00 57.40 ? 279 HIS B ND1 1 
ATOM   4146 C  CD2 . HIS B 1 215 ? 24.195  -43.822 -48.673 1.00 56.85 ? 279 HIS B CD2 1 
ATOM   4147 C  CE1 . HIS B 1 215 ? 24.911  -43.771 -46.605 1.00 58.00 ? 279 HIS B CE1 1 
ATOM   4148 N  NE2 . HIS B 1 215 ? 24.762  -43.044 -47.695 1.00 56.65 ? 279 HIS B NE2 1 
ATOM   4149 N  N   . LEU B 1 216 ? 23.777  -49.123 -50.780 1.00 60.05 ? 280 LEU B N   1 
ATOM   4150 C  CA  . LEU B 1 216 ? 23.347  -50.504 -50.916 1.00 60.72 ? 280 LEU B CA  1 
ATOM   4151 C  C   . LEU B 1 216 ? 24.486  -51.452 -50.564 1.00 61.85 ? 280 LEU B C   1 
ATOM   4152 O  O   . LEU B 1 216 ? 25.640  -51.220 -50.945 1.00 62.07 ? 280 LEU B O   1 
ATOM   4153 C  CB  . LEU B 1 216 ? 22.779  -50.790 -52.304 1.00 60.27 ? 280 LEU B CB  1 
ATOM   4154 C  CG  . LEU B 1 216 ? 21.407  -50.172 -52.618 1.00 59.36 ? 280 LEU B CG  1 
ATOM   4155 C  CD1 . LEU B 1 216 ? 20.965  -50.562 -53.998 1.00 57.06 ? 280 LEU B CD1 1 
ATOM   4156 C  CD2 . LEU B 1 216 ? 20.344  -50.572 -51.599 1.00 57.43 ? 280 LEU B CD2 1 
ATOM   4157 N  N   . VAL B 1 217 ? 24.160  -52.494 -49.801 1.00 63.02 ? 281 VAL B N   1 
ATOM   4158 C  CA  . VAL B 1 217 ? 25.130  -53.521 -49.441 1.00 64.14 ? 281 VAL B CA  1 
ATOM   4159 C  C   . VAL B 1 217 ? 25.245  -54.510 -50.598 1.00 65.20 ? 281 VAL B C   1 
ATOM   4160 O  O   . VAL B 1 217 ? 26.341  -54.741 -51.096 1.00 65.36 ? 281 VAL B O   1 
ATOM   4161 C  CB  . VAL B 1 217 ? 24.789  -54.231 -48.088 1.00 64.25 ? 281 VAL B CB  1 
ATOM   4162 C  CG1 . VAL B 1 217 ? 25.805  -55.342 -47.769 1.00 63.22 ? 281 VAL B CG1 1 
ATOM   4163 C  CG2 . VAL B 1 217 ? 24.747  -53.211 -46.945 1.00 64.17 ? 281 VAL B CG2 1 
ATOM   4164 N  N   . HIS B 1 218 ? 24.123  -55.079 -51.034 1.00 66.29 ? 282 HIS B N   1 
ATOM   4165 C  CA  . HIS B 1 218 ? 24.140  -55.894 -52.243 1.00 67.75 ? 282 HIS B CA  1 
ATOM   4166 C  C   . HIS B 1 218 ? 23.815  -55.064 -53.486 1.00 67.91 ? 282 HIS B C   1 
ATOM   4167 O  O   . HIS B 1 218 ? 22.641  -54.903 -53.844 1.00 68.17 ? 282 HIS B O   1 
ATOM   4168 C  CB  . HIS B 1 218 ? 23.211  -57.119 -52.129 1.00 68.31 ? 282 HIS B CB  1 
ATOM   4169 C  CG  . HIS B 1 218 ? 23.462  -57.950 -50.911 1.00 70.44 ? 282 HIS B CG  1 
ATOM   4170 N  ND1 . HIS B 1 218 ? 24.732  -58.209 -50.435 1.00 72.47 ? 282 HIS B ND1 1 
ATOM   4171 C  CD2 . HIS B 1 218 ? 22.608  -58.574 -50.065 1.00 72.07 ? 282 HIS B CD2 1 
ATOM   4172 C  CE1 . HIS B 1 218 ? 24.648  -58.951 -49.345 1.00 73.23 ? 282 HIS B CE1 1 
ATOM   4173 N  NE2 . HIS B 1 218 ? 23.370  -59.189 -49.101 1.00 73.43 ? 282 HIS B NE2 1 
ATOM   4174 N  N   . LYS B 1 219 ? 24.864  -54.539 -54.125 1.00 67.99 ? 283 LYS B N   1 
ATOM   4175 C  CA  . LYS B 1 219 ? 24.747  -53.825 -55.405 1.00 68.06 ? 283 LYS B CA  1 
ATOM   4176 C  C   . LYS B 1 219 ? 24.660  -54.837 -56.539 1.00 68.30 ? 283 LYS B C   1 
ATOM   4177 O  O   . LYS B 1 219 ? 25.193  -55.929 -56.420 1.00 68.58 ? 283 LYS B O   1 
ATOM   4178 C  CB  . LYS B 1 219 ? 25.970  -52.933 -55.657 1.00 67.80 ? 283 LYS B CB  1 
ATOM   4179 C  CG  . LYS B 1 219 ? 26.226  -51.836 -54.633 1.00 67.24 ? 283 LYS B CG  1 
ATOM   4180 C  CD  . LYS B 1 219 ? 27.515  -51.101 -54.973 1.00 66.56 ? 283 LYS B CD  1 
ATOM   4181 C  CE  . LYS B 1 219 ? 27.737  -49.872 -54.101 1.00 66.27 ? 283 LYS B CE  1 
ATOM   4182 N  NZ  . LYS B 1 219 ? 27.761  -50.192 -52.650 1.00 66.89 ? 283 LYS B NZ  1 
ATOM   4183 N  N   . PRO B 1 220 ? 23.988  -54.485 -57.649 1.00 68.65 ? 284 PRO B N   1 
ATOM   4184 C  CA  . PRO B 1 220 ? 24.140  -55.305 -58.859 1.00 68.82 ? 284 PRO B CA  1 
ATOM   4185 C  C   . PRO B 1 220 ? 25.566  -55.218 -59.431 1.00 69.30 ? 284 PRO B C   1 
ATOM   4186 O  O   . PRO B 1 220 ? 26.300  -54.261 -59.143 1.00 69.31 ? 284 PRO B O   1 
ATOM   4187 C  CB  . PRO B 1 220 ? 23.130  -54.685 -59.827 1.00 68.61 ? 284 PRO B CB  1 
ATOM   4188 C  CG  . PRO B 1 220 ? 22.908  -53.297 -59.300 1.00 68.52 ? 284 PRO B CG  1 
ATOM   4189 C  CD  . PRO B 1 220 ? 22.982  -53.426 -57.825 1.00 68.36 ? 284 PRO B CD  1 
ATOM   4190 N  N   . SER B 1 221 ? 25.950  -56.213 -60.228 1.00 69.81 ? 285 SER B N   1 
ATOM   4191 C  CA  . SER B 1 221 ? 27.296  -56.268 -60.813 1.00 70.13 ? 285 SER B CA  1 
ATOM   4192 C  C   . SER B 1 221 ? 27.533  -55.160 -61.851 1.00 70.15 ? 285 SER B C   1 
ATOM   4193 O  O   . SER B 1 221 ? 26.587  -54.691 -62.486 1.00 70.02 ? 285 SER B O   1 
ATOM   4194 C  CB  . SER B 1 221 ? 27.538  -57.648 -61.443 1.00 70.28 ? 285 SER B CB  1 
ATOM   4195 O  OG  . SER B 1 221 ? 26.786  -57.817 -62.638 1.00 70.36 ? 285 SER B OG  1 
ATOM   4196 N  N   . GLU B 1 222 ? 28.792  -54.751 -62.017 1.00 70.43 ? 286 GLU B N   1 
ATOM   4197 C  CA  . GLU B 1 222 ? 29.157  -53.772 -63.040 1.00 70.93 ? 286 GLU B CA  1 
ATOM   4198 C  C   . GLU B 1 222 ? 28.622  -54.238 -64.386 1.00 71.27 ? 286 GLU B C   1 
ATOM   4199 O  O   . GLU B 1 222 ? 28.100  -53.447 -65.179 1.00 71.14 ? 286 GLU B O   1 
ATOM   4200 C  CB  . GLU B 1 222 ? 30.681  -53.564 -63.103 1.00 71.00 ? 286 GLU B CB  1 
ATOM   4201 C  CG  . GLU B 1 222 ? 31.142  -52.603 -64.224 1.00 71.22 ? 286 GLU B CG  1 
ATOM   4202 C  CD  . GLU B 1 222 ? 32.404  -51.811 -63.888 1.00 72.05 ? 286 GLU B CD  1 
ATOM   4203 O  OE1 . GLU B 1 222 ? 33.089  -52.154 -62.900 1.00 72.15 ? 286 GLU B OE1 1 
ATOM   4204 O  OE2 . GLU B 1 222 ? 32.711  -50.837 -64.621 1.00 72.05 ? 286 GLU B OE2 1 
ATOM   4205 N  N   . GLU B 1 223 ? 28.742  -55.541 -64.619 1.00 71.70 ? 287 GLU B N   1 
ATOM   4206 C  CA  . GLU B 1 223 ? 28.223  -56.168 -65.821 1.00 72.09 ? 287 GLU B CA  1 
ATOM   4207 C  C   . GLU B 1 223 ? 26.757  -55.793 -66.037 1.00 71.47 ? 287 GLU B C   1 
ATOM   4208 O  O   . GLU B 1 223 ? 26.391  -55.299 -67.101 1.00 71.56 ? 287 GLU B O   1 
ATOM   4209 C  CB  . GLU B 1 223 ? 28.403  -57.696 -65.745 1.00 72.60 ? 287 GLU B CB  1 
ATOM   4210 C  CG  . GLU B 1 223 ? 27.766  -58.486 -66.895 1.00 75.12 ? 287 GLU B CG  1 
ATOM   4211 C  CD  . GLU B 1 223 ? 28.126  -57.924 -68.273 1.00 79.41 ? 287 GLU B CD  1 
ATOM   4212 O  OE1 . GLU B 1 223 ? 29.320  -57.582 -68.505 1.00 80.63 ? 287 GLU B OE1 1 
ATOM   4213 O  OE2 . GLU B 1 223 ? 27.204  -57.818 -69.121 1.00 80.64 ? 287 GLU B OE2 1 
ATOM   4214 N  N   . ARG B 1 224 ? 25.938  -56.013 -65.012 1.00 70.82 ? 288 ARG B N   1 
ATOM   4215 C  CA  . ARG B 1 224 ? 24.497  -55.827 -65.105 1.00 69.90 ? 288 ARG B CA  1 
ATOM   4216 C  C   . ARG B 1 224 ? 24.112  -54.359 -65.291 1.00 69.20 ? 288 ARG B C   1 
ATOM   4217 O  O   . ARG B 1 224 ? 23.226  -54.046 -66.080 1.00 68.80 ? 288 ARG B O   1 
ATOM   4218 C  CB  . ARG B 1 224 ? 23.812  -56.445 -63.878 1.00 70.04 ? 288 ARG B CB  1 
ATOM   4219 C  CG  . ARG B 1 224 ? 22.305  -56.218 -63.769 1.00 70.71 ? 288 ARG B CG  1 
ATOM   4220 C  CD  . ARG B 1 224 ? 21.531  -56.739 -64.962 1.00 72.01 ? 288 ARG B CD  1 
ATOM   4221 N  NE  . ARG B 1 224 ? 20.094  -56.587 -64.753 1.00 74.06 ? 288 ARG B NE  1 
ATOM   4222 C  CZ  . ARG B 1 224 ? 19.188  -56.425 -65.720 1.00 75.11 ? 288 ARG B CZ  1 
ATOM   4223 N  NH1 . ARG B 1 224 ? 17.906  -56.306 -65.393 1.00 75.16 ? 288 ARG B NH1 1 
ATOM   4224 N  NH2 . ARG B 1 224 ? 19.551  -56.373 -67.004 1.00 74.34 ? 288 ARG B NH2 1 
ATOM   4225 N  N   . VAL B 1 225 ? 24.789  -53.469 -64.571 1.00 68.57 ? 289 VAL B N   1 
ATOM   4226 C  CA  . VAL B 1 225 ? 24.551  -52.032 -64.692 1.00 68.05 ? 289 VAL B CA  1 
ATOM   4227 C  C   . VAL B 1 225 ? 24.838  -51.565 -66.124 1.00 68.34 ? 289 VAL B C   1 
ATOM   4228 O  O   . VAL B 1 225 ? 23.980  -50.948 -66.774 1.00 68.30 ? 289 VAL B O   1 
ATOM   4229 C  CB  . VAL B 1 225 ? 25.388  -51.245 -63.669 1.00 67.80 ? 289 VAL B CB  1 
ATOM   4230 C  CG1 . VAL B 1 225 ? 25.274  -49.754 -63.894 1.00 66.82 ? 289 VAL B CG1 1 
ATOM   4231 C  CG2 . VAL B 1 225 ? 24.957  -51.599 -62.264 1.00 67.78 ? 289 VAL B CG2 1 
ATOM   4232 N  N   . ARG B 1 226 ? 26.041  -51.878 -66.611 1.00 68.45 ? 290 ARG B N   1 
ATOM   4233 C  CA  . ARG B 1 226 ? 26.421  -51.633 -68.006 1.00 68.33 ? 290 ARG B CA  1 
ATOM   4234 C  C   . ARG B 1 226 ? 25.292  -52.027 -68.961 1.00 67.85 ? 290 ARG B C   1 
ATOM   4235 O  O   . ARG B 1 226 ? 24.854  -51.219 -69.785 1.00 68.07 ? 290 ARG B O   1 
ATOM   4236 C  CB  . ARG B 1 226 ? 27.723  -52.373 -68.356 1.00 68.50 ? 290 ARG B CB  1 
ATOM   4237 C  CG  . ARG B 1 226 ? 29.010  -51.631 -67.957 1.00 69.67 ? 290 ARG B CG  1 
ATOM   4238 C  CD  . ARG B 1 226 ? 30.292  -52.429 -68.300 1.00 72.15 ? 290 ARG B CD  1 
ATOM   4239 N  NE  . ARG B 1 226 ? 30.245  -52.993 -69.649 1.00 73.67 ? 290 ARG B NE  1 
ATOM   4240 C  CZ  . ARG B 1 226 ? 30.957  -52.562 -70.690 1.00 75.18 ? 290 ARG B CZ  1 
ATOM   4241 N  NH1 . ARG B 1 226 ? 31.825  -51.551 -70.556 1.00 74.48 ? 290 ARG B NH1 1 
ATOM   4242 N  NH2 . ARG B 1 226 ? 30.799  -53.158 -71.876 1.00 74.78 ? 290 ARG B NH2 1 
ATOM   4243 N  N   . GLU B 1 227 ? 24.819  -53.263 -68.826 1.00 67.15 ? 291 GLU B N   1 
ATOM   4244 C  CA  . GLU B 1 227 ? 23.693  -53.776 -69.593 1.00 66.94 ? 291 GLU B CA  1 
ATOM   4245 C  C   . GLU B 1 227 ? 22.542  -52.756 -69.684 1.00 65.89 ? 291 GLU B C   1 
ATOM   4246 O  O   . GLU B 1 227 ? 22.100  -52.411 -70.777 1.00 66.09 ? 291 GLU B O   1 
ATOM   4247 C  CB  . GLU B 1 227 ? 23.204  -55.062 -68.939 1.00 67.44 ? 291 GLU B CB  1 
ATOM   4248 C  CG  . GLU B 1 227 ? 22.773  -56.164 -69.881 1.00 70.52 ? 291 GLU B CG  1 
ATOM   4249 C  CD  . GLU B 1 227 ? 22.891  -57.540 -69.216 1.00 74.70 ? 291 GLU B CD  1 
ATOM   4250 O  OE1 . GLU B 1 227 ? 24.043  -58.029 -69.068 1.00 74.81 ? 291 GLU B OE1 1 
ATOM   4251 O  OE2 . GLU B 1 227 ? 21.835  -58.120 -68.841 1.00 75.34 ? 291 GLU B OE2 1 
ATOM   4252 N  N   . ILE B 1 228 ? 22.086  -52.267 -68.534 1.00 64.48 ? 292 ILE B N   1 
ATOM   4253 C  CA  . ILE B 1 228 ? 20.980  -51.313 -68.461 1.00 62.87 ? 292 ILE B CA  1 
ATOM   4254 C  C   . ILE B 1 228 ? 21.355  -49.951 -69.063 1.00 62.23 ? 292 ILE B C   1 
ATOM   4255 O  O   . ILE B 1 228 ? 20.604  -49.395 -69.861 1.00 61.97 ? 292 ILE B O   1 
ATOM   4256 C  CB  . ILE B 1 228 ? 20.463  -51.146 -66.999 1.00 62.61 ? 292 ILE B CB  1 
ATOM   4257 C  CG1 . ILE B 1 228 ? 20.162  -52.512 -66.386 1.00 61.70 ? 292 ILE B CG1 1 
ATOM   4258 C  CG2 . ILE B 1 228 ? 19.218  -50.270 -66.957 1.00 62.13 ? 292 ILE B CG2 1 
ATOM   4259 C  CD1 . ILE B 1 228 ? 19.874  -52.506 -64.905 1.00 59.72 ? 292 ILE B CD1 1 
ATOM   4260 N  N   . ILE B 1 229 ? 22.512  -49.422 -68.688 1.00 61.52 ? 293 ILE B N   1 
ATOM   4261 C  CA  . ILE B 1 229 ? 22.950  -48.113 -69.185 1.00 61.26 ? 293 ILE B CA  1 
ATOM   4262 C  C   . ILE B 1 229 ? 23.114  -48.084 -70.717 1.00 61.38 ? 293 ILE B C   1 
ATOM   4263 O  O   . ILE B 1 229 ? 22.519  -47.231 -71.390 1.00 61.48 ? 293 ILE B O   1 
ATOM   4264 C  CB  . ILE B 1 229 ? 24.231  -47.626 -68.464 1.00 61.04 ? 293 ILE B CB  1 
ATOM   4265 C  CG1 . ILE B 1 229 ? 23.971  -47.383 -66.967 1.00 61.01 ? 293 ILE B CG1 1 
ATOM   4266 C  CG2 . ILE B 1 229 ? 24.790  -46.392 -69.108 1.00 61.27 ? 293 ILE B CG2 1 
ATOM   4267 C  CD1 . ILE B 1 229 ? 22.753  -46.541 -66.639 1.00 60.85 ? 293 ILE B CD1 1 
ATOM   4268 N  N   . ILE B 1 230 ? 23.897  -49.020 -71.260 1.00 61.21 ? 294 ILE B N   1 
ATOM   4269 C  CA  . ILE B 1 230 ? 24.028  -49.176 -72.712 1.00 61.03 ? 294 ILE B CA  1 
ATOM   4270 C  C   . ILE B 1 230 ? 22.638  -49.246 -73.371 1.00 60.82 ? 294 ILE B C   1 
ATOM   4271 O  O   . ILE B 1 230 ? 22.350  -48.480 -74.303 1.00 60.91 ? 294 ILE B O   1 
ATOM   4272 C  CB  . ILE B 1 230 ? 24.906  -50.419 -73.092 1.00 61.34 ? 294 ILE B CB  1 
ATOM   4273 C  CG1 . ILE B 1 230 ? 26.377  -50.173 -72.737 1.00 61.67 ? 294 ILE B CG1 1 
ATOM   4274 C  CG2 . ILE B 1 230 ? 24.773  -50.795 -74.584 1.00 60.64 ? 294 ILE B CG2 1 
ATOM   4275 C  CD1 . ILE B 1 230 ? 27.203  -51.473 -72.590 1.00 63.04 ? 294 ILE B CD1 1 
ATOM   4276 N  N   . ASN B 1 231 ? 21.786  -50.147 -72.879 1.00 60.13 ? 295 ASN B N   1 
ATOM   4277 C  CA  . ASN B 1 231 ? 20.417  -50.266 -73.372 1.00 59.91 ? 295 ASN B CA  1 
ATOM   4278 C  C   . ASN B 1 231 ? 19.714  -48.895 -73.425 1.00 59.87 ? 295 ASN B C   1 
ATOM   4279 O  O   . ASN B 1 231 ? 19.131  -48.530 -74.452 1.00 59.94 ? 295 ASN B O   1 
ATOM   4280 C  CB  . ASN B 1 231 ? 19.625  -51.281 -72.533 1.00 59.81 ? 295 ASN B CB  1 
ATOM   4281 C  CG  . ASN B 1 231 ? 18.287  -51.666 -73.164 1.00 60.48 ? 295 ASN B CG  1 
ATOM   4282 O  OD1 . ASN B 1 231 ? 18.018  -51.362 -74.325 1.00 60.81 ? 295 ASN B OD1 1 
ATOM   4283 N  ND2 . ASN B 1 231 ? 17.440  -52.341 -72.390 1.00 60.65 ? 295 ASN B ND2 1 
ATOM   4284 N  N   . ALA B 1 232 ? 19.814  -48.125 -72.342 1.00 59.54 ? 296 ALA B N   1 
ATOM   4285 C  CA  . ALA B 1 232 ? 19.186  -46.798 -72.274 1.00 59.37 ? 296 ALA B CA  1 
ATOM   4286 C  C   . ALA B 1 232 ? 19.815  -45.789 -73.232 1.00 59.09 ? 296 ALA B C   1 
ATOM   4287 O  O   . ALA B 1 232 ? 19.116  -44.956 -73.790 1.00 58.95 ? 296 ALA B O   1 
ATOM   4288 C  CB  . ALA B 1 232 ? 19.213  -46.255 -70.845 1.00 59.47 ? 296 ALA B CB  1 
ATOM   4289 N  N   . VAL B 1 233 ? 21.130  -45.861 -73.407 1.00 58.86 ? 297 VAL B N   1 
ATOM   4290 C  CA  . VAL B 1 233 ? 21.821  -44.970 -74.333 1.00 58.88 ? 297 VAL B CA  1 
ATOM   4291 C  C   . VAL B 1 233 ? 21.317  -45.216 -75.757 1.00 59.36 ? 297 VAL B C   1 
ATOM   4292 O  O   . VAL B 1 233 ? 20.942  -44.277 -76.472 1.00 59.49 ? 297 VAL B O   1 
ATOM   4293 C  CB  . VAL B 1 233 ? 23.355  -45.127 -74.237 1.00 58.74 ? 297 VAL B CB  1 
ATOM   4294 C  CG1 . VAL B 1 233 ? 24.058  -44.447 -75.395 1.00 57.85 ? 297 VAL B CG1 1 
ATOM   4295 C  CG2 . VAL B 1 233 ? 23.845  -44.554 -72.933 1.00 58.42 ? 297 VAL B CG2 1 
ATOM   4296 N  N   . ARG B 1 234 ? 21.265  -46.486 -76.148 1.00 59.73 ? 298 ARG B N   1 
ATOM   4297 C  CA  . ARG B 1 234 ? 20.833  -46.850 -77.496 1.00 59.89 ? 298 ARG B CA  1 
ATOM   4298 C  C   . ARG B 1 234 ? 19.445  -46.292 -77.795 1.00 59.67 ? 298 ARG B C   1 
ATOM   4299 O  O   . ARG B 1 234 ? 19.217  -45.714 -78.861 1.00 59.66 ? 298 ARG B O   1 
ATOM   4300 C  CB  . ARG B 1 234 ? 20.887  -48.372 -77.717 1.00 59.96 ? 298 ARG B CB  1 
ATOM   4301 C  CG  . ARG B 1 234 ? 22.299  -48.969 -77.740 1.00 60.57 ? 298 ARG B CG  1 
ATOM   4302 C  CD  . ARG B 1 234 ? 23.332  -48.053 -78.426 1.00 60.99 ? 298 ARG B CD  1 
ATOM   4303 N  NE  . ARG B 1 234 ? 24.672  -48.637 -78.349 1.00 61.96 ? 298 ARG B NE  1 
ATOM   4304 C  CZ  . ARG B 1 234 ? 25.822  -47.975 -78.497 1.00 62.50 ? 298 ARG B CZ  1 
ATOM   4305 N  NH1 . ARG B 1 234 ? 25.852  -46.661 -78.732 1.00 62.26 ? 298 ARG B NH1 1 
ATOM   4306 N  NH2 . ARG B 1 234 ? 26.960  -48.647 -78.397 1.00 62.83 ? 298 ARG B NH2 1 
ATOM   4307 N  N   . ILE B 1 235 ? 18.536  -46.448 -76.836 1.00 59.49 ? 299 ILE B N   1 
ATOM   4308 C  CA  . ILE B 1 235 ? 17.172  -45.959 -76.987 1.00 59.25 ? 299 ILE B CA  1 
ATOM   4309 C  C   . ILE B 1 235 ? 17.146  -44.437 -77.126 1.00 59.33 ? 299 ILE B C   1 
ATOM   4310 O  O   . ILE B 1 235 ? 16.494  -43.906 -78.036 1.00 59.39 ? 299 ILE B O   1 
ATOM   4311 C  CB  . ILE B 1 235 ? 16.265  -46.437 -75.843 1.00 58.94 ? 299 ILE B CB  1 
ATOM   4312 C  CG1 . ILE B 1 235 ? 16.128  -47.966 -75.907 1.00 58.74 ? 299 ILE B CG1 1 
ATOM   4313 C  CG2 . ILE B 1 235 ? 14.903  -45.739 -75.919 1.00 58.48 ? 299 ILE B CG2 1 
ATOM   4314 C  CD1 . ILE B 1 235 ? 15.503  -48.617 -74.673 1.00 58.39 ? 299 ILE B CD1 1 
ATOM   4315 N  N   . GLU B 1 236 ? 17.874  -43.744 -76.249 1.00 59.40 ? 300 GLU B N   1 
ATOM   4316 C  CA  . GLU B 1 236 ? 17.977  -42.282 -76.332 1.00 59.34 ? 300 GLU B CA  1 
ATOM   4317 C  C   . GLU B 1 236 ? 18.478  -41.871 -77.711 1.00 59.30 ? 300 GLU B C   1 
ATOM   4318 O  O   . GLU B 1 236 ? 17.834  -41.071 -78.395 1.00 59.40 ? 300 GLU B O   1 
ATOM   4319 C  CB  . GLU B 1 236 ? 18.873  -41.696 -75.229 1.00 58.97 ? 300 GLU B CB  1 
ATOM   4320 C  CG  . GLU B 1 236 ? 19.019  -40.159 -75.271 1.00 58.53 ? 300 GLU B CG  1 
ATOM   4321 C  CD  . GLU B 1 236 ? 17.710  -39.412 -75.033 1.00 58.34 ? 300 GLU B CD  1 
ATOM   4322 O  OE1 . GLU B 1 236 ? 16.662  -40.068 -74.874 1.00 58.98 ? 300 GLU B OE1 1 
ATOM   4323 O  OE2 . GLU B 1 236 ? 17.719  -38.162 -74.997 1.00 58.26 ? 300 GLU B OE2 1 
ATOM   4324 N  N   . GLN B 1 237 ? 19.614  -42.447 -78.106 1.00 59.30 ? 301 GLN B N   1 
ATOM   4325 C  CA  . GLN B 1 237 ? 20.210  -42.229 -79.425 1.00 59.31 ? 301 GLN B CA  1 
ATOM   4326 C  C   . GLN B 1 237 ? 19.233  -42.459 -80.600 1.00 59.88 ? 301 GLN B C   1 
ATOM   4327 O  O   . GLN B 1 237 ? 19.210  -41.675 -81.547 1.00 60.02 ? 301 GLN B O   1 
ATOM   4328 C  CB  . GLN B 1 237 ? 21.457  -43.091 -79.570 1.00 59.03 ? 301 GLN B CB  1 
ATOM   4329 C  CG  . GLN B 1 237 ? 22.637  -42.599 -78.740 1.00 57.98 ? 301 GLN B CG  1 
ATOM   4330 C  CD  . GLN B 1 237 ? 23.854  -43.498 -78.859 1.00 56.50 ? 301 GLN B CD  1 
ATOM   4331 O  OE1 . GLN B 1 237 ? 23.744  -44.682 -79.184 1.00 54.64 ? 301 GLN B OE1 1 
ATOM   4332 N  NE2 . GLN B 1 237 ? 25.028  -42.937 -78.594 1.00 56.54 ? 301 GLN B NE2 1 
ATOM   4333 N  N   . GLU B 1 238 ? 18.424  -43.516 -80.530 1.00 60.24 ? 302 GLU B N   1 
ATOM   4334 C  CA  . GLU B 1 238 ? 17.413  -43.780 -81.547 1.00 60.90 ? 302 GLU B CA  1 
ATOM   4335 C  C   . GLU B 1 238 ? 16.325  -42.714 -81.488 1.00 60.70 ? 302 GLU B C   1 
ATOM   4336 O  O   . GLU B 1 238 ? 15.803  -42.287 -82.516 1.00 60.66 ? 302 GLU B O   1 
ATOM   4337 C  CB  . GLU B 1 238 ? 16.829  -45.185 -81.368 1.00 61.42 ? 302 GLU B CB  1 
ATOM   4338 C  CG  . GLU B 1 238 ? 15.966  -45.715 -82.518 1.00 64.46 ? 302 GLU B CG  1 
ATOM   4339 C  CD  . GLU B 1 238 ? 14.468  -45.371 -82.386 1.00 69.20 ? 302 GLU B CD  1 
ATOM   4340 O  OE1 . GLU B 1 238 ? 14.014  -44.968 -81.289 1.00 71.50 ? 302 GLU B OE1 1 
ATOM   4341 O  OE2 . GLU B 1 238 ? 13.734  -45.502 -83.395 1.00 71.28 ? 302 GLU B OE2 1 
ATOM   4342 N  N   . PHE B 1 239 ? 15.998  -42.273 -80.280 1.00 60.80 ? 303 PHE B N   1 
ATOM   4343 C  CA  . PHE B 1 239 ? 15.007  -41.216 -80.093 1.00 60.69 ? 303 PHE B CA  1 
ATOM   4344 C  C   . PHE B 1 239 ? 15.473  -39.905 -80.739 1.00 61.14 ? 303 PHE B C   1 
ATOM   4345 O  O   . PHE B 1 239 ? 14.670  -39.184 -81.340 1.00 61.26 ? 303 PHE B O   1 
ATOM   4346 C  CB  . PHE B 1 239 ? 14.710  -41.031 -78.597 1.00 60.04 ? 303 PHE B CB  1 
ATOM   4347 C  CG  . PHE B 1 239 ? 13.782  -39.885 -78.282 1.00 58.75 ? 303 PHE B CG  1 
ATOM   4348 C  CD1 . PHE B 1 239 ? 12.406  -40.082 -78.227 1.00 57.99 ? 303 PHE B CD1 1 
ATOM   4349 C  CD2 . PHE B 1 239 ? 14.286  -38.612 -78.007 1.00 57.72 ? 303 PHE B CD2 1 
ATOM   4350 C  CE1 . PHE B 1 239 ? 11.545  -39.036 -77.916 1.00 57.00 ? 303 PHE B CE1 1 
ATOM   4351 C  CE2 . PHE B 1 239 ? 13.438  -37.558 -77.694 1.00 56.46 ? 303 PHE B CE2 1 
ATOM   4352 C  CZ  . PHE B 1 239 ? 12.064  -37.771 -77.648 1.00 57.44 ? 303 PHE B CZ  1 
ATOM   4353 N  N   . LEU B 1 240 ? 16.765  -39.611 -80.628 1.00 61.59 ? 304 LEU B N   1 
ATOM   4354 C  CA  . LEU B 1 240 ? 17.281  -38.311 -81.046 1.00 62.69 ? 304 LEU B CA  1 
ATOM   4355 C  C   . LEU B 1 240 ? 17.732  -38.240 -82.503 1.00 63.84 ? 304 LEU B C   1 
ATOM   4356 O  O   . LEU B 1 240 ? 17.845  -37.143 -83.070 1.00 64.24 ? 304 LEU B O   1 
ATOM   4357 C  CB  . LEU B 1 240 ? 18.435  -37.875 -80.145 1.00 62.54 ? 304 LEU B CB  1 
ATOM   4358 C  CG  . LEU B 1 240 ? 18.149  -37.540 -78.684 1.00 61.83 ? 304 LEU B CG  1 
ATOM   4359 C  CD1 . LEU B 1 240 ? 19.458  -37.549 -77.953 1.00 60.99 ? 304 LEU B CD1 1 
ATOM   4360 C  CD2 . LEU B 1 240 ? 17.450  -36.201 -78.539 1.00 59.53 ? 304 LEU B CD2 1 
ATOM   4361 N  N   . THR B 1 241 ? 18.022  -39.389 -83.103 1.00 64.75 ? 305 THR B N   1 
ATOM   4362 C  CA  . THR B 1 241 ? 18.443  -39.397 -84.490 1.00 65.85 ? 305 THR B CA  1 
ATOM   4363 C  C   . THR B 1 241 ? 17.346  -39.883 -85.439 1.00 66.55 ? 305 THR B C   1 
ATOM   4364 O  O   . THR B 1 241 ? 17.319  -39.484 -86.602 1.00 66.82 ? 305 THR B O   1 
ATOM   4365 C  CB  . THR B 1 241 ? 19.779  -40.153 -84.712 1.00 65.91 ? 305 THR B CB  1 
ATOM   4366 O  OG1 . THR B 1 241 ? 19.666  -41.502 -84.246 1.00 66.50 ? 305 THR B OG1 1 
ATOM   4367 C  CG2 . THR B 1 241 ? 20.924  -39.456 -83.979 1.00 66.05 ? 305 THR B CG2 1 
ATOM   4368 N  N   . GLU B 1 242 ? 16.436  -40.724 -84.952 1.00 67.10 ? 306 GLU B N   1 
ATOM   4369 C  CA  . GLU B 1 242 ? 15.425  -41.307 -85.833 1.00 67.85 ? 306 GLU B CA  1 
ATOM   4370 C  C   . GLU B 1 242 ? 14.008  -40.811 -85.551 1.00 67.55 ? 306 GLU B C   1 
ATOM   4371 O  O   . GLU B 1 242 ? 13.417  -40.122 -86.378 1.00 67.86 ? 306 GLU B O   1 
ATOM   4372 C  CB  . GLU B 1 242 ? 15.504  -42.840 -85.830 1.00 68.30 ? 306 GLU B CB  1 
ATOM   4373 C  CG  . GLU B 1 242 ? 16.649  -43.411 -86.689 1.00 71.62 ? 306 GLU B CG  1 
ATOM   4374 C  CD  . GLU B 1 242 ? 16.892  -44.912 -86.455 1.00 76.73 ? 306 GLU B CD  1 
ATOM   4375 O  OE1 . GLU B 1 242 ? 18.078  -45.320 -86.359 1.00 77.44 ? 306 GLU B OE1 1 
ATOM   4376 O  OE2 . GLU B 1 242 ? 15.900  -45.687 -86.363 1.00 78.68 ? 306 GLU B OE2 1 
ATOM   4377 N  N   . ALA B 1 243 ? 13.482  -41.145 -84.378 1.00 67.27 ? 307 ALA B N   1 
ATOM   4378 C  CA  . ALA B 1 243 ? 12.102  -40.844 -84.007 1.00 66.66 ? 307 ALA B CA  1 
ATOM   4379 C  C   . ALA B 1 243 ? 11.755  -39.349 -84.002 1.00 66.39 ? 307 ALA B C   1 
ATOM   4380 O  O   . ALA B 1 243 ? 10.682  -38.954 -84.458 1.00 66.02 ? 307 ALA B O   1 
ATOM   4381 C  CB  . ALA B 1 243 ? 11.798  -41.465 -82.662 1.00 67.03 ? 307 ALA B CB  1 
ATOM   4382 N  N   . LEU B 1 244 ? 12.661  -38.525 -83.481 1.00 66.06 ? 308 LEU B N   1 
ATOM   4383 C  CA  . LEU B 1 244 ? 12.460  -37.078 -83.440 1.00 65.59 ? 308 LEU B CA  1 
ATOM   4384 C  C   . LEU B 1 244 ? 13.818  -36.413 -83.607 1.00 65.41 ? 308 LEU B C   1 
ATOM   4385 O  O   . LEU B 1 244 ? 14.421  -35.966 -82.637 1.00 65.57 ? 308 LEU B O   1 
ATOM   4386 C  CB  . LEU B 1 244 ? 11.790  -36.667 -82.124 1.00 65.47 ? 308 LEU B CB  1 
ATOM   4387 C  CG  . LEU B 1 244 ? 11.385  -35.208 -81.910 1.00 64.81 ? 308 LEU B CG  1 
ATOM   4388 C  CD1 . LEU B 1 244 ? 10.154  -34.860 -82.717 1.00 63.97 ? 308 LEU B CD1 1 
ATOM   4389 C  CD2 . LEU B 1 244 ? 11.142  -34.950 -80.436 1.00 64.56 ? 308 LEU B CD2 1 
ATOM   4390 N  N   . PRO B 1 245 ? 14.307  -36.353 -84.850 1.00 65.39 ? 309 PRO B N   1 
ATOM   4391 C  CA  . PRO B 1 245 ? 15.709  -36.034 -85.116 1.00 65.28 ? 309 PRO B CA  1 
ATOM   4392 C  C   . PRO B 1 245 ? 16.055  -34.605 -84.756 1.00 65.21 ? 309 PRO B C   1 
ATOM   4393 O  O   . PRO B 1 245 ? 15.266  -33.703 -85.022 1.00 65.33 ? 309 PRO B O   1 
ATOM   4394 C  CB  . PRO B 1 245 ? 15.847  -36.242 -86.634 1.00 65.14 ? 309 PRO B CB  1 
ATOM   4395 C  CG  . PRO B 1 245 ? 14.602  -36.961 -87.062 1.00 65.39 ? 309 PRO B CG  1 
ATOM   4396 C  CD  . PRO B 1 245 ? 13.543  -36.528 -86.096 1.00 65.56 ? 309 PRO B CD  1 
ATOM   4397 N  N   . VAL B 1 246 ? 17.234  -34.409 -84.170 1.00 65.17 ? 310 VAL B N   1 
ATOM   4398 C  CA  . VAL B 1 246 ? 17.680  -33.080 -83.737 1.00 65.11 ? 310 VAL B CA  1 
ATOM   4399 C  C   . VAL B 1 246 ? 18.052  -32.113 -84.871 1.00 65.53 ? 310 VAL B C   1 
ATOM   4400 O  O   . VAL B 1 246 ? 18.206  -30.907 -84.616 1.00 65.26 ? 310 VAL B O   1 
ATOM   4401 C  CB  . VAL B 1 246 ? 18.844  -33.153 -82.724 1.00 64.75 ? 310 VAL B CB  1 
ATOM   4402 C  CG1 . VAL B 1 246 ? 18.352  -33.635 -81.383 1.00 64.10 ? 310 VAL B CG1 1 
ATOM   4403 C  CG2 . VAL B 1 246 ? 19.950  -34.038 -83.241 1.00 64.94 ? 310 VAL B CG2 1 
ATOM   4404 N  N   . LYS B 1 247 ? 18.192  -32.624 -86.104 1.00 66.15 ? 311 LYS B N   1 
ATOM   4405 C  CA  . LYS B 1 247 ? 18.421  -31.751 -87.279 1.00 66.73 ? 311 LYS B CA  1 
ATOM   4406 C  C   . LYS B 1 247 ? 17.259  -30.768 -87.386 1.00 66.64 ? 311 LYS B C   1 
ATOM   4407 O  O   . LYS B 1 247 ? 17.434  -29.616 -87.795 1.00 66.19 ? 311 LYS B O   1 
ATOM   4408 C  CB  . LYS B 1 247 ? 18.542  -32.508 -88.613 1.00 67.02 ? 311 LYS B CB  1 
ATOM   4409 C  CG  . LYS B 1 247 ? 18.851  -34.012 -88.580 1.00 69.10 ? 311 LYS B CG  1 
ATOM   4410 C  CD  . LYS B 1 247 ? 18.241  -34.681 -89.835 1.00 72.17 ? 311 LYS B CD  1 
ATOM   4411 C  CE  . LYS B 1 247 ? 18.414  -36.207 -89.876 1.00 73.66 ? 311 LYS B CE  1 
ATOM   4412 N  NZ  . LYS B 1 247 ? 19.799  -36.623 -90.295 1.00 74.42 ? 311 LYS B NZ  1 
ATOM   4413 N  N   . LEU B 1 248 ? 16.073  -31.224 -86.989 1.00 66.80 ? 312 LEU B N   1 
ATOM   4414 C  CA  . LEU B 1 248 ? 14.893  -30.366 -86.987 1.00 67.21 ? 312 LEU B CA  1 
ATOM   4415 C  C   . LEU B 1 248 ? 15.152  -28.995 -86.343 1.00 67.59 ? 312 LEU B C   1 
ATOM   4416 O  O   . LEU B 1 248 ? 14.467  -28.021 -86.664 1.00 67.76 ? 312 LEU B O   1 
ATOM   4417 C  CB  . LEU B 1 248 ? 13.692  -31.073 -86.350 1.00 67.05 ? 312 LEU B CB  1 
ATOM   4418 C  CG  . LEU B 1 248 ? 13.205  -32.368 -87.019 1.00 67.36 ? 312 LEU B CG  1 
ATOM   4419 C  CD1 . LEU B 1 248 ? 12.071  -32.988 -86.225 1.00 67.25 ? 312 LEU B CD1 1 
ATOM   4420 C  CD2 . LEU B 1 248 ? 12.790  -32.168 -88.484 1.00 67.08 ? 312 LEU B CD2 1 
ATOM   4421 N  N   . ILE B 1 249 ? 16.143  -28.907 -85.457 1.00 67.80 ? 313 ILE B N   1 
ATOM   4422 C  CA  . ILE B 1 249 ? 16.497  -27.611 -84.890 1.00 68.22 ? 313 ILE B CA  1 
ATOM   4423 C  C   . ILE B 1 249 ? 17.943  -27.169 -85.165 1.00 68.81 ? 313 ILE B C   1 
ATOM   4424 O  O   . ILE B 1 249 ? 18.472  -26.287 -84.484 1.00 69.25 ? 313 ILE B O   1 
ATOM   4425 C  CB  . ILE B 1 249 ? 16.131  -27.490 -83.381 1.00 68.14 ? 313 ILE B CB  1 
ATOM   4426 C  CG1 . ILE B 1 249 ? 16.812  -28.581 -82.551 1.00 68.31 ? 313 ILE B CG1 1 
ATOM   4427 C  CG2 . ILE B 1 249 ? 14.607  -27.475 -83.191 1.00 67.72 ? 313 ILE B CG2 1 
ATOM   4428 C  CD1 . ILE B 1 249 ? 16.887  -28.272 -81.072 1.00 67.48 ? 313 ILE B CD1 1 
ATOM   4429 N  N   . GLY B 1 250 ? 18.574  -27.771 -86.171 1.00 69.06 ? 314 GLY B N   1 
ATOM   4430 C  CA  . GLY B 1 250 ? 19.902  -27.341 -86.613 1.00 69.18 ? 314 GLY B CA  1 
ATOM   4431 C  C   . GLY B 1 250 ? 21.087  -28.022 -85.952 1.00 69.64 ? 314 GLY B C   1 
ATOM   4432 O  O   . GLY B 1 250 ? 22.230  -27.583 -86.128 1.00 70.06 ? 314 GLY B O   1 
ATOM   4433 N  N   . MET B 1 251 ? 20.833  -29.098 -85.205 1.00 69.74 ? 315 MET B N   1 
ATOM   4434 C  CA  . MET B 1 251 ? 21.886  -29.786 -84.456 1.00 69.74 ? 315 MET B CA  1 
ATOM   4435 C  C   . MET B 1 251 ? 22.501  -30.924 -85.256 1.00 69.86 ? 315 MET B C   1 
ATOM   4436 O  O   . MET B 1 251 ? 21.856  -31.492 -86.135 1.00 69.78 ? 315 MET B O   1 
ATOM   4437 C  CB  . MET B 1 251 ? 21.345  -30.341 -83.136 1.00 69.77 ? 315 MET B CB  1 
ATOM   4438 C  CG  . MET B 1 251 ? 20.818  -29.309 -82.148 1.00 70.25 ? 315 MET B CG  1 
ATOM   4439 S  SD  . MET B 1 251 ? 20.652  -29.965 -80.458 1.00 70.75 ? 315 MET B SD  1 
ATOM   4440 C  CE  . MET B 1 251 ? 22.380  -30.046 -79.966 1.00 69.26 ? 315 MET B CE  1 
ATOM   4441 N  N   . ASN B 1 252 ? 23.748  -31.256 -84.923 1.00 70.25 ? 316 ASN B N   1 
ATOM   4442 C  CA  . ASN B 1 252 ? 24.474  -32.372 -85.522 1.00 70.61 ? 316 ASN B CA  1 
ATOM   4443 C  C   . ASN B 1 252 ? 24.103  -33.674 -84.809 1.00 70.85 ? 316 ASN B C   1 
ATOM   4444 O  O   . ASN B 1 252 ? 24.375  -33.828 -83.621 1.00 70.84 ? 316 ASN B O   1 
ATOM   4445 C  CB  . ASN B 1 252 ? 25.984  -32.093 -85.425 1.00 70.71 ? 316 ASN B CB  1 
ATOM   4446 C  CG  . ASN B 1 252 ? 26.863  -33.224 -85.999 1.00 71.55 ? 316 ASN B CG  1 
ATOM   4447 O  OD1 . ASN B 1 252 ? 26.538  -34.420 -85.923 1.00 72.07 ? 316 ASN B OD1 1 
ATOM   4448 N  ND2 . ASN B 1 252 ? 28.010  -32.834 -86.545 1.00 71.23 ? 316 ASN B ND2 1 
ATOM   4449 N  N   . CYS B 1 253 ? 23.481  -34.600 -85.534 1.00 71.23 ? 317 CYS B N   1 
ATOM   4450 C  CA  . CYS B 1 253 ? 23.084  -35.890 -84.972 1.00 71.93 ? 317 CYS B CA  1 
ATOM   4451 C  C   . CYS B 1 253 ? 24.271  -36.665 -84.419 1.00 71.63 ? 317 CYS B C   1 
ATOM   4452 O  O   . CYS B 1 253 ? 24.225  -37.158 -83.294 1.00 71.74 ? 317 CYS B O   1 
ATOM   4453 C  CB  . CYS B 1 253 ? 22.358  -36.747 -86.012 1.00 72.07 ? 317 CYS B CB  1 
ATOM   4454 S  SG  . CYS B 1 253 ? 20.600  -36.335 -86.233 1.00 76.13 ? 317 CYS B SG  1 
ATOM   4455 N  N   . THR B 1 254 ? 25.332  -36.775 -85.212 1.00 71.44 ? 318 THR B N   1 
ATOM   4456 C  CA  . THR B 1 254 ? 26.510  -37.537 -84.807 1.00 71.11 ? 318 THR B CA  1 
ATOM   4457 C  C   . THR B 1 254 ? 27.035  -37.050 -83.446 1.00 70.64 ? 318 THR B C   1 
ATOM   4458 O  O   . THR B 1 254 ? 27.265  -37.863 -82.545 1.00 70.56 ? 318 THR B O   1 
ATOM   4459 C  CB  . THR B 1 254 ? 27.631  -37.512 -85.903 1.00 71.34 ? 318 THR B CB  1 
ATOM   4460 O  OG1 . THR B 1 254 ? 27.100  -37.987 -87.151 1.00 71.12 ? 318 THR B OG1 1 
ATOM   4461 C  CG2 . THR B 1 254 ? 28.827  -38.383 -85.491 1.00 71.03 ? 318 THR B CG2 1 
ATOM   4462 N  N   . LEU B 1 255 ? 27.196  -35.734 -83.300 1.00 69.86 ? 319 LEU B N   1 
ATOM   4463 C  CA  . LEU B 1 255 ? 27.694  -35.149 -82.051 1.00 69.33 ? 319 LEU B CA  1 
ATOM   4464 C  C   . LEU B 1 255 ? 26.779  -35.409 -80.852 1.00 68.80 ? 319 LEU B C   1 
ATOM   4465 O  O   . LEU B 1 255 ? 27.257  -35.602 -79.737 1.00 68.95 ? 319 LEU B O   1 
ATOM   4466 C  CB  . LEU B 1 255 ? 27.955  -33.647 -82.206 1.00 69.18 ? 319 LEU B CB  1 
ATOM   4467 C  CG  . LEU B 1 255 ? 29.101  -33.217 -83.129 1.00 69.76 ? 319 LEU B CG  1 
ATOM   4468 C  CD1 . LEU B 1 255 ? 29.339  -31.707 -83.040 1.00 69.88 ? 319 LEU B CD1 1 
ATOM   4469 C  CD2 . LEU B 1 255 ? 30.399  -34.000 -82.855 1.00 69.53 ? 319 LEU B CD2 1 
ATOM   4470 N  N   . MET B 1 256 ? 25.470  -35.412 -81.094 1.00 68.08 ? 320 MET B N   1 
ATOM   4471 C  CA  . MET B 1 256 ? 24.477  -35.748 -80.078 1.00 67.22 ? 320 MET B CA  1 
ATOM   4472 C  C   . MET B 1 256 ? 24.584  -37.203 -79.606 1.00 66.96 ? 320 MET B C   1 
ATOM   4473 O  O   . MET B 1 256 ? 24.546  -37.462 -78.407 1.00 67.20 ? 320 MET B O   1 
ATOM   4474 C  CB  . MET B 1 256 ? 23.065  -35.445 -80.585 1.00 67.06 ? 320 MET B CB  1 
ATOM   4475 C  CG  . MET B 1 256 ? 21.960  -35.758 -79.587 1.00 66.15 ? 320 MET B CG  1 
ATOM   4476 S  SD  . MET B 1 256 ? 21.993  -34.700 -78.131 1.00 64.34 ? 320 MET B SD  1 
ATOM   4477 C  CE  . MET B 1 256 ? 21.147  -33.251 -78.733 1.00 62.52 ? 320 MET B CE  1 
ATOM   4478 N  N   . LYS B 1 257 ? 24.731  -38.144 -80.537 1.00 66.42 ? 321 LYS B N   1 
ATOM   4479 C  CA  . LYS B 1 257 ? 24.976  -39.543 -80.179 1.00 66.11 ? 321 LYS B CA  1 
ATOM   4480 C  C   . LYS B 1 257 ? 26.188  -39.643 -79.252 1.00 65.59 ? 321 LYS B C   1 
ATOM   4481 O  O   . LYS B 1 257 ? 26.229  -40.492 -78.350 1.00 65.65 ? 321 LYS B O   1 
ATOM   4482 C  CB  . LYS B 1 257 ? 25.218  -40.404 -81.422 1.00 66.40 ? 321 LYS B CB  1 
ATOM   4483 C  CG  . LYS B 1 257 ? 23.975  -40.879 -82.168 1.00 67.46 ? 321 LYS B CG  1 
ATOM   4484 C  CD  . LYS B 1 257 ? 24.367  -41.919 -83.232 1.00 70.27 ? 321 LYS B CD  1 
ATOM   4485 C  CE  . LYS B 1 257 ? 23.151  -42.647 -83.825 1.00 72.20 ? 321 LYS B CE  1 
ATOM   4486 N  NZ  . LYS B 1 257 ? 23.507  -43.920 -84.545 1.00 71.08 ? 321 LYS B NZ  1 
ATOM   4487 N  N   . GLN B 1 258 ? 27.164  -38.763 -79.480 1.00 64.71 ? 322 GLN B N   1 
ATOM   4488 C  CA  . GLN B 1 258 ? 28.404  -38.752 -78.713 1.00 63.98 ? 322 GLN B CA  1 
ATOM   4489 C  C   . GLN B 1 258 ? 28.142  -38.233 -77.298 1.00 63.31 ? 322 GLN B C   1 
ATOM   4490 O  O   . GLN B 1 258 ? 28.595  -38.837 -76.327 1.00 63.05 ? 322 GLN B O   1 
ATOM   4491 C  CB  . GLN B 1 258 ? 29.476  -37.916 -79.427 1.00 64.01 ? 322 GLN B CB  1 
ATOM   4492 C  CG  . GLN B 1 258 ? 30.911  -38.095 -78.912 1.00 65.22 ? 322 GLN B CG  1 
ATOM   4493 C  CD  . GLN B 1 258 ? 31.814  -36.914 -79.282 1.00 68.17 ? 322 GLN B CD  1 
ATOM   4494 O  OE1 . GLN B 1 258 ? 31.929  -36.551 -80.458 1.00 69.95 ? 322 GLN B OE1 1 
ATOM   4495 N  NE2 . GLN B 1 258 ? 32.448  -36.302 -78.277 1.00 67.46 ? 322 GLN B NE2 1 
ATOM   4496 N  N   . TYR B 1 259 ? 27.401  -37.127 -77.192 1.00 62.55 ? 323 TYR B N   1 
ATOM   4497 C  CA  . TYR B 1 259 ? 27.045  -36.530 -75.900 1.00 61.67 ? 323 TYR B CA  1 
ATOM   4498 C  C   . TYR B 1 259 ? 26.238  -37.462 -75.000 1.00 61.25 ? 323 TYR B C   1 
ATOM   4499 O  O   . TYR B 1 259 ? 26.482  -37.525 -73.795 1.00 60.83 ? 323 TYR B O   1 
ATOM   4500 C  CB  . TYR B 1 259 ? 26.260  -35.239 -76.103 1.00 61.82 ? 323 TYR B CB  1 
ATOM   4501 C  CG  . TYR B 1 259 ? 25.743  -34.649 -74.817 1.00 61.17 ? 323 TYR B CG  1 
ATOM   4502 C  CD1 . TYR B 1 259 ? 26.616  -34.121 -73.877 1.00 61.86 ? 323 TYR B CD1 1 
ATOM   4503 C  CD2 . TYR B 1 259 ? 24.380  -34.625 -74.537 1.00 61.18 ? 323 TYR B CD2 1 
ATOM   4504 C  CE1 . TYR B 1 259 ? 26.144  -33.570 -72.677 1.00 62.03 ? 323 TYR B CE1 1 
ATOM   4505 C  CE2 . TYR B 1 259 ? 23.897  -34.083 -73.346 1.00 61.32 ? 323 TYR B CE2 1 
ATOM   4506 C  CZ  . TYR B 1 259 ? 24.786  -33.554 -72.418 1.00 61.38 ? 323 TYR B CZ  1 
ATOM   4507 O  OH  . TYR B 1 259 ? 24.325  -33.018 -71.232 1.00 60.88 ? 323 TYR B OH  1 
ATOM   4508 N  N   . ILE B 1 260 ? 25.275  -38.171 -75.587 1.00 60.61 ? 324 ILE B N   1 
ATOM   4509 C  CA  . ILE B 1 260 ? 24.509  -39.159 -74.843 1.00 60.37 ? 324 ILE B CA  1 
ATOM   4510 C  C   . ILE B 1 260 ? 25.454  -40.182 -74.233 1.00 60.41 ? 324 ILE B C   1 
ATOM   4511 O  O   . ILE B 1 260 ? 25.263  -40.587 -73.088 1.00 60.54 ? 324 ILE B O   1 
ATOM   4512 C  CB  . ILE B 1 260 ? 23.425  -39.861 -75.710 1.00 60.51 ? 324 ILE B CB  1 
ATOM   4513 C  CG1 . ILE B 1 260 ? 22.442  -38.842 -76.298 1.00 59.53 ? 324 ILE B CG1 1 
ATOM   4514 C  CG2 . ILE B 1 260 ? 22.678  -40.935 -74.911 1.00 59.77 ? 324 ILE B CG2 1 
ATOM   4515 C  CD1 . ILE B 1 260 ? 21.976  -37.791 -75.326 1.00 59.27 ? 324 ILE B CD1 1 
ATOM   4516 N  N   . GLU B 1 261 ? 26.485  -40.571 -74.984 1.00 60.46 ? 325 GLU B N   1 
ATOM   4517 C  CA  . GLU B 1 261 ? 27.509  -41.502 -74.478 1.00 60.26 ? 325 GLU B CA  1 
ATOM   4518 C  C   . GLU B 1 261 ? 28.372  -40.896 -73.364 1.00 59.68 ? 325 GLU B C   1 
ATOM   4519 O  O   . GLU B 1 261 ? 28.826  -41.611 -72.465 1.00 59.72 ? 325 GLU B O   1 
ATOM   4520 C  CB  . GLU B 1 261 ? 28.369  -42.051 -75.619 1.00 60.47 ? 325 GLU B CB  1 
ATOM   4521 C  CG  . GLU B 1 261 ? 27.693  -43.200 -76.387 1.00 62.22 ? 325 GLU B CG  1 
ATOM   4522 C  CD  . GLU B 1 261 ? 28.373  -43.563 -77.719 1.00 64.02 ? 325 GLU B CD  1 
ATOM   4523 O  OE1 . GLU B 1 261 ? 29.450  -43.003 -78.027 1.00 64.31 ? 325 GLU B OE1 1 
ATOM   4524 O  OE2 . GLU B 1 261 ? 27.815  -44.413 -78.460 1.00 65.17 ? 325 GLU B OE2 1 
ATOM   4525 N  N   . PHE B 1 262 ? 28.568  -39.581 -73.408 1.00 59.02 ? 326 PHE B N   1 
ATOM   4526 C  CA  . PHE B 1 262 ? 29.338  -38.888 -72.380 1.00 58.80 ? 326 PHE B CA  1 
ATOM   4527 C  C   . PHE B 1 262 ? 28.581  -38.807 -71.057 1.00 59.05 ? 326 PHE B C   1 
ATOM   4528 O  O   . PHE B 1 262 ? 29.156  -39.021 -69.990 1.00 59.19 ? 326 PHE B O   1 
ATOM   4529 C  CB  . PHE B 1 262 ? 29.727  -37.490 -72.848 1.00 58.49 ? 326 PHE B CB  1 
ATOM   4530 C  CG  . PHE B 1 262 ? 30.093  -36.550 -71.732 1.00 58.28 ? 326 PHE B CG  1 
ATOM   4531 C  CD1 . PHE B 1 262 ? 31.375  -36.573 -71.172 1.00 57.57 ? 326 PHE B CD1 1 
ATOM   4532 C  CD2 . PHE B 1 262 ? 29.160  -35.627 -71.248 1.00 58.08 ? 326 PHE B CD2 1 
ATOM   4533 C  CE1 . PHE B 1 262 ? 31.728  -35.700 -70.152 1.00 56.91 ? 326 PHE B CE1 1 
ATOM   4534 C  CE2 . PHE B 1 262 ? 29.500  -34.740 -70.222 1.00 57.38 ? 326 PHE B CE2 1 
ATOM   4535 C  CZ  . PHE B 1 262 ? 30.789  -34.778 -69.673 1.00 57.28 ? 326 PHE B CZ  1 
ATOM   4536 N  N   . VAL B 1 263 ? 27.293  -38.483 -71.146 1.00 59.14 ? 327 VAL B N   1 
ATOM   4537 C  CA  . VAL B 1 263 ? 26.401  -38.453 -69.996 1.00 58.94 ? 327 VAL B CA  1 
ATOM   4538 C  C   . VAL B 1 263 ? 26.383  -39.802 -69.279 1.00 58.98 ? 327 VAL B C   1 
ATOM   4539 O  O   . VAL B 1 263 ? 26.508  -39.857 -68.054 1.00 58.93 ? 327 VAL B O   1 
ATOM   4540 C  CB  . VAL B 1 263 ? 24.966  -38.018 -70.409 1.00 58.85 ? 327 VAL B CB  1 
ATOM   4541 C  CG1 . VAL B 1 263 ? 23.961  -38.270 -69.284 1.00 58.86 ? 327 VAL B CG1 1 
ATOM   4542 C  CG2 . VAL B 1 263 ? 24.957  -36.557 -70.791 1.00 58.44 ? 327 VAL B CG2 1 
ATOM   4543 N  N   . ALA B 1 264 ? 26.235  -40.879 -70.046 1.00 58.93 ? 328 ALA B N   1 
ATOM   4544 C  CA  . ALA B 1 264 ? 26.222  -42.229 -69.486 1.00 59.35 ? 328 ALA B CA  1 
ATOM   4545 C  C   . ALA B 1 264 ? 27.533  -42.565 -68.784 1.00 59.52 ? 328 ALA B C   1 
ATOM   4546 O  O   . ALA B 1 264 ? 27.529  -43.210 -67.734 1.00 59.47 ? 328 ALA B O   1 
ATOM   4547 C  CB  . ALA B 1 264 ? 25.926  -43.250 -70.564 1.00 59.26 ? 328 ALA B CB  1 
ATOM   4548 N  N   . ASP B 1 265 ? 28.647  -42.123 -69.367 1.00 59.83 ? 329 ASP B N   1 
ATOM   4549 C  CA  . ASP B 1 265 ? 29.960  -42.302 -68.753 1.00 60.15 ? 329 ASP B CA  1 
ATOM   4550 C  C   . ASP B 1 265 ? 29.995  -41.632 -67.395 1.00 59.62 ? 329 ASP B C   1 
ATOM   4551 O  O   . ASP B 1 265 ? 30.445  -42.227 -66.417 1.00 59.80 ? 329 ASP B O   1 
ATOM   4552 C  CB  . ASP B 1 265 ? 31.074  -41.737 -69.640 1.00 60.78 ? 329 ASP B CB  1 
ATOM   4553 C  CG  . ASP B 1 265 ? 31.615  -42.753 -70.647 1.00 62.31 ? 329 ASP B CG  1 
ATOM   4554 O  OD1 . ASP B 1 265 ? 31.079  -43.882 -70.765 1.00 63.11 ? 329 ASP B OD1 1 
ATOM   4555 O  OD2 . ASP B 1 265 ? 32.604  -42.399 -71.325 1.00 65.02 ? 329 ASP B OD2 1 
ATOM   4556 N  N   . ARG B 1 266 ? 29.499  -40.404 -67.334 1.00 59.11 ? 330 ARG B N   1 
ATOM   4557 C  CA  . ARG B 1 266 ? 29.505  -39.653 -66.095 1.00 59.30 ? 330 ARG B CA  1 
ATOM   4558 C  C   . ARG B 1 266 ? 28.655  -40.334 -65.034 1.00 59.13 ? 330 ARG B C   1 
ATOM   4559 O  O   . ARG B 1 266 ? 29.057  -40.413 -63.879 1.00 59.40 ? 330 ARG B O   1 
ATOM   4560 C  CB  . ARG B 1 266 ? 29.036  -38.223 -66.328 1.00 59.44 ? 330 ARG B CB  1 
ATOM   4561 C  CG  . ARG B 1 266 ? 29.369  -37.264 -65.194 1.00 60.60 ? 330 ARG B CG  1 
ATOM   4562 C  CD  . ARG B 1 266 ? 29.077  -35.840 -65.614 1.00 62.26 ? 330 ARG B CD  1 
ATOM   4563 N  NE  . ARG B 1 266 ? 27.797  -35.763 -66.314 1.00 64.14 ? 330 ARG B NE  1 
ATOM   4564 C  CZ  . ARG B 1 266 ? 27.361  -34.712 -67.002 1.00 65.05 ? 330 ARG B CZ  1 
ATOM   4565 N  NH1 . ARG B 1 266 ? 28.096  -33.602 -67.102 1.00 64.83 ? 330 ARG B NH1 1 
ATOM   4566 N  NH2 . ARG B 1 266 ? 26.174  -34.778 -67.593 1.00 65.47 ? 330 ARG B NH2 1 
ATOM   4567 N  N   . LEU B 1 267 ? 27.499  -40.845 -65.438 1.00 58.97 ? 331 LEU B N   1 
ATOM   4568 C  CA  . LEU B 1 267 ? 26.625  -41.569 -64.541 1.00 59.04 ? 331 LEU B CA  1 
ATOM   4569 C  C   . LEU B 1 267 ? 27.261  -42.881 -64.061 1.00 59.67 ? 331 LEU B C   1 
ATOM   4570 O  O   . LEU B 1 267 ? 27.169  -43.216 -62.877 1.00 59.73 ? 331 LEU B O   1 
ATOM   4571 C  CB  . LEU B 1 267 ? 25.261  -41.815 -65.203 1.00 58.73 ? 331 LEU B CB  1 
ATOM   4572 C  CG  . LEU B 1 267 ? 24.231  -42.659 -64.441 1.00 57.50 ? 331 LEU B CG  1 
ATOM   4573 C  CD1 . LEU B 1 267 ? 23.838  -41.993 -63.134 1.00 56.34 ? 331 LEU B CD1 1 
ATOM   4574 C  CD2 . LEU B 1 267 ? 23.012  -42.922 -65.288 1.00 55.02 ? 331 LEU B CD2 1 
ATOM   4575 N  N   . MET B 1 268 ? 27.902  -43.617 -64.969 1.00 60.30 ? 332 MET B N   1 
ATOM   4576 C  CA  . MET B 1 268 ? 28.628  -44.842 -64.595 1.00 60.99 ? 332 MET B CA  1 
ATOM   4577 C  C   . MET B 1 268 ? 29.679  -44.574 -63.508 1.00 61.23 ? 332 MET B C   1 
ATOM   4578 O  O   . MET B 1 268 ? 29.742  -45.300 -62.508 1.00 61.24 ? 332 MET B O   1 
ATOM   4579 C  CB  . MET B 1 268 ? 29.299  -45.477 -65.812 1.00 61.08 ? 332 MET B CB  1 
ATOM   4580 C  CG  . MET B 1 268 ? 28.358  -46.209 -66.741 1.00 62.11 ? 332 MET B CG  1 
ATOM   4581 S  SD  . MET B 1 268 ? 27.465  -47.552 -65.941 1.00 65.31 ? 332 MET B SD  1 
ATOM   4582 C  CE  . MET B 1 268 ? 28.797  -48.686 -65.539 1.00 65.88 ? 332 MET B CE  1 
ATOM   4583 N  N   . LEU B 1 269 ? 30.485  -43.527 -63.708 1.00 61.28 ? 333 LEU B N   1 
ATOM   4584 C  CA  . LEU B 1 269 ? 31.498  -43.119 -62.736 1.00 61.66 ? 333 LEU B CA  1 
ATOM   4585 C  C   . LEU B 1 269 ? 30.883  -42.775 -61.389 1.00 61.67 ? 333 LEU B C   1 
ATOM   4586 O  O   . LEU B 1 269 ? 31.352  -43.237 -60.348 1.00 61.76 ? 333 LEU B O   1 
ATOM   4587 C  CB  . LEU B 1 269 ? 32.297  -41.923 -63.257 1.00 61.87 ? 333 LEU B CB  1 
ATOM   4588 C  CG  . LEU B 1 269 ? 33.488  -42.182 -64.188 1.00 62.79 ? 333 LEU B CG  1 
ATOM   4589 C  CD1 . LEU B 1 269 ? 34.068  -40.854 -64.659 1.00 63.37 ? 333 LEU B CD1 1 
ATOM   4590 C  CD2 . LEU B 1 269 ? 34.574  -43.037 -63.515 1.00 62.72 ? 333 LEU B CD2 1 
ATOM   4591 N  N   . GLU B 1 270 ? 29.825  -41.966 -61.429 1.00 61.72 ? 334 GLU B N   1 
ATOM   4592 C  CA  . GLU B 1 270 ? 29.069  -41.555 -60.248 1.00 61.43 ? 334 GLU B CA  1 
ATOM   4593 C  C   . GLU B 1 270 ? 28.505  -42.770 -59.494 1.00 61.25 ? 334 GLU B C   1 
ATOM   4594 O  O   . GLU B 1 270 ? 28.380  -42.751 -58.266 1.00 61.05 ? 334 GLU B O   1 
ATOM   4595 C  CB  . GLU B 1 270 ? 27.946  -40.599 -60.663 1.00 61.30 ? 334 GLU B CB  1 
ATOM   4596 C  CG  . GLU B 1 270 ? 27.707  -39.445 -59.695 1.00 62.01 ? 334 GLU B CG  1 
ATOM   4597 C  CD  . GLU B 1 270 ? 26.423  -38.659 -59.979 1.00 62.57 ? 334 GLU B CD  1 
ATOM   4598 O  OE1 . GLU B 1 270 ? 26.063  -38.469 -61.167 1.00 62.88 ? 334 GLU B OE1 1 
ATOM   4599 O  OE2 . GLU B 1 270 ? 25.776  -38.227 -59.002 1.00 61.26 ? 334 GLU B OE2 1 
ATOM   4600 N  N   . LEU B 1 271 ? 28.194  -43.831 -60.233 1.00 61.20 ? 335 LEU B N   1 
ATOM   4601 C  CA  . LEU B 1 271 ? 27.757  -45.098 -59.635 1.00 61.61 ? 335 LEU B CA  1 
ATOM   4602 C  C   . LEU B 1 271 ? 28.882  -46.012 -59.091 1.00 62.17 ? 335 LEU B C   1 
ATOM   4603 O  O   . LEU B 1 271 ? 28.629  -47.170 -58.715 1.00 62.20 ? 335 LEU B O   1 
ATOM   4604 C  CB  . LEU B 1 271 ? 26.876  -45.868 -60.626 1.00 61.21 ? 335 LEU B CB  1 
ATOM   4605 C  CG  . LEU B 1 271 ? 25.486  -45.276 -60.843 1.00 59.82 ? 335 LEU B CG  1 
ATOM   4606 C  CD1 . LEU B 1 271 ? 24.750  -46.001 -61.942 1.00 57.66 ? 335 LEU B CD1 1 
ATOM   4607 C  CD2 . LEU B 1 271 ? 24.714  -45.329 -59.554 1.00 59.67 ? 335 LEU B CD2 1 
ATOM   4608 N  N   . GLY B 1 272 ? 30.110  -45.490 -59.056 1.00 62.84 ? 336 GLY B N   1 
ATOM   4609 C  CA  . GLY B 1 272 ? 31.281  -46.234 -58.575 1.00 63.64 ? 336 GLY B CA  1 
ATOM   4610 C  C   . GLY B 1 272 ? 31.851  -47.276 -59.532 1.00 64.30 ? 336 GLY B C   1 
ATOM   4611 O  O   . GLY B 1 272 ? 32.559  -48.196 -59.099 1.00 64.17 ? 336 GLY B O   1 
ATOM   4612 N  N   . PHE B 1 273 ? 31.538  -47.137 -60.826 1.00 64.72 ? 337 PHE B N   1 
ATOM   4613 C  CA  . PHE B 1 273 ? 32.036  -48.043 -61.860 1.00 65.20 ? 337 PHE B CA  1 
ATOM   4614 C  C   . PHE B 1 273 ? 32.977  -47.347 -62.863 1.00 65.71 ? 337 PHE B C   1 
ATOM   4615 O  O   . PHE B 1 273 ? 33.431  -46.214 -62.631 1.00 65.60 ? 337 PHE B O   1 
ATOM   4616 C  CB  . PHE B 1 273 ? 30.876  -48.689 -62.618 1.00 65.22 ? 337 PHE B CB  1 
ATOM   4617 C  CG  . PHE B 1 273 ? 29.948  -49.523 -61.767 1.00 65.66 ? 337 PHE B CG  1 
ATOM   4618 C  CD1 . PHE B 1 273 ? 30.378  -50.729 -61.199 1.00 66.40 ? 337 PHE B CD1 1 
ATOM   4619 C  CD2 . PHE B 1 273 ? 28.622  -49.132 -61.582 1.00 65.04 ? 337 PHE B CD2 1 
ATOM   4620 C  CE1 . PHE B 1 273 ? 29.504  -51.521 -60.434 1.00 65.90 ? 337 PHE B CE1 1 
ATOM   4621 C  CE2 . PHE B 1 273 ? 27.746  -49.905 -60.824 1.00 65.70 ? 337 PHE B CE2 1 
ATOM   4622 C  CZ  . PHE B 1 273 ? 28.186  -51.107 -60.251 1.00 66.07 ? 337 PHE B CZ  1 
ATOM   4623 N  N   . SER B 1 274 ? 33.255  -48.036 -63.975 1.00 66.39 ? 338 SER B N   1 
ATOM   4624 C  CA  . SER B 1 274 ? 34.157  -47.545 -65.031 1.00 67.13 ? 338 SER B CA  1 
ATOM   4625 C  C   . SER B 1 274 ? 33.412  -47.037 -66.267 1.00 67.61 ? 338 SER B C   1 
ATOM   4626 O  O   . SER B 1 274 ? 32.341  -47.555 -66.612 1.00 67.59 ? 338 SER B O   1 
ATOM   4627 C  CB  . SER B 1 274 ? 35.136  -48.647 -65.458 1.00 66.94 ? 338 SER B CB  1 
ATOM   4628 O  OG  . SER B 1 274 ? 36.010  -48.983 -64.403 1.00 66.95 ? 338 SER B OG  1 
ATOM   4629 N  N   . LYS B 1 275 ? 33.997  -46.041 -66.938 1.00 68.26 ? 339 LYS B N   1 
ATOM   4630 C  CA  . LYS B 1 275 ? 33.445  -45.506 -68.185 1.00 69.07 ? 339 LYS B CA  1 
ATOM   4631 C  C   . LYS B 1 275 ? 33.172  -46.638 -69.161 1.00 69.43 ? 339 LYS B C   1 
ATOM   4632 O  O   . LYS B 1 275 ? 33.785  -47.705 -69.076 1.00 69.49 ? 339 LYS B O   1 
ATOM   4633 C  CB  . LYS B 1 275 ? 34.392  -44.500 -68.845 1.00 69.18 ? 339 LYS B CB  1 
ATOM   4634 C  CG  . LYS B 1 275 ? 34.766  -43.297 -68.005 1.00 70.21 ? 339 LYS B CG  1 
ATOM   4635 C  CD  . LYS B 1 275 ? 35.160  -42.121 -68.899 1.00 71.45 ? 339 LYS B CD  1 
ATOM   4636 C  CE  . LYS B 1 275 ? 36.080  -41.147 -68.165 1.00 72.27 ? 339 LYS B CE  1 
ATOM   4637 N  NZ  . LYS B 1 275 ? 36.094  -39.812 -68.817 1.00 71.78 ? 339 LYS B NZ  1 
ATOM   4638 N  N   . VAL B 1 276 ? 32.253  -46.407 -70.088 1.00 69.87 ? 340 VAL B N   1 
ATOM   4639 C  CA  . VAL B 1 276 ? 31.872  -47.454 -71.019 1.00 70.46 ? 340 VAL B CA  1 
ATOM   4640 C  C   . VAL B 1 276 ? 32.235  -47.074 -72.447 1.00 70.91 ? 340 VAL B C   1 
ATOM   4641 O  O   . VAL B 1 276 ? 32.641  -47.926 -73.229 1.00 71.09 ? 340 VAL B O   1 
ATOM   4642 C  CB  . VAL B 1 276 ? 30.376  -47.823 -70.872 1.00 70.46 ? 340 VAL B CB  1 
ATOM   4643 C  CG1 . VAL B 1 276 ? 29.888  -48.714 -72.028 1.00 70.22 ? 340 VAL B CG1 1 
ATOM   4644 C  CG2 . VAL B 1 276 ? 30.149  -48.516 -69.538 1.00 70.17 ? 340 VAL B CG2 1 
ATOM   4645 N  N   . PHE B 1 277 ? 32.125  -45.790 -72.765 1.00 71.34 ? 341 PHE B N   1 
ATOM   4646 C  CA  . PHE B 1 277 ? 32.345  -45.322 -74.124 1.00 71.71 ? 341 PHE B CA  1 
ATOM   4647 C  C   . PHE B 1 277 ? 33.643  -44.528 -74.275 1.00 72.06 ? 341 PHE B C   1 
ATOM   4648 O  O   . PHE B 1 277 ? 34.151  -44.362 -75.386 1.00 71.98 ? 341 PHE B O   1 
ATOM   4649 C  CB  . PHE B 1 277 ? 31.139  -44.498 -74.599 1.00 71.72 ? 341 PHE B CB  1 
ATOM   4650 C  CG  . PHE B 1 277 ? 29.832  -45.234 -74.509 1.00 71.41 ? 341 PHE B CG  1 
ATOM   4651 C  CD1 . PHE B 1 277 ? 29.443  -46.113 -75.514 1.00 71.77 ? 341 PHE B CD1 1 
ATOM   4652 C  CD2 . PHE B 1 277 ? 28.992  -45.056 -73.416 1.00 70.88 ? 341 PHE B CD2 1 
ATOM   4653 C  CE1 . PHE B 1 277 ? 28.230  -46.806 -75.431 1.00 71.41 ? 341 PHE B CE1 1 
ATOM   4654 C  CE2 . PHE B 1 277 ? 27.787  -45.738 -73.324 1.00 70.54 ? 341 PHE B CE2 1 
ATOM   4655 C  CZ  . PHE B 1 277 ? 27.403  -46.617 -74.332 1.00 70.79 ? 341 PHE B CZ  1 
ATOM   4656 N  N   . ARG B 1 278 ? 34.170  -44.038 -73.157 1.00 72.49 ? 342 ARG B N   1 
ATOM   4657 C  CA  . ARG B 1 278 ? 35.391  -43.225 -73.149 1.00 73.28 ? 342 ARG B CA  1 
ATOM   4658 C  C   . ARG B 1 278 ? 35.396  -42.104 -74.206 1.00 73.17 ? 342 ARG B C   1 
ATOM   4659 O  O   . ARG B 1 278 ? 36.344  -41.970 -74.987 1.00 73.40 ? 342 ARG B O   1 
ATOM   4660 C  CB  . ARG B 1 278 ? 36.646  -44.121 -73.224 1.00 73.53 ? 342 ARG B CB  1 
ATOM   4661 C  CG  . ARG B 1 278 ? 37.066  -44.639 -71.844 1.00 75.48 ? 342 ARG B CG  1 
ATOM   4662 C  CD  . ARG B 1 278 ? 38.105  -45.738 -71.879 1.00 78.33 ? 342 ARG B CD  1 
ATOM   4663 N  NE  . ARG B 1 278 ? 38.398  -46.203 -70.518 1.00 81.51 ? 342 ARG B NE  1 
ATOM   4664 C  CZ  . ARG B 1 278 ? 37.831  -47.264 -69.927 1.00 82.75 ? 342 ARG B CZ  1 
ATOM   4665 N  NH1 . ARG B 1 278 ? 36.926  -48.006 -70.570 1.00 82.42 ? 342 ARG B NH1 1 
ATOM   4666 N  NH2 . ARG B 1 278 ? 38.173  -47.593 -68.684 1.00 81.86 ? 342 ARG B NH2 1 
ATOM   4667 N  N   . VAL B 1 279 ? 34.328  -41.308 -74.217 1.00 72.94 ? 343 VAL B N   1 
ATOM   4668 C  CA  . VAL B 1 279 ? 34.207  -40.174 -75.139 1.00 72.90 ? 343 VAL B CA  1 
ATOM   4669 C  C   . VAL B 1 279 ? 34.052  -38.829 -74.432 1.00 72.99 ? 343 VAL B C   1 
ATOM   4670 O  O   . VAL B 1 279 ? 33.481  -38.745 -73.343 1.00 72.93 ? 343 VAL B O   1 
ATOM   4671 C  CB  . VAL B 1 279 ? 33.049  -40.348 -76.160 1.00 72.88 ? 343 VAL B CB  1 
ATOM   4672 C  CG1 . VAL B 1 279 ? 33.385  -41.437 -77.178 1.00 72.66 ? 343 VAL B CG1 1 
ATOM   4673 C  CG2 . VAL B 1 279 ? 31.717  -40.625 -75.454 1.00 72.69 ? 343 VAL B CG2 1 
ATOM   4674 N  N   . GLU B 1 280 ? 34.558  -37.783 -75.077 1.00 73.02 ? 344 GLU B N   1 
ATOM   4675 C  CA  . GLU B 1 280 ? 34.485  -36.430 -74.552 1.00 73.39 ? 344 GLU B CA  1 
ATOM   4676 C  C   . GLU B 1 280 ? 33.105  -35.834 -74.769 1.00 73.00 ? 344 GLU B C   1 
ATOM   4677 O  O   . GLU B 1 280 ? 32.323  -36.329 -75.581 1.00 72.90 ? 344 GLU B O   1 
ATOM   4678 C  CB  . GLU B 1 280 ? 35.500  -35.529 -75.252 1.00 73.83 ? 344 GLU B CB  1 
ATOM   4679 C  CG  . GLU B 1 280 ? 36.948  -35.934 -75.110 1.00 75.86 ? 344 GLU B CG  1 
ATOM   4680 C  CD  . GLU B 1 280 ? 37.860  -34.724 -75.174 1.00 79.24 ? 344 GLU B CD  1 
ATOM   4681 O  OE1 . GLU B 1 280 ? 38.269  -34.324 -76.300 1.00 79.92 ? 344 GLU B OE1 1 
ATOM   4682 O  OE2 . GLU B 1 280 ? 38.142  -34.157 -74.091 1.00 79.89 ? 344 GLU B OE2 1 
ATOM   4683 N  N   . ASN B 1 281 ? 32.827  -34.752 -74.047 1.00 72.75 ? 345 ASN B N   1 
ATOM   4684 C  CA  . ASN B 1 281 ? 31.622  -33.958 -74.252 1.00 72.35 ? 345 ASN B CA  1 
ATOM   4685 C  C   . ASN B 1 281 ? 31.808  -32.977 -75.418 1.00 72.12 ? 345 ASN B C   1 
ATOM   4686 O  O   . ASN B 1 281 ? 32.628  -32.057 -75.338 1.00 71.91 ? 345 ASN B O   1 
ATOM   4687 C  CB  . ASN B 1 281 ? 31.261  -33.213 -72.963 1.00 72.28 ? 345 ASN B CB  1 
ATOM   4688 C  CG  . ASN B 1 281 ? 30.100  -32.246 -73.142 1.00 72.10 ? 345 ASN B CG  1 
ATOM   4689 O  OD1 . ASN B 1 281 ? 29.366  -32.309 -74.130 1.00 71.63 ? 345 ASN B OD1 1 
ATOM   4690 N  ND2 . ASN B 1 281 ? 29.929  -31.343 -72.176 1.00 71.01 ? 345 ASN B ND2 1 
ATOM   4691 N  N   . PRO B 1 282 ? 31.037  -33.171 -76.503 1.00 71.95 ? 346 PRO B N   1 
ATOM   4692 C  CA  . PRO B 1 282 ? 31.137  -32.365 -77.716 1.00 71.81 ? 346 PRO B CA  1 
ATOM   4693 C  C   . PRO B 1 282 ? 30.470  -31.000 -77.622 1.00 71.81 ? 346 PRO B C   1 
ATOM   4694 O  O   . PRO B 1 282 ? 30.547  -30.220 -78.569 1.00 71.86 ? 346 PRO B O   1 
ATOM   4695 C  CB  . PRO B 1 282 ? 30.389  -33.210 -78.737 1.00 71.93 ? 346 PRO B CB  1 
ATOM   4696 C  CG  . PRO B 1 282 ? 29.359  -33.901 -77.926 1.00 71.96 ? 346 PRO B CG  1 
ATOM   4697 C  CD  . PRO B 1 282 ? 30.056  -34.258 -76.659 1.00 71.89 ? 346 PRO B CD  1 
ATOM   4698 N  N   . PHE B 1 283 ? 29.812  -30.715 -76.503 1.00 71.88 ? 347 PHE B N   1 
ATOM   4699 C  CA  . PHE B 1 283 ? 29.035  -29.489 -76.373 1.00 71.80 ? 347 PHE B CA  1 
ATOM   4700 C  C   . PHE B 1 283 ? 29.598  -28.576 -75.286 1.00 72.27 ? 347 PHE B C   1 
ATOM   4701 O  O   . PHE B 1 283 ? 29.479  -28.874 -74.099 1.00 72.32 ? 347 PHE B O   1 
ATOM   4702 C  CB  . PHE B 1 283 ? 27.566  -29.813 -76.084 1.00 71.46 ? 347 PHE B CB  1 
ATOM   4703 C  CG  . PHE B 1 283 ? 26.861  -30.588 -77.183 1.00 70.71 ? 347 PHE B CG  1 
ATOM   4704 C  CD1 . PHE B 1 283 ? 27.142  -30.358 -78.530 1.00 69.52 ? 347 PHE B CD1 1 
ATOM   4705 C  CD2 . PHE B 1 283 ? 25.870  -31.520 -76.861 1.00 69.71 ? 347 PHE B CD2 1 
ATOM   4706 C  CE1 . PHE B 1 283 ? 26.468  -31.067 -79.541 1.00 68.31 ? 347 PHE B CE1 1 
ATOM   4707 C  CE2 . PHE B 1 283 ? 25.190  -32.226 -77.861 1.00 69.10 ? 347 PHE B CE2 1 
ATOM   4708 C  CZ  . PHE B 1 283 ? 25.493  -31.998 -79.206 1.00 68.24 ? 347 PHE B CZ  1 
ATOM   4709 N  N   . ASP B 1 284 ? 30.204  -27.459 -75.691 1.00 72.82 ? 348 ASP B N   1 
ATOM   4710 C  CA  . ASP B 1 284 ? 30.817  -26.540 -74.727 1.00 73.17 ? 348 ASP B CA  1 
ATOM   4711 C  C   . ASP B 1 284 ? 29.758  -25.864 -73.865 1.00 73.06 ? 348 ASP B C   1 
ATOM   4712 O  O   . ASP B 1 284 ? 30.065  -25.308 -72.809 1.00 73.25 ? 348 ASP B O   1 
ATOM   4713 C  CB  . ASP B 1 284 ? 31.769  -25.521 -75.397 1.00 73.51 ? 348 ASP B CB  1 
ATOM   4714 C  CG  . ASP B 1 284 ? 31.077  -24.604 -76.442 1.00 75.28 ? 348 ASP B CG  1 
ATOM   4715 O  OD1 . ASP B 1 284 ? 29.840  -24.675 -76.664 1.00 76.01 ? 348 ASP B OD1 1 
ATOM   4716 O  OD2 . ASP B 1 284 ? 31.811  -23.794 -77.062 1.00 76.89 ? 348 ASP B OD2 1 
ATOM   4717 N  N   . PHE B 1 285 ? 28.506  -25.956 -74.311 1.00 72.92 ? 349 PHE B N   1 
ATOM   4718 C  CA  . PHE B 1 285 ? 27.374  -25.334 -73.623 1.00 72.68 ? 349 PHE B CA  1 
ATOM   4719 C  C   . PHE B 1 285 ? 26.673  -26.262 -72.616 1.00 72.13 ? 349 PHE B C   1 
ATOM   4720 O  O   . PHE B 1 285 ? 25.657  -25.881 -72.035 1.00 71.83 ? 349 PHE B O   1 
ATOM   4721 C  CB  . PHE B 1 285 ? 26.370  -24.767 -74.642 1.00 72.74 ? 349 PHE B CB  1 
ATOM   4722 C  CG  . PHE B 1 285 ? 25.831  -25.793 -75.597 1.00 73.79 ? 349 PHE B CG  1 
ATOM   4723 C  CD1 . PHE B 1 285 ? 24.696  -26.543 -75.272 1.00 74.18 ? 349 PHE B CD1 1 
ATOM   4724 C  CD2 . PHE B 1 285 ? 26.454  -26.016 -76.826 1.00 74.42 ? 349 PHE B CD2 1 
ATOM   4725 C  CE1 . PHE B 1 285 ? 24.189  -27.500 -76.152 1.00 73.76 ? 349 PHE B CE1 1 
ATOM   4726 C  CE2 . PHE B 1 285 ? 25.955  -26.977 -77.717 1.00 74.55 ? 349 PHE B CE2 1 
ATOM   4727 C  CZ  . PHE B 1 285 ? 24.817  -27.719 -77.374 1.00 74.34 ? 349 PHE B CZ  1 
ATOM   4728 N  N   . MET B 1 286 ? 27.218  -27.467 -72.424 1.00 71.69 ? 350 MET B N   1 
ATOM   4729 C  CA  . MET B 1 286 ? 26.743  -28.407 -71.394 1.00 71.39 ? 350 MET B CA  1 
ATOM   4730 C  C   . MET B 1 286 ? 27.819  -28.659 -70.322 1.00 71.80 ? 350 MET B C   1 
ATOM   4731 O  O   . MET B 1 286 ? 27.566  -28.936 -69.139 1.00 71.65 ? 350 MET B O   1 
ATOM   4732 C  CB  . MET B 1 286 ? 26.301  -29.745 -72.017 1.00 71.09 ? 350 MET B CB  1 
ATOM   4733 C  CG  . MET B 1 286 ? 25.098  -29.697 -72.982 1.00 68.89 ? 350 MET B CG  1 
ATOM   4734 S  SD  . MET B 1 286 ? 23.583  -28.885 -72.395 1.00 65.27 ? 350 MET B SD  1 
ATOM   4735 C  CE  . MET B 1 286 ? 22.956  -30.051 -71.195 1.00 63.84 ? 350 MET B CE  1 
ATOM   4736 O  OXT . MET B 1 286 ? 29.011  -28.588 -70.623 1.00 72.29 ? 350 MET B OXT 1 
HETATM 4737 MG MG  . MG  C 2 .   ? -5.176  -36.299 -65.195 1.00 63.54 ? 401 MG  A MG  1 
HETATM 4738 FE FE  . FE  D 3 .   ? -1.729  -31.733 -41.583 0.50 50.65 ? 402 FE  A FE  1 
HETATM 4739 MG MG  . MG  E 2 .   ? 14.051  -42.040 -38.340 1.00 68.48 ? 401 MG  B MG  1 
HETATM 4740 FE FE  . FE  F 3 .   ? 13.088  -36.071 -61.894 0.50 51.17 ? 402 FE  B FE  1 
HETATM 4741 O  O   . HOH G 4 .   ? -6.227  -27.198 -67.657 1.00 60.86 ? 501 HOH A O   1 
HETATM 4742 O  O   . HOH G 4 .   ? 17.800  -29.444 -21.458 1.00 47.69 ? 502 HOH A O   1 
HETATM 4743 O  O   . HOH G 4 .   ? -5.578  -48.141 -48.902 1.00 52.45 ? 503 HOH A O   1 
HETATM 4744 O  O   . HOH G 4 .   ? 0.279   -19.204 -32.469 1.00 43.40 ? 504 HOH A O   1 
HETATM 4745 O  O   . HOH G 4 .   ? 3.742   -30.368 -55.878 1.00 29.70 ? 505 HOH A O   1 
HETATM 4746 O  O   . HOH G 4 .   ? -24.965 -45.716 -39.087 1.00 57.99 ? 506 HOH A O   1 
HETATM 4747 O  O   . HOH G 4 .   ? 10.782  -30.960 -20.796 1.00 58.14 ? 507 HOH A O   1 
HETATM 4748 O  O   . HOH G 4 .   ? 10.491  -20.317 -46.179 1.00 40.90 ? 508 HOH A O   1 
HETATM 4749 O  O   . HOH G 4 .   ? 5.154   -20.635 -53.102 1.00 38.02 ? 509 HOH A O   1 
HETATM 4750 O  O   . HOH G 4 .   ? -9.702  -11.208 -23.521 1.00 61.38 ? 510 HOH A O   1 
HETATM 4751 O  O   . HOH G 4 .   ? -8.903  -54.058 -40.619 1.00 55.51 ? 511 HOH A O   1 
HETATM 4752 O  O   . HOH G 4 .   ? -3.707  -50.453 -28.305 1.00 60.69 ? 512 HOH A O   1 
HETATM 4753 O  O   . HOH G 4 .   ? -18.007 -30.903 -21.475 1.00 66.86 ? 513 HOH A O   1 
HETATM 4754 O  O   . HOH G 4 .   ? 14.915  -26.150 -21.007 1.00 49.07 ? 514 HOH A O   1 
HETATM 4755 O  O   . HOH G 4 .   ? -4.844  -46.470 -26.403 1.00 63.24 ? 515 HOH A O   1 
HETATM 4756 O  O   . HOH G 4 .   ? -4.042  -51.012 -44.164 1.00 60.09 ? 516 HOH A O   1 
HETATM 4757 O  O   . HOH G 4 .   ? -16.014 -40.148 -55.519 1.00 47.52 ? 517 HOH A O   1 
HETATM 4758 O  O   . HOH G 4 .   ? -6.298  -33.766 -46.272 1.00 46.80 ? 518 HOH A O   1 
HETATM 4759 O  O   . HOH G 4 .   ? 4.557   -14.848 -29.051 1.00 45.69 ? 519 HOH A O   1 
HETATM 4760 O  O   . HOH G 4 .   ? 3.263   -19.123 -45.597 1.00 47.54 ? 520 HOH A O   1 
HETATM 4761 O  O   . HOH G 4 .   ? 10.139  -28.711 -16.724 1.00 40.34 ? 521 HOH A O   1 
HETATM 4762 O  O   . HOH G 4 .   ? 17.503  -22.981 -33.615 1.00 46.15 ? 522 HOH A O   1 
HETATM 4763 O  O   . HOH G 4 .   ? 7.133   -40.990 -31.115 1.00 43.96 ? 523 HOH A O   1 
HETATM 4764 O  O   . HOH G 4 .   ? -24.098 -44.581 -49.163 1.00 64.06 ? 524 HOH A O   1 
HETATM 4765 O  O   . HOH G 4 .   ? -3.556  -34.834 -14.013 1.00 59.54 ? 525 HOH A O   1 
HETATM 4766 O  O   . HOH G 4 .   ? -13.148 -26.608 -36.870 1.00 42.43 ? 526 HOH A O   1 
HETATM 4767 O  O   . HOH G 4 .   ? -18.635 -54.918 -54.018 1.00 65.00 ? 527 HOH A O   1 
HETATM 4768 O  O   . HOH G 4 .   ? 3.357   -24.515 -59.990 1.00 42.45 ? 528 HOH A O   1 
HETATM 4769 O  O   . HOH G 4 .   ? -4.240  -31.046 -28.867 1.00 38.23 ? 529 HOH A O   1 
HETATM 4770 O  O   . HOH H 4 .   ? 4.178   -15.357 -67.868 1.00 51.37 ? 501 HOH B O   1 
HETATM 4771 O  O   . HOH H 4 .   ? 8.936   -41.104 -43.856 1.00 56.83 ? 502 HOH B O   1 
HETATM 4772 O  O   . HOH H 4 .   ? 8.235   -50.904 -76.598 1.00 59.99 ? 503 HOH B O   1 
HETATM 4773 O  O   . HOH H 4 .   ? 8.287   -19.745 -57.072 1.00 53.42 ? 504 HOH B O   1 
HETATM 4774 O  O   . HOH H 4 .   ? 9.338   -34.454 -48.051 1.00 35.35 ? 505 HOH B O   1 
HETATM 4775 O  O   . HOH H 4 .   ? 8.263   -51.749 -54.454 1.00 63.96 ? 506 HOH B O   1 
HETATM 4776 O  O   . HOH H 4 .   ? 19.288  -34.444 -35.869 1.00 52.27 ? 507 HOH B O   1 
HETATM 4777 O  O   . HOH H 4 .   ? 12.899  -28.682 -69.440 1.00 47.46 ? 508 HOH B O   1 
HETATM 4778 O  O   . HOH H 4 .   ? 25.488  -51.169 -78.372 1.00 71.48 ? 509 HOH B O   1 
HETATM 4779 O  O   . HOH H 4 .   ? 16.918  -59.089 -61.372 1.00 71.14 ? 510 HOH B O   1 
HETATM 4780 O  O   . HOH H 4 .   ? 19.588  -31.944 -36.974 1.00 52.69 ? 511 HOH B O   1 
HETATM 4781 O  O   . HOH H 4 .   ? 26.686  -44.222 -83.866 1.00 72.75 ? 512 HOH B O   1 
HETATM 4782 O  O   . HOH H 4 .   ? 15.255  -22.875 -57.891 1.00 54.55 ? 513 HOH B O   1 
HETATM 4783 O  O   . HOH H 4 .   ? 27.572  -45.188 -81.361 1.00 64.09 ? 514 HOH B O   1 
HETATM 4784 O  O   . HOH H 4 .   ? 12.814  -26.682 -43.436 1.00 42.23 ? 515 HOH B O   1 
HETATM 4785 O  O   . HOH H 4 .   ? 2.164   -28.525 -60.078 1.00 42.21 ? 516 HOH B O   1 
HETATM 4786 O  O   . HOH H 4 .   ? 11.455  -31.436 -43.636 1.00 40.75 ? 517 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   65  65  MET MET A . n 
A 1 2   GLY 2   66  66  GLY GLY A . n 
A 1 3   VAL 3   67  67  VAL VAL A . n 
A 1 4   GLU 4   68  68  GLU GLU A . n 
A 1 5   ASP 5   69  69  ASP ASP A . n 
A 1 6   GLU 6   70  70  GLU GLU A . n 
A 1 7   PRO 7   71  71  PRO PRO A . n 
A 1 8   LEU 8   72  72  LEU LEU A . n 
A 1 9   LEU 9   73  73  LEU LEU A . n 
A 1 10  ARG 10  74  74  ARG ARG A . n 
A 1 11  GLU 11  75  75  GLU GLU A . n 
A 1 12  ASN 12  76  76  ASN ASN A . n 
A 1 13  PRO 13  77  77  PRO PRO A . n 
A 1 14  ARG 14  78  78  ARG ARG A . n 
A 1 15  ARG 15  79  79  ARG ARG A . n 
A 1 16  PHE 16  80  80  PHE PHE A . n 
A 1 17  VAL 17  81  81  VAL VAL A . n 
A 1 18  ILE 18  82  82  ILE ILE A . n 
A 1 19  PHE 19  83  83  PHE PHE A . n 
A 1 20  PRO 20  84  84  PRO PRO A . n 
A 1 21  ILE 21  85  85  ILE ILE A . n 
A 1 22  GLU 22  86  86  GLU GLU A . n 
A 1 23  TYR 23  87  87  TYR TYR A . n 
A 1 24  HIS 24  88  88  HIS HIS A . n 
A 1 25  ASP 25  89  89  ASP ASP A . n 
A 1 26  ILE 26  90  90  ILE ILE A . n 
A 1 27  TRP 27  91  91  TRP TRP A . n 
A 1 28  GLN 28  92  92  GLN GLN A . n 
A 1 29  MET 29  93  93  MET MET A . n 
A 1 30  TYR 30  94  94  TYR TYR A . n 
A 1 31  LYS 31  95  95  LYS LYS A . n 
A 1 32  LYS 32  96  96  LYS LYS A . n 
A 1 33  ALA 33  97  97  ALA ALA A . n 
A 1 34  GLU 34  98  98  GLU GLU A . n 
A 1 35  ALA 35  99  99  ALA ALA A . n 
A 1 36  SER 36  100 100 SER SER A . n 
A 1 37  PHE 37  101 101 PHE PHE A . n 
A 1 38  TRP 38  102 102 TRP TRP A . n 
A 1 39  THR 39  103 103 THR THR A . n 
A 1 40  ALA 40  104 104 ALA ALA A . n 
A 1 41  GLU 41  105 105 GLU GLU A . n 
A 1 42  ALA 42  106 106 ALA ALA A . n 
A 1 43  VAL 43  107 107 VAL VAL A . n 
A 1 44  ASP 44  108 108 ASP ASP A . n 
A 1 45  LEU 45  109 109 LEU LEU A . n 
A 1 46  SER 46  110 110 SER SER A . n 
A 1 47  LYS 47  111 111 LYS LYS A . n 
A 1 48  ASP 48  112 112 ASP ASP A . n 
A 1 49  ILE 49  113 113 ILE ILE A . n 
A 1 50  GLN 50  114 114 GLN GLN A . n 
A 1 51  HIS 51  115 115 HIS HIS A . n 
A 1 52  TRP 52  116 116 TRP TRP A . n 
A 1 53  GLU 53  117 117 GLU GLU A . n 
A 1 54  SER 54  118 118 SER SER A . n 
A 1 55  LEU 55  119 119 LEU LEU A . n 
A 1 56  LYS 56  120 120 LYS LYS A . n 
A 1 57  PRO 57  121 121 PRO PRO A . n 
A 1 58  GLU 58  122 122 GLU GLU A . n 
A 1 59  GLU 59  123 123 GLU GLU A . n 
A 1 60  ARG 60  124 124 ARG ARG A . n 
A 1 61  TYR 61  125 125 TYR TYR A . n 
A 1 62  PHE 62  126 126 PHE PHE A . n 
A 1 63  ILE 63  127 127 ILE ILE A . n 
A 1 64  SER 64  128 128 SER SER A . n 
A 1 65  HIS 65  129 129 HIS HIS A . n 
A 1 66  VAL 66  130 130 VAL VAL A . n 
A 1 67  LEU 67  131 131 LEU LEU A . n 
A 1 68  ALA 68  132 132 ALA ALA A . n 
A 1 69  PHE 69  133 133 PHE PHE A . n 
A 1 70  PHE 70  134 134 PHE PHE A . n 
A 1 71  ALA 71  135 135 ALA ALA A . n 
A 1 72  ALA 72  136 136 ALA ALA A . n 
A 1 73  SER 73  137 137 SER SER A . n 
A 1 74  ASP 74  138 138 ASP ASP A . n 
A 1 75  GLY 75  139 139 GLY GLY A . n 
A 1 76  ILE 76  140 140 ILE ILE A . n 
A 1 77  VAL 77  141 141 VAL VAL A . n 
A 1 78  ASN 78  142 142 ASN ASN A . n 
A 1 79  GLU 79  143 143 GLU GLU A . n 
A 1 80  ASN 80  144 144 ASN ASN A . n 
A 1 81  LEU 81  145 145 LEU LEU A . n 
A 1 82  VAL 82  146 146 VAL VAL A . n 
A 1 83  GLU 83  147 147 GLU GLU A . n 
A 1 84  ARG 84  148 148 ARG ARG A . n 
A 1 85  PHE 85  149 149 PHE PHE A . n 
A 1 86  SER 86  150 150 SER SER A . n 
A 1 87  GLN 87  151 151 GLN GLN A . n 
A 1 88  GLU 88  152 152 GLU GLU A . n 
A 1 89  VAL 89  153 153 VAL VAL A . n 
A 1 90  GLN 90  154 154 GLN GLN A . n 
A 1 91  ILE 91  155 155 ILE ILE A . n 
A 1 92  THR 92  156 156 THR THR A . n 
A 1 93  GLU 93  157 157 GLU GLU A . n 
A 1 94  ALA 94  158 158 ALA ALA A . n 
A 1 95  ARG 95  159 159 ARG ARG A . n 
A 1 96  CYS 96  160 160 CYS CYS A . n 
A 1 97  PHE 97  161 161 PHE PHE A . n 
A 1 98  TYR 98  162 162 TYR TYR A . n 
A 1 99  GLY 99  163 163 GLY GLY A . n 
A 1 100 PHE 100 164 164 PHE PHE A . n 
A 1 101 GLN 101 165 165 GLN GLN A . n 
A 1 102 ILE 102 166 166 ILE ILE A . n 
A 1 103 ALA 103 167 167 ALA ALA A . n 
A 1 104 MET 104 168 168 MET MET A . n 
A 1 105 GLU 105 169 169 GLU GLU A . n 
A 1 106 ASN 106 170 170 ASN ASN A . n 
A 1 107 ILE 107 171 171 ILE ILE A . n 
A 1 108 HIS 108 172 172 HIS HIS A . n 
A 1 109 SER 109 173 173 SER SER A . n 
A 1 110 GLU 110 174 174 GLU GLU A . n 
A 1 111 MET 111 175 175 MET MET A . n 
A 1 112 TYR 112 176 176 TYR TYR A . n 
A 1 113 SER 113 177 177 SER SER A . n 
A 1 114 LEU 114 178 178 LEU LEU A . n 
A 1 115 LEU 115 179 179 LEU LEU A . n 
A 1 116 ILE 116 180 180 ILE ILE A . n 
A 1 117 ASP 117 181 181 ASP ASP A . n 
A 1 118 THR 118 182 182 THR THR A . n 
A 1 119 TYR 119 183 183 TYR TYR A . n 
A 1 120 ILE 120 184 184 ILE ILE A . n 
A 1 121 LYS 121 185 185 LYS LYS A . n 
A 1 122 ASP 122 186 186 ASP ASP A . n 
A 1 123 PRO 123 187 187 PRO PRO A . n 
A 1 124 LYS 124 188 188 LYS LYS A . n 
A 1 125 GLU 125 189 189 GLU GLU A . n 
A 1 126 ARG 126 190 190 ARG ARG A . n 
A 1 127 GLU 127 191 191 GLU GLU A . n 
A 1 128 PHE 128 192 192 PHE PHE A . n 
A 1 129 LEU 129 193 193 LEU LEU A . n 
A 1 130 PHE 130 194 194 PHE PHE A . n 
A 1 131 ASN 131 195 195 ASN ASN A . n 
A 1 132 ALA 132 196 196 ALA ALA A . n 
A 1 133 ILE 133 197 197 ILE ILE A . n 
A 1 134 GLU 134 198 198 GLU GLU A . n 
A 1 135 THR 135 199 199 THR THR A . n 
A 1 136 MET 136 200 200 MET MET A . n 
A 1 137 PRO 137 201 201 PRO PRO A . n 
A 1 138 CYS 138 202 202 CYS CYS A . n 
A 1 139 VAL 139 203 203 VAL VAL A . n 
A 1 140 LYS 140 204 204 LYS LYS A . n 
A 1 141 LYS 141 205 205 LYS LYS A . n 
A 1 142 LYS 142 206 206 LYS LYS A . n 
A 1 143 ALA 143 207 207 ALA ALA A . n 
A 1 144 ASP 144 208 208 ASP ASP A . n 
A 1 145 TRP 145 209 209 TRP TRP A . n 
A 1 146 ALA 146 210 210 ALA ALA A . n 
A 1 147 LEU 147 211 211 LEU LEU A . n 
A 1 148 ARG 148 212 212 ARG ARG A . n 
A 1 149 TRP 149 213 213 TRP TRP A . n 
A 1 150 ILE 150 214 214 ILE ILE A . n 
A 1 151 GLY 151 215 215 GLY GLY A . n 
A 1 152 ASP 152 216 216 ASP ASP A . n 
A 1 153 LYS 153 217 217 LYS LYS A . n 
A 1 154 GLU 154 218 218 GLU GLU A . n 
A 1 155 ALA 155 219 219 ALA ALA A . n 
A 1 156 THR 156 220 220 THR THR A . n 
A 1 157 TYR 157 221 221 TYR TYR A . n 
A 1 158 GLY 158 222 222 GLY GLY A . n 
A 1 159 GLU 159 223 223 GLU GLU A . n 
A 1 160 ARG 160 224 224 ARG ARG A . n 
A 1 161 VAL 161 225 225 VAL VAL A . n 
A 1 162 VAL 162 226 226 VAL VAL A . n 
A 1 163 ALA 163 227 227 ALA ALA A . n 
A 1 164 PHE 164 228 228 PHE PHE A . n 
A 1 165 ALA 165 229 229 ALA ALA A . n 
A 1 166 ALA 166 230 230 ALA ALA A . n 
A 1 167 VAL 167 231 231 VAL VAL A . n 
A 1 168 GLU 168 232 232 GLU GLU A . n 
A 1 169 GLY 169 233 233 GLY GLY A . n 
A 1 170 ILE 170 234 234 ILE ILE A . n 
A 1 171 PHE 171 235 235 PHE PHE A . n 
A 1 172 PHE 172 236 236 PHE PHE A . n 
A 1 173 SER 173 237 237 SER SER A . n 
A 1 174 GLY 174 238 238 GLY GLY A . n 
A 1 175 SER 175 239 239 SER SER A . n 
A 1 176 PHE 176 240 240 PHE PHE A . n 
A 1 177 ALA 177 241 241 ALA ALA A . n 
A 1 178 SER 178 242 242 SER SER A . n 
A 1 179 ILE 179 243 243 ILE ILE A . n 
A 1 180 PHE 180 244 244 PHE PHE A . n 
A 1 181 TRP 181 245 245 TRP TRP A . n 
A 1 182 LEU 182 246 246 LEU LEU A . n 
A 1 183 LYS 183 247 247 LYS LYS A . n 
A 1 184 LYS 184 248 248 LYS LYS A . n 
A 1 185 ARG 185 249 249 ARG ARG A . n 
A 1 186 GLY 186 250 250 GLY GLY A . n 
A 1 187 LEU 187 251 251 LEU LEU A . n 
A 1 188 MET 188 252 252 MET MET A . n 
A 1 189 PRO 189 253 253 PRO PRO A . n 
A 1 190 GLY 190 254 254 GLY GLY A . n 
A 1 191 LEU 191 255 255 LEU LEU A . n 
A 1 192 THR 192 256 256 THR THR A . n 
A 1 193 PHE 193 257 257 PHE PHE A . n 
A 1 194 SER 194 258 258 SER SER A . n 
A 1 195 ASN 195 259 259 ASN ASN A . n 
A 1 196 GLU 196 260 260 GLU GLU A . n 
A 1 197 LEU 197 261 261 LEU LEU A . n 
A 1 198 ILE 198 262 262 ILE ILE A . n 
A 1 199 SER 199 263 263 SER SER A . n 
A 1 200 ARG 200 264 264 ARG ARG A . n 
A 1 201 ASP 201 265 265 ASP ASP A . n 
A 1 202 GLU 202 266 266 GLU GLU A . n 
A 1 203 GLY 203 267 267 GLY GLY A . n 
A 1 204 LEU 204 268 268 LEU LEU A . n 
A 1 205 HIS 205 269 269 HIS HIS A . n 
A 1 206 CYS 206 270 270 CYS CYS A . n 
A 1 207 ASP 207 271 271 ASP ASP A . n 
A 1 208 PHE 208 272 272 PHE PHE A . n 
A 1 209 ALA 209 273 273 ALA ALA A . n 
A 1 210 CYS 210 274 274 CYS CYS A . n 
A 1 211 LEU 211 275 275 LEU LEU A . n 
A 1 212 MET 212 276 276 MET MET A . n 
A 1 213 PHE 213 277 277 PHE PHE A . n 
A 1 214 LYS 214 278 278 LYS LYS A . n 
A 1 215 HIS 215 279 279 HIS HIS A . n 
A 1 216 LEU 216 280 280 LEU LEU A . n 
A 1 217 VAL 217 281 281 VAL VAL A . n 
A 1 218 HIS 218 282 282 HIS HIS A . n 
A 1 219 LYS 219 283 283 LYS LYS A . n 
A 1 220 PRO 220 284 284 PRO PRO A . n 
A 1 221 SER 221 285 285 SER SER A . n 
A 1 222 GLU 222 286 286 GLU GLU A . n 
A 1 223 GLU 223 287 287 GLU GLU A . n 
A 1 224 ARG 224 288 288 ARG ARG A . n 
A 1 225 VAL 225 289 289 VAL VAL A . n 
A 1 226 ARG 226 290 290 ARG ARG A . n 
A 1 227 GLU 227 291 291 GLU GLU A . n 
A 1 228 ILE 228 292 292 ILE ILE A . n 
A 1 229 ILE 229 293 293 ILE ILE A . n 
A 1 230 ILE 230 294 294 ILE ILE A . n 
A 1 231 ASN 231 295 295 ASN ASN A . n 
A 1 232 ALA 232 296 296 ALA ALA A . n 
A 1 233 VAL 233 297 297 VAL VAL A . n 
A 1 234 ARG 234 298 298 ARG ARG A . n 
A 1 235 ILE 235 299 299 ILE ILE A . n 
A 1 236 GLU 236 300 300 GLU GLU A . n 
A 1 237 GLN 237 301 301 GLN GLN A . n 
A 1 238 GLU 238 302 302 GLU GLU A . n 
A 1 239 PHE 239 303 303 PHE PHE A . n 
A 1 240 LEU 240 304 304 LEU LEU A . n 
A 1 241 THR 241 305 305 THR THR A . n 
A 1 242 GLU 242 306 306 GLU GLU A . n 
A 1 243 ALA 243 307 307 ALA ALA A . n 
A 1 244 LEU 244 308 308 LEU LEU A . n 
A 1 245 PRO 245 309 309 PRO PRO A . n 
A 1 246 VAL 246 310 310 VAL VAL A . n 
A 1 247 LYS 247 311 311 LYS LYS A . n 
A 1 248 LEU 248 312 312 LEU LEU A . n 
A 1 249 ILE 249 313 313 ILE ILE A . n 
A 1 250 GLY 250 314 314 GLY GLY A . n 
A 1 251 MET 251 315 315 MET MET A . n 
A 1 252 ASN 252 316 316 ASN ASN A . n 
A 1 253 CYS 253 317 317 CYS CYS A . n 
A 1 254 THR 254 318 318 THR THR A . n 
A 1 255 LEU 255 319 319 LEU LEU A . n 
A 1 256 MET 256 320 320 MET MET A . n 
A 1 257 LYS 257 321 321 LYS LYS A . n 
A 1 258 GLN 258 322 322 GLN GLN A . n 
A 1 259 TYR 259 323 323 TYR TYR A . n 
A 1 260 ILE 260 324 324 ILE ILE A . n 
A 1 261 GLU 261 325 325 GLU GLU A . n 
A 1 262 PHE 262 326 326 PHE PHE A . n 
A 1 263 VAL 263 327 327 VAL VAL A . n 
A 1 264 ALA 264 328 328 ALA ALA A . n 
A 1 265 ASP 265 329 329 ASP ASP A . n 
A 1 266 ARG 266 330 330 ARG ARG A . n 
A 1 267 LEU 267 331 331 LEU LEU A . n 
A 1 268 MET 268 332 332 MET MET A . n 
A 1 269 LEU 269 333 333 LEU LEU A . n 
A 1 270 GLU 270 334 334 GLU GLU A . n 
A 1 271 LEU 271 335 335 LEU LEU A . n 
A 1 272 GLY 272 336 336 GLY GLY A . n 
A 1 273 PHE 273 337 337 PHE PHE A . n 
A 1 274 SER 274 338 338 SER SER A . n 
A 1 275 LYS 275 339 339 LYS LYS A . n 
A 1 276 VAL 276 340 340 VAL VAL A . n 
A 1 277 PHE 277 341 341 PHE PHE A . n 
A 1 278 ARG 278 342 342 ARG ARG A . n 
A 1 279 VAL 279 343 343 VAL VAL A . n 
A 1 280 GLU 280 344 344 GLU GLU A . n 
A 1 281 ASN 281 345 345 ASN ASN A . n 
A 1 282 PRO 282 346 346 PRO PRO A . n 
A 1 283 PHE 283 347 347 PHE PHE A . n 
A 1 284 ASP 284 348 348 ASP ASP A . n 
A 1 285 PHE 285 349 349 PHE PHE A . n 
A 1 286 MET 286 350 350 MET MET A . n 
B 1 1   MET 1   65  65  MET MET B . n 
B 1 2   GLY 2   66  66  GLY GLY B . n 
B 1 3   VAL 3   67  67  VAL VAL B . n 
B 1 4   GLU 4   68  68  GLU GLU B . n 
B 1 5   ASP 5   69  69  ASP ASP B . n 
B 1 6   GLU 6   70  70  GLU GLU B . n 
B 1 7   PRO 7   71  71  PRO PRO B . n 
B 1 8   LEU 8   72  72  LEU LEU B . n 
B 1 9   LEU 9   73  73  LEU LEU B . n 
B 1 10  ARG 10  74  74  ARG ARG B . n 
B 1 11  GLU 11  75  75  GLU GLU B . n 
B 1 12  ASN 12  76  76  ASN ASN B . n 
B 1 13  PRO 13  77  77  PRO PRO B . n 
B 1 14  ARG 14  78  78  ARG ARG B . n 
B 1 15  ARG 15  79  79  ARG ARG B . n 
B 1 16  PHE 16  80  80  PHE PHE B . n 
B 1 17  VAL 17  81  81  VAL VAL B . n 
B 1 18  ILE 18  82  82  ILE ILE B . n 
B 1 19  PHE 19  83  83  PHE PHE B . n 
B 1 20  PRO 20  84  84  PRO PRO B . n 
B 1 21  ILE 21  85  85  ILE ILE B . n 
B 1 22  GLU 22  86  86  GLU GLU B . n 
B 1 23  TYR 23  87  87  TYR TYR B . n 
B 1 24  HIS 24  88  88  HIS HIS B . n 
B 1 25  ASP 25  89  89  ASP ASP B . n 
B 1 26  ILE 26  90  90  ILE ILE B . n 
B 1 27  TRP 27  91  91  TRP TRP B . n 
B 1 28  GLN 28  92  92  GLN GLN B . n 
B 1 29  MET 29  93  93  MET MET B . n 
B 1 30  TYR 30  94  94  TYR TYR B . n 
B 1 31  LYS 31  95  95  LYS LYS B . n 
B 1 32  LYS 32  96  96  LYS LYS B . n 
B 1 33  ALA 33  97  97  ALA ALA B . n 
B 1 34  GLU 34  98  98  GLU GLU B . n 
B 1 35  ALA 35  99  99  ALA ALA B . n 
B 1 36  SER 36  100 100 SER SER B . n 
B 1 37  PHE 37  101 101 PHE PHE B . n 
B 1 38  TRP 38  102 102 TRP TRP B . n 
B 1 39  THR 39  103 103 THR THR B . n 
B 1 40  ALA 40  104 104 ALA ALA B . n 
B 1 41  GLU 41  105 105 GLU GLU B . n 
B 1 42  ALA 42  106 106 ALA ALA B . n 
B 1 43  VAL 43  107 107 VAL VAL B . n 
B 1 44  ASP 44  108 108 ASP ASP B . n 
B 1 45  LEU 45  109 109 LEU LEU B . n 
B 1 46  SER 46  110 110 SER SER B . n 
B 1 47  LYS 47  111 111 LYS LYS B . n 
B 1 48  ASP 48  112 112 ASP ASP B . n 
B 1 49  ILE 49  113 113 ILE ILE B . n 
B 1 50  GLN 50  114 114 GLN GLN B . n 
B 1 51  HIS 51  115 115 HIS HIS B . n 
B 1 52  TRP 52  116 116 TRP TRP B . n 
B 1 53  GLU 53  117 117 GLU GLU B . n 
B 1 54  SER 54  118 118 SER SER B . n 
B 1 55  LEU 55  119 119 LEU LEU B . n 
B 1 56  LYS 56  120 120 LYS LYS B . n 
B 1 57  PRO 57  121 121 PRO PRO B . n 
B 1 58  GLU 58  122 122 GLU GLU B . n 
B 1 59  GLU 59  123 123 GLU GLU B . n 
B 1 60  ARG 60  124 124 ARG ARG B . n 
B 1 61  TYR 61  125 125 TYR TYR B . n 
B 1 62  PHE 62  126 126 PHE PHE B . n 
B 1 63  ILE 63  127 127 ILE ILE B . n 
B 1 64  SER 64  128 128 SER SER B . n 
B 1 65  HIS 65  129 129 HIS HIS B . n 
B 1 66  VAL 66  130 130 VAL VAL B . n 
B 1 67  LEU 67  131 131 LEU LEU B . n 
B 1 68  ALA 68  132 132 ALA ALA B . n 
B 1 69  PHE 69  133 133 PHE PHE B . n 
B 1 70  PHE 70  134 134 PHE PHE B . n 
B 1 71  ALA 71  135 135 ALA ALA B . n 
B 1 72  ALA 72  136 136 ALA ALA B . n 
B 1 73  SER 73  137 137 SER SER B . n 
B 1 74  ASP 74  138 138 ASP ASP B . n 
B 1 75  GLY 75  139 139 GLY GLY B . n 
B 1 76  ILE 76  140 140 ILE ILE B . n 
B 1 77  VAL 77  141 141 VAL VAL B . n 
B 1 78  ASN 78  142 142 ASN ASN B . n 
B 1 79  GLU 79  143 143 GLU GLU B . n 
B 1 80  ASN 80  144 144 ASN ASN B . n 
B 1 81  LEU 81  145 145 LEU LEU B . n 
B 1 82  VAL 82  146 146 VAL VAL B . n 
B 1 83  GLU 83  147 147 GLU GLU B . n 
B 1 84  ARG 84  148 148 ARG ARG B . n 
B 1 85  PHE 85  149 149 PHE PHE B . n 
B 1 86  SER 86  150 150 SER SER B . n 
B 1 87  GLN 87  151 151 GLN GLN B . n 
B 1 88  GLU 88  152 152 GLU GLU B . n 
B 1 89  VAL 89  153 153 VAL VAL B . n 
B 1 90  GLN 90  154 154 GLN GLN B . n 
B 1 91  ILE 91  155 155 ILE ILE B . n 
B 1 92  THR 92  156 156 THR THR B . n 
B 1 93  GLU 93  157 157 GLU GLU B . n 
B 1 94  ALA 94  158 158 ALA ALA B . n 
B 1 95  ARG 95  159 159 ARG ARG B . n 
B 1 96  CYS 96  160 160 CYS CYS B . n 
B 1 97  PHE 97  161 161 PHE PHE B . n 
B 1 98  TYR 98  162 162 TYR TYR B . n 
B 1 99  GLY 99  163 163 GLY GLY B . n 
B 1 100 PHE 100 164 164 PHE PHE B . n 
B 1 101 GLN 101 165 165 GLN GLN B . n 
B 1 102 ILE 102 166 166 ILE ILE B . n 
B 1 103 ALA 103 167 167 ALA ALA B . n 
B 1 104 MET 104 168 168 MET MET B . n 
B 1 105 GLU 105 169 169 GLU GLU B . n 
B 1 106 ASN 106 170 170 ASN ASN B . n 
B 1 107 ILE 107 171 171 ILE ILE B . n 
B 1 108 HIS 108 172 172 HIS HIS B . n 
B 1 109 SER 109 173 173 SER SER B . n 
B 1 110 GLU 110 174 174 GLU GLU B . n 
B 1 111 MET 111 175 175 MET MET B . n 
B 1 112 TYR 112 176 176 TYR TYR B . n 
B 1 113 SER 113 177 177 SER SER B . n 
B 1 114 LEU 114 178 178 LEU LEU B . n 
B 1 115 LEU 115 179 179 LEU LEU B . n 
B 1 116 ILE 116 180 180 ILE ILE B . n 
B 1 117 ASP 117 181 181 ASP ASP B . n 
B 1 118 THR 118 182 182 THR THR B . n 
B 1 119 TYR 119 183 183 TYR TYR B . n 
B 1 120 ILE 120 184 184 ILE ILE B . n 
B 1 121 LYS 121 185 185 LYS LYS B . n 
B 1 122 ASP 122 186 186 ASP ASP B . n 
B 1 123 PRO 123 187 187 PRO PRO B . n 
B 1 124 LYS 124 188 188 LYS LYS B . n 
B 1 125 GLU 125 189 189 GLU GLU B . n 
B 1 126 ARG 126 190 190 ARG ARG B . n 
B 1 127 GLU 127 191 191 GLU GLU B . n 
B 1 128 PHE 128 192 192 PHE PHE B . n 
B 1 129 LEU 129 193 193 LEU LEU B . n 
B 1 130 PHE 130 194 194 PHE PHE B . n 
B 1 131 ASN 131 195 195 ASN ASN B . n 
B 1 132 ALA 132 196 196 ALA ALA B . n 
B 1 133 ILE 133 197 197 ILE ILE B . n 
B 1 134 GLU 134 198 198 GLU GLU B . n 
B 1 135 THR 135 199 199 THR THR B . n 
B 1 136 MET 136 200 200 MET MET B . n 
B 1 137 PRO 137 201 201 PRO PRO B . n 
B 1 138 CYS 138 202 202 CYS CYS B . n 
B 1 139 VAL 139 203 203 VAL VAL B . n 
B 1 140 LYS 140 204 204 LYS LYS B . n 
B 1 141 LYS 141 205 205 LYS LYS B . n 
B 1 142 LYS 142 206 206 LYS LYS B . n 
B 1 143 ALA 143 207 207 ALA ALA B . n 
B 1 144 ASP 144 208 208 ASP ASP B . n 
B 1 145 TRP 145 209 209 TRP TRP B . n 
B 1 146 ALA 146 210 210 ALA ALA B . n 
B 1 147 LEU 147 211 211 LEU LEU B . n 
B 1 148 ARG 148 212 212 ARG ARG B . n 
B 1 149 TRP 149 213 213 TRP TRP B . n 
B 1 150 ILE 150 214 214 ILE ILE B . n 
B 1 151 GLY 151 215 215 GLY GLY B . n 
B 1 152 ASP 152 216 216 ASP ASP B . n 
B 1 153 LYS 153 217 217 LYS LYS B . n 
B 1 154 GLU 154 218 218 GLU GLU B . n 
B 1 155 ALA 155 219 219 ALA ALA B . n 
B 1 156 THR 156 220 220 THR THR B . n 
B 1 157 TYR 157 221 221 TYR TYR B . n 
B 1 158 GLY 158 222 222 GLY GLY B . n 
B 1 159 GLU 159 223 223 GLU GLU B . n 
B 1 160 ARG 160 224 224 ARG ARG B . n 
B 1 161 VAL 161 225 225 VAL VAL B . n 
B 1 162 VAL 162 226 226 VAL VAL B . n 
B 1 163 ALA 163 227 227 ALA ALA B . n 
B 1 164 PHE 164 228 228 PHE PHE B . n 
B 1 165 ALA 165 229 229 ALA ALA B . n 
B 1 166 ALA 166 230 230 ALA ALA B . n 
B 1 167 VAL 167 231 231 VAL VAL B . n 
B 1 168 GLU 168 232 232 GLU GLU B . n 
B 1 169 GLY 169 233 233 GLY GLY B . n 
B 1 170 ILE 170 234 234 ILE ILE B . n 
B 1 171 PHE 171 235 235 PHE PHE B . n 
B 1 172 PHE 172 236 236 PHE PHE B . n 
B 1 173 SER 173 237 237 SER SER B . n 
B 1 174 GLY 174 238 238 GLY GLY B . n 
B 1 175 SER 175 239 239 SER SER B . n 
B 1 176 PHE 176 240 240 PHE PHE B . n 
B 1 177 ALA 177 241 241 ALA ALA B . n 
B 1 178 SER 178 242 242 SER SER B . n 
B 1 179 ILE 179 243 243 ILE ILE B . n 
B 1 180 PHE 180 244 244 PHE PHE B . n 
B 1 181 TRP 181 245 245 TRP TRP B . n 
B 1 182 LEU 182 246 246 LEU LEU B . n 
B 1 183 LYS 183 247 247 LYS LYS B . n 
B 1 184 LYS 184 248 248 LYS LYS B . n 
B 1 185 ARG 185 249 249 ARG ARG B . n 
B 1 186 GLY 186 250 250 GLY GLY B . n 
B 1 187 LEU 187 251 251 LEU LEU B . n 
B 1 188 MET 188 252 252 MET MET B . n 
B 1 189 PRO 189 253 253 PRO PRO B . n 
B 1 190 GLY 190 254 254 GLY GLY B . n 
B 1 191 LEU 191 255 255 LEU LEU B . n 
B 1 192 THR 192 256 256 THR THR B . n 
B 1 193 PHE 193 257 257 PHE PHE B . n 
B 1 194 SER 194 258 258 SER SER B . n 
B 1 195 ASN 195 259 259 ASN ASN B . n 
B 1 196 GLU 196 260 260 GLU GLU B . n 
B 1 197 LEU 197 261 261 LEU LEU B . n 
B 1 198 ILE 198 262 262 ILE ILE B . n 
B 1 199 SER 199 263 263 SER SER B . n 
B 1 200 ARG 200 264 264 ARG ARG B . n 
B 1 201 ASP 201 265 265 ASP ASP B . n 
B 1 202 GLU 202 266 266 GLU GLU B . n 
B 1 203 GLY 203 267 267 GLY GLY B . n 
B 1 204 LEU 204 268 268 LEU LEU B . n 
B 1 205 HIS 205 269 269 HIS HIS B . n 
B 1 206 CYS 206 270 270 CYS CYS B . n 
B 1 207 ASP 207 271 271 ASP ASP B . n 
B 1 208 PHE 208 272 272 PHE PHE B . n 
B 1 209 ALA 209 273 273 ALA ALA B . n 
B 1 210 CYS 210 274 274 CYS CYS B . n 
B 1 211 LEU 211 275 275 LEU LEU B . n 
B 1 212 MET 212 276 276 MET MET B . n 
B 1 213 PHE 213 277 277 PHE PHE B . n 
B 1 214 LYS 214 278 278 LYS LYS B . n 
B 1 215 HIS 215 279 279 HIS HIS B . n 
B 1 216 LEU 216 280 280 LEU LEU B . n 
B 1 217 VAL 217 281 281 VAL VAL B . n 
B 1 218 HIS 218 282 282 HIS HIS B . n 
B 1 219 LYS 219 283 283 LYS LYS B . n 
B 1 220 PRO 220 284 284 PRO PRO B . n 
B 1 221 SER 221 285 285 SER SER B . n 
B 1 222 GLU 222 286 286 GLU GLU B . n 
B 1 223 GLU 223 287 287 GLU GLU B . n 
B 1 224 ARG 224 288 288 ARG ARG B . n 
B 1 225 VAL 225 289 289 VAL VAL B . n 
B 1 226 ARG 226 290 290 ARG ARG B . n 
B 1 227 GLU 227 291 291 GLU GLU B . n 
B 1 228 ILE 228 292 292 ILE ILE B . n 
B 1 229 ILE 229 293 293 ILE ILE B . n 
B 1 230 ILE 230 294 294 ILE ILE B . n 
B 1 231 ASN 231 295 295 ASN ASN B . n 
B 1 232 ALA 232 296 296 ALA ALA B . n 
B 1 233 VAL 233 297 297 VAL VAL B . n 
B 1 234 ARG 234 298 298 ARG ARG B . n 
B 1 235 ILE 235 299 299 ILE ILE B . n 
B 1 236 GLU 236 300 300 GLU GLU B . n 
B 1 237 GLN 237 301 301 GLN GLN B . n 
B 1 238 GLU 238 302 302 GLU GLU B . n 
B 1 239 PHE 239 303 303 PHE PHE B . n 
B 1 240 LEU 240 304 304 LEU LEU B . n 
B 1 241 THR 241 305 305 THR THR B . n 
B 1 242 GLU 242 306 306 GLU GLU B . n 
B 1 243 ALA 243 307 307 ALA ALA B . n 
B 1 244 LEU 244 308 308 LEU LEU B . n 
B 1 245 PRO 245 309 309 PRO PRO B . n 
B 1 246 VAL 246 310 310 VAL VAL B . n 
B 1 247 LYS 247 311 311 LYS LYS B . n 
B 1 248 LEU 248 312 312 LEU LEU B . n 
B 1 249 ILE 249 313 313 ILE ILE B . n 
B 1 250 GLY 250 314 314 GLY GLY B . n 
B 1 251 MET 251 315 315 MET MET B . n 
B 1 252 ASN 252 316 316 ASN ASN B . n 
B 1 253 CYS 253 317 317 CYS CYS B . n 
B 1 254 THR 254 318 318 THR THR B . n 
B 1 255 LEU 255 319 319 LEU LEU B . n 
B 1 256 MET 256 320 320 MET MET B . n 
B 1 257 LYS 257 321 321 LYS LYS B . n 
B 1 258 GLN 258 322 322 GLN GLN B . n 
B 1 259 TYR 259 323 323 TYR TYR B . n 
B 1 260 ILE 260 324 324 ILE ILE B . n 
B 1 261 GLU 261 325 325 GLU GLU B . n 
B 1 262 PHE 262 326 326 PHE PHE B . n 
B 1 263 VAL 263 327 327 VAL VAL B . n 
B 1 264 ALA 264 328 328 ALA ALA B . n 
B 1 265 ASP 265 329 329 ASP ASP B . n 
B 1 266 ARG 266 330 330 ARG ARG B . n 
B 1 267 LEU 267 331 331 LEU LEU B . n 
B 1 268 MET 268 332 332 MET MET B . n 
B 1 269 LEU 269 333 333 LEU LEU B . n 
B 1 270 GLU 270 334 334 GLU GLU B . n 
B 1 271 LEU 271 335 335 LEU LEU B . n 
B 1 272 GLY 272 336 336 GLY GLY B . n 
B 1 273 PHE 273 337 337 PHE PHE B . n 
B 1 274 SER 274 338 338 SER SER B . n 
B 1 275 LYS 275 339 339 LYS LYS B . n 
B 1 276 VAL 276 340 340 VAL VAL B . n 
B 1 277 PHE 277 341 341 PHE PHE B . n 
B 1 278 ARG 278 342 342 ARG ARG B . n 
B 1 279 VAL 279 343 343 VAL VAL B . n 
B 1 280 GLU 280 344 344 GLU GLU B . n 
B 1 281 ASN 281 345 345 ASN ASN B . n 
B 1 282 PRO 282 346 346 PRO PRO B . n 
B 1 283 PHE 283 347 347 PHE PHE B . n 
B 1 284 ASP 284 348 348 ASP ASP B . n 
B 1 285 PHE 285 349 349 PHE PHE B . n 
B 1 286 MET 286 350 350 MET MET B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1  401 1    MG  MG  A . 
D 3 FE  1  402 1001 FE  FE  A . 
E 2 MG  1  401 1    MG  MG  B . 
F 3 FE  1  402 1001 FE  FE  B . 
G 4 HOH 1  501 1    HOH HOH A . 
G 4 HOH 2  502 2    HOH HOH A . 
G 4 HOH 3  503 3    HOH HOH A . 
G 4 HOH 4  504 4    HOH HOH A . 
G 4 HOH 5  505 8    HOH HOH A . 
G 4 HOH 6  506 9    HOH HOH A . 
G 4 HOH 7  507 12   HOH HOH A . 
G 4 HOH 8  508 13   HOH HOH A . 
G 4 HOH 9  509 14   HOH HOH A . 
G 4 HOH 10 510 15   HOH HOH A . 
G 4 HOH 11 511 16   HOH HOH A . 
G 4 HOH 12 512 17   HOH HOH A . 
G 4 HOH 13 513 18   HOH HOH A . 
G 4 HOH 14 514 21   HOH HOH A . 
G 4 HOH 15 515 22   HOH HOH A . 
G 4 HOH 16 516 24   HOH HOH A . 
G 4 HOH 17 517 25   HOH HOH A . 
G 4 HOH 18 518 27   HOH HOH A . 
G 4 HOH 19 519 28   HOH HOH A . 
G 4 HOH 20 520 29   HOH HOH A . 
G 4 HOH 21 521 30   HOH HOH A . 
G 4 HOH 22 522 31   HOH HOH A . 
G 4 HOH 23 523 32   HOH HOH A . 
G 4 HOH 24 524 34   HOH HOH A . 
G 4 HOH 25 525 36   HOH HOH A . 
G 4 HOH 26 526 38   HOH HOH A . 
G 4 HOH 27 527 40   HOH HOH A . 
G 4 HOH 28 528 43   HOH HOH A . 
G 4 HOH 29 529 46   HOH HOH A . 
H 4 HOH 1  501 5    HOH HOH B . 
H 4 HOH 2  502 6    HOH HOH B . 
H 4 HOH 3  503 7    HOH HOH B . 
H 4 HOH 4  504 10   HOH HOH B . 
H 4 HOH 5  505 11   HOH HOH B . 
H 4 HOH 6  506 19   HOH HOH B . 
H 4 HOH 7  507 20   HOH HOH B . 
H 4 HOH 8  508 23   HOH HOH B . 
H 4 HOH 9  509 26   HOH HOH B . 
H 4 HOH 10 510 33   HOH HOH B . 
H 4 HOH 11 511 35   HOH HOH B . 
H 4 HOH 12 512 37   HOH HOH B . 
H 4 HOH 13 513 39   HOH HOH B . 
H 4 HOH 14 514 41   HOH HOH B . 
H 4 HOH 15 515 42   HOH HOH B . 
H 4 HOH 16 516 44   HOH HOH B . 
H 4 HOH 17 517 45   HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3300  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  22560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? B GLU 168 ? B GLU 232 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE1 ? B GLU 202 ? B GLU 266 ? 1_555 95.7  ? 
2  OE1 ? B GLU 168 ? B GLU 232 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE2 ? B GLU 105 ? B GLU 169 ? 1_555 100.5 ? 
3  OE1 ? B GLU 202 ? B GLU 266 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE2 ? B GLU 105 ? B GLU 169 ? 1_555 157.7 ? 
4  OE1 ? B GLU 168 ? B GLU 232 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE2 ? B GLU 202 ? B GLU 266 ? 1_555 146.9 ? 
5  OE1 ? B GLU 202 ? B GLU 266 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE2 ? B GLU 202 ? B GLU 266 ? 1_555 61.8  ? 
6  OE2 ? B GLU 105 ? B GLU 169 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 OE2 ? B GLU 202 ? B GLU 266 ? 1_555 108.5 ? 
7  OE1 ? B GLU 168 ? B GLU 232 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 ND1 ? B HIS 205 ? B HIS 269 ? 1_555 87.2  ? 
8  OE1 ? B GLU 202 ? B GLU 266 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 ND1 ? B HIS 205 ? B HIS 269 ? 1_555 110.9 ? 
9  OE2 ? B GLU 105 ? B GLU 169 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 ND1 ? B HIS 205 ? B HIS 269 ? 1_555 85.3  ? 
10 OE2 ? B GLU 202 ? B GLU 266 ? 1_555 FE ? F FE . ? B FE 402 ? 1_555 ND1 ? B HIS 205 ? B HIS 269 ? 1_555 79.8  ? 
11 OE1 ? A GLU 168 ? A GLU 232 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE1 ? A GLU 202 ? A GLU 266 ? 1_555 91.7  ? 
12 OE1 ? A GLU 168 ? A GLU 232 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE2 ? A GLU 202 ? A GLU 266 ? 1_555 144.0 ? 
13 OE1 ? A GLU 202 ? A GLU 266 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE2 ? A GLU 202 ? A GLU 266 ? 1_555 63.5  ? 
14 OE1 ? A GLU 168 ? A GLU 232 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE2 ? A GLU 105 ? A GLU 169 ? 1_555 109.8 ? 
15 OE1 ? A GLU 202 ? A GLU 266 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE2 ? A GLU 105 ? A GLU 169 ? 1_555 146.3 ? 
16 OE2 ? A GLU 202 ? A GLU 266 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 OE2 ? A GLU 105 ? A GLU 169 ? 1_555 104.6 ? 
17 OE1 ? A GLU 168 ? A GLU 232 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 ND1 ? A HIS 205 ? A HIS 269 ? 1_555 91.1  ? 
18 OE1 ? A GLU 202 ? A GLU 266 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 ND1 ? A HIS 205 ? A HIS 269 ? 1_555 122.6 ? 
19 OE2 ? A GLU 202 ? A GLU 266 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 ND1 ? A HIS 205 ? A HIS 269 ? 1_555 82.5  ? 
20 OE2 ? A GLU 105 ? A GLU 169 ? 1_555 FE ? D FE . ? A FE 402 ? 1_555 ND1 ? A HIS 205 ? A HIS 269 ? 1_555 83.8  ? 
21 O   ? A VAL 17  ? A VAL 81  ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 OG1 ? A THR 92  ? A THR 156 ? 1_555 84.5  ? 
22 O   ? A VAL 17  ? A VAL 81  ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 O   ? A ARG 14  ? A ARG 78  ? 1_555 76.0  ? 
23 OG1 ? A THR 92  ? A THR 156 ? 1_555 MG ? C MG . ? A MG 401 ? 1_555 O   ? A ARG 14  ? A ARG 78  ? 1_555 74.8  ? 
24 OG1 ? B THR 92  ? B THR 156 ? 1_555 MG ? E MG . ? B MG 401 ? 1_555 O   ? B ARG 14  ? B ARG 78  ? 1_555 74.9  ? 
25 OG1 ? B THR 92  ? B THR 156 ? 1_555 MG ? E MG . ? B MG 401 ? 1_555 O   ? B VAL 17  ? B VAL 81  ? 1_555 73.4  ? 
26 O   ? B ARG 14  ? B ARG 78  ? 1_555 MG ? E MG . ? B MG 401 ? 1_555 O   ? B VAL 17  ? B VAL 81  ? 1_555 61.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-03-06 
2 'Structure model' 1 1 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 MAR345dtb   .    ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .    ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
7 HKL-2000    .    ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
8 PHASES      .    ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 148 ? ? -130.33 -69.35  
2 1 MET A 252 ? ? 63.49   67.27   
3 1 GLU A 306 ? ? -105.67 -60.15  
4 1 GLU B 75  ? ? -34.16  121.98  
5 1 SER B 110 ? ? -65.34  0.05    
6 1 ARG B 148 ? ? -129.25 -77.29  
7 1 MET B 252 ? ? 57.56   71.39   
8 1 PHE B 337 ? ? -114.66 -167.19 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'FE (III) ION'  FE  
4 water           HOH 
#