data_3VSQ
# 
_entry.id   3VSQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VSQ         
RCSB  RCSB095453   
WWPDB D_1000095453 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3AGW . unspecified 
PDB 2E4F . unspecified 
PDB 3at9 . unspecified 
PDB 3atb . unspecified 
PDB 3auw . unspecified 
PDB 3at8 . unspecified 
# 
_pdbx_database_status.entry_id                        3VSQ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inanobe, A.' 1 
'Kurachi, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     'Coupling of G Protein Binding to Channel Gating in Mammalian Inward Rectifier K+ channels' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inanobe, A.' 1 
primary 'Kurachi, Y.' 2 
# 
_cell.length_a           85.863 
_cell.length_b           85.863 
_cell.length_c           73.046 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3VSQ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.entry_id                         3VSQ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                90 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'G protein-activated inward rectifier potassium channel 2' 23777.068 1  ? E236R 'UNP residues 53-74, 200-381' 
'a concatemer of cytoplasmic N- and C-termini of G-Protein-Gated Inward Rectifier Potassium Channel Kir3.2' 
2 non-polymer syn BETA-MERCAPTOETHANOL                                       78.133    2  ? ?     ?                             ? 
3 non-polymer syn 'MAGNESIUM ION'                                            24.305    1  ? ?     ?                             ? 
4 water       nat water                                                      18.015    84 ? ?     ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'GIRK-2, Inward rectifier K(+) channel Kir3.2, Potassium channel, inwardly rectifying subfamily J member 6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  TYR n 
1 11  VAL n 
1 12  ARG n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  HIS n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ARG n 
1 29  ALA n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  THR n 
1 37  HIS n 
1 38  ALA n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  CYS n 
1 49  LEU n 
1 50  MET n 
1 51  PHE n 
1 52  ARG n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  SER n 
1 60  HIS n 
1 61  ILE n 
1 62  VAL n 
1 63  ARG n 
1 64  ALA n 
1 65  SER n 
1 66  ILE n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  LEU n 
1 71  ILE n 
1 72  LYS n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  THR n 
1 77  SER n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  ILE n 
1 83  PRO n 
1 84  LEU n 
1 85  ASN n 
1 86  GLN n 
1 87  THR n 
1 88  ASP n 
1 89  ILE n 
1 90  ASN n 
1 91  VAL n 
1 92  GLY n 
1 93  TYR n 
1 94  TYR n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  ASP n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 HIS n 
1 111 GLU n 
1 112 ILE n 
1 113 ASN n 
1 114 GLN n 
1 115 GLN n 
1 116 SER n 
1 117 PRO n 
1 118 PHE n 
1 119 TRP n 
1 120 GLU n 
1 121 ILE n 
1 122 SER n 
1 123 LYS n 
1 124 ALA n 
1 125 GLN n 
1 126 LEU n 
1 127 PRO n 
1 128 LYS n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 GLU n 
1 143 ALA n 
1 144 THR n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 CYS n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 SER n 
1 153 SER n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 GLU n 
1 159 ILE n 
1 160 LEU n 
1 161 TRP n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 PHE n 
1 166 THR n 
1 167 PRO n 
1 168 VAL n 
1 169 LEU n 
1 170 THR n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 PHE n 
1 176 TYR n 
1 177 GLU n 
1 178 VAL n 
1 179 ASP n 
1 180 TYR n 
1 181 ASN n 
1 182 SER n 
1 183 PHE n 
1 184 HIS n 
1 185 GLU n 
1 186 THR n 
1 187 TYR n 
1 188 GLU n 
1 189 THR n 
1 190 SER n 
1 191 THR n 
1 192 PRO n 
1 193 SER n 
1 194 LEU n 
1 195 SER n 
1 196 ALA n 
1 197 LYS n 
1 198 GLU n 
1 199 LEU n 
1 200 ALA n 
1 201 GLU n 
1 202 LEU n 
1 203 ALA n 
1 204 ASN n 
1 205 ARG n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  26  mouse ? Kcnj6 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'Rosetta 2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? 
1 2 sample ? 27 208 mouse ? Kcnj6 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'Rosetta 2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8C4T8_MOUSE Q8C4T8 1 RKIQRYVRKDGKCNVHHGNVRE 53  ? 
2 UNP Q8C4T8_MOUSE Q8C4T8 1 
;KRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPL
IISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHET
YETSTPSLSAKELAELANRAEL
;
200 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VSQ A 5  ? 26  ? Q8C4T8 53  ? 74  ? 53  74  
2 2 3VSQ A 27 ? 208 ? Q8C4T8 200 ? 381 ? 200 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VSQ GLY A 1  ? UNP Q8C4T8 ?   ?   'EXPRESSION TAG'      49  1 
1 3VSQ SER A 2  ? UNP Q8C4T8 ?   ?   'EXPRESSION TAG'      50  2 
1 3VSQ HIS A 3  ? UNP Q8C4T8 ?   ?   'EXPRESSION TAG'      51  3 
1 3VSQ MET A 4  ? UNP Q8C4T8 ?   ?   'EXPRESSION TAG'      52  4 
2 3VSQ ARG A 63 ? UNP Q8C4T8 GLU 236 'ENGINEERED MUTATION' 236 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ? 'C2 H6 O S'      78.133  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'      ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3VSQ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   56.55 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'15%(v/v) ethanol, 0.1M HEPE-NaOH, 0.2M MgCl2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRUKER SMART 6500' 
_diffrn_detector.pdbx_collection_date   2011-06-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'a double-crystal monochromator' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.50000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.50000 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
# 
_reflns.entry_id                     3VSQ 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.00 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   516819 
_reflns.number_obs                   516819 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.125 
_reflns.pdbx_Rsym_value              0.125 
_reflns.pdbx_netI_over_sigmaI        25.515 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              27.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.07 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.801 
_reflns_shell.meanI_over_sigI_obs         6.189 
_reflns_shell.pdbx_Rsym_value             0.801 
_reflns_shell.pdbx_redundancy             27.2 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3VSQ 
_refine.ls_d_res_high                            2.0000 
_refine.ls_d_res_low                             30.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.2400 
_refine.ls_number_reflns_obs                     18813 
_refine.ls_number_reflns_all                     18913 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          0.2184 
_refine.ls_R_factor_obs                          0.2163 
_refine.ls_R_factor_R_work                       0.2163 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2592 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  967 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               42.8148 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.1900 
_refine.aniso_B[2][2]                            0.1900 
_refine.aniso_B[3][3]                            -0.3700 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9520 
_refine.correlation_coeff_Fo_to_Fc_free          0.9360 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1720 
_refine.pdbx_overall_ESU_R_Free                  0.1630 
_refine.overall_SU_ML                            0.1140 
_refine.overall_SU_B                             4.0530 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                79.530 
_refine.B_iso_min                                27.990 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.250 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1576 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             84 
_refine_hist.number_atoms_total               1669 
_refine_hist.d_res_high                       2.0000 
_refine_hist.d_res_low                        30.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1634 0.008  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2207 1.057  1.956  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 201  5.850  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 78   31.604 23.590 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 295  14.736 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 13   19.751 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         248  0.073  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1221 0.004  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            987  0.719  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1603 1.346  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            647  1.696  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           601  2.954  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0030 
_refine_ls_shell.d_res_low                        2.0550 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.9100 
_refine_ls_shell.number_reflns_R_work             1274 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2720 
_refine_ls_shell.R_factor_R_free                  0.2860 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1362 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3VSQ 
_struct.title                     
;Crystal Structure of the Cytoplasmic Domain of G-Protein-Gated Inward Rectifier Potassium Channel Kir3.2 E236R Mutant in the presence of ethanol
;
_struct.pdbx_descriptor           'G protein-activated inward rectifier potassium channel 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VSQ 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'immunoglobulin-like fold, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 28  ? LEU A 32  ? ARG A 201 LEU A 205 5 ? 5  
HELX_P HELX_P2 2 GLN A 125 ? GLU A 129 ? GLN A 298 GLU A 302 5 ? 5  
HELX_P HELX_P3 3 ASN A 181 ? PHE A 183 ? ASN A 354 PHE A 356 5 ? 3  
HELX_P HELX_P4 4 SER A 195 ? ARG A 205 ? SER A 368 ARG A 378 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 19  ? GLY A 22  ? VAL A 67  GLY A 70  
A 2 PHE A 175 ? ASP A 179 ? PHE A 348 ASP A 352 
A 3 LEU A 169 ? GLU A 172 ? LEU A 342 GLU A 345 
B 1 LEU A 106 ? GLU A 111 ? LEU A 279 GLU A 284 
B 2 LYS A 46  ? VAL A 53  ? LYS A 219 VAL A 226 
B 3 ALA A 38  ? ARG A 43  ? ALA A 211 ARG A 216 
B 4 ILE A 159 ? TRP A 161 ? ILE A 332 TRP A 334 
C 1 PHE A 81  ? ILE A 89  ? PHE A 254 ILE A 262 
C 2 ILE A 61  ? GLN A 75  ? ILE A 234 GLN A 248 
C 3 ARG A 99  ? LEU A 100 ? ARG A 272 LEU A 273 
D 1 PHE A 81  ? ILE A 89  ? PHE A 254 ILE A 262 
D 2 ILE A 61  ? GLN A 75  ? ILE A 234 GLN A 248 
D 3 GLU A 132 ? VAL A 141 ? GLU A 305 VAL A 314 
D 4 THR A 147 ? ILE A 155 ? THR A 320 ILE A 328 
E 1 TYR A 163 ? PHE A 165 ? TYR A 336 PHE A 338 
E 2 THR A 186 ? GLU A 188 ? THR A 359 GLU A 361 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 20  ? N HIS A 68  O TYR A 176 ? O TYR A 349 
A 2 3 O GLU A 177 ? O GLU A 350 N THR A 170 ? N THR A 343 
B 1 2 O ILE A 108 ? O ILE A 281 N PHE A 51  ? N PHE A 224 
B 2 3 O MET A 50  ? O MET A 223 N VAL A 39  ? N VAL A 212 
B 3 4 N ALA A 38  ? N ALA A 211 O LEU A 160 ? O LEU A 333 
C 1 2 O ILE A 82  ? O ILE A 255 N LYS A 74  ? N LYS A 247 
C 2 3 N ALA A 64  ? N ALA A 237 O LEU A 100 ? O LEU A 273 
D 1 2 O ILE A 82  ? O ILE A 255 N LYS A 74  ? N LYS A 247 
D 2 3 N VAL A 62  ? N VAL A 235 O MET A 140 ? O MET A 313 
D 3 4 N LEU A 137 ? N LEU A 310 O ALA A 150 ? O ALA A 323 
E 1 2 N ARG A 164 ? N ARG A 337 O TYR A 187 ? O TYR A 360 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BME A 401' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BME A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 GLY A 15  ? GLY A 63  . ? 1_555 ? 
2 AC1 5 CYS A 17  ? CYS A 65  . ? 1_555 ? 
3 AC1 5 HIS A 60  ? HIS A 233 . ? 1_555 ? 
4 AC1 5 VAL A 103 ? VAL A 276 . ? 1_555 ? 
5 AC1 5 ARG A 151 ? ARG A 324 . ? 3_545 ? 
6 AC2 4 VAL A 33  ? VAL A 206 . ? 1_555 ? 
7 AC2 4 ILE A 61  ? ILE A 234 . ? 1_555 ? 
8 AC2 4 CYS A 148 ? CYS A 321 . ? 1_555 ? 
9 AC2 4 ALA A 150 ? ALA A 323 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3VSQ 
_atom_sites.fract_transf_matrix[1][1]   0.011646 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011646 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013690 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 8   ? 16.775 -21.857 12.262 1.00 49.27 ? 56  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 8   ? 16.671 -21.005 11.039 1.00 49.26 ? 56  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 8   ? 17.825 -19.990 10.920 1.00 48.32 ? 56  GLN A C   1 
ATOM   4    O  O   . GLN A 1 8   ? 17.742 -18.870 11.444 1.00 48.84 ? 56  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 8   ? 15.340 -20.269 11.046 1.00 49.67 ? 56  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 8   ? 15.263 -19.178 9.997  1.00 52.05 ? 56  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 8   ? 15.507 -19.707 8.604  1.00 54.38 ? 56  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 8   ? 14.799 -20.605 8.135  1.00 57.47 ? 56  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 8   ? 16.511 -19.155 7.926  1.00 54.62 ? 56  GLN A NE2 1 
ATOM   10   N  N   . ARG A 1 9   ? 18.884 -20.358 10.207 1.00 46.21 ? 57  ARG A N   1 
ATOM   11   C  CA  . ARG A 1 9   ? 20.098 -19.546 10.237 1.00 44.49 ? 57  ARG A CA  1 
ATOM   12   C  C   . ARG A 1 9   ? 20.043 -18.258 9.403  1.00 43.44 ? 57  ARG A C   1 
ATOM   13   O  O   . ARG A 1 9   ? 19.357 -18.174 8.371  1.00 42.30 ? 57  ARG A O   1 
ATOM   14   C  CB  . ARG A 1 9   ? 21.322 -20.382 9.866  1.00 44.21 ? 57  ARG A CB  1 
ATOM   15   C  CG  . ARG A 1 9   ? 21.413 -20.763 8.401  1.00 43.84 ? 57  ARG A CG  1 
ATOM   16   C  CD  . ARG A 1 9   ? 22.365 -21.944 8.237  1.00 42.96 ? 57  ARG A CD  1 
ATOM   17   N  NE  . ARG A 1 9   ? 23.659 -21.690 8.869  1.00 42.30 ? 57  ARG A NE  1 
ATOM   18   C  CZ  . ARG A 1 9   ? 24.387 -22.608 9.501  1.00 41.46 ? 57  ARG A CZ  1 
ATOM   19   N  NH1 . ARG A 1 9   ? 25.556 -22.278 10.037 1.00 39.68 ? 57  ARG A NH1 1 
ATOM   20   N  NH2 . ARG A 1 9   ? 23.946 -23.854 9.615  1.00 39.73 ? 57  ARG A NH2 1 
ATOM   21   N  N   . TYR A 1 10  ? 20.776 -17.256 9.879  1.00 42.09 ? 58  TYR A N   1 
ATOM   22   C  CA  . TYR A 1 10  ? 20.861 -15.965 9.215  1.00 41.82 ? 58  TYR A CA  1 
ATOM   23   C  C   . TYR A 1 10  ? 21.933 -16.033 8.136  1.00 41.00 ? 58  TYR A C   1 
ATOM   24   O  O   . TYR A 1 10  ? 21.751 -15.542 7.040  1.00 41.20 ? 58  TYR A O   1 
ATOM   25   C  CB  . TYR A 1 10  ? 21.203 -14.888 10.246 1.00 41.80 ? 58  TYR A CB  1 
ATOM   26   C  CG  . TYR A 1 10  ? 21.107 -13.461 9.765  1.00 43.31 ? 58  TYR A CG  1 
ATOM   27   C  CD1 . TYR A 1 10  ? 22.200 -12.826 9.189  1.00 46.07 ? 58  TYR A CD1 1 
ATOM   28   C  CD2 . TYR A 1 10  ? 19.938 -12.735 9.917  1.00 44.54 ? 58  TYR A CD2 1 
ATOM   29   C  CE1 . TYR A 1 10  ? 22.124 -11.517 8.760  1.00 46.49 ? 58  TYR A CE1 1 
ATOM   30   C  CE2 . TYR A 1 10  ? 19.856 -11.420 9.504  1.00 45.75 ? 58  TYR A CE2 1 
ATOM   31   C  CZ  . TYR A 1 10  ? 20.953 -10.815 8.929  1.00 46.28 ? 58  TYR A CZ  1 
ATOM   32   O  OH  . TYR A 1 10  ? 20.879 -9.502  8.512  1.00 47.33 ? 58  TYR A OH  1 
ATOM   33   N  N   . VAL A 1 11  ? 23.049 -16.671 8.453  1.00 40.64 ? 59  VAL A N   1 
ATOM   34   C  CA  . VAL A 1 11  ? 24.152 -16.778 7.521  1.00 40.44 ? 59  VAL A CA  1 
ATOM   35   C  C   . VAL A 1 11  ? 24.316 -18.243 7.161  1.00 40.83 ? 59  VAL A C   1 
ATOM   36   O  O   . VAL A 1 11  ? 24.449 -19.085 8.038  1.00 40.33 ? 59  VAL A O   1 
ATOM   37   C  CB  . VAL A 1 11  ? 25.469 -16.233 8.163  1.00 40.42 ? 59  VAL A CB  1 
ATOM   38   C  CG1 . VAL A 1 11  ? 26.678 -16.455 7.239  1.00 39.86 ? 59  VAL A CG1 1 
ATOM   39   C  CG2 . VAL A 1 11  ? 25.305 -14.766 8.521  1.00 40.05 ? 59  VAL A CG2 1 
ATOM   40   N  N   . ARG A 1 12  ? 24.281 -18.551 5.868  1.00 41.56 ? 60  ARG A N   1 
ATOM   41   C  CA  . ARG A 1 12  ? 24.499 -19.918 5.408  1.00 42.62 ? 60  ARG A CA  1 
ATOM   42   C  C   . ARG A 1 12  ? 25.978 -20.299 5.437  1.00 43.25 ? 60  ARG A C   1 
ATOM   43   O  O   . ARG A 1 12  ? 26.855 -19.434 5.436  1.00 43.72 ? 60  ARG A O   1 
ATOM   44   C  CB  . ARG A 1 12  ? 23.931 -20.100 3.993  1.00 42.48 ? 60  ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 12  ? 22.454 -19.760 3.886  1.00 43.38 ? 60  ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 12  ? 21.746 -20.590 2.818  1.00 43.98 ? 60  ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 12  ? 22.196 -20.254 1.470  1.00 42.99 ? 60  ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 12  ? 21.635 -19.325 0.704  1.00 43.05 ? 60  ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 12  ? 20.597 -18.622 1.151  1.00 42.00 ? 60  ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 12  ? 22.119 -19.095 -0.511 1.00 43.09 ? 60  ARG A NH2 1 
ATOM   51   N  N   . LYS A 1 13  ? 26.260 -21.594 5.471  1.00 44.20 ? 61  LYS A N   1 
ATOM   52   C  CA  . LYS A 1 13  ? 27.632 -22.063 5.386  1.00 45.52 ? 61  LYS A CA  1 
ATOM   53   C  C   . LYS A 1 13  ? 28.374 -21.514 4.153  1.00 46.67 ? 61  LYS A C   1 
ATOM   54   O  O   . LYS A 1 13  ? 29.594 -21.359 4.182  1.00 47.73 ? 61  LYS A O   1 
ATOM   55   C  CB  . LYS A 1 13  ? 27.674 -23.592 5.392  1.00 45.36 ? 61  LYS A CB  1 
ATOM   56   C  CG  . LYS A 1 13  ? 27.309 -24.199 6.728  1.00 45.05 ? 61  LYS A CG  1 
ATOM   57   C  CD  . LYS A 1 13  ? 28.272 -23.723 7.790  1.00 44.56 ? 61  LYS A CD  1 
ATOM   58   C  CE  . LYS A 1 13  ? 28.101 -24.516 9.062  1.00 44.14 ? 61  LYS A CE  1 
ATOM   59   N  NZ  . LYS A 1 13  ? 29.116 -24.109 10.072 1.00 42.27 ? 61  LYS A NZ  1 
ATOM   60   N  N   . ASP A 1 14  ? 27.645 -21.212 3.081  1.00 47.86 ? 62  ASP A N   1 
ATOM   61   C  CA  . ASP A 1 14  ? 28.283 -20.722 1.858  1.00 48.53 ? 62  ASP A CA  1 
ATOM   62   C  C   . ASP A 1 14  ? 28.553 -19.216 1.898  1.00 48.58 ? 62  ASP A C   1 
ATOM   63   O  O   . ASP A 1 14  ? 29.000 -18.633 0.905  1.00 48.86 ? 62  ASP A O   1 
ATOM   64   C  CB  . ASP A 1 14  ? 27.470 -21.106 0.616  1.00 48.93 ? 62  ASP A CB  1 
ATOM   65   C  CG  . ASP A 1 14  ? 26.131 -20.406 0.553  1.00 50.97 ? 62  ASP A CG  1 
ATOM   66   O  OD1 . ASP A 1 14  ? 25.774 -19.710 1.529  1.00 52.67 ? 62  ASP A OD1 1 
ATOM   67   O  OD2 . ASP A 1 14  ? 25.423 -20.554 -0.471 1.00 52.90 ? 62  ASP A OD2 1 
ATOM   68   N  N   . GLY A 1 15  ? 28.282 -18.590 3.044  1.00 48.01 ? 63  GLY A N   1 
ATOM   69   C  CA  . GLY A 1 15  ? 28.569 -17.169 3.222  1.00 46.77 ? 63  GLY A CA  1 
ATOM   70   C  C   . GLY A 1 15  ? 27.441 -16.238 2.822  1.00 46.18 ? 63  GLY A C   1 
ATOM   71   O  O   . GLY A 1 15  ? 27.521 -15.031 3.041  1.00 45.75 ? 63  GLY A O   1 
ATOM   72   N  N   . LYS A 1 16  ? 26.384 -16.785 2.229  1.00 45.54 ? 64  LYS A N   1 
ATOM   73   C  CA  . LYS A 1 16  ? 25.250 -15.956 1.846  1.00 45.40 ? 64  LYS A CA  1 
ATOM   74   C  C   . LYS A 1 16  ? 24.232 -15.827 2.996  1.00 44.98 ? 64  LYS A C   1 
ATOM   75   O  O   . LYS A 1 16  ? 24.207 -16.644 3.919  1.00 44.95 ? 64  LYS A O   1 
ATOM   76   C  CB  . LYS A 1 16  ? 24.579 -16.484 0.573  1.00 45.55 ? 64  LYS A CB  1 
ATOM   77   C  CG  . LYS A 1 16  ? 25.527 -16.799 -0.573 1.00 46.54 ? 64  LYS A CG  1 
ATOM   78   C  CD  . LYS A 1 16  ? 24.849 -16.545 -1.922 1.00 51.04 ? 64  LYS A CD  1 
ATOM   79   C  CE  . LYS A 1 16  ? 25.299 -17.535 -3.019 1.00 53.36 ? 64  LYS A CE  1 
ATOM   80   N  NZ  . LYS A 1 16  ? 26.698 -18.021 -2.836 1.00 53.99 ? 64  LYS A NZ  1 
ATOM   81   N  N   . CYS A 1 17  ? 23.401 -14.796 2.935  1.00 44.47 ? 65  CYS A N   1 
ATOM   82   C  CA  . CYS A 1 17  ? 22.452 -14.513 4.002  1.00 44.66 ? 65  CYS A CA  1 
ATOM   83   C  C   . CYS A 1 17  ? 21.023 -14.837 3.589  1.00 44.56 ? 65  CYS A C   1 
ATOM   84   O  O   . CYS A 1 17  ? 20.642 -14.628 2.437  1.00 44.46 ? 65  CYS A O   1 
ATOM   85   C  CB  . CYS A 1 17  ? 22.536 -13.041 4.404  1.00 44.46 ? 65  CYS A CB  1 
ATOM   86   S  SG  . CYS A 1 17  ? 24.057 -12.610 5.283  1.00 46.79 ? 65  CYS A SG  1 
ATOM   87   N  N   . ASN A 1 18  ? 20.242 -15.333 4.545  1.00 43.97 ? 66  ASN A N   1 
ATOM   88   C  CA  . ASN A 1 18  ? 18.829 -15.597 4.350  1.00 43.96 ? 66  ASN A CA  1 
ATOM   89   C  C   . ASN A 1 18  ? 18.011 -14.384 4.742  1.00 44.10 ? 66  ASN A C   1 
ATOM   90   O  O   . ASN A 1 18  ? 17.198 -14.437 5.667  1.00 44.06 ? 66  ASN A O   1 
ATOM   91   C  CB  . ASN A 1 18  ? 18.398 -16.800 5.190  1.00 43.68 ? 66  ASN A CB  1 
ATOM   92   C  CG  . ASN A 1 18  ? 19.089 -18.083 4.763  1.00 44.11 ? 66  ASN A CG  1 
ATOM   93   O  OD1 . ASN A 1 18  ? 19.292 -18.317 3.573  1.00 44.59 ? 66  ASN A OD1 1 
ATOM   94   N  ND2 . ASN A 1 18  ? 19.448 -18.921 5.730  1.00 42.18 ? 66  ASN A ND2 1 
ATOM   95   N  N   . VAL A 1 19  ? 18.241 -13.287 4.039  1.00 44.13 ? 67  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 19  ? 17.577 -12.031 4.337  1.00 44.60 ? 67  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 19  ? 16.874 -11.491 3.102  1.00 45.24 ? 67  VAL A C   1 
ATOM   98   O  O   . VAL A 1 19  ? 17.452 -11.446 2.008  1.00 45.21 ? 67  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 19  ? 18.581 -10.956 4.840  1.00 44.62 ? 67  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 19  ? 17.874 -9.634  5.063  1.00 43.47 ? 67  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 19  ? 19.266 -11.423 6.130  1.00 44.23 ? 67  VAL A CG2 1 
ATOM   102  N  N   . HIS A 1 20  ? 15.623 -11.088 3.271  1.00 45.47 ? 68  HIS A N   1 
ATOM   103  C  CA  . HIS A 1 20  ? 14.939 -10.386 2.205  1.00 46.39 ? 68  HIS A CA  1 
ATOM   104  C  C   . HIS A 1 20  ? 14.697 -8.926  2.563  1.00 46.49 ? 68  HIS A C   1 
ATOM   105  O  O   . HIS A 1 20  ? 14.181 -8.623  3.631  1.00 46.57 ? 68  HIS A O   1 
ATOM   106  C  CB  . HIS A 1 20  ? 13.613 -11.060 1.858  1.00 46.19 ? 68  HIS A CB  1 
ATOM   107  C  CG  . HIS A 1 20  ? 12.973 -10.484 0.636  1.00 47.88 ? 68  HIS A CG  1 
ATOM   108  N  ND1 . HIS A 1 20  ? 11.893 -9.628  0.691  1.00 49.20 ? 68  HIS A ND1 1 
ATOM   109  C  CD2 . HIS A 1 20  ? 13.292 -10.610 -0.674 1.00 47.96 ? 68  HIS A CD2 1 
ATOM   110  C  CE1 . HIS A 1 20  ? 11.562 -9.265  -0.537 1.00 49.19 ? 68  HIS A CE1 1 
ATOM   111  N  NE2 . HIS A 1 20  ? 12.392 -9.852  -1.382 1.00 50.71 ? 68  HIS A NE2 1 
ATOM   112  N  N   . HIS A 1 21  ? 15.071 -8.032  1.659  1.00 47.21 ? 69  HIS A N   1 
ATOM   113  C  CA  . HIS A 1 21  ? 14.907 -6.597  1.870  1.00 48.17 ? 69  HIS A CA  1 
ATOM   114  C  C   . HIS A 1 21  ? 13.584 -6.136  1.250  1.00 49.05 ? 69  HIS A C   1 
ATOM   115  O  O   . HIS A 1 21  ? 13.500 -5.937  0.045  1.00 48.88 ? 69  HIS A O   1 
ATOM   116  C  CB  . HIS A 1 21  ? 16.101 -5.855  1.262  1.00 48.00 ? 69  HIS A CB  1 
ATOM   117  C  CG  . HIS A 1 21  ? 17.406 -6.188  1.921  1.00 49.04 ? 69  HIS A CG  1 
ATOM   118  N  ND1 . HIS A 1 21  ? 18.274 -7.142  1.426  1.00 50.57 ? 69  HIS A ND1 1 
ATOM   119  C  CD2 . HIS A 1 21  ? 17.982 -5.710  3.050  1.00 47.91 ? 69  HIS A CD2 1 
ATOM   120  C  CE1 . HIS A 1 21  ? 19.328 -7.235  2.221  1.00 48.97 ? 69  HIS A CE1 1 
ATOM   121  N  NE2 . HIS A 1 21  ? 19.176 -6.377  3.214  1.00 49.13 ? 69  HIS A NE2 1 
ATOM   122  N  N   . GLY A 1 22  ? 12.552 -5.987  2.080  1.00 49.99 ? 70  GLY A N   1 
ATOM   123  C  CA  . GLY A 1 22  ? 11.185 -5.771  1.597  1.00 51.50 ? 70  GLY A CA  1 
ATOM   124  C  C   . GLY A 1 22  ? 10.692 -4.336  1.648  1.00 52.63 ? 70  GLY A C   1 
ATOM   125  O  O   . GLY A 1 22  ? 11.107 -3.553  2.503  1.00 52.48 ? 70  GLY A O   1 
ATOM   126  N  N   . ASN A 1 23  ? 9.798  -3.991  0.723  1.00 53.68 ? 71  ASN A N   1 
ATOM   127  C  CA  . ASN A 1 23  ? 9.237  -2.640  0.642  1.00 54.93 ? 71  ASN A CA  1 
ATOM   128  C  C   . ASN A 1 23  ? 10.302 -1.587  0.380  1.00 55.44 ? 71  ASN A C   1 
ATOM   129  O  O   . ASN A 1 23  ? 10.314 -0.541  1.027  1.00 55.53 ? 71  ASN A O   1 
ATOM   130  C  CB  . ASN A 1 23  ? 8.472  -2.288  1.923  1.00 54.91 ? 71  ASN A CB  1 
ATOM   131  C  CG  . ASN A 1 23  ? 7.357  -3.276  2.233  1.00 56.20 ? 71  ASN A CG  1 
ATOM   132  O  OD1 . ASN A 1 23  ? 6.994  -3.480  3.394  1.00 57.04 ? 71  ASN A OD1 1 
ATOM   133  N  ND2 . ASN A 1 23  ? 6.807  -3.893  1.193  1.00 56.75 ? 71  ASN A ND2 1 
ATOM   134  N  N   . VAL A 1 24  ? 11.193 -1.873  -0.565 1.00 56.05 ? 72  VAL A N   1 
ATOM   135  C  CA  . VAL A 1 24  ? 12.303 -0.979  -0.892 1.00 56.96 ? 72  VAL A CA  1 
ATOM   136  C  C   . VAL A 1 24  ? 12.227 -0.493  -2.343 1.00 57.18 ? 72  VAL A C   1 
ATOM   137  O  O   . VAL A 1 24  ? 12.460 0.685   -2.633 1.00 57.50 ? 72  VAL A O   1 
ATOM   138  C  CB  . VAL A 1 24  ? 13.683 -1.666  -0.638 1.00 57.08 ? 72  VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 24  ? 13.841 -2.913  -1.501 1.00 57.36 ? 72  VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 24  ? 14.828 -0.694  -0.889 1.00 57.87 ? 72  VAL A CG2 1 
ATOM   141  N  N   . LYS A 1 27  ? 11.628 3.237   -3.050 1.00 66.26 ? 200 LYS A N   1 
ATOM   142  C  CA  . LYS A 1 27  ? 12.362 4.183   -2.210 1.00 66.26 ? 200 LYS A CA  1 
ATOM   143  C  C   . LYS A 1 27  ? 13.786 4.409   -2.717 1.00 66.01 ? 200 LYS A C   1 
ATOM   144  O  O   . LYS A 1 27  ? 14.473 3.459   -3.101 1.00 66.07 ? 200 LYS A O   1 
ATOM   145  C  CB  . LYS A 1 27  ? 12.409 3.687   -0.760 1.00 66.43 ? 200 LYS A CB  1 
ATOM   146  C  CG  . LYS A 1 27  ? 11.048 3.510   -0.105 1.00 66.92 ? 200 LYS A CG  1 
ATOM   147  C  CD  . LYS A 1 27  ? 11.187 2.964   1.314  1.00 67.86 ? 200 LYS A CD  1 
ATOM   148  C  CE  . LYS A 1 27  ? 9.830  2.833   2.000  1.00 68.76 ? 200 LYS A CE  1 
ATOM   149  N  NZ  . LYS A 1 27  ? 8.956  1.811   1.346  1.00 68.54 ? 200 LYS A NZ  1 
ATOM   150  N  N   . ARG A 1 28  ? 14.230 5.663   -2.710 1.00 65.65 ? 201 ARG A N   1 
ATOM   151  C  CA  . ARG A 1 28  ? 15.605 5.990   -3.082 1.00 65.36 ? 201 ARG A CA  1 
ATOM   152  C  C   . ARG A 1 28  ? 16.587 5.326   -2.109 1.00 64.80 ? 201 ARG A C   1 
ATOM   153  O  O   . ARG A 1 28  ? 16.482 5.497   -0.890 1.00 64.45 ? 201 ARG A O   1 
ATOM   154  C  CB  . ARG A 1 28  ? 15.823 7.506   -3.089 1.00 65.65 ? 201 ARG A CB  1 
ATOM   155  C  CG  . ARG A 1 28  ? 14.714 8.315   -3.764 1.00 67.31 ? 201 ARG A CG  1 
ATOM   156  C  CD  . ARG A 1 28  ? 14.673 8.094   -5.274 1.00 70.01 ? 201 ARG A CD  1 
ATOM   157  N  NE  . ARG A 1 28  ? 15.920 8.490   -5.934 1.00 71.75 ? 201 ARG A NE  1 
ATOM   158  C  CZ  . ARG A 1 28  ? 16.879 7.642   -6.302 1.00 72.47 ? 201 ARG A CZ  1 
ATOM   159  N  NH1 . ARG A 1 28  ? 16.743 6.341   -6.081 1.00 73.18 ? 201 ARG A NH1 1 
ATOM   160  N  NH2 . ARG A 1 28  ? 17.977 8.095   -6.893 1.00 72.75 ? 201 ARG A NH2 1 
ATOM   161  N  N   . ALA A 1 29  ? 17.542 4.574   -2.654 1.00 63.99 ? 202 ALA A N   1 
ATOM   162  C  CA  . ALA A 1 29  ? 18.487 3.813   -1.840 1.00 63.09 ? 202 ALA A CA  1 
ATOM   163  C  C   . ALA A 1 29  ? 19.220 4.694   -0.834 1.00 62.46 ? 202 ALA A C   1 
ATOM   164  O  O   . ALA A 1 29  ? 19.442 4.291   0.311  1.00 62.41 ? 202 ALA A O   1 
ATOM   165  C  CB  . ALA A 1 29  ? 19.486 3.082   -2.725 1.00 63.10 ? 202 ALA A CB  1 
ATOM   166  N  N   . GLU A 1 30  ? 19.589 5.896   -1.263 1.00 61.39 ? 203 GLU A N   1 
ATOM   167  C  CA  . GLU A 1 30  ? 20.418 6.764   -0.440 1.00 60.57 ? 203 GLU A CA  1 
ATOM   168  C  C   . GLU A 1 30  ? 19.655 7.423   0.712  1.00 59.14 ? 203 GLU A C   1 
ATOM   169  O  O   . GLU A 1 30  ? 20.238 8.160   1.501  1.00 59.38 ? 203 GLU A O   1 
ATOM   170  C  CB  . GLU A 1 30  ? 21.160 7.801   -1.298 1.00 61.13 ? 203 GLU A CB  1 
ATOM   171  C  CG  . GLU A 1 30  ? 22.665 7.499   -1.478 1.00 63.14 ? 203 GLU A CG  1 
ATOM   172  C  CD  . GLU A 1 30  ? 22.980 6.550   -2.642 1.00 65.84 ? 203 GLU A CD  1 
ATOM   173  O  OE1 . GLU A 1 30  ? 22.582 6.856   -3.790 1.00 67.44 ? 203 GLU A OE1 1 
ATOM   174  O  OE2 . GLU A 1 30  ? 23.646 5.513   -2.411 1.00 65.42 ? 203 GLU A OE2 1 
ATOM   175  N  N   . THR A 1 31  ? 18.360 7.142   0.818  1.00 56.98 ? 204 THR A N   1 
ATOM   176  C  CA  . THR A 1 31  ? 17.573 7.617   1.954  1.00 54.77 ? 204 THR A CA  1 
ATOM   177  C  C   . THR A 1 31  ? 17.375 6.510   2.987  1.00 52.59 ? 204 THR A C   1 
ATOM   178  O  O   . THR A 1 31  ? 16.685 6.694   3.988  1.00 52.04 ? 204 THR A O   1 
ATOM   179  C  CB  . THR A 1 31  ? 16.197 8.126   1.517  1.00 55.06 ? 204 THR A CB  1 
ATOM   180  O  OG1 . THR A 1 31  ? 15.474 7.053   0.897  1.00 55.79 ? 204 THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 31  ? 16.344 9.292   0.538  1.00 55.36 ? 204 THR A CG2 1 
ATOM   182  N  N   . LEU A 1 32  ? 17.977 5.353   2.739  1.00 50.26 ? 205 LEU A N   1 
ATOM   183  C  CA  . LEU A 1 32  ? 17.862 4.246   3.675  1.00 48.00 ? 205 LEU A CA  1 
ATOM   184  C  C   . LEU A 1 32  ? 19.231 3.895   4.248  1.00 46.50 ? 205 LEU A C   1 
ATOM   185  O  O   . LEU A 1 32  ? 19.493 2.740   4.597  1.00 46.31 ? 205 LEU A O   1 
ATOM   186  C  CB  . LEU A 1 32  ? 17.193 3.024   3.021  1.00 47.85 ? 205 LEU A CB  1 
ATOM   187  C  CG  . LEU A 1 32  ? 15.724 3.198   2.605  1.00 47.70 ? 205 LEU A CG  1 
ATOM   188  C  CD1 . LEU A 1 32  ? 15.203 1.963   1.836  1.00 47.59 ? 205 LEU A CD1 1 
ATOM   189  C  CD2 . LEU A 1 32  ? 14.825 3.514   3.799  1.00 45.66 ? 205 LEU A CD2 1 
ATOM   190  N  N   . VAL A 1 33  ? 20.102 4.898   4.337  1.00 44.33 ? 206 VAL A N   1 
ATOM   191  C  CA  . VAL A 1 33  ? 21.404 4.699   4.957  1.00 42.34 ? 206 VAL A CA  1 
ATOM   192  C  C   . VAL A 1 33  ? 21.376 5.048   6.454  1.00 40.80 ? 206 VAL A C   1 
ATOM   193  O  O   . VAL A 1 33  ? 21.802 4.236   7.271  1.00 40.59 ? 206 VAL A O   1 
ATOM   194  C  CB  . VAL A 1 33  ? 22.532 5.448   4.235  1.00 42.73 ? 206 VAL A CB  1 
ATOM   195  C  CG1 . VAL A 1 33  ? 23.862 5.129   4.899  1.00 42.37 ? 206 VAL A CG1 1 
ATOM   196  C  CG2 . VAL A 1 33  ? 22.588 5.039   2.757  1.00 42.98 ? 206 VAL A CG2 1 
ATOM   197  N  N   . PHE A 1 34  ? 20.866 6.232   6.800  1.00 38.47 ? 207 PHE A N   1 
ATOM   198  C  CA  . PHE A 1 34  ? 20.695 6.652   8.200  1.00 37.18 ? 207 PHE A CA  1 
ATOM   199  C  C   . PHE A 1 34  ? 19.249 7.037   8.492  1.00 36.66 ? 207 PHE A C   1 
ATOM   200  O  O   . PHE A 1 34  ? 18.605 7.691   7.671  1.00 36.46 ? 207 PHE A O   1 
ATOM   201  C  CB  . PHE A 1 34  ? 21.572 7.878   8.528  1.00 36.48 ? 207 PHE A CB  1 
ATOM   202  C  CG  . PHE A 1 34  ? 23.059 7.656   8.347  1.00 35.63 ? 207 PHE A CG  1 
ATOM   203  C  CD1 . PHE A 1 34  ? 23.798 7.003   9.315  1.00 35.00 ? 207 PHE A CD1 1 
ATOM   204  C  CD2 . PHE A 1 34  ? 23.713 8.135   7.219  1.00 34.91 ? 207 PHE A CD2 1 
ATOM   205  C  CE1 . PHE A 1 34  ? 25.172 6.805   9.155  1.00 35.41 ? 207 PHE A CE1 1 
ATOM   206  C  CE2 . PHE A 1 34  ? 25.072 7.948   7.045  1.00 35.76 ? 207 PHE A CE2 1 
ATOM   207  C  CZ  . PHE A 1 34  ? 25.808 7.284   8.020  1.00 35.78 ? 207 PHE A CZ  1 
ATOM   208  N  N   . SER A 1 35  ? 18.752 6.671   9.673  1.00 36.19 ? 208 SER A N   1 
ATOM   209  C  CA  . SER A 1 35  ? 17.447 7.138   10.129 1.00 35.77 ? 208 SER A CA  1 
ATOM   210  C  C   . SER A 1 35  ? 17.432 8.661   10.130 1.00 35.92 ? 208 SER A C   1 
ATOM   211  O  O   . SER A 1 35  ? 18.477 9.290   10.372 1.00 35.51 ? 208 SER A O   1 
ATOM   212  C  CB  . SER A 1 35  ? 17.122 6.576   11.514 1.00 35.77 ? 208 SER A CB  1 
ATOM   213  O  OG  . SER A 1 35  ? 18.136 6.888   12.460 1.00 35.05 ? 208 SER A OG  1 
ATOM   214  N  N   . THR A 1 36  ? 16.271 9.257   9.828  1.00 35.53 ? 209 THR A N   1 
ATOM   215  C  CA  . THR A 1 36  ? 16.135 10.718  9.821  1.00 35.64 ? 209 THR A CA  1 
ATOM   216  C  C   . THR A 1 36  ? 16.337 11.276  11.228 1.00 35.46 ? 209 THR A C   1 
ATOM   217  O  O   . THR A 1 36  ? 16.816 12.405  11.402 1.00 35.78 ? 209 THR A O   1 
ATOM   218  C  CB  . THR A 1 36  ? 14.732 11.181  9.344  1.00 35.68 ? 209 THR A CB  1 
ATOM   219  O  OG1 . THR A 1 36  ? 13.729 10.500  10.105 1.00 35.67 ? 209 THR A OG1 1 
ATOM   220  C  CG2 . THR A 1 36  ? 14.523 10.915  7.841  1.00 35.85 ? 209 THR A CG2 1 
ATOM   221  N  N   . HIS A 1 37  ? 15.958 10.487  12.226 1.00 35.08 ? 210 HIS A N   1 
ATOM   222  C  CA  . HIS A 1 37  ? 16.059 10.920  13.604 1.00 35.83 ? 210 HIS A CA  1 
ATOM   223  C  C   . HIS A 1 37  ? 16.921 10.005  14.475 1.00 35.31 ? 210 HIS A C   1 
ATOM   224  O  O   . HIS A 1 37  ? 17.202 8.859   14.120 1.00 35.15 ? 210 HIS A O   1 
ATOM   225  C  CB  . HIS A 1 37  ? 14.653 11.060  14.210 1.00 36.35 ? 210 HIS A CB  1 
ATOM   226  C  CG  . HIS A 1 37  ? 13.828 12.122  13.548 1.00 38.43 ? 210 HIS A CG  1 
ATOM   227  N  ND1 . HIS A 1 37  ? 13.442 13.279  14.192 1.00 41.25 ? 210 HIS A ND1 1 
ATOM   228  C  CD2 . HIS A 1 37  ? 13.354 12.219  12.285 1.00 40.52 ? 210 HIS A CD2 1 
ATOM   229  C  CE1 . HIS A 1 37  ? 12.758 14.040  13.357 1.00 41.11 ? 210 HIS A CE1 1 
ATOM   230  N  NE2 . HIS A 1 37  ? 12.687 13.418  12.193 1.00 42.83 ? 210 HIS A NE2 1 
ATOM   231  N  N   . ALA A 1 38  ? 17.335 10.535  15.619 1.00 34.51 ? 211 ALA A N   1 
ATOM   232  C  CA  . ALA A 1 38  ? 18.004 9.754   16.635 1.00 34.42 ? 211 ALA A CA  1 
ATOM   233  C  C   . ALA A 1 38  ? 17.083 9.749   17.852 1.00 34.33 ? 211 ALA A C   1 
ATOM   234  O  O   . ALA A 1 38  ? 16.204 10.607  17.961 1.00 34.30 ? 211 ALA A O   1 
ATOM   235  C  CB  . ALA A 1 38  ? 19.347 10.401  16.967 1.00 33.69 ? 211 ALA A CB  1 
ATOM   236  N  N   . VAL A 1 39  ? 17.271 8.802   18.764 1.00 34.13 ? 212 VAL A N   1 
ATOM   237  C  CA  . VAL A 1 39  ? 16.414 8.711   19.950 1.00 34.30 ? 212 VAL A CA  1 
ATOM   238  C  C   . VAL A 1 39  ? 17.224 8.526   21.229 1.00 34.29 ? 212 VAL A C   1 
ATOM   239  O  O   . VAL A 1 39  ? 18.371 8.053   21.199 1.00 34.33 ? 212 VAL A O   1 
ATOM   240  C  CB  . VAL A 1 39  ? 15.386 7.545   19.850 1.00 34.50 ? 212 VAL A CB  1 
ATOM   241  C  CG1 . VAL A 1 39  ? 14.528 7.692   18.605 1.00 35.87 ? 212 VAL A CG1 1 
ATOM   242  C  CG2 . VAL A 1 39  ? 16.092 6.204   19.858 1.00 34.81 ? 212 VAL A CG2 1 
ATOM   243  N  N   . ILE A 1 40  ? 16.621 8.890   22.356 1.00 33.79 ? 213 ILE A N   1 
ATOM   244  C  CA  . ILE A 1 40  ? 17.227 8.618   23.650 1.00 33.94 ? 213 ILE A CA  1 
ATOM   245  C  C   . ILE A 1 40  ? 16.224 7.865   24.506 1.00 34.61 ? 213 ILE A C   1 
ATOM   246  O  O   . ILE A 1 40  ? 15.081 8.301   24.653 1.00 34.49 ? 213 ILE A O   1 
ATOM   247  C  CB  . ILE A 1 40  ? 17.682 9.919   24.364 1.00 33.54 ? 213 ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1 40  ? 18.831 10.588  23.602 1.00 33.83 ? 213 ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1 40  ? 18.107 9.628   25.810 1.00 33.34 ? 213 ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1 40  ? 19.132 12.029  24.039 1.00 33.03 ? 213 ILE A CD1 1 
ATOM   251  N  N   . SER A 1 41  ? 16.630 6.715   25.030 1.00 34.75 ? 214 SER A N   1 
ATOM   252  C  CA  . SER A 1 41  ? 15.801 5.957   25.961 1.00 35.43 ? 214 SER A CA  1 
ATOM   253  C  C   . SER A 1 41  ? 16.659 4.922   26.673 1.00 35.84 ? 214 SER A C   1 
ATOM   254  O  O   . SER A 1 41  ? 17.836 4.757   26.339 1.00 35.15 ? 214 SER A O   1 
ATOM   255  C  CB  . SER A 1 41  ? 14.629 5.266   25.247 1.00 36.07 ? 214 SER A CB  1 
ATOM   256  O  OG  . SER A 1 41  ? 15.085 4.466   24.156 1.00 37.09 ? 214 SER A OG  1 
ATOM   257  N  N   . MET A 1 42  ? 16.054 4.220   27.634 1.00 35.76 ? 215 MET A N   1 
ATOM   258  C  CA  . MET A 1 42  ? 16.777 3.319   28.515 1.00 36.53 ? 215 MET A CA  1 
ATOM   259  C  C   . MET A 1 42  ? 16.957 1.949   27.883 1.00 36.68 ? 215 MET A C   1 
ATOM   260  O  O   . MET A 1 42  ? 16.051 1.437   27.229 1.00 36.39 ? 215 MET A O   1 
ATOM   261  C  CB  . MET A 1 42  ? 16.035 3.157   29.857 1.00 36.92 ? 215 MET A CB  1 
ATOM   262  C  CG  . MET A 1 42  ? 15.983 4.421   30.705 1.00 38.35 ? 215 MET A CG  1 
ATOM   263  S  SD  . MET A 1 42  ? 17.578 4.930   31.374 1.00 41.55 ? 215 MET A SD  1 
ATOM   264  C  CE  . MET A 1 42  ? 17.662 3.910   32.852 1.00 41.96 ? 215 MET A CE  1 
ATOM   265  N  N   . ARG A 1 43  ? 18.139 1.366   28.077 1.00 36.59 ? 216 ARG A N   1 
ATOM   266  C  CA  . ARG A 1 43  ? 18.378 -0.021  27.727 1.00 36.90 ? 216 ARG A CA  1 
ATOM   267  C  C   . ARG A 1 43  ? 19.146 -0.664  28.857 1.00 37.63 ? 216 ARG A C   1 
ATOM   268  O  O   . ARG A 1 43  ? 20.240 -0.208  29.208 1.00 37.19 ? 216 ARG A O   1 
ATOM   269  C  CB  . ARG A 1 43  ? 19.195 -0.144  26.445 1.00 37.30 ? 216 ARG A CB  1 
ATOM   270  C  CG  . ARG A 1 43  ? 18.384 0.044   25.185 1.00 36.60 ? 216 ARG A CG  1 
ATOM   271  C  CD  . ARG A 1 43  ? 19.201 -0.384  23.971 1.00 36.34 ? 216 ARG A CD  1 
ATOM   272  N  NE  . ARG A 1 43  ? 18.361 -0.519  22.779 1.00 36.50 ? 216 ARG A NE  1 
ATOM   273  C  CZ  . ARG A 1 43  ? 18.825 -0.879  21.584 1.00 37.13 ? 216 ARG A CZ  1 
ATOM   274  N  NH1 . ARG A 1 43  ? 20.119 -1.140  21.417 1.00 36.56 ? 216 ARG A NH1 1 
ATOM   275  N  NH2 . ARG A 1 43  ? 17.996 -0.980  20.560 1.00 39.01 ? 216 ARG A NH2 1 
ATOM   276  N  N   . ASP A 1 44  ? 18.563 -1.715  29.423 1.00 38.19 ? 217 ASP A N   1 
ATOM   277  C  CA  . ASP A 1 44  ? 19.176 -2.429  30.531 1.00 39.29 ? 217 ASP A CA  1 
ATOM   278  C  C   . ASP A 1 44  ? 19.790 -1.481  31.561 1.00 39.53 ? 217 ASP A C   1 
ATOM   279  O  O   . ASP A 1 44  ? 20.939 -1.660  31.988 1.00 40.36 ? 217 ASP A O   1 
ATOM   280  C  CB  . ASP A 1 44  ? 20.205 -3.433  30.008 1.00 39.53 ? 217 ASP A CB  1 
ATOM   281  C  CG  . ASP A 1 44  ? 19.556 -4.593  29.267 1.00 41.40 ? 217 ASP A CG  1 
ATOM   282  O  OD1 . ASP A 1 44  ? 18.484 -5.056  29.701 1.00 42.67 ? 217 ASP A OD1 1 
ATOM   283  O  OD2 . ASP A 1 44  ? 20.113 -5.043  28.248 1.00 45.98 ? 217 ASP A OD2 1 
ATOM   284  N  N   . GLY A 1 45  ? 19.024 -0.467  31.949 1.00 39.17 ? 218 GLY A N   1 
ATOM   285  C  CA  . GLY A 1 45  ? 19.427 0.427   33.028 1.00 39.27 ? 218 GLY A CA  1 
ATOM   286  C  C   . GLY A 1 45  ? 20.352 1.573   32.652 1.00 39.04 ? 218 GLY A C   1 
ATOM   287  O  O   . GLY A 1 45  ? 20.725 2.368   33.509 1.00 39.65 ? 218 GLY A O   1 
ATOM   288  N  N   . LYS A 1 46  ? 20.731 1.662   31.382 1.00 38.16 ? 219 LYS A N   1 
ATOM   289  C  CA  . LYS A 1 46  ? 21.596 2.742   30.922 1.00 37.83 ? 219 LYS A CA  1 
ATOM   290  C  C   . LYS A 1 46  ? 20.845 3.596   29.920 1.00 36.79 ? 219 LYS A C   1 
ATOM   291  O  O   . LYS A 1 46  ? 20.107 3.086   29.074 1.00 36.97 ? 219 LYS A O   1 
ATOM   292  C  CB  . LYS A 1 46  ? 22.902 2.212   30.292 1.00 38.06 ? 219 LYS A CB  1 
ATOM   293  C  CG  . LYS A 1 46  ? 23.702 1.187   31.147 1.00 40.71 ? 219 LYS A CG  1 
ATOM   294  C  CD  . LYS A 1 46  ? 23.969 1.707   32.571 1.00 45.66 ? 219 LYS A CD  1 
ATOM   295  C  CE  . LYS A 1 46  ? 25.113 0.954   33.280 1.00 48.28 ? 219 LYS A CE  1 
ATOM   296  N  NZ  . LYS A 1 46  ? 25.212 -0.477  32.854 1.00 50.13 ? 219 LYS A NZ  1 
ATOM   297  N  N   . LEU A 1 47  ? 21.025 4.902   30.024 1.00 35.48 ? 220 LEU A N   1 
ATOM   298  C  CA  . LEU A 1 47  ? 20.420 5.820   29.089 1.00 35.55 ? 220 LEU A CA  1 
ATOM   299  C  C   . LEU A 1 47  ? 21.278 5.823   27.828 1.00 34.99 ? 220 LEU A C   1 
ATOM   300  O  O   . LEU A 1 47  ? 22.488 6.008   27.921 1.00 34.54 ? 220 LEU A O   1 
ATOM   301  C  CB  . LEU A 1 47  ? 20.385 7.222   29.693 1.00 34.98 ? 220 LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 47  ? 19.431 8.224   29.048 1.00 36.24 ? 220 LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 47  ? 17.981 7.777   29.203 1.00 36.14 ? 220 LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 47  ? 19.635 9.626   29.643 1.00 37.28 ? 220 LEU A CD2 1 
ATOM   305  N  N   . CYS A 1 48  ? 20.657 5.590   26.671 1.00 34.35 ? 221 CYS A N   1 
ATOM   306  C  CA  . CYS A 1 48  ? 21.388 5.497   25.396 1.00 34.43 ? 221 CYS A CA  1 
ATOM   307  C  C   . CYS A 1 48  ? 20.851 6.426   24.315 1.00 34.08 ? 221 CYS A C   1 
ATOM   308  O  O   . CYS A 1 48  ? 19.645 6.638   24.206 1.00 34.02 ? 221 CYS A O   1 
ATOM   309  C  CB  . CYS A 1 48  ? 21.345 4.071   24.841 1.00 34.75 ? 221 CYS A CB  1 
ATOM   310  S  SG  . CYS A 1 48  ? 22.063 2.810   25.909 1.00 36.90 ? 221 CYS A SG  1 
ATOM   311  N  N   . LEU A 1 49  ? 21.770 6.983   23.531 1.00 32.89 ? 222 LEU A N   1 
ATOM   312  C  CA  . LEU A 1 49  ? 21.453 7.709   22.324 1.00 32.22 ? 222 LEU A CA  1 
ATOM   313  C  C   . LEU A 1 49  ? 21.624 6.729   21.148 1.00 32.02 ? 222 LEU A C   1 
ATOM   314  O  O   . LEU A 1 49  ? 22.668 6.079   21.016 1.00 31.70 ? 222 LEU A O   1 
ATOM   315  C  CB  . LEU A 1 49  ? 22.387 8.913   22.170 1.00 32.31 ? 222 LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 49  ? 22.407 9.665   20.830 1.00 33.39 ? 222 LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 49  ? 21.164 10.497  20.656 1.00 33.13 ? 222 LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 49  ? 23.650 10.552  20.739 1.00 36.56 ? 222 LEU A CD2 1 
ATOM   319  N  N   . MET A 1 50  ? 20.599 6.619   20.306 1.00 31.58 ? 223 MET A N   1 
ATOM   320  C  CA  . MET A 1 50  ? 20.551 5.571   19.279 1.00 31.46 ? 223 MET A CA  1 
ATOM   321  C  C   . MET A 1 50  ? 20.159 6.138   17.915 1.00 31.40 ? 223 MET A C   1 
ATOM   322  O  O   . MET A 1 50  ? 19.385 7.110   17.825 1.00 30.68 ? 223 MET A O   1 
ATOM   323  C  CB  . MET A 1 50  ? 19.559 4.481   19.694 1.00 31.72 ? 223 MET A CB  1 
ATOM   324  C  CG  . MET A 1 50  ? 19.983 3.689   20.930 1.00 33.23 ? 223 MET A CG  1 
ATOM   325  S  SD  . MET A 1 50  ? 18.708 2.577   21.576 1.00 36.43 ? 223 MET A SD  1 
ATOM   326  C  CE  . MET A 1 50  ? 17.678 3.741   22.499 1.00 35.50 ? 223 MET A CE  1 
ATOM   327  N  N   . PHE A 1 51  ? 20.722 5.560   16.857 1.00 31.09 ? 224 PHE A N   1 
ATOM   328  C  CA  . PHE A 1 51  ? 20.303 5.886   15.498 1.00 31.50 ? 224 PHE A CA  1 
ATOM   329  C  C   . PHE A 1 51  ? 20.409 4.615   14.675 1.00 31.85 ? 224 PHE A C   1 
ATOM   330  O  O   . PHE A 1 51  ? 21.082 3.661   15.084 1.00 31.98 ? 224 PHE A O   1 
ATOM   331  C  CB  . PHE A 1 51  ? 21.129 7.034   14.889 1.00 32.02 ? 224 PHE A CB  1 
ATOM   332  C  CG  . PHE A 1 51  ? 22.599 6.735   14.762 1.00 32.14 ? 224 PHE A CG  1 
ATOM   333  C  CD1 . PHE A 1 51  ? 23.123 6.251   13.558 1.00 33.53 ? 224 PHE A CD1 1 
ATOM   334  C  CD2 . PHE A 1 51  ? 23.452 6.926   15.837 1.00 32.36 ? 224 PHE A CD2 1 
ATOM   335  C  CE1 . PHE A 1 51  ? 24.490 5.953   13.429 1.00 31.91 ? 224 PHE A CE1 1 
ATOM   336  C  CE2 . PHE A 1 51  ? 24.819 6.639   15.736 1.00 31.01 ? 224 PHE A CE2 1 
ATOM   337  C  CZ  . PHE A 1 51  ? 25.345 6.164   14.513 1.00 32.91 ? 224 PHE A CZ  1 
ATOM   338  N  N   . ARG A 1 52  ? 19.731 4.575   13.542 1.00 31.84 ? 225 ARG A N   1 
ATOM   339  C  CA  . ARG A 1 52  ? 19.685 3.343   12.762 1.00 33.07 ? 225 ARG A CA  1 
ATOM   340  C  C   . ARG A 1 52  ? 20.485 3.507   11.497 1.00 33.47 ? 225 ARG A C   1 
ATOM   341  O  O   . ARG A 1 52  ? 20.495 4.582   10.893 1.00 33.36 ? 225 ARG A O   1 
ATOM   342  C  CB  . ARG A 1 52  ? 18.235 2.921   12.451 1.00 33.20 ? 225 ARG A CB  1 
ATOM   343  C  CG  . ARG A 1 52  ? 18.100 1.692   11.537 1.00 34.58 ? 225 ARG A CG  1 
ATOM   344  C  CD  . ARG A 1 52  ? 17.098 0.652   12.073 1.00 37.35 ? 225 ARG A CD  1 
ATOM   345  N  NE  . ARG A 1 52  ? 15.755 1.181   12.110 1.00 37.89 ? 225 ARG A NE  1 
ATOM   346  C  CZ  . ARG A 1 52  ? 14.726 0.613   12.734 1.00 36.82 ? 225 ARG A CZ  1 
ATOM   347  N  NH1 . ARG A 1 52  ? 14.869 -0.523  13.402 1.00 38.42 ? 225 ARG A NH1 1 
ATOM   348  N  NH2 . ARG A 1 52  ? 13.549 1.198   12.685 1.00 35.61 ? 225 ARG A NH2 1 
ATOM   349  N  N   . VAL A 1 53  ? 21.167 2.438   11.105 1.00 34.76 ? 226 VAL A N   1 
ATOM   350  C  CA  . VAL A 1 53  ? 21.945 2.449   9.880  1.00 36.33 ? 226 VAL A CA  1 
ATOM   351  C  C   . VAL A 1 53  ? 21.552 1.262   8.983  1.00 37.68 ? 226 VAL A C   1 
ATOM   352  O  O   . VAL A 1 53  ? 21.185 0.189   9.476  1.00 37.16 ? 226 VAL A O   1 
ATOM   353  C  CB  . VAL A 1 53  ? 23.440 2.412   10.189 1.00 36.44 ? 226 VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 53  ? 23.815 1.074   10.816 1.00 35.93 ? 226 VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 53  ? 24.250 2.666   8.912  1.00 38.53 ? 226 VAL A CG2 1 
ATOM   356  N  N   . GLY A 1 54  ? 21.626 1.464   7.673  1.00 39.34 ? 227 GLY A N   1 
ATOM   357  C  CA  . GLY A 1 54  ? 21.236 0.435   6.709  1.00 42.03 ? 227 GLY A CA  1 
ATOM   358  C  C   . GLY A 1 54  ? 22.316 0.137   5.684  1.00 44.18 ? 227 GLY A C   1 
ATOM   359  O  O   . GLY A 1 54  ? 23.217 0.949   5.467  1.00 43.93 ? 227 GLY A O   1 
ATOM   360  N  N   . ASP A 1 55  ? 22.238 -1.036  5.062  1.00 46.20 ? 228 ASP A N   1 
ATOM   361  C  CA  . ASP A 1 55  ? 23.213 -1.440  4.041  1.00 49.17 ? 228 ASP A CA  1 
ATOM   362  C  C   . ASP A 1 55  ? 22.891 -0.740  2.730  1.00 51.21 ? 228 ASP A C   1 
ATOM   363  O  O   . ASP A 1 55  ? 21.837 -0.124  2.606  1.00 51.24 ? 228 ASP A O   1 
ATOM   364  C  CB  . ASP A 1 55  ? 23.148 -2.952  3.835  1.00 48.89 ? 228 ASP A CB  1 
ATOM   365  C  CG  . ASP A 1 55  ? 24.321 -3.497  3.033  1.00 49.94 ? 228 ASP A CG  1 
ATOM   366  O  OD1 . ASP A 1 55  ? 25.329 -2.775  2.819  1.00 49.46 ? 228 ASP A OD1 1 
ATOM   367  O  OD2 . ASP A 1 55  ? 24.226 -4.677  2.629  1.00 50.48 ? 228 ASP A OD2 1 
ATOM   368  N  N   . LEU A 1 56  ? 23.793 -0.812  1.754  1.00 54.02 ? 229 LEU A N   1 
ATOM   369  C  CA  . LEU A 1 56  ? 23.469 -0.288  0.428  1.00 56.65 ? 229 LEU A CA  1 
ATOM   370  C  C   . LEU A 1 56  ? 22.595 -1.293  -0.312 1.00 58.22 ? 229 LEU A C   1 
ATOM   371  O  O   . LEU A 1 56  ? 22.856 -2.495  -0.278 1.00 58.53 ? 229 LEU A O   1 
ATOM   372  C  CB  . LEU A 1 56  ? 24.725 0.033   -0.388 1.00 56.92 ? 229 LEU A CB  1 
ATOM   373  C  CG  . LEU A 1 56  ? 24.974 1.514   -0.704 1.00 57.61 ? 229 LEU A CG  1 
ATOM   374  C  CD1 . LEU A 1 56  ? 26.095 1.647   -1.719 1.00 58.53 ? 229 LEU A CD1 1 
ATOM   375  C  CD2 . LEU A 1 56  ? 23.705 2.187   -1.224 1.00 58.32 ? 229 LEU A CD2 1 
ATOM   376  N  N   . ARG A 1 57  ? 21.545 -0.807  -0.964 1.00 60.37 ? 230 ARG A N   1 
ATOM   377  C  CA  . ARG A 1 57  ? 20.674 -1.702  -1.722 1.00 62.27 ? 230 ARG A CA  1 
ATOM   378  C  C   . ARG A 1 57  ? 21.316 -2.135  -3.033 1.00 62.96 ? 230 ARG A C   1 
ATOM   379  O  O   . ARG A 1 57  ? 22.004 -1.348  -3.691 1.00 63.22 ? 230 ARG A O   1 
ATOM   380  C  CB  . ARG A 1 57  ? 19.291 -1.089  -1.962 1.00 62.74 ? 230 ARG A CB  1 
ATOM   381  C  CG  . ARG A 1 57  ? 18.139 -1.863  -1.284 1.00 64.64 ? 230 ARG A CG  1 
ATOM   382  C  CD  . ARG A 1 57  ? 18.366 -2.073  0.217  1.00 67.22 ? 230 ARG A CD  1 
ATOM   383  N  NE  . ARG A 1 57  ? 19.131 -0.973  0.804  1.00 69.12 ? 230 ARG A NE  1 
ATOM   384  C  CZ  . ARG A 1 57  ? 18.761 0.305   0.764  1.00 69.93 ? 230 ARG A CZ  1 
ATOM   385  N  NH1 . ARG A 1 57  ? 17.633 0.655   0.156  1.00 70.38 ? 230 ARG A NH1 1 
ATOM   386  N  NH2 . ARG A 1 57  ? 19.529 1.238   1.321  1.00 69.85 ? 230 ARG A NH2 1 
ATOM   387  N  N   . ASN A 1 58  ? 21.094 -3.400  -3.385 1.00 63.77 ? 231 ASN A N   1 
ATOM   388  C  CA  . ASN A 1 58  ? 21.660 -3.999  -4.595 1.00 64.34 ? 231 ASN A CA  1 
ATOM   389  C  C   . ASN A 1 58  ? 23.177 -4.151  -4.558 1.00 64.31 ? 231 ASN A C   1 
ATOM   390  O  O   . ASN A 1 58  ? 23.788 -4.582  -5.535 1.00 64.55 ? 231 ASN A O   1 
ATOM   391  C  CB  . ASN A 1 58  ? 21.205 -3.239  -5.846 1.00 64.58 ? 231 ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 58  ? 19.719 -3.395  -6.099 1.00 65.48 ? 231 ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 58  ? 19.080 -2.530  -6.704 1.00 67.43 ? 231 ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 58  ? 19.155 -4.503  -5.623 1.00 65.30 ? 231 ASN A ND2 1 
ATOM   395  N  N   . SER A 1 59  ? 23.776 -3.806  -3.421 1.00 64.16 ? 232 SER A N   1 
ATOM   396  C  CA  . SER A 1 59  ? 25.217 -3.990  -3.225 1.00 63.66 ? 232 SER A CA  1 
ATOM   397  C  C   . SER A 1 59  ? 25.595 -4.001  -1.745 1.00 62.98 ? 232 SER A C   1 
ATOM   398  O  O   . SER A 1 59  ? 25.486 -2.989  -1.050 1.00 63.52 ? 232 SER A O   1 
ATOM   399  C  CB  . SER A 1 59  ? 26.025 -2.930  -3.987 1.00 63.92 ? 232 SER A CB  1 
ATOM   400  O  OG  . SER A 1 59  ? 25.672 -1.617  -3.589 1.00 64.43 ? 232 SER A OG  1 
ATOM   401  N  N   . HIS A 1 60  ? 26.045 -5.155  -1.274 1.00 61.65 ? 233 HIS A N   1 
ATOM   402  C  CA  . HIS A 1 60  ? 26.429 -5.324  0.117  1.00 60.34 ? 233 HIS A CA  1 
ATOM   403  C  C   . HIS A 1 60  ? 27.711 -4.567  0.459  1.00 59.14 ? 233 HIS A C   1 
ATOM   404  O  O   . HIS A 1 60  ? 28.693 -4.608  -0.289 1.00 58.83 ? 233 HIS A O   1 
ATOM   405  C  CB  . HIS A 1 60  ? 26.569 -6.817  0.439  1.00 60.29 ? 233 HIS A CB  1 
ATOM   406  C  CG  . HIS A 1 60  ? 27.041 -7.099  1.830  1.00 60.87 ? 233 HIS A CG  1 
ATOM   407  N  ND1 . HIS A 1 60  ? 26.345 -6.696  2.950  1.00 61.30 ? 233 HIS A ND1 1 
ATOM   408  C  CD2 . HIS A 1 60  ? 28.133 -7.761  2.284  1.00 61.07 ? 233 HIS A CD2 1 
ATOM   409  C  CE1 . HIS A 1 60  ? 26.992 -7.087  4.033  1.00 60.95 ? 233 HIS A CE1 1 
ATOM   410  N  NE2 . HIS A 1 60  ? 28.080 -7.737  3.657  1.00 61.37 ? 233 HIS A NE2 1 
ATOM   411  N  N   . ILE A 1 61  ? 27.681 -3.863  1.591  1.00 57.46 ? 234 ILE A N   1 
ATOM   412  C  CA  . ILE A 1 61  ? 28.848 -3.144  2.101  1.00 55.89 ? 234 ILE A CA  1 
ATOM   413  C  C   . ILE A 1 61  ? 29.679 -4.039  3.011  1.00 54.56 ? 234 ILE A C   1 
ATOM   414  O  O   . ILE A 1 61  ? 29.147 -4.742  3.874  1.00 54.44 ? 234 ILE A O   1 
ATOM   415  C  CB  . ILE A 1 61  ? 28.448 -1.881  2.886  1.00 56.06 ? 234 ILE A CB  1 
ATOM   416  C  CG1 . ILE A 1 61  ? 27.750 -0.884  1.959  1.00 56.62 ? 234 ILE A CG1 1 
ATOM   417  C  CG2 . ILE A 1 61  ? 29.662 -1.264  3.555  1.00 55.86 ? 234 ILE A CG2 1 
ATOM   418  C  CD1 . ILE A 1 61  ? 28.498 -0.630  0.642  1.00 58.37 ? 234 ILE A CD1 1 
ATOM   419  N  N   . VAL A 1 62  ? 30.990 -3.982  2.828  1.00 52.91 ? 235 VAL A N   1 
ATOM   420  C  CA  . VAL A 1 62  ? 31.905 -4.879  3.507  1.00 51.75 ? 235 VAL A CA  1 
ATOM   421  C  C   . VAL A 1 62  ? 32.959 -4.061  4.267  1.00 50.42 ? 235 VAL A C   1 
ATOM   422  O  O   . VAL A 1 62  ? 33.178 -2.892  3.948  1.00 50.55 ? 235 VAL A O   1 
ATOM   423  C  CB  . VAL A 1 62  ? 32.562 -5.804  2.462  1.00 51.86 ? 235 VAL A CB  1 
ATOM   424  C  CG1 . VAL A 1 62  ? 34.078 -5.623  2.417  1.00 52.18 ? 235 VAL A CG1 1 
ATOM   425  C  CG2 . VAL A 1 62  ? 32.128 -7.249  2.672  1.00 52.07 ? 235 VAL A CG2 1 
ATOM   426  N  N   . ARG A 1 63  ? 33.600 -4.672  5.265  1.00 48.66 ? 236 ARG A N   1 
ATOM   427  C  CA  . ARG A 1 63  ? 34.573 -3.984  6.126  1.00 47.11 ? 236 ARG A CA  1 
ATOM   428  C  C   . ARG A 1 63  ? 33.971 -2.709  6.743  1.00 45.01 ? 236 ARG A C   1 
ATOM   429  O  O   . ARG A 1 63  ? 34.640 -1.684  6.867  1.00 44.36 ? 236 ARG A O   1 
ATOM   430  C  CB  . ARG A 1 63  ? 35.853 -3.657  5.351  1.00 47.86 ? 236 ARG A CB  1 
ATOM   431  C  CG  . ARG A 1 63  ? 36.628 -4.895  4.902  1.00 50.25 ? 236 ARG A CG  1 
ATOM   432  C  CD  . ARG A 1 63  ? 37.573 -4.597  3.749  1.00 54.11 ? 236 ARG A CD  1 
ATOM   433  N  NE  . ARG A 1 63  ? 38.143 -5.821  3.180  1.00 56.75 ? 236 ARG A NE  1 
ATOM   434  C  CZ  . ARG A 1 63  ? 39.374 -6.258  3.428  1.00 57.41 ? 236 ARG A CZ  1 
ATOM   435  N  NH1 . ARG A 1 63  ? 40.181 -5.559  4.223  1.00 56.92 ? 236 ARG A NH1 1 
ATOM   436  N  NH2 . ARG A 1 63  ? 39.806 -7.387  2.870  1.00 57.49 ? 236 ARG A NH2 1 
ATOM   437  N  N   . ALA A 1 64  ? 32.701 -2.792  7.117  1.00 42.55 ? 237 ALA A N   1 
ATOM   438  C  CA  . ALA A 1 64  ? 31.939 -1.618  7.521  1.00 40.98 ? 237 ALA A CA  1 
ATOM   439  C  C   . ALA A 1 64  ? 32.279 -1.167  8.944  1.00 39.84 ? 237 ALA A C   1 
ATOM   440  O  O   . ALA A 1 64  ? 32.491 -1.993  9.838  1.00 38.79 ? 237 ALA A O   1 
ATOM   441  C  CB  . ALA A 1 64  ? 30.444 -1.884  7.384  1.00 40.90 ? 237 ALA A CB  1 
ATOM   442  N  N   . SER A 1 65  ? 32.352 0.149   9.130  1.00 38.43 ? 238 SER A N   1 
ATOM   443  C  CA  . SER A 1 65  ? 32.539 0.717   10.454 1.00 37.59 ? 238 SER A CA  1 
ATOM   444  C  C   . SER A 1 65  ? 31.768 2.029   10.613 1.00 36.17 ? 238 SER A C   1 
ATOM   445  O  O   . SER A 1 65  ? 31.578 2.778   9.646  1.00 36.61 ? 238 SER A O   1 
ATOM   446  C  CB  . SER A 1 65  ? 34.023 0.924   10.759 1.00 37.93 ? 238 SER A CB  1 
ATOM   447  O  OG  . SER A 1 65  ? 34.555 1.931   9.931  1.00 39.51 ? 238 SER A OG  1 
ATOM   448  N  N   . ILE A 1 66  ? 31.332 2.295   11.839 1.00 34.34 ? 239 ILE A N   1 
ATOM   449  C  CA  . ILE A 1 66  ? 30.545 3.481   12.143 1.00 32.83 ? 239 ILE A CA  1 
ATOM   450  C  C   . ILE A 1 66  ? 31.330 4.370   13.131 1.00 32.70 ? 239 ILE A C   1 
ATOM   451  O  O   . ILE A 1 66  ? 31.926 3.872   14.088 1.00 31.35 ? 239 ILE A O   1 
ATOM   452  C  CB  . ILE A 1 66  ? 29.187 3.081   12.759 1.00 32.44 ? 239 ILE A CB  1 
ATOM   453  C  CG1 . ILE A 1 66  ? 28.294 4.315   13.010 1.00 32.94 ? 239 ILE A CG1 1 
ATOM   454  C  CG2 . ILE A 1 66  ? 29.399 2.313   14.069 1.00 30.98 ? 239 ILE A CG2 1 
ATOM   455  C  CD1 . ILE A 1 66  ? 27.789 5.003   11.719 1.00 32.72 ? 239 ILE A CD1 1 
ATOM   456  N  N   . ARG A 1 67  ? 31.387 5.670   12.857 1.00 32.70 ? 240 ARG A N   1 
ATOM   457  C  CA  A ARG A 1 67  ? 31.874 6.623   13.856 0.50 32.70 ? 240 ARG A CA  1 
ATOM   458  C  CA  B ARG A 1 67  ? 31.887 6.627   13.844 0.50 32.91 ? 240 ARG A CA  1 
ATOM   459  C  C   . ARG A 1 67  ? 30.917 7.803   13.971 1.00 32.76 ? 240 ARG A C   1 
ATOM   460  O  O   . ARG A 1 67  ? 30.034 7.986   13.111 1.00 32.53 ? 240 ARG A O   1 
ATOM   461  C  CB  A ARG A 1 67  ? 33.314 7.073   13.568 0.50 33.12 ? 240 ARG A CB  1 
ATOM   462  C  CB  B ARG A 1 67  ? 33.317 7.081   13.508 0.50 33.49 ? 240 ARG A CB  1 
ATOM   463  C  CG  A ARG A 1 67  ? 33.756 6.911   12.138 0.50 33.76 ? 240 ARG A CG  1 
ATOM   464  C  CG  B ARG A 1 67  ? 33.487 7.692   12.137 0.50 35.07 ? 240 ARG A CG  1 
ATOM   465  C  CD  A ARG A 1 67  ? 35.233 7.236   11.992 0.50 34.76 ? 240 ARG A CD  1 
ATOM   466  C  CD  B ARG A 1 67  ? 34.810 7.257   11.513 0.50 38.95 ? 240 ARG A CD  1 
ATOM   467  N  NE  A ARG A 1 67  ? 35.486 8.672   12.021 0.50 34.70 ? 240 ARG A NE  1 
ATOM   468  N  NE  B ARG A 1 67  ? 34.955 5.801   11.531 0.50 41.11 ? 240 ARG A NE  1 
ATOM   469  C  CZ  A ARG A 1 67  ? 35.856 9.390   10.966 0.50 33.34 ? 240 ARG A CZ  1 
ATOM   470  C  CZ  B ARG A 1 67  ? 36.059 5.153   11.176 0.50 42.30 ? 240 ARG A CZ  1 
ATOM   471  N  NH1 A ARG A 1 67  ? 36.030 8.811   9.785  0.50 32.37 ? 240 ARG A NH1 1 
ATOM   472  N  NH1 B ARG A 1 67  ? 37.129 5.824   10.768 0.50 42.02 ? 240 ARG A NH1 1 
ATOM   473  N  NH2 A ARG A 1 67  ? 36.067 10.686  11.099 0.50 31.30 ? 240 ARG A NH2 1 
ATOM   474  N  NH2 B ARG A 1 67  ? 36.092 3.830   11.230 0.50 44.17 ? 240 ARG A NH2 1 
ATOM   475  N  N   . ALA A 1 68  ? 31.061 8.580   15.045 1.00 32.00 ? 241 ALA A N   1 
ATOM   476  C  CA  . ALA A 1 68  ? 30.157 9.707   15.321 1.00 31.83 ? 241 ALA A CA  1 
ATOM   477  C  C   . ALA A 1 68  ? 30.920 10.811  16.036 1.00 32.24 ? 241 ALA A C   1 
ATOM   478  O  O   . ALA A 1 68  ? 31.712 10.520  16.945 1.00 31.46 ? 241 ALA A O   1 
ATOM   479  C  CB  . ALA A 1 68  ? 28.993 9.250   16.198 1.00 31.41 ? 241 ALA A CB  1 
ATOM   480  N  N   . LYS A 1 69  ? 30.663 12.058  15.631 1.00 32.33 ? 242 LYS A N   1 
ATOM   481  C  CA  . LYS A 1 69  ? 31.309 13.243  16.192 1.00 33.31 ? 242 LYS A CA  1 
ATOM   482  C  C   . LYS A 1 69  ? 30.246 14.207  16.688 1.00 33.94 ? 242 LYS A C   1 
ATOM   483  O  O   . LYS A 1 69  ? 29.240 14.439  16.004 1.00 34.28 ? 242 LYS A O   1 
ATOM   484  C  CB  . LYS A 1 69  ? 32.137 13.981  15.131 1.00 32.87 ? 242 LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 69  ? 33.256 13.186  14.485 1.00 35.29 ? 242 LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 69  ? 34.291 12.700  15.504 1.00 37.45 ? 242 LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 69  ? 35.566 12.222  14.793 1.00 38.91 ? 242 LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 69  ? 36.596 11.747  15.773 1.00 41.03 ? 242 LYS A NZ  1 
ATOM   489  N  N   . LEU A 1 70  ? 30.460 14.753  17.882 1.00 33.86 ? 243 LEU A N   1 
ATOM   490  C  CA  . LEU A 1 70  ? 29.655 15.851  18.380 1.00 34.83 ? 243 LEU A CA  1 
ATOM   491  C  C   . LEU A 1 70  ? 30.290 17.153  17.913 1.00 35.00 ? 243 LEU A C   1 
ATOM   492  O  O   . LEU A 1 70  ? 31.479 17.387  18.142 1.00 35.02 ? 243 LEU A O   1 
ATOM   493  C  CB  . LEU A 1 70  ? 29.595 15.832  19.907 1.00 35.13 ? 243 LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 70  ? 28.946 17.070  20.531 1.00 36.98 ? 243 LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 70  ? 27.471 17.156  20.188 1.00 37.03 ? 243 LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 70  ? 29.153 17.095  22.028 1.00 37.18 ? 243 LEU A CD2 1 
ATOM   497  N  N   . ILE A 1 71  ? 29.510 17.984  17.226 1.00 34.92 ? 244 ILE A N   1 
ATOM   498  C  CA  . ILE A 1 71  ? 29.971 19.310  16.845 1.00 35.98 ? 244 ILE A CA  1 
ATOM   499  C  C   . ILE A 1 71  ? 29.224 20.308  17.714 1.00 36.40 ? 244 ILE A C   1 
ATOM   500  O  O   . ILE A 1 71  ? 27.996 20.326  17.734 1.00 35.19 ? 244 ILE A O   1 
ATOM   501  C  CB  . ILE A 1 71  ? 29.700 19.625  15.363 1.00 36.60 ? 244 ILE A CB  1 
ATOM   502  C  CG1 . ILE A 1 71  ? 30.510 18.697  14.467 1.00 37.99 ? 244 ILE A CG1 1 
ATOM   503  C  CG2 . ILE A 1 71  ? 30.063 21.080  15.052 1.00 36.49 ? 244 ILE A CG2 1 
ATOM   504  C  CD1 . ILE A 1 71  ? 30.280 18.989  12.984 1.00 43.48 ? 244 ILE A CD1 1 
ATOM   505  N  N   . LYS A 1 72  ? 29.968 21.123  18.455 1.00 36.93 ? 245 LYS A N   1 
ATOM   506  C  CA  . LYS A 1 72  ? 29.345 22.023  19.426 1.00 38.12 ? 245 LYS A CA  1 
ATOM   507  C  C   . LYS A 1 72  ? 30.352 23.064  19.872 1.00 38.48 ? 245 LYS A C   1 
ATOM   508  O  O   . LYS A 1 72  ? 31.445 22.735  20.347 1.00 37.78 ? 245 LYS A O   1 
ATOM   509  C  CB  . LYS A 1 72  ? 28.811 21.237  20.628 1.00 37.98 ? 245 LYS A CB  1 
ATOM   510  C  CG  . LYS A 1 72  ? 28.334 22.092  21.824 1.00 40.66 ? 245 LYS A CG  1 
ATOM   511  C  CD  . LYS A 1 72  ? 27.730 21.191  22.909 1.00 41.78 ? 245 LYS A CD  1 
ATOM   512  C  CE  . LYS A 1 72  ? 27.651 21.852  24.278 1.00 44.68 ? 245 LYS A CE  1 
ATOM   513  N  NZ  . LYS A 1 72  ? 27.088 23.242  24.201 1.00 46.07 ? 245 LYS A NZ  1 
ATOM   514  N  N   . SER A 1 73  ? 29.986 24.327  19.692 1.00 38.98 ? 246 SER A N   1 
ATOM   515  C  CA  . SER A 1 73  ? 30.851 25.413  20.101 1.00 39.60 ? 246 SER A CA  1 
ATOM   516  C  C   . SER A 1 73  ? 31.072 25.336  21.602 1.00 39.92 ? 246 SER A C   1 
ATOM   517  O  O   . SER A 1 73  ? 30.199 24.910  22.360 1.00 40.05 ? 246 SER A O   1 
ATOM   518  C  CB  . SER A 1 73  ? 30.253 26.759  19.688 1.00 39.37 ? 246 SER A CB  1 
ATOM   519  O  OG  . SER A 1 73  ? 30.274 26.854  18.280 1.00 39.95 ? 246 SER A OG  1 
ATOM   520  N  N   . LYS A 1 74  ? 32.267 25.709  22.027 1.00 40.75 ? 247 LYS A N   1 
ATOM   521  C  CA  . LYS A 1 74  ? 32.565 25.717  23.437 1.00 41.24 ? 247 LYS A CA  1 
ATOM   522  C  C   . LYS A 1 74  ? 33.577 26.808  23.751 1.00 41.41 ? 247 LYS A C   1 
ATOM   523  O  O   . LYS A 1 74  ? 34.283 27.308  22.863 1.00 41.26 ? 247 LYS A O   1 
ATOM   524  C  CB  . LYS A 1 74  ? 33.119 24.364  23.873 1.00 41.73 ? 247 LYS A CB  1 
ATOM   525  C  CG  . LYS A 1 74  ? 34.541 24.124  23.411 1.00 42.25 ? 247 LYS A CG  1 
ATOM   526  C  CD  . LYS A 1 74  ? 35.172 23.002  24.212 1.00 45.85 ? 247 LYS A CD  1 
ATOM   527  C  CE  . LYS A 1 74  ? 35.046 23.232  25.700 1.00 46.72 ? 247 LYS A CE  1 
ATOM   528  N  NZ  . LYS A 1 74  ? 35.884 22.248  26.477 1.00 48.14 ? 247 LYS A NZ  1 
ATOM   529  N  N   . GLN A 1 75  ? 33.644 27.156  25.029 1.00 41.35 ? 248 GLN A N   1 
ATOM   530  C  CA  . GLN A 1 75  ? 34.624 28.107  25.506 1.00 41.75 ? 248 GLN A CA  1 
ATOM   531  C  C   . GLN A 1 75  ? 35.389 27.436  26.621 1.00 40.98 ? 248 GLN A C   1 
ATOM   532  O  O   . GLN A 1 75  ? 34.792 26.816  27.506 1.00 40.99 ? 248 GLN A O   1 
ATOM   533  C  CB  . GLN A 1 75  ? 33.928 29.361  26.022 1.00 42.41 ? 248 GLN A CB  1 
ATOM   534  C  CG  . GLN A 1 75  ? 34.880 30.521  26.201 1.00 44.75 ? 248 GLN A CG  1 
ATOM   535  C  CD  . GLN A 1 75  ? 34.157 31.834  26.351 1.00 49.43 ? 248 GLN A CD  1 
ATOM   536  O  OE1 . GLN A 1 75  ? 34.389 32.770  25.585 1.00 50.83 ? 248 GLN A OE1 1 
ATOM   537  N  NE2 . GLN A 1 75  ? 33.265 31.911  27.339 1.00 49.68 ? 248 GLN A NE2 1 
ATOM   538  N  N   . THR A 1 76  ? 36.711 27.511  26.564 1.00 40.61 ? 249 THR A N   1 
ATOM   539  C  CA  . THR A 1 76  ? 37.517 26.919  27.624 1.00 40.76 ? 249 THR A CA  1 
ATOM   540  C  C   . THR A 1 76  ? 37.432 27.806  28.873 1.00 41.21 ? 249 THR A C   1 
ATOM   541  O  O   . THR A 1 76  ? 37.059 28.978  28.775 1.00 40.45 ? 249 THR A O   1 
ATOM   542  C  CB  . THR A 1 76  ? 38.981 26.749  27.207 1.00 40.41 ? 249 THR A CB  1 
ATOM   543  O  OG1 . THR A 1 76  ? 39.568 28.034  26.954 1.00 40.43 ? 249 THR A OG1 1 
ATOM   544  C  CG2 . THR A 1 76  ? 39.083 25.889  25.947 1.00 40.32 ? 249 THR A CG2 1 
ATOM   545  N  N   . SER A 1 77  ? 37.779 27.254  30.034 1.00 41.62 ? 250 SER A N   1 
ATOM   546  C  CA  . SER A 1 77  ? 37.780 28.051  31.264 1.00 42.65 ? 250 SER A CA  1 
ATOM   547  C  C   . SER A 1 77  ? 38.745 29.241  31.171 1.00 43.06 ? 250 SER A C   1 
ATOM   548  O  O   . SER A 1 77  ? 38.583 30.223  31.898 1.00 43.89 ? 250 SER A O   1 
ATOM   549  C  CB  . SER A 1 77  ? 38.084 27.191  32.495 1.00 42.33 ? 250 SER A CB  1 
ATOM   550  O  OG  . SER A 1 77  ? 39.301 26.493  32.318 1.00 43.43 ? 250 SER A OG  1 
ATOM   551  N  N   . GLU A 1 78  ? 39.719 29.179  30.261 1.00 43.00 ? 251 GLU A N   1 
ATOM   552  C  CA  . GLU A 1 78  ? 40.640 30.307  30.054 1.00 43.03 ? 251 GLU A CA  1 
ATOM   553  C  C   . GLU A 1 78  ? 40.075 31.328  29.082 1.00 43.06 ? 251 GLU A C   1 
ATOM   554  O  O   . GLU A 1 78  ? 40.737 32.318  28.763 1.00 43.22 ? 251 GLU A O   1 
ATOM   555  C  CB  . GLU A 1 78  ? 42.008 29.842  29.533 1.00 42.95 ? 251 GLU A CB  1 
ATOM   556  C  CG  . GLU A 1 78  ? 42.763 28.887  30.456 1.00 43.51 ? 251 GLU A CG  1 
ATOM   557  C  CD  . GLU A 1 78  ? 42.342 27.425  30.283 1.00 43.39 ? 251 GLU A CD  1 
ATOM   558  O  OE1 . GLU A 1 78  ? 41.490 27.132  29.399 1.00 40.92 ? 251 GLU A OE1 1 
ATOM   559  O  OE2 . GLU A 1 78  ? 42.865 26.574  31.037 1.00 41.61 ? 251 GLU A OE2 1 
ATOM   560  N  N   . GLY A 1 79  ? 38.875 31.066  28.573 1.00 42.84 ? 252 GLY A N   1 
ATOM   561  C  CA  . GLY A 1 79  ? 38.179 32.033  27.740 1.00 42.56 ? 252 GLY A CA  1 
ATOM   562  C  C   . GLY A 1 79  ? 38.363 31.885  26.236 1.00 42.51 ? 252 GLY A C   1 
ATOM   563  O  O   . GLY A 1 79  ? 37.898 32.728  25.476 1.00 42.32 ? 252 GLY A O   1 
ATOM   564  N  N   . GLU A 1 80  ? 39.029 30.821  25.795 1.00 42.11 ? 253 GLU A N   1 
ATOM   565  C  CA  . GLU A 1 80  ? 39.159 30.560  24.358 1.00 42.26 ? 253 GLU A CA  1 
ATOM   566  C  C   . GLU A 1 80  ? 37.851 30.009  23.780 1.00 41.88 ? 253 GLU A C   1 
ATOM   567  O  O   . GLU A 1 80  ? 37.347 28.971  24.223 1.00 41.64 ? 253 GLU A O   1 
ATOM   568  C  CB  . GLU A 1 80  ? 40.315 29.589  24.083 1.00 42.41 ? 253 GLU A CB  1 
ATOM   569  C  CG  . GLU A 1 80  ? 40.612 29.336  22.601 1.00 43.11 ? 253 GLU A CG  1 
ATOM   570  C  CD  . GLU A 1 80  ? 41.651 28.236  22.383 1.00 44.82 ? 253 GLU A CD  1 
ATOM   571  O  OE1 . GLU A 1 80  ? 41.974 27.516  23.357 1.00 43.28 ? 253 GLU A OE1 1 
ATOM   572  O  OE2 . GLU A 1 80  ? 42.147 28.095  21.234 1.00 45.49 ? 253 GLU A OE2 1 
ATOM   573  N  N   . PHE A 1 81  ? 37.303 30.717  22.800 1.00 41.76 ? 254 PHE A N   1 
ATOM   574  C  CA  . PHE A 1 81  ? 36.102 30.268  22.091 1.00 41.63 ? 254 PHE A CA  1 
ATOM   575  C  C   . PHE A 1 81  ? 36.499 29.358  20.942 1.00 40.81 ? 254 PHE A C   1 
ATOM   576  O  O   . PHE A 1 81  ? 37.312 29.729  20.101 1.00 40.89 ? 254 PHE A O   1 
ATOM   577  C  CB  . PHE A 1 81  ? 35.294 31.469  21.566 1.00 42.11 ? 254 PHE A CB  1 
ATOM   578  C  CG  . PHE A 1 81  ? 34.014 31.081  20.852 1.00 43.75 ? 254 PHE A CG  1 
ATOM   579  C  CD1 . PHE A 1 81  ? 32.919 30.609  21.565 1.00 43.92 ? 254 PHE A CD1 1 
ATOM   580  C  CD2 . PHE A 1 81  ? 33.918 31.176  19.460 1.00 45.22 ? 254 PHE A CD2 1 
ATOM   581  C  CE1 . PHE A 1 81  ? 31.748 30.247  20.917 1.00 45.04 ? 254 PHE A CE1 1 
ATOM   582  C  CE2 . PHE A 1 81  ? 32.749 30.804  18.796 1.00 44.63 ? 254 PHE A CE2 1 
ATOM   583  C  CZ  . PHE A 1 81  ? 31.664 30.344  19.527 1.00 44.76 ? 254 PHE A CZ  1 
ATOM   584  N  N   . ILE A 1 82  ? 35.941 28.150  20.913 1.00 40.29 ? 255 ILE A N   1 
ATOM   585  C  CA  . ILE A 1 82  ? 36.240 27.212  19.833 1.00 39.12 ? 255 ILE A CA  1 
ATOM   586  C  C   . ILE A 1 82  ? 34.961 26.928  19.048 1.00 39.02 ? 255 ILE A C   1 
ATOM   587  O  O   . ILE A 1 82  ? 34.090 26.203  19.513 1.00 38.83 ? 255 ILE A O   1 
ATOM   588  C  CB  . ILE A 1 82  ? 36.836 25.891  20.375 1.00 39.35 ? 255 ILE A CB  1 
ATOM   589  C  CG1 . ILE A 1 82  ? 38.028 26.182  21.291 1.00 38.84 ? 255 ILE A CG1 1 
ATOM   590  C  CG2 . ILE A 1 82  ? 37.244 24.957  19.215 1.00 37.41 ? 255 ILE A CG2 1 
ATOM   591  C  CD1 . ILE A 1 82  ? 38.406 25.016  22.174 1.00 41.18 ? 255 ILE A CD1 1 
ATOM   592  N  N   . PRO A 1 83  ? 34.831 27.531  17.859 1.00 39.29 ? 256 PRO A N   1 
ATOM   593  C  CA  . PRO A 1 83  ? 33.589 27.352  17.107 1.00 38.74 ? 256 PRO A CA  1 
ATOM   594  C  C   . PRO A 1 83  ? 33.446 25.912  16.615 1.00 38.27 ? 256 PRO A C   1 
ATOM   595  O  O   . PRO A 1 83  ? 34.386 25.363  16.060 1.00 38.65 ? 256 PRO A O   1 
ATOM   596  C  CB  . PRO A 1 83  ? 33.740 28.303  15.914 1.00 38.95 ? 256 PRO A CB  1 
ATOM   597  C  CG  . PRO A 1 83  ? 34.921 29.191  16.231 1.00 39.82 ? 256 PRO A CG  1 
ATOM   598  C  CD  . PRO A 1 83  ? 35.801 28.401  17.168 1.00 38.86 ? 256 PRO A CD  1 
ATOM   599  N  N   . LEU A 1 84  ? 32.281 25.313  16.828 1.00 37.52 ? 257 LEU A N   1 
ATOM   600  C  CA  . LEU A 1 84  ? 31.999 23.981  16.315 1.00 37.47 ? 257 LEU A CA  1 
ATOM   601  C  C   . LEU A 1 84  ? 33.110 22.990  16.674 1.00 36.95 ? 257 LEU A C   1 
ATOM   602  O  O   . LEU A 1 84  ? 33.562 22.219  15.809 1.00 36.42 ? 257 LEU A O   1 
ATOM   603  C  CB  . LEU A 1 84  ? 31.852 24.021  14.788 1.00 37.81 ? 257 LEU A CB  1 
ATOM   604  C  CG  . LEU A 1 84  ? 30.770 24.917  14.198 1.00 40.01 ? 257 LEU A CG  1 
ATOM   605  C  CD1 . LEU A 1 84  ? 30.505 24.520  12.744 1.00 41.62 ? 257 LEU A CD1 1 
ATOM   606  C  CD2 . LEU A 1 84  ? 29.491 24.807  14.999 1.00 41.10 ? 257 LEU A CD2 1 
ATOM   607  N  N   . ASN A 1 85  ? 33.557 23.029  17.929 1.00 35.81 ? 258 ASN A N   1 
ATOM   608  C  CA  . ASN A 1 85  ? 34.534 22.062  18.448 1.00 35.41 ? 258 ASN A CA  1 
ATOM   609  C  C   . ASN A 1 85  ? 34.038 20.641  18.176 1.00 35.64 ? 258 ASN A C   1 
ATOM   610  O  O   . ASN A 1 85  ? 32.865 20.341  18.382 1.00 35.72 ? 258 ASN A O   1 
ATOM   611  C  CB  . ASN A 1 85  ? 34.724 22.250  19.966 1.00 34.58 ? 258 ASN A CB  1 
ATOM   612  C  CG  . ASN A 1 85  ? 35.783 21.322  20.550 1.00 33.68 ? 258 ASN A CG  1 
ATOM   613  O  OD1 . ASN A 1 85  ? 36.906 21.286  20.074 1.00 33.97 ? 258 ASN A OD1 1 
ATOM   614  N  ND2 . ASN A 1 85  ? 35.420 20.568  21.574 1.00 32.44 ? 258 ASN A ND2 1 
ATOM   615  N  N   . GLN A 1 86  ? 34.946 19.774  17.741 1.00 36.11 ? 259 GLN A N   1 
ATOM   616  C  CA  . GLN A 1 86  ? 34.630 18.388  17.403 1.00 36.76 ? 259 GLN A CA  1 
ATOM   617  C  C   . GLN A 1 86  ? 35.155 17.425  18.436 1.00 37.16 ? 259 GLN A C   1 
ATOM   618  O  O   . GLN A 1 86  ? 36.333 17.496  18.816 1.00 36.92 ? 259 GLN A O   1 
ATOM   619  C  CB  . GLN A 1 86  ? 35.342 18.008  16.125 1.00 36.81 ? 259 GLN A CB  1 
ATOM   620  C  CG  . GLN A 1 86  ? 34.600 18.242  14.874 1.00 39.70 ? 259 GLN A CG  1 
ATOM   621  C  CD  . GLN A 1 86  ? 35.208 17.451  13.749 1.00 40.14 ? 259 GLN A CD  1 
ATOM   622  O  OE1 . GLN A 1 86  ? 35.376 17.956  12.655 1.00 43.80 ? 259 GLN A OE1 1 
ATOM   623  N  NE2 . GLN A 1 86  ? 35.574 16.209  14.026 1.00 41.50 ? 259 GLN A NE2 1 
ATOM   624  N  N   . THR A 1 87  ? 34.319 16.485  18.854 1.00 37.12 ? 260 THR A N   1 
ATOM   625  C  CA  . THR A 1 87  ? 34.788 15.431  19.749 1.00 37.30 ? 260 THR A CA  1 
ATOM   626  C  C   . THR A 1 87  ? 34.109 14.103  19.431 1.00 37.29 ? 260 THR A C   1 
ATOM   627  O  O   . THR A 1 87  ? 32.957 14.063  18.982 1.00 36.75 ? 260 THR A O   1 
ATOM   628  C  CB  . THR A 1 87  ? 34.588 15.794  21.234 1.00 37.58 ? 260 THR A CB  1 
ATOM   629  O  OG1 . THR A 1 87  ? 33.220 16.133  21.449 1.00 36.86 ? 260 THR A OG1 1 
ATOM   630  C  CG2 . THR A 1 87  ? 35.471 16.999  21.624 1.00 38.37 ? 260 THR A CG2 1 
ATOM   631  N  N   . ASP A 1 88  ? 34.840 13.015  19.645 1.00 36.89 ? 261 ASP A N   1 
ATOM   632  C  CA  . ASP A 1 88  ? 34.368 11.722  19.225 1.00 36.91 ? 261 ASP A CA  1 
ATOM   633  C  C   . ASP A 1 88  ? 33.309 11.219  20.196 1.00 36.39 ? 261 ASP A C   1 
ATOM   634  O  O   . ASP A 1 88  ? 33.472 11.338  21.401 1.00 35.47 ? 261 ASP A O   1 
ATOM   635  C  CB  . ASP A 1 88  ? 35.542 10.748  19.167 1.00 38.02 ? 261 ASP A CB  1 
ATOM   636  C  CG  . ASP A 1 88  ? 35.228 9.515   18.362 1.00 39.86 ? 261 ASP A CG  1 
ATOM   637  O  OD1 . ASP A 1 88  ? 34.709 8.558   18.976 1.00 44.10 ? 261 ASP A OD1 1 
ATOM   638  O  OD2 . ASP A 1 88  ? 35.463 9.511   17.124 1.00 40.02 ? 261 ASP A OD2 1 
ATOM   639  N  N   . ILE A 1 89  ? 32.231 10.652  19.656 1.00 34.88 ? 262 ILE A N   1 
ATOM   640  C  CA  . ILE A 1 89  ? 31.188 10.017  20.443 1.00 34.31 ? 262 ILE A CA  1 
ATOM   641  C  C   . ILE A 1 89  ? 31.374 8.496   20.381 1.00 33.72 ? 262 ILE A C   1 
ATOM   642  O  O   . ILE A 1 89  ? 31.421 7.917   19.280 1.00 32.79 ? 262 ILE A O   1 
ATOM   643  C  CB  . ILE A 1 89  ? 29.791 10.368  19.849 1.00 34.92 ? 262 ILE A CB  1 
ATOM   644  C  CG1 . ILE A 1 89  ? 29.532 11.876  19.956 1.00 36.17 ? 262 ILE A CG1 1 
ATOM   645  C  CG2 . ILE A 1 89  ? 28.675 9.577   20.528 1.00 35.31 ? 262 ILE A CG2 1 
ATOM   646  C  CD1 . ILE A 1 89  ? 28.282 12.339  19.187 1.00 37.07 ? 262 ILE A CD1 1 
ATOM   647  N  N   . ASN A 1 90  ? 31.471 7.853   21.543 1.00 32.47 ? 263 ASN A N   1 
ATOM   648  C  CA  . ASN A 1 90  ? 31.683 6.403   21.625 1.00 32.09 ? 263 ASN A CA  1 
ATOM   649  C  C   . ASN A 1 90  ? 30.504 5.575   21.098 1.00 31.32 ? 263 ASN A C   1 
ATOM   650  O  O   . ASN A 1 90  ? 29.424 5.560   21.708 1.00 30.78 ? 263 ASN A O   1 
ATOM   651  C  CB  . ASN A 1 90  ? 31.985 5.996   23.074 1.00 31.86 ? 263 ASN A CB  1 
ATOM   652  C  CG  . ASN A 1 90  ? 32.403 4.518   23.223 1.00 34.52 ? 263 ASN A CG  1 
ATOM   653  O  OD1 . ASN A 1 90  ? 32.350 3.706   22.272 1.00 32.73 ? 263 ASN A OD1 1 
ATOM   654  N  ND2 . ASN A 1 90  ? 32.824 4.164   24.444 1.00 34.46 ? 263 ASN A ND2 1 
ATOM   655  N  N   . VAL A 1 91  ? 30.731 4.898   19.970 1.00 30.61 ? 264 VAL A N   1 
ATOM   656  C  CA  . VAL A 1 91  ? 29.772 3.921   19.426 1.00 30.53 ? 264 VAL A CA  1 
ATOM   657  C  C   . VAL A 1 91  ? 30.426 2.550   19.179 1.00 30.94 ? 264 VAL A C   1 
ATOM   658  O  O   . VAL A 1 91  ? 30.034 1.819   18.260 1.00 31.27 ? 264 VAL A O   1 
ATOM   659  C  CB  . VAL A 1 91  ? 29.114 4.431   18.144 1.00 30.05 ? 264 VAL A CB  1 
ATOM   660  C  CG1 . VAL A 1 91  ? 28.129 5.552   18.482 1.00 29.54 ? 264 VAL A CG1 1 
ATOM   661  C  CG2 . VAL A 1 91  ? 30.207 4.946   17.121 1.00 28.79 ? 264 VAL A CG2 1 
ATOM   662  N  N   . GLY A 1 92  ? 31.416 2.204   20.001 1.00 31.36 ? 265 GLY A N   1 
ATOM   663  C  CA  . GLY A 1 92  ? 31.970 0.845   19.998 1.00 31.66 ? 265 GLY A CA  1 
ATOM   664  C  C   . GLY A 1 92  ? 33.461 0.660   19.777 1.00 32.14 ? 265 GLY A C   1 
ATOM   665  O  O   . GLY A 1 92  ? 33.954 -0.470  19.789 1.00 31.84 ? 265 GLY A O   1 
ATOM   666  N  N   . TYR A 1 93  ? 34.181 1.762   19.584 1.00 32.38 ? 266 TYR A N   1 
ATOM   667  C  CA  . TYR A 1 93  ? 35.626 1.750   19.341 1.00 32.96 ? 266 TYR A CA  1 
ATOM   668  C  C   . TYR A 1 93  ? 36.440 0.880   20.322 1.00 33.30 ? 266 TYR A C   1 
ATOM   669  O  O   . TYR A 1 93  ? 37.406 0.229   19.923 1.00 32.37 ? 266 TYR A O   1 
ATOM   670  C  CB  . TYR A 1 93  ? 36.135 3.202   19.388 1.00 33.48 ? 266 TYR A CB  1 
ATOM   671  C  CG  . TYR A 1 93  ? 37.610 3.449   19.067 1.00 36.35 ? 266 TYR A CG  1 
ATOM   672  C  CD1 . TYR A 1 93  ? 38.117 3.246   17.784 1.00 40.66 ? 266 TYR A CD1 1 
ATOM   673  C  CD2 . TYR A 1 93  ? 38.480 3.930   20.040 1.00 39.69 ? 266 TYR A CD2 1 
ATOM   674  C  CE1 . TYR A 1 93  ? 39.462 3.492   17.483 1.00 42.00 ? 266 TYR A CE1 1 
ATOM   675  C  CE2 . TYR A 1 93  ? 39.826 4.182   19.750 1.00 41.71 ? 266 TYR A CE2 1 
ATOM   676  C  CZ  . TYR A 1 93  ? 40.303 3.968   18.471 1.00 41.89 ? 266 TYR A CZ  1 
ATOM   677  O  OH  . TYR A 1 93  ? 41.636 4.216   18.182 1.00 45.02 ? 266 TYR A OH  1 
ATOM   678  N  N   . TYR A 1 94  ? 36.085 0.903   21.606 1.00 33.28 ? 267 TYR A N   1 
ATOM   679  C  CA  . TYR A 1 94  ? 36.881 0.205   22.622 1.00 33.93 ? 267 TYR A CA  1 
ATOM   680  C  C   . TYR A 1 94  ? 36.717 -1.309  22.573 1.00 33.91 ? 267 TYR A C   1 
ATOM   681  O  O   . TYR A 1 94  ? 37.607 -2.061  22.999 1.00 34.49 ? 267 TYR A O   1 
ATOM   682  C  CB  . TYR A 1 94  ? 36.536 0.721   24.036 1.00 34.43 ? 267 TYR A CB  1 
ATOM   683  C  CG  . TYR A 1 94  ? 36.914 2.172   24.269 1.00 36.45 ? 267 TYR A CG  1 
ATOM   684  C  CD1 . TYR A 1 94  ? 38.232 2.608   24.120 1.00 38.03 ? 267 TYR A CD1 1 
ATOM   685  C  CD2 . TYR A 1 94  ? 35.958 3.105   24.653 1.00 39.20 ? 267 TYR A CD2 1 
ATOM   686  C  CE1 . TYR A 1 94  ? 38.581 3.935   24.343 1.00 39.30 ? 267 TYR A CE1 1 
ATOM   687  C  CE2 . TYR A 1 94  ? 36.299 4.449   24.874 1.00 38.62 ? 267 TYR A CE2 1 
ATOM   688  C  CZ  . TYR A 1 94  ? 37.601 4.854   24.717 1.00 39.74 ? 267 TYR A CZ  1 
ATOM   689  O  OH  . TYR A 1 94  ? 37.931 6.179   24.928 1.00 38.61 ? 267 TYR A OH  1 
ATOM   690  N  N   . THR A 1 95  ? 35.578 -1.765  22.067 1.00 33.80 ? 268 THR A N   1 
ATOM   691  C  CA  . THR A 1 95  ? 35.278 -3.193  22.061 1.00 34.19 ? 268 THR A CA  1 
ATOM   692  C  C   . THR A 1 95  ? 35.293 -3.814  20.674 1.00 34.34 ? 268 THR A C   1 
ATOM   693  O  O   . THR A 1 95  ? 35.245 -5.033  20.563 1.00 34.79 ? 268 THR A O   1 
ATOM   694  C  CB  . THR A 1 95  ? 33.899 -3.493  22.687 1.00 34.56 ? 268 THR A CB  1 
ATOM   695  O  OG1 . THR A 1 95  ? 32.889 -2.761  21.977 1.00 34.40 ? 268 THR A OG1 1 
ATOM   696  C  CG2 . THR A 1 95  ? 33.882 -3.089  24.167 1.00 35.22 ? 268 THR A CG2 1 
ATOM   697  N  N   . GLY A 1 96  ? 35.370 -2.994  19.623 1.00 33.83 ? 269 GLY A N   1 
ATOM   698  C  CA  . GLY A 1 96  ? 35.246 -3.524  18.264 1.00 32.98 ? 269 GLY A CA  1 
ATOM   699  C  C   . GLY A 1 96  ? 33.796 -3.584  17.791 1.00 32.63 ? 269 GLY A C   1 
ATOM   700  O  O   . GLY A 1 96  ? 33.513 -4.050  16.688 1.00 32.16 ? 269 GLY A O   1 
ATOM   701  N  N   . ASP A 1 97  ? 32.874 -3.084  18.605 1.00 31.91 ? 270 ASP A N   1 
ATOM   702  C  CA  . ASP A 1 97  ? 31.475 -3.078  18.225 1.00 32.21 ? 270 ASP A CA  1 
ATOM   703  C  C   . ASP A 1 97  ? 31.129 -2.011  17.193 1.00 31.38 ? 270 ASP A C   1 
ATOM   704  O  O   . ASP A 1 97  ? 30.005 -1.977  16.696 1.00 31.30 ? 270 ASP A O   1 
ATOM   705  C  CB  . ASP A 1 97  ? 30.575 -2.936  19.447 1.00 33.02 ? 270 ASP A CB  1 
ATOM   706  C  CG  . ASP A 1 97  ? 30.418 -4.248  20.198 1.00 35.34 ? 270 ASP A CG  1 
ATOM   707  O  OD1 . ASP A 1 97  ? 29.629 -5.119  19.759 1.00 35.19 ? 270 ASP A OD1 1 
ATOM   708  O  OD2 . ASP A 1 97  ? 31.083 -4.394  21.237 1.00 37.20 ? 270 ASP A OD2 1 
ATOM   709  N  N   . ASP A 1 98  ? 32.083 -1.145  16.880 1.00 29.93 ? 271 ASP A N   1 
ATOM   710  C  CA  . ASP A 1 98  ? 31.898 -0.189  15.804 1.00 29.72 ? 271 ASP A CA  1 
ATOM   711  C  C   . ASP A 1 98  ? 32.227 -0.793  14.439 1.00 29.49 ? 271 ASP A C   1 
ATOM   712  O  O   . ASP A 1 98  ? 32.029 -0.137  13.431 1.00 28.25 ? 271 ASP A O   1 
ATOM   713  C  CB  . ASP A 1 98  ? 32.720 1.093   16.026 1.00 29.41 ? 271 ASP A CB  1 
ATOM   714  C  CG  . ASP A 1 98  ? 34.213 0.832   16.142 1.00 31.45 ? 271 ASP A CG  1 
ATOM   715  O  OD1 . ASP A 1 98  ? 34.613 -0.318  16.412 1.00 31.01 ? 271 ASP A OD1 1 
ATOM   716  O  OD2 . ASP A 1 98  ? 34.988 1.804   15.989 1.00 32.43 ? 271 ASP A OD2 1 
ATOM   717  N  N   . ARG A 1 99  ? 32.742 -2.025  14.429 1.00 29.52 ? 272 ARG A N   1 
ATOM   718  C  CA  . ARG A 1 99  ? 32.946 -2.777  13.183 1.00 30.28 ? 272 ARG A CA  1 
ATOM   719  C  C   . ARG A 1 99  ? 31.681 -3.590  12.915 1.00 30.80 ? 272 ARG A C   1 
ATOM   720  O  O   . ARG A 1 99  ? 31.347 -4.515  13.655 1.00 30.40 ? 272 ARG A O   1 
ATOM   721  C  CB  . ARG A 1 99  ? 34.173 -3.691  13.292 1.00 30.46 ? 272 ARG A CB  1 
ATOM   722  C  CG  . ARG A 1 99  ? 35.446 -2.941  13.761 1.00 31.18 ? 272 ARG A CG  1 
ATOM   723  C  CD  . ARG A 1 99  ? 36.566 -3.900  14.110 1.00 32.92 ? 272 ARG A CD  1 
ATOM   724  N  NE  . ARG A 1 99  ? 36.132 -4.918  15.071 1.00 34.23 ? 272 ARG A NE  1 
ATOM   725  C  CZ  . ARG A 1 99  ? 36.862 -5.986  15.388 1.00 33.02 ? 272 ARG A CZ  1 
ATOM   726  N  NH1 . ARG A 1 99  ? 38.049 -6.160  14.818 1.00 30.79 ? 272 ARG A NH1 1 
ATOM   727  N  NH2 . ARG A 1 99  ? 36.415 -6.881  16.262 1.00 32.01 ? 272 ARG A NH2 1 
ATOM   728  N  N   . LEU A 1 100 ? 30.932 -3.192  11.897 1.00 31.08 ? 273 LEU A N   1 
ATOM   729  C  CA  . LEU A 1 100 ? 29.576 -3.708  11.732 1.00 32.02 ? 273 LEU A CA  1 
ATOM   730  C  C   . LEU A 1 100 ? 29.508 -4.903  10.804 1.00 33.09 ? 273 LEU A C   1 
ATOM   731  O  O   . LEU A 1 100 ? 30.235 -4.962  9.818  1.00 33.19 ? 273 LEU A O   1 
ATOM   732  C  CB  . LEU A 1 100 ? 28.678 -2.623  11.145 1.00 32.02 ? 273 LEU A CB  1 
ATOM   733  C  CG  . LEU A 1 100 ? 28.577 -1.320  11.925 1.00 32.34 ? 273 LEU A CG  1 
ATOM   734  C  CD1 . LEU A 1 100 ? 27.511 -0.463  11.298 1.00 30.67 ? 273 LEU A CD1 1 
ATOM   735  C  CD2 . LEU A 1 100 ? 28.284 -1.616  13.413 1.00 30.95 ? 273 LEU A CD2 1 
ATOM   736  N  N   . PHE A 1 101 ? 28.631 -5.845  11.122 1.00 33.62 ? 274 PHE A N   1 
ATOM   737  C  CA  . PHE A 1 101 ? 28.178 -6.819  10.134 1.00 34.64 ? 274 PHE A CA  1 
ATOM   738  C  C   . PHE A 1 101 ? 26.814 -6.314  9.677  1.00 34.76 ? 274 PHE A C   1 
ATOM   739  O  O   . PHE A 1 101 ? 25.812 -6.507  10.368 1.00 34.87 ? 274 PHE A O   1 
ATOM   740  C  CB  . PHE A 1 101 ? 28.081 -8.216  10.744 1.00 34.56 ? 274 PHE A CB  1 
ATOM   741  C  CG  . PHE A 1 101 ? 27.574 -9.263  9.778  1.00 36.62 ? 274 PHE A CG  1 
ATOM   742  C  CD1 . PHE A 1 101 ? 28.150 -9.406  8.524  1.00 38.64 ? 274 PHE A CD1 1 
ATOM   743  C  CD2 . PHE A 1 101 ? 26.526 -10.094 10.130 1.00 37.62 ? 274 PHE A CD2 1 
ATOM   744  C  CE1 . PHE A 1 101 ? 27.682 -10.370 7.628  1.00 41.05 ? 274 PHE A CE1 1 
ATOM   745  C  CE2 . PHE A 1 101 ? 26.048 -11.060 9.254  1.00 39.76 ? 274 PHE A CE2 1 
ATOM   746  C  CZ  . PHE A 1 101 ? 26.619 -11.197 7.993  1.00 40.39 ? 274 PHE A CZ  1 
ATOM   747  N  N   . LEU A 1 102 ? 26.795 -5.605  8.549  1.00 35.24 ? 275 LEU A N   1 
ATOM   748  C  CA  . LEU A 1 102 ? 25.637 -4.799  8.166  1.00 36.38 ? 275 LEU A CA  1 
ATOM   749  C  C   . LEU A 1 102 ? 24.879 -5.421  7.002  1.00 36.64 ? 275 LEU A C   1 
ATOM   750  O  O   . LEU A 1 102 ? 25.215 -5.184  5.848  1.00 36.66 ? 275 LEU A O   1 
ATOM   751  C  CB  . LEU A 1 102 ? 26.102 -3.409  7.738  1.00 36.58 ? 275 LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 102 ? 25.294 -2.176  8.138  1.00 38.34 ? 275 LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 102 ? 25.526 -1.015  7.171  1.00 38.98 ? 275 LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 102 ? 23.823 -2.455  8.338  1.00 38.52 ? 275 LEU A CD2 1 
ATOM   755  N  N   . VAL A 1 103 ? 23.857 -6.208  7.304  1.00 37.30 ? 276 VAL A N   1 
ATOM   756  C  CA  . VAL A 1 103 ? 23.031 -6.813  6.265  1.00 37.70 ? 276 VAL A CA  1 
ATOM   757  C  C   . VAL A 1 103 ? 21.642 -6.218  6.438  1.00 37.76 ? 276 VAL A C   1 
ATOM   758  O  O   . VAL A 1 103 ? 21.218 -5.384  5.640  1.00 38.24 ? 276 VAL A O   1 
ATOM   759  C  CB  . VAL A 1 103 ? 23.007 -8.341  6.391  1.00 37.60 ? 276 VAL A CB  1 
ATOM   760  C  CG1 . VAL A 1 103 ? 22.189 -8.980  5.256  1.00 38.58 ? 276 VAL A CG1 1 
ATOM   761  C  CG2 . VAL A 1 103 ? 24.423 -8.874  6.359  1.00 38.07 ? 276 VAL A CG2 1 
ATOM   762  N  N   . SER A 1 104 ? 20.963 -6.603  7.509  1.00 37.61 ? 277 SER A N   1 
ATOM   763  C  CA  . SER A 1 104 ? 19.732 -5.931  7.898  1.00 37.88 ? 277 SER A CA  1 
ATOM   764  C  C   . SER A 1 104 ? 20.061 -4.708  8.763  1.00 37.59 ? 277 SER A C   1 
ATOM   765  O  O   . SER A 1 104 ? 21.158 -4.617  9.325  1.00 38.38 ? 277 SER A O   1 
ATOM   766  C  CB  . SER A 1 104 ? 18.770 -6.890  8.602  1.00 37.45 ? 277 SER A CB  1 
ATOM   767  O  OG  . SER A 1 104 ? 19.396 -7.556  9.679  1.00 38.88 ? 277 SER A OG  1 
ATOM   768  N  N   . PRO A 1 105 ? 19.137 -3.739  8.826  1.00 37.00 ? 278 PRO A N   1 
ATOM   769  C  CA  . PRO A 1 105 ? 19.448 -2.474  9.489  1.00 36.18 ? 278 PRO A CA  1 
ATOM   770  C  C   . PRO A 1 105 ? 19.813 -2.665  10.963 1.00 35.45 ? 278 PRO A C   1 
ATOM   771  O  O   . PRO A 1 105 ? 19.281 -3.542  11.626 1.00 34.91 ? 278 PRO A O   1 
ATOM   772  C  CB  . PRO A 1 105 ? 18.154 -1.663  9.335  1.00 36.40 ? 278 PRO A CB  1 
ATOM   773  C  CG  . PRO A 1 105 ? 17.468 -2.278  8.133  1.00 36.86 ? 278 PRO A CG  1 
ATOM   774  C  CD  . PRO A 1 105 ? 17.799 -3.735  8.207  1.00 36.76 ? 278 PRO A CD  1 
ATOM   775  N  N   . LEU A 1 106 ? 20.727 -1.838  11.458 1.00 34.59 ? 279 LEU A N   1 
ATOM   776  C  CA  . LEU A 1 106 ? 21.221 -1.973  12.824 1.00 34.39 ? 279 LEU A CA  1 
ATOM   777  C  C   . LEU A 1 106 ? 20.938 -0.702  13.617 1.00 33.73 ? 279 LEU A C   1 
ATOM   778  O  O   . LEU A 1 106 ? 21.097 0.392   13.112 1.00 33.50 ? 279 LEU A O   1 
ATOM   779  C  CB  . LEU A 1 106 ? 22.739 -2.214  12.827 1.00 33.92 ? 279 LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 106 ? 23.289 -3.479  12.153 1.00 35.07 ? 279 LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 106 ? 24.807 -3.444  12.114 1.00 33.40 ? 279 LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 106 ? 22.820 -4.738  12.891 1.00 34.39 ? 279 LEU A CD2 1 
ATOM   783  N  N   . ILE A 1 107 ? 20.544 -0.860  14.873 1.00 33.63 ? 280 ILE A N   1 
ATOM   784  C  CA  . ILE A 1 107 ? 20.492 0.276   15.790 1.00 33.68 ? 280 ILE A CA  1 
ATOM   785  C  C   . ILE A 1 107 ? 21.861 0.482   16.449 1.00 32.91 ? 280 ILE A C   1 
ATOM   786  O  O   . ILE A 1 107 ? 22.351 -0.361  17.175 1.00 33.14 ? 280 ILE A O   1 
ATOM   787  C  CB  . ILE A 1 107 ? 19.379 0.113   16.842 1.00 33.87 ? 280 ILE A CB  1 
ATOM   788  C  CG1 . ILE A 1 107 ? 18.025 0.048   16.131 1.00 34.58 ? 280 ILE A CG1 1 
ATOM   789  C  CG2 . ILE A 1 107 ? 19.401 1.283   17.852 1.00 32.79 ? 280 ILE A CG2 1 
ATOM   790  C  CD1 . ILE A 1 107 ? 16.896 -0.501  16.991 1.00 37.22 ? 280 ILE A CD1 1 
ATOM   791  N  N   . ILE A 1 108 ? 22.498 1.596   16.142 1.00 32.53 ? 281 ILE A N   1 
ATOM   792  C  CA  . ILE A 1 108 ? 23.772 1.924   16.770 1.00 31.86 ? 281 ILE A CA  1 
ATOM   793  C  C   . ILE A 1 108 ? 23.459 2.608   18.100 1.00 32.25 ? 281 ILE A C   1 
ATOM   794  O  O   . ILE A 1 108 ? 22.611 3.487   18.147 1.00 32.11 ? 281 ILE A O   1 
ATOM   795  C  CB  . ILE A 1 108 ? 24.555 2.864   15.875 1.00 31.09 ? 281 ILE A CB  1 
ATOM   796  C  CG1 . ILE A 1 108 ? 24.720 2.227   14.490 1.00 31.04 ? 281 ILE A CG1 1 
ATOM   797  C  CG2 . ILE A 1 108 ? 25.909 3.211   16.504 1.00 31.18 ? 281 ILE A CG2 1 
ATOM   798  C  CD1 . ILE A 1 108 ? 25.276 0.774   14.539 1.00 28.65 ? 281 ILE A CD1 1 
ATOM   799  N  N   . SER A 1 109 ? 24.126 2.193   19.175 1.00 32.36 ? 282 SER A N   1 
ATOM   800  C  CA  . SER A 1 109 ? 23.822 2.706   20.499 1.00 33.13 ? 282 SER A CA  1 
ATOM   801  C  C   . SER A 1 109 ? 25.044 3.380   21.143 1.00 33.18 ? 282 SER A C   1 
ATOM   802  O  O   . SER A 1 109 ? 26.144 2.823   21.159 1.00 34.06 ? 282 SER A O   1 
ATOM   803  C  CB  . SER A 1 109 ? 23.266 1.578   21.379 1.00 33.67 ? 282 SER A CB  1 
ATOM   804  O  OG  . SER A 1 109 ? 22.841 2.071   22.643 1.00 35.34 ? 282 SER A OG  1 
ATOM   805  N  N   . HIS A 1 110 ? 24.861 4.598   21.640 1.00 32.18 ? 283 HIS A N   1 
ATOM   806  C  CA  . HIS A 1 110 ? 25.899 5.283   22.402 1.00 31.66 ? 283 HIS A CA  1 
ATOM   807  C  C   . HIS A 1 110 ? 25.417 5.323   23.847 1.00 32.14 ? 283 HIS A C   1 
ATOM   808  O  O   . HIS A 1 110 ? 24.406 5.951   24.133 1.00 31.39 ? 283 HIS A O   1 
ATOM   809  C  CB  . HIS A 1 110 ? 26.095 6.709   21.876 1.00 31.18 ? 283 HIS A CB  1 
ATOM   810  C  CG  . HIS A 1 110 ? 26.755 7.639   22.854 1.00 32.48 ? 283 HIS A CG  1 
ATOM   811  N  ND1 . HIS A 1 110 ? 28.095 7.557   23.176 1.00 33.12 ? 283 HIS A ND1 1 
ATOM   812  C  CD2 . HIS A 1 110 ? 26.265 8.695   23.556 1.00 32.49 ? 283 HIS A CD2 1 
ATOM   813  C  CE1 . HIS A 1 110 ? 28.403 8.514   24.039 1.00 32.94 ? 283 HIS A CE1 1 
ATOM   814  N  NE2 . HIS A 1 110 ? 27.308 9.213   24.292 1.00 34.75 ? 283 HIS A NE2 1 
ATOM   815  N  N   . GLU A 1 111 ? 26.130 4.656   24.747 1.00 31.94 ? 284 GLU A N   1 
ATOM   816  C  CA  . GLU A 1 111 ? 25.757 4.681   26.150 1.00 32.63 ? 284 GLU A CA  1 
ATOM   817  C  C   . GLU A 1 111 ? 26.145 6.020   26.749 1.00 32.11 ? 284 GLU A C   1 
ATOM   818  O  O   . GLU A 1 111 ? 27.291 6.453   26.649 1.00 31.29 ? 284 GLU A O   1 
ATOM   819  C  CB  . GLU A 1 111 ? 26.408 3.534   26.933 1.00 33.21 ? 284 GLU A CB  1 
ATOM   820  C  CG  . GLU A 1 111 ? 26.035 3.542   28.421 1.00 37.65 ? 284 GLU A CG  1 
ATOM   821  C  CD  . GLU A 1 111 ? 26.635 2.371   29.184 1.00 42.87 ? 284 GLU A CD  1 
ATOM   822  O  OE1 . GLU A 1 111 ? 26.486 1.214   28.728 1.00 44.74 ? 284 GLU A OE1 1 
ATOM   823  O  OE2 . GLU A 1 111 ? 27.257 2.611   30.244 1.00 46.31 ? 284 GLU A OE2 1 
ATOM   824  N  N   . ILE A 1 112 ? 25.173 6.684   27.362 1.00 31.97 ? 285 ILE A N   1 
ATOM   825  C  CA  . ILE A 1 112 ? 25.437 7.964   27.992 1.00 32.18 ? 285 ILE A CA  1 
ATOM   826  C  C   . ILE A 1 112 ? 25.990 7.743   29.405 1.00 32.55 ? 285 ILE A C   1 
ATOM   827  O  O   . ILE A 1 112 ? 25.245 7.588   30.380 1.00 32.94 ? 285 ILE A O   1 
ATOM   828  C  CB  . ILE A 1 112 ? 24.188 8.845   28.019 1.00 32.13 ? 285 ILE A CB  1 
ATOM   829  C  CG1 . ILE A 1 112 ? 23.683 9.041   26.582 1.00 31.35 ? 285 ILE A CG1 1 
ATOM   830  C  CG2 . ILE A 1 112 ? 24.519 10.189  28.688 1.00 31.56 ? 285 ILE A CG2 1 
ATOM   831  C  CD1 . ILE A 1 112 ? 22.250 9.606   26.472 1.00 33.14 ? 285 ILE A CD1 1 
ATOM   832  N  N   . ASN A 1 113 ? 27.304 7.677   29.492 1.00 32.72 ? 286 ASN A N   1 
ATOM   833  C  CA  . ASN A 1 113 ? 27.968 7.490   30.775 1.00 33.20 ? 286 ASN A CA  1 
ATOM   834  C  C   . ASN A 1 113 ? 28.796 8.715   31.104 1.00 33.55 ? 286 ASN A C   1 
ATOM   835  O  O   . ASN A 1 113 ? 28.678 9.746   30.448 1.00 32.41 ? 286 ASN A O   1 
ATOM   836  C  CB  . ASN A 1 113 ? 28.850 6.233   30.759 1.00 32.96 ? 286 ASN A CB  1 
ATOM   837  C  CG  . ASN A 1 113 ? 29.896 6.259   29.646 1.00 32.97 ? 286 ASN A CG  1 
ATOM   838  O  OD1 . ASN A 1 113 ? 30.332 7.322   29.191 1.00 31.01 ? 286 ASN A OD1 1 
ATOM   839  N  ND2 . ASN A 1 113 ? 30.322 5.073   29.220 1.00 33.31 ? 286 ASN A ND2 1 
ATOM   840  N  N   . GLN A 1 114 ? 29.657 8.586   32.112 1.00 35.08 ? 287 GLN A N   1 
ATOM   841  C  CA  . GLN A 1 114 ? 30.406 9.724   32.609 1.00 36.47 ? 287 GLN A CA  1 
ATOM   842  C  C   . GLN A 1 114 ? 31.331 10.314  31.553 1.00 36.51 ? 287 GLN A C   1 
ATOM   843  O  O   . GLN A 1 114 ? 31.646 11.502  31.597 1.00 36.72 ? 287 GLN A O   1 
ATOM   844  C  CB  . GLN A 1 114 ? 31.180 9.355   33.888 1.00 37.53 ? 287 GLN A CB  1 
ATOM   845  C  CG  . GLN A 1 114 ? 31.807 10.566  34.573 1.00 41.52 ? 287 GLN A CG  1 
ATOM   846  C  CD  . GLN A 1 114 ? 32.467 10.224  35.897 1.00 47.70 ? 287 GLN A CD  1 
ATOM   847  O  OE1 . GLN A 1 114 ? 31.927 9.468   36.709 1.00 50.09 ? 287 GLN A OE1 1 
ATOM   848  N  NE2 . GLN A 1 114 ? 33.641 10.792  36.124 1.00 50.90 ? 287 GLN A NE2 1 
ATOM   849  N  N   . GLN A 1 115 ? 31.742 9.506   30.576 1.00 36.14 ? 288 GLN A N   1 
ATOM   850  C  CA  . GLN A 1 115 ? 32.577 10.033  29.499 1.00 36.32 ? 288 GLN A CA  1 
ATOM   851  C  C   . GLN A 1 115 ? 31.789 10.562  28.294 1.00 35.71 ? 288 GLN A C   1 
ATOM   852  O  O   . GLN A 1 115 ? 32.384 11.036  27.335 1.00 35.89 ? 288 GLN A O   1 
ATOM   853  C  CB  . GLN A 1 115 ? 33.604 8.988   29.033 1.00 36.95 ? 288 GLN A CB  1 
ATOM   854  C  CG  . GLN A 1 115 ? 34.634 8.637   30.100 1.00 40.24 ? 288 GLN A CG  1 
ATOM   855  C  CD  . GLN A 1 115 ? 34.061 7.787   31.220 1.00 44.84 ? 288 GLN A CD  1 
ATOM   856  O  OE1 . GLN A 1 115 ? 33.388 6.774   30.981 1.00 47.86 ? 288 GLN A OE1 1 
ATOM   857  N  NE2 . GLN A 1 115 ? 34.335 8.187   32.457 1.00 47.29 ? 288 GLN A NE2 1 
ATOM   858  N  N   . SER A 1 116 ? 30.460 10.477  28.324 1.00 34.65 ? 289 SER A N   1 
ATOM   859  C  CA  . SER A 1 116 ? 29.669 10.953  27.192 1.00 33.98 ? 289 SER A CA  1 
ATOM   860  C  C   . SER A 1 116 ? 29.427 12.449  27.298 1.00 34.38 ? 289 SER A C   1 
ATOM   861  O  O   . SER A 1 116 ? 29.145 12.950  28.385 1.00 33.48 ? 289 SER A O   1 
ATOM   862  C  CB  . SER A 1 116 ? 28.313 10.255  27.149 1.00 33.63 ? 289 SER A CB  1 
ATOM   863  O  OG  . SER A 1 116 ? 27.444 10.993  26.305 1.00 32.80 ? 289 SER A OG  1 
ATOM   864  N  N   . PRO A 1 117 ? 29.494 13.163  26.170 1.00 34.87 ? 290 PRO A N   1 
ATOM   865  C  CA  . PRO A 1 117 ? 29.165 14.587  26.243 1.00 35.39 ? 290 PRO A CA  1 
ATOM   866  C  C   . PRO A 1 117 ? 27.694 14.858  26.613 1.00 35.21 ? 290 PRO A C   1 
ATOM   867  O  O   . PRO A 1 117 ? 27.348 16.000  26.900 1.00 35.77 ? 290 PRO A O   1 
ATOM   868  C  CB  . PRO A 1 117 ? 29.482 15.112  24.832 1.00 35.85 ? 290 PRO A CB  1 
ATOM   869  C  CG  . PRO A 1 117 ? 29.541 13.876  23.935 1.00 36.05 ? 290 PRO A CG  1 
ATOM   870  C  CD  . PRO A 1 117 ? 29.892 12.721  24.813 1.00 35.08 ? 290 PRO A CD  1 
ATOM   871  N  N   . PHE A 1 118 ? 26.848 13.828  26.619 1.00 35.07 ? 291 PHE A N   1 
ATOM   872  C  CA  . PHE A 1 118 ? 25.441 13.984  27.019 1.00 35.54 ? 291 PHE A CA  1 
ATOM   873  C  C   . PHE A 1 118 ? 25.164 13.691  28.502 1.00 34.92 ? 291 PHE A C   1 
ATOM   874  O  O   . PHE A 1 118 ? 24.011 13.708  28.929 1.00 34.97 ? 291 PHE A O   1 
ATOM   875  C  CB  . PHE A 1 118 ? 24.525 13.088  26.166 1.00 35.87 ? 291 PHE A CB  1 
ATOM   876  C  CG  . PHE A 1 118 ? 24.454 13.501  24.724 1.00 38.36 ? 291 PHE A CG  1 
ATOM   877  C  CD1 . PHE A 1 118 ? 23.475 14.392  24.294 1.00 41.12 ? 291 PHE A CD1 1 
ATOM   878  C  CD2 . PHE A 1 118 ? 25.371 13.008  23.800 1.00 40.75 ? 291 PHE A CD2 1 
ATOM   879  C  CE1 . PHE A 1 118 ? 23.408 14.793  22.958 1.00 44.07 ? 291 PHE A CE1 1 
ATOM   880  C  CE2 . PHE A 1 118 ? 25.314 13.402  22.458 1.00 43.23 ? 291 PHE A CE2 1 
ATOM   881  C  CZ  . PHE A 1 118 ? 24.329 14.296  22.038 1.00 43.45 ? 291 PHE A CZ  1 
ATOM   882  N  N   . TRP A 1 119 ? 26.211 13.391  29.261 1.00 34.25 ? 292 TRP A N   1 
ATOM   883  C  CA  . TRP A 1 119 ? 26.098 12.909  30.652 1.00 34.88 ? 292 TRP A CA  1 
ATOM   884  C  C   . TRP A 1 119 ? 25.209 13.809  31.535 1.00 35.14 ? 292 TRP A C   1 
ATOM   885  O  O   . TRP A 1 119 ? 24.415 13.318  32.343 1.00 34.72 ? 292 TRP A O   1 
ATOM   886  C  CB  . TRP A 1 119 ? 27.512 12.820  31.231 1.00 34.48 ? 292 TRP A CB  1 
ATOM   887  C  CG  . TRP A 1 119 ? 27.691 12.405  32.669 1.00 35.10 ? 292 TRP A CG  1 
ATOM   888  C  CD1 . TRP A 1 119 ? 28.384 13.102  33.628 1.00 34.04 ? 292 TRP A CD1 1 
ATOM   889  C  CD2 . TRP A 1 119 ? 27.245 11.192  33.303 1.00 34.37 ? 292 TRP A CD2 1 
ATOM   890  N  NE1 . TRP A 1 119 ? 28.378 12.406  34.815 1.00 35.05 ? 292 TRP A NE1 1 
ATOM   891  C  CE2 . TRP A 1 119 ? 27.693 11.233  34.645 1.00 35.12 ? 292 TRP A CE2 1 
ATOM   892  C  CE3 . TRP A 1 119 ? 26.514 10.077  32.871 1.00 34.63 ? 292 TRP A CE3 1 
ATOM   893  C  CZ2 . TRP A 1 119 ? 27.430 10.205  35.558 1.00 35.06 ? 292 TRP A CZ2 1 
ATOM   894  C  CZ3 . TRP A 1 119 ? 26.245 9.062   33.780 1.00 34.59 ? 292 TRP A CZ3 1 
ATOM   895  C  CH2 . TRP A 1 119 ? 26.704 9.132   35.107 1.00 35.61 ? 292 TRP A CH2 1 
ATOM   896  N  N   . GLU A 1 120 ? 25.340 15.113  31.359 1.00 35.88 ? 293 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 120 ? 24.665 16.082  32.239 1.00 37.92 ? 293 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 120 ? 23.390 16.690  31.645 1.00 37.69 ? 293 GLU A C   1 
ATOM   899  O  O   . GLU A 1 120 ? 22.799 17.595  32.238 1.00 38.14 ? 293 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 120 ? 25.639 17.203  32.591 1.00 38.26 ? 293 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 120 ? 26.899 16.707  33.251 1.00 42.29 ? 293 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 120 ? 27.494 17.743  34.170 1.00 47.84 ? 293 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 120 ? 27.660 18.893  33.726 1.00 50.53 ? 293 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 120 ? 27.786 17.409  35.337 1.00 51.69 ? 293 GLU A OE2 1 
ATOM   905  N  N   . ILE A 1 121 ? 22.965 16.199  30.481 1.00 37.63 ? 294 ILE A N   1 
ATOM   906  C  CA  . ILE A 1 121 ? 21.827 16.794  29.760 1.00 37.48 ? 294 ILE A CA  1 
ATOM   907  C  C   . ILE A 1 121 ? 20.525 16.052  30.041 1.00 37.62 ? 294 ILE A C   1 
ATOM   908  O  O   . ILE A 1 121 ? 20.409 14.853  29.766 1.00 37.05 ? 294 ILE A O   1 
ATOM   909  C  CB  . ILE A 1 121 ? 22.096 16.837  28.228 1.00 37.50 ? 294 ILE A CB  1 
ATOM   910  C  CG1 . ILE A 1 121 ? 23.370 17.633  27.951 1.00 38.64 ? 294 ILE A CG1 1 
ATOM   911  C  CG2 . ILE A 1 121 ? 20.909 17.449  27.466 1.00 37.28 ? 294 ILE A CG2 1 
ATOM   912  C  CD1 . ILE A 1 121 ? 23.712 17.778  26.464 1.00 41.53 ? 294 ILE A CD1 1 
ATOM   913  N  N   . SER A 1 122 ? 19.538 16.775  30.583 1.00 37.26 ? 295 SER A N   1 
ATOM   914  C  CA  . SER A 1 122 ? 18.228 16.198  30.902 1.00 36.77 ? 295 SER A CA  1 
ATOM   915  C  C   . SER A 1 122 ? 17.247 16.439  29.760 1.00 36.76 ? 295 SER A C   1 
ATOM   916  O  O   . SER A 1 122 ? 17.537 17.199  28.841 1.00 36.20 ? 295 SER A O   1 
ATOM   917  C  CB  . SER A 1 122 ? 17.658 16.851  32.162 1.00 37.30 ? 295 SER A CB  1 
ATOM   918  O  OG  . SER A 1 122 ? 17.345 18.205  31.874 1.00 35.52 ? 295 SER A OG  1 
ATOM   919  N  N   . LYS A 1 123 ? 16.084 15.799  29.831 1.00 36.72 ? 296 LYS A N   1 
ATOM   920  C  CA  . LYS A 1 123 ? 15.042 16.014  28.828 1.00 37.52 ? 296 LYS A CA  1 
ATOM   921  C  C   . LYS A 1 123 ? 14.696 17.500  28.664 1.00 37.55 ? 296 LYS A C   1 
ATOM   922  O  O   . LYS A 1 123 ? 14.531 17.984  27.548 1.00 37.46 ? 296 LYS A O   1 
ATOM   923  C  CB  . LYS A 1 123 ? 13.783 15.201  29.156 1.00 37.19 ? 296 LYS A CB  1 
ATOM   924  C  CG  . LYS A 1 123 ? 12.659 15.390  28.151 1.00 37.31 ? 296 LYS A CG  1 
ATOM   925  C  CD  . LYS A 1 123 ? 11.465 14.494  28.469 1.00 38.39 ? 296 LYS A CD  1 
ATOM   926  C  CE  . LYS A 1 123 ? 10.526 14.373  27.257 1.00 38.58 ? 296 LYS A CE  1 
ATOM   927  N  NZ  . LYS A 1 123 ? 9.424  13.425  27.556 1.00 39.23 ? 296 LYS A NZ  1 
ATOM   928  N  N   . ALA A 1 124 ? 14.611 18.234  29.772 1.00 37.94 ? 297 ALA A N   1 
ATOM   929  C  CA  . ALA A 1 124 ? 14.234 19.653  29.702 1.00 38.58 ? 297 ALA A CA  1 
ATOM   930  C  C   . ALA A 1 124 ? 15.349 20.512  29.109 1.00 38.88 ? 297 ALA A C   1 
ATOM   931  O  O   . ALA A 1 124 ? 15.086 21.523  28.455 1.00 39.03 ? 297 ALA A O   1 
ATOM   932  C  CB  . ALA A 1 124 ? 13.825 20.179  31.092 1.00 38.48 ? 297 ALA A CB  1 
ATOM   933  N  N   . GLN A 1 125 ? 16.596 20.100  29.323 1.00 39.38 ? 298 GLN A N   1 
ATOM   934  C  CA  . GLN A 1 125 ? 17.745 20.877  28.863 1.00 40.40 ? 298 GLN A CA  1 
ATOM   935  C  C   . GLN A 1 125 ? 18.041 20.678  27.373 1.00 40.30 ? 298 GLN A C   1 
ATOM   936  O  O   . GLN A 1 125 ? 18.462 21.603  26.685 1.00 40.58 ? 298 GLN A O   1 
ATOM   937  C  CB  . GLN A 1 125 ? 18.982 20.505  29.682 1.00 40.82 ? 298 GLN A CB  1 
ATOM   938  C  CG  . GLN A 1 125 ? 20.248 21.240  29.266 1.00 43.60 ? 298 GLN A CG  1 
ATOM   939  C  CD  . GLN A 1 125 ? 20.156 22.743  29.472 1.00 46.87 ? 298 GLN A CD  1 
ATOM   940  O  OE1 . GLN A 1 125 ? 20.747 23.520  28.723 1.00 49.68 ? 298 GLN A OE1 1 
ATOM   941  N  NE2 . GLN A 1 125 ? 19.409 23.159  30.482 1.00 48.20 ? 298 GLN A NE2 1 
ATOM   942  N  N   . LEU A 1 126 ? 17.819 19.464  26.886 1.00 40.33 ? 299 LEU A N   1 
ATOM   943  C  CA  . LEU A 1 126 ? 18.193 19.095  25.514 1.00 40.31 ? 299 LEU A CA  1 
ATOM   944  C  C   . LEU A 1 126 ? 17.829 20.121  24.426 1.00 40.52 ? 299 LEU A C   1 
ATOM   945  O  O   . LEU A 1 126 ? 18.697 20.547  23.656 1.00 40.01 ? 299 LEU A O   1 
ATOM   946  C  CB  . LEU A 1 126 ? 17.609 17.731  25.169 1.00 40.36 ? 299 LEU A CB  1 
ATOM   947  C  CG  . LEU A 1 126 ? 17.861 17.273  23.739 1.00 40.17 ? 299 LEU A CG  1 
ATOM   948  C  CD1 . LEU A 1 126 ? 19.370 17.140  23.487 1.00 39.18 ? 299 LEU A CD1 1 
ATOM   949  C  CD2 . LEU A 1 126 ? 17.118 15.967  23.492 1.00 39.24 ? 299 LEU A CD2 1 
ATOM   950  N  N   . PRO A 1 127 ? 16.549 20.517  24.347 1.00 41.05 ? 300 PRO A N   1 
ATOM   951  C  CA  . PRO A 1 127 ? 16.182 21.452  23.285 1.00 41.45 ? 300 PRO A CA  1 
ATOM   952  C  C   . PRO A 1 127 ? 16.870 22.818  23.397 1.00 41.80 ? 300 PRO A C   1 
ATOM   953  O  O   . PRO A 1 127 ? 16.913 23.564  22.420 1.00 41.75 ? 300 PRO A O   1 
ATOM   954  C  CB  . PRO A 1 127 ? 14.654 21.568  23.418 1.00 41.66 ? 300 PRO A CB  1 
ATOM   955  C  CG  . PRO A 1 127 ? 14.332 21.030  24.753 1.00 41.57 ? 300 PRO A CG  1 
ATOM   956  C  CD  . PRO A 1 127 ? 15.368 20.008  25.064 1.00 41.11 ? 300 PRO A CD  1 
ATOM   957  N  N   . LYS A 1 128 ? 17.425 23.141  24.561 1.00 42.35 ? 301 LYS A N   1 
ATOM   958  C  CA  . LYS A 1 128 ? 18.185 24.386  24.701 1.00 43.35 ? 301 LYS A CA  1 
ATOM   959  C  C   . LYS A 1 128 ? 19.621 24.274  24.166 1.00 43.69 ? 301 LYS A C   1 
ATOM   960  O  O   . LYS A 1 128 ? 20.315 25.280  24.019 1.00 43.75 ? 301 LYS A O   1 
ATOM   961  C  CB  . LYS A 1 128 ? 18.227 24.841  26.158 1.00 43.65 ? 301 LYS A CB  1 
ATOM   962  C  CG  . LYS A 1 128 ? 16.881 24.897  26.863 1.00 45.74 ? 301 LYS A CG  1 
ATOM   963  C  CD  . LYS A 1 128 ? 17.108 25.279  28.328 1.00 49.64 ? 301 LYS A CD  1 
ATOM   964  C  CE  . LYS A 1 128 ? 15.815 25.329  29.124 1.00 51.21 ? 301 LYS A CE  1 
ATOM   965  N  NZ  . LYS A 1 128 ? 16.080 25.732  30.541 1.00 52.86 ? 301 LYS A NZ  1 
ATOM   966  N  N   . GLU A 1 129 ? 20.078 23.058  23.888 1.00 43.54 ? 302 GLU A N   1 
ATOM   967  C  CA  . GLU A 1 129 ? 21.457 22.874  23.436 1.00 43.93 ? 302 GLU A CA  1 
ATOM   968  C  C   . GLU A 1 129 ? 21.612 23.165  21.957 1.00 43.70 ? 302 GLU A C   1 
ATOM   969  O  O   . GLU A 1 129 ? 20.742 22.835  21.148 1.00 43.84 ? 302 GLU A O   1 
ATOM   970  C  CB  . GLU A 1 129 ? 21.942 21.457  23.729 1.00 44.32 ? 302 GLU A CB  1 
ATOM   971  C  CG  . GLU A 1 129 ? 21.990 21.118  25.203 1.00 45.81 ? 302 GLU A CG  1 
ATOM   972  C  CD  . GLU A 1 129 ? 23.160 21.763  25.894 1.00 48.42 ? 302 GLU A CD  1 
ATOM   973  O  OE1 . GLU A 1 129 ? 24.213 21.935  25.241 1.00 51.39 ? 302 GLU A OE1 1 
ATOM   974  O  OE2 . GLU A 1 129 ? 23.037 22.094  27.085 1.00 48.72 ? 302 GLU A OE2 1 
ATOM   975  N  N   . GLU A 1 130 ? 22.732 23.783  21.608 1.00 42.91 ? 303 GLU A N   1 
ATOM   976  C  CA  . GLU A 1 130 ? 23.082 24.040  20.226 1.00 42.95 ? 303 GLU A CA  1 
ATOM   977  C  C   . GLU A 1 130 ? 24.126 23.019  19.801 1.00 42.08 ? 303 GLU A C   1 
ATOM   978  O  O   . GLU A 1 130 ? 25.330 23.239  19.994 1.00 41.76 ? 303 GLU A O   1 
ATOM   979  C  CB  . GLU A 1 130 ? 23.687 25.435  20.124 1.00 43.51 ? 303 GLU A CB  1 
ATOM   980  C  CG  . GLU A 1 130 ? 23.576 26.077  18.764 1.00 47.54 ? 303 GLU A CG  1 
ATOM   981  C  CD  . GLU A 1 130 ? 23.472 27.593  18.860 1.00 51.49 ? 303 GLU A CD  1 
ATOM   982  O  OE1 . GLU A 1 130 ? 24.339 28.296  18.295 1.00 54.07 ? 303 GLU A OE1 1 
ATOM   983  O  OE2 . GLU A 1 130 ? 22.526 28.083  19.515 1.00 53.58 ? 303 GLU A OE2 1 
ATOM   984  N  N   . LEU A 1 131 ? 23.681 21.905  19.228 1.00 40.78 ? 304 LEU A N   1 
ATOM   985  C  CA  . LEU A 1 131 ? 24.613 20.828  18.916 1.00 40.15 ? 304 LEU A CA  1 
ATOM   986  C  C   . LEU A 1 131 ? 24.231 20.042  17.666 1.00 39.32 ? 304 LEU A C   1 
ATOM   987  O  O   . LEU A 1 131 ? 23.131 20.175  17.143 1.00 38.98 ? 304 LEU A O   1 
ATOM   988  C  CB  . LEU A 1 131 ? 24.767 19.899  20.121 1.00 40.03 ? 304 LEU A CB  1 
ATOM   989  C  CG  . LEU A 1 131 ? 23.513 19.221  20.682 1.00 41.16 ? 304 LEU A CG  1 
ATOM   990  C  CD1 . LEU A 1 131 ? 23.109 18.032  19.823 1.00 42.01 ? 304 LEU A CD1 1 
ATOM   991  C  CD2 . LEU A 1 131 ? 23.742 18.766  22.126 1.00 40.83 ? 304 LEU A CD2 1 
ATOM   992  N  N   . GLU A 1 132 ? 25.164 19.233  17.182 1.00 38.40 ? 305 GLU A N   1 
ATOM   993  C  CA  . GLU A 1 132 ? 24.948 18.456  15.972 1.00 37.53 ? 305 GLU A CA  1 
ATOM   994  C  C   . GLU A 1 132 ? 25.822 17.222  16.055 1.00 37.01 ? 305 GLU A C   1 
ATOM   995  O  O   . GLU A 1 132 ? 27.010 17.324  16.309 1.00 36.53 ? 305 GLU A O   1 
ATOM   996  C  CB  . GLU A 1 132 ? 25.306 19.285  14.732 1.00 37.44 ? 305 GLU A CB  1 
ATOM   997  C  CG  . GLU A 1 132 ? 25.033 18.598  13.409 1.00 38.46 ? 305 GLU A CG  1 
ATOM   998  C  CD  . GLU A 1 132 ? 25.263 19.505  12.193 1.00 39.24 ? 305 GLU A CD  1 
ATOM   999  O  OE1 . GLU A 1 132 ? 25.273 20.739  12.345 1.00 38.49 ? 305 GLU A OE1 1 
ATOM   1000 O  OE2 . GLU A 1 132 ? 25.437 18.976  11.076 1.00 40.24 ? 305 GLU A OE2 1 
ATOM   1001 N  N   . ILE A 1 133 ? 25.211 16.060  15.862 1.00 36.41 ? 306 ILE A N   1 
ATOM   1002 C  CA  . ILE A 1 133 ? 25.920 14.795  15.822 1.00 36.29 ? 306 ILE A CA  1 
ATOM   1003 C  C   . ILE A 1 133 ? 26.089 14.385  14.372 1.00 35.84 ? 306 ILE A C   1 
ATOM   1004 O  O   . ILE A 1 133 ? 25.102 14.171  13.665 1.00 36.64 ? 306 ILE A O   1 
ATOM   1005 C  CB  . ILE A 1 133 ? 25.121 13.703  16.535 1.00 36.42 ? 306 ILE A CB  1 
ATOM   1006 C  CG1 . ILE A 1 133 ? 24.912 14.097  17.992 1.00 37.54 ? 306 ILE A CG1 1 
ATOM   1007 C  CG2 . ILE A 1 133 ? 25.834 12.378  16.437 1.00 36.73 ? 306 ILE A CG2 1 
ATOM   1008 C  CD1 . ILE A 1 133 ? 23.756 13.392  18.640 1.00 39.13 ? 306 ILE A CD1 1 
ATOM   1009 N  N   . VAL A 1 134 ? 27.338 14.296  13.931 1.00 34.46 ? 307 VAL A N   1 
ATOM   1010 C  CA  . VAL A 1 134 ? 27.658 13.848  12.592 1.00 33.80 ? 307 VAL A CA  1 
ATOM   1011 C  C   . VAL A 1 134 ? 27.933 12.358  12.649 1.00 33.66 ? 307 VAL A C   1 
ATOM   1012 O  O   . VAL A 1 134 ? 28.731 11.905  13.479 1.00 33.08 ? 307 VAL A O   1 
ATOM   1013 C  CB  . VAL A 1 134 ? 28.905 14.573  12.064 1.00 33.73 ? 307 VAL A CB  1 
ATOM   1014 C  CG1 . VAL A 1 134 ? 29.248 14.106  10.658 1.00 33.81 ? 307 VAL A CG1 1 
ATOM   1015 C  CG2 . VAL A 1 134 ? 28.696 16.081  12.108 1.00 34.25 ? 307 VAL A CG2 1 
ATOM   1016 N  N   . VAL A 1 135 ? 27.266 11.591  11.788 1.00 32.64 ? 308 VAL A N   1 
ATOM   1017 C  CA  . VAL A 1 135 ? 27.479 10.156  11.742 1.00 32.08 ? 308 VAL A CA  1 
ATOM   1018 C  C   . VAL A 1 135 ? 28.125 9.773   10.420 1.00 32.62 ? 308 VAL A C   1 
ATOM   1019 O  O   . VAL A 1 135 ? 27.774 10.306  9.368  1.00 31.28 ? 308 VAL A O   1 
ATOM   1020 C  CB  . VAL A 1 135 ? 26.174 9.359   11.972 1.00 31.87 ? 308 VAL A CB  1 
ATOM   1021 C  CG1 . VAL A 1 135 ? 25.673 9.585   13.390 1.00 30.62 ? 308 VAL A CG1 1 
ATOM   1022 C  CG2 . VAL A 1 135 ? 25.092 9.759   10.940 1.00 31.34 ? 308 VAL A CG2 1 
ATOM   1023 N  N   . ILE A 1 136 ? 29.101 8.868   10.499 1.00 32.81 ? 309 ILE A N   1 
ATOM   1024 C  CA  . ILE A 1 136 ? 29.921 8.531   9.358  1.00 33.91 ? 309 ILE A CA  1 
ATOM   1025 C  C   . ILE A 1 136 ? 30.059 7.037   9.233  1.00 34.53 ? 309 ILE A C   1 
ATOM   1026 O  O   . ILE A 1 136 ? 30.569 6.369   10.140 1.00 34.01 ? 309 ILE A O   1 
ATOM   1027 C  CB  . ILE A 1 136 ? 31.335 9.141   9.465  1.00 34.46 ? 309 ILE A CB  1 
ATOM   1028 C  CG1 . ILE A 1 136 ? 31.233 10.662  9.594  1.00 34.29 ? 309 ILE A CG1 1 
ATOM   1029 C  CG2 . ILE A 1 136 ? 32.194 8.712   8.265  1.00 34.18 ? 309 ILE A CG2 1 
ATOM   1030 C  CD1 . ILE A 1 136 ? 32.580 11.359  9.712  1.00 36.63 ? 309 ILE A CD1 1 
ATOM   1031 N  N   . LEU A 1 137 ? 29.595 6.521   8.101  1.00 34.98 ? 310 LEU A N   1 
ATOM   1032 C  CA  . LEU A 1 137 ? 29.673 5.109   7.820  1.00 36.63 ? 310 LEU A CA  1 
ATOM   1033 C  C   . LEU A 1 137 ? 30.706 4.931   6.723  1.00 37.54 ? 310 LEU A C   1 
ATOM   1034 O  O   . LEU A 1 137 ? 30.641 5.592   5.681  1.00 37.36 ? 310 LEU A O   1 
ATOM   1035 C  CB  . LEU A 1 137 ? 28.301 4.571   7.387  1.00 36.45 ? 310 LEU A CB  1 
ATOM   1036 C  CG  . LEU A 1 137 ? 28.244 3.103   6.967  1.00 37.69 ? 310 LEU A CG  1 
ATOM   1037 C  CD1 . LEU A 1 137 ? 28.448 2.176   8.173  1.00 38.29 ? 310 LEU A CD1 1 
ATOM   1038 C  CD2 . LEU A 1 137 ? 26.912 2.787   6.272  1.00 37.73 ? 310 LEU A CD2 1 
ATOM   1039 N  N   . GLU A 1 138 ? 31.680 4.067   6.980  1.00 39.10 ? 311 GLU A N   1 
ATOM   1040 C  CA  . GLU A 1 138 ? 32.756 3.813   6.033  1.00 40.94 ? 311 GLU A CA  1 
ATOM   1041 C  C   . GLU A 1 138 ? 32.823 2.331   5.747  1.00 42.19 ? 311 GLU A C   1 
ATOM   1042 O  O   . GLU A 1 138 ? 32.494 1.509   6.595  1.00 41.60 ? 311 GLU A O   1 
ATOM   1043 C  CB  . GLU A 1 138 ? 34.102 4.295   6.581  1.00 41.08 ? 311 GLU A CB  1 
ATOM   1044 C  CG  . GLU A 1 138 ? 34.072 5.717   7.073  1.00 43.37 ? 311 GLU A CG  1 
ATOM   1045 C  CD  . GLU A 1 138 ? 35.439 6.252   7.451  1.00 46.58 ? 311 GLU A CD  1 
ATOM   1046 O  OE1 . GLU A 1 138 ? 36.367 5.443   7.703  1.00 49.10 ? 311 GLU A OE1 1 
ATOM   1047 O  OE2 . GLU A 1 138 ? 35.581 7.489   7.491  1.00 45.41 ? 311 GLU A OE2 1 
ATOM   1048 N  N   . GLY A 1 139 ? 33.254 1.981   4.540  1.00 43.66 ? 312 GLY A N   1 
ATOM   1049 C  CA  . GLY A 1 139 ? 33.364 0.580   4.189  1.00 45.93 ? 312 GLY A CA  1 
ATOM   1050 C  C   . GLY A 1 139 ? 33.820 0.357   2.766  1.00 47.54 ? 312 GLY A C   1 
ATOM   1051 O  O   . GLY A 1 139 ? 34.503 1.190   2.186  1.00 46.96 ? 312 GLY A O   1 
ATOM   1052 N  N   . MET A 1 140 ? 33.433 -0.782  2.209  1.00 49.21 ? 313 MET A N   1 
ATOM   1053 C  CA  A MET A 1 140 ? 33.795 -1.117  0.838  0.50 50.11 ? 313 MET A CA  1 
ATOM   1054 C  CA  B MET A 1 140 ? 33.805 -1.133  0.843  0.50 49.96 ? 313 MET A CA  1 
ATOM   1055 C  C   . MET A 1 140 ? 32.678 -1.881  0.152  1.00 50.69 ? 313 MET A C   1 
ATOM   1056 O  O   . MET A 1 140 ? 32.059 -2.771  0.749  1.00 50.49 ? 313 MET A O   1 
ATOM   1057 C  CB  A MET A 1 140 ? 35.097 -1.915  0.809  0.50 50.16 ? 313 MET A CB  1 
ATOM   1058 C  CB  B MET A 1 140 ? 35.068 -1.989  0.846  0.50 49.87 ? 313 MET A CB  1 
ATOM   1059 C  CG  A MET A 1 140 ? 36.312 -1.100  1.220  0.50 50.91 ? 313 MET A CG  1 
ATOM   1060 C  CG  B MET A 1 140 ? 35.395 -2.611  -0.495 0.50 50.02 ? 313 MET A CG  1 
ATOM   1061 S  SD  A MET A 1 140 ? 37.807 -2.095  1.354  0.50 54.04 ? 313 MET A SD  1 
ATOM   1062 S  SD  B MET A 1 140 ? 36.889 -3.604  -0.399 0.50 51.07 ? 313 MET A SD  1 
ATOM   1063 C  CE  A MET A 1 140 ? 39.005 -0.864  1.874  0.50 52.94 ? 313 MET A CE  1 
ATOM   1064 C  CE  B MET A 1 140 ? 38.108 -2.328  -0.096 0.50 50.51 ? 313 MET A CE  1 
ATOM   1065 N  N   . VAL A 1 141 ? 32.407 -1.512  -1.101 1.00 51.69 ? 314 VAL A N   1 
ATOM   1066 C  CA  . VAL A 1 141 ? 31.432 -2.236  -1.898 1.00 53.13 ? 314 VAL A CA  1 
ATOM   1067 C  C   . VAL A 1 141 ? 32.017 -3.628  -2.133 1.00 54.27 ? 314 VAL A C   1 
ATOM   1068 O  O   . VAL A 1 141 ? 33.183 -3.768  -2.534 1.00 54.38 ? 314 VAL A O   1 
ATOM   1069 C  CB  . VAL A 1 141 ? 31.150 -1.513  -3.240 1.00 53.23 ? 314 VAL A CB  1 
ATOM   1070 C  CG1 . VAL A 1 141 ? 30.113 -2.272  -4.061 1.00 53.41 ? 314 VAL A CG1 1 
ATOM   1071 C  CG2 . VAL A 1 141 ? 30.676 -0.094  -2.981 1.00 53.29 ? 314 VAL A CG2 1 
ATOM   1072 N  N   . GLU A 1 142 ? 31.218 -4.654  -1.853 1.00 55.44 ? 315 GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 142 ? 31.689 -6.036  -1.918 1.00 56.74 ? 315 GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 142 ? 32.130 -6.432  -3.328 1.00 57.59 ? 315 GLU A C   1 
ATOM   1075 O  O   . GLU A 1 142 ? 33.256 -6.894  -3.530 1.00 57.87 ? 315 GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 142 ? 30.604 -6.999  -1.416 1.00 56.68 ? 315 GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 142 ? 31.082 -8.435  -1.222 1.00 56.64 ? 315 GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 142 ? 30.047 -9.309  -0.513 1.00 56.96 ? 315 GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 142 ? 28.841 -8.980  -0.550 1.00 56.60 ? 315 GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 142 ? 30.444 -10.328 0.082  1.00 56.95 ? 315 GLU A OE2 1 
ATOM   1081 N  N   . ALA A 1 143 ? 31.244 -6.242  -4.299 1.00 58.55 ? 316 ALA A N   1 
ATOM   1082 C  CA  . ALA A 1 143 ? 31.501 -6.705  -5.665 1.00 59.45 ? 316 ALA A CA  1 
ATOM   1083 C  C   . ALA A 1 143 ? 32.636 -5.954  -6.372 1.00 59.84 ? 316 ALA A C   1 
ATOM   1084 O  O   . ALA A 1 143 ? 33.198 -6.444  -7.354 1.00 60.45 ? 316 ALA A O   1 
ATOM   1085 C  CB  . ALA A 1 143 ? 30.220 -6.651  -6.491 1.00 59.38 ? 316 ALA A CB  1 
ATOM   1086 N  N   . THR A 1 144 ? 32.992 -4.781  -5.859 1.00 60.07 ? 317 THR A N   1 
ATOM   1087 C  CA  . THR A 1 144 ? 33.915 -3.889  -6.558 1.00 60.04 ? 317 THR A CA  1 
ATOM   1088 C  C   . THR A 1 144 ? 35.243 -3.679  -5.841 1.00 59.64 ? 317 THR A C   1 
ATOM   1089 O  O   . THR A 1 144 ? 36.232 -3.251  -6.451 1.00 59.64 ? 317 THR A O   1 
ATOM   1090 C  CB  . THR A 1 144 ? 33.259 -2.516  -6.782 1.00 60.40 ? 317 THR A CB  1 
ATOM   1091 O  OG1 . THR A 1 144 ? 32.426 -2.572  -7.947 1.00 61.83 ? 317 THR A OG1 1 
ATOM   1092 C  CG2 . THR A 1 144 ? 34.309 -1.436  -6.963 1.00 60.79 ? 317 THR A CG2 1 
ATOM   1093 N  N   . GLY A 1 145 ? 35.273 -3.973  -4.547 1.00 58.97 ? 318 GLY A N   1 
ATOM   1094 C  CA  . GLY A 1 145 ? 36.438 -3.651  -3.736 1.00 58.22 ? 318 GLY A CA  1 
ATOM   1095 C  C   . GLY A 1 145 ? 36.683 -2.154  -3.740 1.00 57.62 ? 318 GLY A C   1 
ATOM   1096 O  O   . GLY A 1 145 ? 37.770 -1.689  -3.412 1.00 57.73 ? 318 GLY A O   1 
ATOM   1097 N  N   . MET A 1 146 ? 35.661 -1.395  -4.118 1.00 57.26 ? 319 MET A N   1 
ATOM   1098 C  CA  . MET A 1 146 ? 35.750 0.064   -4.119 1.00 56.93 ? 319 MET A CA  1 
ATOM   1099 C  C   . MET A 1 146 ? 35.285 0.622   -2.766 1.00 55.74 ? 319 MET A C   1 
ATOM   1100 O  O   . MET A 1 146 ? 34.212 0.263   -2.271 1.00 55.49 ? 319 MET A O   1 
ATOM   1101 C  CB  . MET A 1 146 ? 34.906 0.644   -5.263 1.00 57.52 ? 319 MET A CB  1 
ATOM   1102 C  CG  . MET A 1 146 ? 35.545 1.831   -6.004 1.00 60.63 ? 319 MET A CG  1 
ATOM   1103 S  SD  . MET A 1 146 ? 37.243 1.544   -6.595 1.00 65.67 ? 319 MET A SD  1 
ATOM   1104 C  CE  . MET A 1 146 ? 37.104 -0.112  -7.277 1.00 65.19 ? 319 MET A CE  1 
ATOM   1105 N  N   . THR A 1 147 ? 36.097 1.496   -2.178 1.00 54.12 ? 320 THR A N   1 
ATOM   1106 C  CA  . THR A 1 147 ? 35.773 2.116   -0.900 1.00 52.98 ? 320 THR A CA  1 
ATOM   1107 C  C   . THR A 1 147 ? 34.611 3.096   -1.021 1.00 51.72 ? 320 THR A C   1 
ATOM   1108 O  O   . THR A 1 147 ? 34.330 3.603   -2.107 1.00 51.41 ? 320 THR A O   1 
ATOM   1109 C  CB  . THR A 1 147 ? 36.980 2.855   -0.334 1.00 53.08 ? 320 THR A CB  1 
ATOM   1110 O  OG1 . THR A 1 147 ? 37.393 3.857   -1.265 1.00 53.72 ? 320 THR A OG1 1 
ATOM   1111 C  CG2 . THR A 1 147 ? 38.125 1.887   -0.121 1.00 53.71 ? 320 THR A CG2 1 
ATOM   1112 N  N   . CYS A 1 148 ? 33.932 3.345   0.097  1.00 50.00 ? 321 CYS A N   1 
ATOM   1113 C  CA  . CYS A 1 148 ? 32.832 4.306   0.146  1.00 48.66 ? 321 CYS A CA  1 
ATOM   1114 C  C   . CYS A 1 148 ? 32.666 4.888   1.547  1.00 46.86 ? 321 CYS A C   1 
ATOM   1115 O  O   . CYS A 1 148 ? 33.059 4.269   2.539  1.00 45.99 ? 321 CYS A O   1 
ATOM   1116 C  CB  . CYS A 1 148 ? 31.514 3.664   -0.315 1.00 48.88 ? 321 CYS A CB  1 
ATOM   1117 S  SG  . CYS A 1 148 ? 30.938 2.254   0.687  1.00 52.35 ? 321 CYS A SG  1 
ATOM   1118 N  N   . GLN A 1 149 ? 32.099 6.089   1.606  1.00 44.92 ? 322 GLN A N   1 
ATOM   1119 C  CA  . GLN A 1 149 ? 31.746 6.744   2.866  1.00 43.52 ? 322 GLN A CA  1 
ATOM   1120 C  C   . GLN A 1 149 ? 30.348 7.308   2.674  1.00 42.19 ? 322 GLN A C   1 
ATOM   1121 O  O   . GLN A 1 149 ? 29.971 7.687   1.565  1.00 42.28 ? 322 GLN A O   1 
ATOM   1122 C  CB  . GLN A 1 149 ? 32.747 7.868   3.244  1.00 43.54 ? 322 GLN A CB  1 
ATOM   1123 C  CG  . GLN A 1 149 ? 32.529 8.496   4.669  1.00 44.45 ? 322 GLN A CG  1 
ATOM   1124 C  CD  . GLN A 1 149 ? 33.448 9.707   5.024  1.00 45.23 ? 322 GLN A CD  1 
ATOM   1125 O  OE1 . GLN A 1 149 ? 33.038 10.876  4.935  1.00 41.73 ? 322 GLN A OE1 1 
ATOM   1126 N  NE2 . GLN A 1 149 ? 34.681 9.414   5.456  1.00 46.41 ? 322 GLN A NE2 1 
ATOM   1127 N  N   . ALA A 1 150 ? 29.573 7.334   3.745  1.00 40.01 ? 323 ALA A N   1 
ATOM   1128 C  CA  . ALA A 1 150 ? 28.292 8.008   3.754  1.00 38.63 ? 323 ALA A CA  1 
ATOM   1129 C  C   . ALA A 1 150 ? 28.181 8.783   5.067  1.00 37.87 ? 323 ALA A C   1 
ATOM   1130 O  O   . ALA A 1 150 ? 28.642 8.313   6.115  1.00 37.04 ? 323 ALA A O   1 
ATOM   1131 C  CB  . ALA A 1 150 ? 27.156 6.998   3.630  1.00 38.30 ? 323 ALA A CB  1 
ATOM   1132 N  N   . ARG A 1 151 ? 27.567 9.960   5.016  1.00 36.98 ? 324 ARG A N   1 
ATOM   1133 C  CA  . ARG A 1 151 ? 27.505 10.821  6.185  1.00 37.00 ? 324 ARG A CA  1 
ATOM   1134 C  C   . ARG A 1 151 ? 26.130 11.430  6.316  1.00 36.77 ? 324 ARG A C   1 
ATOM   1135 O  O   . ARG A 1 151 ? 25.423 11.611  5.322  1.00 35.66 ? 324 ARG A O   1 
ATOM   1136 C  CB  . ARG A 1 151 ? 28.528 11.961  6.065  1.00 37.40 ? 324 ARG A CB  1 
ATOM   1137 C  CG  . ARG A 1 151 ? 29.948 11.503  5.852  1.00 41.17 ? 324 ARG A CG  1 
ATOM   1138 C  CD  . ARG A 1 151 ? 30.884 12.707  5.628  1.00 47.78 ? 324 ARG A CD  1 
ATOM   1139 N  NE  . ARG A 1 151 ? 30.327 13.608  4.633  1.00 49.22 ? 324 ARG A NE  1 
ATOM   1140 C  CZ  . ARG A 1 151 ? 30.713 13.638  3.365  1.00 51.68 ? 324 ARG A CZ  1 
ATOM   1141 N  NH1 . ARG A 1 151 ? 31.687 12.837  2.942  1.00 52.20 ? 324 ARG A NH1 1 
ATOM   1142 N  NH2 . ARG A 1 151 ? 30.132 14.482  2.526  1.00 51.74 ? 324 ARG A NH2 1 
ATOM   1143 N  N   . SER A 1 152 ? 25.758 11.760  7.550  1.00 36.32 ? 325 SER A N   1 
ATOM   1144 C  CA  . SER A 1 152 ? 24.537 12.501  7.809  1.00 36.31 ? 325 SER A CA  1 
ATOM   1145 C  C   . SER A 1 152 ? 24.717 13.141  9.167  1.00 36.41 ? 325 SER A C   1 
ATOM   1146 O  O   . SER A 1 152 ? 25.801 13.055  9.750  1.00 35.99 ? 325 SER A O   1 
ATOM   1147 C  CB  . SER A 1 152 ? 23.325 11.566  7.805  1.00 36.06 ? 325 SER A CB  1 
ATOM   1148 O  OG  . SER A 1 152 ? 22.117 12.294  7.891  1.00 37.14 ? 325 SER A OG  1 
ATOM   1149 N  N   . SER A 1 153 ? 23.672 13.781  9.673  1.00 36.51 ? 326 SER A N   1 
ATOM   1150 C  CA  . SER A 1 153 ? 23.765 14.422  10.971 1.00 36.88 ? 326 SER A CA  1 
ATOM   1151 C  C   . SER A 1 153 ? 22.423 14.589  11.659 1.00 37.06 ? 326 SER A C   1 
ATOM   1152 O  O   . SER A 1 153 ? 21.363 14.555  11.016 1.00 37.30 ? 326 SER A O   1 
ATOM   1153 C  CB  . SER A 1 153 ? 24.486 15.771  10.854 1.00 37.47 ? 326 SER A CB  1 
ATOM   1154 O  OG  . SER A 1 153 ? 23.606 16.841  10.531 1.00 37.09 ? 326 SER A OG  1 
ATOM   1155 N  N   . TYR A 1 154 ? 22.481 14.749  12.981 1.00 36.65 ? 327 TYR A N   1 
ATOM   1156 C  CA  . TYR A 1 154 ? 21.307 14.996  13.791 1.00 36.37 ? 327 TYR A CA  1 
ATOM   1157 C  C   . TYR A 1 154 ? 21.519 16.293  14.564 1.00 36.58 ? 327 TYR A C   1 
ATOM   1158 O  O   . TYR A 1 154 ? 22.384 16.367  15.445 1.00 36.20 ? 327 TYR A O   1 
ATOM   1159 C  CB  . TYR A 1 154 ? 21.041 13.829  14.754 1.00 36.16 ? 327 TYR A CB  1 
ATOM   1160 C  CG  . TYR A 1 154 ? 20.919 12.487  14.045 1.00 35.83 ? 327 TYR A CG  1 
ATOM   1161 C  CD1 . TYR A 1 154 ? 19.737 12.125  13.395 1.00 33.91 ? 327 TYR A CD1 1 
ATOM   1162 C  CD2 . TYR A 1 154 ? 21.998 11.606  13.997 1.00 33.65 ? 327 TYR A CD2 1 
ATOM   1163 C  CE1 . TYR A 1 154 ? 19.633 10.919  12.730 1.00 33.53 ? 327 TYR A CE1 1 
ATOM   1164 C  CE2 . TYR A 1 154 ? 21.907 10.402  13.335 1.00 34.10 ? 327 TYR A CE2 1 
ATOM   1165 C  CZ  . TYR A 1 154 ? 20.725 10.058  12.699 1.00 35.15 ? 327 TYR A CZ  1 
ATOM   1166 O  OH  . TYR A 1 154 ? 20.638 8.848   12.049 1.00 35.07 ? 327 TYR A OH  1 
ATOM   1167 N  N   . ILE A 1 155 ? 20.751 17.324  14.217 1.00 36.67 ? 328 ILE A N   1 
ATOM   1168 C  CA  . ILE A 1 155 ? 20.761 18.550  15.011 1.00 37.09 ? 328 ILE A CA  1 
ATOM   1169 C  C   . ILE A 1 155 ? 19.865 18.335  16.213 1.00 37.28 ? 328 ILE A C   1 
ATOM   1170 O  O   . ILE A 1 155 ? 19.185 17.318  16.303 1.00 37.20 ? 328 ILE A O   1 
ATOM   1171 C  CB  . ILE A 1 155 ? 20.356 19.813  14.209 1.00 36.99 ? 328 ILE A CB  1 
ATOM   1172 C  CG1 . ILE A 1 155 ? 18.982 19.643  13.548 1.00 37.65 ? 328 ILE A CG1 1 
ATOM   1173 C  CG2 . ILE A 1 155 ? 21.435 20.150  13.182 1.00 37.27 ? 328 ILE A CG2 1 
ATOM   1174 C  CD1 . ILE A 1 155 ? 18.513 20.917  12.784 1.00 38.93 ? 328 ILE A CD1 1 
ATOM   1175 N  N   . THR A 1 156 ? 19.875 19.290  17.136 1.00 37.65 ? 329 THR A N   1 
ATOM   1176 C  CA  . THR A 1 156 ? 19.152 19.172  18.404 1.00 37.62 ? 329 THR A CA  1 
ATOM   1177 C  C   . THR A 1 156 ? 17.702 18.689  18.269 1.00 37.94 ? 329 THR A C   1 
ATOM   1178 O  O   . THR A 1 156 ? 17.278 17.775  18.978 1.00 36.87 ? 329 THR A O   1 
ATOM   1179 C  CB  . THR A 1 156 ? 19.173 20.530  19.152 1.00 37.88 ? 329 THR A CB  1 
ATOM   1180 O  OG1 . THR A 1 156 ? 20.520 21.031  19.184 1.00 38.81 ? 329 THR A OG1 1 
ATOM   1181 C  CG2 . THR A 1 156 ? 18.632 20.383  20.577 1.00 38.58 ? 329 THR A CG2 1 
ATOM   1182 N  N   . SER A 1 157 ? 16.955 19.285  17.345 1.00 38.49 ? 330 SER A N   1 
ATOM   1183 C  CA  . SER A 1 157 ? 15.518 18.991  17.198 1.00 39.45 ? 330 SER A CA  1 
ATOM   1184 C  C   . SER A 1 157 ? 15.247 17.625  16.568 1.00 39.82 ? 330 SER A C   1 
ATOM   1185 O  O   . SER A 1 157 ? 14.109 17.144  16.564 1.00 40.32 ? 330 SER A O   1 
ATOM   1186 C  CB  . SER A 1 157 ? 14.846 20.086  16.361 1.00 39.49 ? 330 SER A CB  1 
ATOM   1187 O  OG  . SER A 1 157 ? 15.474 20.205  15.093 1.00 39.38 ? 330 SER A OG  1 
ATOM   1188 N  N   . GLU A 1 158 ? 16.293 17.001  16.033 1.00 39.61 ? 331 GLU A N   1 
ATOM   1189 C  CA  . GLU A 1 158 ? 16.164 15.687  15.406 1.00 39.37 ? 331 GLU A CA  1 
ATOM   1190 C  C   . GLU A 1 158 ? 16.536 14.554  16.358 1.00 38.71 ? 331 GLU A C   1 
ATOM   1191 O  O   . GLU A 1 158 ? 16.648 13.406  15.949 1.00 37.99 ? 331 GLU A O   1 
ATOM   1192 C  CB  . GLU A 1 158 ? 17.023 15.618  14.140 1.00 39.63 ? 331 GLU A CB  1 
ATOM   1193 C  CG  . GLU A 1 158 ? 16.572 16.610  13.070 1.00 40.45 ? 331 GLU A CG  1 
ATOM   1194 C  CD  . GLU A 1 158 ? 17.535 16.708  11.923 1.00 40.84 ? 331 GLU A CD  1 
ATOM   1195 O  OE1 . GLU A 1 158 ? 17.129 17.240  10.875 1.00 42.12 ? 331 GLU A OE1 1 
ATOM   1196 O  OE2 . GLU A 1 158 ? 18.699 16.266  12.062 1.00 40.89 ? 331 GLU A OE2 1 
ATOM   1197 N  N   . ILE A 1 159 ? 16.732 14.899  17.627 1.00 38.17 ? 332 ILE A N   1 
ATOM   1198 C  CA  . ILE A 1 159 ? 17.017 13.921  18.670 1.00 37.55 ? 332 ILE A CA  1 
ATOM   1199 C  C   . ILE A 1 159 ? 15.798 13.815  19.577 1.00 37.72 ? 332 ILE A C   1 
ATOM   1200 O  O   . ILE A 1 159 ? 15.435 14.777  20.241 1.00 38.50 ? 332 ILE A O   1 
ATOM   1201 C  CB  . ILE A 1 159 ? 18.237 14.346  19.508 1.00 37.51 ? 332 ILE A CB  1 
ATOM   1202 C  CG1 . ILE A 1 159 ? 19.453 14.547  18.598 1.00 37.29 ? 332 ILE A CG1 1 
ATOM   1203 C  CG2 . ILE A 1 159 ? 18.525 13.325  20.614 1.00 35.66 ? 332 ILE A CG2 1 
ATOM   1204 C  CD1 . ILE A 1 159 ? 20.586 15.277  19.280 1.00 37.38 ? 332 ILE A CD1 1 
ATOM   1205 N  N   . LEU A 1 160 ? 15.167 12.649  19.599 1.00 37.23 ? 333 LEU A N   1 
ATOM   1206 C  CA  . LEU A 1 160 ? 13.880 12.483  20.267 1.00 37.11 ? 333 LEU A CA  1 
ATOM   1207 C  C   . LEU A 1 160 ? 14.022 11.790  21.609 1.00 36.31 ? 333 LEU A C   1 
ATOM   1208 O  O   . LEU A 1 160 ? 14.313 10.604  21.656 1.00 35.73 ? 333 LEU A O   1 
ATOM   1209 C  CB  . LEU A 1 160 ? 12.937 11.670  19.372 1.00 37.03 ? 333 LEU A CB  1 
ATOM   1210 C  CG  . LEU A 1 160 ? 12.831 12.163  17.926 1.00 38.11 ? 333 LEU A CG  1 
ATOM   1211 C  CD1 . LEU A 1 160 ? 11.898 11.251  17.116 1.00 39.92 ? 333 LEU A CD1 1 
ATOM   1212 C  CD2 . LEU A 1 160 ? 12.356 13.617  17.875 1.00 38.33 ? 333 LEU A CD2 1 
ATOM   1213 N  N   . TRP A 1 161 ? 13.809 12.527  22.698 1.00 36.10 ? 334 TRP A N   1 
ATOM   1214 C  CA  . TRP A 1 161 ? 13.935 11.957  24.051 1.00 35.73 ? 334 TRP A CA  1 
ATOM   1215 C  C   . TRP A 1 161 ? 12.707 11.140  24.407 1.00 36.12 ? 334 TRP A C   1 
ATOM   1216 O  O   . TRP A 1 161 ? 11.580 11.631  24.275 1.00 36.37 ? 334 TRP A O   1 
ATOM   1217 C  CB  . TRP A 1 161 ? 14.101 13.070  25.095 1.00 35.39 ? 334 TRP A CB  1 
ATOM   1218 C  CG  . TRP A 1 161 ? 14.470 12.558  26.474 1.00 34.42 ? 334 TRP A CG  1 
ATOM   1219 C  CD1 . TRP A 1 161 ? 13.697 11.799  27.302 1.00 34.68 ? 334 TRP A CD1 1 
ATOM   1220 C  CD2 . TRP A 1 161 ? 15.698 12.792  27.175 1.00 34.92 ? 334 TRP A CD2 1 
ATOM   1221 N  NE1 . TRP A 1 161 ? 14.372 11.538  28.475 1.00 35.99 ? 334 TRP A NE1 1 
ATOM   1222 C  CE2 . TRP A 1 161 ? 15.603 12.137  28.419 1.00 35.10 ? 334 TRP A CE2 1 
ATOM   1223 C  CE3 . TRP A 1 161 ? 16.871 13.497  26.868 1.00 35.15 ? 334 TRP A CE3 1 
ATOM   1224 C  CZ2 . TRP A 1 161 ? 16.636 12.159  29.363 1.00 35.04 ? 334 TRP A CZ2 1 
ATOM   1225 C  CZ3 . TRP A 1 161 ? 17.898 13.507  27.805 1.00 36.60 ? 334 TRP A CZ3 1 
ATOM   1226 C  CH2 . TRP A 1 161 ? 17.768 12.841  29.036 1.00 34.21 ? 334 TRP A CH2 1 
ATOM   1227 N  N   . GLY A 1 162 ? 12.916 9.906   24.855 1.00 36.20 ? 335 GLY A N   1 
ATOM   1228 C  CA  . GLY A 1 162 ? 11.815 9.042   25.282 1.00 37.44 ? 335 GLY A CA  1 
ATOM   1229 C  C   . GLY A 1 162 ? 11.190 8.200   24.175 1.00 38.05 ? 335 GLY A C   1 
ATOM   1230 O  O   . GLY A 1 162 ? 9.984  7.927   24.199 1.00 38.14 ? 335 GLY A O   1 
ATOM   1231 N  N   . TYR A 1 163 ? 12.017 7.793   23.210 1.00 37.83 ? 336 TYR A N   1 
ATOM   1232 C  CA  . TYR A 1 163 ? 11.572 7.062   22.021 1.00 38.25 ? 336 TYR A CA  1 
ATOM   1233 C  C   . TYR A 1 163 ? 12.502 5.888   21.739 1.00 38.17 ? 336 TYR A C   1 
ATOM   1234 O  O   . TYR A 1 163 ? 13.678 5.918   22.122 1.00 38.19 ? 336 TYR A O   1 
ATOM   1235 C  CB  . TYR A 1 163 ? 11.553 7.978   20.790 1.00 37.79 ? 336 TYR A CB  1 
ATOM   1236 C  CG  . TYR A 1 163 ? 10.411 8.970   20.770 1.00 40.77 ? 336 TYR A CG  1 
ATOM   1237 C  CD1 . TYR A 1 163 ? 9.310  8.772   19.946 1.00 42.31 ? 336 TYR A CD1 1 
ATOM   1238 C  CD2 . TYR A 1 163 ? 10.431 10.107  21.579 1.00 43.20 ? 336 TYR A CD2 1 
ATOM   1239 C  CE1 . TYR A 1 163 ? 8.252  9.678   19.928 1.00 44.87 ? 336 TYR A CE1 1 
ATOM   1240 C  CE2 . TYR A 1 163 ? 9.378  11.023  21.568 1.00 43.91 ? 336 TYR A CE2 1 
ATOM   1241 C  CZ  . TYR A 1 163 ? 8.295  10.797  20.740 1.00 45.25 ? 336 TYR A CZ  1 
ATOM   1242 O  OH  . TYR A 1 163 ? 7.251  11.690  20.712 1.00 47.29 ? 336 TYR A OH  1 
ATOM   1243 N  N   . ARG A 1 164 ? 11.963 4.853   21.095 1.00 37.78 ? 337 ARG A N   1 
ATOM   1244 C  CA  . ARG A 1 164 ? 12.762 3.747   20.567 1.00 38.13 ? 337 ARG A CA  1 
ATOM   1245 C  C   . ARG A 1 164 ? 12.470 3.632   19.086 1.00 37.95 ? 337 ARG A C   1 
ATOM   1246 O  O   . ARG A 1 164 ? 11.475 4.162   18.603 1.00 37.56 ? 337 ARG A O   1 
ATOM   1247 C  CB  . ARG A 1 164 ? 12.371 2.405   21.185 1.00 37.60 ? 337 ARG A CB  1 
ATOM   1248 C  CG  . ARG A 1 164 ? 12.562 2.253   22.680 1.00 39.49 ? 337 ARG A CG  1 
ATOM   1249 C  CD  . ARG A 1 164 ? 11.744 1.041   23.116 1.00 39.44 ? 337 ARG A CD  1 
ATOM   1250 N  NE  . ARG A 1 164 ? 11.873 0.750   24.530 1.00 38.78 ? 337 ARG A NE  1 
ATOM   1251 C  CZ  . ARG A 1 164 ? 11.088 -0.096  25.179 1.00 39.39 ? 337 ARG A CZ  1 
ATOM   1252 N  NH1 . ARG A 1 164 ? 11.275 -0.326  26.468 1.00 39.46 ? 337 ARG A NH1 1 
ATOM   1253 N  NH2 . ARG A 1 164 ? 10.127 -0.733  24.529 1.00 39.76 ? 337 ARG A NH2 1 
ATOM   1254 N  N   . PHE A 1 165 ? 13.331 2.913   18.372 1.00 37.85 ? 338 PHE A N   1 
ATOM   1255 C  CA  . PHE A 1 165 ? 13.053 2.560   16.986 1.00 37.86 ? 338 PHE A CA  1 
ATOM   1256 C  C   . PHE A 1 165 ? 12.064 1.394   16.868 1.00 38.33 ? 338 PHE A C   1 
ATOM   1257 O  O   . PHE A 1 165 ? 12.094 0.440   17.654 1.00 38.58 ? 338 PHE A O   1 
ATOM   1258 C  CB  . PHE A 1 165 ? 14.355 2.263   16.232 1.00 37.22 ? 338 PHE A CB  1 
ATOM   1259 C  CG  . PHE A 1 165 ? 15.141 3.493   15.926 1.00 36.65 ? 338 PHE A CG  1 
ATOM   1260 C  CD1 . PHE A 1 165 ? 16.182 3.889   16.752 1.00 34.03 ? 338 PHE A CD1 1 
ATOM   1261 C  CD2 . PHE A 1 165 ? 14.797 4.292   14.844 1.00 35.33 ? 338 PHE A CD2 1 
ATOM   1262 C  CE1 . PHE A 1 165 ? 16.886 5.047   16.483 1.00 34.48 ? 338 PHE A CE1 1 
ATOM   1263 C  CE2 . PHE A 1 165 ? 15.495 5.437   14.563 1.00 34.28 ? 338 PHE A CE2 1 
ATOM   1264 C  CZ  . PHE A 1 165 ? 16.537 5.828   15.388 1.00 33.97 ? 338 PHE A CZ  1 
ATOM   1265 N  N   . THR A 1 166 ? 11.164 1.507   15.899 1.00 39.35 ? 339 THR A N   1 
ATOM   1266 C  CA  . THR A 1 166 ? 10.245 0.424   15.548 1.00 39.88 ? 339 THR A CA  1 
ATOM   1267 C  C   . THR A 1 166 ? 11.060 -0.680  14.891 1.00 40.51 ? 339 THR A C   1 
ATOM   1268 O  O   . THR A 1 166 ? 11.812 -0.410  13.953 1.00 39.58 ? 339 THR A O   1 
ATOM   1269 C  CB  . THR A 1 166 ? 9.187  0.949   14.560 1.00 39.95 ? 339 THR A CB  1 
ATOM   1270 O  OG1 . THR A 1 166 ? 8.497  2.052   15.161 1.00 40.06 ? 339 THR A OG1 1 
ATOM   1271 C  CG2 . THR A 1 166 ? 8.177  -0.165  14.163 1.00 40.64 ? 339 THR A CG2 1 
ATOM   1272 N  N   . PRO A 1 167 ? 10.938 -1.926  15.387 1.00 41.23 ? 340 PRO A N   1 
ATOM   1273 C  CA  . PRO A 1 167 ? 11.754 -2.993  14.803 1.00 42.03 ? 340 PRO A CA  1 
ATOM   1274 C  C   . PRO A 1 167 ? 11.369 -3.240  13.333 1.00 42.75 ? 340 PRO A C   1 
ATOM   1275 O  O   . PRO A 1 167 ? 10.255 -2.908  12.930 1.00 42.46 ? 340 PRO A O   1 
ATOM   1276 C  CB  . PRO A 1 167 ? 11.455 -4.216  15.690 1.00 42.04 ? 340 PRO A CB  1 
ATOM   1277 C  CG  . PRO A 1 167 ? 10.134 -3.906  16.366 1.00 42.64 ? 340 PRO A CG  1 
ATOM   1278 C  CD  . PRO A 1 167 ? 10.021 -2.404  16.441 1.00 41.57 ? 340 PRO A CD  1 
ATOM   1279 N  N   . VAL A 1 168 ? 12.292 -3.772  12.535 1.00 43.14 ? 341 VAL A N   1 
ATOM   1280 C  CA  . VAL A 1 168 ? 12.035 -3.951  11.101 1.00 43.79 ? 341 VAL A CA  1 
ATOM   1281 C  C   . VAL A 1 168 ? 12.172 -5.400  10.678 1.00 44.65 ? 341 VAL A C   1 
ATOM   1282 O  O   . VAL A 1 168 ? 11.801 -5.767  9.563  1.00 44.57 ? 341 VAL A O   1 
ATOM   1283 C  CB  . VAL A 1 168 ? 12.996 -3.117  10.209 1.00 43.60 ? 341 VAL A CB  1 
ATOM   1284 C  CG1 . VAL A 1 168 ? 12.794 -1.625  10.425 1.00 44.00 ? 341 VAL A CG1 1 
ATOM   1285 C  CG2 . VAL A 1 168 ? 14.454 -3.522  10.442 1.00 43.63 ? 341 VAL A CG2 1 
ATOM   1286 N  N   . LEU A 1 169 ? 12.728 -6.215  11.562 1.00 45.53 ? 342 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 169 ? 13.110 -7.572  11.211 1.00 47.00 ? 342 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 169 ? 12.151 -8.605  11.781 1.00 47.66 ? 342 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 169 ? 11.829 -8.584  12.973 1.00 47.68 ? 342 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 169 ? 14.529 -7.865  11.700 1.00 46.83 ? 342 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 169 ? 15.261 -9.080  11.127 1.00 48.20 ? 342 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 169 ? 15.622 -8.854  9.672  1.00 48.65 ? 342 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 169 ? 16.521 -9.370  11.941 1.00 49.42 ? 342 LEU A CD2 1 
ATOM   1294 N  N   . THR A 1 170 ? 11.707 -9.512  10.917 1.00 48.42 ? 343 THR A N   1 
ATOM   1295 C  CA  . THR A 1 170 ? 10.915 -10.662 11.334 1.00 49.31 ? 343 THR A CA  1 
ATOM   1296 C  C   . THR A 1 170 ? 11.364 -11.905 10.576 1.00 50.28 ? 343 THR A C   1 
ATOM   1297 O  O   . THR A 1 170 ? 12.115 -11.818 9.604  1.00 50.08 ? 343 THR A O   1 
ATOM   1298 C  CB  . THR A 1 170 ? 9.423  -10.447 11.062 1.00 49.19 ? 343 THR A CB  1 
ATOM   1299 O  OG1 . THR A 1 170 ? 9.247  -10.004 9.711  1.00 48.83 ? 343 THR A OG1 1 
ATOM   1300 C  CG2 . THR A 1 170 ? 8.843  -9.399  12.018 1.00 49.79 ? 343 THR A CG2 1 
ATOM   1301 N  N   . LEU A 1 171 ? 10.895 -13.062 11.025 1.00 51.21 ? 344 LEU A N   1 
ATOM   1302 C  CA  . LEU A 1 171 ? 11.184 -14.316 10.352 1.00 52.15 ? 344 LEU A CA  1 
ATOM   1303 C  C   . LEU A 1 171 ? 9.939  -14.825 9.629  1.00 52.92 ? 344 LEU A C   1 
ATOM   1304 O  O   . LEU A 1 171 ? 8.905  -15.046 10.251 1.00 52.78 ? 344 LEU A O   1 
ATOM   1305 C  CB  . LEU A 1 171 ? 11.670 -15.353 11.364 1.00 52.10 ? 344 LEU A CB  1 
ATOM   1306 C  CG  . LEU A 1 171 ? 11.852 -16.765 10.805 1.00 52.66 ? 344 LEU A CG  1 
ATOM   1307 C  CD1 . LEU A 1 171 ? 12.707 -16.724 9.539  1.00 52.90 ? 344 LEU A CD1 1 
ATOM   1308 C  CD2 . LEU A 1 171 ? 12.454 -17.688 11.848 1.00 51.64 ? 344 LEU A CD2 1 
ATOM   1309 N  N   . GLU A 1 172 ? 10.039 -14.999 8.314  1.00 53.84 ? 345 GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 172 ? 8.899  -15.436 7.516  1.00 54.95 ? 345 GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 172 ? 9.299  -16.477 6.471  1.00 54.85 ? 345 GLU A C   1 
ATOM   1312 O  O   . GLU A 1 172 ? 9.923  -16.148 5.465  1.00 54.71 ? 345 GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 172 ? 8.223  -14.240 6.833  1.00 55.29 ? 345 GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 172 ? 6.808  -13.945 7.330  1.00 58.27 ? 345 GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 172 ? 6.767  -13.008 8.528  1.00 62.29 ? 345 GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 172 ? 7.393  -11.921 8.474  1.00 63.80 ? 345 GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 172 ? 6.085  -13.349 9.523  1.00 64.40 ? 345 GLU A OE2 1 
ATOM   1318 N  N   . ASP A 1 173 ? 8.948  -17.734 6.732  1.00 55.09 ? 346 ASP A N   1 
ATOM   1319 C  CA  . ASP A 1 173 ? 9.126  -18.817 5.761  1.00 55.19 ? 346 ASP A CA  1 
ATOM   1320 C  C   . ASP A 1 173 ? 10.574 -18.987 5.308  1.00 54.65 ? 346 ASP A C   1 
ATOM   1321 O  O   . ASP A 1 173 ? 10.856 -19.037 4.111  1.00 54.39 ? 346 ASP A O   1 
ATOM   1322 C  CB  . ASP A 1 173 ? 8.230  -18.583 4.537  1.00 55.90 ? 346 ASP A CB  1 
ATOM   1323 C  CG  . ASP A 1 173 ? 7.883  -19.876 3.802  1.00 57.55 ? 346 ASP A CG  1 
ATOM   1324 O  OD1 . ASP A 1 173 ? 7.813  -19.847 2.553  1.00 58.92 ? 346 ASP A OD1 1 
ATOM   1325 O  OD2 . ASP A 1 173 ? 7.681  -20.916 4.470  1.00 59.74 ? 346 ASP A OD2 1 
ATOM   1326 N  N   . GLY A 1 174 ? 11.491 -19.070 6.263  1.00 53.83 ? 347 GLY A N   1 
ATOM   1327 C  CA  . GLY A 1 174 ? 12.890 -19.287 5.926  1.00 53.22 ? 347 GLY A CA  1 
ATOM   1328 C  C   . GLY A 1 174 ? 13.690 -18.027 5.643  1.00 52.51 ? 347 GLY A C   1 
ATOM   1329 O  O   . GLY A 1 174 ? 14.914 -18.074 5.611  1.00 52.81 ? 347 GLY A O   1 
ATOM   1330 N  N   . PHE A 1 175 ? 13.007 -16.904 5.425  1.00 51.97 ? 348 PHE A N   1 
ATOM   1331 C  CA  . PHE A 1 175 ? 13.676 -15.617 5.183  1.00 51.18 ? 348 PHE A CA  1 
ATOM   1332 C  C   . PHE A 1 175 ? 13.541 -14.687 6.373  1.00 50.00 ? 348 PHE A C   1 
ATOM   1333 O  O   . PHE A 1 175 ? 12.442 -14.511 6.908  1.00 49.58 ? 348 PHE A O   1 
ATOM   1334 C  CB  . PHE A 1 175 ? 13.038 -14.868 4.014  1.00 51.66 ? 348 PHE A CB  1 
ATOM   1335 C  CG  . PHE A 1 175 ? 13.297 -15.476 2.683  1.00 54.06 ? 348 PHE A CG  1 
ATOM   1336 C  CD1 . PHE A 1 175 ? 14.460 -15.176 1.982  1.00 56.20 ? 348 PHE A CD1 1 
ATOM   1337 C  CD2 . PHE A 1 175 ? 12.357 -16.322 2.104  1.00 55.08 ? 348 PHE A CD2 1 
ATOM   1338 C  CE1 . PHE A 1 175 ? 14.695 -15.735 0.731  1.00 56.89 ? 348 PHE A CE1 1 
ATOM   1339 C  CE2 . PHE A 1 175 ? 12.583 -16.878 0.865  1.00 55.53 ? 348 PHE A CE2 1 
ATOM   1340 C  CZ  . PHE A 1 175 ? 13.756 -16.586 0.173  1.00 56.53 ? 348 PHE A CZ  1 
ATOM   1341 N  N   . TYR A 1 176 ? 14.640 -14.054 6.767  1.00 48.51 ? 349 TYR A N   1 
ATOM   1342 C  CA  . TYR A 1 176 ? 14.521 -12.927 7.670  1.00 47.17 ? 349 TYR A CA  1 
ATOM   1343 C  C   . TYR A 1 176 ? 14.103 -11.737 6.837  1.00 46.63 ? 349 TYR A C   1 
ATOM   1344 O  O   . TYR A 1 176 ? 14.785 -11.355 5.891  1.00 47.05 ? 349 TYR A O   1 
ATOM   1345 C  CB  . TYR A 1 176 ? 15.816 -12.673 8.438  1.00 46.56 ? 349 TYR A CB  1 
ATOM   1346 C  CG  . TYR A 1 176 ? 16.017 -13.697 9.516  1.00 45.46 ? 349 TYR A CG  1 
ATOM   1347 C  CD1 . TYR A 1 176 ? 15.311 -13.621 10.714 1.00 44.10 ? 349 TYR A CD1 1 
ATOM   1348 C  CD2 . TYR A 1 176 ? 16.887 -14.762 9.329  1.00 43.94 ? 349 TYR A CD2 1 
ATOM   1349 C  CE1 . TYR A 1 176 ? 15.479 -14.577 11.706 1.00 43.43 ? 349 TYR A CE1 1 
ATOM   1350 C  CE2 . TYR A 1 176 ? 17.068 -15.712 10.310 1.00 43.83 ? 349 TYR A CE2 1 
ATOM   1351 C  CZ  . TYR A 1 176 ? 16.363 -15.618 11.496 1.00 43.94 ? 349 TYR A CZ  1 
ATOM   1352 O  OH  . TYR A 1 176 ? 16.551 -16.581 12.464 1.00 44.25 ? 349 TYR A OH  1 
ATOM   1353 N  N   . GLU A 1 177 ? 12.959 -11.175 7.184  1.00 45.90 ? 350 GLU A N   1 
ATOM   1354 C  CA  . GLU A 1 177 ? 12.344 -10.132 6.395  1.00 45.95 ? 350 GLU A CA  1 
ATOM   1355 C  C   . GLU A 1 177 ? 12.591 -8.762  6.983  1.00 44.96 ? 350 GLU A C   1 
ATOM   1356 O  O   . GLU A 1 177 ? 12.271 -8.524  8.144  1.00 44.29 ? 350 GLU A O   1 
ATOM   1357 C  CB  . GLU A 1 177 ? 10.835 -10.354 6.359  1.00 46.63 ? 350 GLU A CB  1 
ATOM   1358 C  CG  . GLU A 1 177 ? 10.165 -9.662  5.210  1.00 50.55 ? 350 GLU A CG  1 
ATOM   1359 C  CD  . GLU A 1 177 ? 10.240 -10.485 3.943  1.00 55.45 ? 350 GLU A CD  1 
ATOM   1360 O  OE1 . GLU A 1 177 ? 10.891 -10.015 2.982  1.00 57.74 ? 350 GLU A OE1 1 
ATOM   1361 O  OE2 . GLU A 1 177 ? 9.653  -11.602 3.914  1.00 57.74 ? 350 GLU A OE2 1 
ATOM   1362 N  N   . VAL A 1 178 ? 13.126 -7.857  6.172  1.00 44.17 ? 351 VAL A N   1 
ATOM   1363 C  CA  . VAL A 1 178 ? 13.260 -6.466  6.574  1.00 43.93 ? 351 VAL A CA  1 
ATOM   1364 C  C   . VAL A 1 178 ? 12.156 -5.604  5.962  1.00 43.85 ? 351 VAL A C   1 
ATOM   1365 O  O   . VAL A 1 178 ? 12.054 -5.487  4.737  1.00 43.87 ? 351 VAL A O   1 
ATOM   1366 C  CB  . VAL A 1 178 ? 14.612 -5.866  6.136  1.00 43.70 ? 351 VAL A CB  1 
ATOM   1367 C  CG1 . VAL A 1 178 ? 14.755 -4.451  6.682  1.00 43.62 ? 351 VAL A CG1 1 
ATOM   1368 C  CG2 . VAL A 1 178 ? 15.770 -6.748  6.586  1.00 43.74 ? 351 VAL A CG2 1 
ATOM   1369 N  N   . ASP A 1 179 ? 11.352 -4.987  6.817  1.00 43.37 ? 352 ASP A N   1 
ATOM   1370 C  CA  . ASP A 1 179 ? 10.336 -4.044  6.372  1.00 43.59 ? 352 ASP A CA  1 
ATOM   1371 C  C   . ASP A 1 179 ? 10.858 -2.609  6.387  1.00 43.45 ? 352 ASP A C   1 
ATOM   1372 O  O   . ASP A 1 179 ? 10.816 -1.937  7.419  1.00 43.98 ? 352 ASP A O   1 
ATOM   1373 C  CB  . ASP A 1 179 ? 9.090  -4.154  7.258  1.00 43.48 ? 352 ASP A CB  1 
ATOM   1374 C  CG  . ASP A 1 179 ? 7.927  -3.349  6.722  1.00 44.26 ? 352 ASP A CG  1 
ATOM   1375 O  OD1 . ASP A 1 179 ? 8.119  -2.597  5.739  1.00 44.69 ? 352 ASP A OD1 1 
ATOM   1376 O  OD2 . ASP A 1 179 ? 6.820  -3.467  7.283  1.00 46.13 ? 352 ASP A OD2 1 
ATOM   1377 N  N   . TYR A 1 180 ? 11.339 -2.133  5.248  1.00 43.12 ? 353 TYR A N   1 
ATOM   1378 C  CA  . TYR A 1 180 ? 11.923 -0.803  5.187  1.00 43.31 ? 353 TYR A CA  1 
ATOM   1379 C  C   . TYR A 1 180 ? 10.906 0.327   5.341  1.00 43.94 ? 353 TYR A C   1 
ATOM   1380 O  O   . TYR A 1 180 ? 11.279 1.501   5.425  1.00 43.52 ? 353 TYR A O   1 
ATOM   1381 C  CB  . TYR A 1 180 ? 12.747 -0.638  3.916  1.00 43.16 ? 353 TYR A CB  1 
ATOM   1382 C  CG  . TYR A 1 180 ? 14.066 -1.360  4.011  1.00 42.71 ? 353 TYR A CG  1 
ATOM   1383 C  CD1 . TYR A 1 180 ? 15.170 -0.750  4.599  1.00 41.70 ? 353 TYR A CD1 1 
ATOM   1384 C  CD2 . TYR A 1 180 ? 14.203 -2.669  3.558  1.00 43.12 ? 353 TYR A CD2 1 
ATOM   1385 C  CE1 . TYR A 1 180 ? 16.388 -1.418  4.705  1.00 40.59 ? 353 TYR A CE1 1 
ATOM   1386 C  CE2 . TYR A 1 180 ? 15.419 -3.345  3.666  1.00 42.49 ? 353 TYR A CE2 1 
ATOM   1387 C  CZ  . TYR A 1 180 ? 16.507 -2.704  4.243  1.00 42.17 ? 353 TYR A CZ  1 
ATOM   1388 O  OH  . TYR A 1 180 ? 17.715 -3.364  4.359  1.00 42.47 ? 353 TYR A OH  1 
ATOM   1389 N  N   . ASN A 1 181 ? 9.624  -0.032  5.387  1.00 44.22 ? 354 ASN A N   1 
ATOM   1390 C  CA  . ASN A 1 181 ? 8.583  0.926   5.725  1.00 44.70 ? 354 ASN A CA  1 
ATOM   1391 C  C   . ASN A 1 181 ? 8.733  1.405   7.164  1.00 44.34 ? 354 ASN A C   1 
ATOM   1392 O  O   . ASN A 1 181 ? 8.225  2.461   7.539  1.00 44.25 ? 354 ASN A O   1 
ATOM   1393 C  CB  . ASN A 1 181 ? 7.198  0.308   5.529  1.00 45.00 ? 354 ASN A CB  1 
ATOM   1394 C  CG  . ASN A 1 181 ? 6.738  0.359   4.090  1.00 46.05 ? 354 ASN A CG  1 
ATOM   1395 O  OD1 . ASN A 1 181 ? 7.180  1.207   3.312  1.00 47.01 ? 354 ASN A OD1 1 
ATOM   1396 N  ND2 . ASN A 1 181 ? 5.831  -0.546  3.727  1.00 48.23 ? 354 ASN A ND2 1 
ATOM   1397 N  N   . SER A 1 182 ? 9.427  0.614   7.969  1.00 44.11 ? 355 SER A N   1 
ATOM   1398 C  CA  . SER A 1 182 ? 9.610  0.943   9.375  1.00 43.47 ? 355 SER A CA  1 
ATOM   1399 C  C   . SER A 1 182 ? 11.019 1.456   9.687  1.00 43.04 ? 355 SER A C   1 
ATOM   1400 O  O   . SER A 1 182 ? 11.337 1.719   10.847 1.00 42.47 ? 355 SER A O   1 
ATOM   1401 C  CB  . SER A 1 182 ? 9.316  -0.276  10.239 1.00 43.54 ? 355 SER A CB  1 
ATOM   1402 O  OG  . SER A 1 182 ? 7.928  -0.522  10.314 1.00 44.25 ? 355 SER A OG  1 
ATOM   1403 N  N   . PHE A 1 183 ? 11.856 1.584   8.663  1.00 42.67 ? 356 PHE A N   1 
ATOM   1404 C  CA  . PHE A 1 183 ? 13.254 1.985   8.857  1.00 42.29 ? 356 PHE A CA  1 
ATOM   1405 C  C   . PHE A 1 183 ? 13.376 3.233   9.714  1.00 42.00 ? 356 PHE A C   1 
ATOM   1406 O  O   . PHE A 1 183 ? 14.176 3.278   10.649 1.00 42.34 ? 356 PHE A O   1 
ATOM   1407 C  CB  . PHE A 1 183 ? 13.932 2.236   7.515  1.00 41.90 ? 356 PHE A CB  1 
ATOM   1408 C  CG  . PHE A 1 183 ? 15.414 2.514   7.624  1.00 41.38 ? 356 PHE A CG  1 
ATOM   1409 C  CD1 . PHE A 1 183 ? 16.324 1.473   7.724  1.00 40.64 ? 356 PHE A CD1 1 
ATOM   1410 C  CD2 . PHE A 1 183 ? 15.896 3.815   7.598  1.00 40.77 ? 356 PHE A CD2 1 
ATOM   1411 C  CE1 . PHE A 1 183 ? 17.703 1.726   7.804  1.00 40.85 ? 356 PHE A CE1 1 
ATOM   1412 C  CE2 . PHE A 1 183 ? 17.268 4.081   7.680  1.00 40.83 ? 356 PHE A CE2 1 
ATOM   1413 C  CZ  . PHE A 1 183 ? 18.173 3.037   7.781  1.00 40.54 ? 356 PHE A CZ  1 
ATOM   1414 N  N   . HIS A 1 184 ? 12.571 4.242   9.389  1.00 41.51 ? 357 HIS A N   1 
ATOM   1415 C  CA  . HIS A 1 184 ? 12.647 5.537   10.038 1.00 41.21 ? 357 HIS A CA  1 
ATOM   1416 C  C   . HIS A 1 184 ? 11.706 5.729   11.221 1.00 40.96 ? 357 HIS A C   1 
ATOM   1417 O  O   . HIS A 1 184 ? 11.816 6.722   11.931 1.00 40.45 ? 357 HIS A O   1 
ATOM   1418 C  CB  . HIS A 1 184 ? 12.363 6.632   9.024  1.00 41.22 ? 357 HIS A CB  1 
ATOM   1419 C  CG  . HIS A 1 184 ? 13.413 6.760   7.971  1.00 41.71 ? 357 HIS A CG  1 
ATOM   1420 N  ND1 . HIS A 1 184 ? 14.676 7.237   8.241  1.00 40.20 ? 357 HIS A ND1 1 
ATOM   1421 C  CD2 . HIS A 1 184 ? 13.387 6.481   6.645  1.00 40.75 ? 357 HIS A CD2 1 
ATOM   1422 C  CE1 . HIS A 1 184 ? 15.384 7.250   7.125  1.00 41.69 ? 357 HIS A CE1 1 
ATOM   1423 N  NE2 . HIS A 1 184 ? 14.626 6.792   6.144  1.00 41.35 ? 357 HIS A NE2 1 
ATOM   1424 N  N   . GLU A 1 185 ? 10.788 4.787   11.445 1.00 41.22 ? 358 GLU A N   1 
ATOM   1425 C  CA  A GLU A 1 185 ? 9.742  5.019   12.448 0.50 41.23 ? 358 GLU A CA  1 
ATOM   1426 C  CA  B GLU A 1 185 ? 9.720  4.947   12.432 0.50 41.11 ? 358 GLU A CA  1 
ATOM   1427 C  C   . GLU A 1 185 ? 10.186 4.741   13.877 1.00 40.93 ? 358 GLU A C   1 
ATOM   1428 O  O   . GLU A 1 185 ? 10.987 3.842   14.158 1.00 40.61 ? 358 GLU A O   1 
ATOM   1429 C  CB  A GLU A 1 185 ? 8.440  4.268   12.131 0.50 41.65 ? 358 GLU A CB  1 
ATOM   1430 C  CB  B GLU A 1 185 ? 8.556  3.999   12.101 0.50 41.35 ? 358 GLU A CB  1 
ATOM   1431 C  CG  A GLU A 1 185 ? 7.301  4.488   13.158 0.50 42.79 ? 358 GLU A CG  1 
ATOM   1432 C  CG  B GLU A 1 185 ? 7.835  4.346   10.787 0.50 42.19 ? 358 GLU A CG  1 
ATOM   1433 C  CD  A GLU A 1 185 ? 6.767  5.931   13.232 0.50 44.75 ? 358 GLU A CD  1 
ATOM   1434 C  CD  B GLU A 1 185 ? 6.593  3.506   10.545 0.50 43.30 ? 358 GLU A CD  1 
ATOM   1435 O  OE1 A GLU A 1 185 ? 7.565  6.890   13.373 0.50 44.40 ? 358 GLU A OE1 1 
ATOM   1436 O  OE1 B GLU A 1 185 ? 6.389  2.514   11.277 0.50 43.33 ? 358 GLU A OE1 1 
ATOM   1437 O  OE2 A GLU A 1 185 ? 5.527  6.100   13.185 0.50 44.80 ? 358 GLU A OE2 1 
ATOM   1438 O  OE2 B GLU A 1 185 ? 5.819  3.838   9.618  0.50 44.28 ? 358 GLU A OE2 1 
ATOM   1439 N  N   . THR A 1 186 ? 9.657  5.556   14.777 1.00 40.49 ? 359 THR A N   1 
ATOM   1440 C  CA  . THR A 1 186 ? 9.966  5.486   16.182 1.00 40.69 ? 359 THR A CA  1 
ATOM   1441 C  C   . THR A 1 186 ? 8.646  5.469   16.946 1.00 41.04 ? 359 THR A C   1 
ATOM   1442 O  O   . THR A 1 186 ? 7.600  5.816   16.393 1.00 41.39 ? 359 THR A O   1 
ATOM   1443 C  CB  . THR A 1 186 ? 10.812 6.702   16.600 1.00 40.66 ? 359 THR A CB  1 
ATOM   1444 O  OG1 . THR A 1 186 ? 10.170 7.910   16.166 1.00 39.42 ? 359 THR A OG1 1 
ATOM   1445 C  CG2 . THR A 1 186 ? 12.196 6.630   15.941 1.00 39.21 ? 359 THR A CG2 1 
ATOM   1446 N  N   . TYR A 1 187 ? 8.685  5.046   18.199 1.00 41.41 ? 360 TYR A N   1 
ATOM   1447 C  CA  . TYR A 1 187 ? 7.504  5.122   19.049 1.00 41.82 ? 360 TYR A CA  1 
ATOM   1448 C  C   . TYR A 1 187 ? 7.907  5.538   20.440 1.00 42.05 ? 360 TYR A C   1 
ATOM   1449 O  O   . TYR A 1 187 ? 9.041  5.293   20.871 1.00 41.78 ? 360 TYR A O   1 
ATOM   1450 C  CB  . TYR A 1 187 ? 6.751  3.788   19.090 1.00 41.74 ? 360 TYR A CB  1 
ATOM   1451 C  CG  . TYR A 1 187 ? 7.519  2.639   19.705 1.00 41.28 ? 360 TYR A CG  1 
ATOM   1452 C  CD1 . TYR A 1 187 ? 7.348  2.305   21.032 1.00 42.15 ? 360 TYR A CD1 1 
ATOM   1453 C  CD2 . TYR A 1 187 ? 8.402  1.876   18.942 1.00 41.95 ? 360 TYR A CD2 1 
ATOM   1454 C  CE1 . TYR A 1 187 ? 8.034  1.241   21.601 1.00 41.84 ? 360 TYR A CE1 1 
ATOM   1455 C  CE2 . TYR A 1 187 ? 9.106  0.809   19.501 1.00 40.46 ? 360 TYR A CE2 1 
ATOM   1456 C  CZ  . TYR A 1 187 ? 8.912  0.502   20.826 1.00 41.66 ? 360 TYR A CZ  1 
ATOM   1457 O  OH  . TYR A 1 187 ? 9.587  -0.552  21.393 1.00 41.11 ? 360 TYR A OH  1 
ATOM   1458 N  N   . GLU A 1 188 ? 6.965  6.152   21.148 1.00 41.95 ? 361 GLU A N   1 
ATOM   1459 C  CA  . GLU A 1 188 ? 7.219  6.666   22.481 1.00 42.69 ? 361 GLU A CA  1 
ATOM   1460 C  C   . GLU A 1 188 ? 7.185  5.558   23.521 1.00 41.94 ? 361 GLU A C   1 
ATOM   1461 O  O   . GLU A 1 188 ? 6.417  4.606   23.411 1.00 42.14 ? 361 GLU A O   1 
ATOM   1462 C  CB  . GLU A 1 188 ? 6.216  7.778   22.827 1.00 43.49 ? 361 GLU A CB  1 
ATOM   1463 C  CG  . GLU A 1 188 ? 6.342  8.289   24.256 1.00 47.10 ? 361 GLU A CG  1 
ATOM   1464 C  CD  . GLU A 1 188 ? 5.695  9.661   24.453 1.00 51.59 ? 361 GLU A CD  1 
ATOM   1465 O  OE1 . GLU A 1 188 ? 6.096  10.377  25.400 1.00 53.34 ? 361 GLU A OE1 1 
ATOM   1466 O  OE2 . GLU A 1 188 ? 4.806  10.028  23.649 1.00 53.18 ? 361 GLU A OE2 1 
ATOM   1467 N  N   . THR A 1 189 ? 8.041  5.668   24.523 1.00 41.19 ? 362 THR A N   1 
ATOM   1468 C  CA  . THR A 1 189 ? 8.072  4.688   25.589 1.00 41.00 ? 362 THR A CA  1 
ATOM   1469 C  C   . THR A 1 189 ? 8.379  5.395   26.895 1.00 40.93 ? 362 THR A C   1 
ATOM   1470 O  O   . THR A 1 189 ? 9.076  6.412   26.914 1.00 40.64 ? 362 THR A O   1 
ATOM   1471 C  CB  . THR A 1 189 ? 9.149  3.617   25.336 1.00 41.38 ? 362 THR A CB  1 
ATOM   1472 O  OG1 . THR A 1 189 ? 8.895  2.476   26.163 1.00 41.41 ? 362 THR A OG1 1 
ATOM   1473 C  CG2 . THR A 1 189 ? 10.545 4.172   25.646 1.00 40.59 ? 362 THR A CG2 1 
ATOM   1474 N  N   . SER A 1 190 ? 7.841  4.863   27.983 1.00 41.04 ? 363 SER A N   1 
ATOM   1475 C  CA  . SER A 1 190 ? 8.083  5.412   29.304 1.00 41.61 ? 363 SER A CA  1 
ATOM   1476 C  C   . SER A 1 190 ? 9.578  5.582   29.567 1.00 41.56 ? 363 SER A C   1 
ATOM   1477 O  O   . SER A 1 190 ? 10.315 4.594   29.618 1.00 41.19 ? 363 SER A O   1 
ATOM   1478 C  CB  . SER A 1 190 ? 7.513  4.475   30.363 1.00 41.74 ? 363 SER A CB  1 
ATOM   1479 O  OG  . SER A 1 190 ? 7.792  4.990   31.642 1.00 43.42 ? 363 SER A OG  1 
ATOM   1480 N  N   . THR A 1 191 ? 10.014 6.821   29.764 1.00 41.01 ? 364 THR A N   1 
ATOM   1481 C  CA  . THR A 1 191 ? 11.433 7.102   29.972 1.00 41.24 ? 364 THR A CA  1 
ATOM   1482 C  C   . THR A 1 191 ? 11.629 8.165   31.060 1.00 41.33 ? 364 THR A C   1 
ATOM   1483 O  O   . THR A 1 191 ? 10.880 9.138   31.106 1.00 41.43 ? 364 THR A O   1 
ATOM   1484 C  CB  . THR A 1 191 ? 12.069 7.613   28.659 1.00 40.95 ? 364 THR A CB  1 
ATOM   1485 O  OG1 . THR A 1 191 ? 11.795 6.680   27.598 1.00 40.93 ? 364 THR A OG1 1 
ATOM   1486 C  CG2 . THR A 1 191 ? 13.563 7.780   28.813 1.00 40.12 ? 364 THR A CG2 1 
ATOM   1487 N  N   . PRO A 1 192 ? 12.643 7.997   31.923 1.00 41.23 ? 365 PRO A N   1 
ATOM   1488 C  CA  . PRO A 1 192 ? 12.958 9.076   32.871 1.00 41.37 ? 365 PRO A CA  1 
ATOM   1489 C  C   . PRO A 1 192 ? 13.318 10.359  32.131 1.00 41.35 ? 365 PRO A C   1 
ATOM   1490 O  O   . PRO A 1 192 ? 13.766 10.293  30.983 1.00 41.55 ? 365 PRO A O   1 
ATOM   1491 C  CB  . PRO A 1 192 ? 14.192 8.555   33.612 1.00 41.53 ? 365 PRO A CB  1 
ATOM   1492 C  CG  . PRO A 1 192 ? 14.214 7.098   33.369 1.00 41.46 ? 365 PRO A CG  1 
ATOM   1493 C  CD  . PRO A 1 192 ? 13.582 6.872   32.035 1.00 41.62 ? 365 PRO A CD  1 
ATOM   1494 N  N   . SER A 1 193 ? 13.123 11.511  32.775 1.00 40.27 ? 366 SER A N   1 
ATOM   1495 C  CA  . SER A 1 193 ? 13.481 12.797  32.185 1.00 39.54 ? 366 SER A CA  1 
ATOM   1496 C  C   . SER A 1 193 ? 14.748 13.377  32.802 1.00 38.89 ? 366 SER A C   1 
ATOM   1497 O  O   . SER A 1 193 ? 15.241 14.418  32.371 1.00 38.29 ? 366 SER A O   1 
ATOM   1498 C  CB  . SER A 1 193 ? 12.328 13.793  32.323 1.00 39.63 ? 366 SER A CB  1 
ATOM   1499 O  OG  . SER A 1 193 ? 11.121 13.210  31.860 1.00 40.81 ? 366 SER A OG  1 
ATOM   1500 N  N   . LEU A 1 194 ? 15.279 12.692  33.805 1.00 38.77 ? 367 LEU A N   1 
ATOM   1501 C  CA  . LEU A 1 194 ? 16.535 13.092  34.426 1.00 38.85 ? 367 LEU A CA  1 
ATOM   1502 C  C   . LEU A 1 194 ? 17.697 12.929  33.455 1.00 38.37 ? 367 LEU A C   1 
ATOM   1503 O  O   . LEU A 1 194 ? 17.609 12.130  32.527 1.00 38.46 ? 367 LEU A O   1 
ATOM   1504 C  CB  . LEU A 1 194 ? 16.800 12.213  35.638 1.00 39.04 ? 367 LEU A CB  1 
ATOM   1505 C  CG  . LEU A 1 194 ? 15.916 12.444  36.858 1.00 40.94 ? 367 LEU A CG  1 
ATOM   1506 C  CD1 . LEU A 1 194 ? 16.225 11.403  37.918 1.00 42.23 ? 367 LEU A CD1 1 
ATOM   1507 C  CD2 . LEU A 1 194 ? 16.171 13.828  37.397 1.00 43.99 ? 367 LEU A CD2 1 
ATOM   1508 N  N   . SER A 1 195 ? 18.780 13.663  33.681 1.00 37.42 ? 368 SER A N   1 
ATOM   1509 C  CA  . SER A 1 195 ? 20.035 13.401  32.979 1.00 37.15 ? 368 SER A CA  1 
ATOM   1510 C  C   . SER A 1 195 ? 20.614 12.062  33.433 1.00 36.35 ? 368 SER A C   1 
ATOM   1511 O  O   . SER A 1 195 ? 20.339 11.609  34.541 1.00 35.79 ? 368 SER A O   1 
ATOM   1512 C  CB  . SER A 1 195 ? 21.049 14.504  33.245 1.00 36.85 ? 368 SER A CB  1 
ATOM   1513 O  OG  . SER A 1 195 ? 21.440 14.505  34.603 1.00 38.78 ? 368 SER A OG  1 
ATOM   1514 N  N   . ALA A 1 196 ? 21.409 11.426  32.570 1.00 35.62 ? 369 ALA A N   1 
ATOM   1515 C  CA  . ALA A 1 196 ? 22.067 10.179  32.936 1.00 34.99 ? 369 ALA A CA  1 
ATOM   1516 C  C   . ALA A 1 196 ? 22.848 10.343  34.250 1.00 34.68 ? 369 ALA A C   1 
ATOM   1517 O  O   . ALA A 1 196 ? 22.834 9.454   35.094 1.00 34.54 ? 369 ALA A O   1 
ATOM   1518 C  CB  . ALA A 1 196 ? 22.999 9.703   31.810 1.00 34.95 ? 369 ALA A CB  1 
ATOM   1519 N  N   . LYS A 1 197 ? 23.523 11.475  34.418 1.00 34.87 ? 370 LYS A N   1 
ATOM   1520 C  CA  . LYS A 1 197 ? 24.283 11.711  35.644 1.00 36.21 ? 370 LYS A CA  1 
ATOM   1521 C  C   . LYS A 1 197 ? 23.414 11.585  36.904 1.00 36.20 ? 370 LYS A C   1 
ATOM   1522 O  O   . LYS A 1 197 ? 23.782 10.891  37.844 1.00 35.84 ? 370 LYS A O   1 
ATOM   1523 C  CB  . LYS A 1 197 ? 24.995 13.066  35.628 1.00 36.19 ? 370 LYS A CB  1 
ATOM   1524 C  CG  . LYS A 1 197 ? 25.683 13.362  36.968 1.00 38.37 ? 370 LYS A CG  1 
ATOM   1525 C  CD  . LYS A 1 197 ? 26.512 14.614  36.915 1.00 42.28 ? 370 LYS A CD  1 
ATOM   1526 C  CE  . LYS A 1 197 ? 26.785 15.130  38.324 1.00 45.12 ? 370 LYS A CE  1 
ATOM   1527 N  NZ  . LYS A 1 197 ? 27.456 16.451  38.273 1.00 49.01 ? 370 LYS A NZ  1 
ATOM   1528 N  N   . GLU A 1 198 ? 22.254 12.238  36.905 1.00 36.82 ? 371 GLU A N   1 
ATOM   1529 C  CA  . GLU A 1 198 ? 21.397 12.239  38.079 1.00 37.74 ? 371 GLU A CA  1 
ATOM   1530 C  C   . GLU A 1 198 ? 20.706 10.897  38.263 1.00 38.46 ? 371 GLU A C   1 
ATOM   1531 O  O   . GLU A 1 198 ? 20.508 10.449  39.399 1.00 38.21 ? 371 GLU A O   1 
ATOM   1532 C  CB  . GLU A 1 198 ? 20.376 13.393  38.036 1.00 37.91 ? 371 GLU A CB  1 
ATOM   1533 C  CG  . GLU A 1 198 ? 20.984 14.756  38.371 1.00 38.72 ? 371 GLU A CG  1 
ATOM   1534 C  CD  . GLU A 1 198 ? 19.934 15.805  38.782 1.00 42.50 ? 371 GLU A CD  1 
ATOM   1535 O  OE1 . GLU A 1 198 ? 18.718 15.564  38.613 1.00 41.84 ? 371 GLU A OE1 1 
ATOM   1536 O  OE2 . GLU A 1 198 ? 20.338 16.879  39.284 1.00 45.31 ? 371 GLU A OE2 1 
ATOM   1537 N  N   . LEU A 1 199 ? 20.366 10.237  37.156 1.00 39.28 ? 372 LEU A N   1 
ATOM   1538 C  CA  . LEU A 1 199 ? 19.854 8.864   37.219 1.00 40.41 ? 372 LEU A CA  1 
ATOM   1539 C  C   . LEU A 1 199 ? 20.843 7.943   37.913 1.00 41.05 ? 372 LEU A C   1 
ATOM   1540 O  O   . LEU A 1 199 ? 20.461 7.120   38.750 1.00 40.84 ? 372 LEU A O   1 
ATOM   1541 C  CB  . LEU A 1 199 ? 19.567 8.311   35.818 1.00 40.30 ? 372 LEU A CB  1 
ATOM   1542 C  CG  . LEU A 1 199 ? 18.282 8.779   35.144 1.00 41.56 ? 372 LEU A CG  1 
ATOM   1543 C  CD1 . LEU A 1 199 ? 18.339 8.483   33.640 1.00 41.15 ? 372 LEU A CD1 1 
ATOM   1544 C  CD2 . LEU A 1 199 ? 17.091 8.080   35.788 1.00 41.98 ? 372 LEU A CD2 1 
ATOM   1545 N  N   . ALA A 1 200 ? 22.115 8.063   37.552 1.00 41.98 ? 373 ALA A N   1 
ATOM   1546 C  CA  . ALA A 1 200 ? 23.137 7.217   38.163 1.00 43.44 ? 373 ALA A CA  1 
ATOM   1547 C  C   . ALA A 1 200 ? 23.274 7.530   39.653 1.00 44.52 ? 373 ALA A C   1 
ATOM   1548 O  O   . ALA A 1 200 ? 23.286 6.621   40.481 1.00 44.75 ? 373 ALA A O   1 
ATOM   1549 C  CB  . ALA A 1 200 ? 24.473 7.390   37.458 1.00 43.36 ? 373 ALA A CB  1 
ATOM   1550 N  N   . GLU A 1 201 ? 23.372 8.813   39.988 1.00 45.50 ? 374 GLU A N   1 
ATOM   1551 C  CA  . GLU A 1 201 ? 23.516 9.226   41.387 1.00 46.82 ? 374 GLU A CA  1 
ATOM   1552 C  C   . GLU A 1 201 ? 22.383 8.665   42.242 1.00 47.00 ? 374 GLU A C   1 
ATOM   1553 O  O   . GLU A 1 201 ? 22.612 8.186   43.358 1.00 47.03 ? 374 GLU A O   1 
ATOM   1554 C  CB  . GLU A 1 201 ? 23.576 10.749  41.508 1.00 46.71 ? 374 GLU A CB  1 
ATOM   1555 C  CG  . GLU A 1 201 ? 24.818 11.348  40.872 1.00 49.56 ? 374 GLU A CG  1 
ATOM   1556 C  CD  . GLU A 1 201 ? 24.845 12.872  40.923 1.00 53.12 ? 374 GLU A CD  1 
ATOM   1557 O  OE1 . GLU A 1 201 ? 23.803 13.506  41.219 1.00 55.32 ? 374 GLU A OE1 1 
ATOM   1558 O  OE2 . GLU A 1 201 ? 25.919 13.441  40.653 1.00 54.49 ? 374 GLU A OE2 1 
ATOM   1559 N  N   . LEU A 1 202 ? 21.163 8.723   41.714 1.00 47.67 ? 375 LEU A N   1 
ATOM   1560 C  CA  . LEU A 1 202 ? 20.009 8.181   42.417 1.00 48.46 ? 375 LEU A CA  1 
ATOM   1561 C  C   . LEU A 1 202 ? 20.078 6.657   42.540 1.00 49.71 ? 375 LEU A C   1 
ATOM   1562 O  O   . LEU A 1 202 ? 19.741 6.115   43.581 1.00 49.52 ? 375 LEU A O   1 
ATOM   1563 C  CB  . LEU A 1 202 ? 18.698 8.614   41.757 1.00 48.27 ? 375 LEU A CB  1 
ATOM   1564 C  CG  . LEU A 1 202 ? 18.342 10.104  41.811 1.00 47.17 ? 375 LEU A CG  1 
ATOM   1565 C  CD1 . LEU A 1 202 ? 17.010 10.359  41.125 1.00 45.80 ? 375 LEU A CD1 1 
ATOM   1566 C  CD2 . LEU A 1 202 ? 18.319 10.620  43.250 1.00 47.94 ? 375 LEU A CD2 1 
ATOM   1567 N  N   . ALA A 1 203 ? 20.512 5.960   41.491 1.00 51.14 ? 376 ALA A N   1 
ATOM   1568 C  CA  . ALA A 1 203 ? 20.679 4.503   41.598 1.00 52.91 ? 376 ALA A CA  1 
ATOM   1569 C  C   . ALA A 1 203 ? 21.729 4.158   42.651 1.00 54.06 ? 376 ALA A C   1 
ATOM   1570 O  O   . ALA A 1 203 ? 21.561 3.217   43.432 1.00 54.35 ? 376 ALA A O   1 
ATOM   1571 C  CB  . ALA A 1 203 ? 21.045 3.885   40.254 1.00 52.71 ? 376 ALA A CB  1 
ATOM   1572 N  N   . ASN A 1 204 ? 22.801 4.941   42.679 1.00 55.65 ? 377 ASN A N   1 
ATOM   1573 C  CA  . ASN A 1 204 ? 23.884 4.732   43.632 1.00 57.56 ? 377 ASN A CA  1 
ATOM   1574 C  C   . ASN A 1 204 ? 23.459 4.911   45.095 1.00 58.72 ? 377 ASN A C   1 
ATOM   1575 O  O   . ASN A 1 204 ? 24.047 4.305   45.993 1.00 58.93 ? 377 ASN A O   1 
ATOM   1576 C  CB  . ASN A 1 204 ? 25.086 5.615   43.284 1.00 57.41 ? 377 ASN A CB  1 
ATOM   1577 C  CG  . ASN A 1 204 ? 25.783 5.167   42.005 1.00 58.64 ? 377 ASN A CG  1 
ATOM   1578 O  OD1 . ASN A 1 204 ? 25.690 4.002   41.614 1.00 59.59 ? 377 ASN A OD1 1 
ATOM   1579 N  ND2 . ASN A 1 204 ? 26.477 6.094   41.343 1.00 59.40 ? 377 ASN A ND2 1 
ATOM   1580 N  N   . ARG A 1 205 ? 22.442 5.736   45.336 1.00 60.03 ? 378 ARG A N   1 
ATOM   1581 C  CA  . ARG A 1 205 ? 21.845 5.830   46.673 1.00 61.44 ? 378 ARG A CA  1 
ATOM   1582 C  C   . ARG A 1 205 ? 21.064 4.556   46.965 1.00 62.29 ? 378 ARG A C   1 
ATOM   1583 O  O   . ARG A 1 205 ? 19.908 4.427   46.563 1.00 62.44 ? 378 ARG A O   1 
ATOM   1584 C  CB  . ARG A 1 205 ? 20.896 7.017   46.765 1.00 61.43 ? 378 ARG A CB  1 
ATOM   1585 C  CG  . ARG A 1 205 ? 21.553 8.353   46.958 1.00 61.58 ? 378 ARG A CG  1 
ATOM   1586 C  CD  . ARG A 1 205 ? 20.556 9.268   47.648 1.00 63.02 ? 378 ARG A CD  1 
ATOM   1587 N  NE  . ARG A 1 205 ? 20.457 10.567  46.993 1.00 63.11 ? 378 ARG A NE  1 
ATOM   1588 C  CZ  . ARG A 1 205 ? 19.312 11.226  46.832 1.00 62.22 ? 378 ARG A CZ  1 
ATOM   1589 N  NH1 . ARG A 1 205 ? 18.175 10.692  47.262 1.00 61.15 ? 378 ARG A NH1 1 
ATOM   1590 N  NH2 . ARG A 1 205 ? 19.300 12.408  46.232 1.00 60.98 ? 378 ARG A NH2 1 
ATOM   1591 N  N   . ALA A 1 206 ? 21.695 3.612   47.656 1.00 63.48 ? 379 ALA A N   1 
ATOM   1592 C  CA  . ALA A 1 206 ? 21.093 2.295   47.862 1.00 63.99 ? 379 ALA A CA  1 
ATOM   1593 C  C   . ALA A 1 206 ? 21.281 1.419   46.622 1.00 64.36 ? 379 ALA A C   1 
ATOM   1594 O  O   . ALA A 1 206 ? 22.154 0.544   46.589 1.00 64.78 ? 379 ALA A O   1 
ATOM   1595 C  CB  . ALA A 1 206 ? 19.608 2.430   48.204 1.00 64.12 ? 379 ALA A CB  1 
HETATM 1596 C  C1  . BME B 2 .   ? 25.978 -10.305 2.122  1.00 68.56 ? 401 BME A C1  1 
HETATM 1597 C  C2  . BME B 2 .   ? 25.930 -10.616 3.617  1.00 68.19 ? 401 BME A C2  1 
HETATM 1598 O  O1  . BME B 2 .   ? 24.681 -9.892  1.688  1.00 68.16 ? 401 BME A O1  1 
HETATM 1599 S  S2  . BME B 2 .   ? 25.510 -12.367 3.844  1.00 68.88 ? 401 BME A S2  1 
HETATM 1600 C  C1  . BME C 2 .   ? 27.320 3.889   2.023  1.00 68.63 ? 402 BME A C1  1 
HETATM 1601 C  C2  . BME C 2 .   ? 28.265 2.688   2.066  1.00 68.55 ? 402 BME A C2  1 
HETATM 1602 O  O1  . BME C 2 .   ? 26.013 3.484   2.442  1.00 68.02 ? 402 BME A O1  1 
HETATM 1603 S  S2  . BME C 2 .   ? 29.894 3.192   2.696  1.00 68.59 ? 402 BME A S2  1 
HETATM 1604 MG MG  . MG  D 3 .   ? 42.937 0.001   18.135 0.25 79.53 ? 403 MG  A MG  1 
HETATM 1605 O  O   . HOH E 4 .   ? 24.039 -23.600 5.301  1.00 39.96 ? 501 HOH A O   1 
HETATM 1606 O  O   . HOH E 4 .   ? 32.469 -19.485 3.925  1.00 52.88 ? 502 HOH A O   1 
HETATM 1607 O  O   . HOH E 4 .   ? 32.032 -16.010 2.401  1.00 44.63 ? 503 HOH A O   1 
HETATM 1608 O  O   . HOH E 4 .   ? 13.909 8.164   12.086 1.00 38.13 ? 504 HOH A O   1 
HETATM 1609 O  O   . HOH E 4 .   ? 31.847 -5.653  7.426  1.00 38.21 ? 505 HOH A O   1 
HETATM 1610 O  O   . HOH E 4 .   ? 32.904 7.585   17.038 1.00 29.71 ? 506 HOH A O   1 
HETATM 1611 O  O   . HOH E 4 .   ? 32.267 18.588  20.696 1.00 41.29 ? 507 HOH A O   1 
HETATM 1612 O  O   . HOH E 4 .   ? 32.273 20.761  21.983 1.00 32.85 ? 508 HOH A O   1 
HETATM 1613 O  O   . HOH E 4 .   ? 42.169 27.937  26.134 1.00 36.29 ? 509 HOH A O   1 
HETATM 1614 O  O   . HOH E 4 .   ? 40.718 34.690  26.401 1.00 52.10 ? 510 HOH A O   1 
HETATM 1615 O  O   . HOH E 4 .   ? 38.262 33.421  21.949 1.00 46.29 ? 511 HOH A O   1 
HETATM 1616 O  O   . HOH E 4 .   ? 31.716 9.299   24.095 1.00 30.92 ? 512 HOH A O   1 
HETATM 1617 O  O   . HOH E 4 .   ? 31.096 7.500   26.519 1.00 29.16 ? 513 HOH A O   1 
HETATM 1618 O  O   . HOH E 4 .   ? 29.574 5.486   25.617 1.00 30.66 ? 514 HOH A O   1 
HETATM 1619 O  O   . HOH E 4 .   ? 33.414 1.241   22.994 1.00 32.13 ? 515 HOH A O   1 
HETATM 1620 O  O   . HOH E 4 .   ? 33.368 4.661   18.872 1.00 27.99 ? 516 HOH A O   1 
HETATM 1621 O  O   . HOH E 4 .   ? 33.954 4.311   16.038 1.00 28.14 ? 517 HOH A O   1 
HETATM 1622 O  O   . HOH E 4 .   ? 28.804 3.474   23.849 1.00 37.72 ? 518 HOH A O   1 
HETATM 1623 O  O   . HOH E 4 .   ? 28.212 0.337   16.980 1.00 35.76 ? 519 HOH A O   1 
HETATM 1624 O  O   . HOH E 4 .   ? 25.980 0.016   18.817 1.00 35.81 ? 520 HOH A O   1 
HETATM 1625 O  O   . HOH E 4 .   ? 28.918 -5.774  17.139 1.00 44.12 ? 521 HOH A O   1 
HETATM 1626 O  O   . HOH E 4 .   ? 36.412 0.844   13.289 1.00 58.97 ? 522 HOH A O   1 
HETATM 1627 O  O   . HOH E 4 .   ? 28.828 -5.712  6.530  1.00 44.15 ? 523 HOH A O   1 
HETATM 1628 O  O   . HOH E 4 .   ? 22.835 -6.902  9.937  1.00 45.95 ? 524 HOH A O   1 
HETATM 1629 O  O   . HOH E 4 .   ? 17.285 -2.085  13.401 1.00 38.52 ? 525 HOH A O   1 
HETATM 1630 O  O   . HOH E 4 .   ? 14.541 -5.038  13.914 1.00 40.92 ? 526 HOH A O   1 
HETATM 1631 O  O   . HOH E 4 .   ? 22.296 -1.302  23.025 1.00 52.67 ? 527 HOH A O   1 
HETATM 1632 O  O   . HOH E 4 .   ? 29.564 6.379   34.058 1.00 49.78 ? 528 HOH A O   1 
HETATM 1633 O  O   . HOH E 4 .   ? 30.819 13.855  30.220 1.00 50.22 ? 529 HOH A O   1 
HETATM 1634 O  O   . HOH E 4 .   ? 33.473 6.464   26.229 1.00 35.05 ? 530 HOH A O   1 
HETATM 1635 O  O   . HOH E 4 .   ? 26.903 16.632  29.464 1.00 41.08 ? 531 HOH A O   1 
HETATM 1636 O  O   . HOH E 4 .   ? 21.793 12.571  29.979 1.00 31.67 ? 532 HOH A O   1 
HETATM 1637 O  O   . HOH E 4 .   ? 20.685 19.303  31.933 1.00 36.70 ? 533 HOH A O   1 
HETATM 1638 O  O   . HOH E 4 .   ? 14.162 17.079  32.333 1.00 39.09 ? 534 HOH A O   1 
HETATM 1639 O  O   . HOH E 4 .   ? 24.342 24.126  23.491 1.00 56.10 ? 535 HOH A O   1 
HETATM 1640 O  O   . HOH E 4 .   ? 8.750  9.204   26.959 1.00 44.17 ? 536 HOH A O   1 
HETATM 1641 O  O   . HOH E 4 .   ? 15.524 1.735   20.060 1.00 35.56 ? 537 HOH A O   1 
HETATM 1642 O  O   . HOH E 4 .   ? 13.234 -1.156  19.272 1.00 45.95 ? 538 HOH A O   1 
HETATM 1643 O  O   . HOH E 4 .   ? 10.332 4.531   7.658  1.00 43.03 ? 539 HOH A O   1 
HETATM 1644 O  O   . HOH E 4 .   ? 10.455 8.669   13.560 1.00 48.40 ? 540 HOH A O   1 
HETATM 1645 O  O   . HOH E 4 .   ? 5.657  7.328   15.456 1.00 48.20 ? 541 HOH A O   1 
HETATM 1646 O  O   . HOH E 4 .   ? 13.295 6.370   3.141  1.00 56.47 ? 542 HOH A O   1 
HETATM 1647 O  O   . HOH E 4 .   ? 19.731 11.296  9.053  1.00 38.89 ? 543 HOH A O   1 
HETATM 1648 O  O   . HOH E 4 .   ? 13.269 4.370   28.369 1.00 38.33 ? 544 HOH A O   1 
HETATM 1649 O  O   . HOH E 4 .   ? 23.503 -2.247  31.128 1.00 62.78 ? 545 HOH A O   1 
HETATM 1650 O  O   . HOH E 4 .   ? 23.236 5.895   31.470 1.00 40.72 ? 546 HOH A O   1 
HETATM 1651 O  O   . HOH E 4 .   ? 23.082 6.700   34.070 1.00 37.14 ? 547 HOH A O   1 
HETATM 1652 O  O   . HOH E 4 .   ? 20.091 -2.812  5.752  1.00 37.84 ? 548 HOH A O   1 
HETATM 1653 O  O   . HOH E 4 .   ? 36.016 -7.823  1.596  1.00 49.28 ? 549 HOH A O   1 
HETATM 1654 O  O   . HOH E 4 .   ? 26.552 22.722  16.559 1.00 48.06 ? 550 HOH A O   1 
HETATM 1655 O  O   . HOH E 4 .   ? 27.380 24.914  18.699 1.00 42.60 ? 551 HOH A O   1 
HETATM 1656 O  O   . HOH E 4 .   ? 31.430 25.856  26.699 1.00 49.66 ? 552 HOH A O   1 
HETATM 1657 O  O   . HOH E 4 .   ? 37.563 20.570  16.684 1.00 48.13 ? 553 HOH A O   1 
HETATM 1658 O  O   . HOH E 4 .   ? 39.151 22.712  16.204 1.00 42.39 ? 554 HOH A O   1 
HETATM 1659 O  O   . HOH E 4 .   ? 35.256 6.500   20.075 1.00 39.23 ? 555 HOH A O   1 
HETATM 1660 O  O   . HOH E 4 .   ? 31.627 -0.902  23.238 1.00 47.03 ? 556 HOH A O   1 
HETATM 1661 O  O   . HOH E 4 .   ? 33.821 5.130   28.602 1.00 50.58 ? 557 HOH A O   1 
HETATM 1662 O  O   . HOH E 4 .   ? 29.634 12.798  37.366 1.00 46.04 ? 558 HOH A O   1 
HETATM 1663 O  O   . HOH E 4 .   ? 18.448 15.900  35.676 1.00 42.65 ? 559 HOH A O   1 
HETATM 1664 O  O   . HOH E 4 .   ? 39.892 2.835   -2.640 1.00 52.25 ? 560 HOH A O   1 
HETATM 1665 O  O   . HOH E 4 .   ? 12.076 16.421  14.383 1.00 50.86 ? 561 HOH A O   1 
HETATM 1666 O  O   . HOH E 4 .   ? 6.178  2.865   28.098 1.00 64.04 ? 562 HOH A O   1 
HETATM 1667 O  O   . HOH E 4 .   ? 10.865 11.167  29.592 1.00 52.77 ? 563 HOH A O   1 
HETATM 1668 O  O   . HOH E 4 .   ? 21.936 -5.437  -0.393 1.00 60.61 ? 564 HOH A O   1 
HETATM 1669 O  O   . HOH E 4 .   ? 33.057 1.349   25.951 1.00 48.63 ? 565 HOH A O   1 
HETATM 1670 O  O   . HOH E 4 .   ? 35.204 7.484   22.141 1.00 51.64 ? 566 HOH A O   1 
HETATM 1671 O  O   . HOH E 4 .   ? 39.238 8.489   9.926  1.00 45.69 ? 567 HOH A O   1 
HETATM 1672 O  O   . HOH E 4 .   ? 22.318 -5.933  2.921  1.00 70.12 ? 568 HOH A O   1 
HETATM 1673 O  O   . HOH E 4 .   ? 9.025  -7.689  -0.902 1.00 70.66 ? 569 HOH A O   1 
HETATM 1674 O  O   . HOH E 4 .   ? 22.278 -8.443  12.325 1.00 50.80 ? 570 HOH A O   1 
HETATM 1675 O  O   . HOH E 4 .   ? 21.244 -7.200  14.305 1.00 47.22 ? 571 HOH A O   1 
HETATM 1676 O  O   . HOH E 4 .   ? 20.817 -2.407  19.075 1.00 44.18 ? 572 HOH A O   1 
HETATM 1677 O  O   . HOH E 4 .   ? 22.582 -0.725  27.721 1.00 41.30 ? 573 HOH A O   1 
HETATM 1678 O  O   . HOH E 4 .   ? 14.622 20.945  19.867 1.00 51.25 ? 574 HOH A O   1 
HETATM 1679 O  O   . HOH E 4 .   ? 17.695 22.021  16.052 1.00 42.39 ? 575 HOH A O   1 
HETATM 1680 O  O   . HOH E 4 .   ? 9.735  -18.935 1.458  1.00 53.81 ? 576 HOH A O   1 
HETATM 1681 O  O   . HOH E 4 .   ? 11.148 10.502  9.189  1.00 50.35 ? 577 HOH A O   1 
HETATM 1682 O  O   . HOH E 4 .   ? 12.833 11.098  35.978 1.00 52.93 ? 578 HOH A O   1 
HETATM 1683 O  O   . HOH E 4 .   ? 25.510 4.487   31.837 1.00 47.52 ? 579 HOH A O   1 
HETATM 1684 O  O   . HOH E 4 .   ? 28.171 -4.990  -3.461 1.00 56.80 ? 580 HOH A O   1 
HETATM 1685 O  O   . HOH E 4 .   ? 32.477 14.648  28.519 1.00 60.60 ? 581 HOH A O   1 
HETATM 1686 O  O   . HOH E 4 .   ? 9.085  10.963  13.480 1.00 58.76 ? 582 HOH A O   1 
HETATM 1687 O  O   . HOH E 4 .   ? 39.829 18.742  16.847 1.00 62.34 ? 583 HOH A O   1 
HETATM 1688 O  O   . HOH E 4 .   ? 40.835 0.426   20.603 1.00 60.03 ? 584 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ARG 5   53  ?   ?   ?   A . n 
A 1 6   LYS 6   54  ?   ?   ?   A . n 
A 1 7   ILE 7   55  ?   ?   ?   A . n 
A 1 8   GLN 8   56  56  GLN GLN A . n 
A 1 9   ARG 9   57  57  ARG ARG A . n 
A 1 10  TYR 10  58  58  TYR TYR A . n 
A 1 11  VAL 11  59  59  VAL VAL A . n 
A 1 12  ARG 12  60  60  ARG ARG A . n 
A 1 13  LYS 13  61  61  LYS LYS A . n 
A 1 14  ASP 14  62  62  ASP ASP A . n 
A 1 15  GLY 15  63  63  GLY GLY A . n 
A 1 16  LYS 16  64  64  LYS LYS A . n 
A 1 17  CYS 17  65  65  CYS CYS A . n 
A 1 18  ASN 18  66  66  ASN ASN A . n 
A 1 19  VAL 19  67  67  VAL VAL A . n 
A 1 20  HIS 20  68  68  HIS HIS A . n 
A 1 21  HIS 21  69  69  HIS HIS A . n 
A 1 22  GLY 22  70  70  GLY GLY A . n 
A 1 23  ASN 23  71  71  ASN ASN A . n 
A 1 24  VAL 24  72  72  VAL VAL A . n 
A 1 25  ARG 25  73  ?   ?   ?   A . n 
A 1 26  GLU 26  74  ?   ?   ?   A . n 
A 1 27  LYS 27  200 200 LYS LYS A . n 
A 1 28  ARG 28  201 201 ARG ARG A . n 
A 1 29  ALA 29  202 202 ALA ALA A . n 
A 1 30  GLU 30  203 203 GLU GLU A . n 
A 1 31  THR 31  204 204 THR THR A . n 
A 1 32  LEU 32  205 205 LEU LEU A . n 
A 1 33  VAL 33  206 206 VAL VAL A . n 
A 1 34  PHE 34  207 207 PHE PHE A . n 
A 1 35  SER 35  208 208 SER SER A . n 
A 1 36  THR 36  209 209 THR THR A . n 
A 1 37  HIS 37  210 210 HIS HIS A . n 
A 1 38  ALA 38  211 211 ALA ALA A . n 
A 1 39  VAL 39  212 212 VAL VAL A . n 
A 1 40  ILE 40  213 213 ILE ILE A . n 
A 1 41  SER 41  214 214 SER SER A . n 
A 1 42  MET 42  215 215 MET MET A . n 
A 1 43  ARG 43  216 216 ARG ARG A . n 
A 1 44  ASP 44  217 217 ASP ASP A . n 
A 1 45  GLY 45  218 218 GLY GLY A . n 
A 1 46  LYS 46  219 219 LYS LYS A . n 
A 1 47  LEU 47  220 220 LEU LEU A . n 
A 1 48  CYS 48  221 221 CYS CYS A . n 
A 1 49  LEU 49  222 222 LEU LEU A . n 
A 1 50  MET 50  223 223 MET MET A . n 
A 1 51  PHE 51  224 224 PHE PHE A . n 
A 1 52  ARG 52  225 225 ARG ARG A . n 
A 1 53  VAL 53  226 226 VAL VAL A . n 
A 1 54  GLY 54  227 227 GLY GLY A . n 
A 1 55  ASP 55  228 228 ASP ASP A . n 
A 1 56  LEU 56  229 229 LEU LEU A . n 
A 1 57  ARG 57  230 230 ARG ARG A . n 
A 1 58  ASN 58  231 231 ASN ASN A . n 
A 1 59  SER 59  232 232 SER SER A . n 
A 1 60  HIS 60  233 233 HIS HIS A . n 
A 1 61  ILE 61  234 234 ILE ILE A . n 
A 1 62  VAL 62  235 235 VAL VAL A . n 
A 1 63  ARG 63  236 236 ARG ARG A . n 
A 1 64  ALA 64  237 237 ALA ALA A . n 
A 1 65  SER 65  238 238 SER SER A . n 
A 1 66  ILE 66  239 239 ILE ILE A . n 
A 1 67  ARG 67  240 240 ARG ARG A . n 
A 1 68  ALA 68  241 241 ALA ALA A . n 
A 1 69  LYS 69  242 242 LYS LYS A . n 
A 1 70  LEU 70  243 243 LEU LEU A . n 
A 1 71  ILE 71  244 244 ILE ILE A . n 
A 1 72  LYS 72  245 245 LYS LYS A . n 
A 1 73  SER 73  246 246 SER SER A . n 
A 1 74  LYS 74  247 247 LYS LYS A . n 
A 1 75  GLN 75  248 248 GLN GLN A . n 
A 1 76  THR 76  249 249 THR THR A . n 
A 1 77  SER 77  250 250 SER SER A . n 
A 1 78  GLU 78  251 251 GLU GLU A . n 
A 1 79  GLY 79  252 252 GLY GLY A . n 
A 1 80  GLU 80  253 253 GLU GLU A . n 
A 1 81  PHE 81  254 254 PHE PHE A . n 
A 1 82  ILE 82  255 255 ILE ILE A . n 
A 1 83  PRO 83  256 256 PRO PRO A . n 
A 1 84  LEU 84  257 257 LEU LEU A . n 
A 1 85  ASN 85  258 258 ASN ASN A . n 
A 1 86  GLN 86  259 259 GLN GLN A . n 
A 1 87  THR 87  260 260 THR THR A . n 
A 1 88  ASP 88  261 261 ASP ASP A . n 
A 1 89  ILE 89  262 262 ILE ILE A . n 
A 1 90  ASN 90  263 263 ASN ASN A . n 
A 1 91  VAL 91  264 264 VAL VAL A . n 
A 1 92  GLY 92  265 265 GLY GLY A . n 
A 1 93  TYR 93  266 266 TYR TYR A . n 
A 1 94  TYR 94  267 267 TYR TYR A . n 
A 1 95  THR 95  268 268 THR THR A . n 
A 1 96  GLY 96  269 269 GLY GLY A . n 
A 1 97  ASP 97  270 270 ASP ASP A . n 
A 1 98  ASP 98  271 271 ASP ASP A . n 
A 1 99  ARG 99  272 272 ARG ARG A . n 
A 1 100 LEU 100 273 273 LEU LEU A . n 
A 1 101 PHE 101 274 274 PHE PHE A . n 
A 1 102 LEU 102 275 275 LEU LEU A . n 
A 1 103 VAL 103 276 276 VAL VAL A . n 
A 1 104 SER 104 277 277 SER SER A . n 
A 1 105 PRO 105 278 278 PRO PRO A . n 
A 1 106 LEU 106 279 279 LEU LEU A . n 
A 1 107 ILE 107 280 280 ILE ILE A . n 
A 1 108 ILE 108 281 281 ILE ILE A . n 
A 1 109 SER 109 282 282 SER SER A . n 
A 1 110 HIS 110 283 283 HIS HIS A . n 
A 1 111 GLU 111 284 284 GLU GLU A . n 
A 1 112 ILE 112 285 285 ILE ILE A . n 
A 1 113 ASN 113 286 286 ASN ASN A . n 
A 1 114 GLN 114 287 287 GLN GLN A . n 
A 1 115 GLN 115 288 288 GLN GLN A . n 
A 1 116 SER 116 289 289 SER SER A . n 
A 1 117 PRO 117 290 290 PRO PRO A . n 
A 1 118 PHE 118 291 291 PHE PHE A . n 
A 1 119 TRP 119 292 292 TRP TRP A . n 
A 1 120 GLU 120 293 293 GLU GLU A . n 
A 1 121 ILE 121 294 294 ILE ILE A . n 
A 1 122 SER 122 295 295 SER SER A . n 
A 1 123 LYS 123 296 296 LYS LYS A . n 
A 1 124 ALA 124 297 297 ALA ALA A . n 
A 1 125 GLN 125 298 298 GLN GLN A . n 
A 1 126 LEU 126 299 299 LEU LEU A . n 
A 1 127 PRO 127 300 300 PRO PRO A . n 
A 1 128 LYS 128 301 301 LYS LYS A . n 
A 1 129 GLU 129 302 302 GLU GLU A . n 
A 1 130 GLU 130 303 303 GLU GLU A . n 
A 1 131 LEU 131 304 304 LEU LEU A . n 
A 1 132 GLU 132 305 305 GLU GLU A . n 
A 1 133 ILE 133 306 306 ILE ILE A . n 
A 1 134 VAL 134 307 307 VAL VAL A . n 
A 1 135 VAL 135 308 308 VAL VAL A . n 
A 1 136 ILE 136 309 309 ILE ILE A . n 
A 1 137 LEU 137 310 310 LEU LEU A . n 
A 1 138 GLU 138 311 311 GLU GLU A . n 
A 1 139 GLY 139 312 312 GLY GLY A . n 
A 1 140 MET 140 313 313 MET MET A . n 
A 1 141 VAL 141 314 314 VAL VAL A . n 
A 1 142 GLU 142 315 315 GLU GLU A . n 
A 1 143 ALA 143 316 316 ALA ALA A . n 
A 1 144 THR 144 317 317 THR THR A . n 
A 1 145 GLY 145 318 318 GLY GLY A . n 
A 1 146 MET 146 319 319 MET MET A . n 
A 1 147 THR 147 320 320 THR THR A . n 
A 1 148 CYS 148 321 321 CYS CYS A . n 
A 1 149 GLN 149 322 322 GLN GLN A . n 
A 1 150 ALA 150 323 323 ALA ALA A . n 
A 1 151 ARG 151 324 324 ARG ARG A . n 
A 1 152 SER 152 325 325 SER SER A . n 
A 1 153 SER 153 326 326 SER SER A . n 
A 1 154 TYR 154 327 327 TYR TYR A . n 
A 1 155 ILE 155 328 328 ILE ILE A . n 
A 1 156 THR 156 329 329 THR THR A . n 
A 1 157 SER 157 330 330 SER SER A . n 
A 1 158 GLU 158 331 331 GLU GLU A . n 
A 1 159 ILE 159 332 332 ILE ILE A . n 
A 1 160 LEU 160 333 333 LEU LEU A . n 
A 1 161 TRP 161 334 334 TRP TRP A . n 
A 1 162 GLY 162 335 335 GLY GLY A . n 
A 1 163 TYR 163 336 336 TYR TYR A . n 
A 1 164 ARG 164 337 337 ARG ARG A . n 
A 1 165 PHE 165 338 338 PHE PHE A . n 
A 1 166 THR 166 339 339 THR THR A . n 
A 1 167 PRO 167 340 340 PRO PRO A . n 
A 1 168 VAL 168 341 341 VAL VAL A . n 
A 1 169 LEU 169 342 342 LEU LEU A . n 
A 1 170 THR 170 343 343 THR THR A . n 
A 1 171 LEU 171 344 344 LEU LEU A . n 
A 1 172 GLU 172 345 345 GLU GLU A . n 
A 1 173 ASP 173 346 346 ASP ASP A . n 
A 1 174 GLY 174 347 347 GLY GLY A . n 
A 1 175 PHE 175 348 348 PHE PHE A . n 
A 1 176 TYR 176 349 349 TYR TYR A . n 
A 1 177 GLU 177 350 350 GLU GLU A . n 
A 1 178 VAL 178 351 351 VAL VAL A . n 
A 1 179 ASP 179 352 352 ASP ASP A . n 
A 1 180 TYR 180 353 353 TYR TYR A . n 
A 1 181 ASN 181 354 354 ASN ASN A . n 
A 1 182 SER 182 355 355 SER SER A . n 
A 1 183 PHE 183 356 356 PHE PHE A . n 
A 1 184 HIS 184 357 357 HIS HIS A . n 
A 1 185 GLU 185 358 358 GLU GLU A . n 
A 1 186 THR 186 359 359 THR THR A . n 
A 1 187 TYR 187 360 360 TYR TYR A . n 
A 1 188 GLU 188 361 361 GLU GLU A . n 
A 1 189 THR 189 362 362 THR THR A . n 
A 1 190 SER 190 363 363 SER SER A . n 
A 1 191 THR 191 364 364 THR THR A . n 
A 1 192 PRO 192 365 365 PRO PRO A . n 
A 1 193 SER 193 366 366 SER SER A . n 
A 1 194 LEU 194 367 367 LEU LEU A . n 
A 1 195 SER 195 368 368 SER SER A . n 
A 1 196 ALA 196 369 369 ALA ALA A . n 
A 1 197 LYS 197 370 370 LYS LYS A . n 
A 1 198 GLU 198 371 371 GLU GLU A . n 
A 1 199 LEU 199 372 372 LEU LEU A . n 
A 1 200 ALA 200 373 373 ALA ALA A . n 
A 1 201 GLU 201 374 374 GLU GLU A . n 
A 1 202 LEU 202 375 375 LEU LEU A . n 
A 1 203 ALA 203 376 376 ALA ALA A . n 
A 1 204 ASN 204 377 377 ASN ASN A . n 
A 1 205 ARG 205 378 378 ARG ARG A . n 
A 1 206 ALA 206 379 379 ALA ALA A . n 
A 1 207 GLU 207 380 ?   ?   ?   A . n 
A 1 208 LEU 208 381 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BME 1  401 1  BME BME A . 
C 2 BME 1  402 2  BME BME A . 
D 3 MG  1  403 1  MG  MG  A . 
E 4 HOH 1  501 1  HOH HOH A . 
E 4 HOH 2  502 2  HOH HOH A . 
E 4 HOH 3  503 3  HOH HOH A . 
E 4 HOH 4  504 4  HOH HOH A . 
E 4 HOH 5  505 5  HOH HOH A . 
E 4 HOH 6  506 6  HOH HOH A . 
E 4 HOH 7  507 7  HOH HOH A . 
E 4 HOH 8  508 8  HOH HOH A . 
E 4 HOH 9  509 9  HOH HOH A . 
E 4 HOH 10 510 10 HOH HOH A . 
E 4 HOH 11 511 11 HOH HOH A . 
E 4 HOH 12 512 13 HOH HOH A . 
E 4 HOH 13 513 14 HOH HOH A . 
E 4 HOH 14 514 15 HOH HOH A . 
E 4 HOH 15 515 16 HOH HOH A . 
E 4 HOH 16 516 17 HOH HOH A . 
E 4 HOH 17 517 18 HOH HOH A . 
E 4 HOH 18 518 19 HOH HOH A . 
E 4 HOH 19 519 20 HOH HOH A . 
E 4 HOH 20 520 21 HOH HOH A . 
E 4 HOH 21 521 22 HOH HOH A . 
E 4 HOH 22 522 23 HOH HOH A . 
E 4 HOH 23 523 24 HOH HOH A . 
E 4 HOH 24 524 25 HOH HOH A . 
E 4 HOH 25 525 26 HOH HOH A . 
E 4 HOH 26 526 27 HOH HOH A . 
E 4 HOH 27 527 28 HOH HOH A . 
E 4 HOH 28 528 29 HOH HOH A . 
E 4 HOH 29 529 30 HOH HOH A . 
E 4 HOH 30 530 31 HOH HOH A . 
E 4 HOH 31 531 32 HOH HOH A . 
E 4 HOH 32 532 33 HOH HOH A . 
E 4 HOH 33 533 34 HOH HOH A . 
E 4 HOH 34 534 35 HOH HOH A . 
E 4 HOH 35 535 36 HOH HOH A . 
E 4 HOH 36 536 37 HOH HOH A . 
E 4 HOH 37 537 38 HOH HOH A . 
E 4 HOH 38 538 39 HOH HOH A . 
E 4 HOH 39 539 40 HOH HOH A . 
E 4 HOH 40 540 41 HOH HOH A . 
E 4 HOH 41 541 42 HOH HOH A . 
E 4 HOH 42 542 43 HOH HOH A . 
E 4 HOH 43 543 44 HOH HOH A . 
E 4 HOH 44 544 45 HOH HOH A . 
E 4 HOH 45 545 46 HOH HOH A . 
E 4 HOH 46 546 47 HOH HOH A . 
E 4 HOH 47 547 48 HOH HOH A . 
E 4 HOH 48 548 49 HOH HOH A . 
E 4 HOH 49 549 51 HOH HOH A . 
E 4 HOH 50 550 52 HOH HOH A . 
E 4 HOH 51 551 53 HOH HOH A . 
E 4 HOH 52 552 54 HOH HOH A . 
E 4 HOH 53 553 55 HOH HOH A . 
E 4 HOH 54 554 56 HOH HOH A . 
E 4 HOH 55 555 57 HOH HOH A . 
E 4 HOH 56 556 58 HOH HOH A . 
E 4 HOH 57 557 60 HOH HOH A . 
E 4 HOH 58 558 61 HOH HOH A . 
E 4 HOH 59 559 62 HOH HOH A . 
E 4 HOH 60 560 63 HOH HOH A . 
E 4 HOH 61 561 64 HOH HOH A . 
E 4 HOH 62 562 66 HOH HOH A . 
E 4 HOH 63 563 67 HOH HOH A . 
E 4 HOH 64 564 68 HOH HOH A . 
E 4 HOH 65 565 69 HOH HOH A . 
E 4 HOH 66 566 70 HOH HOH A . 
E 4 HOH 67 567 71 HOH HOH A . 
E 4 HOH 68 568 72 HOH HOH A . 
E 4 HOH 69 569 73 HOH HOH A . 
E 4 HOH 70 570 74 HOH HOH A . 
E 4 HOH 71 571 75 HOH HOH A . 
E 4 HOH 72 572 76 HOH HOH A . 
E 4 HOH 73 573 77 HOH HOH A . 
E 4 HOH 74 574 78 HOH HOH A . 
E 4 HOH 75 575 79 HOH HOH A . 
E 4 HOH 76 576 80 HOH HOH A . 
E 4 HOH 77 577 81 HOH HOH A . 
E 4 HOH 78 578 82 HOH HOH A . 
E 4 HOH 79 579 83 HOH HOH A . 
E 4 HOH 80 580 84 HOH HOH A . 
E 4 HOH 81 581 87 HOH HOH A . 
E 4 HOH 82 582 88 HOH HOH A . 
E 4 HOH 83 583 89 HOH HOH A . 
E 4 HOH 84 584 90 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13990 ? 
1 MORE         -6    ? 
1 'SSA (A^2)'  34590 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z      -1.0000000000 0.0000000000  0.0000000000 85.8630000000 0.0000000000  
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_545 -y+1/2,x-1/2,z 0.0000000000  -1.0000000000 0.0000000000 42.9315000000 1.0000000000  
0.0000000000  0.0000000000 -42.9315000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y+1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 42.9315000000 -1.0000000000 
0.0000000000  0.0000000000 42.9315000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    MG 
_pdbx_struct_special_symmetry.auth_seq_id     403 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   MG 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-05-08 
2 'Structure model' 1 1 2017-08-16 
3 'Structure model' 1 2 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 2 'Structure model' 'Source and taxonomy'    
3 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' entity_src_gen 
2 2 'Structure model' software       
3 3 'Structure model' software       
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHASER      .        ?                program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
2 REFMAC      5.5.0109 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 HKL-2000    .        ?                ?       ?                    ?                           'data collection' ? ?          ? 
5 DENZO       .        ?                ?       ?                    ?                           'data reduction'  ? ?          ? 
6 SCALEPACK   .        ?                ?       ?                    ?                           'data scaling'    ? ?          ? 
7 HKL-2000    .        ?                ?       ?                    ?                           'data scaling'    ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    65 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   S2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   BME 
_pdbx_validate_close_contact.auth_seq_id_2    401 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    PHE 
_pdbx_validate_symm_contact.auth_seq_id_1     348 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    CE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    PHE 
_pdbx_validate_symm_contact.auth_seq_id_2     348 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_555 
_pdbx_validate_symm_contact.dist              2.07 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 276 ? ? -115.65 -70.51  
2 1 ASN A 286 ? ? -115.29 -167.48 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ARG 53  ? A ARG 5   
6  1 Y 1 A LYS 54  ? A LYS 6   
7  1 Y 1 A ILE 55  ? A ILE 7   
8  1 Y 1 A ARG 73  ? A ARG 25  
9  1 Y 1 A GLU 74  ? A GLU 26  
10 1 Y 1 A GLU 380 ? A GLU 207 
11 1 Y 1 A LEU 381 ? A LEU 208 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 BETA-MERCAPTOETHANOL BME 
3 'MAGNESIUM ION'      MG  
4 water                HOH 
#